data_3UCZ
# 
_entry.id   3UCZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UCZ         
NDB   NA1366       
RCSB  RCSB068598   
WWPDB D_1000068598 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3UCU 'The same RNA in complex with a different ligand.' unspecified 
PDB 3UD3 .                                                  unspecified 
PDB 3UD4 .                                                  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UCZ 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Smith, K.D.'   1 
'Strobel, S.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            51 
_citation.page_first                425 
_citation.page_last                 432 
_citation.year                      2012 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22148472 
_citation.pdbx_database_id_DOI      10.1021/bi2016662 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Smith, K.D.'    1 
primary 'Lipchock, S.V.' 2 
primary 'Strobel, S.A.'  3 
# 
_cell.entry_id           3UCZ 
_cell.length_a           49.808 
_cell.length_b           45.358 
_cell.length_c           77.334 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.81 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UCZ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'U1 small nuclear ribonucleoprotein A' 11340.315 1  ? 'Y31H, Q36R' 'RNA binding domain, UNP residues 1-98' ? 
2 polymer     syn 'RNA (92-MER)'                         29942.773 1  ? ?            ?                                       
'c-di-GMP-I riboswitch' 
3 polymer     syn 
;RNA (5'-R(*GP*G)-3')
;
645.454   1  ? ?            ?                                       GpG                     
4 non-polymer syn 'MAGNESIUM ION'                        24.305    3  ? ?            ?                                       ? 
5 water       nat water                                  18.015    32 ? ?            ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'U1 snRNP A, U1-A, U1A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no  
;MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMK
;
;MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMK
;
P ? 
2 polyribonucleotide no yes 
;(GTP)GUCACGCACAGGGCAAACCAUUCGAAAGAGUGGGACGCAAAGCCUCCGGCCUAAACCAUUGCACUCCGGUAGGUA
GCGGGGUUACCGAUGG
;
;GGUCACGCACAGGGCAAACCAUUCGAAAGAGUGGGACGCAAAGCCUCCGGCCUAAACCAUUGCACUCCGGUAGGUAGCGG
GGUUACCGAUGG
;
R ? 
3 polyribonucleotide no no  GG                                                                                                    
GG                                                                                                    D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  VAL n 
1 4  PRO n 
1 5  GLU n 
1 6  THR n 
1 7  ARG n 
1 8  PRO n 
1 9  ASN n 
1 10 HIS n 
1 11 THR n 
1 12 ILE n 
1 13 TYR n 
1 14 ILE n 
1 15 ASN n 
1 16 ASN n 
1 17 LEU n 
1 18 ASN n 
1 19 GLU n 
1 20 LYS n 
1 21 ILE n 
1 22 LYS n 
1 23 LYS n 
1 24 ASP n 
1 25 GLU n 
1 26 LEU n 
1 27 LYS n 
1 28 LYS n 
1 29 SER n 
1 30 LEU n 
1 31 HIS n 
1 32 ALA n 
1 33 ILE n 
1 34 PHE n 
1 35 SER n 
1 36 ARG n 
1 37 PHE n 
1 38 GLY n 
1 39 GLN n 
1 40 ILE n 
1 41 LEU n 
1 42 ASP n 
1 43 ILE n 
1 44 LEU n 
1 45 VAL n 
1 46 SER n 
1 47 ARG n 
1 48 SER n 
1 49 LEU n 
1 50 LYS n 
1 51 MET n 
1 52 ARG n 
1 53 GLY n 
1 54 GLN n 
1 55 ALA n 
1 56 PHE n 
1 57 VAL n 
1 58 ILE n 
1 59 PHE n 
1 60 LYS n 
1 61 GLU n 
1 62 VAL n 
1 63 SER n 
1 64 SER n 
1 65 ALA n 
1 66 THR n 
1 67 ASN n 
1 68 ALA n 
1 69 LEU n 
1 70 ARG n 
1 71 SER n 
1 72 MET n 
1 73 GLN n 
1 74 GLY n 
1 75 PHE n 
1 76 PRO n 
1 77 PHE n 
1 78 TYR n 
1 79 ASP n 
1 80 LYS n 
1 81 PRO n 
1 82 MET n 
1 83 ARG n 
1 84 ILE n 
1 85 GLN n 
1 86 TYR n 
1 87 ALA n 
1 88 LYS n 
1 89 THR n 
1 90 ASP n 
1 91 SER n 
1 92 ASP n 
1 93 ILE n 
1 94 ILE n 
1 95 ALA n 
1 96 LYS n 
1 97 MET n 
1 98 LYS n 
2 1  GTP n 
2 2  G   n 
2 3  U   n 
2 4  C   n 
2 5  A   n 
2 6  C   n 
2 7  G   n 
2 8  C   n 
2 9  A   n 
2 10 C   n 
2 11 A   n 
2 12 G   n 
2 13 G   n 
2 14 G   n 
2 15 C   n 
2 16 A   n 
2 17 A   n 
2 18 A   n 
2 19 C   n 
2 20 C   n 
2 21 A   n 
2 22 U   n 
2 23 U   n 
2 24 C   n 
2 25 G   n 
2 26 A   n 
2 27 A   n 
2 28 A   n 
2 29 G   n 
2 30 A   n 
2 31 G   n 
2 32 U   n 
2 33 G   n 
2 34 G   n 
2 35 G   n 
2 36 A   n 
2 37 C   n 
2 38 G   n 
2 39 C   n 
2 40 A   n 
2 41 A   n 
2 42 A   n 
2 43 G   n 
2 44 C   n 
2 45 C   n 
2 46 U   n 
2 47 C   n 
2 48 C   n 
2 49 G   n 
2 50 G   n 
2 51 C   n 
2 52 C   n 
2 53 U   n 
2 54 A   n 
2 55 A   n 
2 56 A   n 
2 57 C   n 
2 58 C   n 
2 59 A   n 
2 60 U   n 
2 61 U   n 
2 62 G   n 
2 63 C   n 
2 64 A   n 
2 65 C   n 
2 66 U   n 
2 67 C   n 
2 68 C   n 
2 69 G   n 
2 70 G   n 
2 71 U   n 
2 72 A   n 
2 73 G   n 
2 74 G   n 
2 75 U   n 
2 76 A   n 
2 77 G   n 
2 78 C   n 
2 79 G   n 
2 80 G   n 
2 81 G   n 
2 82 G   n 
2 83 U   n 
2 84 U   n 
2 85 A   n 
2 86 C   n 
2 87 C   n 
2 88 G   n 
2 89 A   n 
2 90 U   n 
2 91 G   n 
2 92 G   n 
3 1  G   n 
3 2  G   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SNRPA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'in vitro transcribed RNA transcript' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SNRPA_HUMAN P09012 1 
;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMK
;
1 ? 
2 PDB 3UCZ        3UCZ   2 ?                                                                                                     ? 
? 
3 PDB 3UCZ        3UCZ   3 ?                                                                                                     ? 
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UCZ P 1 ? 98 ? P09012 1 ? 98 ? 1 98 
2 2 3UCZ R 1 ? 92 ? 3UCZ   8 ? 98 ? 8 98 
3 3 3UCZ D 1 ? 2  ? 3UCZ   1 ? 2  ? 1 2  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UCZ HIS P 31 ? UNP P09012 TYR 31 'ENGINEERED MUTATION' 31 1 
1 3UCZ ARG P 36 ? UNP P09012 GLN 36 'ENGINEERED MUTATION' 36 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'    323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3UCZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   40.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    
'24% PEG550mme, 50 mM MES, pH 6.0, 5 mM MgSO4, 300 mM NaCl, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-02-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     3UCZ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   8467 
_reflns.number_all                   8491 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.85 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        6.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3UCZ 
_refine.ls_number_reflns_obs                     8233 
_refine.ls_number_reflns_all                     8233 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    99.76 
_refine.ls_R_factor_obs                          0.20560 
_refine.ls_R_factor_all                          0.20560 
_refine.ls_R_factor_R_work                       0.20242 
_refine.ls_R_factor_R_free                       0.26930 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  411 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.901 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 3MXH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.451 
_refine.overall_SU_ML                            0.426 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        742 
_refine_hist.pdbx_number_atoms_nucleic_acid   2027 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               2804 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.005  0.021  ? 3086 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.072  2.773  ? 4655 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.133  5.000  ? 90   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 32.635 23.235 ? 34   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 17.195 15.000 ? 153  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 14.311 15.000 ? 6    ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.002  0.020  ? 1559 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             586 
_refine_ls_shell.R_factor_R_work                  0.417 
_refine_ls_shell.percent_reflns_obs               99.84 
_refine_ls_shell.R_factor_R_free                  0.478 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UCZ 
_struct.title                     'The c-di-GMP-I riboswitch bound to GpG' 
_struct.pdbx_descriptor           'U1 small nuclear ribonucleoprotein A/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UCZ 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/RNA' 
_struct_keywords.text            'riboswitch, SIGNALING PROTEIN-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'THE PROTEIN IS NOT BIOLOGICALLY RELEVANT AND HAS BEEN USED AS A CRYSTALLIZATION CHAPERONE' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 22 ? SER A 35 ? LYS P 22 SER P 35 1 ? 14 
HELX_P HELX_P2 2 ARG A 36 ? GLY A 38 ? ARG P 36 GLY P 38 5 ? 3  
HELX_P HELX_P3 3 GLU A 61 ? MET A 72 ? GLU P 61 MET P 72 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B GTP 1  "O3'" ? ? ? 1_555 B G   2  P  ? ? R GTP 8   R G   9   1_555 ? ? ? ? ? ? ?                    1.601 ? 
metalc1  metalc ? ? F MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  670 R HOH 691 1_555 ? ? ? ? ? ? ?                    2.174 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  1   R HOH 674 1_555 ? ? ? ? ? ? ?                    2.175 ? 
metalc3  metalc ? ? D MG  .  MG    ? ? ? 1_555 G HOH .  O  ? ? P MG  99  P HOH 102 1_555 ? ? ? ? ? ? ?                    2.175 ? 
metalc4  metalc ? ? F MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  670 R HOH 690 1_555 ? ? ? ? ? ? ?                    2.178 ? 
metalc5  metalc ? ? F MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  670 R HOH 687 1_555 ? ? ? ? ? ? ?                    2.178 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  1   R HOH 675 1_555 ? ? ? ? ? ? ?                    2.179 ? 
metalc7  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  1   R HOH 672 1_555 ? ? ? ? ? ? ?                    2.179 ? 
metalc8  metalc ? ? D MG  .  MG    ? ? ? 1_555 G HOH .  O  ? ? P MG  99  P HOH 101 1_555 ? ? ? ? ? ? ?                    2.180 ? 
metalc9  metalc ? ? F MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  670 R HOH 688 1_555 ? ? ? ? ? ? ?                    2.180 ? 
metalc10 metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  1   R HOH 671 1_555 ? ? ? ? ? ? ?                    2.181 ? 
metalc11 metalc ? ? F MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  670 R HOH 692 1_555 ? ? ? ? ? ? ?                    2.182 ? 
metalc12 metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  1   R HOH 676 1_555 ? ? ? ? ? ? ?                    2.182 ? 
metalc13 metalc ? ? D MG  .  MG    ? ? ? 1_555 G HOH .  O  ? ? P MG  99  P HOH 100 1_555 ? ? ? ? ? ? ?                    2.183 ? 
metalc14 metalc ? ? F MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  670 R HOH 689 1_555 ? ? ? ? ? ? ?                    2.184 ? 
metalc15 metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O  ? ? R MG  1   R HOH 673 1_555 ? ? ? ? ? ? ?                    2.186 ? 
hydrog1  hydrog ? ? B C   4  N3    ? ? ? 1_555 B G   92 N1 ? ? R C   11  R G   98  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? B C   4  N4    ? ? ? 1_555 B G   92 O6 ? ? R C   11  R G   98  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? B C   4  O2    ? ? ? 1_555 B G   92 N2 ? ? R C   11  R G   98  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? B A   5  N1    ? ? ? 1_555 B G   91 N1 ? ? R A   12  R G   97  1_555 ? ? ? ? ? ? TYPE_8_PAIR          ?     ? 
hydrog5  hydrog ? ? B A   5  N6    ? ? ? 1_555 B G   91 O6 ? ? R A   12  R G   97  1_555 ? ? ? ? ? ? TYPE_8_PAIR          ?     ? 
hydrog6  hydrog ? ? B C   6  N3    ? ? ? 1_555 B G   88 N1 ? ? R C   13  R G   94  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? B C   6  N4    ? ? ? 1_555 B G   88 O6 ? ? R C   13  R G   94  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? B C   6  O2    ? ? ? 1_555 B G   88 N2 ? ? R C   13  R G   94  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? B G   7  N2    ? ? ? 1_555 B A   9  N7 ? ? R G   14  R A   16  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog10 hydrog ? ? B G   7  N1    ? ? ? 1_555 B C   87 N3 ? ? R G   14  R C   93  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? B G   7  N2    ? ? ? 1_555 B C   87 O2 ? ? R G   14  R C   93  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12 hydrog ? ? B G   7  O6    ? ? ? 1_555 B C   87 N4 ? ? R G   14  R C   93  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? B C   10 N4    ? ? ? 1_555 B C   87 O2 ? ? R C   17  R C   93  1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ?     ? 
hydrog14 hydrog ? ? B C   10 N4    ? ? ? 1_555 C G   2  N3 A ? R C   17  D G   2   1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog15 hydrog ? ? B A   11 N6    ? ? ? 1_555 C G   2  N3 A ? R A   18  D G   2   1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ?     ? 
hydrog16 hydrog ? ? B G   12 O6    ? ? ? 1_555 B A   40 N6 ? ? R G   19  R A   47  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog17 hydrog ? ? B G   13 N1    ? ? ? 1_555 C G   1  N7 A ? R G   20  D G   1   1_555 ? ? ? ? ? ? TYPE_7_PAIR          ?     ? 
hydrog18 hydrog ? ? B G   13 N2    ? ? ? 1_555 C G   1  O6 A ? R G   20  D G   1   1_555 ? ? ? ? ? ? TYPE_7_PAIR          ?     ? 
hydrog19 hydrog ? ? B G   14 N1    ? ? ? 1_555 B C   39 N3 ? ? R G   21  R C   46  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? B G   14 N2    ? ? ? 1_555 B C   39 O2 ? ? R G   21  R C   46  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? B G   14 O6    ? ? ? 1_555 B C   39 N4 ? ? R G   21  R C   46  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? B C   15 N3    ? ? ? 1_555 B G   38 N1 ? ? R C   22  R G   45  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? B C   15 N4    ? ? ? 1_555 B G   38 O6 ? ? R C   22  R G   45  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? B C   15 O2    ? ? ? 1_555 B G   38 N2 ? ? R C   22  R G   45  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? B A   16 N3    ? ? ? 1_555 B C   37 N4 ? ? R A   23  R C   44  1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog26 hydrog ? ? B A   18 N6    ? ? ? 1_555 B G   35 N3 ? ? R A   25  R G   42  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog27 hydrog ? ? B A   18 N7    ? ? ? 1_555 B G   35 N2 ? ? R A   25  R G   42  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog28 hydrog ? ? B C   19 N3    ? ? ? 1_555 B G   34 N1 ? ? R C   26  R G   41  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29 hydrog ? ? B C   19 N4    ? ? ? 1_555 B G   34 O6 ? ? R C   26  R G   41  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? B C   19 O2    ? ? ? 1_555 B G   34 N2 ? ? R C   26  R G   41  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? B C   20 N3    ? ? ? 1_555 B G   33 N1 ? ? R C   27  R G   40  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? B C   20 N4    ? ? ? 1_555 B G   33 O6 ? ? R C   27  R G   40  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33 hydrog ? ? B C   20 O2    ? ? ? 1_555 B G   33 N2 ? ? R C   27  R G   40  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? B A   21 N1    ? ? ? 1_555 B U   32 N3 ? ? R A   28  R U   39  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? B A   21 N6    ? ? ? 1_555 B U   32 O4 ? ? R A   28  R U   39  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog36 hydrog ? ? B U   22 N3    ? ? ? 1_555 B G   31 O6 ? ? R U   29  R G   38  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog37 hydrog ? ? B U   22 O2    ? ? ? 1_555 B G   31 N1 ? ? R U   29  R G   38  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog38 hydrog ? ? B U   23 N3    ? ? ? 1_555 B A   30 N1 ? ? R U   30  R A   37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog39 hydrog ? ? B U   23 O4    ? ? ? 1_555 B A   30 N6 ? ? R U   30  R A   37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog40 hydrog ? ? B C   24 N3    ? ? ? 1_555 B G   29 N1 ? ? R C   31  R G   36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog41 hydrog ? ? B C   24 N4    ? ? ? 1_555 B G   29 O6 ? ? R C   31  R G   36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42 hydrog ? ? B C   24 O2    ? ? ? 1_555 B G   29 N2 ? ? R C   31  R G   36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog43 hydrog ? ? B G   25 N2    ? ? ? 1_555 B A   28 N7 ? ? R G   32  R A   35  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog44 hydrog ? ? B A   28 N3    ? ? ? 1_555 B G   73 N2 ? ? R A   35  R G   79  1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ?     ? 
hydrog45 hydrog ? ? B C   37 N3    ? ? ? 1_555 B G   77 N1 ? ? R C   44  R G   83  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46 hydrog ? ? B C   37 N4    ? ? ? 1_555 B G   77 O6 ? ? R C   44  R G   83  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47 hydrog ? ? B C   37 O2    ? ? ? 1_555 B G   77 N2 ? ? R C   44  R G   83  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48 hydrog ? ? B A   41 N6    ? ? ? 1_555 B U   84 O2 ? ? R A   48  R U   90  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog49 hydrog ? ? B A   41 N7    ? ? ? 1_555 B U   84 N3 ? ? R A   48  R U   90  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog50 hydrog ? ? B G   43 N1    ? ? ? 1_555 B U   83 O2 ? ? R G   50  R U   89  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog51 hydrog ? ? B G   43 O6    ? ? ? 1_555 B U   83 N3 ? ? R G   50  R U   89  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog52 hydrog ? ? B C   44 N3    ? ? ? 1_555 B G   82 N1 ? ? R C   51  R G   88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog53 hydrog ? ? B C   44 N4    ? ? ? 1_555 B G   82 O6 ? ? R C   51  R G   88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog54 hydrog ? ? B C   44 O2    ? ? ? 1_555 B G   82 N2 ? ? R C   51  R G   88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog55 hydrog ? ? B C   45 N3    ? ? ? 1_555 B G   81 N1 ? ? R C   52  R G   87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog56 hydrog ? ? B C   45 N4    ? ? ? 1_555 B G   81 O6 ? ? R C   52  R G   87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog57 hydrog ? ? B C   45 O2    ? ? ? 1_555 B G   81 N2 ? ? R C   52  R G   87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog58 hydrog ? ? B U   46 O2    ? ? ? 1_555 B C   48 N4 ? ? R U   53  R C   55  1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ?     ? 
hydrog59 hydrog ? ? B C   47 N4    ? ? ? 1_555 B A   76 N1 ? ? R C   54  R A   82  1_555 ? ? ? ? ? ? 'C-A MISPAIR'        ?     ? 
hydrog60 hydrog ? ? B C   47 N3    ? ? ? 1_555 B G   80 N1 ? ? R C   54  R G   86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog61 hydrog ? ? B C   47 N4    ? ? ? 1_555 B G   80 O6 ? ? R C   54  R G   86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog62 hydrog ? ? B C   47 O2    ? ? ? 1_555 B G   80 N2 ? ? R C   54  R G   86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog63 hydrog ? ? B C   48 N3    ? ? ? 1_555 B G   79 N1 ? ? R C   55  R G   85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog64 hydrog ? ? B C   48 N4    ? ? ? 1_555 B G   79 O6 ? ? R C   55  R G   85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog65 hydrog ? ? B C   48 O2    ? ? ? 1_555 B G   79 N2 ? ? R C   55  R G   85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog66 hydrog ? ? B G   49 N1    ? ? ? 1_555 B C   78 N3 ? ? R G   56  R C   84  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog67 hydrog ? ? B G   49 N2    ? ? ? 1_555 B C   78 O2 ? ? R G   56  R C   84  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog68 hydrog ? ? B G   49 O6    ? ? ? 1_555 B C   78 N4 ? ? R G   56  R C   84  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog69 hydrog ? ? B G   50 N1    ? ? ? 1_555 B U   75 O2 ? ? R G   57  R U   81  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog70 hydrog ? ? B G   50 O6    ? ? ? 1_555 B U   75 N3 ? ? R G   57  R U   81  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog71 hydrog ? ? B C   51 N3    ? ? ? 1_555 B G   74 N1 ? ? R C   58  R G   80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog72 hydrog ? ? B C   51 N4    ? ? ? 1_555 B G   74 O6 ? ? R C   58  R G   80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog73 hydrog ? ? B C   51 O2    ? ? ? 1_555 B G   74 N2 ? ? R C   58  R G   80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog74 hydrog ? ? B C   52 N3    ? ? ? 1_555 B G   73 N1 ? ? R C   59  R G   79  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog75 hydrog ? ? B C   52 N4    ? ? ? 1_555 B G   73 O6 ? ? R C   59  R G   79  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog76 hydrog ? ? B C   52 O2    ? ? ? 1_555 B G   73 N2 ? ? R C   59  R G   79  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog77 hydrog ? ? B U   53 N3    ? ? ? 1_555 B A   72 N1 ? ? R U   60  R A   78  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog78 hydrog ? ? B U   53 O4    ? ? ? 1_555 B A   72 N6 ? ? R U   60  R A   78  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog79 hydrog ? ? B A   54 N1    ? ? ? 1_555 B U   71 N3 ? ? R A   61  R U   77  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog80 hydrog ? ? B A   54 N6    ? ? ? 1_555 B U   71 O4 ? ? R A   61  R U   77  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog81 hydrog ? ? B A   56 N6    ? ? ? 1_555 B U   71 O2 ? ? R A   63  R U   77  1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog82 hydrog ? ? B C   57 N3    ? ? ? 1_555 B G   70 N1 ? ? R C   64  R G   76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog83 hydrog ? ? B C   57 N4    ? ? ? 1_555 B G   70 O6 ? ? R C   64  R G   76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog84 hydrog ? ? B C   57 O2    ? ? ? 1_555 B G   70 N2 ? ? R C   64  R G   76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog85 hydrog ? ? B C   58 N3    ? ? ? 1_555 B G   69 N1 ? ? R C   65  R G   75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog86 hydrog ? ? B C   58 N4    ? ? ? 1_555 B G   69 O6 ? ? R C   65  R G   75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog87 hydrog ? ? B C   58 O2    ? ? ? 1_555 B G   69 N2 ? ? R C   65  R G   75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog88 hydrog ? ? B C   86 N3    ? ? ? 1_555 C G   2  N1 A ? R C   92  D G   2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog89 hydrog ? ? B C   86 N4    ? ? ? 1_555 C G   2  O6 A ? R C   92  D G   2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog90 hydrog ? ? B C   86 O2    ? ? ? 1_555 C G   2  N2 A ? R C   92  D G   2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog91 hydrog ? ? B G   88 N2    ? ? ? 1_555 B A   89 N1 ? ? R G   94  R A   95  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 40 ? LEU A 44 ? ILE P 40 LEU P 44 
A 2 ALA A 55 ? PHE A 59 ? ALA P 55 PHE P 59 
A 3 THR A 11 ? ASN A 15 ? THR P 11 ASN P 15 
A 4 ARG A 83 ? TYR A 86 ? ARG P 83 TYR P 86 
B 1 PRO A 76 ? PHE A 77 ? PRO P 76 PHE P 77 
B 2 LYS A 80 ? PRO A 81 ? LYS P 80 PRO P 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 41 ? N LEU P 41 O ILE A 58 ? O ILE P 58 
A 2 3 O ALA A 55 ? O ALA P 55 N ILE A 14 ? N ILE P 14 
A 3 4 N TYR A 13 ? N TYR P 13 O GLN A 85 ? O GLN P 85 
B 1 2 N PHE A 77 ? N PHE P 77 O LYS A 80 ? O LYS P 80 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG P 99'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG R 1'   
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG R 670' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 31 ? HIS P 31  . ? 1_555 ? 
2  AC1 4 HOH G .  ? HOH P 100 . ? 1_555 ? 
3  AC1 4 HOH G .  ? HOH P 101 . ? 1_555 ? 
4  AC1 4 HOH G .  ? HOH P 102 . ? 1_555 ? 
5  AC2 7 G   B 35 ? G   R 42  . ? 1_555 ? 
6  AC2 7 HOH H .  ? HOH R 671 . ? 1_555 ? 
7  AC2 7 HOH H .  ? HOH R 672 . ? 1_555 ? 
8  AC2 7 HOH H .  ? HOH R 673 . ? 1_555 ? 
9  AC2 7 HOH H .  ? HOH R 674 . ? 1_555 ? 
10 AC2 7 HOH H .  ? HOH R 675 . ? 1_555 ? 
11 AC2 7 HOH H .  ? HOH R 676 . ? 1_555 ? 
12 AC3 6 HOH H .  ? HOH R 687 . ? 1_555 ? 
13 AC3 6 HOH H .  ? HOH R 688 . ? 1_555 ? 
14 AC3 6 HOH H .  ? HOH R 689 . ? 1_555 ? 
15 AC3 6 HOH H .  ? HOH R 690 . ? 1_555 ? 
16 AC3 6 HOH H .  ? HOH R 691 . ? 1_555 ? 
17 AC3 6 HOH H .  ? HOH R 692 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3UCZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UCZ 
_atom_sites.fract_transf_matrix[1][1]   0.020077 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002042 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022047 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012998 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 7  ? 3.387  29.627  -6.514  1.00 86.69  ? 7   ARG P N     1 
ATOM   2    C  CA    . ARG A 1 7  ? 4.162  28.383  -6.797  1.00 80.95  ? 7   ARG P CA    1 
ATOM   3    C  C     . ARG A 1 7  ? 5.528  28.295  -6.080  1.00 73.70  ? 7   ARG P C     1 
ATOM   4    O  O     . ARG A 1 7  ? 5.720  27.392  -5.263  1.00 69.34  ? 7   ARG P O     1 
ATOM   5    C  CB    . ARG A 1 7  ? 4.297  28.149  -8.307  1.00 84.31  ? 7   ARG P CB    1 
ATOM   6    C  CG    . ARG A 1 7  ? 3.081  27.487  -8.945  1.00 90.82  ? 7   ARG P CG    1 
ATOM   7    C  CD    . ARG A 1 7  ? 3.511  26.320  -9.831  1.00 90.93  ? 7   ARG P CD    1 
ATOM   8    N  NE    . ARG A 1 7  ? 4.555  25.521  -9.180  1.00 83.02  ? 7   ARG P NE    1 
ATOM   9    C  CZ    . ARG A 1 7  ? 5.153  24.458  -9.712  1.00 81.74  ? 7   ARG P CZ    1 
ATOM   10   N  NH1   . ARG A 1 7  ? 4.819  24.026  -10.923 1.00 88.38  ? 7   ARG P NH1   1 
ATOM   11   N  NH2   . ARG A 1 7  ? 6.089  23.821  -9.023  1.00 74.94  ? 7   ARG P NH2   1 
ATOM   12   N  N     . PRO A 1 8  ? 6.476  29.220  -6.369  1.00 73.31  ? 8   PRO P N     1 
ATOM   13   C  CA    . PRO A 1 8  ? 7.781  29.157  -5.693  1.00 67.88  ? 8   PRO P CA    1 
ATOM   14   C  C     . PRO A 1 8  ? 7.689  29.288  -4.177  1.00 65.97  ? 8   PRO P C     1 
ATOM   15   O  O     . PRO A 1 8  ? 6.719  29.839  -3.659  1.00 69.77  ? 8   PRO P O     1 
ATOM   16   C  CB    . PRO A 1 8  ? 8.535  30.356  -6.271  1.00 70.36  ? 8   PRO P CB    1 
ATOM   17   C  CG    . PRO A 1 8  ? 7.915  30.584  -7.574  1.00 75.83  ? 8   PRO P CG    1 
ATOM   18   C  CD    . PRO A 1 8  ? 6.459  30.298  -7.373  1.00 78.70  ? 8   PRO P CD    1 
ATOM   19   N  N     . ASN A 1 9  ? 8.705  28.783  -3.483  1.00 61.42  ? 9   ASN P N     1 
ATOM   20   C  CA    . ASN A 1 9  ? 8.697  28.698  -2.024  1.00 60.35  ? 9   ASN P CA    1 
ATOM   21   C  C     . ASN A 1 9  ? 10.116 28.732  -1.438  1.00 57.45  ? 9   ASN P C     1 
ATOM   22   O  O     . ASN A 1 9  ? 11.088 28.430  -2.133  1.00 55.46  ? 9   ASN P O     1 
ATOM   23   C  CB    . ASN A 1 9  ? 7.969  27.417  -1.598  1.00 58.74  ? 9   ASN P CB    1 
ATOM   24   C  CG    . ASN A 1 9  ? 7.401  27.503  -0.200  1.00 61.00  ? 9   ASN P CG    1 
ATOM   25   O  OD1   . ASN A 1 9  ? 8.143  27.514  0.783   1.00 60.62  ? 9   ASN P OD1   1 
ATOM   26   N  ND2   . ASN A 1 9  ? 6.074  27.549  -0.100  1.00 65.54  ? 9   ASN P ND2   1 
ATOM   27   N  N     . HIS A 1 10 ? 10.231 29.111  -0.166  1.00 58.50  ? 10  HIS P N     1 
ATOM   28   C  CA    . HIS A 1 10 ? 11.511 29.074  0.542   1.00 56.94  ? 10  HIS P CA    1 
ATOM   29   C  C     . HIS A 1 10 ? 11.970 27.638  0.727   1.00 52.39  ? 10  HIS P C     1 
ATOM   30   O  O     . HIS A 1 10 ? 13.171 27.351  0.780   1.00 50.74  ? 10  HIS P O     1 
ATOM   31   C  CB    . HIS A 1 10 ? 11.380 29.727  1.913   1.00 60.75  ? 10  HIS P CB    1 
ATOM   32   C  CG    . HIS A 1 10 ? 11.366 31.219  1.870   1.00 66.20  ? 10  HIS P CG    1 
ATOM   33   N  ND1   . HIS A 1 10 ? 12.464 31.980  2.205   1.00 68.85  ? 10  HIS P ND1   1 
ATOM   34   C  CD2   . HIS A 1 10 ? 10.392 32.094  1.526   1.00 70.66  ? 10  HIS P CD2   1 
ATOM   35   C  CE1   . HIS A 1 10 ? 12.167 33.260  2.070   1.00 74.03  ? 10  HIS P CE1   1 
ATOM   36   N  NE2   . HIS A 1 10 ? 10.914 33.356  1.662   1.00 75.04  ? 10  HIS P NE2   1 
ATOM   37   N  N     . THR A 1 11 ? 10.991 26.746  0.833   1.00 51.17  ? 11  THR P N     1 
ATOM   38   C  CA    . THR A 1 11 ? 11.236 25.344  1.099   1.00 47.67  ? 11  THR P CA    1 
ATOM   39   C  C     . THR A 1 11 ? 11.152 24.562  -0.202  1.00 45.69  ? 11  THR P C     1 
ATOM   40   O  O     . THR A 1 11 ? 10.339 24.876  -1.071  1.00 47.55  ? 11  THR P O     1 
ATOM   41   C  CB    . THR A 1 11 ? 10.206 24.793  2.101   1.00 48.92  ? 11  THR P CB    1 
ATOM   42   O  OG1   . THR A 1 11 ? 9.997  25.745  3.153   1.00 52.98  ? 11  THR P OG1   1 
ATOM   43   C  CG2   . THR A 1 11 ? 10.678 23.481  2.697   1.00 46.48  ? 11  THR P CG2   1 
ATOM   44   N  N     . ILE A 1 12 ? 12.010 23.558  -0.338  1.00 43.04  ? 12  ILE P N     1 
ATOM   45   C  CA    . ILE A 1 12 ? 11.893 22.605  -1.436  1.00 42.39  ? 12  ILE P CA    1 
ATOM   46   C  C     . ILE A 1 12 ? 11.576 21.208  -0.902  1.00 40.94  ? 12  ILE P C     1 
ATOM   47   O  O     . ILE A 1 12 ? 12.101 20.790  0.134   1.00 39.84  ? 12  ILE P O     1 
ATOM   48   C  CB    . ILE A 1 12 ? 13.148 22.574  -2.339  1.00 42.37  ? 12  ILE P CB    1 
ATOM   49   C  CG1   . ILE A 1 12 ? 14.420 22.326  -1.518  1.00 41.12  ? 12  ILE P CG1   1 
ATOM   50   C  CG2   . ILE A 1 12 ? 13.256 23.867  -3.142  1.00 45.17  ? 12  ILE P CG2   1 
ATOM   51   C  CD1   . ILE A 1 12 ? 15.509 21.607  -2.292  1.00 41.48  ? 12  ILE P CD1   1 
ATOM   52   N  N     . TYR A 1 13 ? 10.703 20.501  -1.610  1.00 41.94  ? 13  TYR P N     1 
ATOM   53   C  CA    . TYR A 1 13 ? 10.276 19.172  -1.209  1.00 41.50  ? 13  TYR P CA    1 
ATOM   54   C  C     . TYR A 1 13 ? 10.995 18.127  -2.039  1.00 41.25  ? 13  TYR P C     1 
ATOM   55   O  O     . TYR A 1 13 ? 10.728 17.964  -3.231  1.00 43.59  ? 13  TYR P O     1 
ATOM   56   C  CB    . TYR A 1 13 ? 8.762  19.033  -1.365  1.00 44.53  ? 13  TYR P CB    1 
ATOM   57   C  CG    . TYR A 1 13 ? 8.211  17.657  -1.058  1.00 44.90  ? 13  TYR P CG    1 
ATOM   58   C  CD1   . TYR A 1 13 ? 8.034  17.236  0.259   1.00 44.03  ? 13  TYR P CD1   1 
ATOM   59   C  CD2   . TYR A 1 13 ? 7.845  16.788  -2.085  1.00 46.72  ? 13  TYR P CD2   1 
ATOM   60   C  CE1   . TYR A 1 13 ? 7.521  15.982  0.549   1.00 45.63  ? 13  TYR P CE1   1 
ATOM   61   C  CE2   . TYR A 1 13 ? 7.328  15.529  -1.806  1.00 48.54  ? 13  TYR P CE2   1 
ATOM   62   C  CZ    . TYR A 1 13 ? 7.168  15.133  -0.486  1.00 47.91  ? 13  TYR P CZ    1 
ATOM   63   O  OH    . TYR A 1 13 ? 6.656  13.889  -0.197  1.00 50.82  ? 13  TYR P OH    1 
ATOM   64   N  N     . ILE A 1 14 ? 11.917 17.424  -1.396  1.00 39.76  ? 14  ILE P N     1 
ATOM   65   C  CA    . ILE A 1 14 ? 12.654 16.359  -2.055  1.00 40.37  ? 14  ILE P CA    1 
ATOM   66   C  C     . ILE A 1 14 ? 11.945 15.043  -1.798  1.00 41.36  ? 14  ILE P C     1 
ATOM   67   O  O     . ILE A 1 14 ? 11.583 14.716  -0.662  1.00 40.83  ? 14  ILE P O     1 
ATOM   68   C  CB    . ILE A 1 14 ? 14.123 16.314  -1.609  1.00 39.25  ? 14  ILE P CB    1 
ATOM   69   C  CG1   . ILE A 1 14 ? 14.771 17.682  -1.842  1.00 39.32  ? 14  ILE P CG1   1 
ATOM   70   C  CG2   . ILE A 1 14 ? 14.878 15.252  -2.394  1.00 41.12  ? 14  ILE P CG2   1 
ATOM   71   C  CD1   . ILE A 1 14 ? 15.794 18.054  -0.819  1.00 39.25  ? 14  ILE P CD1   1 
ATOM   72   N  N     . ASN A 1 15 ? 11.741 14.310  -2.882  1.00 43.97  ? 15  ASN P N     1 
ATOM   73   C  CA    . ASN A 1 15 ? 10.944 13.100  -2.896  1.00 46.26  ? 15  ASN P CA    1 
ATOM   74   C  C     . ASN A 1 15 ? 11.856 11.948  -3.278  1.00 47.49  ? 15  ASN P C     1 
ATOM   75   O  O     . ASN A 1 15 ? 12.992 12.175  -3.698  1.00 47.43  ? 15  ASN P O     1 
ATOM   76   C  CB    . ASN A 1 15 ? 9.838  13.271  -3.946  1.00 50.33  ? 15  ASN P CB    1 
ATOM   77   C  CG    . ASN A 1 15 ? 8.611  12.447  -3.654  1.00 53.79  ? 15  ASN P CG    1 
ATOM   78   O  OD1   . ASN A 1 15 ? 8.275  12.199  -2.498  1.00 53.58  ? 15  ASN P OD1   1 
ATOM   79   N  ND2   . ASN A 1 15 ? 7.918  12.030  -4.708  1.00 59.51  ? 15  ASN P ND2   1 
ATOM   80   N  N     . ASN A 1 16 ? 11.374 10.717  -3.128  1.00 49.57  ? 16  ASN P N     1 
ATOM   81   C  CA    . ASN A 1 16 ? 12.061 9.550   -3.682  1.00 52.43  ? 16  ASN P CA    1 
ATOM   82   C  C     . ASN A 1 16 ? 13.498 9.392   -3.152  1.00 50.46  ? 16  ASN P C     1 
ATOM   83   O  O     . ASN A 1 16 ? 14.453 9.215   -3.919  1.00 52.93  ? 16  ASN P O     1 
ATOM   84   C  CB    . ASN A 1 16 ? 12.032 9.630   -5.220  1.00 56.99  ? 16  ASN P CB    1 
ATOM   85   C  CG    . ASN A 1 16 ? 12.394 8.324   -5.890  1.00 62.06  ? 16  ASN P CG    1 
ATOM   86   O  OD1   . ASN A 1 16 ? 11.774 7.290   -5.647  1.00 64.39  ? 16  ASN P OD1   1 
ATOM   87   N  ND2   . ASN A 1 16 ? 13.399 8.371   -6.755  1.00 64.74  ? 16  ASN P ND2   1 
ATOM   88   N  N     . LEU A 1 17 ? 13.643 9.472   -1.834  1.00 47.09  ? 17  LEU P N     1 
ATOM   89   C  CA    . LEU A 1 17 ? 14.943 9.290   -1.201  1.00 46.30  ? 17  LEU P CA    1 
ATOM   90   C  C     . LEU A 1 17 ? 15.116 7.856   -0.718  1.00 48.97  ? 17  LEU P C     1 
ATOM   91   O  O     . LEU A 1 17 ? 14.136 7.178   -0.392  1.00 50.01  ? 17  LEU P O     1 
ATOM   92   C  CB    . LEU A 1 17 ? 15.119 10.257  -0.026  1.00 42.73  ? 17  LEU P CB    1 
ATOM   93   C  CG    . LEU A 1 17 ? 15.042 11.764  -0.289  1.00 40.51  ? 17  LEU P CG    1 
ATOM   94   C  CD1   . LEU A 1 17 ? 14.913 12.516  1.024   1.00 37.79  ? 17  LEU P CD1   1 
ATOM   95   C  CD2   . LEU A 1 17 ? 16.240 12.266  -1.090  1.00 40.96  ? 17  LEU P CD2   1 
ATOM   96   N  N     . ASN A 1 18 ? 16.369 7.405   -0.685  1.00 50.98  ? 18  ASN P N     1 
ATOM   97   C  CA    . ASN A 1 18 ? 16.729 6.108   -0.125  1.00 53.93  ? 18  ASN P CA    1 
ATOM   98   C  C     . ASN A 1 18 ? 16.361 6.060   1.354   1.00 52.20  ? 18  ASN P C     1 
ATOM   99   O  O     . ASN A 1 18 ? 16.955 6.757   2.173   1.00 50.54  ? 18  ASN P O     1 
ATOM   100  C  CB    . ASN A 1 18 ? 18.226 5.858   -0.318  1.00 56.91  ? 18  ASN P CB    1 
ATOM   101  C  CG    . ASN A 1 18 ? 18.622 4.419   -0.049  1.00 61.41  ? 18  ASN P CG    1 
ATOM   102  O  OD1   . ASN A 1 18 ? 18.135 3.789   0.888   1.00 61.39  ? 18  ASN P OD1   1 
ATOM   103  N  ND2   . ASN A 1 18 ? 19.524 3.896   -0.869  1.00 66.13  ? 18  ASN P ND2   1 
ATOM   104  N  N     . GLU A 1 19 ? 15.370 5.238   1.684   1.00 53.96  ? 19  GLU P N     1 
ATOM   105  C  CA    . GLU A 1 19 ? 14.806 5.187   3.037   1.00 53.75  ? 19  GLU P CA    1 
ATOM   106  C  C     . GLU A 1 19 ? 15.716 4.466   4.035   1.00 56.45  ? 19  GLU P C     1 
ATOM   107  O  O     . GLU A 1 19 ? 15.534 4.587   5.250   1.00 56.98  ? 19  GLU P O     1 
ATOM   108  C  CB    . GLU A 1 19 ? 13.418 4.540   3.011   1.00 55.76  ? 19  GLU P CB    1 
ATOM   109  C  CG    . GLU A 1 19 ? 12.377 5.338   2.225   1.00 54.82  ? 19  GLU P CG    1 
ATOM   110  C  CD    . GLU A 1 19 ? 11.211 4.493   1.716   1.00 59.48  ? 19  GLU P CD    1 
ATOM   111  O  OE1   . GLU A 1 19 ? 11.012 3.362   2.208   1.00 63.12  ? 19  GLU P OE1   1 
ATOM   112  O  OE2   . GLU A 1 19 ? 10.486 4.969   0.815   1.00 60.65  ? 19  GLU P OE2   1 
ATOM   113  N  N     . LYS A 1 20 ? 16.697 3.730   3.513   1.00 59.37  ? 20  LYS P N     1 
ATOM   114  C  CA    . LYS A 1 20 ? 17.615 2.941   4.331   1.00 63.16  ? 20  LYS P CA    1 
ATOM   115  C  C     . LYS A 1 20 ? 18.657 3.788   5.065   1.00 62.52  ? 20  LYS P C     1 
ATOM   116  O  O     . LYS A 1 20 ? 19.320 3.303   5.985   1.00 66.01  ? 20  LYS P O     1 
ATOM   117  C  CB    . LYS A 1 20 ? 18.309 1.874   3.480   1.00 67.72  ? 20  LYS P CB    1 
ATOM   118  C  CG    . LYS A 1 20 ? 17.465 0.640   3.206   1.00 71.66  ? 20  LYS P CG    1 
ATOM   119  C  CD    . LYS A 1 20 ? 18.344 -0.508  2.717   1.00 78.75  ? 20  LYS P CD    1 
ATOM   120  C  CE    . LYS A 1 20 ? 17.698 -1.865  2.960   1.00 83.61  ? 20  LYS P CE    1 
ATOM   121  N  NZ    . LYS A 1 20 ? 18.670 -2.979  2.762   1.00 90.08  ? 20  LYS P NZ    1 
ATOM   122  N  N     . ILE A 1 21 ? 18.797 5.046   4.657   1.00 59.03  ? 21  ILE P N     1 
ATOM   123  C  CA    . ILE A 1 21 ? 19.770 5.957   5.261   1.00 59.34  ? 21  ILE P CA    1 
ATOM   124  C  C     . ILE A 1 21 ? 19.262 6.450   6.615   1.00 59.06  ? 21  ILE P C     1 
ATOM   125  O  O     . ILE A 1 21 ? 18.057 6.632   6.807   1.00 56.91  ? 21  ILE P O     1 
ATOM   126  C  CB    . ILE A 1 21 ? 20.100 7.171   4.332   1.00 56.56  ? 21  ILE P CB    1 
ATOM   127  C  CG1   . ILE A 1 21 ? 20.286 6.731   2.869   1.00 57.70  ? 21  ILE P CG1   1 
ATOM   128  C  CG2   . ILE A 1 21 ? 21.325 7.948   4.835   1.00 58.37  ? 21  ILE P CG2   1 
ATOM   129  C  CD1   . ILE A 1 21 ? 21.313 5.614   2.643   1.00 63.83  ? 21  ILE P CD1   1 
ATOM   130  N  N     . LYS A 1 22 ? 20.188 6.641   7.553   1.00 62.67  ? 22  LYS P N     1 
ATOM   131  C  CA    . LYS A 1 22 ? 19.865 7.182   8.870   1.00 64.32  ? 22  LYS P CA    1 
ATOM   132  C  C     . LYS A 1 22 ? 19.504 8.661   8.759   1.00 61.01  ? 22  LYS P C     1 
ATOM   133  O  O     . LYS A 1 22 ? 19.834 9.311   7.768   1.00 58.34  ? 22  LYS P O     1 
ATOM   134  C  CB    . LYS A 1 22 ? 21.042 6.994   9.833   1.00 70.41  ? 22  LYS P CB    1 
ATOM   135  C  CG    . LYS A 1 22 ? 21.199 5.580   10.377  1.00 75.41  ? 22  LYS P CG    1 
ATOM   136  C  CD    . LYS A 1 22 ? 22.201 5.550   11.521  1.00 82.74  ? 22  LYS P CD    1 
ATOM   137  C  CE    . LYS A 1 22 ? 22.260 4.175   12.169  1.00 88.75  ? 22  LYS P CE    1 
ATOM   138  N  NZ    . LYS A 1 22 ? 23.226 4.130   13.307  1.00 96.80  ? 22  LYS P NZ    1 
ATOM   139  N  N     . LYS A 1 23 ? 18.817 9.186   9.770   1.00 62.28  ? 23  LYS P N     1 
ATOM   140  C  CA    . LYS A 1 23 ? 18.466 10.604  9.802   1.00 60.46  ? 23  LYS P CA    1 
ATOM   141  C  C     . LYS A 1 23 ? 19.733 11.457  9.879   1.00 62.47  ? 23  LYS P C     1 
ATOM   142  O  O     . LYS A 1 23 ? 19.877 12.437  9.141   1.00 59.76  ? 23  LYS P O     1 
ATOM   143  C  CB    . LYS A 1 23 ? 17.550 10.903  10.991  1.00 63.53  ? 23  LYS P CB    1 
ATOM   144  C  CG    . LYS A 1 23 ? 16.670 12.125  10.797  1.00 61.53  ? 23  LYS P CG    1 
ATOM   145  C  CD    . LYS A 1 23 ? 15.914 12.498  12.061  1.00 67.21  ? 23  LYS P CD    1 
ATOM   146  C  CE    . LYS A 1 23 ? 16.656 13.566  12.851  1.00 72.16  ? 23  LYS P CE    1 
ATOM   147  N  NZ    . LYS A 1 23 ? 15.775 14.198  13.870  1.00 77.66  ? 23  LYS P NZ    1 
ATOM   148  N  N     . ASP A 1 24 ? 20.645 11.059  10.766  1.00 68.11  ? 24  ASP P N     1 
ATOM   149  C  CA    . ASP A 1 24 ? 21.918 11.745  10.980  1.00 72.08  ? 24  ASP P CA    1 
ATOM   150  C  C     . ASP A 1 24 ? 22.622 12.048  9.662   1.00 69.26  ? 24  ASP P C     1 
ATOM   151  O  O     . ASP A 1 24 ? 22.898 13.210  9.355   1.00 68.67  ? 24  ASP P O     1 
ATOM   152  C  CB    . ASP A 1 24 ? 22.844 10.901  11.870  1.00 79.35  ? 24  ASP P CB    1 
ATOM   153  C  CG    . ASP A 1 24 ? 22.254 10.616  13.248  1.00 84.24  ? 24  ASP P CG    1 
ATOM   154  O  OD1   . ASP A 1 24 ? 21.015 10.668  13.408  1.00 81.67  ? 24  ASP P OD1   1 
ATOM   155  O  OD2   . ASP A 1 24 ? 23.041 10.327  14.176  1.00 91.87  ? 24  ASP P OD2   1 
ATOM   156  N  N     . GLU A 1 25 ? 22.893 10.997  8.888   1.00 68.36  ? 25  GLU P N     1 
ATOM   157  C  CA    . GLU A 1 25 ? 23.659 11.113  7.649   1.00 67.74  ? 25  GLU P CA    1 
ATOM   158  C  C     . GLU A 1 25 ? 22.869 11.792  6.536   1.00 61.71  ? 25  GLU P C     1 
ATOM   159  O  O     . GLU A 1 25 ? 23.434 12.554  5.748   1.00 61.85  ? 25  GLU P O     1 
ATOM   160  C  CB    . GLU A 1 25 ? 24.158 9.741   7.186   1.00 70.23  ? 25  GLU P CB    1 
ATOM   161  C  CG    . GLU A 1 25 ? 25.306 9.167   8.018   1.00 78.49  ? 25  GLU P CG    1 
ATOM   162  C  CD    . GLU A 1 25 ? 26.654 9.845   7.760   1.00 84.54  ? 25  GLU P CD    1 
ATOM   163  O  OE1   . GLU A 1 25 ? 26.796 10.545  6.733   1.00 82.91  ? 25  GLU P OE1   1 
ATOM   164  O  OE2   . GLU A 1 25 ? 27.579 9.669   8.587   1.00 91.70  ? 25  GLU P OE2   1 
ATOM   165  N  N     . LEU A 1 26 ? 21.567 11.515  6.481   1.00 57.37  ? 26  LEU P N     1 
ATOM   166  C  CA    . LEU A 1 26 ? 20.699 12.057  5.440   1.00 52.46  ? 26  LEU P CA    1 
ATOM   167  C  C     . LEU A 1 26 ? 20.723 13.584  5.444   1.00 51.46  ? 26  LEU P C     1 
ATOM   168  O  O     . LEU A 1 26 ? 21.012 14.197  4.415   1.00 50.69  ? 26  LEU P O     1 
ATOM   169  C  CB    . LEU A 1 26 ? 19.268 11.515  5.578   1.00 49.83  ? 26  LEU P CB    1 
ATOM   170  C  CG    . LEU A 1 26 ? 18.195 11.885  4.541   1.00 46.15  ? 26  LEU P CG    1 
ATOM   171  C  CD1   . LEU A 1 26 ? 18.621 11.533  3.118   1.00 46.58  ? 26  LEU P CD1   1 
ATOM   172  C  CD2   . LEU A 1 26 ? 16.881 11.206  4.874   1.00 45.07  ? 26  LEU P CD2   1 
ATOM   173  N  N     . LYS A 1 27 ? 20.439 14.190  6.596   1.00 52.55  ? 27  LYS P N     1 
ATOM   174  C  CA    . LYS A 1 27 ? 20.541 15.643  6.749   1.00 52.97  ? 27  LYS P CA    1 
ATOM   175  C  C     . LYS A 1 27 ? 21.917 16.136  6.318   1.00 55.94  ? 27  LYS P C     1 
ATOM   176  O  O     . LYS A 1 27 ? 22.028 17.044  5.496   1.00 55.01  ? 27  LYS P O     1 
ATOM   177  C  CB    . LYS A 1 27 ? 20.313 16.061  8.199   1.00 56.47  ? 27  LYS P CB    1 
ATOM   178  C  CG    . LYS A 1 27 ? 18.880 16.219  8.619   1.00 54.61  ? 27  LYS P CG    1 
ATOM   179  C  CD    . LYS A 1 27 ? 18.825 17.113  9.841   1.00 59.21  ? 27  LYS P CD    1 
ATOM   180  C  CE    . LYS A 1 27 ? 17.614 16.821  10.692  1.00 61.01  ? 27  LYS P CE    1 
ATOM   181  N  NZ    . LYS A 1 27 ? 17.287 17.994  11.544  1.00 65.74  ? 27  LYS P NZ    1 
ATOM   182  N  N     . LYS A 1 28 ? 22.953 15.512  6.874   1.00 60.42  ? 28  LYS P N     1 
ATOM   183  C  CA    . LYS A 1 28 ? 24.338 15.910  6.659   1.00 65.27  ? 28  LYS P CA    1 
ATOM   184  C  C     . LYS A 1 28 ? 24.711 15.901  5.176   1.00 63.94  ? 28  LYS P C     1 
ATOM   185  O  O     . LYS A 1 28 ? 25.377 16.822  4.698   1.00 66.40  ? 28  LYS P O     1 
ATOM   186  C  CB    . LYS A 1 28 ? 25.270 15.001  7.463   1.00 71.10  ? 28  LYS P CB    1 
ATOM   187  C  CG    . LYS A 1 28 ? 26.481 15.706  8.043   1.00 78.75  ? 28  LYS P CG    1 
ATOM   188  C  CD    . LYS A 1 28 ? 27.254 14.793  8.988   1.00 85.54  ? 28  LYS P CD    1 
ATOM   189  C  CE    . LYS A 1 28 ? 28.470 15.501  9.566   1.00 94.69  ? 28  LYS P CE    1 
ATOM   190  N  NZ    . LYS A 1 28 ? 29.315 14.588  10.386  1.00 102.53 ? 28  LYS P NZ    1 
ATOM   191  N  N     . SER A 1 29 ? 24.261 14.871  4.458   1.00 61.02  ? 29  SER P N     1 
ATOM   192  C  CA    . SER A 1 29 ? 24.499 14.745  3.017   1.00 60.75  ? 29  SER P CA    1 
ATOM   193  C  C     . SER A 1 29 ? 23.748 15.806  2.221   1.00 57.04  ? 29  SER P C     1 
ATOM   194  O  O     . SER A 1 29 ? 24.354 16.529  1.433   1.00 59.55  ? 29  SER P O     1 
ATOM   195  C  CB    . SER A 1 29 ? 24.125 13.350  2.521   1.00 59.69  ? 29  SER P CB    1 
ATOM   196  O  OG    . SER A 1 29 ? 25.103 12.403  2.908   1.00 65.17  ? 29  SER P OG    1 
ATOM   197  N  N     . LEU A 1 30 ? 22.436 15.897  2.441   1.00 52.08  ? 30  LEU P N     1 
ATOM   198  C  CA    . LEU A 1 30 ? 21.594 16.916  1.811   1.00 49.05  ? 30  LEU P CA    1 
ATOM   199  C  C     . LEU A 1 30 ? 22.133 18.327  2.025   1.00 51.25  ? 30  LEU P C     1 
ATOM   200  O  O     . LEU A 1 30 ? 22.065 19.162  1.126   1.00 51.23  ? 30  LEU P O     1 
ATOM   201  C  CB    . LEU A 1 30 ? 20.164 16.830  2.349   1.00 45.19  ? 30  LEU P CB    1 
ATOM   202  C  CG    . LEU A 1 30 ? 19.279 15.685  1.859   1.00 42.99  ? 30  LEU P CG    1 
ATOM   203  C  CD1   . LEU A 1 30 ? 18.171 15.434  2.854   1.00 41.67  ? 30  LEU P CD1   1 
ATOM   204  C  CD2   . LEU A 1 30 ? 18.709 15.969  0.477   1.00 41.78  ? 30  LEU P CD2   1 
ATOM   205  N  N     . HIS A 1 31 ? 22.658 18.573  3.224   1.00 54.05  ? 31  HIS P N     1 
ATOM   206  C  CA    . HIS A 1 31 ? 23.286 19.842  3.597   1.00 57.83  ? 31  HIS P CA    1 
ATOM   207  C  C     . HIS A 1 31 ? 24.521 20.102  2.739   1.00 62.22  ? 31  HIS P C     1 
ATOM   208  O  O     . HIS A 1 31 ? 24.664 21.180  2.160   1.00 63.61  ? 31  HIS P O     1 
ATOM   209  C  CB    . HIS A 1 31 ? 23.666 19.802  5.083   1.00 61.64  ? 31  HIS P CB    1 
ATOM   210  C  CG    . HIS A 1 31 ? 23.980 21.140  5.678   1.00 66.05  ? 31  HIS P CG    1 
ATOM   211  N  ND1   . HIS A 1 31 ? 25.272 21.573  5.890   1.00 73.50  ? 31  HIS P ND1   1 
ATOM   212  C  CD2   . HIS A 1 31 ? 23.173 22.126  6.134   1.00 65.73  ? 31  HIS P CD2   1 
ATOM   213  C  CE1   . HIS A 1 31 ? 25.247 22.775  6.437   1.00 76.98  ? 31  HIS P CE1   1 
ATOM   214  N  NE2   . HIS A 1 31 ? 23.985 23.135  6.594   1.00 72.48  ? 31  HIS P NE2   1 
ATOM   215  N  N     . ALA A 1 32 ? 25.395 19.098  2.651   1.00 65.24  ? 32  ALA P N     1 
ATOM   216  C  CA    . ALA A 1 32 ? 26.617 19.170  1.845   1.00 70.98  ? 32  ALA P CA    1 
ATOM   217  C  C     . ALA A 1 32 ? 26.314 19.370  0.362   1.00 69.58  ? 32  ALA P C     1 
ATOM   218  O  O     . ALA A 1 32 ? 27.103 19.968  -0.367  1.00 74.57  ? 32  ALA P O     1 
ATOM   219  C  CB    . ALA A 1 32 ? 27.450 17.917  2.046   1.00 74.86  ? 32  ALA P CB    1 
ATOM   220  N  N     . ILE A 1 33 ? 25.163 18.860  -0.067  1.00 63.79  ? 33  ILE P N     1 
ATOM   221  C  CA    . ILE A 1 33 ? 24.709 18.968  -1.446  1.00 62.97  ? 33  ILE P CA    1 
ATOM   222  C  C     . ILE A 1 33 ? 24.099 20.342  -1.739  1.00 61.26  ? 33  ILE P C     1 
ATOM   223  O  O     . ILE A 1 33 ? 24.449 20.978  -2.737  1.00 64.72  ? 33  ILE P O     1 
ATOM   224  C  CB    . ILE A 1 33 ? 23.679 17.843  -1.772  1.00 58.91  ? 33  ILE P CB    1 
ATOM   225  C  CG1   . ILE A 1 33 ? 24.351 16.458  -1.789  1.00 62.04  ? 33  ILE P CG1   1 
ATOM   226  C  CG2   . ILE A 1 33 ? 22.920 18.121  -3.077  1.00 58.34  ? 33  ILE P CG2   1 
ATOM   227  C  CD1   . ILE A 1 33 ? 25.450 16.273  -2.831  1.00 69.72  ? 33  ILE P CD1   1 
ATOM   228  N  N     . PHE A 1 34 ? 23.205 20.795  -0.858  1.00 56.93  ? 34  PHE P N     1 
ATOM   229  C  CA    . PHE A 1 34 ? 22.360 21.967  -1.117  1.00 55.00  ? 34  PHE P CA    1 
ATOM   230  C  C     . PHE A 1 34 ? 22.876 23.308  -0.580  1.00 58.32  ? 34  PHE P C     1 
ATOM   231  O  O     . PHE A 1 34 ? 22.221 24.339  -0.760  1.00 57.78  ? 34  PHE P O     1 
ATOM   232  C  CB    . PHE A 1 34 ? 20.931 21.719  -0.612  1.00 49.68  ? 34  PHE P CB    1 
ATOM   233  C  CG    . PHE A 1 34 ? 20.120 20.831  -1.507  1.00 46.91  ? 34  PHE P CG    1 
ATOM   234  C  CD1   . PHE A 1 34 ? 19.511 21.342  -2.645  1.00 46.91  ? 34  PHE P CD1   1 
ATOM   235  C  CD2   . PHE A 1 34 ? 19.963 19.482  -1.215  1.00 45.22  ? 34  PHE P CD2   1 
ATOM   236  C  CE1   . PHE A 1 34 ? 18.763 20.521  -3.480  1.00 45.72  ? 34  PHE P CE1   1 
ATOM   237  C  CE2   . PHE A 1 34 ? 19.213 18.653  -2.048  1.00 43.56  ? 34  PHE P CE2   1 
ATOM   238  C  CZ    . PHE A 1 34 ? 18.614 19.175  -3.178  1.00 43.85  ? 34  PHE P CZ    1 
ATOM   239  N  N     . SER A 1 35 ? 24.037 23.304  0.069   1.00 62.65  ? 35  SER P N     1 
ATOM   240  C  CA    . SER A 1 35 ? 24.623 24.549  0.576   1.00 67.33  ? 35  SER P CA    1 
ATOM   241  C  C     . SER A 1 35 ? 25.237 25.388  -0.544  1.00 71.85  ? 35  SER P C     1 
ATOM   242  O  O     . SER A 1 35 ? 25.547 26.564  -0.344  1.00 75.90  ? 35  SER P O     1 
ATOM   243  C  CB    . SER A 1 35 ? 25.658 24.270  1.672   1.00 72.09  ? 35  SER P CB    1 
ATOM   244  O  OG    . SER A 1 35 ? 26.793 23.584  1.169   1.00 76.34  ? 35  SER P OG    1 
ATOM   245  N  N     . ARG A 1 36 ? 25.394 24.775  -1.719  1.00 71.99  ? 36  ARG P N     1 
ATOM   246  C  CA    . ARG A 1 36 ? 25.958 25.429  -2.900  1.00 77.37  ? 36  ARG P CA    1 
ATOM   247  C  C     . ARG A 1 36 ? 25.114 26.591  -3.411  1.00 76.06  ? 36  ARG P C     1 
ATOM   248  O  O     . ARG A 1 36 ? 25.592 27.421  -4.189  1.00 81.43  ? 36  ARG P O     1 
ATOM   249  C  CB    . ARG A 1 36 ? 26.140 24.407  -4.026  1.00 78.62  ? 36  ARG P CB    1 
ATOM   250  C  CG    . ARG A 1 36 ? 27.553 23.858  -4.148  1.00 86.82  ? 36  ARG P CG    1 
ATOM   251  C  CD    . ARG A 1 36 ? 27.620 22.678  -5.104  1.00 89.30  ? 36  ARG P CD    1 
ATOM   252  N  NE    . ARG A 1 36 ? 27.103 21.457  -4.488  1.00 84.65  ? 36  ARG P NE    1 
ATOM   253  C  CZ    . ARG A 1 36 ? 27.095 20.261  -5.071  1.00 86.09  ? 36  ARG P CZ    1 
ATOM   254  N  NH1   . ARG A 1 36 ? 26.602 19.212  -4.424  1.00 81.49  ? 36  ARG P NH1   1 
ATOM   255  N  NH2   . ARG A 1 36 ? 27.573 20.109  -6.300  1.00 92.83  ? 36  ARG P NH2   1 
ATOM   256  N  N     . PHE A 1 37 ? 23.867 26.650  -2.956  1.00 69.79  ? 37  PHE P N     1 
ATOM   257  C  CA    . PHE A 1 37 ? 22.867 27.529  -3.548  1.00 68.42  ? 37  PHE P CA    1 
ATOM   258  C  C     . PHE A 1 37 ? 22.428 28.679  -2.640  1.00 68.62  ? 37  PHE P C     1 
ATOM   259  O  O     . PHE A 1 37 ? 21.828 29.648  -3.110  1.00 69.85  ? 37  PHE P O     1 
ATOM   260  C  CB    . PHE A 1 37 ? 21.666 26.698  -4.016  1.00 62.97  ? 37  PHE P CB    1 
ATOM   261  C  CG    . PHE A 1 37 ? 22.039 25.570  -4.943  1.00 63.49  ? 37  PHE P CG    1 
ATOM   262  C  CD1   . PHE A 1 37 ? 22.324 25.818  -6.284  1.00 68.19  ? 37  PHE P CD1   1 
ATOM   263  C  CD2   . PHE A 1 37 ? 22.123 24.265  -4.473  1.00 60.23  ? 37  PHE P CD2   1 
ATOM   264  C  CE1   . PHE A 1 37 ? 22.681 24.782  -7.142  1.00 70.50  ? 37  PHE P CE1   1 
ATOM   265  C  CE2   . PHE A 1 37 ? 22.476 23.222  -5.325  1.00 62.04  ? 37  PHE P CE2   1 
ATOM   266  C  CZ    . PHE A 1 37 ? 22.755 23.481  -6.662  1.00 67.30  ? 37  PHE P CZ    1 
ATOM   267  N  N     . GLY A 1 38 ? 22.743 28.576  -1.352  1.00 68.57  ? 38  GLY P N     1 
ATOM   268  C  CA    . GLY A 1 38 ? 22.399 29.614  -0.381  1.00 70.24  ? 38  GLY P CA    1 
ATOM   269  C  C     . GLY A 1 38 ? 22.346 29.082  1.035   1.00 69.04  ? 38  GLY P C     1 
ATOM   270  O  O     . GLY A 1 38 ? 22.459 27.872  1.257   1.00 66.11  ? 38  GLY P O     1 
ATOM   271  N  N     . GLN A 1 39 ? 22.172 29.987  1.996   1.00 72.31  ? 39  GLN P N     1 
ATOM   272  C  CA    . GLN A 1 39 ? 22.092 29.610  3.405   1.00 72.98  ? 39  GLN P CA    1 
ATOM   273  C  C     . GLN A 1 39 ? 20.806 28.836  3.694   1.00 66.94  ? 39  GLN P C     1 
ATOM   274  O  O     . GLN A 1 39 ? 19.722 29.223  3.254   1.00 64.59  ? 39  GLN P O     1 
ATOM   275  C  CB    . GLN A 1 39 ? 22.201 30.845  4.307   1.00 79.79  ? 39  GLN P CB    1 
ATOM   276  C  CG    . GLN A 1 39 ? 22.470 30.524  5.773   1.00 83.72  ? 39  GLN P CG    1 
ATOM   277  C  CD    . GLN A 1 39 ? 22.751 31.759  6.606   1.00 93.12  ? 39  GLN P CD    1 
ATOM   278  O  OE1   . GLN A 1 39 ? 23.714 32.487  6.356   1.00 99.54  ? 39  GLN P OE1   1 
ATOM   279  N  NE2   . GLN A 1 39 ? 21.916 31.996  7.611   1.00 95.25  ? 39  GLN P NE2   1 
ATOM   280  N  N     . ILE A 1 40 ? 20.948 27.733  4.423   1.00 65.36  ? 40  ILE P N     1 
ATOM   281  C  CA    . ILE A 1 40 ? 19.817 26.889  4.792   1.00 60.81  ? 40  ILE P CA    1 
ATOM   282  C  C     . ILE A 1 40 ? 19.399 27.184  6.225   1.00 64.75  ? 40  ILE P C     1 
ATOM   283  O  O     . ILE A 1 40 ? 20.236 27.215  7.130   1.00 69.71  ? 40  ILE P O     1 
ATOM   284  C  CB    . ILE A 1 40 ? 20.159 25.394  4.647   1.00 57.28  ? 40  ILE P CB    1 
ATOM   285  C  CG1   . ILE A 1 40 ? 20.537 25.076  3.197   1.00 54.70  ? 40  ILE P CG1   1 
ATOM   286  C  CG2   . ILE A 1 40 ? 18.994 24.522  5.123   1.00 53.71  ? 40  ILE P CG2   1 
ATOM   287  C  CD1   . ILE A 1 40 ? 21.455 23.881  3.048   1.00 54.46  ? 40  ILE P CD1   1 
ATOM   288  N  N     . LEU A 1 41 ? 18.103 27.404  6.420   1.00 63.77  ? 41  LEU P N     1 
ATOM   289  C  CA    . LEU A 1 41 ? 17.549 27.681  7.744   1.00 68.62  ? 41  LEU P CA    1 
ATOM   290  C  C     . LEU A 1 41 ? 17.470 26.405  8.584   1.00 67.83  ? 41  LEU P C     1 
ATOM   291  O  O     . LEU A 1 41 ? 17.948 26.370  9.723   1.00 73.27  ? 41  LEU P O     1 
ATOM   292  C  CB    . LEU A 1 41 ? 16.174 28.353  7.621   1.00 69.10  ? 41  LEU P CB    1 
ATOM   293  C  CG    . LEU A 1 41 ? 16.052 29.883  7.701   1.00 74.91  ? 41  LEU P CG    1 
ATOM   294  C  CD1   . LEU A 1 41 ? 17.076 30.627  6.849   1.00 75.48  ? 41  LEU P CD1   1 
ATOM   295  C  CD2   . LEU A 1 41 ? 14.645 30.304  7.318   1.00 74.67  ? 41  LEU P CD2   1 
ATOM   296  N  N     . ASP A 1 42 ? 16.866 25.365  8.010   1.00 61.77  ? 42  ASP P N     1 
ATOM   297  C  CA    . ASP A 1 42 ? 16.830 24.043  8.623   1.00 60.83  ? 42  ASP P CA    1 
ATOM   298  C  C     . ASP A 1 42 ? 16.555 22.983  7.564   1.00 54.08  ? 42  ASP P C     1 
ATOM   299  O  O     . ASP A 1 42 ? 16.019 23.280  6.496   1.00 50.89  ? 42  ASP P O     1 
ATOM   300  C  CB    . ASP A 1 42 ? 15.770 23.973  9.736   1.00 64.81  ? 42  ASP P CB    1 
ATOM   301  C  CG    . ASP A 1 42 ? 16.107 22.935  10.817  1.00 68.32  ? 42  ASP P CG    1 
ATOM   302  O  OD1   . ASP A 1 42 ? 17.031 22.113  10.614  1.00 66.92  ? 42  ASP P OD1   1 
ATOM   303  O  OD2   . ASP A 1 42 ? 15.445 22.943  11.880  1.00 73.87  ? 42  ASP P OD2   1 
ATOM   304  N  N     . ILE A 1 43 ? 16.946 21.749  7.856   1.00 52.86  ? 43  ILE P N     1 
ATOM   305  C  CA    . ILE A 1 43 ? 16.563 20.621  7.020   1.00 47.78  ? 43  ILE P CA    1 
ATOM   306  C  C     . ILE A 1 43 ? 15.703 19.671  7.848   1.00 48.46  ? 43  ILE P C     1 
ATOM   307  O  O     . ILE A 1 43 ? 16.186 19.042  8.792   1.00 51.20  ? 43  ILE P O     1 
ATOM   308  C  CB    . ILE A 1 43 ? 17.782 19.883  6.419   1.00 46.39  ? 43  ILE P CB    1 
ATOM   309  C  CG1   . ILE A 1 43 ? 18.672 20.859  5.641   1.00 47.11  ? 43  ILE P CG1   1 
ATOM   310  C  CG2   . ILE A 1 43 ? 17.315 18.746  5.517   1.00 42.79  ? 43  ILE P CG2   1 
ATOM   311  C  CD1   . ILE A 1 43 ? 19.850 20.212  4.928   1.00 46.68  ? 43  ILE P CD1   1 
ATOM   312  N  N     . LEU A 1 44 ? 14.420 19.595  7.506   1.00 46.89  ? 44  LEU P N     1 
ATOM   313  C  CA    . LEU A 1 44 ? 13.506 18.690  8.195   1.00 48.23  ? 44  LEU P CA    1 
ATOM   314  C  C     . LEU A 1 44 ? 13.553 17.326  7.518   1.00 44.73  ? 44  LEU P C     1 
ATOM   315  O  O     . LEU A 1 44 ? 13.411 17.218  6.300   1.00 41.17  ? 44  LEU P O     1 
ATOM   316  C  CB    . LEU A 1 44 ? 12.073 19.243  8.232   1.00 50.10  ? 44  LEU P CB    1 
ATOM   317  C  CG    . LEU A 1 44 ? 11.712 20.592  8.890   1.00 55.04  ? 44  LEU P CG    1 
ATOM   318  C  CD1   . LEU A 1 44 ? 12.154 20.708  10.352  1.00 60.93  ? 44  LEU P CD1   1 
ATOM   319  C  CD2   . LEU A 1 44 ? 12.240 21.767  8.085   1.00 53.37  ? 44  LEU P CD2   1 
ATOM   320  N  N     . VAL A 1 45 ? 13.793 16.297  8.324   1.00 46.54  ? 45  VAL P N     1 
ATOM   321  C  CA    . VAL A 1 45 ? 13.853 14.917  7.864   1.00 44.60  ? 45  VAL P CA    1 
ATOM   322  C  C     . VAL A 1 45 ? 13.288 14.048  8.978   1.00 48.54  ? 45  VAL P C     1 
ATOM   323  O  O     . VAL A 1 45 ? 13.667 14.193  10.137  1.00 52.70  ? 45  VAL P O     1 
ATOM   324  C  CB    . VAL A 1 45 ? 15.303 14.483  7.525   1.00 43.49  ? 45  VAL P CB    1 
ATOM   325  C  CG1   . VAL A 1 45 ? 15.411 12.980  7.443   1.00 43.81  ? 45  VAL P CG1   1 
ATOM   326  C  CG2   . VAL A 1 45 ? 15.765 15.098  6.216   1.00 40.29  ? 45  VAL P CG2   1 
ATOM   327  N  N     . SER A 1 46 ? 12.362 13.167  8.623   1.00 48.50  ? 46  SER P N     1 
ATOM   328  C  CA    . SER A 1 46 ? 11.730 12.268  9.579   1.00 53.09  ? 46  SER P CA    1 
ATOM   329  C  C     . SER A 1 46 ? 11.611 10.888  8.949   1.00 52.16  ? 46  SER P C     1 
ATOM   330  O  O     . SER A 1 46 ? 11.310 10.775  7.761   1.00 49.31  ? 46  SER P O     1 
ATOM   331  C  CB    . SER A 1 46 ? 10.346 12.797  9.965   1.00 56.55  ? 46  SER P CB    1 
ATOM   332  O  OG    . SER A 1 46 ? 9.712  11.945  10.903  1.00 62.12  ? 46  SER P OG    1 
ATOM   333  N  N     . ARG A 1 47 ? 11.859 9.843   9.733   1.00 55.64  ? 47  ARG P N     1 
ATOM   334  C  CA    . ARG A 1 47 ? 11.765 8.476   9.218   1.00 56.01  ? 47  ARG P CA    1 
ATOM   335  C  C     . ARG A 1 47 ? 10.471 7.779   9.638   1.00 60.41  ? 47  ARG P C     1 
ATOM   336  O  O     . ARG A 1 47 ? 10.434 6.555   9.790   1.00 63.18  ? 47  ARG P O     1 
ATOM   337  C  CB    . ARG A 1 47 ? 13.006 7.653   9.589   1.00 57.40  ? 47  ARG P CB    1 
ATOM   338  C  CG    . ARG A 1 47 ? 14.134 7.735   8.550   1.00 54.54  ? 47  ARG P CG    1 
ATOM   339  C  CD    . ARG A 1 47 ? 15.511 7.468   9.161   1.00 57.98  ? 47  ARG P CD    1 
ATOM   340  N  NE    . ARG A 1 47 ? 15.745 6.057   9.473   1.00 62.41  ? 47  ARG P NE    1 
ATOM   341  C  CZ    . ARG A 1 47 ? 16.637 5.620   10.362  1.00 67.72  ? 47  ARG P CZ    1 
ATOM   342  N  NH1   . ARG A 1 47 ? 17.383 6.481   11.049  1.00 69.25  ? 47  ARG P NH1   1 
ATOM   343  N  NH2   . ARG A 1 47 ? 16.781 4.315   10.578  1.00 72.07  ? 47  ARG P NH2   1 
ATOM   344  N  N     . SER A 1 48 ? 9.411  8.569   9.807   1.00 61.90  ? 48  SER P N     1 
ATOM   345  C  CA    . SER A 1 48 ? 8.079  8.039   10.090  1.00 67.05  ? 48  SER P CA    1 
ATOM   346  C  C     . SER A 1 48 ? 7.422  7.524   8.807   1.00 65.63  ? 48  SER P C     1 
ATOM   347  O  O     . SER A 1 48 ? 7.759  7.976   7.712   1.00 60.71  ? 48  SER P O     1 
ATOM   348  C  CB    . SER A 1 48 ? 7.202  9.106   10.755  1.00 70.77  ? 48  SER P CB    1 
ATOM   349  O  OG    . SER A 1 48 ? 6.890  10.156  9.856   1.00 67.32  ? 48  SER P OG    1 
ATOM   350  N  N     . LEU A 1 49 ? 6.487  6.585   8.957   1.00 70.96  ? 49  LEU P N     1 
ATOM   351  C  CA    . LEU A 1 49 ? 5.775  5.963   7.834   1.00 71.92  ? 49  LEU P CA    1 
ATOM   352  C  C     . LEU A 1 49 ? 5.291  6.974   6.799   1.00 69.38  ? 49  LEU P C     1 
ATOM   353  O  O     . LEU A 1 49 ? 5.400  6.746   5.593   1.00 67.30  ? 49  LEU P O     1 
ATOM   354  C  CB    . LEU A 1 49 ? 4.584  5.144   8.352   1.00 80.08  ? 49  LEU P CB    1 
ATOM   355  C  CG    . LEU A 1 49 ? 3.603  4.537   7.337   1.00 83.80  ? 49  LEU P CG    1 
ATOM   356  C  CD1   . LEU A 1 49 ? 4.137  3.238   6.740   1.00 84.04  ? 49  LEU P CD1   1 
ATOM   357  C  CD2   . LEU A 1 49 ? 2.237  4.311   7.971   1.00 93.05  ? 49  LEU P CD2   1 
ATOM   358  N  N     . LYS A 1 50 ? 4.753  8.087   7.286   1.00 70.64  ? 50  LYS P N     1 
ATOM   359  C  CA    . LYS A 1 50 ? 4.217  9.132   6.430   1.00 69.39  ? 50  LYS P CA    1 
ATOM   360  C  C     . LYS A 1 50 ? 5.322  9.992   5.816   1.00 62.19  ? 50  LYS P C     1 
ATOM   361  O  O     . LYS A 1 50 ? 5.192  10.440  4.681   1.00 60.37  ? 50  LYS P O     1 
ATOM   362  C  CB    . LYS A 1 50 ? 3.225  9.998   7.217   1.00 74.72  ? 50  LYS P CB    1 
ATOM   363  C  CG    . LYS A 1 50 ? 2.247  10.773  6.348   1.00 77.20  ? 50  LYS P CG    1 
ATOM   364  C  CD    . LYS A 1 50 ? 1.117  11.378  7.164   1.00 85.40  ? 50  LYS P CD    1 
ATOM   365  C  CE    . LYS A 1 50 ? 0.224  12.242  6.285   1.00 88.19  ? 50  LYS P CE    1 
ATOM   366  N  NZ    . LYS A 1 50 ? -0.870 12.887  7.060   1.00 97.15  ? 50  LYS P NZ    1 
ATOM   367  N  N     . MET A 1 51 ? 6.408  10.208  6.558   1.00 59.25  ? 51  MET P N     1 
ATOM   368  C  CA    . MET A 1 51 ? 7.468  11.123  6.121   1.00 53.76  ? 51  MET P CA    1 
ATOM   369  C  C     . MET A 1 51 ? 8.752  10.458  5.604   1.00 49.85  ? 51  MET P C     1 
ATOM   370  O  O     . MET A 1 51 ? 9.736  11.148  5.326   1.00 46.46  ? 51  MET P O     1 
ATOM   371  C  CB    . MET A 1 51 ? 7.802  12.139  7.224   1.00 54.57  ? 51  MET P CB    1 
ATOM   372  C  CG    . MET A 1 51 ? 6.660  13.077  7.603   1.00 59.38  ? 51  MET P CG    1 
ATOM   373  S  SD    . MET A 1 51 ? 5.660  13.645  6.206   1.00 61.38  ? 51  MET P SD    1 
ATOM   374  C  CE    . MET A 1 51 ? 6.805  14.720  5.346   1.00 54.44  ? 51  MET P CE    1 
ATOM   375  N  N     . ARG A 1 52 ? 8.738  9.134   5.465   1.00 51.26  ? 52  ARG P N     1 
ATOM   376  C  CA    . ARG A 1 52 ? 9.878  8.392   4.925   1.00 48.95  ? 52  ARG P CA    1 
ATOM   377  C  C     . ARG A 1 52 ? 10.202 8.785   3.490   1.00 46.45  ? 52  ARG P C     1 
ATOM   378  O  O     . ARG A 1 52 ? 9.310  9.132   2.716   1.00 47.39  ? 52  ARG P O     1 
ATOM   379  C  CB    . ARG A 1 52 ? 9.610  6.894   4.988   1.00 52.53  ? 52  ARG P CB    1 
ATOM   380  C  CG    . ARG A 1 52 ? 10.022 6.273   6.287   1.00 54.61  ? 52  ARG P CG    1 
ATOM   381  C  CD    . ARG A 1 52 ? 9.246  5.009   6.571   1.00 59.43  ? 52  ARG P CD    1 
ATOM   382  N  NE    . ARG A 1 52 ? 9.277  4.707   7.999   1.00 62.80  ? 52  ARG P NE    1 
ATOM   383  C  CZ    . ARG A 1 52 ? 8.942  3.540   8.535   1.00 67.63  ? 52  ARG P CZ    1 
ATOM   384  N  NH1   . ARG A 1 52 ? 8.545  2.537   7.764   1.00 69.98  ? 52  ARG P NH1   1 
ATOM   385  N  NH2   . ARG A 1 52 ? 9.012  3.376   9.848   1.00 71.68  ? 52  ARG P NH2   1 
ATOM   386  N  N     . GLY A 1 53 ? 11.487 8.729   3.147   1.00 44.47  ? 53  GLY P N     1 
ATOM   387  C  CA    . GLY A 1 53 ? 11.962 9.028   1.793   1.00 43.23  ? 53  GLY P CA    1 
ATOM   388  C  C     . GLY A 1 53 ? 11.722 10.451  1.325   1.00 41.13  ? 53  GLY P C     1 
ATOM   389  O  O     . GLY A 1 53 ? 11.750 10.724  0.127   1.00 41.50  ? 53  GLY P O     1 
ATOM   390  N  N     . GLN A 1 54 ? 11.495 11.356  2.272   1.00 40.15  ? 54  GLN P N     1 
ATOM   391  C  CA    . GLN A 1 54 ? 11.174 12.748  1.968   1.00 39.14  ? 54  GLN P CA    1 
ATOM   392  C  C     . GLN A 1 54 ? 12.071 13.690  2.756   1.00 37.70  ? 54  GLN P C     1 
ATOM   393  O  O     . GLN A 1 54 ? 12.504 13.358  3.865   1.00 38.46  ? 54  GLN P O     1 
ATOM   394  C  CB    . GLN A 1 54 ? 9.711  13.048  2.310   1.00 41.37  ? 54  GLN P CB    1 
ATOM   395  C  CG    . GLN A 1 54 ? 8.698  12.175  1.588   1.00 44.51  ? 54  GLN P CG    1 
ATOM   396  C  CD    . GLN A 1 54 ? 7.396  12.035  2.349   1.00 48.15  ? 54  GLN P CD    1 
ATOM   397  O  OE1   . GLN A 1 54 ? 6.615  12.979  2.450   1.00 50.26  ? 54  GLN P OE1   1 
ATOM   398  N  NE2   . GLN A 1 54 ? 7.149  10.845  2.878   1.00 50.22  ? 54  GLN P NE2   1 
ATOM   399  N  N     . ALA A 1 55 ? 12.341 14.863  2.183   1.00 36.61  ? 55  ALA P N     1 
ATOM   400  C  CA    . ALA A 1 55 ? 13.076 15.919  2.887   1.00 36.28  ? 55  ALA P CA    1 
ATOM   401  C  C     . ALA A 1 55 ? 12.636 17.333  2.496   1.00 36.49  ? 55  ALA P C     1 
ATOM   402  O  O     . ALA A 1 55 ? 12.258 17.594  1.347   1.00 36.39  ? 55  ALA P O     1 
ATOM   403  C  CB    . ALA A 1 55 ? 14.579 15.756  2.695   1.00 35.72  ? 55  ALA P CB    1 
ATOM   404  N  N     . PHE A 1 56 ? 12.694 18.234  3.473   1.00 37.71  ? 56  PHE P N     1 
ATOM   405  C  CA    . PHE A 1 56 ? 12.417 19.648  3.270   1.00 38.60  ? 56  PHE P CA    1 
ATOM   406  C  C     . PHE A 1 56 ? 13.677 20.463  3.548   1.00 39.00  ? 56  PHE P C     1 
ATOM   407  O  O     . PHE A 1 56 ? 14.156 20.500  4.686   1.00 41.11  ? 56  PHE P O     1 
ATOM   408  C  CB    . PHE A 1 56 ? 11.316 20.115  4.220   1.00 41.64  ? 56  PHE P CB    1 
ATOM   409  C  CG    . PHE A 1 56 ? 9.981  19.502  3.957   1.00 42.77  ? 56  PHE P CG    1 
ATOM   410  C  CD1   . PHE A 1 56 ? 9.655  18.257  4.487   1.00 43.81  ? 56  PHE P CD1   1 
ATOM   411  C  CD2   . PHE A 1 56 ? 9.032  20.178  3.202   1.00 44.13  ? 56  PHE P CD2   1 
ATOM   412  C  CE1   . PHE A 1 56 ? 8.404  17.687  4.252   1.00 45.81  ? 56  PHE P CE1   1 
ATOM   413  C  CE2   . PHE A 1 56 ? 7.783  19.618  2.960   1.00 46.22  ? 56  PHE P CE2   1 
ATOM   414  C  CZ    . PHE A 1 56 ? 7.468  18.370  3.487   1.00 47.25  ? 56  PHE P CZ    1 
ATOM   415  N  N     . VAL A 1 57 ? 14.220 21.105  2.519   1.00 38.11  ? 57  VAL P N     1 
ATOM   416  C  CA    . VAL A 1 57 ? 15.286 22.075  2.725   1.00 39.68  ? 57  VAL P CA    1 
ATOM   417  C  C     . VAL A 1 57 ? 14.671 23.472  2.724   1.00 41.85  ? 57  VAL P C     1 
ATOM   418  O  O     . VAL A 1 57 ? 14.079 23.888  1.725   1.00 41.79  ? 57  VAL P O     1 
ATOM   419  C  CB    . VAL A 1 57 ? 16.390 21.977  1.650   1.00 39.26  ? 57  VAL P CB    1 
ATOM   420  C  CG1   . VAL A 1 57 ? 17.491 22.996  1.923   1.00 41.94  ? 57  VAL P CG1   1 
ATOM   421  C  CG2   . VAL A 1 57 ? 16.975 20.576  1.611   1.00 38.18  ? 57  VAL P CG2   1 
ATOM   422  N  N     . ILE A 1 58 ? 14.789 24.179  3.847   1.00 44.74  ? 58  ILE P N     1 
ATOM   423  C  CA    . ILE A 1 58 ? 14.311 25.557  3.934   1.00 47.82  ? 58  ILE P CA    1 
ATOM   424  C  C     . ILE A 1 58 ? 15.454 26.535  3.659   1.00 50.15  ? 58  ILE P C     1 
ATOM   425  O  O     . ILE A 1 58 ? 16.424 26.606  4.418   1.00 52.62  ? 58  ILE P O     1 
ATOM   426  C  CB    . ILE A 1 58 ? 13.673 25.889  5.307   1.00 51.92  ? 58  ILE P CB    1 
ATOM   427  C  CG1   . ILE A 1 58 ? 12.744 24.770  5.784   1.00 50.47  ? 58  ILE P CG1   1 
ATOM   428  C  CG2   . ILE A 1 58 ? 12.927 27.225  5.236   1.00 55.82  ? 58  ILE P CG2   1 
ATOM   429  C  CD1   . ILE A 1 58 ? 12.051 25.076  7.106   1.00 55.54  ? 58  ILE P CD1   1 
ATOM   430  N  N     . PHE A 1 59 ? 15.333 27.291  2.574   1.00 50.43  ? 59  PHE P N     1 
ATOM   431  C  CA    . PHE A 1 59 ? 16.355 28.267  2.211   1.00 53.66  ? 59  PHE P CA    1 
ATOM   432  C  C     . PHE A 1 59 ? 16.101 29.637  2.826   1.00 59.00  ? 59  PHE P C     1 
ATOM   433  O  O     . PHE A 1 59 ? 14.960 29.990  3.125   1.00 60.31  ? 59  PHE P O     1 
ATOM   434  C  CB    . PHE A 1 59 ? 16.464 28.380  0.689   1.00 52.47  ? 59  PHE P CB    1 
ATOM   435  C  CG    . PHE A 1 59 ? 17.108 27.193  0.046   1.00 49.59  ? 59  PHE P CG    1 
ATOM   436  C  CD1   . PHE A 1 59 ? 18.495 27.097  -0.035  1.00 51.75  ? 59  PHE P CD1   1 
ATOM   437  C  CD2   . PHE A 1 59 ? 16.335 26.160  -0.459  1.00 46.01  ? 59  PHE P CD2   1 
ATOM   438  C  CE1   . PHE A 1 59 ? 19.104 25.990  -0.623  1.00 50.20  ? 59  PHE P CE1   1 
ATOM   439  C  CE2   . PHE A 1 59 ? 16.931 25.051  -1.055  1.00 44.78  ? 59  PHE P CE2   1 
ATOM   440  C  CZ    . PHE A 1 59 ? 18.320 24.965  -1.134  1.00 46.74  ? 59  PHE P CZ    1 
ATOM   441  N  N     . LYS A 1 60 ? 17.175 30.399  3.019   1.00 63.32  ? 60  LYS P N     1 
ATOM   442  C  CA    . LYS A 1 60 ? 17.072 31.792  3.438   1.00 69.48  ? 60  LYS P CA    1 
ATOM   443  C  C     . LYS A 1 60 ? 16.341 32.600  2.368   1.00 70.05  ? 60  LYS P C     1 
ATOM   444  O  O     . LYS A 1 60 ? 15.486 33.427  2.684   1.00 73.53  ? 60  LYS P O     1 
ATOM   445  C  CB    . LYS A 1 60 ? 18.462 32.380  3.696   1.00 74.51  ? 60  LYS P CB    1 
ATOM   446  C  CG    . LYS A 1 60 ? 18.460 33.786  4.288   1.00 82.07  ? 60  LYS P CG    1 
ATOM   447  C  CD    . LYS A 1 60 ? 19.845 34.412  4.230   1.00 87.50  ? 60  LYS P CD    1 
ATOM   448  C  CE    . LYS A 1 60 ? 19.794 35.890  4.569   1.00 95.75  ? 60  LYS P CE    1 
ATOM   449  N  NZ    . LYS A 1 60 ? 21.138 36.530  4.521   1.00 102.90 ? 60  LYS P NZ    1 
ATOM   450  N  N     . GLU A 1 61 ? 16.670 32.338  1.105   1.00 67.71  ? 61  GLU P N     1 
ATOM   451  C  CA    . GLU A 1 61 ? 16.078 33.061  -0.018  1.00 69.25  ? 61  GLU P CA    1 
ATOM   452  C  C     . GLU A 1 61 ? 15.355 32.132  -0.989  1.00 64.83  ? 61  GLU P C     1 
ATOM   453  O  O     . GLU A 1 61 ? 15.726 30.964  -1.136  1.00 60.87  ? 61  GLU P O     1 
ATOM   454  C  CB    . GLU A 1 61 ? 17.149 33.864  -0.754  1.00 73.28  ? 61  GLU P CB    1 
ATOM   455  C  CG    . GLU A 1 61 ? 17.763 34.977  0.079   1.00 79.94  ? 61  GLU P CG    1 
ATOM   456  C  CD    . GLU A 1 61 ? 19.098 35.436  -0.463  1.00 84.87  ? 61  GLU P CD    1 
ATOM   457  O  OE1   . GLU A 1 61 ? 20.040 35.599  0.344   1.00 88.90  ? 61  GLU P OE1   1 
ATOM   458  O  OE2   . GLU A 1 61 ? 19.210 35.627  -1.694  1.00 85.80  ? 61  GLU P OE2   1 
ATOM   459  N  N     . VAL A 1 62 ? 14.322 32.661  -1.647  1.00 66.60  ? 62  VAL P N     1 
ATOM   460  C  CA    . VAL A 1 62 ? 13.529 31.886  -2.607  1.00 64.23  ? 62  VAL P CA    1 
ATOM   461  C  C     . VAL A 1 62 ? 14.328 31.649  -3.888  1.00 64.49  ? 62  VAL P C     1 
ATOM   462  O  O     . VAL A 1 62 ? 14.270 30.566  -4.472  1.00 61.73  ? 62  VAL P O     1 
ATOM   463  C  CB    . VAL A 1 62 ? 12.175 32.568  -2.951  1.00 67.60  ? 62  VAL P CB    1 
ATOM   464  C  CG1   . VAL A 1 62 ? 11.226 31.578  -3.631  1.00 65.20  ? 62  VAL P CG1   1 
ATOM   465  C  CG2   . VAL A 1 62 ? 11.523 33.151  -1.703  1.00 70.23  ? 62  VAL P CG2   1 
ATOM   466  N  N     . SER A 1 63 ? 15.074 32.666  -4.314  1.00 68.89  ? 63  SER P N     1 
ATOM   467  C  CA    . SER A 1 63 ? 15.952 32.541  -5.472  1.00 70.96  ? 63  SER P CA    1 
ATOM   468  C  C     . SER A 1 63 ? 16.933 31.384  -5.279  1.00 67.83  ? 63  SER P C     1 
ATOM   469  O  O     . SER A 1 63 ? 17.277 30.693  -6.237  1.00 68.33  ? 63  SER P O     1 
ATOM   470  C  CB    . SER A 1 63 ? 16.700 33.850  -5.736  1.00 77.03  ? 63  SER P CB    1 
ATOM   471  O  OG    . SER A 1 63 ? 17.605 34.154  -4.686  1.00 78.02  ? 63  SER P OG    1 
ATOM   472  N  N     . SER A 1 64 ? 17.365 31.173  -4.037  1.00 65.71  ? 64  SER P N     1 
ATOM   473  C  CA    . SER A 1 64 ? 18.231 30.046  -3.700  1.00 63.26  ? 64  SER P CA    1 
ATOM   474  C  C     . SER A 1 64 ? 17.507 28.721  -3.915  1.00 58.66  ? 64  SER P C     1 
ATOM   475  O  O     . SER A 1 64 ? 18.075 27.789  -4.489  1.00 58.19  ? 64  SER P O     1 
ATOM   476  C  CB    . SER A 1 64 ? 18.745 30.148  -2.258  1.00 63.32  ? 64  SER P CB    1 
ATOM   477  O  OG    . SER A 1 64 ? 19.829 31.058  -2.154  1.00 68.53  ? 64  SER P OG    1 
ATOM   478  N  N     . ALA A 1 65 ? 16.254 28.650  -3.458  1.00 56.31  ? 65  ALA P N     1 
ATOM   479  C  CA    . ALA A 1 65 ? 15.417 27.453  -3.633  1.00 52.75  ? 65  ALA P CA    1 
ATOM   480  C  C     . ALA A 1 65 ? 15.182 27.151  -5.107  1.00 54.40  ? 65  ALA P C     1 
ATOM   481  O  O     . ALA A 1 65 ? 15.327 26.008  -5.539  1.00 53.43  ? 65  ALA P O     1 
ATOM   482  C  CB    . ALA A 1 65 ? 14.089 27.605  -2.900  1.00 51.61  ? 65  ALA P CB    1 
ATOM   483  N  N     . THR A 1 66 ? 14.838 28.188  -5.869  1.00 58.03  ? 66  THR P N     1 
ATOM   484  C  CA    . THR A 1 66 ? 14.604 28.070  -7.303  1.00 61.29  ? 66  THR P CA    1 
ATOM   485  C  C     . THR A 1 66 ? 15.868 27.574  -7.999  1.00 63.22  ? 66  THR P C     1 
ATOM   486  O  O     . THR A 1 66 ? 15.798 26.760  -8.921  1.00 64.98  ? 66  THR P O     1 
ATOM   487  C  CB    . THR A 1 66 ? 14.145 29.424  -7.901  1.00 66.14  ? 66  THR P CB    1 
ATOM   488  O  OG1   . THR A 1 66 ? 12.936 29.846  -7.256  1.00 65.24  ? 66  THR P OG1   1 
ATOM   489  C  CG2   . THR A 1 66 ? 13.898 29.315  -9.399  1.00 70.89  ? 66  THR P CG2   1 
ATOM   490  N  N     . ASN A 1 67 ? 17.018 28.053  -7.531  1.00 64.00  ? 67  ASN P N     1 
ATOM   491  C  CA    . ASN A 1 67 ? 18.310 27.675  -8.091  1.00 67.21  ? 67  ASN P CA    1 
ATOM   492  C  C     . ASN A 1 67 ? 18.637 26.205  -7.853  1.00 64.21  ? 67  ASN P C     1 
ATOM   493  O  O     . ASN A 1 67 ? 19.135 25.529  -8.748  1.00 67.61  ? 67  ASN P O     1 
ATOM   494  C  CB    . ASN A 1 67 ? 19.420 28.562  -7.520  1.00 69.74  ? 67  ASN P CB    1 
ATOM   495  C  CG    . ASN A 1 67 ? 20.565 28.768  -8.494  1.00 76.97  ? 67  ASN P CG    1 
ATOM   496  O  OD1   . ASN A 1 67 ? 21.708 28.412  -8.207  1.00 79.03  ? 67  ASN P OD1   1 
ATOM   497  N  ND2   . ASN A 1 67 ? 20.264 29.349  -9.654  1.00 82.17  ? 67  ASN P ND2   1 
ATOM   498  N  N     . ALA A 1 68 ? 18.340 25.717  -6.650  1.00 58.88  ? 68  ALA P N     1 
ATOM   499  C  CA    . ALA A 1 68 ? 18.627 24.332  -6.263  1.00 56.14  ? 68  ALA P CA    1 
ATOM   500  C  C     . ALA A 1 68 ? 17.714 23.326  -6.964  1.00 55.37  ? 68  ALA P C     1 
ATOM   501  O  O     . ALA A 1 68 ? 18.170 22.275  -7.420  1.00 56.71  ? 68  ALA P O     1 
ATOM   502  C  CB    . ALA A 1 68 ? 18.531 24.177  -4.754  1.00 51.93  ? 68  ALA P CB    1 
ATOM   503  N  N     . LEU A 1 69 ? 16.427 23.659  -7.036  1.00 54.15  ? 69  LEU P N     1 
ATOM   504  C  CA    . LEU A 1 69 ? 15.440 22.846  -7.739  1.00 54.89  ? 69  LEU P CA    1 
ATOM   505  C  C     . LEU A 1 69 ? 15.829 22.681  -9.203  1.00 60.85  ? 69  LEU P C     1 
ATOM   506  O  O     . LEU A 1 69 ? 15.878 21.564  -9.711  1.00 62.64  ? 69  LEU P O     1 
ATOM   507  C  CB    . LEU A 1 69 ? 14.044 23.480  -7.626  1.00 54.50  ? 69  LEU P CB    1 
ATOM   508  C  CG    . LEU A 1 69 ? 12.798 22.715  -8.103  1.00 55.78  ? 69  LEU P CG    1 
ATOM   509  C  CD1   . LEU A 1 69 ? 11.585 23.176  -7.319  1.00 54.34  ? 69  LEU P CD1   1 
ATOM   510  C  CD2   . LEU A 1 69 ? 12.537 22.850  -9.603  1.00 61.81  ? 69  LEU P CD2   1 
ATOM   511  N  N     . ARG A 1 70 ? 16.111 23.795  -9.868  1.00 64.91  ? 70  ARG P N     1 
ATOM   512  C  CA    . ARG A 1 70 ? 16.401 23.775  -11.296 1.00 72.42  ? 70  ARG P CA    1 
ATOM   513  C  C     . ARG A 1 70 ? 17.762 23.168  -11.629 1.00 75.87  ? 70  ARG P C     1 
ATOM   514  O  O     . ARG A 1 70 ? 17.953 22.633  -12.723 1.00 82.23  ? 70  ARG P O     1 
ATOM   515  C  CB    . ARG A 1 70 ? 16.231 25.170  -11.908 1.00 76.82  ? 70  ARG P CB    1 
ATOM   516  C  CG    . ARG A 1 70 ? 14.831 25.398  -12.472 1.00 79.14  ? 70  ARG P CG    1 
ATOM   517  C  CD    . ARG A 1 70 ? 14.317 26.808  -12.230 1.00 79.51  ? 70  ARG P CD    1 
ATOM   518  N  NE    . ARG A 1 70 ? 14.916 27.794  -13.128 1.00 86.13  ? 70  ARG P NE    1 
ATOM   519  C  CZ    . ARG A 1 70 ? 14.393 28.990  -13.386 1.00 89.36  ? 70  ARG P CZ    1 
ATOM   520  N  NH1   . ARG A 1 70 ? 13.246 29.360  -12.825 1.00 86.54  ? 70  ARG P NH1   1 
ATOM   521  N  NH2   . ARG A 1 70 ? 15.014 29.818  -14.215 1.00 96.50  ? 70  ARG P NH2   1 
ATOM   522  N  N     . SER A 1 71 ? 18.695 23.239  -10.684 1.00 72.92  ? 71  SER P N     1 
ATOM   523  C  CA    . SER A 1 71 ? 20.026 22.678  -10.887 1.00 77.04  ? 71  SER P CA    1 
ATOM   524  C  C     . SER A 1 71 ? 20.068 21.170  -10.675 1.00 75.64  ? 71  SER P C     1 
ATOM   525  O  O     . SER A 1 71 ? 20.714 20.454  -11.439 1.00 81.59  ? 71  SER P O     1 
ATOM   526  C  CB    . SER A 1 71 ? 21.058 23.360  -9.987  1.00 75.98  ? 71  SER P CB    1 
ATOM   527  O  OG    . SER A 1 71 ? 21.480 24.595  -10.541 1.00 81.30  ? 71  SER P OG    1 
ATOM   528  N  N     . MET A 1 72 ? 19.371 20.687  -9.651  1.00 68.93  ? 72  MET P N     1 
ATOM   529  C  CA    . MET A 1 72 ? 19.541 19.296  -9.230  1.00 67.66  ? 72  MET P CA    1 
ATOM   530  C  C     . MET A 1 72 ? 18.332 18.371  -9.346  1.00 65.83  ? 72  MET P C     1 
ATOM   531  O  O     . MET A 1 72 ? 18.192 17.428  -8.563  1.00 62.41  ? 72  MET P O     1 
ATOM   532  C  CB    . MET A 1 72 ? 20.150 19.241  -7.833  1.00 63.18  ? 72  MET P CB    1 
ATOM   533  C  CG    . MET A 1 72 ? 21.643 19.417  -7.878  1.00 68.53  ? 72  MET P CG    1 
ATOM   534  S  SD    . MET A 1 72 ? 22.365 19.722  -6.278  1.00 66.35  ? 72  MET P SD    1 
ATOM   535  C  CE    . MET A 1 72 ? 24.100 19.670  -6.723  1.00 74.86  ? 72  MET P CE    1 
ATOM   536  N  N     . GLN A 1 73 ? 17.487 18.621  -10.344 1.00 69.24  ? 73  GLN P N     1 
ATOM   537  C  CA    . GLN A 1 73 ? 16.387 17.717  -10.658 1.00 69.95  ? 73  GLN P CA    1 
ATOM   538  C  C     . GLN A 1 73 ? 16.902 16.370  -11.148 1.00 74.45  ? 73  GLN P C     1 
ATOM   539  O  O     . GLN A 1 73 ? 17.690 16.305  -12.095 1.00 81.37  ? 73  GLN P O     1 
ATOM   540  C  CB    . GLN A 1 73 ? 15.443 18.330  -11.694 1.00 74.48  ? 73  GLN P CB    1 
ATOM   541  C  CG    . GLN A 1 73 ? 14.278 19.104  -11.093 1.00 70.58  ? 73  GLN P CG    1 
ATOM   542  C  CD    . GLN A 1 73 ? 13.218 18.214  -10.448 1.00 67.93  ? 73  GLN P CD    1 
ATOM   543  O  OE1   . GLN A 1 73 ? 13.494 17.099  -9.997  1.00 66.30  ? 73  GLN P OE1   1 
ATOM   544  N  NE2   . GLN A 1 73 ? 11.994 18.718  -10.397 1.00 68.41  ? 73  GLN P NE2   1 
ATOM   545  N  N     . GLY A 1 74 ? 16.459 15.307  -10.479 1.00 71.32  ? 74  GLY P N     1 
ATOM   546  C  CA    . GLY A 1 74 ? 16.811 13.938  -10.847 1.00 75.83  ? 74  GLY P CA    1 
ATOM   547  C  C     . GLY A 1 74 ? 18.258 13.570  -10.579 1.00 77.21  ? 74  GLY P C     1 
ATOM   548  O  O     . GLY A 1 74 ? 18.796 12.657  -11.207 1.00 83.81  ? 74  GLY P O     1 
ATOM   549  N  N     . PHE A 1 75 ? 18.886 14.282  -9.647  1.00 72.14  ? 75  PHE P N     1 
ATOM   550  C  CA    . PHE A 1 75 ? 20.279 14.038  -9.291  1.00 74.07  ? 75  PHE P CA    1 
ATOM   551  C  C     . PHE A 1 75 ? 20.421 12.710  -8.545  1.00 72.96  ? 75  PHE P C     1 
ATOM   552  O  O     . PHE A 1 75 ? 19.757 12.501  -7.525  1.00 66.76  ? 75  PHE P O     1 
ATOM   553  C  CB    . PHE A 1 75 ? 20.825 15.200  -8.453  1.00 69.91  ? 75  PHE P CB    1 
ATOM   554  C  CG    . PHE A 1 75 ? 22.305 15.125  -8.194  1.00 73.59  ? 75  PHE P CG    1 
ATOM   555  C  CD1   . PHE A 1 75 ? 23.217 15.541  -9.160  1.00 81.10  ? 75  PHE P CD1   1 
ATOM   556  C  CD2   . PHE A 1 75 ? 22.787 14.649  -6.979  1.00 70.54  ? 75  PHE P CD2   1 
ATOM   557  C  CE1   . PHE A 1 75 ? 24.586 15.476  -8.922  1.00 85.72  ? 75  PHE P CE1   1 
ATOM   558  C  CE2   . PHE A 1 75 ? 24.155 14.578  -6.734  1.00 75.07  ? 75  PHE P CE2   1 
ATOM   559  C  CZ    . PHE A 1 75 ? 25.053 14.993  -7.707  1.00 82.69  ? 75  PHE P CZ    1 
ATOM   560  N  N     . PRO A 1 76 ? 21.277 11.804  -9.063  1.00 79.95  ? 76  PRO P N     1 
ATOM   561  C  CA    . PRO A 1 76 ? 21.513 10.504  -8.437  1.00 80.46  ? 76  PRO P CA    1 
ATOM   562  C  C     . PRO A 1 76 ? 22.085 10.671  -7.034  1.00 75.50  ? 76  PRO P C     1 
ATOM   563  O  O     . PRO A 1 76 ? 23.216 11.137  -6.870  1.00 78.10  ? 76  PRO P O     1 
ATOM   564  C  CB    . PRO A 1 76 ? 22.536 9.841   -9.366  1.00 90.56  ? 76  PRO P CB    1 
ATOM   565  C  CG    . PRO A 1 76 ? 22.384 10.543  -10.664 1.00 95.80  ? 76  PRO P CG    1 
ATOM   566  C  CD    . PRO A 1 76 ? 22.053 11.954  -10.305 1.00 89.16  ? 76  PRO P CD    1 
ATOM   567  N  N     . PHE A 1 77 ? 21.288 10.287  -6.040  1.00 69.66  ? 77  PHE P N     1 
ATOM   568  C  CA    . PHE A 1 77 ? 21.595 10.516  -4.634  1.00 65.13  ? 77  PHE P CA    1 
ATOM   569  C  C     . PHE A 1 77 ? 21.272 9.263   -3.823  1.00 64.41  ? 77  PHE P C     1 
ATOM   570  O  O     . PHE A 1 77 ? 20.100 8.922   -3.645  1.00 61.44  ? 77  PHE P O     1 
ATOM   571  C  CB    . PHE A 1 77 ? 20.775 11.704  -4.140  1.00 58.74  ? 77  PHE P CB    1 
ATOM   572  C  CG    . PHE A 1 77 ? 21.113 12.153  -2.753  1.00 55.16  ? 77  PHE P CG    1 
ATOM   573  C  CD1   . PHE A 1 77 ? 22.367 12.679  -2.462  1.00 57.33  ? 77  PHE P CD1   1 
ATOM   574  C  CD2   . PHE A 1 77 ? 20.157 12.089  -1.744  1.00 50.37  ? 77  PHE P CD2   1 
ATOM   575  C  CE1   . PHE A 1 77 ? 22.670 13.111  -1.183  1.00 55.63  ? 77  PHE P CE1   1 
ATOM   576  C  CE2   . PHE A 1 77 ? 20.446 12.522  -0.462  1.00 48.31  ? 77  PHE P CE2   1 
ATOM   577  C  CZ    . PHE A 1 77 ? 21.708 13.033  -0.179  1.00 51.59  ? 77  PHE P CZ    1 
ATOM   578  N  N     . TYR A 1 78 ? 22.316 8.595   -3.327  1.00 68.07  ? 78  TYR P N     1 
ATOM   579  C  CA    . TYR A 1 78 ? 22.184 7.296   -2.665  1.00 69.29  ? 78  TYR P CA    1 
ATOM   580  C  C     . TYR A 1 78 ? 21.345 6.350   -3.522  1.00 72.01  ? 78  TYR P C     1 
ATOM   581  O  O     . TYR A 1 78 ? 20.252 5.946   -3.118  1.00 68.95  ? 78  TYR P O     1 
ATOM   582  C  CB    . TYR A 1 78 ? 21.550 7.427   -1.273  1.00 63.56  ? 78  TYR P CB    1 
ATOM   583  C  CG    . TYR A 1 78 ? 22.424 8.034   -0.196  1.00 63.04  ? 78  TYR P CG    1 
ATOM   584  C  CD1   . TYR A 1 78 ? 23.346 7.258   0.501   1.00 67.22  ? 78  TYR P CD1   1 
ATOM   585  C  CD2   . TYR A 1 78 ? 22.301 9.379   0.152   1.00 59.14  ? 78  TYR P CD2   1 
ATOM   586  C  CE1   . TYR A 1 78 ? 24.135 7.810   1.507   1.00 68.13  ? 78  TYR P CE1   1 
ATOM   587  C  CE2   . TYR A 1 78 ? 23.088 9.942   1.155   1.00 59.60  ? 78  TYR P CE2   1 
ATOM   588  C  CZ    . TYR A 1 78 ? 24.002 9.152   1.828   1.00 64.39  ? 78  TYR P CZ    1 
ATOM   589  O  OH    . TYR A 1 78 ? 24.785 9.702   2.820   1.00 66.26  ? 78  TYR P OH    1 
ATOM   590  N  N     . ASP A 1 79 ? 21.855 6.028   -4.712  1.00 79.11  ? 79  ASP P N     1 
ATOM   591  C  CA    . ASP A 1 79 ? 21.216 5.089   -5.654  1.00 84.25  ? 79  ASP P CA    1 
ATOM   592  C  C     . ASP A 1 79 ? 20.014 5.636   -6.435  1.00 82.58  ? 79  ASP P C     1 
ATOM   593  O  O     . ASP A 1 79 ? 19.693 5.114   -7.506  1.00 88.89  ? 79  ASP P O     1 
ATOM   594  C  CB    . ASP A 1 79 ? 20.825 3.771   -4.962  1.00 85.07  ? 79  ASP P CB    1 
ATOM   595  C  CG    . ASP A 1 79 ? 21.867 2.687   -5.129  1.00 93.18  ? 79  ASP P CG    1 
ATOM   596  O  OD1   . ASP A 1 79 ? 21.999 2.150   -6.249  1.00 101.15 ? 79  ASP P OD1   1 
ATOM   597  O  OD2   . ASP A 1 79 ? 22.544 2.359   -4.136  1.00 92.79  ? 79  ASP P OD2   1 
ATOM   598  N  N     . LYS A 1 80 ? 19.352 6.667   -5.911  1.00 75.50  ? 80  LYS P N     1 
ATOM   599  C  CA    . LYS A 1 80 ? 18.083 7.130   -6.485  1.00 74.20  ? 80  LYS P CA    1 
ATOM   600  C  C     . LYS A 1 80 ? 18.115 8.601   -6.912  1.00 72.22  ? 80  LYS P C     1 
ATOM   601  O  O     . LYS A 1 80 ? 18.758 9.421   -6.254  1.00 68.60  ? 80  LYS P O     1 
ATOM   602  C  CB    . LYS A 1 80 ? 16.941 6.910   -5.490  1.00 68.98  ? 80  LYS P CB    1 
ATOM   603  C  CG    . LYS A 1 80 ? 16.888 5.518   -4.874  1.00 70.88  ? 80  LYS P CG    1 
ATOM   604  C  CD    . LYS A 1 80 ? 15.763 5.403   -3.865  1.00 66.79  ? 80  LYS P CD    1 
ATOM   605  C  CE    . LYS A 1 80 ? 14.412 5.277   -4.556  1.00 69.34  ? 80  LYS P CE    1 
ATOM   606  N  NZ    . LYS A 1 80 ? 13.300 5.321   -3.574  1.00 66.17  ? 80  LYS P NZ    1 
ATOM   607  N  N     . PRO A 1 81 ? 17.417 8.944   -8.017  1.00 75.58  ? 81  PRO P N     1 
ATOM   608  C  CA    . PRO A 1 81 ? 17.325 10.355  -8.392  1.00 73.93  ? 81  PRO P CA    1 
ATOM   609  C  C     . PRO A 1 81 ? 16.342 11.116  -7.498  1.00 67.07  ? 81  PRO P C     1 
ATOM   610  O  O     . PRO A 1 81 ? 15.205 10.673  -7.295  1.00 66.22  ? 81  PRO P O     1 
ATOM   611  C  CB    . PRO A 1 81 ? 16.827 10.308  -9.841  1.00 80.87  ? 81  PRO P CB    1 
ATOM   612  C  CG    . PRO A 1 81 ? 16.096 9.030   -9.954  1.00 84.05  ? 81  PRO P CG    1 
ATOM   613  C  CD    . PRO A 1 81 ? 16.734 8.067   -8.989  1.00 82.18  ? 81  PRO P CD    1 
ATOM   614  N  N     . MET A 1 82 ? 16.798 12.240  -6.953  1.00 63.34  ? 82  MET P N     1 
ATOM   615  C  CA    . MET A 1 82 ? 15.949 13.107  -6.148  1.00 58.30  ? 82  MET P CA    1 
ATOM   616  C  C     . MET A 1 82 ? 14.797 13.659  -6.992  1.00 60.39  ? 82  MET P C     1 
ATOM   617  O  O     . MET A 1 82 ? 14.997 14.027  -8.152  1.00 64.91  ? 82  MET P O     1 
ATOM   618  C  CB    . MET A 1 82 ? 16.765 14.269  -5.575  1.00 55.48  ? 82  MET P CB    1 
ATOM   619  C  CG    . MET A 1 82 ? 17.973 13.863  -4.746  1.00 55.14  ? 82  MET P CG    1 
ATOM   620  S  SD    . MET A 1 82 ? 18.775 15.237  -3.877  1.00 52.63  ? 82  MET P SD    1 
ATOM   621  C  CE    . MET A 1 82 ? 19.352 16.259  -5.227  1.00 56.98  ? 82  MET P CE    1 
ATOM   622  N  N     . ARG A 1 83 ? 13.596 13.703  -6.418  1.00 58.42  ? 83  ARG P N     1 
ATOM   623  C  CA    . ARG A 1 83 ? 12.466 14.358  -7.078  1.00 61.10  ? 83  ARG P CA    1 
ATOM   624  C  C     . ARG A 1 83 ? 12.102 15.657  -6.365  1.00 57.47  ? 83  ARG P C     1 
ATOM   625  O  O     . ARG A 1 83 ? 11.364 15.662  -5.376  1.00 55.18  ? 83  ARG P O     1 
ATOM   626  C  CB    . ARG A 1 83 ? 11.255 13.420  -7.201  1.00 64.16  ? 83  ARG P CB    1 
ATOM   627  C  CG    . ARG A 1 83 ? 11.446 12.249  -8.177  1.00 70.96  ? 83  ARG P CG    1 
ATOM   628  C  CD    . ARG A 1 83 ? 11.886 12.737  -9.555  1.00 77.53  ? 83  ARG P CD    1 
ATOM   629  N  NE    . ARG A 1 83 ? 12.350 11.655  -10.419 1.00 84.90  ? 83  ARG P NE    1 
ATOM   630  C  CZ    . ARG A 1 83 ? 12.973 11.841  -11.581 1.00 91.75  ? 83  ARG P CZ    1 
ATOM   631  N  NH1   . ARG A 1 83 ? 13.217 13.072  -12.019 1.00 91.97  ? 83  ARG P NH1   1 
ATOM   632  N  NH2   . ARG A 1 83 ? 13.357 10.796  -12.306 1.00 99.02  ? 83  ARG P NH2   1 
ATOM   633  N  N     . ILE A 1 84 ? 12.633 16.761  -6.876  1.00 58.19  ? 84  ILE P N     1 
ATOM   634  C  CA    . ILE A 1 84 ? 12.469 18.052  -6.227  1.00 55.59  ? 84  ILE P CA    1 
ATOM   635  C  C     . ILE A 1 84 ? 11.289 18.820  -6.812  1.00 58.76  ? 84  ILE P C     1 
ATOM   636  O  O     . ILE A 1 84 ? 11.113 18.876  -8.027  1.00 63.46  ? 84  ILE P O     1 
ATOM   637  C  CB    . ILE A 1 84 ? 13.768 18.903  -6.316  1.00 55.29  ? 84  ILE P CB    1 
ATOM   638  C  CG1   . ILE A 1 84 ? 14.994 18.052  -5.947  1.00 53.98  ? 84  ILE P CG1   1 
ATOM   639  C  CG2   . ILE A 1 84 ? 13.664 20.164  -5.431  1.00 52.60  ? 84  ILE P CG2   1 
ATOM   640  C  CD1   . ILE A 1 84 ? 16.333 18.682  -6.279  1.00 54.54  ? 84  ILE P CD1   1 
ATOM   641  N  N     . GLN A 1 85 ? 10.472 19.380  -5.928  1.00 57.38  ? 85  GLN P N     1 
ATOM   642  C  CA    . GLN A 1 85 ? 9.453  20.359  -6.295  1.00 60.99  ? 85  GLN P CA    1 
ATOM   643  C  C     . GLN A 1 85 ? 9.243  21.281  -5.101  1.00 59.13  ? 85  GLN P C     1 
ATOM   644  O  O     . GLN A 1 85 ? 9.494  20.878  -3.971  1.00 55.94  ? 85  GLN P O     1 
ATOM   645  C  CB    . GLN A 1 85 ? 8.139  19.690  -6.739  1.00 65.03  ? 85  GLN P CB    1 
ATOM   646  C  CG    . GLN A 1 85 ? 7.554  18.668  -5.761  1.00 63.23  ? 85  GLN P CG    1 
ATOM   647  C  CD    . GLN A 1 85 ? 6.196  18.104  -6.187  1.00 67.73  ? 85  GLN P CD    1 
ATOM   648  O  OE1   . GLN A 1 85 ? 5.800  17.030  -5.739  1.00 67.45  ? 85  GLN P OE1   1 
ATOM   649  N  NE2   . GLN A 1 85 ? 5.478  18.832  -7.035  1.00 72.86  ? 85  GLN P NE2   1 
ATOM   650  N  N     . TYR A 1 86 ? 8.806  22.516  -5.351  1.00 62.42  ? 86  TYR P N     1 
ATOM   651  C  CA    . TYR A 1 86 ? 8.539  23.483  -4.279  1.00 62.62  ? 86  TYR P CA    1 
ATOM   652  C  C     . TYR A 1 86 ? 7.576  22.914  -3.242  1.00 63.53  ? 86  TYR P C     1 
ATOM   653  O  O     . TYR A 1 86 ? 6.778  22.025  -3.545  1.00 65.48  ? 86  TYR P O     1 
ATOM   654  C  CB    . TYR A 1 86 ? 7.944  24.782  -4.841  1.00 66.86  ? 86  TYR P CB    1 
ATOM   655  C  CG    . TYR A 1 86 ? 8.827  25.540  -5.809  1.00 67.72  ? 86  TYR P CG    1 
ATOM   656  C  CD1   . TYR A 1 86 ? 9.955  26.231  -5.363  1.00 65.24  ? 86  TYR P CD1   1 
ATOM   657  C  CD2   . TYR A 1 86 ? 8.518  25.587  -7.169  1.00 71.83  ? 86  TYR P CD2   1 
ATOM   658  C  CE1   . TYR A 1 86 ? 10.763 26.933  -6.247  1.00 67.30  ? 86  TYR P CE1   1 
ATOM   659  C  CE2   . TYR A 1 86 ? 9.319  26.286  -8.062  1.00 74.16  ? 86  TYR P CE2   1 
ATOM   660  C  CZ    . TYR A 1 86 ? 10.440 26.955  -7.593  1.00 71.94  ? 86  TYR P CZ    1 
ATOM   661  O  OH    . TYR A 1 86 ? 11.237 27.647  -8.472  1.00 75.42  ? 86  TYR P OH    1 
ATOM   662  N  N     . ALA A 1 87 ? 7.655  23.427  -2.018  1.00 63.73  ? 87  ALA P N     1 
ATOM   663  C  CA    . ALA A 1 87 ? 6.679  23.091  -0.988  1.00 66.78  ? 87  ALA P CA    1 
ATOM   664  C  C     . ALA A 1 87 ? 5.334  23.746  -1.310  1.00 73.46  ? 87  ALA P C     1 
ATOM   665  O  O     . ALA A 1 87 ? 5.275  24.712  -2.073  1.00 75.73  ? 87  ALA P O     1 
ATOM   666  C  CB    . ALA A 1 87 ? 7.175  23.527  0.375   1.00 65.71  ? 87  ALA P CB    1 
ATOM   667  N  N     . LYS A 1 88 ? 4.261  23.204  -0.739  1.00 78.12  ? 88  LYS P N     1 
ATOM   668  C  CA    . LYS A 1 88 ? 2.919  23.758  -0.903  1.00 86.39  ? 88  LYS P CA    1 
ATOM   669  C  C     . LYS A 1 88 ? 2.720  24.991  -0.018  1.00 90.82  ? 88  LYS P C     1 
ATOM   670  O  O     . LYS A 1 88 ? 2.194  26.011  -0.468  1.00 95.41  ? 88  LYS P O     1 
ATOM   671  C  CB    . LYS A 1 88 ? 1.869  22.699  -0.577  1.00 89.98  ? 88  LYS P CB    1 
ATOM   672  C  CG    . LYS A 1 88 ? 1.827  21.534  -1.548  1.00 88.99  ? 88  LYS P CG    1 
ATOM   673  C  CD    . LYS A 1 88 ? 0.782  20.520  -1.115  1.00 93.55  ? 88  LYS P CD    1 
ATOM   674  C  CE    . LYS A 1 88 ? 0.725  19.338  -2.060  1.00 93.92  ? 88  LYS P CE    1 
ATOM   675  N  NZ    . LYS A 1 88 ? -0.193 18.285  -1.546  1.00 98.70  ? 88  LYS P NZ    1 
ATOM   676  N  N     . THR A 1 89 ? 3.137  24.871  1.242   1.00 91.01  ? 89  THR P N     1 
ATOM   677  C  CA    . THR A 1 89 ? 3.137  25.965  2.217   1.00 96.20  ? 89  THR P CA    1 
ATOM   678  C  C     . THR A 1 89 ? 4.453  25.883  2.988   1.00 92.58  ? 89  THR P C     1 
ATOM   679  O  O     . THR A 1 89 ? 5.033  24.798  3.098   1.00 88.18  ? 89  THR P O     1 
ATOM   680  C  CB    . THR A 1 89 ? 1.964  25.847  3.225   1.00 103.52 ? 89  THR P CB    1 
ATOM   681  O  OG1   . THR A 1 89 ? 2.198  24.753  4.121   1.00 101.71 ? 89  THR P OG1   1 
ATOM   682  C  CG2   . THR A 1 89 ? 0.633  25.634  2.513   1.00 109.09 ? 89  THR P CG2   1 
ATOM   683  N  N     . ASP A 1 90 ? 4.921  27.009  3.529   1.00 96.20  ? 90  ASP P N     1 
ATOM   684  C  CA    . ASP A 1 90 ? 6.234  27.037  4.198   1.00 94.54  ? 90  ASP P CA    1 
ATOM   685  C  C     . ASP A 1 90 ? 6.199  26.936  5.727   1.00 99.84  ? 90  ASP P C     1 
ATOM   686  O  O     . ASP A 1 90 ? 6.879  26.091  6.308   1.00 97.03  ? 90  ASP P O     1 
ATOM   687  C  CB    . ASP A 1 90 ? 7.067  28.249  3.749   1.00 94.24  ? 90  ASP P CB    1 
ATOM   688  C  CG    . ASP A 1 90 ? 6.211  29.428  3.285   1.00 99.93  ? 90  ASP P CG    1 
ATOM   689  O  OD1   . ASP A 1 90 ? 5.095  29.621  3.811   1.00 105.74 ? 90  ASP P OD1   1 
ATOM   690  O  OD2   . ASP A 1 90 ? 6.667  30.170  2.389   1.00 99.16  ? 90  ASP P OD2   1 
ATOM   691  N  N     . SER A 1 91 ? 5.407  27.795  6.367   1.00 109.31 ? 91  SER P N     1 
ATOM   692  C  CA    . SER A 1 91 ? 5.327  27.878  7.837   1.00 117.31 ? 91  SER P CA    1 
ATOM   693  C  C     . SER A 1 91 ? 6.701  28.085  8.498   1.00 117.05 ? 91  SER P C     1 
ATOM   694  O  O     . SER A 1 91 ? 7.488  28.919  8.040   1.00 115.57 ? 91  SER P O     1 
ATOM   695  C  CB    . SER A 1 91 ? 4.581  26.669  8.429   1.00 119.06 ? 91  SER P CB    1 
ATOM   696  O  OG    . SER A 1 91 ? 4.387  26.806  9.829   1.00 126.99 ? 91  SER P OG    1 
ATOM   697  N  N     . ASP A 1 92 ? 6.977  27.325  9.561   1.00 120.14 ? 92  ASP P N     1 
ATOM   698  C  CA    . ASP A 1 92 ? 8.202  27.465  10.356  1.00 122.55 ? 92  ASP P CA    1 
ATOM   699  C  C     . ASP A 1 92 ? 8.388  28.913  10.826  1.00 130.97 ? 92  ASP P C     1 
ATOM   700  O  O     . ASP A 1 92 ? 7.596  29.403  11.633  1.00 140.04 ? 92  ASP P O     1 
ATOM   701  C  CB    . ASP A 1 92 ? 9.428  26.940  9.585   1.00 113.86 ? 92  ASP P CB    1 
ATOM   702  C  CG    . ASP A 1 92 ? 10.682 26.856  10.450  1.00 115.69 ? 92  ASP P CG    1 
ATOM   703  O  OD1   . ASP A 1 92 ? 10.571 26.520  11.650  1.00 121.48 ? 92  ASP P OD1   1 
ATOM   704  O  OD2   . ASP A 1 92 ? 11.783 27.127  9.922   1.00 112.37 ? 92  ASP P OD2   1 
ATOM   705  N  N     . ILE A 1 93 ? 9.419  29.590  10.321  1.00 129.76 ? 93  ILE P N     1 
ATOM   706  C  CA    . ILE A 1 93 ? 9.648  31.010  10.618  1.00 138.30 ? 93  ILE P CA    1 
ATOM   707  C  C     . ILE A 1 93 ? 9.853  31.830  9.339   1.00 135.68 ? 93  ILE P C     1 
ATOM   708  O  O     . ILE A 1 93 ? 10.719 32.711  9.276   1.00 137.90 ? 93  ILE P O     1 
ATOM   709  C  CB    . ILE A 1 93 ? 10.819 31.245  11.631  1.00 142.98 ? 93  ILE P CB    1 
ATOM   710  C  CG1   . ILE A 1 93 ? 12.012 30.321  11.331  1.00 135.51 ? 93  ILE P CG1   1 
ATOM   711  C  CG2   . ILE A 1 93 ? 10.319 31.092  13.076  1.00 152.47 ? 93  ILE P CG2   1 
ATOM   712  C  CD1   . ILE A 1 93 ? 13.322 30.744  11.991  1.00 140.00 ? 93  ILE P CD1   1 
ATOM   713  N  N     . ILE A 1 94 ? 9.036  31.538  8.329   1.00 132.66 ? 94  ILE P N     1 
ATOM   714  C  CA    . ILE A 1 94 ? 9.106  32.229  7.043   1.00 131.17 ? 94  ILE P CA    1 
ATOM   715  C  C     . ILE A 1 94 ? 8.280  33.528  7.051   1.00 140.24 ? 94  ILE P C     1 
ATOM   716  O  O     . ILE A 1 94 ? 8.824  34.609  7.316   1.00 145.32 ? 94  ILE P O     1 
ATOM   717  C  CB    . ILE A 1 94 ? 8.724  31.280  5.864   1.00 123.47 ? 94  ILE P CB    1 
ATOM   718  C  CG1   . ILE A 1 94 ? 9.703  30.101  5.782   1.00 116.25 ? 94  ILE P CG1   1 
ATOM   719  C  CG2   . ILE A 1 94 ? 8.670  32.028  4.531   1.00 122.39 ? 94  ILE P CG2   1 
ATOM   720  C  CD1   . ILE A 1 94 ? 11.172 30.497  5.661   1.00 114.47 ? 94  ILE P CD1   1 
ATOM   721  N  N     . ALA A 1 95 ? 6.978  33.415  6.777   1.00 64.82  ? 95  ALA P N     1 
ATOM   722  C  CA    . ALA A 1 95 ? 6.088  34.577  6.711   1.00 66.19  ? 95  ALA P CA    1 
ATOM   723  C  C     . ALA A 1 95 ? 5.260  34.662  7.986   1.00 67.18  ? 95  ALA P C     1 
ATOM   724  O  O     . ALA A 1 95 ? 4.131  34.152  8.032   1.00 67.49  ? 95  ALA P O     1 
ATOM   725  C  CB    . ALA A 1 95 ? 5.178  34.493  5.470   1.00 66.04  ? 95  ALA P CB    1 
ATOM   726  N  N     . LYS A 1 96 ? 5.831  35.293  9.018   1.00 68.27  ? 96  LYS P N     1 
ATOM   727  C  CA    . LYS A 1 96 ? 5.218  35.354  10.359  1.00 69.35  ? 96  LYS P CA    1 
ATOM   728  C  C     . LYS A 1 96 ? 5.201  33.964  11.026  1.00 69.84  ? 96  LYS P C     1 
ATOM   729  O  O     . LYS A 1 96 ? 5.939  33.721  11.987  1.00 69.99  ? 96  LYS P O     1 
ATOM   730  C  CB    . LYS A 1 96 ? 3.821  36.021  10.304  1.00 69.48  ? 96  LYS P CB    1 
ATOM   731  C  CG    . LYS A 1 96 ? 2.963  35.927  11.569  1.00 70.23  ? 96  LYS P CG    1 
ATOM   732  C  CD    . LYS A 1 96 ? 1.837  34.895  11.437  1.00 71.27  ? 96  LYS P CD    1 
ATOM   733  C  CE    . LYS A 1 96 ? 0.931  34.885  12.672  1.00 72.16  ? 96  LYS P CE    1 
ATOM   734  N  NZ    . LYS A 1 96 ? 0.184  36.172  12.863  1.00 72.53  ? 96  LYS P NZ    1 
ATOM   735  N  N     . MET A 1 97 ? 4.369  33.064  10.502  1.00 70.39  ? 97  MET P N     1 
ATOM   736  C  CA    . MET A 1 97 ? 4.331  31.672  10.935  1.00 70.88  ? 97  MET P CA    1 
ATOM   737  C  C     . MET A 1 97 ? 4.920  30.802  9.826   1.00 70.88  ? 97  MET P C     1 
ATOM   738  O  O     . MET A 1 97 ? 4.825  31.136  8.640   1.00 70.79  ? 97  MET P O     1 
ATOM   739  C  CB    . MET A 1 97 ? 2.888  31.246  11.254  1.00 71.18  ? 97  MET P CB    1 
ATOM   740  C  CG    . MET A 1 97 ? 2.733  29.839  11.858  1.00 72.16  ? 97  MET P CG    1 
ATOM   741  S  SD    . MET A 1 97 ? 1.020  29.233  11.822  1.00 74.24  ? 97  MET P SD    1 
ATOM   742  C  CE    . MET A 1 97 ? 1.223  27.544  12.405  1.00 73.70  ? 97  MET P CE    1 
HETATM 743  P  PG    . GTP B 2 1  ? 0.629  -8.626  69.070  1.00 115.34 ? 8   GTP R PG    1 
HETATM 744  O  O1G   . GTP B 2 1  ? -0.657 -9.426  69.039  1.00 116.10 ? 8   GTP R O1G   1 
HETATM 745  O  O2G   . GTP B 2 1  ? 0.487  -7.361  68.253  1.00 112.97 ? 8   GTP R O2G   1 
HETATM 746  O  O3G   . GTP B 2 1  ? 0.933  -8.282  70.511  1.00 119.37 ? 8   GTP R O3G   1 
HETATM 747  O  O3B   . GTP B 2 1  ? 1.842  -9.484  68.441  1.00 111.59 ? 8   GTP R O3B   1 
HETATM 748  P  PB    . GTP B 2 1  ? 1.596  -10.769 67.500  1.00 108.43 ? 8   GTP R PB    1 
HETATM 749  O  O1B   . GTP B 2 1  ? 0.300  -10.640 66.734  1.00 107.36 ? 8   GTP R O1B   1 
HETATM 750  O  O2B   . GTP B 2 1  ? 1.618  -12.031 68.325  1.00 111.06 ? 8   GTP R O2B   1 
HETATM 751  O  O3A   . GTP B 2 1  ? 2.824  -10.738 66.460  1.00 103.66 ? 8   GTP R O3A   1 
HETATM 752  P  PA    . GTP B 2 1  ? 2.763  -11.591 65.094  1.00 99.50  ? 8   GTP R PA    1 
HETATM 753  O  O1A   . GTP B 2 1  ? 4.161  -12.043 64.733  1.00 97.98  ? 8   GTP R O1A   1 
HETATM 754  O  O2A   . GTP B 2 1  ? 2.173  -10.771 63.966  1.00 96.89  ? 8   GTP R O2A   1 
HETATM 755  O  "O5'" . GTP B 2 1  ? 1.819  -12.853 65.448  1.00 99.37  ? 8   GTP R "O5'" 1 
HETATM 756  C  "C5'" . GTP B 2 1  ? 2.363  -14.103 65.812  1.00 97.68  ? 8   GTP R "C5'" 1 
HETATM 757  C  "C4'" . GTP B 2 1  ? 1.435  -15.243 65.404  1.00 95.82  ? 8   GTP R "C4'" 1 
HETATM 758  O  "O4'" . GTP B 2 1  ? 0.367  -15.379 66.324  1.00 98.43  ? 8   GTP R "O4'" 1 
HETATM 759  C  "C3'" . GTP B 2 1  ? 0.761  -15.018 64.063  1.00 91.82  ? 8   GTP R "C3'" 1 
HETATM 760  O  "O3'" . GTP B 2 1  ? 1.530  -15.435 62.960  1.00 87.86  ? 8   GTP R "O3'" 1 
HETATM 761  C  "C2'" . GTP B 2 1  ? -0.535 -15.783 64.198  1.00 93.48  ? 8   GTP R "C2'" 1 
HETATM 762  O  "O2'" . GTP B 2 1  ? -0.351 -17.147 63.894  1.00 93.74  ? 8   GTP R "O2'" 1 
HETATM 763  C  "C1'" . GTP B 2 1  ? -0.872 -15.618 65.669  1.00 96.99  ? 8   GTP R "C1'" 1 
HETATM 764  N  N9    . GTP B 2 1  ? -1.795 -14.465 65.815  1.00 96.54  ? 8   GTP R N9    1 
HETATM 765  C  C8    . GTP B 2 1  ? -1.537 -13.284 66.467  1.00 97.25  ? 8   GTP R C8    1 
HETATM 766  N  N7    . GTP B 2 1  ? -2.622 -12.480 66.374  1.00 97.20  ? 8   GTP R N7    1 
HETATM 767  C  C5    . GTP B 2 1  ? -3.574 -13.123 65.666  1.00 96.10  ? 8   GTP R C5    1 
HETATM 768  C  C6    . GTP B 2 1  ? -4.860 -12.760 65.278  1.00 95.91  ? 8   GTP R C6    1 
HETATM 769  O  O6    . GTP B 2 1  ? -5.311 -11.663 65.591  1.00 96.89  ? 8   GTP R O6    1 
HETATM 770  N  N1    . GTP B 2 1  ? -5.631 -13.637 64.540  1.00 94.89  ? 8   GTP R N1    1 
HETATM 771  C  C2    . GTP B 2 1  ? -5.115 -14.869 64.191  1.00 93.89  ? 8   GTP R C2    1 
HETATM 772  N  N2    . GTP B 2 1  ? -5.845 -15.719 63.481  1.00 93.11  ? 8   GTP R N2    1 
HETATM 773  N  N3    . GTP B 2 1  ? -3.838 -15.225 64.579  1.00 94.12  ? 8   GTP R N3    1 
HETATM 774  C  C4    . GTP B 2 1  ? -3.073 -14.370 65.306  1.00 95.46  ? 8   GTP R C4    1 
ATOM   775  P  P     . G   B 2 2  ? 1.499  -14.584 61.604  1.00 83.49  ? 9   G   R P     1 
ATOM   776  O  OP1   . G   B 2 2  ? 2.607  -15.052 60.741  1.00 80.89  ? 9   G   R OP1   1 
ATOM   777  O  OP2   . G   B 2 2  ? 1.405  -13.149 61.964  1.00 83.35  ? 9   G   R OP2   1 
ATOM   778  O  "O5'" . G   B 2 2  ? 0.116  -15.022 60.940  1.00 83.21  ? 9   G   R "O5'" 1 
ATOM   779  C  "C5'" . G   B 2 2  ? -0.059 -16.350 60.459  1.00 82.73  ? 9   G   R "C5'" 1 
ATOM   780  C  "C4'" . G   B 2 2  ? -1.433 -16.504 59.843  1.00 82.33  ? 9   G   R "C4'" 1 
ATOM   781  O  "O4'" . G   B 2 2  ? -2.425 -16.392 60.895  1.00 84.93  ? 9   G   R "O4'" 1 
ATOM   782  C  "C3'" . G   B 2 2  ? -1.811 -15.410 58.853  1.00 79.88  ? 9   G   R "C3'" 1 
ATOM   783  O  "O3'" . G   B 2 2  ? -1.336 -15.684 57.543  1.00 77.43  ? 9   G   R "O3'" 1 
ATOM   784  C  "C2'" . G   B 2 2  ? -3.331 -15.424 58.947  1.00 81.37  ? 9   G   R "C2'" 1 
ATOM   785  O  "O2'" . G   B 2 2  ? -3.932 -16.506 58.261  1.00 81.20  ? 9   G   R "O2'" 1 
ATOM   786  C  "C1'" . G   B 2 2  ? -3.497 -15.574 60.456  1.00 84.36  ? 9   G   R "C1'" 1 
ATOM   787  N  N9    . G   B 2 2  ? -3.502 -14.282 61.158  1.00 84.66  ? 9   G   R N9    1 
ATOM   788  C  C8    . G   B 2 2  ? -2.517 -13.722 61.939  1.00 84.78  ? 9   G   R C8    1 
ATOM   789  N  N7    . G   B 2 2  ? -2.829 -12.551 62.423  1.00 85.65  ? 9   G   R N7    1 
ATOM   790  C  C5    . G   B 2 2  ? -4.105 -12.310 61.934  1.00 85.89  ? 9   G   R C5    1 
ATOM   791  C  C6    . G   B 2 2  ? -4.971 -11.200 62.117  1.00 87.18  ? 9   G   R C6    1 
ATOM   792  O  O6    . G   B 2 2  ? -4.765 -10.169 62.773  1.00 88.53  ? 9   G   R O6    1 
ATOM   793  N  N1    . G   B 2 2  ? -6.182 -11.360 61.437  1.00 87.16  ? 9   G   R N1    1 
ATOM   794  C  C2    . G   B 2 2  ? -6.505 -12.464 60.676  1.00 86.12  ? 9   G   R C2    1 
ATOM   795  N  N2    . G   B 2 2  ? -7.705 -12.479 60.086  1.00 86.39  ? 9   G   R N2    1 
ATOM   796  N  N3    . G   B 2 2  ? -5.707 -13.506 60.502  1.00 85.03  ? 9   G   R N3    1 
ATOM   797  C  C4    . G   B 2 2  ? -4.528 -13.365 61.154  1.00 85.11  ? 9   G   R C4    1 
ATOM   798  P  P     . U   B 2 3  ? -0.911 -14.460 56.595  1.00 75.55  ? 10  U   R P     1 
ATOM   799  O  OP1   . U   B 2 3  ? -0.355 -15.020 55.343  1.00 73.40  ? 10  U   R OP1   1 
ATOM   800  O  OP2   . U   B 2 3  ? -0.094 -13.507 57.384  1.00 75.45  ? 10  U   R OP2   1 
ATOM   801  O  "O5'" . U   B 2 3  ? -2.311 -13.753 56.267  1.00 75.98  ? 10  U   R "O5'" 1 
ATOM   802  C  "C5'" . U   B 2 3  ? -3.328 -14.401 55.500  1.00 75.45  ? 10  U   R "C5'" 1 
ATOM   803  C  "C4'" . U   B 2 3  ? -4.577 -13.543 55.461  1.00 76.32  ? 10  U   R "C4'" 1 
ATOM   804  O  "O4'" . U   B 2 3  ? -5.059 -13.301 56.810  1.00 78.57  ? 10  U   R "O4'" 1 
ATOM   805  C  "C3'" . U   B 2 3  ? -4.359 -12.140 54.912  1.00 74.89  ? 10  U   R "C3'" 1 
ATOM   806  O  "O3'" . U   B 2 3  ? -4.317 -12.121 53.497  1.00 73.69  ? 10  U   R "O3'" 1 
ATOM   807  C  "C2'" . U   B 2 3  ? -5.561 -11.394 55.481  1.00 76.85  ? 10  U   R "C2'" 1 
ATOM   808  O  "O2'" . U   B 2 3  ? -6.760 -11.580 54.750  1.00 77.10  ? 10  U   R "O2'" 1 
ATOM   809  C  "C1'" . U   B 2 3  ? -5.644 -12.006 56.883  1.00 78.99  ? 10  U   R "C1'" 1 
ATOM   810  N  N1    . U   B 2 3  ? -4.945 -11.142 57.908  1.00 79.12  ? 10  U   R N1    1 
ATOM   811  C  C2    . U   B 2 3  ? -5.579 -10.005 58.393  1.00 80.45  ? 10  U   R C2    1 
ATOM   812  O  O2    . U   B 2 3  ? -6.695 -9.648  58.051  1.00 80.93  ? 10  U   R O2    1 
ATOM   813  N  N3    . U   B 2 3  ? -4.852 -9.284  59.315  1.00 81.32  ? 10  U   R N3    1 
ATOM   814  C  C4    . U   B 2 3  ? -3.579 -9.567  59.787  1.00 80.71  ? 10  U   R C4    1 
ATOM   815  O  O4    . U   B 2 3  ? -3.056 -8.829  60.618  1.00 81.65  ? 10  U   R O4    1 
ATOM   816  C  C5    . U   B 2 3  ? -2.980 -10.756 59.234  1.00 79.08  ? 10  U   R C5    1 
ATOM   817  C  C6    . U   B 2 3  ? -3.670 -11.478 58.339  1.00 78.35  ? 10  U   R C6    1 
ATOM   818  P  P     . C   B 2 4  ? -3.285 -11.141 52.759  1.00 72.49  ? 11  C   R P     1 
ATOM   819  O  OP1   . C   B 2 4  ? -2.951 -11.723 51.439  1.00 70.55  ? 11  C   R OP1   1 
ATOM   820  O  OP2   . C   B 2 4  ? -2.184 -10.833 53.698  1.00 72.77  ? 11  C   R OP2   1 
ATOM   821  O  "O5'" . C   B 2 4  ? -4.128 -9.799  52.549  1.00 73.33  ? 11  C   R "O5'" 1 
ATOM   822  C  "C5'" . C   B 2 4  ? -5.495 -9.821  52.142  1.00 75.33  ? 11  C   R "C5'" 1 
ATOM   823  C  "C4'" . C   B 2 4  ? -6.185 -8.522  52.523  1.00 77.49  ? 11  C   R "C4'" 1 
ATOM   824  O  "O4'" . C   B 2 4  ? -6.461 -8.484  53.950  1.00 79.95  ? 11  C   R "O4'" 1 
ATOM   825  C  "C3'" . C   B 2 4  ? -5.344 -7.279  52.280  1.00 76.38  ? 11  C   R "C3'" 1 
ATOM   826  O  "O3'" . C   B 2 4  ? -5.408 -6.871  50.929  1.00 75.53  ? 11  C   R "O3'" 1 
ATOM   827  C  "C2'" . C   B 2 4  ? -5.959 -6.273  53.247  1.00 78.74  ? 11  C   R "C2'" 1 
ATOM   828  O  "O2'" . C   B 2 4  ? -7.142 -5.662  52.761  1.00 80.17  ? 11  C   R "O2'" 1 
ATOM   829  C  "C1'" . C   B 2 4  ? -6.237 -7.172  54.452  1.00 80.34  ? 11  C   R "C1'" 1 
ATOM   830  N  N1    . C   B 2 4  ? -5.117 -7.166  55.478  1.00 79.90  ? 11  C   R N1    1 
ATOM   831  C  C2    . C   B 2 4  ? -5.164 -6.265  56.559  1.00 81.52  ? 11  C   R C2    1 
ATOM   832  O  O2    . C   B 2 4  ? -6.117 -5.484  56.671  1.00 83.17  ? 11  C   R O2    1 
ATOM   833  N  N3    . C   B 2 4  ? -4.150 -6.275  57.467  1.00 81.48  ? 11  C   R N3    1 
ATOM   834  C  C4    . C   B 2 4  ? -3.126 -7.126  57.332  1.00 79.88  ? 11  C   R C4    1 
ATOM   835  N  N4    . C   B 2 4  ? -2.157 -7.094  58.249  1.00 80.48  ? 11  C   R N4    1 
ATOM   836  C  C5    . C   B 2 4  ? -3.047 -8.046  56.243  1.00 77.93  ? 11  C   R C5    1 
ATOM   837  C  C6    . C   B 2 4  ? -4.052 -8.027  55.357  1.00 78.03  ? 11  C   R C6    1 
ATOM   838  P  P     . A   B 2 5  ? -4.084 -6.272  50.262  1.00 74.20  ? 12  A   R P     1 
ATOM   839  O  OP1   . A   B 2 5  ? -4.151 -6.563  48.813  1.00 73.32  ? 12  A   R OP1   1 
ATOM   840  O  OP2   . A   B 2 5  ? -2.893 -6.745  51.014  1.00 73.45  ? 12  A   R OP2   1 
ATOM   841  O  "O5'" . A   B 2 5  ? -4.290 -4.696  50.507  1.00 74.34  ? 12  A   R "O5'" 1 
ATOM   842  C  "C5'" . A   B 2 5  ? -3.278 -3.889  51.119  1.00 72.75  ? 12  A   R "C5'" 1 
ATOM   843  C  "C4'" . A   B 2 5  ? -3.889 -2.971  52.161  1.00 74.39  ? 12  A   R "C4'" 1 
ATOM   844  O  "O4'" . A   B 2 5  ? -4.187 -3.712  53.372  1.00 75.58  ? 12  A   R "O4'" 1 
ATOM   845  C  "C3'" . A   B 2 5  ? -3.001 -1.841  52.657  1.00 74.03  ? 12  A   R "C3'" 1 
ATOM   846  O  "O3'" . A   B 2 5  ? -2.993 -0.755  51.737  1.00 73.60  ? 12  A   R "O3'" 1 
ATOM   847  C  "C2'" . A   B 2 5  ? -3.715 -1.488  53.958  1.00 76.84  ? 12  A   R "C2'" 1 
ATOM   848  O  "O2'" . A   B 2 5  ? -4.928 -0.784  53.766  1.00 78.82  ? 12  A   R "O2'" 1 
ATOM   849  C  "C1'" . A   B 2 5  ? -4.012 -2.879  54.507  1.00 76.76  ? 12  A   R "C1'" 1 
ATOM   850  N  N9    . A   B 2 5  ? -2.945 -3.416  55.357  1.00 75.35  ? 12  A   R N9    1 
ATOM   851  C  C8    . A   B 2 5  ? -2.212 -4.551  55.135  1.00 73.23  ? 12  A   R C8    1 
ATOM   852  N  N7    . A   B 2 5  ? -1.314 -4.802  56.057  1.00 73.00  ? 12  A   R N7    1 
ATOM   853  C  C5    . A   B 2 5  ? -1.463 -3.759  56.953  1.00 74.97  ? 12  A   R C5    1 
ATOM   854  C  C6    . A   B 2 5  ? -0.801 -3.442  58.160  1.00 76.24  ? 12  A   R C6    1 
ATOM   855  N  N6    . A   B 2 5  ? 0.182  -4.189  58.675  1.00 75.60  ? 12  A   R N6    1 
ATOM   856  N  N1    . A   B 2 5  ? -1.187 -2.325  58.818  1.00 78.25  ? 12  A   R N1    1 
ATOM   857  C  C2    . A   B 2 5  ? -2.169 -1.576  58.298  1.00 78.89  ? 12  A   R C2    1 
ATOM   858  N  N3    . A   B 2 5  ? -2.864 -1.772  57.175  1.00 77.88  ? 12  A   R N3    1 
ATOM   859  C  C4    . A   B 2 5  ? -2.463 -2.892  56.540  1.00 76.18  ? 12  A   R C4    1 
ATOM   860  P  P     . C   B 2 6  ? -1.668 0.120   51.506  1.00 72.33  ? 13  C   R P     1 
ATOM   861  O  OP1   . C   B 2 6  ? -2.028 1.273   50.655  1.00 72.90  ? 13  C   R OP1   1 
ATOM   862  O  OP2   . C   B 2 6  ? -0.572 -0.779  51.077  1.00 69.75  ? 13  C   R OP2   1 
ATOM   863  O  "O5'" . C   B 2 6  ? -1.322 0.665   52.967  1.00 73.44  ? 13  C   R "O5'" 1 
ATOM   864  C  "C5'" . C   B 2 6  ? -2.025 1.769   53.517  1.00 74.98  ? 13  C   R "C5'" 1 
ATOM   865  C  "C4'" . C   B 2 6  ? -1.390 2.148   54.839  1.00 76.00  ? 13  C   R "C4'" 1 
ATOM   866  O  "O4'" . C   B 2 6  ? -1.446 1.016   55.745  1.00 75.91  ? 13  C   R "O4'" 1 
ATOM   867  C  "C3'" . C   B 2 6  ? 0.089  2.502   54.752  1.00 73.82  ? 13  C   R "C3'" 1 
ATOM   868  O  "O3'" . C   B 2 6  ? 0.231  3.871   54.392  1.00 74.78  ? 13  C   R "O3'" 1 
ATOM   869  C  "C2'" . C   B 2 6  ? 0.568  2.200   56.171  1.00 74.70  ? 13  C   R "C2'" 1 
ATOM   870  O  "O2'" . C   B 2 6  ? 0.307  3.239   57.092  1.00 77.61  ? 13  C   R "O2'" 1 
ATOM   871  C  "C1'" . C   B 2 6  ? -0.272 0.981   56.538  1.00 74.58  ? 13  C   R "C1'" 1 
ATOM   872  N  N1    . C   B 2 6  ? 0.458  -0.311  56.331  1.00 70.98  ? 13  C   R N1    1 
ATOM   873  C  C2    . C   B 2 6  ? 1.304  -0.788  57.345  1.00 70.67  ? 13  C   R C2    1 
ATOM   874  O  O2    . C   B 2 6  ? 1.435  -0.144  58.393  1.00 72.42  ? 13  C   R O2    1 
ATOM   875  N  N3    . C   B 2 6  ? 1.962  -1.958  57.145  1.00 68.40  ? 13  C   R N3    1 
ATOM   876  C  C4    . C   B 2 6  ? 1.799  -2.633  56.004  1.00 65.91  ? 13  C   R C4    1 
ATOM   877  N  N4    . C   B 2 6  ? 2.466  -3.775  55.867  1.00 64.51  ? 13  C   R N4    1 
ATOM   878  C  C5    . C   B 2 6  ? 0.949  -2.175  54.956  1.00 65.54  ? 13  C   R C5    1 
ATOM   879  C  C6    . C   B 2 6  ? 0.306  -1.020  55.165  1.00 68.17  ? 13  C   R C6    1 
ATOM   880  P  P     . G   B 2 7  ? 1.523  4.407   53.615  1.00 72.84  ? 14  G   R P     1 
ATOM   881  O  OP1   . G   B 2 7  ? 1.260  5.817   53.251  1.00 74.41  ? 14  G   R OP1   1 
ATOM   882  O  OP2   . G   B 2 7  ? 1.898  3.452   52.549  1.00 69.82  ? 14  G   R OP2   1 
ATOM   883  O  "O5'" . G   B 2 7  ? 2.644  4.374   54.754  1.00 73.42  ? 14  G   R "O5'" 1 
ATOM   884  C  "C5'" . G   B 2 7  ? 2.583  5.286   55.849  1.00 76.56  ? 14  G   R "C5'" 1 
ATOM   885  C  "C4'" . G   B 2 7  ? 3.788  5.101   56.752  1.00 77.22  ? 14  G   R "C4'" 1 
ATOM   886  O  "O4'" . G   B 2 7  ? 3.878  3.716   57.173  1.00 76.72  ? 14  G   R "O4'" 1 
ATOM   887  C  "C3'" . G   B 2 7  ? 5.126  5.451   56.105  1.00 75.40  ? 14  G   R "C3'" 1 
ATOM   888  O  "O3'" . G   B 2 7  ? 5.942  6.199   57.022  1.00 77.73  ? 14  G   R "O3'" 1 
ATOM   889  C  "C2'" . G   B 2 7  ? 5.707  4.086   55.725  1.00 72.70  ? 14  G   R "C2'" 1 
ATOM   890  O  "O2'" . G   B 2 7  ? 7.123  4.054   55.724  1.00 71.74  ? 14  G   R "O2'" 1 
ATOM   891  C  "C1'" . G   B 2 7  ? 5.129  3.170   56.805  1.00 74.23  ? 14  G   R "C1'" 1 
ATOM   892  N  N9    . G   B 2 7  ? 4.922  1.784   56.371  1.00 71.99  ? 14  G   R N9    1 
ATOM   893  C  C8    . G   B 2 7  ? 4.160  1.345   55.313  1.00 70.12  ? 14  G   R C8    1 
ATOM   894  N  N7    . G   B 2 7  ? 4.165  0.050   55.165  1.00 68.78  ? 14  G   R N7    1 
ATOM   895  C  C5    . G   B 2 7  ? 4.981  -0.406  56.191  1.00 69.60  ? 14  G   R C5    1 
ATOM   896  C  C6    . G   B 2 7  ? 5.365  -1.725  56.544  1.00 69.30  ? 14  G   R C6    1 
ATOM   897  O  O6    . G   B 2 7  ? 5.048  -2.789  55.997  1.00 68.32  ? 14  G   R O6    1 
ATOM   898  N  N1    . G   B 2 7  ? 6.209  -1.753  57.653  1.00 70.61  ? 14  G   R N1    1 
ATOM   899  C  C2    . G   B 2 7  ? 6.628  -0.642  58.343  1.00 72.02  ? 14  G   R C2    1 
ATOM   900  N  N2    . G   B 2 7  ? 7.440  -0.860  59.387  1.00 73.36  ? 14  G   R N2    1 
ATOM   901  N  N3    . G   B 2 7  ? 6.274  0.597   58.025  1.00 72.59  ? 14  G   R N3    1 
ATOM   902  C  C4    . G   B 2 7  ? 5.452  0.647   56.944  1.00 71.36  ? 14  G   R C4    1 
ATOM   903  P  P     . C   B 2 8  ? 5.948  7.804   56.994  1.00 79.47  ? 15  C   R P     1 
ATOM   904  O  OP1   . C   B 2 8  ? 4.567  8.284   57.241  1.00 81.34  ? 15  C   R OP1   1 
ATOM   905  O  OP2   . C   B 2 8  ? 6.688  8.251   55.793  1.00 76.77  ? 15  C   R OP2   1 
ATOM   906  O  "O5'" . C   B 2 8  ? 6.868  8.147   58.255  1.00 82.71  ? 15  C   R "O5'" 1 
ATOM   907  C  "C5'" . C   B 2 8  ? 6.657  9.325   59.030  1.00 87.01  ? 15  C   R "C5'" 1 
ATOM   908  C  "C4'" . C   B 2 8  ? 6.990  9.096   60.495  1.00 90.66  ? 15  C   R "C4'" 1 
ATOM   909  O  "O4'" . C   B 2 8  ? 5.757  9.115   61.255  1.00 94.08  ? 15  C   R "O4'" 1 
ATOM   910  C  "C3'" . C   B 2 8  ? 7.691  7.780   60.825  1.00 89.79  ? 15  C   R "C3'" 1 
ATOM   911  O  "O3'" . C   B 2 8  ? 9.095  7.996   60.944  1.00 89.65  ? 15  C   R "O3'" 1 
ATOM   912  C  "C2'" . C   B 2 8  ? 7.079  7.344   62.156  1.00 93.35  ? 15  C   R "C2'" 1 
ATOM   913  O  "O2'" . C   B 2 8  ? 7.870  7.739   63.264  1.00 95.98  ? 15  C   R "O2'" 1 
ATOM   914  C  "C1'" . C   B 2 8  ? 5.719  8.051   62.187  1.00 95.42  ? 15  C   R "C1'" 1 
ATOM   915  N  N1    . C   B 2 8  ? 4.511  7.200   61.867  1.00 95.00  ? 15  C   R N1    1 
ATOM   916  C  C2    . C   B 2 8  ? 3.436  7.145   62.775  1.00 98.30  ? 15  C   R C2    1 
ATOM   917  O  O2    . C   B 2 8  ? 3.493  7.786   63.833  1.00 101.49 ? 15  C   R O2    1 
ATOM   918  N  N3    . C   B 2 8  ? 2.351  6.379   62.466  1.00 98.01  ? 15  C   R N3    1 
ATOM   919  C  C4    . C   B 2 8  ? 2.313  5.695   61.313  1.00 94.54  ? 15  C   R C4    1 
ATOM   920  N  N4    . C   B 2 8  ? 1.233  4.956   61.046  1.00 94.29  ? 15  C   R N4    1 
ATOM   921  C  C5    . C   B 2 8  ? 3.389  5.740   60.376  1.00 91.20  ? 15  C   R C5    1 
ATOM   922  C  C6    . C   B 2 8  ? 4.450  6.496   60.690  1.00 91.51  ? 15  C   R C6    1 
ATOM   923  P  P     . A   B 2 9  ? 10.102 7.669   59.743  1.00 86.18  ? 16  A   R P     1 
ATOM   924  O  OP1   . A   B 2 9  ? 10.630 8.957   59.240  1.00 85.97  ? 16  A   R OP1   1 
ATOM   925  O  OP2   . A   B 2 9  ? 9.424  6.758   58.794  1.00 83.84  ? 16  A   R OP2   1 
ATOM   926  O  "O5'" . A   B 2 9  ? 11.276 6.869   60.494  1.00 87.06  ? 16  A   R "O5'" 1 
ATOM   927  C  "C5'" . A   B 2 9  ? 11.097 5.520   60.947  1.00 88.29  ? 16  A   R "C5'" 1 
ATOM   928  C  "C4'" . A   B 2 9  ? 10.726 5.421   62.418  1.00 93.03  ? 16  A   R "C4'" 1 
ATOM   929  O  "O4'" . A   B 2 9  ? 9.388  4.877   62.561  1.00 93.93  ? 16  A   R "O4'" 1 
ATOM   930  C  "C3'" . A   B 2 9  ? 11.581 4.457   63.228  1.00 94.58  ? 16  A   R "C3'" 1 
ATOM   931  O  "O3'" . A   B 2 9  ? 12.797 5.069   63.648  1.00 97.01  ? 16  A   R "O3'" 1 
ATOM   932  C  "C2'" . A   B 2 9  ? 10.661 4.129   64.402  1.00 97.70  ? 16  A   R "C2'" 1 
ATOM   933  O  "O2'" . A   B 2 9  ? 10.594 5.154   65.379  1.00 100.68 ? 16  A   R "O2'" 1 
ATOM   934  C  "C1'" . A   B 2 9  ? 9.320  3.998   63.681  1.00 96.46  ? 16  A   R "C1'" 1 
ATOM   935  N  N9    . A   B 2 9  ? 8.961  2.626   63.260  1.00 94.73  ? 16  A   R N9    1 
ATOM   936  C  C8    . A   B 2 9  ? 8.691  2.201   61.985  1.00 91.13  ? 16  A   R C8    1 
ATOM   937  N  N7    . A   B 2 9  ? 8.390  0.928   61.885  1.00 89.99  ? 16  A   R N7    1 
ATOM   938  C  C5    . A   B 2 9  ? 8.462  0.468   63.187  1.00 93.24  ? 16  A   R C5    1 
ATOM   939  C  C6    . A   B 2 9  ? 8.252  -0.809  63.758  1.00 94.40  ? 16  A   R C6    1 
ATOM   940  N  N6    . A   B 2 9  ? 7.917  -1.883  63.037  1.00 92.67  ? 16  A   R N6    1 
ATOM   941  N  N1    . A   B 2 9  ? 8.404  -0.949  65.095  1.00 97.63  ? 16  A   R N1    1 
ATOM   942  C  C2    . A   B 2 9  ? 8.745  0.130   65.811  1.00 99.91  ? 16  A   R C2    1 
ATOM   943  N  N3    . A   B 2 9  ? 8.962  1.380   65.387  1.00 99.41  ? 16  A   R N3    1 
ATOM   944  C  C4    . A   B 2 9  ? 8.810  1.494   64.051  1.00 95.99  ? 16  A   R C4    1 
ATOM   945  P  P     . C   B 2 10 ? 14.201 4.325   63.432  1.00 96.06  ? 17  C   R P     1 
ATOM   946  O  OP1   . C   B 2 10 ? 15.266 5.219   63.944  1.00 97.60  ? 17  C   R OP1   1 
ATOM   947  O  OP2   . C   B 2 10 ? 14.259 3.873   62.022  1.00 91.87  ? 17  C   R OP2   1 
ATOM   948  O  "O5'" . C   B 2 10 ? 14.075 3.030   64.373  1.00 98.30  ? 17  C   R "O5'" 1 
ATOM   949  C  "C5'" . C   B 2 10 ? 14.020 3.161   65.797  1.00 104.06 ? 17  C   R "C5'" 1 
ATOM   950  C  "C4'" . C   B 2 10 ? 13.861 1.819   66.490  1.00 106.46 ? 17  C   R "C4'" 1 
ATOM   951  O  "O4'" . C   B 2 10 ? 12.550 1.274   66.205  1.00 106.01 ? 17  C   R "O4'" 1 
ATOM   952  C  "C3'" . C   B 2 10 ? 14.834 0.740   66.034  1.00 105.05 ? 17  C   R "C3'" 1 
ATOM   953  O  "O3'" . C   B 2 10 ? 16.052 0.838   66.761  1.00 107.75 ? 17  C   R "O3'" 1 
ATOM   954  C  "C2'" . C   B 2 10 ? 14.076 -0.554  66.321  1.00 105.38 ? 17  C   R "C2'" 1 
ATOM   955  O  "O2'" . C   B 2 10 ? 14.245 -1.011  67.649  1.00 108.98 ? 17  C   R "O2'" 1 
ATOM   956  C  "C1'" . C   B 2 10 ? 12.628 -0.135  66.061  1.00 105.07 ? 17  C   R "C1'" 1 
ATOM   957  N  N1    . C   B 2 10 ? 12.126 -0.535  64.698  1.00 101.25 ? 17  C   R N1    1 
ATOM   958  C  C2    . C   B 2 10 ? 11.564 -1.812  64.491  1.00 100.54 ? 17  C   R C2    1 
ATOM   959  O  O2    . C   B 2 10 ? 11.471 -2.621  65.427  1.00 102.71 ? 17  C   R O2    1 
ATOM   960  N  N3    . C   B 2 10 ? 11.127 -2.134  63.242  1.00 97.31  ? 17  C   R N3    1 
ATOM   961  C  C4    . C   B 2 10 ? 11.231 -1.255  62.238  1.00 94.87  ? 17  C   R C4    1 
ATOM   962  N  N4    . C   B 2 10 ? 10.785 -1.620  61.035  1.00 92.15  ? 17  C   R N4    1 
ATOM   963  C  C5    . C   B 2 10 ? 11.797 0.042   62.425  1.00 95.58  ? 17  C   R C5    1 
ATOM   964  C  C6    . C   B 2 10 ? 12.223 0.352   63.655  1.00 98.69  ? 17  C   R C6    1 
ATOM   965  P  P     . A   B 2 11 ? 17.444 0.838   65.972  1.00 105.93 ? 18  A   R P     1 
ATOM   966  O  OP1   . A   B 2 11 ? 18.491 1.254   66.937  1.00 109.10 ? 18  A   R OP1   1 
ATOM   967  O  OP2   . A   B 2 11 ? 17.269 1.601   64.715  1.00 102.25 ? 18  A   R OP2   1 
ATOM   968  O  "O5'" . A   B 2 11 ? 17.636 -0.708  65.583  1.00 104.36 ? 18  A   R "O5'" 1 
ATOM   969  C  "C5'" . A   B 2 11 ? 17.751 -1.711  66.596  1.00 107.43 ? 18  A   R "C5'" 1 
ATOM   970  C  "C4'" . A   B 2 11 ? 17.489 -3.103  66.046  1.00 105.87 ? 18  A   R "C4'" 1 
ATOM   971  O  "O4'" . A   B 2 11 ? 16.094 -3.235  65.666  1.00 104.97 ? 18  A   R "O4'" 1 
ATOM   972  C  "C3'" . A   B 2 11 ? 18.246 -3.465  64.775  1.00 102.46 ? 18  A   R "C3'" 1 
ATOM   973  O  "O3'" . A   B 2 11 ? 19.598 -3.847  65.032  1.00 103.42 ? 18  A   R "O3'" 1 
ATOM   974  C  "C2'" . A   B 2 11 ? 17.388 -4.598  64.213  1.00 100.93 ? 18  A   R "C2'" 1 
ATOM   975  O  "O2'" . A   B 2 11 ? 17.621 -5.860  64.810  1.00 102.40 ? 18  A   R "O2'" 1 
ATOM   976  C  "C1'" . A   B 2 11 ? 15.984 -4.084  64.532  1.00 102.04 ? 18  A   R "C1'" 1 
ATOM   977  N  N9    . A   B 2 11 ? 15.416 -3.352  63.394  1.00 99.45  ? 18  A   R N9    1 
ATOM   978  C  C8    . A   B 2 11 ? 15.354 -1.993  63.226  1.00 99.19  ? 18  A   R C8    1 
ATOM   979  N  N7    . A   B 2 11 ? 14.799 -1.619  62.097  1.00 96.50  ? 18  A   R N7    1 
ATOM   980  C  C5    . A   B 2 11 ? 14.477 -2.814  61.473  1.00 94.67  ? 18  A   R C5    1 
ATOM   981  C  C6    . A   B 2 11 ? 13.859 -3.107  60.237  1.00 91.64  ? 18  A   R C6    1 
ATOM   982  N  N6    . A   B 2 11 ? 13.447 -2.163  59.384  1.00 89.64  ? 18  A   R N6    1 
ATOM   983  N  N1    . A   B 2 11 ? 13.683 -4.411  59.911  1.00 90.79  ? 18  A   R N1    1 
ATOM   984  C  C2    . A   B 2 11 ? 14.096 -5.357  60.768  1.00 92.68  ? 18  A   R C2    1 
ATOM   985  N  N3    . A   B 2 11 ? 14.688 -5.201  61.954  1.00 95.55  ? 18  A   R N3    1 
ATOM   986  C  C4    . A   B 2 11 ? 14.852 -3.896  62.255  1.00 96.48  ? 18  A   R C4    1 
ATOM   987  P  P     . G   B 2 12 ? 20.728 -3.582  63.916  1.00 100.65 ? 19  G   R P     1 
ATOM   988  O  OP1   . G   B 2 12 ? 22.043 -3.617  64.592  1.00 103.29 ? 19  G   R OP1   1 
ATOM   989  O  OP2   . G   B 2 12 ? 20.359 -2.376  63.142  1.00 98.35  ? 19  G   R OP2   1 
ATOM   990  O  "O5'" . G   B 2 12 ? 20.602 -4.847  62.942  1.00 97.31  ? 19  G   R "O5'" 1 
ATOM   991  C  "C5'" . G   B 2 12 ? 20.716 -6.178  63.437  1.00 98.26  ? 19  G   R "C5'" 1 
ATOM   992  C  "C4'" . G   B 2 12 ? 20.206 -7.176  62.416  1.00 95.34  ? 19  G   R "C4'" 1 
ATOM   993  O  "O4'" . G   B 2 12 ? 18.778 -7.009  62.216  1.00 94.37  ? 19  G   R "O4'" 1 
ATOM   994  C  "C3'" . G   B 2 12 ? 20.770 -6.995  61.013  1.00 91.85  ? 19  G   R "C3'" 1 
ATOM   995  O  "O3'" . G   B 2 12 ? 22.083 -7.512  60.886  1.00 91.83  ? 19  G   R "O3'" 1 
ATOM   996  C  "C2'" . G   B 2 12 ? 19.731 -7.705  60.151  1.00 89.74  ? 19  G   R "C2'" 1 
ATOM   997  O  "O2'" . G   B 2 12 ? 19.846 -9.114  60.154  1.00 90.43  ? 19  G   R "O2'" 1 
ATOM   998  C  "C1'" . G   B 2 12 ? 18.456 -7.227  60.846  1.00 90.99  ? 19  G   R "C1'" 1 
ATOM   999  N  N9    . G   B 2 12 ? 17.934 -5.999  60.233  1.00 88.90  ? 19  G   R N9    1 
ATOM   1000 C  C8    . G   B 2 12 ? 18.203 -4.698  60.601  1.00 89.54  ? 19  G   R C8    1 
ATOM   1001 N  N7    . G   B 2 12 ? 17.601 -3.805  59.868  1.00 87.48  ? 19  G   R N7    1 
ATOM   1002 C  C5    . G   B 2 12 ? 16.886 -4.558  58.946  1.00 85.21  ? 19  G   R C5    1 
ATOM   1003 C  C6    . G   B 2 12 ? 16.037 -4.138  57.892  1.00 82.65  ? 19  G   R C6    1 
ATOM   1004 O  O6    . G   B 2 12 ? 15.749 -2.979  57.565  1.00 81.71  ? 19  G   R O6    1 
ATOM   1005 N  N1    . G   B 2 12 ? 15.499 -5.218  57.189  1.00 81.08  ? 19  G   R N1    1 
ATOM   1006 C  C2    . G   B 2 12 ? 15.753 -6.541  57.470  1.00 81.74  ? 19  G   R C2    1 
ATOM   1007 N  N2    . G   B 2 12 ? 15.150 -7.445  56.686  1.00 80.16  ? 19  G   R N2    1 
ATOM   1008 N  N3    . G   B 2 12 ? 16.547 -6.946  58.455  1.00 84.18  ? 19  G   R N3    1 
ATOM   1009 C  C4    . G   B 2 12 ? 17.079 -5.908  59.153  1.00 85.96  ? 19  G   R C4    1 
ATOM   1010 P  P     . G   B 2 13 ? 23.294 -6.480  60.693  1.00 91.14  ? 20  G   R P     1 
ATOM   1011 O  OP1   . G   B 2 13 ? 24.437 -7.024  61.461  1.00 93.95  ? 20  G   R OP1   1 
ATOM   1012 O  OP2   . G   B 2 13 ? 22.817 -5.102  60.969  1.00 91.17  ? 20  G   R OP2   1 
ATOM   1013 O  "O5'" . G   B 2 13 ? 23.615 -6.584  59.131  1.00 86.09  ? 20  G   R "O5'" 1 
ATOM   1014 C  "C5'" . G   B 2 13 ? 23.059 -5.635  58.229  1.00 81.97  ? 20  G   R "C5'" 1 
ATOM   1015 C  "C4'" . G   B 2 13 ? 21.923 -6.263  57.444  1.00 78.46  ? 20  G   R "C4'" 1 
ATOM   1016 O  "O4'" . G   B 2 13 ? 20.644 -5.787  57.941  1.00 78.77  ? 20  G   R "O4'" 1 
ATOM   1017 C  "C3'" . G   B 2 13 ? 21.905 -5.907  55.969  1.00 73.91  ? 20  G   R "C3'" 1 
ATOM   1018 O  "O3'" . G   B 2 13 ? 22.763 -6.765  55.231  1.00 71.09  ? 20  G   R "O3'" 1 
ATOM   1019 C  "C2'" . G   B 2 13 ? 20.435 -6.120  55.630  1.00 73.00  ? 20  G   R "C2'" 1 
ATOM   1020 O  "O2'" . G   B 2 13 ? 20.090 -7.484  55.514  1.00 72.85  ? 20  G   R "O2'" 1 
ATOM   1021 C  "C1'" . G   B 2 13 ? 19.772 -5.516  56.860  1.00 75.53  ? 20  G   R "C1'" 1 
ATOM   1022 N  N9    . G   B 2 13 ? 19.537 -4.071  56.759  1.00 75.00  ? 20  G   R N9    1 
ATOM   1023 C  C8    . G   B 2 13 ? 20.164 -3.066  57.461  1.00 76.50  ? 20  G   R C8    1 
ATOM   1024 N  N7    . G   B 2 13 ? 19.745 -1.868  57.159  1.00 75.76  ? 20  G   R N7    1 
ATOM   1025 C  C5    . G   B 2 13 ? 18.773 -2.084  56.191  1.00 73.81  ? 20  G   R C5    1 
ATOM   1026 C  C6    . G   B 2 13 ? 17.962 -1.157  55.482  1.00 72.62  ? 20  G   R C6    1 
ATOM   1027 O  O6    . G   B 2 13 ? 17.944 0.080   55.582  1.00 73.31  ? 20  G   R O6    1 
ATOM   1028 N  N1    . G   B 2 13 ? 17.104 -1.798  54.580  1.00 70.50  ? 20  G   R N1    1 
ATOM   1029 C  C2    . G   B 2 13 ? 17.038 -3.164  54.394  1.00 69.56  ? 20  G   R C2    1 
ATOM   1030 N  N2    . G   B 2 13 ? 16.155 -3.610  53.492  1.00 67.63  ? 20  G   R N2    1 
ATOM   1031 N  N3    . G   B 2 13 ? 17.790 -4.038  55.051  1.00 70.93  ? 20  G   R N3    1 
ATOM   1032 C  C4    . G   B 2 13 ? 18.634 -3.435  55.931  1.00 73.12  ? 20  G   R C4    1 
ATOM   1033 P  P     . G   B 2 14 ? 23.508 -6.201  53.928  1.00 67.62  ? 21  G   R P     1 
ATOM   1034 O  OP1   . G   B 2 14 ? 24.545 -7.180  53.537  1.00 67.82  ? 21  G   R OP1   1 
ATOM   1035 O  OP2   . G   B 2 14 ? 23.882 -4.786  54.179  1.00 67.88  ? 21  G   R OP2   1 
ATOM   1036 O  "O5'" . G   B 2 14 ? 22.363 -6.219  52.812  1.00 63.04  ? 21  G   R "O5'" 1 
ATOM   1037 C  "C5'" . G   B 2 14 ? 21.670 -7.429  52.537  1.00 59.08  ? 21  G   R "C5'" 1 
ATOM   1038 C  "C4'" . G   B 2 14 ? 20.453 -7.151  51.686  1.00 54.80  ? 21  G   R "C4'" 1 
ATOM   1039 O  "O4'" . G   B 2 14 ? 19.576 -6.222  52.363  1.00 54.36  ? 21  G   R "O4'" 1 
ATOM   1040 C  "C3'" . G   B 2 14 ? 20.779 -6.432  50.396  1.00 51.18  ? 21  G   R "C3'" 1 
ATOM   1041 O  "O3'" . G   B 2 14 ? 21.273 -7.350  49.448  1.00 49.32  ? 21  G   R "O3'" 1 
ATOM   1042 C  "C2'" . G   B 2 14 ? 19.434 -5.828  50.021  1.00 49.73  ? 21  G   R "C2'" 1 
ATOM   1043 O  "O2'" . G   B 2 14 ? 18.554 -6.744  49.403  1.00 48.49  ? 21  G   R "O2'" 1 
ATOM   1044 C  "C1'" . G   B 2 14 ? 18.914 -5.422  51.399  1.00 51.52  ? 21  G   R "C1'" 1 
ATOM   1045 N  N9    . G   B 2 14 ? 19.141 -4.015  51.731  1.00 50.85  ? 21  G   R N9    1 
ATOM   1046 C  C8    . G   B 2 14 ? 19.942 -3.520  52.734  1.00 52.10  ? 21  G   R C8    1 
ATOM   1047 N  N7    . G   B 2 14 ? 19.947 -2.216  52.805  1.00 52.16  ? 21  G   R N7    1 
ATOM   1048 C  C5    . G   B 2 14 ? 19.095 -1.814  51.780  1.00 50.37  ? 21  G   R C5    1 
ATOM   1049 C  C6    . G   B 2 14 ? 18.706 -0.510  51.364  1.00 49.58  ? 21  G   R C6    1 
ATOM   1050 O  O6    . G   B 2 14 ? 19.052 0.583   51.840  1.00 49.98  ? 21  G   R O6    1 
ATOM   1051 N  N1    . G   B 2 14 ? 17.825 -0.548  50.277  1.00 47.83  ? 21  G   R N1    1 
ATOM   1052 C  C2    . G   B 2 14 ? 17.373 -1.708  49.675  1.00 46.66  ? 21  G   R C2    1 
ATOM   1053 N  N2    . G   B 2 14 ? 16.526 -1.561  48.647  1.00 44.99  ? 21  G   R N2    1 
ATOM   1054 N  N3    . G   B 2 14 ? 17.728 -2.931  50.057  1.00 46.99  ? 21  G   R N3    1 
ATOM   1055 C  C4    . G   B 2 14 ? 18.589 -2.914  51.110  1.00 49.25  ? 21  G   R C4    1 
ATOM   1056 P  P     . C   B 2 15 ? 22.422 -6.843  48.464  1.00 47.49  ? 22  C   R P     1 
ATOM   1057 O  OP1   . C   B 2 15 ? 23.003 -8.014  47.776  1.00 47.43  ? 22  C   R OP1   1 
ATOM   1058 O  OP2   . C   B 2 15 ? 23.292 -5.911  49.216  1.00 48.74  ? 22  C   R OP2   1 
ATOM   1059 O  "O5'" . C   B 2 15 ? 21.604 -5.982  47.404  1.00 45.02  ? 22  C   R "O5'" 1 
ATOM   1060 C  "C5'" . C   B 2 15 ? 20.654 -6.598  46.543  1.00 43.70  ? 22  C   R "C5'" 1 
ATOM   1061 C  "C4'" . C   B 2 15 ? 19.867 -5.518  45.835  1.00 42.46  ? 22  C   R "C4'" 1 
ATOM   1062 O  "O4'" . C   B 2 15 ? 19.257 -4.654  46.829  1.00 42.99  ? 22  C   R "O4'" 1 
ATOM   1063 C  "C3'" . C   B 2 15 ? 20.698 -4.572  44.984  1.00 41.18  ? 22  C   R "C3'" 1 
ATOM   1064 O  "O3'" . C   B 2 15 ? 20.885 -5.129  43.696  1.00 40.77  ? 22  C   R "O3'" 1 
ATOM   1065 C  "C2'" . C   B 2 15 ? 19.779 -3.361  44.939  1.00 40.62  ? 22  C   R "C2'" 1 
ATOM   1066 O  "O2'" . C   B 2 15 ? 18.716 -3.525  44.023  1.00 41.45  ? 22  C   R "O2'" 1 
ATOM   1067 C  "C1'" . C   B 2 15 ? 19.183 -3.331  46.334  1.00 40.93  ? 22  C   R "C1'" 1 
ATOM   1068 N  N1    . C   B 2 15 ? 19.833 -2.370  47.266  1.00 40.33  ? 22  C   R N1    1 
ATOM   1069 C  C2    . C   B 2 15 ? 19.582 -1.006  47.100  1.00 40.41  ? 22  C   R C2    1 
ATOM   1070 O  O2    . C   B 2 15 ? 18.841 -0.635  46.179  1.00 39.62  ? 22  C   R O2    1 
ATOM   1071 N  N3    . C   B 2 15 ? 20.166 -0.127  47.960  1.00 41.45  ? 22  C   R N3    1 
ATOM   1072 C  C4    . C   B 2 15 ? 20.963 -0.564  48.940  1.00 42.01  ? 22  C   R C4    1 
ATOM   1073 N  N4    . C   B 2 15 ? 21.509 0.345   49.750  1.00 42.92  ? 22  C   R N4    1 
ATOM   1074 C  C5    . C   B 2 15 ? 21.227 -1.952  49.127  1.00 41.82  ? 22  C   R C5    1 
ATOM   1075 C  C6    . C   B 2 15 ? 20.642 -2.805  48.277  1.00 41.14  ? 22  C   R C6    1 
ATOM   1076 P  P     . A   B 2 16 ? 22.139 -4.757  42.764  1.00 41.44  ? 23  A   R P     1 
ATOM   1077 O  OP1   . A   B 2 16 ? 21.890 -5.406  41.456  1.00 40.69  ? 23  A   R OP1   1 
ATOM   1078 O  OP2   . A   B 2 16 ? 23.396 -5.011  43.505  1.00 41.77  ? 23  A   R OP2   1 
ATOM   1079 O  "O5'" . A   B 2 16 ? 22.041 -3.179  42.555  1.00 40.38  ? 23  A   R "O5'" 1 
ATOM   1080 C  "C5'" . A   B 2 16 ? 20.990 -2.593  41.801  1.00 39.66  ? 23  A   R "C5'" 1 
ATOM   1081 C  "C4'" . A   B 2 16 ? 21.113 -1.094  41.947  1.00 39.92  ? 23  A   R "C4'" 1 
ATOM   1082 O  "O4'" . A   B 2 16 ? 21.161 -0.736  43.353  1.00 40.54  ? 23  A   R "O4'" 1 
ATOM   1083 C  "C3'" . A   B 2 16 ? 22.405 -0.601  41.325  1.00 39.57  ? 23  A   R "C3'" 1 
ATOM   1084 O  "O3'" . A   B 2 16 ? 22.129 0.469   40.466  1.00 40.23  ? 23  A   R "O3'" 1 
ATOM   1085 C  "C2'" . A   B 2 16 ? 23.273 -0.174  42.500  1.00 39.98  ? 23  A   R "C2'" 1 
ATOM   1086 O  "O2'" . A   B 2 16 ? 24.016 0.985   42.206  1.00 40.48  ? 23  A   R "O2'" 1 
ATOM   1087 C  "C1'" . A   B 2 16 ? 22.260 0.110   43.601  1.00 40.14  ? 23  A   R "C1'" 1 
ATOM   1088 N  N9    . A   B 2 16 ? 22.841 -0.191  44.903  1.00 40.30  ? 23  A   R N9    1 
ATOM   1089 C  C8    . A   B 2 16 ? 23.207 -1.419  45.384  1.00 40.36  ? 23  A   R C8    1 
ATOM   1090 N  N7    . A   B 2 16 ? 23.727 -1.381  46.589  1.00 41.43  ? 23  A   R N7    1 
ATOM   1091 C  C5    . A   B 2 16 ? 23.708 -0.038  46.923  1.00 41.94  ? 23  A   R C5    1 
ATOM   1092 C  C6    . A   B 2 16 ? 24.125 0.676   48.070  1.00 43.39  ? 23  A   R C6    1 
ATOM   1093 N  N6    . A   B 2 16 ? 24.664 0.094   49.143  1.00 45.12  ? 23  A   R N6    1 
ATOM   1094 N  N1    . A   B 2 16 ? 23.965 2.017   48.084  1.00 43.49  ? 23  A   R N1    1 
ATOM   1095 C  C2    . A   B 2 16 ? 23.428 2.604   47.010  1.00 42.47  ? 23  A   R C2    1 
ATOM   1096 N  N3    . A   B 2 16 ? 23.002 2.044   45.874  1.00 41.23  ? 23  A   R N3    1 
ATOM   1097 C  C4    . A   B 2 16 ? 23.169 0.710   45.891  1.00 41.14  ? 23  A   R C4    1 
ATOM   1098 P  P     . A   B 2 17 ? 22.919 0.525   39.081  1.00 40.96  ? 24  A   R P     1 
ATOM   1099 O  OP1   . A   B 2 17 ? 22.376 -0.509  38.173  1.00 40.68  ? 24  A   R OP1   1 
ATOM   1100 O  OP2   . A   B 2 17 ? 24.369 0.530   39.386  1.00 41.20  ? 24  A   R OP2   1 
ATOM   1101 O  "O5'" . A   B 2 17 ? 22.496 1.964   38.527  1.00 40.36  ? 24  A   R "O5'" 1 
ATOM   1102 C  "C5'" . A   B 2 17 ? 21.130 2.322   38.449  1.00 40.24  ? 24  A   R "C5'" 1 
ATOM   1103 C  "C4'" . A   B 2 17 ? 20.960 3.829   38.435  1.00 41.15  ? 24  A   R "C4'" 1 
ATOM   1104 O  "O4'" . A   B 2 17 ? 21.124 4.341   39.779  1.00 42.07  ? 24  A   R "O4'" 1 
ATOM   1105 C  "C3'" . A   B 2 17 ? 21.962 4.638   37.620  1.00 40.91  ? 24  A   R "C3'" 1 
ATOM   1106 O  "O3'" . A   B 2 17 ? 21.627 4.616   36.236  1.00 40.22  ? 24  A   R "O3'" 1 
ATOM   1107 C  "C2'" . A   B 2 17 ? 21.750 6.015   38.238  1.00 42.31  ? 24  A   R "C2'" 1 
ATOM   1108 O  "O2'" . A   B 2 17 ? 20.584 6.659   37.756  1.00 43.74  ? 24  A   R "O2'" 1 
ATOM   1109 C  "C1'" . A   B 2 17 ? 21.584 5.679   39.720  1.00 42.37  ? 24  A   R "C1'" 1 
ATOM   1110 N  N9    . A   B 2 17 ? 22.817 5.796   40.499  1.00 42.60  ? 24  A   R N9    1 
ATOM   1111 C  C8    . A   B 2 17 ? 23.471 4.794   41.160  1.00 42.43  ? 24  A   R C8    1 
ATOM   1112 N  N7    . A   B 2 17 ? 24.561 5.180   41.776  1.00 43.10  ? 24  A   R N7    1 
ATOM   1113 C  C5    . A   B 2 17 ? 24.631 6.534   41.503  1.00 43.87  ? 24  A   R C5    1 
ATOM   1114 C  C6    . A   B 2 17 ? 25.559 7.536   41.867  1.00 45.36  ? 24  A   R C6    1 
ATOM   1115 N  N6    . A   B 2 17 ? 26.639 7.306   42.624  1.00 46.72  ? 24  A   R N6    1 
ATOM   1116 N  N1    . A   B 2 17 ? 25.341 8.797   41.426  1.00 46.17  ? 24  A   R N1    1 
ATOM   1117 C  C2    . A   B 2 17 ? 24.264 9.038   40.667  1.00 45.65  ? 24  A   R C2    1 
ATOM   1118 N  N3    . A   B 2 17 ? 23.327 8.178   40.258  1.00 44.64  ? 24  A   R N3    1 
ATOM   1119 C  C4    . A   B 2 17 ? 23.565 6.932   40.717  1.00 43.62  ? 24  A   R C4    1 
ATOM   1120 P  P     . A   B 2 18 ? 22.749 4.651   35.084  1.00 40.34  ? 25  A   R P     1 
ATOM   1121 O  OP1   . A   B 2 18 ? 22.048 4.871   33.795  1.00 40.03  ? 25  A   R OP1   1 
ATOM   1122 O  OP2   . A   B 2 18 ? 23.672 3.502   35.239  1.00 38.88  ? 25  A   R OP2   1 
ATOM   1123 O  "O5'" . A   B 2 18 ? 23.565 5.975   35.447  1.00 40.29  ? 25  A   R "O5'" 1 
ATOM   1124 C  "C5'" . A   B 2 18 ? 23.117 7.237   34.984  1.00 39.47  ? 25  A   R "C5'" 1 
ATOM   1125 C  "C4'" . A   B 2 18 ? 24.007 8.324   35.537  1.00 39.41  ? 25  A   R "C4'" 1 
ATOM   1126 O  "O4'" . A   B 2 18 ? 24.122 8.189   36.976  1.00 39.05  ? 25  A   R "O4'" 1 
ATOM   1127 C  "C3'" . A   B 2 18 ? 25.444 8.263   35.053  1.00 38.94  ? 25  A   R "C3'" 1 
ATOM   1128 O  "O3'" . A   B 2 18 ? 25.559 8.855   33.770  1.00 38.55  ? 25  A   R "O3'" 1 
ATOM   1129 C  "C2'" . A   B 2 18 ? 26.129 9.099   36.121  1.00 39.92  ? 25  A   R "C2'" 1 
ATOM   1130 O  "O2'" . A   B 2 18 ? 25.909 10.481  35.932  1.00 41.98  ? 25  A   R "O2'" 1 
ATOM   1131 C  "C1'" . A   B 2 18 ? 25.408 8.625   37.378  1.00 39.53  ? 25  A   R "C1'" 1 
ATOM   1132 N  N9    . A   B 2 18 ? 26.089 7.540   38.092  1.00 39.22  ? 25  A   R N9    1 
ATOM   1133 C  C8    . A   B 2 18 ? 25.674 6.241   38.212  1.00 38.14  ? 25  A   R C8    1 
ATOM   1134 N  N7    . A   B 2 18 ? 26.478 5.487   38.925  1.00 37.95  ? 25  A   R N7    1 
ATOM   1135 C  C5    . A   B 2 18 ? 27.499 6.345   39.300  1.00 39.22  ? 25  A   R C5    1 
ATOM   1136 C  C6    . A   B 2 18 ? 28.675 6.167   40.071  1.00 39.72  ? 25  A   R C6    1 
ATOM   1137 N  N6    . A   B 2 18 ? 29.036 5.003   40.623  1.00 38.94  ? 25  A   R N6    1 
ATOM   1138 N  N1    . A   B 2 18 ? 29.485 7.237   40.252  1.00 40.50  ? 25  A   R N1    1 
ATOM   1139 C  C2    . A   B 2 18 ? 29.137 8.409   39.709  1.00 40.74  ? 25  A   R C2    1 
ATOM   1140 N  N3    . A   B 2 18 ? 28.061 8.697   38.974  1.00 40.64  ? 25  A   R N3    1 
ATOM   1141 C  C4    . A   B 2 18 ? 27.273 7.618   38.799  1.00 39.75  ? 25  A   R C4    1 
ATOM   1142 P  P     . C   B 2 19 ? 26.459 8.160   32.648  1.00 37.83  ? 26  C   R P     1 
ATOM   1143 O  OP1   . C   B 2 19 ? 26.505 9.067   31.480  1.00 37.76  ? 26  C   R OP1   1 
ATOM   1144 O  OP2   . C   B 2 19 ? 26.041 6.753   32.467  1.00 36.28  ? 26  C   R OP2   1 
ATOM   1145 O  "O5'" . C   B 2 19 ? 27.883 8.133   33.368  1.00 38.65  ? 26  C   R "O5'" 1 
ATOM   1146 C  "C5'" . C   B 2 19 ? 28.593 9.349   33.587  1.00 40.31  ? 26  C   R "C5'" 1 
ATOM   1147 C  "C4'" . C   B 2 19 ? 29.815 9.071   34.431  1.00 40.40  ? 26  C   R "C4'" 1 
ATOM   1148 O  "O4'" . C   B 2 19 ? 29.402 8.614   35.743  1.00 40.55  ? 26  C   R "O4'" 1 
ATOM   1149 C  "C3'" . C   B 2 19 ? 30.686 7.945   33.905  1.00 39.61  ? 26  C   R "C3'" 1 
ATOM   1150 O  "O3'" . C   B 2 19 ? 31.544 8.429   32.880  1.00 39.68  ? 26  C   R "O3'" 1 
ATOM   1151 C  "C2'" . C   B 2 19 ? 31.429 7.563   35.177  1.00 40.34  ? 26  C   R "C2'" 1 
ATOM   1152 O  "O2'" . C   B 2 19 ? 32.448 8.484   35.514  1.00 42.37  ? 26  C   R "O2'" 1 
ATOM   1153 C  "C1'" . C   B 2 19 ? 30.307 7.628   36.209  1.00 40.34  ? 26  C   R "C1'" 1 
ATOM   1154 N  N1    . C   B 2 19 ? 29.601 6.317   36.414  1.00 39.83  ? 26  C   R N1    1 
ATOM   1155 C  C2    . C   B 2 19 ? 30.206 5.316   37.185  1.00 40.26  ? 26  C   R C2    1 
ATOM   1156 O  O2    . C   B 2 19 ? 31.309 5.536   37.691  1.00 41.68  ? 26  C   R O2    1 
ATOM   1157 N  N3    . C   B 2 19 ? 29.564 4.130   37.366  1.00 39.87  ? 26  C   R N3    1 
ATOM   1158 C  C4    . C   B 2 19 ? 28.369 3.928   36.801  1.00 39.27  ? 26  C   R C4    1 
ATOM   1159 N  N4    . C   B 2 19 ? 27.763 2.757   36.999  1.00 38.67  ? 26  C   R N4    1 
ATOM   1160 C  C5    . C   B 2 19 ? 27.737 4.926   36.003  1.00 39.36  ? 26  C   R C5    1 
ATOM   1161 C  C6    . C   B 2 19 ? 28.379 6.088   35.844  1.00 39.77  ? 26  C   R C6    1 
ATOM   1162 P  P     . C   B 2 20 ? 32.028 7.483   31.679  1.00 38.99  ? 27  C   R P     1 
ATOM   1163 O  OP1   . C   B 2 20 ? 32.674 8.371   30.694  1.00 38.86  ? 27  C   R OP1   1 
ATOM   1164 O  OP2   . C   B 2 20 ? 30.907 6.609   31.272  1.00 38.09  ? 27  C   R OP2   1 
ATOM   1165 O  "O5'" . C   B 2 20 ? 33.109 6.508   32.345  1.00 39.44  ? 27  C   R "O5'" 1 
ATOM   1166 C  "C5'" . C   B 2 20 ? 34.256 7.009   33.033  1.00 41.03  ? 27  C   R "C5'" 1 
ATOM   1167 C  "C4'" . C   B 2 20 ? 34.931 5.909   33.833  1.00 41.46  ? 27  C   R "C4'" 1 
ATOM   1168 O  "O4'" . C   B 2 20 ? 34.083 5.481   34.928  1.00 41.73  ? 27  C   R "O4'" 1 
ATOM   1169 C  "C3'" . C   B 2 20 ? 35.186 4.618   33.073  1.00 41.49  ? 27  C   R "C3'" 1 
ATOM   1170 O  "O3'" . C   B 2 20 ? 36.328 4.734   32.242  1.00 41.20  ? 27  C   R "O3'" 1 
ATOM   1171 C  "C2'" . C   B 2 20 ? 35.384 3.632   34.226  1.00 42.45  ? 27  C   R "C2'" 1 
ATOM   1172 O  "O2'" . C   B 2 20 ? 36.666 3.681   34.832  1.00 44.58  ? 27  C   R "O2'" 1 
ATOM   1173 C  "C1'" . C   B 2 20 ? 34.333 4.110   35.220  1.00 41.75  ? 27  C   R "C1'" 1 
ATOM   1174 N  N1    . C   B 2 20 ? 33.081 3.280   35.159  1.00 41.02  ? 27  C   R N1    1 
ATOM   1175 C  C2    . C   B 2 20 ? 33.059 1.995   35.741  1.00 41.85  ? 27  C   R C2    1 
ATOM   1176 O  O2    . C   B 2 20 ? 34.071 1.554   36.310  1.00 42.85  ? 27  C   R O2    1 
ATOM   1177 N  N3    . C   B 2 20 ? 31.912 1.255   35.672  1.00 40.93  ? 27  C   R N3    1 
ATOM   1178 C  C4    . C   B 2 20 ? 30.833 1.747   35.055  1.00 39.85  ? 27  C   R C4    1 
ATOM   1179 N  N4    . C   B 2 20 ? 29.734 0.991   35.011  1.00 38.99  ? 27  C   R N4    1 
ATOM   1180 C  C5    . C   B 2 20 ? 30.835 3.046   34.457  1.00 40.03  ? 27  C   R C5    1 
ATOM   1181 C  C6    . C   B 2 20 ? 31.964 3.765   34.532  1.00 40.47  ? 27  C   R C6    1 
ATOM   1182 P  P     . A   B 2 21 ? 36.440 3.871   30.904  1.00 41.58  ? 28  A   R P     1 
ATOM   1183 O  OP1   . A   B 2 21 ? 37.649 4.311   30.170  1.00 42.68  ? 28  A   R OP1   1 
ATOM   1184 O  OP2   . A   B 2 21 ? 35.130 3.926   30.227  1.00 41.39  ? 28  A   R OP2   1 
ATOM   1185 O  "O5'" . A   B 2 21 ? 36.670 2.377   31.431  1.00 42.08  ? 28  A   R "O5'" 1 
ATOM   1186 C  "C5'" . A   B 2 21 ? 37.952 1.966   31.917  1.00 43.42  ? 28  A   R "C5'" 1 
ATOM   1187 C  "C4'" . A   B 2 21 ? 37.932 0.515   32.354  1.00 44.02  ? 28  A   R "C4'" 1 
ATOM   1188 O  "O4'" . A   B 2 21 ? 36.972 0.371   33.428  1.00 43.70  ? 28  A   R "O4'" 1 
ATOM   1189 C  "C3'" . A   B 2 21 ? 37.442 -0.488  31.321  1.00 44.04  ? 28  A   R "C3'" 1 
ATOM   1190 O  "O3'" . A   B 2 21 ? 38.454 -0.861  30.413  1.00 45.31  ? 28  A   R "O3'" 1 
ATOM   1191 C  "C2'" . A   B 2 21 ? 37.043 -1.651  32.216  1.00 44.17  ? 28  A   R "C2'" 1 
ATOM   1192 O  "O2'" . A   B 2 21 ? 38.138 -2.417  32.666  1.00 45.40  ? 28  A   R "O2'" 1 
ATOM   1193 C  "C1'" . A   B 2 21 ? 36.390 -0.918  33.376  1.00 43.86  ? 28  A   R "C1'" 1 
ATOM   1194 N  N9    . A   B 2 21 ? 34.946 -0.811  33.185  1.00 43.81  ? 28  A   R N9    1 
ATOM   1195 C  C8    . A   B 2 21 ? 34.252 0.231   32.636  1.00 43.68  ? 28  A   R C8    1 
ATOM   1196 N  N7    . A   B 2 21 ? 32.956 0.039   32.592  1.00 43.65  ? 28  A   R N7    1 
ATOM   1197 C  C5    . A   B 2 21 ? 32.786 -1.217  33.150  1.00 43.71  ? 28  A   R C5    1 
ATOM   1198 C  C6    . A   B 2 21 ? 31.640 -2.010  33.395  1.00 43.83  ? 28  A   R C6    1 
ATOM   1199 N  N6    . A   B 2 21 ? 30.395 -1.621  33.085  1.00 42.73  ? 28  A   R N6    1 
ATOM   1200 N  N1    . A   B 2 21 ? 31.825 -3.230  33.964  1.00 44.47  ? 28  A   R N1    1 
ATOM   1201 C  C2    . A   B 2 21 ? 33.070 -3.625  34.269  1.00 44.99  ? 28  A   R C2    1 
ATOM   1202 N  N3    . A   B 2 21 ? 34.218 -2.966  34.085  1.00 45.17  ? 28  A   R N3    1 
ATOM   1203 C  C4    . A   B 2 21 ? 34.006 -1.760  33.517  1.00 44.24  ? 28  A   R C4    1 
ATOM   1204 P  P     . U   B 2 22 ? 38.082 -1.145  28.880  1.00 45.81  ? 29  U   R P     1 
ATOM   1205 O  OP1   . U   B 2 22 ? 39.354 -1.254  28.136  1.00 47.58  ? 29  U   R OP1   1 
ATOM   1206 O  OP2   . U   B 2 22 ? 37.046 -0.191  28.424  1.00 43.95  ? 29  U   R OP2   1 
ATOM   1207 O  "O5'" . U   B 2 22 ? 37.409 -2.590  28.946  1.00 46.00  ? 29  U   R "O5'" 1 
ATOM   1208 C  "C5'" . U   B 2 22 ? 38.133 -3.728  29.400  1.00 46.53  ? 29  U   R "C5'" 1 
ATOM   1209 C  "C4'" . U   B 2 22 ? 37.153 -4.820  29.782  1.00 46.13  ? 29  U   R "C4'" 1 
ATOM   1210 O  "O4'" . U   B 2 22 ? 36.250 -4.337  30.812  1.00 44.99  ? 29  U   R "O4'" 1 
ATOM   1211 C  "C3'" . U   B 2 22 ? 36.200 -5.225  28.674  1.00 45.71  ? 29  U   R "C3'" 1 
ATOM   1212 O  "O3'" . U   B 2 22 ? 36.839 -6.095  27.770  1.00 47.73  ? 29  U   R "O3'" 1 
ATOM   1213 C  "C2'" . U   B 2 22 ? 35.090 -5.892  29.480  1.00 44.67  ? 29  U   R "C2'" 1 
ATOM   1214 O  "O2'" . U   B 2 22 ? 35.432 -7.179  29.955  1.00 44.32  ? 29  U   R "O2'" 1 
ATOM   1215 C  "C1'" . U   B 2 22 ? 34.964 -4.904  30.637  1.00 43.73  ? 29  U   R "C1'" 1 
ATOM   1216 N  N1    . U   B 2 22 ? 33.934 -3.831  30.396  1.00 42.74  ? 29  U   R N1    1 
ATOM   1217 C  C2    . U   B 2 22 ? 32.611 -4.102  30.688  1.00 41.74  ? 29  U   R C2    1 
ATOM   1218 O  O2    . U   B 2 22 ? 32.234 -5.166  31.132  1.00 41.95  ? 29  U   R O2    1 
ATOM   1219 N  N3    . U   B 2 22 ? 31.727 -3.079  30.434  1.00 40.96  ? 29  U   R N3    1 
ATOM   1220 C  C4    . U   B 2 22 ? 32.022 -1.825  29.928  1.00 41.74  ? 29  U   R C4    1 
ATOM   1221 O  O4    . U   B 2 22 ? 31.123 -1.004  29.754  1.00 42.05  ? 29  U   R O4    1 
ATOM   1222 C  C5    . U   B 2 22 ? 33.421 -1.607  29.647  1.00 42.73  ? 29  U   R C5    1 
ATOM   1223 C  C6    . U   B 2 22 ? 34.300 -2.595  29.883  1.00 43.23  ? 29  U   R C6    1 
ATOM   1224 P  P     . U   B 2 23 ? 36.345 -6.166  26.251  1.00 48.61  ? 30  U   R P     1 
ATOM   1225 O  OP1   . U   B 2 23 ? 37.372 -6.911  25.488  1.00 49.94  ? 30  U   R OP1   1 
ATOM   1226 O  OP2   . U   B 2 23 ? 35.945 -4.809  25.816  1.00 47.61  ? 30  U   R OP2   1 
ATOM   1227 O  "O5'" . U   B 2 23 ? 35.013 -7.050  26.361  1.00 47.96  ? 30  U   R "O5'" 1 
ATOM   1228 C  "C5'" . U   B 2 23 ? 35.091 -8.446  26.642  1.00 48.89  ? 30  U   R "C5'" 1 
ATOM   1229 C  "C4'" . U   B 2 23 ? 33.714 -9.014  26.923  1.00 48.47  ? 30  U   R "C4'" 1 
ATOM   1230 O  "O4'" . U   B 2 23 ? 33.093 -8.242  27.979  1.00 47.13  ? 30  U   R "O4'" 1 
ATOM   1231 C  "C3'" . U   B 2 23 ? 32.726 -8.888  25.776  1.00 48.76  ? 30  U   R "C3'" 1 
ATOM   1232 O  "O3'" . U   B 2 23 ? 32.865 -9.936  24.839  1.00 50.55  ? 30  U   R "O3'" 1 
ATOM   1233 C  "C2'" . U   B 2 23 ? 31.380 -8.937  26.487  1.00 47.47  ? 30  U   R "C2'" 1 
ATOM   1234 O  "O2'" . U   B 2 23 ? 30.949 -10.248 26.787  1.00 48.37  ? 30  U   R "O2'" 1 
ATOM   1235 C  "C1'" . U   B 2 23 ? 31.692 -8.177  27.771  1.00 46.33  ? 30  U   R "C1'" 1 
ATOM   1236 N  N1    . U   B 2 23 ? 31.225 -6.755  27.729  1.00 45.31  ? 30  U   R N1    1 
ATOM   1237 C  C2    . U   B 2 23 ? 29.881 -6.489  27.929  1.00 45.22  ? 30  U   R C2    1 
ATOM   1238 O  O2    . U   B 2 23 ? 29.047 -7.349  28.145  1.00 46.13  ? 30  U   R O2    1 
ATOM   1239 N  N3    . U   B 2 23 ? 29.527 -5.164  27.873  1.00 44.90  ? 30  U   R N3    1 
ATOM   1240 C  C4    . U   B 2 23 ? 30.373 -4.092  27.637  1.00 45.04  ? 30  U   R C4    1 
ATOM   1241 O  O4    . U   B 2 23 ? 29.915 -2.954  27.620  1.00 45.04  ? 30  U   R O4    1 
ATOM   1242 C  C5    . U   B 2 23 ? 31.758 -4.444  27.431  1.00 45.34  ? 30  U   R C5    1 
ATOM   1243 C  C6    . U   B 2 23 ? 32.123 -5.733  27.485  1.00 45.46  ? 30  U   R C6    1 
ATOM   1244 P  P     . C   B 2 24 ? 32.559 -9.614  23.304  1.00 52.31  ? 31  C   R P     1 
ATOM   1245 O  OP1   . C   B 2 24 ? 33.103 -10.723 22.491  1.00 54.90  ? 31  C   R OP1   1 
ATOM   1246 O  OP2   . C   B 2 24 ? 32.998 -8.229  23.021  1.00 51.91  ? 31  C   R OP2   1 
ATOM   1247 O  "O5'" . C   B 2 24 ? 30.958 -9.629  23.248  1.00 51.67  ? 31  C   R "O5'" 1 
ATOM   1248 C  "C5'" . C   B 2 24 ? 30.222 -10.853 23.241  1.00 52.59  ? 31  C   R "C5'" 1 
ATOM   1249 C  "C4'" . C   B 2 24 ? 28.737 -10.593 23.425  1.00 51.91  ? 31  C   R "C4'" 1 
ATOM   1250 O  "O4'" . C   B 2 24 ? 28.533 -9.747  24.586  1.00 50.04  ? 31  C   R "O4'" 1 
ATOM   1251 C  "C3'" . C   B 2 24 ? 28.058 -9.786  22.328  1.00 52.70  ? 31  C   R "C3'" 1 
ATOM   1252 O  "O3'" . C   B 2 24 ? 27.788 -10.537 21.142  1.00 55.31  ? 31  C   R "O3'" 1 
ATOM   1253 C  "C2'" . C   B 2 24 ? 26.795 -9.321  23.049  1.00 50.98  ? 31  C   R "C2'" 1 
ATOM   1254 O  "O2'" . C   B 2 24 ? 25.806 -10.317 23.197  1.00 51.79  ? 31  C   R "O2'" 1 
ATOM   1255 C  "C1'" . C   B 2 24 ? 27.363 -8.962  24.414  1.00 49.23  ? 31  C   R "C1'" 1 
ATOM   1256 N  N1    . C   B 2 24 ? 27.667 -7.493  24.533  1.00 48.66  ? 31  C   R N1    1 
ATOM   1257 C  C2    . C   B 2 24 ? 26.629 -6.593  24.846  1.00 47.94  ? 31  C   R C2    1 
ATOM   1258 O  O2    . C   B 2 24 ? 25.477 -7.012  25.027  1.00 47.18  ? 31  C   R O2    1 
ATOM   1259 N  N3    . C   B 2 24 ? 26.920 -5.267  24.947  1.00 47.81  ? 31  C   R N3    1 
ATOM   1260 C  C4    . C   B 2 24 ? 28.166 -4.827  24.743  1.00 47.85  ? 31  C   R C4    1 
ATOM   1261 N  N4    . C   B 2 24 ? 28.393 -3.515  24.856  1.00 47.14  ? 31  C   R N4    1 
ATOM   1262 C  C5    . C   B 2 24 ? 29.233 -5.718  24.420  1.00 48.71  ? 31  C   R C5    1 
ATOM   1263 C  C6    . C   B 2 24 ? 28.940 -7.024  24.328  1.00 49.15  ? 31  C   R C6    1 
ATOM   1264 P  P     . G   B 2 25 ? 28.030 -9.842  19.713  1.00 57.44  ? 32  G   R P     1 
ATOM   1265 O  OP1   . G   B 2 25 ? 27.913 -10.892 18.681  1.00 59.89  ? 32  G   R OP1   1 
ATOM   1266 O  OP2   . G   B 2 25 ? 29.267 -9.028  19.772  1.00 56.79  ? 32  G   R OP2   1 
ATOM   1267 O  "O5'" . G   B 2 25 ? 26.800 -8.826  19.584  1.00 56.88  ? 32  G   R "O5'" 1 
ATOM   1268 C  "C5'" . G   B 2 25 ? 25.453 -9.300  19.623  1.00 58.00  ? 32  G   R "C5'" 1 
ATOM   1269 C  "C4'" . G   B 2 25 ? 24.445 -8.165  19.727  1.00 57.53  ? 32  G   R "C4'" 1 
ATOM   1270 O  "O4'" . G   B 2 25 ? 24.475 -7.521  21.032  1.00 55.12  ? 32  G   R "O4'" 1 
ATOM   1271 C  "C3'" . G   B 2 25 ? 24.674 -6.990  18.791  1.00 58.64  ? 32  G   R "C3'" 1 
ATOM   1272 O  "O3'" . G   B 2 25 ? 24.401 -7.309  17.433  1.00 61.62  ? 32  G   R "O3'" 1 
ATOM   1273 C  "C2'" . G   B 2 25 ? 23.712 -5.993  19.421  1.00 56.98  ? 32  G   R "C2'" 1 
ATOM   1274 O  "O2'" . G   B 2 25 ? 22.362 -6.363  19.232  1.00 57.92  ? 32  G   R "O2'" 1 
ATOM   1275 C  "C1'" . G   B 2 25 ? 24.133 -6.149  20.883  1.00 54.71  ? 32  G   R "C1'" 1 
ATOM   1276 N  N9    . G   B 2 25 ? 25.285 -5.293  21.185  1.00 54.05  ? 32  G   R N9    1 
ATOM   1277 C  C8    . G   B 2 25 ? 26.610 -5.656  21.158  1.00 54.43  ? 32  G   R C8    1 
ATOM   1278 N  N7    . G   B 2 25 ? 27.433 -4.691  21.447  1.00 53.95  ? 32  G   R N7    1 
ATOM   1279 C  C5    . G   B 2 25 ? 26.607 -3.606  21.677  1.00 53.53  ? 32  G   R C5    1 
ATOM   1280 C  C6    . G   B 2 25 ? 26.940 -2.276  22.029  1.00 53.45  ? 32  G   R C6    1 
ATOM   1281 O  O6    . G   B 2 25 ? 28.072 -1.804  22.207  1.00 54.46  ? 32  G   R O6    1 
ATOM   1282 N  N1    . G   B 2 25 ? 25.817 -1.461  22.175  1.00 52.64  ? 32  G   R N1    1 
ATOM   1283 C  C2    . G   B 2 25 ? 24.525 -1.890  21.997  1.00 52.78  ? 32  G   R C2    1 
ATOM   1284 N  N2    . G   B 2 25 ? 23.570 -0.968  22.178  1.00 52.50  ? 32  G   R N2    1 
ATOM   1285 N  N3    . G   B 2 25 ? 24.200 -3.139  21.662  1.00 53.66  ? 32  G   R N3    1 
ATOM   1286 C  C4    . G   B 2 25 ? 25.283 -3.950  21.518  1.00 53.56  ? 32  G   R C4    1 
ATOM   1287 P  P     . A   B 2 26 ? 25.529 -6.965  16.343  1.00 64.22  ? 33  A   R P     1 
ATOM   1288 O  OP1   . A   B 2 26 ? 25.401 -7.929  15.228  1.00 66.55  ? 33  A   R OP1   1 
ATOM   1289 O  OP2   . A   B 2 26 ? 26.834 -6.783  17.027  1.00 62.74  ? 33  A   R OP2   1 
ATOM   1290 O  "O5'" . A   B 2 26 ? 25.046 -5.533  15.833  1.00 64.08  ? 33  A   R "O5'" 1 
ATOM   1291 C  "C5'" . A   B 2 26 ? 25.927 -4.661  15.138  1.00 64.12  ? 33  A   R "C5'" 1 
ATOM   1292 C  "C4'" . A   B 2 26 ? 25.200 -3.366  14.827  1.00 63.47  ? 33  A   R "C4'" 1 
ATOM   1293 O  "O4'" . A   B 2 26 ? 24.005 -3.659  14.062  1.00 64.66  ? 33  A   R "O4'" 1 
ATOM   1294 C  "C3'" . A   B 2 26 ? 24.715 -2.598  16.045  1.00 60.62  ? 33  A   R "C3'" 1 
ATOM   1295 O  "O3'" . A   B 2 26 ? 25.739 -1.707  16.444  1.00 60.15  ? 33  A   R "O3'" 1 
ATOM   1296 C  "C2'" . A   B 2 26 ? 23.501 -1.854  15.501  1.00 61.29  ? 33  A   R "C2'" 1 
ATOM   1297 O  "O2'" . A   B 2 26 ? 23.843 -0.636  14.862  1.00 62.36  ? 33  A   R "O2'" 1 
ATOM   1298 C  "C1'" . A   B 2 26 ? 22.938 -2.832  14.475  1.00 63.16  ? 33  A   R "C1'" 1 
ATOM   1299 N  N9    . A   B 2 26 ? 21.859 -3.690  14.961  1.00 62.12  ? 33  A   R N9    1 
ATOM   1300 C  C8    . A   B 2 26 ? 21.905 -5.044  15.145  1.00 62.03  ? 33  A   R C8    1 
ATOM   1301 N  N7    . A   B 2 26 ? 20.787 -5.563  15.586  1.00 61.46  ? 33  A   R N7    1 
ATOM   1302 C  C5    . A   B 2 26 ? 19.944 -4.475  15.694  1.00 61.38  ? 33  A   R C5    1 
ATOM   1303 C  C6    . A   B 2 26 ? 18.603 -4.354  16.111  1.00 61.57  ? 33  A   R C6    1 
ATOM   1304 N  N6    . A   B 2 26 ? 17.867 -5.395  16.505  1.00 61.81  ? 33  A   R N6    1 
ATOM   1305 N  N1    . A   B 2 26 ? 18.043 -3.123  16.105  1.00 61.74  ? 33  A   R N1    1 
ATOM   1306 C  C2    . A   B 2 26 ? 18.788 -2.082  15.710  1.00 61.82  ? 33  A   R C2    1 
ATOM   1307 N  N3    . A   B 2 26 ? 20.058 -2.074  15.299  1.00 61.89  ? 33  A   R N3    1 
ATOM   1308 C  C4    . A   B 2 26 ? 20.584 -3.312  15.314  1.00 61.63  ? 33  A   R C4    1 
ATOM   1309 P  P     . A   B 2 27 ? 25.987 -1.357  17.980  1.00 57.49  ? 34  A   R P     1 
ATOM   1310 O  OP1   . A   B 2 27 ? 27.195 -0.502  18.059  1.00 57.43  ? 34  A   R OP1   1 
ATOM   1311 O  OP2   . A   B 2 27 ? 25.917 -2.622  18.739  1.00 56.79  ? 34  A   R OP2   1 
ATOM   1312 O  "O5'" . A   B 2 27 ? 24.713 -0.480  18.364  1.00 56.60  ? 34  A   R "O5'" 1 
ATOM   1313 C  "C5'" . A   B 2 27 ? 24.600 0.865   17.915  1.00 57.44  ? 34  A   R "C5'" 1 
ATOM   1314 C  "C4'" . A   B 2 27 ? 23.184 1.366   18.141  1.00 57.69  ? 34  A   R "C4'" 1 
ATOM   1315 O  "O4'" . A   B 2 27 ? 22.247 0.438   17.532  1.00 58.93  ? 34  A   R "O4'" 1 
ATOM   1316 C  "C3'" . A   B 2 27 ? 22.744 1.460   19.598  1.00 55.31  ? 34  A   R "C3'" 1 
ATOM   1317 O  "O3'" . A   B 2 27 ? 23.117 2.724   20.154  1.00 54.40  ? 34  A   R "O3'" 1 
ATOM   1318 C  "C2'" . A   B 2 27 ? 21.229 1.270   19.490  1.00 55.66  ? 34  A   R "C2'" 1 
ATOM   1319 O  "O2'" . A   B 2 27 ? 20.545 2.444   19.102  1.00 56.74  ? 34  A   R "O2'" 1 
ATOM   1320 C  "C1'" . A   B 2 27 ? 21.103 0.269   18.354  1.00 57.19  ? 34  A   R "C1'" 1 
ATOM   1321 N  N9    . A   B 2 27 ? 20.971 -1.137  18.746  1.00 55.85  ? 34  A   R N9    1 
ATOM   1322 C  C8    . A   B 2 27 ? 21.977 -2.048  18.912  1.00 55.32  ? 34  A   R C8    1 
ATOM   1323 N  N7    . A   B 2 27 ? 21.565 -3.246  19.251  1.00 55.02  ? 34  A   R N7    1 
ATOM   1324 C  C5    . A   B 2 27 ? 20.188 -3.117  19.308  1.00 55.45  ? 34  A   R C5    1 
ATOM   1325 C  C6    . A   B 2 27 ? 19.151 -4.032  19.614  1.00 55.51  ? 34  A   R C6    1 
ATOM   1326 N  N6    . A   B 2 27 ? 19.373 -5.310  19.933  1.00 55.14  ? 34  A   R N6    1 
ATOM   1327 N  N1    . A   B 2 27 ? 17.874 -3.584  19.586  1.00 55.77  ? 34  A   R N1    1 
ATOM   1328 C  C2    . A   B 2 27 ? 17.656 -2.300  19.269  1.00 56.18  ? 34  A   R C2    1 
ATOM   1329 N  N3    . A   B 2 27 ? 18.546 -1.352  18.962  1.00 56.18  ? 34  A   R N3    1 
ATOM   1330 C  C4    . A   B 2 27 ? 19.805 -1.822  18.999  1.00 55.70  ? 34  A   R C4    1 
ATOM   1331 P  P     . A   B 2 28 ? 23.162 2.956   21.742  1.00 52.68  ? 35  A   R P     1 
ATOM   1332 O  OP1   . A   B 2 28 ? 23.585 4.360   21.943  1.00 53.03  ? 35  A   R OP1   1 
ATOM   1333 O  OP2   . A   B 2 28 ? 23.918 1.846   22.365  1.00 51.75  ? 35  A   R OP2   1 
ATOM   1334 O  "O5'" . A   B 2 28 ? 21.650 2.785   22.230  1.00 51.87  ? 35  A   R "O5'" 1 
ATOM   1335 C  "C5'" . A   B 2 28 ? 20.775 3.897   22.373  1.00 52.12  ? 35  A   R "C5'" 1 
ATOM   1336 C  "C4'" . A   B 2 28 ? 19.382 3.402   22.704  1.00 52.05  ? 35  A   R "C4'" 1 
ATOM   1337 O  "O4'" . A   B 2 28 ? 19.053 2.280   21.850  1.00 52.88  ? 35  A   R "O4'" 1 
ATOM   1338 C  "C3'" . A   B 2 28 ? 19.227 2.825   24.098  1.00 50.45  ? 35  A   R "C3'" 1 
ATOM   1339 O  "O3'" . A   B 2 28 ? 19.032 3.846   25.049  1.00 50.70  ? 35  A   R "O3'" 1 
ATOM   1340 C  "C2'" . A   B 2 28 ? 17.997 1.939   23.939  1.00 50.62  ? 35  A   R "C2'" 1 
ATOM   1341 O  "O2'" . A   B 2 28 ? 16.771 2.645   23.907  1.00 51.42  ? 35  A   R "O2'" 1 
ATOM   1342 C  "C1'" . A   B 2 28 ? 18.294 1.329   22.577  1.00 52.01  ? 35  A   R "C1'" 1 
ATOM   1343 N  N9    . A   B 2 28 ? 19.037 0.075   22.675  1.00 51.25  ? 35  A   R N9    1 
ATOM   1344 C  C8    . A   B 2 28 ? 20.397 -0.082  22.746  1.00 50.96  ? 35  A   R C8    1 
ATOM   1345 N  N7    . A   B 2 28 ? 20.783 -1.335  22.828  1.00 50.83  ? 35  A   R N7    1 
ATOM   1346 C  C5    . A   B 2 28 ? 19.596 -2.050  22.813  1.00 50.62  ? 35  A   R C5    1 
ATOM   1347 C  C6    . A   B 2 28 ? 19.322 -3.432  22.878  1.00 50.46  ? 35  A   R C6    1 
ATOM   1348 N  N6    . A   B 2 28 ? 20.280 -4.364  22.967  1.00 49.74  ? 35  A   R N6    1 
ATOM   1349 N  N1    . A   B 2 28 ? 18.023 -3.811  22.837  1.00 51.04  ? 35  A   R N1    1 
ATOM   1350 C  C2    . A   B 2 28 ? 17.070 -2.871  22.741  1.00 51.13  ? 35  A   R C2    1 
ATOM   1351 N  N3    . A   B 2 28 ? 17.205 -1.548  22.678  1.00 50.99  ? 35  A   R N3    1 
ATOM   1352 C  C4    . A   B 2 28 ? 18.505 -1.197  22.719  1.00 51.02  ? 35  A   R C4    1 
ATOM   1353 P  P     . G   B 2 29 ? 20.005 3.952   26.315  1.00 49.46  ? 36  G   R P     1 
ATOM   1354 O  OP1   . G   B 2 29 ? 19.285 4.777   27.315  1.00 49.01  ? 36  G   R OP1   1 
ATOM   1355 O  OP2   . G   B 2 29 ? 21.347 4.349   25.812  1.00 48.76  ? 36  G   R OP2   1 
ATOM   1356 O  "O5'" . G   B 2 29 ? 20.117 2.460   26.878  1.00 48.22  ? 36  G   R "O5'" 1 
ATOM   1357 C  "C5'" . G   B 2 29 ? 19.022 1.845   27.564  1.00 47.88  ? 36  G   R "C5'" 1 
ATOM   1358 C  "C4'" . G   B 2 29 ? 19.011 0.346   27.306  1.00 47.63  ? 36  G   R "C4'" 1 
ATOM   1359 O  "O4'" . G   B 2 29 ? 19.704 0.028   26.068  1.00 48.29  ? 36  G   R "O4'" 1 
ATOM   1360 C  "C3'" . G   B 2 29 ? 19.737 -0.514  28.328  1.00 46.06  ? 36  G   R "C3'" 1 
ATOM   1361 O  "O3'" . G   B 2 29 ? 18.968 -0.690  29.527  1.00 44.72  ? 36  G   R "O3'" 1 
ATOM   1362 C  "C2'" . G   B 2 29 ? 19.903 -1.804  27.527  1.00 46.74  ? 36  G   R "C2'" 1 
ATOM   1363 O  "O2'" . G   B 2 29 ? 18.700 -2.548  27.420  1.00 47.32  ? 36  G   R "O2'" 1 
ATOM   1364 C  "C1'" . G   B 2 29 ? 20.306 -1.249  26.164  1.00 47.43  ? 36  G   R "C1'" 1 
ATOM   1365 N  N9    . G   B 2 29 ? 21.750 -1.095  25.962  1.00 47.41  ? 36  G   R N9    1 
ATOM   1366 C  C8    . G   B 2 29 ? 22.466 0.083   25.941  1.00 47.79  ? 36  G   R C8    1 
ATOM   1367 N  N7    . G   B 2 29 ? 23.746 -0.075  25.732  1.00 47.47  ? 36  G   R N7    1 
ATOM   1368 C  C5    . G   B 2 29 ? 23.894 -1.448  25.606  1.00 47.08  ? 36  G   R C5    1 
ATOM   1369 C  C6    . G   B 2 29 ? 25.057 -2.218  25.377  1.00 47.24  ? 36  G   R C6    1 
ATOM   1370 O  O6    . G   B 2 29 ? 26.218 -1.823  25.238  1.00 47.55  ? 36  G   R O6    1 
ATOM   1371 N  N1    . G   B 2 29 ? 24.780 -3.581  25.316  1.00 47.57  ? 36  G   R N1    1 
ATOM   1372 C  C2    . G   B 2 29 ? 23.526 -4.130  25.460  1.00 47.47  ? 36  G   R C2    1 
ATOM   1373 N  N2    . G   B 2 29 ? 23.440 -5.462  25.373  1.00 47.77  ? 36  G   R N2    1 
ATOM   1374 N  N3    . G   B 2 29 ? 22.427 -3.420  25.680  1.00 47.34  ? 36  G   R N3    1 
ATOM   1375 C  C4    . G   B 2 29 ? 22.680 -2.089  25.742  1.00 47.16  ? 36  G   R C4    1 
ATOM   1376 P  P     . A   B 2 30 ? 19.742 -0.897  30.916  1.00 42.94  ? 37  A   R P     1 
ATOM   1377 O  OP1   . A   B 2 30 ? 18.802 -0.724  32.050  1.00 41.93  ? 37  A   R OP1   1 
ATOM   1378 O  OP2   . A   B 2 30 ? 20.974 -0.071  30.848  1.00 43.19  ? 37  A   R OP2   1 
ATOM   1379 O  "O5'" . A   B 2 30 ? 20.186 -2.432  30.813  1.00 42.12  ? 37  A   R "O5'" 1 
ATOM   1380 C  "C5'" . A   B 2 30 ? 19.251 -3.481  31.024  1.00 41.65  ? 37  A   R "C5'" 1 
ATOM   1381 C  "C4'" . A   B 2 30 ? 19.814 -4.808  30.545  1.00 41.67  ? 37  A   R "C4'" 1 
ATOM   1382 O  "O4'" . A   B 2 30 ? 20.436 -4.652  29.244  1.00 42.22  ? 37  A   R "O4'" 1 
ATOM   1383 C  "C3'" . A   B 2 30 ? 20.929 -5.396  31.392  1.00 41.00  ? 37  A   R "C3'" 1 
ATOM   1384 O  "O3'" . A   B 2 30 ? 20.407 -6.092  32.504  1.00 40.68  ? 37  A   R "O3'" 1 
ATOM   1385 C  "C2'" . A   B 2 30 ? 21.583 -6.336  30.391  1.00 41.63  ? 37  A   R "C2'" 1 
ATOM   1386 O  "O2'" . A   B 2 30 ? 20.793 -7.476  30.125  1.00 42.98  ? 37  A   R "O2'" 1 
ATOM   1387 C  "C1'" . A   B 2 30 ? 21.607 -5.450  29.158  1.00 41.83  ? 37  A   R "C1'" 1 
ATOM   1388 N  N9    . A   B 2 30 ? 22.789 -4.587  29.060  1.00 41.25  ? 37  A   R N9    1 
ATOM   1389 C  C8    . A   B 2 30 ? 22.815 -3.226  29.199  1.00 40.96  ? 37  A   R C8    1 
ATOM   1390 N  N7    . A   B 2 30 ? 24.005 -2.694  29.061  1.00 41.14  ? 37  A   R N7    1 
ATOM   1391 C  C5    . A   B 2 30 ? 24.822 -3.779  28.812  1.00 41.22  ? 37  A   R C5    1 
ATOM   1392 C  C6    . A   B 2 30 ? 26.207 -3.878  28.574  1.00 42.10  ? 37  A   R C6    1 
ATOM   1393 N  N6    . A   B 2 30 ? 27.016 -2.813  28.556  1.00 41.91  ? 37  A   R N6    1 
ATOM   1394 N  N1    . A   B 2 30 ? 26.725 -5.109  28.355  1.00 42.61  ? 37  A   R N1    1 
ATOM   1395 C  C2    . A   B 2 30 ? 25.897 -6.160  28.378  1.00 42.46  ? 37  A   R C2    1 
ATOM   1396 N  N3    . A   B 2 30 ? 24.580 -6.187  28.594  1.00 41.68  ? 37  A   R N3    1 
ATOM   1397 C  C4    . A   B 2 30 ? 24.093 -4.954  28.805  1.00 41.17  ? 37  A   R C4    1 
ATOM   1398 P  P     . G   B 2 31 ? 21.248 -6.110  33.859  1.00 40.26  ? 38  G   R P     1 
ATOM   1399 O  OP1   . G   B 2 31 ? 20.391 -6.682  34.924  1.00 40.10  ? 38  G   R OP1   1 
ATOM   1400 O  OP2   . G   B 2 31 ? 21.845 -4.772  34.041  1.00 40.26  ? 38  G   R OP2   1 
ATOM   1401 O  "O5'" . G   B 2 31 ? 22.448 -7.106  33.521  1.00 40.90  ? 38  G   R "O5'" 1 
ATOM   1402 C  "C5'" . G   B 2 31 ? 22.223 -8.504  33.456  1.00 41.16  ? 38  G   R "C5'" 1 
ATOM   1403 C  "C4'" . G   B 2 31 ? 23.522 -9.203  33.126  1.00 41.81  ? 38  G   R "C4'" 1 
ATOM   1404 O  "O4'" . G   B 2 31 ? 24.067 -8.652  31.909  1.00 41.79  ? 38  G   R "O4'" 1 
ATOM   1405 C  "C3'" . G   B 2 31 ? 24.639 -8.974  34.126  1.00 41.91  ? 38  G   R "C3'" 1 
ATOM   1406 O  "O3'" . G   B 2 31 ? 24.459 -9.817  35.236  1.00 42.70  ? 38  G   R "O3'" 1 
ATOM   1407 C  "C2'" . G   B 2 31 ? 25.851 -9.369  33.298  1.00 42.74  ? 38  G   R "C2'" 1 
ATOM   1408 O  "O2'" . G   B 2 31 ? 26.031 -10.764 33.162  1.00 44.24  ? 38  G   R "O2'" 1 
ATOM   1409 C  "C1'" . G   B 2 31 ? 25.475 -8.764  31.951  1.00 42.81  ? 38  G   R "C1'" 1 
ATOM   1410 N  N9    . G   B 2 31 ? 26.080 -7.450  31.770  1.00 42.88  ? 38  G   R N9    1 
ATOM   1411 C  C8    . G   B 2 31 ? 25.461 -6.225  31.813  1.00 42.33  ? 38  G   R C8    1 
ATOM   1412 N  N7    . G   B 2 31 ? 26.279 -5.229  31.613  1.00 42.35  ? 38  G   R N7    1 
ATOM   1413 C  C5    . G   B 2 31 ? 27.513 -5.834  31.439  1.00 43.01  ? 38  G   R C5    1 
ATOM   1414 C  C6    . G   B 2 31 ? 28.779 -5.263  31.192  1.00 43.65  ? 38  G   R C6    1 
ATOM   1415 O  O6    . G   B 2 31 ? 29.059 -4.067  31.080  1.00 44.93  ? 38  G   R O6    1 
ATOM   1416 N  N1    . G   B 2 31 ? 29.780 -6.222  31.078  1.00 44.30  ? 38  G   R N1    1 
ATOM   1417 C  C2    . G   B 2 31 ? 29.580 -7.575  31.187  1.00 44.83  ? 38  G   R C2    1 
ATOM   1418 N  N2    . G   B 2 31 ? 30.662 -8.346  31.045  1.00 46.36  ? 38  G   R N2    1 
ATOM   1419 N  N3    . G   B 2 31 ? 28.398 -8.132  31.415  1.00 44.50  ? 38  G   R N3    1 
ATOM   1420 C  C4    . G   B 2 31 ? 27.412 -7.201  31.531  1.00 43.60  ? 38  G   R C4    1 
ATOM   1421 P  P     . U   B 2 32 ? 24.775 -9.303  36.712  1.00 42.29  ? 39  U   R P     1 
ATOM   1422 O  OP1   . U   B 2 32 ? 24.218 -10.308 37.652  1.00 42.79  ? 39  U   R OP1   1 
ATOM   1423 O  OP2   . U   B 2 32 ? 24.379 -7.884  36.811  1.00 41.58  ? 39  U   R OP2   1 
ATOM   1424 O  "O5'" . U   B 2 32 ? 26.362 -9.334  36.764  1.00 43.08  ? 39  U   R "O5'" 1 
ATOM   1425 C  "C5'" . U   B 2 32 ? 27.040 -10.574 36.671  1.00 45.77  ? 39  U   R "C5'" 1 
ATOM   1426 C  "C4'" . U   B 2 32 ? 28.507 -10.299 36.460  1.00 47.00  ? 39  U   R "C4'" 1 
ATOM   1427 O  "O4'" . U   B 2 32 ? 28.688 -9.572  35.222  1.00 46.72  ? 39  U   R "O4'" 1 
ATOM   1428 C  "C3'" . U   B 2 32 ? 29.085 -9.348  37.488  1.00 47.49  ? 39  U   R "C3'" 1 
ATOM   1429 O  "O3'" . U   B 2 32 ? 29.305 -9.998  38.733  1.00 47.84  ? 39  U   R "O3'" 1 
ATOM   1430 C  "C2'" . U   B 2 32 ? 30.349 -8.881  36.774  1.00 48.12  ? 39  U   R "C2'" 1 
ATOM   1431 O  "O2'" . U   B 2 32 ? 31.372 -9.860  36.784  1.00 50.40  ? 39  U   R "O2'" 1 
ATOM   1432 C  "C1'" . U   B 2 32 ? 29.801 -8.704  35.358  1.00 47.46  ? 39  U   R "C1'" 1 
ATOM   1433 N  N1    . U   B 2 32 ? 29.402 -7.295  35.038  1.00 47.30  ? 39  U   R N1    1 
ATOM   1434 C  C2    . U   B 2 32 ? 30.361 -6.434  34.524  1.00 48.00  ? 39  U   R C2    1 
ATOM   1435 O  O2    . U   B 2 32 ? 31.518 -6.770  34.322  1.00 48.99  ? 39  U   R O2    1 
ATOM   1436 N  N3    . U   B 2 32 ? 29.916 -5.155  34.254  1.00 46.90  ? 39  U   R N3    1 
ATOM   1437 C  C4    . U   B 2 32 ? 28.635 -4.664  34.446  1.00 46.13  ? 39  U   R C4    1 
ATOM   1438 O  O4    . U   B 2 32 ? 28.382 -3.500  34.158  1.00 46.54  ? 39  U   R O4    1 
ATOM   1439 C  C5    . U   B 2 32 ? 27.688 -5.612  34.980  1.00 46.17  ? 39  U   R C5    1 
ATOM   1440 C  C6    . U   B 2 32 ? 28.097 -6.863  35.248  1.00 46.97  ? 39  U   R C6    1 
ATOM   1441 P  P     . G   B 2 33 ? 29.089 -9.152  40.076  1.00 47.81  ? 40  G   R P     1 
ATOM   1442 O  OP1   . G   B 2 33 ? 29.140 -10.121 41.195  1.00 49.23  ? 40  G   R OP1   1 
ATOM   1443 O  OP2   . G   B 2 33 ? 27.906 -8.271  39.926  1.00 46.20  ? 40  G   R OP2   1 
ATOM   1444 O  "O5'" . G   B 2 33 ? 30.374 -8.190  40.111  1.00 47.13  ? 40  G   R "O5'" 1 
ATOM   1445 C  "C5'" . G   B 2 33 ? 31.665 -8.720  40.381  1.00 47.37  ? 40  G   R "C5'" 1 
ATOM   1446 C  "C4'" . G   B 2 33 ? 32.762 -7.703  40.142  1.00 47.00  ? 40  G   R "C4'" 1 
ATOM   1447 O  "O4'" . G   B 2 33 ? 32.770 -7.300  38.751  1.00 46.23  ? 40  G   R "O4'" 1 
ATOM   1448 C  "C3'" . G   B 2 33 ? 32.642 -6.385  40.896  1.00 46.53  ? 40  G   R "C3'" 1 
ATOM   1449 O  "O3'" . G   B 2 33 ? 33.068 -6.518  42.238  1.00 48.43  ? 40  G   R "O3'" 1 
ATOM   1450 C  "C2'" . G   B 2 33 ? 33.579 -5.502  40.080  1.00 46.05  ? 40  G   R "C2'" 1 
ATOM   1451 O  "O2'" . G   B 2 33 ? 34.957 -5.700  40.337  1.00 46.18  ? 40  G   R "O2'" 1 
ATOM   1452 C  "C1'" . G   B 2 33 ? 33.211 -5.952  38.669  1.00 45.83  ? 40  G   R "C1'" 1 
ATOM   1453 N  N9    . G   B 2 33 ? 32.154 -5.110  38.110  1.00 44.45  ? 40  G   R N9    1 
ATOM   1454 C  C8    . G   B 2 33 ? 30.838 -5.448  37.903  1.00 43.93  ? 40  G   R C8    1 
ATOM   1455 N  N7    . G   B 2 33 ? 30.128 -4.480  37.392  1.00 43.43  ? 40  G   R N7    1 
ATOM   1456 C  C5    . G   B 2 33 ? 31.030 -3.431  37.253  1.00 43.32  ? 40  G   R C5    1 
ATOM   1457 C  C6    . G   B 2 33 ? 30.837 -2.120  36.754  1.00 42.66  ? 40  G   R C6    1 
ATOM   1458 O  O6    . G   B 2 33 ? 29.793 -1.611  36.320  1.00 42.56  ? 40  G   R O6    1 
ATOM   1459 N  N1    . G   B 2 33 ? 32.013 -1.373  36.784  1.00 43.12  ? 40  G   R N1    1 
ATOM   1460 C  C2    . G   B 2 33 ? 33.225 -1.834  37.246  1.00 43.89  ? 40  G   R C2    1 
ATOM   1461 N  N2    . G   B 2 33 ? 34.252 -0.973  37.203  1.00 44.23  ? 40  G   R N2    1 
ATOM   1462 N  N3    . G   B 2 33 ? 33.418 -3.058  37.719  1.00 44.24  ? 40  G   R N3    1 
ATOM   1463 C  C4    . G   B 2 33 ? 32.282 -3.802  37.694  1.00 43.99  ? 40  G   R C4    1 
ATOM   1464 P  P     . G   B 2 34 ? 32.384 -5.646  43.393  1.00 48.39  ? 41  G   R P     1 
ATOM   1465 O  OP1   . G   B 2 34 ? 32.879 -6.141  44.692  1.00 51.03  ? 41  G   R OP1   1 
ATOM   1466 O  OP2   . G   B 2 34 ? 30.929 -5.606  43.148  1.00 47.11  ? 41  G   R OP2   1 
ATOM   1467 O  "O5'" . G   B 2 34 ? 32.986 -4.193  43.139  1.00 47.80  ? 41  G   R "O5'" 1 
ATOM   1468 C  "C5'" . G   B 2 34 ? 34.368 -3.944  43.365  1.00 48.96  ? 41  G   R "C5'" 1 
ATOM   1469 C  "C4'" . G   B 2 34 ? 34.787 -2.624  42.739  1.00 48.03  ? 41  G   R "C4'" 1 
ATOM   1470 O  "O4'" . G   B 2 34 ? 34.416 -2.567  41.336  1.00 46.70  ? 41  G   R "O4'" 1 
ATOM   1471 C  "C3'" . G   B 2 34 ? 34.116 -1.386  43.309  1.00 47.14  ? 41  G   R "C3'" 1 
ATOM   1472 O  "O3'" . G   B 2 34 ? 34.688 -1.041  44.551  1.00 48.02  ? 41  G   R "O3'" 1 
ATOM   1473 C  "C2'" . G   B 2 34 ? 34.477 -0.384  42.224  1.00 46.71  ? 41  G   R "C2'" 1 
ATOM   1474 O  "O2'" . G   B 2 34 ? 35.842 -0.030  42.261  1.00 48.36  ? 41  G   R "O2'" 1 
ATOM   1475 C  "C1'" . G   B 2 34 ? 34.191 -1.211  40.975  1.00 46.10  ? 41  G   R "C1'" 1 
ATOM   1476 N  N9    . G   B 2 34 ? 32.825 -1.025  40.479  1.00 44.77  ? 41  G   R N9    1 
ATOM   1477 C  C8    . G   B 2 34 ? 31.789 -1.926  40.540  1.00 44.31  ? 41  G   R C8    1 
ATOM   1478 N  N7    . G   B 2 34 ? 30.678 -1.485  40.022  1.00 43.51  ? 41  G   R N7    1 
ATOM   1479 C  C5    . G   B 2 34 ? 30.991 -0.201  39.592  1.00 43.49  ? 41  G   R C5    1 
ATOM   1480 C  C6    . G   B 2 34 ? 30.178 0.768   38.946  1.00 42.89  ? 41  G   R C6    1 
ATOM   1481 O  O6    . G   B 2 34 ? 28.984 0.668   38.629  1.00 42.05  ? 41  G   R O6    1 
ATOM   1482 N  N1    . G   B 2 34 ? 30.880 1.946   38.672  1.00 43.11  ? 41  G   R N1    1 
ATOM   1483 C  C2    . G   B 2 34 ? 32.208 2.154   38.988  1.00 43.75  ? 41  G   R C2    1 
ATOM   1484 N  N2    . G   B 2 34 ? 32.720 3.346   38.647  1.00 43.27  ? 41  G   R N2    1 
ATOM   1485 N  N3    . G   B 2 34 ? 32.980 1.251   39.594  1.00 44.14  ? 41  G   R N3    1 
ATOM   1486 C  C4    . G   B 2 34 ? 32.310 0.100   39.867  1.00 44.09  ? 41  G   R C4    1 
ATOM   1487 P  P     . G   B 2 35 ? 33.792 -0.442  45.733  1.00 48.08  ? 42  G   R P     1 
ATOM   1488 O  OP1   . G   B 2 35 ? 34.725 -0.004  46.795  1.00 49.84  ? 42  G   R OP1   1 
ATOM   1489 O  OP2   . G   B 2 35 ? 32.693 -1.385  46.043  1.00 47.16  ? 42  G   R OP2   1 
ATOM   1490 O  "O5'" . G   B 2 35 ? 33.105 0.840   45.081  1.00 46.77  ? 42  G   R "O5'" 1 
ATOM   1491 C  "C5'" . G   B 2 35 ? 33.818 2.042   44.857  1.00 46.99  ? 42  G   R "C5'" 1 
ATOM   1492 C  "C4'" . G   B 2 35 ? 32.926 2.972   44.065  1.00 45.53  ? 42  G   R "C4'" 1 
ATOM   1493 O  "O4'" . G   B 2 35 ? 32.349 2.259   42.942  1.00 44.33  ? 42  G   R "O4'" 1 
ATOM   1494 C  "C3'" . G   B 2 35 ? 31.734 3.474   44.854  1.00 45.33  ? 42  G   R "C3'" 1 
ATOM   1495 O  "O3'" . G   B 2 35 ? 32.153 4.598   45.609  1.00 46.25  ? 42  G   R "O3'" 1 
ATOM   1496 C  "C2'" . G   B 2 35 ? 30.754 3.819   43.733  1.00 44.36  ? 42  G   R "C2'" 1 
ATOM   1497 O  "O2'" . G   B 2 35 ? 30.968 5.096   43.160  1.00 44.46  ? 42  G   R "O2'" 1 
ATOM   1498 C  "C1'" . G   B 2 35 ? 31.040 2.734   42.692  1.00 43.35  ? 42  G   R "C1'" 1 
ATOM   1499 N  N9    . G   B 2 35 ? 30.098 1.609   42.706  1.00 42.57  ? 42  G   R N9    1 
ATOM   1500 C  C8    . G   B 2 35 ? 30.249 0.419   43.368  1.00 43.11  ? 42  G   R C8    1 
ATOM   1501 N  N7    . G   B 2 35 ? 29.254 -0.404  43.205  1.00 42.68  ? 42  G   R N7    1 
ATOM   1502 C  C5    . G   B 2 35 ? 28.379 0.282   42.380  1.00 41.95  ? 42  G   R C5    1 
ATOM   1503 C  C6    . G   B 2 35 ? 27.118 -0.102  41.856  1.00 41.46  ? 42  G   R C6    1 
ATOM   1504 O  O6    . G   B 2 35 ? 26.501 -1.157  42.022  1.00 41.08  ? 42  G   R O6    1 
ATOM   1505 N  N1    . G   B 2 35 ? 26.546 0.881   41.059  1.00 41.24  ? 42  G   R N1    1 
ATOM   1506 C  C2    . G   B 2 35 ? 27.119 2.097   40.802  1.00 41.54  ? 42  G   R C2    1 
ATOM   1507 N  N2    . G   B 2 35 ? 26.411 2.918   40.008  1.00 41.37  ? 42  G   R N2    1 
ATOM   1508 N  N3    . G   B 2 35 ? 28.301 2.469   41.288  1.00 41.98  ? 42  G   R N3    1 
ATOM   1509 C  C4    . G   B 2 35 ? 28.880 1.522   42.066  1.00 41.73  ? 42  G   R C4    1 
ATOM   1510 P  P     . A   B 2 36 ? 31.383 5.067   46.928  1.00 47.13  ? 43  A   R P     1 
ATOM   1511 O  OP1   . A   B 2 36 ? 32.267 6.012   47.637  1.00 48.85  ? 43  A   R OP1   1 
ATOM   1512 O  OP2   . A   B 2 36 ? 30.837 3.880   47.618  1.00 47.50  ? 43  A   R OP2   1 
ATOM   1513 O  "O5'" . A   B 2 36 ? 30.157 5.890   46.336  1.00 46.71  ? 43  A   R "O5'" 1 
ATOM   1514 C  "C5'" . A   B 2 36 ? 29.053 6.211   47.151  1.00 47.89  ? 43  A   R "C5'" 1 
ATOM   1515 C  "C4'" . A   B 2 36 ? 27.886 6.633   46.272  1.00 47.40  ? 43  A   R "C4'" 1 
ATOM   1516 O  "O4'" . A   B 2 36 ? 27.576 5.599   45.302  1.00 45.18  ? 43  A   R "O4'" 1 
ATOM   1517 C  "C3'" . A   B 2 36 ? 26.583 6.891   47.018  1.00 48.65  ? 43  A   R "C3'" 1 
ATOM   1518 O  "O3'" . A   B 2 36 ? 25.826 7.878   46.334  1.00 48.96  ? 43  A   R "O3'" 1 
ATOM   1519 C  "C2'" . A   B 2 36 ? 25.891 5.538   46.949  1.00 47.57  ? 43  A   R "C2'" 1 
ATOM   1520 O  "O2'" . A   B 2 36 ? 24.495 5.670   47.104  1.00 48.58  ? 43  A   R "O2'" 1 
ATOM   1521 C  "C1'" . A   B 2 36 ? 26.261 5.112   45.528  1.00 45.18  ? 43  A   R "C1'" 1 
ATOM   1522 N  N9    . A   B 2 36 ? 26.239 3.672   45.253  1.00 43.63  ? 43  A   R N9    1 
ATOM   1523 C  C8    . A   B 2 36 ? 25.601 3.080   44.202  1.00 41.78  ? 43  A   R C8    1 
ATOM   1524 N  N7    . A   B 2 36 ? 25.737 1.781   44.163  1.00 41.51  ? 43  A   R N7    1 
ATOM   1525 C  C5    . A   B 2 36 ? 26.525 1.493   45.259  1.00 42.82  ? 43  A   R C5    1 
ATOM   1526 C  C6    . A   B 2 36 ? 27.030 0.281   45.771  1.00 43.60  ? 43  A   R C6    1 
ATOM   1527 N  N6    . A   B 2 36 ? 26.789 -0.898  45.202  1.00 43.34  ? 43  A   R N6    1 
ATOM   1528 N  N1    . A   B 2 36 ? 27.792 0.318   46.886  1.00 45.59  ? 43  A   R N1    1 
ATOM   1529 C  C2    . A   B 2 36 ? 28.030 1.511   47.451  1.00 46.92  ? 43  A   R C2    1 
ATOM   1530 N  N3    . A   B 2 36 ? 27.609 2.719   47.059  1.00 46.23  ? 43  A   R N3    1 
ATOM   1531 C  C4    . A   B 2 36 ? 26.850 2.646   45.946  1.00 44.14  ? 43  A   R C4    1 
ATOM   1532 P  P     . C   B 2 37 ? 26.008 9.436   46.647  1.00 51.22  ? 44  C   R P     1 
ATOM   1533 O  OP1   . C   B 2 37 ? 27.011 9.959   45.683  1.00 50.01  ? 44  C   R OP1   1 
ATOM   1534 O  OP2   . C   B 2 37 ? 26.219 9.634   48.102  1.00 52.73  ? 44  C   R OP2   1 
ATOM   1535 O  "O5'" . C   B 2 37 ? 24.518 9.937   46.324  1.00 50.35  ? 44  C   R "O5'" 1 
ATOM   1536 C  "C5'" . C   B 2 37 ? 24.253 11.079  45.527  1.00 49.52  ? 44  C   R "C5'" 1 
ATOM   1537 C  "C4'" . C   B 2 37 ? 23.098 10.810  44.581  1.00 47.08  ? 44  C   R "C4'" 1 
ATOM   1538 O  "O4'" . C   B 2 37 ? 23.303 9.578   43.855  1.00 45.29  ? 44  C   R "O4'" 1 
ATOM   1539 C  "C3'" . C   B 2 37 ? 21.749 10.542  45.220  1.00 46.98  ? 44  C   R "C3'" 1 
ATOM   1540 O  "O3'" . C   B 2 37 ? 21.175 11.703  45.787  1.00 47.68  ? 44  C   R "O3'" 1 
ATOM   1541 C  "C2'" . C   B 2 37 ? 20.989 10.047  43.999  1.00 46.14  ? 44  C   R "C2'" 1 
ATOM   1542 O  "O2'" . C   B 2 37 ? 20.665 11.058  43.071  1.00 47.11  ? 44  C   R "O2'" 1 
ATOM   1543 C  "C1'" . C   B 2 37 ? 22.038 9.144   43.367  1.00 45.06  ? 44  C   R "C1'" 1 
ATOM   1544 N  N1    . C   B 2 37 ? 21.799 7.668   43.616  1.00 44.95  ? 44  C   R N1    1 
ATOM   1545 C  C2    . C   B 2 37 ? 20.745 7.007   42.952  1.00 44.22  ? 44  C   R C2    1 
ATOM   1546 O  O2    . C   B 2 37 ? 20.011 7.631   42.172  1.00 44.32  ? 44  C   R O2    1 
ATOM   1547 N  N3    . C   B 2 37 ? 20.549 5.681   43.186  1.00 43.38  ? 44  C   R N3    1 
ATOM   1548 C  C4    . C   B 2 37 ? 21.341 5.022   44.035  1.00 43.08  ? 44  C   R C4    1 
ATOM   1549 N  N4    . C   B 2 37 ? 21.099 3.725   44.227  1.00 42.57  ? 44  C   R N4    1 
ATOM   1550 C  C5    . C   B 2 37 ? 22.412 5.666   44.722  1.00 44.00  ? 44  C   R C5    1 
ATOM   1551 C  C6    . C   B 2 37 ? 22.604 6.971   44.485  1.00 45.05  ? 44  C   R C6    1 
ATOM   1552 P  P     . G   B 2 38 ? 20.293 11.546  47.112  1.00 48.71  ? 45  G   R P     1 
ATOM   1553 O  OP1   . G   B 2 38 ? 20.249 12.869  47.775  1.00 50.18  ? 45  G   R OP1   1 
ATOM   1554 O  OP2   . G   B 2 38 ? 20.761 10.345  47.848  1.00 48.26  ? 45  G   R OP2   1 
ATOM   1555 O  "O5'" . G   B 2 38 ? 18.839 11.212  46.546  1.00 47.82  ? 45  G   R "O5'" 1 
ATOM   1556 C  "C5'" . G   B 2 38 ? 18.040 10.208  47.150  1.00 46.81  ? 45  G   R "C5'" 1 
ATOM   1557 C  "C4'" . G   B 2 38 ? 17.485 9.292   46.073  1.00 44.92  ? 45  G   R "C4'" 1 
ATOM   1558 O  "O4'" . G   B 2 38 ? 18.566 8.559   45.430  1.00 43.14  ? 45  G   R "O4'" 1 
ATOM   1559 C  "C3'" . G   B 2 38 ? 16.517 8.232   46.579  1.00 44.22  ? 45  G   R "C3'" 1 
ATOM   1560 O  "O3'" . G   B 2 38 ? 15.182 8.720   46.511  1.00 45.08  ? 45  G   R "O3'" 1 
ATOM   1561 C  "C2'" . G   B 2 38 ? 16.761 7.101   45.595  1.00 41.86  ? 45  G   R "C2'" 1 
ATOM   1562 O  "O2'" . G   B 2 38 ? 16.136 7.355   44.356  1.00 40.61  ? 45  G   R "O2'" 1 
ATOM   1563 C  "C1'" . G   B 2 38 ? 18.275 7.174   45.420  1.00 41.60  ? 45  G   R "C1'" 1 
ATOM   1564 N  N9    . G   B 2 38 ? 19.086 6.494   46.448  1.00 42.06  ? 45  G   R N9    1 
ATOM   1565 C  C8    . G   B 2 38 ? 19.927 7.086   47.369  1.00 43.22  ? 45  G   R C8    1 
ATOM   1566 N  N7    . G   B 2 38 ? 20.531 6.249   48.166  1.00 42.93  ? 45  G   R N7    1 
ATOM   1567 C  C5    . G   B 2 38 ? 20.067 5.012   47.750  1.00 41.50  ? 45  G   R C5    1 
ATOM   1568 C  C6    . G   B 2 38 ? 20.375 3.725   48.244  1.00 41.15  ? 45  G   R C6    1 
ATOM   1569 O  O6    . G   B 2 38 ? 21.143 3.433   49.172  1.00 41.88  ? 45  G   R O6    1 
ATOM   1570 N  N1    . G   B 2 38 ? 19.691 2.724   47.548  1.00 39.98  ? 45  G   R N1    1 
ATOM   1571 C  C2    . G   B 2 38 ? 18.819 2.945   46.506  1.00 38.97  ? 45  G   R C2    1 
ATOM   1572 N  N2    . G   B 2 38 ? 18.252 1.865   45.952  1.00 37.67  ? 45  G   R N2    1 
ATOM   1573 N  N3    . G   B 2 38 ? 18.526 4.150   46.035  1.00 39.43  ? 45  G   R N3    1 
ATOM   1574 C  C4    . G   B 2 38 ? 19.182 5.138   46.697  1.00 40.83  ? 45  G   R C4    1 
ATOM   1575 P  P     . C   B 2 39 ? 14.144 8.340   47.666  1.00 45.98  ? 46  C   R P     1 
ATOM   1576 O  OP1   . C   B 2 39 ? 12.900 9.120   47.457  1.00 46.75  ? 46  C   R OP1   1 
ATOM   1577 O  OP2   . C   B 2 39 ? 14.854 8.377   48.968  1.00 46.71  ? 46  C   R OP2   1 
ATOM   1578 O  "O5'" . C   B 2 39 ? 13.861 6.810   47.333  1.00 44.92  ? 46  C   R "O5'" 1 
ATOM   1579 C  "C5'" . C   B 2 39 ? 13.021 6.434   46.252  1.00 44.27  ? 46  C   R "C5'" 1 
ATOM   1580 C  "C4'" . C   B 2 39 ? 13.077 4.930   46.121  1.00 43.22  ? 46  C   R "C4'" 1 
ATOM   1581 O  "O4'" . C   B 2 39 ? 14.470 4.547   46.141  1.00 42.56  ? 46  C   R "O4'" 1 
ATOM   1582 C  "C3'" . C   B 2 39 ? 12.499 4.142   47.284  1.00 44.22  ? 46  C   R "C3'" 1 
ATOM   1583 O  "O3'" . C   B 2 39 ? 11.104 3.992   47.163  1.00 44.91  ? 46  C   R "O3'" 1 
ATOM   1584 C  "C2'" . C   B 2 39 ? 13.209 2.807   47.126  1.00 42.85  ? 46  C   R "C2'" 1 
ATOM   1585 O  "O2'" . C   B 2 39 ? 12.654 2.008   46.101  1.00 42.46  ? 46  C   R "O2'" 1 
ATOM   1586 C  "C1'" . C   B 2 39 ? 14.603 3.254   46.708  1.00 42.07  ? 46  C   R "C1'" 1 
ATOM   1587 N  N1    . C   B 2 39 ? 15.579 3.266   47.830  1.00 42.24  ? 46  C   R N1    1 
ATOM   1588 C  C2    . C   B 2 39 ? 16.102 2.051   48.288  1.00 42.69  ? 46  C   R C2    1 
ATOM   1589 O  O2    . C   B 2 39 ? 15.750 0.992   47.756  1.00 42.06  ? 46  C   R O2    1 
ATOM   1590 N  N3    . C   B 2 39 ? 16.992 2.059   49.313  1.00 44.27  ? 46  C   R N3    1 
ATOM   1591 C  C4    . C   B 2 39 ? 17.356 3.213   49.872  1.00 44.83  ? 46  C   R C4    1 
ATOM   1592 N  N4    . C   B 2 39 ? 18.228 3.158   50.878  1.00 45.90  ? 46  C   R N4    1 
ATOM   1593 C  C5    . C   B 2 39 ? 16.835 4.462   49.421  1.00 45.19  ? 46  C   R C5    1 
ATOM   1594 C  C6    . C   B 2 39 ? 15.960 4.441   48.406  1.00 43.57  ? 46  C   R C6    1 
ATOM   1595 P  P     . A   B 2 40 ? 10.147 4.707   48.219  1.00 47.75  ? 47  A   R P     1 
ATOM   1596 O  OP1   . A   B 2 40 ? 9.254  5.580   47.427  1.00 48.69  ? 47  A   R OP1   1 
ATOM   1597 O  OP2   . A   B 2 40 ? 10.991 5.269   49.303  1.00 48.32  ? 47  A   R OP2   1 
ATOM   1598 O  "O5'" . A   B 2 40 ? 9.258  3.523   48.824  1.00 48.10  ? 47  A   R "O5'" 1 
ATOM   1599 C  "C5'" . A   B 2 40 ? 9.839  2.647   49.764  1.00 48.97  ? 47  A   R "C5'" 1 
ATOM   1600 C  "C4'" . A   B 2 40 ? 9.111  1.319   49.861  1.00 49.44  ? 47  A   R "C4'" 1 
ATOM   1601 O  "O4'" . A   B 2 40 ? 9.944  0.391   50.603  1.00 49.76  ? 47  A   R "O4'" 1 
ATOM   1602 C  "C3'" . A   B 2 40 ? 7.790  1.298   50.612  1.00 51.83  ? 47  A   R "C3'" 1 
ATOM   1603 O  "O3'" . A   B 2 40 ? 7.142  0.105   50.257  1.00 51.79  ? 47  A   R "O3'" 1 
ATOM   1604 C  "C2'" . A   B 2 40 ? 8.269  1.163   52.051  1.00 53.85  ? 47  A   R "C2'" 1 
ATOM   1605 O  "O2'" . A   B 2 40 ? 7.258  0.686   52.917  1.00 56.30  ? 47  A   R "O2'" 1 
ATOM   1606 C  "C1'" . A   B 2 40 ? 9.351  0.102   51.856  1.00 52.13  ? 47  A   R "C1'" 1 
ATOM   1607 N  N9    . A   B 2 40 ? 10.400 0.070   52.871  1.00 53.20  ? 47  A   R N9    1 
ATOM   1608 C  C8    . A   B 2 40 ? 10.869 1.118   53.610  1.00 54.78  ? 47  A   R C8    1 
ATOM   1609 N  N7    . A   B 2 40 ? 11.821 0.794   54.448  1.00 55.61  ? 47  A   R N7    1 
ATOM   1610 C  C5    . A   B 2 40 ? 11.996 -0.557  54.244  1.00 54.31  ? 47  A   R C5    1 
ATOM   1611 C  C6    . A   B 2 40 ? 12.865 -1.491  54.833  1.00 54.88  ? 47  A   R C6    1 
ATOM   1612 N  N6    . A   B 2 40 ? 13.745 -1.163  55.782  1.00 56.72  ? 47  A   R N6    1 
ATOM   1613 N  N1    . A   B 2 40 ? 12.789 -2.772  54.414  1.00 54.28  ? 47  A   R N1    1 
ATOM   1614 C  C2    . A   B 2 40 ? 11.895 -3.086  53.461  1.00 53.26  ? 47  A   R C2    1 
ATOM   1615 N  N3    . A   B 2 40 ? 11.028 -2.289  52.829  1.00 52.29  ? 47  A   R N3    1 
ATOM   1616 C  C4    . A   B 2 40 ? 11.132 -1.024  53.271  1.00 53.06  ? 47  A   R C4    1 
ATOM   1617 P  P     . A   B 2 41 ? 5.766  0.031   49.463  1.00 52.42  ? 48  A   R P     1 
ATOM   1618 O  OP1   . A   B 2 41 ? 5.784  1.001   48.340  1.00 51.36  ? 48  A   R OP1   1 
ATOM   1619 O  OP2   . A   B 2 41 ? 4.673  0.041   50.458  1.00 54.45  ? 48  A   R OP2   1 
ATOM   1620 O  "O5'" . A   B 2 41 ? 5.859  -1.462  48.899  1.00 50.81  ? 48  A   R "O5'" 1 
ATOM   1621 C  "C5'" . A   B 2 41 ? 6.396  -1.713  47.621  1.00 48.17  ? 48  A   R "C5'" 1 
ATOM   1622 C  "C4'" . A   B 2 41 ? 7.897  -1.923  47.670  1.00 47.01  ? 48  A   R "C4'" 1 
ATOM   1623 O  "O4'" . A   B 2 41 ? 8.225  -3.224  48.236  1.00 47.60  ? 48  A   R "O4'" 1 
ATOM   1624 C  "C3'" . A   B 2 41 ? 8.509  -1.936  46.276  1.00 45.73  ? 48  A   R "C3'" 1 
ATOM   1625 O  "O3'" . A   B 2 41 ? 9.803  -1.356  46.263  1.00 44.83  ? 48  A   R "O3'" 1 
ATOM   1626 C  "C2'" . A   B 2 41 ? 8.602  -3.418  45.961  1.00 44.92  ? 48  A   R "C2'" 1 
ATOM   1627 O  "O2'" . A   B 2 41 ? 9.552  -3.674  44.952  1.00 43.79  ? 48  A   R "O2'" 1 
ATOM   1628 C  "C1'" . A   B 2 41 ? 9.076  -3.904  47.324  1.00 45.74  ? 48  A   R "C1'" 1 
ATOM   1629 N  N9    . A   B 2 41 ? 9.013  -5.359  47.451  1.00 45.70  ? 48  A   R N9    1 
ATOM   1630 C  C8    . A   B 2 41 ? 7.914  -6.157  47.276  1.00 46.72  ? 48  A   R C8    1 
ATOM   1631 N  N7    . A   B 2 41 ? 8.159  -7.436  47.433  1.00 46.67  ? 48  A   R N7    1 
ATOM   1632 C  C5    . A   B 2 41 ? 9.510  -7.482  47.729  1.00 45.45  ? 48  A   R C5    1 
ATOM   1633 C  C6    . A   B 2 41 ? 10.384 -8.553  48.010  1.00 45.42  ? 48  A   R C6    1 
ATOM   1634 N  N6    . A   B 2 41 ? 9.986  -9.829  48.033  1.00 46.23  ? 48  A   R N6    1 
ATOM   1635 N  N1    . A   B 2 41 ? 11.682 -8.267  48.267  1.00 44.74  ? 48  A   R N1    1 
ATOM   1636 C  C2    . A   B 2 41 ? 12.068 -6.983  48.245  1.00 44.57  ? 48  A   R C2    1 
ATOM   1637 N  N3    . A   B 2 41 ? 11.336 -5.892  47.993  1.00 44.55  ? 48  A   R N3    1 
ATOM   1638 C  C4    . A   B 2 41 ? 10.053 -6.211  47.743  1.00 44.98  ? 48  A   R C4    1 
ATOM   1639 P  P     . A   B 2 42 ? 10.132 -0.319  45.107  1.00 43.52  ? 49  A   R P     1 
ATOM   1640 O  OP1   . A   B 2 42 ? 10.204 1.013   45.741  1.00 44.85  ? 49  A   R OP1   1 
ATOM   1641 O  OP2   . A   B 2 42 ? 9.200  -0.565  43.982  1.00 44.08  ? 49  A   R OP2   1 
ATOM   1642 O  "O5'" . A   B 2 42 ? 11.595 -0.737  44.647  1.00 42.61  ? 49  A   R "O5'" 1 
ATOM   1643 C  "C5'" . A   B 2 42 ? 11.809 -1.748  43.680  1.00 41.76  ? 49  A   R "C5'" 1 
ATOM   1644 C  "C4'" . A   B 2 42 ? 13.301 -1.953  43.467  1.00 41.10  ? 49  A   R "C4'" 1 
ATOM   1645 O  "O4'" . A   B 2 42 ? 13.831 -0.931  42.589  1.00 41.21  ? 49  A   R "O4'" 1 
ATOM   1646 C  "C3'" . A   B 2 42 ? 14.186 -1.898  44.705  1.00 41.46  ? 49  A   R "C3'" 1 
ATOM   1647 O  "O3'" . A   B 2 42 ? 15.277 -2.795  44.502  1.00 40.14  ? 49  A   R "O3'" 1 
ATOM   1648 C  "C2'" . A   B 2 42 ? 14.638 -0.438  44.776  1.00 41.92  ? 49  A   R "C2'" 1 
ATOM   1649 O  "O2'" . A   B 2 42 ? 15.963 -0.312  45.245  1.00 42.28  ? 49  A   R "O2'" 1 
ATOM   1650 C  "C1'" . A   B 2 42 ? 14.579 0.024   43.322  1.00 41.65  ? 49  A   R "C1'" 1 
ATOM   1651 N  N9    . A   B 2 42 ? 13.973 1.339   43.092  1.00 43.05  ? 49  A   R N9    1 
ATOM   1652 C  C8    . A   B 2 42 ? 12.686 1.590   42.697  1.00 43.80  ? 49  A   R C8    1 
ATOM   1653 N  N7    . A   B 2 42 ? 12.410 2.861   42.548  1.00 44.50  ? 49  A   R N7    1 
ATOM   1654 C  C5    . A   B 2 42 ? 13.596 3.496   42.859  1.00 44.22  ? 49  A   R C5    1 
ATOM   1655 C  C6    . A   B 2 42 ? 13.961 4.859   42.890  1.00 45.04  ? 49  A   R C6    1 
ATOM   1656 N  N6    . A   B 2 42 ? 13.123 5.859   42.598  1.00 45.85  ? 49  A   R N6    1 
ATOM   1657 N  N1    . A   B 2 42 ? 15.230 5.158   43.242  1.00 45.05  ? 49  A   R N1    1 
ATOM   1658 C  C2    . A   B 2 42 ? 16.075 4.160   43.542  1.00 44.24  ? 49  A   R C2    1 
ATOM   1659 N  N3    . A   B 2 42 ? 15.845 2.846   43.550  1.00 43.48  ? 49  A   R N3    1 
ATOM   1660 C  C4    . A   B 2 42 ? 14.574 2.575   43.195  1.00 43.48  ? 49  A   R C4    1 
ATOM   1661 P  P     . G   B 2 43 ? 15.466 -4.090  45.426  1.00 39.77  ? 50  G   R P     1 
ATOM   1662 O  OP1   . G   B 2 43 ? 15.447 -3.655  46.840  1.00 40.89  ? 50  G   R OP1   1 
ATOM   1663 O  OP2   . G   B 2 43 ? 16.641 -4.812  44.899  1.00 39.03  ? 50  G   R OP2   1 
ATOM   1664 O  "O5'" . G   B 2 43 ? 14.155 -4.968  45.135  1.00 39.86  ? 50  G   R "O5'" 1 
ATOM   1665 C  "C5'" . G   B 2 43 ? 13.904 -5.563  43.861  1.00 38.82  ? 50  G   R "C5'" 1 
ATOM   1666 C  "C4'" . G   B 2 43 ? 14.021 -7.069  43.962  1.00 39.38  ? 50  G   R "C4'" 1 
ATOM   1667 O  "O4'" . G   B 2 43 ? 13.202 -7.515  45.073  1.00 40.87  ? 50  G   R "O4'" 1 
ATOM   1668 C  "C3'" . G   B 2 43 ? 13.518 -7.855  42.757  1.00 39.36  ? 50  G   R "C3'" 1 
ATOM   1669 O  "O3'" . G   B 2 43 ? 14.563 -8.094  41.809  1.00 38.26  ? 50  G   R "O3'" 1 
ATOM   1670 C  "C2'" . G   B 2 43 ? 13.032 -9.142  43.420  1.00 41.00  ? 50  G   R "C2'" 1 
ATOM   1671 O  "O2'" . G   B 2 43 ? 14.092 -10.003 43.791  1.00 42.44  ? 50  G   R "O2'" 1 
ATOM   1672 C  "C1'" . G   B 2 43 ? 12.376 -8.597  44.685  1.00 41.46  ? 50  G   R "C1'" 1 
ATOM   1673 N  N9    . G   B 2 43 ? 10.999 -8.116  44.516  1.00 41.46  ? 50  G   R N9    1 
ATOM   1674 C  C8    . G   B 2 43 ? 10.572 -6.816  44.632  1.00 41.29  ? 50  G   R C8    1 
ATOM   1675 N  N7    . G   B 2 43 ? 9.296  -6.658  44.435  1.00 41.99  ? 50  G   R N7    1 
ATOM   1676 C  C5    . G   B 2 43 ? 8.837  -7.933  44.164  1.00 42.43  ? 50  G   R C5    1 
ATOM   1677 C  C6    . G   B 2 43 ? 7.526  -8.380  43.865  1.00 43.27  ? 50  G   R C6    1 
ATOM   1678 O  O6    . G   B 2 43 ? 6.491  -7.711  43.778  1.00 43.90  ? 50  G   R O6    1 
ATOM   1679 N  N1    . G   B 2 43 ? 7.472  -9.755  43.648  1.00 43.76  ? 50  G   R N1    1 
ATOM   1680 C  C2    . G   B 2 43 ? 8.560  -10.593 43.714  1.00 43.45  ? 50  G   R C2    1 
ATOM   1681 N  N2    . G   B 2 43 ? 8.310  -11.887 43.476  1.00 44.21  ? 50  G   R N2    1 
ATOM   1682 N  N3    . G   B 2 43 ? 9.800  -10.188 43.993  1.00 42.73  ? 50  G   R N3    1 
ATOM   1683 C  C4    . G   B 2 43 ? 9.871  -8.848  44.208  1.00 42.05  ? 50  G   R C4    1 
ATOM   1684 P  P     . C   B 2 44 ? 14.377 -7.717  40.258  1.00 36.89  ? 51  C   R P     1 
ATOM   1685 O  OP1   . C   B 2 44 ? 15.651 -7.970  39.553  1.00 36.32  ? 51  C   R OP1   1 
ATOM   1686 O  OP2   . C   B 2 44 ? 13.753 -6.383  40.163  1.00 36.96  ? 51  C   R OP2   1 
ATOM   1687 O  "O5'" . C   B 2 44 ? 13.291 -8.781  39.777  1.00 38.81  ? 51  C   R "O5'" 1 
ATOM   1688 C  "C5'" . C   B 2 44 ? 13.577 -10.173 39.765  1.00 40.41  ? 51  C   R "C5'" 1 
ATOM   1689 C  "C4'" . C   B 2 44 ? 12.289 -10.961 39.659  1.00 42.34  ? 51  C   R "C4'" 1 
ATOM   1690 O  "O4'" . C   B 2 44 ? 11.391 -10.609 40.743  1.00 43.81  ? 51  C   R "O4'" 1 
ATOM   1691 C  "C3'" . C   B 2 44 ? 11.455 -10.629 38.437  1.00 42.54  ? 51  C   R "C3'" 1 
ATOM   1692 O  "O3'" . C   B 2 44 ? 11.977 -11.233 37.279  1.00 42.58  ? 51  C   R "O3'" 1 
ATOM   1693 C  "C2'" . C   B 2 44 ? 10.097 -11.187 38.832  1.00 43.93  ? 51  C   R "C2'" 1 
ATOM   1694 O  "O2'" . C   B 2 44 ? 9.996  -12.588 38.682  1.00 44.97  ? 51  C   R "O2'" 1 
ATOM   1695 C  "C1'" . C   B 2 44 ? 10.050 -10.788 40.306  1.00 44.47  ? 51  C   R "C1'" 1 
ATOM   1696 N  N1    . C   B 2 44 ? 9.262  -9.531  40.495  1.00 44.74  ? 51  C   R N1    1 
ATOM   1697 C  C2    . C   B 2 44 ? 7.860  -9.584  40.411  1.00 45.78  ? 51  C   R C2    1 
ATOM   1698 O  O2    . C   B 2 44 ? 7.295  -10.663 40.199  1.00 45.94  ? 51  C   R O2    1 
ATOM   1699 N  N3    . C   B 2 44 ? 7.150  -8.436  40.573  1.00 46.72  ? 51  C   R N3    1 
ATOM   1700 C  C4    . C   B 2 44 ? 7.776  -7.277  40.801  1.00 45.90  ? 51  C   R C4    1 
ATOM   1701 N  N4    . C   B 2 44 ? 7.018  -6.187  40.957  1.00 46.33  ? 51  C   R N4    1 
ATOM   1702 C  C5    . C   B 2 44 ? 9.202  -7.196  40.884  1.00 44.77  ? 51  C   R C5    1 
ATOM   1703 C  C6    . C   B 2 44 ? 9.895  -8.335  40.724  1.00 44.31  ? 51  C   R C6    1 
ATOM   1704 P  P     . C   B 2 45 ? 11.902 -10.400 35.918  1.00 42.09  ? 52  C   R P     1 
ATOM   1705 O  OP1   . C   B 2 45 ? 12.819 -11.041 34.949  1.00 41.74  ? 52  C   R OP1   1 
ATOM   1706 O  OP2   . C   B 2 45 ? 12.052 -8.960  36.236  1.00 40.84  ? 52  C   R OP2   1 
ATOM   1707 O  "O5'" . C   B 2 45 ? 10.381 -10.628 35.472  1.00 42.75  ? 52  C   R "O5'" 1 
ATOM   1708 C  "C5'" . C   B 2 45 ? 9.912  -11.922 35.097  1.00 43.09  ? 52  C   R "C5'" 1 
ATOM   1709 C  "C4'" . C   B 2 45 ? 8.410  -11.905 34.867  1.00 43.52  ? 52  C   R "C4'" 1 
ATOM   1710 O  "O4'" . C   B 2 45 ? 7.719  -11.341 36.011  1.00 42.99  ? 52  C   R "O4'" 1 
ATOM   1711 C  "C3'" . C   B 2 45 ? 7.968  -11.023 33.718  1.00 43.33  ? 52  C   R "C3'" 1 
ATOM   1712 O  "O3'" . C   B 2 45 ? 8.162  -11.711 32.498  1.00 44.51  ? 52  C   R "O3'" 1 
ATOM   1713 C  "C2'" . C   B 2 45 ? 6.501  -10.789 34.057  1.00 43.96  ? 52  C   R "C2'" 1 
ATOM   1714 O  "O2'" . C   B 2 45 ? 5.662  -11.854 33.663  1.00 45.34  ? 52  C   R "O2'" 1 
ATOM   1715 C  "C1'" . C   B 2 45 ? 6.541  -10.686 35.583  1.00 43.12  ? 52  C   R "C1'" 1 
ATOM   1716 N  N1    . C   B 2 45 ? 6.549  -9.273  36.108  1.00 42.15  ? 52  C   R N1    1 
ATOM   1717 C  C2    . C   B 2 45 ? 5.364  -8.507  36.142  1.00 42.57  ? 52  C   R C2    1 
ATOM   1718 O  O2    . C   B 2 45 ? 4.296  -8.980  35.743  1.00 43.29  ? 52  C   R O2    1 
ATOM   1719 N  N3    . C   B 2 45 ? 5.411  -7.236  36.623  1.00 42.47  ? 52  C   R N3    1 
ATOM   1720 C  C4    . C   B 2 45 ? 6.563  -6.716  37.061  1.00 41.11  ? 52  C   R C4    1 
ATOM   1721 N  N4    . C   B 2 45 ? 6.540  -5.461  37.525  1.00 40.61  ? 52  C   R N4    1 
ATOM   1722 C  C5    . C   B 2 45 ? 7.777  -7.469  37.036  1.00 40.17  ? 52  C   R C5    1 
ATOM   1723 C  C6    . C   B 2 45 ? 7.723  -8.724  36.560  1.00 40.75  ? 52  C   R C6    1 
ATOM   1724 P  P     . U   B 2 46 ? 8.633  -10.935 31.178  1.00 44.62  ? 53  U   R P     1 
ATOM   1725 O  OP1   . U   B 2 46 ? 9.165  -11.934 30.225  1.00 44.94  ? 53  U   R OP1   1 
ATOM   1726 O  OP2   . U   B 2 46 ? 9.488  -9.785  31.542  1.00 43.33  ? 53  U   R OP2   1 
ATOM   1727 O  "O5'" . U   B 2 46 ? 7.223  -10.372 30.679  1.00 46.17  ? 53  U   R "O5'" 1 
ATOM   1728 C  "C5'" . U   B 2 46 ? 7.138  -9.655  29.473  1.00 48.50  ? 53  U   R "C5'" 1 
ATOM   1729 C  "C4'" . U   B 2 46 ? 5.767  -9.020  29.359  1.00 51.32  ? 53  U   R "C4'" 1 
ATOM   1730 O  "O4'" . U   B 2 46 ? 5.685  -7.832  30.193  1.00 51.26  ? 53  U   R "O4'" 1 
ATOM   1731 C  "C3'" . U   B 2 46 ? 5.415  -8.537  27.962  1.00 53.59  ? 53  U   R "C3'" 1 
ATOM   1732 O  "O3'" . U   B 2 46 ? 4.005  -8.474  27.850  1.00 55.88  ? 53  U   R "O3'" 1 
ATOM   1733 C  "C2'" . U   B 2 46 ? 6.050  -7.149  27.957  1.00 52.99  ? 53  U   R "C2'" 1 
ATOM   1734 O  "O2'" . U   B 2 46 ? 5.509  -6.284  26.978  1.00 54.23  ? 53  U   R "O2'" 1 
ATOM   1735 C  "C1'" . U   B 2 46 ? 5.708  -6.674  29.372  1.00 52.06  ? 53  U   R "C1'" 1 
ATOM   1736 N  N1    . U   B 2 46 ? 6.675  -5.700  29.960  1.00 50.62  ? 53  U   R N1    1 
ATOM   1737 C  C2    . U   B 2 46 ? 6.190  -4.540  30.535  1.00 51.08  ? 53  U   R C2    1 
ATOM   1738 O  O2    . U   B 2 46 ? 5.006  -4.263  30.593  1.00 52.76  ? 53  U   R O2    1 
ATOM   1739 N  N3    . U   B 2 46 ? 7.152  -3.705  31.053  1.00 49.86  ? 53  U   R N3    1 
ATOM   1740 C  C4    . U   B 2 46 ? 8.523  -3.916  31.047  1.00 49.28  ? 53  U   R C4    1 
ATOM   1741 O  O4    . U   B 2 46 ? 9.273  -3.080  31.548  1.00 49.53  ? 53  U   R O4    1 
ATOM   1742 C  C5    . U   B 2 46 ? 8.953  -5.146  30.426  1.00 48.75  ? 53  U   R C5    1 
ATOM   1743 C  C6    . U   B 2 46 ? 8.032  -5.971  29.916  1.00 49.51  ? 53  U   R C6    1 
ATOM   1744 P  P     . C   B 2 47 ? 3.172  -9.652  27.162  1.00 58.77  ? 54  C   R P     1 
ATOM   1745 O  OP1   . C   B 2 47 ? 3.782  -10.966 27.477  1.00 58.24  ? 54  C   R OP1   1 
ATOM   1746 O  OP2   . C   B 2 47 ? 2.970  -9.269  25.745  1.00 60.63  ? 54  C   R OP2   1 
ATOM   1747 O  "O5'" . C   B 2 47 ? 1.788  -9.528  27.958  1.00 60.14  ? 54  C   R "O5'" 1 
ATOM   1748 C  "C5'" . C   B 2 47 ? 0.546  -9.970  27.409  1.00 62.96  ? 54  C   R "C5'" 1 
ATOM   1749 C  "C4'" . C   B 2 47 ? -0.624 -9.330  28.139  1.00 63.97  ? 54  C   R "C4'" 1 
ATOM   1750 O  "O4'" . C   B 2 47 ? -0.453 -9.475  29.573  1.00 62.40  ? 54  C   R "O4'" 1 
ATOM   1751 C  "C3'" . C   B 2 47 ? -0.750 -7.826  27.954  1.00 64.47  ? 54  C   R "C3'" 1 
ATOM   1752 O  "O3'" . C   B 2 47 ? -1.387 -7.491  26.727  1.00 67.33  ? 54  C   R "O3'" 1 
ATOM   1753 C  "C2'" . C   B 2 47 ? -1.573 -7.433  29.175  1.00 64.16  ? 54  C   R "C2'" 1 
ATOM   1754 O  "O2'" . C   B 2 47 ? -2.952 -7.709  29.031  1.00 66.28  ? 54  C   R "O2'" 1 
ATOM   1755 C  "C1'" . C   B 2 47 ? -0.943 -8.323  30.244  1.00 62.23  ? 54  C   R "C1'" 1 
ATOM   1756 N  N1    . C   B 2 47 ? 0.162  -7.634  31.019  1.00 59.83  ? 54  C   R N1    1 
ATOM   1757 C  C2    . C   B 2 47 ? -0.158 -6.668  31.996  1.00 59.59  ? 54  C   R C2    1 
ATOM   1758 O  O2    . C   B 2 47 ? -1.337 -6.378  32.231  1.00 61.32  ? 54  C   R O2    1 
ATOM   1759 N  N3    . C   B 2 47 ? 0.844  -6.058  32.678  1.00 57.71  ? 54  C   R N3    1 
ATOM   1760 C  C4    . C   B 2 47 ? 2.114  -6.373  32.422  1.00 56.42  ? 54  C   R C4    1 
ATOM   1761 N  N4    . C   B 2 47 ? 3.058  -5.740  33.123  1.00 55.08  ? 54  C   R N4    1 
ATOM   1762 C  C5    . C   B 2 47 ? 2.468  -7.348  31.437  1.00 56.56  ? 54  C   R C5    1 
ATOM   1763 C  C6    . C   B 2 47 ? 1.473  -7.943  30.771  1.00 57.98  ? 54  C   R C6    1 
ATOM   1764 P  P     . C   B 2 48 ? -0.905 -6.171  25.962  1.00 67.66  ? 55  C   R P     1 
ATOM   1765 O  OP1   . C   B 2 48 ? -1.532 -6.158  24.623  1.00 70.54  ? 55  C   R OP1   1 
ATOM   1766 O  OP2   . C   B 2 48 ? 0.570  -6.103  26.061  1.00 65.32  ? 55  C   R OP2   1 
ATOM   1767 O  "O5'" . C   B 2 48 ? -1.535 -4.996  26.860  1.00 68.12  ? 55  C   R "O5'" 1 
ATOM   1768 C  "C5'" . C   B 2 48 ? -2.955 -4.806  26.964  1.00 70.60  ? 55  C   R "C5'" 1 
ATOM   1769 C  "C4'" . C   B 2 48 ? -3.311 -3.558  27.760  1.00 71.08  ? 55  C   R "C4'" 1 
ATOM   1770 O  "O4'" . C   B 2 48 ? -2.951 -3.716  29.162  1.00 69.42  ? 55  C   R "O4'" 1 
ATOM   1771 C  "C3'" . C   B 2 48 ? -2.586 -2.282  27.351  1.00 70.77  ? 55  C   R "C3'" 1 
ATOM   1772 O  "O3'" . C   B 2 48 ? -3.166 -1.679  26.209  1.00 73.11  ? 55  C   R "O3'" 1 
ATOM   1773 C  "C2'" . C   B 2 48 ? -2.752 -1.425  28.600  1.00 70.45  ? 55  C   R "C2'" 1 
ATOM   1774 O  "O2'" . C   B 2 48 ? -4.035 -0.843  28.742  1.00 72.72  ? 55  C   R "O2'" 1 
ATOM   1775 C  "C1'" . C   B 2 48 ? -2.502 -2.472  29.684  1.00 68.92  ? 55  C   R "C1'" 1 
ATOM   1776 N  N1    . C   B 2 48 ? -1.044 -2.536  30.090  1.00 66.76  ? 55  C   R N1    1 
ATOM   1777 C  C2    . C   B 2 48 ? -0.463 -1.474  30.817  1.00 65.84  ? 55  C   R C2    1 
ATOM   1778 O  O2    . C   B 2 48 ? -1.139 -0.487  31.131  1.00 67.07  ? 55  C   R O2    1 
ATOM   1779 N  N3    . C   B 2 48 ? 0.849  -1.548  31.166  1.00 63.98  ? 55  C   R N3    1 
ATOM   1780 C  C4    . C   B 2 48 ? 1.581  -2.615  30.826  1.00 63.05  ? 55  C   R C4    1 
ATOM   1781 N  N4    . C   B 2 48 ? 2.867  -2.637  31.202  1.00 60.85  ? 55  C   R N4    1 
ATOM   1782 C  C5    . C   B 2 48 ? 1.017  -3.705  30.087  1.00 64.05  ? 55  C   R C5    1 
ATOM   1783 C  C6    . C   B 2 48 ? -0.279 -3.623  29.746  1.00 65.89  ? 55  C   R C6    1 
ATOM   1784 P  P     . G   B 2 49 ? -2.207 -1.116  25.058  1.00 72.95  ? 56  G   R P     1 
ATOM   1785 O  OP1   . G   B 2 49 ? -3.069 -0.734  23.917  1.00 75.94  ? 56  G   R OP1   1 
ATOM   1786 O  OP2   . G   B 2 49 ? -1.111 -2.091  24.854  1.00 70.91  ? 56  G   R OP2   1 
ATOM   1787 O  "O5'" . G   B 2 49 ? -1.567 0.195   25.713  1.00 71.81  ? 56  G   R "O5'" 1 
ATOM   1788 C  "C5'" . G   B 2 49 ? -2.071 1.483   25.391  1.00 74.02  ? 56  G   R "C5'" 1 
ATOM   1789 C  "C4'" . G   B 2 49 ? -1.957 2.448   26.558  1.00 73.40  ? 56  G   R "C4'" 1 
ATOM   1790 O  "O4'" . G   B 2 49 ? -1.780 1.756   27.826  1.00 71.21  ? 56  G   R "O4'" 1 
ATOM   1791 C  "C3'" . G   B 2 49 ? -0.753 3.375   26.533  1.00 72.18  ? 56  G   R "C3'" 1 
ATOM   1792 O  "O3'" . G   B 2 49 ? -0.881 4.396   25.567  1.00 74.64  ? 56  G   R "O3'" 1 
ATOM   1793 C  "C2'" . G   B 2 49 ? -0.834 3.895   27.961  1.00 71.19  ? 56  G   R "C2'" 1 
ATOM   1794 O  "O2'" . G   B 2 49 ? -1.976 4.686   28.222  1.00 73.28  ? 56  G   R "O2'" 1 
ATOM   1795 C  "C1'" . G   B 2 49 ? -0.953 2.549   28.669  1.00 69.63  ? 56  G   R "C1'" 1 
ATOM   1796 N  N9    . G   B 2 49 ? 0.350  1.900   28.891  1.00 66.98  ? 56  G   R N9    1 
ATOM   1797 C  C8    . G   B 2 49 ? 0.726  0.626   28.526  1.00 65.71  ? 56  G   R C8    1 
ATOM   1798 N  N7    . G   B 2 49 ? 1.950  0.323   28.857  1.00 63.26  ? 56  G   R N7    1 
ATOM   1799 C  C5    . G   B 2 49 ? 2.427  1.469   29.479  1.00 62.91  ? 56  G   R C5    1 
ATOM   1800 C  C6    . G   B 2 49 ? 3.696  1.744   30.052  1.00 61.10  ? 56  G   R C6    1 
ATOM   1801 O  O6    . G   B 2 49 ? 4.686  1.004   30.119  1.00 59.30  ? 56  G   R O6    1 
ATOM   1802 N  N1    . G   B 2 49 ? 3.773  3.033   30.584  1.00 61.74  ? 56  G   R N1    1 
ATOM   1803 C  C2    . G   B 2 49 ? 2.745  3.948   30.567  1.00 63.70  ? 56  G   R C2    1 
ATOM   1804 N  N2    . G   B 2 49 ? 2.993  5.142   31.124  1.00 63.96  ? 56  G   R N2    1 
ATOM   1805 N  N3    . G   B 2 49 ? 1.554  3.703   30.035  1.00 65.48  ? 56  G   R N3    1 
ATOM   1806 C  C4    . G   B 2 49 ? 1.459  2.450   29.508  1.00 65.03  ? 56  G   R C4    1 
ATOM   1807 P  P     . G   B 2 50 ? 0.114  4.420   24.313  1.00 75.53  ? 57  G   R P     1 
ATOM   1808 O  OP1   . G   B 2 50 ? -0.481 5.342   23.314  1.00 78.38  ? 57  G   R OP1   1 
ATOM   1809 O  OP2   . G   B 2 50 ? 0.433  3.021   23.931  1.00 74.59  ? 57  G   R OP2   1 
ATOM   1810 O  "O5'" . G   B 2 50 ? 1.464  5.052   24.905  1.00 72.22  ? 57  G   R "O5'" 1 
ATOM   1811 C  "C5'" . G   B 2 50 ? 1.660  6.456   24.925  1.00 72.11  ? 57  G   R "C5'" 1 
ATOM   1812 C  "C4'" . G   B 2 50 ? 2.534  6.869   26.092  1.00 69.23  ? 57  G   R "C4'" 1 
ATOM   1813 O  "O4'" . G   B 2 50 ? 2.514  5.866   27.139  1.00 67.39  ? 57  G   R "O4'" 1 
ATOM   1814 C  "C3'" . G   B 2 50 ? 4.010  6.973   25.763  1.00 67.38  ? 57  G   R "C3'" 1 
ATOM   1815 O  "O3'" . G   B 2 50 ? 4.282  8.176   25.064  1.00 68.59  ? 57  G   R "O3'" 1 
ATOM   1816 C  "C2'" . G   B 2 50 ? 4.616  6.945   27.162  1.00 65.00  ? 57  G   R "C2'" 1 
ATOM   1817 O  "O2'" . G   B 2 50 ? 4.453  8.150   27.886  1.00 65.53  ? 57  G   R "O2'" 1 
ATOM   1818 C  "C1'" . G   B 2 50 ? 3.777  5.834   27.786  1.00 64.46  ? 57  G   R "C1'" 1 
ATOM   1819 N  N9    . G   B 2 50 ? 4.376  4.502   27.658  1.00 62.48  ? 57  G   R N9    1 
ATOM   1820 C  C8    . G   B 2 50 ? 3.828  3.380   27.079  1.00 62.95  ? 57  G   R C8    1 
ATOM   1821 N  N7    . G   B 2 50 ? 4.608  2.332   27.117  1.00 61.07  ? 57  G   R N7    1 
ATOM   1822 C  C5    . G   B 2 50 ? 5.752  2.782   27.765  1.00 59.36  ? 57  G   R C5    1 
ATOM   1823 C  C6    . G   B 2 50 ? 6.951  2.099   28.107  1.00 57.42  ? 57  G   R C6    1 
ATOM   1824 O  O6    . G   B 2 50 ? 7.261  0.916   27.893  1.00 56.55  ? 57  G   R O6    1 
ATOM   1825 N  N1    . G   B 2 50 ? 7.859  2.936   28.757  1.00 56.54  ? 57  G   R N1    1 
ATOM   1826 C  C2    . G   B 2 50 ? 7.632  4.264   29.046  1.00 57.41  ? 57  G   R C2    1 
ATOM   1827 N  N2    . G   B 2 50 ? 8.611  4.920   29.680  1.00 56.67  ? 57  G   R N2    1 
ATOM   1828 N  N3    . G   B 2 50 ? 6.517  4.911   28.737  1.00 59.14  ? 57  G   R N3    1 
ATOM   1829 C  C4    . G   B 2 50 ? 5.621  4.115   28.101  1.00 60.14  ? 57  G   R C4    1 
ATOM   1830 P  P     . C   B 2 51 ? 4.858  8.132   23.569  1.00 68.93  ? 58  C   R P     1 
ATOM   1831 O  OP1   . C   B 2 51 ? 4.182  9.215   22.820  1.00 71.56  ? 58  C   R OP1   1 
ATOM   1832 O  OP2   . C   B 2 51 ? 4.810  6.736   23.070  1.00 68.30  ? 58  C   R OP2   1 
ATOM   1833 O  "O5'" . C   B 2 51 ? 6.408  8.490   23.740  1.00 66.15  ? 58  C   R "O5'" 1 
ATOM   1834 C  "C5'" . C   B 2 51 ? 6.886  9.283   24.818  1.00 63.81  ? 58  C   R "C5'" 1 
ATOM   1835 C  "C4'" . C   B 2 51 ? 8.129  8.663   25.424  1.00 59.75  ? 58  C   R "C4'" 1 
ATOM   1836 O  "O4'" . C   B 2 51 ? 7.764  7.519   26.227  1.00 58.31  ? 58  C   R "O4'" 1 
ATOM   1837 C  "C3'" . C   B 2 51 ? 9.098  8.041   24.439  1.00 58.73  ? 58  C   R "C3'" 1 
ATOM   1838 O  "O3'" . C   B 2 51 ? 9.840  9.021   23.744  1.00 58.97  ? 58  C   R "O3'" 1 
ATOM   1839 C  "C2'" . C   B 2 51 ? 9.949  7.199   25.380  1.00 56.32  ? 58  C   R "C2'" 1 
ATOM   1840 O  "O2'" . C   B 2 51 ? 10.878 7.948   26.138  1.00 55.28  ? 58  C   R "O2'" 1 
ATOM   1841 C  "C1'" . C   B 2 51 ? 8.859  6.617   26.275  1.00 56.23  ? 58  C   R "C1'" 1 
ATOM   1842 N  N1    . C   B 2 51 ? 8.432  5.248   25.827  1.00 56.03  ? 58  C   R N1    1 
ATOM   1843 C  C2    . C   B 2 51 ? 9.270  4.142   26.070  1.00 54.04  ? 58  C   R C2    1 
ATOM   1844 O  O2    . C   B 2 51 ? 10.348 4.302   26.658  1.00 52.66  ? 58  C   R O2    1 
ATOM   1845 N  N3    . C   B 2 51 ? 8.871  2.910   25.655  1.00 54.01  ? 58  C   R N3    1 
ATOM   1846 C  C4    . C   B 2 51 ? 7.701  2.764   25.024  1.00 56.10  ? 58  C   R C4    1 
ATOM   1847 N  N4    . C   B 2 51 ? 7.350  1.532   24.641  1.00 56.50  ? 58  C   R N4    1 
ATOM   1848 C  C5    . C   B 2 51 ? 6.834  3.872   24.765  1.00 58.12  ? 58  C   R C5    1 
ATOM   1849 C  C6    . C   B 2 51 ? 7.236  5.082   25.176  1.00 57.95  ? 58  C   R C6    1 
ATOM   1850 P  P     . C   B 2 52 ? 10.363 8.693   22.270  1.00 59.16  ? 59  C   R P     1 
ATOM   1851 O  OP1   . C   B 2 52 ? 10.838 9.965   21.679  1.00 60.63  ? 59  C   R OP1   1 
ATOM   1852 O  OP2   . C   B 2 52 ? 9.334  7.900   21.562  1.00 60.85  ? 59  C   R OP2   1 
ATOM   1853 O  "O5'" . C   B 2 52 ? 11.591 7.711   22.542  1.00 56.24  ? 59  C   R "O5'" 1 
ATOM   1854 C  "C5'" . C   B 2 52 ? 12.752 8.203   23.194  1.00 54.96  ? 59  C   R "C5'" 1 
ATOM   1855 C  "C4'" . C   B 2 52 ? 13.764 7.098   23.409  1.00 52.82  ? 59  C   R "C4'" 1 
ATOM   1856 O  "O4'" . C   B 2 52 ? 13.193 6.063   24.246  1.00 51.66  ? 59  C   R "O4'" 1 
ATOM   1857 C  "C3'" . C   B 2 52 ? 14.170 6.347   22.153  1.00 53.45  ? 59  C   R "C3'" 1 
ATOM   1858 O  "O3'" . C   B 2 52 ? 15.122 7.075   21.408  1.00 54.19  ? 59  C   R "O3'" 1 
ATOM   1859 C  "C2'" . C   B 2 52 ? 14.744 5.081   22.766  1.00 51.42  ? 59  C   R "C2'" 1 
ATOM   1860 O  "O2'" . C   B 2 52 ? 16.004 5.284   23.369  1.00 50.58  ? 59  C   R "O2'" 1 
ATOM   1861 C  "C1'" . C   B 2 52 ? 13.697 4.800   23.841  1.00 50.83  ? 59  C   R "C1'" 1 
ATOM   1862 N  N1    . C   B 2 52 ? 12.575 3.920   23.358  1.00 51.81  ? 59  C   R N1    1 
ATOM   1863 C  C2    . C   B 2 52 ? 12.808 2.554   23.107  1.00 51.18  ? 59  C   R C2    1 
ATOM   1864 O  O2    . C   B 2 52 ? 13.933 2.064   23.290  1.00 49.41  ? 59  C   R O2    1 
ATOM   1865 N  N3    . C   B 2 52 ? 11.773 1.789   22.668  1.00 52.72  ? 59  C   R N3    1 
ATOM   1866 C  C4    . C   B 2 52 ? 10.562 2.325   22.478  1.00 54.52  ? 59  C   R C4    1 
ATOM   1867 N  N4    . C   B 2 52 ? 9.584  1.523   22.044  1.00 55.66  ? 59  C   R N4    1 
ATOM   1868 C  C5    . C   B 2 52 ? 10.304 3.708   22.722  1.00 55.22  ? 59  C   R C5    1 
ATOM   1869 C  C6    . C   B 2 52 ? 11.328 4.454   23.156  1.00 53.81  ? 59  C   R C6    1 
ATOM   1870 P  P     . U   B 2 53 ? 15.020 7.073   19.812  1.00 56.82  ? 60  U   R P     1 
ATOM   1871 O  OP1   . U   B 2 53 ? 15.981 8.069   19.282  1.00 57.62  ? 60  U   R OP1   1 
ATOM   1872 O  OP2   . U   B 2 53 ? 13.597 7.145   19.409  1.00 58.81  ? 60  U   R OP2   1 
ATOM   1873 O  "O5'" . U   B 2 53 ? 15.552 5.615   19.466  1.00 55.45  ? 60  U   R "O5'" 1 
ATOM   1874 C  "C5'" . U   B 2 53 ? 16.926 5.343   19.625  1.00 53.56  ? 60  U   R "C5'" 1 
ATOM   1875 C  "C4'" . U   B 2 53 ? 17.145 3.861   19.478  1.00 52.40  ? 60  U   R "C4'" 1 
ATOM   1876 O  "O4'" . U   B 2 53 ? 16.075 3.141   20.120  1.00 51.13  ? 60  U   R "O4'" 1 
ATOM   1877 C  "C3'" . U   B 2 53 ? 17.056 3.378   18.052  1.00 54.91  ? 60  U   R "C3'" 1 
ATOM   1878 O  "O3'" . U   B 2 53 ? 18.280 3.655   17.415  1.00 56.96  ? 60  U   R "O3'" 1 
ATOM   1879 C  "C2'" . U   B 2 53 ? 16.851 1.888   18.269  1.00 53.47  ? 60  U   R "C2'" 1 
ATOM   1880 O  "O2'" . U   B 2 53 ? 18.060 1.213   18.544  1.00 51.94  ? 60  U   R "O2'" 1 
ATOM   1881 C  "C1'" . U   B 2 53 ? 15.972 1.870   19.515  1.00 51.20  ? 60  U   R "C1'" 1 
ATOM   1882 N  N1    . U   B 2 53 ? 14.534 1.557   19.264  1.00 51.81  ? 60  U   R N1    1 
ATOM   1883 C  C2    . U   B 2 53 ? 14.173 0.283   18.856  1.00 52.54  ? 60  U   R C2    1 
ATOM   1884 O  O2    . U   B 2 53 ? 14.964 -0.624  18.672  1.00 52.55  ? 60  U   R O2    1 
ATOM   1885 N  N3    . U   B 2 53 ? 12.828 0.094   18.660  1.00 53.75  ? 60  U   R N3    1 
ATOM   1886 C  C4    . U   B 2 53 ? 11.824 1.025   18.833  1.00 54.51  ? 60  U   R C4    1 
ATOM   1887 O  O4    . U   B 2 53 ? 10.664 0.696   18.622  1.00 56.11  ? 60  U   R O4    1 
ATOM   1888 C  C5    . U   B 2 53 ? 12.271 2.328   19.261  1.00 53.97  ? 60  U   R C5    1 
ATOM   1889 C  C6    . U   B 2 53 ? 13.581 2.540   19.456  1.00 52.39  ? 60  U   R C6    1 
ATOM   1890 P  P     . A   B 2 54 ? 18.298 4.440   16.027  1.00 60.64  ? 61  A   R P     1 
ATOM   1891 O  OP1   . A   B 2 54 ? 19.704 4.820   15.764  1.00 60.84  ? 61  A   R OP1   1 
ATOM   1892 O  OP2   . A   B 2 54 ? 17.233 5.470   16.026  1.00 61.69  ? 61  A   R OP2   1 
ATOM   1893 O  "O5'" . A   B 2 54 ? 17.881 3.296   15.008  1.00 63.02  ? 61  A   R "O5'" 1 
ATOM   1894 C  "C5'" . A   B 2 54 ? 18.704 2.155   14.885  1.00 64.22  ? 61  A   R "C5'" 1 
ATOM   1895 C  "C4'" . A   B 2 54 ? 17.878 1.036   14.302  1.00 66.94  ? 61  A   R "C4'" 1 
ATOM   1896 O  "O4'" . A   B 2 54 ? 16.645 0.937   15.047  1.00 66.76  ? 61  A   R "O4'" 1 
ATOM   1897 C  "C3'" . A   B 2 54 ? 17.487 1.274   12.851  1.00 70.99  ? 61  A   R "C3'" 1 
ATOM   1898 O  "O3'" . A   B 2 54 ? 18.137 0.310   12.049  1.00 73.33  ? 61  A   R "O3'" 1 
ATOM   1899 C  "C2'" . A   B 2 54 ? 15.967 1.148   12.808  1.00 72.16  ? 61  A   R "C2'" 1 
ATOM   1900 O  "O2'" . A   B 2 54 ? 15.519 0.313   11.760  1.00 74.73  ? 61  A   R "O2'" 1 
ATOM   1901 C  "C1'" . A   B 2 54 ? 15.636 0.524   14.159  1.00 69.75  ? 61  A   R "C1'" 1 
ATOM   1902 N  N9    . A   B 2 54 ? 14.342 0.952   14.678  1.00 70.52  ? 61  A   R N9    1 
ATOM   1903 C  C8    . A   B 2 54 ? 13.984 2.188   15.155  1.00 70.41  ? 61  A   R C8    1 
ATOM   1904 N  N7    . A   B 2 54 ? 12.731 2.263   15.546  1.00 70.94  ? 61  A   R N7    1 
ATOM   1905 C  C5    . A   B 2 54 ? 12.241 0.988   15.308  1.00 71.70  ? 61  A   R C5    1 
ATOM   1906 C  C6    . A   B 2 54 ? 10.973 0.399   15.500  1.00 72.65  ? 61  A   R C6    1 
ATOM   1907 N  N6    . A   B 2 54 ? 9.929  1.063   16.006  1.00 72.89  ? 61  A   R N6    1 
ATOM   1908 N  N1    . A   B 2 54 ? 10.824 -0.904  15.150  1.00 73.55  ? 61  A   R N1    1 
ATOM   1909 C  C2    . A   B 2 54 ? 11.868 -1.578  14.638  1.00 73.22  ? 61  A   R C2    1 
ATOM   1910 N  N3    . A   B 2 54 ? 13.104 -1.131  14.413  1.00 72.47  ? 61  A   R N3    1 
ATOM   1911 C  C4    . A   B 2 54 ? 13.221 0.166   14.771  1.00 71.57  ? 61  A   R C4    1 
ATOM   1912 P  P     . A   B 2 55 ? 19.179 0.817   10.948  1.00 76.31  ? 62  A   R P     1 
ATOM   1913 O  OP1   . A   B 2 55 ? 20.375 1.363   11.645  1.00 73.84  ? 62  A   R OP1   1 
ATOM   1914 O  OP2   . A   B 2 55 ? 18.419 1.663   9.991   1.00 78.51  ? 62  A   R OP2   1 
ATOM   1915 O  "O5'" . A   B 2 55 ? 19.570 -0.554  10.214  1.00 77.07  ? 62  A   R "O5'" 1 
ATOM   1916 C  "C5'" . A   B 2 55 ? 20.917 -1.032  10.223  1.00 75.46  ? 62  A   R "C5'" 1 
ATOM   1917 C  "C4'" . A   B 2 55 ? 20.984 -2.547  10.312  1.00 74.30  ? 62  A   R "C4'" 1 
ATOM   1918 O  "O4'" . A   B 2 55 ? 20.738 -2.976  11.676  1.00 70.94  ? 62  A   R "O4'" 1 
ATOM   1919 C  "C3'" . A   B 2 55 ? 19.930 -3.307  9.522   1.00 76.04  ? 62  A   R "C3'" 1 
ATOM   1920 O  "O3'" . A   B 2 55 ? 20.201 -3.338  8.116   1.00 77.83  ? 62  A   R "O3'" 1 
ATOM   1921 C  "C2'" . A   B 2 55 ? 19.961 -4.671  10.217  1.00 74.84  ? 62  A   R "C2'" 1 
ATOM   1922 O  "O2'" . A   B 2 55 ? 21.075 -5.482  9.890   1.00 75.76  ? 62  A   R "O2'" 1 
ATOM   1923 C  "C1'" . A   B 2 55 ? 20.053 -4.218  11.666  1.00 71.20  ? 62  A   R "C1'" 1 
ATOM   1924 N  N9    . A   B 2 55 ? 18.750 -4.032  12.296  1.00 70.27  ? 62  A   R N9    1 
ATOM   1925 C  C8    . A   B 2 55 ? 18.059 -2.860  12.439  1.00 69.80  ? 62  A   R C8    1 
ATOM   1926 N  N7    . A   B 2 55 ? 16.912 -2.997  13.057  1.00 69.38  ? 62  A   R N7    1 
ATOM   1927 C  C5    . A   B 2 55 ? 16.844 -4.351  13.338  1.00 69.15  ? 62  A   R C5    1 
ATOM   1928 C  C6    . A   B 2 55 ? 15.872 -5.143  13.988  1.00 68.67  ? 62  A   R C6    1 
ATOM   1929 N  N6    . A   B 2 55 ? 14.735 -4.644  14.487  1.00 68.17  ? 62  A   R N6    1 
ATOM   1930 N  N1    . A   B 2 55 ? 16.116 -6.472  14.105  1.00 68.66  ? 62  A   R N1    1 
ATOM   1931 C  C2    . A   B 2 55 ? 17.258 -6.971  13.603  1.00 69.20  ? 62  A   R C2    1 
ATOM   1932 N  N3    . A   B 2 55 ? 18.243 -6.324  12.974  1.00 69.82  ? 62  A   R N3    1 
ATOM   1933 C  C4    . A   B 2 55 ? 17.973 -5.007  12.874  1.00 69.72  ? 62  A   R C4    1 
ATOM   1934 P  P     . A   B 2 56 ? 18.959 -3.276  7.102   1.00 80.08  ? 63  A   R P     1 
ATOM   1935 O  OP1   . A   B 2 56 ? 19.454 -3.082  5.719   1.00 83.42  ? 63  A   R OP1   1 
ATOM   1936 O  OP2   . A   B 2 56 ? 17.958 -2.334  7.654   1.00 78.88  ? 63  A   R OP2   1 
ATOM   1937 O  "O5'" . A   B 2 56 ? 18.359 -4.746  7.242   1.00 79.18  ? 63  A   R "O5'" 1 
ATOM   1938 C  "C5'" . A   B 2 56 ? 19.174 -5.872  6.977   1.00 78.74  ? 63  A   R "C5'" 1 
ATOM   1939 C  "C4'" . A   B 2 56 ? 18.424 -7.140  7.318   1.00 78.05  ? 63  A   R "C4'" 1 
ATOM   1940 O  "O4'" . A   B 2 56 ? 18.148 -7.197  8.737   1.00 73.83  ? 63  A   R "O4'" 1 
ATOM   1941 C  "C3'" . A   B 2 56 ? 17.049 -7.227  6.684   1.00 80.42  ? 63  A   R "C3'" 1 
ATOM   1942 O  "O3'" . A   B 2 56 ? 17.155 -7.605  5.319   1.00 84.83  ? 63  A   R "O3'" 1 
ATOM   1943 C  "C2'" . A   B 2 56 ? 16.384 -8.269  7.577   1.00 78.64  ? 63  A   R "C2'" 1 
ATOM   1944 O  "O2'" . A   B 2 56 ? 16.777 -9.596  7.280   1.00 80.05  ? 63  A   R "O2'" 1 
ATOM   1945 C  "C1'" . A   B 2 56 ? 16.901 -7.840  8.950   1.00 73.93  ? 63  A   R "C1'" 1 
ATOM   1946 N  N9    . A   B 2 56 ? 15.998 -6.924  9.648   1.00 71.49  ? 63  A   R N9    1 
ATOM   1947 C  C8    . A   B 2 56 ? 16.050 -5.557  9.647   1.00 70.92  ? 63  A   R C8    1 
ATOM   1948 N  N7    . A   B 2 56 ? 15.112 -4.984  10.360  1.00 69.53  ? 63  A   R N7    1 
ATOM   1949 C  C5    . A   B 2 56 ? 14.389 -6.048  10.865  1.00 68.85  ? 63  A   R C5    1 
ATOM   1950 C  C6    . A   B 2 56 ? 13.259 -6.112  11.705  1.00 67.63  ? 63  A   R C6    1 
ATOM   1951 N  N6    . A   B 2 56 ? 12.650 -5.029  12.188  1.00 66.58  ? 63  A   R N6    1 
ATOM   1952 N  N1    . A   B 2 56 ? 12.774 -7.332  12.031  1.00 68.22  ? 63  A   R N1    1 
ATOM   1953 C  C2    . A   B 2 56 ? 13.389 -8.421  11.541  1.00 69.57  ? 63  A   R C2    1 
ATOM   1954 N  N3    . A   B 2 56 ? 14.460 -8.482  10.742  1.00 70.68  ? 63  A   R N3    1 
ATOM   1955 C  C4    . A   B 2 56 ? 14.919 -7.253  10.437  1.00 70.16  ? 63  A   R C4    1 
ATOM   1956 P  P     . C   B 2 57 ? 16.254 -6.868  4.219   1.00 88.67  ? 64  C   R P     1 
ATOM   1957 O  OP1   . C   B 2 57 ? 16.815 -7.165  2.881   1.00 92.30  ? 64  C   R OP1   1 
ATOM   1958 O  OP2   . C   B 2 57 ? 16.038 -5.462  4.630   1.00 87.18  ? 64  C   R OP2   1 
ATOM   1959 O  "O5'" . C   B 2 57 ? 14.861 -7.626  4.402   1.00 89.84  ? 64  C   R "O5'" 1 
ATOM   1960 C  "C5'" . C   B 2 57 ? 14.774 -9.032  4.241   1.00 91.98  ? 64  C   R "C5'" 1 
ATOM   1961 C  "C4'" . C   B 2 57 ? 13.510 -9.547  4.892   1.00 92.13  ? 64  C   R "C4'" 1 
ATOM   1962 O  "O4'" . C   B 2 57 ? 13.564 -9.273  6.311   1.00 87.65  ? 64  C   R "O4'" 1 
ATOM   1963 C  "C3'" . C   B 2 57 ? 12.234 -8.854  4.447   1.00 95.04  ? 64  C   R "C3'" 1 
ATOM   1964 O  "O3'" . C   B 2 57 ? 11.787 -9.393  3.226   1.00 101.49 ? 64  C   R "O3'" 1 
ATOM   1965 C  "C2'" . C   B 2 57 ? 11.310 -9.177  5.612   1.00 92.23  ? 64  C   R "C2'" 1 
ATOM   1966 O  "O2'" . C   B 2 57 ? 10.836 -10.510 5.590   1.00 93.44  ? 64  C   R "O2'" 1 
ATOM   1967 C  "C1'" . C   B 2 57 ? 12.266 -8.968  6.785   1.00 87.28  ? 64  C   R "C1'" 1 
ATOM   1968 N  N1    . C   B 2 57 ? 12.247 -7.571  7.328   1.00 84.94  ? 64  C   R N1    1 
ATOM   1969 C  C2    . C   B 2 57 ? 11.342 -7.247  8.349   1.00 82.90  ? 64  C   R C2    1 
ATOM   1970 O  O2    . C   B 2 57 ? 10.581 -8.119  8.790   1.00 83.00  ? 64  C   R O2    1 
ATOM   1971 N  N3    . C   B 2 57 ? 11.333 -5.974  8.832   1.00 81.26  ? 64  C   R N3    1 
ATOM   1972 C  C4    . C   B 2 57 ? 12.169 -5.052  8.339   1.00 81.35  ? 64  C   R C4    1 
ATOM   1973 N  N4    . C   B 2 57 ? 12.117 -3.821  8.850   1.00 79.85  ? 64  C   R N4    1 
ATOM   1974 C  C5    . C   B 2 57 ? 13.098 -5.356  7.300   1.00 83.59  ? 64  C   R C5    1 
ATOM   1975 C  C6    . C   B 2 57 ? 13.098 -6.612  6.835   1.00 85.35  ? 64  C   R C6    1 
ATOM   1976 P  P     . C   B 2 58 ? 11.253 -8.430  2.072   1.00 106.82 ? 65  C   R P     1 
ATOM   1977 O  OP1   . C   B 2 58 ? 11.180 -9.223  0.825   1.00 111.20 ? 65  C   R OP1   1 
ATOM   1978 O  OP2   . C   B 2 58 ? 12.036 -7.176  2.081   1.00 105.38 ? 65  C   R OP2   1 
ATOM   1979 O  "O5'" . C   B 2 58 ? 9.782  -8.102  2.605   1.00 109.07 ? 65  C   R "O5'" 1 
ATOM   1980 C  "C5'" . C   B 2 58 ? 8.812  -9.137  2.730   1.00 114.35 ? 65  C   R "C5'" 1 
ATOM   1981 C  "C4'" . C   B 2 58 ? 7.568  -8.634  3.429   1.00 116.67 ? 65  C   R "C4'" 1 
ATOM   1982 O  "O4'" . C   B 2 58 ? 7.896  -8.245  4.785   1.00 112.07 ? 65  C   R "O4'" 1 
ATOM   1983 C  "C3'" . C   B 2 58 ? 6.984  -7.354  2.864   1.00 121.44 ? 65  C   R "C3'" 1 
ATOM   1984 O  "O3'" . C   B 2 58 ? 6.262  -7.554  1.667   1.00 131.41 ? 65  C   R "O3'" 1 
ATOM   1985 C  "C2'" . C   B 2 58 ? 6.118  -6.881  4.022   1.00 117.80 ? 65  C   R "C2'" 1 
ATOM   1986 O  "O2'" . C   B 2 58 ? 4.920  -7.614  4.178   1.00 119.01 ? 65  C   R "O2'" 1 
ATOM   1987 C  "C1'" . C   B 2 58 ? 7.081  -7.148  5.175   1.00 112.15 ? 65  C   R "C1'" 1 
ATOM   1988 N  N1    . C   B 2 58 ? 7.938  -5.955  5.518   1.00 109.49 ? 65  C   R N1    1 
ATOM   1989 C  C2    . C   B 2 58 ? 7.381  -4.852  6.194   1.00 107.87 ? 65  C   R C2    1 
ATOM   1990 O  O2    . C   B 2 58 ? 6.190  -4.856  6.524   1.00 108.58 ? 65  C   R O2    1 
ATOM   1991 N  N3    . C   B 2 58 ? 8.173  -3.794  6.497   1.00 105.91 ? 65  C   R N3    1 
ATOM   1992 C  C4    . C   B 2 58 ? 9.460  -3.797  6.146   1.00 105.46 ? 65  C   R C4    1 
ATOM   1993 N  N4    . C   B 2 58 ? 10.192 -2.728  6.466   1.00 103.75 ? 65  C   R N4    1 
ATOM   1994 C  C5    . C   B 2 58 ? 10.049 -4.897  5.453   1.00 107.08 ? 65  C   R C5    1 
ATOM   1995 C  C6    . C   B 2 58 ? 9.261  -5.941  5.165   1.00 108.97 ? 65  C   R C6    1 
ATOM   1996 P  P     . A   B 2 59 ? 6.432  -6.428  0.541   1.00 50.91  ? 660 A   R P     1 
ATOM   1997 O  OP1   . A   B 2 59 ? 5.824  -6.898  -0.731  1.00 50.65  ? 660 A   R OP1   1 
ATOM   1998 O  OP2   . A   B 2 59 ? 7.850  -5.990  0.533   1.00 50.57  ? 660 A   R OP2   1 
ATOM   1999 O  "O5'" . A   B 2 59 ? 5.586  -5.204  1.146   1.00 52.32  ? 660 A   R "O5'" 1 
ATOM   2000 C  "C5'" . A   B 2 59 ? 4.170  -5.253  1.262   1.00 54.36  ? 660 A   R "C5'" 1 
ATOM   2001 C  "C4'" . A   B 2 59 ? 3.644  -4.086  2.085   1.00 55.79  ? 660 A   R "C4'" 1 
ATOM   2002 O  "O4'" . A   B 2 59 ? 4.318  -4.018  3.371   1.00 56.16  ? 660 A   R "O4'" 1 
ATOM   2003 C  "C3'" . A   B 2 59 ? 3.845  -2.701  1.483   1.00 56.04  ? 660 A   R "C3'" 1 
ATOM   2004 O  "O3'" . A   B 2 59 ? 2.845  -2.395  0.531   1.00 56.80  ? 660 A   R "O3'" 1 
ATOM   2005 C  "C2'" . A   B 2 59 ? 3.714  -1.834  2.727   1.00 56.28  ? 660 A   R "C2'" 1 
ATOM   2006 O  "O2'" . A   B 2 59 ? 2.370  -1.680  3.151   1.00 55.35  ? 660 A   R "O2'" 1 
ATOM   2007 C  "C1'" . A   B 2 59 ? 4.538  -2.657  3.717   1.00 56.70  ? 660 A   R "C1'" 1 
ATOM   2008 N  N9    . A   B 2 59 ? 5.982  -2.353  3.703   1.00 57.49  ? 660 A   R N9    1 
ATOM   2009 C  C8    . A   B 2 59 ? 6.983  -3.102  3.139   1.00 57.75  ? 660 A   R C8    1 
ATOM   2010 N  N7    . A   B 2 59 ? 8.188  -2.598  3.276   1.00 57.71  ? 660 A   R N7    1 
ATOM   2011 C  C5    . A   B 2 59 ? 7.975  -1.431  3.982   1.00 57.55  ? 660 A   R C5    1 
ATOM   2012 C  C6    . A   B 2 59 ? 8.857  -0.434  4.446   1.00 57.66  ? 660 A   R C6    1 
ATOM   2013 N  N6    . A   B 2 59 ? 10.178 -0.475  4.246   1.00 57.87  ? 660 A   R N6    1 
ATOM   2014 N  N1    . A   B 2 59 ? 8.330  0.612   5.120   1.00 57.81  ? 660 A   R N1    1 
ATOM   2015 C  C2    . A   B 2 59 ? 7.003  0.655   5.314   1.00 57.81  ? 660 A   R C2    1 
ATOM   2016 N  N3    . A   B 2 59 ? 6.076  -0.224  4.922   1.00 57.86  ? 660 A   R N3    1 
ATOM   2017 C  C4    . A   B 2 59 ? 6.626  -1.258  4.253   1.00 57.62  ? 660 A   R C4    1 
ATOM   2018 P  P     . U   B 2 60 ? 3.196  -1.494  -0.747  1.00 57.84  ? 661 U   R P     1 
ATOM   2019 O  OP1   . U   B 2 60 ? 1.979  -1.469  -1.594  1.00 58.08  ? 661 U   R OP1   1 
ATOM   2020 O  OP2   . U   B 2 60 ? 4.475  -1.952  -1.340  1.00 57.35  ? 661 U   R OP2   1 
ATOM   2021 O  "O5'" . U   B 2 60 ? 3.421  -0.042  -0.113  1.00 57.85  ? 661 U   R "O5'" 1 
ATOM   2022 C  "C5'" . U   B 2 60 ? 2.329  0.632   0.518   1.00 59.02  ? 661 U   R "C5'" 1 
ATOM   2023 C  "C4'" . U   B 2 60 ? 2.780  1.891   1.234   1.00 59.59  ? 661 U   R "C4'" 1 
ATOM   2024 O  "O4'" . U   B 2 60 ? 3.750  1.566   2.266   1.00 59.86  ? 661 U   R "O4'" 1 
ATOM   2025 C  "C3'" . U   B 2 60 ? 3.508  2.894   0.356   1.00 59.78  ? 661 U   R "C3'" 1 
ATOM   2026 O  "O3'" . U   B 2 60 ? 2.587  3.681   -0.375  1.00 60.42  ? 661 U   R "O3'" 1 
ATOM   2027 C  "C2'" . U   B 2 60 ? 4.272  3.698   1.397   1.00 59.60  ? 661 U   R "C2'" 1 
ATOM   2028 O  "O2'" . U   B 2 60 ? 3.441  4.627   2.070   1.00 59.36  ? 661 U   R "O2'" 1 
ATOM   2029 C  "C1'" . U   B 2 60 ? 4.741  2.582   2.337   1.00 59.30  ? 661 U   R "C1'" 1 
ATOM   2030 N  N1    . U   B 2 60 ? 6.124  2.018   2.013   1.00 58.59  ? 661 U   R N1    1 
ATOM   2031 C  C2    . U   B 2 60 ? 7.267  2.695   2.434   1.00 58.15  ? 661 U   R C2    1 
ATOM   2032 O  O2    . U   B 2 60 ? 7.245  3.741   3.065   1.00 57.84  ? 661 U   R O2    1 
ATOM   2033 N  N3    . U   B 2 60 ? 8.465  2.102   2.088   1.00 57.57  ? 661 U   R N3    1 
ATOM   2034 C  C4    . U   B 2 60 ? 8.641  0.925   1.378   1.00 57.16  ? 661 U   R C4    1 
ATOM   2035 O  O4    . U   B 2 60 ? 9.772  0.515   1.144   1.00 56.59  ? 661 U   R O4    1 
ATOM   2036 C  C5    . U   B 2 60 ? 7.417  0.275   0.977   1.00 57.30  ? 661 U   R C5    1 
ATOM   2037 C  C6    . U   B 2 60 ? 6.240  0.831   1.301   1.00 57.74  ? 661 U   R C6    1 
ATOM   2038 P  P     . U   B 2 61 ? 2.961  4.093   -1.875  1.00 61.87  ? 662 U   R P     1 
ATOM   2039 O  OP1   . U   B 2 61 ? 1.796  4.794   -2.470  1.00 61.94  ? 662 U   R OP1   1 
ATOM   2040 O  OP2   . U   B 2 61 ? 3.536  2.917   -2.565  1.00 60.97  ? 662 U   R OP2   1 
ATOM   2041 O  "O5'" . U   B 2 61 ? 4.129  5.161   -1.634  1.00 62.13  ? 662 U   R "O5'" 1 
ATOM   2042 C  "C5'" . U   B 2 61 ? 3.784  6.478   -1.209  1.00 62.30  ? 662 U   R "C5'" 1 
ATOM   2043 C  "C4'" . U   B 2 61 ? 4.442  7.508   -2.104  1.00 62.53  ? 662 U   R "C4'" 1 
ATOM   2044 O  "O4'" . U   B 2 61 ? 5.856  7.215   -2.136  1.00 62.69  ? 662 U   R "O4'" 1 
ATOM   2045 C  "C3'" . U   B 2 61 ? 3.966  7.550   -3.561  1.00 62.72  ? 662 U   R "C3'" 1 
ATOM   2046 O  "O3'" . U   B 2 61 ? 3.626  8.885   -3.956  1.00 62.71  ? 662 U   R "O3'" 1 
ATOM   2047 C  "C2'" . U   B 2 61 ? 5.164  7.033   -4.354  1.00 62.75  ? 662 U   R "C2'" 1 
ATOM   2048 O  "O2'" . U   B 2 61 ? 5.283  7.653   -5.618  1.00 62.81  ? 662 U   R "O2'" 1 
ATOM   2049 C  "C1'" . U   B 2 61 ? 6.321  7.434   -3.445  1.00 63.06  ? 662 U   R "C1'" 1 
ATOM   2050 N  N1    . U   B 2 61 ? 7.578  6.655   -3.622  1.00 63.62  ? 662 U   R N1    1 
ATOM   2051 C  C2    . U   B 2 61 ? 8.552  7.146   -4.472  1.00 63.92  ? 662 U   R C2    1 
ATOM   2052 O  O2    . U   B 2 61 ? 8.433  8.187   -5.095  1.00 64.31  ? 662 U   R O2    1 
ATOM   2053 N  N3    . U   B 2 61 ? 9.680  6.363   -4.568  1.00 63.71  ? 662 U   R N3    1 
ATOM   2054 C  C4    . U   B 2 61 ? 9.920  5.171   -3.907  1.00 63.86  ? 662 U   R C4    1 
ATOM   2055 O  O4    . U   B 2 61 ? 10.975 4.581   -4.089  1.00 64.25  ? 662 U   R O4    1 
ATOM   2056 C  C5    . U   B 2 61 ? 8.865  4.725   -3.032  1.00 63.86  ? 662 U   R C5    1 
ATOM   2057 C  C6    . U   B 2 61 ? 7.757  5.471   -2.924  1.00 63.82  ? 662 U   R C6    1 
ATOM   2058 P  P     . G   B 2 62 ? 2.267  9.594   -3.478  1.00 63.10  ? 663 G   R P     1 
ATOM   2059 O  OP1   . G   B 2 62 ? 1.184  8.583   -3.489  1.00 63.90  ? 663 G   R OP1   1 
ATOM   2060 O  OP2   . G   B 2 62 ? 2.128  10.818  -4.295  1.00 62.77  ? 663 G   R OP2   1 
ATOM   2061 O  "O5'" . G   B 2 62 ? 2.539  10.024  -1.957  1.00 62.05  ? 663 G   R "O5'" 1 
ATOM   2062 C  "C5'" . G   B 2 62 ? 1.490  9.997   -0.993  1.00 61.52  ? 663 G   R "C5'" 1 
ATOM   2063 C  "C4'" . G   B 2 62 ? 2.041  10.059  0.421   1.00 61.70  ? 663 G   R "C4'" 1 
ATOM   2064 O  "O4'" . G   B 2 62 ? 3.131  9.114   0.576   1.00 61.56  ? 663 G   R "O4'" 1 
ATOM   2065 C  "C3'" . G   B 2 62 ? 2.681  11.379  0.799   1.00 61.89  ? 663 G   R "C3'" 1 
ATOM   2066 O  "O3'" . G   B 2 62 ? 1.722  12.333  1.218   1.00 62.85  ? 663 G   R "O3'" 1 
ATOM   2067 C  "C2'" . G   B 2 62 ? 3.644  10.981  1.912   1.00 61.18  ? 663 G   R "C2'" 1 
ATOM   2068 O  "O2'" . G   B 2 62 ? 2.986  10.761  3.145   1.00 60.87  ? 663 G   R "O2'" 1 
ATOM   2069 C  "C1'" . G   B 2 62 ? 4.185  9.672   1.348   1.00 60.62  ? 663 G   R "C1'" 1 
ATOM   2070 N  N9    . G   B 2 62 ? 5.374  9.781   0.492   1.00 59.37  ? 663 G   R N9    1 
ATOM   2071 C  C8    . G   B 2 62 ? 5.668  10.760  -0.429  1.00 58.82  ? 663 G   R C8    1 
ATOM   2072 N  N7    . G   B 2 62 ? 6.796  10.582  -1.050  1.00 58.14  ? 663 G   R N7    1 
ATOM   2073 C  C5    . G   B 2 62 ? 7.298  9.410   -0.512  1.00 58.33  ? 663 G   R C5    1 
ATOM   2074 C  C6    . G   B 2 62 ? 8.501  8.718   -0.799  1.00 58.02  ? 663 G   R C6    1 
ATOM   2075 O  O6    . G   B 2 62 ? 9.383  9.024   -1.613  1.00 57.84  ? 663 G   R O6    1 
ATOM   2076 N  N1    . G   B 2 62 ? 8.634  7.560   -0.031  1.00 57.83  ? 663 G   R N1    1 
ATOM   2077 C  C2    . G   B 2 62 ? 7.710  7.130   0.896   1.00 57.97  ? 663 G   R C2    1 
ATOM   2078 N  N2    . G   B 2 62 ? 7.997  5.994   1.543   1.00 58.03  ? 663 G   R N2    1 
ATOM   2079 N  N3    . G   B 2 62 ? 6.578  7.768   1.174   1.00 58.34  ? 663 G   R N3    1 
ATOM   2080 C  C4    . G   B 2 62 ? 6.434  8.901   0.437   1.00 58.78  ? 663 G   R C4    1 
ATOM   2081 P  P     . C   B 2 63 ? 1.916  13.820  0.658   1.00 63.94  ? 664 C   R P     1 
ATOM   2082 O  OP1   . C   B 2 63 ? 0.777  14.641  1.130   1.00 63.56  ? 664 C   R OP1   1 
ATOM   2083 O  OP2   . C   B 2 63 ? 2.217  13.705  -0.792  1.00 63.32  ? 664 C   R OP2   1 
ATOM   2084 O  "O5'" . C   B 2 63 ? 3.247  14.334  1.397   1.00 63.57  ? 664 C   R "O5'" 1 
ATOM   2085 C  "C5'" . C   B 2 63 ? 3.294  14.425  2.823   1.00 62.86  ? 664 C   R "C5'" 1 
ATOM   2086 C  "C4'" . C   B 2 63 ? 3.505  15.855  3.284   1.00 62.20  ? 664 C   R "C4'" 1 
ATOM   2087 O  "O4'" . C   B 2 63 ? 4.357  16.542  2.338   1.00 60.93  ? 664 C   R "O4'" 1 
ATOM   2088 C  "C3'" . C   B 2 63 ? 2.245  16.702  3.419   1.00 62.41  ? 664 C   R "C3'" 1 
ATOM   2089 O  "O3'" . C   B 2 63 ? 2.368  17.516  4.578   1.00 63.97  ? 664 C   R "O3'" 1 
ATOM   2090 C  "C2'" . C   B 2 63 ? 2.247  17.554  2.156   1.00 61.80  ? 664 C   R "C2'" 1 
ATOM   2091 O  "O2'" . C   B 2 63 ? 1.621  18.805  2.365   1.00 62.56  ? 664 C   R "O2'" 1 
ATOM   2092 C  "C1'" . C   B 2 63 ? 3.744  17.743  1.930   1.00 60.18  ? 664 C   R "C1'" 1 
ATOM   2093 N  N1    . C   B 2 63 ? 4.146  18.025  0.517   1.00 58.13  ? 664 C   R N1    1 
ATOM   2094 C  C2    . C   B 2 63 ? 4.649  19.292  0.186   1.00 56.80  ? 664 C   R C2    1 
ATOM   2095 O  O2    . C   B 2 63 ? 4.744  20.157  1.061   1.00 56.60  ? 664 C   R O2    1 
ATOM   2096 N  N3    . C   B 2 63 ? 5.018  19.542  -1.094  1.00 56.04  ? 664 C   R N3    1 
ATOM   2097 C  C4    . C   B 2 63 ? 4.901  18.590  -2.021  1.00 56.19  ? 664 C   R C4    1 
ATOM   2098 N  N4    . C   B 2 63 ? 5.276  18.893  -3.264  1.00 55.84  ? 664 C   R N4    1 
ATOM   2099 C  C5    . C   B 2 63 ? 4.394  17.290  -1.714  1.00 56.81  ? 664 C   R C5    1 
ATOM   2100 C  C6    . C   B 2 63 ? 4.037  17.051  -0.444  1.00 57.67  ? 664 C   R C6    1 
ATOM   2101 P  P     . A   B 2 64 ? 1.121  17.786  5.541   1.00 65.35  ? 665 A   R P     1 
ATOM   2102 O  OP1   . A   B 2 64 ? 0.050  16.851  5.128   1.00 65.85  ? 665 A   R OP1   1 
ATOM   2103 O  OP2   . A   B 2 64 ? 0.886  19.247  5.547   1.00 65.45  ? 665 A   R OP2   1 
ATOM   2104 O  "O5'" . A   B 2 64 ? 1.613  17.392  7.015   1.00 65.17  ? 665 A   R "O5'" 1 
ATOM   2105 C  "C5'" . A   B 2 64 ? 2.383  16.215  7.221   1.00 65.94  ? 665 A   R "C5'" 1 
ATOM   2106 C  "C4'" . A   B 2 64 ? 3.832  16.555  7.526   1.00 66.40  ? 665 A   R "C4'" 1 
ATOM   2107 O  "O4'" . A   B 2 64 ? 4.506  17.129  6.379   1.00 65.81  ? 665 A   R "O4'" 1 
ATOM   2108 C  "C3'" . A   B 2 64 ? 4.016  17.621  8.585   1.00 67.01  ? 665 A   R "C3'" 1 
ATOM   2109 O  "O3'" . A   B 2 64 ? 3.823  17.047  9.858   1.00 68.57  ? 665 A   R "O3'" 1 
ATOM   2110 C  "C2'" . A   B 2 64 ? 5.451  18.070  8.350   1.00 66.35  ? 665 A   R "C2'" 1 
ATOM   2111 O  "O2'" . A   B 2 64 ? 6.399  17.230  8.976   1.00 66.16  ? 665 A   R "O2'" 1 
ATOM   2112 C  "C1'" . A   B 2 64 ? 5.568  17.955  6.830   1.00 65.65  ? 665 A   R "C1'" 1 
ATOM   2113 N  N9    . A   B 2 64 ? 5.542  19.239  6.122   1.00 65.22  ? 665 A   R N9    1 
ATOM   2114 C  C8    . A   B 2 64 ? 4.604  19.687  5.229   1.00 64.96  ? 665 A   R C8    1 
ATOM   2115 N  N7    . A   B 2 64 ? 4.851  20.883  4.744   1.00 64.49  ? 665 A   R N7    1 
ATOM   2116 C  C5    . A   B 2 64 ? 6.037  21.248  5.358   1.00 64.38  ? 665 A   R C5    1 
ATOM   2117 C  C6    . A   B 2 64 ? 6.843  22.406  5.277   1.00 64.31  ? 665 A   R C6    1 
ATOM   2118 N  N6    . A   B 2 64 ? 6.552  23.453  4.505   1.00 64.28  ? 665 A   R N6    1 
ATOM   2119 N  N1    . A   B 2 64 ? 7.970  22.460  6.020   1.00 64.25  ? 665 A   R N1    1 
ATOM   2120 C  C2    . A   B 2 64 ? 8.271  21.414  6.799   1.00 64.68  ? 665 A   R C2    1 
ATOM   2121 N  N3    . A   B 2 64 ? 7.595  20.273  6.959   1.00 64.88  ? 665 A   R N3    1 
ATOM   2122 C  C4    . A   B 2 64 ? 6.478  20.250  6.207   1.00 64.81  ? 665 A   R C4    1 
ATOM   2123 P  P     . C   B 2 65 ? 2.950  17.867  10.913  1.00 70.00  ? 666 C   R P     1 
ATOM   2124 O  OP1   . C   B 2 65 ? 2.644  16.965  12.050  1.00 70.07  ? 666 C   R OP1   1 
ATOM   2125 O  OP2   . C   B 2 65 ? 1.842  18.508  10.164  1.00 70.19  ? 666 C   R OP2   1 
ATOM   2126 O  "O5'" . C   B 2 65 ? 3.962  19.009  11.403  1.00 70.29  ? 666 C   R "O5'" 1 
ATOM   2127 C  "C5'" . C   B 2 65 ? 5.088  18.648  12.203  1.00 71.61  ? 666 C   R "C5'" 1 
ATOM   2128 C  "C4'" . C   B 2 65 ? 5.974  19.840  12.512  1.00 72.56  ? 666 C   R "C4'" 1 
ATOM   2129 O  "O4'" . C   B 2 65 ? 6.627  20.255  11.287  1.00 72.47  ? 666 C   R "O4'" 1 
ATOM   2130 C  "C3'" . C   B 2 65 ? 5.249  21.079  13.029  1.00 73.50  ? 666 C   R "C3'" 1 
ATOM   2131 O  "O3'" . C   B 2 65 ? 5.102  21.033  14.458  1.00 74.93  ? 666 C   R "O3'" 1 
ATOM   2132 C  "C2'" . C   B 2 65 ? 6.139  22.224  12.537  1.00 73.02  ? 666 C   R "C2'" 1 
ATOM   2133 O  "O2'" . C   B 2 65 ? 7.211  22.524  13.414  1.00 72.80  ? 666 C   R "O2'" 1 
ATOM   2134 C  "C1'" . C   B 2 65 ? 6.674  21.668  11.214  1.00 72.46  ? 666 C   R "C1'" 1 
ATOM   2135 N  N1    . C   B 2 65 ? 5.925  22.129  9.990   1.00 72.23  ? 666 C   R N1    1 
ATOM   2136 C  C2    . C   B 2 65 ? 6.406  23.227  9.251   1.00 72.22  ? 666 C   R C2    1 
ATOM   2137 O  O2    . C   B 2 65 ? 7.438  23.815  9.601   1.00 72.47  ? 666 C   R O2    1 
ATOM   2138 N  N3    . C   B 2 65 ? 5.719  23.628  8.149   1.00 71.97  ? 666 C   R N3    1 
ATOM   2139 C  C4    . C   B 2 65 ? 4.605  22.993  7.776   1.00 72.01  ? 666 C   R C4    1 
ATOM   2140 N  N4    . C   B 2 65 ? 3.976  23.436  6.683   1.00 71.77  ? 666 C   R N4    1 
ATOM   2141 C  C5    . C   B 2 65 ? 4.095  21.874  8.506   1.00 72.26  ? 666 C   R C5    1 
ATOM   2142 C  C6    . C   B 2 65 ? 4.781  21.485  9.591   1.00 72.29  ? 666 C   R C6    1 
ATOM   2143 P  P     . U   B 2 66 ? 3.673  20.698  15.123  1.00 75.99  ? 667 U   R P     1 
ATOM   2144 O  OP1   . U   B 2 66 ? 3.362  19.265  14.904  1.00 75.60  ? 667 U   R OP1   1 
ATOM   2145 O  OP2   . U   B 2 66 ? 2.709  21.732  14.676  1.00 75.83  ? 667 U   R OP2   1 
ATOM   2146 O  "O5'" . U   B 2 66 ? 3.948  20.913  16.687  1.00 75.77  ? 667 U   R "O5'" 1 
ATOM   2147 C  "C5'" . U   B 2 66 ? 4.970  20.158  17.340  1.00 74.97  ? 667 U   R "C5'" 1 
ATOM   2148 C  "C4'" . U   B 2 66 ? 4.426  18.983  18.143  1.00 73.90  ? 667 U   R "C4'" 1 
ATOM   2149 O  "O4'" . U   B 2 66 ? 2.975  18.946  18.201  1.00 73.43  ? 667 U   R "O4'" 1 
ATOM   2150 C  "C3'" . U   B 2 66 ? 4.733  17.593  17.603  1.00 73.27  ? 667 U   R "C3'" 1 
ATOM   2151 O  "O3'" . U   B 2 66 ? 6.124  17.261  17.718  1.00 72.46  ? 667 U   R "O3'" 1 
ATOM   2152 C  "C2'" . U   B 2 66 ? 3.853  16.769  18.541  1.00 73.14  ? 667 U   R "C2'" 1 
ATOM   2153 O  "O2'" . U   B 2 66 ? 4.453  16.528  19.803  1.00 73.11  ? 667 U   R "O2'" 1 
ATOM   2154 C  "C1'" . U   B 2 66 ? 2.614  17.662  18.703  1.00 72.87  ? 667 U   R "C1'" 1 
ATOM   2155 N  N1    . U   B 2 66 ? 1.347  17.127  18.045  1.00 72.09  ? 667 U   R N1    1 
ATOM   2156 C  C2    . U   B 2 66 ? 0.843  15.878  18.398  1.00 71.61  ? 667 U   R C2    1 
ATOM   2157 O  O2    . U   B 2 66 ? 1.358  15.142  19.220  1.00 71.89  ? 667 U   R O2    1 
ATOM   2158 N  N3    . U   B 2 66 ? -0.308 15.494  17.749  1.00 70.87  ? 667 U   R N3    1 
ATOM   2159 C  C4    . U   B 2 66 ? -1.008 16.212  16.796  1.00 70.67  ? 667 U   R C4    1 
ATOM   2160 O  O4    . U   B 2 66 ? -2.023 15.732  16.300  1.00 70.09  ? 667 U   R O4    1 
ATOM   2161 C  C5    . U   B 2 66 ? -0.436 17.498  16.475  1.00 71.16  ? 667 U   R C5    1 
ATOM   2162 C  C6    . U   B 2 66 ? 0.688  17.898  17.095  1.00 71.81  ? 667 U   R C6    1 
ATOM   2163 P  P     . C   B 2 67 ? 6.978  16.704  16.470  1.00 71.74  ? 668 C   R P     1 
ATOM   2164 O  OP1   . C   B 2 67 ? 8.398  17.046  16.736  1.00 71.29  ? 668 C   R OP1   1 
ATOM   2165 O  OP2   . C   B 2 67 ? 6.339  17.134  15.202  1.00 71.66  ? 668 C   R OP2   1 
ATOM   2166 O  "O5'" . C   B 2 67 ? 6.790  15.119  16.559  1.00 69.44  ? 668 C   R "O5'" 1 
ATOM   2167 C  "C5'" . C   B 2 67 ? 7.247  14.412  17.703  1.00 66.37  ? 668 C   R "C5'" 1 
ATOM   2168 C  "C4'" . C   B 2 67 ? 6.328  13.242  17.986  1.00 63.95  ? 668 C   R "C4'" 1 
ATOM   2169 O  "O4'" . C   B 2 67 ? 5.001  13.745  18.264  1.00 63.00  ? 668 C   R "O4'" 1 
ATOM   2170 C  "C3'" . C   B 2 67 ? 6.072  12.307  16.816  1.00 62.63  ? 668 C   R "C3'" 1 
ATOM   2171 O  "O3'" . C   B 2 67 ? 7.160  11.431  16.555  1.00 60.81  ? 668 C   R "O3'" 1 
ATOM   2172 C  "C2'" . C   B 2 67 ? 4.839  11.579  17.332  1.00 62.72  ? 668 C   R "C2'" 1 
ATOM   2173 O  "O2'" . C   B 2 67 ? 5.130  10.608  18.321  1.00 63.39  ? 668 C   R "O2'" 1 
ATOM   2174 C  "C1'" . C   B 2 67 ? 4.053  12.755  17.908  1.00 62.53  ? 668 C   R "C1'" 1 
ATOM   2175 N  N1    . C   B 2 67 ? 3.031  13.264  16.921  1.00 61.99  ? 668 C   R N1    1 
ATOM   2176 C  C2    . C   B 2 67 ? 1.760  12.675  16.931  1.00 61.71  ? 668 C   R C2    1 
ATOM   2177 O  O2    . C   B 2 67 ? 1.516  11.783  17.752  1.00 61.81  ? 668 C   R O2    1 
ATOM   2178 N  N3    . C   B 2 67 ? 0.818  13.092  16.048  1.00 61.49  ? 668 C   R N3    1 
ATOM   2179 C  C4    . C   B 2 67 ? 1.107  14.054  15.175  1.00 61.64  ? 668 C   R C4    1 
ATOM   2180 N  N4    . C   B 2 67 ? 0.135  14.424  14.334  1.00 61.72  ? 668 C   R N4    1 
ATOM   2181 C  C5    . C   B 2 67 ? 2.398  14.672  15.135  1.00 61.71  ? 668 C   R C5    1 
ATOM   2182 C  C6    . C   B 2 67 ? 3.322  14.249  16.011  1.00 61.71  ? 668 C   R C6    1 
ATOM   2183 P  P     . C   B 2 68 ? 7.307  10.792  15.091  1.00 59.47  ? 669 C   R P     1 
ATOM   2184 O  OP1   . C   B 2 68 ? 8.642  10.158  14.980  1.00 59.11  ? 669 C   R OP1   1 
ATOM   2185 O  OP2   . C   B 2 68 ? 6.908  11.814  14.096  1.00 60.01  ? 669 C   R OP2   1 
ATOM   2186 O  "O5'" . C   B 2 68 ? 6.173  9.659   15.093  1.00 57.48  ? 669 C   R "O5'" 1 
ATOM   2187 C  "C5'" . C   B 2 68 ? 6.325  8.505   15.910  1.00 54.60  ? 669 C   R "C5'" 1 
ATOM   2188 C  "C4'" . C   B 2 68 ? 5.052  7.680   15.971  1.00 52.33  ? 669 C   R "C4'" 1 
ATOM   2189 O  "O4'" . C   B 2 68 ? 3.907  8.503   16.318  1.00 51.89  ? 669 C   R "O4'" 1 
ATOM   2190 C  "C3'" . C   B 2 68 ? 4.636  7.026   14.662  1.00 50.43  ? 669 C   R "C3'" 1 
ATOM   2191 O  "O3'" . C   B 2 68 ? 5.416  5.865   14.387  1.00 47.03  ? 669 C   R "O3'" 1 
ATOM   2192 C  "C2'" . C   B 2 68 ? 3.176  6.704   14.965  1.00 50.80  ? 669 C   R "C2'" 1 
ATOM   2193 O  "O2'" . C   B 2 68 ? 3.011  5.586   15.817  1.00 50.94  ? 669 C   R "O2'" 1 
ATOM   2194 C  "C1'" . C   B 2 68 ? 2.753  7.991   15.670  1.00 51.15  ? 669 C   R "C1'" 1 
ATOM   2195 N  N1    . C   B 2 68 ? 2.188  9.027   14.732  1.00 50.94  ? 669 C   R N1    1 
ATOM   2196 C  C2    . C   B 2 68 ? 0.921  8.834   14.151  1.00 50.85  ? 669 C   R C2    1 
ATOM   2197 O  O2    . C   B 2 68 ? 0.272  7.812   14.416  1.00 50.87  ? 669 C   R O2    1 
ATOM   2198 N  N3    . C   B 2 68 ? 0.430  9.785   13.311  1.00 50.66  ? 669 C   R N3    1 
ATOM   2199 C  C4    . C   B 2 68 ? 1.147  10.880  13.039  1.00 50.65  ? 669 C   R C4    1 
ATOM   2200 N  N4    . C   B 2 68 ? 0.627  11.784  12.205  1.00 50.58  ? 669 C   R N4    1 
ATOM   2201 C  C5    . C   B 2 68 ? 2.436  11.096  13.615  1.00 50.90  ? 669 C   R C5    1 
ATOM   2202 C  C6    . C   B 2 68 ? 2.908  10.157  14.445  1.00 50.81  ? 669 C   R C6    1 
ATOM   2203 P  P     . G   B 2 69 ? 5.670  5.429   12.869  1.00 100.75 ? 75  G   R P     1 
ATOM   2204 O  OP1   . G   B 2 69 ? 6.823  4.500   12.871  1.00 98.35  ? 75  G   R OP1   1 
ATOM   2205 O  OP2   . G   B 2 69 ? 5.693  6.645   12.029  1.00 103.56 ? 75  G   R OP2   1 
ATOM   2206 O  "O5'" . G   B 2 69 ? 4.327  4.652   12.479  1.00 100.35 ? 75  G   R "O5'" 1 
ATOM   2207 C  "C5'" . G   B 2 69 ? 3.963  3.433   13.113  1.00 94.26  ? 75  G   R "C5'" 1 
ATOM   2208 C  "C4'" . G   B 2 69 ? 3.070  2.610   12.203  1.00 94.04  ? 75  G   R "C4'" 1 
ATOM   2209 O  "O4'" . G   B 2 69 ? 3.449  2.797   10.814  1.00 96.04  ? 75  G   R "O4'" 1 
ATOM   2210 C  "C3'" . G   B 2 69 ? 3.177  1.112   12.424  1.00 90.60  ? 75  G   R "C3'" 1 
ATOM   2211 O  "O3'" . G   B 2 69 ? 2.313  0.714   13.462  1.00 87.16  ? 75  G   R "O3'" 1 
ATOM   2212 C  "C2'" . G   B 2 69 ? 2.781  0.556   11.060  1.00 94.18  ? 75  G   R "C2'" 1 
ATOM   2213 O  "O2'" . G   B 2 69 ? 1.390  0.569   10.813  1.00 96.60  ? 75  G   R "O2'" 1 
ATOM   2214 C  "C1'" . G   B 2 69 ? 3.498  1.547   10.147  1.00 96.12  ? 75  G   R "C1'" 1 
ATOM   2215 N  N9    . G   B 2 69 ? 4.893  1.172   9.882   1.00 94.12  ? 75  G   R N9    1 
ATOM   2216 C  C8    . G   B 2 69 ? 6.032  1.774   10.369  1.00 91.39  ? 75  G   R C8    1 
ATOM   2217 N  N7    . G   B 2 69 ? 7.139  1.212   9.972   1.00 90.40  ? 75  G   R N7    1 
ATOM   2218 C  C5    . G   B 2 69 ? 6.714  0.165   9.166   1.00 92.60  ? 75  G   R C5    1 
ATOM   2219 C  C6    . G   B 2 69 ? 7.469  -0.800  8.451   1.00 93.07  ? 75  G   R C6    1 
ATOM   2220 O  O6    . G   B 2 69 ? 8.702  -0.913  8.394   1.00 91.41  ? 75  G   R O6    1 
ATOM   2221 N  N1    . G   B 2 69 ? 6.650  -1.692  7.754   1.00 95.70  ? 75  G   R N1    1 
ATOM   2222 C  C2    . G   B 2 69 ? 5.273  -1.653  7.754   1.00 97.45  ? 75  G   R C2    1 
ATOM   2223 N  N2    . G   B 2 69 ? 4.643  -2.586  7.032   1.00 100.24 ? 75  G   R N2    1 
ATOM   2224 N  N3    . G   B 2 69 ? 4.557  -0.755  8.418   1.00 97.06  ? 75  G   R N3    1 
ATOM   2225 C  C4    . G   B 2 69 ? 5.336  0.124   9.101   1.00 94.73  ? 75  G   R C4    1 
ATOM   2226 P  P     . G   B 2 70 ? 2.896  -0.173  14.653  1.00 81.96  ? 76  G   R P     1 
ATOM   2227 O  OP1   . G   B 2 70 ? 1.840  -0.273  15.681  1.00 81.85  ? 76  G   R OP1   1 
ATOM   2228 O  OP2   . G   B 2 70 ? 4.224  0.340   15.051  1.00 79.54  ? 76  G   R OP2   1 
ATOM   2229 O  "O5'" . G   B 2 70 ? 3.099  -1.597  13.957  1.00 82.26  ? 76  G   R "O5'" 1 
ATOM   2230 C  "C5'" . G   B 2 70 ? 1.973  -2.407  13.650  1.00 83.88  ? 76  G   R "C5'" 1 
ATOM   2231 C  "C4'" . G   B 2 70 ? 2.294  -3.441  12.588  1.00 85.50  ? 76  G   R "C4'" 1 
ATOM   2232 O  "O4'" . G   B 2 70 ? 3.047  -2.839  11.507  1.00 87.15  ? 76  G   R "O4'" 1 
ATOM   2233 C  "C3'" . G   B 2 70 ? 3.173  -4.594  13.043  1.00 82.98  ? 76  G   R "C3'" 1 
ATOM   2234 O  "O3'" . G   B 2 70 ? 2.412  -5.572  13.729  1.00 82.59  ? 76  G   R "O3'" 1 
ATOM   2235 C  "C2'" . G   B 2 70 ? 3.697  -5.110  11.707  1.00 85.57  ? 76  G   R "C2'" 1 
ATOM   2236 O  "O2'" . G   B 2 70 ? 2.793  -5.936  10.992  1.00 88.81  ? 76  G   R "O2'" 1 
ATOM   2237 C  "C1'" . G   B 2 70 ? 3.939  -3.798  10.961  1.00 86.99  ? 76  G   R "C1'" 1 
ATOM   2238 N  N9    . G   B 2 70 ? 5.325  -3.338  11.091  1.00 84.42  ? 76  G   R N9    1 
ATOM   2239 C  C8    . G   B 2 70 ? 5.790  -2.246  11.786  1.00 81.81  ? 76  G   R C8    1 
ATOM   2240 N  N7    . G   B 2 70 ? 7.084  -2.096  11.722  1.00 80.06  ? 76  G   R N7    1 
ATOM   2241 C  C5    . G   B 2 70 ? 7.510  -3.157  10.934  1.00 81.47  ? 76  G   R C5    1 
ATOM   2242 C  C6    . G   B 2 70 ? 8.812  -3.519  10.507  1.00 80.82  ? 76  G   R C6    1 
ATOM   2243 O  O6    . G   B 2 70 ? 9.882  -2.951  10.760  1.00 78.77  ? 76  G   R O6    1 
ATOM   2244 N  N1    . G   B 2 70 ? 8.805  -4.668  9.710   1.00 83.10  ? 76  G   R N1    1 
ATOM   2245 C  C2    . G   B 2 70 ? 7.677  -5.381  9.367   1.00 85.24  ? 76  G   R C2    1 
ATOM   2246 N  N2    . G   B 2 70 ? 7.853  -6.464  8.595   1.00 86.98  ? 76  G   R N2    1 
ATOM   2247 N  N3    . G   B 2 70 ? 6.453  -5.050  9.756   1.00 85.90  ? 76  G   R N3    1 
ATOM   2248 C  C4    . G   B 2 70 ? 6.440  -3.932  10.535  1.00 84.08  ? 76  G   R C4    1 
ATOM   2249 P  P     . U   B 2 71 ? 2.926  -6.184  15.116  1.00 79.48  ? 77  U   R P     1 
ATOM   2250 O  OP1   . U   B 2 71 ? 2.045  -7.334  15.420  1.00 80.22  ? 77  U   R OP1   1 
ATOM   2251 O  OP2   . U   B 2 71 ? 3.085  -5.091  16.100  1.00 76.86  ? 77  U   R OP2   1 
ATOM   2252 O  "O5'" . U   B 2 71 ? 4.398  -6.706  14.790  1.00 78.71  ? 77  U   R "O5'" 1 
ATOM   2253 C  "C5'" . U   B 2 71 ? 4.583  -7.889  14.036  1.00 81.11  ? 77  U   R "C5'" 1 
ATOM   2254 C  "C4'" . U   B 2 71 ? 6.008  -7.991  13.539  1.00 81.18  ? 77  U   R "C4'" 1 
ATOM   2255 O  "O4'" . U   B 2 71 ? 6.379  -6.817  12.772  1.00 82.76  ? 77  U   R "O4'" 1 
ATOM   2256 C  "C3'" . U   B 2 71 ? 7.051  -8.012  14.640  1.00 77.75  ? 77  U   R "C3'" 1 
ATOM   2257 O  "O3'" . U   B 2 71 ? 7.068  -9.263  15.305  1.00 76.35  ? 77  U   R "O3'" 1 
ATOM   2258 C  "C2'" . U   B 2 71 ? 8.300  -7.673  13.833  1.00 78.45  ? 77  U   R "C2'" 1 
ATOM   2259 O  "O2'" . U   B 2 71 ? 8.722  -8.716  12.974  1.00 80.37  ? 77  U   R "O2'" 1 
ATOM   2260 C  "C1'" . U   B 2 71 ? 7.746  -6.509  13.013  1.00 80.96  ? 77  U   R "C1'" 1 
ATOM   2261 N  N1    . U   B 2 71 ? 7.865  -5.153  13.683  1.00 79.67  ? 77  U   R N1    1 
ATOM   2262 C  C2    . U   B 2 71 ? 9.096  -4.513  13.755  1.00 78.25  ? 77  U   R C2    1 
ATOM   2263 O  O2    . U   B 2 71 ? 10.131 -4.973  13.306  1.00 78.43  ? 77  U   R O2    1 
ATOM   2264 N  N3    . U   B 2 71 ? 9.080  -3.287  14.382  1.00 76.92  ? 77  U   R N3    1 
ATOM   2265 C  C4    . U   B 2 71 ? 7.986  -2.644  14.938  1.00 77.23  ? 77  U   R C4    1 
ATOM   2266 O  O4    . U   B 2 71 ? 8.119  -1.547  15.473  1.00 76.33  ? 77  U   R O4    1 
ATOM   2267 C  C5    . U   B 2 71 ? 6.743  -3.366  14.830  1.00 78.91  ? 77  U   R C5    1 
ATOM   2268 C  C6    . U   B 2 71 ? 6.732  -4.558  14.219  1.00 80.00  ? 77  U   R C6    1 
ATOM   2269 P  P     . A   B 2 72 ? 6.773  -9.286  16.880  1.00 73.27  ? 78  A   R P     1 
ATOM   2270 O  OP1   . A   B 2 72 ? 6.143  -10.583 17.203  1.00 73.78  ? 78  A   R OP1   1 
ATOM   2271 O  OP2   . A   B 2 72 ? 6.095  -8.028  17.266  1.00 72.65  ? 78  A   R OP2   1 
ATOM   2272 O  "O5'" . A   B 2 72 ? 8.252  -9.261  17.490  1.00 70.72  ? 78  A   R "O5'" 1 
ATOM   2273 C  "C5'" . A   B 2 72 ? 9.254  -10.117 16.934  1.00 71.34  ? 78  A   R "C5'" 1 
ATOM   2274 C  "C4'" . A   B 2 72 ? 10.622 -9.457  16.906  1.00 69.86  ? 78  A   R "C4'" 1 
ATOM   2275 O  "O4'" . A   B 2 72 ? 10.614 -8.288  16.050  1.00 70.74  ? 78  A   R "O4'" 1 
ATOM   2276 C  "C3'" . A   B 2 72 ? 11.092 -8.906  18.241  1.00 66.89  ? 78  A   R "C3'" 1 
ATOM   2277 O  "O3'" . A   B 2 72 ? 11.575 -9.933  19.095  1.00 65.82  ? 78  A   R "O3'" 1 
ATOM   2278 C  "C2'" . A   B 2 72 ? 12.165 -7.921  17.792  1.00 66.25  ? 78  A   R "C2'" 1 
ATOM   2279 O  "O2'" . A   B 2 72 ? 13.364 -8.537  17.365  1.00 66.27  ? 78  A   R "O2'" 1 
ATOM   2280 C  "C1'" . A   B 2 72 ? 11.450 -7.282  16.606  1.00 68.45  ? 78  A   R "C1'" 1 
ATOM   2281 N  N9    . A   B 2 72 ? 10.656 -6.098  16.954  1.00 67.58  ? 78  A   R N9    1 
ATOM   2282 C  C8    . A   B 2 72 ? 9.293  -6.002  17.026  1.00 68.78  ? 78  A   R C8    1 
ATOM   2283 N  N7    . A   B 2 72 ? 8.852  -4.811  17.357  1.00 68.30  ? 78  A   R N7    1 
ATOM   2284 C  C5    . A   B 2 72 ? 10.007 -4.063  17.513  1.00 66.71  ? 78  A   R C5    1 
ATOM   2285 C  C6    . A   B 2 72 ? 10.233 -2.709  17.863  1.00 65.83  ? 78  A   R C6    1 
ATOM   2286 N  N6    . A   B 2 72 ? 9.257  -1.834  18.128  1.00 66.03  ? 78  A   R N6    1 
ATOM   2287 N  N1    . A   B 2 72 ? 11.514 -2.282  17.931  1.00 64.83  ? 78  A   R N1    1 
ATOM   2288 C  C2    . A   B 2 72 ? 12.503 -3.151  17.666  1.00 64.54  ? 78  A   R C2    1 
ATOM   2289 N  N3    . A   B 2 72 ? 12.410 -4.440  17.325  1.00 65.19  ? 78  A   R N3    1 
ATOM   2290 C  C4    . A   B 2 72 ? 11.127 -4.842  17.267  1.00 66.14  ? 78  A   R C4    1 
ATOM   2291 P  P     . G   B 2 73 ? 11.202 -9.833  20.649  1.00 64.33  ? 79  G   R P     1 
ATOM   2292 O  OP1   . G   B 2 73 ? 11.426 -11.154 21.283  1.00 63.77  ? 79  G   R OP1   1 
ATOM   2293 O  OP2   . G   B 2 73 ? 9.877  -9.176  20.771  1.00 64.62  ? 79  G   R OP2   1 
ATOM   2294 O  "O5'" . G   B 2 73 ? 12.302 -8.809  21.184  1.00 61.70  ? 79  G   R "O5'" 1 
ATOM   2295 C  "C5'" . G   B 2 73 ? 13.677 -9.120  21.075  1.00 61.12  ? 79  G   R "C5'" 1 
ATOM   2296 C  "C4'" . G   B 2 73 ? 14.493 -7.868  21.308  1.00 59.95  ? 79  G   R "C4'" 1 
ATOM   2297 O  "O4'" . G   B 2 73 ? 14.100 -6.829  20.375  1.00 61.22  ? 79  G   R "O4'" 1 
ATOM   2298 C  "C3'" . G   B 2 73 ? 14.278 -7.188  22.649  1.00 58.11  ? 79  G   R "C3'" 1 
ATOM   2299 O  "O3'" . G   B 2 73 ? 14.901 -7.899  23.721  1.00 56.68  ? 79  G   R "O3'" 1 
ATOM   2300 C  "C2'" . G   B 2 73 ? 14.941 -5.852  22.334  1.00 57.79  ? 79  G   R "C2'" 1 
ATOM   2301 O  "O2'" . G   B 2 73 ? 16.348 -5.955  22.223  1.00 57.45  ? 79  G   R "O2'" 1 
ATOM   2302 C  "C1'" . G   B 2 73 ? 14.323 -5.560  20.969  1.00 59.71  ? 79  G   R "C1'" 1 
ATOM   2303 N  N9    . G   B 2 73 ? 13.071 -4.801  21.052  1.00 59.93  ? 79  G   R N9    1 
ATOM   2304 C  C8    . G   B 2 73 ? 11.788 -5.270  20.889  1.00 61.31  ? 79  G   R C8    1 
ATOM   2305 N  N7    . G   B 2 73 ? 10.864 -4.357  21.031  1.00 61.65  ? 79  G   R N7    1 
ATOM   2306 C  C5    . G   B 2 73 ? 11.577 -3.199  21.308  1.00 60.84  ? 79  G   R C5    1 
ATOM   2307 C  C6    . G   B 2 73 ? 11.119 -1.876  21.555  1.00 61.17  ? 79  G   R C6    1 
ATOM   2308 O  O6    . G   B 2 73 ? 9.950  -1.457  21.578  1.00 61.92  ? 79  G   R O6    1 
ATOM   2309 N  N1    . G   B 2 73 ? 12.179 -0.996  21.794  1.00 60.04  ? 79  G   R N1    1 
ATOM   2310 C  C2    . G   B 2 73 ? 13.513 -1.355  21.792  1.00 58.86  ? 79  G   R C2    1 
ATOM   2311 N  N2    . G   B 2 73 ? 14.404 -0.383  22.043  1.00 58.11  ? 79  G   R N2    1 
ATOM   2312 N  N3    . G   B 2 73 ? 13.949 -2.589  21.559  1.00 58.52  ? 79  G   R N3    1 
ATOM   2313 C  C4    . G   B 2 73 ? 12.935 -3.458  21.324  1.00 59.53  ? 79  G   R C4    1 
ATOM   2314 P  P     . G   B 2 74 ? 14.289 -7.830  25.205  1.00 55.39  ? 80  G   R P     1 
ATOM   2315 O  OP1   . G   B 2 74 ? 15.155 -8.673  26.061  1.00 54.78  ? 80  G   R OP1   1 
ATOM   2316 O  OP2   . G   B 2 74 ? 12.832 -8.100  25.154  1.00 55.37  ? 80  G   R OP2   1 
ATOM   2317 O  "O5'" . G   B 2 74 ? 14.492 -6.296  25.615  1.00 53.26  ? 80  G   R "O5'" 1 
ATOM   2318 C  "C5'" . G   B 2 74 ? 15.800 -5.844  25.953  1.00 51.51  ? 80  G   R "C5'" 1 
ATOM   2319 C  "C4'" . G   B 2 74 ? 15.854 -4.333  26.039  1.00 50.34  ? 80  G   R "C4'" 1 
ATOM   2320 O  "O4'" . G   B 2 74 ? 15.047 -3.735  24.997  1.00 51.79  ? 80  G   R "O4'" 1 
ATOM   2321 C  "C3'" . G   B 2 74 ? 15.208 -3.740  27.272  1.00 49.27  ? 80  G   R "C3'" 1 
ATOM   2322 O  "O3'" . G   B 2 74 ? 15.977 -3.959  28.449  1.00 47.32  ? 80  G   R "O3'" 1 
ATOM   2323 C  "C2'" . G   B 2 74 ? 15.108 -2.276  26.859  1.00 49.80  ? 80  G   R "C2'" 1 
ATOM   2324 O  "O2'" . G   B 2 74 ? 16.344 -1.589  26.911  1.00 49.21  ? 80  G   R "O2'" 1 
ATOM   2325 C  "C1'" . G   B 2 74 ? 14.634 -2.444  25.415  1.00 51.40  ? 80  G   R "C1'" 1 
ATOM   2326 N  N9    . G   B 2 74 ? 13.182 -2.320  25.249  1.00 52.57  ? 80  G   R N9    1 
ATOM   2327 C  C8    . G   B 2 74 ? 12.285 -3.299  24.874  1.00 53.37  ? 80  G   R C8    1 
ATOM   2328 N  N7    . G   B 2 74 ? 11.049 -2.882  24.814  1.00 54.30  ? 80  G   R N7    1 
ATOM   2329 C  C5    . G   B 2 74 ? 11.129 -1.540  25.173  1.00 54.39  ? 80  G   R C5    1 
ATOM   2330 C  C6    . G   B 2 74 ? 10.110 -0.552  25.287  1.00 55.53  ? 80  G   R C6    1 
ATOM   2331 O  O6    . G   B 2 74 ? 8.889  -0.687  25.087  1.00 57.08  ? 80  G   R O6    1 
ATOM   2332 N  N1    . G   B 2 74 ? 10.626 0.691   25.681  1.00 54.64  ? 80  G   R N1    1 
ATOM   2333 C  C2    . G   B 2 74 ? 11.959 0.948   25.933  1.00 53.18  ? 80  G   R C2    1 
ATOM   2334 N  N2    . G   B 2 74 ? 12.283 2.196   26.298  1.00 52.75  ? 80  G   R N2    1 
ATOM   2335 N  N3    . G   B 2 74 ? 12.918 0.036   25.825  1.00 52.37  ? 80  G   R N3    1 
ATOM   2336 C  C4    . G   B 2 74 ? 12.435 -1.179  25.444  1.00 53.05  ? 80  G   R C4    1 
ATOM   2337 P  P     . U   B 2 75 ? 15.168 -4.358  29.769  1.00 45.34  ? 81  U   R P     1 
ATOM   2338 O  OP1   . U   B 2 75 ? 16.097 -4.987  30.734  1.00 44.49  ? 81  U   R OP1   1 
ATOM   2339 O  OP2   . U   B 2 75 ? 13.969 -5.105  29.340  1.00 46.50  ? 81  U   R OP2   1 
ATOM   2340 O  "O5'" . U   B 2 75 ? 14.667 -2.934  30.300  1.00 44.77  ? 81  U   R "O5'" 1 
ATOM   2341 C  "C5'" . U   B 2 75 ? 15.599 -1.909  30.631  1.00 43.86  ? 81  U   R "C5'" 1 
ATOM   2342 C  "C4'" . U   B 2 75 ? 14.889 -0.593  30.876  1.00 43.89  ? 81  U   R "C4'" 1 
ATOM   2343 O  "O4'" . U   B 2 75 ? 14.130 -0.246  29.693  1.00 45.22  ? 81  U   R "O4'" 1 
ATOM   2344 C  "C3'" . U   B 2 75 ? 13.844 -0.618  31.980  1.00 44.14  ? 81  U   R "C3'" 1 
ATOM   2345 O  "O3'" . U   B 2 75 ? 14.442 -0.412  33.258  1.00 43.19  ? 81  U   R "O3'" 1 
ATOM   2346 C  "C2'" . U   B 2 75 ? 12.920 0.529   31.569  1.00 45.24  ? 81  U   R "C2'" 1 
ATOM   2347 O  "O2'" . U   B 2 75 ? 13.403 1.801   31.957  1.00 45.95  ? 81  U   R "O2'" 1 
ATOM   2348 C  "C1'" . U   B 2 75 ? 12.928 0.418   30.046  1.00 45.36  ? 81  U   R "C1'" 1 
ATOM   2349 N  N1    . U   B 2 75 ? 11.736 -0.316  29.478  1.00 45.78  ? 81  U   R N1    1 
ATOM   2350 C  C2    . U   B 2 75 ? 10.559 0.376   29.251  1.00 47.03  ? 81  U   R C2    1 
ATOM   2351 O  O2    . U   B 2 75 ? 10.421 1.565   29.485  1.00 48.10  ? 81  U   R O2    1 
ATOM   2352 N  N3    . U   B 2 75 ? 9.529  -0.378  28.735  1.00 47.61  ? 81  U   R N3    1 
ATOM   2353 C  C4    . U   B 2 75 ? 9.557  -1.727  28.423  1.00 47.46  ? 81  U   R C4    1 
ATOM   2354 O  O4    . U   B 2 75 ? 8.557  -2.268  27.961  1.00 48.54  ? 81  U   R O4    1 
ATOM   2355 C  C5    . U   B 2 75 ? 10.814 -2.384  28.682  1.00 46.07  ? 81  U   R C5    1 
ATOM   2356 C  C6    . U   B 2 75 ? 11.827 -1.670  29.189  1.00 45.35  ? 81  U   R C6    1 
ATOM   2357 P  P     . A   B 2 76 ? 14.231 -1.477  34.440  1.00 42.68  ? 82  A   R P     1 
ATOM   2358 O  OP1   . A   B 2 76 ? 14.701 -0.846  35.694  1.00 41.91  ? 82  A   R OP1   1 
ATOM   2359 O  OP2   . A   B 2 76 ? 14.815 -2.763  34.001  1.00 41.56  ? 82  A   R OP2   1 
ATOM   2360 O  "O5'" . A   B 2 76 ? 12.642 -1.666  34.508  1.00 43.65  ? 82  A   R "O5'" 1 
ATOM   2361 C  "C5'" . A   B 2 76 ? 11.842 -0.724  35.205  1.00 44.60  ? 82  A   R "C5'" 1 
ATOM   2362 C  "C4'" . A   B 2 76 ? 10.787 -1.430  36.032  1.00 45.51  ? 82  A   R "C4'" 1 
ATOM   2363 O  "O4'" . A   B 2 76 ? 10.092 -2.382  35.189  1.00 46.59  ? 82  A   R "O4'" 1 
ATOM   2364 C  "C3'" . A   B 2 76 ? 11.313 -2.216  37.232  1.00 44.85  ? 82  A   R "C3'" 1 
ATOM   2365 O  "O3'" . A   B 2 76 ? 10.613 -1.818  38.423  1.00 45.06  ? 82  A   R "O3'" 1 
ATOM   2366 C  "C2'" . A   B 2 76 ? 11.050 -3.669  36.840  1.00 45.32  ? 82  A   R "C2'" 1 
ATOM   2367 O  "O2'" . A   B 2 76 ? 10.731 -4.504  37.930  1.00 46.68  ? 82  A   R "O2'" 1 
ATOM   2368 C  "C1'" . A   B 2 76 ? 9.817  -3.526  35.960  1.00 46.63  ? 82  A   R "C1'" 1 
ATOM   2369 N  N9    . A   B 2 76 ? 9.544  -4.674  35.091  1.00 47.35  ? 82  A   R N9    1 
ATOM   2370 C  C8    . A   B 2 76 ? 10.437 -5.612  34.641  1.00 47.34  ? 82  A   R C8    1 
ATOM   2371 N  N7    . A   B 2 76 ? 9.905  -6.538  33.876  1.00 48.07  ? 82  A   R N7    1 
ATOM   2372 C  C5    . A   B 2 76 ? 8.569  -6.185  33.817  1.00 48.52  ? 82  A   R C5    1 
ATOM   2373 C  C6    . A   B 2 76 ? 7.464  -6.763  33.160  1.00 49.88  ? 82  A   R C6    1 
ATOM   2374 N  N6    . A   B 2 76 ? 7.555  -7.866  32.412  1.00 50.85  ? 82  A   R N6    1 
ATOM   2375 N  N1    . A   B 2 76 ? 6.260  -6.167  33.295  1.00 50.77  ? 82  A   R N1    1 
ATOM   2376 C  C2    . A   B 2 76 ? 6.175  -5.059  34.046  1.00 50.38  ? 82  A   R C2    1 
ATOM   2377 N  N3    . A   B 2 76 ? 7.142  -4.425  34.711  1.00 49.39  ? 82  A   R N3    1 
ATOM   2378 C  C4    . A   B 2 76 ? 8.327  -5.042  34.558  1.00 48.36  ? 82  A   R C4    1 
ATOM   2379 P  P     . G   B 2 77 ? 11.332 -0.914  39.539  1.00 45.15  ? 83  G   R P     1 
ATOM   2380 O  OP1   . G   B 2 77 ? 12.609 -1.570  39.911  1.00 44.34  ? 83  G   R OP1   1 
ATOM   2381 O  OP2   . G   B 2 77 ? 10.339 -0.570  40.590  1.00 46.33  ? 83  G   R OP2   1 
ATOM   2382 O  "O5'" . G   B 2 77 ? 11.674 0.424   38.732  1.00 44.81  ? 83  G   R "O5'" 1 
ATOM   2383 C  "C5'" . G   B 2 77 ? 11.410 1.726   39.257  1.00 44.70  ? 83  G   R "C5'" 1 
ATOM   2384 C  "C4'" . G   B 2 77 ? 12.296 2.764   38.589  1.00 43.83  ? 83  G   R "C4'" 1 
ATOM   2385 O  "O4'" . G   B 2 77 ? 13.492 2.967   39.380  1.00 43.06  ? 83  G   R "O4'" 1 
ATOM   2386 C  "C3'" . G   B 2 77 ? 12.812 2.444   37.192  1.00 43.19  ? 83  G   R "C3'" 1 
ATOM   2387 O  "O3'" . G   B 2 77 ? 12.796 3.667   36.482  1.00 45.21  ? 83  G   R "O3'" 1 
ATOM   2388 C  "C2'" . G   B 2 77 ? 14.233 1.933   37.450  1.00 40.87  ? 83  G   R "C2'" 1 
ATOM   2389 O  "O2'" . G   B 2 77 ? 15.096 2.075   36.341  1.00 40.31  ? 83  G   R "O2'" 1 
ATOM   2390 C  "C1'" . G   B 2 77 ? 14.635 2.897   38.552  1.00 40.70  ? 83  G   R "C1'" 1 
ATOM   2391 N  N9    . G   B 2 77 ? 15.746 2.526   39.419  1.00 38.73  ? 83  G   R N9    1 
ATOM   2392 C  C8    . G   B 2 77 ? 16.104 1.277   39.855  1.00 37.82  ? 83  G   R C8    1 
ATOM   2393 N  N7    . G   B 2 77 ? 17.139 1.280   40.644  1.00 37.37  ? 83  G   R N7    1 
ATOM   2394 C  C5    . G   B 2 77 ? 17.484 2.620   40.746  1.00 37.82  ? 83  G   R C5    1 
ATOM   2395 C  C6    . G   B 2 77 ? 18.531 3.245   41.470  1.00 38.24  ? 83  G   R C6    1 
ATOM   2396 O  O6    . G   B 2 77 ? 19.386 2.715   42.192  1.00 39.38  ? 83  G   R O6    1 
ATOM   2397 N  N1    . G   B 2 77 ? 18.537 4.628   41.306  1.00 38.44  ? 83  G   R N1    1 
ATOM   2398 C  C2    . G   B 2 77 ? 17.635 5.322   40.537  1.00 38.58  ? 83  G   R C2    1 
ATOM   2399 N  N2    . G   B 2 77 ? 17.799 6.649   40.503  1.00 38.43  ? 83  G   R N2    1 
ATOM   2400 N  N3    . G   B 2 77 ? 16.646 4.753   39.852  1.00 38.49  ? 83  G   R N3    1 
ATOM   2401 C  C4    . G   B 2 77 ? 16.631 3.402   40.003  1.00 38.31  ? 83  G   R C4    1 
ATOM   2402 P  P     . C   B 2 78 ? 12.553 3.740   34.907  1.00 46.51  ? 84  C   R P     1 
ATOM   2403 O  OP1   . C   B 2 78 ? 12.316 2.388   34.363  1.00 46.38  ? 84  C   R OP1   1 
ATOM   2404 O  OP2   . C   B 2 78 ? 13.647 4.569   34.351  1.00 46.47  ? 84  C   R OP2   1 
ATOM   2405 O  "O5'" . C   B 2 78 ? 11.175 4.539   34.827  1.00 49.04  ? 84  C   R "O5'" 1 
ATOM   2406 C  "C5'" . C   B 2 78 ? 11.078 5.884   35.284  1.00 51.89  ? 84  C   R "C5'" 1 
ATOM   2407 C  "C4'" . C   B 2 78 ? 9.666  6.384   35.068  1.00 55.22  ? 84  C   R "C4'" 1 
ATOM   2408 O  "O4'" . C   B 2 78 ? 9.315  6.231   33.667  1.00 55.84  ? 84  C   R "O4'" 1 
ATOM   2409 C  "C3'" . C   B 2 78 ? 8.584  5.574   35.770  1.00 56.88  ? 84  C   R "C3'" 1 
ATOM   2410 O  "O3'" . C   B 2 78 ? 8.482  5.874   37.163  1.00 59.07  ? 84  C   R "O3'" 1 
ATOM   2411 C  "C2'" . C   B 2 78 ? 7.364  5.991   34.953  1.00 58.32  ? 84  C   R "C2'" 1 
ATOM   2412 O  "O2'" . C   B 2 78 ? 6.944  7.318   35.215  1.00 59.94  ? 84  C   R "O2'" 1 
ATOM   2413 C  "C1'" . C   B 2 78 ? 7.946  5.874   33.547  1.00 57.39  ? 84  C   R "C1'" 1 
ATOM   2414 N  N1    . C   B 2 78 ? 7.771  4.495   32.934  1.00 56.49  ? 84  C   R N1    1 
ATOM   2415 C  C2    . C   B 2 78 ? 6.562  4.156   32.297  1.00 57.98  ? 84  C   R C2    1 
ATOM   2416 O  O2    . C   B 2 78 ? 5.635  4.978   32.227  1.00 60.29  ? 84  C   R O2    1 
ATOM   2417 N  N3    . C   B 2 78 ? 6.425  2.917   31.761  1.00 57.09  ? 84  C   R N3    1 
ATOM   2418 C  C4    . C   B 2 78 ? 7.420  2.038   31.837  1.00 55.55  ? 84  C   R C4    1 
ATOM   2419 N  N4    . C   B 2 78 ? 7.228  0.838   31.290  1.00 56.01  ? 84  C   R N4    1 
ATOM   2420 C  C5    . C   B 2 78 ? 8.655  2.348   32.475  1.00 54.48  ? 84  C   R C5    1 
ATOM   2421 C  C6    . C   B 2 78 ? 8.781  3.572   33.002  1.00 54.89  ? 84  C   R C6    1 
ATOM   2422 P  P     . G   B 2 79 ? 7.546  4.981   38.117  1.00 61.07  ? 85  G   R P     1 
ATOM   2423 O  OP1   . G   B 2 79 ? 7.748  5.430   39.514  1.00 61.88  ? 85  G   R OP1   1 
ATOM   2424 O  OP2   . G   B 2 79 ? 7.727  3.549   37.778  1.00 59.47  ? 85  G   R OP2   1 
ATOM   2425 O  "O5'" . G   B 2 79 ? 6.090  5.449   37.650  1.00 62.19  ? 85  G   R "O5'" 1 
ATOM   2426 C  "C5'" . G   B 2 79 ? 4.930  5.021   38.321  1.00 62.72  ? 85  G   R "C5'" 1 
ATOM   2427 C  "C4'" . G   B 2 79 ? 3.714  5.398   37.499  1.00 64.27  ? 85  G   R "C4'" 1 
ATOM   2428 O  "O4'" . G   B 2 79 ? 4.041  5.473   36.085  1.00 64.16  ? 85  G   R "O4'" 1 
ATOM   2429 C  "C3'" . G   B 2 79 ? 2.604  4.370   37.545  1.00 64.67  ? 85  G   R "C3'" 1 
ATOM   2430 O  "O3'" . G   B 2 79 ? 1.870  4.501   38.753  1.00 65.54  ? 85  G   R "O3'" 1 
ATOM   2431 C  "C2'" . G   B 2 79 ? 1.831  4.681   36.262  1.00 65.82  ? 85  G   R "C2'" 1 
ATOM   2432 O  "O2'" . G   B 2 79 ? 1.034  5.849   36.299  1.00 67.65  ? 85  G   R "O2'" 1 
ATOM   2433 C  "C1'" . G   B 2 79 ? 3.016  4.862   35.314  1.00 64.46  ? 85  G   R "C1'" 1 
ATOM   2434 N  N9    . G   B 2 79 ? 3.517  3.594   34.771  1.00 62.38  ? 85  G   R N9    1 
ATOM   2435 C  C8    . G   B 2 79 ? 4.790  3.086   34.901  1.00 60.14  ? 85  G   R C8    1 
ATOM   2436 N  N7    . G   B 2 79 ? 4.953  1.931   34.317  1.00 59.25  ? 85  G   R N7    1 
ATOM   2437 C  C5    . G   B 2 79 ? 3.710  1.648   33.764  1.00 60.40  ? 85  G   R C5    1 
ATOM   2438 C  C6    . G   B 2 79 ? 3.276  0.524   33.014  1.00 60.37  ? 85  G   R C6    1 
ATOM   2439 O  O6    . G   B 2 79 ? 3.934  -0.474  32.678  1.00 59.12  ? 85  G   R O6    1 
ATOM   2440 N  N1    . G   B 2 79 ? 1.934  0.629   32.641  1.00 61.83  ? 85  G   R N1    1 
ATOM   2441 C  C2    . G   B 2 79 ? 1.115  1.687   32.962  1.00 63.29  ? 85  G   R C2    1 
ATOM   2442 N  N2    . G   B 2 79 ? -0.147 1.624   32.527  1.00 65.12  ? 85  G   R N2    1 
ATOM   2443 N  N3    . G   B 2 79 ? 1.507  2.741   33.665  1.00 63.56  ? 85  G   R N3    1 
ATOM   2444 C  C4    . G   B 2 79 ? 2.813  2.660   34.034  1.00 62.23  ? 85  G   R C4    1 
ATOM   2445 P  P     . G   B 2 80 ? 1.909  3.293   39.809  1.00 64.31  ? 86  G   R P     1 
ATOM   2446 O  OP1   . G   B 2 80 ? 1.853  3.897   41.159  1.00 65.36  ? 86  G   R OP1   1 
ATOM   2447 O  OP2   . G   B 2 80 ? 3.016  2.366   39.471  1.00 61.35  ? 86  G   R OP2   1 
ATOM   2448 O  "O5'" . G   B 2 80 ? 0.534  2.525   39.502  1.00 64.66  ? 86  G   R "O5'" 1 
ATOM   2449 C  "C5'" . G   B 2 80 ? -0.616 3.201   38.972  1.00 64.88  ? 86  G   R "C5'" 1 
ATOM   2450 C  "C4'" . G   B 2 80 ? -1.289 2.380   37.883  1.00 63.59  ? 86  G   R "C4'" 1 
ATOM   2451 O  "O4'" . G   B 2 80 ? -0.422 2.208   36.734  1.00 62.22  ? 86  G   R "O4'" 1 
ATOM   2452 C  "C3'" . G   B 2 80 ? -1.597 0.941   38.242  1.00 61.73  ? 86  G   R "C3'" 1 
ATOM   2453 O  "O3'" . G   B 2 80 ? -2.695 0.864   39.130  1.00 62.18  ? 86  G   R "O3'" 1 
ATOM   2454 C  "C2'" . G   B 2 80 ? -1.897 0.369   36.863  1.00 61.96  ? 86  G   R "C2'" 1 
ATOM   2455 O  "O2'" . G   B 2 80 ? -3.152 0.746   36.339  1.00 64.06  ? 86  G   R "O2'" 1 
ATOM   2456 C  "C1'" . G   B 2 80 ? -0.790 1.021   36.044  1.00 61.39  ? 86  G   R "C1'" 1 
ATOM   2457 N  N9    . G   B 2 80 ? 0.374  0.146   35.880  1.00 59.34  ? 86  G   R N9    1 
ATOM   2458 C  C8    . G   B 2 80 ? 1.648  0.373   36.347  1.00 57.82  ? 86  G   R C8    1 
ATOM   2459 N  N7    . G   B 2 80 ? 2.490  -0.580  36.056  1.00 56.42  ? 86  G   R N7    1 
ATOM   2460 C  C5    . G   B 2 80 ? 1.729  -1.503  35.349  1.00 57.10  ? 86  G   R C5    1 
ATOM   2461 C  C6    . G   B 2 80 ? 2.104  -2.747  34.776  1.00 56.40  ? 86  G   R C6    1 
ATOM   2462 O  O6    . G   B 2 80 ? 3.219  -3.285  34.789  1.00 55.15  ? 86  G   R O6    1 
ATOM   2463 N  N1    . G   B 2 80 ? 1.032  -3.385  34.148  1.00 57.39  ? 86  G   R N1    1 
ATOM   2464 C  C2    . G   B 2 80 ? -0.243 -2.871  34.078  1.00 59.12  ? 86  G   R C2    1 
ATOM   2465 N  N2    . G   B 2 80 ? -1.150 -3.617  33.432  1.00 60.56  ? 86  G   R N2    1 
ATOM   2466 N  N3    . G   B 2 80 ? -0.606 -1.709  34.612  1.00 59.77  ? 86  G   R N3    1 
ATOM   2467 C  C4    . G   B 2 80 ? 0.423  -1.074  35.231  1.00 58.70  ? 86  G   R C4    1 
ATOM   2468 P  P     . G   B 2 81 ? -2.630 -0.169  40.348  1.00 60.45  ? 87  G   R P     1 
ATOM   2469 O  OP1   . G   B 2 81 ? -3.811 0.029   41.221  1.00 62.37  ? 87  G   R OP1   1 
ATOM   2470 O  OP2   . G   B 2 81 ? -1.266 -0.096  40.919  1.00 57.94  ? 87  G   R OP2   1 
ATOM   2471 O  "O5'" . G   B 2 81 ? -2.775 -1.578  39.609  1.00 59.21  ? 87  G   R "O5'" 1 
ATOM   2472 C  "C5'" . G   B 2 81 ? -3.954 -1.964  38.919  1.00 59.43  ? 87  G   R "C5'" 1 
ATOM   2473 C  "C4'" . G   B 2 81 ? -3.639 -3.198  38.101  1.00 58.22  ? 87  G   R "C4'" 1 
ATOM   2474 O  "O4'" . G   B 2 81 ? -2.558 -2.891  37.188  1.00 56.55  ? 87  G   R "O4'" 1 
ATOM   2475 C  "C3'" . G   B 2 81 ? -3.070 -4.376  38.876  1.00 56.89  ? 87  G   R "C3'" 1 
ATOM   2476 O  "O3'" . G   B 2 81 ? -4.076 -5.116  39.546  1.00 58.66  ? 87  G   R "O3'" 1 
ATOM   2477 C  "C2'" . G   B 2 81 ? -2.409 -5.173  37.758  1.00 55.58  ? 87  G   R "C2'" 1 
ATOM   2478 O  "O2'" . G   B 2 81 ? -3.317 -5.853  36.915  1.00 57.08  ? 87  G   R "O2'" 1 
ATOM   2479 C  "C1'" . G   B 2 81 ? -1.753 -4.042  36.986  1.00 54.59  ? 87  G   R "C1'" 1 
ATOM   2480 N  N9    . G   B 2 81 ? -0.373 -3.792  37.407  1.00 52.27  ? 87  G   R N9    1 
ATOM   2481 C  C8    . G   B 2 81 ? 0.117  -2.711  38.108  1.00 51.68  ? 87  G   R C8    1 
ATOM   2482 N  N7    . G   B 2 81 ? 1.400  -2.775  38.331  1.00 49.77  ? 87  G   R N7    1 
ATOM   2483 C  C5    . G   B 2 81 ? 1.789  -3.977  37.746  1.00 48.67  ? 87  G   R C5    1 
ATOM   2484 C  C6    . G   B 2 81 ? 3.064  -4.595  37.661  1.00 46.67  ? 87  G   R C6    1 
ATOM   2485 O  O6    . G   B 2 81 ? 4.148  -4.189  38.103  1.00 45.32  ? 87  G   R O6    1 
ATOM   2486 N  N1    . G   B 2 81 ? 3.013  -5.811  36.982  1.00 46.46  ? 87  G   R N1    1 
ATOM   2487 C  C2    . G   B 2 81 ? 1.875  -6.368  36.446  1.00 47.91  ? 87  G   R C2    1 
ATOM   2488 N  N2    . G   B 2 81 ? 2.011  -7.550  35.825  1.00 47.18  ? 87  G   R N2    1 
ATOM   2489 N  N3    . G   B 2 81 ? 0.679  -5.798  36.517  1.00 49.66  ? 87  G   R N3    1 
ATOM   2490 C  C4    . G   B 2 81 ? 0.708  -4.612  37.175  1.00 49.98  ? 87  G   R C4    1 
ATOM   2491 P  P     . G   B 2 82 ? -3.683 -5.914  40.879  1.00 58.50  ? 88  G   R P     1 
ATOM   2492 O  OP1   . G   B 2 82 ? -4.935 -6.399  41.501  1.00 60.25  ? 88  G   R OP1   1 
ATOM   2493 O  OP2   . G   B 2 82 ? -2.751 -5.057  41.654  1.00 57.20  ? 88  G   R OP2   1 
ATOM   2494 O  "O5'" . G   B 2 82 ? -2.871 -7.185  40.334  1.00 56.79  ? 88  G   R "O5'" 1 
ATOM   2495 C  "C5'" . G   B 2 82 ? -3.525 -8.169  39.526  1.00 57.19  ? 88  G   R "C5'" 1 
ATOM   2496 C  "C4'" . G   B 2 82 ? -2.548 -9.204  39.002  1.00 55.37  ? 88  G   R "C4'" 1 
ATOM   2497 O  "O4'" . G   B 2 82 ? -1.518 -8.572  38.200  1.00 53.76  ? 88  G   R "O4'" 1 
ATOM   2498 C  "C3'" . G   B 2 82 ? -1.783 -9.925  40.095  1.00 54.50  ? 88  G   R "C3'" 1 
ATOM   2499 O  "O3'" . G   B 2 82 ? -2.560 -10.993 40.600  1.00 56.28  ? 88  G   R "O3'" 1 
ATOM   2500 C  "C2'" . G   B 2 82 ? -0.519 -10.371 39.372  1.00 52.55  ? 88  G   R "C2'" 1 
ATOM   2501 O  "O2'" . G   B 2 82 ? -0.697 -11.543 38.611  1.00 53.24  ? 88  G   R "O2'" 1 
ATOM   2502 C  "C1'" . G   B 2 82 ? -0.259 -9.169  38.464  1.00 51.88  ? 88  G   R "C1'" 1 
ATOM   2503 N  N9    . G   B 2 82 ? 0.622  -8.190  39.103  1.00 50.46  ? 88  G   R N9    1 
ATOM   2504 C  C8    . G   B 2 82 ? 0.275  -6.970  39.643  1.00 51.00  ? 88  G   R C8    1 
ATOM   2505 N  N7    . G   B 2 82 ? 1.278  -6.317  40.164  1.00 49.58  ? 88  G   R N7    1 
ATOM   2506 C  C5    . G   B 2 82 ? 2.362  -7.159  39.962  1.00 48.27  ? 88  G   R C5    1 
ATOM   2507 C  C6    . G   B 2 82 ? 3.725  -6.993  40.312  1.00 47.04  ? 88  G   R C6    1 
ATOM   2508 O  O6    . G   B 2 82 ? 4.247  -6.032  40.893  1.00 47.33  ? 88  G   R O6    1 
ATOM   2509 N  N1    . G   B 2 82 ? 4.508  -8.085  39.932  1.00 45.67  ? 88  G   R N1    1 
ATOM   2510 C  C2    . G   B 2 82 ? 4.030  -9.203  39.288  1.00 46.11  ? 88  G   R C2    1 
ATOM   2511 N  N2    . G   B 2 82 ? 4.925  -10.155 38.993  1.00 45.08  ? 88  G   R N2    1 
ATOM   2512 N  N3    . G   B 2 82 ? 2.754  -9.372  38.954  1.00 47.82  ? 88  G   R N3    1 
ATOM   2513 C  C4    . G   B 2 82 ? 1.978  -8.316  39.317  1.00 48.69  ? 88  G   R C4    1 
ATOM   2514 P  P     . U   B 2 83 ? -2.694 -11.157 42.186  1.00 57.57  ? 89  U   R P     1 
ATOM   2515 O  OP1   . U   B 2 83 ? -3.720 -12.188 42.468  1.00 58.71  ? 89  U   R OP1   1 
ATOM   2516 O  OP2   . U   B 2 83 ? -2.828 -9.810  42.787  1.00 57.30  ? 89  U   R OP2   1 
ATOM   2517 O  "O5'" . U   B 2 83 ? -1.249 -11.736 42.559  1.00 55.83  ? 89  U   R "O5'" 1 
ATOM   2518 C  "C5'" . U   B 2 83 ? -0.896 -13.048 42.121  1.00 55.52  ? 89  U   R "C5'" 1 
ATOM   2519 C  "C4'" . U   B 2 83 ? 0.598  -13.299 42.211  1.00 53.56  ? 89  U   R "C4'" 1 
ATOM   2520 O  "O4'" . U   B 2 83 ? 1.322  -12.312 41.435  1.00 51.96  ? 89  U   R "O4'" 1 
ATOM   2521 C  "C3'" . U   B 2 83 ? 1.192  -13.195 43.608  1.00 53.10  ? 89  U   R "C3'" 1 
ATOM   2522 O  "O3'" . U   B 2 83 ? 0.994  -14.404 44.314  1.00 53.82  ? 89  U   R "O3'" 1 
ATOM   2523 C  "C2'" . U   B 2 83 ? 2.656  -12.971 43.272  1.00 51.36  ? 89  U   R "C2'" 1 
ATOM   2524 O  "O2'" . U   B 2 83 ? 3.287  -14.174 42.901  1.00 51.48  ? 89  U   R "O2'" 1 
ATOM   2525 C  "C1'" . U   B 2 83 ? 2.551  -12.024 42.079  1.00 50.77  ? 89  U   R "C1'" 1 
ATOM   2526 N  N1    . U   B 2 83 ? 2.612  -10.570 42.484  1.00 50.64  ? 89  U   R N1    1 
ATOM   2527 C  C2    . U   B 2 83 ? 3.852  -9.981  42.651  1.00 49.66  ? 89  U   R C2    1 
ATOM   2528 O  O2    . U   B 2 83 ? 4.903  -10.570 42.479  1.00 49.36  ? 89  U   R O2    1 
ATOM   2529 N  N3    . U   B 2 83 ? 3.824  -8.660  43.032  1.00 49.85  ? 89  U   R N3    1 
ATOM   2530 C  C4    . U   B 2 83 ? 2.704  -7.873  43.261  1.00 50.72  ? 89  U   R C4    1 
ATOM   2531 O  O4    . U   B 2 83 ? 2.844  -6.694  43.592  1.00 50.61  ? 89  U   R O4    1 
ATOM   2532 C  C5    . U   B 2 83 ? 1.445  -8.550  43.070  1.00 51.52  ? 89  U   R C5    1 
ATOM   2533 C  C6    . U   B 2 83 ? 1.451  -9.840  42.700  1.00 51.65  ? 89  U   R C6    1 
ATOM   2534 P  P     . U   B 2 84 ? 0.905  -14.408 45.911  1.00 54.77  ? 90  U   R P     1 
ATOM   2535 O  OP1   . U   B 2 84 ? 0.453  -15.755 46.338  1.00 55.94  ? 90  U   R OP1   1 
ATOM   2536 O  OP2   . U   B 2 84 ? 0.143  -13.218 46.353  1.00 55.69  ? 90  U   R OP2   1 
ATOM   2537 O  "O5'" . U   B 2 84 ? 2.434  -14.194 46.323  1.00 52.01  ? 90  U   R "O5'" 1 
ATOM   2538 C  "C5'" . U   B 2 84 ? 3.289  -15.318 46.310  1.00 50.60  ? 90  U   R "C5'" 1 
ATOM   2539 C  "C4'" . U   B 2 84 ? 4.725  -14.949 46.611  1.00 48.59  ? 90  U   R "C4'" 1 
ATOM   2540 O  "O4'" . U   B 2 84 ? 5.204  -13.944 45.681  1.00 46.54  ? 90  U   R "O4'" 1 
ATOM   2541 C  "C3'" . U   B 2 84 ? 4.953  -14.308 47.964  1.00 48.66  ? 90  U   R "C3'" 1 
ATOM   2542 O  "O3'" . U   B 2 84 ? 4.974  -15.282 48.980  1.00 49.88  ? 90  U   R "O3'" 1 
ATOM   2543 C  "C2'" . U   B 2 84 ? 6.322  -13.689 47.736  1.00 47.15  ? 90  U   R "C2'" 1 
ATOM   2544 O  "O2'" . U   B 2 84 ? 7.376  -14.627 47.802  1.00 47.30  ? 90  U   R "O2'" 1 
ATOM   2545 C  "C1'" . U   B 2 84 ? 6.150  -13.115 46.331  1.00 45.56  ? 90  U   R "C1'" 1 
ATOM   2546 N  N1    . U   B 2 84 ? 5.662  -11.689 46.386  1.00 45.22  ? 90  U   R N1    1 
ATOM   2547 C  C2    . U   B 2 84 ? 6.563  -10.673 46.656  1.00 44.16  ? 90  U   R C2    1 
ATOM   2548 O  O2    . U   B 2 84 ? 7.755  -10.856 46.838  1.00 42.86  ? 90  U   R O2    1 
ATOM   2549 N  N3    . U   B 2 84 ? 6.010  -9.412  46.701  1.00 44.36  ? 90  U   R N3    1 
ATOM   2550 C  C4    . U   B 2 84 ? 4.682  -9.068  46.513  1.00 45.02  ? 90  U   R C4    1 
ATOM   2551 O  O4    . U   B 2 84 ? 4.336  -7.894  46.584  1.00 45.48  ? 90  U   R O4    1 
ATOM   2552 C  C5    . U   B 2 84 ? 3.803  -10.173 46.244  1.00 45.98  ? 90  U   R C5    1 
ATOM   2553 C  C6    . U   B 2 84 ? 4.316  -11.409 46.197  1.00 46.12  ? 90  U   R C6    1 
ATOM   2554 P  P     . A   B 2 85 ? 4.460  -14.883 50.439  1.00 51.32  ? 91  A   R P     1 
ATOM   2555 O  OP1   . A   B 2 85 ? 4.381  -16.122 51.244  1.00 53.10  ? 91  A   R OP1   1 
ATOM   2556 O  OP2   . A   B 2 85 ? 3.259  -14.031 50.294  1.00 51.50  ? 91  A   R OP2   1 
ATOM   2557 O  "O5'" . A   B 2 85 ? 5.645  -13.962 50.989  1.00 50.94  ? 91  A   R "O5'" 1 
ATOM   2558 C  "C5'" . A   B 2 85 ? 6.939  -14.506 51.234  1.00 51.16  ? 91  A   R "C5'" 1 
ATOM   2559 C  "C4'" . A   B 2 85 ? 7.966  -13.414 51.477  1.00 50.48  ? 91  A   R "C4'" 1 
ATOM   2560 O  "O4'" . A   B 2 85 ? 8.001  -12.466 50.378  1.00 48.69  ? 91  A   R "O4'" 1 
ATOM   2561 C  "C3'" . A   B 2 85 ? 7.708  -12.538 52.690  1.00 51.76  ? 91  A   R "C3'" 1 
ATOM   2562 O  "O3'" . A   B 2 85 ? 8.103  -13.223 53.863  1.00 53.07  ? 91  A   R "O3'" 1 
ATOM   2563 C  "C2'" . A   B 2 85 ? 8.595  -11.341 52.359  1.00 50.77  ? 91  A   R "C2'" 1 
ATOM   2564 O  "O2'" . A   B 2 85 ? 9.969  -11.594 52.569  1.00 51.47  ? 91  A   R "O2'" 1 
ATOM   2565 C  "C1'" . A   B 2 85 ? 8.334  -11.178 50.867  1.00 48.53  ? 91  A   R "C1'" 1 
ATOM   2566 N  N9    . A   B 2 85 ? 7.246  -10.242 50.583  1.00 48.46  ? 91  A   R N9    1 
ATOM   2567 C  C8    . A   B 2 85 ? 5.955  -10.559 50.264  1.00 48.87  ? 91  A   R C8    1 
ATOM   2568 N  N7    . A   B 2 85 ? 5.184  -9.517  50.060  1.00 48.99  ? 91  A   R N7    1 
ATOM   2569 C  C5    . A   B 2 85 ? 6.024  -8.435  50.262  1.00 48.23  ? 91  A   R C5    1 
ATOM   2570 C  C6    . A   B 2 85 ? 5.808  -7.040  50.197  1.00 47.91  ? 91  A   R C6    1 
ATOM   2571 N  N6    . A   B 2 85 ? 4.623  -6.502  49.898  1.00 48.11  ? 91  A   R N6    1 
ATOM   2572 N  N1    . A   B 2 85 ? 6.857  -6.223  50.450  1.00 47.87  ? 91  A   R N1    1 
ATOM   2573 C  C2    . A   B 2 85 ? 8.046  -6.774  50.754  1.00 47.68  ? 91  A   R C2    1 
ATOM   2574 N  N3    . A   B 2 85 ? 8.369  -8.071  50.847  1.00 47.47  ? 91  A   R N3    1 
ATOM   2575 C  C4    . A   B 2 85 ? 7.304  -8.861  50.586  1.00 48.05  ? 91  A   R C4    1 
ATOM   2576 P  P     . C   B 2 86 ? 7.685  -12.693 55.314  1.00 55.35  ? 92  C   R P     1 
ATOM   2577 O  OP1   . C   B 2 86 ? 7.645  -13.863 56.216  1.00 57.57  ? 92  C   R OP1   1 
ATOM   2578 O  OP2   . C   B 2 86 ? 6.499  -11.811 55.213  1.00 54.94  ? 92  C   R OP2   1 
ATOM   2579 O  "O5'" . C   B 2 86 ? 8.946  -11.783 55.678  1.00 55.83  ? 92  C   R "O5'" 1 
ATOM   2580 C  "C5'" . C   B 2 86 ? 10.214 -12.361 55.980  1.00 57.31  ? 92  C   R "C5'" 1 
ATOM   2581 C  "C4'" . C   B 2 86 ? 11.104 -11.320 56.623  1.00 58.55  ? 92  C   R "C4'" 1 
ATOM   2582 O  "O4'" . C   B 2 86 ? 11.334 -10.270 55.657  1.00 56.52  ? 92  C   R "O4'" 1 
ATOM   2583 C  "C3'" . C   B 2 86 ? 10.475 -10.602 57.806  1.00 61.78  ? 92  C   R "C3'" 1 
ATOM   2584 O  "O3'" . C   B 2 86 ? 10.685 -11.315 59.020  1.00 65.30  ? 92  C   R "O3'" 1 
ATOM   2585 C  "C2'" . C   B 2 86 ? 11.186 -9.253  57.792  1.00 61.45  ? 92  C   R "C2'" 1 
ATOM   2586 O  "O2'" . C   B 2 86 ? 12.411 -9.257  58.505  1.00 63.38  ? 92  C   R "O2'" 1 
ATOM   2587 C  "C1'" . C   B 2 86 ? 11.392 -9.009  56.299  1.00 58.00  ? 92  C   R "C1'" 1 
ATOM   2588 N  N1    . C   B 2 86 ? 10.355 -8.087  55.715  1.00 57.44  ? 92  C   R N1    1 
ATOM   2589 C  C2    . C   B 2 86 ? 10.563 -6.693  55.727  1.00 57.81  ? 92  C   R C2    1 
ATOM   2590 O  O2    . C   B 2 86 ? 11.601 -6.221  56.214  1.00 58.69  ? 92  C   R O2    1 
ATOM   2591 N  N3    . C   B 2 86 ? 9.606  -5.883  55.192  1.00 57.35  ? 92  C   R N3    1 
ATOM   2592 C  C4    . C   B 2 86 ? 8.490  -6.410  54.670  1.00 56.83  ? 92  C   R C4    1 
ATOM   2593 N  N4    . C   B 2 86 ? 7.577  -5.578  54.156  1.00 56.69  ? 92  C   R N4    1 
ATOM   2594 C  C5    . C   B 2 86 ? 8.259  -7.819  54.652  1.00 56.61  ? 92  C   R C5    1 
ATOM   2595 C  C6    . C   B 2 86 ? 9.206  -8.604  55.178  1.00 56.85  ? 92  C   R C6    1 
ATOM   2596 P  P     . C   B 2 87 ? 9.697  -11.063 60.250  1.00 68.66  ? 93  C   R P     1 
ATOM   2597 O  OP1   . C   B 2 87 ? 10.111 -11.944 61.364  1.00 71.40  ? 93  C   R OP1   1 
ATOM   2598 O  OP2   . C   B 2 87 ? 8.309  -11.138 59.739  1.00 68.12  ? 93  C   R OP2   1 
ATOM   2599 O  "O5'" . C   B 2 87 ? 9.995  -9.535  60.629  1.00 69.16  ? 93  C   R "O5'" 1 
ATOM   2600 C  "C5'" . C   B 2 87 ? 11.067 -9.166  61.498  1.00 71.15  ? 93  C   R "C5'" 1 
ATOM   2601 C  "C4'" . C   B 2 87 ? 11.097 -7.660  61.683  1.00 71.41  ? 93  C   R "C4'" 1 
ATOM   2602 O  "O4'" . C   B 2 87 ? 10.967 -7.001  60.400  1.00 68.34  ? 93  C   R "O4'" 1 
ATOM   2603 C  "C3'" . C   B 2 87 ? 9.933  -7.100  62.482  1.00 73.92  ? 93  C   R "C3'" 1 
ATOM   2604 O  "O3'" . C   B 2 87 ? 10.191 -7.218  63.867  1.00 78.16  ? 93  C   R "O3'" 1 
ATOM   2605 C  "C2'" . C   B 2 87 ? 9.864  -5.649  62.015  1.00 72.52  ? 93  C   R "C2'" 1 
ATOM   2606 O  "O2'" . C   B 2 87 ? 10.814 -4.806  62.633  1.00 74.07  ? 93  C   R "O2'" 1 
ATOM   2607 C  "C1'" . C   B 2 87 ? 10.219 -5.799  60.542  1.00 68.52  ? 93  C   R "C1'" 1 
ATOM   2608 N  N1    . C   B 2 87 ? 9.042  -5.779  59.587  1.00 66.55  ? 93  C   R N1    1 
ATOM   2609 C  C2    . C   B 2 87 ? 8.368  -4.574  59.301  1.00 66.16  ? 93  C   R C2    1 
ATOM   2610 O  O2    . C   B 2 87 ? 8.717  -3.516  59.838  1.00 67.63  ? 93  C   R O2    1 
ATOM   2611 N  N3    . C   B 2 87 ? 7.326  -4.590  58.428  1.00 64.44  ? 93  C   R N3    1 
ATOM   2612 C  C4    . C   B 2 87 ? 6.951  -5.731  57.850  1.00 63.22  ? 93  C   R C4    1 
ATOM   2613 N  N4    . C   B 2 87 ? 5.925  -5.688  56.998  1.00 61.69  ? 93  C   R N4    1 
ATOM   2614 C  C5    . C   B 2 87 ? 7.616  -6.965  58.119  1.00 63.78  ? 93  C   R C5    1 
ATOM   2615 C  C6    . C   B 2 87 ? 8.641  -6.940  58.981  1.00 65.29  ? 93  C   R C6    1 
ATOM   2616 P  P     . G   B 2 88 ? 9.112  -7.952  64.790  1.00 81.95  ? 94  G   R P     1 
ATOM   2617 O  OP1   . G   B 2 88 ? 9.739  -8.253  66.098  1.00 85.17  ? 94  G   R OP1   1 
ATOM   2618 O  OP2   . G   B 2 88 ? 8.505  -9.039  63.990  1.00 80.17  ? 94  G   R OP2   1 
ATOM   2619 O  "O5'" . G   B 2 88 ? 8.006  -6.823  65.001  1.00 83.34  ? 94  G   R "O5'" 1 
ATOM   2620 C  "C5'" . G   B 2 88 ? 8.389  -5.529  65.450  1.00 85.60  ? 94  G   R "C5'" 1 
ATOM   2621 C  "C4'" . G   B 2 88 ? 7.298  -4.539  65.105  1.00 86.23  ? 94  G   R "C4'" 1 
ATOM   2622 O  "O4'" . G   B 2 88 ? 7.039  -4.602  63.678  1.00 82.31  ? 94  G   R "O4'" 1 
ATOM   2623 C  "C3'" . G   B 2 88 ? 5.970  -4.815  65.810  1.00 89.81  ? 94  G   R "C3'" 1 
ATOM   2624 O  "O3'" . G   B 2 88 ? 5.482  -3.635  66.447  1.00 94.35  ? 94  G   R "O3'" 1 
ATOM   2625 C  "C2'" . G   B 2 88 ? 5.067  -5.276  64.672  1.00 86.43  ? 94  G   R "C2'" 1 
ATOM   2626 O  "O2'" . G   B 2 88 ? 3.708  -4.949  64.860  1.00 87.73  ? 94  G   R "O2'" 1 
ATOM   2627 C  "C1'" . G   B 2 88 ? 5.647  -4.487  63.507  1.00 82.80  ? 94  G   R "C1'" 1 
ATOM   2628 N  N9    . G   B 2 88 ? 5.186  -5.012  62.225  1.00 79.55  ? 94  G   R N9    1 
ATOM   2629 C  C8    . G   B 2 88 ? 5.170  -6.327  61.828  1.00 78.66  ? 94  G   R C8    1 
ATOM   2630 N  N7    . G   B 2 88 ? 4.679  -6.516  60.637  1.00 75.78  ? 94  G   R N7    1 
ATOM   2631 C  C5    . G   B 2 88 ? 4.336  -5.241  60.220  1.00 75.04  ? 94  G   R C5    1 
ATOM   2632 C  C6    . G   B 2 88 ? 3.749  -4.819  59.005  1.00 72.98  ? 94  G   R C6    1 
ATOM   2633 O  O6    . G   B 2 88 ? 3.415  -5.522  58.040  1.00 71.17  ? 94  G   R O6    1 
ATOM   2634 N  N1    . G   B 2 88 ? 3.563  -3.437  58.964  1.00 73.38  ? 94  G   R N1    1 
ATOM   2635 C  C2    . G   B 2 88 ? 3.901  -2.572  59.981  1.00 75.27  ? 94  G   R C2    1 
ATOM   2636 N  N2    . G   B 2 88 ? 3.643  -1.276  59.764  1.00 75.19  ? 94  G   R N2    1 
ATOM   2637 N  N3    . G   B 2 88 ? 4.446  -2.958  61.131  1.00 77.44  ? 94  G   R N3    1 
ATOM   2638 C  C4    . G   B 2 88 ? 4.636  -4.302  61.184  1.00 77.26  ? 94  G   R C4    1 
ATOM   2639 P  P     . A   B 2 89 ? 5.671  -3.379  68.021  1.00 100.60 ? 95  A   R P     1 
ATOM   2640 O  OP1   . A   B 2 89 ? 6.829  -4.173  68.496  1.00 100.84 ? 95  A   R OP1   1 
ATOM   2641 O  OP2   . A   B 2 89 ? 4.355  -3.527  68.685  1.00 103.29 ? 95  A   R OP2   1 
ATOM   2642 O  "O5'" . A   B 2 89 ? 6.046  -1.825  68.067  1.00 102.66 ? 95  A   R "O5'" 1 
ATOM   2643 C  "C5'" . A   B 2 89 ? 5.310  -0.891  67.288  1.00 103.97 ? 95  A   R "C5'" 1 
ATOM   2644 C  "C4'" . A   B 2 89 ? 5.563  0.517   67.789  1.00 108.01 ? 95  A   R "C4'" 1 
ATOM   2645 O  "O4'" . A   B 2 89 ? 6.156  1.318   66.738  1.00 105.38 ? 95  A   R "O4'" 1 
ATOM   2646 C  "C3'" . A   B 2 89 ? 4.322  1.266   68.250  1.00 112.15 ? 95  A   R "C3'" 1 
ATOM   2647 O  "O3'" . A   B 2 89 ? 4.626  1.831   69.513  1.00 118.58 ? 95  A   R "O3'" 1 
ATOM   2648 C  "C2'" . A   B 2 89 ? 4.080  2.315   67.159  1.00 109.64 ? 95  A   R "C2'" 1 
ATOM   2649 O  "O2'" . A   B 2 89 ? 3.526  3.519   67.652  1.00 112.41 ? 95  A   R "O2'" 1 
ATOM   2650 C  "C1'" . A   B 2 89 ? 5.484  2.554   66.618  1.00 106.86 ? 95  A   R "C1'" 1 
ATOM   2651 N  N9    . A   B 2 89 ? 5.547  2.962   65.213  1.00 103.42 ? 95  A   R N9    1 
ATOM   2652 C  C8    . A   B 2 89 ? 5.852  4.209   64.736  1.00 102.88 ? 95  A   R C8    1 
ATOM   2653 N  N7    . A   B 2 89 ? 5.846  4.299   63.426  1.00 99.23  ? 95  A   R N7    1 
ATOM   2654 C  C5    . A   B 2 89 ? 5.519  3.022   63.011  1.00 97.42  ? 95  A   R C5    1 
ATOM   2655 C  C6    . A   B 2 89 ? 5.349  2.454   61.734  1.00 94.02  ? 95  A   R C6    1 
ATOM   2656 N  N6    . A   B 2 89 ? 5.500  3.146   60.602  1.00 92.27  ? 95  A   R N6    1 
ATOM   2657 N  N1    . A   B 2 89 ? 5.022  1.145   61.659  1.00 93.14  ? 95  A   R N1    1 
ATOM   2658 C  C2    . A   B 2 89 ? 4.872  0.448   62.793  1.00 95.67  ? 95  A   R C2    1 
ATOM   2659 N  N3    . A   B 2 89 ? 5.004  0.873   64.052  1.00 99.23  ? 95  A   R N3    1 
ATOM   2660 C  C4    . A   B 2 89 ? 5.333  2.180   64.096  1.00 99.98  ? 95  A   R C4    1 
ATOM   2661 P  P     . U   B 2 90 ? 3.621  1.695   70.749  1.00 125.31 ? 96  U   R P     1 
ATOM   2662 O  OP1   . U   B 2 90 ? 2.595  2.741   70.545  1.00 126.72 ? 96  U   R OP1   1 
ATOM   2663 O  OP2   . U   B 2 90 ? 4.436  1.704   71.987  1.00 128.71 ? 96  U   R OP2   1 
ATOM   2664 O  "O5'" . U   B 2 90 ? 2.928  0.252   70.588  1.00 125.55 ? 96  U   R "O5'" 1 
ATOM   2665 C  "C5'" . U   B 2 90 ? 3.361  -0.900  71.328  1.00 128.24 ? 96  U   R "C5'" 1 
ATOM   2666 C  "C4'" . U   B 2 90 ? 2.354  -1.323  72.387  1.00 133.26 ? 96  U   R "C4'" 1 
ATOM   2667 O  "O4'" . U   B 2 90 ? 2.038  -0.198  73.249  1.00 137.90 ? 96  U   R "O4'" 1 
ATOM   2668 C  "C3'" . U   B 2 90 ? 0.979  -1.751  71.892  1.00 133.07 ? 96  U   R "C3'" 1 
ATOM   2669 O  "O3'" . U   B 2 90 ? 0.968  -3.068  71.351  1.00 130.68 ? 96  U   R "O3'" 1 
ATOM   2670 C  "C2'" . U   B 2 90 ? 0.159  -1.637  73.177  1.00 138.75 ? 96  U   R "C2'" 1 
ATOM   2671 O  "O2'" . U   B 2 90 ? 0.356  -2.699  74.094  1.00 141.38 ? 96  U   R "O2'" 1 
ATOM   2672 C  "C1'" . U   B 2 90 ? 0.706  -0.324  73.734  1.00 141.30 ? 96  U   R "C1'" 1 
ATOM   2673 N  N1    . U   B 2 90 ? -0.153 0.846   73.318  1.00 142.27 ? 96  U   R N1    1 
ATOM   2674 C  C2    . U   B 2 90 ? -1.293 1.149   74.051  1.00 146.46 ? 96  U   R C2    1 
ATOM   2675 O  O2    . U   B 2 90 ? -1.658 0.535   75.038  1.00 149.87 ? 96  U   R O2    1 
ATOM   2676 N  N3    . U   B 2 90 ? -2.009 2.224   73.581  1.00 146.89 ? 96  U   R N3    1 
ATOM   2677 C  C4    . U   B 2 90 ? -1.719 3.008   72.474  1.00 143.83 ? 96  U   R C4    1 
ATOM   2678 O  O4    . U   B 2 90 ? -2.462 3.938   72.184  1.00 145.05 ? 96  U   R O4    1 
ATOM   2679 C  C5    . U   B 2 90 ? -0.526 2.636   71.753  1.00 139.49 ? 96  U   R C5    1 
ATOM   2680 C  C6    . U   B 2 90 ? 0.189  1.593   72.196  1.00 139.08 ? 96  U   R C6    1 
ATOM   2681 P  P     . G   B 2 91 ? -0.221 -3.521  70.369  1.00 128.50 ? 97  G   R P     1 
ATOM   2682 O  OP1   . G   B 2 91 ? -1.418 -3.776  71.209  1.00 131.85 ? 97  G   R OP1   1 
ATOM   2683 O  OP2   . G   B 2 91 ? 0.304  -4.594  69.487  1.00 124.84 ? 97  G   R OP2   1 
ATOM   2684 O  "O5'" . G   B 2 91 ? -0.485 -2.215  69.469  1.00 125.38 ? 97  G   R "O5'" 1 
ATOM   2685 C  "C5'" . G   B 2 91 ? 0.118  -2.068  68.187  1.00 118.75 ? 97  G   R "C5'" 1 
ATOM   2686 C  "C4'" . G   B 2 91 ? 0.307  -0.604  67.835  1.00 116.69 ? 97  G   R "C4'" 1 
ATOM   2687 O  "O4'" . G   B 2 91 ? 1.621  -0.438  67.241  1.00 113.42 ? 97  G   R "O4'" 1 
ATOM   2688 C  "C3'" . G   B 2 91 ? -0.665 -0.072  66.786  1.00 114.15 ? 97  G   R "C3'" 1 
ATOM   2689 O  "O3'" . G   B 2 91 ? -1.775 0.588   67.375  1.00 115.93 ? 97  G   R "O3'" 1 
ATOM   2690 C  "C2'" . G   B 2 91 ? 0.197  0.893   65.980  1.00 111.71 ? 97  G   R "C2'" 1 
ATOM   2691 O  "O2'" . G   B 2 91 ? 0.381  2.136   66.627  1.00 114.29 ? 97  G   R "O2'" 1 
ATOM   2692 C  "C1'" . G   B 2 91 ? 1.498  0.100   65.932  1.00 110.00 ? 97  G   R "C1'" 1 
ATOM   2693 N  N9    . G   B 2 91 ? 1.526  -0.984  64.934  1.00 106.52 ? 97  G   R N9    1 
ATOM   2694 C  C8    . G   B 2 91 ? 1.959  -2.275  65.147  1.00 105.98 ? 97  G   R C8    1 
ATOM   2695 N  N7    . G   B 2 91 ? 1.879  -3.045  64.098  1.00 102.87 ? 97  G   R N7    1 
ATOM   2696 C  C5    . G   B 2 91 ? 1.359  -2.218  63.112  1.00 100.80 ? 97  G   R C5    1 
ATOM   2697 C  C6    . G   B 2 91 ? 1.053  -2.506  61.759  1.00 97.12  ? 97  G   R C6    1 
ATOM   2698 O  O6    . G   B 2 91 ? 1.192  -3.582  61.163  1.00 94.92  ? 97  G   R O6    1 
ATOM   2699 N  N1    . G   B 2 91 ? 0.540  -1.396  61.087  1.00 96.27  ? 97  G   R N1    1 
ATOM   2700 C  C2    . G   B 2 91 ? 0.348  -0.160  61.658  1.00 98.52  ? 97  G   R C2    1 
ATOM   2701 N  N2    . G   B 2 91 ? -0.156 0.793   60.864  1.00 97.78  ? 97  G   R N2    1 
ATOM   2702 N  N3    . G   B 2 91 ? 0.633  0.125   62.924  1.00 102.02 ? 97  G   R N3    1 
ATOM   2703 C  C4    . G   B 2 91 ? 1.134  -0.945  63.602  1.00 103.11 ? 97  G   R C4    1 
ATOM   2704 P  P     . G   B 2 92 ? -3.186 0.594   66.614  1.00 114.32 ? 98  G   R P     1 
ATOM   2705 O  OP1   . G   B 2 92 ? -4.104 1.397   67.454  1.00 118.79 ? 98  G   R OP1   1 
ATOM   2706 O  OP2   . G   B 2 92 ? -3.530 -0.811  66.289  1.00 112.63 ? 98  G   R OP2   1 
ATOM   2707 O  "O5'" . G   B 2 92 ? -2.907 1.370   65.233  1.00 109.66 ? 98  G   R "O5'" 1 
ATOM   2708 C  "C5'" . G   B 2 92 ? -3.692 2.498   64.827  1.00 108.72 ? 98  G   R "C5'" 1 
ATOM   2709 C  "C4'" . G   B 2 92 ? -4.635 2.161   63.682  1.00 105.68 ? 98  G   R "C4'" 1 
ATOM   2710 O  "O4'" . G   B 2 92 ? -3.906 1.481   62.632  1.00 100.83 ? 98  G   R "O4'" 1 
ATOM   2711 C  "C3'" . G   B 2 92 ? -5.789 1.219   64.014  1.00 106.92 ? 98  G   R "C3'" 1 
ATOM   2712 O  "O3'" . G   B 2 92 ? -6.897 1.942   64.546  1.00 110.83 ? 98  G   R "O3'" 1 
ATOM   2713 C  "C2'" . G   B 2 92 ? -6.121 0.605   62.655  1.00 103.14 ? 98  G   R "C2'" 1 
ATOM   2714 O  "O2'" . G   B 2 92 ? -7.017 1.395   61.896  1.00 103.33 ? 98  G   R "O2'" 1 
ATOM   2715 C  "C1'" . G   B 2 92 ? -4.761 0.567   61.960  1.00 99.00  ? 98  G   R "C1'" 1 
ATOM   2716 N  N9    . G   B 2 92 ? -4.127 -0.758  61.909  1.00 95.99  ? 98  G   R N9    1 
ATOM   2717 C  C8    . G   B 2 92 ? -3.188 -1.267  62.780  1.00 96.00  ? 98  G   R C8    1 
ATOM   2718 N  N7    . G   B 2 92 ? -2.792 -2.475  62.487  1.00 93.53  ? 98  G   R N7    1 
ATOM   2719 C  C5    . G   B 2 92 ? -3.509 -2.797  61.342  1.00 91.51  ? 98  G   R C5    1 
ATOM   2720 C  C6    . G   B 2 92 ? -3.498 -3.982  60.559  1.00 88.74  ? 98  G   R C6    1 
ATOM   2721 O  O6    . G   B 2 92 ? -2.830 -5.009  60.737  1.00 87.59  ? 98  G   R O6    1 
ATOM   2722 N  N1    . G   B 2 92 ? -4.373 -3.908  59.474  1.00 87.39  ? 98  G   R N1    1 
ATOM   2723 C  C2    . G   B 2 92 ? -5.167 -2.821  59.183  1.00 88.54  ? 98  G   R C2    1 
ATOM   2724 N  N2    . G   B 2 92 ? -5.948 -2.927  58.099  1.00 87.22  ? 98  G   R N2    1 
ATOM   2725 N  N3    . G   B 2 92 ? -5.185 -1.703  59.906  1.00 91.17  ? 98  G   R N3    1 
ATOM   2726 C  C4    . G   B 2 92 ? -4.336 -1.754  60.971  1.00 92.77  ? 98  G   R C4    1 
ATOM   2727 O  "O5'" A G   C 3 1  ? 16.121 3.603   54.875  0.50 43.08  ? 1   G   D "O5'" 1 
ATOM   2728 O  "O5'" B G   C 3 1  ? 9.432  4.742   56.897  0.50 47.08  ? 1   G   D "O5'" 1 
ATOM   2729 C  "C5'" A G   C 3 1  ? 14.822 4.172   54.974  0.50 42.82  ? 1   G   D "C5'" 1 
ATOM   2730 C  "C5'" B G   C 3 1  ? 10.834 4.518   56.816  0.50 47.12  ? 1   G   D "C5'" 1 
ATOM   2731 C  "C4'" A G   C 3 1  ? 14.284 4.497   53.594  0.50 42.89  ? 1   G   D "C4'" 1 
ATOM   2732 C  "C4'" B G   C 3 1  ? 11.276 3.513   57.862  0.50 47.23  ? 1   G   D "C4'" 1 
ATOM   2733 O  "O4'" A G   C 3 1  ? 15.105 3.846   52.589  0.50 42.64  ? 1   G   D "O4'" 1 
ATOM   2734 O  "O4'" B G   C 3 1  ? 10.128 2.741   58.293  0.50 47.34  ? 1   G   D "O4'" 1 
ATOM   2735 C  "C3'" A G   C 3 1  ? 12.856 4.032   53.343  0.50 42.93  ? 1   G   D "C3'" 1 
ATOM   2736 C  "C3'" B G   C 3 1  ? 12.309 2.504   57.379  0.50 47.21  ? 1   G   D "C3'" 1 
ATOM   2737 O  "O3'" A G   C 3 1  ? 11.957 5.094   53.603  0.50 43.40  ? 1   G   D "O3'" 1 
ATOM   2738 O  "O3'" B G   C 3 1  ? 13.605 2.969   57.711  0.50 46.80  ? 1   G   D "O3'" 1 
ATOM   2739 C  "C2'" A G   C 3 1  ? 12.863 3.681   51.859  0.50 42.80  ? 1   G   D "C2'" 1 
ATOM   2740 C  "C2'" B G   C 3 1  ? 11.950 1.236   58.149  0.50 47.41  ? 1   G   D "C2'" 1 
ATOM   2741 O  "O2'" A G   C 3 1  ? 12.646 4.816   51.041  0.50 42.34  ? 1   G   D "O2'" 1 
ATOM   2742 O  "O2'" B G   C 3 1  ? 12.551 1.183   59.427  0.50 47.74  ? 1   G   D "O2'" 1 
ATOM   2743 C  "C1'" A G   C 3 1  ? 14.284 3.167   51.660  0.50 42.56  ? 1   G   D "C1'" 1 
ATOM   2744 C  "C1'" B G   C 3 1  ? 10.438 1.361   58.296  0.50 47.49  ? 1   G   D "C1'" 1 
ATOM   2745 N  N9    A G   C 3 1  ? 14.461 1.730   51.854  0.50 42.54  ? 1   G   D N9    1 
ATOM   2746 N  N9    B G   C 3 1  ? 9.690  0.719   57.220  0.50 47.82  ? 1   G   D N9    1 
ATOM   2747 C  C8    A G   C 3 1  ? 15.188 1.111   52.844  0.50 42.62  ? 1   G   D C8    1 
ATOM   2748 C  C8    B G   C 3 1  ? 8.791  1.315   56.369  0.50 47.76  ? 1   G   D C8    1 
ATOM   2749 N  N7    A G   C 3 1  ? 15.181 -0.191  52.765  0.50 42.47  ? 1   G   D N7    1 
ATOM   2750 N  N7    B G   C 3 1  ? 8.273  0.485   55.507  0.50 47.97  ? 1   G   D N7    1 
ATOM   2751 C  C5    A G   C 3 1  ? 14.400 -0.454  51.645  0.50 42.57  ? 1   G   D C5    1 
ATOM   2752 C  C5    B G   C 3 1  ? 8.868  -0.737  55.801  0.50 47.95  ? 1   G   D C5    1 
ATOM   2753 C  C6    A G   C 3 1  ? 14.033 -1.687  51.060  0.50 42.40  ? 1   G   D C6    1 
ATOM   2754 C  C6    B G   C 3 1  ? 8.698  -2.007  55.198  0.50 47.99  ? 1   G   D C6    1 
ATOM   2755 O  O6    A G   C 3 1  ? 14.338 -2.827  51.428  0.50 42.66  ? 1   G   D O6    1 
ATOM   2756 O  O6    B G   C 3 1  ? 7.965  -2.313  54.247  0.50 48.14  ? 1   G   D O6    1 
ATOM   2757 N  N1    A G   C 3 1  ? 13.232 -1.515  49.936  0.50 42.28  ? 1   G   D N1    1 
ATOM   2758 N  N1    B G   C 3 1  ? 9.492  -2.979  55.801  0.50 47.90  ? 1   G   D N1    1 
ATOM   2759 C  C2    A G   C 3 1  ? 12.836 -0.297  49.439  0.50 42.52  ? 1   G   D C2    1 
ATOM   2760 C  C2    B G   C 3 1  ? 10.342 -2.749  56.858  0.50 48.10  ? 1   G   D C2    1 
ATOM   2761 N  N2    A G   C 3 1  ? 12.063 -0.326  48.343  0.50 42.62  ? 1   G   D N2    1 
ATOM   2762 N  N2    B G   C 3 1  ? 11.030 -3.808  57.312  0.50 47.94  ? 1   G   D N2    1 
ATOM   2763 N  N3    A G   C 3 1  ? 13.172 0.870   49.976  0.50 42.63  ? 1   G   D N3    1 
ATOM   2764 N  N3    B G   C 3 1  ? 10.507 -1.564  57.434  0.50 48.07  ? 1   G   D N3    1 
ATOM   2765 C  C4    A G   C 3 1  ? 13.953 0.717   51.073  0.50 42.63  ? 1   G   D C4    1 
ATOM   2766 C  C4    B G   C 3 1  ? 9.742  -0.608  56.855  0.50 47.90  ? 1   G   D C4    1 
ATOM   2767 P  P     A G   C 3 2  ? 10.406 4.786   53.828  0.50 44.54  ? 2   G   D P     1 
ATOM   2768 P  P     B G   C 3 2  ? 14.878 2.407   56.928  0.50 46.67  ? 2   G   D P     1 
ATOM   2769 O  OP1   A G   C 3 2  ? 9.941  3.936   52.712  0.50 43.89  ? 2   G   D OP1   1 
ATOM   2770 O  OP1   B G   C 3 2  ? 14.961 0.945   57.145  0.50 46.44  ? 2   G   D OP1   1 
ATOM   2771 O  OP2   A G   C 3 2  ? 9.720  6.070   54.111  0.50 44.55  ? 2   G   D OP2   1 
ATOM   2772 O  OP2   B G   C 3 2  ? 16.032 3.262   57.282  0.50 46.81  ? 2   G   D OP2   1 
ATOM   2773 O  "O5'" A G   C 3 2  ? 10.418 3.930   55.183  0.50 44.88  ? 2   G   D "O5'" 1 
ATOM   2774 O  "O5'" B G   C 3 2  ? 14.487 2.692   55.403  0.50 47.01  ? 2   G   D "O5'" 1 
ATOM   2775 C  "C5'" A G   C 3 2  ? 10.413 4.607   56.441  0.50 45.05  ? 2   G   D "C5'" 1 
ATOM   2776 C  "C5'" B G   C 3 2  ? 13.921 3.941   55.012  0.50 47.10  ? 2   G   D "C5'" 1 
ATOM   2777 C  "C4'" A G   C 3 2  ? 11.217 3.872   57.501  0.50 45.25  ? 2   G   D "C4'" 1 
ATOM   2778 C  "C4'" B G   C 3 2  ? 14.497 4.393   53.680  0.50 47.44  ? 2   G   D "C4'" 1 
ATOM   2779 O  "O4'" A G   C 3 2  ? 10.314 3.056   58.291  0.50 45.50  ? 2   G   D "O4'" 1 
ATOM   2780 O  "O4'" B G   C 3 2  ? 15.276 3.314   53.106  0.50 47.38  ? 2   G   D "O4'" 1 
ATOM   2781 C  "C3'" A G   C 3 2  ? 12.302 2.934   56.978  0.50 45.32  ? 2   G   D "C3'" 1 
ATOM   2782 C  "C3'" B G   C 3 2  ? 13.476 4.747   52.606  0.50 47.76  ? 2   G   D "C3'" 1 
ATOM   2783 O  "O3'" A G   C 3 2  ? 13.579 3.556   57.059  0.50 44.65  ? 2   G   D "O3'" 1 
ATOM   2784 O  "O3'" B G   C 3 2  ? 14.039 5.659   51.662  0.50 47.89  ? 2   G   D "O3'" 1 
ATOM   2785 C  "C2'" A G   C 3 2  ? 12.211 1.733   57.916  0.50 45.63  ? 2   G   D "C2'" 1 
ATOM   2786 C  "C2'" B G   C 3 2  ? 13.223 3.402   51.944  0.50 47.66  ? 2   G   D "C2'" 1 
ATOM   2787 O  "O2'" A G   C 3 2  ? 12.961 1.919   59.099  0.50 46.12  ? 2   G   D "O2'" 1 
ATOM   2788 O  "O2'" B G   C 3 2  ? 12.798 3.575   50.610  0.50 47.96  ? 2   G   D "O2'" 1 
ATOM   2789 C  "C1'" A G   C 3 2  ? 10.727 1.706   58.256  0.50 45.72  ? 2   G   D "C1'" 1 
ATOM   2790 C  "C1'" B G   C 3 2  ? 14.626 2.811   51.954  0.50 47.40  ? 2   G   D "C1'" 1 
ATOM   2791 N  N9    A G   C 3 2  ? 9.911  0.999   57.273  0.50 46.10  ? 2   G   D N9    1 
ATOM   2792 N  N9    B G   C 3 2  ? 14.676 1.351   51.980  0.50 47.36  ? 2   G   D N9    1 
ATOM   2793 C  C8    A G   C 3 2  ? 8.962  1.546   56.444  0.50 46.04  ? 2   G   D C8    1 
ATOM   2794 C  C8    B G   C 3 2  ? 15.375 0.564   52.866  0.50 47.24  ? 2   G   D C8    1 
ATOM   2795 N  N7    A G   C 3 2  ? 8.389  0.670   55.668  0.50 46.27  ? 2   G   D N7    1 
ATOM   2796 N  N7    B G   C 3 2  ? 15.242 -0.714  52.644  0.50 47.16  ? 2   G   D N7    1 
ATOM   2797 C  C5    A G   C 3 2  ? 8.995  -0.536  56.001  0.50 46.33  ? 2   G   D C5    1 
ATOM   2798 C  C5    B G   C 3 2  ? 14.403 -0.782  51.538  0.50 47.21  ? 2   G   D C5    1 
ATOM   2799 C  C6    A G   C 3 2  ? 8.780  -1.840  55.491  0.50 46.41  ? 2   G   D C6    1 
ATOM   2800 C  C6    B G   C 3 2  ? 13.904 -1.906  50.840  0.50 47.07  ? 2   G   D C6    1 
ATOM   2801 O  O6    A G   C 3 2  ? 7.988  -2.199  54.609  0.50 46.65  ? 2   G   D O6    1 
ATOM   2802 O  O6    B G   C 3 2  ? 14.109 -3.105  51.065  0.50 47.33  ? 2   G   D O6    1 
ATOM   2803 N  N1    A G   C 3 2  ? 9.604  -2.779  56.103  0.50 46.43  ? 2   G   D N1    1 
ATOM   2804 N  N1    B G   C 3 2  ? 13.084 -1.539  49.779  0.50 46.96  ? 2   G   D N1    1 
ATOM   2805 C  C2    A G   C 3 2  ? 10.519 -2.495  57.090  0.50 46.54  ? 2   G   D C2    1 
ATOM   2806 C  C2    B G   C 3 2  ? 12.787 -0.243  49.433  0.50 47.19  ? 2   G   D C2    1 
ATOM   2807 N  N2    A G   C 3 2  ? 11.226 -3.534  57.561  0.50 46.34  ? 2   G   D N2    1 
ATOM   2808 N  N2    B G   C 3 2  ? 11.977 -0.090  48.376  0.50 47.25  ? 2   G   D N2    1 
ATOM   2809 N  N3    A G   C 3 2  ? 10.729 -1.277  57.578  0.50 46.47  ? 2   G   D N3    1 
ATOM   2810 N  N3    B G   C 3 2  ? 13.247 0.824   50.076  0.50 47.31  ? 2   G   D N3    1 
ATOM   2811 C  C4    A G   C 3 2  ? 9.934  -0.350  56.989  0.50 46.27  ? 2   G   D C4    1 
ATOM   2812 C  C4    B G   C 3 2  ? 14.047 0.481   51.116  0.50 47.34  ? 2   G   D C4    1 
HETATM 2813 MG MG    . MG  D 4 .  ? 24.089 25.655  5.968   1.00 48.64  ? 99  MG  P MG    1 
HETATM 2814 MG MG    . MG  E 4 .  ? 27.360 -4.428  42.216  1.00 53.89  ? 1   MG  R MG    1 
HETATM 2815 MG MG    . MG  F 4 .  ? 13.324 -8.311  31.965  1.00 57.92  ? 670 MG  R MG    1 
HETATM 2816 O  O     . HOH G 5 .  ? 24.331 27.262  4.511   1.00 48.12  ? 100 HOH P O     1 
HETATM 2817 O  O     . HOH G 5 .  ? 23.078 27.014  7.340   1.00 49.09  ? 101 HOH P O     1 
HETATM 2818 O  O     . HOH G 5 .  ? 25.953 26.143  6.977   1.00 48.96  ? 102 HOH P O     1 
HETATM 2819 O  O     . HOH G 5 .  ? 14.559 17.945  11.250  1.00 52.14  ? 103 HOH P O     1 
HETATM 2820 O  O     . HOH G 5 .  ? 13.742 8.154   5.137   1.00 44.04  ? 104 HOH P O     1 
HETATM 2821 O  O     . HOH G 5 .  ? 17.045 10.402  -4.387  1.00 60.51  ? 105 HOH P O     1 
HETATM 2822 O  O     . HOH G 5 .  ? 8.934  25.162  5.776   1.00 42.93  ? 106 HOH P O     1 
HETATM 2823 O  O     . HOH H 5 .  ? 18.013 -0.873  43.700  1.00 38.36  ? 4   HOH R O     1 
HETATM 2824 O  O     . HOH H 5 .  ? 15.536 -5.152  17.671  1.00 44.72  ? 5   HOH R O     1 
HETATM 2825 O  O     . HOH H 5 .  ? 3.107  -1.687  27.422  1.00 43.05  ? 6   HOH R O     1 
HETATM 2826 O  O     . HOH H 5 .  ? 25.548 -4.748  41.045  1.00 53.63  ? 671 HOH R O     1 
HETATM 2827 O  O     . HOH H 5 .  ? 29.184 -4.122  43.369  1.00 54.31  ? 672 HOH R O     1 
HETATM 2828 O  O     . HOH H 5 .  ? 28.387 -5.903  40.971  1.00 53.99  ? 673 HOH R O     1 
HETATM 2829 O  O     . HOH H 5 .  ? 26.335 -2.982  43.476  1.00 54.59  ? 674 HOH R O     1 
HETATM 2830 O  O     . HOH H 5 .  ? 27.992 -2.864  40.836  1.00 54.05  ? 675 HOH R O     1 
HETATM 2831 O  O     . HOH H 5 .  ? 26.746 -6.012  43.585  1.00 53.91  ? 676 HOH R O     1 
HETATM 2832 O  O     . HOH H 5 .  ? 9.408  -10.564 10.415  1.00 59.12  ? 677 HOH R O     1 
HETATM 2833 O  O     . HOH H 5 .  ? 13.887 -5.353  55.020  1.00 38.53  ? 678 HOH R O     1 
HETATM 2834 O  O     . HOH H 5 .  ? 18.572 -1.022  59.352  1.00 57.64  ? 679 HOH R O     1 
HETATM 2835 O  O     . HOH H 5 .  ? 4.025  -13.241 38.626  1.00 31.16  ? 680 HOH R O     1 
HETATM 2836 O  O     . HOH H 5 .  ? 5.314  -2.170  51.936  1.00 51.51  ? 681 HOH R O     1 
HETATM 2837 O  O     . HOH H 5 .  ? 6.134  -1.182  26.878  1.00 43.92  ? 682 HOH R O     1 
HETATM 2838 O  O     . HOH H 5 .  ? 3.773  -4.095  42.379  1.00 45.33  ? 683 HOH R O     1 
HETATM 2839 O  O     . HOH H 5 .  ? 23.740 -8.783  23.854  1.00 43.77  ? 684 HOH R O     1 
HETATM 2840 O  O     . HOH H 5 .  ? 21.797 -7.500  7.415   1.00 57.86  ? 685 HOH R O     1 
HETATM 2841 O  O     . HOH H 5 .  ? 26.830 -2.414  38.163  1.00 50.48  ? 686 HOH R O     1 
HETATM 2842 O  O     . HOH H 5 .  ? 11.161 -8.114  31.801  1.00 57.51  ? 687 HOH R O     1 
HETATM 2843 O  O     . HOH H 5 .  ? 15.489 -8.503  32.131  1.00 57.79  ? 688 HOH R O     1 
HETATM 2844 O  O     . HOH H 5 .  ? 13.465 -8.702  29.821  1.00 57.44  ? 689 HOH R O     1 
HETATM 2845 O  O     . HOH H 5 .  ? 13.183 -7.920  34.103  1.00 57.62  ? 690 HOH R O     1 
HETATM 2846 O  O     . HOH H 5 .  ? 13.544 -6.172  31.648  1.00 57.95  ? 691 HOH R O     1 
HETATM 2847 O  O     . HOH H 5 .  ? 13.122 -10.459 32.289  1.00 57.50  ? 692 HOH R O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ARG A 7  ? 0.7912 0.8176 1.6848 0.0739  -0.5277 0.3814  7   ARG P N     
2    C CA    . ARG A 7  ? 0.7713 0.8018 1.5024 0.0362  -0.5311 0.3470  7   ARG P CA    
3    C C     . ARG A 7  ? 0.7231 0.7463 1.3305 0.0338  -0.4454 0.2828  7   ARG P C     
4    O O     . ARG A 7  ? 0.6534 0.7226 1.2583 0.0399  -0.3990 0.2435  7   ARG P O     
5    C CB    . ARG A 7  ? 0.8818 0.8490 1.4723 -0.0070 -0.6248 0.3830  7   ARG P CB    
6    C CG    . ARG A 7  ? 0.9321 0.9134 1.6049 -0.0215 -0.7285 0.4298  7   ARG P CG    
7    C CD    . ARG A 7  ? 1.0158 0.9460 1.4929 -0.0647 -0.7798 0.4123  7   ARG P CD    
8    N NE    . ARG A 7  ? 0.9412 0.8919 1.3210 -0.0637 -0.6886 0.3447  7   ARG P NE    
9    C CZ    . ARG A 7  ? 0.9960 0.9031 1.2066 -0.0896 -0.6976 0.3133  7   ARG P CZ    
10   N NH1   . ARG A 7  ? 1.1486 0.9739 1.2354 -0.1216 -0.7947 0.3356  7   ARG P NH1   
11   N NH2   . ARG A 7  ? 0.9175 0.8527 1.0769 -0.0818 -0.6124 0.2589  7   ARG P NH2   
12   N N     . PRO A 8  ? 0.7671 0.7334 1.2848 0.0225  -0.4296 0.2787  8   PRO P N     
13   C CA    . PRO A 8  ? 0.7274 0.6933 1.1581 0.0153  -0.3622 0.2256  8   PRO P CA    
14   C C     . PRO A 8  ? 0.6694 0.6624 1.1748 0.0496  -0.2986 0.1804  8   PRO P C     
15   O O     . PRO A 8  ? 0.6774 0.6718 1.3014 0.0855  -0.2876 0.1900  8   PRO P O     
16   C CB    . PRO A 8  ? 0.7984 0.6986 1.1760 -0.0023 -0.3660 0.2464  8   PRO P CB    
17   C CG    . PRO A 8  ? 0.8884 0.7495 1.2432 -0.0167 -0.4376 0.3086  8   PRO P CG    
18   C CD    . PRO A 8  ? 0.8660 0.7652 1.3589 0.0098  -0.4785 0.3295  8   PRO P CD    
19   N N     . ASN A 9  ? 0.6317 0.6393 1.0626 0.0406  -0.2561 0.1337  9   ASN P N     
20   C CA    . ASN A 9  ? 0.6062 0.6265 1.0602 0.0686  -0.2017 0.0884  9   ASN P CA    
21   C C     . ASN A 9  ? 0.6052 0.6087 0.9687 0.0487  -0.1793 0.0463  9   ASN P C     
22   O O     . ASN A 9  ? 0.5969 0.6091 0.9010 0.0155  -0.1937 0.0535  9   ASN P O     
23   C CB    . ASN A 9  ? 0.5518 0.6357 1.0444 0.0825  -0.1883 0.0878  9   ASN P CB    
24   C CG    . ASN A 9  ? 0.5628 0.6515 1.1033 0.1238  -0.1267 0.0625  9   ASN P CG    
25   O OD1   . ASN A 9  ? 0.5926 0.6575 1.0531 0.1277  -0.0906 0.0188  9   ASN P OD1   
26   N ND2   . ASN A 9  ? 0.5678 0.6840 1.2383 0.1554  -0.1142 0.0936  9   ASN P ND2   
27   N N     . HIS A 10 ? 0.6318 0.6057 0.9850 0.0698  -0.1448 0.0049  10  HIS P N     
28   C CA    . HIS A 10 ? 0.6431 0.6002 0.9199 0.0489  -0.1404 -0.0336 10  HIS P CA    
29   C C     . HIS A 10 ? 0.5757 0.5991 0.8154 0.0387  -0.1352 -0.0398 10  HIS P C     
30   O O     . HIS A 10 ? 0.5627 0.5997 0.7652 0.0119  -0.1461 -0.0501 10  HIS P O     
31   C CB    . HIS A 10 ? 0.7257 0.6136 0.9686 0.0759  -0.1134 -0.0802 10  HIS P CB    
32   C CG    . HIS A 10 ? 0.8195 0.6165 1.0792 0.0793  -0.1231 -0.0880 10  HIS P CG    
33   N ND1   . HIS A 10 ? 0.8911 0.6217 1.1033 0.0490  -0.1507 -0.1153 10  HIS P ND1   
34   C CD2   . HIS A 10 ? 0.8649 0.6224 1.1972 0.1084  -0.1144 -0.0687 10  HIS P CD2   
35   C CE1   . HIS A 10 ? 0.9748 0.6196 1.2183 0.0582  -0.1565 -0.1162 10  HIS P CE1   
36   N NE2   . HIS A 10 ? 0.9584 0.6180 1.2745 0.0974  -0.1322 -0.0879 10  HIS P NE2   
37   N N     . THR A 11 ? 0.5363 0.6017 0.8062 0.0606  -0.1193 -0.0284 11  THR P N     
38   C CA    . THR A 11 ? 0.4831 0.6008 0.7270 0.0559  -0.1127 -0.0323 11  THR P CA    
39   C C     . THR A 11 ? 0.4424 0.5949 0.6987 0.0367  -0.1403 -0.0024 11  THR P C     
40   O O     . THR A 11 ? 0.4546 0.5997 0.7521 0.0368  -0.1636 0.0269  11  THR P O     
41   C CB    . THR A 11 ? 0.4854 0.6187 0.7545 0.0892  -0.0740 -0.0350 11  THR P CB    
42   O OG1   . THR A 11 ? 0.5657 0.6397 0.8074 0.1162  -0.0396 -0.0626 11  THR P OG1   
43   C CG2   . THR A 11 ? 0.4576 0.6258 0.6824 0.0837  -0.0658 -0.0428 11  THR P CG2   
44   N N     . ILE A 12 ? 0.4142 0.5931 0.6279 0.0214  -0.1415 -0.0100 12  ILE P N     
45   C CA    . ILE A 12 ? 0.4072 0.5985 0.6046 0.0088  -0.1610 0.0070  12  ILE P CA    
46   C C     . ILE A 12 ? 0.3748 0.5975 0.5831 0.0174  -0.1540 0.0015  12  ILE P C     
47   O O     . ILE A 12 ? 0.3582 0.5985 0.5567 0.0254  -0.1320 -0.0154 12  ILE P O     
48   C CB    . ILE A 12 ? 0.4301 0.6112 0.5684 -0.0123 -0.1585 0.0072  12  ILE P CB    
49   C CG1   . ILE A 12 ? 0.4048 0.6133 0.5439 -0.0143 -0.1358 -0.0133 12  ILE P CG1   
50   C CG2   . ILE A 12 ? 0.4815 0.6250 0.6097 -0.0258 -0.1687 0.0283  12  ILE P CG2   
51   C CD1   . ILE A 12 ? 0.4145 0.6356 0.5259 -0.0234 -0.1178 -0.0105 12  ILE P CD1   
52   N N     . TYR A 13 ? 0.3813 0.6028 0.6092 0.0124  -0.1815 0.0197  13  TYR P N     
53   C CA    . TYR A 13 ? 0.3599 0.6029 0.6139 0.0154  -0.1817 0.0214  13  TYR P CA    
54   C C     . TYR A 13 ? 0.3885 0.6068 0.5719 0.0015  -0.1963 0.0088  13  TYR P C     
55   O O     . TYR A 13 ? 0.4472 0.6229 0.5860 -0.0134 -0.2330 0.0145  13  TYR P O     
56   C CB    . TYR A 13 ? 0.3627 0.6179 0.7114 0.0161  -0.2088 0.0530  13  TYR P CB    
57   C CG    . TYR A 13 ? 0.3450 0.6193 0.7417 0.0115  -0.2161 0.0641  13  TYR P CG    
58   C CD1   . TYR A 13 ? 0.3072 0.6177 0.7480 0.0292  -0.1674 0.0692  13  TYR P CD1   
59   C CD2   . TYR A 13 ? 0.3820 0.6241 0.7689 -0.0126 -0.2745 0.0715  13  TYR P CD2   
60   C CE1   . TYR A 13 ? 0.3041 0.6302 0.7991 0.0221  -0.1717 0.0884  13  TYR P CE1   
61   C CE2   . TYR A 13 ? 0.3837 0.6340 0.8263 -0.0217 -0.2878 0.0834  13  TYR P CE2   
62   C CZ    . TYR A 13 ? 0.3380 0.6365 0.8458 -0.0047 -0.2338 0.0956  13  TYR P CZ    
63   O OH    . TYR A 13 ? 0.3510 0.6563 0.9234 -0.0164 -0.2442 0.1160  13  TYR P OH    
64   N N     . ILE A 14 ? 0.3702 0.6050 0.5354 0.0090  -0.1683 -0.0082 14  ILE P N     
65   C CA    . ILE A 14 ? 0.4046 0.6131 0.5158 0.0058  -0.1681 -0.0227 14  ILE P CA    
66   C C     . ILE A 14 ? 0.4088 0.6106 0.5519 0.0054  -0.1861 -0.0178 14  ILE P C     
67   O O     . ILE A 14 ? 0.3699 0.6083 0.5730 0.0137  -0.1731 -0.0053 14  ILE P O     
68   C CB    . ILE A 14 ? 0.3854 0.6182 0.4875 0.0155  -0.1323 -0.0362 14  ILE P CB    
69   C CG1   . ILE A 14 ? 0.3867 0.6267 0.4803 0.0084  -0.1200 -0.0341 14  ILE P CG1   
70   C CG2   . ILE A 14 ? 0.4343 0.6356 0.4922 0.0213  -0.1182 -0.0503 14  ILE P CG2   
71   C CD1   . ILE A 14 ? 0.3600 0.6394 0.4920 0.0115  -0.1061 -0.0379 14  ILE P CD1   
72   N N     . ASN A 15 ? 0.4792 0.6215 0.5698 -0.0060 -0.2168 -0.0265 15  ASN P N     
73   C CA    . ASN A 15 ? 0.5068 0.6221 0.6287 -0.0159 -0.2517 -0.0211 15  ASN P CA    
74   C C     . ASN A 15 ? 0.5634 0.6243 0.6167 -0.0070 -0.2380 -0.0503 15  ASN P C     
75   O O     . ASN A 15 ? 0.5893 0.6370 0.5756 0.0073  -0.1998 -0.0707 15  ASN P O     
76   C CB    . ASN A 15 ? 0.5790 0.6449 0.6881 -0.0413 -0.3191 -0.0096 15  ASN P CB    
77   C CG    . ASN A 15 ? 0.5861 0.6574 0.8003 -0.0593 -0.3658 0.0163  15  ASN P CG    
78   O OD1   . ASN A 15 ? 0.5260 0.6619 0.8479 -0.0504 -0.3348 0.0397  15  ASN P OD1   
79   N ND2   . ASN A 15 ? 0.6943 0.6915 0.8751 -0.0874 -0.4436 0.0162  15  ASN P ND2   
80   N N     . ASN A 16 ? 0.5903 0.6189 0.6741 -0.0137 -0.2641 -0.0489 16  ASN P N     
81   C CA    . ASN A 16 ? 0.6775 0.6253 0.6893 -0.0040 -0.2590 -0.0812 16  ASN P CA    
82   C C     . ASN A 16 ? 0.6390 0.6225 0.6555 0.0293  -0.1936 -0.0918 16  ASN P C     
83   O O     . ASN A 16 ? 0.7122 0.6472 0.6514 0.0479  -0.1593 -0.1206 16  ASN P O     
84   C CB    . ASN A 16 ? 0.8196 0.6590 0.6864 -0.0149 -0.2876 -0.1124 16  ASN P CB    
85   C CG    . ASN A 16 ? 0.9544 0.6748 0.7287 -0.0068 -0.2924 -0.1522 16  ASN P CG    
86   O OD1   . ASN A 16 ? 0.9814 0.6625 0.8024 -0.0206 -0.3359 -0.1506 16  ASN P OD1   
87   N ND2   . ASN A 16 ? 1.0540 0.7086 0.6972 0.0168  -0.2422 -0.1870 16  ASN P ND2   
88   N N     . LEU A 17 ? 0.5385 0.6039 0.6468 0.0377  -0.1760 -0.0647 17  LEU P N     
89   C CA    . LEU A 17 ? 0.5062 0.6109 0.6420 0.0645  -0.1352 -0.0647 17  LEU P CA    
90   C C     . LEU A 17 ? 0.5361 0.6124 0.7121 0.0778  -0.1389 -0.0587 17  LEU P C     
91   O O     . LEU A 17 ? 0.5461 0.6007 0.7532 0.0619  -0.1696 -0.0415 17  LEU P O     
92   C CB    . LEU A 17 ? 0.4166 0.6065 0.6002 0.0644  -0.1260 -0.0401 17  LEU P CB    
93   C CG    . LEU A 17 ? 0.3871 0.6048 0.5474 0.0534  -0.1215 -0.0431 17  LEU P CG    
94   C CD1   . LEU A 17 ? 0.3243 0.5952 0.5161 0.0528  -0.1207 -0.0243 17  LEU P CD1   
95   C CD2   . LEU A 17 ? 0.4021 0.6192 0.5348 0.0614  -0.0921 -0.0592 17  LEU P CD2   
96   N N     . ASN A 18 ? 0.5549 0.6335 0.7482 0.1073  -0.1068 -0.0668 18  ASN P N     
97   C CA    . ASN A 18 ? 0.5817 0.6382 0.8291 0.1267  -0.1086 -0.0548 18  ASN P CA    
98   C C     . ASN A 18 ? 0.5200 0.6360 0.8273 0.1175  -0.1302 -0.0080 18  ASN P C     
99   O O     . ASN A 18 ? 0.4692 0.6531 0.7979 0.1223  -0.1257 0.0109  18  ASN P O     
100  C CB    . ASN A 18 ? 0.6033 0.6715 0.8873 0.1650  -0.0659 -0.0638 18  ASN P CB    
101  C CG    . ASN A 18 ? 0.6582 0.6787 0.9961 0.1926  -0.0652 -0.0576 18  ASN P CG    
102  O OD1   . ASN A 18 ? 0.6430 0.6665 1.0228 0.1834  -0.0995 -0.0245 18  ASN P OD1   
103  N ND2   . ASN A 18 ? 0.7344 0.7056 1.0724 0.2298  -0.0188 -0.0863 18  ASN P ND2   
104  N N     . GLU A 19 ? 0.5478 0.6283 0.8740 0.1020  -0.1546 0.0121  19  GLU P N     
105  C CA    . GLU A 19 ? 0.5186 0.6428 0.8808 0.0918  -0.1623 0.0623  19  GLU P CA    
106  C C     . GLU A 19 ? 0.5375 0.6730 0.9342 0.1144  -0.1636 0.0946  19  GLU P C     
107  O O     . GLU A 19 ? 0.5348 0.7030 0.9269 0.1106  -0.1666 0.1369  19  GLU P O     
108  C CB    . GLU A 19 ? 0.5449 0.6335 0.9401 0.0646  -0.1821 0.0842  19  GLU P CB    
109  C CG    . GLU A 19 ? 0.5358 0.6268 0.9201 0.0388  -0.1952 0.0683  19  GLU P CG    
110  C CD    . GLU A 19 ? 0.5969 0.6315 1.0315 0.0084  -0.2352 0.0792  19  GLU P CD    
111  O OE1   . GLU A 19 ? 0.6350 0.6391 1.1239 0.0033  -0.2443 0.1092  19  GLU P OE1   
112  O OE2   . GLU A 19 ? 0.6208 0.6374 1.0459 -0.0135 -0.2658 0.0620  19  GLU P OE2   
113  N N     . LYS A 20 ? 0.5764 0.6778 1.0015 0.1409  -0.1597 0.0765  20  LYS P N     
114  C CA    . LYS A 20 ? 0.6032 0.7110 1.0856 0.1664  -0.1694 0.1114  20  LYS P CA    
115  C C     . LYS A 20 ? 0.5650 0.7500 1.0602 0.1769  -0.1769 0.1284  20  LYS P C     
116  O O     . LYS A 20 ? 0.5908 0.7900 1.1272 0.1910  -0.2029 0.1701  20  LYS P O     
117  C CB    . LYS A 20 ? 0.6684 0.7092 1.1951 0.1983  -0.1560 0.0855  20  LYS P CB    
118  C CG    . LYS A 20 ? 0.7499 0.6928 1.2800 0.1891  -0.1713 0.0853  20  LYS P CG    
119  C CD    . LYS A 20 ? 0.8483 0.7159 1.4277 0.2312  -0.1575 0.0675  20  LYS P CD    
120  C CE    . LYS A 20 ? 0.9303 0.7047 1.5416 0.2229  -0.1868 0.0904  20  LYS P CE    
121  N NZ    . LYS A 20 ? 1.0137 0.7183 1.6905 0.2722  -0.1732 0.0837  20  LYS P NZ    
122  N N     . ILE A 21 ? 0.5177 0.7451 0.9798 0.1666  -0.1638 0.0998  21  ILE P N     
123  C CA    . ILE A 21 ? 0.4940 0.7866 0.9738 0.1681  -0.1809 0.1116  21  ILE P CA    
124  C C     . ILE A 21 ? 0.5107 0.8142 0.9192 0.1483  -0.2117 0.1431  21  ILE P C     
125  O O     . ILE A 21 ? 0.5121 0.7942 0.8560 0.1315  -0.1969 0.1437  21  ILE P O     
126  C CB    . ILE A 21 ? 0.4509 0.7753 0.9225 0.1607  -0.1550 0.0733  21  ILE P CB    
127  C CG1   . ILE A 21 ? 0.4734 0.7597 0.9592 0.1789  -0.1087 0.0371  21  ILE P CG1   
128  C CG2   . ILE A 21 ? 0.4325 0.8220 0.9630 0.1609  -0.1788 0.0890  21  ILE P CG2   
129  C CD1   . ILE A 21 ? 0.5244 0.7977 1.1031 0.2184  -0.0905 0.0443  21  ILE P CD1   
130  N N     . LYS A 22 ? 0.5432 0.8740 0.9639 0.1515  -0.2545 0.1715  22  LYS P N     
131  C CA    . LYS A 22 ? 0.6036 0.9223 0.9178 0.1350  -0.2864 0.1956  22  LYS P CA    
132  C C     . LYS A 22 ? 0.5822 0.9108 0.8249 0.1154  -0.2739 0.1585  22  LYS P C     
133  O O     . LYS A 22 ? 0.5213 0.8797 0.8156 0.1125  -0.2569 0.1248  22  LYS P O     
134  C CB    . LYS A 22 ? 0.6693 0.9997 1.0060 0.1400  -0.3555 0.2348  22  LYS P CB    
135  C CG    . LYS A 22 ? 0.7297 1.0327 1.1026 0.1581  -0.3781 0.2875  22  LYS P CG    
136  C CD    . LYS A 22 ? 0.8250 1.1296 1.1891 0.1570  -0.4636 0.3347  22  LYS P CD    
137  C CE    . LYS A 22 ? 0.9073 1.1740 1.2907 0.1740  -0.4906 0.3972  22  LYS P CE    
138  N NZ    . LYS A 22 ? 1.0174 1.2776 1.3829 0.1711  -0.5899 0.4511  22  LYS P NZ    
139  N N     . LYS A 23 ? 0.6513 0.9456 0.7694 0.1049  -0.2760 0.1663  23  LYS P N     
140  C CA    . LYS A 23 ? 0.6555 0.9424 0.6994 0.0912  -0.2645 0.1305  23  LYS P CA    
141  C C     . LYS A 23 ? 0.6664 0.9734 0.7337 0.0792  -0.3210 0.1163  23  LYS P C     
142  O O     . LYS A 23 ? 0.6141 0.9420 0.7143 0.0687  -0.3099 0.0834  23  LYS P O     
143  C CB    . LYS A 23 ? 0.7633 0.9931 0.6571 0.0910  -0.2458 0.1424  23  LYS P CB    
144  C CG    . LYS A 23 ? 0.7610 0.9759 0.6010 0.0878  -0.2010 0.1055  23  LYS P CG    
145  C CD    . LYS A 23 ? 0.9092 1.0560 0.5885 0.0959  -0.1708 0.1138  23  LYS P CD    
146  C CE    . LYS A 23 ? 1.0350 1.1225 0.5839 0.0871  -0.2217 0.0850  23  LYS P CE    
147  N NZ    . LYS A 23 ? 1.1928 1.1942 0.5636 0.1013  -0.1708 0.0746  23  LYS P NZ    
148  N N     . ASP A 24 ? 0.7423 1.0421 0.8035 0.0780  -0.3875 0.1481  24  ASP P N     
149  C CA    . ASP A 24 ? 0.7694 1.0909 0.8785 0.0609  -0.4610 0.1473  24  ASP P CA    
150  C C     . ASP A 24 ? 0.6521 1.0483 0.9312 0.0605  -0.4377 0.1311  24  ASP P C     
151  O O     . ASP A 24 ? 0.6377 1.0435 0.9276 0.0400  -0.4458 0.1056  24  ASP P O     
152  C CB    . ASP A 24 ? 0.8529 1.1730 0.9890 0.0643  -0.5414 0.1985  24  ASP P CB    
153  C CG    . ASP A 24 ? 1.0104 1.2420 0.9483 0.0631  -0.5681 0.2226  24  ASP P CG    
154  O OD1   . ASP A 24 ? 1.0335 1.2197 0.8500 0.0699  -0.4983 0.2090  24  ASP P OD1   
155  O OD2   . ASP A 24 ? 1.1258 1.3321 1.0325 0.0558  -0.6588 0.2610  24  ASP P OD2   
156  N N     . GLU A 25 ? 0.5862 1.0232 0.9877 0.0848  -0.4028 0.1467  25  GLU P N     
157  C CA    . GLU A 25 ? 0.5074 1.0062 1.0601 0.0928  -0.3662 0.1373  25  GLU P CA    
158  C C     . GLU A 25 ? 0.4484 0.9373 0.9587 0.0875  -0.2970 0.0955  25  GLU P C     
159  O O     . GLU A 25 ? 0.4154 0.9400 0.9944 0.0786  -0.2771 0.0847  25  GLU P O     
160  C CB    . GLU A 25 ? 0.4912 1.0129 1.1642 0.1280  -0.3413 0.1609  25  GLU P CB    
161  C CG    . GLU A 25 ? 0.5473 1.1029 1.3319 0.1369  -0.4134 0.2120  25  GLU P CG    
162  C CD    . GLU A 25 ? 0.5409 1.1759 1.4952 0.1280  -0.4408 0.2288  25  GLU P CD    
163  O OE1   . GLU A 25 ? 0.4936 1.1603 1.4963 0.1236  -0.3810 0.2031  25  GLU P OE1   
164  O OE2   . GLU A 25 ? 0.5903 1.2562 1.6376 0.1234  -0.5259 0.2745  25  GLU P OE2   
165  N N     . LEU A 26 ? 0.4439 0.8851 0.8506 0.0911  -0.2639 0.0800  26  LEU P N     
166  C CA    . LEU A 26 ? 0.3997 0.8257 0.7677 0.0859  -0.2124 0.0476  26  LEU P CA    
167  C C     . LEU A 26 ? 0.3973 0.8256 0.7322 0.0621  -0.2226 0.0290  26  LEU P C     
168  O O     . LEU A 26 ? 0.3679 0.8145 0.7437 0.0559  -0.1952 0.0164  26  LEU P O     
169  C CB    . LEU A 26 ? 0.4069 0.7888 0.6975 0.0893  -0.1911 0.0454  26  LEU P CB    
170  C CG    . LEU A 26 ? 0.3767 0.7386 0.6380 0.0829  -0.1545 0.0210  26  LEU P CG    
171  C CD1   . LEU A 26 ? 0.3694 0.7287 0.6716 0.0910  -0.1271 0.0041  26  LEU P CD1   
172  C CD2   . LEU A 26 ? 0.3836 0.7157 0.6129 0.0836  -0.1449 0.0336  26  LEU P CD2   
173  N N     . LYS A 27 ? 0.4497 0.8470 0.6999 0.0497  -0.2595 0.0279  27  LYS P N     
174  C CA    . LYS A 27 ? 0.4728 0.8528 0.6868 0.0274  -0.2787 0.0070  27  LYS P CA    
175  C C     . LYS A 27 ? 0.4548 0.8837 0.7867 0.0106  -0.3064 0.0161  27  LYS P C     
176  O O     . LYS A 27 ? 0.4281 0.8673 0.7945 -0.0030 -0.2847 0.0047  27  LYS P O     
177  C CB    . LYS A 27 ? 0.5788 0.8982 0.6684 0.0203  -0.3223 0.0022  27  LYS P CB    
178  C CG    . LYS A 27 ? 0.6129 0.8779 0.5842 0.0337  -0.2775 -0.0115 27  LYS P CG    
179  C CD    . LYS A 27 ? 0.7449 0.9299 0.5749 0.0261  -0.3098 -0.0310 27  LYS P CD    
180  C CE    . LYS A 27 ? 0.8291 0.9578 0.5309 0.0489  -0.2608 -0.0278 27  LYS P CE    
181  N NZ    . LYS A 27 ? 0.9709 1.0039 0.5229 0.0498  -0.2608 -0.0631 27  LYS P NZ    
182  N N     . LYS A 28 ? 0.4756 0.9372 0.8829 0.0116  -0.3542 0.0447  28  LYS P N     
183  C CA    . LYS A 28 ? 0.4676 0.9884 1.0239 -0.0056 -0.3892 0.0662  28  LYS P CA    
184  C C     . LYS A 28 ? 0.3934 0.9694 1.0666 0.0047  -0.3126 0.0702  28  LYS P C     
185  O O     . LYS A 28 ? 0.3856 0.9933 1.1439 -0.0177 -0.3110 0.0774  28  LYS P O     
186  C CB    . LYS A 28 ? 0.5035 1.0559 1.1422 0.0016  -0.4525 0.1057  28  LYS P CB    
187  C CG    . LYS A 28 ? 0.5572 1.1382 1.2967 -0.0324 -0.5448 0.1293  28  LYS P CG    
188  C CD    . LYS A 28 ? 0.6163 1.2159 1.4179 -0.0260 -0.6271 0.1736  28  LYS P CD    
189  C CE    . LYS A 28 ? 0.6836 1.3117 1.6024 -0.0667 -0.7394 0.2022  28  LYS P CE    
190  N NZ    . LYS A 28 ? 0.7424 1.3990 1.7544 -0.0600 -0.8301 0.2564  28  LYS P NZ    
191  N N     . SER A 29 ? 0.3600 0.9343 1.0238 0.0373  -0.2490 0.0660  29  SER P N     
192  C CA    . SER A 29 ? 0.3301 0.9267 1.0514 0.0531  -0.1678 0.0631  29  SER P CA    
193  C C     . SER A 29 ? 0.3242 0.8854 0.9575 0.0348  -0.1349 0.0392  29  SER P C     
194  O O     . SER A 29 ? 0.3265 0.9142 1.0219 0.0233  -0.1019 0.0498  29  SER P O     
195  C CB    . SER A 29 ? 0.3320 0.9043 1.0316 0.0907  -0.1211 0.0558  29  SER P CB    
196  O OG    . SER A 29 ? 0.3453 0.9595 1.1711 0.1147  -0.1329 0.0854  29  SER P OG    
197  N N     . LEU A 30 ? 0.3243 0.8279 0.8265 0.0327  -0.1429 0.0148  30  LEU P N     
198  C CA    . LEU A 30 ? 0.3238 0.7901 0.7495 0.0175  -0.1251 -0.0027 30  LEU P CA    
199  C C     . LEU A 30 ? 0.3368 0.8120 0.7982 -0.0130 -0.1522 0.0024  30  LEU P C     
200  O O     . LEU A 30 ? 0.3410 0.8063 0.7989 -0.0255 -0.1240 0.0041  30  LEU P O     
201  C CB    . LEU A 30 ? 0.3262 0.7436 0.6470 0.0213  -0.1391 -0.0202 30  LEU P CB    
202  C CG    . LEU A 30 ? 0.3195 0.7128 0.6011 0.0405  -0.1146 -0.0253 30  LEU P CG    
203  C CD1   . LEU A 30 ? 0.3284 0.6979 0.5569 0.0440  -0.1328 -0.0259 30  LEU P CD1   
204  C CD2   . LEU A 30 ? 0.3277 0.6908 0.5686 0.0373  -0.0850 -0.0346 30  LEU P CD2   
205  N N     . HIS A 31 ? 0.3619 0.8436 0.8480 -0.0273 -0.2141 0.0065  31  HIS P N     
206  C CA    . HIS A 31 ? 0.3980 0.8751 0.9241 -0.0621 -0.2601 0.0094  31  HIS P CA    
207  C C     . HIS A 31 ? 0.3787 0.9236 1.0617 -0.0762 -0.2355 0.0433  31  HIS P C     
208  O O     . HIS A 31 ? 0.3901 0.9275 1.0992 -0.1006 -0.2230 0.0497  31  HIS P O     
209  C CB    . HIS A 31 ? 0.4609 0.9172 0.9637 -0.0743 -0.3443 0.0070  31  HIS P CB    
210  C CG    . HIS A 31 ? 0.5383 0.9466 1.0246 -0.1121 -0.4082 -0.0058 31  HIS P CG    
211  N ND1   . HIS A 31 ? 0.5760 1.0214 1.1951 -0.1467 -0.4706 0.0196  31  HIS P ND1   
212  C CD2   . HIS A 31 ? 0.6068 0.9248 0.9658 -0.1204 -0.4227 -0.0420 31  HIS P CD2   
213  C CE1   . HIS A 31 ? 0.6641 1.0345 1.2261 -0.1800 -0.5289 -0.0036 31  HIS P CE1   
214  N NE2   . HIS A 31 ? 0.6897 0.9772 1.0867 -0.1612 -0.4961 -0.0441 31  HIS P NE2   
215  N N     . ALA A 32 ? 0.3576 0.9675 1.1537 -0.0581 -0.2216 0.0699  32  ALA P N     
216  C CA    . ALA A 32 ? 0.3462 1.0329 1.3177 -0.0617 -0.1782 0.1100  32  ALA P CA    
217  C C     . ALA A 32 ? 0.3461 1.0199 1.2774 -0.0497 -0.0785 0.1101  32  ALA P C     
218  O O     . ALA A 32 ? 0.3603 1.0747 1.3982 -0.0642 -0.0346 0.1432  32  ALA P O     
219  C CB    . ALA A 32 ? 0.3324 1.0830 1.4289 -0.0313 -0.1714 0.1362  32  ALA P CB    
220  N N     . ILE A 33 ? 0.3452 0.9577 1.1205 -0.0259 -0.0470 0.0777  33  ILE P N     
221  C CA    . ILE A 33 ? 0.3760 0.9502 1.0663 -0.0154 0.0294  0.0734  33  ILE P CA    
222  C C     . ILE A 33 ? 0.3918 0.9216 1.0142 -0.0472 0.0137  0.0718  33  ILE P C     
223  O O     . ILE A 33 ? 0.4322 0.9603 1.0665 -0.0580 0.0651  0.0966  33  ILE P O     
224  C CB    . ILE A 33 ? 0.3882 0.9047 0.9452 0.0164  0.0477  0.0410  33  ILE P CB    
225  C CG1   . ILE A 33 ? 0.3969 0.9404 1.0197 0.0534  0.0820  0.0442  33  ILE P CG1   
226  C CG2   . ILE A 33 ? 0.4482 0.8965 0.8718 0.0174  0.0926  0.0311  33  ILE P CG2   
227  C CD1   . ILE A 33 ? 0.4575 1.0307 1.1606 0.0741  0.1741  0.0676  33  ILE P CD1   
228  N N     . PHE A 34 ? 0.3736 0.8631 0.9262 -0.0589 -0.0508 0.0464  34  PHE P N     
229  C CA    . PHE A 34 ? 0.3935 0.8256 0.8705 -0.0776 -0.0646 0.0391  34  PHE P CA    
230  C C     . PHE A 34 ? 0.4149 0.8423 0.9587 -0.1147 -0.1090 0.0491  34  PHE P C     
231  O O     . PHE A 34 ? 0.4435 0.8157 0.9360 -0.1280 -0.1207 0.0440  34  PHE P O     
232  C CB    . PHE A 34 ? 0.3801 0.7613 0.7461 -0.0615 -0.0919 0.0067  34  PHE P CB    
233  C CG    . PHE A 34 ? 0.3789 0.7369 0.6663 -0.0387 -0.0582 0.0010  34  PHE P CG    
234  C CD1   . PHE A 34 ? 0.4158 0.7298 0.6367 -0.0436 -0.0398 0.0101  34  PHE P CD1   
235  C CD2   . PHE A 34 ? 0.3579 0.7267 0.6333 -0.0154 -0.0546 -0.0111 34  PHE P CD2   
236  C CE1   . PHE A 34 ? 0.4418 0.7183 0.5769 -0.0285 -0.0268 0.0032  34  PHE P CE1   
237  C CE2   . PHE A 34 ? 0.3742 0.7058 0.5751 -0.0001 -0.0357 -0.0197 34  PHE P CE2   
238  C CZ    . PHE A 34 ? 0.4188 0.7020 0.5454 -0.0081 -0.0261 -0.0145 34  PHE P CZ    
239  N N     . SER A 35 ? 0.4119 0.8905 1.0778 -0.1324 -0.1408 0.0651  35  SER P N     
240  C CA    . SER A 35 ? 0.4514 0.9163 1.1904 -0.1754 -0.1969 0.0747  35  SER P CA    
241  C C     . SER A 35 ? 0.4722 0.9573 1.3002 -0.2010 -0.1491 0.1197  35  SER P C     
242  O O     . SER A 35 ? 0.5150 0.9720 1.3966 -0.2405 -0.1900 0.1308  35  SER P O     
243  C CB    . SER A 35 ? 0.4613 0.9693 1.3082 -0.1930 -0.2677 0.0822  35  SER P CB    
244  O OG    . SER A 35 ? 0.4283 1.0347 1.4375 -0.1879 -0.2282 0.1271  35  SER P OG    
245  N N     . ARG A 36 ? 0.4616 0.9819 1.2917 -0.1782 -0.0604 0.1455  36  ARG P N     
246  C CA    . ARG A 36 ? 0.5053 1.0401 1.3940 -0.1957 0.0078  0.1958  36  ARG P CA    
247  C C     . ARG A 36 ? 0.5500 1.0012 1.3388 -0.2142 0.0007  0.1974  36  ARG P C     
248  O O     . ARG A 36 ? 0.6005 1.0503 1.4429 -0.2404 0.0382  0.2453  36  ARG P O     
249  C CB    . ARG A 36 ? 0.5256 1.0847 1.3767 -0.1574 0.1113  0.2114  36  ARG P CB    
250  C CG    . ARG A 36 ? 0.5342 1.1921 1.5722 -0.1507 0.1663  0.2530  36  ARG P CG    
251  C CD    . ARG A 36 ? 0.5889 1.2463 1.5579 -0.1001 0.2704  0.2506  36  ARG P CD    
252  N NE    . ARG A 36 ? 0.5555 1.2017 1.4589 -0.0646 0.2365  0.2019  36  ARG P NE    
253  C CZ    . ARG A 36 ? 0.5996 1.2304 1.4409 -0.0182 0.3053  0.1861  36  ARG P CZ    
254  N NH1   . ARG A 36 ? 0.5614 1.1778 1.3570 0.0074  0.2634  0.1466  36  ARG P NH1   
255  N NH2   . ARG A 36 ? 0.6985 1.3159 1.5124 0.0031  0.4195  0.2098  36  ARG P NH2   
256  N N     . PHE A 37 ? 0.5368 0.9203 1.1945 -0.1992 -0.0447 0.1516  37  PHE P N     
257  C CA    . PHE A 37 ? 0.5790 0.8833 1.1370 -0.2027 -0.0468 0.1539  37  PHE P CA    
258  C C     . PHE A 37 ? 0.6009 0.8418 1.1644 -0.2228 -0.1187 0.1302  37  PHE P C     
259  O O     . PHE A 37 ? 0.6507 0.8270 1.1763 -0.2311 -0.1234 0.1431  37  PHE P O     
260  C CB    . PHE A 37 ? 0.5685 0.8408 0.9833 -0.1647 -0.0299 0.1299  37  PHE P CB    
261  C CG    . PHE A 37 ? 0.5778 0.8801 0.9543 -0.1430 0.0380  0.1429  37  PHE P CG    
262  C CD1   . PHE A 37 ? 0.6615 0.9404 0.9888 -0.1481 0.1014  0.1846  37  PHE P CD1   
263  C CD2   . PHE A 37 ? 0.5236 0.8636 0.9009 -0.1155 0.0426  0.1139  37  PHE P CD2   
264  C CE1   . PHE A 37 ? 0.7101 0.9937 0.9747 -0.1228 0.1733  0.1891  37  PHE P CE1   
265  C CE2   . PHE A 37 ? 0.5574 0.9064 0.8933 -0.0910 0.1085  0.1191  37  PHE P CE2   
266  C CZ    . PHE A 37 ? 0.6562 0.9724 0.9283 -0.0929 0.1766  0.1528  37  PHE P CZ    
267  N N     . GLY A 38 ? 0.5856 0.8327 1.1866 -0.2291 -0.1755 0.0961  38  GLY P N     
268  C CA    . GLY A 38 ? 0.6415 0.8059 1.2213 -0.2448 -0.2422 0.0624  38  GLY P CA    
269  C C     . GLY A 38 ? 0.6452 0.7970 1.1808 -0.2330 -0.2946 0.0128  38  GLY P C     
270  O O     . GLY A 38 ? 0.5911 0.8030 1.1176 -0.2109 -0.2808 0.0084  38  GLY P O     
271  N N     . GLN A 39 ? 0.7315 0.7907 1.2252 -0.2467 -0.3542 -0.0244 39  GLN P N     
272  C CA    . GLN A 39 ? 0.7820 0.7992 1.1917 -0.2365 -0.4060 -0.0731 39  GLN P CA    
273  C C     . GLN A 39 ? 0.7508 0.7559 1.0368 -0.1827 -0.3624 -0.1022 39  GLN P C     
274  O O     . GLN A 39 ? 0.7477 0.7159 0.9905 -0.1570 -0.3227 -0.1077 39  GLN P O     
275  C CB    . GLN A 39 ? 0.9256 0.8167 1.2892 -0.2634 -0.4771 -0.1122 39  GLN P CB    
276  C CG    . GLN A 39 ? 1.0277 0.8607 1.2926 -0.2662 -0.5476 -0.1569 39  GLN P CG    
277  C CD    . GLN A 39 ? 1.2141 0.9024 1.4216 -0.3005 -0.6302 -0.1989 39  GLN P CD    
278  O OE1   . GLN A 39 ? 1.2546 0.9414 1.5860 -0.3552 -0.6869 -0.1743 39  GLN P OE1   
279  N NE2   . GLN A 39 ? 1.3479 0.9054 1.3658 -0.2687 -0.6347 -0.2623 39  GLN P NE2   
280  N N     . ILE A 40 ? 0.7316 0.7722 0.9795 -0.1674 -0.3727 -0.1124 40  ILE P N     
281  C CA    . ILE A 40 ? 0.7085 0.7450 0.8570 -0.1216 -0.3317 -0.1313 40  ILE P CA    
282  C C     . ILE A 40 ? 0.8387 0.7718 0.8496 -0.1086 -0.3612 -0.1789 40  ILE P C     
283  O O     . ILE A 40 ? 0.9245 0.8228 0.9012 -0.1324 -0.4277 -0.1929 40  ILE P O     
284  C CB    . ILE A 40 ? 0.6203 0.7513 0.8047 -0.1094 -0.3148 -0.1071 40  ILE P CB    
285  C CG1   . ILE A 40 ? 0.5264 0.7375 0.8144 -0.1150 -0.2721 -0.0672 40  ILE P CG1   
286  C CG2   . ILE A 40 ? 0.6088 0.7303 0.7014 -0.0686 -0.2783 -0.1212 40  ILE P CG2   
287  C CD1   . ILE A 40 ? 0.4703 0.7657 0.8331 -0.1131 -0.2667 -0.0424 40  ILE P CD1   
288  N N     . LEU A 41 ? 0.8708 0.7500 0.8020 -0.0700 -0.3114 -0.2010 41  LEU P N     
289  C CA    . LEU A 41 ? 1.0205 0.7884 0.7983 -0.0459 -0.3116 -0.2473 41  LEU P CA    
290  C C     . LEU A 41 ? 1.0279 0.8220 0.7271 -0.0276 -0.3040 -0.2434 41  LEU P C     
291  O O     . LEU A 41 ? 1.1614 0.8821 0.7403 -0.0361 -0.3518 -0.2679 41  LEU P O     
292  C CB    . LEU A 41 ? 1.0544 0.7658 0.8052 -0.0038 -0.2447 -0.2636 41  LEU P CB    
293  C CG    . LEU A 41 ? 1.1760 0.7678 0.9023 -0.0064 -0.2578 -0.2975 41  LEU P CG    
294  C CD1   . LEU A 41 ? 1.1413 0.7492 0.9774 -0.0586 -0.3154 -0.2766 41  LEU P CD1   
295  C CD2   . LEU A 41 ? 1.1677 0.7443 0.9251 0.0421  -0.1831 -0.2940 41  LEU P CD2   
296  N N     . ASP A 42 ? 0.8996 0.7873 0.6600 -0.0054 -0.2512 -0.2103 42  ASP P N     
297  C CA    . ASP A 42 ? 0.8897 0.8147 0.6066 0.0082  -0.2431 -0.1942 42  ASP P CA    
298  C C     . ASP A 42 ? 0.7280 0.7642 0.5622 0.0148  -0.2085 -0.1543 42  ASP P C     
299  O O     . ASP A 42 ? 0.6514 0.7189 0.5631 0.0183  -0.1792 -0.1433 42  ASP P O     
300  C CB    . ASP A 42 ? 1.0141 0.8603 0.5880 0.0470  -0.1917 -0.2144 42  ASP P CB    
301  C CG    . ASP A 42 ? 1.0983 0.9311 0.5662 0.0497  -0.2113 -0.2041 42  ASP P CG    
302  O OD1   . ASP A 42 ? 1.0355 0.9372 0.5697 0.0268  -0.2616 -0.1765 42  ASP P OD1   
303  O OD2   . ASP A 42 ? 1.2478 0.9955 0.5632 0.0779  -0.1716 -0.2203 42  ASP P OD2   
304  N N     . ILE A 43 ? 0.6958 0.7785 0.5341 0.0156  -0.2195 -0.1327 43  ILE P N     
305  C CA    . ILE A 43 ? 0.5779 0.7385 0.4988 0.0260  -0.1861 -0.1026 43  ILE P CA    
306  C C     . ILE A 43 ? 0.6099 0.7607 0.4703 0.0513  -0.1522 -0.0899 43  ILE P C     
307  O O     . ILE A 43 ? 0.6712 0.8059 0.4680 0.0514  -0.1766 -0.0821 43  ILE P O     
308  C CB    . ILE A 43 ? 0.5084 0.7355 0.5186 0.0085  -0.2170 -0.0817 43  ILE P CB    
309  C CG1   . ILE A 43 ? 0.4894 0.7301 0.5705 -0.0178 -0.2386 -0.0844 43  ILE P CG1   
310  C CG2   . ILE A 43 ? 0.4264 0.7042 0.4950 0.0219  -0.1809 -0.0611 43  ILE P CG2   
311  C CD1   . ILE A 43 ? 0.4234 0.7358 0.6141 -0.0285 -0.2462 -0.0590 43  ILE P CD1   
312  N N     . LEU A 44 ? 0.5778 0.7376 0.4661 0.0708  -0.0990 -0.0810 44  LEU P N     
313  C CA    . LEU A 44 ? 0.6030 0.7640 0.4656 0.0923  -0.0558 -0.0579 44  LEU P CA    
314  C C     . LEU A 44 ? 0.5092 0.7325 0.4577 0.0850  -0.0638 -0.0273 44  LEU P C     
315  O O     . LEU A 44 ? 0.4239 0.6828 0.4574 0.0759  -0.0703 -0.0240 44  LEU P O     
316  C CB    . LEU A 44 ? 0.6242 0.7714 0.5079 0.1175  0.0070  -0.0547 44  LEU P CB    
317  C CG    . LEU A 44 ? 0.7397 0.8089 0.5426 0.1380  0.0376  -0.0873 44  LEU P CG    
318  C CD1   . LEU A 44 ? 0.9032 0.8840 0.5278 0.1475  0.0402  -0.1094 44  LEU P CD1   
319  C CD2   . LEU A 44 ? 0.7127 0.7663 0.5485 0.1208  -0.0023 -0.1140 44  LEU P CD2   
320  N N     . VAL A 45 ? 0.5460 0.7666 0.4556 0.0890  -0.0677 -0.0059 45  VAL P N     
321  C CA    . VAL A 45 ? 0.4842 0.7444 0.4660 0.0851  -0.0755 0.0221  45  VAL P CA    
322  C C     . VAL A 45 ? 0.5565 0.7978 0.4900 0.0975  -0.0470 0.0570  45  VAL P C     
323  O O     . VAL A 45 ? 0.6619 0.8589 0.4812 0.1036  -0.0526 0.0591  45  VAL P O     
324  C CB    . VAL A 45 ? 0.4543 0.7345 0.4636 0.0740  -0.1258 0.0179  45  VAL P CB    
325  C CG1   . VAL A 45 ? 0.4370 0.7331 0.4943 0.0786  -0.1303 0.0467  45  VAL P CG1   
326  C CG2   . VAL A 45 ? 0.3844 0.6893 0.4570 0.0626  -0.1350 -0.0042 45  VAL P CG2   
327  N N     . SER A 46 ? 0.5207 0.7870 0.5351 0.0982  -0.0200 0.0874  46  SER P N     
328  C CA    . SER A 46 ? 0.5899 0.8439 0.5832 0.1067  0.0160  0.1328  46  SER P CA    
329  C C     . SER A 46 ? 0.5355 0.8133 0.6330 0.0944  -0.0033 0.1614  46  SER P C     
330  O O     . SER A 46 ? 0.4613 0.7607 0.6515 0.0825  -0.0204 0.1485  46  SER P O     
331  C CB    . SER A 46 ? 0.6290 0.8833 0.6361 0.1217  0.0892  0.1497  46  SER P CB    
332  O OG    . SER A 46 ? 0.7082 0.9526 0.6994 0.1298  0.1388  0.2024  46  SER P OG    
333  N N     . ARG A 47 ? 0.5950 0.8542 0.6646 0.0964  -0.0062 0.1997  47  ARG P N     
334  C CA    . ARG A 47 ? 0.5661 0.8300 0.7320 0.0857  -0.0263 0.2266  47  ARG P CA    
335  C C     . ARG A 47 ? 0.6000 0.8673 0.8280 0.0796  0.0199  0.2828  47  ARG P C     
336  O O     . ARG A 47 ? 0.6252 0.8767 0.8985 0.0717  0.0091  0.3223  47  ARG P O     
337  C CB    . ARG A 47 ? 0.6012 0.8437 0.7359 0.0911  -0.0706 0.2369  47  ARG P CB    
338  C CG    . ARG A 47 ? 0.5469 0.8020 0.7232 0.0924  -0.1148 0.1924  47  ARG P CG    
339  C CD    . ARG A 47 ? 0.6022 0.8519 0.7486 0.1035  -0.1571 0.2017  47  ARG P CD    
340  N NE    . ARG A 47 ? 0.6521 0.8785 0.8405 0.1106  -0.1739 0.2441  47  ARG P NE    
341  C CZ    . ARG A 47 ? 0.7330 0.9467 0.8933 0.1204  -0.2126 0.2777  47  ARG P CZ    
342  N NH1   . ARG A 47 ? 0.7762 0.9953 0.8595 0.1201  -0.2459 0.2715  47  ARG P NH1   
343  N NH2   . ARG A 47 ? 0.7801 0.9673 0.9907 0.1285  -0.2273 0.3202  47  ARG P NH2   
344  N N     . SER A 48 ? 0.6050 0.8939 0.8528 0.0842  0.0741  0.2904  48  SER P N     
345  C CA    . SER A 48 ? 0.6286 0.9392 0.9798 0.0777  0.1272  0.3501  48  SER P CA    
346  C C     . SER A 48 ? 0.5461 0.8827 1.0645 0.0498  0.0839  0.3513  48  SER P C     
347  O O     . SER A 48 ? 0.4803 0.8175 1.0088 0.0425  0.0332  0.3003  48  SER P O     
348  C CB    . SER A 48 ? 0.6786 1.0041 1.0063 0.1003  0.2106  0.3602  48  SER P CB    
349  O OG    . SER A 48 ? 0.6053 0.9592 0.9934 0.1017  0.1976  0.3185  48  SER P OG    
350  N N     . LEU A 49 ? 0.5687 0.9179 1.2096 0.0315  0.1011  0.4126  49  LEU P N     
351  C CA    . LEU A 49 ? 0.5247 0.8824 1.3254 -0.0030 0.0453  0.4205  49  LEU P CA    
352  C C     . LEU A 49 ? 0.4638 0.8507 1.3213 -0.0084 0.0165  0.3841  49  LEU P C     
353  O O     . LEU A 49 ? 0.4382 0.7973 1.3215 -0.0313 -0.0608 0.3496  49  LEU P O     
354  C CB    . LEU A 49 ? 0.5677 0.9523 1.5223 -0.0229 0.0843  0.5056  49  LEU P CB    
355  C CG    . LEU A 49 ? 0.5457 0.9414 1.6966 -0.0668 0.0209  0.5284  49  LEU P CG    
356  C CD1   . LEU A 49 ? 0.5757 0.8943 1.7230 -0.0948 -0.0607 0.5130  49  LEU P CD1   
357  C CD2   . LEU A 49 ? 0.5788 1.0386 1.9179 -0.0795 0.0861  0.6208  49  LEU P CD2   
358  N N     . LYS A 50 ? 0.4631 0.8934 1.3273 0.0150  0.0802  0.3928  50  LYS P N     
359  C CA    . LYS A 50 ? 0.4153 0.8754 1.3457 0.0146  0.0583  0.3699  50  LYS P CA    
360  C C     . LYS A 50 ? 0.3833 0.8096 1.1701 0.0255  0.0193  0.2958  50  LYS P C     
361  O O     . LYS A 50 ? 0.3511 0.7740 1.1686 0.0114  -0.0377 0.2700  50  LYS P O     
362  C CB    . LYS A 50 ? 0.4401 0.9532 1.4455 0.0432  0.1517  0.4092  50  LYS P CB    
363  C CG    . LYS A 50 ? 0.4030 0.9631 1.5672 0.0377  0.1257  0.4182  50  LYS P CG    
364  C CD    . LYS A 50 ? 0.4444 1.0644 1.7357 0.0698  0.2316  0.4726  50  LYS P CD    
365  C CE    . LYS A 50 ? 0.4069 1.0753 1.8686 0.0694  0.1975  0.4833  50  LYS P CE    
366  N NZ    . LYS A 50 ? 0.4507 1.1809 2.0593 0.1104  0.3126  0.5367  50  LYS P NZ    
367  N N     . MET A 51 ? 0.4065 0.8048 1.0399 0.0473  0.0453  0.2677  51  MET P N     
368  C CA    . MET A 51 ? 0.3826 0.7583 0.9018 0.0566  0.0180  0.2070  51  MET P CA    
369  C C     . MET A 51 ? 0.3687 0.7091 0.8161 0.0474  -0.0346 0.1733  51  MET P C     
370  O O     . MET A 51 ? 0.3560 0.6850 0.7241 0.0543  -0.0498 0.1319  51  MET P O     
371  C CB    . MET A 51 ? 0.4330 0.7985 0.8419 0.0863  0.0742  0.1933  51  MET P CB    
372  C CG    . MET A 51 ? 0.4673 0.8552 0.9335 0.1073  0.1383  0.2115  51  MET P CG    
373  S SD    . MET A 51 ? 0.4235 0.8523 1.0562 0.0933  0.0990  0.2166  51  MET P SD    
374  C CE    . MET A 51 ? 0.3843 0.7772 0.9067 0.0901  0.0444  0.1509  51  MET P CE    
375  N N     . ARG A 52 ? 0.3787 0.7004 0.8682 0.0330  -0.0584 0.1938  52  ARG P N     
376  C CA    . ARG A 52 ? 0.3787 0.6608 0.8203 0.0315  -0.0986 0.1639  52  ARG P CA    
377  C C     . ARG A 52 ? 0.3615 0.6202 0.7831 0.0229  -0.1381 0.1166  52  ARG P C     
378  O O     . ARG A 52 ? 0.3584 0.6166 0.8255 0.0060  -0.1607 0.1167  52  ARG P O     
379  C CB    . ARG A 52 ? 0.4144 0.6652 0.9160 0.0183  -0.1165 0.1952  52  ARG P CB    
380  C CG    . ARG A 52 ? 0.4511 0.7008 0.9231 0.0322  -0.0882 0.2340  52  ARG P CG    
381  C CD    . ARG A 52 ? 0.4886 0.7190 1.0503 0.0141  -0.0895 0.2878  52  ARG P CD    
382  N NE    . ARG A 52 ? 0.5414 0.7784 1.0661 0.0265  -0.0448 0.3425  52  ARG P NE    
383  C CZ    . ARG A 52 ? 0.5929 0.8065 1.1702 0.0158  -0.0392 0.4002  52  ARG P CZ    
384  N NH1   . ARG A 52 ? 0.5992 0.7785 1.2810 -0.0094 -0.0809 0.4064  52  ARG P NH1   
385  N NH2   . ARG A 52 ? 0.6667 0.8779 1.1787 0.0287  0.0046  0.4527  52  ARG P NH2   
386  N N     . GLY A 53 ? 0.3650 0.6032 0.7212 0.0354  -0.1453 0.0822  53  GLY P N     
387  C CA    . GLY A 53 ? 0.3747 0.5797 0.6878 0.0320  -0.1663 0.0400  53  GLY P CA    
388  C C     . GLY A 53 ? 0.3487 0.5757 0.6383 0.0273  -0.1641 0.0269  53  GLY P C     
389  O O     . GLY A 53 ? 0.3785 0.5697 0.6284 0.0183  -0.1851 0.0034  53  GLY P O     
390  N N     . GLN A 54 ? 0.3177 0.5899 0.6176 0.0348  -0.1379 0.0421  54  GLN P N     
391  C CA    . GLN A 54 ? 0.3028 0.5899 0.5942 0.0333  -0.1340 0.0337  54  GLN P CA    
392  C C     . GLN A 54 ? 0.2949 0.5997 0.5377 0.0467  -0.1103 0.0205  54  GLN P C     
393  O O     . GLN A 54 ? 0.3090 0.6212 0.5310 0.0569  -0.0963 0.0290  54  GLN P O     
394  C CB    . GLN A 54 ? 0.2971 0.6076 0.6672 0.0306  -0.1256 0.0655  54  GLN P CB    
395  C CG    . GLN A 54 ? 0.3155 0.6125 0.7628 0.0088  -0.1652 0.0870  54  GLN P CG    
396  C CD    . GLN A 54 ? 0.3079 0.6470 0.8746 0.0089  -0.1413 0.1356  54  GLN P CD    
397  O OE1   . GLN A 54 ? 0.3035 0.6742 0.9317 0.0172  -0.1237 0.1521  54  GLN P OE1   
398  N NE2   . GLN A 54 ? 0.3189 0.6578 0.9315 0.0017  -0.1351 0.1637  54  GLN P NE2   
399  N N     . ALA A 55 ? 0.2895 0.5914 0.5099 0.0432  -0.1139 0.0028  55  ALA P N     
400  C CA    . ALA A 55 ? 0.2962 0.6030 0.4792 0.0490  -0.1027 -0.0107 55  ALA P CA    
401  C C     . ALA A 55 ? 0.3019 0.5980 0.4865 0.0464  -0.1012 -0.0176 55  ALA P C     
402  O O     . ALA A 55 ? 0.2980 0.5852 0.4992 0.0366  -0.1169 -0.0141 55  ALA P O     
403  C CB    . ALA A 55 ? 0.2924 0.6059 0.4585 0.0453  -0.1130 -0.0237 55  ALA P CB    
404  N N     . PHE A 56 ? 0.3316 0.6147 0.4865 0.0558  -0.0864 -0.0274 56  PHE P N     
405  C CA    . PHE A 56 ? 0.3507 0.6100 0.5058 0.0571  -0.0837 -0.0374 56  PHE P CA    
406  C C     . PHE A 56 ? 0.3775 0.6158 0.4883 0.0451  -0.1009 -0.0598 56  PHE P C     
407  O O     . PHE A 56 ? 0.4289 0.6468 0.4860 0.0489  -0.1039 -0.0734 56  PHE P O     
408  C CB    . PHE A 56 ? 0.3942 0.6353 0.5524 0.0822  -0.0459 -0.0345 56  PHE P CB    
409  C CG    . PHE A 56 ? 0.3693 0.6418 0.6140 0.0916  -0.0286 -0.0021 56  PHE P CG    
410  C CD1   . PHE A 56 ? 0.3693 0.6656 0.6296 0.0945  -0.0125 0.0188  56  PHE P CD1   
411  C CD2   . PHE A 56 ? 0.3575 0.6354 0.6835 0.0954  -0.0343 0.0144  56  PHE P CD2   
412  C CE1   . PHE A 56 ? 0.3481 0.6772 0.7151 0.0968  -0.0019 0.0557  56  PHE P CE1   
413  C CE2   . PHE A 56 ? 0.3354 0.6494 0.7712 0.0995  -0.0305 0.0518  56  PHE P CE2   
414  C CZ    . PHE A 56 ? 0.3305 0.6721 0.7924 0.0982  -0.0138 0.0723  56  PHE P CZ    
415  N N     . VAL A 57 ? 0.3598 0.5976 0.4905 0.0274  -0.1165 -0.0591 57  VAL P N     
416  C CA    . VAL A 57 ? 0.3899 0.6081 0.5094 0.0106  -0.1347 -0.0725 57  VAL P CA    
417  C C     . VAL A 57 ? 0.4357 0.6030 0.5514 0.0139  -0.1326 -0.0809 57  VAL P C     
418  O O     . VAL A 57 ? 0.4250 0.5898 0.5730 0.0131  -0.1296 -0.0636 57  VAL P O     
419  C CB    . VAL A 57 ? 0.3620 0.6108 0.5186 -0.0109 -0.1408 -0.0585 57  VAL P CB    
420  C CG1   . VAL A 57 ? 0.3925 0.6296 0.5711 -0.0345 -0.1632 -0.0630 57  VAL P CG1   
421  C CG2   . VAL A 57 ? 0.3296 0.6206 0.5002 -0.0056 -0.1350 -0.0521 57  VAL P CG2   
422  N N     . ILE A 58 ? 0.5063 0.6205 0.5731 0.0190  -0.1381 -0.1075 58  ILE P N     
423  C CA    . ILE A 58 ? 0.5701 0.6171 0.6298 0.0259  -0.1345 -0.1223 58  ILE P CA    
424  C C     . ILE A 58 ? 0.6048 0.6225 0.6782 -0.0088 -0.1735 -0.1278 58  ILE P C     
425  O O     . ILE A 58 ? 0.6538 0.6508 0.6946 -0.0281 -0.2078 -0.1463 58  ILE P O     
426  C CB    . ILE A 58 ? 0.6729 0.6486 0.6509 0.0566  -0.1089 -0.1551 58  ILE P CB    
427  C CG1   . ILE A 58 ? 0.6446 0.6579 0.6151 0.0862  -0.0643 -0.1412 58  ILE P CG1   
428  C CG2   . ILE A 58 ? 0.7422 0.6462 0.7323 0.0762  -0.0902 -0.1683 58  ILE P CG2   
429  C CD1   . ILE A 58 ? 0.7644 0.7032 0.6424 0.1228  -0.0165 -0.1673 58  ILE P CD1   
430  N N     . PHE A 59 ? 0.5918 0.6053 0.7189 -0.0200 -0.1743 -0.1055 59  PHE P N     
431  C CA    . PHE A 59 ? 0.6305 0.6179 0.7902 -0.0564 -0.2045 -0.0990 59  PHE P CA    
432  C C     . PHE A 59 ? 0.7413 0.6244 0.8759 -0.0538 -0.2204 -0.1279 59  PHE P C     
433  O O     . PHE A 59 ? 0.7816 0.6173 0.8922 -0.0172 -0.1939 -0.1428 59  PHE P O     
434  C CB    . PHE A 59 ? 0.5855 0.6095 0.7985 -0.0725 -0.1934 -0.0530 59  PHE P CB    
435  C CG    . PHE A 59 ? 0.5185 0.6209 0.7447 -0.0808 -0.1775 -0.0314 59  PHE P CG    
436  C CD1   . PHE A 59 ? 0.5169 0.6571 0.7922 -0.1094 -0.1831 -0.0186 59  PHE P CD1   
437  C CD2   . PHE A 59 ? 0.4710 0.6052 0.6719 -0.0590 -0.1574 -0.0231 59  PHE P CD2   
438  C CE1   . PHE A 59 ? 0.4687 0.6754 0.7630 -0.1079 -0.1554 -0.0002 59  PHE P CE1   
439  C CE2   . PHE A 59 ? 0.4391 0.6243 0.6381 -0.0623 -0.1394 -0.0107 59  PHE P CE2   
440  C CZ    . PHE A 59 ? 0.4373 0.6579 0.6807 -0.0825 -0.1317 -0.0006 59  PHE P CZ    
441  N N     . LYS A 60 ? 0.8030 0.6474 0.9551 -0.0922 -0.2631 -0.1346 60  LYS P N     
442  C CA    . LYS A 60 ? 0.9267 0.6539 1.0594 -0.0977 -0.2871 -0.1619 60  LYS P CA    
443  C C     . LYS A 60 ? 0.9209 0.6294 1.1111 -0.0881 -0.2647 -0.1285 60  LYS P C     
444  O O     . LYS A 60 ? 1.0013 0.6217 1.1706 -0.0584 -0.2535 -0.1508 60  LYS P O     
445  C CB    . LYS A 60 ? 0.9880 0.6865 1.1564 -0.1529 -0.3505 -0.1643 60  LYS P CB    
446  C CG    . LYS A 60 ? 1.1446 0.6965 1.2770 -0.1647 -0.3902 -0.2030 60  LYS P CG    
447  C CD    . LYS A 60 ? 1.1903 0.7288 1.4055 -0.2314 -0.4603 -0.1867 60  LYS P CD    
448  C CE    . LYS A 60 ? 1.3536 0.7355 1.5486 -0.2480 -0.5020 -0.2187 60  LYS P CE    
449  N NZ    . LYS A 60 ? 1.4147 0.7817 1.7132 -0.3213 -0.5795 -0.1969 60  LYS P NZ    
450  N N     . GLU A 61 ? 0.8443 0.6286 1.0998 -0.1097 -0.2559 -0.0732 61  GLU P N     
451  C CA    . GLU A 61 ? 0.8570 0.6206 1.1533 -0.1070 -0.2460 -0.0297 61  GLU P CA    
452  C C     . GLU A 61 ? 0.7782 0.6152 1.0696 -0.0874 -0.2194 0.0064  61  GLU P C     
453  O O     . GLU A 61 ? 0.7092 0.6216 0.9818 -0.0909 -0.2057 0.0092  61  GLU P O     
454  C CB    . GLU A 61 ? 0.8922 0.6439 1.2480 -0.1578 -0.2651 0.0113  61  GLU P CB    
455  C CG    . GLU A 61 ? 1.0016 0.6589 1.3768 -0.1848 -0.3081 -0.0194 61  GLU P CG    
456  C CD    . GLU A 61 ? 1.0278 0.7061 1.4906 -0.2453 -0.3282 0.0251  61  GLU P CD    
457  O OE1   . GLU A 61 ? 1.0748 0.7366 1.5664 -0.2792 -0.3724 0.0006  61  GLU P OE1   
458  O OE2   . GLU A 61 ? 1.0157 0.7249 1.5192 -0.2604 -0.3012 0.0893  61  GLU P OE2   
459  N N     . VAL A 62 ? 0.8048 0.6101 1.1155 -0.0673 -0.2200 0.0346  62  VAL P N     
460  C CA    . VAL A 62 ? 0.7612 0.6161 1.0632 -0.0536 -0.2159 0.0709  62  VAL P CA    
461  C C     . VAL A 62 ? 0.7669 0.6468 1.0366 -0.0894 -0.2149 0.1177  62  VAL P C     
462  O O     . VAL A 62 ? 0.7319 0.6587 0.9548 -0.0884 -0.2060 0.1275  62  VAL P O     
463  C CB    . VAL A 62 ? 0.8017 0.6149 1.1517 -0.0230 -0.2308 0.0965  62  VAL P CB    
464  C CG1   . VAL A 62 ? 0.7534 0.6202 1.1034 -0.0087 -0.2423 0.1241  62  VAL P CG1   
465  C CG2   . VAL A 62 ? 0.8391 0.6031 1.2261 0.0165  -0.2130 0.0520  62  VAL P CG2   
466  N N     . SER A 63 ? 0.8297 0.6682 1.1194 -0.1203 -0.2192 0.1469  63  SER P N     
467  C CA    . SER A 63 ? 0.8609 0.7173 1.1180 -0.1534 -0.1991 0.1964  63  SER P CA    
468  C C     . SER A 63 ? 0.7999 0.7328 1.0442 -0.1616 -0.1651 0.1764  63  SER P C     
469  O O     . SER A 63 ? 0.8173 0.7753 1.0035 -0.1670 -0.1338 0.2035  63  SER P O     
470  C CB    . SER A 63 ? 0.9378 0.7428 1.2462 -0.1890 -0.2026 0.2333  63  SER P CB    
471  O OG    . SER A 63 ? 0.9255 0.7361 1.3026 -0.2088 -0.2090 0.1979  63  SER P OG    
472  N N     . SER A 64 ? 0.7494 0.7081 1.0391 -0.1595 -0.1725 0.1293  64  SER P N     
473  C CA    . SER A 64 ? 0.6911 0.7238 0.9887 -0.1620 -0.1503 0.1117  64  SER P CA    
474  C C     . SER A 64 ? 0.6441 0.7097 0.8747 -0.1310 -0.1368 0.0967  64  SER P C     
475  O O     . SER A 64 ? 0.6326 0.7394 0.8386 -0.1313 -0.1037 0.1068  64  SER P O     
476  C CB    . SER A 64 ? 0.6748 0.7114 1.0195 -0.1677 -0.1799 0.0677  64  SER P CB    
477  O OG    . SER A 64 ? 0.7184 0.7423 1.1430 -0.2086 -0.1966 0.0859  64  SER P OG    
478  N N     . ALA A 65 ? 0.6286 0.6714 0.8395 -0.1034 -0.1591 0.0745  65  ALA P N     
479  C CA    . ALA A 65 ? 0.5892 0.6578 0.7572 -0.0793 -0.1572 0.0655  65  ALA P CA    
480  C C     . ALA A 65 ? 0.6390 0.6891 0.7386 -0.0862 -0.1554 0.1020  65  ALA P C     
481  O O     . ALA A 65 ? 0.6383 0.7074 0.6843 -0.0818 -0.1408 0.0960  65  ALA P O     
482  C CB    . ALA A 65 ? 0.5721 0.6241 0.7647 -0.0506 -0.1756 0.0480  65  ALA P CB    
483  N N     . THR A 66 ? 0.7060 0.7044 0.7943 -0.0968 -0.1731 0.1394  66  THR P N     
484  C CA    . THR A 66 ? 0.7935 0.7499 0.7853 -0.1067 -0.1809 0.1798  66  THR P CA    
485  C C     . THR A 66 ? 0.8371 0.8029 0.7621 -0.1219 -0.1250 0.1901  66  THR P C     
486  O O     . THR A 66 ? 0.9068 0.8448 0.7173 -0.1192 -0.1149 0.1956  66  THR P O     
487  C CB    . THR A 66 ? 0.8734 0.7674 0.8722 -0.1171 -0.2118 0.2272  66  THR P CB    
488  O OG1   . THR A 66 ? 0.8368 0.7247 0.9172 -0.0939 -0.2539 0.2187  66  THR P OG1   
489  C CG2   . THR A 66 ? 0.9971 0.8314 0.8649 -0.1297 -0.2290 0.2745  66  THR P CG2   
490  N N     . ASN A 67 ? 0.8100 0.8100 0.8118 -0.1369 -0.0887 0.1921  67  ASN P N     
491  C CA    . ASN A 67 ? 0.8470 0.8729 0.8337 -0.1481 -0.0223 0.2101  67  ASN P CA    
492  C C     . ASN A 67 ? 0.7998 0.8711 0.7686 -0.1262 0.0062  0.1728  67  ASN P C     
493  O O     . ASN A 67 ? 0.8751 0.9324 0.7613 -0.1195 0.0598  0.1829  67  ASN P O     
494  C CB    . ASN A 67 ? 0.8228 0.8855 0.9414 -0.1740 -0.0052 0.2266  67  ASN P CB    
495  C CG    . ASN A 67 ? 0.9114 0.9822 1.0307 -0.1937 0.0676  0.2796  67  ASN P CG    
496  O OD1   . ASN A 67 ? 0.8824 1.0214 1.0990 -0.1991 0.1119  0.2832  67  ASN P OD1   
497  N ND2   . ASN A 67 ? 1.0348 1.0357 1.0512 -0.2037 0.0823  0.3279  67  ASN P ND2   
498  N N     . ALA A 68 ? 0.6960 0.8094 0.7317 -0.1124 -0.0255 0.1308  68  ALA P N     
499  C CA    . ALA A 68 ? 0.6472 0.8021 0.6838 -0.0916 -0.0068 0.0986  68  ALA P CA    
500  C C     . ALA A 68 ? 0.6924 0.8008 0.6103 -0.0745 -0.0180 0.0844  68  ALA P C     
501  O O     . ALA A 68 ? 0.7288 0.8321 0.5937 -0.0606 0.0202  0.0724  68  ALA P O     
502  C CB    . ALA A 68 ? 0.5496 0.7494 0.6740 -0.0849 -0.0417 0.0662  68  ALA P CB    
503  N N     . LEU A 69 ? 0.7000 0.7699 0.5876 -0.0753 -0.0740 0.0867  69  LEU P N     
504  C CA    . LEU A 69 ? 0.7595 0.7775 0.5485 -0.0688 -0.1083 0.0804  69  LEU P CA    
505  C C     . LEU A 69 ? 0.9114 0.8541 0.5464 -0.0755 -0.0808 0.0984  69  LEU P C     
506  O O     . LEU A 69 ? 0.9798 0.8823 0.5177 -0.0652 -0.0688 0.0757  69  LEU P O     
507  C CB    . LEU A 69 ? 0.7502 0.7490 0.5713 -0.0716 -0.1763 0.0957  69  LEU P CB    
508  C CG    . LEU A 69 ? 0.7946 0.7548 0.5698 -0.0708 -0.2381 0.0955  69  LEU P CG    
509  C CD1   . LEU A 69 ? 0.7225 0.7169 0.6250 -0.0625 -0.2826 0.1056  69  LEU P CD1   
510  C CD2   . LEU A 69 ? 0.9530 0.8187 0.5768 -0.0873 -0.2728 0.1233  69  LEU P CD2   
511  N N     . ARG A 70 ? 0.9846 0.8957 0.5859 -0.0917 -0.0676 0.1392  70  ARG P N     
512  C CA    . ARG A 70 ? 1.1681 0.9904 0.5929 -0.0983 -0.0374 0.1646  70  ARG P CA    
513  C C     . ARG A 70 ? 1.2200 1.0533 0.6091 -0.0853 0.0659  0.1570  70  ARG P C     
514  O O     . ARG A 70 ? 1.3891 1.1355 0.5996 -0.0776 0.1044  0.1568  70  ARG P O     
515  C CB    . ARG A 70 ? 1.2470 1.0262 0.6454 -0.1203 -0.0550 0.2213  70  ARG P CB    
516  C CG    . ARG A 70 ? 1.3278 1.0327 0.6461 -0.1284 -0.1535 0.2402  70  ARG P CG    
517  C CD    . ARG A 70 ? 1.2960 1.0076 0.7172 -0.1402 -0.1986 0.2829  70  ARG P CD    
518  N NE    . ARG A 70 ? 1.4254 1.0800 0.7672 -0.1594 -0.1652 0.3408  70  ARG P NE    
519  C CZ    . ARG A 70 ? 1.4699 1.0861 0.8392 -0.1723 -0.2137 0.3922  70  ARG P CZ    
520  N NH1   . ARG A 70 ? 1.3915 1.0228 0.8738 -0.1631 -0.2937 0.3904  70  ARG P NH1   
521  N NH2   . ARG A 70 ? 1.6048 1.1655 0.8962 -0.1921 -0.1761 0.4508  70  ARG P NH2   
522  N N     . SER A 71 ? 1.0934 1.0265 0.6507 -0.0811 0.1092  0.1514  71  SER P N     
523  C CA    . SER A 71 ? 1.1268 1.0929 0.7071 -0.0651 0.2086  0.1521  71  SER P CA    
524  C C     . SER A 71 ? 1.1184 1.0830 0.6725 -0.0339 0.2224  0.1022  71  SER P C     
525  O O     . SER A 71 ? 1.2387 1.1604 0.7008 -0.0110 0.3014  0.0953  71  SER P O     
526  C CB    . SER A 71 ? 1.0072 1.0811 0.7984 -0.0779 0.2344  0.1742  71  SER P CB    
527  O OG    . SER A 71 ? 1.0741 1.1363 0.8786 -0.1047 0.2627  0.2298  71  SER P OG    
528  N N     . MET A 72 ? 0.9956 0.9978 0.6256 -0.0305 0.1525  0.0693  72  MET P N     
529  C CA    . MET A 72 ? 0.9692 0.9843 0.6171 -0.0033 0.1645  0.0293  72  MET P CA    
530  C C     . MET A 72 ? 1.0028 0.9476 0.5506 0.0008  0.0983  -0.0053 72  MET P C     
531  O O     . MET A 72 ? 0.9272 0.9023 0.5414 0.0144  0.0794  -0.0320 72  MET P O     
532  C CB    . MET A 72 ? 0.8096 0.9375 0.6532 0.0001  0.1587  0.0268  72  MET P CB    
533  C CG    . MET A 72 ? 0.8205 1.0118 0.7714 0.0071  0.2381  0.0527  72  MET P CG    
534  S SD    . MET A 72 ? 0.6782 0.9899 0.8529 -0.0038 0.2007  0.0618  72  MET P SD    
535  C CE    . MET A 72 ? 0.7190 1.0983 1.0269 0.0078  0.3013  0.1010  72  MET P CE    
536  N N     . GLN A 73 ? 1.1306 0.9776 0.5226 -0.0137 0.0583  0.0008  73  GLN P N     
537  C CA    . GLN A 73 ? 1.2000 0.9655 0.4921 -0.0164 -0.0126 -0.0274 73  GLN P CA    
538  C C     . GLN A 73 ? 1.3171 1.0085 0.5030 0.0094  0.0346  -0.0685 73  GLN P C     
539  O O     . GLN A 73 ? 1.4722 1.0944 0.5250 0.0250  0.1117  -0.0710 73  GLN P O     
540  C CB    . GLN A 73 ? 1.3386 1.0070 0.4840 -0.0413 -0.0793 -0.0052 73  GLN P CB    
541  C CG    . GLN A 73 ? 1.2324 0.9520 0.4973 -0.0620 -0.1682 0.0210  73  GLN P CG    
542  C CD    . GLN A 73 ? 1.1668 0.9030 0.5109 -0.0644 -0.2403 0.0006  73  GLN P CD    
543  O OE1   . GLN A 73 ? 1.1345 0.8815 0.5031 -0.0501 -0.2186 -0.0328 73  GLN P OE1   
544  N NE2   . GLN A 73 ? 1.1519 0.8930 0.5540 -0.0821 -0.3245 0.0277  73  GLN P NE2   
545  N N     . GLY A 74 ? 1.2536 0.9548 0.5011 0.0165  -0.0043 -0.0983 74  GLY P N     
546  C CA    . GLY A 74 ? 1.3680 0.9858 0.5274 0.0422  0.0275  -0.1421 74  GLY P CA    
547  C C     . GLY A 74 ? 1.3418 1.0135 0.5780 0.0809  0.1384  -0.1476 74  GLY P C     
548  O O     . GLY A 74 ? 1.4896 1.0725 0.6220 0.1119  0.1977  -0.1806 74  GLY P O     
549  N N     . PHE A 75 ? 1.1696 0.9798 0.5914 0.0802  0.1634  -0.1151 75  PHE P N     
550  C CA    . PHE A 75 ? 1.1285 1.0131 0.6724 0.1118  0.2536  -0.1072 75  PHE P CA    
551  C C     . PHE A 75 ? 1.0824 0.9798 0.7097 0.1385  0.2464  -0.1334 75  PHE P C     
552  O O     . PHE A 75 ? 0.9589 0.9039 0.6736 0.1235  0.1731  -0.1319 75  PHE P O     
553  C CB    . PHE A 75 ? 0.9731 0.9907 0.6922 0.0935  0.2541  -0.0642 75  PHE P CB    
554  C CG    . PHE A 75 ? 0.9420 1.0441 0.8097 0.1180  0.3370  -0.0429 75  PHE P CG    
555  C CD1   . PHE A 75 ? 1.0508 1.1409 0.8897 0.1301  0.4368  -0.0195 75  PHE P CD1   
556  C CD2   . PHE A 75 ? 0.8135 1.0083 0.8583 0.1282  0.3144  -0.0383 75  PHE P CD2   
557  C CE1   . PHE A 75 ? 1.0192 1.2019 1.0358 0.1527  0.5157  0.0096  75  PHE P CE1   
558  C CE2   . PHE A 75 ? 0.7870 1.0674 0.9978 0.1490  0.3772  -0.0106 75  PHE P CE2   
559  C CZ    . PHE A 75 ? 0.8824 1.1637 1.0955 0.1614  0.4791  0.0143  75  PHE P CZ    
560  N N     . PRO A 76 ? 1.1975 1.0449 0.7951 0.1811  0.3293  -0.1546 76  PRO P N     
561  C CA    . PRO A 76 ? 1.1760 1.0237 0.8572 0.2120  0.3287  -0.1760 76  PRO P CA    
562  C C     . PRO A 76 ? 0.9843 0.9844 0.8997 0.2111  0.3081  -0.1391 76  PRO P C     
563  O O     . PRO A 76 ? 0.9438 1.0339 0.9894 0.2244  0.3659  -0.1076 76  PRO P O     
564  C CB    . PRO A 76 ? 1.3492 1.1232 0.9685 0.2646  0.4469  -0.1973 76  PRO P CB    
565  C CG    . PRO A 76 ? 1.5166 1.1948 0.9284 0.2547  0.4889  -0.2028 76  PRO P CG    
566  C CD    . PRO A 76 ? 1.3788 1.1549 0.8538 0.2068  0.4372  -0.1573 76  PRO P CD    
567  N N     . PHE A 77 ? 0.8869 0.9089 0.8509 0.1931  0.2231  -0.1395 77  PHE P N     
568  C CA    . PHE A 77 ? 0.7326 0.8744 0.8674 0.1845  0.1834  -0.1059 77  PHE P CA    
569  C C     . PHE A 77 ? 0.7136 0.8396 0.8940 0.1978  0.1428  -0.1116 77  PHE P C     
570  O O     . PHE A 77 ? 0.7139 0.7907 0.8297 0.1772  0.0862  -0.1230 77  PHE P O     
571  C CB    . PHE A 77 ? 0.6416 0.8247 0.7655 0.1412  0.1220  -0.0899 77  PHE P CB    
572  C CG    . PHE A 77 ? 0.5195 0.8021 0.7742 0.1297  0.0827  -0.0609 77  PHE P CG    
573  C CD1   . PHE A 77 ? 0.4798 0.8422 0.8561 0.1337  0.1073  -0.0346 77  PHE P CD1   
574  C CD2   . PHE A 77 ? 0.4577 0.7471 0.7088 0.1127  0.0196  -0.0575 77  PHE P CD2   
575  C CE1   . PHE A 77 ? 0.4030 0.8358 0.8748 0.1178  0.0535  -0.0113 77  PHE P CE1   
576  C CE2   . PHE A 77 ? 0.3843 0.7394 0.7117 0.1028  -0.0167 -0.0355 77  PHE P CE2   
577  C CZ    . PHE A 77 ? 0.3709 0.7907 0.7984 0.1035  -0.0081 -0.0153 77  PHE P CZ    
578  N N     . TYR A 78 ? 0.7021 0.8734 1.0107 0.2313  0.1706  -0.0957 78  TYR P N     
579  C CA    . TYR A 78 ? 0.7109 0.8549 1.0666 0.2509  0.1419  -0.0956 78  TYR P CA    
580  C C     . TYR A 78 ? 0.8382 0.8424 1.0555 0.2569  0.1427  -0.1403 78  TYR P C     
581  O O     . TYR A 78 ? 0.8239 0.7912 1.0043 0.2312  0.0788  -0.1421 78  TYR P O     
582  C CB    . TYR A 78 ? 0.6041 0.8043 1.0066 0.2211  0.0614  -0.0651 78  TYR P CB    
583  C CG    . TYR A 78 ? 0.5183 0.8288 1.0478 0.2170  0.0382  -0.0234 78  TYR P CG    
584  C CD1   . TYR A 78 ? 0.5155 0.8644 1.1739 0.2451  0.0301  0.0063  78  TYR P CD1   
585  C CD2   . TYR A 78 ? 0.4542 0.8195 0.9732 0.1832  0.0131  -0.0128 78  TYR P CD2   
586  C CE1   . TYR A 78 ? 0.4601 0.9002 1.2284 0.2351  -0.0124 0.0471  78  TYR P CE1   
587  C CE2   . TYR A 78 ? 0.4001 0.8458 1.0184 0.1734  -0.0240 0.0205  78  TYR P CE2   
588  C CZ    . TYR A 78 ? 0.4080 0.8910 1.1475 0.1971  -0.0419 0.0511  78  TYR P CZ    
589  O OH    . TYR A 78 ? 0.3773 0.9305 1.2095 0.1820  -0.0977 0.0865  78  TYR P OH    
590  N N     . ASP A 79 ? 0.9826 0.9028 1.1203 0.2894  0.2162  -0.1747 79  ASP P N     
591  C CA    . ASP A 79 ? 1.1558 0.9113 1.1338 0.2983  0.2170  -0.2272 79  ASP P CA    
592  C C     . ASP A 79 ? 1.2212 0.8955 1.0208 0.2536  0.1669  -0.2514 79  ASP P C     
593  O O     . ASP A 79 ? 1.4080 0.9310 1.0381 0.2599  0.1748  -0.2988 79  ASP P O     
594  C CB    . ASP A 79 ? 1.1627 0.8718 1.1975 0.3056  0.1678  -0.2291 79  ASP P CB    
595  C CG    . ASP A 79 ? 1.2614 0.9208 1.3580 0.3682  0.2363  -0.2438 79  ASP P CG    
596  O OD1   . ASP A 79 ? 1.4549 0.9721 1.4159 0.3982  0.2909  -0.2973 79  ASP P OD1   
597  O OD2   . ASP A 79 ? 1.1664 0.9186 1.4406 0.3893  0.2337  -0.2017 79  ASP P OD2   
598  N N     . LYS A 80 ? 1.0909 0.8537 0.9238 0.2103  0.1117  -0.2197 80  LYS P N     
599  C CA    . LYS A 80 ? 1.1371 0.8373 0.8447 0.1669  0.0465  -0.2307 80  LYS P CA    
600  C C     . LYS A 80 ? 1.1097 0.8592 0.7749 0.1472  0.0597  -0.2125 80  LYS P C     
601  O O     . LYS A 80 ? 0.9862 0.8546 0.7656 0.1492  0.0863  -0.1800 80  LYS P O     
602  C CB    . LYS A 80 ? 1.0283 0.7704 0.8220 0.1327  -0.0384 -0.2058 80  LYS P CB    
603  C CG    . LYS A 80 ? 1.0411 0.7490 0.9031 0.1464  -0.0556 -0.2081 80  LYS P CG    
604  C CD    . LYS A 80 ? 0.9417 0.7012 0.8946 0.1114  -0.1239 -0.1713 80  LYS P CD    
605  C CE    . LYS A 80 ? 1.0263 0.7008 0.9071 0.0706  -0.1960 -0.1831 80  LYS P CE    
606  N NZ    . LYS A 80 ? 0.9231 0.6692 0.9218 0.0385  -0.2456 -0.1363 80  LYS P NZ    
607  N N     . PRO A 81 ? 1.2417 0.8902 0.7396 0.1253  0.0318  -0.2310 81  PRO P N     
608  C CA    . PRO A 81 ? 1.2189 0.9082 0.6816 0.1036  0.0335  -0.2056 81  PRO P CA    
609  C C     . PRO A 81 ? 1.0648 0.8465 0.6371 0.0686  -0.0405 -0.1712 81  PRO P C     
610  O O     . PRO A 81 ? 1.0600 0.8141 0.6420 0.0461  -0.1150 -0.1717 81  PRO P O     
611  C CB    . PRO A 81 ? 1.4360 0.9676 0.6691 0.0923  0.0141  -0.2338 81  PRO P CB    
612  C CG    . PRO A 81 ? 1.5307 0.9541 0.7086 0.0867  -0.0481 -0.2696 81  PRO P CG    
613  C CD    . PRO A 81 ? 1.4387 0.9187 0.7647 0.1182  -0.0095 -0.2745 81  PRO P CD    
614  N N     . MET A 82 ? 0.9524 0.8389 0.6153 0.0652  -0.0159 -0.1406 82  MET P N     
615  C CA    . MET A 82 ? 0.8352 0.7950 0.5849 0.0401  -0.0689 -0.1127 82  MET P CA    
616  C C     . MET A 82 ? 0.9127 0.8091 0.5727 0.0124  -0.1289 -0.1061 82  MET P C     
617  O O     . MET A 82 ? 1.0390 0.8612 0.5658 0.0087  -0.1167 -0.1105 82  MET P O     
618  C CB    . MET A 82 ? 0.7403 0.7928 0.5746 0.0411  -0.0326 -0.0890 82  MET P CB    
619  C CG    . MET A 82 ? 0.6780 0.7997 0.6174 0.0634  0.0105  -0.0863 82  MET P CG    
620  S SD    . MET A 82 ? 0.5750 0.7972 0.6274 0.0518  0.0192  -0.0580 82  MET P SD    
621  C CE    . MET A 82 ? 0.6611 0.8551 0.6485 0.0429  0.0692  -0.0446 82  MET P CE    
622  N N     . ARG A 83 ? 0.8535 0.7772 0.5890 -0.0056 -0.1920 -0.0897 83  ARG P N     
623  C CA    . ARG A 83 ? 0.9116 0.7981 0.6116 -0.0315 -0.2584 -0.0709 83  ARG P CA    
624  C C     . ARG A 83 ? 0.8009 0.7734 0.6092 -0.0347 -0.2591 -0.0388 83  ARG P C     
625  O O     . ARG A 83 ? 0.7107 0.7447 0.6410 -0.0341 -0.2743 -0.0231 83  ARG P O     
626  C CB    . ARG A 83 ? 0.9605 0.7997 0.6776 -0.0515 -0.3367 -0.0710 83  ARG P CB    
627  C CG    . ARG A 83 ? 1.1395 0.8485 0.7080 -0.0544 -0.3565 -0.1094 83  ARG P CG    
628  C CD    . ARG A 83 ? 1.3247 0.9290 0.6920 -0.0562 -0.3496 -0.1236 83  ARG P CD    
629  N NE    . ARG A 83 ? 1.5222 0.9877 0.7158 -0.0463 -0.3376 -0.1711 83  ARG P NE    
630  C CZ    . ARG A 83 ? 1.7150 1.0705 0.7004 -0.0367 -0.3005 -0.1917 83  ARG P CZ    
631  N NH1   . ARG A 83 ? 1.7266 1.1035 0.6640 -0.0405 -0.2763 -0.1615 83  ARG P NH1   
632  N NH2   . ARG A 83 ? 1.9104 1.1239 0.7277 -0.0215 -0.2816 -0.2417 83  ARG P NH2   
633  N N     . ILE A 84 ? 0.8282 0.7956 0.5870 -0.0361 -0.2356 -0.0281 84  ILE P N     
634  C CA    . ILE A 84 ? 0.7437 0.7742 0.5941 -0.0363 -0.2301 -0.0042 84  ILE P CA    
635  C C     . ILE A 84 ? 0.7920 0.7935 0.6468 -0.0518 -0.2937 0.0260  84  ILE P C     
636  O O     . ILE A 84 ? 0.9165 0.8392 0.6554 -0.0668 -0.3302 0.0346  84  ILE P O     
637  C CB    . ILE A 84 ? 0.7410 0.7889 0.5707 -0.0324 -0.1714 -0.0023 84  ILE P CB    
638  C CG1   . ILE A 84 ? 0.7127 0.7876 0.5505 -0.0165 -0.1153 -0.0248 84  ILE P CG1   
639  C CG2   . ILE A 84 ? 0.6564 0.7573 0.5848 -0.0328 -0.1697 0.0128  84  ILE P CG2   
640  C CD1   . ILE A 84 ? 0.7166 0.8074 0.5482 -0.0154 -0.0561 -0.0156 84  ILE P CD1   
641  N N     . GLN A 85 ? 0.7119 0.7707 0.6975 -0.0455 -0.3062 0.0439  85  GLN P N     
642  C CA    . GLN A 85 ? 0.7439 0.7937 0.7797 -0.0517 -0.3552 0.0798  85  GLN P CA    
643  C C     . GLN A 85 ? 0.6586 0.7699 0.8180 -0.0306 -0.3181 0.0854  85  GLN P C     
644  O O     . GLN A 85 ? 0.5879 0.7445 0.7930 -0.0155 -0.2743 0.0649  85  GLN P O     
645  C CB    . GLN A 85 ? 0.7865 0.8177 0.8665 -0.0663 -0.4344 0.1015  85  GLN P CB    
646  C CG    . GLN A 85 ? 0.7064 0.7930 0.9030 -0.0597 -0.4269 0.0970  85  GLN P CG    
647  C CD    . GLN A 85 ? 0.7376 0.8152 1.0203 -0.0806 -0.5129 0.1293  85  GLN P CD    
648  O OE1   . GLN A 85 ? 0.7056 0.8030 1.0539 -0.0867 -0.5199 0.1278  85  GLN P OE1   
649  N NE2   . GLN A 85 ? 0.8082 0.8558 1.1041 -0.0942 -0.5847 0.1648  85  GLN P NE2   
650  N N     . TYR A 86 ? 0.6914 0.7904 0.8898 -0.0280 -0.3360 0.1124  86  TYR P N     
651  C CA    . TYR A 86 ? 0.6488 0.7805 0.9498 -0.0031 -0.2992 0.1123  86  TYR P CA    
652  C C     . TYR A 86 ? 0.6034 0.7884 1.0220 0.0184  -0.2809 0.1139  86  TYR P C     
653  O O     . TYR A 86 ? 0.6064 0.8078 1.0735 0.0095  -0.3186 0.1332  86  TYR P O     
654  C CB    . TYR A 86 ? 0.6978 0.7983 1.0442 -0.0002 -0.3322 0.1486  86  TYR P CB    
655  C CG    . TYR A 86 ? 0.7638 0.8070 1.0022 -0.0213 -0.3422 0.1594  86  TYR P CG    
656  C CD1   . TYR A 86 ? 0.7449 0.7809 0.9528 -0.0226 -0.2930 0.1380  86  TYR P CD1   
657  C CD2   . TYR A 86 ? 0.8577 0.8478 1.0235 -0.0428 -0.4043 0.1965  86  TYR P CD2   
658  C CE1   . TYR A 86 ? 0.8124 0.8022 0.9424 -0.0445 -0.2937 0.1582  86  TYR P CE1   
659  C CE2   . TYR A 86 ? 0.9434 0.8756 0.9987 -0.0615 -0.4017 0.2148  86  TYR P CE2   
660  C CZ    . TYR A 86 ? 0.9149 0.8536 0.9647 -0.0619 -0.3403 0.1981  86  TYR P CZ    
661  O OH    . TYR A 86 ? 1.0057 0.8934 0.9664 -0.0828 -0.3294 0.2258  86  TYR P OH    
662  N N     . ALA A 87 ? 0.5870 0.7898 1.0446 0.0452  -0.2227 0.0951  87  ALA P N     
663  C CA    . ALA A 87 ? 0.5757 0.8213 1.1401 0.0727  -0.1852 0.1037  87  ALA P CA    
664  C C     . ALA A 87 ? 0.6068 0.8662 1.3180 0.0896  -0.2064 0.1483  87  ALA P C     
665  O O     . ALA A 87 ? 0.6453 0.8704 1.3614 0.0861  -0.2433 0.1651  87  ALA P O     
666  C CB    . ALA A 87 ? 0.5794 0.8137 1.1034 0.0988  -0.1157 0.0678  87  ALA P CB    
667  N N     . LYS A 88 ? 0.6037 0.9162 1.4483 0.1076  -0.1828 0.1751  88  LYS P N     
668  C CA    . LYS A 88 ? 0.6356 0.9797 1.6670 0.1297  -0.1939 0.2258  88  LYS P CA    
669  C C     . LYS A 88 ? 0.6850 1.0085 1.7571 0.1803  -0.1148 0.2129  88  LYS P C     
670  O O     . LYS A 88 ? 0.7185 1.0260 1.8805 0.1975  -0.1360 0.2391  88  LYS P O     
671  C CB    . LYS A 88 ? 0.6055 1.0218 1.7914 0.1296  -0.1881 0.2662  88  LYS P CB    
672  C CG    . LYS A 88 ? 0.5975 1.0168 1.7666 0.0787  -0.2829 0.2825  88  LYS P CG    
673  C CD    . LYS A 88 ? 0.5731 1.0629 1.9184 0.0748  -0.2760 0.3267  88  LYS P CD    
674  C CE    . LYS A 88 ? 0.5919 1.0633 1.9131 0.0210  -0.3801 0.3367  88  LYS P CE    
675  N NZ    . LYS A 88 ? 0.5718 1.1086 2.0697 0.0110  -0.3717 0.3804  88  LYS P NZ    
676  N N     . THR A 89 ? 0.7171 1.0284 1.7123 0.2048  -0.0274 0.1723  89  THR P N     
677  C CA    . THR A 89 ? 0.8086 1.0669 1.7797 0.2526  0.0532  0.1413  89  THR P CA    
678  C C     . THR A 89 ? 0.8514 1.0513 1.6149 0.2418  0.0781  0.0781  89  THR P C     
679  O O     . THR A 89 ? 0.8118 1.0379 1.5007 0.2136  0.0637  0.0700  89  THR P O     
680  C CB    . THR A 89 ? 0.8439 1.1405 1.9488 0.3052  0.1514  0.1656  89  THR P CB    
681  O OG1   . THR A 89 ? 0.8401 1.1573 1.8669 0.3010  0.2019  0.1536  89  THR P OG1   
682  C CG2   . THR A 89 ? 0.8030 1.1843 2.1573 0.3087  0.1183  0.2414  89  THR P CG2   
683  N N     . ASP A 90 ? 0.9536 1.0694 1.6321 0.2631  0.1080  0.0353  90  ASP P N     
684  C CA    . ASP A 90 ? 1.0154 1.0693 1.5072 0.2447  0.1075  -0.0211 90  ASP P CA    
685  C C     . ASP A 90 ? 1.1348 1.1375 1.5212 0.2801  0.1886  -0.0581 90  ASP P C     
686  O O     . ASP A 90 ? 1.1343 1.1411 1.4111 0.2617  0.1862  -0.0742 90  ASP P O     
687  C CB    . ASP A 90 ? 1.0555 1.0342 1.4907 0.2269  0.0633  -0.0473 90  ASP P CB    
688  C CG    . ASP A 90 ? 1.1000 1.0461 1.6505 0.2571  0.0684  -0.0260 90  ASP P CG    
689  O OD1   . ASP A 90 ? 1.1420 1.0908 1.7847 0.3083  0.1330  -0.0142 90  ASP P OD1   
690  O OD2   . ASP A 90 ? 1.0978 1.0150 1.6545 0.2312  0.0117  -0.0157 90  ASP P OD2   
691  N N     . SER A 91 ? 1.2653 1.2107 1.6772 0.3336  0.2616  -0.0696 91  SER P N     
692  C CA    . SER A 91 ? 1.4402 1.3034 1.7135 0.3749  0.3506  -0.1105 91  SER P CA    
693  C C     . SER A 91 ? 1.5452 1.3084 1.5935 0.3460  0.3089  -0.1734 91  SER P C     
694  O O     . SER A 91 ? 1.5546 1.2648 1.5714 0.3183  0.2429  -0.2002 91  SER P O     
695  C CB    . SER A 91 ? 1.4240 1.3612 1.7384 0.3931  0.4205  -0.0713 91  SER P CB    
696  O OG    . SER A 91 ? 1.6038 1.4505 1.7705 0.4394  0.5214  -0.1040 91  SER P OG    
697  N N     . ASP A 92 ? 1.6413 1.3791 1.5442 0.3496  0.3417  -0.1891 92  ASP P N     
698  C CA    . ASP A 92 ? 1.7781 1.4139 1.4643 0.3240  0.2953  -0.2439 92  ASP P CA    
699  C C     . ASP A 92 ? 1.9739 1.4532 1.5489 0.3447  0.3005  -0.3070 92  ASP P C     
700  O O     . ASP A 92 ? 2.1420 1.5302 1.6485 0.4028  0.3947  -0.3318 92  ASP P O     
701  C CB    . ASP A 92 ? 1.6379 1.3417 1.3466 0.2582  0.1856  -0.2325 92  ASP P CB    
702  C CG    . ASP A 92 ? 1.7495 1.3738 1.2721 0.2284  0.1280  -0.2730 92  ASP P CG    
703  O OD1   . ASP A 92 ? 1.8997 1.4532 1.2625 0.2507  0.1677  -0.2912 92  ASP P OD1   
704  O OD2   . ASP A 92 ? 1.6993 1.3311 1.2391 0.1815  0.0412  -0.2812 92  ASP P OD2   
705  N N     . ILE A 93 ? 1.9751 1.4179 1.5372 0.2989  0.2055  -0.3314 93  ILE P N     
706  C CA    . ILE A 93 ? 2.1622 1.4508 1.6416 0.3088  0.1928  -0.3890 93  ILE P CA    
707  C C     . ILE A 93 ? 2.0635 1.3864 1.7053 0.2808  0.1345  -0.3671 93  ILE P C     
708  O O     . ILE A 93 ? 2.1372 1.3714 1.7309 0.2466  0.0665  -0.4001 93  ILE P O     
709  C CB    . ILE A 93 ? 2.3441 1.4952 1.5933 0.2766  0.1268  -0.4511 93  ILE P CB    
710  C CG1   . ILE A 93 ? 2.2106 1.4612 1.4767 0.2105  0.0305  -0.4230 93  ILE P CG1   
711  C CG2   . ILE A 93 ? 2.5802 1.6053 1.6076 0.3274  0.2085  -0.4934 93  ILE P CG2   
712  C CD1   . ILE A 93 ? 2.3556 1.4928 1.4709 0.1625  -0.0715 -0.4700 93  ILE P CD1   
713  N N     . ILE A 94 ? 1.9210 1.3660 1.7531 0.2930  0.1571  -0.3069 94  ILE P N     
714  C CA    . ILE A 94 ? 1.8429 1.3217 1.8192 0.2691  0.1052  -0.2733 94  ILE P CA    
715  C C     . ILE A 94 ? 1.9716 1.3529 2.0040 0.3185  0.1472  -0.2868 94  ILE P C     
716  O O     . ILE A 94 ? 2.1049 1.3542 2.0621 0.3107  0.1192  -0.3323 94  ILE P O     
717  C CB    . ILE A 94 ? 1.6412 1.2799 1.7702 0.2503  0.0863  -0.2017 94  ILE P CB    
718  C CG1   . ILE A 94 ? 1.5432 1.2579 1.6158 0.2020  0.0418  -0.1944 94  ILE P CG1   
719  C CG2   . ILE A 94 ? 1.5807 1.2371 1.8323 0.2307  0.0368  -0.1613 94  ILE P CG2   
720  C CD1   . ILE A 94 ? 1.5565 1.2318 1.5608 0.1487  -0.0299 -0.2170 94  ILE P CD1   
743  P PG    . GTP B 1  ? 1.6671 1.7636 0.9515 -0.4484 0.4514  0.0517  8   GTP R PG    
744  O O1G   . GTP B 1  ? 1.6594 1.7696 0.9821 -0.4492 0.4732  0.0611  8   GTP R O1G   
745  O O2G   . GTP B 1  ? 1.6283 1.7136 0.9504 -0.4218 0.4632  0.0108  8   GTP R O2G   
746  O O3G   . GTP B 1  ? 1.7431 1.8505 0.9417 -0.4855 0.4651  0.0469  8   GTP R O3G   
747  O O3B   . GTP B 1  ? 1.6200 1.7032 0.9166 -0.4377 0.4016  0.0905  8   GTP R O3B   
748  P PB    . GTP B 1  ? 1.5602 1.6387 0.9211 -0.4193 0.3814  0.1224  8   GTP R PB    
749  O O1B   . GTP B 1  ? 1.5238 1.6069 0.9483 -0.3995 0.4062  0.1007  8   GTP R O1B   
750  O O2B   . GTP B 1  ? 1.5996 1.6872 0.9331 -0.4446 0.3734  0.1644  8   GTP R O2B   
751  O O3A   . GTP B 1  ? 1.4976 1.5564 0.8845 -0.3952 0.3420  0.1310  8   GTP R O3A   
752  P PA    . GTP B 1  ? 1.4239 1.4715 0.8850 -0.3672 0.3210  0.1467  8   GTP R PA    
753  O O1A   . GTP B 1  ? 1.4100 1.4433 0.8695 -0.3611 0.2816  0.1725  8   GTP R O1A   
754  O O2A   . GTP B 1  ? 1.3750 1.4180 0.8883 -0.3385 0.3327  0.1129  8   GTP R O2A   
755  O "O5'" . GTP B 1  ? 1.4130 1.4718 0.8907 -0.3807 0.3318  0.1724  8   GTP R "O5'" 
756  C "C5'" . GTP B 1  ? 1.3956 1.4515 0.8642 -0.3940 0.3093  0.2158  8   GTP R "C5'" 
757  C "C4'" . GTP B 1  ? 1.3540 1.4120 0.8744 -0.3910 0.3155  0.2324  8   GTP R "C4'" 
758  O "O4'" . GTP B 1  ? 1.3879 1.4642 0.8877 -0.4133 0.3470  0.2315  8   GTP R "O4'" 
759  C "C3'" . GTP B 1  ? 1.2820 1.3362 0.8705 -0.3623 0.3205  0.2068  8   GTP R "C3'" 
760  O "O3'" . GTP B 1  ? 1.2247 1.2612 0.8523 -0.3410 0.2905  0.2160  8   GTP R "O3'" 
761  C "C2'" . GTP B 1  ? 1.2885 1.3558 0.9075 -0.3711 0.3426  0.2128  8   GTP R "C2'" 
762  O "O2'" . GTP B 1  ? 1.2847 1.3425 0.9344 -0.3725 0.3235  0.2464  8   GTP R "O2'" 
763  C "C1'" . GTP B 1  ? 1.3480 1.4310 0.9061 -0.4018 0.3667  0.2176  8   GTP R "C1'" 
764  N N9    . GTP B 1  ? 1.3381 1.4355 0.8943 -0.3994 0.4011  0.1771  8   GTP R N9    
765  C C8    . GTP B 1  ? 1.3626 1.4636 0.8686 -0.4070 0.4156  0.1522  8   GTP R C8    
766  N N7    . GTP B 1  ? 1.3503 1.4637 0.8791 -0.4004 0.4492  0.1176  8   GTP R N7    
767  C C5    . GTP B 1  ? 1.3128 1.4332 0.9054 -0.3889 0.4547  0.1209  8   GTP R C5    
768  C C6    . GTP B 1  ? 1.2883 1.4245 0.9313 -0.3784 0.4828  0.0961  8   GTP R C6    
769  O O6    . GTP B 1  ? 1.3007 1.4454 0.9350 -0.3772 0.5105  0.0644  8   GTP R O6    
770  N N1    . GTP B 1  ? 1.2523 1.3952 0.9579 -0.3696 0.4796  0.1068  8   GTP R N1    
771  C C2    . GTP B 1  ? 1.2396 1.3705 0.9571 -0.3713 0.4505  0.1404  8   GTP R C2    
772  N N2    . GTP B 1  ? 1.2080 1.3443 0.9852 -0.3648 0.4479  0.1484  8   GTP R N2    
773  N N3    . GTP B 1  ? 1.2640 1.3775 0.9343 -0.3803 0.4243  0.1653  8   GTP R N3    
774  C C4    . GTP B 1  ? 1.3028 1.4126 0.9116 -0.3890 0.4252  0.1568  8   GTP R C4    
775  P P     . G   B 2  ? 1.1574 1.1869 0.8278 -0.3100 0.2868  0.1834  9   G   R P     
776  O OP1   . G   B 2  ? 1.1236 1.1341 0.8157 -0.2947 0.2541  0.1980  9   G   R OP1   
777  O OP2   . G   B 2  ? 1.1641 1.1999 0.8028 -0.3092 0.3050  0.1519  9   G   R OP2   
778  O "O5'" . G   B 2  ? 1.1310 1.1713 0.8592 -0.3020 0.3037  0.1736  9   G   R "O5'" 
779  C "C5'" . G   B 2  ? 1.1131 1.1481 0.8821 -0.3019 0.2917  0.1964  9   G   R "C5'" 
780  C "C4'" . G   B 2  ? 1.0857 1.1352 0.9070 -0.2951 0.3098  0.1801  9   G   R "C4'" 
781  O "O4'" . G   B 2  ? 1.1184 1.1877 0.9206 -0.3149 0.3406  0.1776  9   G   R "O4'" 
782  C "C3'" . G   B 2  ? 1.0431 1.0983 0.8934 -0.2711 0.3141  0.1460  9   G   R "C3'" 
783  O "O3'" . G   B 2  ? 1.0038 1.0462 0.8918 -0.2510 0.2897  0.1446  9   G   R "O3'" 
784  C "C2'" . G   B 2  ? 1.0433 1.1223 0.9261 -0.2756 0.3418  0.1333  9   G   R "C2'" 
785  O "O2'" . G   B 2  ? 1.0228 1.1052 0.9570 -0.2746 0.3357  0.1428  9   G   R "O2'" 
786  C "C1'" . G   B 2  ? 1.0950 1.1815 0.9287 -0.3031 0.3623  0.1463  9   G   R "C1'" 
787  N N9    . G   B 2  ? 1.1100 1.2034 0.9030 -0.3059 0.3824  0.1238  9   G   R N9    
788  C C8    . G   B 2  ? 1.1352 1.2189 0.8669 -0.3154 0.3780  0.1257  9   G   R C8    
789  N N7    . G   B 2  ? 1.1511 1.2431 0.8600 -0.3169 0.4020  0.0986  9   G   R N7    
790  C C5    . G   B 2  ? 1.1311 1.2399 0.8924 -0.3060 0.4239  0.0791  9   G   R C5    
791  C C6    . G   B 2  ? 1.1389 1.2623 0.9111 -0.3010 0.4558  0.0472  9   G   R C6    
792  O O6    . G   B 2  ? 1.1692 1.2911 0.9032 -0.3061 0.4731  0.0271  9   G   R O6    
793  N N1    . G   B 2  ? 1.1107 1.2521 0.9486 -0.2890 0.4678  0.0386  9   G   R N1    
794  C C2    . G   B 2  ? 1.0813 1.2259 0.9647 -0.2845 0.4507  0.0567  9   G   R C2    
795  N N2    . G   B 2  ? 1.0573 1.2229 1.0022 -0.2746 0.4637  0.0453  9   G   R N2    
796  N N3    . G   B 2  ? 1.0766 1.2051 0.9489 -0.2899 0.4228  0.0840  9   G   R N3    
797  C C4    . G   B 2  ? 1.1034 1.2146 0.9156 -0.2997 0.4109  0.0947  9   G   R C4    
798  P P     . U   B 3  ? 0.9794 1.0170 0.8740 -0.2262 0.2813  0.1189  10  U   R P     
799  O OP1   . U   B 3  ? 0.9455 0.9695 0.8737 -0.2108 0.2558  0.1230  10  U   R OP1   
800  O OP2   . U   B 3  ? 0.9983 1.0292 0.8392 -0.2306 0.2836  0.1143  10  U   R OP2   
801  O "O5'" . U   B 3  ? 0.9654 1.0265 0.8950 -0.2177 0.3048  0.0936  10  U   R "O5'" 
802  C "C5'" . U   B 3  ? 0.9356 1.0107 0.9202 -0.2134 0.3062  0.0914  10  U   R "C5'" 
803  C "C4'" . U   B 3  ? 0.9292 1.0295 0.9409 -0.2070 0.3307  0.0689  10  U   R "C4'" 
804  O "O4'" . U   B 3  ? 0.9643 1.0750 0.9457 -0.2256 0.3592  0.0682  10  U   R "O4'" 
805  C "C3'" . U   B 3  ? 0.9112 1.0104 0.9238 -0.1858 0.3304  0.0469  10  U   R "C3'" 
806  O "O3'" . U   B 3  ? 0.8830 0.9821 0.9345 -0.1659 0.3097  0.0416  10  U   R "O3'" 
807  C "C2'" . U   B 3  ? 0.9231 1.0460 0.9507 -0.1878 0.3630  0.0297  10  U   R "C2'" 
808  O "O2'" . U   B 3  ? 0.8979 1.0452 0.9862 -0.1797 0.3678  0.0232  10  U   R "O2'" 
809  C "C1'" . U   B 3  ? 0.9629 1.0868 0.9516 -0.2152 0.3806  0.0427  10  U   R "C1'" 
810  N N1    . U   B 3  ? 0.9881 1.1008 0.9171 -0.2237 0.3923  0.0358  10  U   R N1    
811  C C2    . U   B 3  ? 1.0015 1.1260 0.9292 -0.2217 0.4220  0.0116  10  U   R C2    
812  O O2    . U   B 3  ? 0.9847 1.1295 0.9605 -0.2121 0.4395  -0.0027 10  U   R O2    
813  N N3    . U   B 3  ? 1.0359 1.1482 0.9056 -0.2320 0.4310  0.0042  10  U   R N3    
814  C C4    . U   B 3  ? 1.0530 1.1458 0.8675 -0.2438 0.4116  0.0200  10  U   R C4    
815  O O4    . U   B 3  ? 1.0838 1.1697 0.8488 -0.2543 0.4217  0.0098  10  U   R O4    
816  C C5    . U   B 3  ? 1.0328 1.1154 0.8564 -0.2433 0.3805  0.0472  10  U   R C5    
817  C C6    . U   B 3  ? 1.0022 1.0935 0.8810 -0.2335 0.3734  0.0528  10  U   R C6    
818  P P     . C   B 4  ? 0.8785 0.9601 0.9157 -0.1460 0.2927  0.0325  11  C   R P     
819  O OP1   . C   B 4  ? 0.8467 0.9227 0.9113 -0.1345 0.2665  0.0369  11  C   R OP1   
820  O OP2   . C   B 4  ? 0.9075 0.9691 0.8880 -0.1554 0.2928  0.0379  11  C   R OP2   
821  O "O5'" . C   B 4  ? 0.8752 0.9739 0.9371 -0.1306 0.3112  0.0106  11  C   R "O5'" 
822  C "C5'" . C   B 4  ? 0.8734 1.0005 0.9882 -0.1257 0.3224  0.0035  11  C   R "C5'" 
823  C "C4'" . C   B 4  ? 0.8924 1.0325 1.0194 -0.1169 0.3484  -0.0149 11  C   R "C4'" 
824  O "O4'" . C   B 4  ? 0.9326 1.0750 1.0298 -0.1361 0.3770  -0.0179 11  C   R "O4'" 
825  C "C3'" . C   B 4  ? 0.8914 1.0129 0.9977 -0.1013 0.3443  -0.0255 11  C   R "C3'" 
826  O "O3'" . C   B 4  ? 0.8667 0.9929 1.0101 -0.0793 0.3260  -0.0276 11  C   R "O3'" 
827  C "C2'" . C   B 4  ? 0.9196 1.0488 1.0233 -0.1036 0.3788  -0.0428 11  C   R "C2'" 
828  O "O2'" . C   B 4  ? 0.9098 1.0638 1.0725 -0.0884 0.3924  -0.0535 11  C   R "O2'" 
829  C "C1'" . C   B 4  ? 0.9471 1.0817 1.0237 -0.1302 0.3951  -0.0353 11  C   R "C1'" 
830  N N1    . C   B 4  ? 0.9724 1.0835 0.9796 -0.1474 0.3956  -0.0315 11  C   R N1    
831  C C2    . C   B 4  ? 1.0044 1.1131 0.9799 -0.1565 0.4242  -0.0484 11  C   R C2    
832  O O2    . C   B 4  ? 1.0095 1.1334 1.0171 -0.1492 0.4507  -0.0669 11  C   R O2    
833  N N3    . C   B 4  ? 1.0313 1.1220 0.9425 -0.1739 0.4221  -0.0445 11  C   R N3    
834  C C4    . C   B 4  ? 1.0252 1.1011 0.9087 -0.1804 0.3931  -0.0228 11  C   R C4    
835  N N4    . C   B 4  ? 1.0576 1.1194 0.8806 -0.1978 0.3902  -0.0176 11  C   R N4    
836  C C5    . C   B 4  ? 0.9889 1.0647 0.9071 -0.1699 0.3660  -0.0059 11  C   R C5    
837  C C6    . C   B 4  ? 0.9650 1.0582 0.9415 -0.1546 0.3686  -0.0121 11  C   R C6    
838  P P     . A   B 5  ? 0.8675 0.9672 0.9842 -0.0661 0.3044  -0.0271 12  A   R P     
839  O OP1   . A   B 5  ? 0.8427 0.9500 0.9930 -0.0519 0.2793  -0.0215 12  A   R OP1   
840  O OP2   . A   B 5  ? 0.8849 0.9598 0.9457 -0.0817 0.2979  -0.0189 12  A   R OP2   
841  O "O5'" . A   B 5  ? 0.8678 0.9659 0.9908 -0.0528 0.3253  -0.0444 12  A   R "O5'" 
842  C "C5'" . A   B 5  ? 0.8711 0.9437 0.9492 -0.0549 0.3310  -0.0520 12  A   R "C5'" 
843  C "C4'" . A   B 5  ? 0.8909 0.9679 0.9676 -0.0591 0.3659  -0.0702 12  A   R "C4'" 
844  O "O4'" . A   B 5  ? 0.9129 0.9965 0.9623 -0.0835 0.3828  -0.0686 12  A   R "O4'" 
845  C "C3'" . A   B 5  ? 0.9068 0.9590 0.9471 -0.0583 0.3749  -0.0839 12  A   R "C3'" 
846  O "O3'" . A   B 5  ? 0.8920 0.9392 0.9652 -0.0344 0.3715  -0.0905 12  A   R "O3'" 
847  C "C2'" . A   B 5  ? 0.9429 1.0033 0.9731 -0.0731 0.4117  -0.1004 12  A   R "C2'" 
848  O "O2'" . A   B 5  ? 0.9432 1.0222 1.0294 -0.0589 0.4348  -0.1131 12  A   R "O2'" 
849  C "C1'" . A   B 5  ? 0.9427 1.0164 0.9573 -0.0939 0.4092  -0.0856 12  A   R "C1'" 
850  N N9    . A   B 5  ? 0.9522 1.0090 0.9018 -0.1157 0.4008  -0.0771 12  A   R N9    
851  C C8    . A   B 5  ? 0.9342 0.9843 0.8637 -0.1235 0.3729  -0.0547 12  A   R C8    
852  N N7    . A   B 5  ? 0.9546 0.9916 0.8275 -0.1430 0.3696  -0.0486 12  A   R N7    
853  C C5    . A   B 5  ? 0.9879 1.0228 0.8375 -0.1502 0.3975  -0.0704 12  A   R C5    
854  C C6    . A   B 5  ? 1.0275 1.0527 0.8162 -0.1720 0.4078  -0.0771 12  A   R C6    
855  N N6    . A   B 5  ? 1.0381 1.0552 0.7791 -0.1898 0.3880  -0.0580 12  A   R N6    
856  N N1    . A   B 5  ? 1.0561 1.0810 0.8359 -0.1754 0.4391  -0.1042 12  A   R N1    
857  C C2    . A   B 5  ? 1.0434 1.0767 0.8772 -0.1562 0.4589  -0.1214 12  A   R C2    
858  N N3    . A   B 5  ? 1.0062 1.0511 0.9018 -0.1341 0.4499  -0.1143 12  A   R N3    
859  C C4    . A   B 5  ? 0.9836 1.0292 0.8815 -0.1331 0.4184  -0.0891 12  A   R C4    
860  P P     . C   B 6  ? 0.8965 0.9134 0.9382 -0.0279 0.3604  -0.0947 13  C   R P     
861  O OP1   . C   B 6  ? 0.8888 0.9055 0.9756 -0.0034 0.3642  -0.1011 13  C   R OP1   
862  O OP2   . C   B 6  ? 0.8779 0.8833 0.8887 -0.0336 0.3291  -0.0775 13  C   R OP2   
863  O "O5'" . C   B 6  ? 0.9306 0.9339 0.9258 -0.0471 0.3865  -0.1127 13  C   R "O5'" 
864  C "C5'" . C   B 6  ? 0.9434 0.9479 0.9574 -0.0435 0.4202  -0.1353 13  C   R "C5'" 
865  C "C4'" . C   B 6  ? 0.9812 0.9695 0.9369 -0.0660 0.4385  -0.1520 13  C   R "C4'" 
866  O "O4'" . C   B 6  ? 0.9891 0.9885 0.9065 -0.0911 0.4392  -0.1431 13  C   R "O4'" 
867  C "C3'" . C   B 6  ? 0.9768 0.9383 0.8897 -0.0692 0.4186  -0.1507 13  C   R "C3'" 
868  O "O3'" . C   B 6  ? 0.9872 0.9321 0.9216 -0.0531 0.4298  -0.1673 13  C   R "O3'" 
869  C "C2'" . C   B 6  ? 1.0105 0.9683 0.8591 -0.0998 0.4291  -0.1576 13  C   R "C2'" 
870  O "O2'" . C   B 6  ? 1.0541 1.0051 0.8894 -0.1089 0.4634  -0.1865 13  C   R "O2'" 
871  C "C1'" . C   B 6  ? 0.9999 0.9817 0.8521 -0.1114 0.4320  -0.1440 13  C   R "C1'" 
872  N N1    . C   B 6  ? 0.9621 0.9446 0.7900 -0.1200 0.3991  -0.1163 13  C   R N1    
873  C C2    . C   B 6  ? 0.9807 0.9571 0.7470 -0.1457 0.3930  -0.1097 13  C   R C2    
874  O O2    . C   B 6  ? 1.0172 0.9891 0.7453 -0.1626 0.4141  -0.1280 13  C   R O2    
875  N N3    . C   B 6  ? 0.9571 0.9333 0.7084 -0.1518 0.3637  -0.0830 13  C   R N3    
876  C C4    . C   B 6  ? 0.9104 0.8908 0.7028 -0.1348 0.3433  -0.0669 13  C   R C4    
877  N N4    . C   B 6  ? 0.8979 0.8760 0.6770 -0.1417 0.3175  -0.0428 13  C   R N4    
878  C C5    . C   B 6  ? 0.8841 0.8719 0.7339 -0.1107 0.3483  -0.0746 13  C   R C5    
879  C C6    . C   B 6  ? 0.9115 0.9007 0.7779 -0.1037 0.3753  -0.0975 13  C   R C6    
880  P P     . G   B 7  ? 0.9747 0.8950 0.8976 -0.0428 0.4051  -0.1618 14  G   R P     
881  O OP1   . G   B 7  ? 0.9866 0.8940 0.9466 -0.0245 0.4235  -0.1785 14  G   R OP1   
882  O OP2   . G   B 7  ? 0.9314 0.8578 0.8634 -0.0336 0.3701  -0.1353 14  G   R OP2   
883  O "O5'" . G   B 7  ? 1.0104 0.9155 0.8635 -0.0700 0.4047  -0.1701 14  G   R "O5'" 
884  C "C5'" . G   B 7  ? 1.0614 0.9568 0.8906 -0.0845 0.4357  -0.1983 14  G   R "C5'" 
885  C "C4'" . G   B 7  ? 1.0962 0.9809 0.8569 -0.1111 0.4254  -0.2003 14  G   R "C4'" 
886  O "O4'" . G   B 7  ? 1.0944 0.9957 0.8247 -0.1278 0.4087  -0.1785 14  G   R "O4'" 
887  C "C3'" . G   B 7  ? 1.0835 0.9480 0.8334 -0.1048 0.3988  -0.1930 14  G   R "C3'" 
888  O "O3'" . G   B 7  ? 1.1335 0.9823 0.8376 -0.1250 0.4082  -0.2137 14  G   R "O3'" 
889  C "C2'" . G   B 7  ? 1.0508 0.9251 0.7863 -0.1079 0.3639  -0.1617 14  G   R "C2'" 
890  O "O2'" . G   B 7  ? 1.0543 0.9154 0.7561 -0.1163 0.3399  -0.1541 14  G   R "O2'" 
891  C "C1'" . G   B 7  ? 1.0735 0.9668 0.7798 -0.1304 0.3739  -0.1580 14  G   R "C1'" 
892  N N9    . G   B 7  ? 1.0362 0.9449 0.7540 -0.1280 0.3526  -0.1298 14  G   R N9    
893  C C8    . G   B 7  ? 0.9920 0.9109 0.7612 -0.1069 0.3462  -0.1182 14  G   R C8    
894  N N7    . G   B 7  ? 0.9718 0.9018 0.7396 -0.1118 0.3276  -0.0952 14  G   R N7    
895  C C5    . G   B 7  ? 1.0011 0.9283 0.7150 -0.1364 0.3205  -0.0885 14  G   R C5    
896  C C6    . G   B 7  ? 1.0022 0.9366 0.6940 -0.1512 0.3015  -0.0635 14  G   R C6    
897  O O6    . G   B 7  ? 0.9788 0.9216 0.6954 -0.1456 0.2884  -0.0443 14  G   R O6    
898  N N1    . G   B 7  ? 1.0385 0.9695 0.6748 -0.1754 0.2980  -0.0613 14  G   R N1    
899  C C2    . G   B 7  ? 1.0703 0.9925 0.6736 -0.1860 0.3116  -0.0837 14  G   R C2    
900  N N2    . G   B 7  ? 1.1050 1.0285 0.6538 -0.2116 0.3036  -0.0775 14  G   R N2    
901  N N3    . G   B 7  ? 1.0735 0.9865 0.6978 -0.1727 0.3315  -0.1099 14  G   R N3    
902  C C4    . G   B 7  ? 1.0382 0.9541 0.7190 -0.1473 0.3348  -0.1095 14  G   R C4    
903  P P     . C   B 8  ? 1.1568 0.9827 0.8798 -0.1170 0.4337  -0.2442 15  C   R P     
904  O OP1   . C   B 8  ? 1.1661 0.9990 0.9255 -0.1094 0.4700  -0.2630 15  C   R OP1   
905  O OP2   . C   B 8  ? 1.1188 0.9283 0.8696 -0.0955 0.4121  -0.2328 15  C   R OP2   
906  O "O5'" . C   B 8  ? 1.2231 1.0397 0.8796 -0.1496 0.4392  -0.2637 15  C   R "O5'" 
907  C "C5'" . C   B 8  ? 1.2853 1.0879 0.9325 -0.1607 0.4740  -0.3006 15  C   R "C5'" 
908  C "C4'" . C   B 8  ? 1.3527 1.1629 0.9290 -0.1986 0.4827  -0.3153 15  C   R "C4'" 
909  O "O4'" . C   B 8  ? 1.3912 1.2138 0.9696 -0.2067 0.5193  -0.3341 15  C   R "O4'" 
910  C "C3'" . C   B 8  ? 1.3512 1.1794 0.8809 -0.2164 0.4487  -0.2850 15  C   R "C3'" 
911  O "O3'" . C   B 8  ? 1.3649 1.1824 0.8590 -0.2295 0.4246  -0.2828 15  C   R "O3'" 
912  C "C2'" . C   B 8  ? 1.4057 1.2520 0.8891 -0.2455 0.4703  -0.2954 15  C   R "C2'" 
913  O "O2'" . C   B 8  ? 1.4617 1.3047 0.8804 -0.2784 0.4735  -0.3141 15  C   R "O2'" 
914  C "C1'" . C   B 8  ? 1.4183 1.2631 0.9440 -0.2333 0.5134  -0.3222 15  C   R "C1'" 
915  N N1    . C   B 8  ? 1.3934 1.2592 0.9569 -0.2195 0.5196  -0.3047 15  C   R N1    
916  C C2    . C   B 8  ? 1.4332 1.3135 0.9880 -0.2339 0.5556  -0.3225 15  C   R C2    
917  O O2    . C   B 8  ? 1.4892 1.3645 1.0023 -0.2584 0.5825  -0.3532 15  C   R O2    
918  N N3    . C   B 8  ? 1.4103 1.3107 1.0029 -0.2218 0.5609  -0.3065 15  C   R N3    
919  C C4    . C   B 8  ? 1.3503 1.2561 0.9856 -0.1975 0.5315  -0.2756 15  C   R C4    
920  N N4    . C   B 8  ? 1.3278 1.2545 1.0001 -0.1881 0.5371  -0.2619 15  C   R N4    
921  C C5    . C   B 8  ? 1.3108 1.2015 0.9528 -0.1830 0.4958  -0.2585 15  C   R C5    
922  C C6    . C   B 8  ? 1.3329 1.2042 0.9397 -0.1940 0.4916  -0.2732 15  C   R C6    
923  P P     . A   B 9  ? 1.3151 1.1253 0.8338 -0.2095 0.3854  -0.2540 16  A   R P     
924  O OP1   . A   B 9  ? 1.3140 1.0986 0.8538 -0.1989 0.3920  -0.2738 16  A   R OP1   
925  O OP2   . A   B 9  ? 1.2671 1.0889 0.8293 -0.1853 0.3736  -0.2267 16  A   R OP2   
926  O "O5'" . A   B 9  ? 1.3421 1.1642 0.8015 -0.2376 0.3553  -0.2360 16  A   R "O5'" 
927  C "C5'" . A   B 9  ? 1.3579 1.2029 0.7938 -0.2495 0.3404  -0.2091 16  A   R "C5'" 
928  C "C4'" . A   B 9  ? 1.4321 1.2912 0.8114 -0.2829 0.3597  -0.2231 16  A   R "C4'" 
929  O "O4'" . A   B 9  ? 1.4337 1.3061 0.8291 -0.2784 0.3811  -0.2207 16  A   R "O4'" 
930  C "C3'" . A   B 9  ? 1.4640 1.3406 0.7890 -0.3102 0.3313  -0.1977 16  A   R "C3'" 
931  O "O3'" . A   B 9  ? 1.5086 1.3792 0.7979 -0.3285 0.3174  -0.2076 16  A   R "O3'" 
932  C "C2'" . A   B 9  ? 1.5109 1.4048 0.7965 -0.3345 0.3565  -0.2060 16  A   R "C2'" 
933  O "O2'" . A   B 9  ? 1.5639 1.4535 0.8080 -0.3588 0.3847  -0.2442 16  A   R "O2'" 
934  C "C1'" . A   B 9  ? 1.4764 1.3695 0.8190 -0.3076 0.3786  -0.2079 16  A   R "C1'" 
935  N N9    . A   B 9  ? 1.4424 1.3502 0.8064 -0.2977 0.3599  -0.1711 16  A   R N9    
936  C C8    . A   B 9  ? 1.3783 1.2821 0.8019 -0.2663 0.3471  -0.1536 16  A   R C8    
937  N N7    . A   B 9  ? 1.3566 1.2746 0.7879 -0.2657 0.3330  -0.1237 16  A   R N7    
938  C C5    . A   B 9  ? 1.4122 1.3447 0.7858 -0.2980 0.3362  -0.1181 16  A   R C5    
939  C C6    . A   B 9  ? 1.4278 1.3781 0.7806 -0.3138 0.3266  -0.0886 16  A   R C6    
940  N N6    . A   B 9  ? 1.3912 1.3460 0.7838 -0.2978 0.3121  -0.0610 16  A   R N6    
941  N N1    . A   B 9  ? 1.4858 1.4489 0.7748 -0.3477 0.3324  -0.0880 16  A   R N1    
942  C C2    . A   B 9  ? 1.5299 1.4886 0.7775 -0.3657 0.3474  -0.1185 16  A   R C2    
943  N N3    . A   B 9  ? 1.5241 1.4649 0.7879 -0.3538 0.3589  -0.1503 16  A   R N3    
944  C C4    . A   B 9  ? 1.4633 1.3912 0.7924 -0.3188 0.3523  -0.1471 16  A   R C4    
945  P P     . C   B 10 ? 1.4975 1.3753 0.7767 -0.3325 0.2716  -0.1730 17  C   R P     
946  O OP1   . C   B 10 ? 1.5305 1.4024 0.7752 -0.3531 0.2653  -0.1923 17  C   R OP1   
947  O OP2   . C   B 10 ? 1.4270 1.2964 0.7673 -0.2976 0.2547  -0.1509 17  C   R OP2   
948  O "O5'" . C   B 10 ? 1.5310 1.4351 0.7685 -0.3557 0.2584  -0.1435 17  C   R "O5'" 
949  C "C5'" . C   B 10 ? 1.6215 1.5402 0.7919 -0.3931 0.2699  -0.1561 17  C   R "C5'" 
950  C "C4'" . C   B 10 ? 1.6539 1.5968 0.7943 -0.4102 0.2549  -0.1202 17  C   R "C4'" 
951  O "O4'" . C   B 10 ? 1.6375 1.5823 0.8081 -0.3950 0.2766  -0.1159 17  C   R "O4'" 
952  C "C3'" . C   B 10 ? 1.6278 1.5782 0.7853 -0.4025 0.2113  -0.0750 17  C   R "C3'" 
953  O "O3'" . C   B 10 ? 1.6733 1.6352 0.7855 -0.4287 0.1856  -0.0668 17  C   R "O3'" 
954  C "C2'" . C   B 10 ? 1.6271 1.5930 0.7837 -0.4053 0.2106  -0.0442 17  C   R "C2'" 
955  O "O2'" . C   B 10 ? 1.6869 1.6748 0.7787 -0.4416 0.2047  -0.0300 17  C   R "O2'" 
956  C "C1'" . C   B 10 ? 1.6177 1.5754 0.7990 -0.3916 0.2511  -0.0719 17  C   R "C1'" 
957  N N1    . C   B 10 ? 1.5491 1.4953 0.8023 -0.3542 0.2491  -0.0617 17  C   R N1    
958  C C2    . C   B 10 ? 1.5296 1.4855 0.8049 -0.3474 0.2419  -0.0306 17  C   R C2    
959  O O2    . C   B 10 ? 1.5640 1.5367 0.8015 -0.3710 0.2376  -0.0092 17  C   R O2    
960  N N3    . C   B 10 ? 1.4709 1.4173 0.8090 -0.3157 0.2398  -0.0244 17  C   R N3    
961  C C4    . C   B 10 ? 1.4329 1.3624 0.8090 -0.2913 0.2438  -0.0449 17  C   R C4    
962  N N4    . C   B 10 ? 1.3816 1.3049 0.8148 -0.2627 0.2404  -0.0373 17  C   R N4    
963  C C5    . C   B 10 ? 1.4522 1.3705 0.8089 -0.2965 0.2514  -0.0740 17  C   R C5    
964  C C6    . C   B 10 ? 1.5088 1.4354 0.8054 -0.3281 0.2542  -0.0825 17  C   R C6    
965  P P     . A   B 11 ? 1.6418 1.5976 0.7852 -0.4147 0.1493  -0.0495 18  A   R P     
966  O OP1   . A   B 11 ? 1.6953 1.6651 0.7846 -0.4476 0.1320  -0.0530 18  A   R OP1   
967  O OP2   . A   B 11 ? 1.5849 1.5152 0.7847 -0.3818 0.1625  -0.0714 18  A   R OP2   
968  O "O5'" . A   B 11 ? 1.6085 1.5751 0.7814 -0.4023 0.1202  0.0009  18  A   R "O5'" 
969  C "C5'" . A   B 11 ? 1.6529 1.6433 0.7856 -0.4276 0.1037  0.0338  18  A   R "C5'" 
970  C "C4'" . A   B 11 ? 1.6185 1.6109 0.7932 -0.4092 0.0894  0.0738  18  A   R "C4'" 
971  O "O4'" . A   B 11 ? 1.6023 1.5858 0.8001 -0.3941 0.1204  0.0608  18  A   R "O4'" 
972  C "C3'" . A   B 11 ? 1.5583 1.5381 0.7966 -0.3787 0.0662  0.0909  18  A   R "C3'" 
973  O "O3'" . A   B 11 ? 1.5679 1.5603 0.8010 -0.3888 0.0297  0.1193  18  A   R "O3'" 
974  C "C2'" . A   B 11 ? 1.5266 1.5029 0.8051 -0.3600 0.0708  0.1127  18  A   R "C2'" 
975  O "O2'" . A   B 11 ? 1.5431 1.5353 0.8122 -0.3732 0.0495  0.1554  18  A   R "O2'" 
976  C "C1'" . A   B 11 ? 1.5475 1.5214 0.8078 -0.3642 0.1095  0.0825  18  A   R "C1'" 
977  N N9    . A   B 11 ? 1.5064 1.4603 0.8119 -0.3353 0.1298  0.0529  18  A   R N9    
978  C C8    . A   B 11 ? 1.5086 1.4505 0.8096 -0.3317 0.1490  0.0142  18  A   R C8    
979  N N7    . A   B 11 ? 1.4634 1.3894 0.8135 -0.3028 0.1626  -0.0012 18  A   R N7    
980  C C5    . A   B 11 ? 1.4271 1.3555 0.8144 -0.2874 0.1515  0.0267  18  A   R C5    
981  C C6    . A   B 11 ? 1.3734 1.2919 0.8167 -0.2582 0.1561  0.0272  18  A   R C6    
982  N N6    . A   B 11 ? 1.3427 1.2479 0.8153 -0.2376 0.1724  0.0009  18  A   R N6    
983  N N1    . A   B 11 ? 1.3525 1.2760 0.8210 -0.2518 0.1429  0.0566  18  A   R N1    
984  C C2    . A   B 11 ? 1.3809 1.3171 0.8234 -0.2718 0.1263  0.0860  18  A   R C2    
985  N N3    . A   B 11 ? 1.4309 1.3786 0.8208 -0.2993 0.1189  0.0919  18  A   R N3    
986  C C4    . A   B 11 ? 1.4531 1.3969 0.8156 -0.3066 0.1322  0.0598  18  A   R C4    
987  P P     . G   B 12 ? 1.5202 1.5003 0.8038 -0.3654 0.0092  0.1208  19  G   R P     
988  O OP1   . G   B 12 ? 1.5551 1.5540 0.8151 -0.3866 -0.0226 0.1403  19  G   R OP1   
989  O OP2   . G   B 12 ? 1.4925 1.4511 0.7933 -0.3483 0.0343  0.0789  19  G   R OP2   
990  O "O5'" . G   B 12 ? 1.4599 1.4330 0.8044 -0.3381 -0.0016 0.1519  19  G   R "O5'" 
991  C "C5'" . G   B 12 ? 1.4667 1.4542 0.8122 -0.3467 -0.0211 0.1946  19  G   R "C5'" 
992  C "C4'" . G   B 12 ? 1.4147 1.3889 0.8187 -0.3194 -0.0184 0.2100  19  G   R "C4'" 
993  O "O4'" . G   B 12 ? 1.4058 1.3710 0.8087 -0.3127 0.0135  0.1871  19  G   R "O4'" 
994  C "C3'" . G   B 12 ? 1.3573 1.3139 0.8186 -0.2895 -0.0238 0.2014  19  G   R "C3'" 
995  O "O3'" . G   B 12 ? 1.3467 1.3095 0.8327 -0.2876 -0.0546 0.2295  19  G   R "O3'" 
996  C "C2'" . G   B 12 ? 1.3215 1.2650 0.8231 -0.2681 -0.0082 0.2016  19  G   R "C2'" 
997  O "O2'" . G   B 12 ? 1.3198 1.2668 0.8490 -0.2660 -0.0238 0.2390  19  G   R "O2'" 
998  C "C1'" . G   B 12 ? 1.3495 1.2968 0.8106 -0.2816 0.0198  0.1801  19  G   R "C1'" 
999  N N9    . G   B 12 ? 1.3263 1.2605 0.7908 -0.2688 0.0437  0.1393  19  G   R N9    
1000 C C8    . G   B 12 ? 1.3456 1.2785 0.7779 -0.2786 0.0526  0.1108  19  G   R C8    
1001 N N7    . G   B 12 ? 1.3185 1.2370 0.7683 -0.2618 0.0746  0.0797  19  G   R N7    
1002 C C5    . G   B 12 ? 1.2770 1.1892 0.7711 -0.2402 0.0791  0.0880  19  G   R C5    
1003 C C6    . G   B 12 ? 1.2370 1.1369 0.7663 -0.2166 0.0978  0.0673  19  G   R C6    
1004 O O6    . G   B 12 ? 1.2278 1.1183 0.7584 -0.2087 0.1151  0.0385  19  G   R O6    
1005 N N1    . G   B 12 ? 1.2047 1.1040 0.7718 -0.2022 0.0948  0.0840  19  G   R N1    
1006 C C2    . G   B 12 ? 1.2086 1.1152 0.7820 -0.2090 0.0777  0.1161  19  G   R C2    
1007 N N2    . G   B 12 ? 1.1765 1.0795 0.7896 -0.1943 0.0787  0.1256  19  G   R N2    
1008 N N3    . G   B 12 ? 1.2459 1.1629 0.7897 -0.2295 0.0603  0.1382  19  G   R N3    
1009 C C4    . G   B 12 ? 1.2806 1.2013 0.7842 -0.2446 0.0611  0.1229  19  G   R C4    
1010 P P     . G   B 13 ? 1.3381 1.3017 0.8230 -0.2885 -0.0670 0.2144  20  G   R P     
1011 O OP1   . G   B 13 ? 1.3689 1.3539 0.8466 -0.3057 -0.0996 0.2492  20  G   R OP1   
1012 O OP2   . G   B 13 ? 1.3536 1.3122 0.7982 -0.2978 -0.0442 0.1737  20  G   R OP2   
1013 O "O5'" . G   B 13 ? 1.2591 1.2031 0.8087 -0.2554 -0.0662 0.2086  20  G   R "O5'" 
1014 C "C5'" . G   B 13 ? 1.2098 1.1352 0.7692 -0.2384 -0.0426 0.1725  20  G   R "C5'" 
1015 C "C4'" . G   B 13 ? 1.1598 1.0728 0.7482 -0.2192 -0.0254 0.1702  20  G   R "C4'" 
1016 O "O4'" . G   B 13 ? 1.1750 1.0879 0.7299 -0.2274 -0.0003 0.1493  20  G   R "O4'" 
1017 C "C3'" . G   B 13 ? 1.0940 0.9888 0.7253 -0.1916 -0.0163 0.1521  20  G   R "C3'" 
1018 O "O3'" . G   B 13 ? 1.0440 0.9361 0.7207 -0.1782 -0.0341 0.1733  20  G   R "O3'" 
1019 C "C2'" . G   B 13 ? 1.0830 0.9713 0.7192 -0.1826 0.0061  0.1405  20  G   R "C2'" 
1020 O "O2'" . G   B 13 ? 1.0723 0.9626 0.7330 -0.1790 0.0002  0.1648  20  G   R "O2'" 
1021 C "C1'" . G   B 13 ? 1.1294 1.0271 0.7133 -0.2049 0.0197  0.1284  20  G   R "C1'" 
1022 N N9    . G   B 13 ? 1.1311 1.0207 0.6977 -0.2035 0.0381  0.0940  20  G   R N9    
1023 C C8    . G   B 13 ? 1.1607 1.0533 0.6924 -0.2201 0.0370  0.0797  20  G   R C8    
1024 N N7    . G   B 13 ? 1.1565 1.0371 0.6846 -0.2139 0.0578  0.0482  20  G   R N7    
1025 C C5    . G   B 13 ? 1.1234 0.9950 0.6859 -0.1914 0.0721  0.0431  20  G   R C5    
1026 C C6    . G   B 13 ? 1.1073 0.9660 0.6858 -0.1751 0.0951  0.0168  20  G   R C6    
1027 O O6    . G   B 13 ? 1.1229 0.9726 0.6897 -0.1767 0.1096  -0.0084 20  G   R O6    
1028 N N1    . G   B 13 ? 1.0694 0.9261 0.6833 -0.1556 0.1004  0.0225  20  G   R N1    
1029 C C2    . G   B 13 ? 1.0492 0.9129 0.6807 -0.1531 0.0872  0.0476  20  G   R C2    
1030 N N2    . G   B 13 ? 1.0146 0.8760 0.6790 -0.1357 0.0946  0.0473  20  G   R N2    
1031 N N3    . G   B 13 ? 1.0675 0.9403 0.6870 -0.1673 0.0675  0.0722  20  G   R N3    
1032 C C4    . G   B 13 ? 1.1053 0.9826 0.6903 -0.1856 0.0601  0.0697  20  G   R C4    
1033 P P     . G   B 14 ? 0.9926 0.8714 0.7052 -0.1574 -0.0344 0.1589  21  G   R P     
1034 O OP1   . G   B 14 ? 0.9806 0.8616 0.7344 -0.1502 -0.0545 0.1847  21  G   R OP1   
1035 O OP2   . G   B 14 ? 1.0055 0.8833 0.6901 -0.1650 -0.0294 0.1358  21  G   R OP2   
1036 O "O5'" . G   B 14 ? 0.9323 0.7967 0.6660 -0.1371 -0.0134 0.1409  21  G   R "O5'" 
1037 C "C5'" . G   B 14 ? 0.8748 0.7382 0.6314 -0.1308 -0.0118 0.1548  21  G   R "C5'" 
1038 C "C4'" . G   B 14 ? 0.8207 0.6753 0.5860 -0.1167 0.0089  0.1331  21  G   R "C4'" 
1039 O "O4'" . G   B 14 ? 0.8262 0.6843 0.5549 -0.1260 0.0253  0.1148  21  G   R "O4'" 
1040 C "C3'" . G   B 14 ? 0.7715 0.6144 0.5585 -0.0980 0.0137  0.1150  21  G   R "C3'" 
1041 O "O3'" . G   B 14 ? 0.7365 0.5739 0.5634 -0.0853 0.0054  0.1256  21  G   R "O3'" 
1042 C "C2'" . G   B 14 ? 0.7564 0.5963 0.5368 -0.0907 0.0344  0.0937  21  G   R "C2'" 
1043 O "O2'" . G   B 14 ? 0.7327 0.5726 0.5371 -0.0821 0.0390  0.0970  21  G   R "O2'" 
1044 C "C1'" . G   B 14 ? 0.7894 0.6383 0.5296 -0.1098 0.0416  0.0910  21  G   R "C1'" 
1045 N N9    . G   B 14 ? 0.7906 0.6362 0.5052 -0.1145 0.0497  0.0711  21  G   R N9    
1046 C C8    . G   B 14 ? 0.8150 0.6655 0.4988 -0.1325 0.0422  0.0721  21  G   R C8    
1047 N N7    . G   B 14 ? 0.8234 0.6672 0.4910 -0.1338 0.0541  0.0491  21  G   R N7    
1048 C C5    . G   B 14 ? 0.7962 0.6304 0.4870 -0.1141 0.0699  0.0345  21  G   R C5    
1049 C C6    . G   B 14 ? 0.7896 0.6128 0.4814 -0.1052 0.0875  0.0104  21  G   R C6    
1050 O O6    . G   B 14 ? 0.8032 0.6205 0.4752 -0.1136 0.0944  -0.0055 21  G   R O6    
1051 N N1    . G   B 14 ? 0.7590 0.5780 0.4800 -0.0849 0.0970  0.0061  21  G   R N1    
1052 C C2    . G   B 14 ? 0.7346 0.5595 0.4787 -0.0762 0.0908  0.0201  21  G   R C2    
1053 N N2    . G   B 14 ? 0.7059 0.5287 0.4747 -0.0588 0.0998  0.0132  21  G   R N2    
1054 N N3    . G   B 14 ? 0.7361 0.5687 0.4805 -0.0847 0.0765  0.0401  21  G   R N3    
1055 C C4    . G   B 14 ? 0.7721 0.6088 0.4903 -0.1027 0.0665  0.0476  21  G   R C4    
1056 P P     . C   B 15 ? 0.7089 0.5383 0.5572 -0.0732 0.0003  0.1192  22  C   R P     
1057 O OP1   . C   B 15 ? 0.6957 0.5217 0.5845 -0.0646 -0.0084 0.1334  22  C   R OP1   
1058 O OP2   . C   B 15 ? 0.7310 0.5649 0.5557 -0.0845 -0.0066 0.1178  22  C   R OP2   
1059 O "O5'" . C   B 15 ? 0.6802 0.5012 0.5290 -0.0588 0.0175  0.0947  22  C   R "O5'" 
1060 C "C5'" . C   B 15 ? 0.6580 0.4766 0.5257 -0.0481 0.0255  0.0902  22  C   R "C5'" 
1061 C "C4'" . C   B 15 ? 0.6458 0.4609 0.5063 -0.0379 0.0398  0.0694  22  C   R "C4'" 
1062 O "O4'" . C   B 15 ? 0.6613 0.4803 0.4918 -0.0473 0.0487  0.0614  22  C   R "O4'" 
1063 C "C3'" . C   B 15 ? 0.6308 0.4374 0.4963 -0.0283 0.0403  0.0600  22  C   R "C3'" 
1064 O "O3'" . C   B 15 ? 0.6181 0.4207 0.5102 -0.0160 0.0392  0.0595  22  C   R "O3'" 
1065 C "C2'" . C   B 15 ? 0.6296 0.4347 0.4790 -0.0243 0.0547  0.0435  22  C   R "C2'" 
1066 O "O2'" . C   B 15 ? 0.6349 0.4422 0.4978 -0.0129 0.0623  0.0374  22  C   R "O2'" 
1067 C "C1'" . C   B 15 ? 0.6393 0.4515 0.4641 -0.0391 0.0586  0.0444  22  C   R "C1'" 
1068 N N1    . C   B 15 ? 0.6410 0.4509 0.4403 -0.0508 0.0588  0.0393  22  C   R N1    
1069 C C2    . C   B 15 ? 0.6474 0.4496 0.4383 -0.0463 0.0719  0.0215  22  C   R C2    
1070 O O2    . C   B 15 ? 0.6336 0.4322 0.4393 -0.0316 0.0815  0.0136  22  C   R O2    
1071 N N3    . C   B 15 ? 0.6694 0.4684 0.4371 -0.0588 0.0733  0.0139  22  C   R N3    
1072 C C4    . C   B 15 ? 0.6796 0.4859 0.4307 -0.0758 0.0603  0.0244  22  C   R C4    
1073 N N4    . C   B 15 ? 0.6998 0.5043 0.4265 -0.0898 0.0615  0.0147  22  C   R N4    
1074 C C5    . C   B 15 ? 0.6708 0.4868 0.4311 -0.0798 0.0453  0.0459  22  C   R C5    
1075 C C6    . C   B 15 ? 0.6539 0.4698 0.4393 -0.0667 0.0462  0.0519  22  C   R C6    
1076 P P     . A   B 16 ? 0.6243 0.4192 0.5309 -0.0080 0.0359  0.0574  23  A   R P     
1077 O OP1   . A   B 16 ? 0.6083 0.4012 0.5363 0.0027  0.0390  0.0533  23  A   R OP1   
1078 O OP2   . A   B 16 ? 0.6266 0.4228 0.5375 -0.0169 0.0239  0.0700  23  A   R OP2   
1079 O "O5'" . A   B 16 ? 0.6186 0.4081 0.5075 -0.0039 0.0450  0.0440  23  A   R "O5'" 
1080 C "C5'" . A   B 16 ? 0.6105 0.3992 0.4971 0.0060  0.0558  0.0332  23  A   R "C5'" 
1081 C "C4'" . A   B 16 ? 0.6209 0.4023 0.4932 0.0072  0.0634  0.0241  23  A   R "C4'" 
1082 O "O4'" . A   B 16 ? 0.6351 0.4178 0.4874 -0.0063 0.0636  0.0231  23  A   R "O4'" 
1083 C "C3'" . A   B 16 ? 0.6169 0.3900 0.4965 0.0103  0.0605  0.0245  23  A   R "C3'" 
1084 O "O3'" . A   B 16 ? 0.6277 0.3938 0.5071 0.0206  0.0699  0.0170  23  A   R "O3'" 
1085 C "C2'" . A   B 16 ? 0.6267 0.3985 0.4938 -0.0031 0.0554  0.0259  23  A   R "C2'" 
1086 O "O2'" . A   B 16 ? 0.6367 0.3988 0.5025 -0.0017 0.0594  0.0195  23  A   R "O2'" 
1087 C "C1'" . A   B 16 ? 0.6346 0.4100 0.4805 -0.0113 0.0615  0.0204  23  A   R "C1'" 
1088 N N9    . A   B 16 ? 0.6395 0.4210 0.4707 -0.0284 0.0523  0.0266  23  A   R N9    
1089 C C8    . A   B 16 ? 0.6352 0.4261 0.4719 -0.0357 0.0392  0.0419  23  A   R C8    
1090 N N7    . A   B 16 ? 0.6527 0.4499 0.4714 -0.0522 0.0310  0.0471  23  A   R N7    
1091 C C5    . A   B 16 ? 0.6679 0.4586 0.4670 -0.0569 0.0405  0.0311  23  A   R C5    
1092 C C6    . A   B 16 ? 0.6944 0.4874 0.4667 -0.0749 0.0389  0.0249  23  A   R C6    
1093 N N6    . A   B 16 ? 0.7167 0.5227 0.4747 -0.0923 0.0243  0.0374  23  A   R N6    
1094 N N1    . A   B 16 ? 0.7033 0.4851 0.4641 -0.0753 0.0528  0.0056  23  A   R N1    
1095 C C2    . A   B 16 ? 0.6890 0.4588 0.4659 -0.0577 0.0660  -0.0032 23  A   R C2    
1096 N N3    . A   B 16 ? 0.6658 0.4349 0.4656 -0.0404 0.0669  0.0032  23  A   R N3    
1097 C C4    . A   B 16 ? 0.6581 0.4377 0.4671 -0.0415 0.0542  0.0189  23  A   R C4    
1098 P P     . A   B 17 ? 0.6339 0.3952 0.5272 0.0298  0.0696  0.0186  24  A   R P     
1099 O OP1   . A   B 17 ? 0.6242 0.3929 0.5282 0.0361  0.0678  0.0205  24  A   R OP1   
1100 O OP2   . A   B 17 ? 0.6362 0.3939 0.5352 0.0229  0.0635  0.0223  24  A   R OP2   
1101 O "O5'" . A   B 17 ? 0.6308 0.3837 0.5187 0.0383  0.0804  0.0128  24  A   R "O5'" 
1102 C "C5'" . A   B 17 ? 0.6291 0.3856 0.5142 0.0448  0.0870  0.0096  24  A   R "C5'" 
1103 C "C4'" . A   B 17 ? 0.6453 0.3904 0.5278 0.0496  0.0976  0.0050  24  A   R "C4'" 
1104 O "O4'" . A   B 17 ? 0.6626 0.4017 0.5342 0.0386  0.1014  -0.0023 24  A   R "O4'" 
1105 C "C3'" . A   B 17 ? 0.6449 0.3782 0.5312 0.0535  0.0999  0.0073  24  A   R "C3'" 
1106 O "O3'" . A   B 17 ? 0.6327 0.3700 0.5254 0.0649  0.1002  0.0134  24  A   R "O3'" 
1107 C "C2'" . A   B 17 ? 0.6679 0.3881 0.5515 0.0529  0.1109  0.0003  24  A   R "C2'" 
1108 O "O2'" . A   B 17 ? 0.6834 0.4036 0.5746 0.0649  0.1191  0.0014  24  A   R "O2'" 
1109 C "C1'" . A   B 17 ? 0.6714 0.3952 0.5433 0.0398  0.1099  -0.0072 24  A   R "C1'" 
1110 N N9    . A   B 17 ? 0.6787 0.3972 0.5426 0.0259  0.1053  -0.0104 24  A   R N9    
1111 C C8    . A   B 17 ? 0.6750 0.4031 0.5337 0.0145  0.0931  -0.0063 24  A   R C8    
1112 N N7    . A   B 17 ? 0.6865 0.4103 0.5404 0.0027  0.0892  -0.0089 24  A   R N7    
1113 C C5    . A   B 17 ? 0.7010 0.4093 0.5566 0.0060  0.1010  -0.0170 24  A   R C5    
1114 C C6    . A   B 17 ? 0.7242 0.4210 0.5781 -0.0032 0.1041  -0.0245 24  A   R C6    
1115 N N6    . A   B 17 ? 0.7413 0.4437 0.5900 -0.0188 0.0933  -0.0245 24  A   R N6    
1116 N N1    . A   B 17 ? 0.7381 0.4178 0.5982 0.0034  0.1182  -0.0310 24  A   R N1    
1117 C C2    . A   B 17 ? 0.7299 0.4063 0.5980 0.0192  0.1272  -0.0281 24  A   R C2    
1118 N N3    . A   B 17 ? 0.7123 0.4015 0.5822 0.0288  0.1238  -0.0211 24  A   R N3    
1119 C C4    . A   B 17 ? 0.6968 0.4009 0.5595 0.0210  0.1112  -0.0169 24  A   R C4    
1120 P P     . A   B 18 ? 0.6347 0.3675 0.5304 0.0672  0.0992  0.0186  25  A   R P     
1121 O OP1   . A   B 18 ? 0.6288 0.3671 0.5250 0.0781  0.1010  0.0248  25  A   R OP1   
1122 O OP2   . A   B 18 ? 0.6133 0.3511 0.5126 0.0596  0.0917  0.0182  25  A   R OP2   
1123 O "O5'" . A   B 18 ? 0.6397 0.3553 0.5358 0.0644  0.1065  0.0167  25  A   R "O5'" 
1124 C "C5'" . A   B 18 ? 0.6317 0.3371 0.5305 0.0728  0.1157  0.0196  25  A   R "C5'" 
1125 C "C4'" . A   B 18 ? 0.6363 0.3240 0.5371 0.0664  0.1227  0.0149  25  A   R "C4'" 
1126 O "O4'" . A   B 18 ? 0.6339 0.3209 0.5287 0.0544  0.1210  0.0042  25  A   R "O4'" 
1127 C "C3'" . A   B 18 ? 0.6305 0.3144 0.5345 0.0612  0.1208  0.0178  25  A   R "C3'" 
1128 O "O3'" . A   B 18 ? 0.6262 0.3048 0.5336 0.0698  0.1266  0.0273  25  A   R "O3'" 
1129 C "C2'" . A   B 18 ? 0.6470 0.3178 0.5519 0.0502  0.1247  0.0089  25  A   R "C2'" 
1130 O "O2'" . A   B 18 ? 0.6771 0.3303 0.5873 0.0547  0.1368  0.0085  25  A   R "O2'" 
1131 C "C1'" . A   B 18 ? 0.6427 0.3206 0.5385 0.0438  0.1208  0.0004  25  A   R "C1'" 
1132 N N9    . A   B 18 ? 0.6360 0.3260 0.5280 0.0324  0.1087  -0.0004 25  A   R N9    
1133 C C8    . A   B 18 ? 0.6180 0.3232 0.5077 0.0327  0.0996  0.0032  25  A   R C8    
1134 N N7    . A   B 18 ? 0.6128 0.3259 0.5031 0.0217  0.0892  0.0045  25  A   R N7    
1135 C C5    . A   B 18 ? 0.6312 0.3358 0.5232 0.0128  0.0904  0.0005  25  A   R C5    
1136 C C6    . A   B 18 ? 0.6347 0.3445 0.5300 -0.0011 0.0807  0.0009  25  A   R C6    
1137 N N6    . A   B 18 ? 0.6188 0.3434 0.5174 -0.0076 0.0671  0.0079  25  A   R N6    
1138 N N1    . A   B 18 ? 0.6470 0.3468 0.5447 -0.0087 0.0847  -0.0049 25  A   R N1    
1139 C C2    . A   B 18 ? 0.6556 0.3386 0.5533 -0.0020 0.0989  -0.0102 25  A   R C2    
1140 N N3    . A   B 18 ? 0.6571 0.3334 0.5534 0.0121  0.1088  -0.0089 25  A   R N3    
1141 C C4    . A   B 18 ? 0.6428 0.3319 0.5356 0.0189  0.1033  -0.0036 25  A   R C4    
1142 P P     . C   B 19 ? 0.6144 0.3006 0.5223 0.0697  0.1241  0.0334  26  C   R P     
1143 O OP1   . C   B 19 ? 0.6163 0.2948 0.5237 0.0768  0.1323  0.0439  26  C   R OP1   
1144 O OP2   . C   B 19 ? 0.5903 0.2936 0.4945 0.0703  0.1157  0.0319  26  C   R OP2   
1145 O "O5'" . C   B 19 ? 0.6236 0.3049 0.5399 0.0575  0.1228  0.0275  26  C   R "O5'" 
1146 C "C5'" . C   B 19 ? 0.6478 0.3132 0.5702 0.0529  0.1304  0.0265  26  C   R "C5'" 
1147 C "C4'" . C   B 19 ? 0.6453 0.3131 0.5764 0.0396  0.1248  0.0203  26  C   R "C4'" 
1148 O "O4'" . C   B 19 ? 0.6474 0.3212 0.5720 0.0325  0.1162  0.0127  26  C   R "O4'" 
1149 C "C3'" . C   B 19 ? 0.6275 0.3088 0.5684 0.0381  0.1194  0.0237  26  C   R "C3'" 
1150 O "O3'" . C   B 19 ? 0.6273 0.3035 0.5767 0.0393  0.1285  0.0287  26  C   R "O3'" 
1151 C "C2'" . C   B 19 ? 0.6320 0.3196 0.5808 0.0254  0.1091  0.0186  26  C   R "C2'" 
1152 O "O2'" . C   B 19 ? 0.6572 0.3369 0.6158 0.0159  0.1119  0.0159  26  C   R "O2'" 
1153 C "C1'" . C   B 19 ? 0.6377 0.3244 0.5705 0.0239  0.1053  0.0131  26  C   R "C1'" 
1154 N N1    . C   B 19 ? 0.6281 0.3288 0.5564 0.0268  0.0965  0.0150  26  C   R N1    
1155 C C2    . C   B 19 ? 0.6268 0.3398 0.5628 0.0182  0.0843  0.0168  26  C   R C2    
1156 O O2    . C   B 19 ? 0.6408 0.3554 0.5871 0.0082  0.0795  0.0169  26  C   R O2    
1157 N N3    . C   B 19 ? 0.6189 0.3426 0.5533 0.0205  0.0774  0.0197  26  C   R N3    
1158 C C4    . C   B 19 ? 0.6144 0.3381 0.5394 0.0302  0.0821  0.0190  26  C   R C4    
1159 N N4    . C   B 19 ? 0.6035 0.3371 0.5287 0.0310  0.0757  0.0211  26  C   R N4    
1160 C C5    . C   B 19 ? 0.6214 0.3355 0.5384 0.0390  0.0929  0.0175  26  C   R C5    
1161 C C6    . C   B 19 ? 0.6298 0.3321 0.5491 0.0374  0.0999  0.0164  26  C   R C6    
1162 P P     . C   B 20 ? 0.6130 0.3002 0.5679 0.0433  0.1312  0.0328  27  C   R P     
1163 O OP1   . C   B 20 ? 0.6134 0.2919 0.5710 0.0440  0.1438  0.0384  27  C   R OP1   
1164 O OP2   . C   B 20 ? 0.6030 0.2993 0.5448 0.0510  0.1274  0.0330  27  C   R OP2   
1165 O "O5'" . C   B 20 ? 0.6077 0.3066 0.5841 0.0350  0.1229  0.0292  27  C   R "O5'" 
1166 C "C5'" . C   B 20 ? 0.6225 0.3198 0.6164 0.0247  0.1208  0.0280  27  C   R "C5'" 
1167 C "C4'" . C   B 20 ? 0.6165 0.3288 0.6300 0.0184  0.1081  0.0277  27  C   R "C4'" 
1168 O "O4'" . C   B 20 ? 0.6230 0.3391 0.6234 0.0161  0.0960  0.0261  27  C   R "O4'" 
1169 C "C3'" . C   B 20 ? 0.6080 0.3315 0.6366 0.0242  0.1095  0.0294  27  C   R "C3'" 
1170 O "O3'" . C   B 20 ? 0.5968 0.3220 0.6466 0.0234  0.1200  0.0302  27  C   R "O3'" 
1171 C "C2'" . C   B 20 ? 0.6113 0.3469 0.6546 0.0188  0.0934  0.0316  27  C   R "C2'" 
1172 O "O2'" . C   B 20 ? 0.6262 0.3702 0.6971 0.0097  0.0865  0.0350  27  C   R "O2'" 
1173 C "C1'" . C   B 20 ? 0.6132 0.3435 0.6294 0.0157  0.0860  0.0296  27  C   R "C1'" 
1174 N N1    . C   B 20 ? 0.6083 0.3408 0.6093 0.0227  0.0836  0.0291  27  C   R N1    
1175 C C2    . C   B 20 ? 0.6111 0.3547 0.6241 0.0210  0.0726  0.0332  27  C   R C2    
1176 O O2    . C   B 20 ? 0.6128 0.3654 0.6498 0.0146  0.0638  0.0387  27  C   R O2    
1177 N N3    . C   B 20 ? 0.6030 0.3481 0.6038 0.0263  0.0714  0.0322  27  C   R N3    
1178 C C4    . C   B 20 ? 0.5990 0.3375 0.5775 0.0331  0.0793  0.0277  27  C   R C4    
1179 N N4    . C   B 20 ? 0.5898 0.3322 0.5595 0.0370  0.0772  0.0267  27  C   R N4    
1180 C C5    . C   B 20 ? 0.6085 0.3368 0.5756 0.0359  0.0894  0.0255  27  C   R C5    
1181 C C6    . C   B 20 ? 0.6115 0.3360 0.5900 0.0305  0.0918  0.0262  27  C   R C6    
1182 P P     . A   B 21 ? 0.5979 0.3279 0.6538 0.0305  0.1321  0.0281  28  A   R P     
1183 O OP1   . A   B 21 ? 0.6052 0.3355 0.6807 0.0276  0.1454  0.0286  28  A   R OP1   
1184 O OP2   . A   B 21 ? 0.6083 0.3327 0.6315 0.0378  0.1360  0.0268  28  A   R OP2   
1185 O "O5'" . A   B 21 ? 0.5917 0.3342 0.6730 0.0308  0.1222  0.0276  28  A   R "O5'" 
1186 C "C5'" . A   B 21 ? 0.5918 0.3447 0.7130 0.0257  0.1176  0.0311  28  A   R "C5'" 
1187 C "C4'" . A   B 21 ? 0.5884 0.3510 0.7329 0.0280  0.1084  0.0332  28  A   R "C4'" 
1188 O "O4'" . A   B 21 ? 0.5914 0.3535 0.7152 0.0260  0.0926  0.0369  28  A   R "O4'" 
1189 C "C3'" . A   B 21 ? 0.5895 0.3507 0.7331 0.0357  0.1199  0.0256  28  A   R "C3'" 
1190 O "O3'" . A   B 21 ? 0.5943 0.3593 0.7679 0.0373  0.1353  0.0208  28  A   R "O3'" 
1191 C "C2'" . A   B 21 ? 0.5848 0.3514 0.7420 0.0363  0.1053  0.0303  28  A   R "C2'" 
1192 O "O2'" . A   B 21 ? 0.5810 0.3578 0.7860 0.0350  0.1000  0.0372  28  A   R "O2'" 
1193 C "C1'" . A   B 21 ? 0.5905 0.3554 0.7204 0.0310  0.0899  0.0365  28  A   R "C1'" 
1194 N N9    . A   B 21 ? 0.6051 0.3627 0.6969 0.0346  0.0911  0.0316  28  A   R N9    
1195 C C8    . A   B 21 ? 0.6172 0.3662 0.6760 0.0368  0.0987  0.0272  28  A   R C8    
1196 N N7    . A   B 21 ? 0.6258 0.3726 0.6599 0.0404  0.0968  0.0247  28  A   R N7    
1197 C C5    . A   B 21 ? 0.6193 0.3723 0.6692 0.0397  0.0882  0.0268  28  A   R C5    
1198 C C6    . A   B 21 ? 0.6237 0.3784 0.6630 0.0414  0.0831  0.0257  28  A   R C6    
1199 N N6    . A   B 21 ? 0.6204 0.3726 0.6304 0.0446  0.0852  0.0217  28  A   R N6    
1200 N N1    . A   B 21 ? 0.6220 0.3817 0.6857 0.0396  0.0755  0.0303  28  A   R N1    
1201 C C2    . A   B 21 ? 0.6156 0.3796 0.7138 0.0374  0.0724  0.0366  28  A   R C2    
1202 N N3    . A   B 21 ? 0.6127 0.3780 0.7255 0.0358  0.0760  0.0377  28  A   R N3    
1203 C C4    . A   B 21 ? 0.6120 0.3710 0.6979 0.0366  0.0845  0.0319  28  A   R C4    
1204 P P     . U   B 22 ? 0.6079 0.3682 0.7641 0.0417  0.1560  0.0083  29  U   R P     
1205 O OP1   . U   B 22 ? 0.6178 0.3828 0.8070 0.0408  0.1731  0.0039  29  U   R OP1   
1206 O OP2   . U   B 22 ? 0.6035 0.3556 0.7106 0.0423  0.1578  0.0077  29  U   R OP2   
1207 O "O5'" . U   B 22 ? 0.6071 0.3687 0.7716 0.0455  0.1523  0.0029  29  U   R "O5'" 
1208 C "C5'" . U   B 22 ? 0.5955 0.3632 0.8088 0.0467  0.1495  0.0049  29  U   R "C5'" 
1209 C "C4'" . U   B 22 ? 0.5922 0.3577 0.8028 0.0491  0.1408  0.0038  29  U   R "C4'" 
1210 O "O4'" . U   B 22 ? 0.5878 0.3524 0.7689 0.0469  0.1221  0.0135  29  U   R "O4'" 
1211 C "C3'" . U   B 22 ? 0.5984 0.3583 0.7800 0.0506  0.1535  -0.0116 29  U   R "C3'" 
1212 O "O3'" . U   B 22 ? 0.6143 0.3740 0.8250 0.0518  0.1720  -0.0247 29  U   R "O3'" 
1213 C "C2'" . U   B 22 ? 0.5888 0.3472 0.7612 0.0510  0.1380  -0.0073 29  U   R "C2'" 
1214 O "O2'" . U   B 22 ? 0.5697 0.3287 0.7855 0.0524  0.1350  -0.0047 29  U   R "O2'" 
1215 C "C1'" . U   B 22 ? 0.5814 0.3419 0.7379 0.0485  0.1207  0.0076  29  U   R "C1'" 
1216 N N1    . U   B 22 ? 0.5866 0.3434 0.6938 0.0483  0.1197  0.0058  29  U   R N1    
1217 C C2    . U   B 22 ? 0.5822 0.3382 0.6654 0.0488  0.1119  0.0052  29  U   R C2    
1218 O O2    . U   B 22 ? 0.5797 0.3368 0.6771 0.0486  0.1061  0.0058  29  U   R O2    
1219 N N3    . U   B 22 ? 0.5858 0.3397 0.6307 0.0497  0.1118  0.0048  29  U   R N3    
1220 C C4    . U   B 22 ? 0.6024 0.3531 0.6303 0.0502  0.1184  0.0060  29  U   R C4    
1221 O O4    . U   B 22 ? 0.6170 0.3655 0.6152 0.0522  0.1174  0.0075  29  U   R O4    
1222 C C5    . U   B 22 ? 0.6070 0.3575 0.6588 0.0485  0.1268  0.0065  29  U   R C5    
1223 C C6    . U   B 22 ? 0.5992 0.3537 0.6893 0.0477  0.1271  0.0058  29  U   R C6    
1224 P P     . U   B 23 ? 0.6372 0.3940 0.8158 0.0499  0.1920  -0.0442 30  U   R P     
1225 O OP1   . U   B 23 ? 0.6410 0.3982 0.8580 0.0498  0.2135  -0.0576 30  U   R OP1   
1226 O OP2   . U   B 23 ? 0.6402 0.3971 0.7715 0.0479  0.1918  -0.0402 30  U   R OP2   
1227 O "O5'" . U   B 23 ? 0.6356 0.3893 0.7973 0.0496  0.1840  -0.0503 30  U   R "O5'" 
1228 C "C5'" . U   B 23 ? 0.6352 0.3857 0.8364 0.0509  0.1853  -0.0556 30  U   R "C5'" 
1229 C "C4'" . U   B 23 ? 0.6378 0.3860 0.8176 0.0494  0.1743  -0.0576 30  U   R "C4'" 
1230 O "O4'" . U   B 23 ? 0.6275 0.3785 0.7847 0.0502  0.1537  -0.0398 30  U   R "O4'" 
1231 C "C3'" . U   B 23 ? 0.6562 0.4059 0.7903 0.0449  0.1824  -0.0740 30  U   R "C3'" 
1232 O "O3'" . U   B 23 ? 0.6752 0.4214 0.8239 0.0412  0.2006  -0.0958 30  U   R "O3'" 
1233 C "C2'" . U   B 23 ? 0.6469 0.3981 0.7584 0.0445  0.1641  -0.0664 30  U   R "C2'" 
1234 O "O2'" . U   B 23 ? 0.6516 0.3984 0.7878 0.0430  0.1626  -0.0723 30  U   R "O2'" 
1235 C "C1'" . U   B 23 ? 0.6300 0.3821 0.7481 0.0481  0.1481  -0.0444 30  U   R "C1'" 
1236 N N1    . U   B 23 ? 0.6297 0.3854 0.7062 0.0487  0.1421  -0.0370 30  U   R N1    
1237 C C2    . U   B 23 ? 0.6380 0.3968 0.6831 0.0483  0.1319  -0.0346 30  U   R C2    
1238 O O2    . U   B 23 ? 0.6485 0.4081 0.6960 0.0467  0.1270  -0.0385 30  U   R O2    
1239 N N3    . U   B 23 ? 0.6437 0.4044 0.6575 0.0501  0.1282  -0.0271 30  U   R N3    
1240 C C4    . U   B 23 ? 0.6478 0.4063 0.6572 0.0512  0.1338  -0.0219 30  U   R C4    
1241 O O4    . U   B 23 ? 0.6564 0.4148 0.6399 0.0529  0.1304  -0.0147 30  U   R O4    
1242 C C5    . U   B 23 ? 0.6417 0.3980 0.6828 0.0503  0.1442  -0.0251 30  U   R C5    
1243 C C6    . U   B 23 ? 0.6326 0.3882 0.7063 0.0496  0.1479  -0.0324 30  U   R C6    
1244 P P     . C   B 24 ? 0.7102 0.4611 0.8159 0.0342  0.2168  -0.1152 31  C   R P     
1245 O OP1   . C   B 24 ? 0.7358 0.4816 0.8682 0.0298  0.2394  -0.1392 31  C   R OP1   
1246 O OP2   . C   B 24 ? 0.7124 0.4682 0.7918 0.0353  0.2178  -0.1044 31  C   R OP2   
1247 O "O5'" . C   B 24 ? 0.7141 0.4702 0.7787 0.0303  0.2026  -0.1165 31  C   R "O5'" 
1248 C "C5'" . C   B 24 ? 0.7230 0.4761 0.7988 0.0259  0.2023  -0.1301 31  C   R "C5'" 
1249 C "C4'" . C   B 24 ? 0.7236 0.4850 0.7635 0.0236  0.1848  -0.1248 31  C   R "C4'" 
1250 O "O4'" . C   B 24 ? 0.7004 0.4630 0.7378 0.0310  0.1668  -0.1002 31  C   R "O4'" 
1251 C "C3'" . C   B 24 ? 0.7471 0.5211 0.7340 0.0182  0.1851  -0.1298 31  C   R "C3'" 
1252 O "O3'" . C   B 24 ? 0.7835 0.5617 0.7561 0.0072  0.1982  -0.1551 31  C   R "O3'" 
1253 C "C2'" . C   B 24 ? 0.7290 0.5105 0.6974 0.0211  0.1637  -0.1143 31  C   R "C2'" 
1254 O "O2'" . C   B 24 ? 0.7365 0.5203 0.7108 0.0158  0.1580  -0.1238 31  C   R "O2'" 
1255 C "C1'" . C   B 24 ? 0.7005 0.4736 0.6964 0.0301  0.1552  -0.0943 31  C   R "C1'" 
1256 N N1    . C   B 24 ? 0.6993 0.4747 0.6747 0.0356  0.1511  -0.0780 31  C   R N1    
1257 C C2    . C   B 24 ? 0.6970 0.4795 0.6450 0.0385  0.1373  -0.0652 31  C   R C2    
1258 O O2    . C   B 24 ? 0.6874 0.4764 0.6285 0.0366  0.1281  -0.0671 31  C   R O2    
1259 N N3    . C   B 24 ? 0.7004 0.4821 0.6338 0.0434  0.1353  -0.0513 31  C   R N3    
1260 C C4    . C   B 24 ? 0.6998 0.4752 0.6427 0.0443  0.1457  -0.0496 31  C   R C4    
1261 N N4    . C   B 24 ? 0.6960 0.4694 0.6255 0.0482  0.1439  -0.0361 31  C   R N4    
1262 C C5    . C   B 24 ? 0.7032 0.4737 0.6736 0.0414  0.1593  -0.0619 31  C   R C5    
1263 C C6    . C   B 24 ? 0.7036 0.4737 0.6901 0.0376  0.1619  -0.0758 31  C   R C6    
1264 P P     . G   B 25 ? 0.8216 0.6098 0.7509 0.0000  0.2108  -0.1642 32  G   R P     
1265 O OP1   . G   B 25 ? 0.8541 0.6439 0.7774 -0.0132 0.2266  -0.1945 32  G   R OP1   
1266 O OP2   . G   B 25 ? 0.8119 0.5947 0.7510 0.0063  0.2202  -0.1532 32  G   R OP2   
1267 O "O5'" . G   B 25 ? 0.8243 0.6284 0.7081 0.0001  0.1909  -0.1479 32  G   R "O5'" 
1268 C "C5'" . G   B 25 ? 0.8392 0.6535 0.7109 -0.0047 0.1770  -0.1521 32  G   R "C5'" 
1269 C "C4'" . G   B 25 ? 0.8387 0.6674 0.6795 -0.0002 0.1577  -0.1306 32  G   R "C4'" 
1270 O "O4'" . G   B 25 ? 0.8042 0.6248 0.6652 0.0125  0.1467  -0.1084 32  G   R "O4'" 
1271 C "C3'" . G   B 25 ? 0.8624 0.7004 0.6652 -0.0009 0.1604  -0.1206 32  G   R "C3'" 
1272 O "O3'" . G   B 25 ? 0.9069 0.7592 0.6751 -0.0150 0.1669  -0.1373 32  G   R "O3'" 
1273 C "C2'" . G   B 25 ? 0.8417 0.6875 0.6357 0.0083  0.1403  -0.0959 32  G   R "C2'" 
1274 O "O2'" . G   B 25 ? 0.8521 0.7150 0.6335 0.0031  0.1264  -0.0990 32  G   R "O2'" 
1275 C "C1'" . G   B 25 ? 0.8052 0.6340 0.6393 0.0181  0.1380  -0.0886 32  G   R "C1'" 
1276 N N9    . G   B 25 ? 0.7981 0.6145 0.6407 0.0252  0.1455  -0.0768 32  G   R N9    
1277 C C8    . G   B 25 ? 0.7996 0.6040 0.6643 0.0243  0.1612  -0.0852 32  G   R C8    
1278 N N7    . G   B 25 ? 0.7945 0.5916 0.6637 0.0303  0.1643  -0.0715 32  G   R N7    
1279 C C5    . G   B 25 ? 0.7944 0.5968 0.6428 0.0356  0.1509  -0.0535 32  G   R C5    
1280 C C6    . G   B 25 ? 0.7965 0.5929 0.6412 0.0425  0.1488  -0.0349 32  G   R C6    
1281 O O6    . G   B 25 ? 0.8082 0.5947 0.6664 0.0441  0.1577  -0.0309 32  G   R O6    
1282 N N1    . G   B 25 ? 0.7899 0.5931 0.6170 0.0474  0.1356  -0.0206 32  G   R N1    
1283 C C2    . G   B 25 ? 0.7910 0.6080 0.6062 0.0458  0.1246  -0.0231 32  G   R C2    
1284 N N2    . G   B 25 ? 0.7889 0.6121 0.5937 0.0522  0.1134  -0.0070 32  G   R N2    
1285 N N3    . G   B 25 ? 0.7993 0.6234 0.6160 0.0382  0.1254  -0.0406 32  G   R N3    
1286 C C4    . G   B 25 ? 0.7956 0.6105 0.6288 0.0333  0.1393  -0.0557 32  G   R C4    
1287 P P     . A   B 26 ? 0.9473 0.7982 0.6944 -0.0215 0.1878  -0.1447 33  A   R P     
1288 O OP1   . A   B 26 ? 0.9807 0.8404 0.7072 -0.0388 0.1999  -0.1740 33  A   R OP1   
1289 O OP2   . A   B 26 ? 0.9231 0.7545 0.7060 -0.0119 0.2003  -0.1398 33  A   R OP2   
1290 O "O5'" . A   B 26 ? 0.9541 0.8197 0.6607 -0.0189 0.1757  -0.1188 33  A   R "O5'" 
1291 C "C5'" . A   B 26 ? 0.9620 0.8262 0.6480 -0.0199 0.1884  -0.1100 33  A   R "C5'" 
1292 C "C4'" . A   B 26 ? 0.9599 0.8375 0.6141 -0.0158 0.1723  -0.0814 33  A   R "C4'" 
1293 O "O4'" . A   B 26 ? 0.9779 0.8795 0.5991 -0.0262 0.1588  -0.0851 33  A   R "O4'" 
1294 C "C3'" . A   B 26 ? 0.9179 0.7883 0.5968 0.0005  0.1555  -0.0577 33  A   R "C3'" 
1295 O "O3'" . A   B 26 ? 0.9128 0.7666 0.6057 0.0089  0.1646  -0.0439 33  A   R "O3'" 
1296 C "C2'" . A   B 26 ? 0.9298 0.8214 0.5774 0.0004  0.1370  -0.0381 33  A   R "C2'" 
1297 O "O2'" . A   B 26 ? 0.9507 0.8440 0.5745 0.0022  0.1396  -0.0161 33  A   R "O2'" 
1298 C "C1'" . A   B 26 ? 0.9562 0.8681 0.5755 -0.0164 0.1362  -0.0591 33  A   R "C1'" 
1299 N N9    . A   B 26 ? 0.9351 0.8561 0.5689 -0.0179 0.1220  -0.0697 33  A   R N9    
1300 C C8    . A   B 26 ? 0.9298 0.8459 0.5811 -0.0260 0.1290  -0.0981 33  A   R C8    
1301 N N7    . A   B 26 ? 0.9152 0.8417 0.5779 -0.0265 0.1136  -0.1008 33  A   R N7    
1302 C C5    . A   B 26 ? 0.9128 0.8532 0.5659 -0.0176 0.0953  -0.0728 33  A   R C5    
1303 C C6    . A   B 26 ? 0.9068 0.8642 0.5683 -0.0132 0.0746  -0.0612 33  A   R C6    
1304 N N6    . A   B 26 ? 0.9019 0.8651 0.5811 -0.0189 0.0686  -0.0774 33  A   R N6    
1305 N N1    . A   B 26 ? 0.9076 0.8756 0.5623 -0.0029 0.0614  -0.0320 33  A   R N1    
1306 C C2    . A   B 26 ? 0.9164 0.8769 0.5554 0.0020  0.0682  -0.0150 33  A   R C2    
1307 N N3    . A   B 26 ? 0.9262 0.8711 0.5540 -0.0021 0.0871  -0.0233 33  A   R N3    
1308 C C4    . A   B 26 ? 0.9230 0.8593 0.5591 -0.0119 0.1001  -0.0530 33  A   R C4    
1309 P P     . A   B 27 ? 0.8715 0.7072 0.6054 0.0229  0.1588  -0.0334 34  A   R P     
1310 O OP1   . A   B 27 ? 0.8726 0.6944 0.6151 0.0265  0.1714  -0.0236 34  A   R OP1   
1311 O OP2   . A   B 27 ? 0.8545 0.6853 0.6179 0.0221  0.1579  -0.0517 34  A   R OP2   
1312 O "O5'" . A   B 27 ? 0.8602 0.7042 0.5861 0.0315  0.1386  -0.0114 34  A   R "O5'" 
1313 C "C5'" . A   B 27 ? 0.8764 0.7225 0.5835 0.0360  0.1359  0.0123  34  A   R "C5'" 
1314 C "C4'" . A   B 27 ? 0.8766 0.7354 0.5801 0.0430  0.1165  0.0286  34  A   R "C4'" 
1315 O "O4'" . A   B 27 ? 0.8905 0.7712 0.5774 0.0341  0.1074  0.0168  34  A   R "O4'" 
1316 C "C3'" . A   B 27 ? 0.8389 0.6873 0.5753 0.0538  0.1084  0.0314  34  A   R "C3'" 
1317 O "O3'" . A   B 27 ? 0.8287 0.6613 0.5766 0.0635  0.1109  0.0492  34  A   R "O3'" 
1318 C "C2'" . A   B 27 ? 0.8381 0.7077 0.5689 0.0549  0.0914  0.0359  34  A   R "C2'" 
1319 O "O2'" . A   B 27 ? 0.8520 0.7304 0.5732 0.0620  0.0827  0.0606  34  A   R "O2'" 
1320 C "C1'" . A   B 27 ? 0.8600 0.7474 0.5654 0.0407  0.0922  0.0198  34  A   R "C1'" 
1321 N N9    . A   B 27 ? 0.8381 0.7261 0.5576 0.0338  0.0930  -0.0045 34  A   R N9    
1322 C C8    . A   B 27 ? 0.8319 0.7059 0.5638 0.0282  0.1072  -0.0249 34  A   R C8    
1323 N N7    . A   B 27 ? 0.8225 0.6991 0.5687 0.0229  0.1049  -0.0427 34  A   R N7    
1324 C C5    . A   B 27 ? 0.8236 0.7184 0.5649 0.0243  0.0879  -0.0344 34  A   R C5    
1325 C C6    . A   B 27 ? 0.8167 0.7233 0.5690 0.0198  0.0780  -0.0448 34  A   R C6    
1326 N N6    . A   B 27 ? 0.8088 0.7074 0.5789 0.0127  0.0845  -0.0661 34  A   R N6    
1327 N N1    . A   B 27 ? 0.8146 0.7415 0.5626 0.0229  0.0617  -0.0314 34  A   R N1    
1328 C C2    . A   B 27 ? 0.8219 0.7556 0.5571 0.0310  0.0556  -0.0082 34  A   R C2    
1329 N N3    . A   B 27 ? 0.8296 0.7515 0.5533 0.0358  0.0639  0.0040  34  A   R N3    
1330 C C4    . A   B 27 ? 0.8290 0.7319 0.5553 0.0316  0.0802  -0.0106 34  A   R C4    
1331 P P     . A   B 28 ? 0.8019 0.6176 0.5821 0.0719  0.1090  0.0490  35  A   R P     
1332 O OP1   . A   B 28 ? 0.8096 0.6105 0.5946 0.0788  0.1138  0.0661  35  A   R OP1   
1333 O OP2   . A   B 28 ? 0.7869 0.5950 0.5840 0.0666  0.1146  0.0296  35  A   R OP2   
1334 O "O5'" . A   B 28 ? 0.7848 0.6141 0.5716 0.0770  0.0942  0.0520  35  A   R "O5'" 
1335 C "C5'" . A   B 28 ? 0.7859 0.6179 0.5765 0.0869  0.0873  0.0711  35  A   R "C5'" 
1336 C "C4'" . A   B 28 ? 0.7763 0.6261 0.5751 0.0891  0.0746  0.0694  35  A   R "C4'" 
1337 O "O4'" . A   B 28 ? 0.7858 0.6553 0.5680 0.0789  0.0693  0.0578  35  A   R "O4'" 
1338 C "C3'" . A   B 28 ? 0.7513 0.5928 0.5727 0.0900  0.0747  0.0571  35  A   R "C3'" 
1339 O "O3'" . A   B 28 ? 0.7531 0.5819 0.5913 0.0993  0.0769  0.0663  35  A   R "O3'" 
1340 C "C2'" . A   B 28 ? 0.7455 0.6100 0.5678 0.0869  0.0635  0.0514  35  A   R "C2'" 
1341 O "O2'" . A   B 28 ? 0.7482 0.6271 0.5781 0.0952  0.0546  0.0661  35  A   R "O2'" 
1342 C "C1'" . A   B 28 ? 0.7672 0.6442 0.5646 0.0770  0.0630  0.0455  35  A   R "C1'" 
1343 N N9    . A   B 28 ? 0.7594 0.6298 0.5579 0.0671  0.0697  0.0244  35  A   R N9    
1344 C C8    . A   B 28 ? 0.7614 0.6136 0.5611 0.0642  0.0821  0.0168  35  A   R C8    
1345 N N7    . A   B 28 ? 0.7581 0.6082 0.5650 0.0562  0.0863  -0.0015 35  A   R N7    
1346 C C5    . A   B 28 ? 0.7495 0.6162 0.5576 0.0527  0.0762  -0.0072 35  A   R C5    
1347 C C6    . A   B 28 ? 0.7430 0.6143 0.5600 0.0439  0.0756  -0.0252 35  A   R C6    
1348 N N6    . A   B 28 ? 0.7344 0.5925 0.5627 0.0382  0.0861  -0.0404 35  A   R N6    
1349 N N1    . A   B 28 ? 0.7439 0.6338 0.5616 0.0413  0.0643  -0.0264 35  A   R N1    
1350 C C2    . A   B 28 ? 0.7419 0.6466 0.5541 0.0481  0.0539  -0.0098 35  A   R C2    
1351 N N3    . A   B 28 ? 0.7433 0.6446 0.5494 0.0578  0.0537  0.0086  35  A   R N3    
1352 C C4    . A   B 28 ? 0.7515 0.6324 0.5545 0.0592  0.0655  0.0085  35  A   R C4    
1353 P P     . G   B 29 ? 0.7407 0.5461 0.5923 0.0981  0.0856  0.0579  36  G   R P     
1354 O OP1   . G   B 29 ? 0.7317 0.5312 0.5992 0.1058  0.0859  0.0633  36  G   R OP1   
1355 O OP2   . G   B 29 ? 0.7389 0.5308 0.5827 0.0951  0.0945  0.0595  36  G   R OP2   
1356 O "O5'" . G   B 29 ? 0.7219 0.5314 0.5786 0.0897  0.0831  0.0410  36  G   R "O5'" 
1357 C "C5'" . G   B 29 ? 0.7108 0.5311 0.5773 0.0897  0.0764  0.0366  36  G   R "C5'" 
1358 C "C4'" . G   B 29 ? 0.7048 0.5344 0.5704 0.0808  0.0731  0.0235  36  G   R "C4'" 
1359 O "O4'" . G   B 29 ? 0.7173 0.5493 0.5682 0.0759  0.0763  0.0195  36  G   R "O4'" 
1360 C "C3'" . G   B 29 ? 0.6846 0.5024 0.5629 0.0751  0.0759  0.0141  36  G   R "C3'" 
1361 O "O3'" . G   B 29 ? 0.6633 0.4828 0.5530 0.0755  0.0725  0.0141  36  G   R "O3'" 
1362 C "C2'" . G   B 29 ? 0.6914 0.5167 0.5678 0.0673  0.0756  0.0023  36  G   R "C2'" 
1363 O "O2'" . G   B 29 ? 0.6926 0.5341 0.5712 0.0642  0.0686  -0.0022 36  G   R "O2'" 
1364 C "C1'" . G   B 29 ? 0.7052 0.5338 0.5628 0.0677  0.0793  0.0049  36  G   R "C1'" 
1365 N N9    . G   B 29 ? 0.7098 0.5240 0.5676 0.0661  0.0892  0.0029  36  G   R N9    
1366 C C8    . G   B 29 ? 0.7194 0.5227 0.5735 0.0707  0.0945  0.0130  36  G   R C8    
1367 N N7    . G   B 29 ? 0.7171 0.5107 0.5756 0.0672  0.1035  0.0083  36  G   R N7    
1368 C C5    . G   B 29 ? 0.7080 0.5054 0.5751 0.0608  0.1047  -0.0057 36  G   R C5    
1369 C C6    . G   B 29 ? 0.7078 0.4987 0.5881 0.0559  0.1142  -0.0161 36  G   R C6    
1370 O O6    . G   B 29 ? 0.7126 0.4950 0.5991 0.0558  0.1231  -0.0147 36  G   R O6    
1371 N N1    . G   B 29 ? 0.7071 0.5023 0.5978 0.0506  0.1139  -0.0296 36  G   R N1    
1372 C C2    . G   B 29 ? 0.7037 0.5090 0.5909 0.0490  0.1047  -0.0325 36  G   R C2    
1373 N N2    . G   B 29 ? 0.7026 0.5089 0.6033 0.0428  0.1067  -0.0466 36  G   R N2    
1374 N N3    . G   B 29 ? 0.7033 0.5171 0.5783 0.0533  0.0952  -0.0225 36  G   R N3    
1375 C C4    . G   B 29 ? 0.7056 0.5146 0.5716 0.0596  0.0960  -0.0093 36  G   R C4    
1376 P P     . A   B 30 ? 0.6422 0.4470 0.5420 0.0716  0.0748  0.0124  37  A   R P     
1377 O OP1   . A   B 30 ? 0.6268 0.4347 0.5315 0.0721  0.0732  0.0142  37  A   R OP1   
1378 O OP2   . A   B 30 ? 0.6513 0.4418 0.5480 0.0729  0.0803  0.0157  37  A   R OP2   
1379 O "O5'" . A   B 30 ? 0.6284 0.4344 0.5374 0.0637  0.0732  0.0039  37  A   R "O5'" 
1380 C "C5'" . A   B 30 ? 0.6166 0.4329 0.5330 0.0595  0.0688  -0.0006 37  A   R "C5'" 
1381 C "C4'" . A   B 30 ? 0.6141 0.4285 0.5406 0.0529  0.0700  -0.0097 37  A   R "C4'" 
1382 O "O4'" . A   B 30 ? 0.6242 0.4385 0.5413 0.0535  0.0750  -0.0150 37  A   R "O4'" 
1383 C "C3'" . A   B 30 ? 0.6045 0.4057 0.5476 0.0495  0.0714  -0.0080 37  A   R "C3'" 
1384 O "O3'" . A   B 30 ? 0.5964 0.3986 0.5503 0.0452  0.0668  -0.0046 37  A   R "O3'" 
1385 C "C2'" . A   B 30 ? 0.6100 0.4090 0.5624 0.0461  0.0767  -0.0186 37  A   R "C2'" 
1386 O "O2'" . A   B 30 ? 0.6223 0.4278 0.5826 0.0406  0.0754  -0.0274 37  A   R "O2'" 
1387 C "C1'" . A   B 30 ? 0.6179 0.4218 0.5493 0.0496  0.0806  -0.0212 37  A   R "C1'" 
1388 N N9    . A   B 30 ? 0.6147 0.4089 0.5435 0.0531  0.0860  -0.0163 37  A   R N9    
1389 C C8    . A   B 30 ? 0.6162 0.4082 0.5319 0.0585  0.0858  -0.0069 37  A   R C8    
1390 N N7    . A   B 30 ? 0.6206 0.4033 0.5389 0.0593  0.0917  -0.0045 37  A   R N7    
1391 C C5    . A   B 30 ? 0.6169 0.3967 0.5524 0.0550  0.0964  -0.0128 37  A   R C5    
1392 C C6    . A   B 30 ? 0.6255 0.3980 0.5758 0.0539  0.1044  -0.0148 37  A   R C6    
1393 N N6    . A   B 30 ? 0.6261 0.3930 0.5731 0.0560  0.1083  -0.0084 37  A   R N6    
1394 N N1    . A   B 30 ? 0.6252 0.3962 0.5974 0.0505  0.1093  -0.0241 37  A   R N1    
1395 C C2    . A   B 30 ? 0.6203 0.3953 0.5973 0.0475  0.1061  -0.0310 37  A   R C2    
1396 N N3    . A   B 30 ? 0.6127 0.3952 0.5756 0.0470  0.0980  -0.0299 37  A   R N3    
1397 C C4    . A   B 30 ? 0.6120 0.3976 0.5546 0.0513  0.0934  -0.0203 37  A   R C4    
1398 P P     . G   B 31 ? 0.5912 0.3839 0.5544 0.0423  0.0641  0.0051  38  G   R P     
1399 O OP1   . G   B 31 ? 0.5865 0.3837 0.5534 0.0371  0.0598  0.0099  38  G   R OP1   
1400 O OP2   . G   B 31 ? 0.5972 0.3847 0.5478 0.0462  0.0657  0.0093  38  G   R OP2   
1401 O "O5'" . G   B 31 ? 0.5944 0.3791 0.5803 0.0400  0.0662  0.0029  38  G   R "O5'" 
1402 C "C5'" . G   B 31 ? 0.5911 0.3754 0.5971 0.0356  0.0662  -0.0008 38  G   R "C5'" 
1403 C "C4'" . G   B 31 ? 0.5939 0.3691 0.6256 0.0355  0.0705  -0.0026 38  G   R "C4'" 
1404 O "O4'" . G   B 31 ? 0.5967 0.3713 0.6196 0.0392  0.0787  -0.0126 38  G   R "O4'" 
1405 C "C3'" . G   B 31 ? 0.5925 0.3626 0.6371 0.0354  0.0654  0.0113  38  G   R "C3'" 
1406 O "O3'" . G   B 31 ? 0.5976 0.3671 0.6577 0.0305  0.0579  0.0230  38  G   R "O3'" 
1407 C "C2'" . G   B 31 ? 0.5972 0.3611 0.6654 0.0379  0.0734  0.0051  38  G   R "C2'" 
1408 O "O2'" . G   B 31 ? 0.6071 0.3658 0.7079 0.0359  0.0767  0.0019  38  G   R "O2'" 
1409 C "C1'" . G   B 31 ? 0.6049 0.3720 0.6495 0.0405  0.0823  -0.0096 38  G   R "C1'" 
1410 N N9    . G   B 31 ? 0.6113 0.3784 0.6394 0.0441  0.0840  -0.0064 38  G   R N9    
1411 C C8    . G   B 31 ? 0.6129 0.3837 0.6117 0.0464  0.0815  -0.0034 38  G   R C8    
1412 N N7    . G   B 31 ? 0.6161 0.3835 0.6092 0.0489  0.0849  -0.0007 38  G   R N7    
1413 C C5    . G   B 31 ? 0.6169 0.3802 0.6371 0.0480  0.0896  -0.0021 38  G   R C5    
1414 C C6    . G   B 31 ? 0.6228 0.3827 0.6530 0.0490  0.0952  -0.0003 38  G   R C6    
1415 O O6    . G   B 31 ? 0.6446 0.4030 0.6593 0.0503  0.0970  0.0027  38  G   R O6    
1416 N N1    . G   B 31 ? 0.6199 0.3779 0.6852 0.0484  0.0998  -0.0024 38  G   R N1    
1417 C C2    . G   B 31 ? 0.6191 0.3761 0.7079 0.0471  0.0994  -0.0055 38  G   R C2    
1418 N N2    . G   B 31 ? 0.6265 0.3807 0.7542 0.0479  0.1056  -0.0067 38  G   R N2    
1419 N N3    . G   B 31 ? 0.6180 0.3764 0.6964 0.0453  0.0943  -0.0072 38  G   R N3    
1420 C C4    . G   B 31 ? 0.6168 0.3795 0.6601 0.0457  0.0893  -0.0054 38  G   R C4    
1421 P P     . U   B 32 ? 0.5940 0.3659 0.6469 0.0264  0.0473  0.0404  39  U   R P     
1422 O OP1   . U   B 32 ? 0.5963 0.3694 0.6598 0.0200  0.0411  0.0514  39  U   R OP1   
1423 O OP2   . U   B 32 ? 0.5947 0.3702 0.6149 0.0279  0.0480  0.0371  39  U   R OP2   
1424 O "O5'" . U   B 32 ? 0.5968 0.3650 0.6749 0.0278  0.0453  0.0474  39  U   R "O5'" 
1425 C "C5'" . U   B 32 ? 0.6191 0.3828 0.7371 0.0282  0.0456  0.0521  39  U   R "C5'" 
1426 C "C4'" . U   B 32 ? 0.6273 0.3902 0.7680 0.0314  0.0464  0.0553  39  U   R "C4'" 
1427 O "O4'" . U   B 32 ? 0.6288 0.3897 0.7566 0.0364  0.0587  0.0384  39  U   R "O4'" 
1428 C "C3'" . U   B 32 ? 0.6357 0.4052 0.7633 0.0272  0.0350  0.0686  39  U   R "C3'" 
1429 O "O3'" . U   B 32 ? 0.6335 0.4077 0.7764 0.0211  0.0211  0.0890  39  U   R "O3'" 
1430 C "C2'" . U   B 32 ? 0.6378 0.4066 0.7836 0.0317  0.0411  0.0639  39  U   R "C2'" 
1431 O "O2'" . U   B 32 ? 0.6506 0.4193 0.8448 0.0337  0.0401  0.0723  39  U   R "O2'" 
1432 C "C1'" . U   B 32 ? 0.6362 0.3994 0.7674 0.0371  0.0570  0.0433  39  U   R "C1'" 
1433 N N1    . U   B 32 ? 0.6470 0.4110 0.7391 0.0379  0.0602  0.0361  39  U   R N1    
1434 C C2    . U   B 32 ? 0.6556 0.4188 0.7492 0.0399  0.0660  0.0332  39  U   R C2    
1435 O O2    . U   B 32 ? 0.6573 0.4209 0.7829 0.0410  0.0688  0.0353  39  U   R O2    
1436 N N3    . U   B 32 ? 0.6533 0.4152 0.7132 0.0408  0.0692  0.0284  39  U   R N3    
1437 C C4    . U   B 32 ? 0.6539 0.4162 0.6824 0.0409  0.0674  0.0261  39  U   R C4    
1438 O O4    . U   B 32 ? 0.6675 0.4276 0.6732 0.0428  0.0713  0.0232  39  U   R O4    
1439 C C5    . U   B 32 ? 0.6532 0.4183 0.6825 0.0387  0.0616  0.0284  39  U   R C5    
1440 C C6    . U   B 32 ? 0.6533 0.4186 0.7124 0.0368  0.0583  0.0333  39  U   R C6    
1441 P P     . G   B 33 ? 0.6413 0.4241 0.7510 0.0115  0.0082  0.1005  40  G   R P     
1442 O OP1   . G   B 33 ? 0.6522 0.4403 0.7778 0.0045  -0.0050 0.1222  40  G   R OP1   
1443 O OP2   . G   B 33 ? 0.6355 0.4167 0.7032 0.0112  0.0151  0.0867  40  G   R OP2   
1444 O "O5'" . G   B 33 ? 0.6297 0.4169 0.7440 0.0107  0.0045  0.1019  40  G   R "O5'" 
1445 C "C5'" . G   B 33 ? 0.6172 0.4104 0.7722 0.0103  -0.0042 0.1167  40  G   R "C5'" 
1446 C "C4'" . G   B 33 ? 0.6098 0.4070 0.7688 0.0101  -0.0038 0.1129  40  G   R "C4'" 
1447 O "O4'" . G   B 33 ? 0.6033 0.3913 0.7618 0.0192  0.0142  0.0933  40  G   R "O4'" 
1448 C "C3'" . G   B 33 ? 0.6158 0.4175 0.7346 0.0007  -0.0100 0.1108  40  G   R "C3'" 
1449 O "O3'" . G   B 33 ? 0.6354 0.4501 0.7546 -0.0110 -0.0289 0.1295  40  G   R "O3'" 
1450 C "C2'" . G   B 33 ? 0.6069 0.4067 0.7357 0.0046  -0.0016 0.1007  40  G   R "C2'" 
1451 O "O2'" . G   B 33 ? 0.5922 0.4028 0.7595 0.0021  -0.0109 0.1129  40  G   R "O2'" 
1452 C "C1'" . G   B 33 ? 0.6044 0.3934 0.7433 0.0166  0.0161  0.0869  40  G   R "C1'" 
1453 N N9    . G   B 33 ? 0.6031 0.3836 0.7020 0.0193  0.0271  0.0715  40  G   R N9    
1454 C C8    . G   B 33 ? 0.6050 0.3809 0.6830 0.0221  0.0316  0.0652  40  G   R C8    
1455 N N7    . G   B 33 ? 0.6105 0.3812 0.6582 0.0248  0.0402  0.0538  40  G   R N7    
1456 C C5    . G   B 33 ? 0.6096 0.3792 0.6569 0.0236  0.0424  0.0521  40  G   R C5    
1457 C C6    . G   B 33 ? 0.6113 0.3743 0.6352 0.0257  0.0512  0.0435  40  G   R C6    
1458 O O6    . G   B 33 ? 0.6197 0.3779 0.6193 0.0300  0.0580  0.0365  40  G   R O6    
1459 N N1    . G   B 33 ? 0.6135 0.3765 0.6483 0.0223  0.0513  0.0449  40  G   R N1    
1460 C C2    . G   B 33 ? 0.6102 0.3814 0.6759 0.0174  0.0429  0.0538  40  G   R C2    
1461 N N2    . G   B 33 ? 0.6113 0.3831 0.6859 0.0136  0.0441  0.0535  40  G   R N2    
1462 N N3    . G   B 33 ? 0.6041 0.3829 0.6937 0.0164  0.0336  0.0635  40  G   R N3    
1463 C C4    . G   B 33 ? 0.6056 0.3818 0.6837 0.0197  0.0344  0.0621  40  G   R C4    
1464 P P     . G   B 34 ? 0.6502 0.4691 0.7193 -0.0246 -0.0359 0.1285  41  G   R P     
1465 O OP1   . G   B 34 ? 0.6766 0.5113 0.7508 -0.0374 -0.0567 0.1511  41  G   R OP1   
1466 O OP2   . G   B 34 ? 0.6473 0.4563 0.6864 -0.0208 -0.0239 0.1162  41  G   R OP2   
1467 O "O5'" . G   B 34 ? 0.6478 0.4648 0.7033 -0.0272 -0.0310 0.1146  41  G   R "O5'" 
1468 C "C5'" . G   B 34 ? 0.6505 0.4785 0.7313 -0.0326 -0.0416 0.1229  41  G   R "C5'" 
1469 C "C4'" . G   B 34 ? 0.6440 0.4647 0.7161 -0.0317 -0.0305 0.1061  41  G   R "C4'" 
1470 O "O4'" . G   B 34 ? 0.6302 0.4364 0.7078 -0.0168 -0.0110 0.0926  41  G   R "O4'" 
1471 C "C3'" . G   B 34 ? 0.6502 0.4648 0.6758 -0.0411 -0.0268 0.0927  41  G   R "C3'" 
1472 O "O3'" . G   B 34 ? 0.6603 0.4888 0.6754 -0.0589 -0.0433 0.0999  41  G   R "O3'" 
1473 C "C2'" . G   B 34 ? 0.6472 0.4499 0.6775 -0.0338 -0.0112 0.0781  41  G   R "C2'" 
1474 O "O2'" . G   B 34 ? 0.6565 0.4681 0.7128 -0.0397 -0.0178 0.0823  41  G   R "O2'" 
1475 C "C1'" . G   B 34 ? 0.6348 0.4307 0.6861 -0.0173 0.0003  0.0772  41  G   R "C1'" 
1476 N N9    . G   B 34 ? 0.6314 0.4150 0.6545 -0.0096 0.0130  0.0662  41  G   R N9    
1477 C C8    . G   B 34 ? 0.6279 0.4113 0.6441 -0.0055 0.0129  0.0685  41  G   R C8    
1478 N N7    . G   B 34 ? 0.6287 0.4029 0.6216 0.0007  0.0245  0.0575  41  G   R N7    
1479 C C5    . G   B 34 ? 0.6341 0.4005 0.6178 0.0015  0.0330  0.0484  41  G   R C5    
1480 C C6    . G   B 34 ? 0.6369 0.3923 0.6002 0.0082  0.0461  0.0377  41  G   R C6    
1481 O O6    . G   B 34 ? 0.6318 0.3845 0.5811 0.0147  0.0518  0.0337  41  G   R O6    
1482 N N1    . G   B 34 ? 0.6423 0.3903 0.6054 0.0066  0.0520  0.0330  41  G   R N1    
1483 C C2    . G   B 34 ? 0.6430 0.3954 0.6236 -0.0013 0.0459  0.0366  41  G   R C2    
1484 N N2    . G   B 34 ? 0.6404 0.3838 0.6198 -0.0028 0.0539  0.0309  41  G   R N2    
1485 N N3    . G   B 34 ? 0.6369 0.4023 0.6379 -0.0076 0.0325  0.0466  41  G   R N3    
1486 C C4    . G   B 34 ? 0.6342 0.4054 0.6355 -0.0052 0.0267  0.0528  41  G   R C4    
1487 P P     . G   B 35 ? 0.6776 0.5062 0.6428 -0.0738 -0.0456 0.0929  42  G   R P     
1488 O OP1   . G   B 35 ? 0.6965 0.5412 0.6560 -0.0935 -0.0628 0.0984  42  G   R OP1   
1489 O OP2   . G   B 35 ? 0.6702 0.4989 0.6227 -0.0709 -0.0456 0.1000  42  G   R OP2   
1490 O "O5'" . G   B 35 ? 0.6754 0.4839 0.6175 -0.0679 -0.0242 0.0691  42  G   R "O5'" 
1491 C "C5'" . G   B 35 ? 0.6798 0.4823 0.6231 -0.0723 -0.0190 0.0576  42  G   R "C5'" 
1492 C "C4'" . G   B 35 ? 0.6737 0.4551 0.6011 -0.0616 0.0024  0.0401  42  G   R "C4'" 
1493 O "O4'" . G   B 35 ? 0.6558 0.4313 0.5971 -0.0430 0.0113  0.0434  42  G   R "O4'" 
1494 C "C3'" . G   B 35 ? 0.6859 0.4609 0.5753 -0.0680 0.0092  0.0287  42  G   R "C3'" 
1495 O "O3'" . G   B 35 ? 0.7040 0.4765 0.5765 -0.0842 0.0094  0.0166  42  G   R "O3'" 
1496 C "C2'" . G   B 35 ? 0.6793 0.4377 0.5684 -0.0498 0.0280  0.0203  42  G   R "C2'" 
1497 O "O2'" . G   B 35 ? 0.6853 0.4283 0.5756 -0.0468 0.0410  0.0086  42  G   R "O2'" 
1498 C "C1'" . G   B 35 ? 0.6554 0.4184 0.5733 -0.0359 0.0253  0.0324  42  G   R "C1'" 
1499 N N9    . G   B 35 ? 0.6446 0.4127 0.5600 -0.0298 0.0234  0.0389  42  G   R N9    
1500 C C8    . G   B 35 ? 0.6445 0.4260 0.5675 -0.0355 0.0094  0.0528  42  G   R C8    
1501 N N7    . G   B 35 ? 0.6397 0.4215 0.5603 -0.0288 0.0122  0.0555  42  G   R N7    
1502 C C5    . G   B 35 ? 0.6376 0.4078 0.5482 -0.0181 0.0277  0.0427  42  G   R C5    
1503 C C6    . G   B 35 ? 0.6338 0.4017 0.5397 -0.0083 0.0359  0.0393  42  G   R C6    
1504 O O6    . G   B 35 ? 0.6259 0.3999 0.5349 -0.0078 0.0323  0.0455  42  G   R O6    
1505 N N1    . G   B 35 ? 0.6367 0.3946 0.5354 0.0009  0.0491  0.0285  42  G   R N1    
1506 C C2    . G   B 35 ? 0.6444 0.3928 0.5410 0.0010  0.0552  0.0219  42  G   R C2    
1507 N N2    . G   B 35 ? 0.6467 0.3859 0.5389 0.0114  0.0675  0.0151  42  G   R N2    
1508 N N3    . G   B 35 ? 0.6484 0.3972 0.5493 -0.0087 0.0490  0.0233  42  G   R N3    
1509 C C4    . G   B 35 ? 0.6389 0.4001 0.5465 -0.0180 0.0347  0.0336  42  G   R C4    
1510 P P     . A   B 36 ? 0.7284 0.5015 0.5607 -0.1010 0.0113  0.0046  43  A   R P     
1511 O OP1   . A   B 36 ? 0.7527 0.5276 0.5759 -0.1206 0.0066  -0.0055 43  A   R OP1   
1512 O OP2   . A   B 36 ? 0.7320 0.5199 0.5527 -0.1047 0.0006  0.0180  43  A   R OP2   
1513 O "O5'" . A   B 36 ? 0.7336 0.4851 0.5560 -0.0877 0.0352  -0.0115 43  A   R "O5'" 
1514 C "C5'" . A   B 36 ? 0.7596 0.5074 0.5525 -0.0944 0.0450  -0.0239 43  A   R "C5'" 
1515 C "C4'" . A   B 36 ? 0.7569 0.4886 0.5554 -0.0749 0.0647  -0.0314 43  A   R "C4'" 
1516 O "O4'" . A   B 36 ? 0.7206 0.4575 0.5383 -0.0575 0.0609  -0.0162 43  A   R "O4'" 
1517 C "C3'" . A   B 36 ? 0.7816 0.5104 0.5563 -0.0785 0.0779  -0.0439 43  A   R "C3'" 
1518 O "O3'" . A   B 36 ? 0.7887 0.4989 0.5724 -0.0645 0.0979  -0.0556 43  A   R "O3'" 
1519 C "C2'" . A   B 36 ? 0.7628 0.5056 0.5389 -0.0715 0.0706  -0.0290 43  A   R "C2'" 
1520 O "O2'" . A   B 36 ? 0.7798 0.5193 0.5466 -0.0659 0.0857  -0.0375 43  A   R "O2'" 
1521 C "C1'" . A   B 36 ? 0.7232 0.4635 0.5298 -0.0527 0.0669  -0.0168 43  A   R "C1'" 
1522 N N9    . A   B 36 ? 0.6953 0.4488 0.5136 -0.0474 0.0547  0.0001  43  A   R N9    
1523 C C8    . A   B 36 ? 0.6667 0.4196 0.5011 -0.0306 0.0583  0.0056  43  A   R C8    
1524 N N7    . A   B 36 ? 0.6561 0.4200 0.5010 -0.0300 0.0470  0.0192  43  A   R N7    
1525 C C5    . A   B 36 ? 0.6724 0.4457 0.5088 -0.0466 0.0338  0.0261  43  A   R C5    
1526 C C6    . A   B 36 ? 0.6750 0.4619 0.5197 -0.0536 0.0176  0.0434  43  A   R C6    
1527 N N6    . A   B 36 ? 0.6638 0.4540 0.5289 -0.0441 0.0142  0.0544  43  A   R N6    
1528 N N1    . A   B 36 ? 0.7008 0.4978 0.5334 -0.0713 0.0046  0.0495  43  A   R N1    
1529 C C2    . A   B 36 ? 0.7261 0.5191 0.5374 -0.0827 0.0088  0.0355  43  A   R C2    
1530 N N3    . A   B 36 ? 0.7251 0.5029 0.5285 -0.0776 0.0258  0.0164  43  A   R N3    
1531 C C4    . A   B 36 ? 0.6968 0.4654 0.5147 -0.0584 0.0375  0.0141  43  A   R C4    
1532 P P     . C   B 37 ? 0.8255 0.5161 0.6046 -0.0722 0.1136  -0.0767 44  C   R P     
1533 O OP1   . C   B 37 ? 0.8058 0.4863 0.6078 -0.0656 0.1117  -0.0718 44  C   R OP1   
1534 O OP2   . C   B 37 ? 0.8525 0.5491 0.6016 -0.0975 0.1118  -0.0904 44  C   R OP2   
1535 O "O5'" . C   B 37 ? 0.8163 0.4955 0.6011 -0.0567 0.1347  -0.0850 44  C   R "O5'" 
1536 C "C5'" . C   B 37 ? 0.8060 0.4644 0.6112 -0.0430 0.1511  -0.0912 44  C   R "C5'" 
1537 C "C4'" . C   B 37 ? 0.7686 0.4285 0.5915 -0.0203 0.1572  -0.0811 44  C   R "C4'" 
1538 O "O4'" . C   B 37 ? 0.7388 0.4149 0.5671 -0.0125 0.1403  -0.0617 44  C   R "O4'" 
1539 C "C3'" . C   B 37 ? 0.7675 0.4348 0.5825 -0.0193 0.1670  -0.0880 44  C   R "C3'" 
1540 O "O3'" . C   B 37 ? 0.7814 0.4328 0.5975 -0.0221 0.1886  -0.1079 44  C   R "O3'" 
1541 C "C2'" . C   B 37 ? 0.7474 0.4215 0.5840 0.0027  0.1644  -0.0718 44  C   R "C2'" 
1542 O "O2'" . C   B 37 ? 0.7568 0.4159 0.6172 0.0189  0.1760  -0.0703 44  C   R "O2'" 
1543 C "C1'" . C   B 37 ? 0.7305 0.4138 0.5675 0.0023  0.1447  -0.0559 44  C   R "C1'" 
1544 N N1    . C   B 37 ? 0.7252 0.4291 0.5536 -0.0009 0.1310  -0.0460 44  C   R N1    
1545 C C2    . C   B 37 ? 0.7087 0.4228 0.5483 0.0127  0.1310  -0.0378 44  C   R C2    
1546 O O2    . C   B 37 ? 0.7065 0.4153 0.5621 0.0275  0.1404  -0.0374 44  C   R O2    
1547 N N3    . C   B 37 ? 0.6945 0.4249 0.5288 0.0087  0.1198  -0.0296 44  C   R N3    
1548 C C4    . C   B 37 ? 0.6935 0.4302 0.5131 -0.0068 0.1087  -0.0268 44  C   R C4    
1549 N N4    . C   B 37 ? 0.6826 0.4335 0.5010 -0.0096 0.0987  -0.0167 44  C   R N4    
1550 C C5    . C   B 37 ? 0.7115 0.4409 0.5191 -0.0207 0.1066  -0.0332 44  C   R C5    
1551 C C6    . C   B 37 ? 0.7289 0.4420 0.5408 -0.0178 0.1182  -0.0439 44  C   R C6    
1552 P P     . G   B 38 ? 0.7991 0.4582 0.5934 -0.0355 0.2000  -0.1244 45  G   R P     
1553 O OP1   . G   B 38 ? 0.8252 0.4638 0.6176 -0.0446 0.2216  -0.1493 45  G   R OP1   
1554 O OP2   . G   B 38 ? 0.7959 0.4756 0.5622 -0.0521 0.1814  -0.1168 45  G   R OP2   
1555 O "O5'" . G   B 38 ? 0.7779 0.4453 0.5936 -0.0154 0.2081  -0.1167 45  G   R "O5'" 
1556 C "C5'" . G   B 38 ? 0.7630 0.4501 0.5654 -0.0203 0.2061  -0.1145 45  G   R "C5'" 
1557 C "C4'" . G   B 38 ? 0.7276 0.4290 0.5501 -0.0021 0.1945  -0.0936 45  G   R "C4'" 
1558 O "O4'" . G   B 38 ? 0.7045 0.4104 0.5239 -0.0022 0.1727  -0.0772 45  G   R "O4'" 
1559 C "C3'" . G   B 38 ? 0.7144 0.4361 0.5297 -0.0053 0.1937  -0.0901 45  G   R "C3'" 
1560 O "O3'" . G   B 38 ? 0.7177 0.4406 0.5545 0.0062  0.2125  -0.0973 45  G   R "O3'" 
1561 C "C2'" . G   B 38 ? 0.6773 0.4113 0.5017 0.0037  0.1730  -0.0687 45  G   R "C2'" 
1562 O "O2'" . G   B 38 ? 0.6516 0.3858 0.5054 0.0246  0.1747  -0.0608 45  G   R "O2'" 
1563 C "C1'" . G   B 38 ? 0.6802 0.4055 0.4949 -0.0032 0.1594  -0.0643 45  G   R "C1'" 
1564 N N9    . G   B 38 ? 0.6925 0.4252 0.4802 -0.0238 0.1478  -0.0633 45  G   R N9    
1565 C C8    . G   B 38 ? 0.7166 0.4423 0.4829 -0.0417 0.1486  -0.0744 45  G   R C8    
1566 N N7    . G   B 38 ? 0.7160 0.4540 0.4609 -0.0584 0.1341  -0.0674 45  G   R N7    
1567 C C5    . G   B 38 ? 0.6901 0.4416 0.4449 -0.0504 0.1245  -0.0509 45  G   R C5    
1568 C C6    . G   B 38 ? 0.6839 0.4508 0.4286 -0.0606 0.1081  -0.0354 45  G   R C6    
1569 O O6    . G   B 38 ? 0.6978 0.4715 0.4216 -0.0789 0.0970  -0.0313 45  G   R O6    
1570 N N1    . G   B 38 ? 0.6602 0.4352 0.4233 -0.0481 0.1044  -0.0232 45  G   R N1    
1571 C C2    . G   B 38 ? 0.6410 0.4128 0.4268 -0.0293 0.1136  -0.0256 45  G   R C2    
1572 N N2    . G   B 38 ? 0.6163 0.3983 0.4166 -0.0216 0.1077  -0.0145 45  G   R N2    
1573 N N3    . G   B 38 ? 0.6478 0.4077 0.4428 -0.0193 0.1271  -0.0374 45  G   R N3    
1574 C C4    . G   B 38 ? 0.6742 0.4230 0.4540 -0.0301 0.1327  -0.0496 45  G   R C4    
1575 P P     . C   B 39 ? 0.7289 0.4648 0.5532 -0.0048 0.2266  -0.1085 46  C   R P     
1576 O OP1   . C   B 39 ? 0.7287 0.4626 0.5849 0.0099  0.2483  -0.1171 46  C   R OP1   
1577 O OP2   . C   B 39 ? 0.7523 0.4849 0.5375 -0.0300 0.2284  -0.1215 46  C   R OP2   
1578 O "O5'" . C   B 39 ? 0.7084 0.4662 0.5321 -0.0034 0.2082  -0.0889 46  C   R "O5'" 
1579 C "C5'" . C   B 39 ? 0.6861 0.4548 0.5410 0.0154  0.2043  -0.0766 46  C   R "C5'" 
1580 C "C4'" . C   B 39 ? 0.6697 0.4552 0.5171 0.0106  0.1860  -0.0613 46  C   R "C4'" 
1581 O "O4'" . C   B 39 ? 0.6703 0.4489 0.4978 0.0014  0.1691  -0.0543 46  C   R "O4'" 
1582 C "C3'" . C   B 39 ? 0.6840 0.4829 0.5132 -0.0053 0.1913  -0.0640 46  C   R "C3'" 
1583 O "O3'" . C   B 39 ? 0.6804 0.4932 0.5327 0.0028  0.2028  -0.0654 46  C   R "O3'" 
1584 C "C2'" . C   B 39 ? 0.6677 0.4739 0.4864 -0.0120 0.1690  -0.0469 46  C   R "C2'" 
1585 O "O2'" . C   B 39 ? 0.6508 0.4680 0.4942 0.0004  0.1600  -0.0353 46  C   R "O2'" 
1586 C "C1'" . C   B 39 ? 0.6651 0.4563 0.4769 -0.0113 0.1576  -0.0447 46  C   R "C1'" 
1587 N N1    . C   B 39 ? 0.6793 0.4664 0.4591 -0.0314 0.1533  -0.0476 46  C   R N1    
1588 C C2    . C   B 39 ? 0.6864 0.4832 0.4523 -0.0436 0.1371  -0.0331 46  C   R C2    
1589 O O2    . C   B 39 ? 0.6702 0.4762 0.4515 -0.0375 0.1286  -0.0202 46  C   R O2    
1590 N N3    . C   B 39 ? 0.7161 0.5125 0.4533 -0.0627 0.1307  -0.0330 46  C   R N3    
1591 C C4    . C   B 39 ? 0.7322 0.5186 0.4525 -0.0710 0.1404  -0.0496 46  C   R C4    
1592 N N4    . C   B 39 ? 0.7547 0.5441 0.4452 -0.0918 0.1317  -0.0489 46  C   R N4    
1593 C C5    . C   B 39 ? 0.7361 0.5095 0.4712 -0.0589 0.1592  -0.0668 46  C   R C5    
1594 C C6    . C   B 39 ? 0.7051 0.4795 0.4708 -0.0387 0.1646  -0.0637 46  C   R C6    
1595 P P     . A   B 40 ? 0.7162 0.5306 0.5672 -0.0033 0.2301  -0.0841 47  A   R P     
1596 O OP1   . A   B 40 ? 0.7146 0.5289 0.6064 0.0174  0.2422  -0.0879 47  A   R OP1   
1597 O OP2   . A   B 40 ? 0.7399 0.5406 0.5550 -0.0216 0.2369  -0.0978 47  A   R OP2   
1598 O "O5'" . A   B 40 ? 0.7149 0.5508 0.5618 -0.0133 0.2318  -0.0786 47  A   R "O5'" 
1599 C "C5'" . A   B 40 ? 0.7370 0.5762 0.5474 -0.0344 0.2236  -0.0731 47  A   R "C5'" 
1600 C "C4'" . A   B 40 ? 0.7346 0.5929 0.5509 -0.0390 0.2184  -0.0600 47  A   R "C4'" 
1601 O "O4'" . A   B 40 ? 0.7496 0.6087 0.5324 -0.0578 0.2044  -0.0483 47  A   R "O4'" 
1602 C "C3'" . A   B 40 ? 0.7580 0.6308 0.5804 -0.0447 0.2412  -0.0693 47  A   R "C3'" 
1603 O "O3'" . A   B 40 ? 0.7460 0.6354 0.5862 -0.0433 0.2327  -0.0549 47  A   R "O3'" 
1604 C "C2'" . A   B 40 ? 0.7998 0.6708 0.5751 -0.0701 0.2472  -0.0740 47  A   R "C2'" 
1605 O "O2'" . A   B 40 ? 0.8277 0.7144 0.5971 -0.0823 0.2640  -0.0766 47  A   R "O2'" 
1606 C "C1'" . A   B 40 ? 0.7839 0.6532 0.5437 -0.0763 0.2189  -0.0524 47  A   R "C1'" 
1607 N N9    . A   B 40 ? 0.8139 0.6777 0.5296 -0.0972 0.2120  -0.0506 47  A   R N9    
1608 C C8    . A   B 40 ? 0.8465 0.7008 0.5342 -0.1080 0.2228  -0.0683 47  A   R C8    
1609 N N7    . A   B 40 ? 0.8696 0.7244 0.5189 -0.1282 0.2103  -0.0608 47  A   R N7    
1610 C C5    . A   B 40 ? 0.8481 0.7120 0.5035 -0.1291 0.1905  -0.0352 47  A   R C5    
1611 C C6    . A   B 40 ? 0.8615 0.7308 0.4926 -0.1453 0.1699  -0.0137 47  A   R C6    
1612 N N6    . A   B 40 ? 0.8981 0.7673 0.4896 -0.1652 0.1639  -0.0150 47  A   R N6    
1613 N N1    . A   B 40 ? 0.8452 0.7207 0.4965 -0.1407 0.1553  0.0092  47  A   R N1    
1614 C C2    . A   B 40 ? 0.8189 0.6960 0.5084 -0.1228 0.1607  0.0086  47  A   R C2    
1615 N N3    . A   B 40 ? 0.7993 0.6748 0.5125 -0.1073 0.1775  -0.0095 47  A   R N3    
1616 C C4    . A   B 40 ? 0.8174 0.6856 0.5131 -0.1106 0.1921  -0.0301 47  A   R C4    
1617 P P     . A   B 41 ? 0.7327 0.6392 0.6199 -0.0273 0.2399  -0.0551 48  A   R P     
1618 O OP1   . A   B 41 ? 0.7118 0.6118 0.6277 -0.0057 0.2375  -0.0586 48  A   R OP1   
1619 O OP2   . A   B 41 ? 0.7534 0.6737 0.6417 -0.0373 0.2643  -0.0648 48  A   R OP2   
1620 O "O5'" . A   B 41 ? 0.7069 0.6226 0.6009 -0.0296 0.2180  -0.0358 48  A   R "O5'" 
1621 C "C5'" . A   B 41 ? 0.6697 0.5810 0.5794 -0.0165 0.1973  -0.0267 48  A   R "C5'" 
1622 C "C4'" . A   B 41 ? 0.6703 0.5640 0.5515 -0.0226 0.1810  -0.0196 48  A   R "C4'" 
1623 O "O4'" . A   B 41 ? 0.6820 0.5784 0.5480 -0.0381 0.1711  -0.0062 48  A   R "O4'" 
1624 C "C3'" . A   B 41 ? 0.6509 0.5381 0.5482 -0.0078 0.1635  -0.0139 48  A   R "C3'" 
1625 O "O3'" . A   B 41 ? 0.6521 0.5214 0.5296 -0.0079 0.1567  -0.0146 48  A   R "O3'" 
1626 C "C2'" . A   B 41 ? 0.6366 0.5300 0.5402 -0.0134 0.1487  -0.0008 48  A   R "C2'" 
1627 O "O2'" . A   B 41 ? 0.6241 0.5080 0.5315 -0.0061 0.1320  0.0048  48  A   R "O2'" 
1628 C "C1'" . A   B 41 ? 0.6583 0.5477 0.5319 -0.0326 0.1505  0.0046  48  A   R "C1'" 
1629 N N9    . A   B 41 ? 0.6542 0.5492 0.5329 -0.0420 0.1412  0.0186  48  A   R N9    
1630 C C8    . A   B 41 ? 0.6548 0.5643 0.5559 -0.0433 0.1449  0.0211  48  A   R C8    
1631 N N7    . A   B 41 ? 0.6537 0.5623 0.5571 -0.0529 0.1353  0.0348  48  A   R N7    
1632 C C5    . A   B 41 ? 0.6502 0.5440 0.5326 -0.0571 0.1239  0.0430  48  A   R C5    
1633 C C6    . A   B 41 ? 0.6535 0.5396 0.5325 -0.0660 0.1104  0.0601  48  A   R C6    
1634 N N6    . A   B 41 ? 0.6568 0.5465 0.5532 -0.0727 0.1073  0.0716  48  A   R N6    
1635 N N1    . A   B 41 ? 0.6547 0.5295 0.5157 -0.0679 0.1003  0.0658  48  A   R N1    
1636 C C2    . A   B 41 ? 0.6593 0.5295 0.5045 -0.0625 0.1043  0.0534  48  A   R C2    
1637 N N3    . A   B 41 ? 0.6574 0.5312 0.5038 -0.0540 0.1178  0.0365  48  A   R N3    
1638 C C4    . A   B 41 ? 0.6521 0.5384 0.5183 -0.0512 0.1270  0.0327  48  A   R C4    
1639 P P     . A   B 42 ? 0.6336 0.4937 0.5259 0.0099  0.1541  -0.0186 49  A   R P     
1640 O OP1   . A   B 42 ? 0.6574 0.5067 0.5398 0.0097  0.1700  -0.0316 49  A   R OP1   
1641 O OP2   . A   B 42 ? 0.6256 0.5000 0.5493 0.0233  0.1506  -0.0152 49  A   R OP2   
1642 O "O5'" . A   B 42 ? 0.6305 0.4780 0.5105 0.0081  0.1360  -0.0100 49  A   R "O5'" 
1643 C "C5'" . A   B 42 ? 0.6139 0.4654 0.5071 0.0123  0.1212  -0.0004 49  A   R "C5'" 
1644 C "C4'" . A   B 42 ? 0.6138 0.4518 0.4957 0.0097  0.1085  0.0053  49  A   R "C4'" 
1645 O "O4'" . A   B 42 ? 0.6173 0.4455 0.5028 0.0215  0.1083  0.0014  49  A   R "O4'" 
1646 C "C3'" . A   B 42 ? 0.6295 0.4597 0.4861 -0.0049 0.1075  0.0071  49  A   R "C3'" 
1647 O "O3'" . A   B 42 ? 0.6138 0.4397 0.4715 -0.0088 0.0923  0.0183  49  A   R "O3'" 
1648 C "C2'" . A   B 42 ? 0.6424 0.4608 0.4895 -0.0012 0.1152  -0.0032 49  A   R "C2'" 
1649 O "O2'" . A   B 42 ? 0.6558 0.4646 0.4860 -0.0103 0.1072  -0.0005 49  A   R "O2'" 
1650 C "C1'" . A   B 42 ? 0.6330 0.4485 0.5007 0.0163  0.1134  -0.0039 49  A   R "C1'" 
1651 N N9    . A   B 42 ? 0.6495 0.4613 0.5248 0.0264  0.1268  -0.0132 49  A   R N9    
1652 C C8    . A   B 42 ? 0.6488 0.4714 0.5438 0.0365  0.1350  -0.0156 49  A   R C8    
1653 N N7    . A   B 42 ? 0.6572 0.4726 0.5609 0.0457  0.1465  -0.0223 49  A   R N7    
1654 C C5    . A   B 42 ? 0.6653 0.4628 0.5519 0.0403  0.1464  -0.0260 49  A   R C5    
1655 C C6    . A   B 42 ? 0.6811 0.4619 0.5684 0.0445  0.1567  -0.0339 49  A   R C6    
1656 N N6    . A   B 42 ? 0.6849 0.4635 0.5935 0.0569  0.1701  -0.0383 49  A   R N6    
1657 N N1    . A   B 42 ? 0.6920 0.4585 0.5609 0.0352  0.1528  -0.0366 49  A   R N1    
1658 C C2    . A   B 42 ? 0.6859 0.4562 0.5388 0.0238  0.1387  -0.0301 49  A   R C2    
1659 N N3    . A   B 42 ? 0.6717 0.4559 0.5244 0.0200  0.1285  -0.0211 49  A   R N3    
1660 C C4    . A   B 42 ? 0.6621 0.4587 0.5311 0.0283  0.1335  -0.0203 49  A   R C4    
1661 P P     . G   B 43 ? 0.6094 0.4405 0.4612 -0.0235 0.0845  0.0317  50  G   R P     
1662 O OP1   . G   B 43 ? 0.6322 0.4651 0.4561 -0.0383 0.0904  0.0303  50  G   R OP1   
1663 O OP2   . G   B 43 ? 0.5983 0.4229 0.4617 -0.0220 0.0701  0.0419  50  G   R OP2   
1664 O "O5'" . G   B 43 ? 0.6006 0.4435 0.4702 -0.0217 0.0887  0.0329  50  G   R "O5'" 
1665 C "C5'" . G   B 43 ? 0.5784 0.4234 0.4729 -0.0113 0.0838  0.0326  50  G   R "C5'" 
1666 C "C4'" . G   B 43 ? 0.5810 0.4271 0.4882 -0.0188 0.0757  0.0443  50  G   R "C4'" 
1667 O "O4'" . G   B 43 ? 0.5993 0.4542 0.4991 -0.0309 0.0818  0.0496  50  G   R "O4'" 
1668 C "C3'" . G   B 43 ? 0.5707 0.4210 0.5036 -0.0119 0.0730  0.0409  50  G   R "C3'" 
1669 O "O3'" . G   B 43 ? 0.5570 0.3973 0.4994 -0.0057 0.0650  0.0407  50  G   R "O3'" 
1670 C "C2'" . G   B 43 ? 0.5870 0.4415 0.5293 -0.0235 0.0723  0.0509  50  G   R "C2'" 
1671 O "O2'" . G   B 43 ? 0.6072 0.4514 0.5536 -0.0298 0.0632  0.0645  50  G   R "O2'" 
1672 C "C1'" . G   B 43 ? 0.5971 0.4592 0.5190 -0.0321 0.0818  0.0521  50  G   R "C1'" 
1673 N N9    . G   B 43 ? 0.5903 0.4664 0.5185 -0.0282 0.0933  0.0414  50  G   R N9    
1674 C C8    . G   B 43 ? 0.5900 0.4700 0.5085 -0.0221 0.1033  0.0308  50  G   R C8    
1675 N N7    . G   B 43 ? 0.5890 0.4837 0.5225 -0.0186 0.1123  0.0241  50  G   R N7    
1676 C C5    . G   B 43 ? 0.5861 0.4876 0.5382 -0.0240 0.1075  0.0298  50  G   R C5    
1677 C C6    . G   B 43 ? 0.5830 0.5022 0.5586 -0.0244 0.1123  0.0264  50  G   R C6    
1678 O O6    . G   B 43 ? 0.5824 0.5165 0.5689 -0.0190 0.1217  0.0188  50  G   R O6    
1679 N N1    . G   B 43 ? 0.5842 0.5033 0.5751 -0.0323 0.1054  0.0328  50  G   R N1    
1680 C C2    . G   B 43 ? 0.5870 0.4899 0.5739 -0.0375 0.0959  0.0423  50  G   R C2    
1681 N N2    . G   B 43 ? 0.5895 0.4926 0.5974 -0.0446 0.0921  0.0468  50  G   R N2    
1682 N N3    . G   B 43 ? 0.5893 0.4773 0.5568 -0.0360 0.0907  0.0471  50  G   R N3    
1683 C C4    . G   B 43 ? 0.5865 0.4751 0.5359 -0.0298 0.0965  0.0400  50  G   R C4    
1684 P P     . C   B 44 ? 0.5355 0.3782 0.4877 0.0066  0.0650  0.0291  51  C   R P     
1685 O OP1   . C   B 44 ? 0.5303 0.3613 0.4882 0.0100  0.0591  0.0297  51  C   R OP1   
1686 O OP2   . C   B 44 ? 0.5378 0.3866 0.4796 0.0140  0.0717  0.0224  51  C   R OP2   
1687 O "O5'" . C   B 44 ? 0.5496 0.4034 0.5213 0.0035  0.0651  0.0260  51  C   R "O5'" 
1688 C "C5'" . C   B 44 ? 0.5661 0.4143 0.5548 -0.0036 0.0611  0.0306  51  C   R "C5'" 
1689 C "C4'" . C   B 44 ? 0.5812 0.4419 0.5855 -0.0092 0.0636  0.0273  51  C   R "C4'" 
1690 O "O4'" . C   B 44 ? 0.5993 0.4701 0.5952 -0.0142 0.0700  0.0319  51  C   R "O4'" 
1691 C "C3'" . C   B 44 ? 0.5771 0.4518 0.5873 -0.0028 0.0636  0.0142  51  C   R "C3'" 
1692 O "O3'" . C   B 44 ? 0.5763 0.4455 0.5960 -0.0017 0.0593  0.0063  51  C   R "O3'" 
1693 C "C2'" . C   B 44 ? 0.5851 0.4752 0.6088 -0.0104 0.0672  0.0140  51  C   R "C2'" 
1694 O "O2'" . C   B 44 ? 0.5928 0.4793 0.6365 -0.0198 0.0655  0.0137  51  C   R "O2'" 
1695 C "C1'" . C   B 44 ? 0.5971 0.4852 0.6072 -0.0147 0.0733  0.0245  51  C   R "C1'" 
1696 N N1    . C   B 44 ? 0.5990 0.5002 0.6004 -0.0081 0.0801  0.0202  51  C   R N1    
1697 C C2    . C   B 44 ? 0.6001 0.5218 0.6174 -0.0093 0.0849  0.0159  51  C   R C2    
1698 O O2    . C   B 44 ? 0.5936 0.5223 0.6294 -0.0170 0.0830  0.0152  51  C   R O2    
1699 N N3    . C   B 44 ? 0.6086 0.5421 0.6243 -0.0018 0.0923  0.0123  51  C   R N3    
1700 C C4    . C   B 44 ? 0.6075 0.5310 0.6053 0.0057  0.0955  0.0119  51  C   R C4    
1701 N N4    . C   B 44 ? 0.6082 0.5421 0.6100 0.0132  0.1046  0.0078  51  C   R N4    
1702 C C5    . C   B 44 ? 0.6063 0.5091 0.5853 0.0056  0.0902  0.0154  51  C   R C5    
1703 C C6    . C   B 44 ? 0.6025 0.4960 0.5848 -0.0009 0.0823  0.0199  51  C   R C6    
1704 P P     . C   B 45 ? 0.5701 0.4478 0.5813 0.0075  0.0568  -0.0041 52  C   R P     
1705 O OP1   . C   B 45 ? 0.5677 0.4346 0.5836 0.0067  0.0549  -0.0117 52  C   R OP1   
1706 O OP2   . C   B 45 ? 0.5599 0.4380 0.5536 0.0167  0.0589  0.0005  52  C   R OP2   
1707 O "O5'" . C   B 45 ? 0.5667 0.4676 0.5897 0.0044  0.0556  -0.0105 52  C   R "O5'" 
1708 C "C5'" . C   B 45 ? 0.5635 0.4684 0.6052 -0.0058 0.0541  -0.0178 52  C   R "C5'" 
1709 C "C4'" . C   B 45 ? 0.5564 0.4874 0.6096 -0.0088 0.0523  -0.0219 52  C   R "C4'" 
1710 O "O4'" . C   B 45 ? 0.5469 0.4855 0.6010 -0.0072 0.0579  -0.0124 52  C   R "O4'" 
1711 C "C3'" . C   B 45 ? 0.5503 0.5000 0.5959 -0.0012 0.0461  -0.0272 52  C   R "C3'" 
1712 O "O3'" . C   B 45 ? 0.5645 0.5163 0.6105 -0.0071 0.0408  -0.0399 52  C   R "O3'" 
1713 C "C2'" . C   B 45 ? 0.5445 0.5198 0.6059 -0.0020 0.0461  -0.0247 52  C   R "C2'" 
1714 O "O2'" . C   B 45 ? 0.5505 0.5405 0.6314 -0.0140 0.0425  -0.0331 52  C   R "O2'" 
1715 C "C1'" . C   B 45 ? 0.5373 0.5017 0.5990 -0.0027 0.0560  -0.0148 52  C   R "C1'" 
1716 N N1    . C   B 45 ? 0.5288 0.4936 0.5789 0.0089  0.0610  -0.0079 52  C   R N1    
1717 C C2    . C   B 45 ? 0.5221 0.5100 0.5853 0.0148  0.0633  -0.0065 52  C   R C2    
1718 O O2    . C   B 45 ? 0.5166 0.5274 0.6006 0.0102  0.0595  -0.0098 52  C   R O2    
1719 N N3    . C   B 45 ? 0.5241 0.5091 0.5801 0.0255  0.0701  -0.0018 52  C   R N3    
1720 C C4    . C   B 45 ? 0.5221 0.4834 0.5562 0.0288  0.0737  0.0007  52  C   R C4    
1721 N N4    . C   B 45 ? 0.5186 0.4768 0.5476 0.0380  0.0817  0.0030  52  C   R N4    
1722 C C5    . C   B 45 ? 0.5218 0.4623 0.5420 0.0226  0.0698  0.0005  52  C   R C5    
1723 C C6    . C   B 45 ? 0.5251 0.4678 0.5553 0.0136  0.0641  -0.0034 52  C   R C6    
1724 P P     . U   B 46 ? 0.5709 0.5276 0.5966 -0.0002 0.0350  -0.0444 53  U   R P     
1725 O OP1   . U   B 46 ? 0.5776 0.5274 0.6022 -0.0099 0.0345  -0.0597 53  U   R OP1   
1726 O OP2   . U   B 46 ? 0.5646 0.5075 0.5739 0.0121  0.0384  -0.0340 53  U   R OP2   
1727 O "O5'" . U   B 46 ? 0.5771 0.5674 0.6094 0.0014  0.0267  -0.0426 53  U   R "O5'" 
1728 C "C5'" . U   B 46 ? 0.6062 0.6122 0.6240 0.0060  0.0182  -0.0430 53  U   R "C5'" 
1729 C "C4'" . U   B 46 ? 0.6266 0.6646 0.6586 0.0102  0.0104  -0.0353 53  U   R "C4'" 
1730 O "O4'" . U   B 46 ? 0.6260 0.6600 0.6613 0.0245  0.0162  -0.0210 53  U   R "O4'" 
1731 C "C3'" . U   B 46 ? 0.6508 0.7134 0.6717 0.0109  -0.0027 -0.0346 53  U   R "C3'" 
1732 O "O3'" . U   B 46 ? 0.6609 0.7576 0.7046 0.0093  -0.0118 -0.0307 53  U   R "O3'" 
1733 C "C2'" . U   B 46 ? 0.6518 0.7036 0.6578 0.0271  -0.0001 -0.0204 53  U   R "C2'" 
1734 O "O2'" . U   B 46 ? 0.6605 0.7374 0.6623 0.0331  -0.0120 -0.0101 53  U   R "O2'" 
1735 C "C1'" . U   B 46 ? 0.6365 0.6805 0.6612 0.0355  0.0097  -0.0118 53  U   R "C1'" 
1736 N N1    . U   B 46 ? 0.6312 0.6491 0.6430 0.0471  0.0192  -0.0039 53  U   R N1    
1737 C C2    . U   B 46 ? 0.6319 0.6536 0.6554 0.0596  0.0237  0.0074  53  U   R C2    
1738 O O2    . U   B 46 ? 0.6374 0.6834 0.6837 0.0632  0.0208  0.0125  53  U   R O2    
1739 N N3    . U   B 46 ? 0.6293 0.6254 0.6397 0.0677  0.0328  0.0119  53  U   R N3    
1740 C C4    . U   B 46 ? 0.6378 0.6079 0.6265 0.0647  0.0364  0.0076  53  U   R C4    
1741 O O4    . U   B 46 ? 0.6504 0.6009 0.6307 0.0714  0.0438  0.0120  53  U   R O4    
1742 C C5    . U   B 46 ? 0.6342 0.6030 0.6149 0.0529  0.0317  -0.0029 53  U   R C5    
1743 C C6    . U   B 46 ? 0.6327 0.6238 0.6243 0.0445  0.0241  -0.0090 53  U   R C6    
1744 P P     . C   B 47 ? 0.6855 0.8071 0.7402 -0.0090 -0.0217 -0.0453 54  C   R P     
1745 O OP1   . C   B 47 ? 0.6872 0.7843 0.7414 -0.0223 -0.0126 -0.0619 54  C   R OP1   
1746 O OP2   . C   B 47 ? 0.7063 0.8532 0.7439 -0.0114 -0.0373 -0.0445 54  C   R OP2   
1747 O "O5'" . C   B 47 ? 0.6823 0.8288 0.7738 -0.0067 -0.0224 -0.0372 54  C   R "O5'" 
1748 C "C5'" . C   B 47 ? 0.6982 0.8826 0.8112 -0.0172 -0.0353 -0.0410 54  C   R "C5'" 
1749 C "C4'" . C   B 47 ? 0.6912 0.8994 0.8396 -0.0077 -0.0343 -0.0273 54  C   R "C4'" 
1750 O "O4'" . C   B 47 ? 0.6760 0.8598 0.8350 -0.0045 -0.0156 -0.0263 54  C   R "O4'" 
1751 C "C3'" . C   B 47 ? 0.6935 0.9122 0.8435 0.0119  -0.0381 -0.0080 54  C   R "C3'" 
1752 O "O3'" . C   B 47 ? 0.7166 0.9721 0.8693 0.0108  -0.0585 -0.0013 54  C   R "O3'" 
1753 C "C2'" . C   B 47 ? 0.6759 0.9006 0.8613 0.0205  -0.0259 -0.0003 54  C   R "C2'" 
1754 O "O2'" . C   B 47 ? 0.6767 0.9419 0.8996 0.0149  -0.0346 0.0010  54  C   R "O2'" 
1755 C "C1'" . C   B 47 ? 0.6655 0.8567 0.8420 0.0117  -0.0092 -0.0116 54  C   R "C1'" 
1756 N N1    . C   B 47 ? 0.6550 0.8090 0.8093 0.0232  0.0049  -0.0068 54  C   R N1    
1757 C C2    . C   B 47 ? 0.6479 0.7993 0.8170 0.0361  0.0177  0.0024  54  C   R C2    
1758 O O2    . C   B 47 ? 0.6493 0.8283 0.8521 0.0396  0.0186  0.0073  54  C   R O2    
1759 N N3    . C   B 47 ? 0.6420 0.7610 0.7896 0.0440  0.0297  0.0048  54  C   R N3    
1760 C C4    . C   B 47 ? 0.6453 0.7370 0.7612 0.0404  0.0286  0.0002  54  C   R C4    
1761 N N4    . C   B 47 ? 0.6439 0.7069 0.7417 0.0474  0.0393  0.0030  54  C   R N4    
1762 C C5    . C   B 47 ? 0.6507 0.7440 0.7540 0.0288  0.0172  -0.0086 54  C   R C5    
1763 C C6    . C   B 47 ? 0.6525 0.7763 0.7741 0.0201  0.0062  -0.0128 54  C   R C6    
1764 P P     . C   B 48 ? 0.7272 0.9831 0.8604 0.0265  -0.0662 0.0164  55  C   R P     
1765 O OP1   . C   B 48 ? 0.7512 1.0472 0.8818 0.0192  -0.0897 0.0216  55  C   R OP1   
1766 O OP2   . C   B 48 ? 0.7241 0.9375 0.8199 0.0288  -0.0546 0.0107  55  C   R OP2   
1767 O "O5'" . C   B 48 ? 0.7196 0.9802 0.8883 0.0470  -0.0574 0.0345  55  C   R "O5'" 
1768 C "C5'" . C   B 48 ? 0.7225 1.0228 0.9370 0.0501  -0.0645 0.0436  55  C   R "C5'" 
1769 C "C4'" . C   B 48 ? 0.7195 1.0166 0.9646 0.0715  -0.0520 0.0594  55  C   R "C4'" 
1770 O "O4'" . C   B 48 ? 0.7090 0.9737 0.9548 0.0726  -0.0276 0.0490  55  C   R "O4'" 
1771 C "C3'" . C   B 48 ? 0.7266 1.0069 0.9551 0.0884  -0.0522 0.0755  55  C   R "C3'" 
1772 O "O3'" . C   B 48 ? 0.7406 1.0561 0.9810 0.0942  -0.0737 0.0948  55  C   R "O3'" 
1773 C "C2'" . C   B 48 ? 0.7193 0.9821 0.9751 0.1043  -0.0301 0.0796  55  C   R "C2'" 
1774 O "O2'" . C   B 48 ? 0.7193 1.0155 1.0282 0.1152  -0.0317 0.0924  55  C   R "O2'" 
1775 C "C1'" . C   B 48 ? 0.7101 0.9519 0.9564 0.0909  -0.0141 0.0590  55  C   R "C1'" 
1776 N N1    . C   B 48 ? 0.7125 0.9085 0.9153 0.0888  -0.0024 0.0500  55  C   R N1    
1777 C C2    . C   B 48 ? 0.7116 0.8792 0.9106 0.1024  0.0138  0.0545  55  C   R C2    
1778 O O2    . C   B 48 ? 0.7131 0.8904 0.9445 0.1166  0.0206  0.0646  55  C   R O2    
1779 N N3    . C   B 48 ? 0.7130 0.8429 0.8751 0.0993  0.0224  0.0471  55  C   R N3    
1780 C C4    . C   B 48 ? 0.7144 0.8337 0.8473 0.0851  0.0164  0.0365  55  C   R C4    
1781 N N4    . C   B 48 ? 0.7084 0.7926 0.8108 0.0834  0.0248  0.0309  55  C   R N4    
1782 C C5    . C   B 48 ? 0.7174 0.8621 0.8541 0.0717  0.0020  0.0304  55  C   R C5    
1783 C C6    . C   B 48 ? 0.7170 0.8995 0.8870 0.0732  -0.0073 0.0370  55  C   R C6    
1784 P P     . G   B 49 ? 0.7560 1.0613 0.9545 0.0966  -0.0854 0.1060  56  G   R P     
1785 O OP1   . G   B 49 ? 0.7731 1.1245 0.9877 0.0982  -0.1108 0.1265  56  G   R OP1   
1786 O OP2   . G   B 49 ? 0.7551 1.0339 0.9053 0.0800  -0.0819 0.0848  56  G   R OP2   
1787 O "O5'" . G   B 49 ? 0.7518 1.0225 0.9542 0.1176  -0.0672 0.1177  56  G   R "O5'" 
1788 C "C5'" . G   B 49 ? 0.7647 1.0501 0.9974 0.1365  -0.0725 0.1439  56  G   R "C5'" 
1789 C "C4'" . G   B 49 ? 0.7579 1.0144 1.0163 0.1539  -0.0480 0.1458  56  G   R "C4'" 
1790 O "O4'" . G   B 49 ? 0.7386 0.9726 0.9942 0.1462  -0.0276 0.1219  56  G   R "O4'" 
1791 C "C3'" . G   B 49 ? 0.7650 0.9816 0.9959 0.1634  -0.0376 0.1517  56  G   R "C3'" 
1792 O "O3'" . G   B 49 ? 0.7884 1.0183 1.0289 0.1759  -0.0509 0.1792  56  G   R "O3'" 
1793 C "C2'" . G   B 49 ? 0.7519 0.9436 1.0092 0.1733  -0.0112 0.1427  56  G   R "C2'" 
1794 O "O2'" . G   B 49 ? 0.7521 0.9655 1.0666 0.1890  -0.0077 0.1567  56  G   R "O2'" 
1795 C "C1'" . G   B 49 ? 0.7353 0.9281 0.9821 0.1560  -0.0059 0.1187  56  G   R "C1'" 
1796 N N9    . G   B 49 ? 0.7297 0.8881 0.9268 0.1436  0.0002  0.1019  56  G   R N9    
1797 C C8    . G   B 49 ? 0.7230 0.8836 0.8900 0.1256  -0.0086 0.0882  56  G   R C8    
1798 N N7    . G   B 49 ? 0.7152 0.8413 0.8467 0.1193  0.0005  0.0764  56  G   R N7    
1799 C C5    . G   B 49 ? 0.7183 0.8184 0.8533 0.1326  0.0154  0.0820  56  G   R C5    
1800 C C6    . G   B 49 ? 0.7175 0.7786 0.8252 0.1323  0.0288  0.0747  56  G   R C6    
1801 O O6    . G   B 49 ? 0.7115 0.7535 0.7879 0.1213  0.0298  0.0633  56  G   R O6    
1802 N N1    . G   B 49 ? 0.7260 0.7704 0.8491 0.1465  0.0422  0.0819  56  G   R N1    
1803 C C2    . G   B 49 ? 0.7317 0.7934 0.8951 0.1608  0.0440  0.0950  56  G   R C2    
1804 N N2    . G   B 49 ? 0.7384 0.7772 0.9143 0.1730  0.0599  0.0983  56  G   R N2    
1805 N N3    . G   B 49 ? 0.7320 0.8314 0.9245 0.1628  0.0312  0.1039  56  G   R N3    
1806 C C4    . G   B 49 ? 0.7260 0.8438 0.9009 0.1476  0.0165  0.0967  56  G   R C4    
1807 P P     . G   B 50 ? 0.8189 1.0426 1.0080 0.1687  -0.0653 0.1879  57  G   R P     
1808 O OP1   . G   B 50 ? 0.8384 1.0908 1.0488 0.1803  -0.0837 0.2208  57  G   R OP1   
1809 O OP2   . G   B 50 ? 0.8177 1.0483 0.9679 0.1463  -0.0738 0.1666  57  G   R OP2   
1810 O "O5'" . G   B 50 ? 0.8027 0.9740 0.9670 0.1743  -0.0433 0.1811  57  G   R "O5'" 
1811 C "C5'" . G   B 50 ? 0.8008 0.9549 0.9839 0.1925  -0.0354 0.2012  57  G   R "C5'" 
1812 C "C4'" . G   B 50 ? 0.7817 0.8895 0.9592 0.1964  -0.0090 0.1851  57  G   R "C4'" 
1813 O "O4'" . G   B 50 ? 0.7624 0.8632 0.9347 0.1851  0.0019  0.1578  57  G   R "O4'" 
1814 C "C3'" . G   B 50 ? 0.7848 0.8598 0.9152 0.1902  -0.0045 0.1810  57  G   R "C3'" 
1815 O "O3'" . G   B 50 ? 0.8010 0.8687 0.9361 0.2025  -0.0069 0.2062  57  G   R "O3'" 
1816 C "C2'" . G   B 50 ? 0.7673 0.8067 0.8955 0.1886  0.0189  0.1582  57  G   R "C2'" 
1817 O "O2'" . G   B 50 ? 0.7695 0.7899 0.9305 0.2037  0.0358  0.1638  57  G   R "O2'" 
1818 C "C1'" . G   B 50 ? 0.7494 0.8097 0.8898 0.1797  0.0177  0.1416  57  G   R "C1'" 
1819 N N9    . G   B 50 ? 0.7374 0.7963 0.8401 0.1614  0.0122  0.1237  57  G   R N9    
1820 C C8    . G   B 50 ? 0.7354 0.8238 0.8323 0.1493  -0.0033 0.1187  57  G   R C8    
1821 N N7    . G   B 50 ? 0.7267 0.8024 0.7913 0.1344  -0.0024 0.1009  57  G   R N7    
1822 C C5    . G   B 50 ? 0.7230 0.7610 0.7712 0.1370  0.0130  0.0952  57  G   R C5    
1823 C C6    . G   B 50 ? 0.7174 0.7290 0.7353 0.1262  0.0202  0.0793  57  G   R C6    
1824 O O6    . G   B 50 ? 0.7115 0.7254 0.7117 0.1127  0.0157  0.0663  57  G   R O6    
1825 N N1    . G   B 50 ? 0.7187 0.6985 0.7308 0.1324  0.0343  0.0794  57  G   R N1    
1826 C C2    . G   B 50 ? 0.7257 0.6972 0.7581 0.1466  0.0424  0.0911  57  G   R C2    
1827 N N2    . G   B 50 ? 0.7302 0.6697 0.7533 0.1487  0.0560  0.0871  57  G   R N2    
1828 N N3    . G   B 50 ? 0.7302 0.7235 0.7933 0.1578  0.0376  0.1059  57  G   R N3    
1829 C C4    . G   B 50 ? 0.7294 0.7566 0.7990 0.1525  0.0221  0.1081  57  G   R C4    
1830 P P     . C   B 51 ? 0.8148 0.8934 0.9105 0.1954  -0.0249 0.2228  58  C   R P     
1831 O OP1   . C   B 51 ? 0.8320 0.9295 0.9572 0.2103  -0.0363 0.2575  58  C   R OP1   
1832 O OP2   . C   B 51 ? 0.8097 0.9111 0.8740 0.1765  -0.0385 0.2069  58  C   R OP2   
1833 O "O5'" . C   B 51 ? 0.8056 0.8404 0.8674 0.1923  -0.0088 0.2144  58  C   R "O5'" 
1834 C "C5'" . C   B 51 ? 0.7824 0.7806 0.8613 0.2012  0.0130  0.2073  58  C   R "C5'" 
1835 C "C4'" . C   B 51 ? 0.7524 0.7209 0.7967 0.1885  0.0255  0.1814  58  C   R "C4'" 
1836 O "O4'" . C   B 51 ? 0.7314 0.7081 0.7760 0.1790  0.0269  0.1581  58  C   R "O4'" 
1837 C "C3'" . C   B 51 ? 0.7547 0.7233 0.7532 0.1753  0.0174  0.1793  58  C   R "C3'" 
1838 O "O3'" . C   B 51 ? 0.7667 0.7197 0.7540 0.1802  0.0198  0.1976  58  C   R "O3'" 
1839 C "C2'" . C   B 51 ? 0.7375 0.6838 0.7185 0.1641  0.0293  0.1509  58  C   R "C2'" 
1840 O "O2'" . C   B 51 ? 0.7358 0.6467 0.7177 0.1676  0.0463  0.1460  58  C   R "O2'" 
1841 C "C1'" . C   B 51 ? 0.7225 0.6842 0.7296 0.1644  0.0293  0.1396  58  C   R "C1'" 
1842 N N1    . C   B 51 ? 0.7156 0.7040 0.7092 0.1515  0.0159  0.1293  58  C   R N1    
1843 C C2    . C   B 51 ? 0.7032 0.6794 0.6706 0.1373  0.0195  0.1083  58  C   R C2    
1844 O O2    . C   B 51 ? 0.6993 0.6459 0.6554 0.1358  0.0319  0.0998  58  C   R O2    
1845 N N3    . C   B 51 ? 0.6986 0.6965 0.6569 0.1252  0.0090  0.0978  58  C   R N3    
1846 C C4    . C   B 51 ? 0.7091 0.7414 0.6808 0.1255  -0.0056 0.1068  58  C   R C4    
1847 N N4    . C   B 51 ? 0.7107 0.7627 0.6732 0.1116  -0.0150 0.0938  58  C   R N4    
1848 C C5    . C   B 51 ? 0.7204 0.7688 0.7188 0.1399  -0.0114 0.1298  58  C   R C5    
1849 C C6    . C   B 51 ? 0.7225 0.7471 0.7321 0.1531  0.0002  0.1407  58  C   R C6    
1850 P P     . C   B 52 ? 0.7777 0.7454 0.7245 0.1699  0.0069  0.2082  59  C   R P     
1851 O OP1   . C   B 52 ? 0.8011 0.7543 0.7481 0.1787  0.0103  0.2337  59  C   R OP1   
1852 O OP2   . C   B 52 ? 0.7865 0.7952 0.7301 0.1638  -0.0130 0.2115  59  C   R OP2   
1853 O "O5'" . C   B 52 ? 0.7584 0.7067 0.6717 0.1547  0.0164  0.1802  59  C   R "O5'" 
1854 C "C5'" . C   B 52 ? 0.7553 0.6672 0.6655 0.1557  0.0337  0.1724  59  C   R "C5'" 
1855 C "C4'" . C   B 52 ? 0.7403 0.6416 0.6249 0.1414  0.0393  0.1474  59  C   R "C4'" 
1856 O "O4'" . C   B 52 ? 0.7193 0.6292 0.6144 0.1367  0.0374  0.1282  59  C   R "O4'" 
1857 C "C3'" . C   B 52 ? 0.7546 0.6717 0.6044 0.1290  0.0317  0.1456  59  C   R "C3'" 
1858 O "O3'" . C   B 52 ? 0.7746 0.6785 0.6056 0.1286  0.0377  0.1580  59  C   R "O3'" 
1859 C "C2'" . C   B 52 ? 0.7340 0.6430 0.5764 0.1178  0.0374  0.1176  59  C   R "C2'" 
1860 O "O2'" . C   B 52 ? 0.7339 0.6132 0.5745 0.1166  0.0517  0.1090  59  C   R "O2'" 
1861 C "C1'" . C   B 52 ? 0.7149 0.6308 0.5856 0.1225  0.0346  0.1113  59  C   R "C1'" 
1862 N N1    . C   B 52 ? 0.7162 0.6647 0.5874 0.1169  0.0201  0.1085  59  C   R N1    
1863 C C2    . C   B 52 ? 0.7114 0.6670 0.5661 0.1026  0.0178  0.0885  59  C   R C2    
1864 O O2    . C   B 52 ? 0.6999 0.6354 0.5421 0.0959  0.0278  0.0744  59  C   R O2    
1865 N N3    . C   B 52 ? 0.7206 0.7055 0.5769 0.0961  0.0048  0.0848  59  C   R N3    
1866 C C4    . C   B 52 ? 0.7292 0.7386 0.6035 0.1036  -0.0067 0.1013  59  C   R C4    
1867 N N4    . C   B 52 ? 0.7326 0.7728 0.6093 0.0953  -0.0203 0.0965  59  C   R N4    
1868 C C5    . C   B 52 ? 0.7334 0.7368 0.6276 0.1197  -0.0046 0.1233  59  C   R C5    
1869 C C6    . C   B 52 ? 0.7271 0.6987 0.6184 0.1256  0.0094  0.1253  59  C   R C6    
1870 P P     . U   B 53 ? 0.8103 0.7383 0.6101 0.1218  0.0267  0.1738  60  U   R P     
1871 O OP1   . U   B 53 ? 0.8308 0.7402 0.6182 0.1238  0.0362  0.1901  60  U   R OP1   
1872 O OP2   . U   B 53 ? 0.8210 0.7812 0.6323 0.1264  0.0086  0.1897  60  U   R OP2   
1873 O "O5'" . U   B 53 ? 0.7998 0.7347 0.5722 0.1046  0.0280  0.1467  60  U   R "O5'" 
1874 C "C5'" . U   B 53 ? 0.7878 0.6985 0.5485 0.0982  0.0437  0.1313  60  U   R "C5'" 
1875 C "C4'" . U   B 53 ? 0.7750 0.6936 0.5220 0.0842  0.0443  0.1044  60  U   R "C4'" 
1876 O "O4'" . U   B 53 ? 0.7481 0.6805 0.5138 0.0848  0.0346  0.0950  60  U   R "O4'" 
1877 C "C3'" . U   B 53 ? 0.8109 0.7530 0.5224 0.0711  0.0383  0.1034  60  U   R "C3'" 
1878 O "O3'" . U   B 53 ? 0.8487 0.7773 0.5380 0.0657  0.0518  0.1036  60  U   R "O3'" 
1879 C "C2'" . U   B 53 ? 0.7897 0.7394 0.5024 0.0602  0.0373  0.0751  60  U   R "C2'" 
1880 O "O2'" . U   B 53 ? 0.7776 0.7058 0.4899 0.0541  0.0534  0.0541  60  U   R "O2'" 
1881 C "C1'" . U   B 53 ? 0.7495 0.6980 0.4977 0.0703  0.0310  0.0758  60  U   R "C1'" 
1882 N N1    . U   B 53 ? 0.7453 0.7247 0.4985 0.0688  0.0135  0.0799  60  U   R N1    
1883 C C2    . U   B 53 ? 0.7522 0.7487 0.4951 0.0544  0.0084  0.0594  60  U   R C2    
1884 O O2    . U   B 53 ? 0.7599 0.7462 0.4905 0.0433  0.0185  0.0376  60  U   R O2    
1885 N N3    . U   B 53 ? 0.7547 0.7815 0.5057 0.0529  -0.0086 0.0648  60  U   R N3    
1886 C C4    . U   B 53 ? 0.7525 0.7948 0.5237 0.0655  -0.0205 0.0891  60  U   R C4    
1887 O O4    . U   B 53 ? 0.7598 0.8318 0.5402 0.0623  -0.0357 0.0914  60  U   R O4    
1888 C C5    . U   B 53 ? 0.7489 0.7699 0.5317 0.0813  -0.0127 0.1093  60  U   R C5    
1889 C C6    . U   B 53 ? 0.7425 0.7332 0.5148 0.0816  0.0034  0.1035  60  U   R C6    
1890 P P     . A   B 54 ? 0.9015 0.8452 0.5574 0.0616  0.0479  0.1267  61  A   R P     
1891 O OP1   . A   B 54 ? 0.9153 0.8369 0.5591 0.0584  0.0667  0.1257  61  A   R OP1   
1892 O OP2   . A   B 54 ? 0.9061 0.8621 0.5757 0.0740  0.0328  0.1569  61  A   R OP2   
1893 O "O5'" . A   B 54 ? 0.9329 0.9053 0.5563 0.0438  0.0403  0.1101  61  A   R "O5'" 
1894 C "C5'" . A   B 54 ? 0.9544 0.9188 0.5668 0.0307  0.0543  0.0789  61  A   R "C5'" 
1895 C "C4'" . A   B 54 ? 0.9853 0.9771 0.5808 0.0164  0.0433  0.0611  61  A   R "C4'" 
1896 O "O4'" . A   B 54 ? 0.9696 0.9733 0.5934 0.0246  0.0266  0.0662  61  A   R "O4'" 
1897 C "C3'" . A   B 54 ? 1.0415 1.0630 0.5927 0.0037  0.0333  0.0733  61  A   R "C3'" 
1898 O "O3'" . A   B 54 ? 1.0805 1.1049 0.6006 -0.0154 0.0462  0.0454  61  A   R "O3'" 
1899 C "C2'" . A   B 54 ? 1.0435 1.0964 0.6015 0.0041  0.0084  0.0827  61  A   R "C2'" 
1900 O "O2'" . A   B 54 ? 1.0780 1.1604 0.6010 -0.0165 0.0000  0.0677  61  A   R "O2'" 
1901 C "C1'" . A   B 54 ? 1.0031 1.0417 0.6051 0.0129  0.0095  0.0664  61  A   R "C1'" 
1902 N N9    . A   B 54 ? 0.9979 1.0536 0.6277 0.0244  -0.0093 0.0851  61  A   R N9    
1903 C C8    . A   B 54 ? 0.9901 1.0413 0.6437 0.0427  -0.0147 0.1148  61  A   R C8    
1904 N N7    . A   B 54 ? 0.9813 1.0526 0.6612 0.0497  -0.0308 0.1246  61  A   R N7    
1905 C C5    . A   B 54 ? 0.9873 1.0781 0.6589 0.0341  -0.0374 0.1002  61  A   R C5    
1906 C C6    . A   B 54 ? 0.9838 1.1019 0.6746 0.0310  -0.0535 0.0957  61  A   R C6    
1907 N N6    . A   B 54 ? 0.9707 1.1028 0.6959 0.0452  -0.0659 0.1172  61  A   R N6    
1908 N N1    . A   B 54 ? 0.9960 1.1262 0.6723 0.0122  -0.0551 0.0674  61  A   R N1    
1909 C C2    . A   B 54 ? 1.0069 1.1224 0.6528 -0.0017 -0.0404 0.0442  61  A   R C2    
1910 N N3    . A   B 54 ? 1.0118 1.1028 0.6388 0.0003  -0.0238 0.0459  61  A   R N3    
1911 C C4    . A   B 54 ? 0.9994 1.0797 0.6401 0.0183  -0.0240 0.0751  61  A   R C4    
1912 P P     . A   B 55 ? 1.1328 1.1545 0.6120 -0.0251 0.0613  0.0514  62  A   R P     
1913 O OP1   . A   B 55 ? 1.1049 1.0924 0.6082 -0.0131 0.0808  0.0546  62  A   R OP1   
1914 O OP2   . A   B 55 ? 1.1616 1.2123 0.6089 -0.0283 0.0427  0.0829  62  A   R OP2   
1915 O "O5'" . A   B 55 ? 1.1491 1.1777 0.6012 -0.0477 0.0744  0.0120  62  A   R "O5'" 
1916 C "C5'" . A   B 55 ? 1.1359 1.1402 0.5908 -0.0525 0.1021  -0.0117 62  A   R "C5'" 
1917 C "C4'" . A   B 55 ? 1.1191 1.1207 0.5832 -0.0646 0.1117  -0.0525 62  A   R "C4'" 
1918 O "O4'" . A   B 55 ? 1.0650 1.0497 0.5804 -0.0506 0.1073  -0.0579 62  A   R "O4'" 
1919 C "C3'" . A   B 55 ? 1.1406 1.1733 0.5749 -0.0831 0.0974  -0.0673 62  A   R "C3'" 
1920 O "O3'" . A   B 55 ? 1.1756 1.2267 0.5545 -0.1041 0.1049  -0.0749 62  A   R "O3'" 
1921 C "C2'" . A   B 55 ? 1.1186 1.1369 0.5877 -0.0859 0.1060  -0.1022 62  A   R "C2'" 
1922 O "O2'" . A   B 55 ? 1.1365 1.1375 0.6044 -0.0964 0.1339  -0.1338 62  A   R "O2'" 
1923 C "C1'" . A   B 55 ? 1.0633 1.0585 0.5833 -0.0620 0.1023  -0.0846 62  A   R "C1'" 
1924 N N9    . A   B 55 ? 1.0407 1.0503 0.5789 -0.0534 0.0775  -0.0685 62  A   R N9    
1925 C C8    . A   B 55 ? 1.0308 1.0524 0.5687 -0.0410 0.0593  -0.0339 62  A   R C8    
1926 N N7    . A   B 55 ? 1.0137 1.0477 0.5748 -0.0351 0.0410  -0.0278 62  A   R N7    
1927 C C5    . A   B 55 ? 1.0075 1.0368 0.5831 -0.0451 0.0470  -0.0599 62  A   R C5    
1928 C C6    . A   B 55 ? 0.9898 1.0268 0.5924 -0.0461 0.0359  -0.0703 62  A   R C6    
1929 N N6    . A   B 55 ? 0.9720 1.0256 0.5925 -0.0363 0.0161  -0.0494 62  A   R N6    
1930 N N1    . A   B 55 ? 0.9893 1.0160 0.6032 -0.0577 0.0474  -0.1030 62  A   R N1    
1931 C C2    . A   B 55 ? 1.0060 1.0161 0.6071 -0.0667 0.0692  -0.1247 62  A   R C2    
1932 N N3    . A   B 55 ? 1.0244 1.0276 0.6006 -0.0667 0.0821  -0.1188 62  A   R N3    
1933 C C4    . A   B 55 ? 1.0242 1.0376 0.5872 -0.0560 0.0695  -0.0852 62  A   R C4    
1934 P P     . A   B 56 ? 1.2049 1.2988 0.5387 -0.1205 0.0794  -0.0653 63  A   R P     
1935 O OP1   . A   B 56 ? 1.2622 1.3719 0.5354 -0.1411 0.0897  -0.0677 63  A   R OP1   
1936 O OP2   . A   B 56 ? 1.1788 1.2848 0.5334 -0.1026 0.0519  -0.0267 63  A   R OP2   
1937 O "O5'" . A   B 56 ? 1.1874 1.2879 0.5332 -0.1343 0.0776  -0.1044 63  A   R "O5'" 
1938 C "C5'" . A   B 56 ? 1.1880 1.2724 0.5311 -0.1490 0.1045  -0.1469 63  A   R "C5'" 
1939 C "C4'" . A   B 56 ? 1.1706 1.2589 0.5360 -0.1581 0.0988  -0.1773 63  A   R "C4'" 
1940 O "O4'" . A   B 56 ? 1.1038 1.1729 0.5284 -0.1360 0.0915  -0.1675 63  A   R "O4'" 
1941 C "C3'" . A   B 56 ? 1.1967 1.3260 0.5328 -0.1733 0.0703  -0.1727 63  A   R "C3'" 
1942 O "O3'" . A   B 56 ? 1.2647 1.4157 0.5424 -0.2019 0.0769  -0.1945 63  A   R "O3'" 
1943 C "C2'" . A   B 56 ? 1.1611 1.2831 0.5436 -0.1713 0.0649  -0.1934 63  A   R "C2'" 
1944 O "O2'" . A   B 56 ? 1.1827 1.2930 0.5655 -0.1901 0.0861  -0.2395 63  A   R "O2'" 
1945 C "C1'" . A   B 56 ? 1.0946 1.1831 0.5311 -0.1425 0.0714  -0.1752 63  A   R "C1'" 
1946 N N9    . A   B 56 ? 1.0529 1.1531 0.5103 -0.1237 0.0460  -0.1377 63  A   R N9    
1947 C C8    . A   B 56 ? 1.0470 1.1512 0.4962 -0.1087 0.0369  -0.0992 63  A   R C8    
1948 N N7    . A   B 56 ? 1.0169 1.1309 0.4938 -0.0932 0.0160  -0.0730 63  A   R N7    
1949 C C5    . A   B 56 ? 0.9983 1.1163 0.5014 -0.0990 0.0104  -0.0950 63  A   R C5    
1950 C C6    . A   B 56 ? 0.9670 1.0959 0.5068 -0.0897 -0.0077 -0.0849 63  A   R C6    
1951 N N6    . A   B 56 ? 0.9447 1.0824 0.5023 -0.0713 -0.0235 -0.0499 63  A   R N6    
1952 N N1    . A   B 56 ? 0.9674 1.0972 0.5274 -0.1003 -0.0075 -0.1126 63  A   R N1    
1953 C C2    . A   B 56 ? 0.9928 1.1117 0.5389 -0.1186 0.0101  -0.1489 63  A   R C2    
1954 N N3    . A   B 56 ? 1.0213 1.1292 0.5348 -0.1282 0.0293  -0.1633 63  A   R N3    
1955 C C4    . A   B 56 ? 1.0215 1.1304 0.5135 -0.1178 0.0282  -0.1344 63  A   R C4    
1956 P P     . C   B 57 ? 1.3167 1.5147 0.5374 -0.2164 0.0489  -0.1683 64  C   R P     
1957 O OP1   . C   B 57 ? 1.3796 1.5902 0.5369 -0.2448 0.0654  -0.1918 64  C   R OP1   
1958 O OP2   . C   B 57 ? 1.2927 1.4938 0.5259 -0.1921 0.0310  -0.1165 64  C   R OP2   
1959 O "O5'" . C   B 57 ? 1.3176 1.5420 0.5536 -0.2259 0.0232  -0.1797 64  C   R "O5'" 
1960 C "C5'" . C   B 57 ? 1.3452 1.5663 0.5833 -0.2471 0.0352  -0.2282 64  C   R "C5'" 
1961 C "C4'" . C   B 57 ? 1.3294 1.5657 0.6052 -0.2453 0.0113  -0.2293 64  C   R "C4'" 
1962 O "O4'" . C   B 57 ? 1.2612 1.4689 0.5999 -0.2146 0.0119  -0.2104 64  C   R "O4'" 
1963 C "C3'" . C   B 57 ? 1.3569 1.6416 0.6123 -0.2493 -0.0269 -0.1965 64  C   R "C3'" 
1964 O "O3'" . C   B 57 ? 1.4446 1.7650 0.6463 -0.2831 -0.0355 -0.2190 64  C   R "O3'" 
1965 C "C2'" . C   B 57 ? 1.3015 1.5840 0.6188 -0.2341 -0.0417 -0.1915 64  C   R "C2'" 
1966 O "O2'" . C   B 57 ? 1.3120 1.5983 0.6398 -0.2547 -0.0393 -0.2323 64  C   R "O2'" 
1967 C "C1'" . C   B 57 ? 1.2398 1.4733 0.6028 -0.2063 -0.0188 -0.1859 64  C   R "C1'" 
1968 N N1    . C   B 57 ? 1.2056 1.4366 0.5848 -0.1785 -0.0301 -0.1380 64  C   R N1    
1969 C C2    . C   B 57 ? 1.1623 1.3978 0.5897 -0.1591 -0.0482 -0.1153 64  C   R C2    
1970 O O2    . C   B 57 ? 1.1521 1.3943 0.6072 -0.1652 -0.0550 -0.1334 64  C   R O2    
1971 N N3    . C   B 57 ? 1.1375 1.3688 0.5811 -0.1345 -0.0560 -0.0746 64  C   R N3    
1972 C C4    . C   B 57 ? 1.1511 1.3739 0.5659 -0.1292 -0.0476 -0.0552 64  C   R C4    
1973 N N4    . C   B 57 ? 1.1272 1.3440 0.5625 -0.1054 -0.0547 -0.0165 64  C   R N4    
1974 C C5    . C   B 57 ? 1.1972 1.4166 0.5623 -0.1487 -0.0298 -0.0758 64  C   R C5    
1975 C C6    . C   B 57 ? 1.2234 1.4473 0.5722 -0.1727 -0.0212 -0.1174 64  C   R C6    
1976 P P     . C   B 58 ? 1.5158 1.8849 0.6579 -0.2956 -0.0630 -0.1850 65  C   R P     
1977 O OP1   . C   B 58 ? 1.5828 1.9784 0.6639 -0.3350 -0.0604 -0.2216 65  C   R OP1   
1978 O OP2   . C   B 58 ? 1.5056 1.8599 0.6382 -0.2749 -0.0561 -0.1466 65  C   R OP2   
1979 O "O5'" . C   B 58 ? 1.5205 1.9225 0.7010 -0.2842 -0.1015 -0.1541 65  C   R "O5'" 
1980 C "C5'" . C   B 58 ? 1.5745 1.9960 0.7743 -0.3006 -0.1145 -0.1816 65  C   R "C5'" 
1981 C "C4'" . C   B 58 ? 1.5795 2.0261 0.8271 -0.2823 -0.1466 -0.1461 65  C   R "C4'" 
1982 O "O4'" . C   B 58 ? 1.5147 1.9209 0.8226 -0.2477 -0.1339 -0.1299 65  C   R "O4'" 
1983 C "C3'" . C   B 58 ? 1.6334 2.1206 0.8599 -0.2755 -0.1774 -0.0940 65  C   R "C3'" 
1984 O "O3'" . C   B 58 ? 1.7586 2.2991 0.9351 -0.3067 -0.2028 -0.0966 65  C   R "O3'" 
1985 C "C2'" . C   B 58 ? 1.5635 2.0521 0.8603 -0.2464 -0.1941 -0.0640 65  C   R "C2'" 
1986 O "O2'" . C   B 58 ? 1.5594 2.0794 0.8830 -0.2586 -0.2148 -0.0771 65  C   R "O2'" 
1987 C "C1'" . C   B 58 ? 1.4989 1.9273 0.8350 -0.2254 -0.1602 -0.0815 65  C   R "C1'" 
1988 N N1    . C   B 58 ? 1.4735 1.8730 0.8136 -0.1986 -0.1481 -0.0483 65  C   R N1    
1989 C C2    . C   B 58 ? 1.4377 1.8422 0.8185 -0.1705 -0.1641 -0.0040 65  C   R C2    
1990 O O2    . C   B 58 ? 1.4256 1.8590 0.8408 -0.1665 -0.1876 0.0086  65  C   R O2    
1991 N N3    . C   B 58 ? 1.4208 1.7973 0.8059 -0.1481 -0.1518 0.0231  65  C   R N3    
1992 C C4    . C   B 58 ? 1.4362 1.7833 0.7875 -0.1529 -0.1261 0.0094  65  C   R C4    
1993 N N4    . C   B 58 ? 1.4206 1.7416 0.7794 -0.1315 -0.1152 0.0371  65  C   R N4    
1994 C C5    . C   B 58 ? 1.4715 1.8144 0.7825 -0.1803 -0.1089 -0.0344 65  C   R C5    
1995 C C6    . C   B 58 ? 1.4884 1.8568 0.7951 -0.2023 -0.1202 -0.0624 65  C   R C6    
2203 P P     . G   B 69 ? 1.2570 1.5443 1.0264 0.0805  -0.1674 0.2928  75  G   R P     
2204 O OP1   . G   B 69 ? 1.2499 1.5098 0.9770 0.0640  -0.1480 0.2553  75  G   R OP1   
2205 O OP2   . G   B 69 ? 1.2918 1.5892 1.0535 0.0886  -0.1782 0.3362  75  G   R OP2   
2206 O "O5'" . G   B 69 ? 1.2310 1.5712 1.0106 0.0685  -0.1942 0.2902  75  G   R "O5'" 
2207 C "C5'" . G   B 69 ? 1.1490 1.4919 0.9404 0.0584  -0.1905 0.2538  75  G   R "C5'" 
2208 C "C4'" . G   B 69 ? 1.1349 1.5294 0.9084 0.0367  -0.2166 0.2489  75  G   R "C4'" 
2209 O "O4'" . G   B 69 ? 1.1723 1.5870 0.8895 0.0210  -0.2295 0.2629  75  G   R "O4'" 
2210 C "C3'" . G   B 69 ? 1.0978 1.4887 0.8558 0.0159  -0.2090 0.2033  75  G   R "C3'" 
2211 O "O3'" . G   B 69 ? 1.0352 1.4305 0.8458 0.0236  -0.2084 0.1933  75  G   R "O3'" 
2212 C "C2'" . G   B 69 ? 1.1426 1.5790 0.8567 -0.0102 -0.2326 0.2013  75  G   R "C2'" 
2213 O "O2'" . G   B 69 ? 1.1462 1.6339 0.8901 -0.0121 -0.2612 0.2188  75  G   R "O2'" 
2214 C "C1'" . G   B 69 ? 1.1816 1.6146 0.8557 -0.0079 -0.2344 0.2302  75  G   R "C1'" 
2215 N N9    . G   B 69 ? 1.1849 1.5815 0.8095 -0.0193 -0.2105 0.2051  75  G   R N9    
2216 C C8    . G   B 69 ? 1.1665 1.5158 0.7898 -0.0048 -0.1854 0.2074  75  G   R C8    
2217 N N7    . G   B 69 ? 1.1763 1.5035 0.7548 -0.0200 -0.1673 0.1813  75  G   R N7    
2218 C C5    . G   B 69 ? 1.2041 1.5640 0.7503 -0.0466 -0.1798 0.1586  75  G   R C5    
2219 C C6    . G   B 69 ? 1.2287 1.5836 0.7239 -0.0720 -0.1675 0.1236  75  G   R C6    
2220 O O6    . G   B 69 ? 1.2273 1.5480 0.6978 -0.0748 -0.1427 0.1071  75  G   R O6    
2221 N N1    . G   B 69 ? 1.2549 1.6505 0.7306 -0.0964 -0.1863 0.1064  75  G   R N1    
2222 C C2    . G   B 69 ? 1.2535 1.6916 0.7573 -0.0960 -0.2150 0.1229  75  G   R C2    
2223 N N2    . G   B 69 ? 1.2845 1.7596 0.7643 -0.1232 -0.2308 0.1014  75  G   R N2    
2224 N N3    . G   B 69 ? 1.2294 1.6740 0.7842 -0.0711 -0.2267 0.1571  75  G   R N3    
2225 C C4    . G   B 69 ? 1.2078 1.6109 0.7806 -0.0472 -0.2072 0.1727  75  G   R C4    
2226 P P     . G   B 70 ? 0.9796 1.3327 0.8019 0.0231  -0.1816 0.1558  76  G   R P     
2227 O OP1   . G   B 70 ? 0.9553 1.3189 0.8354 0.0339  -0.1834 0.1564  76  G   R OP1   
2228 O OP2   . G   B 70 ? 0.9706 1.2747 0.7768 0.0337  -0.1574 0.1542  76  G   R OP2   
2229 O "O5'" . G   B 70 ? 0.9933 1.3570 0.7749 -0.0067 -0.1838 0.1202  76  G   R "O5'" 
2230 C "C5'" . G   B 70 ? 0.9961 1.4016 0.7892 -0.0229 -0.2034 0.1101  76  G   R "C5'" 
2231 C "C4'" . G   B 70 ? 1.0295 1.4480 0.7710 -0.0530 -0.2076 0.0822  76  G   R "C4'" 
2232 O "O4'" . G   B 70 ? 1.0673 1.4868 0.7570 -0.0581 -0.2100 0.0958  76  G   R "O4'" 
2233 C "C3'" . G   B 70 ? 1.0147 1.3940 0.7441 -0.0642 -0.1824 0.0409  76  G   R "C3'" 
2234 O "O3'" . G   B 70 ? 0.9957 1.3815 0.7606 -0.0711 -0.1829 0.0199  76  G   R "O3'" 
2235 C "C2'" . G   B 70 ? 1.0637 1.4547 0.7327 -0.0902 -0.1854 0.0230  76  G   R "C2'" 
2236 O "O2'" . G   B 70 ? 1.0939 1.5270 0.7531 -0.1151 -0.2051 0.0075  76  G   R "O2'" 
2237 C "C1'" . G   B 70 ? 1.0864 1.4892 0.7296 -0.0804 -0.1957 0.0603  76  G   R "C1'" 
2238 N N9    . G   B 70 ? 1.0758 1.4341 0.6973 -0.0706 -0.1711 0.0602  76  G   R N9    
2239 C C8    . G   B 70 ? 1.0448 1.3751 0.6884 -0.0445 -0.1607 0.0855  76  G   R C8    
2240 N N7    . G   B 70 ? 1.0433 1.3377 0.6608 -0.0431 -0.1390 0.0777  76  G   R N7    
2241 C C5    . G   B 70 ? 1.0734 1.3718 0.6499 -0.0689 -0.1334 0.0451  76  G   R C5    
2242 C C6    . G   B 70 ? 1.0869 1.3576 0.6261 -0.0793 -0.1107 0.0229  76  G   R C6    
2243 O O6    . G   B 70 ? 1.0734 1.3108 0.6086 -0.0674 -0.0920 0.0294  76  G   R O6    
2244 N N1    . G   B 70 ? 1.1218 1.4071 0.6283 -0.1070 -0.1099 -0.0108 76  G   R N1    
2245 C C2    . G   B 70 ? 1.1360 1.4584 0.6442 -0.1241 -0.1299 -0.0221 76  G   R C2    
2246 N N2    . G   B 70 ? 1.1668 1.4969 0.6409 -0.1519 -0.1245 -0.0584 76  G   R N2    
2247 N N3    . G   B 70 ? 1.1231 1.4738 0.6668 -0.1149 -0.1529 -0.0002 76  G   R N3    
2248 C C4    . G   B 70 ? 1.0936 1.4301 0.6708 -0.0866 -0.1527 0.0330  76  G   R C4    
2249 P P     . U   B 71 ? 0.9615 1.3011 0.7570 -0.0621 -0.1566 -0.0008 77  U   R P     
2250 O OP1   . U   B 71 ? 0.9567 1.3129 0.7781 -0.0774 -0.1615 -0.0231 77  U   R OP1   
2251 O OP2   . U   B 71 ? 0.9258 1.2434 0.7509 -0.0340 -0.1478 0.0247  77  U   R OP2   
2252 O "O5'" . U   B 71 ? 0.9783 1.2792 0.7328 -0.0716 -0.1346 -0.0257 77  U   R "O5'" 
2253 C "C5'" . U   B 71 ? 1.0165 1.3223 0.7430 -0.0982 -0.1323 -0.0592 77  U   R "C5'" 
2254 C "C4'" . U   B 71 ? 1.0413 1.3154 0.7276 -0.1031 -0.1123 -0.0741 77  U   R "C4'" 
2255 O "O4'" . U   B 71 ? 1.0691 1.3528 0.7225 -0.0962 -0.1189 -0.0474 77  U   R "O4'" 
2256 C "C3'" . U   B 71 ? 1.0076 1.2318 0.7145 -0.0866 -0.0870 -0.0786 77  U   R "C3'" 
2257 O "O3'" . U   B 71 ? 0.9878 1.1934 0.7195 -0.0950 -0.0749 -0.1070 77  U   R "O3'" 
2258 C "C2'" . U   B 71 ? 1.0366 1.2440 0.7001 -0.0898 -0.0741 -0.0817 77  U   R "C2'" 
2259 O "O2'" . U   B 71 ? 1.0710 1.2781 0.7043 -0.1141 -0.0653 -0.1156 77  U   R "O2'" 
2260 C "C1'" . U   B 71 ? 1.0642 1.3064 0.7053 -0.0862 -0.0955 -0.0494 77  U   R "C1'" 
2261 N N1    . U   B 71 ? 1.0450 1.2750 0.7068 -0.0590 -0.0958 -0.0137 77  U   R N1    
2262 C C2    . U   B 71 ? 1.0427 1.2403 0.6900 -0.0485 -0.0782 -0.0067 77  U   R C2    
2263 O O2    . U   B 71 ? 1.0605 1.2392 0.6802 -0.0589 -0.0616 -0.0270 77  U   R O2    
2264 N N3    . U   B 71 ? 1.0218 1.2097 0.6912 -0.0252 -0.0793 0.0242  77  U   R N3    
2265 C C4    . U   B 71 ? 1.0076 1.2136 0.7130 -0.0108 -0.0943 0.0481  77  U   R C4    
2266 O O4    . U   B 71 ? 0.9947 1.1868 0.7186 0.0092  -0.0911 0.0724  77  U   R O4    
2267 C C5    . U   B 71 ? 1.0122 1.2530 0.7328 -0.0218 -0.1118 0.0402  77  U   R C5    
2268 C C6    . U   B 71 ? 1.0299 1.2814 0.7279 -0.0454 -0.1126 0.0107  77  U   R C6    
2269 P P     . A   B 72 ? 0.9385 1.1242 0.7211 -0.0773 -0.0687 -0.0983 78  A   R P     
2270 O OP1   . A   B 72 ? 0.9356 1.1251 0.7423 -0.0925 -0.0682 -0.1224 78  A   R OP1   
2271 O OP2   . A   B 72 ? 0.9194 1.1221 0.7186 -0.0579 -0.0819 -0.0640 78  A   R OP2   
2272 O "O5'" . A   B 72 ? 0.9226 1.0605 0.7039 -0.0664 -0.0443 -0.1032 78  A   R "O5'" 
2273 C "C5'" . A   B 72 ? 0.9440 1.0616 0.7048 -0.0803 -0.0283 -0.1308 78  A   R "C5'" 
2274 C "C4'" . A   B 72 ? 0.9402 1.0296 0.6843 -0.0691 -0.0127 -0.1237 78  A   R "C4'" 
2275 O "O4'" . A   B 72 ? 0.9558 1.0645 0.6674 -0.0651 -0.0228 -0.1023 78  A   R "O4'" 
2276 C "C3'" . A   B 72 ? 0.9021 0.9636 0.6755 -0.0476 -0.0044 -0.1063 78  A   R "C3'" 
2277 O "O3'" . A   B 72 ? 0.8888 0.9227 0.6893 -0.0492 0.0098  -0.1235 78  A   R "O3'" 
2278 C "C2'" . A   B 72 ? 0.9070 0.9558 0.6545 -0.0390 0.0034  -0.0939 78  A   R "C2'" 
2279 O "O2'" . A   B 72 ? 0.9188 0.9458 0.6531 -0.0474 0.0219  -0.1152 78  A   R "O2'" 
2280 C "C1'" . A   B 72 ? 0.9334 1.0181 0.6492 -0.0457 -0.0137 -0.0820 78  A   R "C1'" 
2281 N N9    . A   B 72 ? 0.9129 1.0139 0.6408 -0.0297 -0.0290 -0.0500 78  A   R N9    
2282 C C8    . A   B 72 ? 0.9121 1.0443 0.6567 -0.0295 -0.0480 -0.0393 78  A   R C8    
2283 N N7    . A   B 72 ? 0.8990 1.0388 0.6571 -0.0122 -0.0564 -0.0098 78  A   R N7    
2284 C C5    . A   B 72 ? 0.8922 1.0027 0.6397 -0.0011 -0.0423 -0.0009 78  A   R C5    
2285 C C6    . A   B 72 ? 0.8820 0.9820 0.6370 0.0178  -0.0410 0.0262  78  A   R C6    
2286 N N6    . A   B 72 ? 0.8711 0.9888 0.6487 0.0307  -0.0536 0.0507  78  A   R N6    
2287 N N1    . A   B 72 ? 0.8838 0.9537 0.6257 0.0228  -0.0250 0.0268  78  A   R N1    
2288 C C2    . A   B 72 ? 0.8915 0.9443 0.6161 0.0109  -0.0111 0.0026  78  A   R C2    
2289 N N3    . A   B 72 ? 0.8998 0.9590 0.6178 -0.0059 -0.0097 -0.0240 78  A   R N3    
2290 C C4    . A   B 72 ? 0.8986 0.9865 0.6276 -0.0118 -0.0259 -0.0249 78  A   R C4    
2291 P P     . G   B 73 ? 0.8611 0.8826 0.7003 -0.0351 0.0094  -0.1093 79  G   R P     
2292 O OP1   . G   B 73 ? 0.8521 0.8537 0.7171 -0.0429 0.0201  -0.1284 79  G   R OP1   
2293 O OP2   . G   B 73 ? 0.8523 0.9038 0.6991 -0.0301 -0.0079 -0.0914 79  G   R OP2   
2294 O "O5'" . G   B 73 ? 0.8371 0.8340 0.6731 -0.0177 0.0188  -0.0920 79  G   R "O5'" 
2295 C "C5'" . G   B 73 ? 0.8403 0.8107 0.6711 -0.0187 0.0350  -0.1029 79  G   R "C5'" 
2296 C "C4'" . G   B 73 ? 0.8328 0.7901 0.6548 -0.0038 0.0391  -0.0833 79  G   R "C4'" 
2297 O "O4'" . G   B 73 ? 0.8509 0.8297 0.6455 -0.0019 0.0293  -0.0691 79  G   R "O4'" 
2298 C "C3'" . G   B 73 ? 0.8050 0.7532 0.6495 0.0109  0.0366  -0.0643 79  G   R "C3'" 
2299 O "O3'" . G   B 73 ? 0.7867 0.7111 0.6555 0.0120  0.0460  -0.0704 79  G   R "O3'" 
2300 C "C2'" . G   B 73 ? 0.8087 0.7515 0.6352 0.0213  0.0388  -0.0477 79  G   R "C2'" 
2301 O "O2'" . G   B 73 ? 0.8135 0.7338 0.6353 0.0208  0.0528  -0.0545 79  G   R "O2'" 
2302 C "C1'" . G   B 73 ? 0.8332 0.8032 0.6322 0.0144  0.0289  -0.0457 79  G   R "C1'" 
2303 N N9    . G   B 73 ? 0.8263 0.8198 0.6309 0.0214  0.0136  -0.0272 79  G   R N9    
2304 C C8    . G   B 73 ? 0.8320 0.8526 0.6447 0.0149  0.0003  -0.0298 79  G   R C8    
2305 N N7    . G   B 73 ? 0.8270 0.8657 0.6496 0.0250  -0.0110 -0.0091 79  G   R N7    
2306 C C5    . G   B 73 ? 0.8239 0.8440 0.6436 0.0389  -0.0041 0.0075  79  G   R C5    
2307 C C6    . G   B 73 ? 0.8229 0.8477 0.6535 0.0543  -0.0090 0.0322  79  G   R C6    
2308 O O6    . G   B 73 ? 0.8189 0.8673 0.6662 0.0599  -0.0209 0.0456  79  G   R O6    
2309 N N1    . G   B 73 ? 0.8194 0.8178 0.6439 0.0635  0.0023  0.0410  79  G   R N1    
2310 C C2    . G   B 73 ? 0.8173 0.7910 0.6281 0.0586  0.0157  0.0284  79  G   R C2    
2311 N N2    . G   B 73 ? 0.8156 0.7676 0.6244 0.0677  0.0250  0.0391  79  G   R N2    
2312 N N3    . G   B 73 ? 0.8166 0.7869 0.6198 0.0455  0.0204  0.0063  79  G   R N3    
2313 C C4    . G   B 73 ? 0.8204 0.8134 0.6280 0.0362  0.0104  -0.0034 79  G   R C4    
2314 P P     . G   B 74 ? 0.7632 0.6836 0.6577 0.0192  0.0426  -0.0591 80  G   R P     
2315 O OP1   . G   B 74 ? 0.7570 0.6535 0.6709 0.0174  0.0519  -0.0652 80  G   R OP1   
2316 O OP2   . G   B 74 ? 0.7522 0.6973 0.6540 0.0146  0.0318  -0.0595 80  G   R OP2   
2317 O "O5'" . G   B 74 ? 0.7399 0.6563 0.6273 0.0336  0.0418  -0.0387 80  G   R "O5'" 
2318 C "C5'" . G   B 74 ? 0.7262 0.6197 0.6113 0.0391  0.0510  -0.0349 80  G   R "C5'" 
2319 C "C4'" . G   B 74 ? 0.7147 0.6072 0.5906 0.0507  0.0499  -0.0176 80  G   R "C4'" 
2320 O "O4'" . G   B 74 ? 0.7307 0.6451 0.5917 0.0520  0.0417  -0.0108 80  G   R "O4'" 
2321 C "C3'" . G   B 74 ? 0.6966 0.5878 0.5876 0.0585  0.0480  -0.0070 80  G   R "C3'" 
2322 O "O3'" . G   B 74 ? 0.6749 0.5460 0.5768 0.0585  0.0544  -0.0079 80  G   R "O3'" 
2323 C "C2'" . G   B 74 ? 0.7057 0.5997 0.5868 0.0687  0.0469  0.0078  80  G   R "C2'" 
2324 O "O2'" . G   B 74 ? 0.7073 0.5813 0.5810 0.0723  0.0549  0.0117  80  G   R "O2'" 
2325 C "C1'" . G   B 74 ? 0.7240 0.6394 0.5892 0.0640  0.0393  0.0068  80  G   R "C1'" 
2326 N N9    . G   B 74 ? 0.7275 0.6687 0.6010 0.0658  0.0282  0.0132  80  G   R N9    
2327 C C8    . G   B 74 ? 0.7293 0.6919 0.6065 0.0563  0.0199  0.0037  80  G   R C8    
2328 N N7    . G   B 74 ? 0.7294 0.7155 0.6182 0.0607  0.0100  0.0139  80  G   R N7    
2329 C C5    . G   B 74 ? 0.7315 0.7094 0.6254 0.0748  0.0131  0.0311  80  G   R C5    
2330 C C6    . G   B 74 ? 0.7348 0.7284 0.6465 0.0862  0.0074  0.0481  80  G   R C6    
2331 O O6    . G   B 74 ? 0.7400 0.7614 0.6672 0.0861  -0.0031 0.0524  80  G   R O6    
2332 N N1    . G   B 74 ? 0.7292 0.7032 0.6436 0.0986  0.0157  0.0605  80  G   R N1    
2333 C C2    . G   B 74 ? 0.7249 0.6700 0.6254 0.0986  0.0267  0.0569  80  G   R C2    
2334 N N2    . G   B 74 ? 0.7229 0.6517 0.6294 0.1097  0.0340  0.0687  80  G   R N2    
2335 N N3    . G   B 74 ? 0.7238 0.6569 0.6089 0.0883  0.0309  0.0424  80  G   R N3    
2336 C C4    . G   B 74 ? 0.7276 0.6773 0.6108 0.0773  0.0243  0.0301  80  G   R C4    
2337 P P     . U   B 75 ? 0.6435 0.5166 0.5625 0.0572  0.0529  -0.0068 81  U   R P     
2338 O OP1   . U   B 75 ? 0.6360 0.4910 0.5632 0.0528  0.0574  -0.0089 81  U   R OP1   
2339 O OP2   . U   B 75 ? 0.6491 0.5429 0.5746 0.0518  0.0465  -0.0123 81  U   R OP2   
2340 O "O5'" . U   B 75 ? 0.6360 0.5103 0.5545 0.0675  0.0540  0.0049  81  U   R "O5'" 
2341 C "C5'" . U   B 75 ? 0.6324 0.4893 0.5444 0.0731  0.0599  0.0107  81  U   R "C5'" 
2342 C "C4'" . U   B 75 ? 0.6308 0.4909 0.5459 0.0829  0.0617  0.0200  81  U   R "C4'" 
2343 O "O4'" . U   B 75 ? 0.6421 0.5204 0.5554 0.0878  0.0554  0.0261  81  U   R "O4'" 
2344 C "C3'" . U   B 75 ? 0.6270 0.4939 0.5559 0.0832  0.0635  0.0195  81  U   R "C3'" 
2345 O "O3'" . U   B 75 ? 0.6211 0.4710 0.5487 0.0802  0.0706  0.0174  81  U   R "O3'" 
2346 C "C2'" . U   B 75 ? 0.6346 0.5125 0.5718 0.0943  0.0635  0.0287  81  U   R "C2'" 
2347 O "O2'" . U   B 75 ? 0.6495 0.5103 0.5859 0.1014  0.0717  0.0336  81  U   R "O2'" 
2348 C "C1'" . U   B 75 ? 0.6348 0.5253 0.5631 0.0953  0.0548  0.0330  81  U   R "C1'" 
2349 N N1    . U   B 75 ? 0.6282 0.5461 0.5648 0.0922  0.0450  0.0319  81  U   R N1    
2350 C C2    . U   B 75 ? 0.6323 0.5697 0.5848 0.1006  0.0407  0.0421  81  U   R C2    
2351 O O2    . U   B 75 ? 0.6448 0.5763 0.6065 0.1115  0.0459  0.0520  81  U   R O2    
2352 N N3    . U   B 75 ? 0.6276 0.5924 0.5887 0.0957  0.0304  0.0403  81  U   R N3    
2353 C C4    . U   B 75 ? 0.6256 0.5977 0.5799 0.0826  0.0253  0.0278  81  U   R C4    
2354 O O4    . U   B 75 ? 0.6274 0.6253 0.5913 0.0779  0.0158  0.0263  81  U   R O4    
2355 C C5    . U   B 75 ? 0.6210 0.5690 0.5603 0.0753  0.0319  0.0173  81  U   R C5    
2356 C C6    . U   B 75 ? 0.6224 0.5462 0.5543 0.0806  0.0406  0.0206  81  U   R C6    
2357 P P     . A   B 76 ? 0.6129 0.4634 0.5451 0.0701  0.0711  0.0124  82  A   R P     
2358 O OP1   . A   B 76 ? 0.6099 0.4461 0.5364 0.0679  0.0782  0.0123  82  A   R OP1   
2359 O OP2   . A   B 76 ? 0.5990 0.4488 0.5311 0.0626  0.0655  0.0086  82  A   R OP2   
2360 O "O5'" . A   B 76 ? 0.6133 0.4851 0.5598 0.0717  0.0704  0.0123  82  A   R "O5'" 
2361 C "C5'" . A   B 76 ? 0.6216 0.4966 0.5762 0.0773  0.0783  0.0140  82  A   R "C5'" 
2362 C "C4'" . A   B 76 ? 0.6249 0.5133 0.5910 0.0711  0.0810  0.0109  82  A   R "C4'" 
2363 O "O4'" . A   B 76 ? 0.6286 0.5361 0.6053 0.0685  0.0719  0.0104  82  A   R "O4'" 
2364 C "C3'" . A   B 76 ? 0.6231 0.5009 0.5798 0.0588  0.0840  0.0082  82  A   R "C3'" 
2365 O "O3'" . A   B 76 ? 0.6241 0.5045 0.5832 0.0563  0.0949  0.0060  82  A   R "O3'" 
2366 C "C2'" . A   B 76 ? 0.6232 0.5110 0.5876 0.0510  0.0760  0.0072  82  A   R "C2'" 
2367 O "O2'" . A   B 76 ? 0.6392 0.5283 0.6059 0.0404  0.0793  0.0074  82  A   R "O2'" 
2368 C "C1'" . A   B 76 ? 0.6268 0.5371 0.6076 0.0572  0.0728  0.0070  82  A   R "C1'" 
2369 N N9    . A   B 76 ? 0.6296 0.5517 0.6176 0.0514  0.0636  0.0037  82  A   R N9    
2370 C C8    . A   B 76 ? 0.6352 0.5470 0.6165 0.0447  0.0586  0.0001  82  A   R C8    
2371 N N7    . A   B 76 ? 0.6368 0.5619 0.6275 0.0390  0.0524  -0.0053 82  A   R N7    
2372 C C5    . A   B 76 ? 0.6302 0.5782 0.6348 0.0419  0.0514  -0.0037 82  A   R C5    
2373 C C6    . A   B 76 ? 0.6340 0.6067 0.6543 0.0374  0.0445  -0.0076 82  A   R C6    
2374 N N6    . A   B 76 ? 0.6449 0.6208 0.6663 0.0275  0.0383  -0.0164 82  A   R N6    
2375 N N1    . A   B 76 ? 0.6322 0.6270 0.6696 0.0427  0.0448  -0.0032 82  A   R N1    
2376 C C2    . A   B 76 ? 0.6286 0.6182 0.6671 0.0524  0.0535  0.0032  82  A   R C2    
2377 N N3    . A   B 76 ? 0.6296 0.5951 0.6518 0.0563  0.0614  0.0052  82  A   R N3    
2378 C C4    . A   B 76 ? 0.6286 0.5750 0.6336 0.0504  0.0588  0.0022  82  A   R C4    
2379 P P     . G   B 77 ? 0.6369 0.4992 0.5791 0.0533  0.1047  0.0031  83  G   R P     
2380 O OP1   . G   B 77 ? 0.6367 0.4856 0.5623 0.0436  0.0980  0.0055  83  G   R OP1   
2381 O OP2   . G   B 77 ? 0.6480 0.5174 0.5948 0.0504  0.1181  -0.0017 83  G   R OP2   
2382 O "O5'" . G   B 77 ? 0.6349 0.4884 0.5793 0.0664  0.1066  0.0037  83  G   R "O5'" 
2383 C "C5'" . G   B 77 ? 0.6350 0.4810 0.5823 0.0719  0.1198  -0.0006 83  G   R "C5'" 
2384 C "C4'" . G   B 77 ? 0.6306 0.4605 0.5741 0.0799  0.1194  0.0017  83  G   R "C4'" 
2385 O "O4'" . G   B 77 ? 0.6338 0.4452 0.5570 0.0703  0.1216  -0.0029 83  G   R "O4'" 
2386 C "C3'" . G   B 77 ? 0.6218 0.4541 0.5651 0.0853  0.1066  0.0098  83  G   R "C3'" 
2387 O "O3'" . G   B 77 ? 0.6465 0.4730 0.5982 0.0974  0.1101  0.0148  83  G   R "O3'" 
2388 C "C2'" . G   B 77 ? 0.6033 0.4214 0.5280 0.0755  0.1015  0.0084  83  G   R "C2'" 
2389 O "O2'" . G   B 77 ? 0.5994 0.4115 0.5206 0.0799  0.0954  0.0132  83  G   R "O2'" 
2390 C "C1'" . G   B 77 ? 0.6091 0.4116 0.5255 0.0716  0.1123  0.0022  83  G   R "C1'" 
2391 N N9    . G   B 77 ? 0.5934 0.3856 0.4926 0.0587  0.1096  -0.0005 83  G   R N9    
2392 C C8    . G   B 77 ? 0.5823 0.3796 0.4750 0.0483  0.1011  0.0021  83  G   R C8    
2393 N N7    . G   B 77 ? 0.5841 0.3721 0.4636 0.0380  0.0988  0.0015  83  G   R N7    
2394 C C5    . G   B 77 ? 0.5953 0.3706 0.4708 0.0407  0.1071  -0.0042 83  G   R C5    
2395 C C6    . G   B 77 ? 0.6091 0.3720 0.4715 0.0314  0.1082  -0.0086 83  G   R C6    
2396 O O6    . G   B 77 ? 0.6273 0.3903 0.4787 0.0190  0.1002  -0.0063 83  G   R O6    
2397 N N1    . G   B 77 ? 0.6151 0.3650 0.4802 0.0372  0.1191  -0.0154 83  G   R N1    
2398 C C2    . G   B 77 ? 0.6119 0.3614 0.4925 0.0516  0.1274  -0.0151 83  G   R C2    
2399 N N2    . G   B 77 ? 0.6136 0.3476 0.4987 0.0557  0.1383  -0.0206 83  G   R N2    
2400 N N3    . G   B 77 ? 0.6019 0.3657 0.4949 0.0607  0.1247  -0.0092 83  G   R N3    
2401 C C4    . G   B 77 ? 0.5969 0.3731 0.4855 0.0539  0.1146  -0.0052 83  G   R C4    
2402 P P     . C   B 78 ? 0.6565 0.4950 0.6157 0.1074  0.1001  0.0260  84  C   R P     
2403 O OP1   . C   B 78 ? 0.6502 0.5057 0.6063 0.1014  0.0885  0.0258  84  C   R OP1   
2404 O OP2   . C   B 78 ? 0.6651 0.4854 0.6149 0.1110  0.1012  0.0306  84  C   R OP2   
2405 O "O5'" . C   B 78 ? 0.6751 0.5270 0.6608 0.1193  0.1055  0.0311  84  C   R "O5'" 
2406 C "C5'" . C   B 78 ? 0.7119 0.5493 0.7101 0.1274  0.1190  0.0309  84  C   R "C5'" 
2407 C "C4'" . C   B 78 ? 0.7373 0.5929 0.7679 0.1395  0.1222  0.0377  84  C   R "C4'" 
2408 O "O4'" . C   B 78 ? 0.7366 0.6113 0.7737 0.1467  0.1068  0.0531  84  C   R "O4'" 
2409 C "C3'" . C   B 78 ? 0.7475 0.6232 0.7902 0.1346  0.1245  0.0305  84  C   R "C3'" 
2410 O "O3'" . C   B 78 ? 0.7792 0.6430 0.8219 0.1291  0.1421  0.0167  84  C   R "O3'" 
2411 C "C2'" . C   B 78 ? 0.7466 0.6461 0.8232 0.1485  0.1198  0.0436  84  C   R "C2'" 
2412 O "O2'" . C   B 78 ? 0.7609 0.6516 0.8650 0.1613  0.1341  0.0464  84  C   R "O2'" 
2413 C "C1'" . C   B 78 ? 0.7383 0.6415 0.8008 0.1509  0.1026  0.0568  84  C   R "C1'" 
2414 N N1    . C   B 78 ? 0.7238 0.6486 0.7740 0.1413  0.0865  0.0561  84  C   R N1    
2415 C C2    . C   B 78 ? 0.7244 0.6815 0.7970 0.1449  0.0758  0.0640  84  C   R C2    
2416 O O2    . C   B 78 ? 0.7388 0.7083 0.8435 0.1573  0.0788  0.0736  84  C   R O2    
2417 N N3    . C   B 78 ? 0.7110 0.6858 0.7723 0.1344  0.0624  0.0606  84  C   R N3    
2418 C C4    . C   B 78 ? 0.7058 0.6662 0.7383 0.1223  0.0607  0.0506  84  C   R C4    
2419 N N4    . C   B 78 ? 0.7085 0.6852 0.7342 0.1121  0.0493  0.0459  84  C   R N4    
2420 C C5    . C   B 78 ? 0.7093 0.6387 0.7218 0.1198  0.0706  0.0447  84  C   R C5    
2421 C C6    . C   B 78 ? 0.7171 0.6306 0.7379 0.1287  0.0825  0.0474  84  C   R C6    
2422 P P     . G   B 79 ? 0.7968 0.6779 0.8453 0.1200  0.1478  0.0077  85  G   R P     
2423 O OP1   . G   B 79 ? 0.8162 0.6804 0.8545 0.1120  0.1667  -0.0070 85  G   R OP1   
2424 O OP2   . G   B 79 ? 0.7777 0.6711 0.8107 0.1098  0.1321  0.0099  85  G   R OP2   
2425 O "O5'" . G   B 79 ? 0.7889 0.6936 0.8801 0.1344  0.1506  0.0152  85  G   R "O5'" 
2426 C "C5'" . G   B 79 ? 0.7821 0.7067 0.8941 0.1316  0.1591  0.0095  85  G   R "C5'" 
2427 C "C4'" . G   B 79 ? 0.7785 0.7294 0.9339 0.1467  0.1547  0.0217  85  G   R "C4'" 
2428 O "O4'" . G   B 79 ? 0.7757 0.7328 0.9290 0.1541  0.1344  0.0378  85  G   R "O4'" 
2429 C "C3'" . G   B 79 ? 0.7669 0.7496 0.9406 0.1413  0.1496  0.0217  85  G   R "C3'" 
2430 O "O3'" . G   B 79 ? 0.7715 0.7570 0.9616 0.1381  0.1714  0.0097  85  G   R "O3'" 
2431 C "C2'" . G   B 79 ? 0.7616 0.7705 0.9687 0.1553  0.1343  0.0392  85  G   R "C2'" 
2432 O "O2'" . G   B 79 ? 0.7683 0.7832 1.0189 0.1719  0.1460  0.0453  85  G   R "O2'" 
2433 C "C1'" . G   B 79 ? 0.7603 0.7521 0.9367 0.1565  0.1198  0.0475  85  G   R "C1'" 
2434 N N9    . G   B 79 ? 0.7420 0.7397 0.8883 0.1433  0.1025  0.0462  85  G   R N9    
2435 C C8    . G   B 79 ? 0.7346 0.7089 0.8413 0.1326  0.1002  0.0392  85  G   R C8    
2436 N N7    . G   B 79 ? 0.7247 0.7096 0.8166 0.1226  0.0857  0.0384  85  G   R N7    
2437 C C5    . G   B 79 ? 0.7188 0.7369 0.8391 0.1255  0.0768  0.0444  85  G   R C5    
2438 C C6    . G   B 79 ? 0.7104 0.7525 0.8307 0.1164  0.0607  0.0442  85  G   R C6    
2439 O O6    . G   B 79 ? 0.7048 0.7410 0.8002 0.1045  0.0528  0.0378  85  G   R O6    
2440 N N1    . G   B 79 ? 0.7054 0.7816 0.8619 0.1218  0.0545  0.0517  85  G   R N1    
2441 C C2    . G   B 79 ? 0.7089 0.7944 0.9012 0.1360  0.0638  0.0595  85  G   R C2    
2442 N N2    . G   B 79 ? 0.7074 0.8297 0.9371 0.1400  0.0551  0.0675  85  G   R N2    
2443 N N3    . G   B 79 ? 0.7199 0.7808 0.9141 0.1453  0.0809  0.0587  85  G   R N3    
2444 C C4    . G   B 79 ? 0.7270 0.7548 0.8824 0.1386  0.0862  0.0505  85  G   R C4    
2445 P P     . G   B 80 ? 0.7639 0.7504 0.9290 0.1181  0.1767  -0.0022 86  G   R P     
2446 O OP1   . G   B 80 ? 0.7836 0.7551 0.9446 0.1135  0.2029  -0.0170 86  G   R OP1   
2447 O OP2   . G   B 80 ? 0.7434 0.7182 0.8691 0.1068  0.1595  -0.0001 86  G   R OP2   
2448 O "O5'" . G   B 80 ? 0.7439 0.7679 0.9446 0.1179  0.1712  0.0025  86  G   R "O5'" 
2449 C "C5'" . G   B 80 ? 0.7217 0.7704 0.9728 0.1336  0.1727  0.0105  86  G   R "C5'" 
2450 C "C4'" . G   B 80 ? 0.6880 0.7699 0.9579 0.1335  0.1496  0.0221  86  G   R "C4'" 
2451 O "O4'" . G   B 80 ? 0.6817 0.7567 0.9256 0.1342  0.1270  0.0313  86  G   R "O4'" 
2452 C "C3'" . G   B 80 ? 0.6633 0.7587 0.9235 0.1155  0.1457  0.0159  86  G   R "C3'" 
2453 O "O3'" . G   B 80 ? 0.6527 0.7657 0.9441 0.1130  0.1640  0.0094  86  G   R "O3'" 
2454 C "C2'" . G   B 80 ? 0.6543 0.7751 0.9246 0.1164  0.1191  0.0269  86  G   R "C2'" 
2455 O "O2'" . G   B 80 ? 0.6524 0.8086 0.9728 0.1270  0.1146  0.0363  86  G   R "O2'" 
2456 C "C1'" . G   B 80 ? 0.6631 0.7623 0.9068 0.1245  0.1081  0.0341  86  G   R "C1'" 
2457 N N9    . G   B 80 ? 0.6592 0.7379 0.8576 0.1115  0.0987  0.0289  86  G   R N9    
2458 C C8    . G   B 80 ? 0.6635 0.7075 0.8256 0.1086  0.1053  0.0237  86  G   R C8    
2459 N N7    . G   B 80 ? 0.6592 0.6928 0.7914 0.0973  0.0947  0.0208  86  G   R N7    
2460 C C5    . G   B 80 ? 0.6537 0.7148 0.8009 0.0914  0.0810  0.0224  86  G   R C5    
2461 C C6    . G   B 80 ? 0.6498 0.7126 0.7805 0.0786  0.0677  0.0184  86  G   R C6    
2462 O O6    . G   B 80 ? 0.6514 0.6913 0.7528 0.0712  0.0657  0.0140  86  G   R O6    
2463 N N1    . G   B 80 ? 0.6434 0.7388 0.7984 0.0741  0.0567  0.0192  86  G   R N1    
2464 C C2    . G   B 80 ? 0.6425 0.7679 0.8358 0.0819  0.0571  0.0253  86  G   R C2    
2465 N N2    . G   B 80 ? 0.6431 0.8004 0.8572 0.0746  0.0440  0.0252  86  G   R N2    
2466 N N3    . G   B 80 ? 0.6446 0.7690 0.8573 0.0956  0.0700  0.0304  86  G   R N3    
2467 C C4    . G   B 80 ? 0.6509 0.7413 0.8380 0.0994  0.0822  0.0277  86  G   R C4    
2468 P P     . G   B 81 ? 0.6411 0.7470 0.9085 0.0927  0.1771  -0.0022 87  G   R P     
2469 O OP1   . G   B 81 ? 0.6472 0.7720 0.9504 0.0925  0.1998  -0.0086 87  G   R OP1   
2470 O OP2   . G   B 81 ? 0.6383 0.7075 0.8555 0.0855  0.1808  -0.0078 87  G   R OP2   
2471 O "O5'" . G   B 81 ? 0.6204 0.7441 0.8850 0.0809  0.1548  0.0026  87  G   R "O5'" 
2472 C "C5'" . G   B 81 ? 0.5967 0.7581 0.9032 0.0826  0.1445  0.0081  87  G   R "C5'" 
2473 C "C4'" . G   B 81 ? 0.5853 0.7518 0.8749 0.0703  0.1220  0.0097  87  G   R "C4'" 
2474 O "O4'" . G   B 81 ? 0.5801 0.7281 0.8402 0.0762  0.1062  0.0141  87  G   R "O4'" 
2475 C "C3'" . G   B 81 ? 0.5851 0.7326 0.8436 0.0513  0.1267  0.0028  87  G   R "C3'" 
2476 O "O3'" . G   B 81 ? 0.5927 0.7602 0.8756 0.0398  0.1369  -0.0003 87  G   R "O3'" 
2477 C "C2'" . G   B 81 ? 0.5762 0.7199 0.8156 0.0457  0.1035  0.0043  87  G   R "C2'" 
2478 O "O2'" . G   B 81 ? 0.5751 0.7510 0.8427 0.0404  0.0891  0.0051  87  G   R "O2'" 
2479 C "C1'" . G   B 81 ? 0.5709 0.7043 0.7988 0.0617  0.0958  0.0099  87  G   R "C1'" 
2480 N N9    . G   B 81 ? 0.5676 0.6636 0.7548 0.0615  0.1008  0.0077  87  G   R N9    
2481 C C8    . G   B 81 ? 0.5709 0.6461 0.7467 0.0700  0.1153  0.0069  87  G   R C8    
2482 N N7    . G   B 81 ? 0.5687 0.6142 0.7078 0.0660  0.1146  0.0050  87  G   R N7    
2483 C C5    . G   B 81 ? 0.5587 0.6043 0.6860 0.0555  0.0999  0.0047  87  G   R C5    
2484 C C6    . G   B 81 ? 0.5519 0.5732 0.6480 0.0481  0.0934  0.0034  87  G   R C6    
2485 O O6    . G   B 81 ? 0.5517 0.5476 0.6225 0.0490  0.0976  0.0033  87  G   R O6    
2486 N N1    . G   B 81 ? 0.5456 0.5748 0.6446 0.0384  0.0811  0.0015  87  G   R N1    
2487 C C2    . G   B 81 ? 0.5455 0.6034 0.6713 0.0345  0.0746  0.0002  87  G   R C2    
2488 N N2    . G   B 81 ? 0.5360 0.5960 0.6605 0.0233  0.0641  -0.0044 87  G   R N2    
2489 N N3    . G   B 81 ? 0.5494 0.6328 0.7045 0.0409  0.0787  0.0027  87  G   R N3    
2490 C C4    . G   B 81 ? 0.5561 0.6315 0.7114 0.0520  0.0918  0.0052  87  G   R C4    
2491 P P     . G   B 82 ? 0.6067 0.7534 0.8624 0.0226  0.1528  -0.0049 88  G   R P     
2492 O OP1   . G   B 82 ? 0.6091 0.7817 0.8982 0.0136  0.1661  -0.0068 88  G   R OP1   
2493 O OP2   . G   B 82 ? 0.6113 0.7281 0.8338 0.0271  0.1655  -0.0073 88  G   R OP2   
2494 O "O5'" . G   B 82 ? 0.5978 0.7305 0.8294 0.0100  0.1345  -0.0037 88  G   R "O5'" 
2495 C "C5'" . G   B 82 ? 0.5873 0.7426 0.8428 0.0018  0.1205  -0.0043 88  G   R "C5'" 
2496 C "C4'" . G   B 82 ? 0.5795 0.7143 0.8097 -0.0080 0.1062  -0.0056 88  G   R "C4'" 
2497 O "O4'" . G   B 82 ? 0.5729 0.6911 0.7785 0.0031  0.0948  -0.0049 88  G   R "O4'" 
2498 C "C3'" . G   B 82 ? 0.5868 0.6933 0.7907 -0.0203 0.1163  -0.0037 88  G   R "C3'" 
2499 O "O3'" . G   B 82 ? 0.5987 0.7168 0.8226 -0.0359 0.1224  -0.0034 88  G   R "O3'" 
2500 C "C2'" . G   B 82 ? 0.5786 0.6609 0.7570 -0.0208 0.1018  -0.0044 88  G   R "C2'" 
2501 O "O2'" . G   B 82 ? 0.5808 0.6692 0.7727 -0.0316 0.0905  -0.0089 88  G   R "O2'" 
2502 C "C1'" . G   B 82 ? 0.5706 0.6566 0.7437 -0.0036 0.0935  -0.0051 88  G   R "C1'" 
2503 N N9    . G   B 82 ? 0.5692 0.6322 0.7157 0.0051  0.1020  -0.0021 88  G   R N9    
2504 C C8    . G   B 82 ? 0.5735 0.6403 0.7238 0.0156  0.1144  -0.0014 88  G   R C8    
2505 N N7    . G   B 82 ? 0.5734 0.6151 0.6952 0.0195  0.1201  -0.0007 88  G   R N7    
2506 C C5    . G   B 82 ? 0.5710 0.5926 0.6703 0.0119  0.1100  0.0006  88  G   R C5    
2507 C C6    . G   B 82 ? 0.5752 0.5687 0.6431 0.0114  0.1092  0.0026  88  G   R C6    
2508 O O6    . G   B 82 ? 0.5892 0.5694 0.6397 0.0164  0.1171  0.0024  88  G   R O6    
2509 N N1    . G   B 82 ? 0.5647 0.5457 0.6247 0.0036  0.0985  0.0043  88  G   R N1    
2510 C C2    . G   B 82 ? 0.5605 0.5525 0.6389 -0.0037 0.0907  0.0021  88  G   R C2    
2511 N N2    . G   B 82 ? 0.5553 0.5306 0.6267 -0.0102 0.0833  0.0024  88  G   R N2    
2512 N N3    . G   B 82 ? 0.5645 0.5828 0.6695 -0.0050 0.0907  -0.0009 88  G   R N3    
2513 C C4    . G   B 82 ? 0.5674 0.6004 0.6822 0.0034  0.1000  -0.0005 88  G   R C4    
2514 P P     . U   B 83 ? 0.6213 0.7307 0.8353 -0.0461 0.1436  0.0015  89  U   R P     
2515 O OP1   . U   B 83 ? 0.6199 0.7479 0.8630 -0.0613 0.1491  0.0021  89  U   R OP1   
2516 O OP2   . U   B 83 ? 0.6195 0.7309 0.8267 -0.0345 0.1579  0.0000  89  U   R OP2   
2517 O "O5'" . U   B 83 ? 0.6238 0.6972 0.8000 -0.0525 0.1389  0.0074  89  U   R "O5'" 
2518 C "C5'" . U   B 83 ? 0.6217 0.6851 0.8027 -0.0635 0.1281  0.0090  89  U   R "C5'" 
2519 C "C4'" . U   B 83 ? 0.6180 0.6486 0.7682 -0.0633 0.1211  0.0145  89  U   R "C4'" 
2520 O "O4'" . U   B 83 ? 0.6051 0.6293 0.7398 -0.0478 0.1125  0.0095  89  U   R "O4'" 
2521 C "C3'" . U   B 83 ? 0.6272 0.6406 0.7495 -0.0693 0.1319  0.0256  89  U   R "C3'" 
2522 O "O3'" . U   B 83 ? 0.6354 0.6443 0.7650 -0.0859 0.1365  0.0354  89  U   R "O3'" 
2523 C "C2'" . U   B 83 ? 0.6219 0.6102 0.7193 -0.0620 0.1209  0.0277  89  U   R "C2'" 
2524 O "O2'" . U   B 83 ? 0.6261 0.5989 0.7308 -0.0690 0.1115  0.0318  89  U   R "O2'" 
2525 C "C1'" . U   B 83 ? 0.6092 0.6077 0.7122 -0.0462 0.1136  0.0162  89  U   R "C1'" 
2526 N N1    . U   B 83 ? 0.6125 0.6123 0.6990 -0.0351 0.1216  0.0143  89  U   R N1    
2527 C C2    . U   B 83 ? 0.6169 0.5950 0.6749 -0.0297 0.1185  0.0166  89  U   R C2    
2528 O O2    . U   B 83 ? 0.6228 0.5826 0.6700 -0.0325 0.1093  0.0212  89  U   R O2    
2529 N N3    . U   B 83 ? 0.6230 0.6018 0.6690 -0.0210 0.1275  0.0129  89  U   R N3    
2530 C C4    . U   B 83 ? 0.6225 0.6203 0.6842 -0.0159 0.1402  0.0072  89  U   R C4    
2531 O O4    . U   B 83 ? 0.6261 0.6195 0.6774 -0.0080 0.1491  0.0030  89  U   R O4    
2532 C C5    . U   B 83 ? 0.6140 0.6359 0.7075 -0.0210 0.1425  0.0063  89  U   R C5    
2533 C C6    . U   B 83 ? 0.6123 0.6345 0.7155 -0.0308 0.1328  0.0096  89  U   R C6    
2534 P P     . U   B 84 ? 0.6554 0.6613 0.7642 -0.0978 0.1521  0.0478  90  U   R P     
2535 O OP1   . U   B 84 ? 0.6642 0.6702 0.7909 -0.1148 0.1556  0.0582  90  U   R OP1   
2536 O OP2   . U   B 84 ? 0.6623 0.6863 0.7672 -0.0921 0.1668  0.0397  90  U   R OP2   
2537 O "O5'" . U   B 84 ? 0.6413 0.6205 0.7141 -0.0957 0.1445  0.0571  90  U   R "O5'" 
2538 C "C5'" . U   B 84 ? 0.6295 0.5889 0.7039 -0.1027 0.1342  0.0696  90  U   R "C5'" 
2539 C "C4'" . U   B 84 ? 0.6208 0.5596 0.6655 -0.0985 0.1258  0.0776  90  U   R "C4'" 
2540 O "O4'" . U   B 84 ? 0.5973 0.5344 0.6364 -0.0821 0.1191  0.0638  90  U   R "O4'" 
2541 C "C3'" . U   B 84 ? 0.6336 0.5723 0.6427 -0.1056 0.1344  0.0864  90  U   R "C3'" 
2542 O "O3'" . U   B 84 ? 0.6522 0.5867 0.6560 -0.1224 0.1369  0.1063  90  U   R "O3'" 
2543 C "C2'" . U   B 84 ? 0.6269 0.5494 0.6150 -0.0963 0.1228  0.0866  90  U   R "C2'" 
2544 O "O2'" . U   B 84 ? 0.6336 0.5387 0.6245 -0.1006 0.1102  0.1029  90  U   R "O2'" 
2545 C "C1'" . U   B 84 ? 0.5993 0.5258 0.6056 -0.0797 0.1184  0.0682  90  U   R "C1'" 
2546 N N1    . U   B 84 ? 0.5953 0.5332 0.5895 -0.0709 0.1282  0.0547  90  U   R N1    
2547 C C2    . U   B 84 ? 0.5945 0.5220 0.5613 -0.0655 0.1270  0.0526  90  U   R C2    
2548 O O2    . U   B 84 ? 0.5883 0.5001 0.5399 -0.0674 0.1170  0.0614  90  U   R O2    
2549 N N3    . U   B 84 ? 0.5957 0.5322 0.5574 -0.0577 0.1383  0.0396  90  U   R N3    
2550 C C4    . U   B 84 ? 0.5905 0.5465 0.5736 -0.0537 0.1501  0.0301  90  U   R C4    
2551 O O4    . U   B 84 ? 0.5953 0.5564 0.5761 -0.0455 0.1604  0.0196  90  U   R O4    
2552 C C5    . U   B 84 ? 0.5890 0.5580 0.5999 -0.0601 0.1494  0.0336  90  U   R C5    
2553 C C6    . U   B 84 ? 0.5932 0.5519 0.6072 -0.0688 0.1391  0.0448  90  U   R C6    
2554 P P     . A   B 85 ? 0.6770 0.6225 0.6504 -0.1367 0.1531  0.1130  91  A   R P     
2555 O OP1   . A   B 85 ? 0.6999 0.6419 0.6756 -0.1543 0.1538  0.1362  91  A   R OP1   
2556 O OP2   . A   B 85 ? 0.6697 0.6353 0.6514 -0.1316 0.1692  0.0936  91  A   R OP2   
2557 O "O5'" . A   B 85 ? 0.6892 0.6244 0.6216 -0.1347 0.1473  0.1152  91  A   R "O5'" 
2558 C "C5'" . A   B 85 ? 0.7013 0.6199 0.6226 -0.1383 0.1309  0.1341  91  A   R "C5'" 
2559 C "C4'" . A   B 85 ? 0.7056 0.6181 0.5942 -0.1336 0.1251  0.1294  91  A   R "C4'" 
2560 O "O4'" . A   B 85 ? 0.6796 0.5910 0.5792 -0.1151 0.1246  0.1072  91  A   R "O4'" 
2561 C "C3'" . A   B 85 ? 0.7323 0.6544 0.5796 -0.1455 0.1387  0.1257  91  A   R "C3'" 
2562 O "O3'" . A   B 85 ? 0.7573 0.6793 0.5799 -0.1647 0.1347  0.1500  91  A   R "O3'" 
2563 C "C2'" . A   B 85 ? 0.7280 0.6425 0.5585 -0.1345 0.1330  0.1119  91  A   R "C2'" 
2564 O "O2'" . A   B 85 ? 0.7448 0.6480 0.5625 -0.1375 0.1145  0.1279  91  A   R "O2'" 
2565 C "C1'" . A   B 85 ? 0.6881 0.6001 0.5557 -0.1141 0.1301  0.0967  91  A   R "C1'" 
2566 N N9    . A   B 85 ? 0.6808 0.6046 0.5555 -0.1062 0.1469  0.0754  91  A   R N9    
2567 C C8    . A   B 85 ? 0.6721 0.6102 0.5743 -0.1046 0.1577  0.0694  91  A   R C8    
2568 N N7    . A   B 85 ? 0.6682 0.6164 0.5765 -0.0958 0.1714  0.0514  91  A   R N7    
2569 C C5    . A   B 85 ? 0.6710 0.6086 0.5529 -0.0915 0.1707  0.0441  91  A   R C5    
2570 C C6    . A   B 85 ? 0.6681 0.6066 0.5455 -0.0820 0.1828  0.0259  91  A   R C6    
2571 N N6    . A   B 85 ? 0.6575 0.6102 0.5600 -0.0735 0.1979  0.0130  91  A   R N6    
2572 N N1    . A   B 85 ? 0.6814 0.6059 0.5315 -0.0815 0.1790  0.0219  91  A   R N1    
2573 C C2    . A   B 85 ? 0.6897 0.6030 0.5189 -0.0900 0.1628  0.0363  91  A   R C2    
2574 N N3    . A   B 85 ? 0.6860 0.5982 0.5193 -0.0981 0.1498  0.0556  91  A   R N3    
2575 C C4    . A   B 85 ? 0.6807 0.6041 0.5406 -0.0985 0.1552  0.0582  91  A   R C4    
2576 P P     . C   B 86 ? 0.7974 0.7319 0.5736 -0.1845 0.1508  0.1504  92  C   R P     
2577 O OP1   . C   B 86 ? 0.8274 0.7648 0.5951 -0.2038 0.1477  0.1798  92  C   R OP1   
2578 O OP2   . C   B 86 ? 0.7870 0.7335 0.5667 -0.1799 0.1742  0.1240  92  C   R OP2   
2579 O "O5'" . C   B 86 ? 0.8177 0.7456 0.5577 -0.1856 0.1396  0.1480  92  C   R "O5'" 
2580 C "C5'" . C   B 86 ? 0.8421 0.7624 0.5729 -0.1916 0.1170  0.1730  92  C   R "C5'" 
2581 C "C4'" . C   B 86 ? 0.8718 0.7927 0.5600 -0.1987 0.1123  0.1666  92  C   R "C4'" 
2582 O "O4'" . C   B 86 ? 0.8444 0.7574 0.5457 -0.1795 0.1140  0.1407  92  C   R "O4'" 
2583 C "C3'" . C   B 86 ? 0.9239 0.8576 0.5656 -0.2175 0.1321  0.1553  92  C   R "C3'" 
2584 O "O3'" . C   B 86 ? 0.9765 0.9191 0.5853 -0.2416 0.1263  0.1824  92  C   R "O3'" 
2585 C "C2'" . C   B 86 ? 0.9292 0.8583 0.5472 -0.2141 0.1316  0.1335  92  C   R "C2'" 
2586 O "O2'" . C   B 86 ? 0.9640 0.8940 0.5501 -0.2281 0.1122  0.1500  92  C   R "O2'" 
2587 C "C1'" . C   B 86 ? 0.8747 0.7912 0.5377 -0.1870 0.1253  0.1212  92  C   R "C1'" 
2588 N N1    . C   B 86 ? 0.8623 0.7796 0.5406 -0.1735 0.1475  0.0915  92  C   R N1    
2589 C C2    . C   B 86 ? 0.8740 0.7869 0.5356 -0.1696 0.1569  0.0669  92  C   R C2    
2590 O O2    . C   B 86 ? 0.8964 0.8050 0.5285 -0.1784 0.1469  0.0679  92  C   R O2    
2591 N N3    . C   B 86 ? 0.8613 0.7750 0.5426 -0.1561 0.1767  0.0431  92  C   R N3    
2592 C C4    . C   B 86 ? 0.8409 0.7624 0.5558 -0.1477 0.1856  0.0431  92  C   R C4    
2593 N N4    . C   B 86 ? 0.8306 0.7553 0.5680 -0.1341 0.2033  0.0218  92  C   R N4    
2594 C C5    . C   B 86 ? 0.8313 0.7580 0.5615 -0.1530 0.1763  0.0657  92  C   R C5    
2595 C C6    . C   B 86 ? 0.8418 0.7648 0.5534 -0.1655 0.1583  0.0891  92  C   R C6    
2596 P P     . C   B 87 ? 1.0281 0.9863 0.5943 -0.2646 0.1510  0.1762  93  C   R P     
2597 O OP1   . C   B 87 ? 1.0706 1.0373 0.6049 -0.2887 0.1389  0.2109  93  C   R OP1   
2598 O OP2   . C   B 87 ? 1.0093 0.9709 0.6079 -0.2549 0.1741  0.1599  93  C   R OP2   
2599 O "O5'" . C   B 87 ? 1.0471 1.0063 0.5743 -0.2686 0.1614  0.1457  93  C   R "O5'" 
2600 C "C5'" . C   B 87 ? 1.0869 1.0496 0.5665 -0.2866 0.1473  0.1532  93  C   R "C5'" 
2601 C "C4'" . C   B 87 ? 1.1000 1.0608 0.5522 -0.2881 0.1635  0.1167  93  C   R "C4'" 
2602 O "O4'" . C   B 87 ? 1.0509 0.9980 0.5475 -0.2598 0.1679  0.0938  93  C   R "O4'" 
2603 C "C3'" . C   B 87 ? 1.1381 1.1089 0.5615 -0.3026 0.1975  0.0935  93  C   R "C3'" 
2604 O "O3'" . C   B 87 ? 1.2075 1.1919 0.5701 -0.3345 0.1975  0.1044  93  C   R "O3'" 
2605 C "C2'" . C   B 87 ? 1.1217 1.0824 0.5514 -0.2893 0.2137  0.0544  93  C   R "C2'" 
2606 O "O2'" . C   B 87 ? 1.1564 1.1153 0.5425 -0.3041 0.2076  0.0432  93  C   R "O2'" 
2607 C "C1'" . C   B 87 ? 1.0567 1.0035 0.5431 -0.2588 0.1967  0.0584  93  C   R "C1'" 
2608 N N1    . C   B 87 ? 1.0156 0.9606 0.5521 -0.2366 0.2140  0.0451  93  C   R N1    
2609 C C2    . C   B 87 ? 1.0081 0.9495 0.5562 -0.2255 0.2385  0.0120  93  C   R C2    
2610 O O2    . C   B 87 ? 1.0385 0.9755 0.5556 -0.2343 0.2486  -0.0088 93  C   R O2    
2611 N N3    . C   B 87 ? 0.9696 0.9128 0.5658 -0.2056 0.2509  0.0037  93  C   R N3    
2612 C C4    . C   B 87 ? 0.9416 0.8896 0.5706 -0.1982 0.2402  0.0239  93  C   R C4    
2613 N N4    . C   B 87 ? 0.9054 0.8579 0.5804 -0.1803 0.2513  0.0144  93  C   R N4    
2614 C C5    . C   B 87 ? 0.9520 0.9007 0.5704 -0.2093 0.2175  0.0552  93  C   R C5    
2615 C C6    . C   B 87 ? 0.9865 0.9338 0.5604 -0.2273 0.2050  0.0659  93  C   R C6    
2616 P P     . G   B 88 ? 1.2575 1.2579 0.5983 -0.3552 0.2175  0.1164  94  G   R P     
2617 O OP1   . G   B 88 ? 1.3148 1.3291 0.5922 -0.3879 0.2059  0.1381  94  G   R OP1   
2618 O OP2   . G   B 88 ? 1.2175 1.2147 0.6136 -0.3381 0.2138  0.1359  94  G   R OP2   
2619 O "O5'" . G   B 88 ? 1.2771 1.2797 0.6098 -0.3560 0.2581  0.0732  94  G   R "O5'" 
2620 C "C5'" . G   B 88 ? 1.3190 1.3186 0.6146 -0.3652 0.2693  0.0415  94  G   R "C5'" 
2621 C "C4'" . G   B 88 ? 1.3201 1.3151 0.6411 -0.3515 0.3057  0.0017  94  G   R "C4'" 
2622 O "O4'" . G   B 88 ? 1.2511 1.2347 0.6413 -0.3170 0.2991  0.0010  94  G   R "O4'" 
2623 C "C3'" . G   B 88 ? 1.3632 1.3735 0.6753 -0.3655 0.3389  -0.0044 94  G   R "C3'" 
2624 O "O3'" . G   B 88 ? 1.4293 1.4407 0.7147 -0.3765 0.3738  -0.0440 94  G   R "O3'" 
2625 C "C2'" . G   B 88 ? 1.2972 1.3054 0.6813 -0.3369 0.3430  -0.0006 94  G   R "C2'" 
2626 O "O2'" . G   B 88 ? 1.3047 1.3224 0.7061 -0.3364 0.3805  -0.0230 94  G   R "O2'" 
2627 C "C1'" . G   B 88 ? 1.2448 1.2349 0.6664 -0.3087 0.3298  -0.0154 94  G   R "C1'" 
2628 N N9    . G   B 88 ? 1.1827 1.1694 0.6703 -0.2805 0.3207  -0.0057 94  G   R N9    
2629 C C8    . G   B 88 ? 1.1624 1.1525 0.6738 -0.2769 0.3009  0.0259  94  G   R C8    
2630 N N7    . G   B 88 ? 1.1076 1.0946 0.6770 -0.2519 0.2976  0.0247  94  G   R N7    
2631 C C5    . G   B 88 ? 1.0943 1.0764 0.6803 -0.2368 0.3153  -0.0070 94  G   R C5    
2632 C C6    . G   B 88 ? 1.0502 1.0297 0.6930 -0.2091 0.3189  -0.0198 94  G   R C6    
2633 O O6    . G   B 88 ? 1.0117 0.9936 0.6986 -0.1936 0.3065  -0.0074 94  G   R O6    
2634 N N1    . G   B 88 ? 1.0561 1.0298 0.7020 -0.2006 0.3387  -0.0499 94  G   R N1    
2635 C C2    . G   B 88 ? 1.0970 1.0664 0.6963 -0.2180 0.3549  -0.0688 94  G   R C2    
2636 N N2    . G   B 88 ? 1.0935 1.0549 0.7083 -0.2061 0.3748  -0.0980 94  G   R N2    
2637 N N3    . G   B 88 ? 1.1423 1.1156 0.6842 -0.2459 0.3517  -0.0594 94  G   R N3    
2638 C C4    . G   B 88 ? 1.1389 1.1192 0.6775 -0.2535 0.3308  -0.0266 94  G   R C4    
2639 P P     . A   B 89 ? 1.5318 1.5561 0.7342 -0.4173 0.3883  -0.0525 95  A   R P     
2640 O OP1   . A   B 89 ? 1.5469 1.5771 0.7074 -0.4358 0.3506  -0.0155 95  A   R OP1   
2641 O OP2   . A   B 89 ? 1.5632 1.6023 0.7588 -0.4305 0.4267  -0.0637 95  A   R OP2   
2642 O "O5'" . A   B 89 ? 1.5672 1.5776 0.7556 -0.4165 0.4039  -0.0964 95  A   R "O5'" 
2643 C "C5'" . A   B 89 ? 1.5700 1.5679 0.8124 -0.3900 0.4298  -0.1293 95  A   R "C5'" 
2644 C "C4'" . A   B 89 ? 1.6347 1.6220 0.8470 -0.4011 0.4526  -0.1719 95  A   R "C4'" 
2645 O "O4'" . A   B 89 ? 1.5948 1.5606 0.8486 -0.3740 0.4397  -0.1835 95  A   R "O4'" 
2646 C "C3'" . A   B 89 ? 1.6838 1.6740 0.9033 -0.4049 0.5032  -0.2101 95  A   R "C3'" 
2647 O "O3'" . A   B 89 ? 1.7881 1.7823 0.9351 -0.4407 0.5210  -0.2343 95  A   R "O3'" 
2648 C "C2'" . A   B 89 ? 1.6365 1.6064 0.9226 -0.3705 0.5143  -0.2354 95  A   R "C2'" 
2649 O "O2'" . A   B 89 ? 1.6751 1.6377 0.9581 -0.3766 0.5570  -0.2806 95  A   R "O2'" 
2650 C "C1'" . A   B 89 ? 1.6089 1.5629 0.8883 -0.3637 0.4765  -0.2251 95  A   R "C1'" 
2651 N N9    . A   B 89 ? 1.5480 1.4851 0.8962 -0.3259 0.4652  -0.2243 95  A   R N9    
2652 C C8    . A   B 89 ? 1.5408 1.4566 0.9114 -0.3117 0.4741  -0.2517 95  A   R C8    
2653 N N7    . A   B 89 ? 1.4777 1.3831 0.9095 -0.2781 0.4596  -0.2412 95  A   R N7    
2654 C C5    . A   B 89 ? 1.4434 1.3641 0.8938 -0.2703 0.4402  -0.2071 95  A   R C5    
2655 C C6    . A   B 89 ? 1.3816 1.3023 0.8885 -0.2410 0.4193  -0.1836 95  A   R C6    
2656 N N6    . A   B 89 ? 1.3489 1.2542 0.9028 -0.2132 0.4134  -0.1891 95  A   R N6    
2657 N N1    . A   B 89 ? 1.3632 1.3001 0.8753 -0.2428 0.4048  -0.1541 95  A   R N1    
2658 C C2    . A   B 89 ? 1.4059 1.3579 0.8708 -0.2711 0.4106  -0.1456 95  A   R C2    
2659 N N3    . A   B 89 ? 1.4693 1.4247 0.8762 -0.3004 0.4291  -0.1635 95  A   R N3    
2660 C C4    . A   B 89 ? 1.4858 1.4251 0.8877 -0.2988 0.4435  -0.1957 95  A   R C4    
2661 P P     . U   B 90 ? 1.8812 1.8947 0.9852 -0.4709 0.5619  -0.2500 96  U   R P     
2662 O OP1   . U   B 90 ? 1.8872 1.8916 1.0360 -0.4555 0.6079  -0.2931 96  U   R OP1   
2663 O OP2   . U   B 90 ? 1.9516 1.9746 0.9642 -0.5128 0.5547  -0.2512 96  U   R OP2   
2664 O "O5'" . U   B 90 ? 1.8705 1.9027 0.9970 -0.4663 0.5522  -0.2085 96  U   R "O5'" 
2665 C "C5'" . U   B 90 ? 1.9169 1.9664 0.9889 -0.4932 0.5286  -0.1699 96  U   R "C5'" 
2666 C "C4'" . U   B 90 ? 1.9853 2.0560 1.0218 -0.5207 0.5632  -0.1725 96  U   R "C4'" 
2667 O "O4'" . U   B 90 ? 2.0576 2.1282 1.0536 -0.5421 0.6051  -0.2206 96  U   R "O4'" 
2668 C "C3'" . U   B 90 ? 1.9587 2.0368 1.0603 -0.5008 0.5884  -0.1709 96  U   R "C3'" 
2669 O "O3'" . U   B 90 ? 1.9162 2.0005 1.0483 -0.4897 0.5581  -0.1244 96  U   R "O3'" 
2670 C "C2'" . U   B 90 ? 2.0416 2.1379 1.0920 -0.5347 0.6327  -0.1912 96  U   R "C2'" 
2671 O "O2'" . U   B 90 ? 2.0892 2.2042 1.0781 -0.5671 0.6202  -0.1559 96  U   R "O2'" 
2672 C "C1'" . U   B 90 ? 2.0930 2.1782 1.0973 -0.5501 0.6494  -0.2348 96  U   R "C1'" 
2673 N N1    . U   B 90 ? 2.0907 2.1641 1.1508 -0.5285 0.6918  -0.2826 96  U   R N1    
2674 C C2    . U   B 90 ? 2.1414 2.2273 1.1959 -0.5434 0.7442  -0.3123 96  U   R C2    
2675 O O2    . U   B 90 ? 2.1953 2.3015 1.1975 -0.5747 0.7594  -0.3031 96  U   R O2    
2676 N N3    . U   B 90 ? 2.1306 2.2044 1.2461 -0.5198 0.7798  -0.3533 96  U   R N3    
2677 C C4    . U   B 90 ? 2.0786 2.1295 1.2566 -0.4842 0.7677  -0.3652 96  U   R C4    
2678 O O4    . U   B 90 ? 2.0790 2.1217 1.3105 -0.4660 0.8036  -0.4002 96  U   R O4    
2679 C C5    . U   B 90 ? 2.0282 2.0676 1.2042 -0.4718 0.7131  -0.3329 96  U   R C5    
2680 C C6    . U   B 90 ? 2.0378 2.0887 1.1576 -0.4936 0.6788  -0.2949 96  U   R C6    
2681 P P     . G   B 91 ? 1.8584 1.9460 1.0778 -0.4591 0.5697  -0.1191 97  G   R P     
2682 O OP1   . G   B 91 ? 1.8979 2.0058 1.1059 -0.4791 0.6107  -0.1273 97  G   R OP1   
2683 O OP2   . G   B 91 ? 1.8023 1.8851 1.0557 -0.4415 0.5258  -0.0767 97  G   R OP2   
2684 O "O5'" . G   B 91 ? 1.8050 1.8765 1.0822 -0.4275 0.5859  -0.1587 97  G   R "O5'" 
2685 C "C5'" . G   B 91 ? 1.7101 1.7643 1.0372 -0.3949 0.5538  -0.1503 97  G   R "C5'" 
2686 C "C4'" . G   B 91 ? 1.6845 1.7209 1.0283 -0.3797 0.5685  -0.1896 97  G   R "C4'" 
2687 O "O4'" . G   B 91 ? 1.6513 1.6700 0.9881 -0.3696 0.5295  -0.1782 97  G   R "O4'" 
2688 C "C3'" . G   B 91 ? 1.6249 1.6583 1.0538 -0.3448 0.5861  -0.2062 97  G   R "C3'" 
2689 O "O3'" . G   B 91 ? 1.6409 1.6833 1.0806 -0.3509 0.6349  -0.2393 97  G   R "O3'" 
2690 C "C2'" . G   B 91 ? 1.5959 1.6054 1.0430 -0.3236 0.5688  -0.2191 97  G   R "C2'" 
2691 O "O2'" . G   B 91 ? 1.6421 1.6400 1.0601 -0.3352 0.5962  -0.2578 97  G   R "O2'" 
2692 C "C1'" . G   B 91 ? 1.5892 1.5940 0.9960 -0.3328 0.5232  -0.1857 97  G   R "C1'" 
2693 N N9    . G   B 91 ? 1.5298 1.5379 0.9793 -0.3131 0.4910  -0.1496 97  G   R N9    
2694 C C8    . G   B 91 ? 1.5282 1.5446 0.9538 -0.3261 0.4636  -0.1124 97  G   R C8    
2695 N N7    . G   B 91 ? 1.4724 1.4882 0.9478 -0.3042 0.4404  -0.0886 97  G   R N7    
2696 C C5    . G   B 91 ? 1.4290 1.4380 0.9626 -0.2753 0.4511  -0.1098 97  G   R C5    
2697 C C6    . G   B 91 ? 1.3611 1.3686 0.9601 -0.2455 0.4352  -0.0992 97  G   R C6    
2698 O O6    . G   B 91 ? 1.3259 1.3362 0.9444 -0.2392 0.4096  -0.0712 97  G   R O6    
2699 N N1    . G   B 91 ? 1.3372 1.3393 0.9811 -0.2225 0.4521  -0.1248 97  G   R N1    
2700 C C2    . G   B 91 ? 1.3719 1.3680 1.0034 -0.2268 0.4827  -0.1578 97  G   R C2    
2701 N N2    . G   B 91 ? 1.3464 1.3368 1.0320 -0.2011 0.4954  -0.1764 97  G   R N2    
2702 N N3    . G   B 91 ? 1.4366 1.4323 1.0071 -0.2553 0.4998  -0.1717 97  G   R N3    
2703 C C4    . G   B 91 ? 1.4642 1.4678 0.9856 -0.2792 0.4820  -0.1459 97  G   R C4    
2704 P P     . G   B 92 ? 1.5873 1.6419 1.1142 -0.3237 0.6571  -0.2446 98  G   R P     
2705 O OP1   . G   B 92 ? 1.6418 1.7038 1.1675 -0.3355 0.7100  -0.2826 98  G   R OP1   
2706 O OP2   . G   B 92 ? 1.5543 1.6256 1.0992 -0.3227 0.6357  -0.2065 98  G   R OP2   
2707 O "O5'" . G   B 92 ? 1.5132 1.5494 1.1037 -0.2853 0.6390  -0.2497 98  G   R "O5'" 
2708 C "C5'" . G   B 92 ? 1.4828 1.5151 1.1329 -0.2632 0.6698  -0.2800 98  G   R "C5'" 
2709 C "C4'" . G   B 92 ? 1.4111 1.4573 1.1467 -0.2324 0.6635  -0.2651 98  G   R "C4'" 
2710 O "O4'" . G   B 92 ? 1.3480 1.3881 1.0947 -0.2169 0.6157  -0.2329 98  G   R "O4'" 
2711 C "C3'" . G   B 92 ? 1.4105 1.4856 1.1662 -0.2413 0.6802  -0.2539 98  G   R "C3'" 
2712 O "O3'" . G   B 92 ? 1.4462 1.5326 1.2321 -0.2421 0.7293  -0.2848 98  G   R "O3'" 
2713 C "C2'" . G   B 92 ? 1.3373 1.4214 1.1601 -0.2131 0.6499  -0.2274 98  G   R "C2'" 
2714 O "O2'" . G   B 92 ? 1.3113 1.4018 1.2129 -0.1847 0.6663  -0.2419 98  G   R "O2'" 
2715 C "C1'" . G   B 92 ? 1.3006 1.3617 1.0993 -0.2044 0.6065  -0.2110 98  G   R "C1'" 
2716 N N9    . G   B 92 ? 1.2728 1.3360 1.0383 -0.2166 0.5714  -0.1771 98  G   R N9    
2717 C C8    . G   B 92 ? 1.3000 1.3560 0.9915 -0.2437 0.5591  -0.1658 98  G   R C8    
2718 N N7    . G   B 92 ? 1.2702 1.3291 0.9544 -0.2473 0.5275  -0.1329 98  G   R N7    
2719 C C5    . G   B 92 ? 1.2180 1.2862 0.9726 -0.2223 0.5187  -0.1242 98  G   R C5    
2720 C C6    . G   B 92 ? 1.1723 1.2460 0.9532 -0.2152 0.4890  -0.0948 98  G   R C6    
2721 O O6    . G   B 92 ? 1.1695 1.2391 0.9194 -0.2284 0.4652  -0.0691 98  G   R O6    
2722 N N1    . G   B 92 ? 1.1274 1.2128 0.9801 -0.1905 0.4886  -0.0970 98  G   R N1    
2723 C C2    . G   B 92 ? 1.1248 1.2168 1.0222 -0.1731 0.5128  -0.1213 98  G   R C2    
2724 N N2    . G   B 92 ? 1.0806 1.1872 1.0461 -0.1509 0.5056  -0.1168 98  G   R N2    
2725 N N3    . G   B 92 ? 1.1669 1.2518 1.0451 -0.1777 0.5420  -0.1482 98  G   R N3    
2726 C C4    . G   B 92 ? 1.2158 1.2885 1.0204 -0.2034 0.5439  -0.1497 98  G   R C4    
2819 O O     . HOH G .  ? 0.7959 0.8312 0.3539 0.1006  -0.0922 -0.0546 103 HOH P O     
2820 O O     . HOH G .  ? 0.3739 0.6322 0.6669 0.0737  -0.1276 0.1020  104 HOH P O     
2821 O O     . HOH G .  ? 0.7921 0.7935 0.7133 0.0920  -0.0347 -0.1296 105 HOH P O     
2822 O O     . HOH G .  ? 0.4811 0.5140 0.6357 0.1846  0.0785  -0.0923 106 HOH P O     
2823 O O     . HOH H .  ? 0.6040 0.4016 0.4520 -0.0011 0.0843  0.0127  4   HOH R O     
2824 O O     . HOH H .  ? 0.6654 0.6557 0.3778 -0.0076 0.0360  -0.0554 5   HOH R O     
2825 O O     . HOH H .  ? 0.4802 0.6048 0.5507 0.0899  -0.0179 0.0557  6   HOH R O     
2832 O O     . HOH H .  ? 0.8256 1.0517 0.3690 -0.1750 -0.0511 -0.1872 677 HOH R O     
2833 O O     . HOH H .  ? 0.6437 0.5308 0.2893 -0.1596 0.1151  0.0658  678 HOH R O     
2834 O O     . HOH H .  ? 0.9514 0.8465 0.3921 -0.2562 0.0893  0.0197  679 HOH R O     
2835 O O     . HOH H .  ? 0.3621 0.3445 0.4771 -0.0392 0.0778  -0.0025 680 HOH R O     
2836 O O     . HOH H .  ? 0.7329 0.6603 0.5640 -0.0756 0.2490  -0.0403 681 HOH R O     
2837 O O     . HOH H .  ? 0.5367 0.5961 0.5360 0.0902  -0.0056 0.0513  682 HOH R O     
2838 O O     . HOH H .  ? 0.5670 0.5441 0.6110 0.0235  0.1456  -0.0043 683 HOH R O     
2839 O O     . HOH H .  ? 0.6433 0.4483 0.5715 0.0216  0.1273  -0.0964 684 HOH R O     
2840 O O     . HOH H .  ? 0.9291 0.9480 0.3212 -0.1515 0.1740  -0.2136 685 HOH R O     
2841 O O     . HOH H .  ? 0.7304 0.4964 0.6909 0.0239  0.0477  0.0389  686 HOH R O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1   ?   ?   ?   P . n 
A 1 2  ALA 2  2   ?   ?   ?   P . n 
A 1 3  VAL 3  3   ?   ?   ?   P . n 
A 1 4  PRO 4  4   ?   ?   ?   P . n 
A 1 5  GLU 5  5   ?   ?   ?   P . n 
A 1 6  THR 6  6   ?   ?   ?   P . n 
A 1 7  ARG 7  7   7   ARG ARG P . n 
A 1 8  PRO 8  8   8   PRO PRO P . n 
A 1 9  ASN 9  9   9   ASN ASN P . n 
A 1 10 HIS 10 10  10  HIS HIS P . n 
A 1 11 THR 11 11  11  THR THR P . n 
A 1 12 ILE 12 12  12  ILE ILE P . n 
A 1 13 TYR 13 13  13  TYR TYR P . n 
A 1 14 ILE 14 14  14  ILE ILE P . n 
A 1 15 ASN 15 15  15  ASN ASN P . n 
A 1 16 ASN 16 16  16  ASN ASN P . n 
A 1 17 LEU 17 17  17  LEU LEU P . n 
A 1 18 ASN 18 18  18  ASN ASN P . n 
A 1 19 GLU 19 19  19  GLU GLU P . n 
A 1 20 LYS 20 20  20  LYS LYS P . n 
A 1 21 ILE 21 21  21  ILE ILE P . n 
A 1 22 LYS 22 22  22  LYS LYS P . n 
A 1 23 LYS 23 23  23  LYS LYS P . n 
A 1 24 ASP 24 24  24  ASP ASP P . n 
A 1 25 GLU 25 25  25  GLU GLU P . n 
A 1 26 LEU 26 26  26  LEU LEU P . n 
A 1 27 LYS 27 27  27  LYS LYS P . n 
A 1 28 LYS 28 28  28  LYS LYS P . n 
A 1 29 SER 29 29  29  SER SER P . n 
A 1 30 LEU 30 30  30  LEU LEU P . n 
A 1 31 HIS 31 31  31  HIS HIS P . n 
A 1 32 ALA 32 32  32  ALA ALA P . n 
A 1 33 ILE 33 33  33  ILE ILE P . n 
A 1 34 PHE 34 34  34  PHE PHE P . n 
A 1 35 SER 35 35  35  SER SER P . n 
A 1 36 ARG 36 36  36  ARG ARG P . n 
A 1 37 PHE 37 37  37  PHE PHE P . n 
A 1 38 GLY 38 38  38  GLY GLY P . n 
A 1 39 GLN 39 39  39  GLN GLN P . n 
A 1 40 ILE 40 40  40  ILE ILE P . n 
A 1 41 LEU 41 41  41  LEU LEU P . n 
A 1 42 ASP 42 42  42  ASP ASP P . n 
A 1 43 ILE 43 43  43  ILE ILE P . n 
A 1 44 LEU 44 44  44  LEU LEU P . n 
A 1 45 VAL 45 45  45  VAL VAL P . n 
A 1 46 SER 46 46  46  SER SER P . n 
A 1 47 ARG 47 47  47  ARG ARG P . n 
A 1 48 SER 48 48  48  SER SER P . n 
A 1 49 LEU 49 49  49  LEU LEU P . n 
A 1 50 LYS 50 50  50  LYS LYS P . n 
A 1 51 MET 51 51  51  MET MET P . n 
A 1 52 ARG 52 52  52  ARG ARG P . n 
A 1 53 GLY 53 53  53  GLY GLY P . n 
A 1 54 GLN 54 54  54  GLN GLN P . n 
A 1 55 ALA 55 55  55  ALA ALA P . n 
A 1 56 PHE 56 56  56  PHE PHE P . n 
A 1 57 VAL 57 57  57  VAL VAL P . n 
A 1 58 ILE 58 58  58  ILE ILE P . n 
A 1 59 PHE 59 59  59  PHE PHE P . n 
A 1 60 LYS 60 60  60  LYS LYS P . n 
A 1 61 GLU 61 61  61  GLU GLU P . n 
A 1 62 VAL 62 62  62  VAL VAL P . n 
A 1 63 SER 63 63  63  SER SER P . n 
A 1 64 SER 64 64  64  SER SER P . n 
A 1 65 ALA 65 65  65  ALA ALA P . n 
A 1 66 THR 66 66  66  THR THR P . n 
A 1 67 ASN 67 67  67  ASN ASN P . n 
A 1 68 ALA 68 68  68  ALA ALA P . n 
A 1 69 LEU 69 69  69  LEU LEU P . n 
A 1 70 ARG 70 70  70  ARG ARG P . n 
A 1 71 SER 71 71  71  SER SER P . n 
A 1 72 MET 72 72  72  MET MET P . n 
A 1 73 GLN 73 73  73  GLN GLN P . n 
A 1 74 GLY 74 74  74  GLY GLY P . n 
A 1 75 PHE 75 75  75  PHE PHE P . n 
A 1 76 PRO 76 76  76  PRO PRO P . n 
A 1 77 PHE 77 77  77  PHE PHE P . n 
A 1 78 TYR 78 78  78  TYR TYR P . n 
A 1 79 ASP 79 79  79  ASP ASP P . n 
A 1 80 LYS 80 80  80  LYS LYS P . n 
A 1 81 PRO 81 81  81  PRO PRO P . n 
A 1 82 MET 82 82  82  MET MET P . n 
A 1 83 ARG 83 83  83  ARG ARG P . n 
A 1 84 ILE 84 84  84  ILE ILE P . n 
A 1 85 GLN 85 85  85  GLN GLN P . n 
A 1 86 TYR 86 86  86  TYR TYR P . n 
A 1 87 ALA 87 87  87  ALA ALA P . n 
A 1 88 LYS 88 88  88  LYS LYS P . n 
A 1 89 THR 89 89  89  THR THR P . n 
A 1 90 ASP 90 90  90  ASP ASP P . n 
A 1 91 SER 91 91  91  SER SER P . n 
A 1 92 ASP 92 92  92  ASP ASP P . n 
A 1 93 ILE 93 93  93  ILE ILE P . n 
A 1 94 ILE 94 94  94  ILE ILE P . n 
A 1 95 ALA 95 95  95  ALA ALA P . n 
A 1 96 LYS 96 96  96  LYS LYS P . n 
A 1 97 MET 97 97  97  MET MET P . n 
A 1 98 LYS 98 98  ?   ?   ?   P . n 
B 2 1  GTP 1  8   8   GTP GTP R . n 
B 2 2  G   2  9   9   G   G   R . n 
B 2 3  U   3  10  10  U   U   R . n 
B 2 4  C   4  11  11  C   C   R . n 
B 2 5  A   5  12  12  A   A   R . n 
B 2 6  C   6  13  13  C   C   R . n 
B 2 7  G   7  14  14  G   G   R . n 
B 2 8  C   8  15  15  C   C   R . n 
B 2 9  A   9  16  16  A   A   R . n 
B 2 10 C   10 17  17  C   C   R . n 
B 2 11 A   11 18  18  A   A   R . n 
B 2 12 G   12 19  19  G   G   R . n 
B 2 13 G   13 20  20  G   G   R . n 
B 2 14 G   14 21  21  G   G   R . n 
B 2 15 C   15 22  22  C   C   R . n 
B 2 16 A   16 23  23  A   A   R . n 
B 2 17 A   17 24  24  A   A   R . n 
B 2 18 A   18 25  25  A   A   R . n 
B 2 19 C   19 26  26  C   C   R . n 
B 2 20 C   20 27  27  C   C   R . n 
B 2 21 A   21 28  28  A   A   R . n 
B 2 22 U   22 29  29  U   U   R . n 
B 2 23 U   23 30  30  U   U   R . n 
B 2 24 C   24 31  31  C   C   R . n 
B 2 25 G   25 32  32  G   G   R . n 
B 2 26 A   26 33  33  A   A   R . n 
B 2 27 A   27 34  34  A   A   R . n 
B 2 28 A   28 35  35  A   A   R . n 
B 2 29 G   29 36  36  G   G   R . n 
B 2 30 A   30 37  37  A   A   R . n 
B 2 31 G   31 38  38  G   G   R . n 
B 2 32 U   32 39  39  U   U   R . n 
B 2 33 G   33 40  40  G   G   R . n 
B 2 34 G   34 41  41  G   G   R . n 
B 2 35 G   35 42  42  G   G   R . n 
B 2 36 A   36 43  43  A   A   R . n 
B 2 37 C   37 44  44  C   C   R . n 
B 2 38 G   38 45  45  G   G   R . n 
B 2 39 C   39 46  46  C   C   R . n 
B 2 40 A   40 47  47  A   A   R . n 
B 2 41 A   41 48  48  A   A   R . n 
B 2 42 A   42 49  49  A   A   R . n 
B 2 43 G   43 50  50  G   G   R . n 
B 2 44 C   44 51  51  C   C   R . n 
B 2 45 C   45 52  52  C   C   R . n 
B 2 46 U   46 53  53  U   U   R . n 
B 2 47 C   47 54  54  C   C   R . n 
B 2 48 C   48 55  55  C   C   R . n 
B 2 49 G   49 56  56  G   G   R . n 
B 2 50 G   50 57  57  G   G   R . n 
B 2 51 C   51 58  58  C   C   R . n 
B 2 52 C   52 59  59  C   C   R . n 
B 2 53 U   53 60  60  U   U   R . n 
B 2 54 A   54 61  61  A   A   R . n 
B 2 55 A   55 62  62  A   A   R . n 
B 2 56 A   56 63  63  A   A   R . n 
B 2 57 C   57 64  64  C   C   R . n 
B 2 58 C   58 65  65  C   C   R . n 
B 2 59 A   59 660 660 A   A   R . n 
B 2 60 U   60 661 661 U   U   R . n 
B 2 61 U   61 662 662 U   U   R . n 
B 2 62 G   62 663 663 G   G   R . n 
B 2 63 C   63 664 664 C   C   R . n 
B 2 64 A   64 665 665 A   A   R . n 
B 2 65 C   65 666 666 C   C   R . n 
B 2 66 U   66 667 667 U   U   R . n 
B 2 67 C   67 668 668 C   C   R . n 
B 2 68 C   68 669 669 C   C   R . n 
B 2 69 G   69 75  75  G   G   R . n 
B 2 70 G   70 76  76  G   G   R . n 
B 2 71 U   71 77  77  U   U   R . n 
B 2 72 A   72 78  78  A   A   R . n 
B 2 73 G   73 79  79  G   G   R . n 
B 2 74 G   74 80  80  G   G   R . n 
B 2 75 U   75 81  81  U   U   R . n 
B 2 76 A   76 82  82  A   A   R . n 
B 2 77 G   77 83  83  G   G   R . n 
B 2 78 C   78 84  84  C   C   R . n 
B 2 79 G   79 85  85  G   G   R . n 
B 2 80 G   80 86  86  G   G   R . n 
B 2 81 G   81 87  87  G   G   R . n 
B 2 82 G   82 88  88  G   G   R . n 
B 2 83 U   83 89  89  U   U   R . n 
B 2 84 U   84 90  90  U   U   R . n 
B 2 85 A   85 91  91  A   A   R . n 
B 2 86 C   86 92  92  C   C   R . n 
B 2 87 C   87 93  93  C   C   R . n 
B 2 88 G   88 94  94  G   G   R . n 
B 2 89 A   89 95  95  A   A   R . n 
B 2 90 U   90 96  96  U   U   R . n 
B 2 91 G   91 97  97  G   G   R . n 
B 2 92 G   92 98  98  G   G   R . n 
C 3 1  G   1  1   1   G   G   D . n 
C 3 2  G   2  2   2   G   G   D . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    GTP 
_pdbx_struct_mod_residue.label_seq_id     1 
_pdbx_struct_mod_residue.auth_asym_id     R 
_pdbx_struct_mod_residue.auth_comp_id     GTP 
_pdbx_struct_mod_residue.auth_seq_id      8 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   G 
_pdbx_struct_mod_residue.details          "GUANOSINE-5'-TRIPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? H HOH . ? R HOH 691 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 690 ? 1_555 88.5  ? 
2  O ? H HOH . ? R HOH 691 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 687 ? 1_555 90.0  ? 
3  O ? H HOH . ? R HOH 690 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 687 ? 1_555 89.6  ? 
4  O ? H HOH . ? R HOH 691 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 688 ? 1_555 89.8  ? 
5  O ? H HOH . ? R HOH 690 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 688 ? 1_555 90.3  ? 
6  O ? H HOH . ? R HOH 687 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 688 ? 1_555 179.9 ? 
7  O ? H HOH . ? R HOH 691 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 692 ? 1_555 179.5 ? 
8  O ? H HOH . ? R HOH 690 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 692 ? 1_555 91.4  ? 
9  O ? H HOH . ? R HOH 687 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 692 ? 1_555 90.5  ? 
10 O ? H HOH . ? R HOH 688 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 692 ? 1_555 89.7  ? 
11 O ? H HOH . ? R HOH 691 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 689 ? 1_555 91.5  ? 
12 O ? H HOH . ? R HOH 690 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 689 ? 1_555 180.0 ? 
13 O ? H HOH . ? R HOH 687 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 689 ? 1_555 90.4  ? 
14 O ? H HOH . ? R HOH 688 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 689 ? 1_555 89.7  ? 
15 O ? H HOH . ? R HOH 692 ? 1_555 MG ? F MG . ? R MG 670 ? 1_555 O ? H HOH . ? R HOH 689 ? 1_555 88.6  ? 
16 O ? H HOH . ? R HOH 674 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 675 ? 1_555 91.5  ? 
17 O ? H HOH . ? R HOH 674 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 672 ? 1_555 89.7  ? 
18 O ? H HOH . ? R HOH 675 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 672 ? 1_555 89.5  ? 
19 O ? H HOH . ? R HOH 674 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 671 ? 1_555 91.0  ? 
20 O ? H HOH . ? R HOH 675 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 671 ? 1_555 90.4  ? 
21 O ? H HOH . ? R HOH 672 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 671 ? 1_555 179.3 ? 
22 O ? H HOH . ? R HOH 674 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 676 ? 1_555 89.2  ? 
23 O ? H HOH . ? R HOH 675 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 676 ? 1_555 179.2 ? 
24 O ? H HOH . ? R HOH 672 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 676 ? 1_555 90.3  ? 
25 O ? H HOH . ? R HOH 671 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 676 ? 1_555 89.8  ? 
26 O ? H HOH . ? R HOH 674 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 673 ? 1_555 179.2 ? 
27 O ? H HOH . ? R HOH 675 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 673 ? 1_555 89.3  ? 
28 O ? H HOH . ? R HOH 672 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 673 ? 1_555 90.2  ? 
29 O ? H HOH . ? R HOH 671 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 673 ? 1_555 89.2  ? 
30 O ? H HOH . ? R HOH 676 ? 1_555 MG ? E MG . ? R MG 1   ? 1_555 O ? H HOH . ? R HOH 673 ? 1_555 90.0  ? 
31 O ? G HOH . ? P HOH 102 ? 1_555 MG ? D MG . ? P MG 99  ? 1_555 O ? G HOH . ? P HOH 101 ? 1_555 88.0  ? 
32 O ? G HOH . ? P HOH 102 ? 1_555 MG ? D MG . ? P MG 99  ? 1_555 O ? G HOH . ? P HOH 100 ? 1_555 92.8  ? 
33 O ? G HOH . ? P HOH 101 ? 1_555 MG ? D MG . ? P MG 99  ? 1_555 O ? G HOH . ? P HOH 100 ? 1_555 90.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-04 
2 'Structure model' 1 1 2012-10-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 15.3478 18.6816 0.4609  0.0820 0.3710 0.2327 0.0149 -0.1163 -0.0400 8.9517 19.8840 6.8554 -0.1928 
1.3111  -4.9613 -0.1608 -0.0520 0.2183 -0.2320 0.1707  -0.1361 -0.2382 0.3667  -0.0099 
'X-RAY DIFFRACTION' 2 ? refined 12.9689 -2.4965 38.9450 0.3264 0.1777 0.2580 0.0442 0.0872  0.0088  3.4541 2.5252  1.3287 1.1777  
-0.7167 -0.2507 0.2174  -0.0989 0.0122 0.1843  -0.1490 0.2530  -0.1069 -0.3318 -0.0684 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 P 1 ? ? P 94 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 R 8 ? ? R 98 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS    'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" R A 48 ? ? "C1'" R A 48 ? ? N9 R A 48 ? ? 113.25 108.50 4.75 0.70 N 
2 1 "O4'" R G 94 ? ? "C1'" R G 94 ? ? N9 R G 94 ? ? 112.93 108.50 4.43 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP P 79 ? ? 76.42  -23.25  
2 1 SER P 91 ? ? 54.33  -134.39 
3 1 ASP P 92 ? ? 53.45  -113.08 
4 1 ILE P 94 ? ? -85.86 -85.00  
5 1 LYS P 96 ? ? 68.11  -69.94  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 P MET 1  ? A MET 1  
2 1 Y 1 P ALA 2  ? A ALA 2  
3 1 Y 1 P VAL 3  ? A VAL 3  
4 1 Y 1 P PRO 4  ? A PRO 4  
5 1 Y 1 P GLU 5  ? A GLU 5  
6 1 Y 1 P THR 6  ? A THR 6  
7 1 Y 1 P LYS 98 ? A LYS 98 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3UCZ 'double helix'         
3UCZ 'a-form double helix'  
3UCZ tetraloop              
3UCZ 'bulge loop'           
3UCZ 'mismatched base pair' 
3UCZ 'triple helix'         
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B C 4  1_555 B G 92 1_555 0.498  0.092  0.029  10.748  -19.497 2.650    1  R_C11:G98_R R 11 ? R 98 ? 19 1 
1 B A 5  1_555 B G 91 1_555 0.020  1.486  -0.709 -15.283 -20.404 -21.258  2  R_A12:G97_R R 12 ? R 97 ? 8  1 
1 B C 6  1_555 B G 88 1_555 -0.466 -0.123 0.239  -15.712 -17.872 0.218    3  R_C13:G94_R R 13 ? R 94 ? 19 1 
1 B G 7  1_555 B C 87 1_555 -0.290 0.131  0.329  12.477  -6.918  0.301    4  R_G14:C93_R R 14 ? R 93 ? 19 1 
1 C G 2  1_555 B C 86 1_555 -0.186 0.265  -0.595 -13.552 -17.887 5.891    5  D_G2:C92_R  D 2  ? R 92 ? 19 1 
1 B G 12 1_555 B A 40 1_555 -0.275 2.935  -0.066 -11.287 -5.347  -53.061  6  R_G19:A47_R R 19 ? R 47 ? ?  ? 
1 B G 13 1_555 C G 1  1_555 5.916  -0.553 -0.095 3.690   -9.898  -106.822 7  R_G20:G1_D  R 20 ? D 1  ? 7  4 
1 B G 14 1_555 B C 39 1_555 -0.258 -0.135 -0.170 -3.244  -0.381  -0.849   8  R_G21:C46_R R 21 ? R 46 ? 19 1 
1 B C 15 1_555 B G 38 1_555 0.061  -0.021 -0.043 7.444   3.761   5.580    9  R_C22:G45_R R 22 ? R 45 ? 19 1 
1 B G 77 1_555 B C 37 1_555 -0.543 -0.241 0.498  3.223   -7.176  -4.496   10 R_G83:C44_R R 83 ? R 44 ? 19 1 
1 B A 18 1_555 B G 35 1_555 -6.593 -3.716 0.190  2.533   -8.863  -0.763   11 R_A25:G42_R R 25 ? R 42 ? 11 9 
1 B C 19 1_555 B G 34 1_555 0.029  -0.120 -0.142 5.487   -9.714  0.084    12 R_C26:G41_R R 26 ? R 41 ? 19 1 
1 B C 20 1_555 B G 33 1_555 0.185  -0.149 0.009  4.789   -5.589  0.704    13 R_C27:G40_R R 27 ? R 40 ? 19 1 
1 B A 21 1_555 B U 32 1_555 0.063  -0.203 -0.476 -6.695  -19.713 4.751    14 R_A28:U39_R R 28 ? R 39 ? 20 1 
1 B U 22 1_555 B G 31 1_555 2.546  -0.583 -0.155 0.805   -17.068 4.742    15 R_U29:G38_R R 29 ? R 38 ? 28 1 
1 B U 23 1_555 B A 30 1_555 0.465  -0.166 0.159  -3.052  -10.590 1.954    16 R_U30:A37_R R 30 ? R 37 ? 20 1 
1 B C 24 1_555 B G 29 1_555 0.174  -0.272 -0.218 3.656   -0.617  0.436    17 R_C31:G36_R R 31 ? R 36 ? 19 1 
1 B A 41 1_555 B U 84 1_555 -4.412 -2.514 -0.354 11.107  -0.993  -87.537  18 R_A48:U90_R R 48 ? R 90 ? 24 4 
1 B G 43 1_555 B U 83 1_555 -2.450 -0.501 -0.490 -4.096  -11.842 -1.867   19 R_G50:U89_R R 50 ? R 89 ? 28 1 
1 B C 44 1_555 B G 82 1_555 -0.235 -0.249 -0.340 6.233   -16.923 1.259    20 R_C51:G88_R R 51 ? R 88 ? 19 1 
1 B C 45 1_555 B G 81 1_555 0.028  -0.205 0.324  -6.106  -5.853  -1.344   21 R_C52:G87_R R 52 ? R 87 ? 19 1 
1 B C 47 1_555 B G 80 1_555 -0.644 0.056  -0.648 17.884  -10.040 -1.934   22 R_C54:G86_R R 54 ? R 86 ? 19 1 
1 B C 48 1_555 B G 79 1_555 0.157  -0.172 0.002  -1.384  -0.197  -0.556   23 R_C55:G85_R R 55 ? R 85 ? 19 1 
1 B G 49 1_555 B C 78 1_555 -0.892 -0.385 0.142  -2.044  -1.551  -2.919   24 R_G56:C84_R R 56 ? R 84 ? 19 1 
1 B G 50 1_555 B U 75 1_555 -2.115 -0.512 0.282  4.578   -4.166  -9.525   25 R_G57:U81_R R 57 ? R 81 ? 28 1 
1 B C 51 1_555 B G 74 1_555 0.001  -0.165 -0.143 14.534  -13.804 -3.554   26 R_C58:G80_R R 58 ? R 80 ? 19 1 
1 B C 52 1_555 B G 73 1_555 -0.063 -0.028 -0.203 -0.427  -11.218 2.574    27 R_C59:G79_R R 59 ? R 79 ? 19 1 
1 B U 53 1_555 B A 72 1_555 -0.643 -0.110 0.101  -4.249  -6.460  1.275    28 R_U60:A78_R R 60 ? R 78 ? 20 1 
1 B A 54 1_555 B U 71 1_555 1.497  -0.084 -0.011 9.802   -5.541  2.179    29 R_A61:U77_R R 61 ? R 77 ? 20 1 
1 B C 57 1_555 B G 70 1_555 0.066  -0.045 -0.905 21.681  -32.463 5.473    30 R_C64:G76_R R 64 ? R 76 ? 19 1 
1 B C 58 1_555 B G 69 1_555 0.465  -0.168 0.080  -6.568  -17.422 2.507    31 R_C65:G75_R R 65 ? R 75 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B C 4  1_555 B G 92 1_555 B A 5  1_555 B G 91 1_555 0.517  -2.588 3.795 7.877   14.652 31.422  -6.433 0.326  2.444 24.983 
-13.431 35.456  1  RR_C11A12:G97G98_RR R 11 ? R 98 ? R 12 ? R 97 ? 
1 B A 5  1_555 B G 91 1_555 B C 6  1_555 B G 88 1_555 2.396  -0.442 3.067 1.342   5.794  43.281  -1.116 -3.100 3.055 7.811  -1.809 
43.668  2  RR_A12C13:G94G97_RR R 12 ? R 97 ? R 13 ? R 94 ? 
1 B C 6  1_555 B G 88 1_555 B G 7  1_555 B C 87 1_555 -0.638 -0.598 2.668 -5.407  20.013 25.948  -3.685 0.408  1.850 37.814 10.217 
33.101  3  RR_C13G14:C93G94_RR R 13 ? R 94 ? R 14 ? R 93 ? 
1 B G 7  1_555 B C 87 1_555 C G 2  1_555 B C 86 1_555 -0.620 -1.171 3.799 1.053   11.397 39.952  -3.004 0.999  3.340 16.279 -1.504 
41.494  4  RD_G14G2:C92C93_RR  R 14 ? R 93 ? D 2  ? R 92 ? 
1 C G 2  1_555 B C 86 1_555 B G 12 1_555 B A 40 1_555 -2.436 3.450  2.839 -12.068 -3.084 115.301 2.066  1.325  2.935 -1.823 7.131 
115.728 5  DR_G2G19:A47C92_RR  D 2  ? R 92 ? R 19 ? R 47 ? 
1 B G 12 1_555 B A 40 1_555 B G 13 1_555 C G 1  1_555 -0.781 -2.699 3.172 -3.664  -0.536 50.849  -3.099 0.657  3.244 -0.623 4.261 
50.975  6  RR_G19G20:G1A47_DR  R 19 ? R 47 ? R 20 ? D 1  ? 
1 B G 13 1_555 C G 1  1_555 B G 14 1_555 B C 39 1_555 1.321  -1.500 3.489 0.162   0.427  -27.666 3.025  2.804  3.503 -0.893 0.338 
-27.670 7  RR_G20G21:C46G1_RD  R 20 ? D 1  ? R 21 ? R 46 ? 
1 B G 14 1_555 B C 39 1_555 B C 15 1_555 B G 38 1_555 0.279  -1.758 3.127 -3.195  -0.164 31.005  -3.242 -1.100 3.092 -0.305 5.956 
31.165  8  RR_G21C22:G45C46_RR R 21 ? R 46 ? R 22 ? R 45 ? 
1 B C 15 1_555 B G 38 1_555 B G 77 1_555 B C 37 1_555 -5.497 -0.270 3.396 -13.357 -8.070 57.079  0.234  4.742  4.468 -8.276 13.698 
59.001  9  RR_C22G83:C44G45_RR R 22 ? R 45 ? R 83 ? R 44 ? 
1 B A 18 1_555 B G 35 1_555 B C 19 1_555 B G 34 1_555 -0.247 -0.786 3.376 -4.811  6.251  60.745  -1.076 0.009  3.298 6.153  4.736 
61.207  10 RR_A25C26:G41G42_RR R 25 ? R 42 ? R 26 ? R 41 ? 
1 B C 19 1_555 B G 34 1_555 B C 20 1_555 B G 33 1_555 -0.046 -1.971 3.236 -1.864  5.257  29.510  -4.819 -0.270 2.848 10.205 3.618 
30.021  11 RR_C26C27:G40G41_RR R 26 ? R 41 ? R 27 ? R 40 ? 
1 B C 20 1_555 B G 33 1_555 B A 21 1_555 B U 32 1_555 0.052  -1.377 3.439 6.993   18.915 32.598  -4.379 0.761  2.296 30.351 
-11.220 38.187  12 RR_C27A28:U39G40_RR R 27 ? R 40 ? R 28 ? R 39 ? 
1 B A 21 1_555 B U 32 1_555 B U 22 1_555 B G 31 1_555 0.299  -0.858 3.056 -0.634  9.794  39.872  -2.190 -0.489 2.773 14.104 0.913 
41.014  13 RR_A28U29:G38U39_RR R 28 ? R 39 ? R 29 ? R 38 ? 
1 B U 22 1_555 B G 31 1_555 B U 23 1_555 B A 30 1_555 -0.045 -1.966 2.983 1.587   12.055 24.596  -6.468 0.399  1.829 26.340 -3.467 
27.396  14 RR_U29U30:A37G38_RR R 29 ? R 38 ? R 30 ? R 37 ? 
1 B U 23 1_555 B A 30 1_555 B C 24 1_555 B G 29 1_555 0.026  -1.402 3.208 3.120   3.824  30.343  -3.362 0.535  3.001 7.246  -5.911 
30.732  15 RR_U30C31:G36A37_RR R 30 ? R 37 ? R 31 ? R 36 ? 
1 B A 41 1_555 B U 84 1_555 B G 43 1_555 B U 83 1_555 3.253  -2.080 3.698 -8.054  10.063 66.217  -2.281 -3.258 3.024 9.121  7.301 
67.320  16 RR_A48G50:U89U90_RR R 48 ? R 90 ? R 50 ? R 89 ? 
1 B G 43 1_555 B U 83 1_555 B C 44 1_555 B G 82 1_555 0.216  -1.407 2.986 -3.044  4.875  38.516  -2.635 -0.650 2.770 7.340  4.583 
38.926  17 RR_G50C51:G88U89_RR R 50 ? R 89 ? R 51 ? R 88 ? 
1 B C 44 1_555 B G 82 1_555 B C 45 1_555 B G 81 1_555 0.049  -1.821 3.683 -1.442  7.748  35.724  -4.046 -0.290 3.227 12.443 2.315 
36.555  18 RR_C51C52:G87G88_RR R 51 ? R 88 ? R 52 ? R 87 ? 
1 B C 45 1_555 B G 81 1_555 B C 47 1_555 B G 80 1_555 -2.795 -1.157 2.748 12.348  3.277  49.714  -1.504 3.857  1.972 3.825  
-14.414 51.228  19 RR_C52C54:G86G87_RR R 52 ? R 87 ? R 54 ? R 86 ? 
1 B C 47 1_555 B G 80 1_555 B C 48 1_555 B G 79 1_555 -0.444 -2.319 3.869 -6.787  9.317  34.822  -5.109 -0.327 3.193 15.066 10.974 
36.624  20 RR_C54C55:G85G86_RR R 54 ? R 86 ? R 55 ? R 85 ? 
1 B C 48 1_555 B G 79 1_555 B G 49 1_555 B C 78 1_555 0.003  -2.153 3.092 -1.116  8.143  23.257  -7.128 -0.294 2.218 19.437 2.664 
24.648  21 RR_C55G56:C84G85_RR R 55 ? R 85 ? R 56 ? R 84 ? 
1 B G 49 1_555 B C 78 1_555 B G 50 1_555 B U 75 1_555 1.999  -2.021 2.791 -0.429  6.021  43.782  -3.144 -2.690 2.487 8.029  0.572 
44.176  22 RR_G56G57:U81C84_RR R 56 ? R 84 ? R 57 ? R 81 ? 
1 B G 50 1_555 B U 75 1_555 B C 51 1_555 B G 74 1_555 0.288  -1.397 3.079 -1.225  3.924  41.785  -2.325 -0.519 2.933 5.486  1.712 
41.978  23 RR_G57C58:G80U81_RR R 57 ? R 81 ? R 58 ? R 80 ? 
1 B C 51 1_555 B G 74 1_555 B C 52 1_555 B G 73 1_555 -0.265 -2.198 3.648 -2.718  8.335  30.118  -5.690 -0.038 2.960 15.629 5.096 
31.339  24 RR_C58C59:G79G80_RR R 58 ? R 80 ? R 59 ? R 79 ? 
1 B C 52 1_555 B G 73 1_555 B U 53 1_555 B A 72 1_555 0.050  -2.217 3.484 -2.213  7.192  25.215  -6.754 -0.689 2.743 16.025 4.930 
26.296  25 RR_C59U60:A78G79_RR R 59 ? R 79 ? R 60 ? R 78 ? 
1 B U 53 1_555 B A 72 1_555 B A 54 1_555 B U 71 1_555 0.168  -0.739 3.010 4.561   15.571 34.713  -2.859 0.250  2.471 24.510 -7.180 
38.212  26 RR_U60A61:U77A78_RR R 60 ? R 78 ? R 61 ? R 77 ? 
1 B A 54 1_555 B U 71 1_555 B C 57 1_555 B G 70 1_555 -5.178 0.694  3.092 11.903  5.799  68.480  0.433  4.896  2.322 5.105  
-10.477 69.594  27 RR_A61C64:G76U77_RR R 61 ? R 77 ? R 64 ? R 76 ? 
1 B C 57 1_555 B G 70 1_555 B C 58 1_555 B G 69 1_555 -0.345 -1.575 4.063 -8.114  16.818 34.747  -4.655 -0.603 3.023 25.972 12.531 
39.310  28 RR_C64C65:G75G76_RR R 64 ? R 76 ? R 65 ? R 75 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1  99  1  MG  MO6 P . 
E 4 MG  1  1   1  MG  MO6 R . 
F 4 MG  1  670 1  MG  MO6 R . 
G 5 HOH 1  100 1  HOH MO6 P . 
G 5 HOH 2  101 1  HOH MO6 P . 
G 5 HOH 3  102 1  HOH MO6 P . 
G 5 HOH 4  103 8  HOH HOH P . 
G 5 HOH 5  104 9  HOH HOH P . 
G 5 HOH 6  105 20 HOH HOH P . 
G 5 HOH 7  106 26 HOH HOH P . 
H 5 HOH 1  4   4  HOH HOH R . 
H 5 HOH 2  5   5  HOH HOH R . 
H 5 HOH 3  6   6  HOH HOH R . 
H 5 HOH 4  671 1  HOH MO6 R . 
H 5 HOH 5  672 1  HOH MO6 R . 
H 5 HOH 6  673 1  HOH MO6 R . 
H 5 HOH 7  674 1  HOH MO6 R . 
H 5 HOH 8  675 1  HOH MO6 R . 
H 5 HOH 9  676 1  HOH MO6 R . 
H 5 HOH 10 677 1  HOH HOH R . 
H 5 HOH 11 678 10 HOH HOH R . 
H 5 HOH 12 679 11 HOH HOH R . 
H 5 HOH 13 680 12 HOH HOH R . 
H 5 HOH 14 681 13 HOH HOH R . 
H 5 HOH 15 682 15 HOH HOH R . 
H 5 HOH 16 683 18 HOH HOH R . 
H 5 HOH 17 684 22 HOH HOH R . 
H 5 HOH 18 685 24 HOH HOH R . 
H 5 HOH 19 686 25 HOH HOH R . 
H 5 HOH 20 687 1  HOH MO6 R . 
H 5 HOH 21 688 1  HOH MO6 R . 
H 5 HOH 22 689 1  HOH MO6 R . 
H 5 HOH 23 690 1  HOH MO6 R . 
H 5 HOH 24 691 1  HOH MO6 R . 
H 5 HOH 25 692 1  HOH MO6 R . 
#