data_3UCU
# 
_entry.id   3UCU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UCU         
NDB   NA1365       
RCSB  RCSB068593   
WWPDB D_1000068593 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3UCZ . unspecified 
PDB 3UD3 . unspecified 
PDB 3UD4 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UCU 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Smith, K.D.'   1 
'Strobel, S.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            51 
_citation.page_first                425 
_citation.page_last                 432 
_citation.year                      2012 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22148472 
_citation.pdbx_database_id_DOI      10.1021/bi2016662 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Smith, K.D.'    1 
primary 'Lipchock, S.V.' 2 
primary 'Strobel, S.A.'  3 
# 
_cell.entry_id           3UCU 
_cell.length_a           49.088 
_cell.length_b           45.350 
_cell.length_c           77.243 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.24 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UCU 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'U1 small nuclear ribonucleoprotein A' 11340.315 1  ? 'Y31H, Q36R' 'RNA binding domain, UNP residues 1-98' ? 
2 polymer     syn 'RNA (92-MER)'                         29942.773 1  ? ?            ?                                       
'c-di-GMP-I riboswitch' 
3 polymer     syn 'diguanosine monophosphate'            645.454   1  ? ?            ?                                       ? 
4 non-polymer syn 'MAGNESIUM ION'                        24.305    1  ? ?            ?                                       ? 
5 water       nat water                                  18.015    14 ? ?            ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'U1 snRNP A, U1-A, U1A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no  
;MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMK
;
;MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMK
;
P ? 
2 polyribonucleotide no yes 
;(GTP)GUCACGCACAGGGCAAACCAUUCGAAAGAGUGGGACGCAAAGCCUCCGGCCUAAACCAUUGCACUCCGGUAGGUA
GCGGGGUUACCGAUGG
;
;GGUCACGCACAGGGCAAACCAUUCGAAAGAGUGGGACGCAAAGCCUCCGGCCUAAACCAUUGCACUCCGGUAGGUAGCGG
GGUUACCGAUGG
;
R ? 
3 polyribonucleotide no no  GG                                                                                                    
GG                                                                                                    A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  VAL n 
1 4  PRO n 
1 5  GLU n 
1 6  THR n 
1 7  ARG n 
1 8  PRO n 
1 9  ASN n 
1 10 HIS n 
1 11 THR n 
1 12 ILE n 
1 13 TYR n 
1 14 ILE n 
1 15 ASN n 
1 16 ASN n 
1 17 LEU n 
1 18 ASN n 
1 19 GLU n 
1 20 LYS n 
1 21 ILE n 
1 22 LYS n 
1 23 LYS n 
1 24 ASP n 
1 25 GLU n 
1 26 LEU n 
1 27 LYS n 
1 28 LYS n 
1 29 SER n 
1 30 LEU n 
1 31 HIS n 
1 32 ALA n 
1 33 ILE n 
1 34 PHE n 
1 35 SER n 
1 36 ARG n 
1 37 PHE n 
1 38 GLY n 
1 39 GLN n 
1 40 ILE n 
1 41 LEU n 
1 42 ASP n 
1 43 ILE n 
1 44 LEU n 
1 45 VAL n 
1 46 SER n 
1 47 ARG n 
1 48 SER n 
1 49 LEU n 
1 50 LYS n 
1 51 MET n 
1 52 ARG n 
1 53 GLY n 
1 54 GLN n 
1 55 ALA n 
1 56 PHE n 
1 57 VAL n 
1 58 ILE n 
1 59 PHE n 
1 60 LYS n 
1 61 GLU n 
1 62 VAL n 
1 63 SER n 
1 64 SER n 
1 65 ALA n 
1 66 THR n 
1 67 ASN n 
1 68 ALA n 
1 69 LEU n 
1 70 ARG n 
1 71 SER n 
1 72 MET n 
1 73 GLN n 
1 74 GLY n 
1 75 PHE n 
1 76 PRO n 
1 77 PHE n 
1 78 TYR n 
1 79 ASP n 
1 80 LYS n 
1 81 PRO n 
1 82 MET n 
1 83 ARG n 
1 84 ILE n 
1 85 GLN n 
1 86 TYR n 
1 87 ALA n 
1 88 LYS n 
1 89 THR n 
1 90 ASP n 
1 91 SER n 
1 92 ASP n 
1 93 ILE n 
1 94 ILE n 
1 95 ALA n 
1 96 LYS n 
1 97 MET n 
1 98 LYS n 
2 1  GTP n 
2 2  G   n 
2 3  U   n 
2 4  C   n 
2 5  A   n 
2 6  C   n 
2 7  G   n 
2 8  C   n 
2 9  A   n 
2 10 C   n 
2 11 A   n 
2 12 G   n 
2 13 G   n 
2 14 G   n 
2 15 C   n 
2 16 A   n 
2 17 A   n 
2 18 A   n 
2 19 C   n 
2 20 C   n 
2 21 A   n 
2 22 U   n 
2 23 U   n 
2 24 C   n 
2 25 G   n 
2 26 A   n 
2 27 A   n 
2 28 A   n 
2 29 G   n 
2 30 A   n 
2 31 G   n 
2 32 U   n 
2 33 G   n 
2 34 G   n 
2 35 G   n 
2 36 A   n 
2 37 C   n 
2 38 G   n 
2 39 C   n 
2 40 A   n 
2 41 A   n 
2 42 A   n 
2 43 G   n 
2 44 C   n 
2 45 C   n 
2 46 U   n 
2 47 C   n 
2 48 C   n 
2 49 G   n 
2 50 G   n 
2 51 C   n 
2 52 C   n 
2 53 U   n 
2 54 A   n 
2 55 A   n 
2 56 A   n 
2 57 C   n 
2 58 C   n 
2 59 A   n 
2 60 U   n 
2 61 U   n 
2 62 G   n 
2 63 C   n 
2 64 A   n 
2 65 C   n 
2 66 U   n 
2 67 C   n 
2 68 C   n 
2 69 G   n 
2 70 G   n 
2 71 U   n 
2 72 A   n 
2 73 G   n 
2 74 G   n 
2 75 U   n 
2 76 A   n 
2 77 G   n 
2 78 C   n 
2 79 G   n 
2 80 G   n 
2 81 G   n 
2 82 G   n 
2 83 U   n 
2 84 U   n 
2 85 A   n 
2 86 C   n 
2 87 C   n 
2 88 G   n 
2 89 A   n 
2 90 U   n 
2 91 G   n 
2 92 G   n 
3 1  G   n 
3 2  G   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SNRPA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'in vitro transcribed RNA transcript' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SNRPA_HUMAN P09012 1 
;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMK
;
1 ? 
2 PDB 3UCU        3UCU   2 ?                                                                                                     ? 
? 
3 PDB 3UCU        3UCU   3 ?                                                                                                     ? 
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UCU P 1 ? 98 ? P09012 1 ? 98 ? 1 98 
2 2 3UCU R 1 ? 92 ? 3UCU   8 ? 98 ? 8 98 
3 3 3UCU A 1 ? 2  ? 3UCU   1 ? 2  ? 1 2  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UCU HIS P 31 ? UNP P09012 TYR 31 'ENGINEERED MUTATION' 31 1 
1 3UCU ARG P 36 ? UNP P09012 GLN 36 'ENGINEERED MUTATION' 36 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'    323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3UCU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.04 
_exptl_crystal.density_percent_sol   39.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    
'24% PEG550mme, 50 mM MES, pH 6.0, 5 mM MgSO4, 300 mM NaCl, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-10-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     3UCU 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   8584 
_reflns.number_all                   8612 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.85 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        6.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3UCU 
_refine.ls_number_reflns_obs                     8150 
_refine.ls_number_reflns_all                     8150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    98.73 
_refine.ls_R_factor_obs                          0.21709 
_refine.ls_R_factor_all                          0.21709 
_refine.ls_R_factor_R_work                       0.21486 
_refine.ls_R_factor_R_free                       0.26208 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  406 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               62.151 
_refine.aniso_B[1][1]                            2.72 
_refine.aniso_B[2][2]                            -5.60 
_refine.aniso_B[3][3]                            3.88 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            4.57 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.433 
_refine.overall_SU_ML                            0.380 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             19.510 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        712 
_refine_hist.pdbx_number_atoms_nucleic_acid   2031 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               2758 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.006  0.021  ? 3002 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.038  2.775  ? 4526 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 4.492  5.000  ? 86   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 33.872 23.235 ? 34   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 15.786 15.000 ? 144  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 14.062 15.000 ? 6    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.055  0.200  ? 575  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.002  0.020  ? 1519 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1.210  6.000  ? 434  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           2.149  8.000  ? 703  ? 'X-RAY DIFFRACTION' 
r_scbond_it            1.331  6.000  ? 2568 ? 'X-RAY DIFFRACTION' 
r_scangle_it           2.184  8.000  ? 3822 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.785 
_refine_ls_shell.d_res_low                        2.857 
_refine_ls_shell.number_reflns_R_work             530 
_refine_ls_shell.R_factor_R_work                  0.420 
_refine_ls_shell.percent_reflns_obs               88.80 
_refine_ls_shell.R_factor_R_free                  0.444 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             33 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                566 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UCU 
_struct.title                     'The c-di-GMP-I riboswitch bound to pGpG' 
_struct.pdbx_descriptor           'U1 small nuclear ribonucleoprotein A/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UCU 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/RNA' 
_struct_keywords.text            'riboswitch, SIGNALING PROTEIN-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'THE PROTEIN IS NOT BIOLOGICALLY RELEVANT AND HAS BEEN USED AS A CRYSTALLIZATION CHAPERONE.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 22 ? SER A 35 ? LYS P 22 SER P 35 1 ? 14 
HELX_P HELX_P2 2 GLU A 61 ? GLN A 73 ? GLU P 61 GLN P 73 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B GTP 1  "O3'" ? ? ? 1_555 B G   2  P  ? ? R GTP 8  R G   9   1_555 ? ? ? ? ? ? ?                    1.600 ? 
covale2  covale ? ? B C   58 "O3'" ? ? ? 1_555 B A   59 P  ? ? R C   65 R A   660 1_555 ? ? ? ? ? ? ?                    1.605 ? 
metalc1  metalc ? ? D MG  .  MG    ? ? ? 1_555 G HOH .  O  ? ? R MG  1  A HOH 3   1_555 ? ? ? ? ? ? ?                    2.176 ? 
metalc2  metalc ? ? D MG  .  MG    ? ? ? 1_555 F HOH .  O  ? ? R MG  1  R HOH 676 1_555 ? ? ? ? ? ? ?                    2.179 ? 
metalc3  metalc ? ? D MG  .  MG    ? ? ? 1_555 F HOH .  O  ? ? R MG  1  R HOH 673 1_555 ? ? ? ? ? ? ?                    2.179 ? 
metalc4  metalc ? ? D MG  .  MG    ? ? ? 1_555 F HOH .  O  ? ? R MG  1  R HOH 674 1_555 ? ? ? ? ? ? ?                    2.180 ? 
metalc5  metalc ? ? D MG  .  MG    ? ? ? 1_555 F HOH .  O  ? ? R MG  1  R HOH 675 1_555 ? ? ? ? ? ? ?                    2.182 ? 
hydrog1  hydrog ? ? B C   4  N3    ? ? ? 1_555 B G   92 N1 ? ? R C   11 R G   98  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? B C   4  N4    ? ? ? 1_555 B G   92 O6 ? ? R C   11 R G   98  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? B C   4  O2    ? ? ? 1_555 B G   92 N2 ? ? R C   11 R G   98  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? B A   5  N1    ? ? ? 1_555 B G   91 N1 ? ? R A   12 R G   97  1_555 ? ? ? ? ? ? TYPE_8_PAIR          ?     ? 
hydrog5  hydrog ? ? B A   5  N6    ? ? ? 1_555 B G   91 O6 ? ? R A   12 R G   97  1_555 ? ? ? ? ? ? TYPE_8_PAIR          ?     ? 
hydrog6  hydrog ? ? B C   6  N3    ? ? ? 1_555 B G   88 N1 ? ? R C   13 R G   94  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? B C   6  N4    ? ? ? 1_555 B G   88 O6 ? ? R C   13 R G   94  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? B C   6  O2    ? ? ? 1_555 B G   88 N2 ? ? R C   13 R G   94  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? B G   7  N2    ? ? ? 1_555 B A   9  N7 ? ? R G   14 R A   16  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog10 hydrog ? ? B G   7  N1    ? ? ? 1_555 B C   87 N3 ? ? R G   14 R C   93  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? B G   7  N2    ? ? ? 1_555 B C   87 O2 ? ? R G   14 R C   93  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12 hydrog ? ? B G   7  O6    ? ? ? 1_555 B C   87 N4 ? ? R G   14 R C   93  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? B A   9  N6    ? ? ? 1_555 B C   87 O2 ? ? R A   16 R C   93  1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog14 hydrog ? ? B C   10 N4    ? ? ? 1_555 B C   87 O2 ? ? R C   17 R C   93  1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ?     ? 
hydrog15 hydrog ? ? B C   10 N4    ? ? ? 1_555 C G   2  N3 ? ? R C   17 A G   2   1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog16 hydrog ? ? B G   12 O6    ? ? ? 1_555 B A   40 N6 ? ? R G   19 R A   47  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog17 hydrog ? ? B G   13 N1    ? ? ? 1_555 C G   1  N7 ? ? R G   20 A G   1   1_555 ? ? ? ? ? ? TYPE_7_PAIR          ?     ? 
hydrog18 hydrog ? ? B G   13 N2    ? ? ? 1_555 C G   1  O6 ? ? R G   20 A G   1   1_555 ? ? ? ? ? ? TYPE_7_PAIR          ?     ? 
hydrog19 hydrog ? ? B G   14 N1    ? ? ? 1_555 B C   39 N3 ? ? R G   21 R C   46  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? B G   14 N2    ? ? ? 1_555 B C   39 O2 ? ? R G   21 R C   46  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? B G   14 O6    ? ? ? 1_555 B C   39 N4 ? ? R G   21 R C   46  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? B C   15 N3    ? ? ? 1_555 B G   38 N1 ? ? R C   22 R G   45  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? B C   15 N4    ? ? ? 1_555 B G   38 O6 ? ? R C   22 R G   45  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? B C   15 O2    ? ? ? 1_555 B G   38 N2 ? ? R C   22 R G   45  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? B A   16 N3    ? ? ? 1_555 B C   37 N4 ? ? R A   23 R C   44  1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog26 hydrog ? ? B A   18 N6    ? ? ? 1_555 B G   35 N3 ? ? R A   25 R G   42  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog27 hydrog ? ? B A   18 N7    ? ? ? 1_555 B G   35 N2 ? ? R A   25 R G   42  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog28 hydrog ? ? B C   19 N3    ? ? ? 1_555 B G   34 N1 ? ? R C   26 R G   41  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29 hydrog ? ? B C   19 N4    ? ? ? 1_555 B G   34 O6 ? ? R C   26 R G   41  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? B C   19 O2    ? ? ? 1_555 B G   34 N2 ? ? R C   26 R G   41  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? B C   20 N3    ? ? ? 1_555 B G   33 N1 ? ? R C   27 R G   40  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? B C   20 N4    ? ? ? 1_555 B G   33 O6 ? ? R C   27 R G   40  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33 hydrog ? ? B C   20 O2    ? ? ? 1_555 B G   33 N2 ? ? R C   27 R G   40  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? B A   21 N1    ? ? ? 1_555 B U   32 N3 ? ? R A   28 R U   39  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? B A   21 N6    ? ? ? 1_555 B U   32 O4 ? ? R A   28 R U   39  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog36 hydrog ? ? B U   22 N3    ? ? ? 1_555 B G   31 O6 ? ? R U   29 R G   38  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog37 hydrog ? ? B U   22 O2    ? ? ? 1_555 B G   31 N1 ? ? R U   29 R G   38  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog38 hydrog ? ? B U   23 N3    ? ? ? 1_555 B A   30 N1 ? ? R U   30 R A   37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog39 hydrog ? ? B U   23 O4    ? ? ? 1_555 B A   30 N6 ? ? R U   30 R A   37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog40 hydrog ? ? B C   24 N3    ? ? ? 1_555 B G   29 N1 ? ? R C   31 R G   36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog41 hydrog ? ? B C   24 N4    ? ? ? 1_555 B G   29 O6 ? ? R C   31 R G   36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42 hydrog ? ? B C   24 O2    ? ? ? 1_555 B G   29 N2 ? ? R C   31 R G   36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog43 hydrog ? ? B G   25 N2    ? ? ? 1_555 B A   28 N7 ? ? R G   32 R A   35  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog44 hydrog ? ? B A   28 N3    ? ? ? 1_555 B G   73 N2 ? ? R A   35 R G   79  1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ?     ? 
hydrog45 hydrog ? ? B C   37 N3    ? ? ? 1_555 B G   77 N1 ? ? R C   44 R G   83  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46 hydrog ? ? B C   37 N4    ? ? ? 1_555 B G   77 O6 ? ? R C   44 R G   83  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47 hydrog ? ? B C   37 O2    ? ? ? 1_555 B G   77 N2 ? ? R C   44 R G   83  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48 hydrog ? ? B G   38 N2    ? ? ? 1_555 B A   42 N3 ? ? R G   45 R A   49  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog49 hydrog ? ? B A   41 N6    ? ? ? 1_555 B U   84 O2 ? ? R A   48 R U   90  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog50 hydrog ? ? B A   41 N7    ? ? ? 1_555 B U   84 N3 ? ? R A   48 R U   90  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog51 hydrog ? ? B G   43 N1    ? ? ? 1_555 B U   83 O2 ? ? R G   50 R U   89  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog52 hydrog ? ? B G   43 O6    ? ? ? 1_555 B U   83 N3 ? ? R G   50 R U   89  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog53 hydrog ? ? B C   44 N3    ? ? ? 1_555 B G   82 N1 ? ? R C   51 R G   88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog54 hydrog ? ? B C   44 N4    ? ? ? 1_555 B G   82 O6 ? ? R C   51 R G   88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog55 hydrog ? ? B C   44 O2    ? ? ? 1_555 B G   82 N2 ? ? R C   51 R G   88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog56 hydrog ? ? B C   45 N3    ? ? ? 1_555 B G   81 N1 ? ? R C   52 R G   87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog57 hydrog ? ? B C   45 N4    ? ? ? 1_555 B G   81 O6 ? ? R C   52 R G   87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog58 hydrog ? ? B C   45 O2    ? ? ? 1_555 B G   81 N2 ? ? R C   52 R G   87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog59 hydrog ? ? B U   46 O2    ? ? ? 1_555 B C   48 N4 ? ? R U   53 R C   55  1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ?     ? 
hydrog60 hydrog ? ? B C   47 N4    ? ? ? 1_555 B A   76 N1 ? ? R C   54 R A   82  1_555 ? ? ? ? ? ? 'C-A MISPAIR'        ?     ? 
hydrog61 hydrog ? ? B C   47 N3    ? ? ? 1_555 B G   80 N1 ? ? R C   54 R G   86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog62 hydrog ? ? B C   47 N4    ? ? ? 1_555 B G   80 O6 ? ? R C   54 R G   86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog63 hydrog ? ? B C   47 O2    ? ? ? 1_555 B G   80 N2 ? ? R C   54 R G   86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog64 hydrog ? ? B C   48 N3    ? ? ? 1_555 B G   79 N1 ? ? R C   55 R G   85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog65 hydrog ? ? B C   48 N4    ? ? ? 1_555 B G   79 O6 ? ? R C   55 R G   85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog66 hydrog ? ? B C   48 O2    ? ? ? 1_555 B G   79 N2 ? ? R C   55 R G   85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog67 hydrog ? ? B G   49 N1    ? ? ? 1_555 B C   78 N3 ? ? R G   56 R C   84  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog68 hydrog ? ? B G   49 N2    ? ? ? 1_555 B C   78 O2 ? ? R G   56 R C   84  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog69 hydrog ? ? B G   49 O6    ? ? ? 1_555 B C   78 N4 ? ? R G   56 R C   84  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog70 hydrog ? ? B G   50 N1    ? ? ? 1_555 B U   75 O2 ? ? R G   57 R U   81  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog71 hydrog ? ? B G   50 O6    ? ? ? 1_555 B U   75 N3 ? ? R G   57 R U   81  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog72 hydrog ? ? B C   51 N3    ? ? ? 1_555 B G   74 N1 ? ? R C   58 R G   80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog73 hydrog ? ? B C   51 N4    ? ? ? 1_555 B G   74 O6 ? ? R C   58 R G   80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog74 hydrog ? ? B C   51 O2    ? ? ? 1_555 B G   74 N2 ? ? R C   58 R G   80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog75 hydrog ? ? B C   52 N3    ? ? ? 1_555 B G   73 N1 ? ? R C   59 R G   79  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog76 hydrog ? ? B C   52 N4    ? ? ? 1_555 B G   73 O6 ? ? R C   59 R G   79  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog77 hydrog ? ? B C   52 O2    ? ? ? 1_555 B G   73 N2 ? ? R C   59 R G   79  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog78 hydrog ? ? B U   53 N3    ? ? ? 1_555 B A   72 N1 ? ? R U   60 R A   78  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog79 hydrog ? ? B U   53 O4    ? ? ? 1_555 B A   72 N6 ? ? R U   60 R A   78  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog80 hydrog ? ? B A   54 N3    ? ? ? 1_555 B A   55 N6 ? ? R A   61 R A   62  1_555 ? ? ? ? ? ? 'A-A MISPAIR'        ?     ? 
hydrog81 hydrog ? ? B A   54 N1    ? ? ? 1_555 B U   71 N3 ? ? R A   61 R U   77  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog82 hydrog ? ? B A   54 N6    ? ? ? 1_555 B U   71 O4 ? ? R A   61 R U   77  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog83 hydrog ? ? B A   56 N6    ? ? ? 1_555 B U   71 O2 ? ? R A   63 R U   77  1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog84 hydrog ? ? B C   57 N3    ? ? ? 1_555 B G   70 N1 ? ? R C   64 R G   76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog85 hydrog ? ? B C   57 N4    ? ? ? 1_555 B G   70 O6 ? ? R C   64 R G   76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog86 hydrog ? ? B C   57 O2    ? ? ? 1_555 B G   70 N2 ? ? R C   64 R G   76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog87 hydrog ? ? B C   58 N3    ? ? ? 1_555 B G   69 N1 ? ? R C   65 R G   75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog88 hydrog ? ? B C   58 N4    ? ? ? 1_555 B G   69 O6 ? ? R C   65 R G   75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog89 hydrog ? ? B C   58 O2    ? ? ? 1_555 B G   69 N2 ? ? R C   65 R G   75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog90 hydrog ? ? B C   86 N3    ? ? ? 1_555 C G   2  N1 ? ? R C   92 A G   2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog91 hydrog ? ? B C   86 N4    ? ? ? 1_555 C G   2  O6 ? ? R C   92 A G   2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog92 hydrog ? ? B C   86 O2    ? ? ? 1_555 C G   2  N2 ? ? R C   92 A G   2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog93 hydrog ? ? B G   88 N2    ? ? ? 1_555 B A   89 N1 ? ? R G   94 R A   95  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 40 ? LEU A 44 ? ILE P 40 LEU P 44 
A 2 ALA A 55 ? PHE A 59 ? ALA P 55 PHE P 59 
A 3 THR A 11 ? ASN A 15 ? THR P 11 ASN P 15 
A 4 ARG A 83 ? TYR A 86 ? ARG P 83 TYR P 86 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 44 ? N LEU P 44 O PHE A 56 ? O PHE P 56 
A 2 3 O ALA A 55 ? O ALA P 55 N ILE A 14 ? N ILE P 14 
A 3 4 N TYR A 13 ? N TYR P 13 O GLN A 85 ? O GLN P 85 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE MG R 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 HOH G .  ? HOH A 3   . ? 1_555 ? 
2 AC1 7 A   B 40 ? A   R 47  . ? 1_555 ? 
3 AC1 7 A   B 41 ? A   R 48  . ? 1_555 ? 
4 AC1 7 HOH F .  ? HOH R 673 . ? 1_555 ? 
5 AC1 7 HOH F .  ? HOH R 674 . ? 1_555 ? 
6 AC1 7 HOH F .  ? HOH R 675 . ? 1_555 ? 
7 AC1 7 HOH F .  ? HOH R 676 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3UCU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UCU 
_atom_sites.fract_transf_matrix[1][1]   0.020372 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002227 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022051 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013023 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 7  ? 3.282  29.355  -6.805  1.00 77.39  ? 7   ARG P N     1 
ATOM   2    C  CA    . ARG A 1 7  ? 3.842  27.969  -6.824  1.00 76.12  ? 7   ARG P CA    1 
ATOM   3    C  C     . ARG A 1 7  ? 5.170  27.792  -6.062  1.00 74.61  ? 7   ARG P C     1 
ATOM   4    O  O     . ARG A 1 7  ? 5.300  26.839  -5.293  1.00 74.64  ? 7   ARG P O     1 
ATOM   5    C  CB    . ARG A 1 7  ? 3.967  27.446  -8.260  1.00 76.94  ? 7   ARG P CB    1 
ATOM   6    C  CG    . ARG A 1 7  ? 2.734  26.712  -8.767  1.00 77.92  ? 7   ARG P CG    1 
ATOM   7    C  CD    . ARG A 1 7  ? 3.102  25.692  -9.840  1.00 78.78  ? 7   ARG P CD    1 
ATOM   8    N  NE    . ARG A 1 7  ? 4.202  24.827  -9.411  1.00 79.23  ? 7   ARG P NE    1 
ATOM   9    C  CZ    . ARG A 1 7  ? 4.780  23.898  -10.169 1.00 80.34  ? 7   ARG P CZ    1 
ATOM   10   N  NH1   . ARG A 1 7  ? 4.370  23.689  -11.415 1.00 80.85  ? 7   ARG P NH1   1 
ATOM   11   N  NH2   . ARG A 1 7  ? 5.774  23.173  -9.676  1.00 80.08  ? 7   ARG P NH2   1 
ATOM   12   N  N     . PRO A 1 8  ? 6.156  28.698  -6.267  1.00 73.28  ? 8   PRO P N     1 
ATOM   13   C  CA    . PRO A 1 8  ? 7.454  28.531  -5.598  1.00 72.17  ? 8   PRO P CA    1 
ATOM   14   C  C     . PRO A 1 8  ? 7.404  28.719  -4.080  1.00 71.22  ? 8   PRO P C     1 
ATOM   15   O  O     . PRO A 1 8  ? 6.475  29.336  -3.559  1.00 71.67  ? 8   PRO P O     1 
ATOM   16   C  CB    . PRO A 1 8  ? 8.317  29.623  -6.235  1.00 72.40  ? 8   PRO P CB    1 
ATOM   17   C  CG    . PRO A 1 8  ? 7.351  30.654  -6.669  1.00 73.06  ? 8   PRO P CG    1 
ATOM   18   C  CD    . PRO A 1 8  ? 6.155  29.890  -7.137  1.00 73.11  ? 8   PRO P CD    1 
ATOM   19   N  N     . ASN A 1 9  ? 8.414  28.190  -3.391  1.00 70.44  ? 9   ASN P N     1 
ATOM   20   C  CA    . ASN A 1 9  ? 8.463  28.184  -1.929  1.00 69.18  ? 9   ASN P CA    1 
ATOM   21   C  C     . ASN A 1 9  ? 9.904  28.146  -1.414  1.00 68.38  ? 9   ASN P C     1 
ATOM   22   O  O     . ASN A 1 9  ? 10.807 27.696  -2.122  1.00 69.28  ? 9   ASN P O     1 
ATOM   23   C  CB    . ASN A 1 9  ? 7.688  26.974  -1.393  1.00 69.51  ? 9   ASN P CB    1 
ATOM   24   C  CG    . ASN A 1 9  ? 7.174  27.177  0.021   1.00 69.76  ? 9   ASN P CG    1 
ATOM   25   O  OD1   . ASN A 1 9  ? 7.804  27.848  0.839   1.00 71.77  ? 9   ASN P OD1   1 
ATOM   26   N  ND2   . ASN A 1 9  ? 6.020  26.590  0.315   1.00 68.93  ? 9   ASN P ND2   1 
ATOM   27   N  N     . HIS A 1 10 ? 10.109 28.617  -0.184  1.00 66.82  ? 10  HIS P N     1 
ATOM   28   C  CA    . HIS A 1 10 ? 11.412 28.538  0.486   1.00 66.08  ? 10  HIS P CA    1 
ATOM   29   C  C     . HIS A 1 10 ? 11.863 27.090  0.668   1.00 65.03  ? 10  HIS P C     1 
ATOM   30   O  O     . HIS A 1 10 ? 13.062 26.797  0.685   1.00 64.70  ? 10  HIS P O     1 
ATOM   31   C  CB    . HIS A 1 10 ? 11.351 29.199  1.865   1.00 67.33  ? 10  HIS P CB    1 
ATOM   32   C  CG    . HIS A 1 10 ? 11.091 30.670  1.825   1.00 67.56  ? 10  HIS P CG    1 
ATOM   33   N  ND1   . HIS A 1 10 ? 12.103 31.603  1.849   1.00 68.36  ? 10  HIS P ND1   1 
ATOM   34   C  CD2   . HIS A 1 10 ? 9.933  31.370  1.779   1.00 68.42  ? 10  HIS P CD2   1 
ATOM   35   C  CE1   . HIS A 1 10 ? 11.581 32.816  1.812   1.00 68.48  ? 10  HIS P CE1   1 
ATOM   36   N  NE2   . HIS A 1 10 ? 10.267 32.703  1.768   1.00 68.45  ? 10  HIS P NE2   1 
ATOM   37   N  N     . THR A 1 11 ? 10.887 26.198  0.814   1.00 63.00  ? 11  THR P N     1 
ATOM   38   C  CA    . THR A 1 11 ? 11.134 24.790  1.084   1.00 60.82  ? 11  THR P CA    1 
ATOM   39   C  C     . THR A 1 11 ? 10.971 23.958  -0.184  1.00 59.43  ? 11  THR P C     1 
ATOM   40   O  O     . THR A 1 11 ? 10.107 24.239  -1.015  1.00 60.52  ? 11  THR P O     1 
ATOM   41   C  CB    . THR A 1 11 ? 10.176 24.268  2.176   1.00 61.19  ? 11  THR P CB    1 
ATOM   42   O  OG1   . THR A 1 11 ? 10.174 25.178  3.283   1.00 61.69  ? 11  THR P OG1   1 
ATOM   43   C  CG2   . THR A 1 11 ? 10.598 22.888  2.666   1.00 61.40  ? 11  THR P CG2   1 
ATOM   44   N  N     . ILE A 1 12 ? 11.819 22.943  -0.327  1.00 57.83  ? 12  ILE P N     1 
ATOM   45   C  CA    . ILE A 1 12 ? 11.712 21.984  -1.424  1.00 55.69  ? 12  ILE P CA    1 
ATOM   46   C  C     . ILE A 1 12 ? 11.417 20.580  -0.902  1.00 55.32  ? 12  ILE P C     1 
ATOM   47   O  O     . ILE A 1 12 ? 11.992 20.134  0.097   1.00 54.83  ? 12  ILE P O     1 
ATOM   48   C  CB    . ILE A 1 12 ? 12.966 21.974  -2.332  1.00 55.89  ? 12  ILE P CB    1 
ATOM   49   C  CG1   . ILE A 1 12 ? 14.249 21.850  -1.499  1.00 55.80  ? 12  ILE P CG1   1 
ATOM   50   C  CG2   . ILE A 1 12 ? 12.995 23.227  -3.206  1.00 55.63  ? 12  ILE P CG2   1 
ATOM   51   C  CD1   . ILE A 1 12 ? 15.436 21.305  -2.266  1.00 56.47  ? 12  ILE P CD1   1 
ATOM   52   N  N     . TYR A 1 13 ? 10.503 19.900  -1.586  1.00 53.47  ? 13  TYR P N     1 
ATOM   53   C  CA    . TYR A 1 13 ? 10.067 18.570  -1.201  1.00 51.15  ? 13  TYR P CA    1 
ATOM   54   C  C     . TYR A 1 13 ? 10.810 17.526  -2.014  1.00 51.67  ? 13  TYR P C     1 
ATOM   55   O  O     . TYR A 1 13 ? 10.506 17.307  -3.189  1.00 52.90  ? 13  TYR P O     1 
ATOM   56   C  CB    . TYR A 1 13 ? 8.559  18.430  -1.407  1.00 50.24  ? 13  TYR P CB    1 
ATOM   57   C  CG    . TYR A 1 13 ? 7.995  17.085  -1.013  1.00 48.48  ? 13  TYR P CG    1 
ATOM   58   C  CD1   . TYR A 1 13 ? 7.675  16.810  0.310   1.00 48.54  ? 13  TYR P CD1   1 
ATOM   59   C  CD2   . TYR A 1 13 ? 7.772  16.095  -1.965  1.00 49.30  ? 13  TYR P CD2   1 
ATOM   60   C  CE1   . TYR A 1 13 ? 7.156  15.581  0.683   1.00 50.28  ? 13  TYR P CE1   1 
ATOM   61   C  CE2   . TYR A 1 13 ? 7.251  14.859  -1.605  1.00 50.24  ? 13  TYR P CE2   1 
ATOM   62   C  CZ    . TYR A 1 13 ? 6.943  14.610  -0.278  1.00 50.26  ? 13  TYR P CZ    1 
ATOM   63   O  OH    . TYR A 1 13 ? 6.426  13.392  0.097   1.00 51.27  ? 13  TYR P OH    1 
ATOM   64   N  N     . ILE A 1 14 ? 11.790 16.891  -1.380  1.00 52.72  ? 14  ILE P N     1 
ATOM   65   C  CA    . ILE A 1 14 ? 12.554 15.824  -2.020  1.00 53.08  ? 14  ILE P CA    1 
ATOM   66   C  C     . ILE A 1 14 ? 11.854 14.493  -1.781  1.00 54.93  ? 14  ILE P C     1 
ATOM   67   O  O     . ILE A 1 14 ? 11.422 14.189  -0.665  1.00 54.75  ? 14  ILE P O     1 
ATOM   68   C  CB    . ILE A 1 14 ? 14.018 15.793  -1.539  1.00 50.75  ? 14  ILE P CB    1 
ATOM   69   C  CG1   . ILE A 1 14 ? 14.691 17.129  -1.849  1.00 49.83  ? 14  ILE P CG1   1 
ATOM   70   C  CG2   . ILE A 1 14 ? 14.786 14.670  -2.221  1.00 50.96  ? 14  ILE P CG2   1 
ATOM   71   C  CD1   . ILE A 1 14 ? 15.762 17.515  -0.872  1.00 51.18  ? 14  ILE P CD1   1 
ATOM   72   N  N     . ASN A 1 15 ? 11.749 13.714  -2.851  1.00 56.95  ? 15  ASN P N     1 
ATOM   73   C  CA    . ASN A 1 15 ? 10.951 12.501  -2.872  1.00 60.17  ? 15  ASN P CA    1 
ATOM   74   C  C     . ASN A 1 15 ? 11.800 11.318  -3.327  1.00 60.77  ? 15  ASN P C     1 
ATOM   75   O  O     . ASN A 1 15 ? 12.890 11.509  -3.876  1.00 62.14  ? 15  ASN P O     1 
ATOM   76   C  CB    . ASN A 1 15 ? 9.773  12.710  -3.831  1.00 63.33  ? 15  ASN P CB    1 
ATOM   77   C  CG    . ASN A 1 15 ? 8.558  11.882  -3.469  1.00 66.30  ? 15  ASN P CG    1 
ATOM   78   O  OD1   . ASN A 1 15 ? 7.895  11.324  -4.348  1.00 68.07  ? 15  ASN P OD1   1 
ATOM   79   N  ND2   . ASN A 1 15 ? 8.248  11.806  -2.178  1.00 66.31  ? 15  ASN P ND2   1 
ATOM   80   N  N     . ASN A 1 16 ? 11.303 10.104  -3.092  1.00 59.64  ? 16  ASN P N     1 
ATOM   81   C  CA    . ASN A 1 16 ? 11.931 8.883   -3.602  1.00 60.22  ? 16  ASN P CA    1 
ATOM   82   C  C     . ASN A 1 16 ? 13.369 8.685   -3.083  1.00 60.60  ? 16  ASN P C     1 
ATOM   83   O  O     . ASN A 1 16 ? 14.333 8.496   -3.867  1.00 62.95  ? 16  ASN P O     1 
ATOM   84   C  CB    . ASN A 1 16 ? 11.875 8.863   -5.143  1.00 59.98  ? 16  ASN P CB    1 
ATOM   85   C  CG    . ASN A 1 16 ? 12.281 7.527   -5.734  1.00 59.13  ? 16  ASN P CG    1 
ATOM   86   O  OD1   . ASN A 1 16 ? 11.670 6.497   -5.452  1.00 58.94  ? 16  ASN P OD1   1 
ATOM   87   N  ND2   . ASN A 1 16 ? 13.318 7.540   -6.566  1.00 58.95  ? 16  ASN P ND2   1 
ATOM   88   N  N     . LEU A 1 17 ? 13.500 8.729   -1.751  1.00 59.36  ? 17  LEU P N     1 
ATOM   89   C  CA    . LEU A 1 17 ? 14.815 8.588   -1.120  1.00 57.68  ? 17  LEU P CA    1 
ATOM   90   C  C     . LEU A 1 17 ? 15.016 7.195   -0.544  1.00 58.55  ? 17  LEU P C     1 
ATOM   91   O  O     . LEU A 1 17 ? 14.056 6.541   -0.131  1.00 58.44  ? 17  LEU P O     1 
ATOM   92   C  CB    . LEU A 1 17 ? 14.993 9.624   -0.009  1.00 54.86  ? 17  LEU P CB    1 
ATOM   93   C  CG    . LEU A 1 17 ? 15.024 11.105  -0.383  1.00 54.27  ? 17  LEU P CG    1 
ATOM   94   C  CD1   . LEU A 1 17 ? 14.809 11.960  0.857   1.00 53.68  ? 17  LEU P CD1   1 
ATOM   95   C  CD2   . LEU A 1 17 ? 16.327 11.467  -1.075  1.00 53.69  ? 17  LEU P CD2   1 
ATOM   96   N  N     . ASN A 1 18 ? 16.272 6.752   -0.523  1.00 59.90  ? 18  ASN P N     1 
ATOM   97   C  CA    . ASN A 1 18 ? 16.646 5.501   0.123   1.00 60.60  ? 18  ASN P CA    1 
ATOM   98   C  C     . ASN A 1 18 ? 16.255 5.552   1.595   1.00 62.35  ? 18  ASN P C     1 
ATOM   99   O  O     . ASN A 1 18 ? 16.767 6.371   2.362   1.00 62.63  ? 18  ASN P O     1 
ATOM   100  C  CB    . ASN A 1 18 ? 18.149 5.251   -0.034  1.00 61.17  ? 18  ASN P CB    1 
ATOM   101  C  CG    . ASN A 1 18 ? 18.556 3.824   0.318   1.00 61.79  ? 18  ASN P CG    1 
ATOM   102  O  OD1   . ASN A 1 18 ? 17.827 3.093   0.995   1.00 62.04  ? 18  ASN P OD1   1 
ATOM   103  N  ND2   . ASN A 1 18 ? 19.738 3.425   -0.141  1.00 61.43  ? 18  ASN P ND2   1 
ATOM   104  N  N     . GLU A 1 19 ? 15.333 4.675   1.976   1.00 64.29  ? 19  GLU P N     1 
ATOM   105  C  CA    . GLU A 1 19 ? 14.754 4.686   3.317   1.00 64.71  ? 19  GLU P CA    1 
ATOM   106  C  C     . GLU A 1 19 ? 15.668 4.026   4.346   1.00 65.51  ? 19  GLU P C     1 
ATOM   107  O  O     . GLU A 1 19 ? 15.414 4.101   5.552   1.00 66.45  ? 19  GLU P O     1 
ATOM   108  C  CB    . GLU A 1 19 ? 13.382 4.011   3.302   1.00 64.85  ? 19  GLU P CB    1 
ATOM   109  C  CG    . GLU A 1 19 ? 12.405 4.625   2.305   1.00 66.67  ? 19  GLU P CG    1 
ATOM   110  C  CD    . GLU A 1 19 ? 11.296 3.672   1.902   1.00 68.11  ? 19  GLU P CD    1 
ATOM   111  O  OE1   . GLU A 1 19 ? 10.483 3.295   2.773   1.00 68.88  ? 19  GLU P OE1   1 
ATOM   112  O  OE2   . GLU A 1 19 ? 11.233 3.305   0.709   1.00 69.92  ? 19  GLU P OE2   1 
ATOM   113  N  N     . LYS A 1 20 ? 16.737 3.395   3.864   1.00 66.19  ? 20  LYS P N     1 
ATOM   114  C  CA    . LYS A 1 20 ? 17.672 2.671   4.726   1.00 66.48  ? 20  LYS P CA    1 
ATOM   115  C  C     . LYS A 1 20 ? 18.696 3.579   5.407   1.00 66.60  ? 20  LYS P C     1 
ATOM   116  O  O     . LYS A 1 20 ? 19.346 3.172   6.373   1.00 66.83  ? 20  LYS P O     1 
ATOM   117  C  CB    . LYS A 1 20 ? 18.375 1.557   3.945   1.00 66.85  ? 20  LYS P CB    1 
ATOM   118  C  CG    . LYS A 1 20 ? 17.452 0.418   3.544   1.00 69.82  ? 20  LYS P CG    1 
ATOM   119  C  CD    . LYS A 1 20 ? 18.193 -0.907  3.474   1.00 72.14  ? 20  LYS P CD    1 
ATOM   120  C  CE    . LYS A 1 20 ? 17.218 -2.078  3.535   1.00 73.89  ? 20  LYS P CE    1 
ATOM   121  N  NZ    . LYS A 1 20 ? 17.905 -3.370  3.828   1.00 74.59  ? 20  LYS P NZ    1 
ATOM   122  N  N     . ILE A 1 21 ? 18.826 4.806   4.908   1.00 66.63  ? 21  ILE P N     1 
ATOM   123  C  CA    . ILE A 1 21 ? 19.771 5.776   5.463   1.00 67.18  ? 21  ILE P CA    1 
ATOM   124  C  C     . ILE A 1 21 ? 19.315 6.224   6.848   1.00 67.73  ? 21  ILE P C     1 
ATOM   125  O  O     . ILE A 1 21 ? 18.141 6.538   7.050   1.00 67.09  ? 21  ILE P O     1 
ATOM   126  C  CB    . ILE A 1 21 ? 19.937 7.035   4.553   1.00 66.89  ? 21  ILE P CB    1 
ATOM   127  C  CG1   . ILE A 1 21 ? 19.962 6.669   3.061   1.00 66.21  ? 21  ILE P CG1   1 
ATOM   128  C  CG2   . ILE A 1 21 ? 21.169 7.851   4.959   1.00 67.31  ? 21  ILE P CG2   1 
ATOM   129  C  CD1   . ILE A 1 21 ? 21.055 5.705   2.649   1.00 67.59  ? 21  ILE P CD1   1 
ATOM   130  N  N     . LYS A 1 22 ? 20.246 6.244   7.797   1.00 70.10  ? 22  LYS P N     1 
ATOM   131  C  CA    . LYS A 1 22 ? 19.963 6.749   9.136   1.00 72.14  ? 22  LYS P CA    1 
ATOM   132  C  C     . LYS A 1 22 ? 19.669 8.247   9.097   1.00 72.02  ? 22  LYS P C     1 
ATOM   133  O  O     . LYS A 1 22 ? 20.360 9.011   8.414   1.00 72.88  ? 22  LYS P O     1 
ATOM   134  C  CB    . LYS A 1 22 ? 21.121 6.452   10.095  1.00 73.72  ? 22  LYS P CB    1 
ATOM   135  C  CG    . LYS A 1 22 ? 21.105 5.048   10.685  1.00 75.74  ? 22  LYS P CG    1 
ATOM   136  C  CD    . LYS A 1 22 ? 21.957 4.974   11.948  1.00 77.58  ? 22  LYS P CD    1 
ATOM   137  C  CE    . LYS A 1 22 ? 21.768 3.651   12.675  1.00 78.80  ? 22  LYS P CE    1 
ATOM   138  N  NZ    . LYS A 1 22 ? 22.372 3.667   14.040  1.00 79.25  ? 22  LYS P NZ    1 
ATOM   139  N  N     . LYS A 1 23 ? 18.632 8.646   9.831   1.00 71.68  ? 23  LYS P N     1 
ATOM   140  C  CA    . LYS A 1 23 ? 18.194 10.041  9.936   1.00 71.22  ? 23  LYS P CA    1 
ATOM   141  C  C     . LYS A 1 23 ? 19.358 11.042  10.014  1.00 70.30  ? 23  LYS P C     1 
ATOM   142  O  O     . LYS A 1 23 ? 19.318 12.117  9.383   1.00 70.36  ? 23  LYS P O     1 
ATOM   143  C  CB    . LYS A 1 23 ? 17.264 10.196  11.149  1.00 72.38  ? 23  LYS P CB    1 
ATOM   144  C  CG    . LYS A 1 23 ? 16.655 11.578  11.342  1.00 73.48  ? 23  LYS P CG    1 
ATOM   145  C  CD    . LYS A 1 23 ? 15.606 11.566  12.447  1.00 74.43  ? 23  LYS P CD    1 
ATOM   146  C  CE    . LYS A 1 23 ? 15.165 12.983  12.792  1.00 75.99  ? 23  LYS P CE    1 
ATOM   147  N  NZ    . LYS A 1 23 ? 13.907 13.014  13.592  1.00 75.30  ? 23  LYS P NZ    1 
ATOM   148  N  N     . ASP A 1 24 ? 20.391 10.672  10.780  1.00 69.62  ? 24  ASP P N     1 
ATOM   149  C  CA    . ASP A 1 24 ? 21.549 11.539  11.002  1.00 68.79  ? 24  ASP P CA    1 
ATOM   150  C  C     . ASP A 1 24 ? 22.321 11.767  9.710   1.00 67.58  ? 24  ASP P C     1 
ATOM   151  O  O     . ASP A 1 24 ? 22.617 12.908  9.356   1.00 66.30  ? 24  ASP P O     1 
ATOM   152  C  CB    . ASP A 1 24 ? 22.481 10.937  12.062  1.00 70.00  ? 24  ASP P CB    1 
ATOM   153  C  CG    . ASP A 1 24 ? 21.732 10.415  13.272  1.00 70.21  ? 24  ASP P CG    1 
ATOM   154  O  OD1   . ASP A 1 24 ? 21.278 11.236  14.097  1.00 69.90  ? 24  ASP P OD1   1 
ATOM   155  O  OD2   . ASP A 1 24 ? 21.602 9.178   13.398  1.00 71.39  ? 24  ASP P OD2   1 
ATOM   156  N  N     . GLU A 1 25 ? 22.637 10.675  9.016   1.00 66.70  ? 25  GLU P N     1 
ATOM   157  C  CA    . GLU A 1 25 ? 23.394 10.734  7.769   1.00 67.02  ? 25  GLU P CA    1 
ATOM   158  C  C     . GLU A 1 25 ? 22.588 11.404  6.661   1.00 65.66  ? 25  GLU P C     1 
ATOM   159  O  O     . GLU A 1 25 ? 23.133 12.180  5.873   1.00 63.20  ? 25  GLU P O     1 
ATOM   160  C  CB    . GLU A 1 25 ? 23.836 9.334   7.330   1.00 70.58  ? 25  GLU P CB    1 
ATOM   161  C  CG    . GLU A 1 25 ? 24.819 8.646   8.277   1.00 75.58  ? 25  GLU P CG    1 
ATOM   162  C  CD    . GLU A 1 25 ? 26.128 9.411   8.450   1.00 78.43  ? 25  GLU P CD    1 
ATOM   163  O  OE1   . GLU A 1 25 ? 26.717 9.841   7.433   1.00 79.52  ? 25  GLU P OE1   1 
ATOM   164  O  OE2   . GLU A 1 25 ? 26.572 9.575   9.608   1.00 80.01  ? 25  GLU P OE2   1 
ATOM   165  N  N     . LEU A 1 26 ? 21.290 11.106  6.620   1.00 64.01  ? 26  LEU P N     1 
ATOM   166  C  CA    . LEU A 1 26 ? 20.392 11.665  5.615   1.00 63.38  ? 26  LEU P CA    1 
ATOM   167  C  C     . LEU A 1 26 ? 20.417 13.198  5.622   1.00 63.82  ? 26  LEU P C     1 
ATOM   168  O  O     . LEU A 1 26 ? 20.719 13.815  4.598   1.00 62.41  ? 26  LEU P O     1 
ATOM   169  C  CB    . LEU A 1 26 ? 18.969 11.115  5.796   1.00 62.60  ? 26  LEU P CB    1 
ATOM   170  C  CG    . LEU A 1 26 ? 17.858 11.397  4.770   1.00 61.96  ? 26  LEU P CG    1 
ATOM   171  C  CD1   . LEU A 1 26 ? 18.338 11.310  3.321   1.00 61.38  ? 26  LEU P CD1   1 
ATOM   172  C  CD2   . LEU A 1 26 ? 16.693 10.441  4.996   1.00 61.28  ? 26  LEU P CD2   1 
ATOM   173  N  N     . LYS A 1 27 ? 20.127 13.802  6.775   1.00 64.51  ? 27  LYS P N     1 
ATOM   174  C  CA    . LYS A 1 27 ? 20.209 15.258  6.925   1.00 66.21  ? 27  LYS P CA    1 
ATOM   175  C  C     . LYS A 1 27 ? 21.602 15.751  6.537   1.00 67.46  ? 27  LYS P C     1 
ATOM   176  O  O     . LYS A 1 27 ? 21.742 16.634  5.684   1.00 67.87  ? 27  LYS P O     1 
ATOM   177  C  CB    . LYS A 1 27 ? 19.886 15.694  8.359   1.00 66.81  ? 27  LYS P CB    1 
ATOM   178  C  CG    . LYS A 1 27 ? 18.460 15.421  8.808   1.00 68.72  ? 27  LYS P CG    1 
ATOM   179  C  CD    . LYS A 1 27 ? 18.100 16.247  10.033  1.00 69.14  ? 27  LYS P CD    1 
ATOM   180  C  CE    . LYS A 1 27 ? 16.707 15.901  10.539  1.00 70.46  ? 27  LYS P CE    1 
ATOM   181  N  NZ    . LYS A 1 27 ? 16.140 16.984  11.392  1.00 70.41  ? 27  LYS P NZ    1 
ATOM   182  N  N     . LYS A 1 28 ? 22.617 15.148  7.160   1.00 67.07  ? 28  LYS P N     1 
ATOM   183  C  CA    . LYS A 1 28 ? 24.022 15.482  6.944   1.00 65.95  ? 28  LYS P CA    1 
ATOM   184  C  C     . LYS A 1 28 ? 24.361 15.546  5.452   1.00 63.96  ? 28  LYS P C     1 
ATOM   185  O  O     . LYS A 1 28 ? 24.862 16.563  4.970   1.00 62.21  ? 28  LYS P O     1 
ATOM   186  C  CB    . LYS A 1 28 ? 24.910 14.456  7.657   1.00 68.03  ? 28  LYS P CB    1 
ATOM   187  C  CG    . LYS A 1 28 ? 26.276 14.965  8.094   1.00 69.74  ? 28  LYS P CG    1 
ATOM   188  C  CD    . LYS A 1 28 ? 27.231 13.799  8.328   1.00 71.03  ? 28  LYS P CD    1 
ATOM   189  C  CE    . LYS A 1 28 ? 28.535 14.239  8.983   1.00 71.65  ? 28  LYS P CE    1 
ATOM   190  N  NZ    . LYS A 1 28 ? 28.434 14.278  10.470  1.00 71.45  ? 28  LYS P NZ    1 
ATOM   191  N  N     . SER A 1 29 ? 24.062 14.465  4.732   1.00 62.97  ? 29  SER P N     1 
ATOM   192  C  CA    . SER A 1 29 ? 24.323 14.378  3.292   1.00 62.46  ? 29  SER P CA    1 
ATOM   193  C  C     . SER A 1 29 ? 23.541 15.422  2.495   1.00 63.18  ? 29  SER P C     1 
ATOM   194  O  O     . SER A 1 29 ? 24.109 16.091  1.634   1.00 65.29  ? 29  SER P O     1 
ATOM   195  C  CB    . SER A 1 29 ? 24.013 12.978  2.765   1.00 61.42  ? 29  SER P CB    1 
ATOM   196  O  OG    . SER A 1 29 ? 24.614 11.985  3.572   1.00 61.08  ? 29  SER P OG    1 
ATOM   197  N  N     . LEU A 1 30 ? 22.248 15.563  2.787   1.00 62.10  ? 30  LEU P N     1 
ATOM   198  C  CA    . LEU A 1 30 ? 21.409 16.567  2.125   1.00 60.90  ? 30  LEU P CA    1 
ATOM   199  C  C     . LEU A 1 30 ? 21.945 17.979  2.342   1.00 61.95  ? 30  LEU P C     1 
ATOM   200  O  O     . LEU A 1 30 ? 21.902 18.811  1.435   1.00 60.80  ? 30  LEU P O     1 
ATOM   201  C  CB    . LEU A 1 30 ? 19.957 16.473  2.603   1.00 57.93  ? 30  LEU P CB    1 
ATOM   202  C  CG    . LEU A 1 30 ? 19.133 15.272  2.128   1.00 55.91  ? 30  LEU P CG    1 
ATOM   203  C  CD1   . LEU A 1 30 ? 17.927 15.085  3.022   1.00 56.03  ? 30  LEU P CD1   1 
ATOM   204  C  CD2   . LEU A 1 30 ? 18.708 15.406  0.675   1.00 54.70  ? 30  LEU P CD2   1 
ATOM   205  N  N     . HIS A 1 31 ? 22.454 18.234  3.544   1.00 64.40  ? 31  HIS P N     1 
ATOM   206  C  CA    . HIS A 1 31 ? 23.106 19.499  3.862   1.00 66.73  ? 31  HIS P CA    1 
ATOM   207  C  C     . HIS A 1 31 ? 24.406 19.639  3.078   1.00 67.17  ? 31  HIS P C     1 
ATOM   208  O  O     . HIS A 1 31 ? 24.723 20.717  2.572   1.00 67.39  ? 31  HIS P O     1 
ATOM   209  C  CB    . HIS A 1 31 ? 23.382 19.600  5.364   1.00 68.23  ? 31  HIS P CB    1 
ATOM   210  C  CG    . HIS A 1 31 ? 23.744 20.978  5.820   1.00 70.27  ? 31  HIS P CG    1 
ATOM   211  N  ND1   . HIS A 1 31 ? 22.812 21.870  6.306   1.00 71.21  ? 31  HIS P ND1   1 
ATOM   212  C  CD2   . HIS A 1 31 ? 24.936 21.620  5.862   1.00 71.57  ? 31  HIS P CD2   1 
ATOM   213  C  CE1   . HIS A 1 31 ? 23.413 23.002  6.626   1.00 72.11  ? 31  HIS P CE1   1 
ATOM   214  N  NE2   . HIS A 1 31 ? 24.703 22.876  6.367   1.00 72.30  ? 31  HIS P NE2   1 
ATOM   215  N  N     . ALA A 1 32 ? 25.144 18.537  2.969   1.00 66.61  ? 32  ALA P N     1 
ATOM   216  C  CA    . ALA A 1 32 ? 26.419 18.518  2.258   1.00 67.14  ? 32  ALA P CA    1 
ATOM   217  C  C     . ALA A 1 32 ? 26.266 18.676  0.740   1.00 67.12  ? 32  ALA P C     1 
ATOM   218  O  O     . ALA A 1 32 ? 27.247 18.914  0.036   1.00 68.42  ? 32  ALA P O     1 
ATOM   219  C  CB    . ALA A 1 32 ? 27.182 17.242  2.587   1.00 67.01  ? 32  ALA P CB    1 
ATOM   220  N  N     . ILE A 1 33 ? 25.038 18.551  0.245   1.00 66.22  ? 33  ILE P N     1 
ATOM   221  C  CA    . ILE A 1 33 ? 24.779 18.577  -1.192  1.00 66.21  ? 33  ILE P CA    1 
ATOM   222  C  C     . ILE A 1 33 ? 24.008 19.825  -1.634  1.00 65.72  ? 33  ILE P C     1 
ATOM   223  O  O     . ILE A 1 33 ? 24.216 20.325  -2.741  1.00 65.62  ? 33  ILE P O     1 
ATOM   224  C  CB    . ILE A 1 33 ? 24.048 17.279  -1.653  1.00 67.78  ? 33  ILE P CB    1 
ATOM   225  C  CG1   . ILE A 1 33 ? 24.893 16.028  -1.351  1.00 69.97  ? 33  ILE P CG1   1 
ATOM   226  C  CG2   . ILE A 1 33 ? 23.676 17.329  -3.132  1.00 67.72  ? 33  ILE P CG2   1 
ATOM   227  C  CD1   . ILE A 1 33 ? 26.364 16.077  -1.816  1.00 72.17  ? 33  ILE P CD1   1 
ATOM   228  N  N     . PHE A 1 34 ? 23.136 20.329  -0.764  1.00 65.46  ? 34  PHE P N     1 
ATOM   229  C  CA    . PHE A 1 34 ? 22.262 21.453  -1.108  1.00 64.57  ? 34  PHE P CA    1 
ATOM   230  C  C     . PHE A 1 34 ? 22.737 22.822  -0.613  1.00 65.26  ? 34  PHE P C     1 
ATOM   231  O  O     . PHE A 1 34 ? 22.223 23.850  -1.063  1.00 65.25  ? 34  PHE P O     1 
ATOM   232  C  CB    . PHE A 1 34 ? 20.830 21.192  -0.622  1.00 62.75  ? 34  PHE P CB    1 
ATOM   233  C  CG    . PHE A 1 34 ? 20.070 20.209  -1.468  1.00 60.53  ? 34  PHE P CG    1 
ATOM   234  C  CD1   . PHE A 1 34 ? 19.527 20.596  -2.691  1.00 59.24  ? 34  PHE P CD1   1 
ATOM   235  C  CD2   . PHE A 1 34 ? 19.892 18.899  -1.041  1.00 59.15  ? 34  PHE P CD2   1 
ATOM   236  C  CE1   . PHE A 1 34 ? 18.825 19.691  -3.479  1.00 57.79  ? 34  PHE P CE1   1 
ATOM   237  C  CE2   . PHE A 1 34 ? 19.189 17.987  -1.823  1.00 58.66  ? 34  PHE P CE2   1 
ATOM   238  C  CZ    . PHE A 1 34 ? 18.654 18.385  -3.044  1.00 57.78  ? 34  PHE P CZ    1 
ATOM   239  N  N     . SER A 1 35 ? 23.711 22.838  0.298   1.00 66.13  ? 35  SER P N     1 
ATOM   240  C  CA    . SER A 1 35 ? 24.194 24.093  0.898   1.00 67.08  ? 35  SER P CA    1 
ATOM   241  C  C     . SER A 1 35 ? 24.891 25.020  -0.097  1.00 65.70  ? 35  SER P C     1 
ATOM   242  O  O     . SER A 1 35 ? 25.042 26.215  0.164   1.00 66.47  ? 35  SER P O     1 
ATOM   243  C  CB    . SER A 1 35 ? 25.109 23.824  2.099   1.00 68.50  ? 35  SER P CB    1 
ATOM   244  O  OG    . SER A 1 35 ? 26.304 23.176  1.701   1.00 71.12  ? 35  SER P OG    1 
ATOM   245  N  N     . ARG A 1 36 ? 25.302 24.467  -1.236  1.00 64.91  ? 36  ARG P N     1 
ATOM   246  C  CA    . ARG A 1 36 ? 25.956 25.244  -2.286  1.00 64.08  ? 36  ARG P CA    1 
ATOM   247  C  C     . ARG A 1 36 ? 24.983 26.130  -3.070  1.00 63.63  ? 36  ARG P C     1 
ATOM   248  O  O     . ARG A 1 36 ? 25.395 26.887  -3.952  1.00 64.13  ? 36  ARG P O     1 
ATOM   249  C  CB    . ARG A 1 36 ? 26.751 24.332  -3.232  1.00 65.69  ? 36  ARG P CB    1 
ATOM   250  C  CG    . ARG A 1 36 ? 25.968 23.181  -3.854  1.00 67.06  ? 36  ARG P CG    1 
ATOM   251  C  CD    . ARG A 1 36 ? 26.789 22.490  -4.938  1.00 68.94  ? 36  ARG P CD    1 
ATOM   252  N  NE    . ARG A 1 36 ? 26.791 23.249  -6.190  1.00 70.61  ? 36  ARG P NE    1 
ATOM   253  C  CZ    . ARG A 1 36 ? 26.169 22.870  -7.306  1.00 71.80  ? 36  ARG P CZ    1 
ATOM   254  N  NH1   . ARG A 1 36 ? 26.229 23.632  -8.390  1.00 71.50  ? 36  ARG P NH1   1 
ATOM   255  N  NH2   . ARG A 1 36 ? 25.495 21.728  -7.350  1.00 72.57  ? 36  ARG P NH2   1 
ATOM   256  N  N     . PHE A 1 37 ? 23.697 26.033  -2.744  1.00 62.13  ? 37  PHE P N     1 
ATOM   257  C  CA    . PHE A 1 37 ? 22.666 26.814  -3.422  1.00 60.59  ? 37  PHE P CA    1 
ATOM   258  C  C     . PHE A 1 37 ? 22.213 28.016  -2.599  1.00 62.21  ? 37  PHE P C     1 
ATOM   259  O  O     . PHE A 1 37 ? 21.757 29.017  -3.154  1.00 62.93  ? 37  PHE P O     1 
ATOM   260  C  CB    . PHE A 1 37 ? 21.470 25.929  -3.775  1.00 57.92  ? 37  PHE P CB    1 
ATOM   261  C  CG    . PHE A 1 37 ? 21.791 24.843  -4.759  1.00 56.27  ? 37  PHE P CG    1 
ATOM   262  C  CD1   . PHE A 1 37 ? 21.945 25.133  -6.110  1.00 55.82  ? 37  PHE P CD1   1 
ATOM   263  C  CD2   . PHE A 1 37 ? 21.939 23.527  -4.337  1.00 55.93  ? 37  PHE P CD2   1 
ATOM   264  C  CE1   . PHE A 1 37 ? 22.242 24.130  -7.023  1.00 55.73  ? 37  PHE P CE1   1 
ATOM   265  C  CE2   . PHE A 1 37 ? 22.234 22.515  -5.246  1.00 55.14  ? 37  PHE P CE2   1 
ATOM   266  C  CZ    . PHE A 1 37 ? 22.386 22.818  -6.590  1.00 55.40  ? 37  PHE P CZ    1 
ATOM   267  N  N     . GLY A 1 38 ? 22.351 27.911  -1.279  1.00 63.47  ? 38  GLY P N     1 
ATOM   268  C  CA    . GLY A 1 38 ? 21.933 28.963  -0.356  1.00 64.83  ? 38  GLY P CA    1 
ATOM   269  C  C     . GLY A 1 38 ? 21.995 28.505  1.087   1.00 66.45  ? 38  GLY P C     1 
ATOM   270  O  O     . GLY A 1 38 ? 22.129 27.311  1.364   1.00 66.85  ? 38  GLY P O     1 
ATOM   271  N  N     . GLN A 1 39 ? 21.897 29.460  2.007   1.00 68.03  ? 39  GLN P N     1 
ATOM   272  C  CA    . GLN A 1 39 ? 21.910 29.174  3.442   1.00 69.07  ? 39  GLN P CA    1 
ATOM   273  C  C     . GLN A 1 39 ? 20.644 28.413  3.830   1.00 68.49  ? 39  GLN P C     1 
ATOM   274  O  O     . GLN A 1 39 ? 19.545 28.752  3.383   1.00 69.87  ? 39  GLN P O     1 
ATOM   275  C  CB    . GLN A 1 39 ? 22.028 30.471  4.252   1.00 70.75  ? 39  GLN P CB    1 
ATOM   276  C  CG    . GLN A 1 39 ? 23.298 31.299  3.975   1.00 74.26  ? 39  GLN P CG    1 
ATOM   277  C  CD    . GLN A 1 39 ? 23.243 32.107  2.670   1.00 74.93  ? 39  GLN P CD    1 
ATOM   278  O  OE1   . GLN A 1 39 ? 22.190 32.250  2.044   1.00 75.34  ? 39  GLN P OE1   1 
ATOM   279  N  NE2   . GLN A 1 39 ? 24.389 32.640  2.266   1.00 75.22  ? 39  GLN P NE2   1 
ATOM   280  N  N     . ILE A 1 40 ? 20.804 27.380  4.650   1.00 65.88  ? 40  ILE P N     1 
ATOM   281  C  CA    . ILE A 1 40 ? 19.679 26.533  5.034   1.00 65.76  ? 40  ILE P CA    1 
ATOM   282  C  C     . ILE A 1 40 ? 19.252 26.794  6.475   1.00 67.11  ? 40  ILE P C     1 
ATOM   283  O  O     . ILE A 1 40 ? 20.080 26.790  7.389   1.00 67.67  ? 40  ILE P O     1 
ATOM   284  C  CB    . ILE A 1 40 ? 19.998 25.032  4.816   1.00 64.90  ? 40  ILE P CB    1 
ATOM   285  C  CG1   . ILE A 1 40 ? 20.232 24.754  3.326   1.00 64.01  ? 40  ILE P CG1   1 
ATOM   286  C  CG2   . ILE A 1 40 ? 18.876 24.143  5.364   1.00 63.92  ? 40  ILE P CG2   1 
ATOM   287  C  CD1   . ILE A 1 40 ? 21.022 23.496  3.039   1.00 63.60  ? 40  ILE P CD1   1 
ATOM   288  N  N     . LEU A 1 41 ? 17.955 27.030  6.661   1.00 68.35  ? 41  LEU P N     1 
ATOM   289  C  CA    . LEU A 1 41 ? 17.369 27.212  7.987   1.00 70.51  ? 41  LEU P CA    1 
ATOM   290  C  C     . LEU A 1 41 ? 17.447 25.908  8.782   1.00 71.19  ? 41  LEU P C     1 
ATOM   291  O  O     . LEU A 1 41 ? 18.153 25.826  9.789   1.00 72.12  ? 41  LEU P O     1 
ATOM   292  C  CB    . LEU A 1 41 ? 15.913 27.684  7.872   1.00 71.76  ? 41  LEU P CB    1 
ATOM   293  C  CG    . LEU A 1 41 ? 15.569 29.180  7.807   1.00 72.63  ? 41  LEU P CG    1 
ATOM   294  C  CD1   . LEU A 1 41 ? 16.293 29.912  6.691   1.00 72.37  ? 41  LEU P CD1   1 
ATOM   295  C  CD2   . LEU A 1 41 ? 14.063 29.363  7.656   1.00 73.26  ? 41  LEU P CD2   1 
ATOM   296  N  N     . ASP A 1 42 ? 16.721 24.896  8.314   1.00 70.65  ? 42  ASP P N     1 
ATOM   297  C  CA    . ASP A 1 42 ? 16.770 23.559  8.891   1.00 70.54  ? 42  ASP P CA    1 
ATOM   298  C  C     . ASP A 1 42 ? 16.354 22.551  7.830   1.00 69.26  ? 42  ASP P C     1 
ATOM   299  O  O     . ASP A 1 42 ? 15.696 22.907  6.852   1.00 69.42  ? 42  ASP P O     1 
ATOM   300  C  CB    . ASP A 1 42 ? 15.847 23.459  10.115  1.00 72.25  ? 42  ASP P CB    1 
ATOM   301  C  CG    . ASP A 1 42 ? 16.182 22.270  11.017  1.00 73.64  ? 42  ASP P CG    1 
ATOM   302  O  OD1   . ASP A 1 42 ? 17.379 22.044  11.311  1.00 74.48  ? 42  ASP P OD1   1 
ATOM   303  O  OD2   . ASP A 1 42 ? 15.240 21.566  11.443  1.00 72.67  ? 42  ASP P OD2   1 
ATOM   304  N  N     . ILE A 1 43 ? 16.755 21.297  8.015   1.00 67.83  ? 43  ILE P N     1 
ATOM   305  C  CA    . ILE A 1 43 ? 16.316 20.217  7.143   1.00 66.49  ? 43  ILE P CA    1 
ATOM   306  C  C     . ILE A 1 43 ? 15.410 19.268  7.923   1.00 66.22  ? 43  ILE P C     1 
ATOM   307  O  O     . ILE A 1 43 ? 15.827 18.669  8.916   1.00 66.44  ? 43  ILE P O     1 
ATOM   308  C  CB    . ILE A 1 43 ? 17.506 19.458  6.509   1.00 66.63  ? 43  ILE P CB    1 
ATOM   309  C  CG1   . ILE A 1 43 ? 18.313 20.399  5.609   1.00 66.94  ? 43  ILE P CG1   1 
ATOM   310  C  CG2   . ILE A 1 43 ? 17.013 18.246  5.718   1.00 66.60  ? 43  ILE P CG2   1 
ATOM   311  C  CD1   . ILE A 1 43 ? 19.555 19.774  4.999   1.00 67.64  ? 43  ILE P CD1   1 
ATOM   312  N  N     . LEU A 1 44 ? 14.166 19.151  7.470   1.00 66.04  ? 44  LEU P N     1 
ATOM   313  C  CA    . LEU A 1 44 ? 13.185 18.297  8.122   1.00 66.09  ? 44  LEU P CA    1 
ATOM   314  C  C     . LEU A 1 44 ? 13.199 16.900  7.517   1.00 65.09  ? 44  LEU P C     1 
ATOM   315  O  O     . LEU A 1 44 ? 12.866 16.717  6.346   1.00 65.42  ? 44  LEU P O     1 
ATOM   316  C  CB    . LEU A 1 44 ? 11.781 18.910  8.023   1.00 68.08  ? 44  LEU P CB    1 
ATOM   317  C  CG    . LEU A 1 44 ? 11.299 19.984  9.013   1.00 69.60  ? 44  LEU P CG    1 
ATOM   318  C  CD1   . LEU A 1 44 ? 11.063 19.395  10.405  1.00 71.01  ? 44  LEU P CD1   1 
ATOM   319  C  CD2   . LEU A 1 44 ? 12.223 21.203  9.084   1.00 69.42  ? 44  LEU P CD2   1 
ATOM   320  N  N     . VAL A 1 45 ? 13.601 15.923  8.324   1.00 63.60  ? 45  VAL P N     1 
ATOM   321  C  CA    . VAL A 1 45 ? 13.624 14.522  7.916   1.00 62.92  ? 45  VAL P CA    1 
ATOM   322  C  C     . VAL A 1 45 ? 13.030 13.667  9.032   1.00 63.65  ? 45  VAL P C     1 
ATOM   323  O  O     . VAL A 1 45 ? 13.415 13.797  10.193  1.00 65.60  ? 45  VAL P O     1 
ATOM   324  C  CB    . VAL A 1 45 ? 15.067 14.041  7.588   1.00 61.93  ? 45  VAL P CB    1 
ATOM   325  C  CG1   . VAL A 1 45 ? 15.094 12.549  7.326   1.00 61.28  ? 45  VAL P CG1   1 
ATOM   326  C  CG2   . VAL A 1 45 ? 15.631 14.786  6.391   1.00 61.76  ? 45  VAL P CG2   1 
ATOM   327  N  N     . SER A 1 46 ? 12.083 12.804  8.677   1.00 64.18  ? 46  SER P N     1 
ATOM   328  C  CA    . SER A 1 46 ? 11.467 11.892  9.636   1.00 64.69  ? 46  SER P CA    1 
ATOM   329  C  C     . SER A 1 46 ? 11.265 10.524  8.994   1.00 65.06  ? 46  SER P C     1 
ATOM   330  O  O     . SER A 1 46 ? 11.017 10.431  7.791   1.00 65.32  ? 46  SER P O     1 
ATOM   331  C  CB    . SER A 1 46 ? 10.138 12.459  10.132  1.00 65.49  ? 46  SER P CB    1 
ATOM   332  O  OG    . SER A 1 46 ? 9.620  11.684  11.196  1.00 66.95  ? 46  SER P OG    1 
ATOM   333  N  N     . ARG A 1 47 ? 11.372 9.468   9.795   1.00 66.39  ? 47  ARG P N     1 
ATOM   334  C  CA    . ARG A 1 47 ? 11.339 8.099   9.267   1.00 67.79  ? 47  ARG P CA    1 
ATOM   335  C  C     . ARG A 1 47 ? 10.098 7.293   9.660   1.00 68.16  ? 47  ARG P C     1 
ATOM   336  O  O     . ARG A 1 47 ? 10.147 6.061   9.729   1.00 69.44  ? 47  ARG P O     1 
ATOM   337  C  CB    . ARG A 1 47 ? 12.621 7.346   9.641   1.00 68.54  ? 47  ARG P CB    1 
ATOM   338  C  CG    . ARG A 1 47 ? 13.850 7.809   8.870   1.00 70.75  ? 47  ARG P CG    1 
ATOM   339  C  CD    . ARG A 1 47 ? 15.100 7.063   9.303   1.00 71.97  ? 47  ARG P CD    1 
ATOM   340  N  NE    . ARG A 1 47 ? 15.141 5.702   8.772   1.00 73.06  ? 47  ARG P NE    1 
ATOM   341  C  CZ    . ARG A 1 47 ? 16.059 4.796   9.094   1.00 74.07  ? 47  ARG P CZ    1 
ATOM   342  N  NH1   . ARG A 1 47 ? 17.026 5.093   9.956   1.00 74.03  ? 47  ARG P NH1   1 
ATOM   343  N  NH2   . ARG A 1 47 ? 16.010 3.585   8.552   1.00 74.22  ? 47  ARG P NH2   1 
ATOM   344  N  N     . SER A 1 48 ? 8.990  7.987   9.905   1.00 67.76  ? 48  SER P N     1 
ATOM   345  C  CA    . SER A 1 48 ? 7.708  7.329   10.147  1.00 66.74  ? 48  SER P CA    1 
ATOM   346  C  C     . SER A 1 48 ? 7.106  6.881   8.820   1.00 67.60  ? 48  SER P C     1 
ATOM   347  O  O     . SER A 1 48 ? 7.478  7.395   7.766   1.00 68.37  ? 48  SER P O     1 
ATOM   348  C  CB    . SER A 1 48 ? 6.749  8.262   10.891  1.00 66.41  ? 48  SER P CB    1 
ATOM   349  O  OG    . SER A 1 48 ? 6.604  9.499   10.219  1.00 64.76  ? 48  SER P OG    1 
ATOM   350  N  N     . LEU A 1 49 ? 6.178  5.926   8.878   1.00 68.66  ? 49  LEU P N     1 
ATOM   351  C  CA    . LEU A 1 49 ? 5.533  5.365   7.682   1.00 68.33  ? 49  LEU P CA    1 
ATOM   352  C  C     . LEU A 1 49 ? 5.019  6.444   6.726   1.00 68.08  ? 49  LEU P C     1 
ATOM   353  O  O     . LEU A 1 49 ? 5.067  6.285   5.507   1.00 67.25  ? 49  LEU P O     1 
ATOM   354  C  CB    . LEU A 1 49 ? 4.383  4.439   8.090   1.00 68.60  ? 49  LEU P CB    1 
ATOM   355  C  CG    . LEU A 1 49 ? 3.707  3.606   6.996   1.00 69.29  ? 49  LEU P CG    1 
ATOM   356  C  CD1   . LEU A 1 49 ? 4.452  2.304   6.765   1.00 69.11  ? 49  LEU P CD1   1 
ATOM   357  C  CD2   . LEU A 1 49 ? 2.254  3.329   7.353   1.00 70.29  ? 49  LEU P CD2   1 
ATOM   358  N  N     . LYS A 1 50 ? 4.539  7.539   7.303   1.00 69.37  ? 50  LYS P N     1 
ATOM   359  C  CA    . LYS A 1 50 ? 3.982  8.657   6.556   1.00 70.58  ? 50  LYS P CA    1 
ATOM   360  C  C     . LYS A 1 50 ? 5.077  9.592   6.033   1.00 69.87  ? 50  LYS P C     1 
ATOM   361  O  O     . LYS A 1 50 ? 4.845  10.381  5.116   1.00 69.14  ? 50  LYS P O     1 
ATOM   362  C  CB    . LYS A 1 50 ? 3.025  9.433   7.468   1.00 72.95  ? 50  LYS P CB    1 
ATOM   363  C  CG    . LYS A 1 50 ? 1.919  10.186  6.754   1.00 75.40  ? 50  LYS P CG    1 
ATOM   364  C  CD    . LYS A 1 50 ? 1.063  10.945  7.753   1.00 76.49  ? 50  LYS P CD    1 
ATOM   365  C  CE    . LYS A 1 50 ? -0.052 11.706  7.059   1.00 77.39  ? 50  LYS P CE    1 
ATOM   366  N  NZ    . LYS A 1 50 ? -0.787 12.572  8.019   1.00 78.07  ? 50  LYS P NZ    1 
ATOM   367  N  N     . MET A 1 51 ? 6.270  9.495   6.614   1.00 68.96  ? 51  MET P N     1 
ATOM   368  C  CA    . MET A 1 51 ? 7.346  10.447  6.331   1.00 69.07  ? 51  MET P CA    1 
ATOM   369  C  C     . MET A 1 51 ? 8.580  9.842   5.655   1.00 68.01  ? 51  MET P C     1 
ATOM   370  O  O     . MET A 1 51 ? 9.479  10.574  5.239   1.00 68.98  ? 51  MET P O     1 
ATOM   371  C  CB    . MET A 1 51 ? 7.755  11.167  7.617   1.00 70.99  ? 51  MET P CB    1 
ATOM   372  C  CG    . MET A 1 51 ? 6.684  12.088  8.186   1.00 72.46  ? 51  MET P CG    1 
ATOM   373  S  SD    . MET A 1 51 ? 6.282  13.463  7.091   1.00 75.65  ? 51  MET P SD    1 
ATOM   374  C  CE    . MET A 1 51 ? 7.805  14.414  7.159   1.00 74.62  ? 51  MET P CE    1 
ATOM   375  N  N     . ARG A 1 52 ? 8.606  8.515   5.538   1.00 65.85  ? 52  ARG P N     1 
ATOM   376  C  CA    . ARG A 1 52 ? 9.739  7.783   4.964   1.00 63.78  ? 52  ARG P CA    1 
ATOM   377  C  C     . ARG A 1 52 ? 10.053 8.171   3.523   1.00 62.25  ? 52  ARG P C     1 
ATOM   378  O  O     . ARG A 1 52 ? 9.146  8.426   2.730   1.00 63.55  ? 52  ARG P O     1 
ATOM   379  C  CB    . ARG A 1 52 ? 9.489  6.277   5.051   1.00 65.46  ? 52  ARG P CB    1 
ATOM   380  C  CG    . ARG A 1 52 ? 9.761  5.709   6.425   1.00 68.07  ? 52  ARG P CG    1 
ATOM   381  C  CD    . ARG A 1 52 ? 9.093  4.366   6.656   1.00 68.80  ? 52  ARG P CD    1 
ATOM   382  N  NE    . ARG A 1 52 ? 9.089  4.040   8.082   1.00 69.38  ? 52  ARG P NE    1 
ATOM   383  C  CZ    . ARG A 1 52 ? 8.948  2.818   8.586   1.00 69.95  ? 52  ARG P CZ    1 
ATOM   384  N  NH1   . ARG A 1 52 ? 8.797  1.769   7.787   1.00 70.80  ? 52  ARG P NH1   1 
ATOM   385  N  NH2   . ARG A 1 52 ? 8.962  2.643   9.900   1.00 71.50  ? 52  ARG P NH2   1 
ATOM   386  N  N     . GLY A 1 53 ? 11.345 8.216   3.203   1.00 59.84  ? 53  GLY P N     1 
ATOM   387  C  CA    . GLY A 1 53 ? 11.820 8.506   1.846   1.00 57.52  ? 53  GLY P CA    1 
ATOM   388  C  C     . GLY A 1 53 ? 11.596 9.933   1.380   1.00 55.96  ? 53  GLY P C     1 
ATOM   389  O  O     . GLY A 1 53 ? 11.617 10.211  0.182   1.00 56.35  ? 53  GLY P O     1 
ATOM   390  N  N     . GLN A 1 54 ? 11.395 10.841  2.331   1.00 55.63  ? 54  GLN P N     1 
ATOM   391  C  CA    . GLN A 1 54 ? 11.038 12.225  2.026   1.00 55.28  ? 54  GLN P CA    1 
ATOM   392  C  C     . GLN A 1 54 ? 11.924 13.212  2.780   1.00 53.06  ? 54  GLN P C     1 
ATOM   393  O  O     . GLN A 1 54 ? 12.485 12.875  3.823   1.00 51.99  ? 54  GLN P O     1 
ATOM   394  C  CB    . GLN A 1 54 ? 9.564  12.472  2.368   1.00 56.99  ? 54  GLN P CB    1 
ATOM   395  C  CG    . GLN A 1 54 ? 8.597  11.512  1.686   1.00 58.64  ? 54  GLN P CG    1 
ATOM   396  C  CD    . GLN A 1 54 ? 7.285  11.371  2.427   1.00 60.02  ? 54  GLN P CD    1 
ATOM   397  O  OE1   . GLN A 1 54 ? 6.492  12.312  2.499   1.00 62.25  ? 54  GLN P OE1   1 
ATOM   398  N  NE2   . GLN A 1 54 ? 7.041  10.186  2.973   1.00 59.54  ? 54  GLN P NE2   1 
ATOM   399  N  N     . ALA A 1 55 ? 12.043 14.428  2.248   1.00 51.60  ? 55  ALA P N     1 
ATOM   400  C  CA    . ALA A 1 55 ? 12.855 15.476  2.874   1.00 50.86  ? 55  ALA P CA    1 
ATOM   401  C  C     . ALA A 1 55 ? 12.371 16.890  2.566   1.00 51.02  ? 55  ALA P C     1 
ATOM   402  O  O     . ALA A 1 55 ? 12.000 17.207  1.434   1.00 51.77  ? 55  ALA P O     1 
ATOM   403  C  CB    . ALA A 1 55 ? 14.317 15.328  2.479   1.00 50.85  ? 55  ALA P CB    1 
ATOM   404  N  N     . PHE A 1 56 ? 12.394 17.736  3.592   1.00 51.48  ? 56  PHE P N     1 
ATOM   405  C  CA    . PHE A 1 56 ? 12.088 19.151  3.449   1.00 52.22  ? 56  PHE P CA    1 
ATOM   406  C  C     . PHE A 1 56 ? 13.344 19.973  3.710   1.00 51.54  ? 56  PHE P C     1 
ATOM   407  O  O     . PHE A 1 56 ? 13.870 19.971  4.825   1.00 53.03  ? 56  PHE P O     1 
ATOM   408  C  CB    . PHE A 1 56 ? 10.980 19.565  4.424   1.00 53.24  ? 56  PHE P CB    1 
ATOM   409  C  CG    . PHE A 1 56 ? 9.632  18.989  4.094   1.00 55.48  ? 56  PHE P CG    1 
ATOM   410  C  CD1   . PHE A 1 56 ? 9.241  17.754  4.609   1.00 56.61  ? 56  PHE P CD1   1 
ATOM   411  C  CD2   . PHE A 1 56 ? 8.748  19.685  3.275   1.00 55.66  ? 56  PHE P CD2   1 
ATOM   412  C  CE1   . PHE A 1 56 ? 7.992  17.216  4.304   1.00 56.49  ? 56  PHE P CE1   1 
ATOM   413  C  CE2   . PHE A 1 56 ? 7.498  19.158  2.964   1.00 55.83  ? 56  PHE P CE2   1 
ATOM   414  C  CZ    . PHE A 1 56 ? 7.119  17.920  3.482   1.00 56.89  ? 56  PHE P CZ    1 
ATOM   415  N  N     . VAL A 1 57 ? 13.829 20.660  2.678   1.00 49.70  ? 57  VAL P N     1 
ATOM   416  C  CA    . VAL A 1 57 ? 14.964 21.566  2.821   1.00 49.92  ? 57  VAL P CA    1 
ATOM   417  C  C     . VAL A 1 57 ? 14.473 23.008  2.748   1.00 51.04  ? 57  VAL P C     1 
ATOM   418  O  O     . VAL A 1 57 ? 14.019 23.462  1.696   1.00 50.95  ? 57  VAL P O     1 
ATOM   419  C  CB    . VAL A 1 57 ? 16.049 21.320  1.745   1.00 49.85  ? 57  VAL P CB    1 
ATOM   420  C  CG1   . VAL A 1 57 ? 17.189 22.317  1.895   1.00 50.58  ? 57  VAL P CG1   1 
ATOM   421  C  CG2   . VAL A 1 57 ? 16.586 19.904  1.840   1.00 49.81  ? 57  VAL P CG2   1 
ATOM   422  N  N     . ILE A 1 58 ? 14.564 23.717  3.871   1.00 51.65  ? 58  ILE P N     1 
ATOM   423  C  CA    . ILE A 1 58 ? 14.102 25.102  3.954   1.00 52.28  ? 58  ILE P CA    1 
ATOM   424  C  C     . ILE A 1 58 ? 15.261 26.072  3.744   1.00 53.40  ? 58  ILE P C     1 
ATOM   425  O  O     . ILE A 1 58 ? 16.260 26.027  4.463   1.00 55.73  ? 58  ILE P O     1 
ATOM   426  C  CB    . ILE A 1 58 ? 13.404 25.408  5.304   1.00 51.18  ? 58  ILE P CB    1 
ATOM   427  C  CG1   . ILE A 1 58 ? 12.446 24.278  5.697   1.00 50.88  ? 58  ILE P CG1   1 
ATOM   428  C  CG2   . ILE A 1 58 ? 12.662 26.741  5.230   1.00 52.22  ? 58  ILE P CG2   1 
ATOM   429  C  CD1   . ILE A 1 58 ? 11.880 24.403  7.103   1.00 51.34  ? 58  ILE P CD1   1 
ATOM   430  N  N     . PHE A 1 59 ? 15.116 26.948  2.756   1.00 55.12  ? 59  PHE P N     1 
ATOM   431  C  CA    . PHE A 1 59 ? 16.137 27.943  2.443   1.00 57.70  ? 59  PHE P CA    1 
ATOM   432  C  C     . PHE A 1 59 ? 15.776 29.311  3.011   1.00 59.81  ? 59  PHE P C     1 
ATOM   433  O  O     . PHE A 1 59 ? 14.606 29.583  3.290   1.00 59.92  ? 59  PHE P O     1 
ATOM   434  C  CB    . PHE A 1 59 ? 16.315 28.059  0.927   1.00 56.34  ? 59  PHE P CB    1 
ATOM   435  C  CG    . PHE A 1 59 ? 16.958 26.859  0.293   1.00 55.66  ? 59  PHE P CG    1 
ATOM   436  C  CD1   . PHE A 1 59 ? 18.343 26.772  0.185   1.00 55.51  ? 59  PHE P CD1   1 
ATOM   437  C  CD2   . PHE A 1 59 ? 16.181 25.822  -0.210  1.00 55.01  ? 59  PHE P CD2   1 
ATOM   438  C  CE1   . PHE A 1 59 ? 18.945 25.663  -0.408  1.00 55.30  ? 59  PHE P CE1   1 
ATOM   439  C  CE2   . PHE A 1 59 ? 16.771 24.712  -0.808  1.00 55.15  ? 59  PHE P CE2   1 
ATOM   440  C  CZ    . PHE A 1 59 ? 18.157 24.631  -0.905  1.00 54.59  ? 59  PHE P CZ    1 
ATOM   441  N  N     . LYS A 1 60 ? 16.786 30.166  3.181   1.00 62.92  ? 60  LYS P N     1 
ATOM   442  C  CA    . LYS A 1 60 ? 16.564 31.576  3.498   1.00 64.82  ? 60  LYS P CA    1 
ATOM   443  C  C     . LYS A 1 60 ? 15.810 32.248  2.362   1.00 65.30  ? 60  LYS P C     1 
ATOM   444  O  O     . LYS A 1 60 ? 14.854 32.985  2.593   1.00 65.12  ? 60  LYS P O     1 
ATOM   445  C  CB    . LYS A 1 60 ? 17.887 32.312  3.729   1.00 67.05  ? 60  LYS P CB    1 
ATOM   446  C  CG    . LYS A 1 60 ? 18.379 32.322  5.167   1.00 68.90  ? 60  LYS P CG    1 
ATOM   447  C  CD    . LYS A 1 60 ? 19.448 33.392  5.363   1.00 71.74  ? 60  LYS P CD    1 
ATOM   448  C  CE    . LYS A 1 60 ? 20.033 33.373  6.776   1.00 73.73  ? 60  LYS P CE    1 
ATOM   449  N  NZ    . LYS A 1 60 ? 21.063 32.308  6.968   1.00 74.60  ? 60  LYS P NZ    1 
ATOM   450  N  N     . GLU A 1 61 ? 16.239 31.971  1.134   1.00 66.25  ? 61  GLU P N     1 
ATOM   451  C  CA    . GLU A 1 61 ? 15.692 32.627  -0.047  1.00 66.70  ? 61  GLU P CA    1 
ATOM   452  C  C     . GLU A 1 61 ? 15.037 31.640  -1.006  1.00 66.84  ? 61  GLU P C     1 
ATOM   453  O  O     . GLU A 1 61 ? 15.579 30.564  -1.267  1.00 67.07  ? 61  GLU P O     1 
ATOM   454  C  CB    . GLU A 1 61 ? 16.794 33.409  -0.758  1.00 67.58  ? 61  GLU P CB    1 
ATOM   455  C  CG    . GLU A 1 61 ? 17.429 34.489  0.112   1.00 69.78  ? 61  GLU P CG    1 
ATOM   456  C  CD    . GLU A 1 61 ? 18.677 35.086  -0.502  1.00 70.73  ? 61  GLU P CD    1 
ATOM   457  O  OE1   . GLU A 1 61 ? 19.654 35.309  0.246   1.00 71.11  ? 61  GLU P OE1   1 
ATOM   458  O  OE2   . GLU A 1 61 ? 18.683 35.328  -1.729  1.00 71.63  ? 61  GLU P OE2   1 
ATOM   459  N  N     . VAL A 1 62 ? 13.869 32.021  -1.523  1.00 67.50  ? 62  VAL P N     1 
ATOM   460  C  CA    . VAL A 1 62 ? 13.124 31.217  -2.504  1.00 68.34  ? 62  VAL P CA    1 
ATOM   461  C  C     . VAL A 1 62 ? 13.938 31.014  -3.785  1.00 69.51  ? 62  VAL P C     1 
ATOM   462  O  O     . VAL A 1 62 ? 13.882 29.949  -4.401  1.00 69.69  ? 62  VAL P O     1 
ATOM   463  C  CB    . VAL A 1 62 ? 11.750 31.861  -2.859  1.00 67.33  ? 62  VAL P CB    1 
ATOM   464  C  CG1   . VAL A 1 62 ? 10.998 31.023  -3.892  1.00 66.61  ? 62  VAL P CG1   1 
ATOM   465  C  CG2   . VAL A 1 62 ? 10.899 32.049  -1.615  1.00 65.99  ? 62  VAL P CG2   1 
ATOM   466  N  N     . SER A 1 63 ? 14.691 32.040  -4.174  1.00 70.80  ? 63  SER P N     1 
ATOM   467  C  CA    . SER A 1 63 ? 15.532 31.980  -5.366  1.00 72.94  ? 63  SER P CA    1 
ATOM   468  C  C     . SER A 1 63 ? 16.560 30.851  -5.278  1.00 73.51  ? 63  SER P C     1 
ATOM   469  O  O     . SER A 1 63 ? 16.797 30.148  -6.261  1.00 74.86  ? 63  SER P O     1 
ATOM   470  C  CB    . SER A 1 63 ? 16.226 33.323  -5.601  1.00 73.36  ? 63  SER P CB    1 
ATOM   471  O  OG    . SER A 1 63 ? 16.988 33.704  -4.470  1.00 75.33  ? 63  SER P OG    1 
ATOM   472  N  N     . SER A 1 64 ? 17.153 30.678  -4.097  1.00 73.28  ? 64  SER P N     1 
ATOM   473  C  CA    . SER A 1 64 ? 18.118 29.607  -3.863  1.00 73.78  ? 64  SER P CA    1 
ATOM   474  C  C     . SER A 1 64 ? 17.442 28.233  -3.872  1.00 74.09  ? 64  SER P C     1 
ATOM   475  O  O     . SER A 1 64 ? 18.055 27.233  -4.255  1.00 74.55  ? 64  SER P O     1 
ATOM   476  C  CB    . SER A 1 64 ? 18.878 29.833  -2.553  1.00 74.22  ? 64  SER P CB    1 
ATOM   477  O  OG    . SER A 1 64 ? 18.035 29.680  -1.428  1.00 76.33  ? 64  SER P OG    1 
ATOM   478  N  N     . ALA A 1 65 ? 16.179 28.194  -3.450  1.00 73.75  ? 65  ALA P N     1 
ATOM   479  C  CA    . ALA A 1 65 ? 15.363 26.983  -3.538  1.00 72.77  ? 65  ALA P CA    1 
ATOM   480  C  C     . ALA A 1 65 ? 15.023 26.666  -4.991  1.00 72.62  ? 65  ALA P C     1 
ATOM   481  O  O     . ALA A 1 65 ? 14.969 25.499  -5.379  1.00 73.18  ? 65  ALA P O     1 
ATOM   482  C  CB    . ALA A 1 65 ? 14.090 27.137  -2.721  1.00 71.97  ? 65  ALA P CB    1 
ATOM   483  N  N     . THR A 1 66 ? 14.800 27.716  -5.780  1.00 72.37  ? 66  THR P N     1 
ATOM   484  C  CA    . THR A 1 66 ? 14.475 27.594  -7.201  1.00 71.59  ? 66  THR P CA    1 
ATOM   485  C  C     . THR A 1 66 ? 15.646 27.000  -7.979  1.00 70.84  ? 66  THR P C     1 
ATOM   486  O  O     . THR A 1 66 ? 15.458 26.130  -8.831  1.00 69.83  ? 66  THR P O     1 
ATOM   487  C  CB    . THR A 1 66 ? 14.083 28.966  -7.804  1.00 72.05  ? 66  THR P CB    1 
ATOM   488  O  OG1   . THR A 1 66 ? 13.075 29.579  -6.991  1.00 72.70  ? 66  THR P OG1   1 
ATOM   489  C  CG2   . THR A 1 66 ? 13.555 28.812  -9.229  1.00 71.59  ? 66  THR P CG2   1 
ATOM   490  N  N     . ASN A 1 67 ? 16.852 27.471  -7.672  1.00 70.47  ? 67  ASN P N     1 
ATOM   491  C  CA    . ASN A 1 67 ? 18.058 26.971  -8.319  1.00 70.79  ? 67  ASN P CA    1 
ATOM   492  C  C     . ASN A 1 67 ? 18.331 25.519  -7.955  1.00 69.83  ? 67  ASN P C     1 
ATOM   493  O  O     . ASN A 1 67 ? 18.590 24.702  -8.834  1.00 70.19  ? 67  ASN P O     1 
ATOM   494  C  CB    . ASN A 1 67 ? 19.262 27.854  -7.983  1.00 71.93  ? 67  ASN P CB    1 
ATOM   495  C  CG    . ASN A 1 67 ? 19.121 29.272  -8.523  1.00 73.48  ? 67  ASN P CG    1 
ATOM   496  O  OD1   . ASN A 1 67 ? 18.128 29.618  -9.170  1.00 72.43  ? 67  ASN P OD1   1 
ATOM   497  N  ND2   . ASN A 1 67 ? 20.123 30.103  -8.253  1.00 75.22  ? 67  ASN P ND2   1 
ATOM   498  N  N     . ALA A 1 68 ? 18.239 25.207  -6.662  1.00 69.11  ? 68  ALA P N     1 
ATOM   499  C  CA    . ALA A 1 68 ? 18.466 23.854  -6.140  1.00 68.14  ? 68  ALA P CA    1 
ATOM   500  C  C     . ALA A 1 68 ? 17.574 22.801  -6.797  1.00 68.29  ? 68  ALA P C     1 
ATOM   501  O  O     . ALA A 1 68 ? 18.025 21.692  -7.086  1.00 67.81  ? 68  ALA P O     1 
ATOM   502  C  CB    . ALA A 1 68 ? 18.282 23.836  -4.629  1.00 67.95  ? 68  ALA P CB    1 
ATOM   503  N  N     . LEU A 1 69 ? 16.312 23.160  -7.026  1.00 69.27  ? 69  LEU P N     1 
ATOM   504  C  CA    . LEU A 1 69 ? 15.340 22.281  -7.674  1.00 69.95  ? 69  LEU P CA    1 
ATOM   505  C  C     . LEU A 1 69 ? 15.719 22.050  -9.130  1.00 71.53  ? 69  LEU P C     1 
ATOM   506  O  O     . LEU A 1 69 ? 15.865 20.909  -9.568  1.00 72.31  ? 69  LEU P O     1 
ATOM   507  C  CB    . LEU A 1 69 ? 13.930 22.886  -7.578  1.00 68.95  ? 69  LEU P CB    1 
ATOM   508  C  CG    . LEU A 1 69 ? 12.708 22.127  -8.115  1.00 68.62  ? 69  LEU P CG    1 
ATOM   509  C  CD1   . LEU A 1 69 ? 11.455 22.552  -7.366  1.00 68.96  ? 69  LEU P CD1   1 
ATOM   510  C  CD2   . LEU A 1 69 ? 12.511 22.311  -9.617  1.00 68.65  ? 69  LEU P CD2   1 
ATOM   511  N  N     . ARG A 1 70 ? 15.876 23.145  -9.870  1.00 73.08  ? 70  ARG P N     1 
ATOM   512  C  CA    . ARG A 1 70 ? 16.155 23.088  -11.298 1.00 74.41  ? 70  ARG P CA    1 
ATOM   513  C  C     . ARG A 1 70 ? 17.530 22.486  -11.599 1.00 75.37  ? 70  ARG P C     1 
ATOM   514  O  O     . ARG A 1 70 ? 17.700 21.795  -12.607 1.00 75.39  ? 70  ARG P O     1 
ATOM   515  C  CB    . ARG A 1 70 ? 15.986 24.477  -11.931 1.00 75.27  ? 70  ARG P CB    1 
ATOM   516  C  CG    . ARG A 1 70 ? 14.540 24.779  -12.343 1.00 76.61  ? 70  ARG P CG    1 
ATOM   517  C  CD    . ARG A 1 70 ? 14.132 26.241  -12.128 1.00 78.28  ? 70  ARG P CD    1 
ATOM   518  N  NE    . ARG A 1 70 ? 14.722 27.167  -13.100 1.00 79.62  ? 70  ARG P NE    1 
ATOM   519  C  CZ    . ARG A 1 70 ? 14.294 28.411  -13.320 1.00 79.79  ? 70  ARG P CZ    1 
ATOM   520  N  NH1   . ARG A 1 70 ? 13.256 28.901  -12.652 1.00 80.16  ? 70  ARG P NH1   1 
ATOM   521  N  NH2   . ARG A 1 70 ? 14.902 29.170  -14.221 1.00 80.30  ? 70  ARG P NH2   1 
ATOM   522  N  N     . SER A 1 71 ? 18.491 22.722  -10.705 1.00 75.79  ? 71  SER P N     1 
ATOM   523  C  CA    . SER A 1 71 ? 19.872 22.276  -10.908 1.00 76.68  ? 71  SER P CA    1 
ATOM   524  C  C     . SER A 1 71 ? 20.121 20.816  -10.532 1.00 77.22  ? 71  SER P C     1 
ATOM   525  O  O     . SER A 1 71 ? 21.059 20.199  -11.042 1.00 78.31  ? 71  SER P O     1 
ATOM   526  C  CB    . SER A 1 71 ? 20.852 23.173  -10.147 1.00 76.18  ? 71  SER P CB    1 
ATOM   527  O  OG    . SER A 1 71 ? 20.682 24.535  -10.506 1.00 77.09  ? 71  SER P OG    1 
ATOM   528  N  N     . MET A 1 72 ? 19.292 20.264  -9.649  1.00 77.19  ? 72  MET P N     1 
ATOM   529  C  CA    . MET A 1 72 ? 19.538 18.914  -9.136  1.00 76.71  ? 72  MET P CA    1 
ATOM   530  C  C     . MET A 1 72 ? 18.343 17.947  -9.154  1.00 76.58  ? 72  MET P C     1 
ATOM   531  O  O     . MET A 1 72 ? 18.313 16.933  -8.359  1.00 75.50  ? 72  MET P O     1 
ATOM   532  C  CB    . MET A 1 72 ? 20.158 18.976  -7.739  1.00 77.03  ? 72  MET P CB    1 
ATOM   533  C  CG    . MET A 1 72 ? 21.659 19.136  -7.768  1.00 78.13  ? 72  MET P CG    1 
ATOM   534  S  SD    . MET A 1 72 ? 22.386 18.963  -6.138  1.00 80.36  ? 72  MET P SD    1 
ATOM   535  C  CE    . MET A 1 72 ? 24.116 18.765  -6.562  1.00 81.61  ? 72  MET P CE    1 
ATOM   536  N  N     . GLN A 1 73 ? 17.377 18.244  -10.069 1.00 77.39  ? 73  GLN P N     1 
ATOM   537  C  CA    . GLN A 1 73 ? 16.236 17.333  -10.223 1.00 78.05  ? 73  GLN P CA    1 
ATOM   538  C  C     . GLN A 1 73 ? 16.685 16.089  -10.985 1.00 78.05  ? 73  GLN P C     1 
ATOM   539  O  O     . GLN A 1 73 ? 17.300 16.195  -12.048 1.00 77.97  ? 73  GLN P O     1 
ATOM   540  C  CB    . GLN A 1 73 ? 15.086 18.020  -10.964 1.00 78.23  ? 73  GLN P CB    1 
ATOM   541  C  CG    . GLN A 1 73 ? 13.720 17.913  -10.273 1.00 79.31  ? 73  GLN P CG    1 
ATOM   542  C  CD    . GLN A 1 73 ? 13.085 16.525  -10.335 1.00 79.89  ? 73  GLN P CD    1 
ATOM   543  O  OE1   . GLN A 1 73 ? 13.680 15.564  -10.825 1.00 80.91  ? 73  GLN P OE1   1 
ATOM   544  N  NE2   . GLN A 1 73 ? 11.861 16.424  -9.833  1.00 80.00  ? 73  GLN P NE2   1 
ATOM   545  N  N     . GLY A 1 74 ? 16.390 14.916  -10.427 1.00 78.16  ? 74  GLY P N     1 
ATOM   546  C  CA    . GLY A 1 74 ? 16.762 13.639  -11.042 1.00 78.21  ? 74  GLY P CA    1 
ATOM   547  C  C     . GLY A 1 74 ? 18.062 13.044  -10.523 1.00 77.68  ? 74  GLY P C     1 
ATOM   548  O  O     . GLY A 1 74 ? 18.272 11.834  -10.615 1.00 78.32  ? 74  GLY P O     1 
ATOM   549  N  N     . PHE A 1 75 ? 18.925 13.903  -9.980  1.00 76.74  ? 75  PHE P N     1 
ATOM   550  C  CA    . PHE A 1 75 ? 20.240 13.526  -9.446  1.00 77.20  ? 75  PHE P CA    1 
ATOM   551  C  C     . PHE A 1 75 ? 20.203 12.243  -8.600  1.00 76.71  ? 75  PHE P C     1 
ATOM   552  O  O     . PHE A 1 75 ? 19.464 12.170  -7.614  1.00 75.98  ? 75  PHE P O     1 
ATOM   553  C  CB    . PHE A 1 75 ? 20.806 14.692  -8.622  1.00 77.88  ? 75  PHE P CB    1 
ATOM   554  C  CG    . PHE A 1 75 ? 22.297 14.643  -8.417  1.00 79.00  ? 75  PHE P CG    1 
ATOM   555  C  CD1   . PHE A 1 75 ? 23.151 15.331  -9.276  1.00 79.61  ? 75  PHE P CD1   1 
ATOM   556  C  CD2   . PHE A 1 75 ? 22.848 13.938  -7.349  1.00 79.27  ? 75  PHE P CD2   1 
ATOM   557  C  CE1   . PHE A 1 75 ? 24.534 15.303  -9.084  1.00 80.20  ? 75  PHE P CE1   1 
ATOM   558  C  CE2   . PHE A 1 75 ? 24.229 13.900  -7.150  1.00 79.39  ? 75  PHE P CE2   1 
ATOM   559  C  CZ    . PHE A 1 75 ? 25.073 14.585  -8.017  1.00 79.98  ? 75  PHE P CZ    1 
ATOM   560  N  N     . PRO A 1 76 ? 20.990 11.222  -8.999  1.00 76.70  ? 76  PRO P N     1 
ATOM   561  C  CA    . PRO A 1 76 ? 21.116 9.972   -8.246  1.00 76.59  ? 76  PRO P CA    1 
ATOM   562  C  C     . PRO A 1 76 ? 21.790 10.183  -6.891  1.00 75.90  ? 76  PRO P C     1 
ATOM   563  O  O     . PRO A 1 76 ? 22.881 10.757  -6.815  1.00 75.94  ? 76  PRO P O     1 
ATOM   564  C  CB    . PRO A 1 76 ? 21.990 9.097   -9.153  1.00 76.82  ? 76  PRO P CB    1 
ATOM   565  C  CG    . PRO A 1 76 ? 21.821 9.672   -10.511 1.00 77.27  ? 76  PRO P CG    1 
ATOM   566  C  CD    . PRO A 1 76 ? 21.701 11.145  -10.288 1.00 77.15  ? 76  PRO P CD    1 
ATOM   567  N  N     . PHE A 1 77 ? 21.129 9.700   -5.841  1.00 74.72  ? 77  PHE P N     1 
ATOM   568  C  CA    . PHE A 1 77 ? 21.515 9.960   -4.458  1.00 72.57  ? 77  PHE P CA    1 
ATOM   569  C  C     . PHE A 1 77 ? 21.297 8.693   -3.629  1.00 71.11  ? 77  PHE P C     1 
ATOM   570  O  O     . PHE A 1 77 ? 20.155 8.282   -3.395  1.00 68.54  ? 77  PHE P O     1 
ATOM   571  C  CB    . PHE A 1 77 ? 20.676 11.120  -3.918  1.00 72.34  ? 77  PHE P CB    1 
ATOM   572  C  CG    . PHE A 1 77 ? 21.122 11.635  -2.586  1.00 72.37  ? 77  PHE P CG    1 
ATOM   573  C  CD1   . PHE A 1 77 ? 22.336 12.300  -2.451  1.00 72.45  ? 77  PHE P CD1   1 
ATOM   574  C  CD2   . PHE A 1 77 ? 20.310 11.486  -1.468  1.00 72.33  ? 77  PHE P CD2   1 
ATOM   575  C  CE1   . PHE A 1 77 ? 22.745 12.788  -1.217  1.00 73.06  ? 77  PHE P CE1   1 
ATOM   576  C  CE2   . PHE A 1 77 ? 20.707 11.975  -0.231  1.00 73.27  ? 77  PHE P CE2   1 
ATOM   577  C  CZ    . PHE A 1 77 ? 21.929 12.627  -0.105  1.00 73.40  ? 77  PHE P CZ    1 
ATOM   578  N  N     . TYR A 1 78 ? 22.401 8.088   -3.190  1.00 69.87  ? 78  TYR P N     1 
ATOM   579  C  CA    . TYR A 1 78 ? 22.399 6.757   -2.575  1.00 69.55  ? 78  TYR P CA    1 
ATOM   580  C  C     . TYR A 1 78 ? 21.743 5.741   -3.510  1.00 71.10  ? 78  TYR P C     1 
ATOM   581  O  O     . TYR A 1 78 ? 20.803 5.042   -3.121  1.00 70.76  ? 78  TYR P O     1 
ATOM   582  C  CB    . TYR A 1 78 ? 21.700 6.758   -1.209  1.00 67.92  ? 78  TYR P CB    1 
ATOM   583  C  CG    . TYR A 1 78 ? 22.436 7.489   -0.110  1.00 66.15  ? 78  TYR P CG    1 
ATOM   584  C  CD1   . TYR A 1 78 ? 23.514 6.900   0.547   1.00 65.85  ? 78  TYR P CD1   1 
ATOM   585  C  CD2   . TYR A 1 78 ? 22.039 8.761   0.291   1.00 65.44  ? 78  TYR P CD2   1 
ATOM   586  C  CE1   . TYR A 1 78 ? 24.183 7.566   1.568   1.00 65.00  ? 78  TYR P CE1   1 
ATOM   587  C  CE2   . TYR A 1 78 ? 22.706 9.436   1.308   1.00 65.15  ? 78  TYR P CE2   1 
ATOM   588  C  CZ    . TYR A 1 78 ? 23.777 8.832   1.941   1.00 64.50  ? 78  TYR P CZ    1 
ATOM   589  O  OH    . TYR A 1 78 ? 24.438 9.492   2.950   1.00 63.15  ? 78  TYR P OH    1 
ATOM   590  N  N     . ASP A 1 79 ? 22.242 5.689   -4.747  1.00 73.33  ? 79  ASP P N     1 
ATOM   591  C  CA    . ASP A 1 79 ? 21.730 4.804   -5.808  1.00 74.53  ? 79  ASP P CA    1 
ATOM   592  C  C     . ASP A 1 79 ? 20.236 5.014   -6.150  1.00 73.85  ? 79  ASP P C     1 
ATOM   593  O  O     . ASP A 1 79 ? 19.592 4.131   -6.724  1.00 73.76  ? 79  ASP P O     1 
ATOM   594  C  CB    . ASP A 1 79 ? 22.039 3.328   -5.488  1.00 75.93  ? 79  ASP P CB    1 
ATOM   595  C  CG    . ASP A 1 79 ? 22.074 2.443   -6.732  1.00 77.34  ? 79  ASP P CG    1 
ATOM   596  O  OD1   . ASP A 1 79 ? 22.408 2.944   -7.831  1.00 77.86  ? 79  ASP P OD1   1 
ATOM   597  O  OD2   . ASP A 1 79 ? 21.771 1.236   -6.605  1.00 77.54  ? 79  ASP P OD2   1 
ATOM   598  N  N     . LYS A 1 80 ? 19.696 6.182   -5.803  1.00 73.73  ? 80  LYS P N     1 
ATOM   599  C  CA    . LYS A 1 80 ? 18.301 6.518   -6.110  1.00 73.49  ? 80  LYS P CA    1 
ATOM   600  C  C     . LYS A 1 80 ? 18.146 7.961   -6.599  1.00 74.26  ? 80  LYS P C     1 
ATOM   601  O  O     . LYS A 1 80 ? 18.685 8.886   -5.985  1.00 73.92  ? 80  LYS P O     1 
ATOM   602  C  CB    . LYS A 1 80 ? 17.389 6.271   -4.903  1.00 72.16  ? 80  LYS P CB    1 
ATOM   603  C  CG    . LYS A 1 80 ? 16.982 4.816   -4.711  1.00 72.11  ? 80  LYS P CG    1 
ATOM   604  C  CD    . LYS A 1 80 ? 15.839 4.673   -3.718  1.00 71.48  ? 80  LYS P CD    1 
ATOM   605  C  CE    . LYS A 1 80 ? 14.502 5.031   -4.348  1.00 71.99  ? 80  LYS P CE    1 
ATOM   606  N  NZ    . LYS A 1 80 ? 13.403 5.043   -3.345  1.00 73.15  ? 80  LYS P NZ    1 
ATOM   607  N  N     . PRO A 1 81 ? 17.397 8.156   -7.704  1.00 74.32  ? 81  PRO P N     1 
ATOM   608  C  CA    . PRO A 1 81 ? 17.201 9.495   -8.254  1.00 73.20  ? 81  PRO P CA    1 
ATOM   609  C  C     . PRO A 1 81 ? 16.276 10.331  -7.376  1.00 72.45  ? 81  PRO P C     1 
ATOM   610  O  O     . PRO A 1 81 ? 15.177 9.889   -7.029  1.00 71.86  ? 81  PRO P O     1 
ATOM   611  C  CB    . PRO A 1 81 ? 16.554 9.225   -9.615  1.00 73.27  ? 81  PRO P CB    1 
ATOM   612  C  CG    . PRO A 1 81 ? 15.848 7.926   -9.447  1.00 73.64  ? 81  PRO P CG    1 
ATOM   613  C  CD    . PRO A 1 81 ? 16.650 7.130   -8.459  1.00 74.15  ? 81  PRO P CD    1 
ATOM   614  N  N     . MET A 1 82 ? 16.734 11.523  -7.009  1.00 72.19  ? 82  MET P N     1 
ATOM   615  C  CA    . MET A 1 82 ? 15.919 12.453  -6.239  1.00 72.11  ? 82  MET P CA    1 
ATOM   616  C  C     . MET A 1 82 ? 14.759 12.967  -7.083  1.00 72.34  ? 82  MET P C     1 
ATOM   617  O  O     . MET A 1 82 ? 14.875 13.085  -8.305  1.00 72.60  ? 82  MET P O     1 
ATOM   618  C  CB    . MET A 1 82 ? 16.769 13.620  -5.733  1.00 71.74  ? 82  MET P CB    1 
ATOM   619  C  CG    . MET A 1 82 ? 17.663 13.272  -4.551  1.00 71.59  ? 82  MET P CG    1 
ATOM   620  S  SD    . MET A 1 82 ? 18.623 14.674  -3.937  1.00 71.26  ? 82  MET P SD    1 
ATOM   621  C  CE    . MET A 1 82 ? 20.010 14.674  -5.066  1.00 71.25  ? 82  MET P CE    1 
ATOM   622  N  N     . ARG A 1 83 ? 13.635 13.249  -6.430  1.00 72.88  ? 83  ARG P N     1 
ATOM   623  C  CA    . ARG A 1 83 ? 12.481 13.836  -7.103  1.00 74.28  ? 83  ARG P CA    1 
ATOM   624  C  C     . ARG A 1 83 ? 12.070 15.115  -6.384  1.00 73.25  ? 83  ARG P C     1 
ATOM   625  O  O     . ARG A 1 83 ? 11.290 15.089  -5.429  1.00 74.77  ? 83  ARG P O     1 
ATOM   626  C  CB    . ARG A 1 83 ? 11.314 12.840  -7.184  1.00 77.26  ? 83  ARG P CB    1 
ATOM   627  C  CG    . ARG A 1 83 ? 11.616 11.564  -7.975  1.00 80.64  ? 83  ARG P CG    1 
ATOM   628  C  CD    . ARG A 1 83 ? 11.611 11.798  -9.487  1.00 82.60  ? 83  ARG P CD    1 
ATOM   629  N  NE    . ARG A 1 83 ? 12.506 10.879  -10.193 1.00 84.36  ? 83  ARG P NE    1 
ATOM   630  C  CZ    . ARG A 1 83 ? 12.192 9.637   -10.559 1.00 85.59  ? 83  ARG P CZ    1 
ATOM   631  N  NH1   . ARG A 1 83 ? 10.994 9.129   -10.292 1.00 85.97  ? 83  ARG P NH1   1 
ATOM   632  N  NH2   . ARG A 1 83 ? 13.087 8.893   -11.197 1.00 85.96  ? 83  ARG P NH2   1 
ATOM   633  N  N     . ILE A 1 84 ? 12.614 16.234  -6.848  1.00 70.68  ? 84  ILE P N     1 
ATOM   634  C  CA    . ILE A 1 84 ? 12.389 17.524  -6.207  1.00 68.59  ? 84  ILE P CA    1 
ATOM   635  C  C     . ILE A 1 84 ? 11.180 18.243  -6.802  1.00 68.25  ? 84  ILE P C     1 
ATOM   636  O  O     . ILE A 1 84 ? 11.027 18.329  -8.021  1.00 68.71  ? 84  ILE P O     1 
ATOM   637  C  CB    . ILE A 1 84 ? 13.643 18.437  -6.297  1.00 68.14  ? 84  ILE P CB    1 
ATOM   638  C  CG1   . ILE A 1 84 ? 14.920 17.630  -6.026  1.00 67.86  ? 84  ILE P CG1   1 
ATOM   639  C  CG2   . ILE A 1 84 ? 13.520 19.619  -5.329  1.00 68.05  ? 84  ILE P CG2   1 
ATOM   640  C  CD1   . ILE A 1 84 ? 16.214 18.332  -6.419  1.00 67.21  ? 84  ILE P CD1   1 
ATOM   641  N  N     . GLN A 1 85 ? 10.319 18.734  -5.919  1.00 68.10  ? 85  GLN P N     1 
ATOM   642  C  CA    . GLN A 1 85 ? 9.235  19.639  -6.281  1.00 69.41  ? 85  GLN P CA    1 
ATOM   643  C  C     . GLN A 1 85 ? 9.021  20.614  -5.123  1.00 70.51  ? 85  GLN P C     1 
ATOM   644  O  O     . GLN A 1 85 ? 9.499  20.373  -4.015  1.00 71.01  ? 85  GLN P O     1 
ATOM   645  C  CB    . GLN A 1 85 ? 7.950  18.867  -6.612  1.00 69.26  ? 85  GLN P CB    1 
ATOM   646  C  CG    . GLN A 1 85 ? 7.436  17.958  -5.495  1.00 69.64  ? 85  GLN P CG    1 
ATOM   647  C  CD    . GLN A 1 85 ? 6.210  17.141  -5.888  1.00 68.19  ? 85  GLN P CD    1 
ATOM   648  O  OE1   . GLN A 1 85 ? 5.755  16.289  -5.123  1.00 66.95  ? 85  GLN P OE1   1 
ATOM   649  N  NE2   . GLN A 1 85 ? 5.671  17.398  -7.074  1.00 67.51  ? 85  GLN P NE2   1 
ATOM   650  N  N     . TYR A 1 86 ? 8.322  21.716  -5.380  1.00 71.54  ? 86  TYR P N     1 
ATOM   651  C  CA    . TYR A 1 86 ? 8.063  22.717  -4.347  1.00 72.64  ? 86  TYR P CA    1 
ATOM   652  C  C     . TYR A 1 86 ? 7.132  22.208  -3.252  1.00 73.71  ? 86  TYR P C     1 
ATOM   653  O  O     . TYR A 1 86 ? 6.305  21.319  -3.484  1.00 73.77  ? 86  TYR P O     1 
ATOM   654  C  CB    . TYR A 1 86 ? 7.464  23.985  -4.959  1.00 74.07  ? 86  TYR P CB    1 
ATOM   655  C  CG    . TYR A 1 86 ? 8.466  24.894  -5.629  1.00 74.93  ? 86  TYR P CG    1 
ATOM   656  C  CD1   . TYR A 1 86 ? 9.476  25.515  -4.893  1.00 75.09  ? 86  TYR P CD1   1 
ATOM   657  C  CD2   . TYR A 1 86 ? 8.393  25.150  -6.997  1.00 75.01  ? 86  TYR P CD2   1 
ATOM   658  C  CE1   . TYR A 1 86 ? 10.394 26.355  -5.503  1.00 75.42  ? 86  TYR P CE1   1 
ATOM   659  C  CE2   . TYR A 1 86 ? 9.305  25.988  -7.617  1.00 76.04  ? 86  TYR P CE2   1 
ATOM   660  C  CZ    . TYR A 1 86 ? 10.302 26.587  -6.864  1.00 76.45  ? 86  TYR P CZ    1 
ATOM   661  O  OH    . TYR A 1 86 ? 11.207 27.420  -7.474  1.00 77.07  ? 86  TYR P OH    1 
ATOM   662  N  N     . ALA A 1 87 ? 7.278  22.779  -2.059  1.00 73.67  ? 87  ALA P N     1 
ATOM   663  C  CA    . ALA A 1 87 ? 6.354  22.531  -0.962  1.00 74.48  ? 87  ALA P CA    1 
ATOM   664  C  C     . ALA A 1 87 ? 5.014  23.200  -1.264  1.00 75.95  ? 87  ALA P C     1 
ATOM   665  O  O     . ALA A 1 87 ? 4.978  24.268  -1.889  1.00 76.31  ? 87  ALA P O     1 
ATOM   666  C  CB    . ALA A 1 87 ? 6.931  23.055  0.342   1.00 74.00  ? 87  ALA P CB    1 
ATOM   667  N  N     . LYS A 1 88 ? 3.919  22.560  -0.828  1.00 78.69  ? 88  LYS P N     1 
ATOM   668  C  CA    . LYS A 1 88 ? 2.572  23.092  -1.037  1.00 80.61  ? 88  LYS P CA    1 
ATOM   669  C  C     . LYS A 1 88 ? 2.330  24.286  -0.122  1.00 82.43  ? 88  LYS P C     1 
ATOM   670  O  O     . LYS A 1 88 ? 1.979  25.389  -0.583  1.00 81.29  ? 88  LYS P O     1 
ATOM   671  C  CB    . LYS A 1 88 ? 1.525  22.013  -0.748  1.00 81.34  ? 88  LYS P CB    1 
ATOM   672  C  CG    . LYS A 1 88 ? 1.591  20.802  -1.669  1.00 82.53  ? 88  LYS P CG    1 
ATOM   673  C  CD    . LYS A 1 88 ? 0.630  19.716  -1.206  1.00 82.77  ? 88  LYS P CD    1 
ATOM   674  C  CE    . LYS A 1 88 ? 0.687  18.501  -2.122  1.00 83.16  ? 88  LYS P CE    1 
ATOM   675  N  NZ    . LYS A 1 88 ? -0.109 17.366  -1.577  1.00 83.03  ? 88  LYS P NZ    1 
ATOM   676  N  N     . THR A 1 89 ? 2.532  24.035  1.184   1.00 86.65  ? 89  THR P N     1 
ATOM   677  C  CA    . THR A 1 89 ? 2.326  25.040  2.223   1.00 91.29  ? 89  THR P CA    1 
ATOM   678  C  C     . THR A 1 89 ? 3.624  25.012  3.064   1.00 93.56  ? 89  THR P C     1 
ATOM   679  O  O     . THR A 1 89 ? 4.263  23.915  3.201   1.00 95.63  ? 89  THR P O     1 
ATOM   680  C  CB    . THR A 1 89 ? 1.170  24.605  3.188   1.00 91.85  ? 89  THR P CB    1 
ATOM   681  O  OG1   . THR A 1 89 ? 1.659  23.561  4.098   1.00 92.96  ? 89  THR P OG1   1 
ATOM   682  C  CG2   . THR A 1 89 ? -0.048 24.085  2.409   1.00 91.80  ? 89  THR P CG2   1 
ATOM   683  N  N     . ASP A 1 90 ? 4.015  26.200  3.638   1.00 94.83  ? 90  ASP P N     1 
ATOM   684  C  CA    . ASP A 1 90 ? 5.263  26.232  4.415   1.00 96.77  ? 90  ASP P CA    1 
ATOM   685  C  C     . ASP A 1 90 ? 5.010  26.968  5.761   1.00 96.82  ? 90  ASP P C     1 
ATOM   686  O  O     . ASP A 1 90 ? 4.706  28.166  5.811   1.00 97.65  ? 90  ASP P O     1 
ATOM   687  C  CB    . ASP A 1 90 ? 6.318  27.053  3.601   1.00 98.64  ? 90  ASP P CB    1 
ATOM   688  C  CG    . ASP A 1 90 ? 7.490  27.588  4.452   1.00 100.17 ? 90  ASP P CG    1 
ATOM   689  O  OD1   . ASP A 1 90 ? 8.159  26.774  5.157   1.00 100.67 ? 90  ASP P OD1   1 
ATOM   690  O  OD2   . ASP A 1 90 ? 7.750  28.827  4.396   1.00 101.43 ? 90  ASP P OD2   1 
ATOM   691  N  N     . SER A 1 91 ? 5.112  26.167  6.846   1.00 96.55  ? 91  SER P N     1 
ATOM   692  C  CA    . SER A 1 91 ? 5.073  26.712  8.219   1.00 96.88  ? 91  SER P CA    1 
ATOM   693  C  C     . SER A 1 91 ? 6.514  27.054  8.624   1.00 96.62  ? 91  SER P C     1 
ATOM   694  O  O     . SER A 1 91 ? 7.505  26.742  7.859   1.00 96.50  ? 91  SER P O     1 
ATOM   695  C  CB    . SER A 1 91 ? 4.458  25.701  9.201   1.00 97.01  ? 91  SER P CB    1 
ATOM   696  O  OG    . SER A 1 91 ? 4.501  26.191  10.550  1.00 96.14  ? 91  SER P OG    1 
ATOM   697  N  N     . ASP A 1 92 ? 6.617  27.687  9.827   1.00 96.09  ? 92  ASP P N     1 
ATOM   698  C  CA    . ASP A 1 92 ? 7.916  28.243  10.265  1.00 96.41  ? 92  ASP P CA    1 
ATOM   699  C  C     . ASP A 1 92 ? 8.195  29.522  9.462   1.00 97.21  ? 92  ASP P C     1 
ATOM   700  O  O     . ASP A 1 92 ? 7.266  30.141  8.927   1.00 97.34  ? 92  ASP P O     1 
ATOM   701  C  CB    . ASP A 1 92 ? 9.045  27.210  10.088  1.00 96.12  ? 92  ASP P CB    1 
ATOM   702  C  CG    . ASP A 1 92 ? 10.218 27.458  11.014  1.00 96.39  ? 92  ASP P CG    1 
ATOM   703  O  OD1   . ASP A 1 92 ? 10.147 27.037  12.188  1.00 96.84  ? 92  ASP P OD1   1 
ATOM   704  O  OD2   . ASP A 1 92 ? 11.215 28.064  10.564  1.00 96.10  ? 92  ASP P OD2   1 
ATOM   705  N  N     . ILE A 1 93 ? 9.465  29.912  9.378   1.00 97.36  ? 93  ILE P N     1 
ATOM   706  C  CA    . ILE A 1 93 ? 9.858  31.124  8.662   1.00 97.66  ? 93  ILE P CA    1 
ATOM   707  C  C     . ILE A 1 93 ? 10.452 30.788  7.287   1.00 96.98  ? 93  ILE P C     1 
ATOM   708  O  O     . ILE A 1 93 ? 9.720  30.563  6.320   1.00 94.99  ? 93  ILE P O     1 
ATOM   709  C  CB    . ILE A 1 93 ? 10.845 31.970  9.507   1.00 98.20  ? 93  ILE P CB    1 
ATOM   710  C  CG1   . ILE A 1 93 ? 10.111 32.605  10.695  1.00 98.87  ? 93  ILE P CG1   1 
ATOM   711  C  CG2   . ILE A 1 93 ? 11.518 33.037  8.657   1.00 97.94  ? 93  ILE P CG2   1 
ATOM   712  C  CD1   . ILE A 1 93 ? 11.016 33.035  11.843  1.00 99.64  ? 93  ILE P CD1   1 
HETATM 713  P  PG    . GTP B 2 1  ? 0.140  -8.175  68.585  1.00 101.58 ? 8   GTP R PG    1 
HETATM 714  O  O1G   . GTP B 2 1  ? 0.190  -6.803  67.948  1.00 101.50 ? 8   GTP R O1G   1 
HETATM 715  O  O2G   . GTP B 2 1  ? 1.348  -8.374  69.479  1.00 101.57 ? 8   GTP R O2G   1 
HETATM 716  O  O3G   . GTP B 2 1  ? -1.133 -8.320  69.389  1.00 101.02 ? 8   GTP R O3G   1 
HETATM 717  O  O3B   . GTP B 2 1  ? 0.173  -9.259  67.393  1.00 99.61  ? 8   GTP R O3B   1 
HETATM 718  P  PB    . GTP B 2 1  ? -0.723 -10.597 67.460  1.00 98.43  ? 8   GTP R PB    1 
HETATM 719  O  O1B   . GTP B 2 1  ? -2.146 -10.275 67.056  1.00 97.77  ? 8   GTP R O1B   1 
HETATM 720  O  O2B   . GTP B 2 1  ? -0.672 -11.233 68.832  1.00 98.31  ? 8   GTP R O2B   1 
HETATM 721  O  O3A   . GTP B 2 1  ? -0.024 -11.546 66.359  1.00 94.67  ? 8   GTP R O3A   1 
HETATM 722  P  PA    . GTP B 2 1  ? 1.557  -11.859 66.400  1.00 90.76  ? 8   GTP R PA    1 
HETATM 723  O  O1A   . GTP B 2 1  ? 2.175  -11.300 67.662  1.00 90.52  ? 8   GTP R O1A   1 
HETATM 724  O  O2A   . GTP B 2 1  ? 2.255  -11.317 65.173  1.00 90.62  ? 8   GTP R O2A   1 
HETATM 725  O  "O5'" . GTP B 2 1  ? 1.598  -13.469 66.440  1.00 86.77  ? 8   GTP R "O5'" 1 
HETATM 726  C  "C5'" . GTP B 2 1  ? 1.644  -14.206 65.241  1.00 80.20  ? 8   GTP R "C5'" 1 
HETATM 727  C  "C4'" . GTP B 2 1  ? 0.775  -15.458 65.309  1.00 75.66  ? 8   GTP R "C4'" 1 
HETATM 728  O  "O4'" . GTP B 2 1  ? -0.224 -15.412 66.315  1.00 73.25  ? 8   GTP R "O4'" 1 
HETATM 729  C  "C3'" . GTP B 2 1  ? 0.001  -15.623 64.018  1.00 73.91  ? 8   GTP R "C3'" 1 
HETATM 730  O  "O3'" . GTP B 2 1  ? 0.769  -16.223 63.006  1.00 72.21  ? 8   GTP R "O3'" 1 
HETATM 731  C  "C2'" . GTP B 2 1  ? -1.219 -16.416 64.424  1.00 72.23  ? 8   GTP R "C2'" 1 
HETATM 732  O  "O2'" . GTP B 2 1  ? -0.928 -17.795 64.430  1.00 72.32  ? 8   GTP R "O2'" 1 
HETATM 733  C  "C1'" . GTP B 2 1  ? -1.470 -15.916 65.840  1.00 69.93  ? 8   GTP R "C1'" 1 
HETATM 734  N  N9    . GTP B 2 1  ? -2.500 -14.842 65.861  1.00 65.33  ? 8   GTP R N9    1 
HETATM 735  C  C8    . GTP B 2 1  ? -2.371 -13.634 66.502  1.00 64.07  ? 8   GTP R C8    1 
HETATM 736  N  N7    . GTP B 2 1  ? -3.492 -12.901 66.320  1.00 60.73  ? 8   GTP R N7    1 
HETATM 737  C  C5    . GTP B 2 1  ? -4.351 -13.619 65.569  1.00 59.04  ? 8   GTP R C5    1 
HETATM 738  C  C6    . GTP B 2 1  ? -5.628 -13.335 65.099  1.00 56.79  ? 8   GTP R C6    1 
HETATM 739  O  O6    . GTP B 2 1  ? -6.156 -12.258 65.364  1.00 55.11  ? 8   GTP R O6    1 
HETATM 740  N  N1    . GTP B 2 1  ? -6.300 -14.269 64.337  1.00 55.42  ? 8   GTP R N1    1 
HETATM 741  C  C2    . GTP B 2 1  ? -5.696 -15.476 64.046  1.00 56.18  ? 8   GTP R C2    1 
HETATM 742  N  N2    . GTP B 2 1  ? -6.339 -16.375 63.311  1.00 54.79  ? 8   GTP R N2    1 
HETATM 743  N  N3    . GTP B 2 1  ? -4.423 -15.752 64.517  1.00 58.75  ? 8   GTP R N3    1 
HETATM 744  C  C4    . GTP B 2 1  ? -3.751 -14.841 65.272  1.00 61.17  ? 8   GTP R C4    1 
ATOM   745  P  P     . G   B 2 2  ? 1.092  -15.405 61.669  1.00 71.32  ? 9   G   R P     1 
ATOM   746  O  OP1   . G   B 2 2  ? 2.304  -16.004 61.050  1.00 71.77  ? 9   G   R OP1   1 
ATOM   747  O  OP2   . G   B 2 2  ? 1.080  -13.952 62.005  1.00 70.00  ? 9   G   R OP2   1 
ATOM   748  O  "O5'" . G   B 2 2  ? -0.185 -15.699 60.753  1.00 68.84  ? 9   G   R "O5'" 1 
ATOM   749  C  "C5'" . G   B 2 2  ? -0.533 -17.036 60.402  1.00 66.18  ? 9   G   R "C5'" 1 
ATOM   750  C  "C4'" . G   B 2 2  ? -1.948 -17.101 59.859  1.00 63.74  ? 9   G   R "C4'" 1 
ATOM   751  O  "O4'" . G   B 2 2  ? -2.894 -16.771 60.907  1.00 62.47  ? 9   G   R "O4'" 1 
ATOM   752  C  "C3'" . G   B 2 2  ? -2.285 -16.078 58.784  1.00 62.80  ? 9   G   R "C3'" 1 
ATOM   753  O  "O3'" . G   B 2 2  ? -1.756 -16.429 57.509  1.00 61.79  ? 9   G   R "O3'" 1 
ATOM   754  C  "C2'" . G   B 2 2  ? -3.807 -16.126 58.818  1.00 61.27  ? 9   G   R "C2'" 1 
ATOM   755  O  "O2'" . G   B 2 2  ? -4.345 -17.255 58.154  1.00 62.11  ? 9   G   R "O2'" 1 
ATOM   756  C  "C1'" . G   B 2 2  ? -4.058 -16.199 60.324  1.00 59.67  ? 9   G   R "C1'" 1 
ATOM   757  N  N9    . G   B 2 2  ? -4.368 -14.890 60.915  1.00 55.85  ? 9   G   R N9    1 
ATOM   758  C  C8    . G   B 2 2  ? -3.600 -14.131 61.770  1.00 54.67  ? 9   G   R C8    1 
ATOM   759  N  N7    . G   B 2 2  ? -4.161 -13.003 62.124  1.00 52.55  ? 9   G   R N7    1 
ATOM   760  C  C5    . G   B 2 2  ? -5.381 -13.006 61.462  1.00 52.49  ? 9   G   R C5    1 
ATOM   761  C  C6    . G   B 2 2  ? -6.431 -12.048 61.449  1.00 52.41  ? 9   G   R C6    1 
ATOM   762  O  O6    . G   B 2 2  ? -6.502 -10.961 62.040  1.00 52.44  ? 9   G   R O6    1 
ATOM   763  N  N1    . G   B 2 2  ? -7.495 -12.447 60.641  1.00 53.56  ? 9   G   R N1    1 
ATOM   764  C  C2    . G   B 2 2  ? -7.543 -13.626 59.928  1.00 53.90  ? 9   G   R C2    1 
ATOM   765  N  N2    . G   B 2 2  ? -8.649 -13.846 59.200  1.00 54.28  ? 9   G   R N2    1 
ATOM   766  N  N3    . G   B 2 2  ? -6.570 -14.531 59.932  1.00 53.24  ? 9   G   R N3    1 
ATOM   767  C  C4    . G   B 2 2  ? -5.522 -14.160 60.716  1.00 54.04  ? 9   G   R C4    1 
ATOM   768  P  P     . U   B 2 3  ? -1.279 -15.272 56.506  1.00 62.06  ? 10  U   R P     1 
ATOM   769  O  OP1   . U   B 2 3  ? -0.780 -15.928 55.276  1.00 62.31  ? 10  U   R OP1   1 
ATOM   770  O  OP2   . U   B 2 3  ? -0.389 -14.352 57.253  1.00 60.55  ? 10  U   R OP2   1 
ATOM   771  O  "O5'" . U   B 2 3  ? -2.635 -14.489 56.154  1.00 59.94  ? 10  U   R "O5'" 1 
ATOM   772  C  "C5'" . U   B 2 3  ? -3.637 -15.118 55.355  1.00 57.27  ? 10  U   R "C5'" 1 
ATOM   773  C  "C4'" . U   B 2 3  ? -4.939 -14.343 55.380  1.00 56.27  ? 10  U   R "C4'" 1 
ATOM   774  O  "O4'" . U   B 2 3  ? -5.333 -14.033 56.736  1.00 55.10  ? 10  U   R "O4'" 1 
ATOM   775  C  "C3'" . U   B 2 3  ? -4.857 -12.979 54.725  1.00 57.13  ? 10  U   R "C3'" 1 
ATOM   776  O  "O3'" . U   B 2 3  ? -4.968 -13.123 53.326  1.00 59.57  ? 10  U   R "O3'" 1 
ATOM   777  C  "C2'" . U   B 2 3  ? -6.042 -12.242 55.344  1.00 55.44  ? 10  U   R "C2'" 1 
ATOM   778  O  "O2'" . U   B 2 3  ? -7.281 -12.463 54.696  1.00 53.73  ? 10  U   R "O2'" 1 
ATOM   779  C  "C1'" . U   B 2 3  ? -6.059 -12.812 56.759  1.00 53.94  ? 10  U   R "C1'" 1 
ATOM   780  N  N1    . U   B 2 3  ? -5.456 -11.869 57.759  1.00 52.28  ? 10  U   R N1    1 
ATOM   781  C  C2    . U   B 2 3  ? -6.149 -10.727 58.134  1.00 52.45  ? 10  U   R C2    1 
ATOM   782  O  O2    . U   B 2 3  ? -7.251 -10.412 57.707  1.00 52.60  ? 10  U   R O2    1 
ATOM   783  N  N3    . U   B 2 3  ? -5.493 -9.942  59.053  1.00 53.37  ? 10  U   R N3    1 
ATOM   784  C  C4    . U   B 2 3  ? -4.249 -10.164 59.625  1.00 52.82  ? 10  U   R C4    1 
ATOM   785  O  O4    . U   B 2 3  ? -3.807 -9.356  60.435  1.00 53.67  ? 10  U   R O4    1 
ATOM   786  C  C5    . U   B 2 3  ? -3.584 -11.365 59.185  1.00 52.33  ? 10  U   R C5    1 
ATOM   787  C  C6    . U   B 2 3  ? -4.203 -12.150 58.290  1.00 52.89  ? 10  U   R C6    1 
ATOM   788  P  P     . C   B 2 4  ? -4.133 -12.159 52.363  1.00 60.71  ? 11  C   R P     1 
ATOM   789  O  OP1   . C   B 2 4  ? -4.286 -12.712 50.998  1.00 62.71  ? 11  C   R OP1   1 
ATOM   790  O  OP2   . C   B 2 4  ? -2.776 -11.967 52.927  1.00 60.68  ? 11  C   R OP2   1 
ATOM   791  O  "O5'" . C   B 2 4  ? -4.924 -10.770 52.473  1.00 60.32  ? 11  C   R "O5'" 1 
ATOM   792  C  "C5'" . C   B 2 4  ? -6.256 -10.666 51.967  1.00 61.90  ? 11  C   R "C5'" 1 
ATOM   793  C  "C4'" . C   B 2 4  ? -6.934 -9.390  52.428  1.00 62.56  ? 11  C   R "C4'" 1 
ATOM   794  O  "O4'" . C   B 2 4  ? -7.099 -9.397  53.869  1.00 63.94  ? 11  C   R "O4'" 1 
ATOM   795  C  "C3'" . C   B 2 4  ? -6.141 -8.119  52.178  1.00 63.04  ? 11  C   R "C3'" 1 
ATOM   796  O  "O3'" . C   B 2 4  ? -6.256 -7.704  50.829  1.00 63.93  ? 11  C   R "O3'" 1 
ATOM   797  C  "C2'" . C   B 2 4  ? -6.797 -7.155  53.162  1.00 62.84  ? 11  C   R "C2'" 1 
ATOM   798  O  "O2'" . C   B 2 4  ? -8.042 -6.646  52.723  1.00 63.83  ? 11  C   R "O2'" 1 
ATOM   799  C  "C1'" . C   B 2 4  ? -6.997 -8.068  54.368  1.00 62.60  ? 11  C   R "C1'" 1 
ATOM   800  N  N1    . C   B 2 4  ? -5.895 -7.954  55.398  1.00 60.84  ? 11  C   R N1    1 
ATOM   801  C  C2    . C   B 2 4  ? -5.949 -6.942  56.380  1.00 60.62  ? 11  C   R C2    1 
ATOM   802  O  O2    . C   B 2 4  ? -6.898 -6.143  56.400  1.00 59.51  ? 11  C   R O2    1 
ATOM   803  N  N3    . C   B 2 4  ? -4.944 -6.861  57.296  1.00 59.87  ? 11  C   R N3    1 
ATOM   804  C  C4    . C   B 2 4  ? -3.924 -7.728  57.258  1.00 59.87  ? 11  C   R C4    1 
ATOM   805  N  N4    . C   B 2 4  ? -2.961 -7.608  58.177  1.00 59.50  ? 11  C   R N4    1 
ATOM   806  C  C5    . C   B 2 4  ? -3.846 -8.758  56.273  1.00 60.06  ? 11  C   R C5    1 
ATOM   807  C  C6    . C   B 2 4  ? -4.840 -8.831  55.377  1.00 59.96  ? 11  C   R C6    1 
ATOM   808  P  P     . A   B 2 5  ? -5.012 -7.004  50.105  1.00 64.89  ? 12  A   R P     1 
ATOM   809  O  OP1   . A   B 2 5  ? -5.176 -7.271  48.659  1.00 65.68  ? 12  A   R OP1   1 
ATOM   810  O  OP2   . A   B 2 5  ? -3.751 -7.410  50.776  1.00 63.68  ? 12  A   R OP2   1 
ATOM   811  O  "O5'" . A   B 2 5  ? -5.276 -5.446  50.393  1.00 63.76  ? 12  A   R "O5'" 1 
ATOM   812  C  "C5'" . A   B 2 5  ? -4.347 -4.657  51.146  1.00 62.34  ? 12  A   R "C5'" 1 
ATOM   813  C  "C4'" . A   B 2 5  ? -5.064 -3.579  51.943  1.00 61.88  ? 12  A   R "C4'" 1 
ATOM   814  O  "O4'" . A   B 2 5  ? -5.574 -4.128  53.190  1.00 60.71  ? 12  A   R "O4'" 1 
ATOM   815  C  "C3'" . A   B 2 5  ? -4.192 -2.402  52.357  1.00 61.61  ? 12  A   R "C3'" 1 
ATOM   816  O  "O3'" . A   B 2 5  ? -4.270 -1.384  51.377  1.00 63.11  ? 12  A   R "O3'" 1 
ATOM   817  C  "C2'" . A   B 2 5  ? -4.844 -1.962  53.664  1.00 61.04  ? 12  A   R "C2'" 1 
ATOM   818  O  "O2'" . A   B 2 5  ? -6.018 -1.200  53.455  1.00 62.36  ? 12  A   R "O2'" 1 
ATOM   819  C  "C1'" . A   B 2 5  ? -5.202 -3.306  54.285  1.00 58.98  ? 12  A   R "C1'" 1 
ATOM   820  N  N9    . A   B 2 5  ? -4.097 -3.929  55.022  1.00 56.09  ? 12  A   R N9    1 
ATOM   821  C  C8    . A   B 2 5  ? -3.455 -5.097  54.707  1.00 54.04  ? 12  A   R C8    1 
ATOM   822  N  N7    . A   B 2 5  ? -2.496 -5.424  55.538  1.00 53.37  ? 12  A   R N7    1 
ATOM   823  C  C5    . A   B 2 5  ? -2.501 -4.402  56.470  1.00 52.28  ? 12  A   R C5    1 
ATOM   824  C  C6    . A   B 2 5  ? -1.714 -4.160  57.618  1.00 50.30  ? 12  A   R C6    1 
ATOM   825  N  N6    . A   B 2 5  ? -0.736 -4.976  58.021  1.00 49.01  ? 12  A   R N6    1 
ATOM   826  N  N1    . A   B 2 5  ? -1.971 -3.044  58.336  1.00 50.10  ? 12  A   R N1    1 
ATOM   827  C  C2    . A   B 2 5  ? -2.952 -2.224  57.931  1.00 51.14  ? 12  A   R C2    1 
ATOM   828  N  N3    . A   B 2 5  ? -3.758 -2.348  56.870  1.00 53.09  ? 12  A   R N3    1 
ATOM   829  C  C4    . A   B 2 5  ? -3.482 -3.469  56.171  1.00 54.10  ? 12  A   R C4    1 
ATOM   830  P  P     . C   B 2 6  ? -2.972 -0.548  50.953  1.00 64.68  ? 13  C   R P     1 
ATOM   831  O  OP1   . C   B 2 6  ? -3.427 0.475   49.985  1.00 65.38  ? 13  C   R OP1   1 
ATOM   832  O  OP2   . C   B 2 6  ? -1.909 -1.502  50.562  1.00 64.52  ? 13  C   R OP2   1 
ATOM   833  O  "O5'" . C   B 2 6  ? -2.505 0.167   52.307  1.00 62.85  ? 13  C   R "O5'" 1 
ATOM   834  C  "C5'" . C   B 2 6  ? -3.252 1.244   52.868  1.00 61.05  ? 13  C   R "C5'" 1 
ATOM   835  C  "C4'" . C   B 2 6  ? -2.678 1.621   54.220  1.00 60.77  ? 13  C   R "C4'" 1 
ATOM   836  O  "O4'" . C   B 2 6  ? -2.723 0.482   55.116  1.00 59.20  ? 13  C   R "O4'" 1 
ATOM   837  C  "C3'" . C   B 2 6  ? -1.206 1.997   54.193  1.00 60.65  ? 13  C   R "C3'" 1 
ATOM   838  O  "O3'" . C   B 2 6  ? -1.059 3.351   53.815  1.00 62.13  ? 13  C   R "O3'" 1 
ATOM   839  C  "C2'" . C   B 2 6  ? -0.783 1.746   55.636  1.00 59.30  ? 13  C   R "C2'" 1 
ATOM   840  O  "O2'" . C   B 2 6  ? -1.145 2.793   56.518  1.00 60.09  ? 13  C   R "O2'" 1 
ATOM   841  C  "C1'" . C   B 2 6  ? -1.582 0.489   55.959  1.00 56.30  ? 13  C   R "C1'" 1 
ATOM   842  N  N1    . C   B 2 6  ? -0.809 -0.774  55.761  1.00 53.47  ? 13  C   R N1    1 
ATOM   843  C  C2    . C   B 2 6  ? 0.156  -1.167  56.708  1.00 52.41  ? 13  C   R C2    1 
ATOM   844  O  O2    . C   B 2 6  ? 0.369  -0.463  57.704  1.00 52.00  ? 13  C   R O2    1 
ATOM   845  N  N3    . C   B 2 6  ? 0.839  -2.327  56.501  1.00 50.59  ? 13  C   R N3    1 
ATOM   846  C  C4    . C   B 2 6  ? 0.591  -3.069  55.414  1.00 49.69  ? 13  C   R C4    1 
ATOM   847  N  N4    . C   B 2 6  ? 1.286  -4.194  55.256  1.00 48.88  ? 13  C   R N4    1 
ATOM   848  C  C5    . C   B 2 6  ? -0.382 -2.695  54.439  1.00 50.63  ? 13  C   R C5    1 
ATOM   849  C  C6    . C   B 2 6  ? -1.048 -1.553  54.655  1.00 53.49  ? 13  C   R C6    1 
ATOM   850  P  P     . G   B 2 7  ? 0.258  3.812   53.042  1.00 63.38  ? 14  G   R P     1 
ATOM   851  O  OP1   . G   B 2 7  ? -0.023 5.157   52.492  1.00 64.31  ? 14  G   R OP1   1 
ATOM   852  O  OP2   . G   B 2 7  ? 0.701  2.724   52.141  1.00 63.46  ? 14  G   R OP2   1 
ATOM   853  O  "O5'" . G   B 2 7  ? 1.338  3.926   54.216  1.00 63.49  ? 14  G   R "O5'" 1 
ATOM   854  C  "C5'" . G   B 2 7  ? 1.260  4.992   55.158  1.00 64.52  ? 14  G   R "C5'" 1 
ATOM   855  C  "C4'" . G   B 2 7  ? 2.336  4.838   56.216  1.00 64.74  ? 14  G   R "C4'" 1 
ATOM   856  O  "O4'" . G   B 2 7  ? 2.379  3.456   56.656  1.00 63.78  ? 14  G   R "O4'" 1 
ATOM   857  C  "C3'" . G   B 2 7  ? 3.749  5.197   55.766  1.00 66.62  ? 14  G   R "C3'" 1 
ATOM   858  O  "O3'" . G   B 2 7  ? 4.409  5.948   56.790  1.00 71.46  ? 14  G   R "O3'" 1 
ATOM   859  C  "C2'" . G   B 2 7  ? 4.413  3.839   55.521  1.00 64.82  ? 14  G   R "C2'" 1 
ATOM   860  O  "O2'" . G   B 2 7  ? 5.802  3.826   55.801  1.00 67.05  ? 14  G   R "O2'" 1 
ATOM   861  C  "C1'" . G   B 2 7  ? 3.678  2.922   56.495  1.00 61.77  ? 14  G   R "C1'" 1 
ATOM   862  N  N9    . G   B 2 7  ? 3.560  1.545   56.015  1.00 57.07  ? 14  G   R N9    1 
ATOM   863  C  C8    . G   B 2 7  ? 2.768  1.094   54.984  1.00 55.11  ? 14  G   R C8    1 
ATOM   864  N  N7    . G   B 2 7  ? 2.865  -0.189  54.772  1.00 52.35  ? 14  G   R N7    1 
ATOM   865  C  C5    . G   B 2 7  ? 3.779  -0.619  55.723  1.00 51.71  ? 14  G   R C5    1 
ATOM   866  C  C6    . G   B 2 7  ? 4.283  -1.916  55.982  1.00 50.53  ? 14  G   R C6    1 
ATOM   867  O  O6    . G   B 2 7  ? 4.013  -2.973  55.404  1.00 50.94  ? 14  G   R O6    1 
ATOM   868  N  N1    . G   B 2 7  ? 5.193  -1.930  57.035  1.00 50.87  ? 14  G   R N1    1 
ATOM   869  C  C2    . G   B 2 7  ? 5.571  -0.824  57.756  1.00 51.10  ? 14  G   R C2    1 
ATOM   870  N  N2    . G   B 2 7  ? 6.463  -1.038  58.734  1.00 50.12  ? 14  G   R N2    1 
ATOM   871  N  N3    . G   B 2 7  ? 5.107  0.401   57.523  1.00 52.48  ? 14  G   R N3    1 
ATOM   872  C  C4    . G   B 2 7  ? 4.218  0.433   56.497  1.00 53.49  ? 14  G   R C4    1 
ATOM   873  P  P     . C   B 2 8  ? 4.504  7.550   56.750  1.00 74.77  ? 15  C   R P     1 
ATOM   874  O  OP1   . C   B 2 8  ? 3.298  8.092   57.417  1.00 72.78  ? 15  C   R OP1   1 
ATOM   875  O  OP2   . C   B 2 8  ? 4.830  7.991   55.373  1.00 74.51  ? 15  C   R OP2   1 
ATOM   876  O  "O5'" . C   B 2 8  ? 5.802  7.805   57.658  1.00 75.53  ? 15  C   R "O5'" 1 
ATOM   877  C  "C5'" . C   B 2 8  ? 5.926  8.978   58.464  1.00 78.77  ? 15  C   R "C5'" 1 
ATOM   878  C  "C4'" . C   B 2 8  ? 6.004  8.652   59.950  1.00 80.45  ? 15  C   R "C4'" 1 
ATOM   879  O  "O4'" . C   B 2 8  ? 4.666  8.490   60.476  1.00 81.15  ? 15  C   R "O4'" 1 
ATOM   880  C  "C3'" . C   B 2 8  ? 6.740  7.368   60.316  1.00 81.19  ? 15  C   R "C3'" 1 
ATOM   881  O  "O3'" . C   B 2 8  ? 8.103  7.650   60.564  1.00 81.63  ? 15  C   R "O3'" 1 
ATOM   882  C  "C2'" . C   B 2 8  ? 6.059  6.904   61.598  1.00 81.69  ? 15  C   R "C2'" 1 
ATOM   883  O  "O2'" . C   B 2 8  ? 6.754  7.330   62.754  1.00 81.39  ? 15  C   R "O2'" 1 
ATOM   884  C  "C1'" . C   B 2 8  ? 4.671  7.545   61.529  1.00 82.56  ? 15  C   R "C1'" 1 
ATOM   885  N  N1    . C   B 2 8  ? 3.565  6.550   61.303  1.00 84.70  ? 15  C   R N1    1 
ATOM   886  C  C2    . C   B 2 8  ? 2.796  6.086   62.390  1.00 85.70  ? 15  C   R C2    1 
ATOM   887  O  O2    . C   B 2 8  ? 3.027  6.496   63.536  1.00 85.87  ? 15  C   R O2    1 
ATOM   888  N  N3    . C   B 2 8  ? 1.804  5.183   62.153  1.00 85.99  ? 15  C   R N3    1 
ATOM   889  C  C4    . C   B 2 8  ? 1.568  4.750   60.910  1.00 85.66  ? 15  C   R C4    1 
ATOM   890  N  N4    . C   B 2 8  ? 0.586  3.866   60.725  1.00 85.80  ? 15  C   R N4    1 
ATOM   891  C  C5    . C   B 2 8  ? 2.332  5.208   59.795  1.00 85.77  ? 15  C   R C5    1 
ATOM   892  C  C6    . C   B 2 8  ? 3.308  6.094   60.036  1.00 85.16  ? 15  C   R C6    1 
ATOM   893  P  P     . A   B 2 9  ? 9.197  7.523   59.408  1.00 81.98  ? 16  A   R P     1 
ATOM   894  O  OP1   . A   B 2 9  ? 9.696  8.891   59.140  1.00 82.37  ? 16  A   R OP1   1 
ATOM   895  O  OP2   . A   B 2 9  ? 8.630  6.726   58.298  1.00 82.89  ? 16  A   R OP2   1 
ATOM   896  O  "O5'" . A   B 2 9  ? 10.350 6.664   60.115  1.00 83.24  ? 16  A   R "O5'" 1 
ATOM   897  C  "C5'" . A   B 2 9  ? 10.122 5.307   60.481  1.00 86.50  ? 16  A   R "C5'" 1 
ATOM   898  C  "C4'" . A   B 2 9  ? 10.025 5.146   61.988  1.00 89.36  ? 16  A   R "C4'" 1 
ATOM   899  O  "O4'" . A   B 2 9  ? 8.672  4.755   62.345  1.00 90.33  ? 16  A   R "O4'" 1 
ATOM   900  C  "C3'" . A   B 2 9  ? 10.926 4.065   62.574  1.00 90.38  ? 16  A   R "C3'" 1 
ATOM   901  O  "O3'" . A   B 2 9  ? 12.203 4.596   62.932  1.00 91.82  ? 16  A   R "O3'" 1 
ATOM   902  C  "C2'" . A   B 2 9  ? 10.139 3.609   63.800  1.00 91.00  ? 16  A   R "C2'" 1 
ATOM   903  O  "O2'" . A   B 2 9  ? 10.348 4.429   64.935  1.00 91.41  ? 16  A   R "O2'" 1 
ATOM   904  C  "C1'" . A   B 2 9  ? 8.696  3.719   63.315  1.00 91.59  ? 16  A   R "C1'" 1 
ATOM   905  N  N9    . A   B 2 9  ? 8.165  2.471   62.747  1.00 92.84  ? 16  A   R N9    1 
ATOM   906  C  C8    . A   B 2 9  ? 7.752  2.263   61.458  1.00 93.05  ? 16  A   R C8    1 
ATOM   907  N  N7    . A   B 2 9  ? 7.322  1.047   61.220  1.00 92.93  ? 16  A   R N7    1 
ATOM   908  C  C5    . A   B 2 9  ? 7.459  0.403   62.436  1.00 93.48  ? 16  A   R C5    1 
ATOM   909  C  C6    . A   B 2 9  ? 7.176  -0.918  62.853  1.00 93.99  ? 16  A   R C6    1 
ATOM   910  N  N6    . A   B 2 9  ? 6.673  -1.849  62.038  1.00 94.91  ? 16  A   R N6    1 
ATOM   911  N  N1    . A   B 2 9  ? 7.429  -1.249  64.140  1.00 94.14  ? 16  A   R N1    1 
ATOM   912  C  C2    . A   B 2 9  ? 7.932  -0.314  64.958  1.00 94.09  ? 16  A   R C2    1 
ATOM   913  N  N3    . A   B 2 9  ? 8.239  0.956   64.679  1.00 94.11  ? 16  A   R N3    1 
ATOM   914  C  C4    . A   B 2 9  ? 7.977  1.262   63.391  1.00 93.52  ? 16  A   R C4    1 
ATOM   915  P  P     . C   B 2 10 ? 13.534 3.706   62.814  1.00 93.25  ? 17  C   R P     1 
ATOM   916  O  OP1   . C   B 2 10 ? 14.662 4.503   63.349  1.00 93.31  ? 17  C   R OP1   1 
ATOM   917  O  OP2   . C   B 2 10 ? 13.610 3.188   61.430  1.00 92.50  ? 17  C   R OP2   1 
ATOM   918  O  "O5'" . C   B 2 10 ? 13.259 2.455   63.783  1.00 95.03  ? 17  C   R "O5'" 1 
ATOM   919  C  "C5'" . C   B 2 10 ? 13.312 2.558   65.212  1.00 97.15  ? 17  C   R "C5'" 1 
ATOM   920  C  "C4'" . C   B 2 10 ? 12.938 1.241   65.875  1.00 98.38  ? 17  C   R "C4'" 1 
ATOM   921  O  "O4'" . C   B 2 10 ? 11.607 0.833   65.468  1.00 98.65  ? 17  C   R "O4'" 1 
ATOM   922  C  "C3'" . C   B 2 10 ? 13.838 0.074   65.499  1.00 99.25  ? 17  C   R "C3'" 1 
ATOM   923  O  "O3'" . C   B 2 10 ? 14.931 0.008   66.393  1.00 100.43 ? 17  C   R "O3'" 1 
ATOM   924  C  "C2'" . C   B 2 10 ? 12.934 -1.150  65.613  1.00 99.34  ? 17  C   R "C2'" 1 
ATOM   925  O  "O2'" . C   B 2 10 ? 12.943 -1.730  66.903  1.00 98.94  ? 17  C   R "O2'" 1 
ATOM   926  C  "C1'" . C   B 2 10 ? 11.557 -0.573  65.277  1.00 99.35  ? 17  C   R "C1'" 1 
ATOM   927  N  N1    . C   B 2 10 ? 11.109 -0.885  63.870  1.00 99.84  ? 17  C   R N1    1 
ATOM   928  C  C2    . C   B 2 10 ? 10.585 -2.154  63.548  1.00 99.68  ? 17  C   R C2    1 
ATOM   929  O  O2    . C   B 2 10 ? 10.480 -3.031  64.414  1.00 99.42  ? 17  C   R O2    1 
ATOM   930  N  N3    . C   B 2 10 ? 10.195 -2.398  62.269  1.00 100.14 ? 17  C   R N3    1 
ATOM   931  C  C4    . C   B 2 10 ? 10.309 -1.449  61.335  1.00 100.55 ? 17  C   R C4    1 
ATOM   932  N  N4    . C   B 2 10 ? 9.910  -1.742  60.093  1.00 101.27 ? 17  C   R N4    1 
ATOM   933  C  C5    . C   B 2 10 ? 10.838 -0.158  61.636  1.00 100.21 ? 17  C   R C5    1 
ATOM   934  C  C6    . C   B 2 10 ? 11.220 0.073   62.897  1.00 99.81  ? 17  C   R C6    1 
ATOM   935  P  P     . A   B 2 11 ? 16.406 -0.067  65.791  1.00 101.72 ? 18  A   R P     1 
ATOM   936  O  OP1   . A   B 2 11 ? 17.355 0.159   66.908  1.00 101.76 ? 18  A   R OP1   1 
ATOM   937  O  OP2   . A   B 2 11 ? 16.456 0.812   64.600  1.00 101.60 ? 18  A   R OP2   1 
ATOM   938  O  "O5'" . A   B 2 11 ? 16.506 -1.585  65.289  1.00 101.21 ? 18  A   R "O5'" 1 
ATOM   939  C  "C5'" . A   B 2 11 ? 16.893 -2.607  66.200  1.00 101.02 ? 18  A   R "C5'" 1 
ATOM   940  C  "C4'" . A   B 2 11 ? 16.603 -3.987  65.646  1.00 100.63 ? 18  A   R "C4'" 1 
ATOM   941  O  "O4'" . A   B 2 11 ? 15.218 -4.088  65.235  1.00 101.37 ? 18  A   R "O4'" 1 
ATOM   942  C  "C3'" . A   B 2 11 ? 17.367 -4.358  64.387  1.00 100.17 ? 18  A   R "C3'" 1 
ATOM   943  O  "O3'" . A   B 2 11 ? 18.709 -4.721  64.689  1.00 98.50  ? 18  A   R "O3'" 1 
ATOM   944  C  "C2'" . A   B 2 11 ? 16.532 -5.530  63.879  1.00 100.89 ? 18  A   R "C2'" 1 
ATOM   945  O  "O2'" . A   B 2 11 ? 16.819 -6.758  64.523  1.00 99.68  ? 18  A   R "O2'" 1 
ATOM   946  C  "C1'" . A   B 2 11 ? 15.116 -5.056  64.204  1.00 102.34 ? 18  A   R "C1'" 1 
ATOM   947  N  N9    . A   B 2 11 ? 14.471 -4.455  63.038  1.00 104.57 ? 18  A   R N9    1 
ATOM   948  C  C8    . A   B 2 11 ? 14.257 -3.123  62.812  1.00 105.36 ? 18  A   R C8    1 
ATOM   949  N  N7    . A   B 2 11 ? 13.660 -2.866  61.673  1.00 105.81 ? 18  A   R N7    1 
ATOM   950  C  C5    . A   B 2 11 ? 13.475 -4.116  61.108  1.00 105.43 ? 18  A   R C5    1 
ATOM   951  C  C6    . A   B 2 11 ? 12.891 -4.532  59.893  1.00 105.84 ? 18  A   R C6    1 
ATOM   952  N  N6    . A   B 2 11 ? 12.377 -3.674  59.005  1.00 105.59 ? 18  A   R N6    1 
ATOM   953  N  N1    . A   B 2 11 ? 12.864 -5.859  59.623  1.00 106.12 ? 18  A   R N1    1 
ATOM   954  C  C2    . A   B 2 11 ? 13.383 -6.714  60.519  1.00 105.77 ? 18  A   R C2    1 
ATOM   955  N  N3    . A   B 2 11 ? 13.954 -6.438  61.694  1.00 105.31 ? 18  A   R N3    1 
ATOM   956  C  C4    . A   B 2 11 ? 13.970 -5.112  61.933  1.00 105.07 ? 18  A   R C4    1 
ATOM   957  P  P     . G   B 2 12 ? 19.864 -4.498  63.600  1.00 96.97  ? 19  G   R P     1 
ATOM   958  O  OP1   . G   B 2 12 ? 21.168 -4.712  64.267  1.00 97.32  ? 19  G   R OP1   1 
ATOM   959  O  OP2   . G   B 2 12 ? 19.602 -3.219  62.899  1.00 97.07  ? 19  G   R OP2   1 
ATOM   960  O  "O5'" . G   B 2 12 ? 19.612 -5.686  62.565  1.00 93.61  ? 19  G   R "O5'" 1 
ATOM   961  C  "C5'" . G   B 2 12 ? 19.789 -7.031  62.976  1.00 91.14  ? 19  G   R "C5'" 1 
ATOM   962  C  "C4'" . G   B 2 12 ? 19.351 -7.959  61.867  1.00 89.62  ? 19  G   R "C4'" 1 
ATOM   963  O  "O4'" . G   B 2 12 ? 17.934 -7.764  61.633  1.00 89.19  ? 19  G   R "O4'" 1 
ATOM   964  C  "C3'" . G   B 2 12 ? 19.970 -7.674  60.506  1.00 89.18  ? 19  G   R "C3'" 1 
ATOM   965  O  "O3'" . G   B 2 12 ? 21.299 -8.187  60.375  1.00 87.87  ? 19  G   R "O3'" 1 
ATOM   966  C  "C2'" . G   B 2 12 ? 18.951 -8.316  59.567  1.00 89.10  ? 19  G   R "C2'" 1 
ATOM   967  O  "O2'" . G   B 2 12 ? 19.051 -9.727  59.492  1.00 89.19  ? 19  G   R "O2'" 1 
ATOM   968  C  "C1'" . G   B 2 12 ? 17.652 -7.886  60.248  1.00 88.55  ? 19  G   R "C1'" 1 
ATOM   969  N  N9    . G   B 2 12 ? 17.128 -6.614  59.739  1.00 87.43  ? 19  G   R N9    1 
ATOM   970  C  C8    . G   B 2 12 ? 17.424 -5.346  60.187  1.00 87.12  ? 19  G   R C8    1 
ATOM   971  N  N7    . G   B 2 12 ? 16.808 -4.400  59.536  1.00 86.74  ? 19  G   R N7    1 
ATOM   972  C  C5    . G   B 2 12 ? 16.050 -5.080  58.591  1.00 86.12  ? 19  G   R C5    1 
ATOM   973  C  C6    . G   B 2 12 ? 15.173 -4.584  57.592  1.00 85.60  ? 19  G   R C6    1 
ATOM   974  O  O6    . G   B 2 12 ? 14.882 -3.405  57.346  1.00 85.10  ? 19  G   R O6    1 
ATOM   975  N  N1    . G   B 2 12 ? 14.600 -5.609  56.838  1.00 85.56  ? 19  G   R N1    1 
ATOM   976  C  C2    . G   B 2 12 ? 14.849 -6.951  57.023  1.00 85.36  ? 19  G   R C2    1 
ATOM   977  N  N2    . G   B 2 12 ? 14.210 -7.797  56.202  1.00 84.65  ? 19  G   R N2    1 
ATOM   978  N  N3    . G   B 2 12 ? 15.671 -7.427  57.953  1.00 85.52  ? 19  G   R N3    1 
ATOM   979  C  C4    . G   B 2 12 ? 16.238 -6.442  58.700  1.00 86.32  ? 19  G   R C4    1 
ATOM   980  P  P     . G   B 2 13 ? 22.572 -7.212  60.503  1.00 87.08  ? 20  G   R P     1 
ATOM   981  O  OP1   . G   B 2 13 ? 23.679 -8.042  61.028  1.00 87.37  ? 20  G   R OP1   1 
ATOM   982  O  OP2   . G   B 2 13 ? 22.190 -5.964  61.211  1.00 86.12  ? 20  G   R OP2   1 
ATOM   983  O  "O5'" . G   B 2 13 ? 22.918 -6.816  58.994  1.00 83.80  ? 20  G   R "O5'" 1 
ATOM   984  C  "C5'" . G   B 2 13 ? 22.315 -5.683  58.380  1.00 79.73  ? 20  G   R "C5'" 1 
ATOM   985  C  "C4'" . G   B 2 13 ? 21.161 -6.153  57.518  1.00 76.53  ? 20  G   R "C4'" 1 
ATOM   986  O  "O4'" . G   B 2 13 ? 19.916 -5.538  57.930  1.00 76.27  ? 20  G   R "O4'" 1 
ATOM   987  C  "C3'" . G   B 2 13 ? 21.263 -5.858  56.034  1.00 73.78  ? 20  G   R "C3'" 1 
ATOM   988  O  "O3'" . G   B 2 13 ? 22.152 -6.799  55.427  1.00 69.26  ? 20  G   R "O3'" 1 
ATOM   989  C  "C2'" . G   B 2 13 ? 19.803 -6.053  55.631  1.00 74.20  ? 20  G   R "C2'" 1 
ATOM   990  O  "O2'" . G   B 2 13 ? 19.439 -7.416  55.520  1.00 73.18  ? 20  G   R "O2'" 1 
ATOM   991  C  "C1'" . G   B 2 13 ? 19.071 -5.410  56.803  1.00 75.04  ? 20  G   R "C1'" 1 
ATOM   992  N  N9    . G   B 2 13 ? 18.769 -3.992  56.609  1.00 75.64  ? 20  G   R N9    1 
ATOM   993  C  C8    . G   B 2 13 ? 19.372 -2.929  57.241  1.00 76.41  ? 20  G   R C8    1 
ATOM   994  N  N7    . G   B 2 13 ? 18.903 -1.768  56.879  1.00 76.65  ? 20  G   R N7    1 
ATOM   995  C  C5    . G   B 2 13 ? 17.923 -2.078  55.946  1.00 76.09  ? 20  G   R C5    1 
ATOM   996  C  C6    . G   B 2 13 ? 17.069 -1.220  55.206  1.00 76.26  ? 20  G   R C6    1 
ATOM   997  O  O6    . G   B 2 13 ? 17.019 0.020   55.239  1.00 75.92  ? 20  G   R O6    1 
ATOM   998  N  N1    . G   B 2 13 ? 16.217 -1.939  54.362  1.00 75.80  ? 20  G   R N1    1 
ATOM   999  C  C2    . G   B 2 13 ? 16.196 -3.314  54.251  1.00 74.64  ? 20  G   R C2    1 
ATOM   1000 N  N2    . G   B 2 13 ? 15.308 -3.829  53.391  1.00 74.53  ? 20  G   R N2    1 
ATOM   1001 N  N3    . G   B 2 13 ? 16.990 -4.126  54.939  1.00 74.10  ? 20  G   R N3    1 
ATOM   1002 C  C4    . G   B 2 13 ? 17.827 -3.444  55.765  1.00 75.33  ? 20  G   R C4    1 
ATOM   1003 P  P     . G   B 2 14 ? 22.496 -6.740  53.864  1.00 65.21  ? 21  G   R P     1 
ATOM   1004 O  OP1   . G   B 2 14 ? 23.510 -7.779  53.568  1.00 64.77  ? 21  G   R OP1   1 
ATOM   1005 O  OP2   . G   B 2 14 ? 22.744 -5.329  53.482  1.00 65.68  ? 21  G   R OP2   1 
ATOM   1006 O  "O5'" . G   B 2 14 ? 21.095 -7.180  53.240  1.00 61.98  ? 21  G   R "O5'" 1 
ATOM   1007 C  "C5'" . G   B 2 14 ? 21.026 -7.844  52.009  1.00 57.17  ? 21  G   R "C5'" 1 
ATOM   1008 C  "C4'" . G   B 2 14 ? 19.720 -7.523  51.321  1.00 54.12  ? 21  G   R "C4'" 1 
ATOM   1009 O  "O4'" . G   B 2 14 ? 18.891 -6.638  52.109  1.00 53.25  ? 21  G   R "O4'" 1 
ATOM   1010 C  "C3'" . G   B 2 14 ? 19.920 -6.725  50.060  1.00 52.50  ? 21  G   R "C3'" 1 
ATOM   1011 O  "O3'" . G   B 2 14 ? 20.398 -7.592  49.063  1.00 52.31  ? 21  G   R "O3'" 1 
ATOM   1012 C  "C2'" . G   B 2 14 ? 18.517 -6.195  49.809  1.00 51.43  ? 21  G   R "C2'" 1 
ATOM   1013 O  "O2'" . G   B 2 14 ? 17.639 -7.159  49.261  1.00 48.28  ? 21  G   R "O2'" 1 
ATOM   1014 C  "C1'" . G   B 2 14 ? 18.119 -5.825  51.238  1.00 51.47  ? 21  G   R "C1'" 1 
ATOM   1015 N  N9    . G   B 2 14 ? 18.354 -4.423  51.593  1.00 50.42  ? 21  G   R N9    1 
ATOM   1016 C  C8    . G   B 2 14 ? 19.201 -3.963  52.574  1.00 50.69  ? 21  G   R C8    1 
ATOM   1017 N  N7    . G   B 2 14 ? 19.221 -2.665  52.689  1.00 50.57  ? 21  G   R N7    1 
ATOM   1018 C  C5    . G   B 2 14 ? 18.329 -2.225  51.723  1.00 49.87  ? 21  G   R C5    1 
ATOM   1019 C  C6    . G   B 2 14 ? 17.939 -0.902  51.382  1.00 51.06  ? 21  G   R C6    1 
ATOM   1020 O  O6    . G   B 2 14 ? 18.330 0.162   51.897  1.00 50.76  ? 21  G   R O6    1 
ATOM   1021 N  N1    . G   B 2 14 ? 17.007 -0.884  50.334  1.00 49.85  ? 21  G   R N1    1 
ATOM   1022 C  C2    . G   B 2 14 ? 16.516 -2.015  49.706  1.00 48.94  ? 21  G   R C2    1 
ATOM   1023 N  N2    . G   B 2 14 ? 15.625 -1.819  48.723  1.00 47.46  ? 21  G   R N2    1 
ATOM   1024 N  N3    . G   B 2 14 ? 16.875 -3.258  50.023  1.00 47.98  ? 21  G   R N3    1 
ATOM   1025 C  C4    . G   B 2 14 ? 17.783 -3.295  51.036  1.00 49.64  ? 21  G   R C4    1 
ATOM   1026 P  P     . C   B 2 15 ? 21.706 -7.130  48.274  1.00 50.29  ? 22  C   R P     1 
ATOM   1027 O  OP1   . C   B 2 15 ? 22.378 -8.329  47.735  1.00 48.95  ? 22  C   R OP1   1 
ATOM   1028 O  OP2   . C   B 2 15 ? 22.458 -6.195  49.141  1.00 51.24  ? 22  C   R OP2   1 
ATOM   1029 O  "O5'" . C   B 2 15 ? 21.047 -6.302  47.076  1.00 50.36  ? 22  C   R "O5'" 1 
ATOM   1030 C  "C5'" . C   B 2 15 ? 19.948 -6.853  46.341  1.00 47.32  ? 22  C   R "C5'" 1 
ATOM   1031 C  "C4'" . C   B 2 15 ? 19.100 -5.745  45.754  1.00 47.19  ? 22  C   R "C4'" 1 
ATOM   1032 O  "O4'" . C   B 2 15 ? 18.560 -4.915  46.812  1.00 47.51  ? 22  C   R "O4'" 1 
ATOM   1033 C  "C3'" . C   B 2 15 ? 19.857 -4.761  44.879  1.00 46.49  ? 22  C   R "C3'" 1 
ATOM   1034 O  "O3'" . C   B 2 15 ? 19.985 -5.287  43.572  1.00 46.54  ? 22  C   R "O3'" 1 
ATOM   1035 C  "C2'" . C   B 2 15 ? 18.934 -3.552  44.912  1.00 46.86  ? 22  C   R "C2'" 1 
ATOM   1036 O  "O2'" . C   B 2 15 ? 17.853 -3.638  44.004  1.00 49.26  ? 22  C   R "O2'" 1 
ATOM   1037 C  "C1'" . C   B 2 15 ? 18.393 -3.590  46.336  1.00 45.86  ? 22  C   R "C1'" 1 
ATOM   1038 N  N1    . C   B 2 15 ? 19.057 -2.602  47.243  1.00 44.65  ? 22  C   R N1    1 
ATOM   1039 C  C2    . C   B 2 15 ? 18.775 -1.230  47.099  1.00 46.56  ? 22  C   R C2    1 
ATOM   1040 O  O2    . C   B 2 15 ? 17.985 -0.849  46.221  1.00 46.87  ? 22  C   R O2    1 
ATOM   1041 N  N3    . C   B 2 15 ? 19.384 -0.343  47.935  1.00 46.85  ? 22  C   R N3    1 
ATOM   1042 C  C4    . C   B 2 15 ? 20.234 -0.778  48.874  1.00 45.89  ? 22  C   R C4    1 
ATOM   1043 N  N4    . C   B 2 15 ? 20.802 0.134   49.669  1.00 45.82  ? 22  C   R N4    1 
ATOM   1044 C  C5    . C   B 2 15 ? 20.534 -2.165  49.038  1.00 44.92  ? 22  C   R C5    1 
ATOM   1045 C  C6    . C   B 2 15 ? 19.929 -3.030  48.210  1.00 44.89  ? 22  C   R C6    1 
ATOM   1046 P  P     . A   B 2 16 ? 21.343 -5.149  42.731  1.00 48.48  ? 23  A   R P     1 
ATOM   1047 O  OP1   . A   B 2 16 ? 21.164 -5.965  41.507  1.00 46.89  ? 23  A   R OP1   1 
ATOM   1048 O  OP2   . A   B 2 16 ? 22.500 -5.387  43.633  1.00 44.61  ? 23  A   R OP2   1 
ATOM   1049 O  "O5'" . A   B 2 16 ? 21.373 -3.607  42.310  1.00 46.09  ? 23  A   R "O5'" 1 
ATOM   1050 C  "C5'" . A   B 2 16 ? 20.287 -2.976  41.638  1.00 46.26  ? 23  A   R "C5'" 1 
ATOM   1051 C  "C4'" . A   B 2 16 ? 20.423 -1.469  41.779  1.00 47.11  ? 23  A   R "C4'" 1 
ATOM   1052 O  "O4'" . A   B 2 16 ? 20.405 -1.097  43.184  1.00 46.84  ? 23  A   R "O4'" 1 
ATOM   1053 C  "C3'" . A   B 2 16 ? 21.729 -0.940  41.199  1.00 47.34  ? 23  A   R "C3'" 1 
ATOM   1054 O  "O3'" . A   B 2 16 ? 21.480 0.182   40.378  1.00 47.33  ? 23  A   R "O3'" 1 
ATOM   1055 C  "C2'" . A   B 2 16 ? 22.571 -0.585  42.423  1.00 48.10  ? 23  A   R "C2'" 1 
ATOM   1056 O  "O2'" . A   B 2 16 ? 23.439 0.518   42.227  1.00 49.12  ? 23  A   R "O2'" 1 
ATOM   1057 C  "C1'" . A   B 2 16 ? 21.510 -0.268  43.473  1.00 47.02  ? 23  A   R "C1'" 1 
ATOM   1058 N  N9    . A   B 2 16 ? 22.052 -0.541  44.799  1.00 46.26  ? 23  A   R N9    1 
ATOM   1059 C  C8    . A   B 2 16 ? 22.416 -1.753  45.317  1.00 46.49  ? 23  A   R C8    1 
ATOM   1060 N  N7    . A   B 2 16 ? 22.904 -1.687  46.534  1.00 47.15  ? 23  A   R N7    1 
ATOM   1061 C  C5    . A   B 2 16 ? 22.869 -0.336  46.832  1.00 47.56  ? 23  A   R C5    1 
ATOM   1062 C  C6    . A   B 2 16 ? 23.253 0.406   47.970  1.00 47.67  ? 23  A   R C6    1 
ATOM   1063 N  N6    . A   B 2 16 ? 23.764 -0.152  49.069  1.00 50.08  ? 23  A   R N6    1 
ATOM   1064 N  N1    . A   B 2 16 ? 23.082 1.746   47.950  1.00 47.35  ? 23  A   R N1    1 
ATOM   1065 C  C2    . A   B 2 16 ? 22.571 2.309   46.848  1.00 47.69  ? 23  A   R C2    1 
ATOM   1066 N  N3    . A   B 2 16 ? 22.175 1.719   45.718  1.00 47.86  ? 23  A   R N3    1 
ATOM   1067 C  C4    . A   B 2 16 ? 22.351 0.385   45.771  1.00 47.38  ? 23  A   R C4    1 
ATOM   1068 P  P     . A   B 2 17 ? 22.147 0.226   38.926  1.00 48.21  ? 24  A   R P     1 
ATOM   1069 O  OP1   . A   B 2 17 ? 21.428 -0.731  38.055  1.00 47.98  ? 24  A   R OP1   1 
ATOM   1070 O  OP2   . A   B 2 17 ? 23.618 0.143   39.097  1.00 44.91  ? 24  A   R OP2   1 
ATOM   1071 O  "O5'" . A   B 2 17 ? 21.760 1.695   38.436  1.00 47.93  ? 24  A   R "O5'" 1 
ATOM   1072 C  "C5'" . A   B 2 17 ? 20.397 2.030   38.201  1.00 46.67  ? 24  A   R "C5'" 1 
ATOM   1073 C  "C4'" . A   B 2 17 ? 20.193 3.531   38.277  1.00 47.53  ? 24  A   R "C4'" 1 
ATOM   1074 O  "O4'" . A   B 2 17 ? 20.319 3.997   39.645  1.00 47.25  ? 24  A   R "O4'" 1 
ATOM   1075 C  "C3'" . A   B 2 17 ? 21.223 4.368   37.536  1.00 47.99  ? 24  A   R "C3'" 1 
ATOM   1076 O  "O3'" . A   B 2 17 ? 20.939 4.374   36.152  1.00 49.41  ? 24  A   R "O3'" 1 
ATOM   1077 C  "C2'" . A   B 2 17 ? 20.995 5.728   38.183  1.00 47.92  ? 24  A   R "C2'" 1 
ATOM   1078 O  "O2'" . A   B 2 17 ? 19.850 6.397   37.695  1.00 48.99  ? 24  A   R "O2'" 1 
ATOM   1079 C  "C1'" . A   B 2 17 ? 20.795 5.334   39.646  1.00 46.09  ? 24  A   R "C1'" 1 
ATOM   1080 N  N9    . A   B 2 17 ? 22.032 5.417   40.424  1.00 43.36  ? 24  A   R N9    1 
ATOM   1081 C  C8    . A   B 2 17 ? 22.684 4.393   41.055  1.00 43.62  ? 24  A   R C8    1 
ATOM   1082 N  N7    . A   B 2 17 ? 23.781 4.759   41.675  1.00 43.25  ? 24  A   R N7    1 
ATOM   1083 C  C5    . A   B 2 17 ? 23.855 6.119   41.434  1.00 42.22  ? 24  A   R C5    1 
ATOM   1084 C  C6    . A   B 2 17 ? 24.791 7.101   41.818  1.00 43.42  ? 24  A   R C6    1 
ATOM   1085 N  N6    . A   B 2 17 ? 25.871 6.833   42.561  1.00 45.49  ? 24  A   R N6    1 
ATOM   1086 N  N1    . A   B 2 17 ? 24.576 8.375   41.413  1.00 44.01  ? 24  A   R N1    1 
ATOM   1087 C  C2    . A   B 2 17 ? 23.497 8.643   40.664  1.00 42.83  ? 24  A   R C2    1 
ATOM   1088 N  N3    . A   B 2 17 ? 22.552 7.800   40.241  1.00 42.38  ? 24  A   R N3    1 
ATOM   1089 C  C4    . A   B 2 17 ? 22.788 6.544   40.665  1.00 42.02  ? 24  A   R C4    1 
ATOM   1090 P  P     . A   B 2 18 ? 22.089 4.110   35.069  1.00 51.29  ? 25  A   R P     1 
ATOM   1091 O  OP1   . A   B 2 18 ? 21.412 4.070   33.752  1.00 51.01  ? 25  A   R OP1   1 
ATOM   1092 O  OP2   . A   B 2 18 ? 22.956 2.990   35.506  1.00 49.03  ? 25  A   R OP2   1 
ATOM   1093 O  "O5'" . A   B 2 18 ? 22.962 5.443   35.158  1.00 50.98  ? 25  A   R "O5'" 1 
ATOM   1094 C  "C5'" . A   B 2 18 ? 22.414 6.692   34.749  1.00 47.94  ? 25  A   R "C5'" 1 
ATOM   1095 C  "C4'" . A   B 2 18 ? 23.255 7.822   35.304  1.00 45.90  ? 25  A   R "C4'" 1 
ATOM   1096 O  "O4'" . A   B 2 18 ? 23.315 7.712   36.744  1.00 43.54  ? 25  A   R "O4'" 1 
ATOM   1097 C  "C3'" . A   B 2 18 ? 24.714 7.797   34.880  1.00 45.50  ? 25  A   R "C3'" 1 
ATOM   1098 O  "O3'" . A   B 2 18 ? 24.878 8.394   33.604  1.00 44.28  ? 25  A   R "O3'" 1 
ATOM   1099 C  "C2'" . A   B 2 18 ? 25.344 8.643   35.974  1.00 45.71  ? 25  A   R "C2'" 1 
ATOM   1100 O  "O2'" . A   B 2 18 ? 25.135 10.027  35.764  1.00 49.08  ? 25  A   R "O2'" 1 
ATOM   1101 C  "C1'" . A   B 2 18 ? 24.571 8.169   37.200  1.00 43.36  ? 25  A   R "C1'" 1 
ATOM   1102 N  N9    . A   B 2 18 ? 25.240 7.106   37.950  1.00 42.28  ? 25  A   R N9    1 
ATOM   1103 C  C8    . A   B 2 18 ? 24.838 5.805   38.108  1.00 41.66  ? 25  A   R C8    1 
ATOM   1104 N  N7    . A   B 2 18 ? 25.647 5.081   38.853  1.00 40.50  ? 25  A   R N7    1 
ATOM   1105 C  C5    . A   B 2 18 ? 26.652 5.967   39.208  1.00 42.42  ? 25  A   R C5    1 
ATOM   1106 C  C6    . A   B 2 18 ? 27.822 5.834   39.995  1.00 43.38  ? 25  A   R C6    1 
ATOM   1107 N  N6    . A   B 2 18 ? 28.192 4.693   40.587  1.00 44.62  ? 25  A   R N6    1 
ATOM   1108 N  N1    . A   B 2 18 ? 28.613 6.919   40.149  1.00 42.85  ? 25  A   R N1    1 
ATOM   1109 C  C2    . A   B 2 18 ? 28.251 8.066   39.560  1.00 42.93  ? 25  A   R C2    1 
ATOM   1110 N  N3    . A   B 2 18 ? 27.178 8.315   38.804  1.00 41.24  ? 25  A   R N3    1 
ATOM   1111 C  C4    . A   B 2 18 ? 26.413 7.219   38.663  1.00 41.86  ? 25  A   R C4    1 
ATOM   1112 P  P     . C   B 2 19 ? 25.881 7.756   32.535  1.00 43.87  ? 26  C   R P     1 
ATOM   1113 O  OP1   . C   B 2 19 ? 25.924 8.672   31.372  1.00 45.22  ? 26  C   R OP1   1 
ATOM   1114 O  OP2   . C   B 2 19 ? 25.530 6.337   32.323  1.00 43.11  ? 26  C   R OP2   1 
ATOM   1115 O  "O5'" . C   B 2 19 ? 27.280 7.766   33.302  1.00 42.41  ? 26  C   R "O5'" 1 
ATOM   1116 C  "C5'" . C   B 2 19 ? 28.029 8.954   33.428  1.00 42.47  ? 26  C   R "C5'" 1 
ATOM   1117 C  "C4'" . C   B 2 19 ? 29.199 8.688   34.344  1.00 42.95  ? 26  C   R "C4'" 1 
ATOM   1118 O  "O4'" . C   B 2 19 ? 28.701 8.197   35.611  1.00 44.10  ? 26  C   R "O4'" 1 
ATOM   1119 C  "C3'" . C   B 2 19 ? 30.122 7.583   33.870  1.00 43.32  ? 26  C   R "C3'" 1 
ATOM   1120 O  "O3'" . C   B 2 19 ? 31.055 8.076   32.906  1.00 42.98  ? 26  C   R "O3'" 1 
ATOM   1121 C  "C2'" . C   B 2 19 ? 30.780 7.169   35.180  1.00 44.14  ? 26  C   R "C2'" 1 
ATOM   1122 O  "O2'" . C   B 2 19 ? 31.797 8.067   35.579  1.00 45.74  ? 26  C   R "O2'" 1 
ATOM   1123 C  "C1'" . C   B 2 19 ? 29.596 7.233   36.141  1.00 44.24  ? 26  C   R "C1'" 1 
ATOM   1124 N  N1    . C   B 2 19 ? 28.882 5.914   36.346  1.00 44.11  ? 26  C   R N1    1 
ATOM   1125 C  C2    . C   B 2 19 ? 29.416 4.951   37.225  1.00 44.20  ? 26  C   R C2    1 
ATOM   1126 O  O2    . C   B 2 19 ? 30.471 5.186   37.825  1.00 45.68  ? 26  C   R O2    1 
ATOM   1127 N  N3    . C   B 2 19 ? 28.759 3.771   37.398  1.00 43.48  ? 26  C   R N3    1 
ATOM   1128 C  C4    . C   B 2 19 ? 27.623 3.534   36.735  1.00 43.64  ? 26  C   R C4    1 
ATOM   1129 N  N4    . C   B 2 19 ? 27.013 2.364   36.935  1.00 43.97  ? 26  C   R N4    1 
ATOM   1130 C  C5    . C   B 2 19 ? 27.060 4.491   35.835  1.00 43.52  ? 26  C   R C5    1 
ATOM   1131 C  C6    . C   B 2 19 ? 27.714 5.650   35.678  1.00 43.68  ? 26  C   R C6    1 
ATOM   1132 P  P     . C   B 2 20 ? 31.556 7.144   31.693  1.00 39.78  ? 27  C   R P     1 
ATOM   1133 O  OP1   . C   B 2 20 ? 32.323 8.022   30.791  1.00 39.80  ? 27  C   R OP1   1 
ATOM   1134 O  OP2   . C   B 2 20 ? 30.417 6.356   31.160  1.00 36.35  ? 27  C   R OP2   1 
ATOM   1135 O  "O5'" . C   B 2 20 ? 32.572 6.148   32.419  1.00 38.07  ? 27  C   R "O5'" 1 
ATOM   1136 C  "C5'" . C   B 2 20 ? 33.723 6.671   33.085  1.00 39.59  ? 27  C   R "C5'" 1 
ATOM   1137 C  "C4'" . C   B 2 20 ? 34.404 5.601   33.916  1.00 40.17  ? 27  C   R "C4'" 1 
ATOM   1138 O  "O4'" . C   B 2 20 ? 33.530 5.176   34.989  1.00 41.08  ? 27  C   R "O4'" 1 
ATOM   1139 C  "C3'" . C   B 2 20 ? 34.684 4.298   33.189  1.00 41.06  ? 27  C   R "C3'" 1 
ATOM   1140 O  "O3'" . C   B 2 20 ? 35.819 4.403   32.341  1.00 41.21  ? 27  C   R "O3'" 1 
ATOM   1141 C  "C2'" . C   B 2 20 ? 34.907 3.363   34.373  1.00 41.83  ? 27  C   R "C2'" 1 
ATOM   1142 O  "O2'" . C   B 2 20 ? 36.171 3.525   34.987  1.00 44.59  ? 27  C   R "O2'" 1 
ATOM   1143 C  "C1'" . C   B 2 20 ? 33.805 3.823   35.319  1.00 40.05  ? 27  C   R "C1'" 1 
ATOM   1144 N  N1    . C   B 2 20 ? 32.559 2.968   35.259  1.00 38.33  ? 27  C   R N1    1 
ATOM   1145 C  C2    . C   B 2 20 ? 32.548 1.722   35.912  1.00 38.95  ? 27  C   R C2    1 
ATOM   1146 O  O2    . C   B 2 20 ? 33.554 1.340   36.520  1.00 40.74  ? 27  C   R O2    1 
ATOM   1147 N  N3    . C   B 2 20 ? 31.428 0.953   35.864  1.00 38.42  ? 27  C   R N3    1 
ATOM   1148 C  C4    . C   B 2 20 ? 30.351 1.380   35.200  1.00 37.42  ? 27  C   R C4    1 
ATOM   1149 N  N4    . C   B 2 20 ? 29.283 0.579   35.186  1.00 37.14  ? 27  C   R N4    1 
ATOM   1150 C  C5    . C   B 2 20 ? 30.331 2.642   34.527  1.00 36.89  ? 27  C   R C5    1 
ATOM   1151 C  C6    . C   B 2 20 ? 31.443 3.391   34.584  1.00 37.84  ? 27  C   R C6    1 
ATOM   1152 P  P     . A   B 2 21 ? 35.931 3.458   31.055  1.00 43.40  ? 28  A   R P     1 
ATOM   1153 O  OP1   . A   B 2 21 ? 37.136 3.860   30.290  1.00 41.89  ? 28  A   R OP1   1 
ATOM   1154 O  OP2   . A   B 2 21 ? 34.605 3.427   30.388  1.00 41.02  ? 28  A   R OP2   1 
ATOM   1155 O  "O5'" . A   B 2 21 ? 36.179 2.017   31.702  1.00 43.30  ? 28  A   R "O5'" 1 
ATOM   1156 C  "C5'" . A   B 2 21 ? 37.436 1.648   32.245  1.00 45.08  ? 28  A   R "C5'" 1 
ATOM   1157 C  "C4'" . A   B 2 21 ? 37.394 0.197   32.687  1.00 47.78  ? 28  A   R "C4'" 1 
ATOM   1158 O  "O4'" . A   B 2 21 ? 36.372 0.060   33.704  1.00 48.75  ? 28  A   R "O4'" 1 
ATOM   1159 C  "C3'" . A   B 2 21 ? 36.970 -0.821  31.636  1.00 49.28  ? 28  A   R "C3'" 1 
ATOM   1160 O  "O3'" . A   B 2 21 ? 38.037 -1.180  30.768  1.00 50.48  ? 28  A   R "O3'" 1 
ATOM   1161 C  "C2'" . A   B 2 21 ? 36.530 -1.977  32.528  1.00 50.10  ? 28  A   R "C2'" 1 
ATOM   1162 O  "O2'" . A   B 2 21 ? 37.603 -2.745  33.037  1.00 51.40  ? 28  A   R "O2'" 1 
ATOM   1163 C  "C1'" . A   B 2 21 ? 35.816 -1.239  33.655  1.00 49.12  ? 28  A   R "C1'" 1 
ATOM   1164 N  N9    . A   B 2 21 ? 34.381 -1.148  33.405  1.00 49.16  ? 28  A   R N9    1 
ATOM   1165 C  C8    . A   B 2 21 ? 33.703 -0.130  32.793  1.00 49.52  ? 28  A   R C8    1 
ATOM   1166 N  N7    . A   B 2 21 ? 32.410 -0.333  32.696  1.00 50.33  ? 28  A   R N7    1 
ATOM   1167 C  C5    . A   B 2 21 ? 32.229 -1.574  33.280  1.00 49.47  ? 28  A   R C5    1 
ATOM   1168 C  C6    . A   B 2 21 ? 31.082 -2.366  33.495  1.00 49.83  ? 28  A   R C6    1 
ATOM   1169 N  N6    . A   B 2 21 ? 29.853 -1.996  33.122  1.00 49.71  ? 28  A   R N6    1 
ATOM   1170 N  N1    . A   B 2 21 ? 31.250 -3.562  34.102  1.00 50.49  ? 28  A   R N1    1 
ATOM   1171 C  C2    . A   B 2 21 ? 32.482 -3.938  34.473  1.00 49.24  ? 28  A   R C2    1 
ATOM   1172 N  N3    . A   B 2 21 ? 33.631 -3.277  34.327  1.00 48.13  ? 28  A   R N3    1 
ATOM   1173 C  C4    . A   B 2 21 ? 33.434 -2.095  33.718  1.00 49.09  ? 28  A   R C4    1 
ATOM   1174 P  P     . U   B 2 22 ? 37.749 -1.562  29.235  1.00 51.88  ? 29  U   R P     1 
ATOM   1175 O  OP1   . U   B 2 22 ? 39.065 -1.714  28.578  1.00 52.03  ? 29  U   R OP1   1 
ATOM   1176 O  OP2   . U   B 2 22 ? 36.747 -0.632  28.667  1.00 50.95  ? 29  U   R OP2   1 
ATOM   1177 O  "O5'" . U   B 2 22 ? 37.032 -2.985  29.327  1.00 52.23  ? 29  U   R "O5'" 1 
ATOM   1178 C  "C5'" . U   B 2 22 ? 37.724 -4.155  29.742  1.00 51.27  ? 29  U   R "C5'" 1 
ATOM   1179 C  "C4'" . U   B 2 22 ? 36.710 -5.241  30.046  1.00 51.64  ? 29  U   R "C4'" 1 
ATOM   1180 O  "O4'" . U   B 2 22 ? 35.768 -4.729  31.021  1.00 51.20  ? 29  U   R "O4'" 1 
ATOM   1181 C  "C3'" . U   B 2 22 ? 35.803 -5.623  28.888  1.00 51.62  ? 29  U   R "C3'" 1 
ATOM   1182 O  "O3'" . U   B 2 22 ? 36.436 -6.515  27.977  1.00 53.54  ? 29  U   R "O3'" 1 
ATOM   1183 C  "C2'" . U   B 2 22 ? 34.636 -6.260  29.639  1.00 50.64  ? 29  U   R "C2'" 1 
ATOM   1184 O  "O2'" . U   B 2 22 ? 34.909 -7.570  30.098  1.00 48.36  ? 29  U   R "O2'" 1 
ATOM   1185 C  "C1'" . U   B 2 22 ? 34.487 -5.298  30.814  1.00 49.41  ? 29  U   R "C1'" 1 
ATOM   1186 N  N1    . U   B 2 22 ? 33.449 -4.230  30.577  1.00 49.14  ? 29  U   R N1    1 
ATOM   1187 C  C2    . U   B 2 22 ? 32.119 -4.509  30.860  1.00 48.59  ? 29  U   R C2    1 
ATOM   1188 O  O2    . U   B 2 22 ? 31.733 -5.578  31.298  1.00 47.71  ? 29  U   R O2    1 
ATOM   1189 N  N3    . U   B 2 22 ? 31.237 -3.482  30.606  1.00 47.53  ? 29  U   R N3    1 
ATOM   1190 C  C4    . U   B 2 22 ? 31.542 -2.224  30.111  1.00 48.35  ? 29  U   R C4    1 
ATOM   1191 O  O4    . U   B 2 22 ? 30.646 -1.401  29.941  1.00 49.31  ? 29  U   R O4    1 
ATOM   1192 C  C5    . U   B 2 22 ? 32.942 -2.002  29.841  1.00 48.45  ? 29  U   R C5    1 
ATOM   1193 C  C6    . U   B 2 22 ? 33.819 -2.989  30.078  1.00 48.88  ? 29  U   R C6    1 
ATOM   1194 P  P     . U   B 2 23 ? 35.891 -6.612  26.473  1.00 55.92  ? 30  U   R P     1 
ATOM   1195 O  OP1   . U   B 2 23 ? 36.885 -7.370  25.685  1.00 56.79  ? 30  U   R OP1   1 
ATOM   1196 O  OP2   . U   B 2 23 ? 35.472 -5.266  26.026  1.00 56.02  ? 30  U   R OP2   1 
ATOM   1197 O  "O5'" . U   B 2 23 ? 34.562 -7.489  26.615  1.00 55.88  ? 30  U   R "O5'" 1 
ATOM   1198 C  "C5'" . U   B 2 23 ? 34.646 -8.880  26.907  1.00 54.03  ? 30  U   R "C5'" 1 
ATOM   1199 C  "C4'" . U   B 2 23 ? 33.261 -9.453  27.111  1.00 52.65  ? 30  U   R "C4'" 1 
ATOM   1200 O  "O4'" . U   B 2 23 ? 32.604 -8.723  28.174  1.00 53.98  ? 30  U   R "O4'" 1 
ATOM   1201 C  "C3'" . U   B 2 23 ? 32.326 -9.267  25.931  1.00 52.84  ? 30  U   R "C3'" 1 
ATOM   1202 O  "O3'" . U   B 2 23 ? 32.533 -10.276 24.969  1.00 53.35  ? 30  U   R "O3'" 1 
ATOM   1203 C  "C2'" . U   B 2 23 ? 30.964 -9.386  26.601  1.00 53.57  ? 30  U   R "C2'" 1 
ATOM   1204 O  "O2'" . U   B 2 23 ? 30.578 -10.727 26.842  1.00 53.89  ? 30  U   R "O2'" 1 
ATOM   1205 C  "C1'" . U   B 2 23 ? 31.212 -8.649  27.915  1.00 53.68  ? 30  U   R "C1'" 1 
ATOM   1206 N  N1    . U   B 2 23 ? 30.749 -7.219  27.876  1.00 53.17  ? 30  U   R N1    1 
ATOM   1207 C  C2    . U   B 2 23 ? 29.401 -6.947  28.060  1.00 53.95  ? 30  U   R C2    1 
ATOM   1208 O  O2    . U   B 2 23 ? 28.556 -7.801  28.260  1.00 53.72  ? 30  U   R O2    1 
ATOM   1209 N  N3    . U   B 2 23 ? 29.064 -5.616  28.007  1.00 55.46  ? 30  U   R N3    1 
ATOM   1210 C  C4    . U   B 2 23 ? 29.917 -4.547  27.788  1.00 55.95  ? 30  U   R C4    1 
ATOM   1211 O  O4    . U   B 2 23 ? 29.461 -3.405  27.769  1.00 57.24  ? 30  U   R O4    1 
ATOM   1212 C  C5    . U   B 2 23 ? 31.304 -4.906  27.600  1.00 54.11  ? 30  U   R C5    1 
ATOM   1213 C  C6    . U   B 2 23 ? 31.658 -6.198  27.651  1.00 52.33  ? 30  U   R C6    1 
ATOM   1214 P  P     . C   B 2 24 ? 32.283 -9.967  23.422  1.00 52.17  ? 31  C   R P     1 
ATOM   1215 O  OP1   . C   B 2 24 ? 32.848 -11.102 22.662  1.00 53.59  ? 31  C   R OP1   1 
ATOM   1216 O  OP2   . C   B 2 24 ? 32.747 -8.594  23.131  1.00 54.12  ? 31  C   R OP2   1 
ATOM   1217 O  "O5'" . C   B 2 24 ? 30.687 -9.957  23.300  1.00 52.70  ? 31  C   R "O5'" 1 
ATOM   1218 C  "C5'" . C   B 2 24 ? 29.932 -11.153 23.477  1.00 53.71  ? 31  C   R "C5'" 1 
ATOM   1219 C  "C4'" . C   B 2 24 ? 28.450 -10.857 23.618  1.00 53.63  ? 31  C   R "C4'" 1 
ATOM   1220 O  "O4'" . C   B 2 24 ? 28.230 -9.974  24.745  1.00 54.03  ? 31  C   R "O4'" 1 
ATOM   1221 C  "C3'" . C   B 2 24 ? 27.817 -10.070 22.484  1.00 54.65  ? 31  C   R "C3'" 1 
ATOM   1222 O  "O3'" . C   B 2 24 ? 27.605 -10.864 21.320  1.00 56.43  ? 31  C   R "O3'" 1 
ATOM   1223 C  "C2'" . C   B 2 24 ? 26.527 -9.592  23.151  1.00 54.06  ? 31  C   R "C2'" 1 
ATOM   1224 O  "O2'" . C   B 2 24 ? 25.530 -10.586 23.275  1.00 53.49  ? 31  C   R "O2'" 1 
ATOM   1225 C  "C1'" . C   B 2 24 ? 27.053 -9.208  24.529  1.00 53.46  ? 31  C   R "C1'" 1 
ATOM   1226 N  N1    . C   B 2 24 ? 27.340 -7.732  24.675  1.00 53.11  ? 31  C   R N1    1 
ATOM   1227 C  C2    . C   B 2 24 ? 26.282 -6.835  24.929  1.00 53.12  ? 31  C   R C2    1 
ATOM   1228 O  O2    . C   B 2 24 ? 25.121 -7.255  25.028  1.00 52.24  ? 31  C   R O2    1 
ATOM   1229 N  N3    . C   B 2 24 ? 26.559 -5.511  25.059  1.00 53.11  ? 31  C   R N3    1 
ATOM   1230 C  C4    . C   B 2 24 ? 27.817 -5.073  24.947  1.00 53.09  ? 31  C   R C4    1 
ATOM   1231 N  N4    . C   B 2 24 ? 28.030 -3.762  25.087  1.00 53.24  ? 31  C   R N4    1 
ATOM   1232 C  C5    . C   B 2 24 ? 28.908 -5.959  24.691  1.00 52.72  ? 31  C   R C5    1 
ATOM   1233 C  C6    . C   B 2 24 ? 28.625 -7.264  24.566  1.00 52.42  ? 31  C   R C6    1 
ATOM   1234 P  P     . G   B 2 25 ? 27.805 -10.204 19.869  1.00 57.68  ? 32  G   R P     1 
ATOM   1235 O  OP1   . G   B 2 25 ? 27.654 -11.275 18.856  1.00 57.60  ? 32  G   R OP1   1 
ATOM   1236 O  OP2   . G   B 2 25 ? 29.032 -9.374  19.887  1.00 55.05  ? 32  G   R OP2   1 
ATOM   1237 O  "O5'" . G   B 2 25 ? 26.552 -9.219  19.755  1.00 56.53  ? 32  G   R "O5'" 1 
ATOM   1238 C  "C5'" . G   B 2 25 ? 25.214 -9.713  19.775  1.00 56.44  ? 32  G   R "C5'" 1 
ATOM   1239 C  "C4'" . G   B 2 25 ? 24.243 -8.552  19.860  1.00 57.18  ? 32  G   R "C4'" 1 
ATOM   1240 O  "O4'" . G   B 2 25 ? 24.377 -7.870  21.133  1.00 57.36  ? 32  G   R "O4'" 1 
ATOM   1241 C  "C3'" . G   B 2 25 ? 24.526 -7.412  18.899  1.00 58.50  ? 32  G   R "C3'" 1 
ATOM   1242 O  "O3'" . G   B 2 25 ? 24.232 -7.740  17.545  1.00 60.15  ? 32  G   R "O3'" 1 
ATOM   1243 C  "C2'" . G   B 2 25 ? 23.668 -6.311  19.510  1.00 57.04  ? 32  G   R "C2'" 1 
ATOM   1244 O  "O2'" . G   B 2 25 ? 22.280 -6.522  19.345  1.00 59.42  ? 32  G   R "O2'" 1 
ATOM   1245 C  "C1'" . G   B 2 25 ? 24.075 -6.490  20.971  1.00 55.51  ? 32  G   R "C1'" 1 
ATOM   1246 N  N9    . G   B 2 25 ? 25.235 -5.664  21.304  1.00 53.55  ? 32  G   R N9    1 
ATOM   1247 C  C8    . G   B 2 25 ? 26.554 -6.052  21.347  1.00 53.69  ? 32  G   R C8    1 
ATOM   1248 N  N7    . G   B 2 25 ? 27.377 -5.089  21.658  1.00 53.73  ? 32  G   R N7    1 
ATOM   1249 C  C5    . G   B 2 25 ? 26.554 -3.985  21.829  1.00 53.84  ? 32  G   R C5    1 
ATOM   1250 C  C6    . G   B 2 25 ? 26.881 -2.650  22.174  1.00 54.54  ? 32  G   R C6    1 
ATOM   1251 O  O6    . G   B 2 25 ? 28.007 -2.181  22.400  1.00 56.21  ? 32  G   R O6    1 
ATOM   1252 N  N1    . G   B 2 25 ? 25.752 -1.829  22.248  1.00 52.91  ? 32  G   R N1    1 
ATOM   1253 C  C2    . G   B 2 25 ? 24.465 -2.258  22.013  1.00 52.70  ? 32  G   R C2    1 
ATOM   1254 N  N2    . G   B 2 25 ? 23.496 -1.339  22.126  1.00 53.64  ? 32  G   R N2    1 
ATOM   1255 N  N3    . G   B 2 25 ? 24.147 -3.507  21.689  1.00 52.97  ? 32  G   R N3    1 
ATOM   1256 C  C4    . G   B 2 25 ? 25.234 -4.319  21.614  1.00 53.66  ? 32  G   R C4    1 
ATOM   1257 P  P     . A   B 2 26 ? 25.364 -7.422  16.452  1.00 61.56  ? 33  A   R P     1 
ATOM   1258 O  OP1   . A   B 2 26 ? 25.209 -8.395  15.347  1.00 60.83  ? 33  A   R OP1   1 
ATOM   1259 O  OP2   . A   B 2 26 ? 26.673 -7.287  17.141  1.00 59.56  ? 33  A   R OP2   1 
ATOM   1260 O  "O5'" . A   B 2 26 ? 24.923 -5.972  15.940  1.00 59.89  ? 33  A   R "O5'" 1 
ATOM   1261 C  "C5'" . A   B 2 26 ? 25.897 -5.006  15.557  1.00 58.91  ? 33  A   R "C5'" 1 
ATOM   1262 C  "C4'" . A   B 2 26 ? 25.212 -3.749  15.057  1.00 57.67  ? 33  A   R "C4'" 1 
ATOM   1263 O  "O4'" . A   B 2 26 ? 24.090 -4.120  14.217  1.00 57.15  ? 33  A   R "O4'" 1 
ATOM   1264 C  "C3'" . A   B 2 26 ? 24.622 -2.871  16.147  1.00 56.29  ? 33  A   R "C3'" 1 
ATOM   1265 O  "O3'" . A   B 2 26 ? 25.604 -1.932  16.570  1.00 56.61  ? 33  A   R "O3'" 1 
ATOM   1266 C  "C2'" . A   B 2 26 ? 23.457 -2.197  15.434  1.00 55.61  ? 33  A   R "C2'" 1 
ATOM   1267 O  "O2'" . A   B 2 26 ? 23.855 -1.055  14.695  1.00 55.44  ? 33  A   R "O2'" 1 
ATOM   1268 C  "C1'" . A   B 2 26 ? 22.981 -3.284  14.474  1.00 55.30  ? 33  A   R "C1'" 1 
ATOM   1269 N  N9    . A   B 2 26 ? 21.864 -4.121  14.930  1.00 55.07  ? 33  A   R N9    1 
ATOM   1270 C  C8    . A   B 2 26 ? 21.863 -5.482  15.079  1.00 54.80  ? 33  A   R C8    1 
ATOM   1271 N  N7    . A   B 2 26 ? 20.720 -5.978  15.491  1.00 54.47  ? 33  A   R N7    1 
ATOM   1272 C  C5    . A   B 2 26 ? 19.907 -4.868  15.616  1.00 54.13  ? 33  A   R C5    1 
ATOM   1273 C  C6    . A   B 2 26 ? 18.564 -4.713  16.014  1.00 54.74  ? 33  A   R C6    1 
ATOM   1274 N  N6    . A   B 2 26 ? 17.779 -5.732  16.372  1.00 55.74  ? 33  A   R N6    1 
ATOM   1275 N  N1    . A   B 2 26 ? 18.047 -3.466  16.028  1.00 55.08  ? 33  A   R N1    1 
ATOM   1276 C  C2    . A   B 2 26 ? 18.830 -2.439  15.671  1.00 55.44  ? 33  A   R C2    1 
ATOM   1277 N  N3    . A   B 2 26 ? 20.104 -2.458  15.280  1.00 55.35  ? 33  A   R N3    1 
ATOM   1278 C  C4    . A   B 2 26 ? 20.592 -3.714  15.273  1.00 54.75  ? 33  A   R C4    1 
ATOM   1279 P  P     . A   B 2 27 ? 25.899 -1.729  18.128  1.00 55.74  ? 34  A   R P     1 
ATOM   1280 O  OP1   . A   B 2 27 ? 27.156 -0.961  18.279  1.00 54.88  ? 34  A   R OP1   1 
ATOM   1281 O  OP2   . A   B 2 27 ? 25.781 -3.059  18.763  1.00 57.39  ? 34  A   R OP2   1 
ATOM   1282 O  "O5'" . A   B 2 27 ? 24.665 -0.832  18.614  1.00 54.02  ? 34  A   R "O5'" 1 
ATOM   1283 C  "C5'" . A   B 2 27 ? 24.456 0.481   18.090  1.00 52.80  ? 34  A   R "C5'" 1 
ATOM   1284 C  "C4'" . A   B 2 27 ? 22.992 0.875   18.185  1.00 52.89  ? 34  A   R "C4'" 1 
ATOM   1285 O  "O4'" . A   B 2 27 ? 22.172 -0.161  17.588  1.00 52.10  ? 34  A   R "O4'" 1 
ATOM   1286 C  "C3'" . A   B 2 27 ? 22.445 1.015   19.600  1.00 53.41  ? 34  A   R "C3'" 1 
ATOM   1287 O  "O3'" . A   B 2 27 ? 22.684 2.325   20.108  1.00 53.18  ? 34  A   R "O3'" 1 
ATOM   1288 C  "C2'" . A   B 2 27 ? 20.954 0.743   19.413  1.00 53.05  ? 34  A   R "C2'" 1 
ATOM   1289 O  "O2'" . A   B 2 27 ? 20.243 1.896   19.006  1.00 54.41  ? 34  A   R "O2'" 1 
ATOM   1290 C  "C1'" . A   B 2 27 ? 20.940 -0.277  18.282  1.00 51.91  ? 34  A   R "C1'" 1 
ATOM   1291 N  N9    . A   B 2 27 ? 20.731 -1.672  18.685  1.00 50.62  ? 34  A   R N9    1 
ATOM   1292 C  C8    . A   B 2 27 ? 21.693 -2.623  18.898  1.00 51.25  ? 34  A   R C8    1 
ATOM   1293 N  N7    . A   B 2 27 ? 21.222 -3.801  19.236  1.00 49.82  ? 34  A   R N7    1 
ATOM   1294 C  C5    . A   B 2 27 ? 19.852 -3.617  19.243  1.00 49.76  ? 34  A   R C5    1 
ATOM   1295 C  C6    . A   B 2 27 ? 18.774 -4.490  19.521  1.00 49.94  ? 34  A   R C6    1 
ATOM   1296 N  N6    . A   B 2 27 ? 18.940 -5.773  19.859  1.00 49.41  ? 34  A   R N6    1 
ATOM   1297 N  N1    . A   B 2 27 ? 17.515 -3.998  19.441  1.00 49.13  ? 34  A   R N1    1 
ATOM   1298 C  C2    . A   B 2 27 ? 17.354 -2.711  19.106  1.00 49.13  ? 34  A   R C2    1 
ATOM   1299 N  N3    . A   B 2 27 ? 18.290 -1.800  18.822  1.00 49.72  ? 34  A   R N3    1 
ATOM   1300 C  C4    . A   B 2 27 ? 19.531 -2.314  18.908  1.00 49.62  ? 34  A   R C4    1 
ATOM   1301 P  P     . A   B 2 28 ? 22.801 2.583   21.687  1.00 53.86  ? 35  A   R P     1 
ATOM   1302 O  OP1   . A   B 2 28 ? 23.178 4.002   21.865  1.00 53.79  ? 35  A   R OP1   1 
ATOM   1303 O  OP2   . A   B 2 28 ? 23.645 1.520   22.280  1.00 53.01  ? 35  A   R OP2   1 
ATOM   1304 O  "O5'" . A   B 2 28 ? 21.308 2.352   22.218  1.00 53.14  ? 35  A   R "O5'" 1 
ATOM   1305 C  "C5'" . A   B 2 28 ? 20.402 3.437   22.382  1.00 52.47  ? 35  A   R "C5'" 1 
ATOM   1306 C  "C4'" . A   B 2 28 ? 18.998 2.929   22.666  1.00 52.85  ? 35  A   R "C4'" 1 
ATOM   1307 O  "O4'" . A   B 2 28 ? 18.675 1.828   21.776  1.00 51.59  ? 35  A   R "O4'" 1 
ATOM   1308 C  "C3'" . A   B 2 28 ? 18.780 2.345   24.053  1.00 53.08  ? 35  A   R "C3'" 1 
ATOM   1309 O  "O3'" . A   B 2 28 ? 18.546 3.363   25.014  1.00 55.52  ? 35  A   R "O3'" 1 
ATOM   1310 C  "C2'" . A   B 2 28 ? 17.554 1.462   23.825  1.00 51.88  ? 35  A   R "C2'" 1 
ATOM   1311 O  "O2'" . A   B 2 28 ? 16.329 2.169   23.769  1.00 50.77  ? 35  A   R "O2'" 1 
ATOM   1312 C  "C1'" . A   B 2 28 ? 17.890 0.869   22.461  1.00 50.48  ? 35  A   R "C1'" 1 
ATOM   1313 N  N9    . A   B 2 28 ? 18.635 -0.384  22.559  1.00 48.64  ? 35  A   R N9    1 
ATOM   1314 C  C8    . A   B 2 28 ? 19.995 -0.546  22.610  1.00 49.70  ? 35  A   R C8    1 
ATOM   1315 N  N7    . A   B 2 28 ? 20.384 -1.798  22.699  1.00 48.97  ? 35  A   R N7    1 
ATOM   1316 C  C5    . A   B 2 28 ? 19.192 -2.508  22.711  1.00 46.90  ? 35  A   R C5    1 
ATOM   1317 C  C6    . A   B 2 28 ? 18.911 -3.888  22.795  1.00 46.04  ? 35  A   R C6    1 
ATOM   1318 N  N6    . A   B 2 28 ? 19.859 -4.832  22.882  1.00 46.58  ? 35  A   R N6    1 
ATOM   1319 N  N1    . A   B 2 28 ? 17.612 -4.262  22.779  1.00 45.17  ? 35  A   R N1    1 
ATOM   1320 C  C2    . A   B 2 28 ? 16.664 -3.315  22.691  1.00 45.35  ? 35  A   R C2    1 
ATOM   1321 N  N3    . A   B 2 28 ? 16.805 -1.992  22.613  1.00 45.86  ? 35  A   R N3    1 
ATOM   1322 C  C4    . A   B 2 28 ? 18.105 -1.650  22.628  1.00 46.96  ? 35  A   R C4    1 
ATOM   1323 P  P     . G   B 2 29 ? 19.511 3.530   26.284  1.00 58.20  ? 36  G   R P     1 
ATOM   1324 O  OP1   . G   B 2 29 ? 18.775 4.376   27.253  1.00 57.99  ? 36  G   R OP1   1 
ATOM   1325 O  OP2   . G   B 2 29 ? 20.855 3.939   25.807  1.00 55.69  ? 36  G   R OP2   1 
ATOM   1326 O  "O5'" . G   B 2 29 ? 19.655 2.050   26.878  1.00 57.97  ? 36  G   R "O5'" 1 
ATOM   1327 C  "C5'" . G   B 2 29 ? 18.560 1.412   27.534  1.00 57.83  ? 36  G   R "C5'" 1 
ATOM   1328 C  "C4'" . G   B 2 29 ? 18.527 -0.076  27.225  1.00 57.14  ? 36  G   R "C4'" 1 
ATOM   1329 O  "O4'" . G   B 2 29 ? 19.195 -0.379  25.969  1.00 56.01  ? 36  G   R "O4'" 1 
ATOM   1330 C  "C3'" . G   B 2 29 ? 19.252 -0.970  28.216  1.00 56.29  ? 36  G   R "C3'" 1 
ATOM   1331 O  "O3'" . G   B 2 29 ? 18.497 -1.147  29.413  1.00 54.08  ? 36  G   R "O3'" 1 
ATOM   1332 C  "C2'" . G   B 2 29 ? 19.365 -2.246  27.386  1.00 56.82  ? 36  G   R "C2'" 1 
ATOM   1333 O  "O2'" . G   B 2 29 ? 18.134 -2.940  27.256  1.00 58.92  ? 36  G   R "O2'" 1 
ATOM   1334 C  "C1'" . G   B 2 29 ? 19.789 -1.662  26.038  1.00 53.98  ? 36  G   R "C1'" 1 
ATOM   1335 N  N9    . G   B 2 29 ? 21.240 -1.527  25.870  1.00 51.24  ? 36  G   R N9    1 
ATOM   1336 C  C8    . G   B 2 29 ? 21.969 -0.360  25.841  1.00 50.73  ? 36  G   R C8    1 
ATOM   1337 N  N7    . G   B 2 29 ? 23.253 -0.536  25.681  1.00 48.03  ? 36  G   R N7    1 
ATOM   1338 C  C5    . G   B 2 29 ? 23.393 -1.914  25.600  1.00 47.67  ? 36  G   R C5    1 
ATOM   1339 C  C6    . G   B 2 29 ? 24.558 -2.703  25.430  1.00 46.74  ? 36  G   R C6    1 
ATOM   1340 O  O6    . G   B 2 29 ? 25.729 -2.322  25.314  1.00 45.80  ? 36  G   R O6    1 
ATOM   1341 N  N1    . G   B 2 29 ? 24.269 -4.067  25.399  1.00 46.80  ? 36  G   R N1    1 
ATOM   1342 C  C2    . G   B 2 29 ? 23.003 -4.598  25.520  1.00 48.59  ? 36  G   R C2    1 
ATOM   1343 N  N2    . G   B 2 29 ? 22.910 -5.934  25.471  1.00 48.06  ? 36  G   R N2    1 
ATOM   1344 N  N3    . G   B 2 29 ? 21.900 -3.870  25.682  1.00 48.76  ? 36  G   R N3    1 
ATOM   1345 C  C4    . G   B 2 29 ? 22.165 -2.538  25.714  1.00 49.31  ? 36  G   R C4    1 
ATOM   1346 P  P     . A   B 2 30 ? 19.268 -1.223  30.816  1.00 52.19  ? 37  A   R P     1 
ATOM   1347 O  OP1   . A   B 2 30 ? 18.287 -1.000  31.901  1.00 52.56  ? 37  A   R OP1   1 
ATOM   1348 O  OP2   . A   B 2 30 ? 20.468 -0.356  30.739  1.00 53.44  ? 37  A   R OP2   1 
ATOM   1349 O  "O5'" . A   B 2 30 ? 19.758 -2.747  30.849  1.00 50.68  ? 37  A   R "O5'" 1 
ATOM   1350 C  "C5'" . A   B 2 30 ? 18.810 -3.814  30.923  1.00 47.96  ? 37  A   R "C5'" 1 
ATOM   1351 C  "C4'" . A   B 2 30 ? 19.407 -5.142  30.487  1.00 45.30  ? 37  A   R "C4'" 1 
ATOM   1352 O  "O4'" . A   B 2 30 ? 20.061 -5.001  29.198  1.00 43.97  ? 37  A   R "O4'" 1 
ATOM   1353 C  "C3'" . A   B 2 30 ? 20.502 -5.691  31.389  1.00 43.93  ? 37  A   R "C3'" 1 
ATOM   1354 O  "O3'" . A   B 2 30 ? 19.963 -6.389  32.497  1.00 43.64  ? 37  A   R "O3'" 1 
ATOM   1355 C  "C2'" . A   B 2 30 ? 21.231 -6.628  30.436  1.00 43.05  ? 37  A   R "C2'" 1 
ATOM   1356 O  "O2'" . A   B 2 30 ? 20.541 -7.846  30.248  1.00 44.55  ? 37  A   R "O2'" 1 
ATOM   1357 C  "C1'" . A   B 2 30 ? 21.228 -5.807  29.152  1.00 42.24  ? 37  A   R "C1'" 1 
ATOM   1358 N  N9    . A   B 2 30 ? 22.415 -4.959  28.993  1.00 41.12  ? 37  A   R N9    1 
ATOM   1359 C  C8    . A   B 2 30 ? 22.462 -3.591  29.039  1.00 41.53  ? 37  A   R C8    1 
ATOM   1360 N  N7    . A   B 2 30 ? 23.662 -3.085  28.864  1.00 40.53  ? 37  A   R N7    1 
ATOM   1361 C  C5    . A   B 2 30 ? 24.463 -4.195  28.689  1.00 39.80  ? 37  A   R C5    1 
ATOM   1362 C  C6    . A   B 2 30 ? 25.847 -4.333  28.455  1.00 40.58  ? 37  A   R C6    1 
ATOM   1363 N  N6    . A   B 2 30 ? 26.675 -3.287  28.360  1.00 39.26  ? 37  A   R N6    1 
ATOM   1364 N  N1    . A   B 2 30 ? 26.346 -5.585  28.321  1.00 39.87  ? 37  A   R N1    1 
ATOM   1365 C  C2    . A   B 2 30 ? 25.502 -6.622  28.415  1.00 41.00  ? 37  A   R C2    1 
ATOM   1366 N  N3    . A   B 2 30 ? 24.183 -6.615  28.634  1.00 40.26  ? 37  A   R N3    1 
ATOM   1367 C  C4    . A   B 2 30 ? 23.716 -5.360  28.764  1.00 40.22  ? 37  A   R C4    1 
ATOM   1368 P  P     . G   B 2 31 ? 20.801 -6.465  33.861  1.00 44.19  ? 38  G   R P     1 
ATOM   1369 O  OP1   . G   B 2 31 ? 19.904 -7.043  34.886  1.00 44.89  ? 38  G   R OP1   1 
ATOM   1370 O  OP2   . G   B 2 31 ? 21.425 -5.149  34.106  1.00 43.62  ? 38  G   R OP2   1 
ATOM   1371 O  "O5'" . G   B 2 31 ? 21.993 -7.478  33.532  1.00 42.81  ? 38  G   R "O5'" 1 
ATOM   1372 C  "C5'" . G   B 2 31 ? 21.780 -8.880  33.459  1.00 41.49  ? 38  G   R "C5'" 1 
ATOM   1373 C  "C4'" . G   B 2 31 ? 23.070 -9.592  33.091  1.00 43.18  ? 38  G   R "C4'" 1 
ATOM   1374 O  "O4'" . G   B 2 31 ? 23.612 -9.055  31.860  1.00 42.94  ? 38  G   R "O4'" 1 
ATOM   1375 C  "C3'" . G   B 2 31 ? 24.221 -9.425  34.071  1.00 43.20  ? 38  G   R "C3'" 1 
ATOM   1376 O  "O3'" . G   B 2 31 ? 24.055 -10.299 35.164  1.00 43.73  ? 38  G   R "O3'" 1 
ATOM   1377 C  "C2'" . G   B 2 31 ? 25.407 -9.815  33.205  1.00 41.94  ? 38  G   R "C2'" 1 
ATOM   1378 O  "O2'" . G   B 2 31 ? 25.520 -11.212 33.024  1.00 41.94  ? 38  G   R "O2'" 1 
ATOM   1379 C  "C1'" . G   B 2 31 ? 25.026 -9.143  31.889  1.00 43.10  ? 38  G   R "C1'" 1 
ATOM   1380 N  N9    . G   B 2 31 ? 25.602 -7.807  31.746  1.00 44.86  ? 38  G   R N9    1 
ATOM   1381 C  C8    . G   B 2 31 ? 24.936 -6.604  31.741  1.00 45.13  ? 38  G   R C8    1 
ATOM   1382 N  N7    . G   B 2 31 ? 25.720 -5.571  31.599  1.00 44.89  ? 38  G   R N7    1 
ATOM   1383 C  C5    . G   B 2 31 ? 26.988 -6.123  31.511  1.00 45.32  ? 38  G   R C5    1 
ATOM   1384 C  C6    . G   B 2 31 ? 28.243 -5.495  31.349  1.00 46.89  ? 38  G   R C6    1 
ATOM   1385 O  O6    . G   B 2 31 ? 28.487 -4.287  31.253  1.00 50.65  ? 38  G   R O6    1 
ATOM   1386 N  N1    . G   B 2 31 ? 29.288 -6.412  31.307  1.00 47.83  ? 38  G   R N1    1 
ATOM   1387 C  C2    . G   B 2 31 ? 29.143 -7.776  31.406  1.00 47.49  ? 38  G   R C2    1 
ATOM   1388 N  N2    . G   B 2 31 ? 30.275 -8.493  31.341  1.00 47.67  ? 38  G   R N2    1 
ATOM   1389 N  N3    . G   B 2 31 ? 27.970 -8.384  31.552  1.00 45.77  ? 38  G   R N3    1 
ATOM   1390 C  C4    . G   B 2 31 ? 26.938 -7.498  31.599  1.00 45.82  ? 38  G   R C4    1 
ATOM   1391 P  P     . U   B 2 32 ? 24.162 -9.740  36.657  1.00 44.51  ? 39  U   R P     1 
ATOM   1392 O  OP1   . U   B 2 32 ? 23.503 -10.743 37.528  1.00 43.82  ? 39  U   R OP1   1 
ATOM   1393 O  OP2   . U   B 2 32 ? 23.692 -8.336  36.680  1.00 44.11  ? 39  U   R OP2   1 
ATOM   1394 O  "O5'" . U   B 2 32 ? 25.740 -9.730  36.933  1.00 42.60  ? 39  U   R "O5'" 1 
ATOM   1395 C  "C5'" . U   B 2 32 ? 26.491 -10.927 36.778  1.00 43.07  ? 39  U   R "C5'" 1 
ATOM   1396 C  "C4'" . U   B 2 32 ? 27.958 -10.640 36.533  1.00 44.22  ? 39  U   R "C4'" 1 
ATOM   1397 O  "O4'" . U   B 2 32 ? 28.141 -9.947  35.275  1.00 43.57  ? 39  U   R "O4'" 1 
ATOM   1398 C  "C3'" . U   B 2 32 ? 28.603 -9.687  37.523  1.00 46.48  ? 39  U   R "C3'" 1 
ATOM   1399 O  "O3'" . U   B 2 32 ? 28.866 -10.319 38.765  1.00 46.94  ? 39  U   R "O3'" 1 
ATOM   1400 C  "C2'" . U   B 2 32 ? 29.858 -9.288  36.758  1.00 45.68  ? 39  U   R "C2'" 1 
ATOM   1401 O  "O2'" . U   B 2 32 ? 30.836 -10.311 36.728  1.00 46.72  ? 39  U   R "O2'" 1 
ATOM   1402 C  "C1'" . U   B 2 32 ? 29.259 -9.079  35.370  1.00 44.61  ? 39  U   R "C1'" 1 
ATOM   1403 N  N1    . U   B 2 32 ? 28.846 -7.656  35.102  1.00 45.89  ? 39  U   R N1    1 
ATOM   1404 C  C2    . U   B 2 32 ? 29.813 -6.712  34.788  1.00 47.86  ? 39  U   R C2    1 
ATOM   1405 O  O2    . U   B 2 32 ? 31.004 -6.959  34.716  1.00 48.89  ? 39  U   R O2    1 
ATOM   1406 N  N3    . U   B 2 32 ? 29.338 -5.439  34.562  1.00 48.50  ? 39  U   R N3    1 
ATOM   1407 C  C4    . U   B 2 32 ? 28.021 -5.019  34.612  1.00 48.94  ? 39  U   R C4    1 
ATOM   1408 O  O4    . U   B 2 32 ? 27.750 -3.845  34.385  1.00 50.10  ? 39  U   R O4    1 
ATOM   1409 C  C5    . U   B 2 32 ? 27.069 -6.052  34.940  1.00 48.62  ? 39  U   R C5    1 
ATOM   1410 C  C6    . U   B 2 32 ? 27.508 -7.299  35.166  1.00 47.17  ? 39  U   R C6    1 
ATOM   1411 P  P     . G   B 2 33 ? 28.661 -9.463  40.100  1.00 46.70  ? 40  G   R P     1 
ATOM   1412 O  OP1   . G   B 2 33 ? 28.707 -10.400 41.245  1.00 48.42  ? 40  G   R OP1   1 
ATOM   1413 O  OP2   . G   B 2 33 ? 27.484 -8.579  39.938  1.00 45.90  ? 40  G   R OP2   1 
ATOM   1414 O  "O5'" . G   B 2 33 ? 29.970 -8.542  40.100  1.00 48.32  ? 40  G   R "O5'" 1 
ATOM   1415 C  "C5'" . G   B 2 33 ? 31.266 -9.105  40.315  1.00 48.50  ? 40  G   R "C5'" 1 
ATOM   1416 C  "C4'" . G   B 2 33 ? 32.356 -8.056  40.164  1.00 49.16  ? 40  G   R "C4'" 1 
ATOM   1417 O  "O4'" . G   B 2 33 ? 32.432 -7.604  38.786  1.00 49.52  ? 40  G   R "O4'" 1 
ATOM   1418 C  "C3'" . G   B 2 33 ? 32.154 -6.765  40.944  1.00 48.95  ? 40  G   R "C3'" 1 
ATOM   1419 O  "O3'" . G   B 2 33 ? 32.509 -6.919  42.303  1.00 50.51  ? 40  G   R "O3'" 1 
ATOM   1420 C  "C2'" . G   B 2 33 ? 33.104 -5.839  40.195  1.00 48.68  ? 40  G   R "C2'" 1 
ATOM   1421 O  "O2'" . G   B 2 33 ? 34.470 -6.059  40.491  1.00 48.19  ? 40  G   R "O2'" 1 
ATOM   1422 C  "C1'" . G   B 2 33 ? 32.784 -6.231  38.758  1.00 48.39  ? 40  G   R "C1'" 1 
ATOM   1423 N  N9    . G   B 2 33 ? 31.682 -5.434  38.216  1.00 48.51  ? 40  G   R N9    1 
ATOM   1424 C  C8    . G   B 2 33 ? 30.376 -5.822  38.028  1.00 47.85  ? 40  G   R C8    1 
ATOM   1425 N  N7    . G   B 2 33 ? 29.621 -4.883  37.528  1.00 48.63  ? 40  G   R N7    1 
ATOM   1426 C  C5    . G   B 2 33 ? 30.475 -3.797  37.376  1.00 48.23  ? 40  G   R C5    1 
ATOM   1427 C  C6    . G   B 2 33 ? 30.225 -2.489  36.882  1.00 48.37  ? 40  G   R C6    1 
ATOM   1428 O  O6    . G   B 2 33 ? 29.156 -2.019  36.462  1.00 48.86  ? 40  G   R O6    1 
ATOM   1429 N  N1    . G   B 2 33 ? 31.373 -1.694  36.900  1.00 47.02  ? 40  G   R N1    1 
ATOM   1430 C  C2    . G   B 2 33 ? 32.606 -2.111  37.342  1.00 46.42  ? 40  G   R C2    1 
ATOM   1431 N  N2    . G   B 2 33 ? 33.599 -1.216  37.286  1.00 46.60  ? 40  G   R N2    1 
ATOM   1432 N  N3    . G   B 2 33 ? 32.852 -3.328  37.807  1.00 46.58  ? 40  G   R N3    1 
ATOM   1433 C  C4    . G   B 2 33 ? 31.747 -4.119  37.800  1.00 48.20  ? 40  G   R C4    1 
ATOM   1434 P  P     . G   B 2 34 ? 31.803 -6.020  43.428  1.00 51.79  ? 41  G   R P     1 
ATOM   1435 O  OP1   . G   B 2 34 ? 32.238 -6.556  44.736  1.00 50.89  ? 41  G   R OP1   1 
ATOM   1436 O  OP2   . G   B 2 34 ? 30.356 -5.903  43.125  1.00 49.31  ? 41  G   R OP2   1 
ATOM   1437 O  "O5'" . G   B 2 34 ? 32.464 -4.579  43.213  1.00 50.20  ? 41  G   R "O5'" 1 
ATOM   1438 C  "C5'" . G   B 2 34 ? 33.840 -4.359  43.502  1.00 50.09  ? 41  G   R "C5'" 1 
ATOM   1439 C  "C4'" . G   B 2 34 ? 34.306 -3.012  42.972  1.00 49.58  ? 41  G   R "C4'" 1 
ATOM   1440 O  "O4'" . G   B 2 34 ? 34.019 -2.884  41.553  1.00 49.09  ? 41  G   R "O4'" 1 
ATOM   1441 C  "C3'" . G   B 2 34 ? 33.620 -1.787  43.554  1.00 49.25  ? 41  G   R "C3'" 1 
ATOM   1442 O  "O3'" . G   B 2 34 ? 34.098 -1.482  44.854  1.00 49.30  ? 41  G   R "O3'" 1 
ATOM   1443 C  "C2'" . G   B 2 34 ? 34.043 -0.744  42.525  1.00 48.28  ? 41  G   R "C2'" 1 
ATOM   1444 O  "O2'" . G   B 2 34 ? 35.415 -0.410  42.617  1.00 48.44  ? 41  G   R "O2'" 1 
ATOM   1445 C  "C1'" . G   B 2 34 ? 33.779 -1.519  41.242  1.00 46.85  ? 41  G   R "C1'" 1 
ATOM   1446 N  N9    . G   B 2 34 ? 32.419 -1.360  40.725  1.00 45.11  ? 41  G   R N9    1 
ATOM   1447 C  C8    . G   B 2 34 ? 31.414 -2.297  40.746  1.00 44.97  ? 41  G   R C8    1 
ATOM   1448 N  N7    . G   B 2 34 ? 30.299 -1.887  40.208  1.00 45.13  ? 41  G   R N7    1 
ATOM   1449 C  C5    . G   B 2 34 ? 30.577 -0.591  39.798  1.00 44.76  ? 41  G   R C5    1 
ATOM   1450 C  C6    . G   B 2 34 ? 29.745 0.356   39.145  1.00 45.41  ? 41  G   R C6    1 
ATOM   1451 O  O6    . G   B 2 34 ? 28.562 0.230   38.792  1.00 45.47  ? 41  G   R O6    1 
ATOM   1452 N  N1    . G   B 2 34 ? 30.412 1.556   38.903  1.00 44.98  ? 41  G   R N1    1 
ATOM   1453 C  C2    . G   B 2 34 ? 31.720 1.805   39.249  1.00 44.31  ? 41  G   R C2    1 
ATOM   1454 N  N2    . G   B 2 34 ? 32.189 3.020   38.933  1.00 44.23  ? 41  G   R N2    1 
ATOM   1455 N  N3    . G   B 2 34 ? 32.511 0.925   39.859  1.00 43.72  ? 41  G   R N3    1 
ATOM   1456 C  C4    . G   B 2 34 ? 31.878 -0.250  40.107  1.00 44.73  ? 41  G   R C4    1 
ATOM   1457 P  P     . G   B 2 35 ? 33.143 -0.770  45.924  1.00 51.11  ? 42  G   R P     1 
ATOM   1458 O  OP1   . G   B 2 35 ? 34.010 -0.259  47.009  1.00 51.05  ? 42  G   R OP1   1 
ATOM   1459 O  OP2   . G   B 2 35 ? 32.031 -1.698  46.228  1.00 51.32  ? 42  G   R OP2   1 
ATOM   1460 O  "O5'" . G   B 2 35 ? 32.483 0.459   45.142  1.00 50.76  ? 42  G   R "O5'" 1 
ATOM   1461 C  "C5'" . G   B 2 35 ? 33.118 1.726   45.039  1.00 50.33  ? 42  G   R "C5'" 1 
ATOM   1462 C  "C4'" . G   B 2 35 ? 32.195 2.676   44.298  1.00 50.72  ? 42  G   R "C4'" 1 
ATOM   1463 O  "O4'" . G   B 2 35 ? 31.640 2.016   43.131  1.00 48.78  ? 42  G   R "O4'" 1 
ATOM   1464 C  "C3'" . G   B 2 35 ? 30.989 3.122   45.107  1.00 50.26  ? 42  G   R "C3'" 1 
ATOM   1465 O  "O3'" . G   B 2 35 ? 31.354 4.266   45.871  1.00 51.31  ? 42  G   R "O3'" 1 
ATOM   1466 C  "C2'" . G   B 2 35 ? 29.963 3.436   44.019  1.00 49.86  ? 42  G   R "C2'" 1 
ATOM   1467 O  "O2'" . G   B 2 35 ? 30.077 4.753   43.515  1.00 51.59  ? 42  G   R "O2'" 1 
ATOM   1468 C  "C1'" . G   B 2 35 ? 30.307 2.435   42.919  1.00 47.89  ? 42  G   R "C1'" 1 
ATOM   1469 N  N9    . G   B 2 35 ? 29.436 1.259   42.894  1.00 45.85  ? 42  G   R N9    1 
ATOM   1470 C  C8    . G   B 2 35 ? 29.644 0.068   43.546  1.00 45.91  ? 42  G   R C8    1 
ATOM   1471 N  N7    . G   B 2 35 ? 28.701 -0.809  43.340  1.00 45.51  ? 42  G   R N7    1 
ATOM   1472 C  C5    . G   B 2 35 ? 27.806 -0.163  42.499  1.00 43.67  ? 42  G   R C5    1 
ATOM   1473 C  C6    . G   B 2 35 ? 26.584 -0.620  41.937  1.00 44.02  ? 42  G   R C6    1 
ATOM   1474 O  O6    . G   B 2 35 ? 26.033 -1.723  42.075  1.00 43.11  ? 42  G   R O6    1 
ATOM   1475 N  N1    . G   B 2 35 ? 25.986 0.349   41.135  1.00 43.67  ? 42  G   R N1    1 
ATOM   1476 C  C2    . G   B 2 35 ? 26.507 1.603   40.910  1.00 43.58  ? 42  G   R C2    1 
ATOM   1477 N  N2    . G   B 2 35 ? 25.791 2.408   40.110  1.00 44.89  ? 42  G   R N2    1 
ATOM   1478 N  N3    . G   B 2 35 ? 27.647 2.038   41.433  1.00 41.86  ? 42  G   R N3    1 
ATOM   1479 C  C4    . G   B 2 35 ? 28.245 1.111   42.216  1.00 42.98  ? 42  G   R C4    1 
ATOM   1480 P  P     . A   B 2 36 ? 30.465 4.786   47.100  1.00 52.33  ? 43  A   R P     1 
ATOM   1481 O  OP1   . A   B 2 36 ? 31.357 5.592   47.961  1.00 53.58  ? 43  A   R OP1   1 
ATOM   1482 O  OP2   . A   B 2 36 ? 29.712 3.644   47.664  1.00 52.58  ? 43  A   R OP2   1 
ATOM   1483 O  "O5'" . A   B 2 36 ? 29.419 5.771   46.416  1.00 51.77  ? 43  A   R "O5'" 1 
ATOM   1484 C  "C5'" . A   B 2 36 ? 28.291 6.189   47.152  1.00 52.46  ? 43  A   R "C5'" 1 
ATOM   1485 C  "C4'" . A   B 2 36 ? 27.107 6.418   46.229  1.00 52.39  ? 43  A   R "C4'" 1 
ATOM   1486 O  "O4'" . A   B 2 36 ? 26.932 5.274   45.353  1.00 50.60  ? 43  A   R "O4'" 1 
ATOM   1487 C  "C3'" . A   B 2 36 ? 25.786 6.619   46.960  1.00 52.71  ? 43  A   R "C3'" 1 
ATOM   1488 O  "O3'" . A   B 2 36 ? 25.046 7.652   46.335  1.00 55.18  ? 43  A   R "O3'" 1 
ATOM   1489 C  "C2'" . A   B 2 36 ? 25.077 5.277   46.795  1.00 53.30  ? 43  A   R "C2'" 1 
ATOM   1490 O  "O2'" . A   B 2 36 ? 23.668 5.412   46.769  1.00 54.56  ? 43  A   R "O2'" 1 
ATOM   1491 C  "C1'" . A   B 2 36 ? 25.595 4.819   45.434  1.00 51.94  ? 43  A   R "C1'" 1 
ATOM   1492 N  N9    . A   B 2 36 ? 25.561 3.371   45.210  1.00 50.70  ? 43  A   R N9    1 
ATOM   1493 C  C8    . A   B 2 36 ? 24.875 2.734   44.212  1.00 50.32  ? 43  A   R C8    1 
ATOM   1494 N  N7    . A   B 2 36 ? 25.004 1.430   44.217  1.00 49.68  ? 43  A   R N7    1 
ATOM   1495 C  C5    . A   B 2 36 ? 25.836 1.189   45.295  1.00 50.21  ? 43  A   R C5    1 
ATOM   1496 C  C6    . A   B 2 36 ? 26.363 -0.004  45.837  1.00 50.79  ? 43  A   R C6    1 
ATOM   1497 N  N6    . A   B 2 36 ? 26.095 -1.208  45.326  1.00 49.84  ? 43  A   R N6    1 
ATOM   1498 N  N1    . A   B 2 36 ? 27.174 0.088   46.920  1.00 52.32  ? 43  A   R N1    1 
ATOM   1499 C  C2    . A   B 2 36 ? 27.437 1.304   47.428  1.00 51.59  ? 43  A   R C2    1 
ATOM   1500 N  N3    . A   B 2 36 ? 26.996 2.494   47.001  1.00 51.17  ? 43  A   R N3    1 
ATOM   1501 C  C4    . A   B 2 36 ? 26.194 2.372   45.922  1.00 50.16  ? 43  A   R C4    1 
ATOM   1502 P  P     . C   B 2 37 ? 25.237 9.201   46.692  1.00 57.03  ? 44  C   R P     1 
ATOM   1503 O  OP1   . C   B 2 37 ? 26.222 9.752   45.727  1.00 56.12  ? 44  C   R OP1   1 
ATOM   1504 O  OP2   . C   B 2 37 ? 25.474 9.358   48.148  1.00 56.22  ? 44  C   R OP2   1 
ATOM   1505 O  "O5'" . C   B 2 37 ? 23.757 9.735   46.387  1.00 52.44  ? 44  C   R "O5'" 1 
ATOM   1506 C  "C5'" . C   B 2 37 ? 23.516 10.797  45.483  1.00 48.40  ? 44  C   R "C5'" 1 
ATOM   1507 C  "C4'" . C   B 2 37 ? 22.333 10.492  44.584  1.00 44.93  ? 44  C   R "C4'" 1 
ATOM   1508 O  "O4'" . C   B 2 37 ? 22.527 9.245   43.881  1.00 44.65  ? 44  C   R "O4'" 1 
ATOM   1509 C  "C3'" . C   B 2 37 ? 21.002 10.214  45.256  1.00 44.11  ? 44  C   R "C3'" 1 
ATOM   1510 O  "O3'" . C   B 2 37 ? 20.425 11.371  45.832  1.00 44.49  ? 44  C   R "O3'" 1 
ATOM   1511 C  "C2'" . C   B 2 37 ? 20.219 9.714   44.049  1.00 44.48  ? 44  C   R "C2'" 1 
ATOM   1512 O  "O2'" . C   B 2 37 ? 19.804 10.730  43.161  1.00 45.65  ? 44  C   R "O2'" 1 
ATOM   1513 C  "C1'" . C   B 2 37 ? 21.265 8.852   43.354  1.00 44.25  ? 44  C   R "C1'" 1 
ATOM   1514 N  N1    . C   B 2 37 ? 21.016 7.375   43.529  1.00 43.78  ? 44  C   R N1    1 
ATOM   1515 C  C2    . C   B 2 37 ? 19.950 6.749   42.847  1.00 42.83  ? 44  C   R C2    1 
ATOM   1516 O  O2    . C   B 2 37 ? 19.214 7.405   42.099  1.00 41.60  ? 44  C   R O2    1 
ATOM   1517 N  N3    . C   B 2 37 ? 19.746 5.418   43.026  1.00 42.89  ? 44  C   R N3    1 
ATOM   1518 C  C4    . C   B 2 37 ? 20.551 4.718   43.833  1.00 43.67  ? 44  C   R C4    1 
ATOM   1519 N  N4    . C   B 2 37 ? 20.313 3.410   43.972  1.00 44.22  ? 44  C   R N4    1 
ATOM   1520 C  C5    . C   B 2 37 ? 21.637 5.328   44.536  1.00 43.51  ? 44  C   R C5    1 
ATOM   1521 C  C6    . C   B 2 37 ? 21.829 6.642   44.358  1.00 43.72  ? 44  C   R C6    1 
ATOM   1522 P  P     . G   B 2 38 ? 19.380 11.223  47.042  1.00 45.07  ? 45  G   R P     1 
ATOM   1523 O  OP1   . G   B 2 38 ? 19.337 12.529  47.735  1.00 41.50  ? 45  G   R OP1   1 
ATOM   1524 O  OP2   . G   B 2 38 ? 19.689 9.972   47.783  1.00 43.11  ? 45  G   R OP2   1 
ATOM   1525 O  "O5'" . G   B 2 38 ? 17.977 11.024  46.304  1.00 43.44  ? 45  G   R "O5'" 1 
ATOM   1526 C  "C5'" . G   B 2 38 ? 16.994 10.169  46.858  1.00 43.41  ? 45  G   R "C5'" 1 
ATOM   1527 C  "C4'" . G   B 2 38 ? 16.637 9.089   45.854  1.00 44.48  ? 45  G   R "C4'" 1 
ATOM   1528 O  "O4'" . G   B 2 38 ? 17.831 8.359   45.475  1.00 44.34  ? 45  G   R "O4'" 1 
ATOM   1529 C  "C3'" . G   B 2 38 ? 15.686 8.032   46.387  1.00 43.37  ? 45  G   R "C3'" 1 
ATOM   1530 O  "O3'" . G   B 2 38 ? 14.328 8.451   46.218  1.00 42.53  ? 45  G   R "O3'" 1 
ATOM   1531 C  "C2'" . G   B 2 38 ? 16.048 6.823   45.535  1.00 42.65  ? 45  G   R "C2'" 1 
ATOM   1532 O  "O2'" . G   B 2 38 ? 15.456 6.887   44.256  1.00 42.86  ? 45  G   R "O2'" 1 
ATOM   1533 C  "C1'" . G   B 2 38 ? 17.561 6.970   45.399  1.00 43.55  ? 45  G   R "C1'" 1 
ATOM   1534 N  N9    . G   B 2 38 ? 18.374 6.268   46.403  1.00 44.12  ? 45  G   R N9    1 
ATOM   1535 C  C8    . G   B 2 38 ? 19.247 6.824   47.314  1.00 43.89  ? 45  G   R C8    1 
ATOM   1536 N  N7    . G   B 2 38 ? 19.846 5.956   48.083  1.00 42.13  ? 45  G   R N7    1 
ATOM   1537 C  C5    . G   B 2 38 ? 19.341 4.740   47.653  1.00 42.81  ? 45  G   R C5    1 
ATOM   1538 C  C6    . G   B 2 38 ? 19.618 3.431   48.112  1.00 44.14  ? 45  G   R C6    1 
ATOM   1539 O  O6    . G   B 2 38 ? 20.391 3.095   49.024  1.00 45.94  ? 45  G   R O6    1 
ATOM   1540 N  N1    . G   B 2 38 ? 18.898 2.464   47.403  1.00 44.37  ? 45  G   R N1    1 
ATOM   1541 C  C2    . G   B 2 38 ? 18.012 2.738   46.383  1.00 44.72  ? 45  G   R C2    1 
ATOM   1542 N  N2    . G   B 2 38 ? 17.398 1.695   45.808  1.00 44.15  ? 45  G   R N2    1 
ATOM   1543 N  N3    . G   B 2 38 ? 17.745 3.963   45.948  1.00 44.64  ? 45  G   R N3    1 
ATOM   1544 C  C4    . G   B 2 38 ? 18.442 4.911   46.622  1.00 43.43  ? 45  G   R C4    1 
ATOM   1545 P  P     . C   B 2 39 ? 13.264 8.018   47.333  1.00 42.35  ? 46  C   R P     1 
ATOM   1546 O  OP1   . C   B 2 39 ? 11.995 8.754   47.122  1.00 38.48  ? 46  C   R OP1   1 
ATOM   1547 O  OP2   . C   B 2 39 ? 13.968 8.074   48.638  1.00 42.04  ? 46  C   R OP2   1 
ATOM   1548 O  "O5'" . C   B 2 39 ? 13.038 6.474   46.998  1.00 42.35  ? 46  C   R "O5'" 1 
ATOM   1549 C  "C5'" . C   B 2 39 ? 12.257 6.057   45.884  1.00 42.72  ? 46  C   R "C5'" 1 
ATOM   1550 C  "C4'" . C   B 2 39 ? 12.267 4.541   45.826  1.00 43.56  ? 46  C   R "C4'" 1 
ATOM   1551 O  "O4'" . C   B 2 39 ? 13.642 4.107   45.882  1.00 43.58  ? 46  C   R "O4'" 1 
ATOM   1552 C  "C3'" . C   B 2 39 ? 11.637 3.825   47.011  1.00 43.82  ? 46  C   R "C3'" 1 
ATOM   1553 O  "O3'" . C   B 2 39 ? 10.237 3.694   46.849  1.00 44.65  ? 46  C   R "O3'" 1 
ATOM   1554 C  "C2'" . C   B 2 39 ? 12.327 2.470   46.977  1.00 43.64  ? 46  C   R "C2'" 1 
ATOM   1555 O  "O2'" . C   B 2 39 ? 11.742 1.570   46.058  1.00 46.61  ? 46  C   R "O2'" 1 
ATOM   1556 C  "C1'" . C   B 2 39 ? 13.730 2.844   46.514  1.00 43.43  ? 46  C   R "C1'" 1 
ATOM   1557 N  N1    . C   B 2 39 ? 14.734 2.898   47.622  1.00 41.58  ? 46  C   R N1    1 
ATOM   1558 C  C2    . C   B 2 39 ? 15.249 1.701   48.143  1.00 42.96  ? 46  C   R C2    1 
ATOM   1559 O  O2    . C   B 2 39 ? 14.870 0.617   47.677  1.00 43.48  ? 46  C   R O2    1 
ATOM   1560 N  N3    . C   B 2 39 ? 16.159 1.760   49.152  1.00 43.65  ? 46  C   R N3    1 
ATOM   1561 C  C4    . C   B 2 39 ? 16.546 2.943   49.633  1.00 43.09  ? 46  C   R C4    1 
ATOM   1562 N  N4    . C   B 2 39 ? 17.441 2.953   50.626  1.00 43.69  ? 46  C   R N4    1 
ATOM   1563 C  C5    . C   B 2 39 ? 16.030 4.170   49.113  1.00 43.36  ? 46  C   R C5    1 
ATOM   1564 C  C6    . C   B 2 39 ? 15.136 4.101   48.121  1.00 41.05  ? 46  C   R C6    1 
ATOM   1565 P  P     . A   B 2 40 ? 9.259  4.280   47.969  1.00 44.44  ? 47  A   R P     1 
ATOM   1566 O  OP1   . A   B 2 40 ? 8.289  5.159   47.280  1.00 43.91  ? 47  A   R OP1   1 
ATOM   1567 O  OP2   . A   B 2 40 ? 10.102 4.809   49.066  1.00 43.82  ? 47  A   R OP2   1 
ATOM   1568 O  "O5'" . A   B 2 40 ? 8.477  2.990   48.507  1.00 45.10  ? 47  A   R "O5'" 1 
ATOM   1569 C  "C5'" . A   B 2 40 ? 9.176  1.947   49.190  1.00 46.36  ? 47  A   R "C5'" 1 
ATOM   1570 C  "C4'" . A   B 2 40 ? 8.270  0.766   49.515  1.00 47.32  ? 47  A   R "C4'" 1 
ATOM   1571 O  "O4'" . A   B 2 40 ? 8.989  -0.183  50.342  1.00 47.90  ? 47  A   R "O4'" 1 
ATOM   1572 C  "C3'" . A   B 2 40 ? 7.010  1.057   50.317  1.00 47.66  ? 47  A   R "C3'" 1 
ATOM   1573 O  "O3'" . A   B 2 40 ? 6.108  -0.014  50.173  1.00 48.86  ? 47  A   R "O3'" 1 
ATOM   1574 C  "C2'" . A   B 2 40 ? 7.550  1.018   51.735  1.00 47.93  ? 47  A   R "C2'" 1 
ATOM   1575 O  "O2'" . A   B 2 40 ? 6.521  0.826   52.682  1.00 49.51  ? 47  A   R "O2'" 1 
ATOM   1576 C  "C1'" . A   B 2 40 ? 8.435  -0.222  51.646  1.00 47.50  ? 47  A   R "C1'" 1 
ATOM   1577 N  N9    . A   B 2 40 ? 9.542  -0.298  52.602  1.00 47.73  ? 47  A   R N9    1 
ATOM   1578 C  C8    . A   B 2 40 ? 10.145 0.737   53.264  1.00 47.31  ? 47  A   R C8    1 
ATOM   1579 N  N7    . A   B 2 40 ? 11.122 0.359   54.054  1.00 48.47  ? 47  A   R N7    1 
ATOM   1580 C  C5    . A   B 2 40 ? 11.166 -1.014  53.906  1.00 45.96  ? 47  A   R C5    1 
ATOM   1581 C  C6    . A   B 2 40 ? 11.986 -2.006  54.482  1.00 46.35  ? 47  A   R C6    1 
ATOM   1582 N  N6    . A   B 2 40 ? 12.957 -1.735  55.360  1.00 46.71  ? 47  A   R N6    1 
ATOM   1583 N  N1    . A   B 2 40 ? 11.772 -3.292  54.123  1.00 47.25  ? 47  A   R N1    1 
ATOM   1584 C  C2    . A   B 2 40 ? 10.796 -3.560  53.242  1.00 47.77  ? 47  A   R C2    1 
ATOM   1585 N  N3    . A   B 2 40 ? 9.962  -2.710  52.636  1.00 47.19  ? 47  A   R N3    1 
ATOM   1586 C  C4    . A   B 2 40 ? 10.202 -1.439  53.012  1.00 46.72  ? 47  A   R C4    1 
ATOM   1587 P  P     . A   B 2 41 ? 4.955  -0.091  49.076  1.00 51.51  ? 48  A   R P     1 
ATOM   1588 O  OP1   . A   B 2 41 ? 5.265  0.820   47.948  1.00 51.90  ? 48  A   R OP1   1 
ATOM   1589 O  OP2   . A   B 2 41 ? 3.646  0.007   49.757  1.00 52.49  ? 48  A   R OP2   1 
ATOM   1590 O  "O5'" . A   B 2 41 ? 5.117  -1.628  48.662  1.00 51.05  ? 48  A   R "O5'" 1 
ATOM   1591 C  "C5'" . A   B 2 41 ? 5.581  -2.012  47.387  1.00 48.96  ? 48  A   R "C5'" 1 
ATOM   1592 C  "C4'" . A   B 2 41 ? 7.076  -2.256  47.406  1.00 47.63  ? 48  A   R "C4'" 1 
ATOM   1593 O  "O4'" . A   B 2 41 ? 7.366  -3.557  47.994  1.00 47.54  ? 48  A   R "O4'" 1 
ATOM   1594 C  "C3'" . A   B 2 41 ? 7.670  -2.294  46.000  1.00 48.38  ? 48  A   R "C3'" 1 
ATOM   1595 O  "O3'" . A   B 2 41 ? 8.953  -1.683  45.942  1.00 47.50  ? 48  A   R "O3'" 1 
ATOM   1596 C  "C2'" . A   B 2 41 ? 7.764  -3.785  45.722  1.00 47.48  ? 48  A   R "C2'" 1 
ATOM   1597 O  "O2'" . A   B 2 41 ? 8.712  -4.111  44.727  1.00 47.73  ? 48  A   R "O2'" 1 
ATOM   1598 C  "C1'" . A   B 2 41 ? 8.217  -4.251  47.099  1.00 46.30  ? 48  A   R "C1'" 1 
ATOM   1599 N  N9    . A   B 2 41 ? 8.131  -5.703  47.214  1.00 44.07  ? 48  A   R N9    1 
ATOM   1600 C  C8    . A   B 2 41 ? 7.038  -6.496  46.986  1.00 43.97  ? 48  A   R C8    1 
ATOM   1601 N  N7    . A   B 2 41 ? 7.279  -7.776  47.136  1.00 43.91  ? 48  A   R N7    1 
ATOM   1602 C  C5    . A   B 2 41 ? 8.622  -7.823  47.479  1.00 41.25  ? 48  A   R C5    1 
ATOM   1603 C  C6    . A   B 2 41 ? 9.493  -8.888  47.778  1.00 40.57  ? 48  A   R C6    1 
ATOM   1604 N  N6    . A   B 2 41 ? 9.103  -10.165 47.777  1.00 41.36  ? 48  A   R N6    1 
ATOM   1605 N  N1    . A   B 2 41 ? 10.780 -8.596  48.082  1.00 41.01  ? 48  A   R N1    1 
ATOM   1606 C  C2    . A   B 2 41 ? 11.169 -7.314  48.087  1.00 40.88  ? 48  A   R C2    1 
ATOM   1607 N  N3    . A   B 2 41 ? 10.439 -6.228  47.823  1.00 41.29  ? 48  A   R N3    1 
ATOM   1608 C  C4    . A   B 2 41 ? 9.166  -6.554  47.527  1.00 41.82  ? 48  A   R C4    1 
ATOM   1609 P  P     . A   B 2 42 ? 9.244  -0.667  44.749  1.00 47.34  ? 49  A   R P     1 
ATOM   1610 O  OP1   . A   B 2 42 ? 9.187  0.705   45.299  1.00 47.04  ? 49  A   R OP1   1 
ATOM   1611 O  OP2   . A   B 2 42 ? 8.388  -1.041  43.595  1.00 47.35  ? 49  A   R OP2   1 
ATOM   1612 O  "O5'" . A   B 2 42 ? 10.757 -1.007  44.375  1.00 47.41  ? 49  A   R "O5'" 1 
ATOM   1613 C  "C5'" . A   B 2 42 ? 11.069 -2.228  43.707  1.00 46.93  ? 49  A   R "C5'" 1 
ATOM   1614 C  "C4'" . A   B 2 42 ? 12.558 -2.330  43.426  1.00 45.41  ? 49  A   R "C4'" 1 
ATOM   1615 O  "O4'" . A   B 2 42 ? 12.939 -1.251  42.542  1.00 45.25  ? 49  A   R "O4'" 1 
ATOM   1616 C  "C3'" . A   B 2 42 ? 13.487 -2.228  44.632  1.00 45.51  ? 49  A   R "C3'" 1 
ATOM   1617 O  "O3'" . A   B 2 42 ? 14.614 -3.079  44.421  1.00 46.52  ? 49  A   R "O3'" 1 
ATOM   1618 C  "C2'" . A   B 2 42 ? 13.887 -0.751  44.666  1.00 44.48  ? 49  A   R "C2'" 1 
ATOM   1619 O  "O2'" . A   B 2 42 ? 15.206 -0.573  45.143  1.00 44.52  ? 49  A   R "O2'" 1 
ATOM   1620 C  "C1'" . A   B 2 42 ? 13.820 -0.356  43.193  1.00 43.80  ? 49  A   R "C1'" 1 
ATOM   1621 N  N9    . A   B 2 42 ? 13.351 0.999   42.903  1.00 42.51  ? 49  A   R N9    1 
ATOM   1622 C  C8    . A   B 2 42 ? 12.136 1.356   42.382  1.00 42.71  ? 49  A   R C8    1 
ATOM   1623 N  N7    . A   B 2 42 ? 11.991 2.649   42.202  1.00 41.67  ? 49  A   R N7    1 
ATOM   1624 C  C5    . A   B 2 42 ? 13.195 3.175   42.631  1.00 40.69  ? 49  A   R C5    1 
ATOM   1625 C  C6    . A   B 2 42 ? 13.685 4.495   42.700  1.00 40.78  ? 49  A   R C6    1 
ATOM   1626 N  N6    . A   B 2 42 ? 12.985 5.567   42.328  1.00 41.62  ? 49  A   R N6    1 
ATOM   1627 N  N1    . A   B 2 42 ? 14.931 4.682   43.177  1.00 41.13  ? 49  A   R N1    1 
ATOM   1628 C  C2    . A   B 2 42 ? 15.643 3.613   43.564  1.00 42.39  ? 49  A   R C2    1 
ATOM   1629 N  N3    . A   B 2 42 ? 15.294 2.325   43.544  1.00 41.56  ? 49  A   R N3    1 
ATOM   1630 C  C4    . A   B 2 42 ? 14.047 2.172   43.061  1.00 41.16  ? 49  A   R C4    1 
ATOM   1631 P  P     . G   B 2 43 ? 14.830 -4.432  45.254  1.00 46.95  ? 50  G   R P     1 
ATOM   1632 O  OP1   . G   B 2 43 ? 14.915 -4.082  46.690  1.00 47.70  ? 50  G   R OP1   1 
ATOM   1633 O  OP2   . G   B 2 43 ? 15.952 -5.166  44.622  1.00 45.67  ? 50  G   R OP2   1 
ATOM   1634 O  "O5'" . G   B 2 43 ? 13.472 -5.244  44.996  1.00 44.47  ? 50  G   R "O5'" 1 
ATOM   1635 C  "C5'" . G   B 2 43 ? 13.208 -5.853  43.740  1.00 43.48  ? 50  G   R "C5'" 1 
ATOM   1636 C  "C4'" . G   B 2 43 ? 13.210 -7.362  43.866  1.00 43.27  ? 50  G   R "C4'" 1 
ATOM   1637 O  "O4'" . G   B 2 43 ? 12.263 -7.755  44.893  1.00 42.53  ? 50  G   R "O4'" 1 
ATOM   1638 C  "C3'" . G   B 2 43 ? 12.767 -8.102  42.612  1.00 43.46  ? 50  G   R "C3'" 1 
ATOM   1639 O  "O3'" . G   B 2 43 ? 13.883 -8.375  41.771  1.00 44.99  ? 50  G   R "O3'" 1 
ATOM   1640 C  "C2'" . G   B 2 43 ? 12.169 -9.379  43.192  1.00 42.91  ? 50  G   R "C2'" 1 
ATOM   1641 O  "O2'" . G   B 2 43 ? 13.156 -10.333 43.534  1.00 44.03  ? 50  G   R "O2'" 1 
ATOM   1642 C  "C1'" . G   B 2 43 ? 11.483 -8.853  44.452  1.00 41.18  ? 50  G   R "C1'" 1 
ATOM   1643 N  N9    . G   B 2 43 ? 10.107 -8.406  44.233  1.00 38.70  ? 50  G   R N9    1 
ATOM   1644 C  C8    . G   B 2 43 ? 9.642  -7.114  44.307  1.00 37.65  ? 50  G   R C8    1 
ATOM   1645 N  N7    . G   B 2 43 ? 8.365  -7.003  44.066  1.00 37.68  ? 50  G   R N7    1 
ATOM   1646 C  C5    . G   B 2 43 ? 7.953  -8.303  43.810  1.00 36.40  ? 50  G   R C5    1 
ATOM   1647 C  C6    . G   B 2 43 ? 6.671  -8.804  43.477  1.00 37.05  ? 50  G   R C6    1 
ATOM   1648 O  O6    . G   B 2 43 ? 5.614  -8.173  43.342  1.00 37.59  ? 50  G   R O6    1 
ATOM   1649 N  N1    . G   B 2 43 ? 6.674  -10.185 43.290  1.00 37.48  ? 50  G   R N1    1 
ATOM   1650 C  C2    . G   B 2 43 ? 7.787  -10.980 43.413  1.00 38.03  ? 50  G   R C2    1 
ATOM   1651 N  N2    . G   B 2 43 ? 7.598  -12.288 43.199  1.00 40.53  ? 50  G   R N2    1 
ATOM   1652 N  N3    . G   B 2 43 ? 8.997  -10.524 43.721  1.00 37.80  ? 50  G   R N3    1 
ATOM   1653 C  C4    . G   B 2 43 ? 9.012  -9.179  43.906  1.00 37.29  ? 50  G   R C4    1 
ATOM   1654 P  P     . C   B 2 44 ? 13.818 -8.093  40.194  1.00 45.41  ? 51  C   R P     1 
ATOM   1655 O  OP1   . C   B 2 44 ? 15.136 -8.458  39.632  1.00 45.51  ? 51  C   R OP1   1 
ATOM   1656 O  OP2   . C   B 2 44 ? 13.300 -6.720  40.000  1.00 47.90  ? 51  C   R OP2   1 
ATOM   1657 O  "O5'" . C   B 2 44 ? 12.698 -9.100  39.649  1.00 44.83  ? 51  C   R "O5'" 1 
ATOM   1658 C  "C5'" . C   B 2 44 ? 12.918 -10.507 39.627  1.00 45.29  ? 51  C   R "C5'" 1 
ATOM   1659 C  "C4'" . C   B 2 44 ? 11.613 -11.268 39.472  1.00 45.75  ? 51  C   R "C4'" 1 
ATOM   1660 O  "O4'" . C   B 2 44 ? 10.687 -10.934 40.536  1.00 46.23  ? 51  C   R "O4'" 1 
ATOM   1661 C  "C3'" . C   B 2 44 ? 10.806 -10.940 38.227  1.00 46.47  ? 51  C   R "C3'" 1 
ATOM   1662 O  "O3'" . C   B 2 44 ? 11.348 -11.575 37.091  1.00 46.60  ? 51  C   R "O3'" 1 
ATOM   1663 C  "C2'" . C   B 2 44 ? 9.444  -11.508 38.603  1.00 46.63  ? 51  C   R "C2'" 1 
ATOM   1664 O  "O2'" . C   B 2 44 ? 9.388  -12.921 38.525  1.00 49.14  ? 51  C   R "O2'" 1 
ATOM   1665 C  "C1'" . C   B 2 44 ? 9.353  -11.058 40.056  1.00 45.84  ? 51  C   R "C1'" 1 
ATOM   1666 N  N1    . C   B 2 44 ? 8.611  -9.763  40.221  1.00 45.10  ? 51  C   R N1    1 
ATOM   1667 C  C2    . C   B 2 44 ? 7.210  -9.732  40.100  1.00 45.06  ? 51  C   R C2    1 
ATOM   1668 O  O2    . C   B 2 44 ? 6.581  -10.768 39.859  1.00 43.14  ? 51  C   R O2    1 
ATOM   1669 N  N3    . C   B 2 44 ? 6.567  -8.545  40.255  1.00 45.68  ? 51  C   R N3    1 
ATOM   1670 C  C4    . C   B 2 44 ? 7.255  -7.430  40.520  1.00 44.03  ? 51  C   R C4    1 
ATOM   1671 N  N4    . C   B 2 44 ? 6.568  -6.295  40.666  1.00 44.60  ? 51  C   R N4    1 
ATOM   1672 C  C5    . C   B 2 44 ? 8.674  -7.434  40.648  1.00 43.53  ? 51  C   R C5    1 
ATOM   1673 C  C6    . C   B 2 44 ? 9.299  -8.608  40.492  1.00 44.83  ? 51  C   R C6    1 
ATOM   1674 P  P     . C   B 2 45 ? 11.224 -10.860 35.670  1.00 47.31  ? 52  C   R P     1 
ATOM   1675 O  OP1   . C   B 2 45 ? 12.072 -11.630 34.730  1.00 46.90  ? 52  C   R OP1   1 
ATOM   1676 O  OP2   . C   B 2 45 ? 11.449 -9.404  35.844  1.00 45.44  ? 52  C   R OP2   1 
ATOM   1677 O  "O5'" . C   B 2 45 ? 9.679  -11.078 35.300  1.00 46.82  ? 52  C   R "O5'" 1 
ATOM   1678 C  "C5'" . C   B 2 45 ? 9.287  -12.186 34.497  1.00 46.25  ? 52  C   R "C5'" 1 
ATOM   1679 C  "C4'" . C   B 2 45 ? 7.780  -12.268 34.376  1.00 45.47  ? 52  C   R "C4'" 1 
ATOM   1680 O  "O4'" . C   B 2 45 ? 7.159  -11.805 35.606  1.00 43.62  ? 52  C   R "O4'" 1 
ATOM   1681 C  "C3'" . C   B 2 45 ? 7.188  -11.377 33.298  1.00 46.15  ? 52  C   R "C3'" 1 
ATOM   1682 O  "O3'" . C   B 2 45 ? 7.304  -11.973 32.000  1.00 47.35  ? 52  C   R "O3'" 1 
ATOM   1683 C  "C2'" . C   B 2 45 ? 5.746  -11.267 33.781  1.00 44.90  ? 52  C   R "C2'" 1 
ATOM   1684 O  "O2'" . C   B 2 45 ? 4.977  -12.401 33.430  1.00 43.53  ? 52  C   R "O2'" 1 
ATOM   1685 C  "C1'" . C   B 2 45 ? 5.929  -11.169 35.302  1.00 43.74  ? 52  C   R "C1'" 1 
ATOM   1686 N  N1    . C   B 2 45 ? 5.951  -9.755  35.839  1.00 42.95  ? 52  C   R N1    1 
ATOM   1687 C  C2    . C   B 2 45 ? 4.769  -8.993  35.949  1.00 43.00  ? 52  C   R C2    1 
ATOM   1688 O  O2    . C   B 2 45 ? 3.681  -9.470  35.612  1.00 44.02  ? 52  C   R O2    1 
ATOM   1689 N  N3    . C   B 2 45 ? 4.840  -7.724  36.433  1.00 42.38  ? 52  C   R N3    1 
ATOM   1690 C  C4    . C   B 2 45 ? 6.014  -7.206  36.804  1.00 42.74  ? 52  C   R C4    1 
ATOM   1691 N  N4    . C   B 2 45 ? 6.030  -5.955  37.278  1.00 43.12  ? 52  C   R N4    1 
ATOM   1692 C  C5    . C   B 2 45 ? 7.225  -7.954  36.708  1.00 42.43  ? 52  C   R C5    1 
ATOM   1693 C  C6    . C   B 2 45 ? 7.144  -9.202  36.226  1.00 43.56  ? 52  C   R C6    1 
ATOM   1694 P  P     . U   B 2 46 ? 8.138  -11.249 30.828  1.00 48.68  ? 53  U   R P     1 
ATOM   1695 O  OP1   . U   B 2 46 ? 8.489  -12.289 29.839  1.00 47.12  ? 53  U   R OP1   1 
ATOM   1696 O  OP2   . U   B 2 46 ? 9.230  -10.441 31.421  1.00 48.44  ? 53  U   R OP2   1 
ATOM   1697 O  "O5'" . U   B 2 46 ? 7.083  -10.220 30.199  1.00 49.66  ? 53  U   R "O5'" 1 
ATOM   1698 C  "C5'" . U   B 2 46 ? 5.921  -10.671 29.502  1.00 54.40  ? 53  U   R "C5'" 1 
ATOM   1699 C  "C4'" . U   B 2 46 ? 4.963  -9.523  29.198  1.00 57.53  ? 53  U   R "C4'" 1 
ATOM   1700 O  "O4'" . U   B 2 46 ? 5.287  -8.340  29.980  1.00 58.88  ? 53  U   R "O4'" 1 
ATOM   1701 C  "C3'" . U   B 2 46 ? 4.914  -9.062  27.740  1.00 59.19  ? 53  U   R "C3'" 1 
ATOM   1702 O  "O3'" . U   B 2 46 ? 3.560  -8.799  27.368  1.00 61.47  ? 53  U   R "O3'" 1 
ATOM   1703 C  "C2'" . U   B 2 46 ? 5.745  -7.780  27.752  1.00 59.32  ? 53  U   R "C2'" 1 
ATOM   1704 O  "O2'" . U   B 2 46 ? 5.377  -6.857  26.745  1.00 57.74  ? 53  U   R "O2'" 1 
ATOM   1705 C  "C1'" . U   B 2 46 ? 5.371  -7.220  29.121  1.00 59.06  ? 53  U   R "C1'" 1 
ATOM   1706 N  N1    . U   B 2 46 ? 6.340  -6.249  29.712  1.00 58.09  ? 53  U   R N1    1 
ATOM   1707 C  C2    . U   B 2 46 ? 5.859  -5.056  30.218  1.00 58.80  ? 53  U   R C2    1 
ATOM   1708 O  O2    . U   B 2 46 ? 4.677  -4.755  30.201  1.00 58.05  ? 53  U   R O2    1 
ATOM   1709 N  N3    . U   B 2 46 ? 6.820  -4.221  30.752  1.00 59.01  ? 53  U   R N3    1 
ATOM   1710 C  C4    . U   B 2 46 ? 8.187  -4.464  30.825  1.00 60.61  ? 53  U   R C4    1 
ATOM   1711 O  O4    . U   B 2 46 ? 8.943  -3.633  31.329  1.00 61.27  ? 53  U   R O4    1 
ATOM   1712 C  C5    . U   B 2 46 ? 8.606  -5.731  30.274  1.00 60.10  ? 53  U   R C5    1 
ATOM   1713 C  C6    . U   B 2 46 ? 7.688  -6.556  29.750  1.00 58.38  ? 53  U   R C6    1 
ATOM   1714 P  P     . C   B 2 47 ? 2.584  -9.951  26.828  1.00 64.91  ? 54  C   R P     1 
ATOM   1715 O  OP1   . C   B 2 47 ? 2.979  -11.258 27.407  1.00 63.17  ? 54  C   R OP1   1 
ATOM   1716 O  OP2   . C   B 2 47 ? 2.483  -9.798  25.359  1.00 65.09  ? 54  C   R OP2   1 
ATOM   1717 O  "O5'" . C   B 2 47 ? 1.185  -9.501  27.460  1.00 65.30  ? 54  C   R "O5'" 1 
ATOM   1718 C  "C5'" . C   B 2 47 ? 0.024  -10.322 27.343  1.00 66.07  ? 54  C   R "C5'" 1 
ATOM   1719 C  "C4'" . C   B 2 47 ? -1.185 -9.644  27.967  1.00 66.39  ? 54  C   R "C4'" 1 
ATOM   1720 O  "O4'" . C   B 2 47 ? -1.087 -9.717  29.411  1.00 65.78  ? 54  C   R "O4'" 1 
ATOM   1721 C  "C3'" . C   B 2 47 ? -1.312 -8.159  27.662  1.00 66.72  ? 54  C   R "C3'" 1 
ATOM   1722 O  "O3'" . C   B 2 47 ? -2.036 -7.964  26.455  1.00 67.66  ? 54  C   R "O3'" 1 
ATOM   1723 C  "C2'" . C   B 2 47 ? -2.044 -7.617  28.886  1.00 66.13  ? 54  C   R "C2'" 1 
ATOM   1724 O  "O2'" . C   B 2 47 ? -3.449 -7.770  28.809  1.00 66.82  ? 54  C   R "O2'" 1 
ATOM   1725 C  "C1'" . C   B 2 47 ? -1.474 -8.487  30.002  1.00 65.57  ? 54  C   R "C1'" 1 
ATOM   1726 N  N1    . C   B 2 47 ? -0.310 -7.864  30.746  1.00 65.06  ? 54  C   R N1    1 
ATOM   1727 C  C2    . C   B 2 47 ? -0.545 -6.896  31.745  1.00 64.59  ? 54  C   R C2    1 
ATOM   1728 O  O2    . C   B 2 47 ? -1.699 -6.547  32.019  1.00 64.26  ? 54  C   R O2    1 
ATOM   1729 N  N3    . C   B 2 47 ? 0.512  -6.352  32.401  1.00 64.26  ? 54  C   R N3    1 
ATOM   1730 C  C4    . C   B 2 47 ? 1.757  -6.733  32.100  1.00 64.92  ? 54  C   R C4    1 
ATOM   1731 N  N4    . C   B 2 47 ? 2.760  -6.164  32.775  1.00 64.83  ? 54  C   R N4    1 
ATOM   1732 C  C5    . C   B 2 47 ? 2.024  -7.713  31.093  1.00 64.53  ? 54  C   R C5    1 
ATOM   1733 C  C6    . C   B 2 47 ? 0.975  -8.243  30.454  1.00 63.98  ? 54  C   R C6    1 
ATOM   1734 P  P     . C   B 2 48 ? -1.674 -6.723  25.517  1.00 68.81  ? 55  C   R P     1 
ATOM   1735 O  OP1   . C   B 2 48 ? -2.447 -6.864  24.261  1.00 69.41  ? 55  C   R OP1   1 
ATOM   1736 O  OP2   . C   B 2 48 ? -0.200 -6.603  25.448  1.00 67.86  ? 55  C   R OP2   1 
ATOM   1737 O  "O5'" . C   B 2 48 ? -2.242 -5.482  26.358  1.00 69.07  ? 55  C   R "O5'" 1 
ATOM   1738 C  "C5'" . C   B 2 48 ? -3.646 -5.221  26.427  1.00 69.11  ? 55  C   R "C5'" 1 
ATOM   1739 C  "C4'" . C   B 2 48 ? -3.923 -3.891  27.104  1.00 69.61  ? 55  C   R "C4'" 1 
ATOM   1740 O  "O4'" . C   B 2 48 ? -3.596 -3.997  28.516  1.00 69.65  ? 55  C   R "O4'" 1 
ATOM   1741 C  "C3'" . C   B 2 48 ? -3.074 -2.716  26.634  1.00 70.13  ? 55  C   R "C3'" 1 
ATOM   1742 O  "O3'" . C   B 2 48 ? -3.542 -2.139  25.412  1.00 71.13  ? 55  C   R "O3'" 1 
ATOM   1743 C  "C2'" . C   B 2 48 ? -3.199 -1.771  27.825  1.00 69.72  ? 55  C   R "C2'" 1 
ATOM   1744 O  "O2'" . C   B 2 48 ? -4.425 -1.063  27.857  1.00 70.48  ? 55  C   R "O2'" 1 
ATOM   1745 C  "C1'" . C   B 2 48 ? -3.094 -2.756  28.991  1.00 68.89  ? 55  C   R "C1'" 1 
ATOM   1746 N  N1    . C   B 2 48 ? -1.672 -2.897  29.486  1.00 67.73  ? 55  C   R N1    1 
ATOM   1747 C  C2    . C   B 2 48 ? -1.115 -1.908  30.324  1.00 66.72  ? 55  C   R C2    1 
ATOM   1748 O  O2    . C   B 2 48 ? -1.786 -0.928  30.673  1.00 66.06  ? 55  C   R O2    1 
ATOM   1749 N  N3    . C   B 2 48 ? 0.167  -2.051  30.746  1.00 65.96  ? 55  C   R N3    1 
ATOM   1750 C  C4    . C   B 2 48 ? 0.889  -3.110  30.372  1.00 66.12  ? 55  C   R C4    1 
ATOM   1751 N  N4    . C   B 2 48 ? 2.144  -3.192  30.825  1.00 65.85  ? 55  C   R N4    1 
ATOM   1752 C  C5    . C   B 2 48 ? 0.355  -4.127  29.520  1.00 66.17  ? 55  C   R C5    1 
ATOM   1753 C  C6    . C   B 2 48 ? -0.912 -3.978  29.109  1.00 67.27  ? 55  C   R C6    1 
ATOM   1754 P  P     . G   B 2 49 ? -2.484 -1.496  24.388  1.00 71.07  ? 56  G   R P     1 
ATOM   1755 O  OP1   . G   B 2 49 ? -3.206 -1.125  23.152  1.00 69.59  ? 56  G   R OP1   1 
ATOM   1756 O  OP2   . G   B 2 49 ? -1.316 -2.403  24.306  1.00 72.26  ? 56  G   R OP2   1 
ATOM   1757 O  "O5'" . G   B 2 49 ? -1.997 -0.169  25.135  1.00 70.09  ? 56  G   R "O5'" 1 
ATOM   1758 C  "C5'" . G   B 2 49 ? -2.853 0.960   25.173  1.00 70.52  ? 56  G   R "C5'" 1 
ATOM   1759 C  "C4'" . G   B 2 49 ? -2.377 1.985   26.182  1.00 70.37  ? 56  G   R "C4'" 1 
ATOM   1760 O  "O4'" . G   B 2 49 ? -2.024 1.355   27.441  1.00 69.03  ? 56  G   R "O4'" 1 
ATOM   1761 C  "C3'" . G   B 2 49 ? -1.099 2.727   25.832  1.00 71.29  ? 56  G   R "C3'" 1 
ATOM   1762 O  "O3'" . G   B 2 49 ? -1.282 3.677   24.778  1.00 73.32  ? 56  G   R "O3'" 1 
ATOM   1763 C  "C2'" . G   B 2 49 ? -0.848 3.381   27.187  1.00 70.15  ? 56  G   R "C2'" 1 
ATOM   1764 O  "O2'" . G   B 2 49 ? -1.722 4.456   27.464  1.00 71.67  ? 56  G   R "O2'" 1 
ATOM   1765 C  "C1'" . G   B 2 49 ? -1.125 2.211   28.132  1.00 68.21  ? 56  G   R "C1'" 1 
ATOM   1766 N  N9    . G   B 2 49 ? 0.118  1.509   28.466  1.00 66.22  ? 56  G   R N9    1 
ATOM   1767 C  C8    . G   B 2 49 ? 0.498  0.241   28.086  1.00 65.38  ? 56  G   R C8    1 
ATOM   1768 N  N7    . G   B 2 49 ? 1.676  -0.105  28.526  1.00 63.88  ? 56  G   R N7    1 
ATOM   1769 C  C5    . G   B 2 49 ? 2.112  1.006   29.239  1.00 63.04  ? 56  G   R C5    1 
ATOM   1770 C  C6    . G   B 2 49 ? 3.322  1.229   29.944  1.00 62.11  ? 56  G   R C6    1 
ATOM   1771 O  O6    . G   B 2 49 ? 4.279  0.457   30.079  1.00 60.80  ? 56  G   R O6    1 
ATOM   1772 N  N1    . G   B 2 49 ? 3.373  2.494   30.533  1.00 61.90  ? 56  G   R N1    1 
ATOM   1773 C  C2    . G   B 2 49 ? 2.370  3.432   30.446  1.00 62.39  ? 56  G   R C2    1 
ATOM   1774 N  N2    . G   B 2 49 ? 2.583  4.598   31.071  1.00 62.64  ? 56  G   R N2    1 
ATOM   1775 N  N3    . G   B 2 49 ? 1.233  3.238   29.788  1.00 62.60  ? 56  G   R N3    1 
ATOM   1776 C  C4    . G   B 2 49 ? 1.168  2.009   29.209  1.00 63.77  ? 56  G   R C4    1 
ATOM   1777 P  P     . G   B 2 50 ? -0.085 4.016   23.757  1.00 75.33  ? 57  G   R P     1 
ATOM   1778 O  OP1   . G   B 2 50 ? -0.597 5.022   22.796  1.00 74.12  ? 57  G   R OP1   1 
ATOM   1779 O  OP2   . G   B 2 50 ? 0.475  2.738   23.256  1.00 74.57  ? 57  G   R OP2   1 
ATOM   1780 O  "O5'" . G   B 2 50 ? 1.039  4.692   24.679  1.00 72.62  ? 57  G   R "O5'" 1 
ATOM   1781 C  "C5'" . G   B 2 50 ? 0.908  6.045   25.089  1.00 70.25  ? 57  G   R "C5'" 1 
ATOM   1782 C  "C4'" . G   B 2 50 ? 1.990  6.442   26.077  1.00 68.44  ? 57  G   R "C4'" 1 
ATOM   1783 O  "O4'" . G   B 2 50 ? 2.130  5.455   27.130  1.00 67.93  ? 57  G   R "O4'" 1 
ATOM   1784 C  "C3'" . G   B 2 50 ? 3.389  6.533   25.501  1.00 67.83  ? 57  G   R "C3'" 1 
ATOM   1785 O  "O3'" . G   B 2 50 ? 3.544  7.750   24.788  1.00 67.62  ? 57  G   R "O3'" 1 
ATOM   1786 C  "C2'" . G   B 2 50 ? 4.228  6.480   26.775  1.00 67.28  ? 57  G   R "C2'" 1 
ATOM   1787 O  "O2'" . G   B 2 50 ? 4.245  7.701   27.493  1.00 67.41  ? 57  G   R "O2'" 1 
ATOM   1788 C  "C1'" . G   B 2 50 ? 3.480  5.411   27.565  1.00 65.42  ? 57  G   R "C1'" 1 
ATOM   1789 N  N9    . G   B 2 50 ? 3.992  4.050   27.384  1.00 62.94  ? 57  G   R N9    1 
ATOM   1790 C  C8    . G   B 2 50 ? 3.357  3.008   26.749  1.00 61.94  ? 57  G   R C8    1 
ATOM   1791 N  N7    . G   B 2 50 ? 4.045  1.901   26.738  1.00 61.98  ? 57  G   R N7    1 
ATOM   1792 C  C5    . G   B 2 50 ? 5.214  2.221   27.415  1.00 62.24  ? 57  G   R C5    1 
ATOM   1793 C  C6    . G   B 2 50 ? 6.345  1.415   27.723  1.00 62.49  ? 57  G   R C6    1 
ATOM   1794 O  O6    . G   B 2 50 ? 6.537  0.220   27.442  1.00 63.27  ? 57  G   R O6    1 
ATOM   1795 N  N1    . G   B 2 50 ? 7.322  2.129   28.421  1.00 61.21  ? 57  G   R N1    1 
ATOM   1796 C  C2    . G   B 2 50 ? 7.215  3.454   28.781  1.00 61.37  ? 57  G   R C2    1 
ATOM   1797 N  N2    . G   B 2 50 ? 8.253  3.973   29.450  1.00 60.62  ? 57  G   R N2    1 
ATOM   1798 N  N3    . G   B 2 50 ? 6.161  4.217   28.502  1.00 61.88  ? 57  G   R N3    1 
ATOM   1799 C  C4    . G   B 2 50 ? 5.198  3.542   27.820  1.00 62.34  ? 57  G   R C4    1 
ATOM   1800 P  P     . C   B 2 51 ? 4.331  7.764   23.394  1.00 66.82  ? 58  C   R P     1 
ATOM   1801 O  OP1   . C   B 2 51 ? 4.146  9.102   22.794  1.00 64.78  ? 58  C   R OP1   1 
ATOM   1802 O  OP2   . C   B 2 51 ? 3.955  6.551   22.628  1.00 65.42  ? 58  C   R OP2   1 
ATOM   1803 O  "O5'" . C   B 2 51 ? 5.853  7.597   23.862  1.00 65.33  ? 58  C   R "O5'" 1 
ATOM   1804 C  "C5'" . C   B 2 51 ? 6.470  8.558   24.720  1.00 63.15  ? 58  C   R "C5'" 1 
ATOM   1805 C  "C4'" . C   B 2 51 ? 7.754  8.014   25.325  1.00 61.23  ? 58  C   R "C4'" 1 
ATOM   1806 O  "O4'" . C   B 2 51 ? 7.477  6.872   26.179  1.00 60.71  ? 58  C   R "O4'" 1 
ATOM   1807 C  "C3'" . C   B 2 51 ? 8.746  7.463   24.317  1.00 60.20  ? 58  C   R "C3'" 1 
ATOM   1808 O  "O3'" . C   B 2 51 ? 9.461  8.522   23.692  1.00 59.53  ? 58  C   R "O3'" 1 
ATOM   1809 C  "C2'" . C   B 2 51 ? 9.603  6.564   25.208  1.00 60.13  ? 58  C   R "C2'" 1 
ATOM   1810 O  "O2'" . C   B 2 51 ? 10.540 7.271   26.001  1.00 59.39  ? 58  C   R "O2'" 1 
ATOM   1811 C  "C1'" . C   B 2 51 ? 8.528  5.923   26.083  1.00 58.53  ? 58  C   R "C1'" 1 
ATOM   1812 N  N1    . C   B 2 51 ? 7.995  4.611   25.552  1.00 57.48  ? 58  C   R N1    1 
ATOM   1813 C  C2    . C   B 2 51 ? 8.740  3.421   25.706  1.00 57.42  ? 58  C   R C2    1 
ATOM   1814 O  O2    . C   B 2 51 ? 9.839  3.447   26.275  1.00 58.14  ? 58  C   R O2    1 
ATOM   1815 N  N3    . C   B 2 51 ? 8.236  2.254   25.218  1.00 56.01  ? 58  C   R N3    1 
ATOM   1816 C  C4    . C   B 2 51 ? 7.048  2.239   24.601  1.00 56.24  ? 58  C   R C4    1 
ATOM   1817 N  N4    . C   B 2 51 ? 6.590  1.069   24.143  1.00 55.00  ? 58  C   R N4    1 
ATOM   1818 C  C5    . C   B 2 51 ? 6.273  3.430   24.436  1.00 56.57  ? 58  C   R C5    1 
ATOM   1819 C  C6    . C   B 2 51 ? 6.779  4.573   24.918  1.00 56.66  ? 58  C   R C6    1 
ATOM   1820 P  P     . C   B 2 52 ? 9.970  8.372   22.178  1.00 58.04  ? 59  C   R P     1 
ATOM   1821 O  OP1   . C   B 2 52 ? 10.457 9.700   21.742  1.00 56.37  ? 59  C   R OP1   1 
ATOM   1822 O  OP2   . C   B 2 52 ? 8.936  7.670   21.381  1.00 56.88  ? 59  C   R OP2   1 
ATOM   1823 O  "O5'" . C   B 2 52 ? 11.218 7.381   22.342  1.00 56.91  ? 59  C   R "O5'" 1 
ATOM   1824 C  "C5'" . C   B 2 52 ? 12.373 7.793   23.078  1.00 54.79  ? 59  C   R "C5'" 1 
ATOM   1825 C  "C4'" . C   B 2 52 ? 13.325 6.634   23.316  1.00 53.17  ? 59  C   R "C4'" 1 
ATOM   1826 O  "O4'" . C   B 2 52 ? 12.666 5.587   24.069  1.00 51.92  ? 59  C   R "O4'" 1 
ATOM   1827 C  "C3'" . C   B 2 52 ? 13.788 5.902   22.066  1.00 52.19  ? 59  C   R "C3'" 1 
ATOM   1828 O  "O3'" . C   B 2 52 ? 14.813 6.614   21.401  1.00 52.04  ? 59  C   R "O3'" 1 
ATOM   1829 C  "C2'" . C   B 2 52 ? 14.293 4.599   22.662  1.00 50.91  ? 59  C   R "C2'" 1 
ATOM   1830 O  "O2'" . C   B 2 52 ? 15.539 4.726   23.317  1.00 52.45  ? 59  C   R "O2'" 1 
ATOM   1831 C  "C1'" . C   B 2 52 ? 13.203 4.330   23.688  1.00 50.14  ? 59  C   R "C1'" 1 
ATOM   1832 N  N1    . C   B 2 52 ? 12.117 3.425   23.184  1.00 47.53  ? 59  C   R N1    1 
ATOM   1833 C  C2    . C   B 2 52 ? 12.376 2.054   23.009  1.00 47.46  ? 59  C   R C2    1 
ATOM   1834 O  O2    . C   B 2 52 ? 13.499 1.589   23.268  1.00 46.61  ? 59  C   R O2    1 
ATOM   1835 N  N3    . C   B 2 52 ? 11.370 1.256   22.561  1.00 47.15  ? 59  C   R N3    1 
ATOM   1836 C  C4    . C   B 2 52 ? 10.166 1.769   22.294  1.00 46.45  ? 59  C   R C4    1 
ATOM   1837 N  N4    . C   B 2 52 ? 9.216  0.940   21.853  1.00 47.76  ? 59  C   R N4    1 
ATOM   1838 C  C5    . C   B 2 52 ? 9.887  3.157   22.462  1.00 46.52  ? 59  C   R C5    1 
ATOM   1839 C  C6    . C   B 2 52 ? 10.880 3.936   22.905  1.00 46.27  ? 59  C   R C6    1 
ATOM   1840 P  P     . U   B 2 53 ? 14.852 6.617   19.804  1.00 51.39  ? 60  U   R P     1 
ATOM   1841 O  OP1   . U   B 2 53 ? 15.893 7.589   19.399  1.00 49.66  ? 60  U   R OP1   1 
ATOM   1842 O  OP2   . U   B 2 53 ? 13.469 6.751   19.281  1.00 49.84  ? 60  U   R OP2   1 
ATOM   1843 O  "O5'" . U   B 2 53 ? 15.358 5.134   19.492  1.00 49.51  ? 60  U   R "O5'" 1 
ATOM   1844 C  "C5'" . U   B 2 53 ? 16.729 4.827   19.687  1.00 49.76  ? 60  U   R "C5'" 1 
ATOM   1845 C  "C4'" . U   B 2 53 ? 16.990 3.360   19.429  1.00 49.17  ? 60  U   R "C4'" 1 
ATOM   1846 O  "O4'" . U   B 2 53 ? 15.995 2.556   20.099  1.00 48.61  ? 60  U   R "O4'" 1 
ATOM   1847 C  "C3'" . U   B 2 53 ? 16.868 2.953   17.977  1.00 50.30  ? 60  U   R "C3'" 1 
ATOM   1848 O  "O3'" . U   B 2 53 ? 18.092 3.224   17.328  1.00 53.67  ? 60  U   R "O3'" 1 
ATOM   1849 C  "C2'" . U   B 2 53 ? 16.607 1.458   18.086  1.00 48.65  ? 60  U   R "C2'" 1 
ATOM   1850 O  "O2'" . U   B 2 53 ? 17.800 0.717   18.227  1.00 47.72  ? 60  U   R "O2'" 1 
ATOM   1851 C  "C1'" . U   B 2 53 ? 15.795 1.360   19.372  1.00 47.50  ? 60  U   R "C1'" 1 
ATOM   1852 N  N1    . U   B 2 53 ? 14.331 1.139   19.159  1.00 46.04  ? 60  U   R N1    1 
ATOM   1853 C  C2    . U   B 2 53 ? 13.900 -0.110  18.747  1.00 46.05  ? 60  U   R C2    1 
ATOM   1854 O  O2    . U   B 2 53 ? 14.652 -1.046  18.538  1.00 46.35  ? 60  U   R O2    1 
ATOM   1855 N  N3    . U   B 2 53 ? 12.539 -0.229  18.583  1.00 45.25  ? 60  U   R N3    1 
ATOM   1856 C  C4    . U   B 2 53 ? 11.588 0.752   18.788  1.00 45.23  ? 60  U   R C4    1 
ATOM   1857 O  O4    . U   B 2 53 ? 10.404 0.491   18.600  1.00 46.01  ? 60  U   R O4    1 
ATOM   1858 C  C5    . U   B 2 53 ? 12.112 2.027   19.216  1.00 44.64  ? 60  U   R C5    1 
ATOM   1859 C  C6    . U   B 2 53 ? 13.435 2.170   19.383  1.00 44.49  ? 60  U   R C6    1 
ATOM   1860 P  P     . A   B 2 54 ? 18.095 3.811   15.843  1.00 55.88  ? 61  A   R P     1 
ATOM   1861 O  OP1   . A   B 2 54 ? 19.511 4.030   15.463  1.00 55.87  ? 61  A   R OP1   1 
ATOM   1862 O  OP2   . A   B 2 54 ? 17.121 4.925   15.779  1.00 55.17  ? 61  A   R OP2   1 
ATOM   1863 O  "O5'" . A   B 2 54 ? 17.499 2.607   14.985  1.00 56.08  ? 61  A   R "O5'" 1 
ATOM   1864 C  "C5'" . A   B 2 54 ? 18.247 1.418   14.804  1.00 60.18  ? 61  A   R "C5'" 1 
ATOM   1865 C  "C4'" . A   B 2 54 ? 17.368 0.397   14.120  1.00 63.58  ? 61  A   R "C4'" 1 
ATOM   1866 O  "O4'" . A   B 2 54 ? 16.139 0.242   14.864  1.00 65.68  ? 61  A   R "O4'" 1 
ATOM   1867 C  "C3'" . A   B 2 54 ? 16.953 0.786   12.708  1.00 65.51  ? 61  A   R "C3'" 1 
ATOM   1868 O  "O3'" . A   B 2 54 ? 17.601 -0.087  11.816  1.00 67.99  ? 61  A   R "O3'" 1 
ATOM   1869 C  "C2'" . A   B 2 54 ? 15.435 0.617   12.666  1.00 66.06  ? 61  A   R "C2'" 1 
ATOM   1870 O  "O2'" . A   B 2 54 ? 14.996 -0.118  11.540  1.00 67.03  ? 61  A   R "O2'" 1 
ATOM   1871 C  "C1'" . A   B 2 54 ? 15.150 -0.159  13.947  1.00 66.09  ? 61  A   R "C1'" 1 
ATOM   1872 N  N9    . A   B 2 54 ? 13.830 0.121   14.502  1.00 66.27  ? 61  A   R N9    1 
ATOM   1873 C  C8    . A   B 2 54 ? 13.390 1.277   15.092  1.00 67.06  ? 61  A   R C8    1 
ATOM   1874 N  N7    . A   B 2 54 ? 12.139 1.229   15.490  1.00 66.93  ? 61  A   R N7    1 
ATOM   1875 C  C5    . A   B 2 54 ? 11.735 -0.048  15.134  1.00 66.40  ? 61  A   R C5    1 
ATOM   1876 C  C6    . A   B 2 54 ? 10.512 -0.736  15.276  1.00 66.60  ? 61  A   R C6    1 
ATOM   1877 N  N6    . A   B 2 54 ? 9.431  -0.193  15.845  1.00 66.56  ? 61  A   R N6    1 
ATOM   1878 N  N1    . A   B 2 54 ? 10.447 -2.007  14.807  1.00 66.86  ? 61  A   R N1    1 
ATOM   1879 C  C2    . A   B 2 54 ? 11.529 -2.556  14.234  1.00 66.21  ? 61  A   R C2    1 
ATOM   1880 N  N3    . A   B 2 54 ? 12.730 -2.006  14.047  1.00 66.53  ? 61  A   R N3    1 
ATOM   1881 C  C4    . A   B 2 54 ? 12.765 -0.745  14.523  1.00 66.31  ? 61  A   R C4    1 
ATOM   1882 P  P     . A   B 2 55 ? 18.808 0.448   10.921  1.00 70.61  ? 62  A   R P     1 
ATOM   1883 O  OP1   . A   B 2 55 ? 19.846 1.046   11.801  1.00 70.09  ? 62  A   R OP1   1 
ATOM   1884 O  OP2   . A   B 2 55 ? 18.189 1.269   9.850   1.00 69.57  ? 62  A   R OP2   1 
ATOM   1885 O  "O5'" . A   B 2 55 ? 19.363 -0.920  10.281  1.00 70.02  ? 62  A   R "O5'" 1 
ATOM   1886 C  "C5'" . A   B 2 55 ? 20.685 -1.405  10.548  1.00 68.98  ? 62  A   R "C5'" 1 
ATOM   1887 C  "C4'" . A   B 2 55 ? 20.806 -2.926  10.497  1.00 68.42  ? 62  A   R "C4'" 1 
ATOM   1888 O  "O4'" . A   B 2 55 ? 20.652 -3.464  11.837  1.00 67.73  ? 62  A   R "O4'" 1 
ATOM   1889 C  "C3'" . A   B 2 55 ? 19.780 -3.698  9.671   1.00 67.81  ? 62  A   R "C3'" 1 
ATOM   1890 O  "O3'" . A   B 2 55 ? 20.150 -3.767  8.301   1.00 67.43  ? 62  A   R "O3'" 1 
ATOM   1891 C  "C2'" . A   B 2 55 ? 19.794 -5.065  10.356  1.00 67.15  ? 62  A   R "C2'" 1 
ATOM   1892 O  "O2'" . A   B 2 55 ? 20.926 -5.855  10.048  1.00 66.64  ? 62  A   R "O2'" 1 
ATOM   1893 C  "C1'" . A   B 2 55 ? 19.851 -4.633  11.811  1.00 66.76  ? 62  A   R "C1'" 1 
ATOM   1894 N  N9    . A   B 2 55 ? 18.531 -4.335  12.368  1.00 66.14  ? 62  A   R N9    1 
ATOM   1895 C  C8    . A   B 2 55 ? 17.961 -3.103  12.531  1.00 65.50  ? 62  A   R C8    1 
ATOM   1896 N  N7    . A   B 2 55 ? 16.762 -3.134  13.055  1.00 66.50  ? 62  A   R N7    1 
ATOM   1897 C  C5    . A   B 2 55 ? 16.524 -4.481  13.248  1.00 65.38  ? 62  A   R C5    1 
ATOM   1898 C  C6    . A   B 2 55 ? 15.419 -5.178  13.774  1.00 65.32  ? 62  A   R C6    1 
ATOM   1899 N  N6    . A   B 2 55 ? 14.316 -4.565  14.213  1.00 65.36  ? 62  A   R N6    1 
ATOM   1900 N  N1    . A   B 2 55 ? 15.494 -6.528  13.829  1.00 65.84  ? 62  A   R N1    1 
ATOM   1901 C  C2    . A   B 2 55 ? 16.606 -7.135  13.385  1.00 65.92  ? 62  A   R C2    1 
ATOM   1902 N  N3    . A   B 2 55 ? 17.708 -6.582  12.869  1.00 65.79  ? 62  A   R N3    1 
ATOM   1903 C  C4    . A   B 2 55 ? 17.602 -5.240  12.828  1.00 65.71  ? 62  A   R C4    1 
ATOM   1904 P  P     . A   B 2 56 ? 19.022 -3.797  7.162   1.00 67.83  ? 63  A   R P     1 
ATOM   1905 O  OP1   . A   B 2 56 ? 19.713 -3.744  5.853   1.00 68.70  ? 63  A   R OP1   1 
ATOM   1906 O  OP2   . A   B 2 56 ? 18.003 -2.770  7.474   1.00 66.63  ? 63  A   R OP2   1 
ATOM   1907 O  "O5'" . A   B 2 56 ? 18.365 -5.245  7.349   1.00 65.68  ? 63  A   R "O5'" 1 
ATOM   1908 C  "C5'" . A   B 2 56 ? 19.118 -6.412  7.029   1.00 65.79  ? 63  A   R "C5'" 1 
ATOM   1909 C  "C4'" . A   B 2 56 ? 18.365 -7.669  7.413   1.00 65.99  ? 63  A   R "C4'" 1 
ATOM   1910 O  "O4'" . A   B 2 56 ? 18.059 -7.655  8.831   1.00 66.84  ? 63  A   R "O4'" 1 
ATOM   1911 C  "C3'" . A   B 2 56 ? 17.002 -7.824  6.758   1.00 66.13  ? 63  A   R "C3'" 1 
ATOM   1912 O  "O3'" . A   B 2 56 ? 17.132 -8.296  5.419   1.00 65.53  ? 63  A   R "O3'" 1 
ATOM   1913 C  "C2'" . A   B 2 56 ? 16.341 -8.827  7.702   1.00 66.33  ? 63  A   R "C2'" 1 
ATOM   1914 O  "O2'" . A   B 2 56 ? 16.763 -10.162 7.497   1.00 67.01  ? 63  A   R "O2'" 1 
ATOM   1915 C  "C1'" . A   B 2 56 ? 16.823 -8.316  9.060   1.00 65.48  ? 63  A   R "C1'" 1 
ATOM   1916 N  N9    . A   B 2 56 ? 15.866 -7.394  9.678   1.00 64.09  ? 63  A   R N9    1 
ATOM   1917 C  C8    . A   B 2 56 ? 15.881 -6.026  9.629   1.00 64.16  ? 63  A   R C8    1 
ATOM   1918 N  N7    . A   B 2 56 ? 14.890 -5.454  10.271  1.00 63.71  ? 63  A   R N7    1 
ATOM   1919 C  C5    . A   B 2 56 ? 14.171 -6.521  10.773  1.00 62.63  ? 63  A   R C5    1 
ATOM   1920 C  C6    . A   B 2 56 ? 12.999 -6.589  11.549  1.00 62.92  ? 63  A   R C6    1 
ATOM   1921 N  N6    . A   B 2 56 ? 12.331 -5.507  11.959  1.00 63.55  ? 63  A   R N6    1 
ATOM   1922 N  N1    . A   B 2 56 ? 12.535 -7.811  11.889  1.00 64.68  ? 63  A   R N1    1 
ATOM   1923 C  C2    . A   B 2 56 ? 13.205 -8.897  11.477  1.00 65.12  ? 63  A   R C2    1 
ATOM   1924 N  N3    . A   B 2 56 ? 14.318 -8.955  10.742  1.00 64.84  ? 63  A   R N3    1 
ATOM   1925 C  C4    . A   B 2 56 ? 14.754 -7.723  10.418  1.00 63.46  ? 63  A   R C4    1 
ATOM   1926 P  P     . C   B 2 57 ? 16.202 -7.701  4.256   1.00 64.35  ? 64  C   R P     1 
ATOM   1927 O  OP1   . C   B 2 57 ? 16.630 -8.322  2.979   1.00 64.74  ? 64  C   R OP1   1 
ATOM   1928 O  OP2   . C   B 2 57 ? 16.158 -6.226  4.374   1.00 64.06  ? 64  C   R OP2   1 
ATOM   1929 O  "O5'" . C   B 2 57 ? 14.762 -8.261  4.660   1.00 63.87  ? 64  C   R "O5'" 1 
ATOM   1930 C  "C5'" . C   B 2 57 ? 14.475 -9.632  4.450   1.00 64.11  ? 64  C   R "C5'" 1 
ATOM   1931 C  "C4'" . C   B 2 57 ? 13.188 -10.026 5.137   1.00 64.62  ? 64  C   R "C4'" 1 
ATOM   1932 O  "O4'" . C   B 2 57 ? 13.264 -9.676  6.539   1.00 64.41  ? 64  C   R "O4'" 1 
ATOM   1933 C  "C3'" . C   B 2 57 ? 11.952 -9.289  4.653   1.00 65.26  ? 64  C   R "C3'" 1 
ATOM   1934 O  "O3'" . C   B 2 57 ? 11.474 -9.832  3.432   1.00 66.02  ? 64  C   R "O3'" 1 
ATOM   1935 C  "C2'" . C   B 2 57 ? 11.004 -9.512  5.827   1.00 65.59  ? 64  C   R "C2'" 1 
ATOM   1936 O  "O2'" . C   B 2 57 ? 10.404 -10.796 5.841   1.00 65.45  ? 64  C   R "O2'" 1 
ATOM   1937 C  "C1'" . C   B 2 57 ? 11.971 -9.331  7.001   1.00 65.21  ? 64  C   R "C1'" 1 
ATOM   1938 N  N1    . C   B 2 57 ? 11.972 -7.932  7.538   1.00 65.99  ? 64  C   R N1    1 
ATOM   1939 C  C2    . C   B 2 57 ? 10.991 -7.563  8.469   1.00 65.89  ? 64  C   R C2    1 
ATOM   1940 O  O2    . C   B 2 57 ? 10.156 -8.399  8.839   1.00 65.59  ? 64  C   R O2    1 
ATOM   1941 N  N3    . C   B 2 57 ? 10.992 -6.288  8.943   1.00 66.88  ? 64  C   R N3    1 
ATOM   1942 C  C4    . C   B 2 57 ? 11.912 -5.407  8.529   1.00 66.35  ? 64  C   R C4    1 
ATOM   1943 N  N4    . C   B 2 57 ? 11.866 -4.171  9.035   1.00 66.67  ? 64  C   R N4    1 
ATOM   1944 C  C5    . C   B 2 57 ? 12.920 -5.759  7.581   1.00 65.89  ? 64  C   R C5    1 
ATOM   1945 C  C6    . C   B 2 57 ? 12.908 -7.017  7.120   1.00 66.49  ? 64  C   R C6    1 
ATOM   1946 P  P     . C   B 2 58 ? 10.835 -8.852  2.340   1.00 66.38  ? 65  C   R P     1 
ATOM   1947 O  OP1   . C   B 2 58 ? 10.679 -9.605  1.076   1.00 65.39  ? 65  C   R OP1   1 
ATOM   1948 O  OP2   . C   B 2 58 ? 11.591 -7.578  2.342   1.00 66.10  ? 65  C   R OP2   1 
ATOM   1949 O  "O5'" . C   B 2 58 ? 9.402  -8.544  2.968   1.00 66.36  ? 65  C   R "O5'" 1 
ATOM   1950 C  "C5'" . C   B 2 58 ? 8.415  -9.549  3.103   1.00 67.74  ? 65  C   R "C5'" 1 
ATOM   1951 C  "C4'" . C   B 2 58 ? 7.214  -8.955  3.805   1.00 70.39  ? 65  C   R "C4'" 1 
ATOM   1952 O  "O4'" . C   B 2 58 ? 7.605  -8.542  5.140   1.00 71.34  ? 65  C   R "O4'" 1 
ATOM   1953 C  "C3'" . C   B 2 58 ? 6.693  -7.661  3.196   1.00 71.53  ? 65  C   R "C3'" 1 
ATOM   1954 O  "O3'" . C   B 2 58 ? 5.913  -7.861  2.023   1.00 72.00  ? 65  C   R "O3'" 1 
ATOM   1955 C  "C2'" . C   B 2 58 ? 5.917  -7.071  4.369   1.00 72.12  ? 65  C   R "C2'" 1 
ATOM   1956 O  "O2'" . C   B 2 58 ? 4.665  -7.687  4.621   1.00 71.68  ? 65  C   R "O2'" 1 
ATOM   1957 C  "C1'" . C   B 2 58 ? 6.905  -7.356  5.499   1.00 71.91  ? 65  C   R "C1'" 1 
ATOM   1958 N  N1    . C   B 2 58 ? 7.867  -6.218  5.736   1.00 71.73  ? 65  C   R N1    1 
ATOM   1959 C  C2    . C   B 2 58 ? 7.417  -5.018  6.319   1.00 72.06  ? 65  C   R C2    1 
ATOM   1960 O  O2    . C   B 2 58 ? 6.235  -4.893  6.648   1.00 72.91  ? 65  C   R O2    1 
ATOM   1961 N  N3    . C   B 2 58 ? 8.297  -4.006  6.525   1.00 72.19  ? 65  C   R N3    1 
ATOM   1962 C  C4    . C   B 2 58 ? 9.573  -4.153  6.169   1.00 72.47  ? 65  C   R C4    1 
ATOM   1963 N  N4    . C   B 2 58 ? 10.400 -3.130  6.389   1.00 73.39  ? 65  C   R N4    1 
ATOM   1964 C  C5    . C   B 2 58 ? 10.058 -5.355  5.571   1.00 72.68  ? 65  C   R C5    1 
ATOM   1965 C  C6    . C   B 2 58 ? 9.181  -6.348  5.378   1.00 72.24  ? 65  C   R C6    1 
ATOM   1966 P  P     . A   B 2 59 ? 6.157  -6.872  0.783   1.00 73.36  ? 660 A   R P     1 
ATOM   1967 O  OP1   . A   B 2 59 ? 5.571  -7.487  -0.427  1.00 73.30  ? 660 A   R OP1   1 
ATOM   1968 O  OP2   . A   B 2 59 ? 7.582  -6.473  0.770   1.00 73.48  ? 660 A   R OP2   1 
ATOM   1969 O  "O5'" . A   B 2 59 ? 5.314  -5.575  1.184   1.00 72.74  ? 660 A   R "O5'" 1 
ATOM   1970 C  "C5'" . A   B 2 59 ? 3.924  -5.665  1.449   1.00 72.25  ? 660 A   R "C5'" 1 
ATOM   1971 C  "C4'" . A   B 2 59 ? 3.469  -4.486  2.286   1.00 72.01  ? 660 A   R "C4'" 1 
ATOM   1972 O  "O4'" . A   B 2 59 ? 4.206  -4.450  3.534   1.00 72.01  ? 660 A   R "O4'" 1 
ATOM   1973 C  "C3'" . A   B 2 59 ? 3.731  -3.125  1.668   1.00 71.66  ? 660 A   R "C3'" 1 
ATOM   1974 O  "O3'" . A   B 2 59 ? 2.728  -2.794  0.719   1.00 71.28  ? 660 A   R "O3'" 1 
ATOM   1975 C  "C2'" . A   B 2 59 ? 3.696  -2.244  2.911   1.00 72.75  ? 660 A   R "C2'" 1 
ATOM   1976 O  "O2'" . A   B 2 59 ? 2.391  -2.003  3.403   1.00 73.27  ? 660 A   R "O2'" 1 
ATOM   1977 C  "C1'" . A   B 2 59 ? 4.488  -3.108  3.886   1.00 73.07  ? 660 A   R "C1'" 1 
ATOM   1978 N  N9    . A   B 2 59 ? 5.932  -2.849  3.820   1.00 74.15  ? 660 A   R N9    1 
ATOM   1979 C  C8    . A   B 2 59 ? 6.898  -3.631  3.242   1.00 74.58  ? 660 A   R C8    1 
ATOM   1980 N  N7    . A   B 2 59 ? 8.111  -3.139  3.332   1.00 74.48  ? 660 A   R N7    1 
ATOM   1981 C  C5    . A   B 2 59 ? 7.937  -1.946  4.014   1.00 73.91  ? 660 A   R C5    1 
ATOM   1982 C  C6    . A   B 2 59 ? 8.841  -0.942  4.432   1.00 73.43  ? 660 A   R C6    1 
ATOM   1983 N  N6    . A   B 2 59 ? 10.158 -0.990  4.203   1.00 73.85  ? 660 A   R N6    1 
ATOM   1984 N  N1    . A   B 2 59 ? 8.339  0.125   5.093   1.00 72.70  ? 660 A   R N1    1 
ATOM   1985 C  C2    . A   B 2 59 ? 7.020  0.182   5.323   1.00 72.56  ? 660 A   R C2    1 
ATOM   1986 N  N3    . A   B 2 59 ? 6.076  -0.697  4.981   1.00 73.34  ? 660 A   R N3    1 
ATOM   1987 C  C4    . A   B 2 59 ? 6.600  -1.749  4.322   1.00 73.85  ? 660 A   R C4    1 
ATOM   1988 P  P     . U   B 2 60 ? 3.116  -2.005  -0.622  1.00 71.84  ? 661 U   R P     1 
ATOM   1989 O  OP1   . U   B 2 60 ? 1.940  -2.052  -1.522  1.00 72.64  ? 661 U   R OP1   1 
ATOM   1990 O  OP2   . U   B 2 60 ? 4.423  -2.496  -1.116  1.00 71.22  ? 661 U   R OP2   1 
ATOM   1991 O  "O5'" . U   B 2 60 ? 3.316  -0.505  -0.100  1.00 70.01  ? 661 U   R "O5'" 1 
ATOM   1992 C  "C5'" . U   B 2 60 ? 2.241  0.173   0.553   1.00 69.47  ? 661 U   R "C5'" 1 
ATOM   1993 C  "C4'" . U   B 2 60 ? 2.741  1.356   1.359   1.00 68.25  ? 661 U   R "C4'" 1 
ATOM   1994 O  "O4'" . U   B 2 60 ? 3.717  0.928   2.345   1.00 67.65  ? 661 U   R "O4'" 1 
ATOM   1995 C  "C3'" . U   B 2 60 ? 3.497  2.388   0.545   1.00 67.97  ? 661 U   R "C3'" 1 
ATOM   1996 O  "O3'" . U   B 2 60 ? 2.603  3.226   -0.163  1.00 67.88  ? 661 U   R "O3'" 1 
ATOM   1997 C  "C2'" . U   B 2 60 ? 4.277  3.110   1.636   1.00 67.61  ? 661 U   R "C2'" 1 
ATOM   1998 O  "O2'" . U   B 2 60 ? 3.480  4.008   2.389   1.00 68.00  ? 661 U   R "O2'" 1 
ATOM   1999 C  "C1'" . U   B 2 60 ? 4.726  1.919   2.488   1.00 66.13  ? 661 U   R "C1'" 1 
ATOM   2000 N  N1    . U   B 2 60 ? 6.093  1.375   2.098   1.00 63.66  ? 661 U   R N1    1 
ATOM   2001 C  C2    . U   B 2 60 ? 7.240  2.057   2.492   1.00 62.13  ? 661 U   R C2    1 
ATOM   2002 O  O2    . U   B 2 60 ? 7.224  3.083   3.152   1.00 61.93  ? 661 U   R O2    1 
ATOM   2003 N  N3    . U   B 2 60 ? 8.430  1.491   2.089   1.00 59.95  ? 661 U   R N3    1 
ATOM   2004 C  C4    . U   B 2 60 ? 8.596  0.338   1.343   1.00 59.19  ? 661 U   R C4    1 
ATOM   2005 O  O4    . U   B 2 60 ? 9.725  -0.046  1.055   1.00 56.54  ? 661 U   R O4    1 
ATOM   2006 C  C5    . U   B 2 60 ? 7.366  -0.317  0.968   1.00 60.54  ? 661 U   R C5    1 
ATOM   2007 C  C6    . U   B 2 60 ? 6.194  0.212   1.350   1.00 61.70  ? 661 U   R C6    1 
ATOM   2008 P  P     . U   B 2 61 ? 2.902  3.522   -1.708  1.00 68.53  ? 662 U   R P     1 
ATOM   2009 O  OP1   . U   B 2 61 ? 1.692  4.153   -2.287  1.00 68.43  ? 662 U   R OP1   1 
ATOM   2010 O  OP2   . U   B 2 61 ? 3.464  2.303   -2.334  1.00 65.79  ? 662 U   R OP2   1 
ATOM   2011 O  "O5'" . U   B 2 61 ? 4.059  4.620   -1.611  1.00 68.79  ? 662 U   R "O5'" 1 
ATOM   2012 C  "C5'" . U   B 2 61 ? 3.740  5.916   -1.115  1.00 69.67  ? 662 U   R "C5'" 1 
ATOM   2013 C  "C4'" . U   B 2 61 ? 4.317  6.999   -2.007  1.00 70.36  ? 662 U   R "C4'" 1 
ATOM   2014 O  "O4'" . U   B 2 61 ? 5.749  6.834   -2.074  1.00 70.13  ? 662 U   R "O4'" 1 
ATOM   2015 C  "C3'" . U   B 2 61 ? 3.808  7.049   -3.448  1.00 70.69  ? 662 U   R "C3'" 1 
ATOM   2016 O  "O3'" . U   B 2 61 ? 3.355  8.374   -3.746  1.00 70.70  ? 662 U   R "O3'" 1 
ATOM   2017 C  "C2'" . U   B 2 61 ? 5.016  6.625   -4.288  1.00 71.10  ? 662 U   R "C2'" 1 
ATOM   2018 O  "O2'" . U   B 2 61 ? 5.059  7.286   -5.538  1.00 70.55  ? 662 U   R "O2'" 1 
ATOM   2019 C  "C1'" . U   B 2 61 ? 6.192  7.029   -3.396  1.00 71.40  ? 662 U   R "C1'" 1 
ATOM   2020 N  N1    . U   B 2 61 ? 7.458  6.232   -3.525  1.00 72.53  ? 662 U   R N1    1 
ATOM   2021 C  C2    . U   B 2 61 ? 8.528  6.733   -4.252  1.00 73.18  ? 662 U   R C2    1 
ATOM   2022 O  O2    . U   B 2 61 ? 8.520  7.804   -4.834  1.00 74.02  ? 662 U   R O2    1 
ATOM   2023 N  N3    . U   B 2 61 ? 9.633  5.917   -4.283  1.00 72.80  ? 662 U   R N3    1 
ATOM   2024 C  C4    . U   B 2 61 ? 9.783  4.683   -3.672  1.00 73.39  ? 662 U   R C4    1 
ATOM   2025 O  O4    . U   B 2 61 ? 10.839 4.072   -3.794  1.00 74.02  ? 662 U   R O4    1 
ATOM   2026 C  C5    . U   B 2 61 ? 8.638  4.230   -2.925  1.00 73.15  ? 662 U   R C5    1 
ATOM   2027 C  C6    . U   B 2 61 ? 7.547  5.008   -2.880  1.00 72.98  ? 662 U   R C6    1 
ATOM   2028 P  P     . G   B 2 62 ? 1.990  8.935   -3.111  1.00 73.05  ? 663 G   R P     1 
ATOM   2029 O  OP1   . G   B 2 62 ? 1.118  7.788   -2.774  1.00 73.27  ? 663 G   R OP1   1 
ATOM   2030 O  OP2   . G   B 2 62 ? 1.486  10.008  -3.997  1.00 73.40  ? 663 G   R OP2   1 
ATOM   2031 O  "O5'" . G   B 2 62 ? 2.431  9.638   -1.754  1.00 71.69  ? 663 G   R "O5'" 1 
ATOM   2032 C  "C5'" . G   B 2 62 ? 1.438  9.866   -0.773  1.00 72.31  ? 663 G   R "C5'" 1 
ATOM   2033 C  "C4'" . G   B 2 62 ? 2.016  9.625   0.603   1.00 72.96  ? 663 G   R "C4'" 1 
ATOM   2034 O  "O4'" . G   B 2 62 ? 3.078  8.642   0.522   1.00 72.80  ? 663 G   R "O4'" 1 
ATOM   2035 C  "C3'" . G   B 2 62 ? 2.679  10.849  1.201   1.00 73.11  ? 663 G   R "C3'" 1 
ATOM   2036 O  "O3'" . G   B 2 62 ? 1.703  11.632  1.857   1.00 74.84  ? 663 G   R "O3'" 1 
ATOM   2037 C  "C2'" . G   B 2 62 ? 3.680  10.224  2.163   1.00 72.69  ? 663 G   R "C2'" 1 
ATOM   2038 O  "O2'" . G   B 2 62 ? 3.085  9.811   3.379   1.00 73.60  ? 663 G   R "O2'" 1 
ATOM   2039 C  "C1'" . G   B 2 62 ? 4.147  9.001   1.374   1.00 71.67  ? 663 G   R "C1'" 1 
ATOM   2040 N  N9    . G   B 2 62 ? 5.344  9.197   0.550   1.00 70.19  ? 663 G   R N9    1 
ATOM   2041 C  C8    . G   B 2 62 ? 5.646  10.283  -0.241  1.00 69.50  ? 663 G   R C8    1 
ATOM   2042 N  N7    . G   B 2 62 ? 6.783  10.180  -0.865  1.00 68.29  ? 663 G   R N7    1 
ATOM   2043 C  C5    . G   B 2 62 ? 7.277  8.949   -0.468  1.00 67.98  ? 663 G   R C5    1 
ATOM   2044 C  C6    . G   B 2 62 ? 8.481  8.295   -0.825  1.00 66.62  ? 663 G   R C6    1 
ATOM   2045 O  O6    . G   B 2 62 ? 9.366  8.702   -1.585  1.00 64.99  ? 663 G   R O6    1 
ATOM   2046 N  N1    . G   B 2 62 ? 8.610  7.051   -0.208  1.00 66.74  ? 663 G   R N1    1 
ATOM   2047 C  C2    . G   B 2 62 ? 7.680  6.509   0.652   1.00 66.89  ? 663 G   R C2    1 
ATOM   2048 N  N2    . G   B 2 62 ? 7.968  5.301   1.152   1.00 67.29  ? 663 G   R N2    1 
ATOM   2049 N  N3    . G   B 2 62 ? 6.545  7.111   0.997   1.00 67.70  ? 663 G   R N3    1 
ATOM   2050 C  C4    . G   B 2 62 ? 6.405  8.327   0.404   1.00 68.85  ? 663 G   R C4    1 
ATOM   2051 P  P     . C   B 2 63 ? 1.388  13.121  1.352   1.00 77.36  ? 664 C   R P     1 
ATOM   2052 O  OP1   . C   B 2 63 ? 0.247  13.614  2.163   1.00 77.15  ? 664 C   R OP1   1 
ATOM   2053 O  OP2   . C   B 2 63 ? 1.291  13.114  -0.128  1.00 75.72  ? 664 C   R OP2   1 
ATOM   2054 O  "O5'" . C   B 2 63 ? 2.703  13.937  1.767   1.00 74.70  ? 664 C   R "O5'" 1 
ATOM   2055 C  "C5'" . C   B 2 63 ? 3.071  14.011  3.145   1.00 71.98  ? 664 C   R "C5'" 1 
ATOM   2056 C  "C4'" . C   B 2 63 ? 3.257  15.447  3.605   1.00 68.89  ? 664 C   R "C4'" 1 
ATOM   2057 O  "O4'" . C   B 2 63 ? 4.112  16.148  2.668   1.00 66.34  ? 664 C   R "O4'" 1 
ATOM   2058 C  "C3'" . C   B 2 63 ? 1.995  16.288  3.758   1.00 67.15  ? 664 C   R "C3'" 1 
ATOM   2059 O  "O3'" . C   B 2 63 ? 2.144  17.037  4.962   1.00 69.06  ? 664 C   R "O3'" 1 
ATOM   2060 C  "C2'" . C   B 2 63 ? 1.993  17.177  2.510   1.00 66.25  ? 664 C   R "C2'" 1 
ATOM   2061 O  "O2'" . C   B 2 63 ? 1.416  18.448  2.746   1.00 65.72  ? 664 C   R "O2'" 1 
ATOM   2062 C  "C1'" . C   B 2 63 ? 3.485  17.326  2.207   1.00 64.00  ? 664 C   R "C1'" 1 
ATOM   2063 N  N1    . C   B 2 63 ? 3.886  17.517  0.762   1.00 60.59  ? 664 C   R N1    1 
ATOM   2064 C  C2    . C   B 2 63 ? 4.339  18.773  0.315   1.00 58.54  ? 664 C   R C2    1 
ATOM   2065 O  O2    . C   B 2 63 ? 4.388  19.729  1.098   1.00 57.97  ? 664 C   R O2    1 
ATOM   2066 N  N3    . C   B 2 63 ? 4.710  18.917  -0.985  1.00 56.69  ? 664 C   R N3    1 
ATOM   2067 C  C4    . C   B 2 63 ? 4.651  17.880  -1.824  1.00 55.57  ? 664 C   R C4    1 
ATOM   2068 N  N4    . C   B 2 63 ? 5.027  18.086  -3.087  1.00 54.13  ? 664 C   R N4    1 
ATOM   2069 C  C5    . C   B 2 63 ? 4.203  16.593  -1.398  1.00 56.43  ? 664 C   R C5    1 
ATOM   2070 C  C6    . C   B 2 63 ? 3.839  16.460  -0.113  1.00 59.25  ? 664 C   R C6    1 
ATOM   2071 P  P     . A   B 2 64 ? 0.950  17.272  6.000   1.00 70.69  ? 665 A   R P     1 
ATOM   2072 O  OP1   . A   B 2 64 ? -0.050 16.201  5.791   1.00 72.42  ? 665 A   R OP1   1 
ATOM   2073 O  OP2   . A   B 2 64 ? 0.559  18.696  5.896   1.00 70.42  ? 665 A   R OP2   1 
ATOM   2074 O  "O5'" . A   B 2 64 ? 1.610  17.095  7.448   1.00 71.51  ? 665 A   R "O5'" 1 
ATOM   2075 C  "C5'" . A   B 2 64 ? 2.194  15.864  7.861   1.00 72.59  ? 665 A   R "C5'" 1 
ATOM   2076 C  "C4'" . A   B 2 64 ? 3.682  16.048  8.091   1.00 73.87  ? 665 A   R "C4'" 1 
ATOM   2077 O  "O4'" . A   B 2 64 ? 4.315  16.485  6.863   1.00 73.15  ? 665 A   R "O4'" 1 
ATOM   2078 C  "C3'" . A   B 2 64 ? 4.043  17.130  9.096   1.00 75.09  ? 665 A   R "C3'" 1 
ATOM   2079 O  "O3'" . A   B 2 64 ? 4.004  16.605  10.413  1.00 78.27  ? 665 A   R "O3'" 1 
ATOM   2080 C  "C2'" . A   B 2 64 ? 5.457  17.517  8.677   1.00 73.86  ? 665 A   R "C2'" 1 
ATOM   2081 O  "O2'" . A   B 2 64 ? 6.453  16.708  9.269   1.00 73.63  ? 665 A   R "O2'" 1 
ATOM   2082 C  "C1'" . A   B 2 64 ? 5.430  17.308  7.161   1.00 72.50  ? 665 A   R "C1'" 1 
ATOM   2083 N  N9    . A   B 2 64 ? 5.355  18.543  6.375   1.00 71.09  ? 665 A   R N9    1 
ATOM   2084 C  C8    . A   B 2 64 ? 4.413  18.864  5.436   1.00 70.77  ? 665 A   R C8    1 
ATOM   2085 N  N7    . A   B 2 64 ? 4.587  20.037  4.874   1.00 70.25  ? 665 A   R N7    1 
ATOM   2086 C  C5    . A   B 2 64 ? 5.728  20.530  5.483   1.00 69.46  ? 665 A   R C5    1 
ATOM   2087 C  C6    . A   B 2 64 ? 6.450  21.738  5.332   1.00 68.69  ? 665 A   R C6    1 
ATOM   2088 N  N6    . A   B 2 64 ? 6.105  22.708  4.480   1.00 68.87  ? 665 A   R N6    1 
ATOM   2089 N  N1    . A   B 2 64 ? 7.550  21.922  6.092   1.00 67.79  ? 665 A   R N1    1 
ATOM   2090 C  C2    . A   B 2 64 ? 7.908  20.953  6.946   1.00 69.36  ? 665 A   R C2    1 
ATOM   2091 N  N3    . A   B 2 64 ? 7.312  19.780  7.178   1.00 69.82  ? 665 A   R N3    1 
ATOM   2092 C  C4    . A   B 2 64 ? 6.218  19.622  6.409   1.00 70.21  ? 665 A   R C4    1 
ATOM   2093 P  P     . C   B 2 65 ? 3.137  17.338  11.542  1.00 81.19  ? 666 C   R P     1 
ATOM   2094 O  OP1   . C   B 2 65 ? 3.058  16.420  12.706  1.00 81.02  ? 666 C   R OP1   1 
ATOM   2095 O  OP2   . C   B 2 65 ? 1.890  17.840  10.913  1.00 80.71  ? 666 C   R OP2   1 
ATOM   2096 O  "O5'" . C   B 2 65 ? 4.051  18.591  11.938  1.00 80.24  ? 666 C   R "O5'" 1 
ATOM   2097 C  "C5'" . C   B 2 65 ? 5.146  18.403  12.830  1.00 80.72  ? 666 C   R "C5'" 1 
ATOM   2098 C  "C4'" . C   B 2 65 ? 6.048  19.620  12.884  1.00 80.88  ? 666 C   R "C4'" 1 
ATOM   2099 O  "O4'" . C   B 2 65 ? 6.613  19.850  11.570  1.00 80.29  ? 666 C   R "O4'" 1 
ATOM   2100 C  "C3'" . C   B 2 65 ? 5.350  20.931  13.222  1.00 81.64  ? 666 C   R "C3'" 1 
ATOM   2101 O  "O3'" . C   B 2 65 ? 5.171  21.071  14.627  1.00 83.95  ? 666 C   R "O3'" 1 
ATOM   2102 C  "C2'" . C   B 2 65 ? 6.297  21.962  12.615  1.00 80.07  ? 666 C   R "C2'" 1 
ATOM   2103 O  "O2'" . C   B 2 65 ? 7.430  22.230  13.423  1.00 78.39  ? 666 C   R "O2'" 1 
ATOM   2104 C  "C1'" . C   B 2 65 ? 6.691  21.244  11.321  1.00 78.65  ? 666 C   R "C1'" 1 
ATOM   2105 N  N1    . C   B 2 65 ? 5.832  21.602  10.132  1.00 75.84  ? 666 C   R N1    1 
ATOM   2106 C  C2    . C   B 2 65 ? 6.202  22.682  9.312   1.00 75.18  ? 666 C   R C2    1 
ATOM   2107 O  O2    . C   B 2 65 ? 7.228  23.331  9.564   1.00 74.05  ? 666 C   R O2    1 
ATOM   2108 N  N3    . C   B 2 65 ? 5.417  22.991  8.243   1.00 74.35  ? 666 C   R N3    1 
ATOM   2109 C  C4    . C   B 2 65 ? 4.311  22.286  7.985   1.00 73.74  ? 666 C   R C4    1 
ATOM   2110 N  N4    . C   B 2 65 ? 3.581  22.638  6.925   1.00 72.83  ? 666 C   R N4    1 
ATOM   2111 C  C5    . C   B 2 65 ? 3.913  21.185  8.802   1.00 74.51  ? 666 C   R C5    1 
ATOM   2112 C  C6    . C   B 2 65 ? 4.695  20.888  9.848   1.00 75.15  ? 666 C   R C6    1 
ATOM   2113 P  P     . U   B 2 66 ? 3.681  21.126  15.214  1.00 85.44  ? 667 U   R P     1 
ATOM   2114 O  OP1   . U   B 2 66 ? 2.761  20.443  14.269  1.00 84.32  ? 667 U   R OP1   1 
ATOM   2115 O  OP2   . U   B 2 66 ? 3.423  22.533  15.602  1.00 85.16  ? 667 U   R OP2   1 
ATOM   2116 O  "O5'" . U   B 2 66 ? 3.803  20.244  16.545  1.00 83.25  ? 667 U   R "O5'" 1 
ATOM   2117 C  "C5'" . U   B 2 66 ? 3.811  18.830  16.438  1.00 80.35  ? 667 U   R "C5'" 1 
ATOM   2118 C  "C4'" . U   B 2 66 ? 3.961  18.177  17.795  1.00 78.41  ? 667 U   R "C4'" 1 
ATOM   2119 O  "O4'" . U   B 2 66 ? 2.679  18.168  18.471  1.00 77.53  ? 667 U   R "O4'" 1 
ATOM   2120 C  "C3'" . U   B 2 66 ? 4.400  16.726  17.709  1.00 78.17  ? 667 U   R "C3'" 1 
ATOM   2121 O  "O3'" . U   B 2 66 ? 5.812  16.660  17.870  1.00 78.19  ? 667 U   R "O3'" 1 
ATOM   2122 C  "C2'" . U   B 2 66 ? 3.652  16.047  18.853  1.00 77.56  ? 667 U   R "C2'" 1 
ATOM   2123 O  "O2'" . U   B 2 66 ? 4.355  16.085  20.081  1.00 78.60  ? 667 U   R "O2'" 1 
ATOM   2124 C  "C1'" . U   B 2 66 ? 2.374  16.873  18.964  1.00 75.82  ? 667 U   R "C1'" 1 
ATOM   2125 N  N1    . U   B 2 66 ? 1.158  16.315  18.251  1.00 73.30  ? 667 U   R N1    1 
ATOM   2126 C  C2    . U   B 2 66 ? 0.611  15.087  18.615  1.00 72.31  ? 667 U   R C2    1 
ATOM   2127 O  O2    . U   B 2 66 ? 1.049  14.369  19.498  1.00 71.97  ? 667 U   R O2    1 
ATOM   2128 N  N3    . U   B 2 66 ? -0.501 14.707  17.894  1.00 70.90  ? 667 U   R N3    1 
ATOM   2129 C  C4    . U   B 2 66 ? -1.116 15.411  16.869  1.00 70.84  ? 667 U   R C4    1 
ATOM   2130 O  O4    . U   B 2 66 ? -2.106 14.946  16.309  1.00 70.32  ? 667 U   R O4    1 
ATOM   2131 C  C5    . U   B 2 66 ? -0.496 16.672  16.546  1.00 70.74  ? 667 U   R C5    1 
ATOM   2132 C  C6    . U   B 2 66 ? 0.583  17.065  17.235  1.00 72.25  ? 667 U   R C6    1 
ATOM   2133 P  P     . C   B 2 67 ? 6.763  16.185  16.670  1.00 78.26  ? 668 C   R P     1 
ATOM   2134 O  OP1   . C   B 2 67 ? 8.146  16.577  17.031  1.00 76.72  ? 668 C   R OP1   1 
ATOM   2135 O  OP2   . C   B 2 67 ? 6.180  16.623  15.380  1.00 77.82  ? 668 C   R OP2   1 
ATOM   2136 O  "O5'" . C   B 2 67 ? 6.628  14.595  16.719  1.00 74.82  ? 668 C   R "O5'" 1 
ATOM   2137 C  "C5'" . C   B 2 67 ? 7.138  13.875  17.825  1.00 71.24  ? 668 C   R "C5'" 1 
ATOM   2138 C  "C4'" . C   B 2 67 ? 6.244  12.691  18.113  1.00 69.21  ? 668 C   R "C4'" 1 
ATOM   2139 O  "O4'" . C   B 2 67 ? 4.898  13.168  18.353  1.00 67.80  ? 668 C   R "O4'" 1 
ATOM   2140 C  "C3'" . C   B 2 67 ? 6.038  11.725  16.960  1.00 68.63  ? 668 C   R "C3'" 1 
ATOM   2141 O  "O3'" . C   B 2 67 ? 7.160  10.872  16.746  1.00 68.74  ? 668 C   R "O3'" 1 
ATOM   2142 C  "C2'" . C   B 2 67 ? 4.806  10.982  17.464  1.00 68.15  ? 668 C   R "C2'" 1 
ATOM   2143 O  "O2'" . C   B 2 67 ? 5.090  10.060  18.501  1.00 69.50  ? 668 C   R "O2'" 1 
ATOM   2144 C  "C1'" . C   B 2 67 ? 3.978  12.151  17.996  1.00 66.35  ? 668 C   R "C1'" 1 
ATOM   2145 N  N1    . C   B 2 67 ? 2.969  12.650  16.994  1.00 63.67  ? 668 C   R N1    1 
ATOM   2146 C  C2    . C   B 2 67 ? 1.701  12.042  16.943  1.00 63.26  ? 668 C   R C2    1 
ATOM   2147 O  O2    . C   B 2 67 ? 1.429  11.120  17.722  1.00 62.50  ? 668 C   R O2    1 
ATOM   2148 N  N3    . C   B 2 67 ? 0.791  12.485  16.034  1.00 62.12  ? 668 C   R N3    1 
ATOM   2149 C  C4    . C   B 2 67 ? 1.107  13.479  15.202  1.00 62.02  ? 668 C   R C4    1 
ATOM   2150 N  N4    . C   B 2 67 ? 0.172  13.870  14.334  1.00 62.50  ? 668 C   R N4    1 
ATOM   2151 C  C5    . C   B 2 67 ? 2.388  14.112  15.228  1.00 62.03  ? 668 C   R C5    1 
ATOM   2152 C  C6    . C   B 2 67 ? 3.275  13.667  16.128  1.00 63.06  ? 668 C   R C6    1 
ATOM   2153 P  P     . C   B 2 68 ? 7.486  10.354  15.260  1.00 69.21  ? 669 C   R P     1 
ATOM   2154 O  OP1   . C   B 2 68 ? 8.826  9.722   15.288  1.00 68.32  ? 669 C   R OP1   1 
ATOM   2155 O  OP2   . C   B 2 68 ? 7.223  11.455  14.306  1.00 69.12  ? 669 C   R OP2   1 
ATOM   2156 O  "O5'" . C   B 2 68 ? 6.369  9.235   15.009  1.00 66.96  ? 669 C   R "O5'" 1 
ATOM   2157 C  "C5'" . C   B 2 68 ? 6.613  7.904   15.433  1.00 64.72  ? 669 C   R "C5'" 1 
ATOM   2158 C  "C4'" . C   B 2 68 ? 5.330  7.149   15.717  1.00 63.48  ? 669 C   R "C4'" 1 
ATOM   2159 O  "O4'" . C   B 2 68 ? 4.246  8.043   16.088  1.00 60.36  ? 669 C   R "O4'" 1 
ATOM   2160 C  "C3'" . C   B 2 68 ? 4.746  6.406   14.528  1.00 63.85  ? 669 C   R "C3'" 1 
ATOM   2161 O  "O3'" . C   B 2 68 ? 5.491  5.232   14.211  1.00 67.88  ? 669 C   R "O3'" 1 
ATOM   2162 C  "C2'" . C   B 2 68 ? 3.356  6.105   15.079  1.00 60.09  ? 669 C   R "C2'" 1 
ATOM   2163 O  "O2'" . C   B 2 68 ? 3.341  5.084   16.057  1.00 58.08  ? 669 C   R "O2'" 1 
ATOM   2164 C  "C1'" . C   B 2 68 ? 3.010  7.453   15.707  1.00 57.11  ? 669 C   R "C1'" 1 
ATOM   2165 N  N1    . C   B 2 68 ? 2.258  8.377   14.780  1.00 52.27  ? 669 C   R N1    1 
ATOM   2166 C  C2    . C   B 2 68 ? 0.984  8.026   14.278  1.00 49.00  ? 669 C   R C2    1 
ATOM   2167 O  O2    . C   B 2 68 ? 0.453  6.951   14.589  1.00 45.59  ? 669 C   R O2    1 
ATOM   2168 N  N3    . C   B 2 68 ? 0.346  8.892   13.450  1.00 47.56  ? 669 C   R N3    1 
ATOM   2169 C  C4    . C   B 2 68 ? 0.919  10.053  13.114  1.00 48.78  ? 669 C   R C4    1 
ATOM   2170 N  N4    . C   B 2 68 ? 0.250  10.868  12.293  1.00 47.03  ? 669 C   R N4    1 
ATOM   2171 C  C5    . C   B 2 68 ? 2.208  10.431  13.607  1.00 49.92  ? 669 C   R C5    1 
ATOM   2172 C  C6    . C   B 2 68 ? 2.830  9.572   14.427  1.00 51.00  ? 669 C   R C6    1 
ATOM   2173 P  P     . G   B 2 69 ? 5.428  4.614   12.732  1.00 71.37  ? 75  G   R P     1 
ATOM   2174 O  OP1   . G   B 2 69 ? 6.788  4.138   12.394  1.00 72.21  ? 75  G   R OP1   1 
ATOM   2175 O  OP2   . G   B 2 69 ? 4.747  5.579   11.833  1.00 71.60  ? 75  G   R OP2   1 
ATOM   2176 O  "O5'" . G   B 2 69 ? 4.492  3.328   12.921  1.00 71.76  ? 75  G   R "O5'" 1 
ATOM   2177 C  "C5'" . G   B 2 69 ? 3.070  3.402   12.818  1.00 72.39  ? 75  G   R "C5'" 1 
ATOM   2178 C  "C4'" . G   B 2 69 ? 2.505  2.198   12.085  1.00 72.32  ? 75  G   R "C4'" 1 
ATOM   2179 O  "O4'" . G   B 2 69 ? 2.928  2.238   10.698  1.00 71.55  ? 75  G   R "O4'" 1 
ATOM   2180 C  "C3'" . G   B 2 69 ? 2.982  0.829   12.554  1.00 72.22  ? 75  G   R "C3'" 1 
ATOM   2181 O  "O3'" . G   B 2 69 ? 2.330  0.386   13.738  1.00 72.50  ? 75  G   R "O3'" 1 
ATOM   2182 C  "C2'" . G   B 2 69 ? 2.611  -0.005  11.334  1.00 72.20  ? 75  G   R "C2'" 1 
ATOM   2183 O  "O2'" . G   B 2 69 ? 1.225  -0.263  11.227  1.00 72.60  ? 75  G   R "O2'" 1 
ATOM   2184 C  "C1'" . G   B 2 69 ? 3.106  0.916   10.224  1.00 71.83  ? 75  G   R "C1'" 1 
ATOM   2185 N  N9    . G   B 2 69 ? 4.518  0.655   9.939   1.00 72.58  ? 75  G   R N9    1 
ATOM   2186 C  C8    . G   B 2 69 ? 5.625  1.352   10.376  1.00 72.56  ? 75  G   R C8    1 
ATOM   2187 N  N7    . G   B 2 69 ? 6.757  0.851   9.962   1.00 71.87  ? 75  G   R N7    1 
ATOM   2188 C  C5    . G   B 2 69 ? 6.383  -0.253  9.205   1.00 72.03  ? 75  G   R C5    1 
ATOM   2189 C  C6    . G   B 2 69 ? 7.173  -1.195  8.496   1.00 71.88  ? 75  G   R C6    1 
ATOM   2190 O  O6    . G   B 2 69 ? 8.407  -1.233  8.396   1.00 71.72  ? 75  G   R O6    1 
ATOM   2191 N  N1    . G   B 2 69 ? 6.391  -2.165  7.858   1.00 71.90  ? 75  G   R N1    1 
ATOM   2192 C  C2    . G   B 2 69 ? 5.013  -2.213  7.903   1.00 71.17  ? 75  G   R C2    1 
ATOM   2193 N  N2    . G   B 2 69 ? 4.417  -3.209  7.237   1.00 70.27  ? 75  G   R N2    1 
ATOM   2194 N  N3    . G   B 2 69 ? 4.263  -1.338  8.562   1.00 71.45  ? 75  G   R N3    1 
ATOM   2195 C  C4    . G   B 2 69 ? 5.009  -0.388  9.186   1.00 72.30  ? 75  G   R C4    1 
ATOM   2196 P  P     . G   B 2 70 ? 3.082  -0.613  14.742  1.00 72.31  ? 76  G   R P     1 
ATOM   2197 O  OP1   . G   B 2 70 ? 2.235  -0.759  15.946  1.00 73.30  ? 76  G   R OP1   1 
ATOM   2198 O  OP2   . G   B 2 70 ? 4.484  -0.167  14.903  1.00 72.40  ? 76  G   R OP2   1 
ATOM   2199 O  "O5'" . G   B 2 70 ? 3.086  -1.999  13.940  1.00 72.44  ? 76  G   R "O5'" 1 
ATOM   2200 C  "C5'" . G   B 2 70 ? 1.869  -2.705  13.702  1.00 72.32  ? 76  G   R "C5'" 1 
ATOM   2201 C  "C4'" . G   B 2 70 ? 2.065  -3.816  12.686  1.00 72.84  ? 76  G   R "C4'" 1 
ATOM   2202 O  "O4'" . G   B 2 70 ? 2.761  -3.308  11.519  1.00 73.09  ? 76  G   R "O4'" 1 
ATOM   2203 C  "C3'" . G   B 2 70 ? 2.928  -4.972  13.162  1.00 73.20  ? 76  G   R "C3'" 1 
ATOM   2204 O  "O3'" . G   B 2 70 ? 2.147  -5.923  13.861  1.00 73.40  ? 76  G   R "O3'" 1 
ATOM   2205 C  "C2'" . G   B 2 70 ? 3.451  -5.545  11.852  1.00 73.38  ? 76  G   R "C2'" 1 
ATOM   2206 O  "O2'" . G   B 2 70 ? 2.519  -6.398  11.214  1.00 75.40  ? 76  G   R "O2'" 1 
ATOM   2207 C  "C1'" . G   B 2 70 ? 3.679  -4.275  11.037  1.00 72.95  ? 76  G   R "C1'" 1 
ATOM   2208 N  N9    . G   B 2 70 ? 5.049  -3.756  11.134  1.00 71.95  ? 76  G   R N9    1 
ATOM   2209 C  C8    . G   B 2 70 ? 5.462  -2.595  11.746  1.00 71.23  ? 76  G   R C8    1 
ATOM   2210 N  N7    . G   B 2 70 ? 6.748  -2.390  11.673  1.00 70.22  ? 76  G   R N7    1 
ATOM   2211 C  C5    . G   B 2 70 ? 7.225  -3.485  10.968  1.00 70.28  ? 76  G   R C5    1 
ATOM   2212 C  C6    . G   B 2 70 ? 8.546  -3.814  10.576  1.00 70.42  ? 76  G   R C6    1 
ATOM   2213 O  O6    . G   B 2 70 ? 9.585  -3.174  10.791  1.00 70.51  ? 76  G   R O6    1 
ATOM   2214 N  N1    . G   B 2 70 ? 8.602  -5.016  9.868   1.00 70.17  ? 76  G   R N1    1 
ATOM   2215 C  C2    . G   B 2 70 ? 7.511  -5.803  9.576   1.00 70.03  ? 76  G   R C2    1 
ATOM   2216 N  N2    . G   B 2 70 ? 7.746  -6.927  8.885   1.00 69.97  ? 76  G   R N2    1 
ATOM   2217 N  N3    . G   B 2 70 ? 6.268  -5.503  9.934   1.00 70.63  ? 76  G   R N3    1 
ATOM   2218 C  C4    . G   B 2 70 ? 6.194  -4.335  10.626  1.00 71.07  ? 76  G   R C4    1 
ATOM   2219 P  P     . U   B 2 71 ? 2.713  -6.599  15.196  1.00 74.13  ? 77  U   R P     1 
ATOM   2220 O  OP1   . U   B 2 71 ? 1.720  -7.616  15.612  1.00 74.26  ? 77  U   R OP1   1 
ATOM   2221 O  OP2   . U   B 2 71 ? 3.118  -5.526  16.135  1.00 72.60  ? 77  U   R OP2   1 
ATOM   2222 O  "O5'" . U   B 2 71 ? 4.050  -7.336  14.719  1.00 73.80  ? 77  U   R "O5'" 1 
ATOM   2223 C  "C5'" . U   B 2 71 ? 4.029  -8.495  13.889  1.00 74.24  ? 77  U   R "C5'" 1 
ATOM   2224 C  "C4'" . U   B 2 71 ? 5.443  -8.860  13.476  1.00 74.39  ? 77  U   R "C4'" 1 
ATOM   2225 O  "O4'" . U   B 2 71 ? 5.985  -7.832  12.601  1.00 74.84  ? 77  U   R "O4'" 1 
ATOM   2226 C  "C3'" . U   B 2 71 ? 6.454  -8.899  14.615  1.00 73.90  ? 77  U   R "C3'" 1 
ATOM   2227 O  "O3'" . U   B 2 71 ? 6.376  -10.083 15.398  1.00 71.11  ? 77  U   R "O3'" 1 
ATOM   2228 C  "C2'" . U   B 2 71 ? 7.757  -8.737  13.847  1.00 74.30  ? 77  U   R "C2'" 1 
ATOM   2229 O  "O2'" . U   B 2 71 ? 8.099  -9.890  13.101  1.00 75.85  ? 77  U   R "O2'" 1 
ATOM   2230 C  "C1'" . U   B 2 71 ? 7.346  -7.585  12.932  1.00 74.63  ? 77  U   R "C1'" 1 
ATOM   2231 N  N1    . U   B 2 71 ? 7.492  -6.216  13.569  1.00 74.85  ? 77  U   R N1    1 
ATOM   2232 C  C2    . U   B 2 71 ? 8.744  -5.634  13.714  1.00 75.56  ? 77  U   R C2    1 
ATOM   2233 O  O2    . U   B 2 71 ? 9.786  -6.155  13.350  1.00 76.56  ? 77  U   R O2    1 
ATOM   2234 N  N3    . U   B 2 71 ? 8.741  -4.392  14.310  1.00 75.42  ? 77  U   R N3    1 
ATOM   2235 C  C4    . U   B 2 71 ? 7.641  -3.683  14.767  1.00 75.70  ? 77  U   R C4    1 
ATOM   2236 O  O4    . U   B 2 71 ? 7.785  -2.579  15.280  1.00 76.39  ? 77  U   R O4    1 
ATOM   2237 C  C5    . U   B 2 71 ? 6.377  -4.345  14.587  1.00 75.87  ? 77  U   R C5    1 
ATOM   2238 C  C6    . U   B 2 71 ? 6.362  -5.550  14.008  1.00 75.21  ? 77  U   R C6    1 
ATOM   2239 P  P     . A   B 2 72 ? 6.322  -9.915  16.991  1.00 69.61  ? 78  A   R P     1 
ATOM   2240 O  OP1   . A   B 2 72 ? 5.846  -11.191 17.566  1.00 69.08  ? 78  A   R OP1   1 
ATOM   2241 O  OP2   . A   B 2 72 ? 5.613  -8.654  17.309  1.00 69.17  ? 78  A   R OP2   1 
ATOM   2242 O  "O5'" . A   B 2 72 ? 7.855  -9.693  17.386  1.00 68.19  ? 78  A   R "O5'" 1 
ATOM   2243 C  "C5'" . A   B 2 72 ? 8.850  -10.615 16.967  1.00 66.24  ? 78  A   R "C5'" 1 
ATOM   2244 C  "C4'" . A   B 2 72 ? 10.207 -9.942  16.934  1.00 65.11  ? 78  A   R "C4'" 1 
ATOM   2245 O  "O4'" . A   B 2 72 ? 10.159 -8.722  16.153  1.00 64.17  ? 78  A   R "O4'" 1 
ATOM   2246 C  "C3'" . A   B 2 72 ? 10.704 -9.449  18.280  1.00 64.46  ? 78  A   R "C3'" 1 
ATOM   2247 O  "O3'" . A   B 2 72 ? 11.184 -10.521 19.070  1.00 64.45  ? 78  A   R "O3'" 1 
ATOM   2248 C  "C2'" . A   B 2 72 ? 11.810 -8.498  17.843  1.00 63.71  ? 78  A   R "C2'" 1 
ATOM   2249 O  "O2'" . A   B 2 72 ? 12.999 -9.159  17.453  1.00 63.20  ? 78  A   R "O2'" 1 
ATOM   2250 C  "C1'" . A   B 2 72 ? 11.138 -7.822  16.649  1.00 62.80  ? 78  A   R "C1'" 1 
ATOM   2251 N  N9    . A   B 2 72 ? 10.505 -6.551  17.007  1.00 60.44  ? 78  A   R N9    1 
ATOM   2252 C  C8    . A   B 2 72 ? 9.168  -6.291  17.131  1.00 59.67  ? 78  A   R C8    1 
ATOM   2253 N  N7    . A   B 2 72 ? 8.897  -5.051  17.467  1.00 59.06  ? 78  A   R N7    1 
ATOM   2254 C  C5    . A   B 2 72 ? 10.143 -4.454  17.575  1.00 58.42  ? 78  A   R C5    1 
ATOM   2255 C  C6    . A   B 2 72 ? 10.556 -3.141  17.903  1.00 58.02  ? 78  A   R C6    1 
ATOM   2256 N  N6    . A   B 2 72 ? 9.707  -2.150  18.199  1.00 56.38  ? 78  A   R N6    1 
ATOM   2257 N  N1    . A   B 2 72 ? 11.886 -2.880  17.918  1.00 57.36  ? 78  A   R N1    1 
ATOM   2258 C  C2    . A   B 2 72 ? 12.747 -3.865  17.624  1.00 57.20  ? 78  A   R C2    1 
ATOM   2259 N  N3    . A   B 2 72 ? 12.476 -5.133  17.303  1.00 58.27  ? 78  A   R N3    1 
ATOM   2260 C  C4    . A   B 2 72 ? 11.148 -5.366  17.296  1.00 58.98  ? 78  A   R C4    1 
ATOM   2261 P  P     . G   B 2 73 ? 10.928 -10.493 20.649  1.00 65.14  ? 79  G   R P     1 
ATOM   2262 O  OP1   . G   B 2 73 ? 11.299 -11.829 21.174  1.00 63.61  ? 79  G   R OP1   1 
ATOM   2263 O  OP2   . G   B 2 73 ? 9.574  -9.943  20.912  1.00 63.23  ? 79  G   R OP2   1 
ATOM   2264 O  "O5'" . G   B 2 73 ? 11.984 -9.399  21.147  1.00 61.88  ? 79  G   R "O5'" 1 
ATOM   2265 C  "C5'" . G   B 2 73 ? 13.378 -9.639  21.031  1.00 59.30  ? 79  G   R "C5'" 1 
ATOM   2266 C  "C4'" . G   B 2 73 ? 14.145 -8.353  21.257  1.00 58.01  ? 79  G   R "C4'" 1 
ATOM   2267 O  "O4'" . G   B 2 73 ? 13.671 -7.323  20.355  1.00 57.31  ? 79  G   R "O4'" 1 
ATOM   2268 C  "C3'" . G   B 2 73 ? 13.951 -7.693  22.613  1.00 57.77  ? 79  G   R "C3'" 1 
ATOM   2269 O  "O3'" . G   B 2 73 ? 14.661 -8.372  23.647  1.00 57.89  ? 79  G   R "O3'" 1 
ATOM   2270 C  "C2'" . G   B 2 73 ? 14.536 -6.321  22.310  1.00 56.72  ? 79  G   R "C2'" 1 
ATOM   2271 O  "O2'" . G   B 2 73 ? 15.951 -6.333  22.264  1.00 57.00  ? 79  G   R "O2'" 1 
ATOM   2272 C  "C1'" . G   B 2 73 ? 13.938 -6.053  20.929  1.00 54.88  ? 79  G   R "C1'" 1 
ATOM   2273 N  N9    . G   B 2 73 ? 12.706 -5.265  20.993  1.00 51.28  ? 79  G   R N9    1 
ATOM   2274 C  C8    . G   B 2 73 ? 11.420 -5.707  20.779  1.00 50.97  ? 79  G   R C8    1 
ATOM   2275 N  N7    . G   B 2 73 ? 10.516 -4.773  20.915  1.00 49.98  ? 79  G   R N7    1 
ATOM   2276 C  C5    . G   B 2 73 ? 11.247 -3.637  21.242  1.00 50.08  ? 79  G   R C5    1 
ATOM   2277 C  C6    . G   B 2 73 ? 10.812 -2.310  21.505  1.00 50.67  ? 79  G   R C6    1 
ATOM   2278 O  O6    . G   B 2 73 ? 9.651  -1.872  21.503  1.00 52.38  ? 79  G   R O6    1 
ATOM   2279 N  N1    . G   B 2 73 ? 11.877 -1.454  21.798  1.00 49.44  ? 79  G   R N1    1 
ATOM   2280 C  C2    . G   B 2 73 ? 13.203 -1.836  21.830  1.00 50.00  ? 79  G   R C2    1 
ATOM   2281 N  N2    . G   B 2 73 ? 14.100 -0.881  22.130  1.00 49.13  ? 79  G   R N2    1 
ATOM   2282 N  N3    . G   B 2 73 ? 13.620 -3.077  21.581  1.00 49.07  ? 79  G   R N3    1 
ATOM   2283 C  C4    . G   B 2 73 ? 12.596 -3.924  21.295  1.00 49.80  ? 79  G   R C4    1 
ATOM   2284 P  P     . G   B 2 74 ? 14.122 -8.350  25.160  1.00 57.66  ? 80  G   R P     1 
ATOM   2285 O  OP1   . G   B 2 74 ? 15.098 -9.124  25.964  1.00 57.33  ? 80  G   R OP1   1 
ATOM   2286 O  OP2   . G   B 2 74 ? 12.693 -8.743  25.173  1.00 55.14  ? 80  G   R OP2   1 
ATOM   2287 O  "O5'" . G   B 2 74 ? 14.209 -6.800  25.553  1.00 53.80  ? 80  G   R "O5'" 1 
ATOM   2288 C  "C5'" . G   B 2 74 ? 15.475 -6.243  25.869  1.00 52.46  ? 80  G   R "C5'" 1 
ATOM   2289 C  "C4'" . G   B 2 74 ? 15.433 -4.729  25.957  1.00 51.00  ? 80  G   R "C4'" 1 
ATOM   2290 O  "O4'" . G   B 2 74 ? 14.604 -4.164  24.918  1.00 49.65  ? 80  G   R "O4'" 1 
ATOM   2291 C  "C3'" . G   B 2 74 ? 14.770 -4.162  27.194  1.00 51.14  ? 80  G   R "C3'" 1 
ATOM   2292 O  "O3'" . G   B 2 74 ? 15.575 -4.364  28.347  1.00 52.84  ? 80  G   R "O3'" 1 
ATOM   2293 C  "C2'" . G   B 2 74 ? 14.648 -2.702  26.774  1.00 49.46  ? 80  G   R "C2'" 1 
ATOM   2294 O  "O2'" . G   B 2 74 ? 15.872 -1.998  26.843  1.00 48.81  ? 80  G   R "O2'" 1 
ATOM   2295 C  "C1'" . G   B 2 74 ? 14.205 -2.866  25.319  1.00 47.58  ? 80  G   R "C1'" 1 
ATOM   2296 N  N9    . G   B 2 74 ? 12.761 -2.739  25.118  1.00 45.43  ? 80  G   R N9    1 
ATOM   2297 C  C8    . G   B 2 74 ? 11.886 -3.721  24.714  1.00 43.16  ? 80  G   R C8    1 
ATOM   2298 N  N7    . G   B 2 74 ? 10.650 -3.313  24.622  1.00 43.61  ? 80  G   R N7    1 
ATOM   2299 C  C5    . G   B 2 74 ? 10.705 -1.975  24.988  1.00 42.89  ? 80  G   R C5    1 
ATOM   2300 C  C6    . G   B 2 74 ? 9.674  -1.014  25.075  1.00 42.76  ? 80  G   R C6    1 
ATOM   2301 O  O6    . G   B 2 74 ? 8.469  -1.184  24.835  1.00 45.44  ? 80  G   R O6    1 
ATOM   2302 N  N1    . G   B 2 74 ? 10.150 0.236   25.489  1.00 41.49  ? 80  G   R N1    1 
ATOM   2303 C  C2    . G   B 2 74 ? 11.471 0.513   25.778  1.00 41.84  ? 80  G   R C2    1 
ATOM   2304 N  N2    . G   B 2 74 ? 11.772 1.764   26.155  1.00 39.89  ? 80  G   R N2    1 
ATOM   2305 N  N3    . G   B 2 74 ? 12.447 -0.381  25.694  1.00 43.10  ? 80  G   R N3    1 
ATOM   2306 C  C4    . G   B 2 74 ? 11.996 -1.602  25.296  1.00 44.40  ? 80  G   R C4    1 
ATOM   2307 P  P     . U   B 2 75 ? 14.858 -4.790  29.716  1.00 52.40  ? 81  U   R P     1 
ATOM   2308 O  OP1   . U   B 2 75 ? 15.889 -5.311  30.644  1.00 51.65  ? 81  U   R OP1   1 
ATOM   2309 O  OP2   . U   B 2 75 ? 13.689 -5.635  29.391  1.00 50.77  ? 81  U   R OP2   1 
ATOM   2310 O  "O5'" . U   B 2 75 ? 14.320 -3.375  30.238  1.00 51.33  ? 81  U   R "O5'" 1 
ATOM   2311 C  "C5'" . U   B 2 75 ? 15.231 -2.303  30.495  1.00 50.78  ? 81  U   R "C5'" 1 
ATOM   2312 C  "C4'" . U   B 2 75 ? 14.473 -1.002  30.666  1.00 49.83  ? 81  U   R "C4'" 1 
ATOM   2313 O  "O4'" . U   B 2 75 ? 13.684 -0.746  29.482  1.00 50.87  ? 81  U   R "O4'" 1 
ATOM   2314 C  "C3'" . U   B 2 75 ? 13.426 -1.036  31.764  1.00 50.10  ? 81  U   R "C3'" 1 
ATOM   2315 O  "O3'" . U   B 2 75 ? 14.033 -0.837  33.036  1.00 49.50  ? 81  U   R "O3'" 1 
ATOM   2316 C  "C2'" . U   B 2 75 ? 12.480 0.091   31.351  1.00 49.41  ? 81  U   R "C2'" 1 
ATOM   2317 O  "O2'" . U   B 2 75 ? 12.910 1.380   31.745  1.00 50.56  ? 81  U   R "O2'" 1 
ATOM   2318 C  "C1'" . U   B 2 75 ? 12.508 -0.031  29.829  1.00 48.83  ? 81  U   R "C1'" 1 
ATOM   2319 N  N1    . U   B 2 75 ? 11.300 -0.724  29.270  1.00 47.38  ? 81  U   R N1    1 
ATOM   2320 C  C2    . U   B 2 75 ? 10.152 0.012   29.036  1.00 46.82  ? 81  U   R C2    1 
ATOM   2321 O  O2    . U   B 2 75 ? 10.065 1.211   29.258  1.00 47.68  ? 81  U   R O2    1 
ATOM   2322 N  N3    . U   B 2 75 ? 9.097  -0.711  28.527  1.00 44.94  ? 81  U   R N3    1 
ATOM   2323 C  C4    . U   B 2 75 ? 9.079  -2.065  28.232  1.00 46.49  ? 81  U   R C4    1 
ATOM   2324 O  O4    . U   B 2 75 ? 8.064  -2.577  27.774  1.00 48.37  ? 81  U   R O4    1 
ATOM   2325 C  C5    . U   B 2 75 ? 10.309 -2.767  28.497  1.00 46.21  ? 81  U   R C5    1 
ATOM   2326 C  C6    . U   B 2 75 ? 11.346 -2.082  28.998  1.00 47.52  ? 81  U   R C6    1 
ATOM   2327 P  P     . A   B 2 76 ? 13.798 -1.911  34.202  1.00 48.15  ? 82  A   R P     1 
ATOM   2328 O  OP1   . A   B 2 76 ? 14.290 -1.283  35.451  1.00 46.89  ? 82  A   R OP1   1 
ATOM   2329 O  OP2   . A   B 2 76 ? 14.356 -3.215  33.771  1.00 46.66  ? 82  A   R OP2   1 
ATOM   2330 O  "O5'" . A   B 2 76 ? 12.207 -2.069  34.249  1.00 44.82  ? 82  A   R "O5'" 1 
ATOM   2331 C  "C5'" . A   B 2 76 ? 11.417 -1.053  34.843  1.00 45.70  ? 82  A   R "C5'" 1 
ATOM   2332 C  "C4'" . A   B 2 76 ? 10.370 -1.627  35.781  1.00 45.95  ? 82  A   R "C4'" 1 
ATOM   2333 O  "O4'" . A   B 2 76 ? 9.539  -2.570  35.053  1.00 45.43  ? 82  A   R "O4'" 1 
ATOM   2334 C  "C3'" . A   B 2 76 ? 10.920 -2.369  36.999  1.00 45.36  ? 82  A   R "C3'" 1 
ATOM   2335 O  "O3'" . A   B 2 76 ? 10.210 -1.979  38.189  1.00 45.87  ? 82  A   R "O3'" 1 
ATOM   2336 C  "C2'" . A   B 2 76 ? 10.697 -3.831  36.622  1.00 45.35  ? 82  A   R "C2'" 1 
ATOM   2337 O  "O2'" . A   B 2 76 ? 10.535 -4.688  37.734  1.00 47.91  ? 82  A   R "O2'" 1 
ATOM   2338 C  "C1'" . A   B 2 76 ? 9.389  -3.719  35.851  1.00 44.92  ? 82  A   R "C1'" 1 
ATOM   2339 N  N9    . A   B 2 76 ? 9.070  -4.873  35.015  1.00 44.59  ? 82  A   R N9    1 
ATOM   2340 C  C8    . A   B 2 76 ? 9.914  -5.869  34.606  1.00 45.57  ? 82  A   R C8    1 
ATOM   2341 N  N7    . A   B 2 76 ? 9.336  -6.785  33.866  1.00 45.95  ? 82  A   R N7    1 
ATOM   2342 C  C5    . A   B 2 76 ? 8.023  -6.360  33.781  1.00 44.58  ? 82  A   R C5    1 
ATOM   2343 C  C6    . A   B 2 76 ? 6.889  -6.894  33.136  1.00 45.34  ? 82  A   R C6    1 
ATOM   2344 N  N6    . A   B 2 76 ? 6.917  -8.024  32.422  1.00 47.42  ? 82  A   R N6    1 
ATOM   2345 N  N1    . A   B 2 76 ? 5.720  -6.226  33.250  1.00 45.56  ? 82  A   R N1    1 
ATOM   2346 C  C2    . A   B 2 76 ? 5.693  -5.094  33.966  1.00 45.89  ? 82  A   R C2    1 
ATOM   2347 N  N3    . A   B 2 76 ? 6.694  -4.495  34.617  1.00 45.59  ? 82  A   R N3    1 
ATOM   2348 C  C4    . A   B 2 76 ? 7.841  -5.185  34.486  1.00 44.73  ? 82  A   R C4    1 
ATOM   2349 P  P     . G   B 2 77 ? 11.017 -1.506  39.497  1.00 47.83  ? 83  G   R P     1 
ATOM   2350 O  OP1   . G   B 2 77 ? 12.163 -2.423  39.702  1.00 45.31  ? 83  G   R OP1   1 
ATOM   2351 O  OP2   . G   B 2 77 ? 10.038 -1.282  40.585  1.00 49.31  ? 83  G   R OP2   1 
ATOM   2352 O  "O5'" . G   B 2 77 ? 11.600 -0.072  39.095  1.00 47.50  ? 83  G   R "O5'" 1 
ATOM   2353 C  "C5'" . G   B 2 77 ? 10.743 1.025   38.770  1.00 45.06  ? 83  G   R "C5'" 1 
ATOM   2354 C  "C4'" . G   B 2 77 ? 11.569 2.199   38.272  1.00 43.12  ? 83  G   R "C4'" 1 
ATOM   2355 O  "O4'" . G   B 2 77 ? 12.687 2.441   39.163  1.00 41.40  ? 83  G   R "O4'" 1 
ATOM   2356 C  "C3'" . G   B 2 77 ? 12.210 2.012   36.903  1.00 43.72  ? 83  G   R "C3'" 1 
ATOM   2357 O  "O3'" . G   B 2 77 ? 12.215 3.265   36.248  1.00 47.09  ? 83  G   R "O3'" 1 
ATOM   2358 C  "C2'" . G   B 2 77 ? 13.628 1.572   37.237  1.00 39.54  ? 83  G   R "C2'" 1 
ATOM   2359 O  "O2'" . G   B 2 77 ? 14.543 1.853   36.205  1.00 40.86  ? 83  G   R "O2'" 1 
ATOM   2360 C  "C1'" . G   B 2 77 ? 13.876 2.504   38.408  1.00 38.06  ? 83  G   R "C1'" 1 
ATOM   2361 N  N9    . G   B 2 77 ? 14.986 2.146   39.276  1.00 34.85  ? 83  G   R N9    1 
ATOM   2362 C  C8    . G   B 2 77 ? 15.352 0.889   39.689  1.00 34.47  ? 83  G   R C8    1 
ATOM   2363 N  N7    . G   B 2 77 ? 16.395 0.886   40.469  1.00 33.72  ? 83  G   R N7    1 
ATOM   2364 C  C5    . G   B 2 77 ? 16.739 2.227   40.581  1.00 32.97  ? 83  G   R C5    1 
ATOM   2365 C  C6    . G   B 2 77 ? 17.790 2.841   41.305  1.00 32.85  ? 83  G   R C6    1 
ATOM   2366 O  O6    . G   B 2 77 ? 18.644 2.303   42.017  1.00 36.28  ? 83  G   R O6    1 
ATOM   2367 N  N1    . G   B 2 77 ? 17.800 4.226   41.161  1.00 32.89  ? 83  G   R N1    1 
ATOM   2368 C  C2    . G   B 2 77 ? 16.893 4.933   40.407  1.00 34.15  ? 83  G   R C2    1 
ATOM   2369 N  N2    . G   B 2 77 ? 17.070 6.262   40.398  1.00 34.45  ? 83  G   R N2    1 
ATOM   2370 N  N3    . G   B 2 77 ? 15.895 4.374   39.719  1.00 32.54  ? 83  G   R N3    1 
ATOM   2371 C  C4    . G   B 2 77 ? 15.879 3.019   39.853  1.00 33.39  ? 83  G   R C4    1 
ATOM   2372 P  P     . C   B 2 78 ? 11.886 3.373   34.693  1.00 49.46  ? 84  C   R P     1 
ATOM   2373 O  OP1   . C   B 2 78 ? 11.613 2.030   34.141  1.00 48.44  ? 84  C   R OP1   1 
ATOM   2374 O  OP2   . C   B 2 78 ? 12.962 4.192   34.093  1.00 51.80  ? 84  C   R OP2   1 
ATOM   2375 O  "O5'" . C   B 2 78 ? 10.514 4.194   34.693  1.00 51.45  ? 84  C   R "O5'" 1 
ATOM   2376 C  "C5'" . C   B 2 78 ? 10.439 5.554   35.117  1.00 54.65  ? 84  C   R "C5'" 1 
ATOM   2377 C  "C4'" . C   B 2 78 ? 9.043  6.096   34.857  1.00 57.66  ? 84  C   R "C4'" 1 
ATOM   2378 O  "O4'" . C   B 2 78 ? 8.734  5.975   33.441  1.00 58.13  ? 84  C   R "O4'" 1 
ATOM   2379 C  "C3'" . C   B 2 78 ? 7.903  5.325   35.513  1.00 60.05  ? 84  C   R "C3'" 1 
ATOM   2380 O  "O3'" . C   B 2 78 ? 7.710  5.639   36.892  1.00 61.35  ? 84  C   R "O3'" 1 
ATOM   2381 C  "C2'" . C   B 2 78 ? 6.724  5.727   34.625  1.00 60.61  ? 84  C   R "C2'" 1 
ATOM   2382 O  "O2'" . C   B 2 78 ? 6.274  7.057   34.824  1.00 62.79  ? 84  C   R "O2'" 1 
ATOM   2383 C  "C1'" . C   B 2 78 ? 7.382  5.575   33.257  1.00 58.08  ? 84  C   R "C1'" 1 
ATOM   2384 N  N1    . C   B 2 78 ? 7.283  4.163   32.714  1.00 57.22  ? 84  C   R N1    1 
ATOM   2385 C  C2    . C   B 2 78 ? 6.070  3.701   32.163  1.00 57.45  ? 84  C   R C2    1 
ATOM   2386 O  O2    . C   B 2 78 ? 5.082  4.446   32.114  1.00 59.29  ? 84  C   R O2    1 
ATOM   2387 N  N3    . C   B 2 78 ? 6.002  2.429   31.686  1.00 55.60  ? 84  C   R N3    1 
ATOM   2388 C  C4    . C   B 2 78 ? 7.070  1.629   31.743  1.00 55.19  ? 84  C   R C4    1 
ATOM   2389 N  N4    . C   B 2 78 ? 6.947  0.390   31.264  1.00 54.87  ? 84  C   R N4    1 
ATOM   2390 C  C5    . C   B 2 78 ? 8.312  2.066   32.297  1.00 55.31  ? 84  C   R C5    1 
ATOM   2391 C  C6    . C   B 2 78 ? 8.367  3.321   32.761  1.00 56.34  ? 84  C   R C6    1 
ATOM   2392 P  P     . G   B 2 79 ? 6.866  4.631   37.815  1.00 63.25  ? 85  G   R P     1 
ATOM   2393 O  OP1   . G   B 2 79 ? 7.429  4.689   39.182  1.00 63.12  ? 85  G   R OP1   1 
ATOM   2394 O  OP2   . G   B 2 79 ? 6.750  3.317   37.143  1.00 62.60  ? 85  G   R OP2   1 
ATOM   2395 O  "O5'" . G   B 2 79 ? 5.422  5.312   37.804  1.00 60.33  ? 85  G   R "O5'" 1 
ATOM   2396 C  "C5'" . G   B 2 79 ? 4.291  4.526   38.093  1.00 59.21  ? 85  G   R "C5'" 1 
ATOM   2397 C  "C4'" . G   B 2 79 ? 3.159  4.854   37.141  1.00 59.01  ? 85  G   R "C4'" 1 
ATOM   2398 O  "O4'" . G   B 2 79 ? 3.589  4.833   35.754  1.00 58.55  ? 85  G   R "O4'" 1 
ATOM   2399 C  "C3'" . G   B 2 79 ? 2.047  3.828   37.153  1.00 59.27  ? 85  G   R "C3'" 1 
ATOM   2400 O  "O3'" . G   B 2 79 ? 1.275  3.953   38.327  1.00 60.57  ? 85  G   R "O3'" 1 
ATOM   2401 C  "C2'" . G   B 2 79 ? 1.325  4.175   35.858  1.00 57.90  ? 85  G   R "C2'" 1 
ATOM   2402 O  "O2'" . G   B 2 79 ? 0.601  5.387   35.895  1.00 58.82  ? 85  G   R "O2'" 1 
ATOM   2403 C  "C1'" . G   B 2 79 ? 2.548  4.294   34.949  1.00 56.89  ? 85  G   R "C1'" 1 
ATOM   2404 N  N9    . G   B 2 79 ? 2.969  2.989   34.430  1.00 54.26  ? 85  G   R N9    1 
ATOM   2405 C  C8    . G   B 2 79 ? 4.195  2.392   34.598  1.00 52.40  ? 85  G   R C8    1 
ATOM   2406 N  N7    . G   B 2 79 ? 4.286  1.222   34.034  1.00 52.13  ? 85  G   R N7    1 
ATOM   2407 C  C5    . G   B 2 79 ? 3.041  1.022   33.456  1.00 51.80  ? 85  G   R C5    1 
ATOM   2408 C  C6    . G   B 2 79 ? 2.545  -0.075  32.708  1.00 51.73  ? 85  G   R C6    1 
ATOM   2409 O  O6    . G   B 2 79 ? 3.131  -1.120  32.395  1.00 51.53  ? 85  G   R O6    1 
ATOM   2410 N  N1    . G   B 2 79 ? 1.227  0.118   32.302  1.00 51.72  ? 85  G   R N1    1 
ATOM   2411 C  C2    . G   B 2 79 ? 0.478  1.234   32.585  1.00 51.74  ? 85  G   R C2    1 
ATOM   2412 N  N2    . G   B 2 79 ? -0.777 1.244   32.113  1.00 52.75  ? 85  G   R N2    1 
ATOM   2413 N  N3    . G   B 2 79 ? 0.930  2.266   33.285  1.00 51.77  ? 85  G   R N3    1 
ATOM   2414 C  C4    . G   B 2 79 ? 2.216  2.099   33.689  1.00 52.38  ? 85  G   R C4    1 
ATOM   2415 P  P     . G   B 2 80 ? 1.228  2.708   39.335  1.00 62.35  ? 86  G   R P     1 
ATOM   2416 O  OP1   . G   B 2 80 ? 1.013  3.258   40.692  1.00 62.27  ? 86  G   R OP1   1 
ATOM   2417 O  OP2   . G   B 2 80 ? 2.383  1.811   39.084  1.00 59.97  ? 86  G   R OP2   1 
ATOM   2418 O  "O5'" . G   B 2 80 ? -0.087 1.934   38.852  1.00 61.06  ? 86  G   R "O5'" 1 
ATOM   2419 C  "C5'" . G   B 2 80 ? -1.254 2.660   38.457  1.00 60.52  ? 86  G   R "C5'" 1 
ATOM   2420 C  "C4'" . G   B 2 80 ? -2.023 1.921   37.377  1.00 58.96  ? 86  G   R "C4'" 1 
ATOM   2421 O  "O4'" . G   B 2 80 ? -1.228 1.792   36.170  1.00 60.02  ? 86  G   R "O4'" 1 
ATOM   2422 C  "C3'" . G   B 2 80 ? -2.355 0.482   37.713  1.00 58.00  ? 86  G   R "C3'" 1 
ATOM   2423 O  "O3'" . G   B 2 80 ? -3.443 0.418   38.619  1.00 57.37  ? 86  G   R "O3'" 1 
ATOM   2424 C  "C2'" . G   B 2 80 ? -2.676 -0.070  36.330  1.00 58.05  ? 86  G   R "C2'" 1 
ATOM   2425 O  "O2'" . G   B 2 80 ? -3.948 0.292   35.837  1.00 58.90  ? 86  G   R "O2'" 1 
ATOM   2426 C  "C1'" . G   B 2 80 ? -1.568 0.583   35.507  1.00 58.67  ? 86  G   R "C1'" 1 
ATOM   2427 N  N9    . G   B 2 80 ? -0.399 -0.296  35.406  1.00 58.68  ? 86  G   R N9    1 
ATOM   2428 C  C8    . G   B 2 80 ? 0.857  -0.098  35.933  1.00 57.81  ? 86  G   R C8    1 
ATOM   2429 N  N7    . G   B 2 80 ? 1.687  -1.073  35.683  1.00 57.19  ? 86  G   R N7    1 
ATOM   2430 C  C5    . G   B 2 80 ? 0.936  -1.981  34.947  1.00 57.25  ? 86  G   R C5    1 
ATOM   2431 C  C6    . G   B 2 80 ? 1.295  -3.236  34.393  1.00 57.26  ? 86  G   R C6    1 
ATOM   2432 O  O6    . G   B 2 80 ? 2.390  -3.808  34.454  1.00 58.09  ? 86  G   R O6    1 
ATOM   2433 N  N1    . G   B 2 80 ? 0.232  -3.843  33.722  1.00 57.48  ? 86  G   R N1    1 
ATOM   2434 C  C2    . G   B 2 80 ? -1.026 -3.296  33.595  1.00 58.19  ? 86  G   R C2    1 
ATOM   2435 N  N2    . G   B 2 80 ? -1.938 -4.007  32.914  1.00 58.42  ? 86  G   R N2    1 
ATOM   2436 N  N3    . G   B 2 80 ? -1.373 -2.125  34.112  1.00 57.80  ? 86  G   R N3    1 
ATOM   2437 C  C4    . G   B 2 80 ? -0.349 -1.521  34.770  1.00 57.74  ? 86  G   R C4    1 
ATOM   2438 P  P     . G   B 2 81 ? -3.358 -0.547  39.893  1.00 55.75  ? 87  G   R P     1 
ATOM   2439 O  OP1   . G   B 2 81 ? -4.558 -0.317  40.729  1.00 56.05  ? 87  G   R OP1   1 
ATOM   2440 O  OP2   . G   B 2 81 ? -2.015 -0.385  40.504  1.00 54.68  ? 87  G   R OP2   1 
ATOM   2441 O  "O5'" . G   B 2 81 ? -3.461 -2.002  39.228  1.00 53.17  ? 87  G   R "O5'" 1 
ATOM   2442 C  "C5'" . G   B 2 81 ? -4.602 -2.390  38.472  1.00 51.62  ? 87  G   R "C5'" 1 
ATOM   2443 C  "C4'" . G   B 2 81 ? -4.289 -3.619  37.640  1.00 52.46  ? 87  G   R "C4'" 1 
ATOM   2444 O  "O4'" . G   B 2 81 ? -3.197 -3.333  36.730  1.00 52.03  ? 87  G   R "O4'" 1 
ATOM   2445 C  "C3'" . G   B 2 81 ? -3.765 -4.810  38.420  1.00 52.68  ? 87  G   R "C3'" 1 
ATOM   2446 O  "O3'" . G   B 2 81 ? -4.805 -5.524  39.083  1.00 54.90  ? 87  G   R "O3'" 1 
ATOM   2447 C  "C2'" . G   B 2 81 ? -3.090 -5.615  37.312  1.00 51.73  ? 87  G   R "C2'" 1 
ATOM   2448 O  "O2'" . G   B 2 81 ? -3.989 -6.319  36.476  1.00 52.38  ? 87  G   R "O2'" 1 
ATOM   2449 C  "C1'" . G   B 2 81 ? -2.405 -4.494  36.542  1.00 50.01  ? 87  G   R "C1'" 1 
ATOM   2450 N  N9    . G   B 2 81 ? -1.035 -4.247  37.004  1.00 49.04  ? 87  G   R N9    1 
ATOM   2451 C  C8    . G   B 2 81 ? -0.571 -3.162  37.715  1.00 48.04  ? 87  G   R C8    1 
ATOM   2452 N  N7    . G   B 2 81 ? 0.703  -3.218  37.993  1.00 46.91  ? 87  G   R N7    1 
ATOM   2453 C  C5    . G   B 2 81 ? 1.118  -4.423  37.435  1.00 46.63  ? 87  G   R C5    1 
ATOM   2454 C  C6    . G   B 2 81 ? 2.399  -5.032  37.410  1.00 45.57  ? 87  G   R C6    1 
ATOM   2455 O  O6    . G   B 2 81 ? 3.458  -4.617  37.890  1.00 45.95  ? 87  G   R O6    1 
ATOM   2456 N  N1    . G   B 2 81 ? 2.393  -6.253  36.745  1.00 46.37  ? 87  G   R N1    1 
ATOM   2457 C  C2    . G   B 2 81 ? 1.282  -6.820  36.166  1.00 47.68  ? 87  G   R C2    1 
ATOM   2458 N  N2    . G   B 2 81 ? 1.468  -8.004  35.565  1.00 47.34  ? 87  G   R N2    1 
ATOM   2459 N  N3    . G   B 2 81 ? 0.075  -6.262  36.176  1.00 47.12  ? 87  G   R N3    1 
ATOM   2460 C  C4    . G   B 2 81 ? 0.062  -5.068  36.824  1.00 47.59  ? 87  G   R C4    1 
ATOM   2461 P  P     . G   B 2 82 ? -4.452 -6.318  40.437  1.00 57.33  ? 88  G   R P     1 
ATOM   2462 O  OP1   . G   B 2 82 ? -5.721 -6.800  41.027  1.00 56.38  ? 88  G   R OP1   1 
ATOM   2463 O  OP2   . G   B 2 82 ? -3.524 -5.481  41.237  1.00 55.25  ? 88  G   R OP2   1 
ATOM   2464 O  "O5'" . G   B 2 82 ? -3.626 -7.587  39.914  1.00 56.94  ? 88  G   R "O5'" 1 
ATOM   2465 C  "C5'" . G   B 2 82 ? -4.248 -8.549  39.058  1.00 56.89  ? 88  G   R "C5'" 1 
ATOM   2466 C  "C4'" . G   B 2 82 ? -3.237 -9.570  38.575  1.00 55.72  ? 88  G   R "C4'" 1 
ATOM   2467 O  "O4'" . G   B 2 82 ? -2.168 -8.913  37.850  1.00 55.49  ? 88  G   R "O4'" 1 
ATOM   2468 C  "C3'" . G   B 2 82 ? -2.501 -10.306 39.680  1.00 55.58  ? 88  G   R "C3'" 1 
ATOM   2469 O  "O3'" . G   B 2 82 ? -3.314 -11.336 40.231  1.00 55.95  ? 88  G   R "O3'" 1 
ATOM   2470 C  "C2'" . G   B 2 82 ? -1.291 -10.825 38.913  1.00 54.34  ? 88  G   R "C2'" 1 
ATOM   2471 O  "O2'" . G   B 2 82 ? -1.605 -11.912 38.070  1.00 54.19  ? 88  G   R "O2'" 1 
ATOM   2472 C  "C1'" . G   B 2 82 ? -0.949 -9.601  38.069  1.00 53.58  ? 88  G   R "C1'" 1 
ATOM   2473 N  N9    . G   B 2 82 ? -0.002 -8.686  38.711  1.00 52.96  ? 88  G   R N9    1 
ATOM   2474 C  C8    . G   B 2 82 ? -0.277 -7.436  39.218  1.00 53.54  ? 88  G   R C8    1 
ATOM   2475 N  N7    . G   B 2 82 ? 0.758  -6.834  39.739  1.00 52.35  ? 88  G   R N7    1 
ATOM   2476 C  C5    . G   B 2 82 ? 1.789  -7.746  39.569  1.00 51.27  ? 88  G   R C5    1 
ATOM   2477 C  C6    . G   B 2 82 ? 3.152  -7.648  39.933  1.00 50.82  ? 88  G   R C6    1 
ATOM   2478 O  O6    . G   B 2 82 ? 3.722  -6.708  40.501  1.00 51.78  ? 88  G   R O6    1 
ATOM   2479 N  N1    . G   B 2 82 ? 3.875  -8.788  39.587  1.00 50.54  ? 88  G   R N1    1 
ATOM   2480 C  C2    . G   B 2 82 ? 3.341  -9.889  38.958  1.00 50.86  ? 88  G   R C2    1 
ATOM   2481 N  N2    . G   B 2 82 ? 4.192  -10.891 38.700  1.00 49.84  ? 88  G   R N2    1 
ATOM   2482 N  N3    . G   B 2 82 ? 2.062  -9.993  38.606  1.00 50.71  ? 88  G   R N3    1 
ATOM   2483 C  C4    . G   B 2 82 ? 1.343  -8.890  38.940  1.00 51.31  ? 88  G   R C4    1 
ATOM   2484 P  P     . U   B 2 83 ? -3.334 -11.564 41.818  1.00 56.48  ? 89  U   R P     1 
ATOM   2485 O  OP1   . U   B 2 83 ? -4.350 -12.600 42.112  1.00 56.34  ? 89  U   R OP1   1 
ATOM   2486 O  OP2   . U   B 2 83 ? -3.425 -10.244 42.482  1.00 54.55  ? 89  U   R OP2   1 
ATOM   2487 O  "O5'" . U   B 2 83 ? -1.879 -12.165 42.103  1.00 54.15  ? 89  U   R "O5'" 1 
ATOM   2488 C  "C5'" . U   B 2 83 ? -1.553 -13.490 41.679  1.00 53.12  ? 89  U   R "C5'" 1 
ATOM   2489 C  "C4'" . U   B 2 83 ? -0.059 -13.733 41.777  1.00 51.71  ? 89  U   R "C4'" 1 
ATOM   2490 O  "O4'" . U   B 2 83 ? 0.647  -12.686 41.068  1.00 51.86  ? 89  U   R "O4'" 1 
ATOM   2491 C  "C3'" . U   B 2 83 ? 0.517  -13.633 43.181  1.00 51.13  ? 89  U   R "C3'" 1 
ATOM   2492 O  "O3'" . U   B 2 83 ? 0.299  -14.812 43.934  1.00 48.90  ? 89  U   R "O3'" 1 
ATOM   2493 C  "C2'" . U   B 2 83 ? 1.989  -13.390 42.882  1.00 50.59  ? 89  U   R "C2'" 1 
ATOM   2494 O  "O2'" . U   B 2 83 ? 2.651  -14.558 42.455  1.00 52.53  ? 89  U   R "O2'" 1 
ATOM   2495 C  "C1'" . U   B 2 83 ? 1.876  -12.408 41.724  1.00 51.16  ? 89  U   R "C1'" 1 
ATOM   2496 N  N1    . U   B 2 83 ? 1.939  -10.973 42.165  1.00 52.58  ? 89  U   R N1    1 
ATOM   2497 C  C2    . U   B 2 83 ? 3.180  -10.398 42.367  1.00 53.85  ? 89  U   R C2    1 
ATOM   2498 O  O2    . U   B 2 83 ? 4.232  -10.983 42.204  1.00 56.49  ? 89  U   R O2    1 
ATOM   2499 N  N3    . U   B 2 83 ? 3.157  -9.088  42.774  1.00 55.13  ? 89  U   R N3    1 
ATOM   2500 C  C4    . U   B 2 83 ? 2.040  -8.301  42.996  1.00 56.18  ? 89  U   R C4    1 
ATOM   2501 O  O4    . U   B 2 83 ? 2.195  -7.136  43.355  1.00 58.79  ? 89  U   R O4    1 
ATOM   2502 C  C5    . U   B 2 83 ? 0.775  -8.959  42.768  1.00 54.63  ? 89  U   R C5    1 
ATOM   2503 C  C6    . U   B 2 83 ? 0.776  -10.241 42.373  1.00 54.47  ? 89  U   R C6    1 
ATOM   2504 P  P     . U   B 2 84 ? 0.075  -14.665 45.511  1.00 48.67  ? 90  U   R P     1 
ATOM   2505 O  OP1   . U   B 2 84 ? -0.506 -15.933 46.007  1.00 47.76  ? 90  U   R OP1   1 
ATOM   2506 O  OP2   . U   B 2 84 ? -0.603 -13.374 45.774  1.00 46.97  ? 90  U   R OP2   1 
ATOM   2507 O  "O5'" . U   B 2 84 ? 1.566  -14.536 46.062  1.00 46.20  ? 90  U   R "O5'" 1 
ATOM   2508 C  "C5'" . U   B 2 84 ? 2.420  -15.654 45.969  1.00 44.74  ? 90  U   R "C5'" 1 
ATOM   2509 C  "C4'" . U   B 2 84 ? 3.838  -15.242 46.274  1.00 43.30  ? 90  U   R "C4'" 1 
ATOM   2510 O  "O4'" . U   B 2 84 ? 4.267  -14.197 45.366  1.00 42.68  ? 90  U   R "O4'" 1 
ATOM   2511 C  "C3'" . U   B 2 84 ? 4.019  -14.594 47.631  1.00 42.37  ? 90  U   R "C3'" 1 
ATOM   2512 O  "O3'" . U   B 2 84 ? 4.017  -15.566 48.651  1.00 44.11  ? 90  U   R "O3'" 1 
ATOM   2513 C  "C2'" . U   B 2 84 ? 5.393  -13.977 47.427  1.00 41.27  ? 90  U   R "C2'" 1 
ATOM   2514 O  "O2'" . U   B 2 84 ? 6.438  -14.925 47.499  1.00 38.75  ? 90  U   R "O2'" 1 
ATOM   2515 C  "C1'" . U   B 2 84 ? 5.238  -13.396 46.022  1.00 41.69  ? 90  U   R "C1'" 1 
ATOM   2516 N  N1    . U   B 2 84 ? 4.800  -11.952 46.073  1.00 41.46  ? 90  U   R N1    1 
ATOM   2517 C  C2    . U   B 2 84 ? 5.723  -10.971 46.409  1.00 40.57  ? 90  U   R C2    1 
ATOM   2518 O  O2    . U   B 2 84 ? 6.893  -11.198 46.655  1.00 39.08  ? 90  U   R O2    1 
ATOM   2519 N  N3    . U   B 2 84 ? 5.225  -9.689  46.447  1.00 40.46  ? 90  U   R N3    1 
ATOM   2520 C  C4    . U   B 2 84 ? 3.922  -9.295  46.186  1.00 42.05  ? 90  U   R C4    1 
ATOM   2521 O  O4    . U   B 2 84 ? 3.621  -8.106  46.254  1.00 45.54  ? 90  U   R O4    1 
ATOM   2522 C  C5    . U   B 2 84 ? 3.015  -10.365 45.851  1.00 40.72  ? 90  U   R C5    1 
ATOM   2523 C  C6    . U   B 2 84 ? 3.478  -11.621 45.811  1.00 40.94  ? 90  U   R C6    1 
ATOM   2524 P  P     . A   B 2 85 ? 3.462  -15.202 50.108  1.00 44.99  ? 91  A   R P     1 
ATOM   2525 O  OP1   . A   B 2 85 ? 3.420  -16.465 50.879  1.00 45.40  ? 91  A   R OP1   1 
ATOM   2526 O  OP2   . A   B 2 85 ? 2.227  -14.392 49.957  1.00 42.04  ? 91  A   R OP2   1 
ATOM   2527 O  "O5'" . A   B 2 85 ? 4.617  -14.274 50.722  1.00 44.06  ? 91  A   R "O5'" 1 
ATOM   2528 C  "C5'" . A   B 2 85 ? 5.928  -14.786 50.971  1.00 43.66  ? 91  A   R "C5'" 1 
ATOM   2529 C  "C4'" . A   B 2 85 ? 6.948  -13.660 51.058  1.00 44.12  ? 91  A   R "C4'" 1 
ATOM   2530 O  "O4'" . A   B 2 85 ? 6.797  -12.722 49.964  1.00 44.00  ? 91  A   R "O4'" 1 
ATOM   2531 C  "C3'" . A   B 2 85 ? 6.797  -12.761 52.266  1.00 45.38  ? 91  A   R "C3'" 1 
ATOM   2532 O  "O3'" . A   B 2 85 ? 7.362  -13.380 53.398  1.00 46.03  ? 91  A   R "O3'" 1 
ATOM   2533 C  "C2'" . A   B 2 85 ? 7.574  -11.521 51.838  1.00 44.50  ? 91  A   R "C2'" 1 
ATOM   2534 O  "O2'" . A   B 2 85 ? 8.978  -11.680 51.941  1.00 44.63  ? 91  A   R "O2'" 1 
ATOM   2535 C  "C1'" . A   B 2 85 ? 7.169  -11.417 50.372  1.00 41.87  ? 91  A   R "C1'" 1 
ATOM   2536 N  N9    . A   B 2 85 ? 6.071  -10.481 50.111  1.00 39.40  ? 91  A   R N9    1 
ATOM   2537 C  C8    . A   B 2 85 ? 4.790  -10.788 49.731  1.00 38.55  ? 91  A   R C8    1 
ATOM   2538 N  N7    . A   B 2 85 ? 4.010  -9.742  49.557  1.00 36.24  ? 91  A   R N7    1 
ATOM   2539 C  C5    . A   B 2 85 ? 4.835  -8.670  49.840  1.00 35.05  ? 91  A   R C5    1 
ATOM   2540 C  C6    . A   B 2 85 ? 4.612  -7.278  49.845  1.00 34.55  ? 91  A   R C6    1 
ATOM   2541 N  N6    . A   B 2 85 ? 3.435  -6.728  49.538  1.00 33.41  ? 91  A   R N6    1 
ATOM   2542 N  N1    . A   B 2 85 ? 5.644  -6.470  50.178  1.00 35.06  ? 91  A   R N1    1 
ATOM   2543 C  C2    . A   B 2 85 ? 6.827  -7.024  50.485  1.00 35.95  ? 91  A   R C2    1 
ATOM   2544 N  N3    . A   B 2 85 ? 7.157  -8.319  50.516  1.00 36.05  ? 91  A   R N3    1 
ATOM   2545 C  C4    . A   B 2 85 ? 6.109  -9.101  50.181  1.00 37.46  ? 91  A   R C4    1 
ATOM   2546 P  P     . C   B 2 86 ? 6.789  -13.028 54.847  1.00 48.12  ? 92  C   R P     1 
ATOM   2547 O  OP1   . C   B 2 86 ? 6.771  -14.310 55.590  1.00 48.81  ? 92  C   R OP1   1 
ATOM   2548 O  OP2   . C   B 2 86 ? 5.542  -12.228 54.736  1.00 44.57  ? 92  C   R OP2   1 
ATOM   2549 O  "O5'" . C   B 2 86 ? 7.933  -12.066 55.427  1.00 48.26  ? 92  C   R "O5'" 1 
ATOM   2550 C  "C5'" . C   B 2 86 ? 9.231  -12.573 55.725  1.00 49.47  ? 92  C   R "C5'" 1 
ATOM   2551 C  "C4'" . C   B 2 86 ? 10.101 -11.516 56.382  1.00 52.54  ? 92  C   R "C4'" 1 
ATOM   2552 O  "O4'" . C   B 2 86 ? 10.443 -10.494 55.409  1.00 52.45  ? 92  C   R "O4'" 1 
ATOM   2553 C  "C3'" . C   B 2 86 ? 9.467  -10.732 57.525  1.00 54.93  ? 92  C   R "C3'" 1 
ATOM   2554 O  "O3'" . C   B 2 86 ? 9.573  -11.442 58.753  1.00 59.24  ? 92  C   R "O3'" 1 
ATOM   2555 C  "C2'" . C   B 2 86 ? 10.325 -9.471  57.529  1.00 53.80  ? 92  C   R "C2'" 1 
ATOM   2556 O  "O2'" . C   B 2 86 ? 11.572 -9.651  58.178  1.00 56.21  ? 92  C   R "O2'" 1 
ATOM   2557 C  "C1'" . C   B 2 86 ? 10.521 -9.225  56.037  1.00 51.06  ? 92  C   R "C1'" 1 
ATOM   2558 N  N1    . C   B 2 86 ? 9.491  -8.287  55.465  1.00 48.29  ? 92  C   R N1    1 
ATOM   2559 C  C2    . C   B 2 86 ? 9.610  -6.899  55.667  1.00 47.94  ? 92  C   R C2    1 
ATOM   2560 O  O2    . C   B 2 86 ? 10.568 -6.447  56.314  1.00 49.20  ? 92  C   R O2    1 
ATOM   2561 N  N3    . C   B 2 86 ? 8.660  -6.075  55.142  1.00 45.47  ? 92  C   R N3    1 
ATOM   2562 C  C4    . C   B 2 86 ? 7.636  -6.584  54.448  1.00 45.47  ? 92  C   R C4    1 
ATOM   2563 N  N4    . C   B 2 86 ? 6.725  -5.741  53.948  1.00 46.21  ? 92  C   R N4    1 
ATOM   2564 C  C5    . C   B 2 86 ? 7.497  -7.987  54.232  1.00 45.83  ? 92  C   R C5    1 
ATOM   2565 C  C6    . C   B 2 86 ? 8.434  -8.787  54.751  1.00 47.06  ? 92  C   R C6    1 
ATOM   2566 P  P     . C   B 2 87 ? 8.530  -11.192 59.941  1.00 62.53  ? 93  C   R P     1 
ATOM   2567 O  OP1   . C   B 2 87 ? 8.886  -12.134 61.027  1.00 61.81  ? 93  C   R OP1   1 
ATOM   2568 O  OP2   . C   B 2 87 ? 7.161  -11.180 59.374  1.00 62.77  ? 93  C   R OP2   1 
ATOM   2569 O  "O5'" . C   B 2 87 ? 8.842  -9.697  60.413  1.00 62.73  ? 93  C   R "O5'" 1 
ATOM   2570 C  "C5'" . C   B 2 87 ? 10.038 -9.370  61.116  1.00 63.71  ? 93  C   R "C5'" 1 
ATOM   2571 C  "C4'" . C   B 2 87 ? 10.062 -7.877  61.377  1.00 64.24  ? 93  C   R "C4'" 1 
ATOM   2572 O  "O4'" . C   B 2 87 ? 9.922  -7.159  60.127  1.00 62.97  ? 93  C   R "O4'" 1 
ATOM   2573 C  "C3'" . C   B 2 87 ? 8.895  -7.386  62.212  1.00 65.58  ? 93  C   R "C3'" 1 
ATOM   2574 O  "O3'" . C   B 2 87 ? 9.208  -7.548  63.587  1.00 69.98  ? 93  C   R "O3'" 1 
ATOM   2575 C  "C2'" . C   B 2 87 ? 8.757  -5.924  61.792  1.00 63.66  ? 93  C   R "C2'" 1 
ATOM   2576 O  "O2'" . C   B 2 87 ? 9.588  -5.036  62.514  1.00 65.57  ? 93  C   R "O2'" 1 
ATOM   2577 C  "C1'" . C   B 2 87 ? 9.186  -5.964  60.329  1.00 60.61  ? 93  C   R "C1'" 1 
ATOM   2578 N  N1    . C   B 2 87 ? 8.031  -5.894  59.374  1.00 57.06  ? 93  C   R N1    1 
ATOM   2579 C  C2    . C   B 2 87 ? 7.417  -4.656  59.104  1.00 57.01  ? 93  C   R C2    1 
ATOM   2580 O  O2    . C   B 2 87 ? 7.826  -3.622  59.652  1.00 58.45  ? 93  C   R O2    1 
ATOM   2581 N  N3    . C   B 2 87 ? 6.374  -4.615  58.237  1.00 54.97  ? 93  C   R N3    1 
ATOM   2582 C  C4    . C   B 2 87 ? 5.945  -5.733  57.653  1.00 53.89  ? 93  C   R C4    1 
ATOM   2583 N  N4    . C   B 2 87 ? 4.919  -5.630  56.806  1.00 53.67  ? 93  C   R N4    1 
ATOM   2584 C  C5    . C   B 2 87 ? 6.548  -7.001  57.910  1.00 54.10  ? 93  C   R C5    1 
ATOM   2585 C  C6    . C   B 2 87 ? 7.576  -7.033  58.767  1.00 55.05  ? 93  C   R C6    1 
ATOM   2586 P  P     . G   B 2 88 ? 8.200  -8.323  64.560  1.00 72.12  ? 94  G   R P     1 
ATOM   2587 O  OP1   . G   B 2 88 ? 8.924  -8.527  65.835  1.00 72.35  ? 94  G   R OP1   1 
ATOM   2588 O  OP2   . G   B 2 88 ? 7.638  -9.492  63.844  1.00 71.76  ? 94  G   R OP2   1 
ATOM   2589 O  "O5'" . G   B 2 88 ? 7.017  -7.265  64.766  1.00 72.76  ? 94  G   R "O5'" 1 
ATOM   2590 C  "C5'" . G   B 2 88 ? 7.316  -5.954  65.232  1.00 75.85  ? 94  G   R "C5'" 1 
ATOM   2591 C  "C4'" . G   B 2 88 ? 6.274  -4.962  64.751  1.00 78.99  ? 94  G   R "C4'" 1 
ATOM   2592 O  "O4'" . G   B 2 88 ? 6.011  -5.149  63.333  1.00 78.53  ? 94  G   R "O4'" 1 
ATOM   2593 C  "C3'" . G   B 2 88 ? 4.927  -5.073  65.462  1.00 81.20  ? 94  G   R "C3'" 1 
ATOM   2594 O  "O3'" . G   B 2 88 ? 4.539  -3.799  65.972  1.00 87.68  ? 94  G   R "O3'" 1 
ATOM   2595 C  "C2'" . G   B 2 88 ? 3.990  -5.521  64.346  1.00 79.31  ? 94  G   R "C2'" 1 
ATOM   2596 O  "O2'" . G   B 2 88 ? 2.671  -5.047  64.513  1.00 79.21  ? 94  G   R "O2'" 1 
ATOM   2597 C  "C1'" . G   B 2 88 ? 4.645  -4.868  63.134  1.00 77.81  ? 94  G   R "C1'" 1 
ATOM   2598 N  N9    . G   B 2 88 ? 4.148  -5.408  61.869  1.00 75.37  ? 94  G   R N9    1 
ATOM   2599 C  C8    . G   B 2 88 ? 4.129  -6.733  61.501  1.00 74.93  ? 94  G   R C8    1 
ATOM   2600 N  N7    . G   B 2 88 ? 3.609  -6.945  60.327  1.00 73.75  ? 94  G   R N7    1 
ATOM   2601 C  C5    . G   B 2 88 ? 3.254  -5.680  59.882  1.00 72.45  ? 94  G   R C5    1 
ATOM   2602 C  C6    . G   B 2 88 ? 2.640  -5.288  58.666  1.00 70.81  ? 94  G   R C6    1 
ATOM   2603 O  O6    . G   B 2 88 ? 2.292  -6.010  57.724  1.00 69.88  ? 94  G   R O6    1 
ATOM   2604 N  N1    . G   B 2 88 ? 2.446  -3.911  58.586  1.00 70.40  ? 94  G   R N1    1 
ATOM   2605 C  C2    . G   B 2 88 ? 2.800  -3.019  59.572  1.00 71.08  ? 94  G   R C2    1 
ATOM   2606 N  N2    . G   B 2 88 ? 2.528  -1.731  59.314  1.00 68.72  ? 94  G   R N2    1 
ATOM   2607 N  N3    . G   B 2 88 ? 3.374  -3.374  60.725  1.00 72.04  ? 94  G   R N3    1 
ATOM   2608 C  C4    . G   B 2 88 ? 3.574  -4.718  60.818  1.00 73.22  ? 94  G   R C4    1 
ATOM   2609 P  P     . A   B 2 89 ? 4.584  -3.446  67.537  1.00 92.04  ? 95  A   R P     1 
ATOM   2610 O  OP1   . A   B 2 89 ? 5.975  -3.080  67.889  1.00 91.19  ? 95  A   R OP1   1 
ATOM   2611 O  OP2   . A   B 2 89 ? 3.890  -4.527  68.276  1.00 92.46  ? 95  A   R OP2   1 
ATOM   2612 O  "O5'" . A   B 2 89 ? 3.680  -2.127  67.620  1.00 93.23  ? 95  A   R "O5'" 1 
ATOM   2613 C  "C5'" . A   B 2 89 ? 3.859  -1.104  66.652  1.00 97.33  ? 95  A   R "C5'" 1 
ATOM   2614 C  "C4'" . A   B 2 89 ? 4.415  0.161   67.278  1.00 100.21 ? 95  A   R "C4'" 1 
ATOM   2615 O  "O4'" . A   B 2 89 ? 5.166  0.911   66.286  1.00 101.29 ? 95  A   R "O4'" 1 
ATOM   2616 C  "C3'" . A   B 2 89 ? 3.365  1.124   67.816  1.00 102.08 ? 95  A   R "C3'" 1 
ATOM   2617 O  "O3'" . A   B 2 89 ? 3.881  1.747   68.988  1.00 105.23 ? 95  A   R "O3'" 1 
ATOM   2618 C  "C2'" . A   B 2 89 ? 3.173  2.098   66.652  1.00 102.18 ? 95  A   R "C2'" 1 
ATOM   2619 O  "O2'" . A   B 2 89 ? 2.683  3.363   67.050  1.00 101.40 ? 95  A   R "O2'" 1 
ATOM   2620 C  "C1'" . A   B 2 89 ? 4.599  2.198   66.117  1.00 102.63 ? 95  A   R "C1'" 1 
ATOM   2621 N  N9    . A   B 2 89 ? 4.703  2.597   64.710  1.00 103.68 ? 95  A   R N9    1 
ATOM   2622 C  C8    . A   B 2 89 ? 5.176  3.793   64.247  1.00 104.22 ? 95  A   R C8    1 
ATOM   2623 N  N7    . A   B 2 89 ? 5.169  3.904   62.940  1.00 104.41 ? 95  A   R N7    1 
ATOM   2624 C  C5    . A   B 2 89 ? 4.651  2.697   62.509  1.00 104.59 ? 95  A   R C5    1 
ATOM   2625 C  C6    . A   B 2 89 ? 4.384  2.185   61.220  1.00 104.89 ? 95  A   R C6    1 
ATOM   2626 N  N6    . A   B 2 89 ? 4.622  2.867   60.095  1.00 105.17 ? 95  A   R N6    1 
ATOM   2627 N  N1    . A   B 2 89 ? 3.870  0.938   61.130  1.00 105.05 ? 95  A   R N1    1 
ATOM   2628 C  C2    . A   B 2 89 ? 3.635  0.253   62.259  1.00 104.88 ? 95  A   R C2    1 
ATOM   2629 N  N3    . A   B 2 89 ? 3.844  0.631   63.523  1.00 104.66 ? 95  A   R N3    1 
ATOM   2630 C  C4    . A   B 2 89 ? 4.359  1.874   63.585  1.00 104.33 ? 95  A   R C4    1 
ATOM   2631 P  P     . U   B 2 90 ? 3.059  1.780   70.362  1.00 107.65 ? 96  U   R P     1 
ATOM   2632 O  OP1   . U   B 2 90 ? 2.059  2.865   70.231  1.00 107.76 ? 96  U   R OP1   1 
ATOM   2633 O  OP2   . U   B 2 90 ? 4.049  1.829   71.465  1.00 107.27 ? 96  U   R OP2   1 
ATOM   2634 O  "O5'" . U   B 2 90 ? 2.286  0.372   70.414  1.00 108.85 ? 96  U   R "O5'" 1 
ATOM   2635 C  "C5'" . U   B 2 90 ? 2.763  -0.727  71.197  1.00 110.91 ? 96  U   R "C5'" 1 
ATOM   2636 C  "C4'" . U   B 2 90 ? 1.848  -1.029  72.374  1.00 112.56 ? 96  U   R "C4'" 1 
ATOM   2637 O  "O4'" . U   B 2 90 ? 1.519  0.189   73.104  1.00 114.42 ? 96  U   R "O4'" 1 
ATOM   2638 C  "C3'" . U   B 2 90 ? 0.461  -1.556  72.036  1.00 112.56 ? 96  U   R "C3'" 1 
ATOM   2639 O  "O3'" . U   B 2 90 ? 0.450  -2.900  71.570  1.00 110.11 ? 96  U   R "O3'" 1 
ATOM   2640 C  "C2'" . U   B 2 90 ? -0.227 -1.363  73.386  1.00 114.12 ? 96  U   R "C2'" 1 
ATOM   2641 O  "O2'" . U   B 2 90 ? 0.231  -2.231  74.407  1.00 114.58 ? 96  U   R "O2'" 1 
ATOM   2642 C  "C1'" . U   B 2 90 ? 0.209  0.076   73.652  1.00 115.24 ? 96  U   R "C1'" 1 
ATOM   2643 N  N1    . U   B 2 90 ? -0.758 1.066   73.034  1.00 117.03 ? 96  U   R N1    1 
ATOM   2644 C  C2    . U   B 2 90 ? -1.907 1.419   73.730  1.00 117.89 ? 96  U   R C2    1 
ATOM   2645 O  O2    . U   B 2 90 ? -2.191 0.994   74.839  1.00 117.99 ? 96  U   R O2    1 
ATOM   2646 N  N3    . U   B 2 90 ? -2.726 2.313   73.074  1.00 118.50 ? 96  U   R N3    1 
ATOM   2647 C  C4    . U   B 2 90 ? -2.529 2.874   71.821  1.00 118.71 ? 96  U   R C4    1 
ATOM   2648 O  O4    . U   B 2 90 ? -3.353 3.660   71.365  1.00 119.12 ? 96  U   R O4    1 
ATOM   2649 C  C5    . U   B 2 90 ? -1.321 2.459   71.153  1.00 118.47 ? 96  U   R C5    1 
ATOM   2650 C  C6    . U   B 2 90 ? -0.509 1.591   71.771  1.00 117.95 ? 96  U   R C6    1 
ATOM   2651 P  P     . G   B 2 91 ? -0.719 -3.356  70.570  1.00 108.46 ? 97  G   R P     1 
ATOM   2652 O  OP1   . G   B 2 91 ? -1.958 -3.506  71.369  1.00 108.16 ? 97  G   R OP1   1 
ATOM   2653 O  OP2   . G   B 2 91 ? -0.210 -4.515  69.800  1.00 108.55 ? 97  G   R OP2   1 
ATOM   2654 O  "O5'" . G   B 2 91 ? -0.898 -2.100  69.579  1.00 105.18 ? 97  G   R "O5'" 1 
ATOM   2655 C  "C5'" . G   B 2 91 ? -0.395 -2.109  68.239  1.00 99.41  ? 97  G   R "C5'" 1 
ATOM   2656 C  "C4'" . G   B 2 91 ? -0.451 -0.724  67.616  1.00 95.40  ? 97  G   R "C4'" 1 
ATOM   2657 O  "O4'" . G   B 2 91 ? 0.728  -0.514  66.795  1.00 94.32  ? 97  G   R "O4'" 1 
ATOM   2658 C  "C3'" . G   B 2 91 ? -1.604 -0.489  66.649  1.00 93.30  ? 97  G   R "C3'" 1 
ATOM   2659 O  "O3'" . G   B 2 91 ? -2.770 -0.024  67.304  1.00 90.11  ? 97  G   R "O3'" 1 
ATOM   2660 C  "C2'" . G   B 2 91 ? -1.025 0.546   65.690  1.00 93.38  ? 97  G   R "C2'" 1 
ATOM   2661 O  "O2'" . G   B 2 91 ? -0.936 1.847   66.240  1.00 93.04  ? 97  G   R "O2'" 1 
ATOM   2662 C  "C1'" . G   B 2 91 ? 0.361  -0.058  65.500  1.00 93.71  ? 97  G   R "C1'" 1 
ATOM   2663 N  N9    . G   B 2 91 ? 0.412  -1.178  64.544  1.00 93.22  ? 97  G   R N9    1 
ATOM   2664 C  C8    . G   B 2 91 ? 0.908  -2.437  64.796  1.00 93.14  ? 97  G   R C8    1 
ATOM   2665 N  N7    . G   B 2 91 ? 0.835  -3.251  63.781  1.00 92.68  ? 97  G   R N7    1 
ATOM   2666 C  C5    . G   B 2 91 ? 0.253  -2.491  62.777  1.00 92.07  ? 97  G   R C5    1 
ATOM   2667 C  C6    . G   B 2 91 ? -0.075 -2.847  61.442  1.00 91.04  ? 97  G   R C6    1 
ATOM   2668 O  O6    . G   B 2 91 ? 0.092  -3.936  60.879  1.00 90.22  ? 97  G   R O6    1 
ATOM   2669 N  N1    . G   B 2 91 ? -0.654 -1.789  60.741  1.00 90.64  ? 97  G   R N1    1 
ATOM   2670 C  C2    . G   B 2 91 ? -0.886 -0.539  61.268  1.00 91.15  ? 97  G   R C2    1 
ATOM   2671 N  N2    . G   B 2 91 ? -1.455 0.354   60.444  1.00 91.28  ? 97  G   R N2    1 
ATOM   2672 N  N3    . G   B 2 91 ? -0.583 -0.193  62.518  1.00 91.92  ? 97  G   R N3    1 
ATOM   2673 C  C4    . G   B 2 91 ? -0.016 -1.211  63.224  1.00 92.35  ? 97  G   R C4    1 
ATOM   2674 P  P     . G   B 2 92 ? -4.177 -0.680  66.913  1.00 88.15  ? 98  G   R P     1 
ATOM   2675 O  OP1   . G   B 2 92 ? -5.196 -0.117  67.829  1.00 89.11  ? 98  G   R OP1   1 
ATOM   2676 O  OP2   . G   B 2 92 ? -3.996 -2.152  66.851  1.00 86.93  ? 98  G   R OP2   1 
ATOM   2677 O  "O5'" . G   B 2 92 ? -4.441 -0.139  65.423  1.00 85.99  ? 98  G   R "O5'" 1 
ATOM   2678 C  "C5'" . G   B 2 92 ? -4.702 1.244   65.157  1.00 81.47  ? 98  G   R "C5'" 1 
ATOM   2679 C  "C4'" . G   B 2 92 ? -5.089 1.476   63.702  1.00 78.96  ? 98  G   R "C4'" 1 
ATOM   2680 O  "O4'" . G   B 2 92 ? -4.249 0.680   62.827  1.00 77.34  ? 98  G   R "O4'" 1 
ATOM   2681 C  "C3'" . G   B 2 92 ? -6.541 1.153   63.356  1.00 77.72  ? 98  G   R "C3'" 1 
ATOM   2682 O  "O3'" . G   B 2 92 ? -7.170 2.313   62.821  1.00 77.97  ? 98  G   R "O3'" 1 
ATOM   2683 C  "C2'" . G   B 2 92 ? -6.489 0.018   62.330  1.00 76.50  ? 98  G   R "C2'" 1 
ATOM   2684 O  "O2'" . G   B 2 92 ? -7.292 0.281   61.193  1.00 75.80  ? 98  G   R "O2'" 1 
ATOM   2685 C  "C1'" . G   B 2 92 ? -5.022 -0.068  61.904  1.00 75.46  ? 98  G   R "C1'" 1 
ATOM   2686 N  N9    . G   B 2 92 ? -4.487 -1.439  61.826  1.00 72.64  ? 98  G   R N9    1 
ATOM   2687 C  C8    . G   B 2 92 ? -3.547 -2.008  62.659  1.00 70.33  ? 98  G   R C8    1 
ATOM   2688 N  N7    . G   B 2 92 ? -3.247 -3.242  62.364  1.00 68.22  ? 98  G   R N7    1 
ATOM   2689 C  C5    . G   B 2 92 ? -4.037 -3.523  61.258  1.00 68.81  ? 98  G   R C5    1 
ATOM   2690 C  C6    . G   B 2 92 ? -4.141 -4.716  60.497  1.00 68.33  ? 98  G   R C6    1 
ATOM   2691 O  O6    . G   B 2 92 ? -3.532 -5.783  60.665  1.00 67.91  ? 98  G   R O6    1 
ATOM   2692 N  N1    . G   B 2 92 ? -5.060 -4.595  59.450  1.00 68.01  ? 98  G   R N1    1 
ATOM   2693 C  C2    . G   B 2 92 ? -5.792 -3.458  59.179  1.00 68.56  ? 98  G   R C2    1 
ATOM   2694 N  N2    . G   B 2 92 ? -6.626 -3.531  58.132  1.00 68.46  ? 98  G   R N2    1 
ATOM   2695 N  N3    . G   B 2 92 ? -5.704 -2.330  59.884  1.00 69.01  ? 98  G   R N3    1 
ATOM   2696 C  C4    . G   B 2 92 ? -4.809 -2.427  60.910  1.00 70.46  ? 98  G   R C4    1 
ATOM   2697 O  OP3   . G   C 3 1  ? 16.680 4.894   56.478  1.00 67.77  ? 1   G   A OP3   1 
ATOM   2698 P  P     . G   C 3 1  ? 16.591 4.857   55.001  1.00 67.32  ? 1   G   A P     1 
ATOM   2699 O  OP1   . G   C 3 1  ? 17.559 5.658   54.215  1.00 66.30  ? 1   G   A OP1   1 
ATOM   2700 O  OP2   . G   C 3 1  ? 16.756 3.435   54.599  1.00 65.81  ? 1   G   A OP2   1 
ATOM   2701 O  "O5'" . G   C 3 1  ? 15.116 5.343   54.600  1.00 62.36  ? 1   G   A "O5'" 1 
ATOM   2702 C  "C5'" . G   C 3 1  ? 14.036 4.409   54.495  1.00 57.38  ? 1   G   A "C5'" 1 
ATOM   2703 C  "C4'" . G   C 3 1  ? 13.513 4.307   53.072  1.00 53.29  ? 1   G   A "C4'" 1 
ATOM   2704 O  "O4'" . G   C 3 1  ? 14.344 3.389   52.324  1.00 49.91  ? 1   G   A "O4'" 1 
ATOM   2705 C  "C3'" . G   C 3 1  ? 12.097 3.762   52.926  1.00 51.90  ? 1   G   A "C3'" 1 
ATOM   2706 O  "O3'" . G   C 3 1  ? 11.148 4.823   53.089  1.00 53.15  ? 1   G   A "O3'" 1 
ATOM   2707 C  "C2'" . G   C 3 1  ? 12.128 3.210   51.500  1.00 50.86  ? 1   G   A "C2'" 1 
ATOM   2708 O  "O2'" . G   C 3 1  ? 11.883 4.186   50.503  1.00 48.54  ? 1   G   A "O2'" 1 
ATOM   2709 C  "C1'" . G   C 3 1  ? 13.561 2.695   51.372  1.00 49.44  ? 1   G   A "C1'" 1 
ATOM   2710 N  N9    . G   C 3 1  ? 13.715 1.254   51.582  1.00 47.96  ? 1   G   A N9    1 
ATOM   2711 C  C8    . G   C 3 1  ? 14.475 0.634   52.548  1.00 47.85  ? 1   G   A C8    1 
ATOM   2712 N  N7    . G   C 3 1  ? 14.436 -0.669  52.503  1.00 46.32  ? 1   G   A N7    1 
ATOM   2713 C  C5    . G   C 3 1  ? 13.596 -0.940  51.434  1.00 47.44  ? 1   G   A C5    1 
ATOM   2714 C  C6    . G   C 3 1  ? 13.172 -2.184  50.900  1.00 47.47  ? 1   G   A C6    1 
ATOM   2715 O  O6    . G   C 3 1  ? 13.471 -3.324  51.289  1.00 47.88  ? 1   G   A O6    1 
ATOM   2716 N  N1    . G   C 3 1  ? 12.316 -2.023  49.807  1.00 46.02  ? 1   G   A N1    1 
ATOM   2717 C  C2    . G   C 3 1  ? 11.924 -0.805  49.299  1.00 46.75  ? 1   G   A C2    1 
ATOM   2718 N  N2    . G   C 3 1  ? 11.095 -0.837  48.246  1.00 48.57  ? 1   G   A N2    1 
ATOM   2719 N  N3    . G   C 3 1  ? 12.313 0.367   49.789  1.00 46.88  ? 1   G   A N3    1 
ATOM   2720 C  C4    . G   C 3 1  ? 13.145 0.231   50.853  1.00 47.68  ? 1   G   A C4    1 
ATOM   2721 P  P     . G   C 3 2  ? 9.589  4.583   53.396  1.00 55.92  ? 2   G   A P     1 
ATOM   2722 O  OP1   . G   C 3 2  ? 9.032  3.714   52.336  1.00 54.98  ? 2   G   A OP1   1 
ATOM   2723 O  OP2   . G   C 3 2  ? 8.950  5.903   53.629  1.00 54.37  ? 2   G   A OP2   1 
ATOM   2724 O  "O5'" . G   C 3 2  ? 9.627  3.783   54.787  1.00 56.00  ? 2   G   A "O5'" 1 
ATOM   2725 C  "C5'" . G   C 3 2  ? 9.986  4.464   55.993  1.00 54.43  ? 2   G   A "C5'" 1 
ATOM   2726 C  "C4'" . G   C 3 2  ? 10.428 3.527   57.108  1.00 53.48  ? 2   G   A "C4'" 1 
ATOM   2727 O  "O4'" . G   C 3 2  ? 9.273  2.816   57.623  1.00 52.76  ? 2   G   A "O4'" 1 
ATOM   2728 C  "C3'" . G   C 3 2  ? 11.449 2.454   56.739  1.00 53.00  ? 2   G   A "C3'" 1 
ATOM   2729 O  "O3'" . G   C 3 2  ? 12.776 2.918   56.975  1.00 51.51  ? 2   G   A "O3'" 1 
ATOM   2730 C  "C2'" . G   C 3 2  ? 11.077 1.300   57.671  1.00 52.24  ? 2   G   A "C2'" 1 
ATOM   2731 O  "O2'" . G   C 3 2  ? 11.644 1.426   58.960  1.00 51.75  ? 2   G   A "O2'" 1 
ATOM   2732 C  "C1'" . G   C 3 2  ? 9.562  1.439   57.773  1.00 51.55  ? 2   G   A "C1'" 1 
ATOM   2733 N  N9    . G   C 3 2  ? 8.790  0.705   56.769  1.00 51.63  ? 2   G   A N9    1 
ATOM   2734 C  C8    . G   C 3 2  ? 7.883  1.261   55.897  1.00 52.21  ? 2   G   A C8    1 
ATOM   2735 N  N7    . G   C 3 2  ? 7.318  0.397   55.104  1.00 52.19  ? 2   G   A N7    1 
ATOM   2736 C  C5    . G   C 3 2  ? 7.884  -0.817  55.466  1.00 51.22  ? 2   G   A C5    1 
ATOM   2737 C  C6    . G   C 3 2  ? 7.647  -2.110  54.945  1.00 50.57  ? 2   G   A C6    1 
ATOM   2738 O  O6    . G   C 3 2  ? 6.872  -2.425  54.031  1.00 51.81  ? 2   G   A O6    1 
ATOM   2739 N  N1    . G   C 3 2  ? 8.417  -3.084  55.582  1.00 48.53  ? 2   G   A N1    1 
ATOM   2740 C  C2    . G   C 3 2  ? 9.303  -2.830  56.603  1.00 48.48  ? 2   G   A C2    1 
ATOM   2741 N  N2    . G   C 3 2  ? 9.957  -3.891  57.096  1.00 46.83  ? 2   G   A N2    1 
ATOM   2742 N  N3    . G   C 3 2  ? 9.531  -1.617  57.104  1.00 49.72  ? 2   G   A N3    1 
ATOM   2743 C  C4    . G   C 3 2  ? 8.791  -0.653  56.494  1.00 51.27  ? 2   G   A C4    1 
HETATM 2744 MG MG    . MG  D 4 .  ? 4.000  -2.776  51.209  1.00 66.65  ? 1   MG  R MG    1 
HETATM 2745 O  O     . HOH E 5 .  ? 4.376  31.687  10.017  1.00 29.48  ? 99  HOH P O     1 
HETATM 2746 O  O     . HOH E 5 .  ? 8.620  24.826  6.657   1.00 42.09  ? 100 HOH P O     1 
HETATM 2747 O  O     . HOH E 5 .  ? 4.700  30.085  8.176   1.00 44.90  ? 101 HOH P O     1 
HETATM 2748 O  O     . HOH F 5 .  ? 3.779  13.244  -1.019  1.00 39.86  ? 3   HOH R O     1 
HETATM 2749 O  O     . HOH F 5 .  ? 26.468 -4.600  41.966  1.00 27.27  ? 4   HOH R O     1 
HETATM 2750 O  O     . HOH F 5 .  ? 12.478 -8.451  31.611  1.00 33.82  ? 5   HOH R O     1 
HETATM 2751 O  O     . HOH F 5 .  ? 29.314 -2.272  18.976  1.00 48.37  ? 670 HOH R O     1 
HETATM 2752 O  O     . HOH F 5 .  ? 9.514  -9.005  51.220  1.00 55.48  ? 671 HOH R O     1 
HETATM 2753 O  O     . HOH F 5 .  ? 11.169 6.329   -1.078  1.00 59.28  ? 672 HOH R O     1 
HETATM 2754 O  O     . HOH F 5 .  ? 2.744  -4.232  50.183  1.00 67.60  ? 673 HOH R O     1 
HETATM 2755 O  O     . HOH F 5 .  ? 5.774  -3.685  50.326  1.00 67.45  ? 674 HOH R O     1 
HETATM 2756 O  O     . HOH F 5 .  ? 2.234  -1.949  52.189  1.00 67.27  ? 675 HOH R O     1 
HETATM 2757 O  O     . HOH F 5 .  ? 4.177  -4.197  52.851  1.00 67.86  ? 676 HOH R O     1 
HETATM 2758 O  O     . HOH G 5 .  ? 5.266  -1.415  52.341  1.00 67.29  ? 3   HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1   ?   ?   ?   P . n 
A 1 2  ALA 2  2   ?   ?   ?   P . n 
A 1 3  VAL 3  3   ?   ?   ?   P . n 
A 1 4  PRO 4  4   ?   ?   ?   P . n 
A 1 5  GLU 5  5   ?   ?   ?   P . n 
A 1 6  THR 6  6   ?   ?   ?   P . n 
A 1 7  ARG 7  7   7   ARG ARG P . n 
A 1 8  PRO 8  8   8   PRO PRO P . n 
A 1 9  ASN 9  9   9   ASN ASN P . n 
A 1 10 HIS 10 10  10  HIS HIS P . n 
A 1 11 THR 11 11  11  THR THR P . n 
A 1 12 ILE 12 12  12  ILE ILE P . n 
A 1 13 TYR 13 13  13  TYR TYR P . n 
A 1 14 ILE 14 14  14  ILE ILE P . n 
A 1 15 ASN 15 15  15  ASN ASN P . n 
A 1 16 ASN 16 16  16  ASN ASN P . n 
A 1 17 LEU 17 17  17  LEU LEU P . n 
A 1 18 ASN 18 18  18  ASN ASN P . n 
A 1 19 GLU 19 19  19  GLU GLU P . n 
A 1 20 LYS 20 20  20  LYS LYS P . n 
A 1 21 ILE 21 21  21  ILE ILE P . n 
A 1 22 LYS 22 22  22  LYS LYS P . n 
A 1 23 LYS 23 23  23  LYS LYS P . n 
A 1 24 ASP 24 24  24  ASP ASP P . n 
A 1 25 GLU 25 25  25  GLU GLU P . n 
A 1 26 LEU 26 26  26  LEU LEU P . n 
A 1 27 LYS 27 27  27  LYS LYS P . n 
A 1 28 LYS 28 28  28  LYS LYS P . n 
A 1 29 SER 29 29  29  SER SER P . n 
A 1 30 LEU 30 30  30  LEU LEU P . n 
A 1 31 HIS 31 31  31  HIS HIS P . n 
A 1 32 ALA 32 32  32  ALA ALA P . n 
A 1 33 ILE 33 33  33  ILE ILE P . n 
A 1 34 PHE 34 34  34  PHE PHE P . n 
A 1 35 SER 35 35  35  SER SER P . n 
A 1 36 ARG 36 36  36  ARG ARG P . n 
A 1 37 PHE 37 37  37  PHE PHE P . n 
A 1 38 GLY 38 38  38  GLY GLY P . n 
A 1 39 GLN 39 39  39  GLN GLN P . n 
A 1 40 ILE 40 40  40  ILE ILE P . n 
A 1 41 LEU 41 41  41  LEU LEU P . n 
A 1 42 ASP 42 42  42  ASP ASP P . n 
A 1 43 ILE 43 43  43  ILE ILE P . n 
A 1 44 LEU 44 44  44  LEU LEU P . n 
A 1 45 VAL 45 45  45  VAL VAL P . n 
A 1 46 SER 46 46  46  SER SER P . n 
A 1 47 ARG 47 47  47  ARG ARG P . n 
A 1 48 SER 48 48  48  SER SER P . n 
A 1 49 LEU 49 49  49  LEU LEU P . n 
A 1 50 LYS 50 50  50  LYS LYS P . n 
A 1 51 MET 51 51  51  MET MET P . n 
A 1 52 ARG 52 52  52  ARG ARG P . n 
A 1 53 GLY 53 53  53  GLY GLY P . n 
A 1 54 GLN 54 54  54  GLN GLN P . n 
A 1 55 ALA 55 55  55  ALA ALA P . n 
A 1 56 PHE 56 56  56  PHE PHE P . n 
A 1 57 VAL 57 57  57  VAL VAL P . n 
A 1 58 ILE 58 58  58  ILE ILE P . n 
A 1 59 PHE 59 59  59  PHE PHE P . n 
A 1 60 LYS 60 60  60  LYS LYS P . n 
A 1 61 GLU 61 61  61  GLU GLU P . n 
A 1 62 VAL 62 62  62  VAL VAL P . n 
A 1 63 SER 63 63  63  SER SER P . n 
A 1 64 SER 64 64  64  SER SER P . n 
A 1 65 ALA 65 65  65  ALA ALA P . n 
A 1 66 THR 66 66  66  THR THR P . n 
A 1 67 ASN 67 67  67  ASN ASN P . n 
A 1 68 ALA 68 68  68  ALA ALA P . n 
A 1 69 LEU 69 69  69  LEU LEU P . n 
A 1 70 ARG 70 70  70  ARG ARG P . n 
A 1 71 SER 71 71  71  SER SER P . n 
A 1 72 MET 72 72  72  MET MET P . n 
A 1 73 GLN 73 73  73  GLN GLN P . n 
A 1 74 GLY 74 74  74  GLY GLY P . n 
A 1 75 PHE 75 75  75  PHE PHE P . n 
A 1 76 PRO 76 76  76  PRO PRO P . n 
A 1 77 PHE 77 77  77  PHE PHE P . n 
A 1 78 TYR 78 78  78  TYR TYR P . n 
A 1 79 ASP 79 79  79  ASP ASP P . n 
A 1 80 LYS 80 80  80  LYS LYS P . n 
A 1 81 PRO 81 81  81  PRO PRO P . n 
A 1 82 MET 82 82  82  MET MET P . n 
A 1 83 ARG 83 83  83  ARG ARG P . n 
A 1 84 ILE 84 84  84  ILE ILE P . n 
A 1 85 GLN 85 85  85  GLN GLN P . n 
A 1 86 TYR 86 86  86  TYR TYR P . n 
A 1 87 ALA 87 87  87  ALA ALA P . n 
A 1 88 LYS 88 88  88  LYS LYS P . n 
A 1 89 THR 89 89  89  THR THR P . n 
A 1 90 ASP 90 90  90  ASP ASP P . n 
A 1 91 SER 91 91  91  SER SER P . n 
A 1 92 ASP 92 92  92  ASP ASP P . n 
A 1 93 ILE 93 93  93  ILE ILE P . n 
A 1 94 ILE 94 94  ?   ?   ?   P . n 
A 1 95 ALA 95 95  ?   ?   ?   P . n 
A 1 96 LYS 96 96  ?   ?   ?   P . n 
A 1 97 MET 97 97  ?   ?   ?   P . n 
A 1 98 LYS 98 98  ?   ?   ?   P . n 
B 2 1  GTP 1  8   8   GTP GTP R . n 
B 2 2  G   2  9   9   G   G   R . n 
B 2 3  U   3  10  10  U   U   R . n 
B 2 4  C   4  11  11  C   C   R . n 
B 2 5  A   5  12  12  A   A   R . n 
B 2 6  C   6  13  13  C   C   R . n 
B 2 7  G   7  14  14  G   G   R . n 
B 2 8  C   8  15  15  C   C   R . n 
B 2 9  A   9  16  16  A   A   R . n 
B 2 10 C   10 17  17  C   C   R . n 
B 2 11 A   11 18  18  A   A   R . n 
B 2 12 G   12 19  19  G   G   R . n 
B 2 13 G   13 20  20  G   G   R . n 
B 2 14 G   14 21  21  G   G   R . n 
B 2 15 C   15 22  22  C   C   R . n 
B 2 16 A   16 23  23  A   A   R . n 
B 2 17 A   17 24  24  A   A   R . n 
B 2 18 A   18 25  25  A   A   R . n 
B 2 19 C   19 26  26  C   C   R . n 
B 2 20 C   20 27  27  C   C   R . n 
B 2 21 A   21 28  28  A   A   R . n 
B 2 22 U   22 29  29  U   U   R . n 
B 2 23 U   23 30  30  U   U   R . n 
B 2 24 C   24 31  31  C   C   R . n 
B 2 25 G   25 32  32  G   G   R . n 
B 2 26 A   26 33  33  A   A   R . n 
B 2 27 A   27 34  34  A   A   R . n 
B 2 28 A   28 35  35  A   A   R . n 
B 2 29 G   29 36  36  G   G   R . n 
B 2 30 A   30 37  37  A   A   R . n 
B 2 31 G   31 38  38  G   G   R . n 
B 2 32 U   32 39  39  U   U   R . n 
B 2 33 G   33 40  40  G   G   R . n 
B 2 34 G   34 41  41  G   G   R . n 
B 2 35 G   35 42  42  G   G   R . n 
B 2 36 A   36 43  43  A   A   R . n 
B 2 37 C   37 44  44  C   C   R . n 
B 2 38 G   38 45  45  G   G   R . n 
B 2 39 C   39 46  46  C   C   R . n 
B 2 40 A   40 47  47  A   A   R . n 
B 2 41 A   41 48  48  A   A   R . n 
B 2 42 A   42 49  49  A   A   R . n 
B 2 43 G   43 50  50  G   G   R . n 
B 2 44 C   44 51  51  C   C   R . n 
B 2 45 C   45 52  52  C   C   R . n 
B 2 46 U   46 53  53  U   U   R . n 
B 2 47 C   47 54  54  C   C   R . n 
B 2 48 C   48 55  55  C   C   R . n 
B 2 49 G   49 56  56  G   G   R . n 
B 2 50 G   50 57  57  G   G   R . n 
B 2 51 C   51 58  58  C   C   R . n 
B 2 52 C   52 59  59  C   C   R . n 
B 2 53 U   53 60  60  U   U   R . n 
B 2 54 A   54 61  61  A   A   R . n 
B 2 55 A   55 62  62  A   A   R . n 
B 2 56 A   56 63  63  A   A   R . n 
B 2 57 C   57 64  64  C   C   R . n 
B 2 58 C   58 65  65  C   C   R . n 
B 2 59 A   59 660 660 A   A   R . n 
B 2 60 U   60 661 661 U   U   R . n 
B 2 61 U   61 662 662 U   U   R . n 
B 2 62 G   62 663 663 G   G   R . n 
B 2 63 C   63 664 664 C   C   R . n 
B 2 64 A   64 665 665 A   A   R . n 
B 2 65 C   65 666 666 C   C   R . n 
B 2 66 U   66 667 667 U   U   R . n 
B 2 67 C   67 668 668 C   C   R . n 
B 2 68 C   68 669 669 C   C   R . n 
B 2 69 G   69 75  75  G   G   R . n 
B 2 70 G   70 76  76  G   G   R . n 
B 2 71 U   71 77  77  U   U   R . n 
B 2 72 A   72 78  78  A   A   R . n 
B 2 73 G   73 79  79  G   G   R . n 
B 2 74 G   74 80  80  G   G   R . n 
B 2 75 U   75 81  81  U   U   R . n 
B 2 76 A   76 82  82  A   A   R . n 
B 2 77 G   77 83  83  G   G   R . n 
B 2 78 C   78 84  84  C   C   R . n 
B 2 79 G   79 85  85  G   G   R . n 
B 2 80 G   80 86  86  G   G   R . n 
B 2 81 G   81 87  87  G   G   R . n 
B 2 82 G   82 88  88  G   G   R . n 
B 2 83 U   83 89  89  U   U   R . n 
B 2 84 U   84 90  90  U   U   R . n 
B 2 85 A   85 91  91  A   A   R . n 
B 2 86 C   86 92  92  C   C   R . n 
B 2 87 C   87 93  93  C   C   R . n 
B 2 88 G   88 94  94  G   G   R . n 
B 2 89 A   89 95  95  A   A   R . n 
B 2 90 U   90 96  96  U   U   R . n 
B 2 91 G   91 97  97  G   G   R . n 
B 2 92 G   92 98  98  G   G   R . n 
C 3 1  G   1  1   1   G   G   A . n 
C 3 2  G   2  2   2   G   G   A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    GTP 
_pdbx_struct_mod_residue.label_seq_id     1 
_pdbx_struct_mod_residue.auth_asym_id     R 
_pdbx_struct_mod_residue.auth_comp_id     GTP 
_pdbx_struct_mod_residue.auth_seq_id      8 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   G 
_pdbx_struct_mod_residue.details          "GUANOSINE-5'-TRIPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3630  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  18700 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? G HOH . ? A HOH 3   ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 676 ? 1_555 88.2  ? 
2  O ? G HOH . ? A HOH 3   ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 673 ? 1_555 176.2 ? 
3  O ? F HOH . ? R HOH 676 ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 673 ? 1_555 88.0  ? 
4  O ? G HOH . ? A HOH 3   ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 674 ? 1_555 89.9  ? 
5  O ? F HOH . ? R HOH 676 ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 674 ? 1_555 88.1  ? 
6  O ? F HOH . ? R HOH 673 ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 674 ? 1_555 90.0  ? 
7  O ? G HOH . ? A HOH 3   ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 675 ? 1_555 90.0  ? 
8  O ? F HOH . ? R HOH 676 ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 675 ? 1_555 88.5  ? 
9  O ? F HOH . ? R HOH 673 ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 675 ? 1_555 89.9  ? 
10 O ? F HOH . ? R HOH 674 ? 1_555 MG ? D MG . ? R MG 1 ? 1_555 O ? F HOH . ? R HOH 675 ? 1_555 176.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-04 
2 'Structure model' 1 1 2012-10-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS    'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            G 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            G 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.480 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.127 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" R A 48 ? ? "C1'" R A 48 ? ? N9  R A 48 ? ? 113.72 108.50 5.22   0.70 N 
2 1 OP1   A G 1  ? ? P     A G 1  ? ? OP2 A G 1  ? ? 107.52 119.60 -12.08 1.50 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    P 
_pdbx_validate_torsion.auth_seq_id     92 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             74.40 
_pdbx_validate_torsion.psi             -158.21 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P MET 1  ? A MET 1  
2  1 Y 1 P ALA 2  ? A ALA 2  
3  1 Y 1 P VAL 3  ? A VAL 3  
4  1 Y 1 P PRO 4  ? A PRO 4  
5  1 Y 1 P GLU 5  ? A GLU 5  
6  1 Y 1 P THR 6  ? A THR 6  
7  1 Y 1 P ILE 94 ? A ILE 94 
8  1 Y 1 P ALA 95 ? A ALA 95 
9  1 Y 1 P LYS 96 ? A LYS 96 
10 1 Y 1 P MET 97 ? A MET 97 
11 1 Y 1 P LYS 98 ? A LYS 98 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3UCU 'double helix'         
3UCU 'a-form double helix'  
3UCU tetraloop              
3UCU 'bulge loop'           
3UCU 'mismatched base pair' 
3UCU 'triple helix'         
3UCU 'quadruple helix'      
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B C 4  1_555 B G 92 1_555 0.187  0.071  0.337  9.615   -19.182 -4.537   1  R_C11:G98_R R 11 ? R 98 ? 19 1 
1 B A 5  1_555 B G 91 1_555 0.554  1.617  -0.349 -16.822 -17.212 -13.950  2  R_A12:G97_R R 12 ? R 97 ? 8  1 
1 B C 6  1_555 B G 88 1_555 -0.469 0.137  0.622  -20.707 -16.164 -0.472   3  R_C13:G94_R R 13 ? R 94 ? 19 1 
1 B G 7  1_555 B C 87 1_555 0.184  0.135  0.584  4.716   -7.849  -2.629   4  R_G14:C93_R R 14 ? R 93 ? 19 1 
1 C G 2  1_555 B C 86 1_555 0.338  0.113  -0.078 -4.607  -14.826 5.538    5  A_G2:C92_R  A 2  ? R 92 ? 19 1 
1 B G 12 1_555 B A 40 1_555 0.069  2.921  -0.085 -9.047  2.152   -51.751  6  R_G19:A47_R R 19 ? R 47 ? ?  ? 
1 B G 13 1_555 C G 1  1_555 5.879  -0.700 -0.221 4.712   -8.096  -110.433 7  R_G20:G1_A  R 20 ? A 1  ? 7  4 
1 B G 14 1_555 B C 39 1_555 -0.212 0.039  -0.260 0.652   0.872   3.393    8  R_G21:C46_R R 21 ? R 46 ? 19 1 
1 B C 15 1_555 B G 38 1_555 0.173  -0.070 -0.159 9.064   2.218   3.213    9  R_C22:G45_R R 22 ? R 45 ? 19 1 
1 B G 77 1_555 B C 37 1_555 -0.330 -0.198 0.543  2.720   -5.846  -5.761   10 R_G83:C44_R R 83 ? R 44 ? 19 1 
1 B A 18 1_555 B G 35 1_555 -6.754 -3.553 0.197  0.918   -5.421  -0.465   11 R_A25:G42_R R 25 ? R 42 ? 11 9 
1 B C 19 1_555 B G 34 1_555 0.349  0.134  -0.325 10.614  -10.850 1.783    12 R_C26:G41_R R 26 ? R 41 ? 19 1 
1 B C 20 1_555 B G 33 1_555 -0.075 -0.115 -0.112 8.320   -7.502  1.321    13 R_C27:G40_R R 27 ? R 40 ? 19 1 
1 B A 21 1_555 B U 32 1_555 0.038  -0.172 0.059  1.620   -19.409 5.470    14 R_A28:U39_R R 28 ? R 39 ? 20 1 
1 B U 22 1_555 B G 31 1_555 2.342  -0.524 -0.039 4.583   -15.736 6.387    15 R_U29:G38_R R 29 ? R 38 ? 28 1 
1 B U 23 1_555 B A 30 1_555 0.476  -0.302 -0.019 -2.641  -6.396  0.821    16 R_U30:A37_R R 30 ? R 37 ? 20 1 
1 B C 24 1_555 B G 29 1_555 0.436  -0.355 -0.148 3.903   2.277   -0.692   17 R_C31:G36_R R 31 ? R 36 ? 19 1 
1 B A 41 1_555 B U 84 1_555 -4.304 -2.416 -0.153 10.581  0.328   -89.980  18 R_A48:U90_R R 48 ? R 90 ? 24 4 
1 B G 43 1_555 B U 83 1_555 -2.395 -0.696 -0.297 -3.035  -13.788 -4.662   19 R_G50:U89_R R 50 ? R 89 ? 28 1 
1 B C 44 1_555 B G 82 1_555 0.469  -0.285 -0.089 5.423   -14.840 1.247    20 R_C51:G88_R R 51 ? R 88 ? 19 1 
1 B C 45 1_555 B G 81 1_555 0.087  -0.116 0.215  -1.792  -8.768  1.383    21 R_C52:G87_R R 52 ? R 87 ? 19 1 
1 B C 47 1_555 B G 80 1_555 0.004  -0.104 -0.573 18.342  -12.475 2.114    22 R_C54:G86_R R 54 ? R 86 ? 19 1 
1 B C 48 1_555 B G 79 1_555 0.240  -0.185 -0.103 3.870   -2.825  -2.273   23 R_C55:G85_R R 55 ? R 85 ? 19 1 
1 B G 49 1_555 B C 78 1_555 -0.983 -0.389 0.218  8.779   1.007   0.707    24 R_G56:C84_R R 56 ? R 84 ? 19 1 
1 B G 50 1_555 B U 75 1_555 -1.511 -0.373 0.226  4.965   -6.746  -5.608   25 R_G57:U81_R R 57 ? R 81 ? 28 1 
1 B C 51 1_555 B G 74 1_555 0.524  -0.235 0.049  12.425  -13.466 3.189    26 R_C58:G80_R R 58 ? R 80 ? 19 1 
1 B C 52 1_555 B G 73 1_555 -0.007 -0.140 -0.228 3.193   -11.369 -0.027   27 R_C59:G79_R R 59 ? R 79 ? 19 1 
1 B U 53 1_555 B A 72 1_555 0.250  -0.214 0.217  -5.026  -5.670  -3.180   28 R_U60:A78_R R 60 ? R 78 ? 20 1 
1 B A 54 1_555 B U 71 1_555 1.394  -0.134 0.318  12.201  2.964   -3.591   29 R_A61:U77_R R 61 ? R 77 ? 20 1 
1 B C 57 1_555 B G 70 1_555 -0.041 -0.090 -0.669 18.961  -24.638 6.074    30 R_C64:G76_R R 64 ? R 76 ? 19 1 
1 B C 58 1_555 B G 69 1_555 1.086  -0.174 0.344  -10.081 -12.706 9.716    31 R_C65:G75_R R 65 ? R 75 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B C 4  1_555 B G 92 1_555 B A 5  1_555 B G 91 1_555 0.329  -2.498 3.630 9.758   10.984 33.904  -5.459 0.820  2.710 17.833 
-15.843 36.865  1  RR_C11A12:G97G98_RR R 11 ? R 98 ? R 12 ? R 97 ? 
1 B A 5  1_555 B G 91 1_555 B C 6  1_555 B G 88 1_555 2.181  -0.463 3.134 -0.142  6.202  41.158  -1.274 -3.085 3.029 8.762  0.201 
41.602  2  RR_A12C13:G94G97_RR R 12 ? R 97 ? R 13 ? R 94 ? 
1 B C 6  1_555 B G 88 1_555 B G 7  1_555 B C 87 1_555 -1.045 -0.668 2.711 -5.009  16.791 28.698  -3.381 1.148  2.155 30.546 9.113 
33.529  3  RR_C13G14:C93G94_RR R 13 ? R 94 ? R 14 ? R 93 ? 
1 B G 7  1_555 B C 87 1_555 C G 2  1_555 B C 86 1_555 -0.505 -1.440 3.425 1.406   5.304  40.341  -2.667 0.884  3.199 7.647  -2.027 
40.697  4  RA_G14G2:C92C93_RR  R 14 ? R 93 ? A 2  ? R 92 ? 
1 C G 2  1_555 B C 86 1_555 B G 12 1_555 B A 40 1_555 -2.554 3.400  3.088 -3.965  -4.060 117.011 2.032  1.459  3.067 -2.380 2.324 
117.097 5  AR_G2G19:A47C92_RR  A 2  ? R 92 ? R 19 ? R 47 ? 
1 B G 12 1_555 B A 40 1_555 B G 13 1_555 C G 1  1_555 -0.492 -2.731 3.149 -3.804  -0.002 46.167  -3.472 0.313  3.178 -0.003 4.842 
46.315  6  RR_G19G20:G1A47_AR  R 19 ? R 47 ? R 20 ? A 1  ? 
1 B G 13 1_555 C G 1  1_555 B G 14 1_555 B C 39 1_555 1.693  -1.439 3.386 0.537   0.911  -25.650 2.973  3.968  3.399 -2.052 1.208 
-25.671 7  RR_G20G21:C46G1_RA  R 20 ? A 1  ? R 21 ? R 46 ? 
1 B G 14 1_555 B C 39 1_555 B C 15 1_555 B G 38 1_555 0.330  -1.786 3.197 -1.954  0.154  31.912  -3.269 -0.944 3.163 0.281  3.550 
31.971  8  RR_G21C22:G45C46_RR R 21 ? R 46 ? R 22 ? R 45 ? 
1 B C 15 1_555 B G 38 1_555 B G 77 1_555 B C 37 1_555 -5.423 -0.104 3.649 -12.294 -7.086 57.603  0.358  4.688  4.601 -7.234 12.551 
59.179  9  RR_C22G83:C44G45_RR R 22 ? R 45 ? R 83 ? R 44 ? 
1 B A 18 1_555 B G 35 1_555 B C 19 1_555 B G 34 1_555 -0.219 -0.737 3.219 -2.754  6.282  61.924  -0.993 0.089  3.145 6.085  2.667 
62.265  10 RR_A25C26:G41G42_RR R 25 ? R 42 ? R 26 ? R 41 ? 
1 B C 19 1_555 B G 34 1_555 B C 20 1_555 B G 33 1_555 -0.032 -1.880 3.288 -2.423  7.796  27.616  -5.406 -0.441 2.662 15.896 4.940 
28.775  11 RR_C26C27:G40G41_RR R 26 ? R 41 ? R 27 ? R 40 ? 
1 B C 20 1_555 B G 33 1_555 B A 21 1_555 B U 32 1_555 0.231  -1.453 3.239 2.570   15.815 34.600  -4.050 -0.059 2.386 24.998 -4.062 
38.027  12 RR_C27A28:U39G40_RR R 27 ? R 40 ? R 28 ? R 39 ? 
1 B A 21 1_555 B U 32 1_555 B U 22 1_555 B G 31 1_555 0.346  -0.978 3.140 2.582   10.221 39.782  -2.423 -0.232 2.831 14.709 -3.716 
41.101  13 RR_A28U29:G38U39_RR R 28 ? R 39 ? R 29 ? R 38 ? 
1 B U 22 1_555 B G 31 1_555 B U 23 1_555 B A 30 1_555 -0.154 -1.916 3.126 3.332   10.226 26.693  -5.809 0.945  2.220 21.092 -6.873 
28.742  14 RR_U29U30:A37G38_RR R 29 ? R 38 ? R 30 ? R 37 ? 
1 B U 23 1_555 B A 30 1_555 B C 24 1_555 B G 29 1_555 0.069  -1.598 3.105 1.614   6.134  29.658  -4.171 0.160  2.727 11.813 -3.108 
30.313  15 RR_U30C31:G36A37_RR R 30 ? R 37 ? R 31 ? R 36 ? 
1 B A 41 1_555 B U 84 1_555 B G 43 1_555 B U 83 1_555 3.254  -2.249 3.664 -7.112  11.087 64.527  -2.535 -3.295 2.952 10.272 6.590 
65.715  16 RR_A48G50:U89U90_RR R 48 ? R 90 ? R 50 ? R 89 ? 
1 B G 43 1_555 B U 83 1_555 B C 44 1_555 B G 82 1_555 0.267  -1.337 3.055 -3.574  4.044  42.574  -2.194 -0.690 2.892 5.543  4.899 
42.899  17 RR_G50C51:G88U89_RR R 50 ? R 89 ? R 51 ? R 88 ? 
1 B C 44 1_555 B G 82 1_555 B C 45 1_555 B G 81 1_555 -0.010 -1.850 3.412 1.493   7.127  32.866  -4.342 0.257  2.954 12.406 -2.599 
33.641  18 RR_C51C52:G87G88_RR R 51 ? R 88 ? R 52 ? R 87 ? 
1 B C 45 1_555 B G 81 1_555 B C 47 1_555 B G 80 1_555 -2.806 -1.058 2.913 11.418  5.518  51.856  -1.457 3.703  2.179 6.204  
-12.838 53.280  19 RR_C52C54:G86G87_RR R 52 ? R 87 ? R 54 ? R 86 ? 
1 B C 47 1_555 B G 80 1_555 B C 48 1_555 B G 79 1_555 -0.843 -2.031 3.701 -4.921  10.685 34.219  -4.875 0.622  3.040 17.529 8.073 
36.128  20 RR_C54C55:G85G86_RR R 54 ? R 86 ? R 55 ? R 85 ? 
1 B C 48 1_555 B G 79 1_555 B G 49 1_555 B C 78 1_555 0.175  -2.414 2.994 -3.793  6.575  19.300  -8.968 -1.788 2.000 18.701 10.789 
20.726  21 RR_C55G56:C84G85_RR R 55 ? R 85 ? R 56 ? R 84 ? 
1 B G 49 1_555 B C 78 1_555 B G 50 1_555 B U 75 1_555 1.981  -1.778 3.113 0.112   6.738  49.194  -2.573 -2.352 2.866 8.050  -0.134 
49.625  22 RR_G56G57:U81C84_RR R 56 ? R 84 ? R 57 ? R 81 ? 
1 B G 50 1_555 B U 75 1_555 B C 51 1_555 B G 74 1_555 0.406  -1.299 3.135 -2.152  3.525  40.540  -2.231 -0.806 2.992 5.071  3.095 
40.741  23 RR_G57C58:G80U81_RR R 57 ? R 81 ? R 58 ? R 80 ? 
1 B C 51 1_555 B G 74 1_555 B C 52 1_555 B G 73 1_555 -0.649 -2.133 3.384 -0.838  7.242  27.415  -5.952 1.140  2.760 14.947 1.730 
28.349  24 RR_C58C59:G79G80_RR R 58 ? R 80 ? R 59 ? R 79 ? 
1 B C 52 1_555 B G 73 1_555 B U 53 1_555 B A 72 1_555 -0.312 -2.050 3.572 -1.941  9.883  31.032  -5.378 0.217  2.817 17.891 3.513 
32.587  25 RR_C59U60:A78G79_RR R 59 ? R 79 ? R 60 ? R 78 ? 
1 B U 53 1_555 B A 72 1_555 B A 54 1_555 B U 71 1_555 -0.076 -1.637 2.879 2.700   14.724 27.674  -5.130 0.526  1.786 28.311 -5.191 
31.394  26 RR_U60A61:U77A78_RR R 60 ? R 78 ? R 61 ? R 77 ? 
1 B A 54 1_555 B U 71 1_555 B C 57 1_555 B G 70 1_555 -4.249 0.516  3.328 10.983  2.181  69.865  0.375  4.032  2.733 1.892  -9.528 
70.643  27 RR_A61C64:G76U77_RR R 61 ? R 77 ? R 64 ? R 76 ? 
1 B C 57 1_555 B G 70 1_555 B C 58 1_555 B G 69 1_555 -0.004 -1.520 3.987 -6.292  13.783 37.819  -3.943 -0.796 3.225 20.297 9.267 
40.638  28 RR_C64C65:G75G76_RR R 64 ? R 76 ? R 65 ? R 75 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1  1   1  MG  MO6 R . 
E 5 HOH 1  99  1  HOH HOH P . 
E 5 HOH 2  100 2  HOH HOH P . 
E 5 HOH 3  101 7  HOH HOH P . 
F 5 HOH 1  3   3  HOH HOH R . 
F 5 HOH 2  4   4  HOH HOH R . 
F 5 HOH 3  5   5  HOH HOH R . 
F 5 HOH 4  670 8  HOH HOH R . 
F 5 HOH 5  671 9  HOH HOH R . 
F 5 HOH 6  672 10 HOH HOH R . 
F 5 HOH 7  673 1  HOH MO6 R . 
F 5 HOH 8  674 1  HOH MO6 R . 
F 5 HOH 9  675 1  HOH MO6 R . 
F 5 HOH 10 676 1  HOH MO6 R . 
G 5 HOH 1  3   1  HOH MO6 A . 
#