data_3UE8
# 
_entry.id   3UE8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UE8         
RCSB  RCSB068643   
WWPDB D_1000068643 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UE8 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dounay, A.B.'     1  
'Anderson, M.'     2  
'Bechle, B.M.'     3  
'Campbell, B.M.'   4  
'Claffey, M.M.'    5  
'Evdokimov, A.'    6  
'Edelweiss, E.'    7  
'Fonseca, K.R.'    8  
'Gan, X.'          9  
'Ghosh, S.'        10 
'Hayward, M.M.'    11 
'Horner, W.'       12 
'Kim, J.Y.'        13 
'McAllister, L.A.' 14 
'Pandit, J.'       15 
'Paradis, V.'      16 
'Parikh, V.D.'     17 
'Reese, M.R.'      18 
'Rong, S.B.'       19 
'Salafia, M.A.'    20 
'Schuyten, K.'     21 
'Strick, C.A.'     22 
'Tuttle, J.B.'     23 
'Valentine, J.'    24 
'Wang, H.'         25 
'Zawadzke, L.E.'   26 
'Verhoest, P.R.'   27 
# 
_citation.id                        primary 
_citation.title                     
'Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia.' 
_citation.journal_abbrev            'ACS Med Chem Lett' 
_citation.journal_volume            3 
_citation.page_first                187 
_citation.page_last                 192 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1948-5875 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24900455 
_citation.pdbx_database_id_DOI      10.1021/ml200204m 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dounay, A.B.'     1  
primary 'Anderson, M.'     2  
primary 'Bechle, B.M.'     3  
primary 'Campbell, B.M.'   4  
primary 'Claffey, M.M.'    5  
primary 'Evdokimov, A.'    6  
primary 'Evrard, E.'       7  
primary 'Fonseca, K.R.'    8  
primary 'Gan, X.'          9  
primary 'Ghosh, S.'        10 
primary 'Hayward, M.M.'    11 
primary 'Horner, W.'       12 
primary 'Kim, J.Y.'        13 
primary 'McAllister, L.A.' 14 
primary 'Pandit, J.'       15 
primary 'Paradis, V.'      16 
primary 'Parikh, V.D.'     17 
primary 'Reese, M.R.'      18 
primary 'Rong, S.'         19 
primary 'Salafia, M.A.'    20 
primary 'Schuyten, K.'     21 
primary 'Strick, C.A.'     22 
primary 'Tuttle, J.B.'     23 
primary 'Valentine, J.'    24 
primary 'Wang, H.'         25 
primary 'Zawadzke, L.E.'   26 
primary 'Verhoest, P.R.'   27 
# 
_cell.entry_id           3UE8 
_cell.length_a           63.616 
_cell.length_b           116.597 
_cell.length_c           129.267 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UE8 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial' 49082.301 2 '2.6.1.39, 2.6.1.7' ? ? ? 
2 non-polymer syn 
'(5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate' 407.314 
2 ?                   ? ? ? 
3 non-polymer syn 'CHLORIDE ION' 35.453    2 ?                   ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;2-aminoadipate aminotransferase, 2-aminoadipate transaminase, Alpha-aminoadipate aminotransferase, AadAT, KAT/AadAT, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESLLVPRGSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESLLVPRGSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 LYS n 
1 241 PHE n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LYS n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
1 426 LEU n 
1 427 VAL n 
1 428 PRO n 
1 429 ARG n 
1 430 GLY n 
1 431 SER n 
1 432 LEU n 
1 433 GLU n 
1 434 HIS n 
1 435 HIS n 
1 436 HIS n 
1 437 HIS n 
1 438 HIS n 
1 439 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AADAT, KAT2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UE8 A 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
2 1 3UE8 B 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UE8 LEU A 426 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 426 1  
1 3UE8 VAL A 427 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 427 2  
1 3UE8 PRO A 428 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 428 3  
1 3UE8 ARG A 429 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 429 4  
1 3UE8 GLY A 430 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 430 5  
1 3UE8 SER A 431 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 431 6  
1 3UE8 LEU A 432 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 432 7  
1 3UE8 GLU A 433 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 433 8  
1 3UE8 HIS A 434 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 434 9  
1 3UE8 HIS A 435 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 435 10 
1 3UE8 HIS A 436 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 436 11 
1 3UE8 HIS A 437 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 437 12 
1 3UE8 HIS A 438 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 438 13 
1 3UE8 HIS A 439 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 439 14 
2 3UE8 LEU B 426 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 426 15 
2 3UE8 VAL B 427 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 427 16 
2 3UE8 PRO B 428 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 428 17 
2 3UE8 ARG B 429 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 429 18 
2 3UE8 GLY B 430 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 430 19 
2 3UE8 SER B 431 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 431 20 
2 3UE8 LEU B 432 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 432 21 
2 3UE8 GLU B 433 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 433 22 
2 3UE8 HIS B 434 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 434 23 
2 3UE8 HIS B 435 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 435 24 
2 3UE8 HIS B 436 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 436 25 
2 3UE8 HIS B 437 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 437 26 
2 3UE8 HIS B 438 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 438 27 
2 3UE8 HIS B 439 ? UNP Q8N5Z0 ? ? 'EXPRESSION TAG' 439 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
09M non-polymer         . 
'(5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate' ? 
'C17 H18 N3 O7 P' 407.314 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION' ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3UE8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rigaku Varimax Mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     3UE8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            3.2 
_reflns.number_obs                   16095 
_reflns.number_all                   16200 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        52.49 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3UE8 
_refine.ls_number_reflns_obs                     15793 
_refine.ls_number_reflns_all                     16200 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.43 
_refine.ls_d_res_high                            3.22 
_refine.ls_percent_reflns_obs                    97.77 
_refine.ls_R_factor_obs                          0.2038 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2000 
_refine.ls_R_factor_R_free                       0.2748 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  790 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8996 
_refine.correlation_coeff_Fo_to_Fc_free          0.8327 
_refine.B_iso_mean                               56.59 
_refine.aniso_B[1][1]                            21.7339 
_refine.aniso_B[2][2]                            -10.4546 
_refine.aniso_B[3][3]                            -11.2793 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3UE8 
_refine_analyze.Luzzati_coordinate_error_obs    0.547 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6427 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6485 
_refine_hist.d_res_high                       3.22 
_refine_hist.d_res_low                        30.43 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  6647 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.33  ? 2.00  9038 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  2249 SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  161  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  995  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 6647 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_omega_torsion           2.89  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           24.39 ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  864  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  8129 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.2 
_refine_ls_shell.d_res_low                        3.31 
_refine_ls_shell.number_reflns_R_work             2667 
_refine_ls_shell.R_factor_R_work                  0.2090 
_refine_ls_shell.percent_reflns_obs               97.77 
_refine_ls_shell.R_factor_R_free                  0.3250 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.22 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.number_reflns_all                2814 
_refine_ls_shell.R_factor_all                     0.2149 
_refine_ls_shell.number_reflns_obs                1605 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UE8 
_struct.title                     'Kynurenine Aminotransferase II Inhibitors' 
_struct.pdbx_descriptor           'Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (E.C.2.6.1.39, 2.6.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UE8 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'KAT II, kynurenine aminotransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 8   ? ALA A 13  ? THR A 8   ALA A 13  1 ? 6  
HELX_P HELX_P2  2  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P3  3  GLY A 64  ? GLN A 73  ? GLY A 64  GLN A 73  1 ? 10 
HELX_P HELX_P4  4  ILE A 80  ? ASN A 96  ? ILE A 80  ASN A 96  1 ? 17 
HELX_P HELX_P5  5  PRO A 97  ? TYR A 102 ? PRO A 97  TYR A 102 5 ? 6  
HELX_P HELX_P6  6  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P7  7  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P8  8  TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P9  9  VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P10 10 ARG A 177 ? TRP A 178 ? ARG A 177 TRP A 178 5 ? 2  
HELX_P HELX_P11 11 LYS A 179 ? LYS A 184 ? LYS A 179 LYS A 184 5 ? 6  
HELX_P HELX_P12 12 THR A 209 ? TYR A 223 ? THR A 209 TYR A 223 1 ? 15 
HELX_P HELX_P13 13 LYS A 278 ? THR A 292 ? LYS A 278 THR A 292 1 ? 15 
HELX_P HELX_P14 14 SER A 296 ? LEU A 341 ? SER A 296 LEU A 341 1 ? 46 
HELX_P HELX_P15 15 LYS A 367 ? GLU A 372 ? LYS A 367 GLU A 372 1 ? 6  
HELX_P HELX_P16 16 ALA A 374 ? MET A 377 ? ALA A 374 MET A 377 5 ? 4  
HELX_P HELX_P17 17 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P18 18 SER A 406 ? LEU A 426 ? SER A 406 LEU A 426 1 ? 21 
HELX_P HELX_P19 19 TYR B 3   ? ILE B 7   ? TYR B 3   ILE B 7   5 ? 5  
HELX_P HELX_P20 20 THR B 8   ? ARG B 14  ? THR B 8   ARG B 14  1 ? 7  
HELX_P HELX_P21 21 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P22 22 GLY B 64  ? GLN B 73  ? GLY B 64  GLN B 73  1 ? 10 
HELX_P HELX_P23 23 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P24 24 PRO B 97  ? TYR B 102 ? PRO B 97  TYR B 102 5 ? 6  
HELX_P HELX_P25 25 SER B 115 ? ILE B 129 ? SER B 115 ILE B 129 1 ? 15 
HELX_P HELX_P26 26 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P27 27 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P28 28 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P29 29 THR B 245 ? ASP B 250 ? THR B 245 ASP B 250 1 ? 6  
HELX_P HELX_P30 30 LYS B 278 ? THR B 292 ? LYS B 278 THR B 292 1 ? 15 
HELX_P HELX_P31 31 SER B 296 ? LEU B 341 ? SER B 296 LEU B 341 1 ? 46 
HELX_P HELX_P32 32 VAL B 366 ? GLU B 372 ? VAL B 366 GLU B 372 1 ? 7  
HELX_P HELX_P33 33 ALA B 374 ? GLY B 378 ? ALA B 374 GLY B 378 5 ? 5  
HELX_P HELX_P34 34 PRO B 383 ? TYR B 388 ? PRO B 383 TYR B 388 5 ? 6  
HELX_P HELX_P35 35 SER B 406 ? LEU B 425 ? SER B 406 LEU B 425 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 1.80  
2 ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 16.26 
3 GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 -0.95 
4 ASN 202 B . ? ASN 202 B PRO 203 B ? PRO 203 B 1 10.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 7 ? 
C ? 4 ? 
D ? 2 ? 
E ? 7 ? 
F ? 2 ? 
G ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 60  ? PHE A 63  ? THR A 60  PHE A 63  
A 2 PHE A 48  ? VAL A 55  ? PHE A 48  VAL A 55  
A 3 PHE B 48  ? VAL B 55  ? PHE B 48  VAL B 55  
A 4 GLY B 58  ? PHE B 63  ? GLY B 58  PHE B 63  
B 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
B 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
B 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
B 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
B 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
B 6 ASN A 134 ? LEU A 137 ? ASN A 134 LEU A 137 
B 7 ASN A 155 ? ASN A 158 ? ASN A 155 ASN A 158 
C 1 ALA A 345 ? TRP A 347 ? ALA A 345 TRP A 347 
C 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
C 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
C 4 LEU A 382 ? PRO A 383 ? LEU A 382 PRO A 383 
D 1 VAL A 379 ? LEU A 380 ? VAL A 379 LEU A 380 
D 2 ILE B 34  ? SER B 35  ? ILE B 34  SER B 35  
E 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
E 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
E 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
E 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
E 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
E 6 ASN B 134 ? LEU B 137 ? ASN B 134 LEU B 137 
E 7 ASN B 155 ? ASN B 158 ? ASN B 155 ASN B 158 
F 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
F 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
G 1 ALA B 345 ? TRP B 347 ? ALA B 345 TRP B 347 
G 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
G 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 63  ? O PHE A 63  N ALA A 51  ? N ALA A 51  
A 2 3 N THR A 50  ? N THR A 50  O THR B 54  ? O THR B 54  
A 3 4 N ALA B 51  ? N ALA B 51  O PHE B 63  ? O PHE B 63  
B 1 2 N THR A 114 ? N THR A 114 O GLY A 272 ? O GLY A 272 
B 2 3 O THR A 275 ? O THR A 275 N ARG A 257 ? N ARG A 257 
B 3 4 O ALA A 258 ? O ALA A 258 N GLU A 229 ? N GLU A 229 
B 4 5 O ASP A 230 ? O ASP A 230 N THR A 196 ? N THR A 196 
B 5 6 O PHE A 193 ? O PHE A 193 N LEU A 136 ? N LEU A 136 
B 6 7 N VAL A 135 ? N VAL A 135 O ASN A 155 ? O ASN A 155 
C 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
C 2 3 N LEU A 356 ? N LEU A 356 O ALA A 400 ? O ALA A 400 
C 3 4 O ARG A 399 ? O ARG A 399 N LEU A 382 ? N LEU A 382 
D 1 2 N LEU A 380 ? N LEU A 380 O ILE B 34  ? O ILE B 34  
E 1 2 N THR B 114 ? N THR B 114 O GLY B 272 ? O GLY B 272 
E 2 3 O THR B 275 ? O THR B 275 N ARG B 257 ? N ARG B 257 
E 3 4 O ALA B 258 ? O ALA B 258 N GLU B 229 ? N GLU B 229 
E 4 5 O ILE B 228 ? O ILE B 228 N LEU B 194 ? N LEU B 194 
E 5 6 O TYR B 195 ? O TYR B 195 N LEU B 136 ? N LEU B 136 
E 6 7 N VAL B 135 ? N VAL B 135 O ASN B 155 ? O ASN B 155 
F 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
G 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
G 2 3 N ILE B 358 ? N ILE B 358 O LEU B 398 ? O LEU B 398 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 09M A 440' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 09M B 440' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 441'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B 441'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 GLY A 116 ? GLY A 116 . ? 1_555 ? 
2  AC1 15 SER A 117 ? SER A 117 . ? 1_555 ? 
3  AC1 15 GLN A 118 ? GLN A 118 . ? 1_555 ? 
4  AC1 15 TYR A 142 ? TYR A 142 . ? 1_555 ? 
5  AC1 15 ASN A 202 ? ASN A 202 . ? 1_555 ? 
6  AC1 15 ASP A 230 ? ASP A 230 . ? 1_555 ? 
7  AC1 15 PRO A 232 ? PRO A 232 . ? 1_555 ? 
8  AC1 15 TYR A 233 ? TYR A 233 . ? 1_555 ? 
9  AC1 15 SER A 260 ? SER A 260 . ? 1_555 ? 
10 AC1 15 SER A 262 ? SER A 262 . ? 1_555 ? 
11 AC1 15 LYS A 263 ? LYS A 263 . ? 1_555 ? 
12 AC1 15 ARG A 270 ? ARG A 270 . ? 1_555 ? 
13 AC1 15 PHE A 355 ? PHE A 355 . ? 1_555 ? 
14 AC1 15 ARG A 399 ? ARG A 399 . ? 1_555 ? 
15 AC1 15 TYR B 74  ? TYR B 74  . ? 1_555 ? 
16 AC2 15 GLY A 39  ? GLY A 39  . ? 1_555 ? 
17 AC2 15 TYR A 74  ? TYR A 74  . ? 1_555 ? 
18 AC2 15 GLY B 116 ? GLY B 116 . ? 1_555 ? 
19 AC2 15 SER B 117 ? SER B 117 . ? 1_555 ? 
20 AC2 15 GLN B 118 ? GLN B 118 . ? 1_555 ? 
21 AC2 15 TYR B 142 ? TYR B 142 . ? 1_555 ? 
22 AC2 15 ASN B 202 ? ASN B 202 . ? 1_555 ? 
23 AC2 15 ASP B 230 ? ASP B 230 . ? 1_555 ? 
24 AC2 15 PRO B 232 ? PRO B 232 . ? 1_555 ? 
25 AC2 15 TYR B 233 ? TYR B 233 . ? 1_555 ? 
26 AC2 15 SER B 260 ? SER B 260 . ? 1_555 ? 
27 AC2 15 SER B 262 ? SER B 262 . ? 1_555 ? 
28 AC2 15 LYS B 263 ? LYS B 263 . ? 1_555 ? 
29 AC2 15 ARG B 270 ? ARG B 270 . ? 1_555 ? 
30 AC2 15 ARG B 399 ? ARG B 399 . ? 1_555 ? 
31 AC3 2  TRP A 178 ? TRP A 178 . ? 1_555 ? 
32 AC3 2  ASN A 189 ? ASN A 189 . ? 1_555 ? 
33 AC4 2  TRP B 178 ? TRP B 178 . ? 1_555 ? 
34 AC4 2  ASN B 189 ? ASN B 189 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3UE8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UE8 
_atom_sites.fract_transf_matrix[1][1]   0.015719 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008577 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007736 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 20.869  -0.553  17.378 1.00 60.35  ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 21.703  0.199   18.335 1.00 59.76  ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 22.211  -0.657  19.512 1.00 63.39  ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 21.439  -1.446  20.094 1.00 63.05  ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 20.980  1.463   18.891 1.00 61.21  ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 21.128  2.708   18.023 1.00 65.21  ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 22.170  4.065   18.674 1.00 68.07  ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 23.811  3.245   18.708 1.00 64.69  ? 1   MET A CE  1 
ATOM   9    N  N   . ASN A 1 2   ? 23.510  -0.468  19.875 1.00 58.43  ? 2   ASN A N   1 
ATOM   10   C  CA  . ASN A 1 2   ? 24.151  -1.158  21.005 1.00 56.45  ? 2   ASN A CA  1 
ATOM   11   C  C   . ASN A 1 2   ? 24.426  -0.164  22.091 1.00 54.23  ? 2   ASN A C   1 
ATOM   12   O  O   . ASN A 1 2   ? 25.381  0.617   22.007 1.00 54.08  ? 2   ASN A O   1 
ATOM   13   C  CB  . ASN A 1 2   ? 25.451  -1.892  20.627 1.00 61.53  ? 2   ASN A CB  1 
ATOM   14   C  CG  . ASN A 1 2   ? 26.131  -2.549  21.821 1.00 90.08  ? 2   ASN A CG  1 
ATOM   15   O  OD1 . ASN A 1 2   ? 25.534  -3.365  22.550 1.00 86.25  ? 2   ASN A OD1 1 
ATOM   16   N  ND2 . ASN A 1 2   ? 27.383  -2.176  22.069 1.00 80.32  ? 2   ASN A ND2 1 
ATOM   17   N  N   . TYR A 1 3   ? 23.587  -0.206  23.119 1.00 45.33  ? 3   TYR A N   1 
ATOM   18   C  CA  . TYR A 1 3   ? 23.674  0.673   24.260 1.00 41.56  ? 3   TYR A CA  1 
ATOM   19   C  C   . TYR A 1 3   ? 24.805  0.253   25.236 1.00 42.61  ? 3   TYR A C   1 
ATOM   20   O  O   . TYR A 1 3   ? 25.452  1.121   25.842 1.00 41.20  ? 3   TYR A O   1 
ATOM   21   C  CB  . TYR A 1 3   ? 22.281  0.820   24.892 1.00 41.51  ? 3   TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 3   ? 21.319  1.549   23.976 1.00 44.23  ? 3   TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 3   ? 20.325  0.865   23.289 1.00 47.60  ? 3   TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 3   ? 21.463  2.906   23.720 1.00 45.60  ? 3   TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 3   ? 19.459  1.525   22.411 1.00 48.21  ? 3   TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 3   ? 20.585  3.583   22.870 1.00 47.44  ? 3   TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 3   ? 19.599  2.883   22.197 1.00 51.26  ? 3   TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 3   ? 18.764  3.546   21.333 1.00 48.45  ? 3   TYR A OH  1 
ATOM   29   N  N   . ALA A 1 4   ? 25.116  -1.070  25.286 1.00 38.05  ? 4   ALA A N   1 
ATOM   30   C  CA  . ALA A 1 4   ? 26.154  -1.677  26.128 1.00 36.66  ? 4   ALA A CA  1 
ATOM   31   C  C   . ALA A 1 4   ? 27.501  -0.948  26.060 1.00 40.92  ? 4   ALA A C   1 
ATOM   32   O  O   . ALA A 1 4   ? 28.167  -0.814  27.098 1.00 41.02  ? 4   ALA A O   1 
ATOM   33   C  CB  . ALA A 1 4   ? 26.324  -3.151  25.787 1.00 37.73  ? 4   ALA A CB  1 
ATOM   34   N  N   . ARG A 1 5   ? 27.872  -0.440  24.861 1.00 36.05  ? 5   ARG A N   1 
ATOM   35   C  CA  . ARG A 1 5   ? 29.139  0.242   24.673 1.00 35.55  ? 5   ARG A CA  1 
ATOM   36   C  C   . ARG A 1 5   ? 29.264  1.539   25.408 1.00 38.85  ? 5   ARG A C   1 
ATOM   37   O  O   . ARG A 1 5   ? 30.336  1.827   25.931 1.00 37.63  ? 5   ARG A O   1 
ATOM   38   C  CB  . ARG A 1 5   ? 29.525  0.376   23.195 1.00 37.49  ? 5   ARG A CB  1 
ATOM   39   C  CG  . ARG A 1 5   ? 28.666  1.285   22.336 1.00 48.51  ? 5   ARG A CG  1 
ATOM   40   C  CD  . ARG A 1 5   ? 29.347  1.547   20.999 1.00 57.08  ? 5   ARG A CD  1 
ATOM   41   N  NE  . ARG A 1 5   ? 29.930  2.887   20.926 1.00 62.48  ? 5   ARG A NE  1 
ATOM   42   C  CZ  . ARG A 1 5   ? 29.631  3.783   19.991 1.00 72.10  ? 5   ARG A CZ  1 
ATOM   43   N  NH1 . ARG A 1 5   ? 30.195  4.989   20.010 1.00 57.65  ? 5   ARG A NH1 1 
ATOM   44   N  NH2 . ARG A 1 5   ? 28.747  3.493   19.044 1.00 51.70  ? 5   ARG A NH2 1 
ATOM   45   N  N   . PHE A 1 6   ? 28.164  2.305   25.480 1.00 36.49  ? 6   PHE A N   1 
ATOM   46   C  CA  . PHE A 1 6   ? 28.108  3.630   26.117 1.00 35.75  ? 6   PHE A CA  1 
ATOM   47   C  C   . PHE A 1 6   ? 27.982  3.533   27.621 1.00 39.91  ? 6   PHE A C   1 
ATOM   48   O  O   . PHE A 1 6   ? 28.170  4.519   28.342 1.00 37.55  ? 6   PHE A O   1 
ATOM   49   C  CB  . PHE A 1 6   ? 26.944  4.449   25.542 1.00 37.33  ? 6   PHE A CB  1 
ATOM   50   C  CG  . PHE A 1 6   ? 26.987  4.664   24.041 1.00 39.44  ? 6   PHE A CG  1 
ATOM   51   C  CD1 . PHE A 1 6   ? 26.228  3.873   23.187 1.00 41.64  ? 6   PHE A CD1 1 
ATOM   52   C  CD2 . PHE A 1 6   ? 27.753  5.690   23.489 1.00 41.16  ? 6   PHE A CD2 1 
ATOM   53   C  CE1 . PHE A 1 6   ? 26.244  4.100   21.812 1.00 43.59  ? 6   PHE A CE1 1 
ATOM   54   C  CE2 . PHE A 1 6   ? 27.763  5.915   22.110 1.00 44.26  ? 6   PHE A CE2 1 
ATOM   55   C  CZ  . PHE A 1 6   ? 26.999  5.130   21.283 1.00 42.83  ? 6   PHE A CZ  1 
ATOM   56   N  N   . ILE A 1 7   ? 27.701  2.313   28.083 1.00 38.52  ? 7   ILE A N   1 
ATOM   57   C  CA  . ILE A 1 7   ? 27.487  1.960   29.470 1.00 37.78  ? 7   ILE A CA  1 
ATOM   58   C  C   . ILE A 1 7   ? 28.737  1.456   30.219 1.00 38.99  ? 7   ILE A C   1 
ATOM   59   O  O   . ILE A 1 7   ? 29.647  0.864   29.620 1.00 38.45  ? 7   ILE A O   1 
ATOM   60   C  CB  . ILE A 1 7   ? 26.226  1.051   29.527 1.00 41.74  ? 7   ILE A CB  1 
ATOM   61   C  CG1 . ILE A 1 7   ? 24.995  1.908   29.814 1.00 42.51  ? 7   ILE A CG1 1 
ATOM   62   C  CG2 . ILE A 1 7   ? 26.327  -0.193  30.451 1.00 42.76  ? 7   ILE A CG2 1 
ATOM   63   C  CD1 . ILE A 1 7   ? 23.747  1.248   29.468 1.00 59.45  ? 7   ILE A CD1 1 
ATOM   64   N  N   . THR A 1 8   ? 28.766  1.764   31.540 1.00 32.59  ? 8   THR A N   1 
ATOM   65   C  CA  . THR A 1 8   ? 29.781  1.374   32.511 1.00 30.51  ? 8   THR A CA  1 
ATOM   66   C  C   . THR A 1 8   ? 29.374  0.015   33.008 1.00 31.22  ? 8   THR A C   1 
ATOM   67   O  O   . THR A 1 8   ? 28.186  -0.231  33.245 1.00 27.72  ? 8   THR A O   1 
ATOM   68   C  CB  . THR A 1 8   ? 29.798  2.326   33.723 1.00 39.71  ? 8   THR A CB  1 
ATOM   69   O  OG1 . THR A 1 8   ? 28.649  2.087   34.534 1.00 41.88  ? 8   THR A OG1 1 
ATOM   70   C  CG2 . THR A 1 8   ? 29.887  3.793   33.344 1.00 37.29  ? 8   THR A CG2 1 
ATOM   71   N  N   . ALA A 1 9   ? 30.377  -0.845  33.232 1.00 29.69  ? 9   ALA A N   1 
ATOM   72   C  CA  . ALA A 1 9   ? 30.226  -2.220  33.707 1.00 29.46  ? 9   ALA A CA  1 
ATOM   73   C  C   . ALA A 1 9   ? 29.280  -2.320  34.886 1.00 32.44  ? 9   ALA A C   1 
ATOM   74   O  O   . ALA A 1 9   ? 28.394  -3.181  34.865 1.00 31.34  ? 9   ALA A O   1 
ATOM   75   C  CB  . ALA A 1 9   ? 31.579  -2.790  34.071 1.00 30.63  ? 9   ALA A CB  1 
ATOM   76   N  N   . ALA A 1 10  ? 29.430  -1.404  35.892 1.00 28.97  ? 10  ALA A N   1 
ATOM   77   C  CA  . ALA A 1 10  ? 28.570  -1.391  37.080 1.00 28.53  ? 10  ALA A CA  1 
ATOM   78   C  C   . ALA A 1 10  ? 27.101  -1.159  36.717 1.00 34.26  ? 10  ALA A C   1 
ATOM   79   O  O   . ALA A 1 10  ? 26.235  -1.860  37.256 1.00 34.89  ? 10  ALA A O   1 
ATOM   80   C  CB  . ALA A 1 10  ? 29.049  -0.378  38.103 1.00 28.21  ? 10  ALA A CB  1 
ATOM   81   N  N   . SER A 1 11  ? 26.824  -0.249  35.747 1.00 29.70  ? 11  SER A N   1 
ATOM   82   C  CA  . SER A 1 11  ? 25.449  0.010   35.311 1.00 28.71  ? 11  SER A CA  1 
ATOM   83   C  C   . SER A 1 11  ? 24.774  -1.239  34.753 1.00 32.57  ? 11  SER A C   1 
ATOM   84   O  O   . SER A 1 11  ? 23.642  -1.546  35.129 1.00 30.53  ? 11  SER A O   1 
ATOM   85   C  CB  . SER A 1 11  ? 25.392  1.133   34.285 1.00 30.61  ? 11  SER A CB  1 
ATOM   86   O  OG  . SER A 1 11  ? 24.371  2.016   34.711 1.00 38.29  ? 11  SER A OG  1 
ATOM   87   N  N   . ALA A 1 12  ? 25.479  -1.970  33.862 1.00 29.90  ? 12  ALA A N   1 
ATOM   88   C  CA  . ALA A 1 12  ? 24.953  -3.175  33.239 1.00 29.20  ? 12  ALA A CA  1 
ATOM   89   C  C   . ALA A 1 12  ? 24.759  -4.254  34.301 1.00 33.59  ? 12  ALA A C   1 
ATOM   90   O  O   . ALA A 1 12  ? 23.842  -5.068  34.192 1.00 34.07  ? 12  ALA A O   1 
ATOM   91   C  CB  . ALA A 1 12  ? 25.892  -3.636  32.147 1.00 30.29  ? 12  ALA A CB  1 
ATOM   92   N  N   . ALA A 1 13  ? 25.558  -4.196  35.382 1.00 30.01  ? 13  ALA A N   1 
ATOM   93   C  CA  . ALA A 1 13  ? 25.476  -5.132  36.507 1.00 30.29  ? 13  ALA A CA  1 
ATOM   94   C  C   . ALA A 1 13  ? 24.372  -4.712  37.538 1.00 34.05  ? 13  ALA A C   1 
ATOM   95   O  O   . ALA A 1 13  ? 24.309  -5.213  38.663 1.00 32.33  ? 13  ALA A O   1 
ATOM   96   C  CB  . ALA A 1 13  ? 26.844  -5.227  37.170 1.00 31.15  ? 13  ALA A CB  1 
ATOM   97   N  N   . ARG A 1 14  ? 23.520  -3.760  37.148 1.00 31.71  ? 14  ARG A N   1 
ATOM   98   C  CA  . ARG A 1 14  ? 22.428  -3.303  37.991 1.00 30.84  ? 14  ARG A CA  1 
ATOM   99   C  C   . ARG A 1 14  ? 21.316  -4.270  37.872 1.00 36.01  ? 14  ARG A C   1 
ATOM   100  O  O   . ARG A 1 14  ? 21.225  -5.014  36.883 1.00 36.30  ? 14  ARG A O   1 
ATOM   101  C  CB  . ARG A 1 14  ? 21.987  -1.870  37.674 1.00 29.91  ? 14  ARG A CB  1 
ATOM   102  C  CG  . ARG A 1 14  ? 23.025  -0.868  38.168 1.00 37.54  ? 14  ARG A CG  1 
ATOM   103  C  CD  . ARG A 1 14  ? 22.420  0.400   38.701 1.00 41.93  ? 14  ARG A CD  1 
ATOM   104  N  NE  . ARG A 1 14  ? 23.274  0.989   39.731 1.00 45.98  ? 14  ARG A NE  1 
ATOM   105  C  CZ  . ARG A 1 14  ? 24.180  1.936   39.506 1.00 48.69  ? 14  ARG A CZ  1 
ATOM   106  N  NH1 . ARG A 1 14  ? 24.901  2.422   40.510 1.00 17.70  ? 14  ARG A NH1 1 
ATOM   107  N  NH2 . ARG A 1 14  ? 24.372  2.406   38.270 1.00 40.36  ? 14  ARG A NH2 1 
ATOM   108  N  N   . ASN A 1 15  ? 20.521  -4.340  38.926 1.00 33.91  ? 15  ASN A N   1 
ATOM   109  C  CA  . ASN A 1 15  ? 19.464  -5.315  38.982 1.00 35.28  ? 15  ASN A CA  1 
ATOM   110  C  C   . ASN A 1 15  ? 18.189  -4.836  39.637 1.00 42.53  ? 15  ASN A C   1 
ATOM   111  O  O   . ASN A 1 15  ? 18.245  -4.197  40.700 1.00 42.81  ? 15  ASN A O   1 
ATOM   112  C  CB  . ASN A 1 15  ? 19.978  -6.619  39.638 1.00 32.89  ? 15  ASN A CB  1 
ATOM   113  C  CG  . ASN A 1 15  ? 20.427  -7.637  38.625 1.00 49.97  ? 15  ASN A CG  1 
ATOM   114  O  OD1 . ASN A 1 15  ? 19.669  -8.018  37.717 1.00 57.07  ? 15  ASN A OD1 1 
ATOM   115  N  ND2 . ASN A 1 15  ? 21.680  -8.066  38.722 1.00 31.35  ? 15  ASN A ND2 1 
ATOM   116  N  N   . PRO A 1 16  ? 17.027  -5.207  39.032 1.00 40.30  ? 16  PRO A N   1 
ATOM   117  C  CA  . PRO A 1 16  ? 15.726  -4.883  39.658 1.00 45.36  ? 16  PRO A CA  1 
ATOM   118  C  C   . PRO A 1 16  ? 15.548  -5.570  41.033 1.00 65.25  ? 16  PRO A C   1 
ATOM   119  O  O   . PRO A 1 16  ? 15.097  -4.982  42.022 1.00 20.61  ? 16  PRO A O   1 
ATOM   120  C  CB  . PRO A 1 16  ? 14.719  -5.425  38.632 1.00 47.39  ? 16  PRO A CB  1 
ATOM   121  C  CG  . PRO A 1 16  ? 15.464  -6.510  37.875 1.00 49.69  ? 16  PRO A CG  1 
ATOM   122  C  CD  . PRO A 1 16  ? 16.855  -5.989  37.781 1.00 43.35  ? 16  PRO A CD  1 
ATOM   123  N  N   . ILE A 1 34  ? -4.156  -9.520  49.149 1.00 83.23  ? 34  ILE A N   1 
ATOM   124  C  CA  . ILE A 1 34  ? -3.631  -9.746  50.506 1.00 82.37  ? 34  ILE A CA  1 
ATOM   125  C  C   . ILE A 1 34  ? -2.105  -9.971  50.443 1.00 85.26  ? 34  ILE A C   1 
ATOM   126  O  O   . ILE A 1 34  ? -1.660  -11.057 50.060 1.00 84.30  ? 34  ILE A O   1 
ATOM   127  C  CB  . ILE A 1 34  ? -4.387  -10.899 51.259 1.00 86.07  ? 34  ILE A CB  1 
ATOM   128  C  CG1 . ILE A 1 34  ? -5.910  -10.685 51.288 1.00 88.27  ? 34  ILE A CG1 1 
ATOM   129  C  CG2 . ILE A 1 34  ? -3.849  -11.119 52.676 1.00 85.08  ? 34  ILE A CG2 1 
ATOM   130  C  CD1 . ILE A 1 34  ? -6.668  -11.504 50.292 1.00 98.42  ? 34  ILE A CD1 1 
ATOM   131  N  N   . SER A 1 35  ? -1.306  -8.944  50.808 1.00 81.21  ? 35  SER A N   1 
ATOM   132  C  CA  . SER A 1 35  ? 0.149   -9.076  50.733 1.00 79.69  ? 35  SER A CA  1 
ATOM   133  C  C   . SER A 1 35  ? 0.960   -8.642  51.944 1.00 82.54  ? 35  SER A C   1 
ATOM   134  O  O   . SER A 1 35  ? 0.965   -7.462  52.324 1.00 81.17  ? 35  SER A O   1 
ATOM   135  C  CB  . SER A 1 35  ? 0.697   -8.443  49.459 1.00 83.07  ? 35  SER A CB  1 
ATOM   136  O  OG  . SER A 1 35  ? 0.602   -7.031  49.534 1.00 94.08  ? 35  SER A OG  1 
ATOM   137  N  N   . LEU A 1 36  ? 1.701   -9.618  52.507 1.00 79.38  ? 36  LEU A N   1 
ATOM   138  C  CA  . LEU A 1 36  ? 2.618   -9.433  53.639 1.00 78.39  ? 36  LEU A CA  1 
ATOM   139  C  C   . LEU A 1 36  ? 4.023   -9.181  53.082 1.00 79.57  ? 36  LEU A C   1 
ATOM   140  O  O   . LEU A 1 36  ? 4.959   -8.974  53.845 1.00 78.37  ? 36  LEU A O   1 
ATOM   141  C  CB  . LEU A 1 36  ? 2.617   -10.670 54.564 1.00 78.98  ? 36  LEU A CB  1 
ATOM   142  C  CG  . LEU A 1 36  ? 1.249   -11.148 55.071 1.00 85.42  ? 36  LEU A CG  1 
ATOM   143  C  CD1 . LEU A 1 36  ? 1.227   -12.645 55.268 1.00 86.04  ? 36  LEU A CD1 1 
ATOM   144  C  CD2 . LEU A 1 36  ? 0.863   -10.457 56.348 1.00 88.38  ? 36  LEU A CD2 1 
ATOM   145  N  N   . ALA A 1 37  ? 4.160   -9.207  51.741 1.00 74.73  ? 37  ALA A N   1 
ATOM   146  C  CA  . ALA A 1 37  ? 5.407   -8.958  51.027 1.00 72.40  ? 37  ALA A CA  1 
ATOM   147  C  C   . ALA A 1 37  ? 5.769   -7.473  51.124 1.00 74.19  ? 37  ALA A C   1 
ATOM   148  O  O   . ALA A 1 37  ? 6.949   -7.138  51.248 1.00 72.07  ? 37  ALA A O   1 
ATOM   149  C  CB  . ALA A 1 37  ? 5.250   -9.361  49.569 1.00 73.22  ? 37  ALA A CB  1 
ATOM   150  N  N   . GLY A 1 38  ? 4.736   -6.623  51.095 1.00 71.27  ? 38  GLY A N   1 
ATOM   151  C  CA  . GLY A 1 38  ? 4.811   -5.165  51.117 1.00 70.53  ? 38  GLY A CA  1 
ATOM   152  C  C   . GLY A 1 38  ? 5.627   -4.530  52.225 1.00 71.98  ? 38  GLY A C   1 
ATOM   153  O  O   . GLY A 1 38  ? 5.143   -4.376  53.355 1.00 72.62  ? 38  GLY A O   1 
ATOM   154  N  N   . GLY A 1 39  ? 6.844   -4.113  51.874 1.00 64.98  ? 39  GLY A N   1 
ATOM   155  C  CA  . GLY A 1 39  ? 7.758   -3.448  52.795 1.00 63.48  ? 39  GLY A CA  1 
ATOM   156  C  C   . GLY A 1 39  ? 7.439   -1.976  52.961 1.00 65.81  ? 39  GLY A C   1 
ATOM   157  O  O   . GLY A 1 39  ? 8.353   -1.147  52.991 1.00 64.40  ? 39  GLY A O   1 
ATOM   158  N  N   . LEU A 1 40  ? 6.130   -1.650  53.075 1.00 61.89  ? 40  LEU A N   1 
ATOM   159  C  CA  . LEU A 1 40  ? 5.603   -0.289  53.190 1.00 61.07  ? 40  LEU A CA  1 
ATOM   160  C  C   . LEU A 1 40  ? 4.980   -0.041  54.543 1.00 64.40  ? 40  LEU A C   1 
ATOM   161  O  O   . LEU A 1 40  ? 4.171   -0.855  54.982 1.00 65.07  ? 40  LEU A O   1 
ATOM   162  C  CB  . LEU A 1 40  ? 4.543   -0.017  52.107 1.00 61.75  ? 40  LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 40  ? 4.994   -0.111  50.662 1.00 65.41  ? 40  LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 40  ? 4.629   -1.465  50.079 1.00 66.34  ? 40  LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 40  ? 4.417   1.030   49.828 1.00 65.77  ? 40  LEU A CD2 1 
ATOM   166  N  N   . PRO A 1 41  ? 5.271   1.111   55.185 1.00 60.64  ? 41  PRO A N   1 
ATOM   167  C  CA  . PRO A 1 41  ? 4.654   1.410   56.492 1.00 61.39  ? 41  PRO A CA  1 
ATOM   168  C  C   . PRO A 1 41  ? 3.152   1.627   56.405 1.00 66.07  ? 41  PRO A C   1 
ATOM   169  O  O   . PRO A 1 41  ? 2.657   1.956   55.328 1.00 65.77  ? 41  PRO A O   1 
ATOM   170  C  CB  . PRO A 1 41  ? 5.357   2.699   56.934 1.00 62.94  ? 41  PRO A CB  1 
ATOM   171  C  CG  . PRO A 1 41  ? 5.816   3.324   55.676 1.00 66.97  ? 41  PRO A CG  1 
ATOM   172  C  CD  . PRO A 1 41  ? 6.196   2.184   54.775 1.00 61.80  ? 41  PRO A CD  1 
ATOM   173  N  N   . ASN A 1 42  ? 2.434   1.434   57.537 1.00 63.51  ? 42  ASN A N   1 
ATOM   174  C  CA  . ASN A 1 42  ? 0.982   1.623   57.614 1.00 64.50  ? 42  ASN A CA  1 
ATOM   175  C  C   . ASN A 1 42  ? 0.650   3.073   57.313 1.00 69.78  ? 42  ASN A C   1 
ATOM   176  O  O   . ASN A 1 42  ? 1.198   3.988   57.947 1.00 68.95  ? 42  ASN A O   1 
ATOM   177  C  CB  . ASN A 1 42  ? 0.422   1.226   58.962 1.00 62.68  ? 42  ASN A CB  1 
ATOM   178  C  CG  . ASN A 1 42  ? -1.077  1.177   58.966 1.00 71.12  ? 42  ASN A CG  1 
ATOM   179  O  OD1 . ASN A 1 42  ? -1.753  2.199   59.104 1.00 60.78  ? 42  ASN A OD1 1 
ATOM   180  N  ND2 . ASN A 1 42  ? -1.626  -0.014  58.796 1.00 63.07  ? 42  ASN A ND2 1 
ATOM   181  N  N   . PRO A 1 43  ? -0.219  3.287   56.306 1.00 67.74  ? 43  PRO A N   1 
ATOM   182  C  CA  . PRO A 1 43  ? -0.537  4.663   55.891 1.00 68.05  ? 43  PRO A CA  1 
ATOM   183  C  C   . PRO A 1 43  ? -1.232  5.503   56.959 1.00 72.51  ? 43  PRO A C   1 
ATOM   184  O  O   . PRO A 1 43  ? -0.920  6.689   57.114 1.00 72.89  ? 43  PRO A O   1 
ATOM   185  C  CB  . PRO A 1 43  ? -1.401  4.465   54.638 1.00 70.79  ? 43  PRO A CB  1 
ATOM   186  C  CG  . PRO A 1 43  ? -1.973  3.080   54.774 1.00 75.81  ? 43  PRO A CG  1 
ATOM   187  C  CD  . PRO A 1 43  ? -0.904  2.286   55.458 1.00 69.94  ? 43  PRO A CD  1 
ATOM   188  N  N   . ASN A 1 44  ? -2.133  4.871   57.728 1.00 68.37  ? 44  ASN A N   1 
ATOM   189  C  CA  . ASN A 1 44  ? -2.931  5.500   58.783 1.00 68.78  ? 44  ASN A CA  1 
ATOM   190  C  C   . ASN A 1 44  ? -2.118  6.005   59.994 1.00 67.89  ? 44  ASN A C   1 
ATOM   191  O  O   . ASN A 1 44  ? -2.694  6.587   60.912 1.00 68.61  ? 44  ASN A O   1 
ATOM   192  C  CB  . ASN A 1 44  ? -4.054  4.549   59.212 1.00 72.37  ? 44  ASN A CB  1 
ATOM   193  C  CG  . ASN A 1 44  ? -4.985  4.163   58.085 1.00 96.24  ? 44  ASN A CG  1 
ATOM   194  O  OD1 . ASN A 1 44  ? -6.122  4.634   58.006 1.00 95.03  ? 44  ASN A OD1 1 
ATOM   195  N  ND2 . ASN A 1 44  ? -4.537  3.278   57.200 1.00 84.32  ? 44  ASN A ND2 1 
ATOM   196  N  N   . MET A 1 45  ? -0.786  5.803   59.973 1.00 59.67  ? 45  MET A N   1 
ATOM   197  C  CA  . MET A 1 45  ? 0.148   6.196   61.028 1.00 57.37  ? 45  MET A CA  1 
ATOM   198  C  C   . MET A 1 45  ? 0.892   7.509   60.755 1.00 60.62  ? 45  MET A C   1 
ATOM   199  O  O   . MET A 1 45  ? 1.630   7.979   61.621 1.00 59.88  ? 45  MET A O   1 
ATOM   200  C  CB  . MET A 1 45  ? 1.142   5.059   61.316 1.00 57.58  ? 45  MET A CB  1 
ATOM   201  C  CG  . MET A 1 45  ? 0.523   3.861   62.001 1.00 60.61  ? 45  MET A CG  1 
ATOM   202  S  SD  . MET A 1 45  ? -0.192  4.259   63.599 1.00 64.84  ? 45  MET A SD  1 
ATOM   203  C  CE  . MET A 1 45  ? -1.892  3.976   63.245 1.00 63.40  ? 45  MET A CE  1 
ATOM   204  N  N   . PHE A 1 46  ? 0.685   8.108   59.575 1.00 57.42  ? 46  PHE A N   1 
ATOM   205  C  CA  . PHE A 1 46  ? 1.330   9.359   59.192 1.00 56.91  ? 46  PHE A CA  1 
ATOM   206  C  C   . PHE A 1 46  ? 0.555   10.568  59.748 1.00 60.17  ? 46  PHE A C   1 
ATOM   207  O  O   . PHE A 1 46  ? -0.675  10.571  59.664 1.00 60.72  ? 46  PHE A O   1 
ATOM   208  C  CB  . PHE A 1 46  ? 1.471   9.438   57.668 1.00 59.10  ? 46  PHE A CB  1 
ATOM   209  C  CG  . PHE A 1 46  ? 2.257   8.328   56.996 1.00 60.62  ? 46  PHE A CG  1 
ATOM   210  C  CD1 . PHE A 1 46  ? 3.507   7.939   57.482 1.00 63.16  ? 46  PHE A CD1 1 
ATOM   211  C  CD2 . PHE A 1 46  ? 1.784   7.721   55.838 1.00 63.91  ? 46  PHE A CD2 1 
ATOM   212  C  CE1 . PHE A 1 46  ? 4.250   6.942   56.839 1.00 62.99  ? 46  PHE A CE1 1 
ATOM   213  C  CE2 . PHE A 1 46  ? 2.525   6.718   55.200 1.00 65.95  ? 46  PHE A CE2 1 
ATOM   214  C  CZ  . PHE A 1 46  ? 3.753   6.338   55.704 1.00 62.68  ? 46  PHE A CZ  1 
ATOM   215  N  N   . PRO A 1 47  ? 1.249   11.593  60.324 1.00 55.59  ? 47  PRO A N   1 
ATOM   216  C  CA  . PRO A 1 47  ? 0.532   12.726  60.951 1.00 56.42  ? 47  PRO A CA  1 
ATOM   217  C  C   . PRO A 1 47  ? -0.291  13.649  60.067 1.00 59.88  ? 47  PRO A C   1 
ATOM   218  O  O   . PRO A 1 47  ? -1.379  14.037  60.494 1.00 61.01  ? 47  PRO A O   1 
ATOM   219  C  CB  . PRO A 1 47  ? 1.637   13.502  61.676 1.00 57.31  ? 47  PRO A CB  1 
ATOM   220  C  CG  . PRO A 1 47  ? 2.875   13.133  60.994 1.00 60.03  ? 47  PRO A CG  1 
ATOM   221  C  CD  . PRO A 1 47  ? 2.703   11.705  60.555 1.00 55.38  ? 47  PRO A CD  1 
ATOM   222  N  N   . PHE A 1 48  ? 0.238   14.047  58.882 1.00 54.10  ? 48  PHE A N   1 
ATOM   223  C  CA  . PHE A 1 48  ? -0.430  14.967  57.955 1.00 53.77  ? 48  PHE A CA  1 
ATOM   224  C  C   . PHE A 1 48  ? -1.664  14.305  57.396 1.00 54.15  ? 48  PHE A C   1 
ATOM   225  O  O   . PHE A 1 48  ? -1.549  13.303  56.685 1.00 51.76  ? 48  PHE A O   1 
ATOM   226  C  CB  . PHE A 1 48  ? 0.517   15.392  56.833 1.00 54.90  ? 48  PHE A CB  1 
ATOM   227  C  CG  . PHE A 1 48  ? 1.864   15.886  57.286 1.00 56.17  ? 48  PHE A CG  1 
ATOM   228  C  CD1 . PHE A 1 48  ? 2.002   17.134  57.878 1.00 61.23  ? 48  PHE A CD1 1 
ATOM   229  C  CD2 . PHE A 1 48  ? 2.997   15.112  57.103 1.00 57.94  ? 48  PHE A CD2 1 
ATOM   230  C  CE1 . PHE A 1 48  ? 3.249   17.598  58.287 1.00 61.92  ? 48  PHE A CE1 1 
ATOM   231  C  CE2 . PHE A 1 48  ? 4.249   15.577  57.507 1.00 60.89  ? 48  PHE A CE2 1 
ATOM   232  C  CZ  . PHE A 1 48  ? 4.367   16.820  58.092 1.00 60.08  ? 48  PHE A CZ  1 
ATOM   233  N  N   . LYS A 1 49  ? -2.853  14.824  57.769 1.00 50.73  ? 49  LYS A N   1 
ATOM   234  C  CA  . LYS A 1 49  ? -4.130  14.210  57.395 1.00 50.67  ? 49  LYS A CA  1 
ATOM   235  C  C   . LYS A 1 49  ? -4.796  14.678  56.101 1.00 53.88  ? 49  LYS A C   1 
ATOM   236  O  O   . LYS A 1 49  ? -5.190  13.825  55.307 1.00 53.07  ? 49  LYS A O   1 
ATOM   237  C  CB  . LYS A 1 49  ? -5.088  14.091  58.594 1.00 54.12  ? 49  LYS A CB  1 
ATOM   238  C  CG  . LYS A 1 49  ? -4.545  13.243  59.772 1.00 55.57  ? 49  LYS A CG  1 
ATOM   239  C  CD  . LYS A 1 49  ? -4.545  11.719  59.510 1.00 59.24  ? 49  LYS A CD  1 
ATOM   240  C  CE  . LYS A 1 49  ? -3.815  10.913  60.568 1.00 60.54  ? 49  LYS A CE  1 
ATOM   241  N  NZ  . LYS A 1 49  ? -3.359  9.584   60.056 1.00 62.50  ? 49  LYS A NZ  1 
ATOM   242  N  N   . THR A 1 50  ? -4.941  16.002  55.879 1.00 50.95  ? 50  THR A N   1 
ATOM   243  C  CA  . THR A 1 50  ? -5.510  16.547  54.626 1.00 51.73  ? 50  THR A CA  1 
ATOM   244  C  C   . THR A 1 50  ? -4.764  17.790  54.187 1.00 53.33  ? 50  THR A C   1 
ATOM   245  O  O   . THR A 1 50  ? -4.177  18.477  55.016 1.00 51.47  ? 50  THR A O   1 
ATOM   246  C  CB  . THR A 1 50  ? -7.036  16.843  54.679 1.00 66.64  ? 50  THR A CB  1 
ATOM   247  O  OG1 . THR A 1 50  ? -7.316  17.959  55.528 1.00 69.96  ? 50  THR A OG1 1 
ATOM   248  C  CG2 . THR A 1 50  ? -7.892  15.627  55.021 1.00 66.74  ? 50  THR A CG2 1 
ATOM   249  N  N   . ALA A 1 51  ? -4.795  18.083  52.887 1.00 50.46  ? 51  ALA A N   1 
ATOM   250  C  CA  . ALA A 1 51  ? -4.144  19.267  52.345 1.00 50.44  ? 51  ALA A CA  1 
ATOM   251  C  C   . ALA A 1 51  ? -5.026  20.030  51.327 1.00 57.83  ? 51  ALA A C   1 
ATOM   252  O  O   . ALA A 1 51  ? -5.813  19.430  50.586 1.00 57.77  ? 51  ALA A O   1 
ATOM   253  C  CB  . ALA A 1 51  ? -2.808  18.893  51.719 1.00 48.52  ? 51  ALA A CB  1 
ATOM   254  N  N   . VAL A 1 52  ? -4.878  21.358  51.306 1.00 55.94  ? 52  VAL A N   1 
ATOM   255  C  CA  . VAL A 1 52  ? -5.556  22.228  50.360 1.00 57.94  ? 52  VAL A CA  1 
ATOM   256  C  C   . VAL A 1 52  ? -4.562  23.259  49.846 1.00 61.90  ? 52  VAL A C   1 
ATOM   257  O  O   . VAL A 1 52  ? -3.993  24.023  50.629 1.00 61.25  ? 52  VAL A O   1 
ATOM   258  C  CB  . VAL A 1 52  ? -6.909  22.799  50.855 1.00 64.95  ? 52  VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 52  ? -6.909  23.040  52.362 1.00 65.39  ? 52  VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 52  ? -7.335  24.047  50.074 1.00 66.13  ? 52  VAL A CG2 1 
ATOM   261  N  N   . ILE A 1 53  ? -4.299  23.208  48.530 1.00 58.43  ? 53  ILE A N   1 
ATOM   262  C  CA  . ILE A 1 53  ? -3.342  24.063  47.835 1.00 57.28  ? 53  ILE A CA  1 
ATOM   263  C  C   . ILE A 1 53  ? -4.011  24.880  46.716 1.00 63.40  ? 53  ILE A C   1 
ATOM   264  O  O   . ILE A 1 53  ? -4.461  24.306  45.723 1.00 62.95  ? 53  ILE A O   1 
ATOM   265  C  CB  . ILE A 1 53  ? -2.135  23.213  47.344 1.00 57.59  ? 53  ILE A CB  1 
ATOM   266  C  CG1 . ILE A 1 53  ? -1.347  22.645  48.552 1.00 56.62  ? 53  ILE A CG1 1 
ATOM   267  C  CG2 . ILE A 1 53  ? -1.216  24.025  46.424 1.00 57.41  ? 53  ILE A CG2 1 
ATOM   268  C  CD1 . ILE A 1 53  ? -0.382  21.441  48.274 1.00 61.68  ? 53  ILE A CD1 1 
ATOM   269  N  N   . THR A 1 54  ? -4.062  26.220  46.879 1.00 62.01  ? 54  THR A N   1 
ATOM   270  C  CA  . THR A 1 54  ? -4.654  27.104  45.871 1.00 63.93  ? 54  THR A CA  1 
ATOM   271  C  C   . THR A 1 54  ? -3.671  27.466  44.779 1.00 70.78  ? 54  THR A C   1 
ATOM   272  O  O   . THR A 1 54  ? -2.457  27.490  45.008 1.00 67.82  ? 54  THR A O   1 
ATOM   273  C  CB  . THR A 1 54  ? -5.352  28.334  46.467 1.00 62.69  ? 54  THR A CB  1 
ATOM   274  O  OG1 . THR A 1 54  ? -4.414  29.136  47.175 1.00 56.07  ? 54  THR A OG1 1 
ATOM   275  C  CG2 . THR A 1 54  ? -6.540  27.977  47.331 1.00 60.73  ? 54  THR A CG2 1 
ATOM   276  N  N   . VAL A 1 55  ? -4.214  27.740  43.583 1.00 72.61  ? 55  VAL A N   1 
ATOM   277  C  CA  . VAL A 1 55  ? -3.472  28.093  42.377 1.00 73.43  ? 55  VAL A CA  1 
ATOM   278  C  C   . VAL A 1 55  ? -4.109  29.307  41.722 1.00 82.28  ? 55  VAL A C   1 
ATOM   279  O  O   . VAL A 1 55  ? -5.333  29.347  41.575 1.00 84.34  ? 55  VAL A O   1 
ATOM   280  C  CB  . VAL A 1 55  ? -3.400  26.877  41.415 1.00 77.19  ? 55  VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 55  ? -3.105  27.295  39.970 1.00 76.97  ? 55  VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 55  ? -2.386  25.847  41.913 1.00 74.82  ? 55  VAL A CG2 1 
ATOM   283  N  N   . GLU A 1 56  ? -3.277  30.293  41.322 1.00 80.68  ? 56  GLU A N   1 
ATOM   284  C  CA  . GLU A 1 56  ? -3.756  31.507  40.649 1.00 83.47  ? 56  GLU A CA  1 
ATOM   285  C  C   . GLU A 1 56  ? -4.069  31.188  39.195 1.00 88.79  ? 56  GLU A C   1 
ATOM   286  O  O   . GLU A 1 56  ? -3.318  30.419  38.566 1.00 86.04  ? 56  GLU A O   1 
ATOM   287  C  CB  . GLU A 1 56  ? -2.739  32.653  40.738 1.00 84.24  ? 56  GLU A CB  1 
ATOM   288  C  CG  . GLU A 1 56  ? -3.390  34.027  40.723 1.00 97.85  ? 56  GLU A CG  1 
ATOM   289  C  CD  . GLU A 1 56  ? -2.555  35.159  40.152 1.00 122.41 ? 56  GLU A CD  1 
ATOM   290  O  OE1 . GLU A 1 56  ? -1.327  35.194  40.408 1.00 111.23 ? 56  GLU A OE1 1 
ATOM   291  O  OE2 . GLU A 1 56  ? -3.143  36.035  39.473 1.00 120.70 ? 56  GLU A OE2 1 
ATOM   292  N  N   . ASN A 1 57  ? -5.204  31.764  38.677 1.00 87.87  ? 57  ASN A N   1 
ATOM   293  C  CA  . ASN A 1 57  ? -5.730  31.586  37.309 1.00 88.30  ? 57  ASN A CA  1 
ATOM   294  C  C   . ASN A 1 57  ? -5.826  30.070  36.935 1.00 89.74  ? 57  ASN A C   1 
ATOM   295  O  O   . ASN A 1 57  ? -5.533  29.647  35.811 1.00 88.80  ? 57  ASN A O   1 
ATOM   296  C  CB  . ASN A 1 57  ? -4.927  32.424  36.269 1.00 89.39  ? 57  ASN A CB  1 
ATOM   297  C  CG  . ASN A 1 57  ? -4.653  33.890  36.610 1.00 115.79 ? 57  ASN A CG  1 
ATOM   298  O  OD1 . ASN A 1 57  ? -3.662  34.478  36.153 1.00 107.45 ? 57  ASN A OD1 1 
ATOM   299  N  ND2 . ASN A 1 57  ? -5.527  34.535  37.377 1.00 111.27 ? 57  ASN A ND2 1 
ATOM   300  N  N   . GLY A 1 58  ? -6.199  29.289  37.941 1.00 84.49  ? 58  GLY A N   1 
ATOM   301  C  CA  . GLY A 1 58  ? -6.387  27.847  37.921 1.00 82.74  ? 58  GLY A CA  1 
ATOM   302  C  C   . GLY A 1 58  ? -7.321  27.505  39.065 1.00 86.59  ? 58  GLY A C   1 
ATOM   303  O  O   . GLY A 1 58  ? -7.648  28.387  39.873 1.00 87.95  ? 58  GLY A O   1 
ATOM   304  N  N   . LYS A 1 59  ? -7.765  26.235  39.154 1.00 80.74  ? 59  LYS A N   1 
ATOM   305  C  CA  . LYS A 1 59  ? -8.690  25.783  40.209 1.00 80.44  ? 59  LYS A CA  1 
ATOM   306  C  C   . LYS A 1 59  ? -8.021  25.602  41.603 1.00 79.22  ? 59  LYS A C   1 
ATOM   307  O  O   . LYS A 1 59  ? -7.035  26.282  41.920 1.00 78.11  ? 59  LYS A O   1 
ATOM   308  C  CB  . LYS A 1 59  ? -9.448  24.520  39.760 1.00 83.15  ? 59  LYS A CB  1 
ATOM   309  N  N   . THR A 1 60  ? -8.589  24.725  42.445 1.00 71.90  ? 60  THR A N   1 
ATOM   310  C  CA  . THR A 1 60  ? -8.041  24.445  43.767 1.00 68.47  ? 60  THR A CA  1 
ATOM   311  C  C   . THR A 1 60  ? -7.695  22.958  43.903 1.00 68.32  ? 60  THR A C   1 
ATOM   312  O  O   . THR A 1 60  ? -8.452  22.087  43.458 1.00 68.06  ? 60  THR A O   1 
ATOM   313  C  CB  . THR A 1 60  ? -8.887  25.086  44.896 1.00 71.28  ? 60  THR A CB  1 
ATOM   314  O  OG1 . THR A 1 60  ? -8.094  25.192  46.075 1.00 62.16  ? 60  THR A OG1 1 
ATOM   315  C  CG2 . THR A 1 60  ? -10.200 24.333  45.194 1.00 71.93  ? 60  THR A CG2 1 
ATOM   316  N  N   . ILE A 1 61  ? -6.522  22.666  44.451 1.00 61.73  ? 61  ILE A N   1 
ATOM   317  C  CA  . ILE A 1 61  ? -6.149  21.268  44.628 1.00 59.64  ? 61  ILE A CA  1 
ATOM   318  C  C   . ILE A 1 61  ? -6.607  20.841  46.023 1.00 65.46  ? 61  ILE A C   1 
ATOM   319  O  O   . ILE A 1 61  ? -6.624  21.641  46.965 1.00 66.06  ? 61  ILE A O   1 
ATOM   320  C  CB  . ILE A 1 61  ? -4.661  20.908  44.300 1.00 59.20  ? 61  ILE A CB  1 
ATOM   321  C  CG1 . ILE A 1 61  ? -4.130  21.678  43.073 1.00 58.78  ? 61  ILE A CG1 1 
ATOM   322  C  CG2 . ILE A 1 61  ? -4.523  19.408  44.055 1.00 58.50  ? 61  ILE A CG2 1 
ATOM   323  C  CD1 . ILE A 1 61  ? -2.662  22.004  43.095 1.00 60.42  ? 61  ILE A CD1 1 
ATOM   324  N  N   . GLN A 1 62  ? -7.073  19.608  46.119 1.00 62.05  ? 62  GLN A N   1 
ATOM   325  C  CA  . GLN A 1 62  ? -7.533  19.034  47.360 1.00 62.16  ? 62  GLN A CA  1 
ATOM   326  C  C   . GLN A 1 62  ? -6.857  17.678  47.485 1.00 64.69  ? 62  GLN A C   1 
ATOM   327  O  O   . GLN A 1 62  ? -6.733  16.937  46.500 1.00 63.12  ? 62  GLN A O   1 
ATOM   328  C  CB  . GLN A 1 62  ? -9.069  18.878  47.370 1.00 66.16  ? 62  GLN A CB  1 
ATOM   329  C  CG  . GLN A 1 62  ? -9.876  20.174  47.179 1.00 85.30  ? 62  GLN A CG  1 
ATOM   330  C  CD  . GLN A 1 62  ? -10.106 20.968  48.446 1.00 107.34 ? 62  GLN A CD  1 
ATOM   331  O  OE1 . GLN A 1 62  ? -10.306 20.418  49.542 1.00 102.40 ? 62  GLN A OE1 1 
ATOM   332  N  NE2 . GLN A 1 62  ? -10.163 22.288  48.306 1.00 99.49  ? 62  GLN A NE2 1 
ATOM   333  N  N   . PHE A 1 63  ? -6.357  17.394  48.686 1.00 60.88  ? 63  PHE A N   1 
ATOM   334  C  CA  . PHE A 1 63  ? -5.774  16.119  49.043 1.00 58.89  ? 63  PHE A CA  1 
ATOM   335  C  C   . PHE A 1 63  ? -6.628  15.663  50.192 1.00 63.62  ? 63  PHE A C   1 
ATOM   336  O  O   . PHE A 1 63  ? -6.487  16.156  51.317 1.00 63.21  ? 63  PHE A O   1 
ATOM   337  C  CB  . PHE A 1 63  ? -4.288  16.228  49.444 1.00 58.43  ? 63  PHE A CB  1 
ATOM   338  C  CG  . PHE A 1 63  ? -3.269  16.200  48.320 1.00 58.51  ? 63  PHE A CG  1 
ATOM   339  C  CD1 . PHE A 1 63  ? -3.672  16.217  46.985 1.00 61.80  ? 63  PHE A CD1 1 
ATOM   340  C  CD2 . PHE A 1 63  ? -1.903  16.183  48.598 1.00 58.66  ? 63  PHE A CD2 1 
ATOM   341  C  CE1 . PHE A 1 63  ? -2.729  16.203  45.953 1.00 61.31  ? 63  PHE A CE1 1 
ATOM   342  C  CE2 . PHE A 1 63  ? -0.959  16.168  47.563 1.00 59.79  ? 63  PHE A CE2 1 
ATOM   343  C  CZ  . PHE A 1 63  ? -1.378  16.192  46.249 1.00 58.37  ? 63  PHE A CZ  1 
ATOM   344  N  N   . GLY A 1 64  ? -7.585  14.803  49.867 1.00 60.90  ? 64  GLY A N   1 
ATOM   345  C  CA  . GLY A 1 64  ? -8.477  14.217  50.850 1.00 62.07  ? 64  GLY A CA  1 
ATOM   346  C  C   . GLY A 1 64  ? -7.754  13.140  51.625 1.00 65.00  ? 64  GLY A C   1 
ATOM   347  O  O   . GLY A 1 64  ? -6.611  12.808  51.311 1.00 61.54  ? 64  GLY A O   1 
ATOM   348  N  N   . GLU A 1 65  ? -8.428  12.573  52.628 1.00 65.04  ? 65  GLU A N   1 
ATOM   349  C  CA  . GLU A 1 65  ? -7.912  11.492  53.478 1.00 64.42  ? 65  GLU A CA  1 
ATOM   350  C  C   . GLU A 1 65  ? -7.064  10.463  52.668 1.00 65.73  ? 65  GLU A C   1 
ATOM   351  O  O   . GLU A 1 65  ? -5.835  10.382  52.836 1.00 62.16  ? 65  GLU A O   1 
ATOM   352  C  CB  . GLU A 1 65  ? -9.090  10.795  54.204 1.00 67.81  ? 65  GLU A CB  1 
ATOM   353  C  CG  . GLU A 1 65  ? -9.962  11.730  55.037 1.00 83.35  ? 65  GLU A CG  1 
ATOM   354  C  CD  . GLU A 1 65  ? -9.411  12.176  56.383 1.00 106.76 ? 65  GLU A CD  1 
ATOM   355  O  OE1 . GLU A 1 65  ? -9.580  13.370  56.721 1.00 105.21 ? 65  GLU A OE1 1 
ATOM   356  O  OE2 . GLU A 1 65  ? -8.845  11.331  57.115 1.00 98.83  ? 65  GLU A OE2 1 
ATOM   357  N  N   . GLU A 1 66  ? -7.741  9.761   51.735 1.00 63.01  ? 66  GLU A N   1 
ATOM   358  C  CA  . GLU A 1 66  ? -7.204  8.736   50.848 1.00 61.29  ? 66  GLU A CA  1 
ATOM   359  C  C   . GLU A 1 66  ? -6.123  9.256   49.910 1.00 62.36  ? 66  GLU A C   1 
ATOM   360  O  O   . GLU A 1 66  ? -5.147  8.538   49.679 1.00 59.72  ? 66  GLU A O   1 
ATOM   361  C  CB  . GLU A 1 66  ? -8.333  8.049   50.050 1.00 64.43  ? 66  GLU A CB  1 
ATOM   362  C  CG  . GLU A 1 66  ? -9.427  7.402   50.883 1.00 75.32  ? 66  GLU A CG  1 
ATOM   363  C  CD  . GLU A 1 66  ? -8.939  6.354   51.860 1.00 98.85  ? 66  GLU A CD  1 
ATOM   364  O  OE1 . GLU A 1 66  ? -8.436  5.304   51.399 1.00 100.78 ? 66  GLU A OE1 1 
ATOM   365  O  OE2 . GLU A 1 66  ? -9.019  6.601   53.085 1.00 93.12  ? 66  GLU A OE2 1 
ATOM   366  N  N   . MET A 1 67  ? -6.294  10.477  49.354 1.00 59.76  ? 67  MET A N   1 
ATOM   367  C  CA  . MET A 1 67  ? -5.286  11.062  48.450 1.00 58.77  ? 67  MET A CA  1 
ATOM   368  C  C   . MET A 1 67  ? -3.996  11.406  49.213 1.00 56.77  ? 67  MET A C   1 
ATOM   369  O  O   . MET A 1 67  ? -2.895  11.185  48.698 1.00 52.91  ? 67  MET A O   1 
ATOM   370  C  CB  . MET A 1 67  ? -5.842  12.285  47.680 1.00 63.35  ? 67  MET A CB  1 
ATOM   371  C  CG  . MET A 1 67  ? -4.924  12.778  46.519 1.00 66.30  ? 67  MET A CG  1 
ATOM   372  S  SD  . MET A 1 67  ? -4.854  11.740  45.020 1.00 69.84  ? 67  MET A SD  1 
ATOM   373  C  CE  . MET A 1 67  ? -6.483  12.110  44.333 1.00 69.48  ? 67  MET A CE  1 
ATOM   374  N  N   . MET A 1 68  ? -4.156  11.914  50.456 1.00 52.50  ? 68  MET A N   1 
ATOM   375  C  CA  . MET A 1 68  ? -3.068  12.263  51.367 1.00 49.73  ? 68  MET A CA  1 
ATOM   376  C  C   . MET A 1 68  ? -2.289  11.011  51.753 1.00 48.28  ? 68  MET A C   1 
ATOM   377  O  O   . MET A 1 68  ? -1.061  11.033  51.700 1.00 44.48  ? 68  MET A O   1 
ATOM   378  C  CB  . MET A 1 68  ? -3.601  12.991  52.609 1.00 53.28  ? 68  MET A CB  1 
ATOM   379  C  CG  . MET A 1 68  ? -2.516  13.530  53.512 1.00 55.58  ? 68  MET A CG  1 
ATOM   380  S  SD  . MET A 1 68  ? -1.563  14.850  52.747 1.00 58.81  ? 68  MET A SD  1 
ATOM   381  C  CE  . MET A 1 68  ? -1.690  16.073  53.962 1.00 56.24  ? 68  MET A CE  1 
ATOM   382  N  N   . LYS A 1 69  ? -3.002  9.906   52.082 1.00 45.01  ? 69  LYS A N   1 
ATOM   383  C  CA  . LYS A 1 69  ? -2.354  8.628   52.410 1.00 43.06  ? 69  LYS A CA  1 
ATOM   384  C  C   . LYS A 1 69  ? -1.527  8.149   51.208 1.00 46.76  ? 69  LYS A C   1 
ATOM   385  O  O   . LYS A 1 69  ? -0.418  7.637   51.404 1.00 45.79  ? 69  LYS A O   1 
ATOM   386  C  CB  . LYS A 1 69  ? -3.354  7.559   52.885 1.00 44.60  ? 69  LYS A CB  1 
ATOM   387  C  CG  . LYS A 1 69  ? -3.880  7.792   54.295 1.00 45.56  ? 69  LYS A CG  1 
ATOM   388  C  CD  . LYS A 1 69  ? -4.789  6.654   54.752 1.00 57.77  ? 69  LYS A CD  1 
ATOM   389  C  CE  . LYS A 1 69  ? -5.775  7.064   55.826 1.00 73.72  ? 69  LYS A CE  1 
ATOM   390  N  NZ  . LYS A 1 69  ? -7.139  7.364   55.284 1.00 82.43  ? 69  LYS A NZ  1 
ATOM   391  N  N   . ARG A 1 70  ? -2.032  8.402   49.968 1.00 42.45  ? 70  ARG A N   1 
ATOM   392  C  CA  . ARG A 1 70  ? -1.326  8.061   48.736 1.00 40.21  ? 70  ARG A CA  1 
ATOM   393  C  C   . ARG A 1 70  ? -0.073  8.913   48.689 1.00 42.36  ? 70  ARG A C   1 
ATOM   394  O  O   . ARG A 1 70  ? 1.023   8.362   48.655 1.00 39.88  ? 70  ARG A O   1 
ATOM   395  C  CB  . ARG A 1 70  ? -2.200  8.287   47.470 1.00 39.61  ? 70  ARG A CB  1 
ATOM   396  C  CG  . ARG A 1 70  ? -1.772  7.401   46.294 1.00 41.39  ? 70  ARG A CG  1 
ATOM   397  C  CD  . ARG A 1 70  ? -2.140  7.888   44.895 1.00 38.71  ? 70  ARG A CD  1 
ATOM   398  N  NE  . ARG A 1 70  ? -1.120  7.459   43.930 1.00 37.52  ? 70  ARG A NE  1 
ATOM   399  C  CZ  . ARG A 1 70  ? -1.102  7.762   42.632 1.00 49.00  ? 70  ARG A CZ  1 
ATOM   400  N  NH1 . ARG A 1 70  ? -2.085  8.472   42.095 1.00 27.98  ? 70  ARG A NH1 1 
ATOM   401  N  NH2 . ARG A 1 70  ? -0.101  7.353   41.861 1.00 39.90  ? 70  ARG A NH2 1 
ATOM   402  N  N   . ALA A 1 71  ? -0.241  10.251  48.793 1.00 40.56  ? 71  ALA A N   1 
ATOM   403  C  CA  . ALA A 1 71  ? 0.831   11.248  48.742 1.00 39.71  ? 71  ALA A CA  1 
ATOM   404  C  C   . ALA A 1 71  ? 1.953   11.023  49.752 1.00 43.80  ? 71  ALA A C   1 
ATOM   405  O  O   . ALA A 1 71  ? 3.110   11.297  49.429 1.00 42.07  ? 71  ALA A O   1 
ATOM   406  C  CB  . ALA A 1 71  ? 0.254   12.643  48.902 1.00 41.53  ? 71  ALA A CB  1 
ATOM   407  N  N   . LEU A 1 72  ? 1.609   10.513  50.962 1.00 41.58  ? 72  LEU A N   1 
ATOM   408  C  CA  . LEU A 1 72  ? 2.551   10.277  52.065 1.00 40.06  ? 72  LEU A CA  1 
ATOM   409  C  C   . LEU A 1 72  ? 3.242   8.925   52.015 1.00 44.94  ? 72  LEU A C   1 
ATOM   410  O  O   . LEU A 1 72  ? 4.238   8.729   52.721 1.00 44.76  ? 72  LEU A O   1 
ATOM   411  C  CB  . LEU A 1 72  ? 1.904   10.524  53.451 1.00 40.44  ? 72  LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 72  ? 1.388   11.948  53.770 1.00 45.26  ? 72  LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 72  ? 1.006   12.054  55.195 1.00 45.93  ? 72  LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 72  ? 2.413   13.051  53.437 1.00 44.58  ? 72  LEU A CD2 1 
ATOM   415  N  N   . GLN A 1 73  ? 2.717   7.993   51.194 1.00 41.33  ? 73  GLN A N   1 
ATOM   416  C  CA  . GLN A 1 73  ? 3.284   6.654   51.000 1.00 39.40  ? 73  GLN A CA  1 
ATOM   417  C  C   . GLN A 1 73  ? 4.238   6.653   49.788 1.00 40.92  ? 73  GLN A C   1 
ATOM   418  O  O   . GLN A 1 73  ? 4.216   7.599   49.003 1.00 39.22  ? 73  GLN A O   1 
ATOM   419  C  CB  . GLN A 1 73  ? 2.167   5.604   50.824 1.00 41.35  ? 73  GLN A CB  1 
ATOM   420  C  CG  . GLN A 1 73  ? 2.649   4.153   50.759 1.00 45.00  ? 73  GLN A CG  1 
ATOM   421  C  CD  . GLN A 1 73  ? 3.252   3.670   52.061 1.00 55.38  ? 73  GLN A CD  1 
ATOM   422  O  OE1 . GLN A 1 73  ? 4.468   3.761   52.297 1.00 41.93  ? 73  GLN A OE1 1 
ATOM   423  N  NE2 . GLN A 1 73  ? 2.409   3.126   52.928 1.00 50.52  ? 73  GLN A NE2 1 
ATOM   424  N  N   . TYR A 1 74  ? 5.075   5.583   49.666 1.00 36.55  ? 74  TYR A N   1 
ATOM   425  C  CA  . TYR A 1 74  ? 6.052   5.300   48.614 1.00 34.90  ? 74  TYR A CA  1 
ATOM   426  C  C   . TYR A 1 74  ? 5.375   5.272   47.230 1.00 44.19  ? 74  TYR A C   1 
ATOM   427  O  O   . TYR A 1 74  ? 4.164   5.005   47.123 1.00 45.41  ? 74  TYR A O   1 
ATOM   428  C  CB  . TYR A 1 74  ? 6.743   3.944   48.862 1.00 33.68  ? 74  TYR A CB  1 
ATOM   429  C  CG  . TYR A 1 74  ? 7.775   3.880   49.975 1.00 32.85  ? 74  TYR A CG  1 
ATOM   430  C  CD1 . TYR A 1 74  ? 8.983   4.565   49.875 1.00 33.10  ? 74  TYR A CD1 1 
ATOM   431  C  CD2 . TYR A 1 74  ? 7.614   3.011   51.048 1.00 33.48  ? 74  TYR A CD2 1 
ATOM   432  C  CE1 . TYR A 1 74  ? 9.952   4.480   50.873 1.00 31.19  ? 74  TYR A CE1 1 
ATOM   433  C  CE2 . TYR A 1 74  ? 8.597   2.879   52.027 1.00 33.47  ? 74  TYR A CE2 1 
ATOM   434  C  CZ  . TYR A 1 74  ? 9.767   3.614   51.935 1.00 36.93  ? 74  TYR A CZ  1 
ATOM   435  O  OH  . TYR A 1 74  ? 10.728  3.488   52.915 1.00 34.47  ? 74  TYR A OH  1 
ATOM   436  N  N   . SER A 1 75  ? 6.169   5.541   46.173 1.00 42.06  ? 75  SER A N   1 
ATOM   437  C  CA  . SER A 1 75  ? 5.668   5.591   44.808 1.00 43.25  ? 75  SER A CA  1 
ATOM   438  C  C   . SER A 1 75  ? 6.498   4.777   43.760 1.00 47.34  ? 75  SER A C   1 
ATOM   439  O  O   . SER A 1 75  ? 7.674   4.453   44.015 1.00 44.58  ? 75  SER A O   1 
ATOM   440  C  CB  . SER A 1 75  ? 5.401   7.039   44.386 1.00 47.68  ? 75  SER A CB  1 
ATOM   441  O  OG  . SER A 1 75  ? 6.517   7.688   43.796 1.00 61.20  ? 75  SER A OG  1 
ATOM   442  N  N   . PRO A 1 76  ? 5.865   4.478   42.579 1.00 45.40  ? 76  PRO A N   1 
ATOM   443  C  CA  . PRO A 1 76  ? 6.509   3.660   41.529 1.00 45.01  ? 76  PRO A CA  1 
ATOM   444  C  C   . PRO A 1 76  ? 8.019   3.617   41.255 1.00 48.15  ? 76  PRO A C   1 
ATOM   445  O  O   . PRO A 1 76  ? 8.466   2.544   40.794 1.00 49.20  ? 76  PRO A O   1 
ATOM   446  C  CB  . PRO A 1 76  ? 5.731   4.021   40.268 1.00 47.74  ? 76  PRO A CB  1 
ATOM   447  C  CG  . PRO A 1 76  ? 4.444   4.537   40.739 1.00 53.41  ? 76  PRO A CG  1 
ATOM   448  C  CD  . PRO A 1 76  ? 4.472   4.788   42.199 1.00 48.25  ? 76  PRO A CD  1 
ATOM   449  N  N   . SER A 1 77  ? 8.785   4.735   41.479 1.00 41.21  ? 77  SER A N   1 
ATOM   450  C  CA  . SER A 1 77  ? 10.246  4.854   41.245 1.00 39.87  ? 77  SER A CA  1 
ATOM   451  C  C   . SER A 1 77  ? 10.584  5.587   39.973 1.00 44.12  ? 77  SER A C   1 
ATOM   452  O  O   . SER A 1 77  ? 11.451  6.453   40.003 1.00 43.97  ? 77  SER A O   1 
ATOM   453  C  CB  . SER A 1 77  ? 11.003  3.522   41.330 1.00 42.88  ? 77  SER A CB  1 
ATOM   454  O  OG  . SER A 1 77  ? 12.416  3.655   41.412 1.00 44.80  ? 77  SER A OG  1 
ATOM   455  N  N   . ALA A 1 78  ? 9.926   5.268   38.856 1.00 41.50  ? 78  ALA A N   1 
ATOM   456  C  CA  . ALA A 1 78  ? 10.146  6.018   37.613 1.00 41.40  ? 78  ALA A CA  1 
ATOM   457  C  C   . ALA A 1 78  ? 9.206   7.237   37.575 1.00 46.43  ? 78  ALA A C   1 
ATOM   458  O  O   . ALA A 1 78  ? 9.337   8.087   36.694 1.00 47.44  ? 78  ALA A O   1 
ATOM   459  C  CB  . ALA A 1 78  ? 9.902   5.132   36.409 1.00 42.72  ? 78  ALA A CB  1 
ATOM   460  N  N   . GLY A 1 79  ? 8.286   7.306   38.544 1.00 42.41  ? 79  GLY A N   1 
ATOM   461  C  CA  . GLY A 1 79  ? 7.295   8.368   38.683 1.00 42.25  ? 79  GLY A CA  1 
ATOM   462  C  C   . GLY A 1 79  ? 5.864   7.868   38.821 1.00 44.48  ? 79  GLY A C   1 
ATOM   463  O  O   . GLY A 1 79  ? 5.570   6.712   38.483 1.00 43.21  ? 79  GLY A O   1 
ATOM   464  N  N   . ILE A 1 80  ? 4.960   8.752   39.309 1.00 40.60  ? 80  ILE A N   1 
ATOM   465  C  CA  . ILE A 1 80  ? 3.540   8.445   39.477 1.00 41.96  ? 80  ILE A CA  1 
ATOM   466  C  C   . ILE A 1 80  ? 2.870   8.248   38.075 1.00 48.78  ? 80  ILE A C   1 
ATOM   467  O  O   . ILE A 1 80  ? 3.160   9.038   37.153 1.00 49.31  ? 80  ILE A O   1 
ATOM   468  C  CB  . ILE A 1 80  ? 2.788   9.389   40.472 1.00 45.87  ? 80  ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 80  ? 2.638   10.822  39.948 1.00 47.70  ? 80  ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 80  ? 3.456   9.405   41.832 1.00 44.62  ? 80  ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 80  ? 1.245   11.387  39.950 1.00 55.75  ? 80  ILE A CD1 1 
ATOM   472  N  N   . PRO A 1 81  ? 2.083   7.141   37.874 1.00 44.96  ? 81  PRO A N   1 
ATOM   473  C  CA  . PRO A 1 81  ? 1.525   6.826   36.538 1.00 44.77  ? 81  PRO A CA  1 
ATOM   474  C  C   . PRO A 1 81  ? 0.913   7.942   35.693 1.00 46.10  ? 81  PRO A C   1 
ATOM   475  O  O   . PRO A 1 81  ? 1.132   7.969   34.472 1.00 44.74  ? 81  PRO A O   1 
ATOM   476  C  CB  . PRO A 1 81  ? 0.520   5.697   36.824 1.00 47.65  ? 81  PRO A CB  1 
ATOM   477  C  CG  . PRO A 1 81  ? 0.365   5.669   38.317 1.00 52.14  ? 81  PRO A CG  1 
ATOM   478  C  CD  . PRO A 1 81  ? 1.684   6.108   38.848 1.00 46.18  ? 81  PRO A CD  1 
ATOM   479  N  N   . GLU A 1 82  ? 0.133   8.834   36.335 1.00 41.61  ? 82  GLU A N   1 
ATOM   480  C  CA  . GLU A 1 82  ? -0.544  9.956   35.675 1.00 42.41  ? 82  GLU A CA  1 
ATOM   481  C  C   . GLU A 1 82  ? 0.398   11.137  35.348 1.00 42.47  ? 82  GLU A C   1 
ATOM   482  O  O   . GLU A 1 82  ? 0.180   11.859  34.364 1.00 39.82  ? 82  GLU A O   1 
ATOM   483  C  CB  . GLU A 1 82  ? -1.858  10.364  36.388 1.00 45.64  ? 82  GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 82  ? -1.772  10.577  37.893 1.00 56.65  ? 82  GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 82  ? -1.665  9.319   38.731 1.00 72.88  ? 82  GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 82  ? -0.532  8.808   38.873 1.00 58.11  ? 82  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 82  ? -2.709  8.829   39.222 1.00 68.39  ? 82  GLU A OE2 1 
ATOM   488  N  N   . LEU A 1 83  ? 1.483   11.286  36.138 1.00 37.60  ? 83  LEU A N   1 
ATOM   489  C  CA  . LEU A 1 83  ? 2.492   12.291  35.830 1.00 36.22  ? 83  LEU A CA  1 
ATOM   490  C  C   . LEU A 1 83  ? 3.270   11.806  34.597 1.00 41.54  ? 83  LEU A C   1 
ATOM   491  O  O   . LEU A 1 83  ? 3.473   12.596  33.665 1.00 40.62  ? 83  LEU A O   1 
ATOM   492  C  CB  . LEU A 1 83  ? 3.431   12.524  37.020 1.00 33.89  ? 83  LEU A CB  1 
ATOM   493  C  CG  . LEU A 1 83  ? 4.488   13.638  36.908 1.00 36.07  ? 83  LEU A CG  1 
ATOM   494  C  CD1 . LEU A 1 83  ? 3.865   15.005  36.581 1.00 36.94  ? 83  LEU A CD1 1 
ATOM   495  C  CD2 . LEU A 1 83  ? 5.261   13.746  38.197 1.00 35.61  ? 83  LEU A CD2 1 
ATOM   496  N  N   . LEU A 1 84  ? 3.638   10.487  34.576 1.00 38.97  ? 84  LEU A N   1 
ATOM   497  C  CA  . LEU A 1 84  ? 4.346   9.847   33.464 1.00 39.39  ? 84  LEU A CA  1 
ATOM   498  C  C   . LEU A 1 84  ? 3.543   9.851   32.144 1.00 49.23  ? 84  LEU A C   1 
ATOM   499  O  O   . LEU A 1 84  ? 4.129   10.054  31.076 1.00 49.68  ? 84  LEU A O   1 
ATOM   500  C  CB  . LEU A 1 84  ? 4.788   8.425   33.824 1.00 38.44  ? 84  LEU A CB  1 
ATOM   501  C  CG  . LEU A 1 84  ? 6.117   8.270   34.582 1.00 41.58  ? 84  LEU A CG  1 
ATOM   502  C  CD1 . LEU A 1 84  ? 6.312   6.823   35.048 1.00 40.90  ? 84  LEU A CD1 1 
ATOM   503  C  CD2 . LEU A 1 84  ? 7.342   8.738   33.744 1.00 43.16  ? 84  LEU A CD2 1 
ATOM   504  N  N   . SER A 1 85  ? 2.208   9.652   32.224 1.00 48.75  ? 85  SER A N   1 
ATOM   505  C  CA  . SER A 1 85  ? 1.313   9.655   31.065 1.00 50.34  ? 85  SER A CA  1 
ATOM   506  C  C   . SER A 1 85  ? 1.160   11.067  30.470 1.00 54.52  ? 85  SER A C   1 
ATOM   507  O  O   . SER A 1 85  ? 1.337   11.244  29.257 1.00 53.54  ? 85  SER A O   1 
ATOM   508  C  CB  . SER A 1 85  ? -0.046  9.069   31.439 1.00 55.84  ? 85  SER A CB  1 
ATOM   509  O  OG  . SER A 1 85  ? -0.829  9.974   32.200 1.00 68.21  ? 85  SER A OG  1 
ATOM   510  N  N   . TRP A 1 86  ? 0.843   12.064  31.333 1.00 52.25  ? 86  TRP A N   1 
ATOM   511  C  CA  . TRP A 1 86  ? 0.661   13.467  30.952 1.00 53.55  ? 86  TRP A CA  1 
ATOM   512  C  C   . TRP A 1 86  ? 1.920   14.016  30.274 1.00 54.03  ? 86  TRP A C   1 
ATOM   513  O  O   . TRP A 1 86  ? 1.819   14.641  29.217 1.00 53.98  ? 86  TRP A O   1 
ATOM   514  C  CB  . TRP A 1 86  ? 0.268   14.317  32.168 1.00 53.55  ? 86  TRP A CB  1 
ATOM   515  C  CG  . TRP A 1 86  ? -0.409  15.609  31.809 1.00 56.81  ? 86  TRP A CG  1 
ATOM   516  C  CD1 . TRP A 1 86  ? -1.753  15.853  31.763 1.00 61.91  ? 86  TRP A CD1 1 
ATOM   517  C  CD2 . TRP A 1 86  ? 0.235   16.825  31.401 1.00 56.63  ? 86  TRP A CD2 1 
ATOM   518  N  NE1 . TRP A 1 86  ? -1.987  17.153  31.365 1.00 62.45  ? 86  TRP A NE1 1 
ATOM   519  C  CE2 . TRP A 1 86  ? -0.786  17.766  31.117 1.00 62.50  ? 86  TRP A CE2 1 
ATOM   520  C  CE3 . TRP A 1 86  ? 1.582   17.210  31.241 1.00 56.17  ? 86  TRP A CE3 1 
ATOM   521  C  CZ2 . TRP A 1 86  ? -0.506  19.057  30.666 1.00 62.09  ? 86  TRP A CZ2 1 
ATOM   522  C  CZ3 . TRP A 1 86  ? 1.859   18.493  30.805 1.00 58.06  ? 86  TRP A CZ3 1 
ATOM   523  C  CH2 . TRP A 1 86  ? 0.824   19.404  30.532 1.00 60.80  ? 86  TRP A CH2 1 
ATOM   524  N  N   . LEU A 1 87  ? 3.103   13.733  30.864 1.00 47.23  ? 87  LEU A N   1 
ATOM   525  C  CA  . LEU A 1 87  ? 4.422   14.093  30.335 1.00 44.44  ? 87  LEU A CA  1 
ATOM   526  C  C   . LEU A 1 87  ? 4.689   13.368  28.991 1.00 46.21  ? 87  LEU A C   1 
ATOM   527  O  O   . LEU A 1 87  ? 5.057   14.036  28.014 1.00 45.18  ? 87  LEU A O   1 
ATOM   528  C  CB  . LEU A 1 87  ? 5.513   13.783  31.378 1.00 42.21  ? 87  LEU A CB  1 
ATOM   529  C  CG  . LEU A 1 87  ? 6.091   14.960  32.179 1.00 45.63  ? 87  LEU A CG  1 
ATOM   530  C  CD1 . LEU A 1 87  ? 5.109   16.111  32.313 1.00 47.24  ? 87  LEU A CD1 1 
ATOM   531  C  CD2 . LEU A 1 87  ? 6.591   14.518  33.550 1.00 45.22  ? 87  LEU A CD2 1 
ATOM   532  N  N   . LYS A 1 88  ? 4.427   12.027  28.923 1.00 41.33  ? 88  LYS A N   1 
ATOM   533  C  CA  . LYS A 1 88  ? 4.566   11.258  27.681 1.00 41.62  ? 88  LYS A CA  1 
ATOM   534  C  C   . LYS A 1 88  ? 3.788   11.964  26.530 1.00 47.68  ? 88  LYS A C   1 
ATOM   535  O  O   . LYS A 1 88  ? 4.363   12.236  25.471 1.00 45.55  ? 88  LYS A O   1 
ATOM   536  C  CB  . LYS A 1 88  ? 4.070   9.806   27.858 1.00 44.02  ? 88  LYS A CB  1 
ATOM   537  C  CG  . LYS A 1 88  ? 4.537   8.860   26.734 1.00 54.23  ? 88  LYS A CG  1 
ATOM   538  C  CD  . LYS A 1 88  ? 3.599   7.679   26.463 1.00 57.27  ? 88  LYS A CD  1 
ATOM   539  C  CE  . LYS A 1 88  ? 3.998   6.910   25.222 1.00 58.73  ? 88  LYS A CE  1 
ATOM   540  N  NZ  . LYS A 1 88  ? 3.305   5.597   25.129 1.00 64.27  ? 88  LYS A NZ  1 
ATOM   541  N  N   . GLN A 1 89  ? 2.507   12.324  26.801 1.00 46.63  ? 89  GLN A N   1 
ATOM   542  C  CA  . GLN A 1 89  ? 1.612   13.022  25.882 1.00 48.07  ? 89  GLN A CA  1 
ATOM   543  C  C   . GLN A 1 89  ? 2.181   14.307  25.390 1.00 51.76  ? 89  GLN A C   1 
ATOM   544  O  O   . GLN A 1 89  ? 2.059   14.597  24.206 1.00 52.19  ? 89  GLN A O   1 
ATOM   545  C  CB  . GLN A 1 89  ? 0.234   13.255  26.513 1.00 51.06  ? 89  GLN A CB  1 
ATOM   546  C  CG  . GLN A 1 89  ? -0.678  12.040  26.376 1.00 79.36  ? 89  GLN A CG  1 
ATOM   547  C  CD  . GLN A 1 89  ? -0.636  11.417  24.987 1.00 102.21 ? 89  GLN A CD  1 
ATOM   548  O  OE1 . GLN A 1 89  ? -1.081  12.010  23.995 1.00 100.74 ? 89  GLN A OE1 1 
ATOM   549  N  NE2 . GLN A 1 89  ? -0.061  10.219  24.885 1.00 88.46  ? 89  GLN A NE2 1 
ATOM   550  N  N   . LEU A 1 90  ? 2.843   15.056  26.296 1.00 47.44  ? 90  LEU A N   1 
ATOM   551  C  CA  . LEU A 1 90  ? 3.485   16.350  26.045 1.00 46.11  ? 90  LEU A CA  1 
ATOM   552  C  C   . LEU A 1 90  ? 4.716   16.164  25.203 1.00 45.52  ? 90  LEU A C   1 
ATOM   553  O  O   . LEU A 1 90  ? 4.880   16.896  24.233 1.00 44.11  ? 90  LEU A O   1 
ATOM   554  C  CB  . LEU A 1 90  ? 3.864   17.002  27.380 1.00 45.02  ? 90  LEU A CB  1 
ATOM   555  C  CG  . LEU A 1 90  ? 4.335   18.449  27.359 1.00 49.19  ? 90  LEU A CG  1 
ATOM   556  C  CD1 . LEU A 1 90  ? 3.213   19.412  26.912 1.00 50.92  ? 90  LEU A CD1 1 
ATOM   557  C  CD2 . LEU A 1 90  ? 4.872   18.838  28.734 1.00 49.72  ? 90  LEU A CD2 1 
ATOM   558  N  N   . GLN A 1 91  ? 5.570   15.175  25.557 1.00 39.44  ? 91  GLN A N   1 
ATOM   559  C  CA  . GLN A 1 91  ? 6.785   14.893  24.800 1.00 37.99  ? 91  GLN A CA  1 
ATOM   560  C  C   . GLN A 1 91  ? 6.492   14.558  23.322 1.00 45.74  ? 91  GLN A C   1 
ATOM   561  O  O   . GLN A 1 91  ? 7.231   15.022  22.454 1.00 46.88  ? 91  GLN A O   1 
ATOM   562  C  CB  . GLN A 1 91  ? 7.691   13.860  25.497 1.00 36.66  ? 91  GLN A CB  1 
ATOM   563  C  CG  . GLN A 1 91  ? 8.254   14.314  26.842 1.00 36.84  ? 91  GLN A CG  1 
ATOM   564  C  CD  . GLN A 1 91  ? 9.216   15.493  26.787 1.00 55.16  ? 91  GLN A CD  1 
ATOM   565  O  OE1 . GLN A 1 91  ? 10.443  15.319  26.892 1.00 55.24  ? 91  GLN A OE1 1 
ATOM   566  N  NE2 . GLN A 1 91  ? 8.687   16.728  26.724 1.00 32.81  ? 91  GLN A NE2 1 
ATOM   567  N  N   . ILE A 1 92  ? 5.380   13.827  23.039 1.00 42.52  ? 92  ILE A N   1 
ATOM   568  C  CA  . ILE A 1 92  ? 4.915   13.477  21.688 1.00 43.19  ? 92  ILE A CA  1 
ATOM   569  C  C   . ILE A 1 92  ? 4.307   14.757  21.089 1.00 51.52  ? 92  ILE A C   1 
ATOM   570  O  O   . ILE A 1 92  ? 4.752   15.206  20.028 1.00 52.17  ? 92  ILE A O   1 
ATOM   571  C  CB  . ILE A 1 92  ? 3.884   12.305  21.734 1.00 46.66  ? 92  ILE A CB  1 
ATOM   572  C  CG1 . ILE A 1 92  ? 4.492   11.026  22.375 1.00 45.84  ? 92  ILE A CG1 1 
ATOM   573  C  CG2 . ILE A 1 92  ? 3.312   12.002  20.369 1.00 47.69  ? 92  ILE A CG2 1 
ATOM   574  C  CD1 . ILE A 1 92  ? 3.557   10.191  23.345 1.00 42.79  ? 92  ILE A CD1 1 
ATOM   575  N  N   . LYS A 1 93  ? 3.340   15.391  21.812 1.00 49.66  ? 93  LYS A N   1 
ATOM   576  C  CA  . LYS A 1 93  ? 2.657   16.628  21.382 1.00 50.79  ? 93  LYS A CA  1 
ATOM   577  C  C   . LYS A 1 93  ? 3.570   17.823  21.117 1.00 52.20  ? 93  LYS A C   1 
ATOM   578  O  O   . LYS A 1 93  ? 3.104   18.798  20.539 1.00 53.07  ? 93  LYS A O   1 
ATOM   579  C  CB  . LYS A 1 93  ? 1.557   17.036  22.381 1.00 55.32  ? 93  LYS A CB  1 
ATOM   580  C  CG  . LYS A 1 93  ? 0.119   16.762  21.897 1.00 86.14  ? 93  LYS A CG  1 
ATOM   581  C  CD  . LYS A 1 93  ? -0.531  17.946  21.131 1.00 101.32 ? 93  LYS A CD  1 
ATOM   582  C  CE  . LYS A 1 93  ? -1.994  17.711  20.802 1.00 115.97 ? 93  LYS A CE  1 
ATOM   583  N  NZ  . LYS A 1 93  ? -2.860  17.677  22.019 1.00 124.86 ? 93  LYS A NZ  1 
ATOM   584  N  N   . LEU A 1 94  ? 4.846   17.766  21.569 1.00 45.82  ? 94  LEU A N   1 
ATOM   585  C  CA  . LEU A 1 94  ? 5.853   18.827  21.440 1.00 43.87  ? 94  LEU A CA  1 
ATOM   586  C  C   . LEU A 1 94  ? 7.033   18.390  20.586 1.00 48.86  ? 94  LEU A C   1 
ATOM   587  O  O   . LEU A 1 94  ? 7.594   19.230  19.891 1.00 49.11  ? 94  LEU A O   1 
ATOM   588  C  CB  . LEU A 1 94  ? 6.369   19.222  22.840 1.00 41.68  ? 94  LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 94  ? 6.129   20.641  23.395 1.00 45.36  ? 94  LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 94  ? 4.810   21.271  22.908 1.00 47.39  ? 94  LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 94  ? 6.181   20.630  24.903 1.00 43.96  ? 94  LEU A CD2 1 
ATOM   592  N  N   . HIS A 1 95  ? 7.440   17.098  20.658 1.00 45.60  ? 95  HIS A N   1 
ATOM   593  C  CA  . HIS A 1 95  ? 8.610   16.591  19.922 1.00 44.92  ? 95  HIS A CA  1 
ATOM   594  C  C   . HIS A 1 95  ? 8.337   15.440  19.012 1.00 49.32  ? 95  HIS A C   1 
ATOM   595  O  O   . HIS A 1 95  ? 9.225   15.109  18.222 1.00 48.59  ? 95  HIS A O   1 
ATOM   596  C  CB  . HIS A 1 95  ? 9.764   16.232  20.872 1.00 43.84  ? 95  HIS A CB  1 
ATOM   597  C  CG  . HIS A 1 95  ? 9.921   17.240  21.949 1.00 46.66  ? 95  HIS A CG  1 
ATOM   598  N  ND1 . HIS A 1 95  ? 10.403  18.511  21.677 1.00 48.44  ? 95  HIS A ND1 1 
ATOM   599  C  CD2 . HIS A 1 95  ? 9.522   17.183  23.239 1.00 48.12  ? 95  HIS A CD2 1 
ATOM   600  C  CE1 . HIS A 1 95  ? 10.330  19.167  22.821 1.00 47.61  ? 95  HIS A CE1 1 
ATOM   601  N  NE2 . HIS A 1 95  ? 9.814   18.404  23.793 1.00 47.69  ? 95  HIS A NE2 1 
ATOM   602  N  N   . ASN A 1 96  ? 7.143   14.799  19.124 1.00 46.70  ? 96  ASN A N   1 
ATOM   603  C  CA  . ASN A 1 96  ? 6.748   13.620  18.332 1.00 47.41  ? 96  ASN A CA  1 
ATOM   604  C  C   . ASN A 1 96  ? 8.013   12.805  17.998 1.00 50.85  ? 96  ASN A C   1 
ATOM   605  O  O   . ASN A 1 96  ? 8.409   12.745  16.823 1.00 51.01  ? 96  ASN A O   1 
ATOM   606  C  CB  . ASN A 1 96  ? 5.972   14.048  17.075 1.00 48.23  ? 96  ASN A CB  1 
ATOM   607  C  CG  . ASN A 1 96  ? 5.196   12.940  16.417 1.00 66.98  ? 96  ASN A CG  1 
ATOM   608  O  OD1 . ASN A 1 96  ? 3.982   12.791  16.615 1.00 59.21  ? 96  ASN A OD1 1 
ATOM   609  N  ND2 . ASN A 1 96  ? 5.875   12.154  15.593 1.00 61.05  ? 96  ASN A ND2 1 
ATOM   610  N  N   . PRO A 1 97  ? 8.758   12.308  19.033 1.00 45.24  ? 97  PRO A N   1 
ATOM   611  C  CA  . PRO A 1 97  ? 10.016  11.616  18.736 1.00 43.83  ? 97  PRO A CA  1 
ATOM   612  C  C   . PRO A 1 97  ? 9.784   10.383  17.874 1.00 49.70  ? 97  PRO A C   1 
ATOM   613  O  O   . PRO A 1 97  ? 8.763   9.702   18.044 1.00 48.14  ? 97  PRO A O   1 
ATOM   614  C  CB  . PRO A 1 97  ? 10.590  11.288  20.116 1.00 43.36  ? 97  PRO A CB  1 
ATOM   615  C  CG  . PRO A 1 97  ? 9.853   12.183  21.069 1.00 47.24  ? 97  PRO A CG  1 
ATOM   616  C  CD  . PRO A 1 97  ? 8.496   12.325  20.490 1.00 44.78  ? 97  PRO A CD  1 
ATOM   617  N  N   . PRO A 1 98  ? 10.683  10.167  16.881 1.00 48.69  ? 98  PRO A N   1 
ATOM   618  C  CA  . PRO A 1 98  ? 10.546  8.995   15.986 1.00 50.19  ? 98  PRO A CA  1 
ATOM   619  C  C   . PRO A 1 98  ? 10.525  7.656   16.737 1.00 54.53  ? 98  PRO A C   1 
ATOM   620  O  O   . PRO A 1 98  ? 9.761   6.741   16.391 1.00 55.44  ? 98  PRO A O   1 
ATOM   621  C  CB  . PRO A 1 98  ? 11.781  9.096   15.073 1.00 51.75  ? 98  PRO A CB  1 
ATOM   622  C  CG  . PRO A 1 98  ? 12.255  10.527  15.193 1.00 55.26  ? 98  PRO A CG  1 
ATOM   623  C  CD  . PRO A 1 98  ? 11.904  10.948  16.576 1.00 49.63  ? 98  PRO A CD  1 
ATOM   624  N  N   . THR A 1 99  ? 11.340  7.579   17.801 1.00 49.39  ? 99  THR A N   1 
ATOM   625  C  CA  . THR A 1 99  ? 11.537  6.422   18.667 1.00 48.83  ? 99  THR A CA  1 
ATOM   626  C  C   . THR A 1 99  ? 10.286  5.940   19.411 1.00 53.13  ? 99  THR A C   1 
ATOM   627  O  O   . THR A 1 99  ? 10.309  4.848   19.992 1.00 52.00  ? 99  THR A O   1 
ATOM   628  C  CB  . THR A 1 99  ? 12.691  6.706   19.606 1.00 61.93  ? 99  THR A CB  1 
ATOM   629  O  OG1 . THR A 1 99  ? 12.469  7.974   20.225 1.00 66.54  ? 99  THR A OG1 1 
ATOM   630  C  CG2 . THR A 1 99  ? 14.010  6.724   18.888 1.00 61.50  ? 99  THR A CG2 1 
ATOM   631  N  N   . ILE A 1 100 ? 9.205   6.750   19.387 1.00 50.76  ? 100 ILE A N   1 
ATOM   632  C  CA  . ILE A 1 100 ? 7.901   6.487   20.017 1.00 51.33  ? 100 ILE A CA  1 
ATOM   633  C  C   . ILE A 1 100 ? 7.411   5.016   19.949 1.00 53.65  ? 100 ILE A C   1 
ATOM   634  O  O   . ILE A 1 100 ? 7.112   4.432   20.995 1.00 52.94  ? 100 ILE A O   1 
ATOM   635  C  CB  . ILE A 1 100 ? 6.828   7.516   19.546 1.00 56.47  ? 100 ILE A CB  1 
ATOM   636  C  CG1 . ILE A 1 100 ? 5.517   7.366   20.339 1.00 57.22  ? 100 ILE A CG1 1 
ATOM   637  C  CG2 . ILE A 1 100 ? 6.597   7.445   18.015 1.00 61.51  ? 100 ILE A CG2 1 
ATOM   638  C  CD1 . ILE A 1 100 ? 4.430   8.340   19.984 1.00 67.45  ? 100 ILE A CD1 1 
ATOM   639  N  N   . HIS A 1 101 ? 7.373   4.422   18.731 1.00 49.58  ? 101 HIS A N   1 
ATOM   640  C  CA  . HIS A 1 101 ? 6.895   3.052   18.490 1.00 49.24  ? 101 HIS A CA  1 
ATOM   641  C  C   . HIS A 1 101 ? 7.969   2.021   18.123 1.00 49.15  ? 101 HIS A C   1 
ATOM   642  O  O   . HIS A 1 101 ? 7.640   0.904   17.707 1.00 48.94  ? 101 HIS A O   1 
ATOM   643  C  CB  . HIS A 1 101 ? 5.765   3.055   17.455 1.00 52.20  ? 101 HIS A CB  1 
ATOM   644  C  CG  . HIS A 1 101 ? 4.548   3.788   17.907 1.00 56.27  ? 101 HIS A CG  1 
ATOM   645  N  ND1 . HIS A 1 101 ? 4.236   5.042   17.412 1.00 58.66  ? 101 HIS A ND1 1 
ATOM   646  C  CD2 . HIS A 1 101 ? 3.607   3.422   18.806 1.00 58.23  ? 101 HIS A CD2 1 
ATOM   647  C  CE1 . HIS A 1 101 ? 3.113   5.392   18.010 1.00 58.79  ? 101 HIS A CE1 1 
ATOM   648  N  NE2 . HIS A 1 101 ? 2.701   4.453   18.862 1.00 58.97  ? 101 HIS A NE2 1 
ATOM   649  N  N   . TYR A 1 102 ? 9.241   2.377   18.312 1.00 43.09  ? 102 TYR A N   1 
ATOM   650  C  CA  . TYR A 1 102 ? 10.361  1.486   18.047 1.00 42.79  ? 102 TYR A CA  1 
ATOM   651  C  C   . TYR A 1 102 ? 10.339  0.321   19.030 1.00 49.21  ? 102 TYR A C   1 
ATOM   652  O  O   . TYR A 1 102 ? 9.845   0.506   20.144 1.00 49.08  ? 102 TYR A O   1 
ATOM   653  C  CB  . TYR A 1 102 ? 11.673  2.230   18.301 1.00 41.84  ? 102 TYR A CB  1 
ATOM   654  C  CG  . TYR A 1 102 ? 12.185  3.109   17.182 1.00 43.42  ? 102 TYR A CG  1 
ATOM   655  C  CD1 . TYR A 1 102 ? 13.518  3.507   17.144 1.00 44.62  ? 102 TYR A CD1 1 
ATOM   656  C  CD2 . TYR A 1 102 ? 11.327  3.607   16.204 1.00 44.40  ? 102 TYR A CD2 1 
ATOM   657  C  CE1 . TYR A 1 102 ? 13.989  4.359   16.153 1.00 44.18  ? 102 TYR A CE1 1 
ATOM   658  C  CE2 . TYR A 1 102 ? 11.786  4.468   15.215 1.00 44.83  ? 102 TYR A CE2 1 
ATOM   659  C  CZ  . TYR A 1 102 ? 13.117  4.845   15.200 1.00 47.42  ? 102 TYR A CZ  1 
ATOM   660  O  OH  . TYR A 1 102 ? 13.587  5.698   14.250 1.00 46.34  ? 102 TYR A OH  1 
ATOM   661  N  N   . PRO A 1 103 ? 10.935  -0.860  18.714 1.00 46.31  ? 103 PRO A N   1 
ATOM   662  C  CA  . PRO A 1 103 ? 11.024  -1.918  19.737 1.00 45.33  ? 103 PRO A CA  1 
ATOM   663  C  C   . PRO A 1 103 ? 11.801  -1.392  20.954 1.00 47.92  ? 103 PRO A C   1 
ATOM   664  O  O   . PRO A 1 103 ? 12.582  -0.445  20.789 1.00 46.46  ? 103 PRO A O   1 
ATOM   665  C  CB  . PRO A 1 103 ? 11.821  -3.014  19.026 1.00 47.44  ? 103 PRO A CB  1 
ATOM   666  C  CG  . PRO A 1 103 ? 11.624  -2.751  17.574 1.00 52.85  ? 103 PRO A CG  1 
ATOM   667  C  CD  . PRO A 1 103 ? 11.599  -1.276  17.459 1.00 48.15  ? 103 PRO A CD  1 
ATOM   668  N  N   . PRO A 1 104 ? 11.612  -1.917  22.181 1.00 45.50  ? 104 PRO A N   1 
ATOM   669  C  CA  . PRO A 1 104 ? 12.382  -1.374  23.325 1.00 44.55  ? 104 PRO A CA  1 
ATOM   670  C  C   . PRO A 1 104 ? 13.905  -1.319  23.067 1.00 49.37  ? 104 PRO A C   1 
ATOM   671  O  O   . PRO A 1 104 ? 14.488  -0.232  23.114 1.00 47.12  ? 104 PRO A O   1 
ATOM   672  C  CB  . PRO A 1 104 ? 11.952  -2.264  24.499 1.00 45.47  ? 104 PRO A CB  1 
ATOM   673  C  CG  . PRO A 1 104 ? 10.603  -2.780  24.091 1.00 50.72  ? 104 PRO A CG  1 
ATOM   674  C  CD  . PRO A 1 104 ? 10.729  -3.018  22.612 1.00 47.47  ? 104 PRO A CD  1 
ATOM   675  N  N   . SER A 1 105 ? 14.491  -2.469  22.640 1.00 48.15  ? 105 SER A N   1 
ATOM   676  C  CA  . SER A 1 105 ? 15.891  -2.703  22.252 1.00 48.37  ? 105 SER A CA  1 
ATOM   677  C  C   . SER A 1 105 ? 16.456  -1.690  21.209 1.00 52.99  ? 105 SER A C   1 
ATOM   678  O  O   . SER A 1 105 ? 17.673  -1.426  21.166 1.00 51.32  ? 105 SER A O   1 
ATOM   679  C  CB  . SER A 1 105 ? 16.007  -4.104  21.671 1.00 53.96  ? 105 SER A CB  1 
ATOM   680  O  OG  . SER A 1 105 ? 15.232  -4.192  20.486 1.00 68.12  ? 105 SER A OG  1 
ATOM   681  N  N   . GLN A 1 106 ? 15.564  -1.162  20.353 1.00 50.66  ? 106 GLN A N   1 
ATOM   682  C  CA  . GLN A 1 106 ? 15.908  -0.189  19.319 1.00 50.66  ? 106 GLN A CA  1 
ATOM   683  C  C   . GLN A 1 106 ? 15.901  1.273   19.776 1.00 51.62  ? 106 GLN A C   1 
ATOM   684  O  O   . GLN A 1 106 ? 16.117  2.186   18.967 1.00 50.59  ? 106 GLN A O   1 
ATOM   685  C  CB  . GLN A 1 106 ? 15.108  -0.427  18.022 1.00 53.96  ? 106 GLN A CB  1 
ATOM   686  C  CG  . GLN A 1 106 ? 15.523  -1.698  17.259 1.00 73.12  ? 106 GLN A CG  1 
ATOM   687  C  CD  . GLN A 1 106 ? 17.021  -1.983  17.243 1.00 97.93  ? 106 GLN A CD  1 
ATOM   688  O  OE1 . GLN A 1 106 ? 17.477  -2.996  17.783 1.00 100.11 ? 106 GLN A OE1 1 
ATOM   689  N  NE2 . GLN A 1 106 ? 17.829  -1.085  16.677 1.00 82.94  ? 106 GLN A NE2 1 
ATOM   690  N  N   . GLY A 1 107 ? 15.716  1.466   21.081 1.00 47.13  ? 107 GLY A N   1 
ATOM   691  C  CA  . GLY A 1 107 ? 15.732  2.780   21.715 1.00 45.95  ? 107 GLY A CA  1 
ATOM   692  C  C   . GLY A 1 107 ? 14.389  3.453   21.891 1.00 48.66  ? 107 GLY A C   1 
ATOM   693  O  O   . GLY A 1 107 ? 14.323  4.690   21.960 1.00 46.20  ? 107 GLY A O   1 
ATOM   694  N  N   . GLN A 1 108 ? 13.308  2.624   21.981 1.00 46.28  ? 108 GLN A N   1 
ATOM   695  C  CA  . GLN A 1 108 ? 11.911  3.029   22.174 1.00 46.66  ? 108 GLN A CA  1 
ATOM   696  C  C   . GLN A 1 108 ? 11.840  4.161   23.180 1.00 51.81  ? 108 GLN A C   1 
ATOM   697  O  O   . GLN A 1 108 ? 12.481  4.081   24.238 1.00 52.38  ? 108 GLN A O   1 
ATOM   698  C  CB  . GLN A 1 108 ? 11.103  1.838   22.684 1.00 47.77  ? 108 GLN A CB  1 
ATOM   699  C  CG  . GLN A 1 108 ? 9.647   2.107   23.017 1.00 50.85  ? 108 GLN A CG  1 
ATOM   700  C  CD  . GLN A 1 108 ? 8.976   0.800   23.334 1.00 70.35  ? 108 GLN A CD  1 
ATOM   701  O  OE1 . GLN A 1 108 ? 9.131   0.229   24.422 1.00 63.26  ? 108 GLN A OE1 1 
ATOM   702  N  NE2 . GLN A 1 108 ? 8.266   0.265   22.360 1.00 68.69  ? 108 GLN A NE2 1 
ATOM   703  N  N   . MET A 1 109 ? 11.096  5.222   22.859 1.00 47.28  ? 109 MET A N   1 
ATOM   704  C  CA  . MET A 1 109 ? 11.005  6.349   23.784 1.00 44.97  ? 109 MET A CA  1 
ATOM   705  C  C   . MET A 1 109 ? 10.473  5.924   25.192 1.00 48.94  ? 109 MET A C   1 
ATOM   706  O  O   . MET A 1 109 ? 9.460   5.213   25.316 1.00 48.05  ? 109 MET A O   1 
ATOM   707  C  CB  . MET A 1 109 ? 10.253  7.534   23.151 1.00 47.04  ? 109 MET A CB  1 
ATOM   708  C  CG  . MET A 1 109 ? 10.089  8.695   24.080 1.00 48.41  ? 109 MET A CG  1 
ATOM   709  S  SD  . MET A 1 109 ? 8.623   9.663   23.724 1.00 52.88  ? 109 MET A SD  1 
ATOM   710  C  CE  . MET A 1 109 ? 7.321   8.517   24.110 1.00 50.45  ? 109 MET A CE  1 
ATOM   711  N  N   . ASP A 1 110 ? 11.248  6.295   26.226 1.00 45.66  ? 110 ASP A N   1 
ATOM   712  C  CA  . ASP A 1 110 ? 10.951  6.018   27.629 1.00 45.65  ? 110 ASP A CA  1 
ATOM   713  C  C   . ASP A 1 110 ? 11.139  7.270   28.452 1.00 50.44  ? 110 ASP A C   1 
ATOM   714  O  O   . ASP A 1 110 ? 12.104  8.011   28.240 1.00 49.89  ? 110 ASP A O   1 
ATOM   715  C  CB  . ASP A 1 110 ? 11.845  4.896   28.185 1.00 46.30  ? 110 ASP A CB  1 
ATOM   716  C  CG  . ASP A 1 110 ? 11.215  4.100   29.313 1.00 49.51  ? 110 ASP A CG  1 
ATOM   717  O  OD1 . ASP A 1 110 ? 9.969   4.084   29.402 1.00 50.96  ? 110 ASP A OD1 1 
ATOM   718  O  OD2 . ASP A 1 110 ? 11.965  3.442   30.068 1.00 49.54  ? 110 ASP A OD2 1 
ATOM   719  N  N   . LEU A 1 111 ? 10.211  7.505   29.386 1.00 47.96  ? 111 LEU A N   1 
ATOM   720  C  CA  . LEU A 1 111 ? 10.221  8.664   30.276 1.00 47.64  ? 111 LEU A CA  1 
ATOM   721  C  C   . LEU A 1 111 ? 10.528  8.264   31.712 1.00 50.38  ? 111 LEU A C   1 
ATOM   722  O  O   . LEU A 1 111 ? 10.304  7.110   32.117 1.00 49.03  ? 111 LEU A O   1 
ATOM   723  C  CB  . LEU A 1 111 ? 8.892   9.429   30.215 1.00 49.17  ? 111 LEU A CB  1 
ATOM   724  C  CG  . LEU A 1 111 ? 8.711   10.418  29.074 1.00 55.15  ? 111 LEU A CG  1 
ATOM   725  C  CD1 . LEU A 1 111 ? 8.062   9.749   27.860 1.00 56.50  ? 111 LEU A CD1 1 
ATOM   726  C  CD2 . LEU A 1 111 ? 7.838   11.573  29.511 1.00 58.96  ? 111 LEU A CD2 1 
ATOM   727  N  N   . CYS A 1 112 ? 11.034  9.243   32.487 1.00 46.46  ? 112 CYS A N   1 
ATOM   728  C  CA  . CYS A 1 112 ? 11.429  9.035   33.874 1.00 44.96  ? 112 CYS A CA  1 
ATOM   729  C  C   . CYS A 1 112 ? 11.405  10.317  34.680 1.00 45.82  ? 112 CYS A C   1 
ATOM   730  O  O   . CYS A 1 112 ? 12.113  11.262  34.339 1.00 46.49  ? 112 CYS A O   1 
ATOM   731  C  CB  . CYS A 1 112 ? 12.804  8.386   33.923 1.00 44.49  ? 112 CYS A CB  1 
ATOM   732  S  SG  . CYS A 1 112 ? 13.286  7.839   35.565 1.00 47.53  ? 112 CYS A SG  1 
ATOM   733  N  N   . VAL A 1 113 ? 10.616  10.347  35.756 1.00 38.75  ? 113 VAL A N   1 
ATOM   734  C  CA  . VAL A 1 113 ? 10.531  11.519  36.629 1.00 36.76  ? 113 VAL A CA  1 
ATOM   735  C  C   . VAL A 1 113 ? 11.727  11.471  37.572 1.00 36.10  ? 113 VAL A C   1 
ATOM   736  O  O   . VAL A 1 113 ? 11.996  10.437  38.201 1.00 35.27  ? 113 VAL A O   1 
ATOM   737  C  CB  . VAL A 1 113 ? 9.188   11.616  37.415 1.00 41.42  ? 113 VAL A CB  1 
ATOM   738  C  CG1 . VAL A 1 113 ? 9.052   12.970  38.099 1.00 41.31  ? 113 VAL A CG1 1 
ATOM   739  C  CG2 . VAL A 1 113 ? 7.979   11.345  36.524 1.00 42.36  ? 113 VAL A CG2 1 
ATOM   740  N  N   . THR A 1 114 ? 12.447  12.585  37.664 1.00 30.12  ? 114 THR A N   1 
ATOM   741  C  CA  . THR A 1 114 ? 13.616  12.707  38.541 1.00 27.85  ? 114 THR A CA  1 
ATOM   742  C  C   . THR A 1 114 ? 13.372  13.749  39.627 1.00 30.34  ? 114 THR A C   1 
ATOM   743  O  O   . THR A 1 114 ? 12.408  14.522  39.522 1.00 30.63  ? 114 THR A O   1 
ATOM   744  C  CB  . THR A 1 114 ? 14.923  12.895  37.738 1.00 29.66  ? 114 THR A CB  1 
ATOM   745  O  OG1 . THR A 1 114 ? 14.887  14.085  36.932 1.00 26.13  ? 114 THR A OG1 1 
ATOM   746  C  CG2 . THR A 1 114 ? 15.252  11.681  36.888 1.00 27.64  ? 114 THR A CG2 1 
ATOM   747  N  N   . SER A 1 115 ? 14.204  13.738  40.695 1.00 25.20  ? 115 SER A N   1 
ATOM   748  C  CA  . SER A 1 115 ? 14.122  14.725  41.773 1.00 25.55  ? 115 SER A CA  1 
ATOM   749  C  C   . SER A 1 115 ? 14.990  15.952  41.348 1.00 32.61  ? 115 SER A C   1 
ATOM   750  O  O   . SER A 1 115 ? 16.090  16.208  41.881 1.00 31.29  ? 115 SER A O   1 
ATOM   751  C  CB  . SER A 1 115 ? 14.529  14.116  43.106 1.00 28.32  ? 115 SER A CB  1 
ATOM   752  O  OG  . SER A 1 115 ? 13.671  13.033  43.444 1.00 40.01  ? 115 SER A OG  1 
ATOM   753  N  N   . GLY A 1 116 ? 14.459  16.650  40.321 1.00 30.51  ? 116 GLY A N   1 
ATOM   754  C  CA  . GLY A 1 116 ? 15.084  17.741  39.589 1.00 29.31  ? 116 GLY A CA  1 
ATOM   755  C  C   . GLY A 1 116 ? 15.794  17.184  38.365 1.00 31.05  ? 116 GLY A C   1 
ATOM   756  O  O   . GLY A 1 116 ? 16.209  16.011  38.362 1.00 28.28  ? 116 GLY A O   1 
ATOM   757  N  N   . SER A 1 117 ? 15.952  18.026  37.308 1.00 27.84  ? 117 SER A N   1 
ATOM   758  C  CA  . SER A 1 117 ? 16.639  17.631  36.069 1.00 26.52  ? 117 SER A CA  1 
ATOM   759  C  C   . SER A 1 117 ? 18.128  17.269  36.291 1.00 28.74  ? 117 SER A C   1 
ATOM   760  O  O   . SER A 1 117 ? 18.678  16.445  35.549 1.00 28.12  ? 117 SER A O   1 
ATOM   761  C  CB  . SER A 1 117 ? 16.460  18.677  34.978 1.00 29.45  ? 117 SER A CB  1 
ATOM   762  O  OG  . SER A 1 117 ? 17.374  19.745  35.138 1.00 39.18  ? 117 SER A OG  1 
ATOM   763  N  N   . GLN A 1 118 ? 18.740  17.827  37.356 1.00 24.05  ? 118 GLN A N   1 
ATOM   764  C  CA  . GLN A 1 118 ? 20.110  17.545  37.787 1.00 23.58  ? 118 GLN A CA  1 
ATOM   765  C  C   . GLN A 1 118 ? 20.287  16.040  38.137 1.00 28.01  ? 118 GLN A C   1 
ATOM   766  O  O   . GLN A 1 118 ? 21.357  15.460  37.860 1.00 26.08  ? 118 GLN A O   1 
ATOM   767  C  CB  . GLN A 1 118 ? 20.463  18.436  38.998 1.00 24.98  ? 118 GLN A CB  1 
ATOM   768  C  CG  . GLN A 1 118 ? 21.946  18.458  39.380 1.00 32.43  ? 118 GLN A CG  1 
ATOM   769  C  CD  . GLN A 1 118 ? 22.824  19.124  38.361 1.00 45.67  ? 118 GLN A CD  1 
ATOM   770  O  OE1 . GLN A 1 118 ? 22.449  20.124  37.748 1.00 44.07  ? 118 GLN A OE1 1 
ATOM   771  N  NE2 . GLN A 1 118 ? 24.005  18.566  38.149 1.00 35.73  ? 118 GLN A NE2 1 
ATOM   772  N  N   . GLN A 1 119 ? 19.231  15.419  38.750 1.00 26.12  ? 119 GLN A N   1 
ATOM   773  C  CA  . GLN A 1 119 ? 19.229  13.981  39.087 1.00 26.27  ? 119 GLN A CA  1 
ATOM   774  C  C   . GLN A 1 119 ? 19.351  13.127  37.804 1.00 28.95  ? 119 GLN A C   1 
ATOM   775  O  O   . GLN A 1 119 ? 20.111  12.150  37.759 1.00 27.77  ? 119 GLN A O   1 
ATOM   776  C  CB  . GLN A 1 119 ? 17.966  13.577  39.903 1.00 27.94  ? 119 GLN A CB  1 
ATOM   777  C  CG  . GLN A 1 119 ? 17.773  12.054  39.995 1.00 31.39  ? 119 GLN A CG  1 
ATOM   778  C  CD  . GLN A 1 119 ? 17.098  11.560  41.233 1.00 40.63  ? 119 GLN A CD  1 
ATOM   779  O  OE1 . GLN A 1 119 ? 15.876  11.618  41.369 1.00 44.32  ? 119 GLN A OE1 1 
ATOM   780  N  NE2 . GLN A 1 119 ? 17.865  10.935  42.096 1.00 20.68  ? 119 GLN A NE2 1 
ATOM   781  N  N   . GLY A 1 120 ? 18.580  13.520  36.800 1.00 24.69  ? 120 GLY A N   1 
ATOM   782  C  CA  . GLY A 1 120 ? 18.537  12.859  35.521 1.00 24.58  ? 120 GLY A CA  1 
ATOM   783  C  C   . GLY A 1 120 ? 19.903  12.826  34.907 1.00 30.19  ? 120 GLY A C   1 
ATOM   784  O  O   . GLY A 1 120 ? 20.439  11.737  34.667 1.00 29.86  ? 120 GLY A O   1 
ATOM   785  N  N   . LEU A 1 121 ? 20.497  14.041  34.735 1.00 27.62  ? 121 LEU A N   1 
ATOM   786  C  CA  . LEU A 1 121 ? 21.811  14.282  34.111 1.00 27.35  ? 121 LEU A CA  1 
ATOM   787  C  C   . LEU A 1 121 ? 22.929  13.554  34.803 1.00 29.41  ? 121 LEU A C   1 
ATOM   788  O  O   . LEU A 1 121 ? 23.721  12.875  34.145 1.00 27.13  ? 121 LEU A O   1 
ATOM   789  C  CB  . LEU A 1 121 ? 22.152  15.770  34.123 1.00 27.72  ? 121 LEU A CB  1 
ATOM   790  C  CG  . LEU A 1 121 ? 21.285  16.695  33.333 1.00 33.22  ? 121 LEU A CG  1 
ATOM   791  C  CD1 . LEU A 1 121 ? 21.396  18.127  33.911 1.00 33.76  ? 121 LEU A CD1 1 
ATOM   792  C  CD2 . LEU A 1 121 ? 21.621  16.605  31.840 1.00 34.14  ? 121 LEU A CD2 1 
ATOM   793  N  N   . CYS A 1 122 ? 23.007  13.733  36.136 1.00 26.74  ? 122 CYS A N   1 
ATOM   794  C  CA  . CYS A 1 122 ? 24.017  13.110  36.961 1.00 26.88  ? 122 CYS A CA  1 
ATOM   795  C  C   . CYS A 1 122 ? 23.991  11.594  36.783 1.00 29.67  ? 122 CYS A C   1 
ATOM   796  O  O   . CYS A 1 122 ? 24.985  11.034  36.348 1.00 30.37  ? 122 CYS A O   1 
ATOM   797  C  CB  . CYS A 1 122 ? 23.846  13.516  38.415 1.00 27.88  ? 122 CYS A CB  1 
ATOM   798  S  SG  . CYS A 1 122 ? 25.228  13.026  39.474 1.00 32.06  ? 122 CYS A SG  1 
ATOM   799  N  N   . LYS A 1 123 ? 22.835  10.959  36.989 1.00 24.89  ? 123 LYS A N   1 
ATOM   800  C  CA  . LYS A 1 123 ? 22.656  9.524   36.821 1.00 24.72  ? 123 LYS A CA  1 
ATOM   801  C  C   . LYS A 1 123 ? 23.114  8.999   35.437 1.00 27.27  ? 123 LYS A C   1 
ATOM   802  O  O   . LYS A 1 123 ? 23.770  7.941   35.337 1.00 24.25  ? 123 LYS A O   1 
ATOM   803  C  CB  . LYS A 1 123 ? 21.196  9.143   37.139 1.00 27.77  ? 123 LYS A CB  1 
ATOM   804  C  CG  . LYS A 1 123 ? 21.050  7.950   38.111 1.00 29.84  ? 123 LYS A CG  1 
ATOM   805  C  CD  . LYS A 1 123 ? 20.886  8.340   39.566 1.00 20.91  ? 123 LYS A CD  1 
ATOM   806  C  CE  . LYS A 1 123 ? 22.195  8.586   40.250 1.00 34.69  ? 123 LYS A CE  1 
ATOM   807  N  NZ  . LYS A 1 123 ? 21.994  9.131   41.617 1.00 61.54  ? 123 LYS A NZ  1 
ATOM   808  N  N   . VAL A 1 124 ? 22.804  9.788   34.389 1.00 25.97  ? 124 VAL A N   1 
ATOM   809  C  CA  . VAL A 1 124 ? 23.170  9.525   32.982 1.00 26.38  ? 124 VAL A CA  1 
ATOM   810  C  C   . VAL A 1 124 ? 24.706  9.534   32.878 1.00 28.93  ? 124 VAL A C   1 
ATOM   811  O  O   . VAL A 1 124 ? 25.287  8.528   32.485 1.00 27.88  ? 124 VAL A O   1 
ATOM   812  C  CB  . VAL A 1 124 ? 22.473  10.512  31.985 1.00 29.74  ? 124 VAL A CB  1 
ATOM   813  C  CG1 . VAL A 1 124 ? 22.908  10.257  30.557 1.00 29.65  ? 124 VAL A CG1 1 
ATOM   814  C  CG2 . VAL A 1 124 ? 20.961  10.410  32.078 1.00 29.57  ? 124 VAL A CG2 1 
ATOM   815  N  N   . PHE A 1 125 ? 25.347  10.638  33.328 1.00 25.55  ? 125 PHE A N   1 
ATOM   816  C  CA  . PHE A 1 125 ? 26.800  10.794  33.368 1.00 25.42  ? 125 PHE A CA  1 
ATOM   817  C  C   . PHE A 1 125 ? 27.407  9.625   34.102 1.00 30.96  ? 125 PHE A C   1 
ATOM   818  O  O   . PHE A 1 125 ? 28.298  8.953   33.574 1.00 32.43  ? 125 PHE A O   1 
ATOM   819  C  CB  . PHE A 1 125 ? 27.199  12.082  34.098 1.00 26.45  ? 125 PHE A CB  1 
ATOM   820  C  CG  . PHE A 1 125 ? 26.834  13.372  33.417 1.00 27.66  ? 125 PHE A CG  1 
ATOM   821  C  CD1 . PHE A 1 125 ? 26.651  14.533  34.153 1.00 29.51  ? 125 PHE A CD1 1 
ATOM   822  C  CD2 . PHE A 1 125 ? 26.688  13.432  32.031 1.00 30.20  ? 125 PHE A CD2 1 
ATOM   823  C  CE1 . PHE A 1 125 ? 26.310  15.728  33.525 1.00 31.01  ? 125 PHE A CE1 1 
ATOM   824  C  CE2 . PHE A 1 125 ? 26.346  14.632  31.402 1.00 33.15  ? 125 PHE A CE2 1 
ATOM   825  C  CZ  . PHE A 1 125 ? 26.168  15.774  32.152 1.00 30.88  ? 125 PHE A CZ  1 
ATOM   826  N  N   . GLU A 1 126 ? 26.857  9.331   35.284 1.00 26.56  ? 126 GLU A N   1 
ATOM   827  C  CA  . GLU A 1 126 ? 27.301  8.232   36.124 1.00 26.13  ? 126 GLU A CA  1 
ATOM   828  C  C   . GLU A 1 126 ? 27.309  6.899   35.373 1.00 30.28  ? 126 GLU A C   1 
ATOM   829  O  O   . GLU A 1 126 ? 28.382  6.284   35.273 1.00 30.03  ? 126 GLU A O   1 
ATOM   830  C  CB  . GLU A 1 126 ? 26.540  8.201   37.471 1.00 26.80  ? 126 GLU A CB  1 
ATOM   831  C  CG  . GLU A 1 126 ? 27.033  9.303   38.396 1.00 32.47  ? 126 GLU A CG  1 
ATOM   832  C  CD  . GLU A 1 126 ? 26.715  9.262   39.874 1.00 51.67  ? 126 GLU A CD  1 
ATOM   833  O  OE1 . GLU A 1 126 ? 27.367  10.025  40.624 1.00 50.62  ? 126 GLU A OE1 1 
ATOM   834  O  OE2 . GLU A 1 126 ? 25.814  8.496   40.285 1.00 43.85  ? 126 GLU A OE2 1 
ATOM   835  N  N   . MET A 1 127 ? 26.168  6.556   34.707 1.00 26.67  ? 127 MET A N   1 
ATOM   836  C  CA  . MET A 1 127 ? 25.988  5.306   33.931 1.00 25.76  ? 127 MET A CA  1 
ATOM   837  C  C   . MET A 1 127 ? 26.758  5.173   32.633 1.00 26.70  ? 127 MET A C   1 
ATOM   838  O  O   . MET A 1 127 ? 26.662  4.130   31.977 1.00 25.46  ? 127 MET A O   1 
ATOM   839  C  CB  . MET A 1 127 ? 24.492  4.977   33.709 1.00 27.84  ? 127 MET A CB  1 
ATOM   840  C  CG  . MET A 1 127 ? 23.816  5.778   32.643 1.00 30.50  ? 127 MET A CG  1 
ATOM   841  S  SD  . MET A 1 127 ? 22.950  4.683   31.534 1.00 34.09  ? 127 MET A SD  1 
ATOM   842  C  CE  . MET A 1 127 ? 22.308  5.866   30.397 1.00 31.08  ? 127 MET A CE  1 
ATOM   843  N  N   . ILE A 1 128 ? 27.501  6.226   32.261 1.00 23.43  ? 128 ILE A N   1 
ATOM   844  C  CA  . ILE A 1 128 ? 28.233  6.297   30.994 1.00 23.75  ? 128 ILE A CA  1 
ATOM   845  C  C   . ILE A 1 128 ? 29.767  6.363   31.125 1.00 29.25  ? 128 ILE A C   1 
ATOM   846  O  O   . ILE A 1 128 ? 30.493  5.587   30.482 1.00 27.75  ? 128 ILE A O   1 
ATOM   847  C  CB  . ILE A 1 128 ? 27.599  7.433   30.128 1.00 25.33  ? 128 ILE A CB  1 
ATOM   848  C  CG1 . ILE A 1 128 ? 26.243  6.956   29.596 1.00 23.71  ? 128 ILE A CG1 1 
ATOM   849  C  CG2 . ILE A 1 128 ? 28.521  7.911   28.982 1.00 26.75  ? 128 ILE A CG2 1 
ATOM   850  C  CD1 . ILE A 1 128 ? 25.325  7.916   29.389 1.00 17.87  ? 128 ILE A CD1 1 
ATOM   851  N  N   . ILE A 1 129 ? 30.230  7.269   31.992 1.00 27.21  ? 129 ILE A N   1 
ATOM   852  C  CA  . ILE A 1 129 ? 31.638  7.575   32.209 1.00 27.69  ? 129 ILE A CA  1 
ATOM   853  C  C   . ILE A 1 129 ? 32.454  6.644   33.080 1.00 31.62  ? 129 ILE A C   1 
ATOM   854  O  O   . ILE A 1 129 ? 32.190  6.476   34.288 1.00 30.11  ? 129 ILE A O   1 
ATOM   855  C  CB  . ILE A 1 129 ? 31.831  9.078   32.597 1.00 30.52  ? 129 ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 129 ? 31.385  10.005  31.452 1.00 31.65  ? 129 ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 129 ? 33.279  9.419   33.086 1.00 30.23  ? 129 ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 129 ? 30.001  10.407  31.489 1.00 39.03  ? 129 ILE A CD1 1 
ATOM   859  N  N   . ASN A 1 130 ? 33.522  6.127   32.451 1.00 29.32  ? 130 ASN A N   1 
ATOM   860  C  CA  . ASN A 1 130 ? 34.610  5.383   33.073 1.00 29.55  ? 130 ASN A CA  1 
ATOM   861  C  C   . ASN A 1 130 ? 35.797  6.343   32.974 1.00 35.90  ? 130 ASN A C   1 
ATOM   862  O  O   . ASN A 1 130 ? 35.934  7.020   31.950 1.00 35.73  ? 130 ASN A O   1 
ATOM   863  C  CB  . ASN A 1 130 ? 34.970  4.110   32.313 1.00 23.94  ? 130 ASN A CB  1 
ATOM   864  C  CG  . ASN A 1 130 ? 33.818  3.212   32.045 1.00 36.57  ? 130 ASN A CG  1 
ATOM   865  O  OD1 . ASN A 1 130 ? 33.314  2.505   32.923 1.00 28.15  ? 130 ASN A OD1 1 
ATOM   866  N  ND2 . ASN A 1 130 ? 33.406  3.193   30.801 1.00 35.24  ? 130 ASN A ND2 1 
ATOM   867  N  N   . PRO A 1 131 ? 36.663  6.448   33.996 1.00 33.85  ? 131 PRO A N   1 
ATOM   868  C  CA  . PRO A 1 131 ? 37.838  7.326   33.859 1.00 34.39  ? 131 PRO A CA  1 
ATOM   869  C  C   . PRO A 1 131 ? 38.655  7.011   32.591 1.00 38.91  ? 131 PRO A C   1 
ATOM   870  O  O   . PRO A 1 131 ? 39.095  5.866   32.411 1.00 38.56  ? 131 PRO A O   1 
ATOM   871  C  CB  . PRO A 1 131 ? 38.642  7.053   35.135 1.00 36.20  ? 131 PRO A CB  1 
ATOM   872  C  CG  . PRO A 1 131 ? 38.093  5.776   35.677 1.00 41.01  ? 131 PRO A CG  1 
ATOM   873  C  CD  . PRO A 1 131 ? 36.658  5.755   35.296 1.00 35.51  ? 131 PRO A CD  1 
ATOM   874  N  N   . GLY A 1 132 ? 38.792  8.018   31.718 1.00 35.26  ? 132 GLY A N   1 
ATOM   875  C  CA  . GLY A 1 132 ? 39.521  7.910   30.461 1.00 36.87  ? 132 GLY A CA  1 
ATOM   876  C  C   . GLY A 1 132 ? 38.682  8.203   29.229 1.00 43.27  ? 132 GLY A C   1 
ATOM   877  O  O   . GLY A 1 132 ? 39.229  8.537   28.164 1.00 43.37  ? 132 GLY A O   1 
ATOM   878  N  N   . ASP A 1 133 ? 37.332  8.075   29.379 1.00 39.73  ? 133 ASP A N   1 
ATOM   879  C  CA  . ASP A 1 133 ? 36.318  8.308   28.341 1.00 38.57  ? 133 ASP A CA  1 
ATOM   880  C  C   . ASP A 1 133 ? 36.338  9.757   27.868 1.00 40.59  ? 133 ASP A C   1 
ATOM   881  O  O   . ASP A 1 133 ? 36.564  10.663  28.671 1.00 38.96  ? 133 ASP A O   1 
ATOM   882  C  CB  . ASP A 1 133 ? 34.909  7.975   28.869 1.00 39.24  ? 133 ASP A CB  1 
ATOM   883  C  CG  . ASP A 1 133 ? 34.571  6.504   29.071 1.00 49.47  ? 133 ASP A CG  1 
ATOM   884  O  OD1 . ASP A 1 133 ? 35.424  5.630   28.716 1.00 50.14  ? 133 ASP A OD1 1 
ATOM   885  O  OD2 . ASP A 1 133 ? 33.459  6.219   29.595 1.00 53.50  ? 133 ASP A OD2 1 
ATOM   886  N  N   . ASN A 1 134 ? 36.076  9.972   26.568 1.00 36.43  ? 134 ASN A N   1 
ATOM   887  C  CA  . ASN A 1 134 ? 36.041  11.306  25.982 1.00 35.29  ? 134 ASN A CA  1 
ATOM   888  C  C   . ASN A 1 134 ? 34.641  11.860  25.930 1.00 39.55  ? 134 ASN A C   1 
ATOM   889  O  O   . ASN A 1 134 ? 33.717  11.160  25.517 1.00 39.90  ? 134 ASN A O   1 
ATOM   890  C  CB  . ASN A 1 134 ? 36.636  11.299  24.594 1.00 30.24  ? 134 ASN A CB  1 
ATOM   891  C  CG  . ASN A 1 134 ? 38.103  11.067  24.623 1.00 35.70  ? 134 ASN A CG  1 
ATOM   892  O  OD1 . ASN A 1 134 ? 38.890  11.901  25.097 1.00 25.18  ? 134 ASN A OD1 1 
ATOM   893  N  ND2 . ASN A 1 134 ? 38.497  9.910   24.140 1.00 30.66  ? 134 ASN A ND2 1 
ATOM   894  N  N   . VAL A 1 135 ? 34.475  13.113  26.370 1.00 35.89  ? 135 VAL A N   1 
ATOM   895  C  CA  . VAL A 1 135 ? 33.183  13.796  26.311 1.00 35.02  ? 135 VAL A CA  1 
ATOM   896  C  C   . VAL A 1 135 ? 33.248  15.100  25.492 1.00 40.69  ? 135 VAL A C   1 
ATOM   897  O  O   . VAL A 1 135 ? 34.209  15.891  25.581 1.00 40.15  ? 135 VAL A O   1 
ATOM   898  C  CB  . VAL A 1 135 ? 32.410  13.935  27.644 1.00 36.19  ? 135 VAL A CB  1 
ATOM   899  C  CG1 . VAL A 1 135 ? 32.285  12.591  28.357 1.00 34.98  ? 135 VAL A CG1 1 
ATOM   900  C  CG2 . VAL A 1 135 ? 33.061  14.973  28.543 1.00 35.54  ? 135 VAL A CG2 1 
ATOM   901  N  N   . LEU A 1 136 ? 32.228  15.276  24.651 1.00 36.73  ? 136 LEU A N   1 
ATOM   902  C  CA  . LEU A 1 136 ? 32.091  16.451  23.812 1.00 35.34  ? 136 LEU A CA  1 
ATOM   903  C  C   . LEU A 1 136 ? 31.127  17.417  24.499 1.00 34.03  ? 136 LEU A C   1 
ATOM   904  O  O   . LEU A 1 136 ? 30.087  17.020  25.023 1.00 31.14  ? 136 LEU A O   1 
ATOM   905  C  CB  . LEU A 1 136 ? 31.687  16.070  22.380 1.00 35.93  ? 136 LEU A CB  1 
ATOM   906  C  CG  . LEU A 1 136 ? 32.705  15.235  21.608 1.00 39.73  ? 136 LEU A CG  1 
ATOM   907  C  CD1 . LEU A 1 136 ? 32.081  14.636  20.389 1.00 39.99  ? 136 LEU A CD1 1 
ATOM   908  C  CD2 . LEU A 1 136 ? 33.935  16.042  21.256 1.00 42.03  ? 136 LEU A CD2 1 
ATOM   909  N  N   . LEU A 1 137 ? 31.564  18.672  24.589 1.00 29.14  ? 137 LEU A N   1 
ATOM   910  C  CA  . LEU A 1 137 ? 30.942  19.747  25.332 1.00 27.48  ? 137 LEU A CA  1 
ATOM   911  C  C   . LEU A 1 137 ? 31.519  21.095  24.861 1.00 32.53  ? 137 LEU A C   1 
ATOM   912  O  O   . LEU A 1 137 ? 32.714  21.220  24.544 1.00 32.80  ? 137 LEU A O   1 
ATOM   913  C  CB  . LEU A 1 137 ? 31.375  19.478  26.779 1.00 26.45  ? 137 LEU A CB  1 
ATOM   914  C  CG  . LEU A 1 137 ? 31.071  20.437  27.877 1.00 30.40  ? 137 LEU A CG  1 
ATOM   915  C  CD1 . LEU A 1 137 ? 30.618  19.675  29.084 1.00 29.76  ? 137 LEU A CD1 1 
ATOM   916  C  CD2 . LEU A 1 137 ? 32.292  21.311  28.205 1.00 32.14  ? 137 LEU A CD2 1 
ATOM   917  N  N   . ASP A 1 138 ? 30.675  22.109  24.864 1.00 29.21  ? 138 ASP A N   1 
ATOM   918  C  CA  . ASP A 1 138 ? 31.105  23.450  24.533 1.00 29.58  ? 138 ASP A CA  1 
ATOM   919  C  C   . ASP A 1 138 ? 31.285  24.226  25.865 1.00 34.24  ? 138 ASP A C   1 
ATOM   920  O  O   . ASP A 1 138 ? 30.426  24.119  26.769 1.00 31.15  ? 138 ASP A O   1 
ATOM   921  C  CB  . ASP A 1 138 ? 30.098  24.114  23.562 1.00 32.21  ? 138 ASP A CB  1 
ATOM   922  C  CG  . ASP A 1 138 ? 28.816  24.650  24.190 1.00 43.89  ? 138 ASP A CG  1 
ATOM   923  O  OD1 . ASP A 1 138 ? 27.829  23.861  24.318 1.00 41.15  ? 138 ASP A OD1 1 
ATOM   924  O  OD2 . ASP A 1 138 ? 28.803  25.855  24.580 1.00 55.25  ? 138 ASP A OD2 1 
ATOM   925  N  N   . GLU A 1 139 ? 32.460  24.912  26.020 1.00 33.28  ? 139 GLU A N   1 
ATOM   926  C  CA  . GLU A 1 139 ? 32.787  25.765  27.189 1.00 32.75  ? 139 GLU A CA  1 
ATOM   927  C  C   . GLU A 1 139 ? 32.517  27.188  26.692 1.00 38.86  ? 139 GLU A C   1 
ATOM   928  O  O   . GLU A 1 139 ? 32.861  27.450  25.526 1.00 38.76  ? 139 GLU A O   1 
ATOM   929  C  CB  . GLU A 1 139 ? 34.258  25.647  27.624 1.00 33.56  ? 139 GLU A CB  1 
ATOM   930  C  CG  . GLU A 1 139 ? 34.636  24.395  28.395 1.00 41.10  ? 139 GLU A CG  1 
ATOM   931  C  CD  . GLU A 1 139 ? 36.121  24.321  28.730 1.00 70.29  ? 139 GLU A CD  1 
ATOM   932  O  OE1 . GLU A 1 139 ? 36.491  24.644  29.884 1.00 72.15  ? 139 GLU A OE1 1 
ATOM   933  O  OE2 . GLU A 1 139 ? 36.922  23.974  27.829 1.00 59.62  ? 139 GLU A OE2 1 
ATOM   934  N  N   . PRO A 1 140 ? 31.868  28.100  27.482 1.00 36.49  ? 140 PRO A N   1 
ATOM   935  C  CA  . PRO A 1 140 ? 31.378  27.926  28.857 1.00 36.23  ? 140 PRO A CA  1 
ATOM   936  C  C   . PRO A 1 140 ? 30.084  27.133  28.951 1.00 42.05  ? 140 PRO A C   1 
ATOM   937  O  O   . PRO A 1 140 ? 29.145  27.378  28.190 1.00 41.94  ? 140 PRO A O   1 
ATOM   938  C  CB  . PRO A 1 140 ? 31.278  29.362  29.387 1.00 38.04  ? 140 PRO A CB  1 
ATOM   939  C  CG  . PRO A 1 140 ? 31.136  30.237  28.195 1.00 42.40  ? 140 PRO A CG  1 
ATOM   940  C  CD  . PRO A 1 140 ? 31.582  29.462  26.983 1.00 38.51  ? 140 PRO A CD  1 
ATOM   941  N  N   . ALA A 1 141 ? 30.083  26.139  29.865 1.00 39.50  ? 141 ALA A N   1 
ATOM   942  C  CA  . ALA A 1 141 ? 29.001  25.185  30.133 1.00 39.05  ? 141 ALA A CA  1 
ATOM   943  C  C   . ALA A 1 141 ? 28.529  25.298  31.574 1.00 41.78  ? 141 ALA A C   1 
ATOM   944  O  O   . ALA A 1 141 ? 29.189  25.957  32.383 1.00 40.99  ? 141 ALA A O   1 
ATOM   945  C  CB  . ALA A 1 141 ? 29.491  23.767  29.864 1.00 39.45  ? 141 ALA A CB  1 
ATOM   946  N  N   . TYR A 1 142 ? 27.390  24.644  31.900 1.00 37.24  ? 142 TYR A N   1 
ATOM   947  C  CA  . TYR A 1 142 ? 26.813  24.660  33.250 1.00 35.38  ? 142 TYR A CA  1 
ATOM   948  C  C   . TYR A 1 142 ? 27.792  24.179  34.321 1.00 37.37  ? 142 TYR A C   1 
ATOM   949  O  O   . TYR A 1 142 ? 28.367  23.093  34.186 1.00 35.79  ? 142 TYR A O   1 
ATOM   950  C  CB  . TYR A 1 142 ? 25.512  23.844  33.292 1.00 35.27  ? 142 TYR A CB  1 
ATOM   951  C  CG  . TYR A 1 142 ? 24.857  23.751  34.655 1.00 35.31  ? 142 TYR A CG  1 
ATOM   952  C  CD1 . TYR A 1 142 ? 24.379  22.541  35.136 1.00 35.76  ? 142 TYR A CD1 1 
ATOM   953  C  CD2 . TYR A 1 142 ? 24.662  24.885  35.439 1.00 36.81  ? 142 TYR A CD2 1 
ATOM   954  C  CE1 . TYR A 1 142 ? 23.745  22.452  36.367 1.00 35.22  ? 142 TYR A CE1 1 
ATOM   955  C  CE2 . TYR A 1 142 ? 24.046  24.805  36.685 1.00 37.76  ? 142 TYR A CE2 1 
ATOM   956  C  CZ  . TYR A 1 142 ? 23.598  23.582  37.152 1.00 43.43  ? 142 TYR A CZ  1 
ATOM   957  O  OH  . TYR A 1 142 ? 22.982  23.490  38.380 1.00 45.06  ? 142 TYR A OH  1 
ATOM   958  N  N   . SER A 1 143 ? 27.965  25.002  35.390 1.00 33.49  ? 143 SER A N   1 
ATOM   959  C  CA  . SER A 1 143 ? 28.832  24.720  36.553 1.00 32.08  ? 143 SER A CA  1 
ATOM   960  C  C   . SER A 1 143 ? 28.535  23.347  37.105 1.00 33.16  ? 143 SER A C   1 
ATOM   961  O  O   . SER A 1 143 ? 29.442  22.525  37.207 1.00 32.58  ? 143 SER A O   1 
ATOM   962  C  CB  . SER A 1 143 ? 28.626  25.746  37.664 1.00 34.72  ? 143 SER A CB  1 
ATOM   963  O  OG  . SER A 1 143 ? 28.560  27.065  37.156 1.00 44.16  ? 143 SER A OG  1 
ATOM   964  N  N   . GLY A 1 144 ? 27.256  23.102  37.377 1.00 28.46  ? 144 GLY A N   1 
ATOM   965  C  CA  . GLY A 1 144 ? 26.748  21.846  37.911 1.00 27.88  ? 144 GLY A CA  1 
ATOM   966  C  C   . GLY A 1 144 ? 27.140  20.619  37.128 1.00 30.23  ? 144 GLY A C   1 
ATOM   967  O  O   . GLY A 1 144 ? 27.497  19.606  37.721 1.00 28.95  ? 144 GLY A O   1 
ATOM   968  N  N   . THR A 1 145 ? 27.107  20.703  35.803 1.00 28.23  ? 145 THR A N   1 
ATOM   969  C  CA  . THR A 1 145 ? 27.503  19.554  35.000 1.00 29.00  ? 145 THR A CA  1 
ATOM   970  C  C   . THR A 1 145 ? 29.012  19.387  34.944 1.00 35.69  ? 145 THR A C   1 
ATOM   971  O  O   . THR A 1 145 ? 29.488  18.253  34.949 1.00 36.98  ? 145 THR A O   1 
ATOM   972  C  CB  . THR A 1 145 ? 26.751  19.434  33.668 1.00 32.30  ? 145 THR A CB  1 
ATOM   973  O  OG1 . THR A 1 145 ? 27.390  20.192  32.655 1.00 24.93  ? 145 THR A OG1 1 
ATOM   974  C  CG2 . THR A 1 145 ? 25.267  19.741  33.797 1.00 30.47  ? 145 THR A CG2 1 
ATOM   975  N  N   . LEU A 1 146 ? 29.769  20.506  34.961 1.00 31.54  ? 146 LEU A N   1 
ATOM   976  C  CA  . LEU A 1 146 ? 31.232  20.453  34.958 1.00 30.52  ? 146 LEU A CA  1 
ATOM   977  C  C   . LEU A 1 146 ? 31.652  19.772  36.224 1.00 32.16  ? 146 LEU A C   1 
ATOM   978  O  O   . LEU A 1 146 ? 32.472  18.855  36.201 1.00 31.03  ? 146 LEU A O   1 
ATOM   979  C  CB  . LEU A 1 146 ? 31.843  21.863  34.911 1.00 30.95  ? 146 LEU A CB  1 
ATOM   980  C  CG  . LEU A 1 146 ? 31.691  22.633  33.610 1.00 36.79  ? 146 LEU A CG  1 
ATOM   981  C  CD1 . LEU A 1 146 ? 31.881  24.103  33.850 1.00 37.98  ? 146 LEU A CD1 1 
ATOM   982  C  CD2 . LEU A 1 146 ? 32.637  22.112  32.532 1.00 38.33  ? 146 LEU A CD2 1 
ATOM   983  N  N   . GLN A 1 147 ? 31.014  20.195  37.327 1.00 29.17  ? 147 GLN A N   1 
ATOM   984  C  CA  . GLN A 1 147 ? 31.224  19.715  38.682 1.00 28.75  ? 147 GLN A CA  1 
ATOM   985  C  C   . GLN A 1 147 ? 30.889  18.214  38.778 1.00 32.85  ? 147 GLN A C   1 
ATOM   986  O  O   . GLN A 1 147 ? 31.577  17.477  39.493 1.00 31.90  ? 147 GLN A O   1 
ATOM   987  C  CB  . GLN A 1 147 ? 30.402  20.564  39.668 1.00 29.54  ? 147 GLN A CB  1 
ATOM   988  C  CG  . GLN A 1 147 ? 31.083  21.856  40.124 1.00 47.40  ? 147 GLN A CG  1 
ATOM   989  C  CD  . GLN A 1 147 ? 30.390  22.512  41.322 1.00 82.90  ? 147 GLN A CD  1 
ATOM   990  O  OE1 . GLN A 1 147 ? 29.742  21.864  42.179 1.00 74.88  ? 147 GLN A OE1 1 
ATOM   991  N  NE2 . GLN A 1 147 ? 30.545  23.828  41.431 1.00 83.63  ? 147 GLN A NE2 1 
ATOM   992  N  N   . SER A 1 148 ? 29.872  17.771  38.008 1.00 29.70  ? 148 SER A N   1 
ATOM   993  C  CA  . SER A 1 148 ? 29.420  16.383  37.946 1.00 29.72  ? 148 SER A CA  1 
ATOM   994  C  C   . SER A 1 148 ? 30.490  15.477  37.292 1.00 34.67  ? 148 SER A C   1 
ATOM   995  O  O   . SER A 1 148 ? 30.938  14.489  37.897 1.00 34.51  ? 148 SER A O   1 
ATOM   996  C  CB  . SER A 1 148 ? 28.096  16.294  37.185 1.00 32.83  ? 148 SER A CB  1 
ATOM   997  O  OG  . SER A 1 148 ? 26.988  16.087  38.048 1.00 40.40  ? 148 SER A OG  1 
ATOM   998  N  N   . LEU A 1 149 ? 30.909  15.856  36.071 1.00 30.47  ? 149 LEU A N   1 
ATOM   999  C  CA  . LEU A 1 149 ? 31.871  15.178  35.211 1.00 29.98  ? 149 LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 149 ? 33.299  15.161  35.714 1.00 33.32  ? 149 LEU A C   1 
ATOM   1001 O  O   . LEU A 1 149 ? 34.029  14.223  35.404 1.00 32.75  ? 149 LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 149 ? 31.826  15.806  33.810 1.00 30.58  ? 149 LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 149 ? 30.517  15.623  33.026 1.00 35.26  ? 149 LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 149 ? 30.428  16.641  31.890 1.00 35.44  ? 149 LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 149 ? 30.319  14.149  32.552 1.00 36.42  ? 149 LEU A CD2 1 
ATOM   1006 N  N   . HIS A 1 150 ? 33.725  16.198  36.436 1.00 31.17  ? 150 HIS A N   1 
ATOM   1007 C  CA  . HIS A 1 150 ? 35.090  16.263  36.949 1.00 32.78  ? 150 HIS A CA  1 
ATOM   1008 C  C   . HIS A 1 150 ? 35.575  15.019  37.758 1.00 35.62  ? 150 HIS A C   1 
ATOM   1009 O  O   . HIS A 1 150 ? 36.523  14.370  37.303 1.00 36.78  ? 150 HIS A O   1 
ATOM   1010 C  CB  . HIS A 1 150 ? 35.343  17.563  37.704 1.00 35.08  ? 150 HIS A CB  1 
ATOM   1011 C  CG  . HIS A 1 150 ? 36.651  17.574  38.427 1.00 40.20  ? 150 HIS A CG  1 
ATOM   1012 N  ND1 . HIS A 1 150 ? 36.710  17.677  39.808 1.00 42.73  ? 150 HIS A ND1 1 
ATOM   1013 C  CD2 . HIS A 1 150 ? 37.911  17.460  37.938 1.00 43.48  ? 150 HIS A CD2 1 
ATOM   1014 C  CE1 . HIS A 1 150 ? 37.998  17.645  40.116 1.00 43.19  ? 150 HIS A CE1 1 
ATOM   1015 N  NE2 . HIS A 1 150 ? 38.759  17.511  39.020 1.00 44.04  ? 150 HIS A NE2 1 
ATOM   1016 N  N   . PRO A 1 151 ? 34.956  14.633  38.906 1.00 28.91  ? 151 PRO A N   1 
ATOM   1017 C  CA  . PRO A 1 151 ? 35.437  13.448  39.643 1.00 28.04  ? 151 PRO A CA  1 
ATOM   1018 C  C   . PRO A 1 151 ? 35.339  12.129  38.873 1.00 28.21  ? 151 PRO A C   1 
ATOM   1019 O  O   . PRO A 1 151 ? 36.002  11.123  39.208 1.00 27.71  ? 151 PRO A O   1 
ATOM   1020 C  CB  . PRO A 1 151 ? 34.496  13.401  40.851 1.00 29.44  ? 151 PRO A CB  1 
ATOM   1021 C  CG  . PRO A 1 151 ? 33.258  14.091  40.395 1.00 33.59  ? 151 PRO A CG  1 
ATOM   1022 C  CD  . PRO A 1 151 ? 33.802  15.232  39.602 1.00 29.70  ? 151 PRO A CD  1 
ATOM   1023 N  N   . LEU A 1 152 ? 34.482  12.153  37.855 1.00 22.13  ? 152 LEU A N   1 
ATOM   1024 C  CA  . LEU A 1 152 ? 34.141  11.018  37.043 1.00 21.72  ? 152 LEU A CA  1 
ATOM   1025 C  C   . LEU A 1 152 ? 35.302  10.419  36.202 1.00 29.93  ? 152 LEU A C   1 
ATOM   1026 O  O   . LEU A 1 152 ? 35.286  9.206   35.906 1.00 29.72  ? 152 LEU A O   1 
ATOM   1027 C  CB  . LEU A 1 152 ? 32.875  11.369  36.245 1.00 20.43  ? 152 LEU A CB  1 
ATOM   1028 C  CG  . LEU A 1 152 ? 31.613  10.592  36.573 1.00 20.55  ? 152 LEU A CG  1 
ATOM   1029 C  CD1 . LEU A 1 152 ? 31.334  10.544  38.074 1.00 19.83  ? 152 LEU A CD1 1 
ATOM   1030 C  CD2 . LEU A 1 152 ? 30.438  11.059  35.722 1.00 17.96  ? 152 LEU A CD2 1 
ATOM   1031 N  N   . GLY A 1 153 ? 36.308  11.259  35.892 1.00 28.88  ? 153 GLY A N   1 
ATOM   1032 C  CA  . GLY A 1 153 ? 37.523  10.856  35.181 1.00 30.16  ? 153 GLY A CA  1 
ATOM   1033 C  C   . GLY A 1 153 ? 37.521  10.988  33.671 1.00 35.90  ? 153 GLY A C   1 
ATOM   1034 O  O   . GLY A 1 153 ? 38.451  10.528  32.991 1.00 35.47  ? 153 GLY A O   1 
ATOM   1035 N  N   . CYS A 1 154 ? 36.476  11.622  33.130 1.00 33.48  ? 154 CYS A N   1 
ATOM   1036 C  CA  . CYS A 1 154 ? 36.369  11.825  31.686 1.00 32.73  ? 154 CYS A CA  1 
ATOM   1037 C  C   . CYS A 1 154 ? 37.265  12.960  31.221 1.00 36.04  ? 154 CYS A C   1 
ATOM   1038 O  O   . CYS A 1 154 ? 37.663  13.804  32.030 1.00 33.59  ? 154 CYS A O   1 
ATOM   1039 C  CB  . CYS A 1 154 ? 34.922  12.057  31.266 1.00 31.25  ? 154 CYS A CB  1 
ATOM   1040 S  SG  . CYS A 1 154 ? 34.149  13.476  32.066 1.00 33.38  ? 154 CYS A SG  1 
ATOM   1041 N  N   . ASN A 1 155 ? 37.582  12.947  29.902 1.00 34.43  ? 155 ASN A N   1 
ATOM   1042 C  CA  . ASN A 1 155 ? 38.362  13.946  29.177 1.00 35.00  ? 155 ASN A CA  1 
ATOM   1043 C  C   . ASN A 1 155 ? 37.342  14.816  28.491 1.00 38.13  ? 155 ASN A C   1 
ATOM   1044 O  O   . ASN A 1 155 ? 36.582  14.334  27.638 1.00 37.46  ? 155 ASN A O   1 
ATOM   1045 C  CB  . ASN A 1 155 ? 39.276  13.305  28.121 1.00 37.86  ? 155 ASN A CB  1 
ATOM   1046 C  CG  . ASN A 1 155 ? 40.279  12.329  28.674 1.00 71.77  ? 155 ASN A CG  1 
ATOM   1047 O  OD1 . ASN A 1 155 ? 41.144  12.684  29.486 1.00 68.95  ? 155 ASN A OD1 1 
ATOM   1048 N  ND2 . ASN A 1 155 ? 40.199  11.076  28.227 1.00 64.80  ? 155 ASN A ND2 1 
ATOM   1049 N  N   . ILE A 1 156 ? 37.266  16.081  28.906 1.00 33.44  ? 156 ILE A N   1 
ATOM   1050 C  CA  . ILE A 1 156 ? 36.313  16.974  28.276 1.00 32.24  ? 156 ILE A CA  1 
ATOM   1051 C  C   . ILE A 1 156 ? 37.022  17.667  27.097 1.00 38.89  ? 156 ILE A C   1 
ATOM   1052 O  O   . ILE A 1 156 ? 38.001  18.401  27.295 1.00 40.41  ? 156 ILE A O   1 
ATOM   1053 C  CB  . ILE A 1 156 ? 35.648  17.935  29.287 1.00 33.70  ? 156 ILE A CB  1 
ATOM   1054 C  CG1 . ILE A 1 156 ? 35.401  17.235  30.666 1.00 32.76  ? 156 ILE A CG1 1 
ATOM   1055 C  CG2 . ILE A 1 156 ? 34.383  18.535  28.681 1.00 33.30  ? 156 ILE A CG2 1 
ATOM   1056 C  CD1 . ILE A 1 156 ? 34.382  17.898  31.665 1.00 34.83  ? 156 ILE A CD1 1 
ATOM   1057 N  N   . ILE A 1 157 ? 36.601  17.339  25.864 1.00 34.20  ? 157 ILE A N   1 
ATOM   1058 C  CA  . ILE A 1 157 ? 37.187  17.942  24.666 1.00 33.32  ? 157 ILE A CA  1 
ATOM   1059 C  C   . ILE A 1 157 ? 36.312  19.151  24.386 1.00 34.60  ? 157 ILE A C   1 
ATOM   1060 O  O   . ILE A 1 157 ? 35.099  19.000  24.185 1.00 33.43  ? 157 ILE A O   1 
ATOM   1061 C  CB  . ILE A 1 157 ? 37.231  16.952  23.464 1.00 36.69  ? 157 ILE A CB  1 
ATOM   1062 C  CG1 . ILE A 1 157 ? 37.756  15.550  23.863 1.00 36.14  ? 157 ILE A CG1 1 
ATOM   1063 C  CG2 . ILE A 1 157 ? 38.050  17.542  22.325 1.00 38.92  ? 157 ILE A CG2 1 
ATOM   1064 C  CD1 . ILE A 1 157 ? 37.524  14.484  22.808 1.00 35.27  ? 157 ILE A CD1 1 
ATOM   1065 N  N   . ASN A 1 158 ? 36.897  20.344  24.430 1.00 30.33  ? 158 ASN A N   1 
ATOM   1066 C  CA  . ASN A 1 158 ? 36.091  21.542  24.218 1.00 30.26  ? 158 ASN A CA  1 
ATOM   1067 C  C   . ASN A 1 158 ? 35.765  21.812  22.750 1.00 35.30  ? 158 ASN A C   1 
ATOM   1068 O  O   . ASN A 1 158 ? 36.669  21.920  21.907 1.00 34.97  ? 158 ASN A O   1 
ATOM   1069 C  CB  . ASN A 1 158 ? 36.705  22.767  24.905 1.00 30.75  ? 158 ASN A CB  1 
ATOM   1070 C  CG  . ASN A 1 158 ? 35.927  24.049  24.711 1.00 46.79  ? 158 ASN A CG  1 
ATOM   1071 O  OD1 . ASN A 1 158 ? 34.681  24.074  24.666 1.00 39.61  ? 158 ASN A OD1 1 
ATOM   1072 N  ND2 . ASN A 1 158 ? 36.657  25.142  24.544 1.00 37.06  ? 158 ASN A ND2 1 
ATOM   1073 N  N   . VAL A 1 159 ? 34.461  21.963  22.472 1.00 32.61  ? 159 VAL A N   1 
ATOM   1074 C  CA  . VAL A 1 159 ? 33.931  22.244  21.136 1.00 34.32  ? 159 VAL A CA  1 
ATOM   1075 C  C   . VAL A 1 159 ? 33.685  23.751  20.975 1.00 42.56  ? 159 VAL A C   1 
ATOM   1076 O  O   . VAL A 1 159 ? 32.936  24.344  21.759 1.00 42.91  ? 159 VAL A O   1 
ATOM   1077 C  CB  . VAL A 1 159 ? 32.651  21.410  20.815 1.00 37.44  ? 159 VAL A CB  1 
ATOM   1078 C  CG1 . VAL A 1 159 ? 32.230  21.585  19.349 1.00 37.59  ? 159 VAL A CG1 1 
ATOM   1079 C  CG2 . VAL A 1 159 ? 32.838  19.924  21.166 1.00 36.66  ? 159 VAL A CG2 1 
ATOM   1080 N  N   . ALA A 1 160 ? 34.301  24.367  19.953 1.00 41.77  ? 160 ALA A N   1 
ATOM   1081 C  CA  . ALA A 1 160 ? 34.147  25.809  19.697 1.00 42.33  ? 160 ALA A CA  1 
ATOM   1082 C  C   . ALA A 1 160 ? 32.692  26.232  19.481 1.00 46.15  ? 160 ALA A C   1 
ATOM   1083 O  O   . ALA A 1 160 ? 31.980  25.637  18.665 1.00 46.10  ? 160 ALA A O   1 
ATOM   1084 C  CB  . ALA A 1 160 ? 35.012  26.245  18.519 1.00 44.06  ? 160 ALA A CB  1 
ATOM   1085 N  N   . SER A 1 161 ? 32.259  27.254  20.238 1.00 41.94  ? 161 SER A N   1 
ATOM   1086 C  CA  . SER A 1 161 ? 30.909  27.813  20.173 1.00 41.45  ? 161 SER A CA  1 
ATOM   1087 C  C   . SER A 1 161 ? 30.878  29.235  19.576 1.00 43.87  ? 161 SER A C   1 
ATOM   1088 O  O   . SER A 1 161 ? 31.886  29.725  19.062 1.00 43.70  ? 161 SER A O   1 
ATOM   1089 C  CB  . SER A 1 161 ? 30.303  27.836  21.570 1.00 45.14  ? 161 SER A CB  1 
ATOM   1090 O  OG  . SER A 1 161 ? 31.016  28.740  22.400 1.00 54.32  ? 161 SER A OG  1 
ATOM   1091 N  N   . ASP A 1 162 ? 29.702  29.890  19.659 1.00 39.22  ? 162 ASP A N   1 
ATOM   1092 C  CA  . ASP A 1 162 ? 29.405  31.268  19.245 1.00 38.67  ? 162 ASP A CA  1 
ATOM   1093 C  C   . ASP A 1 162 ? 27.956  31.607  19.579 1.00 43.94  ? 162 ASP A C   1 
ATOM   1094 O  O   . ASP A 1 162 ? 27.260  30.743  20.116 1.00 43.86  ? 162 ASP A O   1 
ATOM   1095 C  CB  . ASP A 1 162 ? 29.704  31.516  17.752 1.00 40.42  ? 162 ASP A CB  1 
ATOM   1096 C  CG  . ASP A 1 162 ? 28.907  30.722  16.747 1.00 41.19  ? 162 ASP A CG  1 
ATOM   1097 O  OD1 . ASP A 1 162 ? 27.702  30.508  16.975 1.00 39.80  ? 162 ASP A OD1 1 
ATOM   1098 O  OD2 . ASP A 1 162 ? 29.449  30.431  15.678 1.00 47.96  ? 162 ASP A OD2 1 
ATOM   1099 N  N   . GLU A 1 163 ? 27.491  32.839  19.223 1.00 41.54  ? 163 GLU A N   1 
ATOM   1100 C  CA  . GLU A 1 163 ? 26.130  33.359  19.419 1.00 41.65  ? 163 GLU A CA  1 
ATOM   1101 C  C   . GLU A 1 163 ? 25.038  32.350  18.979 1.00 46.45  ? 163 GLU A C   1 
ATOM   1102 O  O   . GLU A 1 163 ? 24.012  32.206  19.666 1.00 46.35  ? 163 GLU A O   1 
ATOM   1103 C  CB  . GLU A 1 163 ? 25.963  34.700  18.690 1.00 44.08  ? 163 GLU A CB  1 
ATOM   1104 N  N   . SER A 1 164 ? 25.284  31.616  17.881 1.00 43.08  ? 164 SER A N   1 
ATOM   1105 C  CA  . SER A 1 164 ? 24.338  30.614  17.411 1.00 44.05  ? 164 SER A CA  1 
ATOM   1106 C  C   . SER A 1 164 ? 24.560  29.197  17.998 1.00 50.24  ? 164 SER A C   1 
ATOM   1107 O  O   . SER A 1 164 ? 23.819  28.265  17.661 1.00 50.70  ? 164 SER A O   1 
ATOM   1108 C  CB  . SER A 1 164 ? 24.275  30.609  15.896 1.00 49.25  ? 164 SER A CB  1 
ATOM   1109 O  OG  . SER A 1 164 ? 23.898  31.909  15.480 1.00 63.82  ? 164 SER A OG  1 
ATOM   1110 N  N   . GLY A 1 165 ? 25.526  29.067  18.911 1.00 46.97  ? 165 GLY A N   1 
ATOM   1111 C  CA  . GLY A 1 165 ? 25.817  27.814  19.600 1.00 46.41  ? 165 GLY A CA  1 
ATOM   1112 C  C   . GLY A 1 165 ? 27.076  27.108  19.150 1.00 51.11  ? 165 GLY A C   1 
ATOM   1113 O  O   . GLY A 1 165 ? 28.017  27.753  18.670 1.00 51.40  ? 165 GLY A O   1 
ATOM   1114 N  N   . ILE A 1 166 ? 27.095  25.762  19.319 1.00 47.17  ? 166 ILE A N   1 
ATOM   1115 C  CA  . ILE A 1 166 ? 28.226  24.906  18.935 1.00 46.95  ? 166 ILE A CA  1 
ATOM   1116 C  C   . ILE A 1 166 ? 28.417  25.046  17.401 1.00 52.69  ? 166 ILE A C   1 
ATOM   1117 O  O   . ILE A 1 166 ? 27.423  25.126  16.672 1.00 54.15  ? 166 ILE A O   1 
ATOM   1118 C  CB  . ILE A 1 166 ? 28.147  23.409  19.481 1.00 49.35  ? 166 ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1 166 ? 27.696  22.385  18.455 1.00 50.80  ? 166 ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1 166 ? 27.336  23.228  20.763 1.00 48.58  ? 166 ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1 166 ? 28.787  21.638  17.839 1.00 63.88  ? 166 ILE A CD1 1 
ATOM   1122 N  N   . VAL A 1 167 ? 29.670  25.178  16.934 1.00 47.82  ? 167 VAL A N   1 
ATOM   1123 C  CA  . VAL A 1 167 ? 29.982  25.333  15.507 1.00 47.52  ? 167 VAL A CA  1 
ATOM   1124 C  C   . VAL A 1 167 ? 30.107  23.932  14.921 1.00 48.39  ? 167 VAL A C   1 
ATOM   1125 O  O   . VAL A 1 167 ? 31.122  23.277  15.166 1.00 47.30  ? 167 VAL A O   1 
ATOM   1126 C  CB  . VAL A 1 167 ? 31.269  26.170  15.293 1.00 51.89  ? 167 VAL A CB  1 
ATOM   1127 C  CG1 . VAL A 1 167 ? 31.644  26.278  13.812 1.00 52.66  ? 167 VAL A CG1 1 
ATOM   1128 C  CG2 . VAL A 1 167 ? 31.122  27.546  15.920 1.00 51.80  ? 167 VAL A CG2 1 
ATOM   1129 N  N   . PRO A 1 168 ? 29.111  23.427  14.159 1.00 43.92  ? 168 PRO A N   1 
ATOM   1130 C  CA  . PRO A 1 168 ? 29.233  22.059  13.618 1.00 43.35  ? 168 PRO A CA  1 
ATOM   1131 C  C   . PRO A 1 168 ? 30.614  21.761  13.045 1.00 45.89  ? 168 PRO A C   1 
ATOM   1132 O  O   . PRO A 1 168 ? 31.125  20.654  13.236 1.00 43.94  ? 168 PRO A O   1 
ATOM   1133 C  CB  . PRO A 1 168 ? 28.125  21.998  12.564 1.00 45.96  ? 168 PRO A CB  1 
ATOM   1134 C  CG  . PRO A 1 168 ? 27.076  22.908  13.097 1.00 50.38  ? 168 PRO A CG  1 
ATOM   1135 C  CD  . PRO A 1 168 ? 27.830  24.047  13.753 1.00 45.62  ? 168 PRO A CD  1 
ATOM   1136 N  N   . ASP A 1 169 ? 31.244  22.797  12.425 1.00 42.85  ? 169 ASP A N   1 
ATOM   1137 C  CA  . ASP A 1 169 ? 32.566  22.742  11.809 1.00 42.78  ? 169 ASP A CA  1 
ATOM   1138 C  C   . ASP A 1 169 ? 33.661  22.405  12.812 1.00 44.52  ? 169 ASP A C   1 
ATOM   1139 O  O   . ASP A 1 169 ? 34.555  21.633  12.474 1.00 44.94  ? 169 ASP A O   1 
ATOM   1140 C  CB  . ASP A 1 169 ? 32.874  24.029  11.025 1.00 45.30  ? 169 ASP A CB  1 
ATOM   1141 C  CG  . ASP A 1 169 ? 32.117  24.177  9.715  1.00 56.59  ? 169 ASP A CG  1 
ATOM   1142 O  OD1 . ASP A 1 169 ? 31.372  23.235  9.343  1.00 57.35  ? 169 ASP A OD1 1 
ATOM   1143 O  OD2 . ASP A 1 169 ? 32.292  25.221  9.042  1.00 62.85  ? 169 ASP A OD2 1 
ATOM   1144 N  N   . SER A 1 170 ? 33.575  22.940  14.050 1.00 37.54  ? 170 SER A N   1 
ATOM   1145 C  CA  . SER A 1 170 ? 34.539  22.653  15.103 1.00 35.76  ? 170 SER A CA  1 
ATOM   1146 C  C   . SER A 1 170 ? 34.410  21.166  15.451 1.00 42.68  ? 170 SER A C   1 
ATOM   1147 O  O   . SER A 1 170 ? 35.394  20.421  15.330 1.00 43.40  ? 170 SER A O   1 
ATOM   1148 C  CB  . SER A 1 170 ? 34.244  23.519  16.314 1.00 36.45  ? 170 SER A CB  1 
ATOM   1149 O  OG  . SER A 1 170 ? 34.953  23.069  17.452 1.00 45.15  ? 170 SER A OG  1 
ATOM   1150 N  N   . LEU A 1 171 ? 33.162  20.721  15.796 1.00 38.96  ? 171 LEU A N   1 
ATOM   1151 C  CA  . LEU A 1 171 ? 32.794  19.336  16.105 1.00 37.63  ? 171 LEU A CA  1 
ATOM   1152 C  C   . LEU A 1 171 ? 33.295  18.439  14.970 1.00 43.82  ? 171 LEU A C   1 
ATOM   1153 O  O   . LEU A 1 171 ? 33.970  17.437  15.230 1.00 44.33  ? 171 LEU A O   1 
ATOM   1154 C  CB  . LEU A 1 171 ? 31.260  19.250  16.258 1.00 36.83  ? 171 LEU A CB  1 
ATOM   1155 C  CG  . LEU A 1 171 ? 30.603  17.906  16.653 1.00 40.49  ? 171 LEU A CG  1 
ATOM   1156 C  CD1 . LEU A 1 171 ? 31.201  17.317  17.932 1.00 39.40  ? 171 LEU A CD1 1 
ATOM   1157 C  CD2 . LEU A 1 171 ? 29.112  18.089  16.869 1.00 40.62  ? 171 LEU A CD2 1 
ATOM   1158 N  N   . ARG A 1 172 ? 33.050  18.877  13.713 1.00 40.65  ? 172 ARG A N   1 
ATOM   1159 C  CA  . ARG A 1 172 ? 33.464  18.223  12.480 1.00 41.69  ? 172 ARG A CA  1 
ATOM   1160 C  C   . ARG A 1 172 ? 34.987  18.041  12.450 1.00 47.25  ? 172 ARG A C   1 
ATOM   1161 O  O   . ARG A 1 172 ? 35.464  16.960  12.079 1.00 48.02  ? 172 ARG A O   1 
ATOM   1162 C  CB  . ARG A 1 172 ? 32.951  19.038  11.284 1.00 41.93  ? 172 ARG A CB  1 
ATOM   1163 C  CG  . ARG A 1 172 ? 33.271  18.503  9.903  1.00 51.34  ? 172 ARG A CG  1 
ATOM   1164 C  CD  . ARG A 1 172 ? 32.993  19.560  8.858  1.00 67.36  ? 172 ARG A CD  1 
ATOM   1165 N  NE  . ARG A 1 172 ? 34.001  20.624  8.867  1.00 86.56  ? 172 ARG A NE  1 
ATOM   1166 C  CZ  . ARG A 1 172 ? 33.958  21.709  8.098  1.00 110.40 ? 172 ARG A CZ  1 
ATOM   1167 N  NH1 . ARG A 1 172 ? 32.960  21.884  7.238  1.00 100.63 ? 172 ARG A NH1 1 
ATOM   1168 N  NH2 . ARG A 1 172 ? 34.914  22.627  8.180  1.00 102.16 ? 172 ARG A NH2 1 
ATOM   1169 N  N   . ASP A 1 173 ? 35.741  19.074  12.881 1.00 43.81  ? 173 ASP A N   1 
ATOM   1170 C  CA  . ASP A 1 173 ? 37.201  19.008  12.924 1.00 44.64  ? 173 ASP A CA  1 
ATOM   1171 C  C   . ASP A 1 173 ? 37.613  18.089  14.040 1.00 43.94  ? 173 ASP A C   1 
ATOM   1172 O  O   . ASP A 1 173 ? 38.482  17.248  13.832 1.00 44.09  ? 173 ASP A O   1 
ATOM   1173 C  CB  . ASP A 1 173 ? 37.849  20.396  13.138 1.00 48.36  ? 173 ASP A CB  1 
ATOM   1174 C  CG  . ASP A 1 173 ? 37.457  21.489  12.147 1.00 74.51  ? 173 ASP A CG  1 
ATOM   1175 O  OD1 . ASP A 1 173 ? 37.094  21.148  10.989 1.00 79.04  ? 173 ASP A OD1 1 
ATOM   1176 O  OD2 . ASP A 1 173 ? 37.501  22.692  12.532 1.00 82.79  ? 173 ASP A OD2 1 
ATOM   1177 N  N   . ILE A 1 174 ? 36.987  18.220  15.218 1.00 36.65  ? 174 ILE A N   1 
ATOM   1178 C  CA  . ILE A 1 174 ? 37.353  17.375  16.359 1.00 35.69  ? 174 ILE A CA  1 
ATOM   1179 C  C   . ILE A 1 174 ? 37.190  15.871  16.062 1.00 39.59  ? 174 ILE A C   1 
ATOM   1180 O  O   . ILE A 1 174 ? 38.097  15.072  16.328 1.00 40.36  ? 174 ILE A O   1 
ATOM   1181 C  CB  . ILE A 1 174 ? 36.660  17.816  17.683 1.00 37.18  ? 174 ILE A CB  1 
ATOM   1182 C  CG1 . ILE A 1 174 ? 37.011  19.286  18.043 1.00 36.90  ? 174 ILE A CG1 1 
ATOM   1183 C  CG2 . ILE A 1 174 ? 37.011  16.858  18.846 1.00 36.32  ? 174 ILE A CG2 1 
ATOM   1184 C  CD1 . ILE A 1 174 ? 35.915  20.039  18.767 1.00 38.51  ? 174 ILE A CD1 1 
ATOM   1185 N  N   . LEU A 1 175 ? 36.054  15.509  15.479 1.00 34.09  ? 175 LEU A N   1 
ATOM   1186 C  CA  . LEU A 1 175 ? 35.736  14.132  15.169 1.00 33.81  ? 175 LEU A CA  1 
ATOM   1187 C  C   . LEU A 1 175 ? 36.700  13.434  14.184 1.00 39.81  ? 175 LEU A C   1 
ATOM   1188 O  O   . LEU A 1 175 ? 36.921  12.208  14.276 1.00 37.49  ? 175 LEU A O   1 
ATOM   1189 C  CB  . LEU A 1 175 ? 34.282  14.059  14.737 1.00 33.35  ? 175 LEU A CB  1 
ATOM   1190 C  CG  . LEU A 1 175 ? 33.325  14.222  15.894 1.00 36.12  ? 175 LEU A CG  1 
ATOM   1191 C  CD1 . LEU A 1 175 ? 31.957  14.542  15.428 1.00 36.77  ? 175 LEU A CD1 1 
ATOM   1192 C  CD2 . LEU A 1 175 ? 33.330  13.015  16.772 1.00 36.08  ? 175 LEU A CD2 1 
ATOM   1193 N  N   . SER A 1 176 ? 37.325  14.258  13.289 1.00 39.20  ? 176 SER A N   1 
ATOM   1194 C  CA  . SER A 1 176 ? 38.308  13.895  12.251 1.00 39.98  ? 176 SER A CA  1 
ATOM   1195 C  C   . SER A 1 176 ? 39.575  13.213  12.838 1.00 44.08  ? 176 SER A C   1 
ATOM   1196 O  O   . SER A 1 176 ? 40.466  12.803  12.077 1.00 45.02  ? 176 SER A O   1 
ATOM   1197 C  CB  . SER A 1 176 ? 38.688  15.130  11.439 1.00 41.57  ? 176 SER A CB  1 
ATOM   1198 O  OG  . SER A 1 176 ? 39.620  15.951  12.126 1.00 44.27  ? 176 SER A OG  1 
ATOM   1199 N  N   . ARG A 1 177 ? 39.648  13.124  14.197 1.00 38.13  ? 177 ARG A N   1 
ATOM   1200 C  CA  . ARG A 1 177 ? 40.714  12.468  14.933 1.00 37.56  ? 177 ARG A CA  1 
ATOM   1201 C  C   . ARG A 1 177 ? 40.486  10.993  14.740 1.00 45.14  ? 177 ARG A C   1 
ATOM   1202 O  O   . ARG A 1 177 ? 41.436  10.266  14.463 1.00 46.81  ? 177 ARG A O   1 
ATOM   1203 C  CB  . ARG A 1 177 ? 40.636  12.819  16.421 1.00 34.08  ? 177 ARG A CB  1 
ATOM   1204 N  N   . TRP A 1 178 ? 39.201  10.564  14.798 1.00 42.58  ? 178 TRP A N   1 
ATOM   1205 C  CA  . TRP A 1 178 ? 38.779  9.172   14.636 1.00 43.25  ? 178 TRP A CA  1 
ATOM   1206 C  C   . TRP A 1 178 ? 38.313  8.812   13.193 1.00 49.50  ? 178 TRP A C   1 
ATOM   1207 O  O   . TRP A 1 178 ? 38.379  9.638   12.266 1.00 50.07  ? 178 TRP A O   1 
ATOM   1208 C  CB  . TRP A 1 178 ? 37.674  8.835   15.652 1.00 40.11  ? 178 TRP A CB  1 
ATOM   1209 C  CG  . TRP A 1 178 ? 38.061  8.991   17.091 1.00 39.74  ? 178 TRP A CG  1 
ATOM   1210 C  CD1 . TRP A 1 178 ? 38.565  8.027   17.910 1.00 42.61  ? 178 TRP A CD1 1 
ATOM   1211 C  CD2 . TRP A 1 178 ? 37.835  10.139  17.916 1.00 38.45  ? 178 TRP A CD2 1 
ATOM   1212 N  NE1 . TRP A 1 178 ? 38.727  8.522   19.184 1.00 40.77  ? 178 TRP A NE1 1 
ATOM   1213 C  CE2 . TRP A 1 178 ? 38.269  9.812   19.219 1.00 41.31  ? 178 TRP A CE2 1 
ATOM   1214 C  CE3 . TRP A 1 178 ? 37.361  11.443  17.669 1.00 39.39  ? 178 TRP A CE3 1 
ATOM   1215 C  CZ2 . TRP A 1 178 ? 38.235  10.732  20.269 1.00 39.39  ? 178 TRP A CZ2 1 
ATOM   1216 C  CZ3 . TRP A 1 178 ? 37.355  12.360  18.705 1.00 39.24  ? 178 TRP A CZ3 1 
ATOM   1217 C  CH2 . TRP A 1 178 ? 37.782  12.000  19.987 1.00 39.12  ? 178 TRP A CH2 1 
ATOM   1218 N  N   . LYS A 1 179 ? 37.867  7.553   13.025 1.00 45.91  ? 179 LYS A N   1 
ATOM   1219 C  CA  . LYS A 1 179 ? 37.294  7.019   11.798 1.00 47.50  ? 179 LYS A CA  1 
ATOM   1220 C  C   . LYS A 1 179 ? 35.869  6.555   12.171 1.00 53.96  ? 179 LYS A C   1 
ATOM   1221 O  O   . LYS A 1 179 ? 35.671  6.098   13.302 1.00 52.88  ? 179 LYS A O   1 
ATOM   1222 C  CB  . LYS A 1 179 ? 38.136  5.852   11.245 1.00 51.30  ? 179 LYS A CB  1 
ATOM   1223 C  CG  . LYS A 1 179 ? 39.186  6.276   10.215 1.00 62.23  ? 179 LYS A CG  1 
ATOM   1224 C  CD  . LYS A 1 179 ? 40.622  6.001   10.675 1.00 70.08  ? 179 LYS A CD  1 
ATOM   1225 C  CE  . LYS A 1 179 ? 41.450  7.263   10.875 1.00 75.11  ? 179 LYS A CE  1 
ATOM   1226 N  NZ  . LYS A 1 179 ? 41.586  7.652   12.317 1.00 73.62  ? 179 LYS A NZ  1 
ATOM   1227 N  N   . PRO A 1 180 ? 34.848  6.685   11.279 1.00 52.36  ? 180 PRO A N   1 
ATOM   1228 C  CA  . PRO A 1 180 ? 33.483  6.289   11.664 1.00 50.92  ? 180 PRO A CA  1 
ATOM   1229 C  C   . PRO A 1 180 ? 33.332  4.845   12.100 1.00 54.23  ? 180 PRO A C   1 
ATOM   1230 O  O   . PRO A 1 180 ? 32.375  4.535   12.821 1.00 53.81  ? 180 PRO A O   1 
ATOM   1231 C  CB  . PRO A 1 180 ? 32.659  6.610   10.421 1.00 53.66  ? 180 PRO A CB  1 
ATOM   1232 C  CG  . PRO A 1 180 ? 33.423  7.704   9.746  1.00 59.13  ? 180 PRO A CG  1 
ATOM   1233 C  CD  . PRO A 1 180 ? 34.854  7.267   9.921  1.00 55.48  ? 180 PRO A CD  1 
ATOM   1234 N  N   . GLU A 1 181 ? 34.289  3.978   11.715 1.00 50.74  ? 181 GLU A N   1 
ATOM   1235 C  CA  . GLU A 1 181 ? 34.264  2.571   12.115 1.00 50.75  ? 181 GLU A CA  1 
ATOM   1236 C  C   . GLU A 1 181 ? 34.678  2.442   13.589 1.00 54.79  ? 181 GLU A C   1 
ATOM   1237 O  O   . GLU A 1 181 ? 34.078  1.629   14.303 1.00 55.01  ? 181 GLU A O   1 
ATOM   1238 C  CB  . GLU A 1 181 ? 35.162  1.668   11.242 1.00 53.60  ? 181 GLU A CB  1 
ATOM   1239 C  CG  . GLU A 1 181 ? 35.324  2.062   9.785  1.00 63.57  ? 181 GLU A CG  1 
ATOM   1240 C  CD  . GLU A 1 181 ? 36.457  3.036   9.513  1.00 79.11  ? 181 GLU A CD  1 
ATOM   1241 O  OE1 . GLU A 1 181 ? 36.165  4.199   9.149  1.00 74.30  ? 181 GLU A OE1 1 
ATOM   1242 O  OE2 . GLU A 1 181 ? 37.636  2.634   9.647  1.00 63.21  ? 181 GLU A OE2 1 
ATOM   1243 N  N   . ASP A 1 182 ? 35.683  3.262   14.047 1.00 49.27  ? 182 ASP A N   1 
ATOM   1244 C  CA  . ASP A 1 182 ? 36.245  3.261   15.415 1.00 47.61  ? 182 ASP A CA  1 
ATOM   1245 C  C   . ASP A 1 182 ? 35.247  3.168   16.575 1.00 51.27  ? 182 ASP A C   1 
ATOM   1246 O  O   . ASP A 1 182 ? 35.614  2.655   17.640 1.00 51.83  ? 182 ASP A O   1 
ATOM   1247 C  CB  . ASP A 1 182 ? 37.224  4.429   15.645 1.00 48.70  ? 182 ASP A CB  1 
ATOM   1248 C  CG  . ASP A 1 182 ? 38.348  4.539   14.638 1.00 56.17  ? 182 ASP A CG  1 
ATOM   1249 O  OD1 . ASP A 1 182 ? 38.465  3.627   13.772 1.00 57.38  ? 182 ASP A OD1 1 
ATOM   1250 O  OD2 . ASP A 1 182 ? 39.102  5.554   14.692 1.00 56.69  ? 182 ASP A OD2 1 
ATOM   1251 N  N   . ALA A 1 183 ? 33.993  3.649   16.380 1.00 46.00  ? 183 ALA A N   1 
ATOM   1252 C  CA  . ALA A 1 183 ? 32.940  3.605   17.406 1.00 43.49  ? 183 ALA A CA  1 
ATOM   1253 C  C   . ALA A 1 183 ? 32.620  2.167   17.783 1.00 45.25  ? 183 ALA A C   1 
ATOM   1254 O  O   . ALA A 1 183 ? 32.317  1.887   18.942 1.00 41.99  ? 183 ALA A O   1 
ATOM   1255 C  CB  . ALA A 1 183 ? 31.694  4.317   16.908 1.00 44.08  ? 183 ALA A CB  1 
ATOM   1256 N  N   . LYS A 1 184 ? 32.736  1.252   16.799 1.00 44.60  ? 184 LYS A N   1 
ATOM   1257 C  CA  . LYS A 1 184 ? 32.512  -0.189  16.963 1.00 45.09  ? 184 LYS A CA  1 
ATOM   1258 C  C   . LYS A 1 184 ? 33.698  -0.794  17.716 1.00 50.04  ? 184 LYS A C   1 
ATOM   1259 O  O   . LYS A 1 184 ? 33.527  -1.779  18.434 1.00 50.76  ? 184 LYS A O   1 
ATOM   1260 C  CB  . LYS A 1 184 ? 32.378  -0.909  15.595 1.00 48.37  ? 184 LYS A CB  1 
ATOM   1261 C  CG  . LYS A 1 184 ? 31.345  -0.350  14.618 1.00 65.93  ? 184 LYS A CG  1 
ATOM   1262 C  CD  . LYS A 1 184 ? 31.519  -0.961  13.204 1.00 79.51  ? 184 LYS A CD  1 
ATOM   1263 C  CE  . LYS A 1 184 ? 30.663  -0.335  12.111 1.00 88.23  ? 184 LYS A CE  1 
ATOM   1264 N  NZ  . LYS A 1 184 ? 31.141  1.024   11.699 1.00 90.35  ? 184 LYS A NZ  1 
ATOM   1265 N  N   . ASN A 1 185 ? 34.897  -0.224  17.532 1.00 46.37  ? 185 ASN A N   1 
ATOM   1266 C  CA  . ASN A 1 185 ? 36.119  -0.763  18.106 1.00 47.18  ? 185 ASN A CA  1 
ATOM   1267 C  C   . ASN A 1 185 ? 36.481  -0.382  19.531 1.00 52.20  ? 185 ASN A C   1 
ATOM   1268 O  O   . ASN A 1 185 ? 37.019  0.714   19.753 1.00 51.31  ? 185 ASN A O   1 
ATOM   1269 C  CB  . ASN A 1 185 ? 37.320  -0.535  17.169 1.00 50.59  ? 185 ASN A CB  1 
ATOM   1270 C  CG  . ASN A 1 185 ? 38.627  -1.158  17.634 1.00 74.49  ? 185 ASN A CG  1 
ATOM   1271 O  OD1 . ASN A 1 185 ? 39.712  -0.630  17.379 1.00 62.74  ? 185 ASN A OD1 1 
ATOM   1272 N  ND2 . ASN A 1 185 ? 38.565  -2.323  18.282 1.00 69.93  ? 185 ASN A ND2 1 
ATOM   1273 N  N   . PRO A 1 186 ? 36.338  -1.330  20.497 1.00 49.87  ? 186 PRO A N   1 
ATOM   1274 C  CA  . PRO A 1 186 ? 36.882  -1.073  21.848 1.00 48.85  ? 186 PRO A CA  1 
ATOM   1275 C  C   . PRO A 1 186 ? 38.404  -1.158  21.644 1.00 54.25  ? 186 PRO A C   1 
ATOM   1276 O  O   . PRO A 1 186 ? 38.854  -2.125  21.031 1.00 57.09  ? 186 PRO A O   1 
ATOM   1277 C  CB  . PRO A 1 186 ? 36.341  -2.252  22.689 1.00 50.19  ? 186 PRO A CB  1 
ATOM   1278 C  CG  . PRO A 1 186 ? 35.343  -2.988  21.799 1.00 54.85  ? 186 PRO A CG  1 
ATOM   1279 C  CD  . PRO A 1 186 ? 35.795  -2.703  20.392 1.00 51.84  ? 186 PRO A CD  1 
ATOM   1280 N  N   . GLN A 1 187 ? 39.169  -0.112  22.010 1.00 48.34  ? 187 GLN A N   1 
ATOM   1281 C  CA  . GLN A 1 187 ? 40.634  0.070   21.795 1.00 47.98  ? 187 GLN A CA  1 
ATOM   1282 C  C   . GLN A 1 187 ? 40.792  1.408   21.104 1.00 50.78  ? 187 GLN A C   1 
ATOM   1283 O  O   . GLN A 1 187 ? 41.908  1.914   20.932 1.00 50.78  ? 187 GLN A O   1 
ATOM   1284 C  CB  . GLN A 1 187 ? 41.305  -1.030  20.929 1.00 49.98  ? 187 GLN A CB  1 
ATOM   1285 C  CG  . GLN A 1 187 ? 41.898  -2.189  21.720 1.00 32.81  ? 187 GLN A CG  1 
ATOM   1286 C  CD  . GLN A 1 187 ? 42.235  -3.320  20.809 1.00 62.08  ? 187 GLN A CD  1 
ATOM   1287 O  OE1 . GLN A 1 187 ? 43.405  -3.579  20.525 1.00 65.21  ? 187 GLN A OE1 1 
ATOM   1288 N  NE2 . GLN A 1 187 ? 41.214  -3.993  20.286 1.00 60.50  ? 187 GLN A NE2 1 
ATOM   1289 N  N   . LYS A 1 188 ? 39.646  1.940   20.669 1.00 46.35  ? 188 LYS A N   1 
ATOM   1290 C  CA  . LYS A 1 188 ? 39.474  3.244   20.053 1.00 45.66  ? 188 LYS A CA  1 
ATOM   1291 C  C   . LYS A 1 188 ? 38.519  4.005   20.982 1.00 46.19  ? 188 LYS A C   1 
ATOM   1292 O  O   . LYS A 1 188 ? 37.376  3.580   21.194 1.00 43.66  ? 188 LYS A O   1 
ATOM   1293 C  CB  . LYS A 1 188 ? 38.932  3.124   18.607 1.00 47.93  ? 188 LYS A CB  1 
ATOM   1294 C  CG  . LYS A 1 188 ? 39.921  2.556   17.599 1.00 44.13  ? 188 LYS A CG  1 
ATOM   1295 C  CD  . LYS A 1 188 ? 41.066  3.506   17.260 1.00 46.75  ? 188 LYS A CD  1 
ATOM   1296 C  CE  . LYS A 1 188 ? 42.189  2.850   16.489 1.00 50.89  ? 188 LYS A CE  1 
ATOM   1297 N  NZ  . LYS A 1 188 ? 43.321  2.509   17.394 1.00 63.35  ? 188 LYS A NZ  1 
ATOM   1298 N  N   . ASN A 1 189 ? 39.021  5.075   21.595 1.00 42.37  ? 189 ASN A N   1 
ATOM   1299 C  CA  . ASN A 1 189 ? 38.219  5.812   22.551 1.00 41.23  ? 189 ASN A CA  1 
ATOM   1300 C  C   . ASN A 1 189 ? 37.445  6.935   21.925 1.00 44.01  ? 189 ASN A C   1 
ATOM   1301 O  O   . ASN A 1 189 ? 37.796  8.110   22.065 1.00 44.10  ? 189 ASN A O   1 
ATOM   1302 C  CB  . ASN A 1 189 ? 39.013  6.246   23.789 1.00 43.77  ? 189 ASN A CB  1 
ATOM   1303 C  CG  . ASN A 1 189 ? 38.121  6.338   24.991 1.00 73.16  ? 189 ASN A CG  1 
ATOM   1304 O  OD1 . ASN A 1 189 ? 37.456  7.352   25.224 1.00 71.29  ? 189 ASN A OD1 1 
ATOM   1305 N  ND2 . ASN A 1 189 ? 37.994  5.233   25.709 1.00 67.44  ? 189 ASN A ND2 1 
ATOM   1306 N  N   . THR A 1 190 ? 36.377  6.561   21.227 1.00 39.01  ? 190 THR A N   1 
ATOM   1307 C  CA  . THR A 1 190 ? 35.476  7.502   20.569 1.00 37.67  ? 190 THR A CA  1 
ATOM   1308 C  C   . THR A 1 190 ? 34.632  8.222   21.612 1.00 38.36  ? 190 THR A C   1 
ATOM   1309 O  O   . THR A 1 190 ? 34.359  7.643   22.671 1.00 38.18  ? 190 THR A O   1 
ATOM   1310 C  CB  . THR A 1 190 ? 34.590  6.784   19.547 1.00 43.07  ? 190 THR A CB  1 
ATOM   1311 O  OG1 . THR A 1 190 ? 34.036  5.602   20.147 1.00 46.06  ? 190 THR A OG1 1 
ATOM   1312 C  CG2 . THR A 1 190 ? 35.336  6.468   18.245 1.00 37.79  ? 190 THR A CG2 1 
ATOM   1313 N  N   . PRO A 1 191 ? 34.233  9.487   21.353 1.00 32.02  ? 191 PRO A N   1 
ATOM   1314 C  CA  . PRO A 1 191 ? 33.387  10.210  22.312 1.00 30.71  ? 191 PRO A CA  1 
ATOM   1315 C  C   . PRO A 1 191 ? 32.124  9.447   22.756 1.00 36.14  ? 191 PRO A C   1 
ATOM   1316 O  O   . PRO A 1 191 ? 31.382  8.953   21.906 1.00 36.16  ? 191 PRO A O   1 
ATOM   1317 C  CB  . PRO A 1 191 ? 33.037  11.479  21.540 1.00 31.70  ? 191 PRO A CB  1 
ATOM   1318 C  CG  . PRO A 1 191 ? 34.170  11.691  20.673 1.00 35.79  ? 191 PRO A CG  1 
ATOM   1319 C  CD  . PRO A 1 191 ? 34.521  10.336  20.186 1.00 32.76  ? 191 PRO A CD  1 
ATOM   1320 N  N   . LYS A 1 192 ? 31.911  9.285   24.082 1.00 33.64  ? 192 LYS A N   1 
ATOM   1321 C  CA  . LYS A 1 192 ? 30.709  8.582   24.552 1.00 34.05  ? 192 LYS A CA  1 
ATOM   1322 C  C   . LYS A 1 192 ? 29.438  9.391   24.273 1.00 41.61  ? 192 LYS A C   1 
ATOM   1323 O  O   . LYS A 1 192 ? 28.444  8.840   23.783 1.00 41.30  ? 192 LYS A O   1 
ATOM   1324 C  CB  . LYS A 1 192 ? 30.823  8.081   26.003 1.00 34.06  ? 192 LYS A CB  1 
ATOM   1325 C  CG  . LYS A 1 192 ? 31.513  6.723   26.030 1.00 34.01  ? 192 LYS A CG  1 
ATOM   1326 C  CD  . LYS A 1 192 ? 31.217  5.853   27.233 1.00 31.46  ? 192 LYS A CD  1 
ATOM   1327 C  CE  . LYS A 1 192 ? 31.943  4.546   27.041 1.00 28.90  ? 192 LYS A CE  1 
ATOM   1328 N  NZ  . LYS A 1 192 ? 31.673  3.556   28.113 1.00 41.56  ? 192 LYS A NZ  1 
ATOM   1329 N  N   . PHE A 1 193 ? 29.519  10.719  24.495 1.00 39.79  ? 193 PHE A N   1 
ATOM   1330 C  CA  . PHE A 1 193 ? 28.425  11.645  24.228 1.00 39.89  ? 193 PHE A CA  1 
ATOM   1331 C  C   . PHE A 1 193 ? 28.889  13.078  23.924 1.00 43.70  ? 193 PHE A C   1 
ATOM   1332 O  O   . PHE A 1 193 ? 30.022  13.480  24.246 1.00 42.46  ? 193 PHE A O   1 
ATOM   1333 C  CB  . PHE A 1 193 ? 27.427  11.683  25.410 1.00 40.83  ? 193 PHE A CB  1 
ATOM   1334 C  CG  . PHE A 1 193 ? 27.985  12.237  26.706 1.00 41.65  ? 193 PHE A CG  1 
ATOM   1335 C  CD1 . PHE A 1 193 ? 28.321  11.395  27.751 1.00 44.46  ? 193 PHE A CD1 1 
ATOM   1336 C  CD2 . PHE A 1 193 ? 28.148  13.603  26.889 1.00 43.39  ? 193 PHE A CD2 1 
ATOM   1337 C  CE1 . PHE A 1 193 ? 28.813  11.912  28.951 1.00 44.45  ? 193 PHE A CE1 1 
ATOM   1338 C  CE2 . PHE A 1 193 ? 28.685  14.108  28.075 1.00 45.13  ? 193 PHE A CE2 1 
ATOM   1339 C  CZ  . PHE A 1 193 ? 28.999  13.261  29.103 1.00 42.47  ? 193 PHE A CZ  1 
ATOM   1340 N  N   . LEU A 1 194 ? 27.957  13.852  23.352 1.00 39.66  ? 194 LEU A N   1 
ATOM   1341 C  CA  . LEU A 1 194 ? 28.075  15.277  23.201 1.00 39.25  ? 194 LEU A CA  1 
ATOM   1342 C  C   . LEU A 1 194 ? 27.061  15.836  24.194 1.00 42.82  ? 194 LEU A C   1 
ATOM   1343 O  O   . LEU A 1 194 ? 25.951  15.306  24.317 1.00 43.41  ? 194 LEU A O   1 
ATOM   1344 C  CB  . LEU A 1 194 ? 27.733  15.764  21.808 1.00 40.23  ? 194 LEU A CB  1 
ATOM   1345 C  CG  . LEU A 1 194 ? 27.590  17.294  21.701 1.00 44.16  ? 194 LEU A CG  1 
ATOM   1346 C  CD1 . LEU A 1 194 ? 28.892  17.947  21.251 1.00 44.60  ? 194 LEU A CD1 1 
ATOM   1347 C  CD2 . LEU A 1 194 ? 26.398  17.675  20.841 1.00 45.23  ? 194 LEU A CD2 1 
ATOM   1348 N  N   . TYR A 1 195 ? 27.450  16.896  24.902 1.00 37.10  ? 195 TYR A N   1 
ATOM   1349 C  CA  . TYR A 1 195 ? 26.617  17.561  25.884 1.00 34.53  ? 195 TYR A CA  1 
ATOM   1350 C  C   . TYR A 1 195 ? 26.366  19.012  25.458 1.00 37.27  ? 195 TYR A C   1 
ATOM   1351 O  O   . TYR A 1 195 ? 27.310  19.772  25.151 1.00 35.48  ? 195 TYR A O   1 
ATOM   1352 C  CB  . TYR A 1 195 ? 27.284  17.478  27.265 1.00 33.62  ? 195 TYR A CB  1 
ATOM   1353 C  CG  . TYR A 1 195 ? 26.524  18.216  28.334 1.00 33.80  ? 195 TYR A CG  1 
ATOM   1354 C  CD1 . TYR A 1 195 ? 25.412  17.644  28.946 1.00 36.40  ? 195 TYR A CD1 1 
ATOM   1355 C  CD2 . TYR A 1 195 ? 26.896  19.499  28.719 1.00 33.35  ? 195 TYR A CD2 1 
ATOM   1356 C  CE1 . TYR A 1 195 ? 24.686  18.333  29.921 1.00 37.72  ? 195 TYR A CE1 1 
ATOM   1357 C  CE2 . TYR A 1 195 ? 26.165  20.208  29.671 1.00 33.81  ? 195 TYR A CE2 1 
ATOM   1358 C  CZ  . TYR A 1 195 ? 25.067  19.617  30.281 1.00 38.90  ? 195 TYR A CZ  1 
ATOM   1359 O  OH  . TYR A 1 195 ? 24.345  20.303  31.230 1.00 30.43  ? 195 TYR A OH  1 
ATOM   1360 N  N   . THR A 1 196 ? 25.074  19.383  25.435 1.00 34.25  ? 196 THR A N   1 
ATOM   1361 C  CA  . THR A 1 196 ? 24.644  20.742  25.101 1.00 34.57  ? 196 THR A CA  1 
ATOM   1362 C  C   . THR A 1 196 ? 23.374  21.251  25.807 1.00 35.65  ? 196 THR A C   1 
ATOM   1363 O  O   . THR A 1 196 ? 22.502  20.463  26.214 1.00 32.55  ? 196 THR A O   1 
ATOM   1364 C  CB  . THR A 1 196 ? 24.694  21.032  23.574 1.00 45.32  ? 196 THR A CB  1 
ATOM   1365 O  OG1 . THR A 1 196 ? 24.914  22.433  23.373 1.00 50.75  ? 196 THR A OG1 1 
ATOM   1366 C  CG2 . THR A 1 196 ? 23.425  20.596  22.836 1.00 43.14  ? 196 THR A CG2 1 
ATOM   1367 N  N   . VAL A 1 197 ? 23.306  22.601  25.938 1.00 32.85  ? 197 VAL A N   1 
ATOM   1368 C  CA  . VAL A 1 197 ? 22.148  23.341  26.431 1.00 33.13  ? 197 VAL A CA  1 
ATOM   1369 C  C   . VAL A 1 197 ? 21.660  24.047  25.175 1.00 38.52  ? 197 VAL A C   1 
ATOM   1370 O  O   . VAL A 1 197 ? 22.147  25.143  24.844 1.00 39.76  ? 197 VAL A O   1 
ATOM   1371 C  CB  . VAL A 1 197 ? 22.371  24.272  27.657 1.00 35.84  ? 197 VAL A CB  1 
ATOM   1372 C  CG1 . VAL A 1 197 ? 21.070  24.963  28.038 1.00 36.10  ? 197 VAL A CG1 1 
ATOM   1373 C  CG2 . VAL A 1 197 ? 22.896  23.478  28.853 1.00 34.53  ? 197 VAL A CG2 1 
ATOM   1374 N  N   . PRO A 1 198 ? 20.799  23.354  24.377 1.00 33.60  ? 198 PRO A N   1 
ATOM   1375 C  CA  . PRO A 1 198 ? 20.409  23.913  23.070 1.00 33.82  ? 198 PRO A CA  1 
ATOM   1376 C  C   . PRO A 1 198 ? 19.660  25.231  23.092 1.00 35.52  ? 198 PRO A C   1 
ATOM   1377 O  O   . PRO A 1 198 ? 19.602  25.875  22.056 1.00 36.50  ? 198 PRO A O   1 
ATOM   1378 C  CB  . PRO A 1 198 ? 19.626  22.770  22.404 1.00 35.66  ? 198 PRO A CB  1 
ATOM   1379 C  CG  . PRO A 1 198 ? 19.130  21.984  23.506 1.00 38.94  ? 198 PRO A CG  1 
ATOM   1380 C  CD  . PRO A 1 198 ? 20.171  22.034  24.587 1.00 33.39  ? 198 PRO A CD  1 
ATOM   1381 N  N   . ASN A 1 199 ? 19.090  25.614  24.238 1.00 29.87  ? 199 ASN A N   1 
ATOM   1382 C  CA  . ASN A 1 199 ? 18.343  26.851  24.367 1.00 30.98  ? 199 ASN A CA  1 
ATOM   1383 C  C   . ASN A 1 199 ? 18.734  27.608  25.626 1.00 35.32  ? 199 ASN A C   1 
ATOM   1384 O  O   . ASN A 1 199 ? 18.586  27.064  26.739 1.00 36.61  ? 199 ASN A O   1 
ATOM   1385 C  CB  . ASN A 1 199 ? 16.827  26.598  24.335 1.00 31.95  ? 199 ASN A CB  1 
ATOM   1386 C  CG  . ASN A 1 199 ? 16.295  26.159  23.005 1.00 57.97  ? 199 ASN A CG  1 
ATOM   1387 O  OD1 . ASN A 1 199 ? 16.603  26.735  21.943 1.00 51.78  ? 199 ASN A OD1 1 
ATOM   1388 N  ND2 . ASN A 1 199 ? 15.445  25.146  23.049 1.00 52.52  ? 199 ASN A ND2 1 
ATOM   1389 N  N   . GLY A 1 200 ? 19.200  28.849  25.432 1.00 28.50  ? 200 GLY A N   1 
ATOM   1390 C  CA  . GLY A 1 200 ? 19.606  29.750  26.500 1.00 27.00  ? 200 GLY A CA  1 
ATOM   1391 C  C   . GLY A 1 200 ? 20.661  29.217  27.452 1.00 27.86  ? 200 GLY A C   1 
ATOM   1392 O  O   . GLY A 1 200 ? 20.478  29.251  28.677 1.00 25.81  ? 200 GLY A O   1 
ATOM   1393 N  N   . ASN A 1 201 ? 21.789  28.769  26.890 1.00 25.01  ? 201 ASN A N   1 
ATOM   1394 C  CA  . ASN A 1 201 ? 22.906  28.203  27.633 1.00 24.55  ? 201 ASN A CA  1 
ATOM   1395 C  C   . ASN A 1 201 ? 23.396  28.986  28.866 1.00 29.85  ? 201 ASN A C   1 
ATOM   1396 O  O   . ASN A 1 201 ? 23.747  30.161  28.784 1.00 27.39  ? 201 ASN A O   1 
ATOM   1397 C  CB  . ASN A 1 201 ? 24.074  27.842  26.686 1.00 26.44  ? 201 ASN A CB  1 
ATOM   1398 C  CG  . ASN A 1 201 ? 25.299  27.275  27.390 1.00 44.59  ? 201 ASN A CG  1 
ATOM   1399 O  OD1 . ASN A 1 201 ? 26.339  27.934  27.508 1.00 37.54  ? 201 ASN A OD1 1 
ATOM   1400 N  ND2 . ASN A 1 201 ? 25.200  26.055  27.908 1.00 32.99  ? 201 ASN A ND2 1 
ATOM   1401 N  N   . ASN A 1 202 ? 23.429  28.286  30.010 1.00 29.95  ? 202 ASN A N   1 
ATOM   1402 C  CA  . ASN A 1 202 ? 24.003  28.758  31.269 1.00 30.84  ? 202 ASN A CA  1 
ATOM   1403 C  C   . ASN A 1 202 ? 25.485  28.598  30.967 1.00 35.84  ? 202 ASN A C   1 
ATOM   1404 O  O   . ASN A 1 202 ? 25.905  27.485  30.624 1.00 36.12  ? 202 ASN A O   1 
ATOM   1405 C  CB  . ASN A 1 202 ? 23.608  27.826  32.442 1.00 36.01  ? 202 ASN A CB  1 
ATOM   1406 C  CG  . ASN A 1 202 ? 23.868  28.364  33.846 1.00 72.27  ? 202 ASN A CG  1 
ATOM   1407 O  OD1 . ASN A 1 202 ? 24.656  29.294  34.070 1.00 74.81  ? 202 ASN A OD1 1 
ATOM   1408 N  ND2 . ASN A 1 202 ? 23.179  27.803  34.833 1.00 60.82  ? 202 ASN A ND2 1 
ATOM   1409 N  N   . PRO A 1 203 ? 26.253  29.691  30.853 1.00 33.20  ? 203 PRO A N   1 
ATOM   1410 C  CA  . PRO A 1 203 ? 25.959  31.065  31.291 1.00 34.10  ? 203 PRO A CA  1 
ATOM   1411 C  C   . PRO A 1 203 ? 25.685  32.121  30.206 1.00 39.31  ? 203 PRO A C   1 
ATOM   1412 O  O   . PRO A 1 203 ? 25.297  33.253  30.532 1.00 38.01  ? 203 PRO A O   1 
ATOM   1413 C  CB  . PRO A 1 203 ? 27.244  31.410  32.053 1.00 35.24  ? 203 PRO A CB  1 
ATOM   1414 C  CG  . PRO A 1 203 ? 28.339  30.708  31.267 1.00 38.92  ? 203 PRO A CG  1 
ATOM   1415 C  CD  . PRO A 1 203 ? 27.690  29.542  30.547 1.00 34.40  ? 203 PRO A CD  1 
ATOM   1416 N  N   . THR A 1 204 ? 25.918  31.737  28.923 1.00 36.37  ? 204 THR A N   1 
ATOM   1417 C  CA  . THR A 1 204 ? 25.898  32.572  27.713 1.00 35.76  ? 204 THR A CA  1 
ATOM   1418 C  C   . THR A 1 204 ? 24.550  33.069  27.233 1.00 41.03  ? 204 THR A C   1 
ATOM   1419 O  O   . THR A 1 204 ? 24.478  34.165  26.657 1.00 42.03  ? 204 THR A O   1 
ATOM   1420 C  CB  . THR A 1 204 ? 26.752  31.949  26.593 1.00 24.92  ? 204 THR A CB  1 
ATOM   1421 O  OG1 . THR A 1 204 ? 25.962  31.039  25.830 1.00 22.09  ? 204 THR A OG1 1 
ATOM   1422 C  CG2 . THR A 1 204 ? 28.001  31.259  27.124 1.00 17.46  ? 204 THR A CG2 1 
ATOM   1423 N  N   . GLY A 1 205 ? 23.517  32.249  27.435 1.00 35.98  ? 205 GLY A N   1 
ATOM   1424 C  CA  . GLY A 1 205 ? 22.158  32.527  26.984 1.00 36.08  ? 205 GLY A CA  1 
ATOM   1425 C  C   . GLY A 1 205 ? 21.981  32.277  25.494 1.00 38.30  ? 205 GLY A C   1 
ATOM   1426 O  O   . GLY A 1 205 ? 20.945  32.641  24.926 1.00 37.19  ? 205 GLY A O   1 
ATOM   1427 N  N   . ASN A 1 206 ? 23.004  31.667  24.844 1.00 34.77  ? 206 ASN A N   1 
ATOM   1428 C  CA  . ASN A 1 206 ? 22.973  31.399  23.406 1.00 36.27  ? 206 ASN A CA  1 
ATOM   1429 C  C   . ASN A 1 206 ? 22.190  30.122  23.140 1.00 43.76  ? 206 ASN A C   1 
ATOM   1430 O  O   . ASN A 1 206 ? 22.287  29.168  23.929 1.00 44.52  ? 206 ASN A O   1 
ATOM   1431 C  CB  . ASN A 1 206 ? 24.391  31.349  22.768 1.00 34.17  ? 206 ASN A CB  1 
ATOM   1432 C  CG  . ASN A 1 206 ? 25.328  32.552  22.958 1.00 53.77  ? 206 ASN A CG  1 
ATOM   1433 O  OD1 . ASN A 1 206 ? 26.548  32.368  23.059 1.00 44.78  ? 206 ASN A OD1 1 
ATOM   1434 N  ND2 . ASN A 1 206 ? 24.828  33.805  22.950 1.00 43.72  ? 206 ASN A ND2 1 
ATOM   1435 N  N   . SER A 1 207 ? 21.380  30.123  22.053 1.00 41.30  ? 207 SER A N   1 
ATOM   1436 C  CA  . SER A 1 207 ? 20.543  28.997  21.629 1.00 41.09  ? 207 SER A CA  1 
ATOM   1437 C  C   . SER A 1 207 ? 21.001  28.498  20.283 1.00 47.67  ? 207 SER A C   1 
ATOM   1438 O  O   . SER A 1 207 ? 21.454  29.298  19.479 1.00 50.25  ? 207 SER A O   1 
ATOM   1439 C  CB  . SER A 1 207 ? 19.074  29.409  21.524 1.00 44.03  ? 207 SER A CB  1 
ATOM   1440 O  OG  . SER A 1 207 ? 18.490  29.710  22.781 1.00 49.90  ? 207 SER A OG  1 
ATOM   1441 N  N   . LEU A 1 208 ? 20.856  27.203  20.009 1.00 44.17  ? 208 LEU A N   1 
ATOM   1442 C  CA  . LEU A 1 208 ? 21.204  26.657  18.712 1.00 45.28  ? 208 LEU A CA  1 
ATOM   1443 C  C   . LEU A 1 208 ? 20.101  26.981  17.689 1.00 50.76  ? 208 LEU A C   1 
ATOM   1444 O  O   . LEU A 1 208 ? 19.021  27.448  18.061 1.00 51.24  ? 208 LEU A O   1 
ATOM   1445 C  CB  . LEU A 1 208 ? 21.442  25.134  18.790 1.00 45.57  ? 208 LEU A CB  1 
ATOM   1446 C  CG  . LEU A 1 208 ? 22.835  24.671  19.261 1.00 50.97  ? 208 LEU A CG  1 
ATOM   1447 C  CD1 . LEU A 1 208 ? 22.802  23.219  19.701 1.00 51.00  ? 208 LEU A CD1 1 
ATOM   1448 C  CD2 . LEU A 1 208 ? 23.913  24.893  18.189 1.00 53.84  ? 208 LEU A CD2 1 
ATOM   1449 N  N   . THR A 1 209 ? 20.395  26.724  16.396 1.00 47.00  ? 209 THR A N   1 
ATOM   1450 C  CA  . THR A 1 209 ? 19.537  26.909  15.223 1.00 46.71  ? 209 THR A CA  1 
ATOM   1451 C  C   . THR A 1 209 ? 19.106  25.520  14.726 1.00 48.17  ? 209 THR A C   1 
ATOM   1452 O  O   . THR A 1 209 ? 19.820  24.549  14.988 1.00 45.15  ? 209 THR A O   1 
ATOM   1453 C  CB  . THR A 1 209 ? 20.354  27.624  14.121 1.00 54.80  ? 209 THR A CB  1 
ATOM   1454 O  OG1 . THR A 1 209 ? 21.260  26.698  13.527 1.00 55.07  ? 209 THR A OG1 1 
ATOM   1455 C  CG2 . THR A 1 209 ? 21.146  28.813  14.644 1.00 51.09  ? 209 THR A CG2 1 
ATOM   1456 N  N   . SER A 1 210 ? 17.981  25.428  13.969 1.00 47.19  ? 210 SER A N   1 
ATOM   1457 C  CA  . SER A 1 210 ? 17.480  24.161  13.372 1.00 47.45  ? 210 SER A CA  1 
ATOM   1458 C  C   . SER A 1 210 ? 18.559  23.534  12.494 1.00 49.27  ? 210 SER A C   1 
ATOM   1459 O  O   . SER A 1 210 ? 18.848  22.337  12.622 1.00 47.01  ? 210 SER A O   1 
ATOM   1460 C  CB  . SER A 1 210 ? 16.247  24.399  12.496 1.00 53.17  ? 210 SER A CB  1 
ATOM   1461 O  OG  . SER A 1 210 ? 15.113  24.846  13.218 1.00 65.08  ? 210 SER A OG  1 
ATOM   1462 N  N   . GLU A 1 211 ? 19.165  24.371  11.615 1.00 46.02  ? 211 GLU A N   1 
ATOM   1463 C  CA  . GLU A 1 211 ? 20.211  23.964  10.696 1.00 46.05  ? 211 GLU A CA  1 
ATOM   1464 C  C   . GLU A 1 211 ? 21.409  23.317  11.397 1.00 45.44  ? 211 GLU A C   1 
ATOM   1465 O  O   . GLU A 1 211 ? 21.692  22.141  11.135 1.00 45.08  ? 211 GLU A O   1 
ATOM   1466 C  CB  . GLU A 1 211 ? 20.612  25.109  9.740  1.00 48.96  ? 211 GLU A CB  1 
ATOM   1467 C  CG  . GLU A 1 211 ? 21.245  24.637  8.430  1.00 66.40  ? 211 GLU A CG  1 
ATOM   1468 C  CD  . GLU A 1 211 ? 20.738  23.317  7.859  1.00 97.28  ? 211 GLU A CD  1 
ATOM   1469 O  OE1 . GLU A 1 211 ? 21.556  22.374  7.748  1.00 87.71  ? 211 GLU A OE1 1 
ATOM   1470 O  OE2 . GLU A 1 211 ? 19.522  23.208  7.568  1.00 94.94  ? 211 GLU A OE2 1 
ATOM   1471 N  N   . ARG A 1 212 ? 22.062  24.060  12.318 1.00 37.62  ? 212 ARG A N   1 
ATOM   1472 C  CA  . ARG A 1 212 ? 23.211  23.595  13.082 1.00 35.25  ? 212 ARG A CA  1 
ATOM   1473 C  C   . ARG A 1 212 ? 22.917  22.271  13.796 1.00 37.95  ? 212 ARG A C   1 
ATOM   1474 O  O   . ARG A 1 212 ? 23.756  21.373  13.747 1.00 36.65  ? 212 ARG A O   1 
ATOM   1475 C  CB  . ARG A 1 212 ? 23.634  24.652  14.106 1.00 35.17  ? 212 ARG A CB  1 
ATOM   1476 C  CG  . ARG A 1 212 ? 24.477  25.783  13.551 1.00 43.76  ? 212 ARG A CG  1 
ATOM   1477 C  CD  . ARG A 1 212 ? 25.139  26.552  14.674 1.00 45.08  ? 212 ARG A CD  1 
ATOM   1478 N  NE  . ARG A 1 212 ? 25.732  27.797  14.190 1.00 48.17  ? 212 ARG A NE  1 
ATOM   1479 C  CZ  . ARG A 1 212 ? 26.788  28.405  14.726 1.00 53.93  ? 212 ARG A CZ  1 
ATOM   1480 N  NH1 . ARG A 1 212 ? 27.407  27.881  15.785 1.00 32.49  ? 212 ARG A NH1 1 
ATOM   1481 N  NH2 . ARG A 1 212 ? 27.244  29.531  14.203 1.00 37.31  ? 212 ARG A NH2 1 
ATOM   1482 N  N   . LYS A 1 213 ? 21.723  22.148  14.441 1.00 34.65  ? 213 LYS A N   1 
ATOM   1483 C  CA  . LYS A 1 213 ? 21.294  20.945  15.158 1.00 33.96  ? 213 LYS A CA  1 
ATOM   1484 C  C   . LYS A 1 213 ? 21.269  19.756  14.214 1.00 42.32  ? 213 LYS A C   1 
ATOM   1485 O  O   . LYS A 1 213 ? 21.740  18.682  14.598 1.00 42.96  ? 213 LYS A O   1 
ATOM   1486 C  CB  . LYS A 1 213 ? 19.919  21.125  15.830 1.00 35.21  ? 213 LYS A CB  1 
ATOM   1487 C  CG  . LYS A 1 213 ? 19.948  21.884  17.150 1.00 34.78  ? 213 LYS A CG  1 
ATOM   1488 C  CD  . LYS A 1 213 ? 18.639  21.727  17.915 1.00 38.88  ? 213 LYS A CD  1 
ATOM   1489 C  CE  . LYS A 1 213 ? 18.295  22.931  18.771 1.00 52.09  ? 213 LYS A CE  1 
ATOM   1490 N  NZ  . LYS A 1 213 ? 16.988  22.777  19.482 1.00 59.56  ? 213 LYS A NZ  1 
ATOM   1491 N  N   . LYS A 1 214 ? 20.764  19.955  12.962 1.00 40.72  ? 214 LYS A N   1 
ATOM   1492 C  CA  . LYS A 1 214 ? 20.707  18.900  11.932 1.00 41.20  ? 214 LYS A CA  1 
ATOM   1493 C  C   . LYS A 1 214 ? 22.115  18.410  11.605 1.00 43.67  ? 214 LYS A C   1 
ATOM   1494 O  O   . LYS A 1 214 ? 22.369  17.199  11.604 1.00 42.50  ? 214 LYS A O   1 
ATOM   1495 C  CB  . LYS A 1 214 ? 19.943  19.351  10.664 1.00 44.31  ? 214 LYS A CB  1 
ATOM   1496 C  CG  . LYS A 1 214 ? 18.436  19.480  10.852 1.00 41.98  ? 214 LYS A CG  1 
ATOM   1497 C  CD  . LYS A 1 214 ? 17.797  20.316  9.744  1.00 50.09  ? 214 LYS A CD  1 
ATOM   1498 C  CE  . LYS A 1 214 ? 16.486  20.925  10.195 1.00 53.97  ? 214 LYS A CE  1 
ATOM   1499 N  NZ  . LYS A 1 214 ? 15.835  21.702  9.116  1.00 54.15  ? 214 LYS A NZ  1 
ATOM   1500 N  N   . GLU A 1 215 ? 23.035  19.374  11.411 1.00 39.78  ? 215 GLU A N   1 
ATOM   1501 C  CA  . GLU A 1 215 ? 24.445  19.134  11.135 1.00 39.48  ? 215 GLU A CA  1 
ATOM   1502 C  C   . GLU A 1 215 ? 25.084  18.355  12.305 1.00 42.40  ? 215 GLU A C   1 
ATOM   1503 O  O   . GLU A 1 215 ? 25.760  17.353  12.041 1.00 44.02  ? 215 GLU A O   1 
ATOM   1504 C  CB  . GLU A 1 215 ? 25.186  20.459  10.885 1.00 40.63  ? 215 GLU A CB  1 
ATOM   1505 C  CG  . GLU A 1 215 ? 24.965  21.088  9.529  1.00 50.75  ? 215 GLU A CG  1 
ATOM   1506 C  CD  . GLU A 1 215 ? 25.245  22.580  9.499  1.00 86.77  ? 215 GLU A CD  1 
ATOM   1507 O  OE1 . GLU A 1 215 ? 24.347  23.340  9.068  1.00 92.21  ? 215 GLU A OE1 1 
ATOM   1508 O  OE2 . GLU A 1 215 ? 26.356  22.994  9.906  1.00 82.80  ? 215 GLU A OE2 1 
ATOM   1509 N  N   . ILE A 1 216 ? 24.838  18.793  13.575 1.00 34.92  ? 216 ILE A N   1 
ATOM   1510 C  CA  . ILE A 1 216 ? 25.333  18.157  14.804 1.00 33.14  ? 216 ILE A CA  1 
ATOM   1511 C  C   . ILE A 1 216 ? 24.790  16.723  14.933 1.00 35.41  ? 216 ILE A C   1 
ATOM   1512 O  O   . ILE A 1 216 ? 25.588  15.807  15.118 1.00 33.27  ? 216 ILE A O   1 
ATOM   1513 C  CB  . ILE A 1 216 ? 25.032  19.010  16.071 1.00 36.00  ? 216 ILE A CB  1 
ATOM   1514 C  CG1 . ILE A 1 216 ? 25.475  20.488  15.909 1.00 36.88  ? 216 ILE A CG1 1 
ATOM   1515 C  CG2 . ILE A 1 216 ? 25.629  18.377  17.354 1.00 35.08  ? 216 ILE A CG2 1 
ATOM   1516 C  CD1 . ILE A 1 216 ? 24.650  21.480  16.800 1.00 41.12  ? 216 ILE A CD1 1 
ATOM   1517 N  N   . TYR A 1 217 ? 23.447  16.526  14.811 1.00 33.48  ? 217 TYR A N   1 
ATOM   1518 C  CA  . TYR A 1 217 ? 22.816  15.192  14.856 1.00 33.92  ? 217 TYR A CA  1 
ATOM   1519 C  C   . TYR A 1 217 ? 23.405  14.292  13.781 1.00 39.26  ? 217 TYR A C   1 
ATOM   1520 O  O   . TYR A 1 217 ? 23.659  13.114  14.033 1.00 37.44  ? 217 TYR A O   1 
ATOM   1521 C  CB  . TYR A 1 217 ? 21.277  15.241  14.681 1.00 35.78  ? 217 TYR A CB  1 
ATOM   1522 C  CG  . TYR A 1 217 ? 20.622  13.895  14.959 1.00 37.74  ? 217 TYR A CG  1 
ATOM   1523 C  CD1 . TYR A 1 217 ? 20.295  13.513  16.259 1.00 38.70  ? 217 TYR A CD1 1 
ATOM   1524 C  CD2 . TYR A 1 217 ? 20.415  12.965  13.934 1.00 39.04  ? 217 TYR A CD2 1 
ATOM   1525 C  CE1 . TYR A 1 217 ? 19.777  12.245  16.532 1.00 39.20  ? 217 TYR A CE1 1 
ATOM   1526 C  CE2 . TYR A 1 217 ? 19.885  11.697  14.198 1.00 38.94  ? 217 TYR A CE2 1 
ATOM   1527 C  CZ  . TYR A 1 217 ? 19.565  11.345  15.499 1.00 41.22  ? 217 TYR A CZ  1 
ATOM   1528 O  OH  . TYR A 1 217 ? 19.026  10.123  15.791 1.00 35.92  ? 217 TYR A OH  1 
ATOM   1529 N  N   . GLU A 1 218 ? 23.583  14.851  12.566 1.00 38.78  ? 218 GLU A N   1 
ATOM   1530 C  CA  . GLU A 1 218 ? 24.163  14.147  11.430 1.00 40.04  ? 218 GLU A CA  1 
ATOM   1531 C  C   . GLU A 1 218 ? 25.569  13.663  11.784 1.00 42.52  ? 218 GLU A C   1 
ATOM   1532 O  O   . GLU A 1 218 ? 25.919  12.522  11.474 1.00 41.24  ? 218 GLU A O   1 
ATOM   1533 C  CB  . GLU A 1 218 ? 24.170  15.049  10.193 1.00 42.88  ? 218 GLU A CB  1 
ATOM   1534 C  CG  . GLU A 1 218 ? 23.946  14.275  8.905  1.00 60.65  ? 218 GLU A CG  1 
ATOM   1535 C  CD  . GLU A 1 218 ? 22.673  13.453  8.847  1.00 83.69  ? 218 GLU A CD  1 
ATOM   1536 O  OE1 . GLU A 1 218 ? 21.597  14.042  8.590  1.00 70.25  ? 218 GLU A OE1 1 
ATOM   1537 O  OE2 . GLU A 1 218 ? 22.755  12.217  9.037  1.00 82.81  ? 218 GLU A OE2 1 
ATOM   1538 N  N   . LEU A 1 219 ? 26.334  14.526  12.507 1.00 38.65  ? 219 LEU A N   1 
ATOM   1539 C  CA  . LEU A 1 219 ? 27.687  14.282  13.012 1.00 37.53  ? 219 LEU A CA  1 
ATOM   1540 C  C   . LEU A 1 219 ? 27.675  13.206  14.067 1.00 41.25  ? 219 LEU A C   1 
ATOM   1541 O  O   . LEU A 1 219 ? 28.587  12.367  14.112 1.00 41.93  ? 219 LEU A O   1 
ATOM   1542 C  CB  . LEU A 1 219 ? 28.306  15.569  13.573 1.00 36.25  ? 219 LEU A CB  1 
ATOM   1543 C  CG  . LEU A 1 219 ? 29.127  16.315  12.549 1.00 41.58  ? 219 LEU A CG  1 
ATOM   1544 C  CD1 . LEU A 1 219 ? 29.020  17.813  12.716 1.00 41.11  ? 219 LEU A CD1 1 
ATOM   1545 C  CD2 . LEU A 1 219 ? 30.553  15.823  12.528 1.00 43.82  ? 219 LEU A CD2 1 
ATOM   1546 N  N   . ALA A 1 220 ? 26.620  13.209  14.901 1.00 35.55  ? 220 ALA A N   1 
ATOM   1547 C  CA  . ALA A 1 220 ? 26.446  12.220  15.952 1.00 33.49  ? 220 ALA A CA  1 
ATOM   1548 C  C   . ALA A 1 220 ? 26.224  10.840  15.363 1.00 36.08  ? 220 ALA A C   1 
ATOM   1549 O  O   . ALA A 1 220 ? 26.673  9.855   15.934 1.00 34.18  ? 220 ALA A O   1 
ATOM   1550 C  CB  . ALA A 1 220 ? 25.297  12.613  16.850 1.00 33.36  ? 220 ALA A CB  1 
ATOM   1551 N  N   . ARG A 1 221 ? 25.565  10.790  14.194 1.00 33.75  ? 221 ARG A N   1 
ATOM   1552 C  CA  . ARG A 1 221 ? 25.234  9.590   13.434 1.00 33.66  ? 221 ARG A CA  1 
ATOM   1553 C  C   . ARG A 1 221 ? 26.511  8.998   12.821 1.00 36.39  ? 221 ARG A C   1 
ATOM   1554 O  O   . ARG A 1 221 ? 26.803  7.812   13.046 1.00 33.75  ? 221 ARG A O   1 
ATOM   1555 C  CB  . ARG A 1 221 ? 24.219  9.964   12.347 1.00 33.70  ? 221 ARG A CB  1 
ATOM   1556 C  CG  . ARG A 1 221 ? 22.976  9.127   12.374 1.00 46.44  ? 221 ARG A CG  1 
ATOM   1557 C  CD  . ARG A 1 221 ? 22.512  8.824   10.960 1.00 62.97  ? 221 ARG A CD  1 
ATOM   1558 N  NE  . ARG A 1 221 ? 21.058  8.683   10.881 1.00 77.26  ? 221 ARG A NE  1 
ATOM   1559 C  CZ  . ARG A 1 221 ? 20.208  9.700   10.761 1.00 98.92  ? 221 ARG A CZ  1 
ATOM   1560 N  NH1 . ARG A 1 221 ? 18.904  9.476   10.697 1.00 93.90  ? 221 ARG A NH1 1 
ATOM   1561 N  NH2 . ARG A 1 221 ? 20.657  10.949  10.707 1.00 84.18  ? 221 ARG A NH2 1 
ATOM   1562 N  N   . LYS A 1 222 ? 27.277  9.855   12.063 1.00 34.38  ? 222 LYS A N   1 
ATOM   1563 C  CA  . LYS A 1 222 ? 28.529  9.522   11.367 1.00 35.14  ? 222 LYS A CA  1 
ATOM   1564 C  C   . LYS A 1 222 ? 29.520  8.912   12.320 1.00 42.82  ? 222 LYS A C   1 
ATOM   1565 O  O   . LYS A 1 222 ? 30.026  7.825   12.049 1.00 44.88  ? 222 LYS A O   1 
ATOM   1566 C  CB  . LYS A 1 222 ? 29.152  10.741  10.639 1.00 35.46  ? 222 LYS A CB  1 
ATOM   1567 C  CG  . LYS A 1 222 ? 30.501  10.443  9.963  1.00 25.87  ? 222 LYS A CG  1 
ATOM   1568 C  CD  . LYS A 1 222 ? 30.864  11.456  8.892  1.00 31.04  ? 222 LYS A CD  1 
ATOM   1569 C  CE  . LYS A 1 222 ? 32.273  11.296  8.328  1.00 44.33  ? 222 LYS A CE  1 
ATOM   1570 N  NZ  . LYS A 1 222 ? 32.530  12.120  7.086  1.00 47.00  ? 222 LYS A NZ  1 
ATOM   1571 N  N   . TYR A 1 223 ? 29.755  9.575   13.449 1.00 39.38  ? 223 TYR A N   1 
ATOM   1572 C  CA  . TYR A 1 223 ? 30.703  9.099   14.431 1.00 39.38  ? 223 TYR A CA  1 
ATOM   1573 C  C   . TYR A 1 223 ? 30.060  8.258   15.517 1.00 43.88  ? 223 TYR A C   1 
ATOM   1574 O  O   . TYR A 1 223 ? 30.757  7.686   16.360 1.00 43.73  ? 223 TYR A O   1 
ATOM   1575 C  CB  . TYR A 1 223 ? 31.559  10.259  14.940 1.00 40.78  ? 223 TYR A CB  1 
ATOM   1576 C  CG  . TYR A 1 223 ? 32.424  10.836  13.834 1.00 44.59  ? 223 TYR A CG  1 
ATOM   1577 C  CD1 . TYR A 1 223 ? 33.679  10.299  13.550 1.00 47.28  ? 223 TYR A CD1 1 
ATOM   1578 C  CD2 . TYR A 1 223 ? 31.959  11.868  13.026 1.00 45.82  ? 223 TYR A CD2 1 
ATOM   1579 C  CE1 . TYR A 1 223 ? 34.463  10.800  12.514 1.00 48.93  ? 223 TYR A CE1 1 
ATOM   1580 C  CE2 . TYR A 1 223 ? 32.726  12.365  11.978 1.00 48.13  ? 223 TYR A CE2 1 
ATOM   1581 C  CZ  . TYR A 1 223 ? 33.980  11.832  11.728 1.00 57.00  ? 223 TYR A CZ  1 
ATOM   1582 O  OH  . TYR A 1 223 ? 34.744  12.347  10.705 1.00 60.51  ? 223 TYR A OH  1 
ATOM   1583 N  N   . ASP A 1 224 ? 28.726  8.112   15.433 1.00 40.92  ? 224 ASP A N   1 
ATOM   1584 C  CA  . ASP A 1 224 ? 27.908  7.310   16.339 1.00 40.34  ? 224 ASP A CA  1 
ATOM   1585 C  C   . ASP A 1 224 ? 28.154  7.540   17.847 1.00 43.66  ? 224 ASP A C   1 
ATOM   1586 O  O   . ASP A 1 224 ? 28.680  6.678   18.571 1.00 43.94  ? 224 ASP A O   1 
ATOM   1587 C  CB  . ASP A 1 224 ? 27.877  5.836   15.914 1.00 42.93  ? 224 ASP A CB  1 
ATOM   1588 C  CG  . ASP A 1 224 ? 26.975  4.956   16.742 1.00 51.80  ? 224 ASP A CG  1 
ATOM   1589 O  OD1 . ASP A 1 224 ? 26.015  5.488   17.358 1.00 51.01  ? 224 ASP A OD1 1 
ATOM   1590 O  OD2 . ASP A 1 224 ? 27.247  3.747   16.814 1.00 60.68  ? 224 ASP A OD2 1 
ATOM   1591 N  N   . PHE A 1 225 ? 27.797  8.738   18.298 1.00 38.34  ? 225 PHE A N   1 
ATOM   1592 C  CA  . PHE A 1 225 ? 27.895  9.082   19.704 1.00 36.55  ? 225 PHE A CA  1 
ATOM   1593 C  C   . PHE A 1 225 ? 26.528  9.483   20.190 1.00 41.49  ? 225 PHE A C   1 
ATOM   1594 O  O   . PHE A 1 225 ? 25.604  9.671   19.385 1.00 41.19  ? 225 PHE A O   1 
ATOM   1595 C  CB  . PHE A 1 225 ? 28.996  10.131  20.039 1.00 37.13  ? 225 PHE A CB  1 
ATOM   1596 C  CG  . PHE A 1 225 ? 29.001  11.413  19.243 1.00 37.80  ? 225 PHE A CG  1 
ATOM   1597 C  CD1 . PHE A 1 225 ? 28.238  12.507  19.646 1.00 39.48  ? 225 PHE A CD1 1 
ATOM   1598 C  CD2 . PHE A 1 225 ? 29.770  11.530  18.090 1.00 38.78  ? 225 PHE A CD2 1 
ATOM   1599 C  CE1 . PHE A 1 225 ? 28.210  13.676  18.882 1.00 39.51  ? 225 PHE A CE1 1 
ATOM   1600 C  CE2 . PHE A 1 225 ? 29.742  12.698  17.332 1.00 41.05  ? 225 PHE A CE2 1 
ATOM   1601 C  CZ  . PHE A 1 225 ? 28.977  13.768  17.742 1.00 38.55  ? 225 PHE A CZ  1 
ATOM   1602 N  N   . LEU A 1 226 ? 26.390  9.543   21.516 1.00 37.88  ? 226 LEU A N   1 
ATOM   1603 C  CA  . LEU A 1 226 ? 25.166  9.904   22.197 1.00 36.46  ? 226 LEU A CA  1 
ATOM   1604 C  C   . LEU A 1 226 ? 25.068  11.423  22.318 1.00 40.59  ? 226 LEU A C   1 
ATOM   1605 O  O   . LEU A 1 226 ? 26.094  12.126  22.277 1.00 39.54  ? 226 LEU A O   1 
ATOM   1606 C  CB  . LEU A 1 226 ? 25.197  9.262   23.582 1.00 34.85  ? 226 LEU A CB  1 
ATOM   1607 C  CG  . LEU A 1 226 ? 24.262  8.120   23.838 1.00 38.32  ? 226 LEU A CG  1 
ATOM   1608 C  CD1 . LEU A 1 226 ? 24.277  7.147   22.716 1.00 39.87  ? 226 LEU A CD1 1 
ATOM   1609 C  CD2 . LEU A 1 226 ? 24.621  7.422   25.128 1.00 37.95  ? 226 LEU A CD2 1 
ATOM   1610 N  N   . ILE A 1 227 ? 23.818  11.929  22.396 1.00 36.84  ? 227 ILE A N   1 
ATOM   1611 C  CA  . ILE A 1 227 ? 23.563  13.345  22.590 1.00 36.22  ? 227 ILE A CA  1 
ATOM   1612 C  C   . ILE A 1 227 ? 22.706  13.491  23.782 1.00 38.60  ? 227 ILE A C   1 
ATOM   1613 O  O   . ILE A 1 227 ? 21.551  13.078  23.784 1.00 38.02  ? 227 ILE A O   1 
ATOM   1614 C  CB  . ILE A 1 227 ? 22.998  14.177  21.388 1.00 40.45  ? 227 ILE A CB  1 
ATOM   1615 C  CG1 . ILE A 1 227 ? 23.822  13.996  20.087 1.00 41.71  ? 227 ILE A CG1 1 
ATOM   1616 C  CG2 . ILE A 1 227 ? 22.883  15.683  21.774 1.00 39.61  ? 227 ILE A CG2 1 
ATOM   1617 C  CD1 . ILE A 1 227 ? 23.285  14.816  18.842 1.00 46.77  ? 227 ILE A CD1 1 
ATOM   1618 N  N   . ILE A 1 228 ? 23.269  14.101  24.803 1.00 35.98  ? 228 ILE A N   1 
ATOM   1619 C  CA  . ILE A 1 228 ? 22.515  14.459  25.991 1.00 35.39  ? 228 ILE A CA  1 
ATOM   1620 C  C   . ILE A 1 228 ? 22.072  15.953  25.876 1.00 39.28  ? 228 ILE A C   1 
ATOM   1621 O  O   . ILE A 1 228 ? 22.902  16.879  25.909 1.00 37.92  ? 228 ILE A O   1 
ATOM   1622 C  CB  . ILE A 1 228 ? 23.052  13.929  27.356 1.00 37.20  ? 228 ILE A CB  1 
ATOM   1623 C  CG1 . ILE A 1 228 ? 22.763  14.891  28.502 1.00 38.56  ? 228 ILE A CG1 1 
ATOM   1624 C  CG2 . ILE A 1 228 ? 24.511  13.451  27.319 1.00 35.24  ? 228 ILE A CG2 1 
ATOM   1625 C  CD1 . ILE A 1 228 ? 21.254  14.926  28.906 1.00 55.95  ? 228 ILE A CD1 1 
ATOM   1626 N  N   . GLU A 1 229 ? 20.756  16.130  25.588 1.00 36.32  ? 229 GLU A N   1 
ATOM   1627 C  CA  . GLU A 1 229 ? 20.069  17.402  25.361 1.00 35.93  ? 229 GLU A CA  1 
ATOM   1628 C  C   . GLU A 1 229 ? 19.599  17.882  26.681 1.00 40.17  ? 229 GLU A C   1 
ATOM   1629 O  O   . GLU A 1 229 ? 18.562  17.411  27.156 1.00 40.57  ? 229 GLU A O   1 
ATOM   1630 C  CB  . GLU A 1 229 ? 18.844  17.215  24.444 1.00 38.04  ? 229 GLU A CB  1 
ATOM   1631 C  CG  . GLU A 1 229 ? 18.523  18.471  23.663 1.00 48.43  ? 229 GLU A CG  1 
ATOM   1632 C  CD  . GLU A 1 229 ? 17.192  18.597  22.950 1.00 68.66  ? 229 GLU A CD  1 
ATOM   1633 O  OE1 . GLU A 1 229 ? 16.720  17.594  22.371 1.00 54.49  ? 229 GLU A OE1 1 
ATOM   1634 O  OE2 . GLU A 1 229 ? 16.663  19.732  22.897 1.00 71.64  ? 229 GLU A OE2 1 
ATOM   1635 N  N   . ASP A 1 230 ? 20.379  18.769  27.314 1.00 35.85  ? 230 ASP A N   1 
ATOM   1636 C  CA  . ASP A 1 230 ? 19.999  19.291  28.607 1.00 35.15  ? 230 ASP A CA  1 
ATOM   1637 C  C   . ASP A 1 230 ? 19.259  20.576  28.339 1.00 41.59  ? 230 ASP A C   1 
ATOM   1638 O  O   . ASP A 1 230 ? 19.894  21.601  28.129 1.00 41.28  ? 230 ASP A O   1 
ATOM   1639 C  CB  . ASP A 1 230 ? 21.232  19.503  29.478 1.00 35.97  ? 230 ASP A CB  1 
ATOM   1640 C  CG  . ASP A 1 230 ? 20.915  20.033  30.860 1.00 48.43  ? 230 ASP A CG  1 
ATOM   1641 O  OD1 . ASP A 1 230 ? 19.777  19.786  31.357 1.00 48.97  ? 230 ASP A OD1 1 
ATOM   1642 O  OD2 . ASP A 1 230 ? 21.793  20.680  31.452 1.00 54.34  ? 230 ASP A OD2 1 
ATOM   1643 N  N   . ASP A 1 231 ? 17.913  20.522  28.291 1.00 41.06  ? 231 ASP A N   1 
ATOM   1644 C  CA  . ASP A 1 231 ? 17.119  21.705  27.945 1.00 42.94  ? 231 ASP A CA  1 
ATOM   1645 C  C   . ASP A 1 231 ? 16.115  22.281  28.985 1.00 47.54  ? 231 ASP A C   1 
ATOM   1646 O  O   . ASP A 1 231 ? 14.885  22.292  28.750 1.00 47.19  ? 231 ASP A O   1 
ATOM   1647 C  CB  . ASP A 1 231 ? 16.547  21.610  26.526 1.00 46.39  ? 231 ASP A CB  1 
ATOM   1648 C  CG  . ASP A 1 231 ? 16.576  22.933  25.785 1.00 65.59  ? 231 ASP A CG  1 
ATOM   1649 O  OD1 . ASP A 1 231 ? 17.125  23.930  26.350 1.00 66.24  ? 231 ASP A OD1 1 
ATOM   1650 O  OD2 . ASP A 1 231 ? 16.083  22.975  24.632 1.00 75.75  ? 231 ASP A OD2 1 
ATOM   1651 N  N   . PRO A 1 232 ? 16.657  22.849  30.104 1.00 43.35  ? 232 PRO A N   1 
ATOM   1652 C  CA  . PRO A 1 232 ? 15.783  23.422  31.131 1.00 42.98  ? 232 PRO A CA  1 
ATOM   1653 C  C   . PRO A 1 232 ? 15.094  24.724  30.756 1.00 45.44  ? 232 PRO A C   1 
ATOM   1654 O  O   . PRO A 1 232 ? 13.987  24.962  31.222 1.00 45.74  ? 232 PRO A O   1 
ATOM   1655 C  CB  . PRO A 1 232 ? 16.720  23.604  32.323 1.00 43.74  ? 232 PRO A CB  1 
ATOM   1656 C  CG  . PRO A 1 232 ? 18.041  23.719  31.758 1.00 47.05  ? 232 PRO A CG  1 
ATOM   1657 C  CD  . PRO A 1 232 ? 18.073  22.911  30.530 1.00 43.17  ? 232 PRO A CD  1 
ATOM   1658 N  N   . TYR A 1 233 ? 15.726  25.550  29.924 1.00 41.33  ? 233 TYR A N   1 
ATOM   1659 C  CA  . TYR A 1 233 ? 15.163  26.847  29.526 1.00 42.19  ? 233 TYR A CA  1 
ATOM   1660 C  C   . TYR A 1 233 ? 14.475  26.770  28.139 1.00 47.74  ? 233 TYR A C   1 
ATOM   1661 O  O   . TYR A 1 233 ? 14.531  27.723  27.338 1.00 48.01  ? 233 TYR A O   1 
ATOM   1662 C  CB  . TYR A 1 233 ? 16.255  27.935  29.556 1.00 42.35  ? 233 TYR A CB  1 
ATOM   1663 C  CG  . TYR A 1 233 ? 17.187  27.848  30.741 1.00 41.03  ? 233 TYR A CG  1 
ATOM   1664 C  CD1 . TYR A 1 233 ? 18.410  27.177  30.647 1.00 41.38  ? 233 TYR A CD1 1 
ATOM   1665 C  CD2 . TYR A 1 233 ? 16.857  28.440  31.952 1.00 41.44  ? 233 TYR A CD2 1 
ATOM   1666 C  CE1 . TYR A 1 233 ? 19.268  27.081  31.744 1.00 40.19  ? 233 TYR A CE1 1 
ATOM   1667 C  CE2 . TYR A 1 233 ? 17.711  28.364  33.050 1.00 41.61  ? 233 TYR A CE2 1 
ATOM   1668 C  CZ  . TYR A 1 233 ? 18.907  27.669  32.950 1.00 49.60  ? 233 TYR A CZ  1 
ATOM   1669 O  OH  . TYR A 1 233 ? 19.724  27.619  34.056 1.00 51.61  ? 233 TYR A OH  1 
ATOM   1670 N  N   . TYR A 1 234 ? 13.833  25.613  27.864 1.00 43.54  ? 234 TYR A N   1 
ATOM   1671 C  CA  . TYR A 1 234 ? 13.131  25.332  26.614 1.00 43.18  ? 234 TYR A CA  1 
ATOM   1672 C  C   . TYR A 1 234 ? 11.843  26.148  26.541 1.00 50.79  ? 234 TYR A C   1 
ATOM   1673 O  O   . TYR A 1 234 ? 11.585  26.827  25.542 1.00 51.26  ? 234 TYR A O   1 
ATOM   1674 C  CB  . TYR A 1 234 ? 12.845  23.823  26.499 1.00 42.12  ? 234 TYR A CB  1 
ATOM   1675 C  CG  . TYR A 1 234 ? 11.939  23.469  25.343 1.00 43.01  ? 234 TYR A CG  1 
ATOM   1676 C  CD1 . TYR A 1 234 ? 12.392  23.539  24.031 1.00 44.98  ? 234 TYR A CD1 1 
ATOM   1677 C  CD2 . TYR A 1 234 ? 10.619  23.081  25.559 1.00 43.66  ? 234 TYR A CD2 1 
ATOM   1678 C  CE1 . TYR A 1 234 ? 11.552  23.247  22.963 1.00 46.02  ? 234 TYR A CE1 1 
ATOM   1679 C  CE2 . TYR A 1 234 ? 9.775   22.772  24.496 1.00 44.80  ? 234 TYR A CE2 1 
ATOM   1680 C  CZ  . TYR A 1 234 ? 10.250  22.848  23.202 1.00 49.30  ? 234 TYR A CZ  1 
ATOM   1681 O  OH  . TYR A 1 234 ? 9.432   22.551  22.147 1.00 51.15  ? 234 TYR A OH  1 
ATOM   1682 N  N   . PHE A 1 235 ? 11.046  26.100  27.619 1.00 49.46  ? 235 PHE A N   1 
ATOM   1683 C  CA  . PHE A 1 235 ? 9.775   26.811  27.686 1.00 51.22  ? 235 PHE A CA  1 
ATOM   1684 C  C   . PHE A 1 235 ? 9.936   28.315  27.664 1.00 55.29  ? 235 PHE A C   1 
ATOM   1685 O  O   . PHE A 1 235 ? 9.045   28.999  27.168 1.00 56.80  ? 235 PHE A O   1 
ATOM   1686 C  CB  . PHE A 1 235 ? 8.903   26.295  28.848 1.00 53.16  ? 235 PHE A CB  1 
ATOM   1687 C  CG  . PHE A 1 235 ? 8.438   24.882  28.579 1.00 54.83  ? 235 PHE A CG  1 
ATOM   1688 C  CD1 . PHE A 1 235 ? 7.575   24.604  27.519 1.00 58.65  ? 235 PHE A CD1 1 
ATOM   1689 C  CD2 . PHE A 1 235 ? 8.920   23.819  29.333 1.00 56.74  ? 235 PHE A CD2 1 
ATOM   1690 C  CE1 . PHE A 1 235 ? 7.176   23.295  27.242 1.00 59.88  ? 235 PHE A CE1 1 
ATOM   1691 C  CE2 . PHE A 1 235 ? 8.512   22.501  29.060 1.00 59.73  ? 235 PHE A CE2 1 
ATOM   1692 C  CZ  . PHE A 1 235 ? 7.648   22.250  28.011 1.00 58.69  ? 235 PHE A CZ  1 
ATOM   1693 N  N   . LEU A 1 236 ? 11.126  28.800  28.106 1.00 49.41  ? 236 LEU A N   1 
ATOM   1694 C  CA  . LEU A 1 236 ? 11.553  30.199  28.189 1.00 48.27  ? 236 LEU A CA  1 
ATOM   1695 C  C   . LEU A 1 236 ? 12.263  30.686  26.936 1.00 52.84  ? 236 LEU A C   1 
ATOM   1696 O  O   . LEU A 1 236 ? 13.338  31.280  27.038 1.00 51.96  ? 236 LEU A O   1 
ATOM   1697 C  CB  . LEU A 1 236 ? 12.476  30.377  29.389 1.00 46.38  ? 236 LEU A CB  1 
ATOM   1698 C  CG  . LEU A 1 236 ? 11.764  30.478  30.689 1.00 51.26  ? 236 LEU A CG  1 
ATOM   1699 C  CD1 . LEU A 1 236 ? 12.352  29.547  31.687 1.00 49.99  ? 236 LEU A CD1 1 
ATOM   1700 C  CD2 . LEU A 1 236 ? 11.762  31.892  31.183 1.00 55.17  ? 236 LEU A CD2 1 
ATOM   1701 N  N   . GLN A 1 237 ? 11.662  30.467  25.759 1.00 50.61  ? 237 GLN A N   1 
ATOM   1702 C  CA  . GLN A 1 237 ? 12.249  30.909  24.505 1.00 50.69  ? 237 GLN A CA  1 
ATOM   1703 C  C   . GLN A 1 237 ? 11.576  32.194  24.045 1.00 58.78  ? 237 GLN A C   1 
ATOM   1704 O  O   . GLN A 1 237 ? 10.360  32.229  23.837 1.00 59.47  ? 237 GLN A O   1 
ATOM   1705 C  CB  . GLN A 1 237 ? 12.143  29.806  23.442 1.00 51.61  ? 237 GLN A CB  1 
ATOM   1706 C  CG  . GLN A 1 237 ? 13.285  28.806  23.457 1.00 58.22  ? 237 GLN A CG  1 
ATOM   1707 C  CD  . GLN A 1 237 ? 13.023  27.676  22.497 1.00 83.17  ? 237 GLN A CD  1 
ATOM   1708 O  OE1 . GLN A 1 237 ? 12.494  26.621  22.867 1.00 77.33  ? 237 GLN A OE1 1 
ATOM   1709 N  NE2 . GLN A 1 237 ? 13.369  27.876  21.229 1.00 81.73  ? 237 GLN A NE2 1 
ATOM   1710 N  N   . PHE A 1 238 ? 12.365  33.255  23.890 1.00 58.12  ? 238 PHE A N   1 
ATOM   1711 C  CA  . PHE A 1 238 ? 11.862  34.549  23.419 1.00 61.19  ? 238 PHE A CA  1 
ATOM   1712 C  C   . PHE A 1 238 ? 11.686  34.568  21.879 1.00 70.69  ? 238 PHE A C   1 
ATOM   1713 O  O   . PHE A 1 238 ? 11.001  35.447  21.330 1.00 71.42  ? 238 PHE A O   1 
ATOM   1714 C  CB  . PHE A 1 238 ? 12.798  35.671  23.887 1.00 62.43  ? 238 PHE A CB  1 
ATOM   1715 C  CG  . PHE A 1 238 ? 13.201  35.586  25.343 1.00 62.62  ? 238 PHE A CG  1 
ATOM   1716 C  CD1 . PHE A 1 238 ? 14.538  35.498  25.706 1.00 64.15  ? 238 PHE A CD1 1 
ATOM   1717 C  CD2 . PHE A 1 238 ? 12.243  35.606  26.352 1.00 65.14  ? 238 PHE A CD2 1 
ATOM   1718 C  CE1 . PHE A 1 238 ? 14.910  35.431  27.049 1.00 64.32  ? 238 PHE A CE1 1 
ATOM   1719 C  CE2 . PHE A 1 238 ? 12.615  35.538  27.694 1.00 67.14  ? 238 PHE A CE2 1 
ATOM   1720 C  CZ  . PHE A 1 238 ? 13.947  35.454  28.034 1.00 63.98  ? 238 PHE A CZ  1 
ATOM   1721 N  N   . ASN A 1 239 ? 12.284  33.546  21.212 1.00 69.87  ? 239 ASN A N   1 
ATOM   1722 C  CA  . ASN A 1 239 ? 12.358  33.234  19.774 1.00 71.32  ? 239 ASN A CA  1 
ATOM   1723 C  C   . ASN A 1 239 ? 11.050  33.312  18.993 1.00 77.83  ? 239 ASN A C   1 
ATOM   1724 O  O   . ASN A 1 239 ? 11.082  33.482  17.768 1.00 77.65  ? 239 ASN A O   1 
ATOM   1725 C  CB  . ASN A 1 239 ? 12.950  31.819  19.589 1.00 72.41  ? 239 ASN A CB  1 
ATOM   1726 C  CG  . ASN A 1 239 ? 14.300  31.577  20.244 1.00 106.42 ? 239 ASN A CG  1 
ATOM   1727 O  OD1 . ASN A 1 239 ? 14.835  32.412  20.992 1.00 102.45 ? 239 ASN A OD1 1 
ATOM   1728 N  ND2 . ASN A 1 239 ? 14.878  30.408  19.988 1.00 100.00 ? 239 ASN A ND2 1 
ATOM   1729 N  N   . LYS A 1 240 ? 9.914   33.171  19.702 1.00 76.37  ? 240 LYS A N   1 
ATOM   1730 C  CA  . LYS A 1 240 ? 8.535   33.084  19.205 1.00 78.76  ? 240 LYS A CA  1 
ATOM   1731 C  C   . LYS A 1 240 ? 8.299   31.606  18.878 1.00 82.40  ? 240 LYS A C   1 
ATOM   1732 O  O   . LYS A 1 240 ? 8.109   30.807  19.807 1.00 82.11  ? 240 LYS A O   1 
ATOM   1733 C  CB  . LYS A 1 240 ? 8.222   34.022  18.010 1.00 83.25  ? 240 LYS A CB  1 
ATOM   1734 N  N   . PHE A 1 241 ? 8.403   31.218  17.597 1.00 77.48  ? 241 PHE A N   1 
ATOM   1735 C  CA  . PHE A 1 241 ? 8.226   29.819  17.235 1.00 76.02  ? 241 PHE A CA  1 
ATOM   1736 C  C   . PHE A 1 241 ? 9.439   29.004  17.649 1.00 72.65  ? 241 PHE A C   1 
ATOM   1737 O  O   . PHE A 1 241 ? 10.559  29.278  17.217 1.00 71.21  ? 241 PHE A O   1 
ATOM   1738 C  CB  . PHE A 1 241 ? 7.790   29.667  15.774 1.00 80.08  ? 241 PHE A CB  1 
ATOM   1739 C  CG  . PHE A 1 241 ? 6.531   30.472  15.524 1.00 84.96  ? 241 PHE A CG  1 
ATOM   1740 C  CD1 . PHE A 1 241 ? 5.314   30.090  16.089 1.00 89.49  ? 241 PHE A CD1 1 
ATOM   1741 C  CD2 . PHE A 1 241 ? 6.575   31.651  14.787 1.00 89.89  ? 241 PHE A CD2 1 
ATOM   1742 C  CE1 . PHE A 1 241 ? 4.159   30.858  15.897 1.00 92.94  ? 241 PHE A CE1 1 
ATOM   1743 C  CE2 . PHE A 1 241 ? 5.417   32.420  14.592 1.00 95.18  ? 241 PHE A CE2 1 
ATOM   1744 C  CZ  . PHE A 1 241 ? 4.218   32.014  15.143 1.00 94.09  ? 241 PHE A CZ  1 
ATOM   1745 N  N   . ARG A 1 242 ? 9.220   28.112  18.618 1.00 64.96  ? 242 ARG A N   1 
ATOM   1746 C  CA  . ARG A 1 242 ? 10.260  27.284  19.219 1.00 61.69  ? 242 ARG A CA  1 
ATOM   1747 C  C   . ARG A 1 242 ? 10.972  26.390  18.208 1.00 61.57  ? 242 ARG A C   1 
ATOM   1748 O  O   . ARG A 1 242 ? 10.337  25.805  17.332 1.00 61.42  ? 242 ARG A O   1 
ATOM   1749 C  CB  . ARG A 1 242 ? 9.712   26.459  20.401 1.00 61.61  ? 242 ARG A CB  1 
ATOM   1750 C  CG  . ARG A 1 242 ? 9.244   27.283  21.619 1.00 68.87  ? 242 ARG A CG  1 
ATOM   1751 C  CD  . ARG A 1 242 ? 8.908   26.407  22.826 1.00 69.72  ? 242 ARG A CD  1 
ATOM   1752 N  NE  . ARG A 1 242 ? 8.027   25.297  22.455 1.00 72.27  ? 242 ARG A NE  1 
ATOM   1753 C  CZ  . ARG A 1 242 ? 6.700   25.339  22.502 1.00 80.55  ? 242 ARG A CZ  1 
ATOM   1754 N  NH1 . ARG A 1 242 ? 6.078   26.423  22.951 1.00 76.26  ? 242 ARG A NH1 1 
ATOM   1755 N  NH2 . ARG A 1 242 ? 5.983   24.293  22.109 1.00 50.84  ? 242 ARG A NH2 1 
ATOM   1756 N  N   . VAL A 1 243 ? 12.296  26.301  18.340 1.00 54.91  ? 243 VAL A N   1 
ATOM   1757 C  CA  . VAL A 1 243 ? 13.165  25.520  17.463 1.00 53.79  ? 243 VAL A CA  1 
ATOM   1758 C  C   . VAL A 1 243 ? 13.023  24.001  17.765 1.00 57.29  ? 243 VAL A C   1 
ATOM   1759 O  O   . VAL A 1 243 ? 13.023  23.624  18.958 1.00 56.24  ? 243 VAL A O   1 
ATOM   1760 C  CB  . VAL A 1 243 ? 14.636  26.018  17.595 1.00 56.02  ? 243 VAL A CB  1 
ATOM   1761 C  CG1 . VAL A 1 243 ? 15.572  25.342  16.591 1.00 55.38  ? 243 VAL A CG1 1 
ATOM   1762 C  CG2 . VAL A 1 243 ? 14.720  27.536  17.474 1.00 56.32  ? 243 VAL A CG2 1 
ATOM   1763 N  N   . PRO A 1 244 ? 12.930  23.128  16.705 1.00 53.12  ? 244 PRO A N   1 
ATOM   1764 C  CA  . PRO A 1 244 ? 12.834  21.666  16.932 1.00 52.00  ? 244 PRO A CA  1 
ATOM   1765 C  C   . PRO A 1 244 ? 14.032  21.103  17.690 1.00 51.45  ? 244 PRO A C   1 
ATOM   1766 O  O   . PRO A 1 244 ? 15.158  21.552  17.481 1.00 51.26  ? 244 PRO A O   1 
ATOM   1767 C  CB  . PRO A 1 244 ? 12.767  21.088  15.512 1.00 55.05  ? 244 PRO A CB  1 
ATOM   1768 C  CG  . PRO A 1 244 ? 12.286  22.210  14.668 1.00 60.71  ? 244 PRO A CG  1 
ATOM   1769 C  CD  . PRO A 1 244 ? 12.918  23.424  15.260 1.00 55.52  ? 244 PRO A CD  1 
ATOM   1770 N  N   . THR A 1 245 ? 13.776  20.137  18.577 1.00 44.19  ? 245 THR A N   1 
ATOM   1771 C  CA  . THR A 1 245 ? 14.771  19.536  19.470 1.00 40.98  ? 245 THR A CA  1 
ATOM   1772 C  C   . THR A 1 245 ? 15.556  18.334  18.884 1.00 43.81  ? 245 THR A C   1 
ATOM   1773 O  O   . THR A 1 245 ? 15.120  17.735  17.903 1.00 43.52  ? 245 THR A O   1 
ATOM   1774 C  CB  . THR A 1 245 ? 14.127  19.298  20.878 1.00 39.12  ? 245 THR A CB  1 
ATOM   1775 O  OG1 . THR A 1 245 ? 13.147  18.263  20.845 1.00 31.34  ? 245 THR A OG1 1 
ATOM   1776 C  CG2 . THR A 1 245 ? 13.473  20.545  21.442 1.00 38.01  ? 245 THR A CG2 1 
ATOM   1777 N  N   . PHE A 1 246 ? 16.708  17.970  19.499 1.00 40.63  ? 246 PHE A N   1 
ATOM   1778 C  CA  . PHE A 1 246 ? 17.480  16.778  19.105 1.00 40.99  ? 246 PHE A CA  1 
ATOM   1779 C  C   . PHE A 1 246 ? 16.591  15.521  19.276 1.00 46.83  ? 246 PHE A C   1 
ATOM   1780 O  O   . PHE A 1 246 ? 16.619  14.631  18.432 1.00 46.66  ? 246 PHE A O   1 
ATOM   1781 C  CB  . PHE A 1 246 ? 18.801  16.642  19.901 1.00 41.45  ? 246 PHE A CB  1 
ATOM   1782 C  CG  . PHE A 1 246 ? 19.939  17.528  19.438 1.00 43.15  ? 246 PHE A CG  1 
ATOM   1783 C  CD1 . PHE A 1 246 ? 20.523  18.448  20.303 1.00 45.79  ? 246 PHE A CD1 1 
ATOM   1784 C  CD2 . PHE A 1 246 ? 20.425  17.446  18.133 1.00 46.11  ? 246 PHE A CD2 1 
ATOM   1785 C  CE1 . PHE A 1 246 ? 21.565  19.286  19.867 1.00 46.83  ? 246 PHE A CE1 1 
ATOM   1786 C  CE2 . PHE A 1 246 ? 21.464  18.281  17.697 1.00 48.91  ? 246 PHE A CE2 1 
ATOM   1787 C  CZ  . PHE A 1 246 ? 22.028  19.195  18.565 1.00 46.49  ? 246 PHE A CZ  1 
ATOM   1788 N  N   . LEU A 1 247 ? 15.756  15.495  20.343 1.00 44.87  ? 247 LEU A N   1 
ATOM   1789 C  CA  . LEU A 1 247 ? 14.788  14.438  20.632 1.00 45.29  ? 247 LEU A CA  1 
ATOM   1790 C  C   . LEU A 1 247 ? 13.761  14.378  19.524 1.00 50.56  ? 247 LEU A C   1 
ATOM   1791 O  O   . LEU A 1 247 ? 13.406  13.279  19.084 1.00 51.38  ? 247 LEU A O   1 
ATOM   1792 C  CB  . LEU A 1 247 ? 14.068  14.687  21.964 1.00 44.99  ? 247 LEU A CB  1 
ATOM   1793 C  CG  . LEU A 1 247 ? 13.131  13.559  22.420 1.00 50.74  ? 247 LEU A CG  1 
ATOM   1794 C  CD1 . LEU A 1 247 ? 13.882  12.242  22.607 1.00 50.19  ? 247 LEU A CD1 1 
ATOM   1795 C  CD2 . LEU A 1 247 ? 12.394  13.923  23.685 1.00 54.51  ? 247 LEU A CD2 1 
ATOM   1796 N  N   . SER A 1 248 ? 13.290  15.560  19.073 1.00 46.76  ? 248 SER A N   1 
ATOM   1797 C  CA  . SER A 1 248 ? 12.324  15.700  17.994 1.00 47.92  ? 248 SER A CA  1 
ATOM   1798 C  C   . SER A 1 248 ? 12.896  15.181  16.665 1.00 53.68  ? 248 SER A C   1 
ATOM   1799 O  O   . SER A 1 248 ? 12.124  14.783  15.785 1.00 56.15  ? 248 SER A O   1 
ATOM   1800 C  CB  . SER A 1 248 ? 11.856  17.147  17.870 1.00 52.15  ? 248 SER A CB  1 
ATOM   1801 O  OG  . SER A 1 248 ? 12.634  17.915  16.964 1.00 63.32  ? 248 SER A OG  1 
ATOM   1802 N  N   . MET A 1 249 ? 14.245  15.138  16.542 1.00 47.67  ? 249 MET A N   1 
ATOM   1803 C  CA  . MET A 1 249 ? 14.929  14.637  15.346 1.00 46.89  ? 249 MET A CA  1 
ATOM   1804 C  C   . MET A 1 249 ? 15.683  13.277  15.524 1.00 48.76  ? 249 MET A C   1 
ATOM   1805 O  O   . MET A 1 249 ? 16.403  12.847  14.621 1.00 48.90  ? 249 MET A O   1 
ATOM   1806 C  CB  . MET A 1 249 ? 15.827  15.740  14.755 1.00 48.81  ? 249 MET A CB  1 
ATOM   1807 C  CG  . MET A 1 249 ? 17.058  16.074  15.577 1.00 50.94  ? 249 MET A CG  1 
ATOM   1808 S  SD  . MET A 1 249 ? 18.012  17.470  14.928 1.00 55.63  ? 249 MET A SD  1 
ATOM   1809 C  CE  . MET A 1 249 ? 18.480  16.787  13.355 1.00 54.04  ? 249 MET A CE  1 
ATOM   1810 N  N   . ASP A 1 250 ? 15.489  12.606  16.668 1.00 43.59  ? 250 ASP A N   1 
ATOM   1811 C  CA  . ASP A 1 250 ? 16.190  11.374  17.053 1.00 42.45  ? 250 ASP A CA  1 
ATOM   1812 C  C   . ASP A 1 250 ? 15.741  10.051  16.398 1.00 47.11  ? 250 ASP A C   1 
ATOM   1813 O  O   . ASP A 1 250 ? 15.194  9.163   17.066 1.00 46.70  ? 250 ASP A O   1 
ATOM   1814 C  CB  . ASP A 1 250 ? 16.309  11.273  18.592 1.00 42.29  ? 250 ASP A CB  1 
ATOM   1815 C  CG  . ASP A 1 250 ? 17.335  10.290  19.115 1.00 45.93  ? 250 ASP A CG  1 
ATOM   1816 O  OD1 . ASP A 1 250 ? 18.387  10.114  18.455 1.00 44.44  ? 250 ASP A OD1 1 
ATOM   1817 O  OD2 . ASP A 1 250 ? 17.129  9.762   20.226 1.00 52.07  ? 250 ASP A OD2 1 
ATOM   1818 N  N   . VAL A 1 251 ? 16.044  9.914   15.100 1.00 43.92  ? 251 VAL A N   1 
ATOM   1819 C  CA  . VAL A 1 251 ? 15.770  8.735   14.264 1.00 44.90  ? 251 VAL A CA  1 
ATOM   1820 C  C   . VAL A 1 251 ? 16.455  7.496   14.854 1.00 48.44  ? 251 VAL A C   1 
ATOM   1821 O  O   . VAL A 1 251 ? 15.823  6.456   14.990 1.00 47.30  ? 251 VAL A O   1 
ATOM   1822 C  CB  . VAL A 1 251 ? 16.234  8.973   12.790 1.00 49.98  ? 251 VAL A CB  1 
ATOM   1823 C  CG1 . VAL A 1 251 ? 16.087  7.719   11.935 1.00 50.97  ? 251 VAL A CG1 1 
ATOM   1824 C  CG2 . VAL A 1 251 ? 15.506  10.149  12.146 1.00 50.83  ? 251 VAL A CG2 1 
ATOM   1825 N  N   . ASP A 1 252 ? 17.752  7.614   15.176 1.00 46.50  ? 252 ASP A N   1 
ATOM   1826 C  CA  . ASP A 1 252 ? 18.583  6.529   15.707 1.00 46.48  ? 252 ASP A CA  1 
ATOM   1827 C  C   . ASP A 1 252 ? 18.149  6.066   17.094 1.00 51.16  ? 252 ASP A C   1 
ATOM   1828 O  O   . ASP A 1 252 ? 17.879  4.875   17.296 1.00 53.45  ? 252 ASP A O   1 
ATOM   1829 C  CB  . ASP A 1 252 ? 20.081  6.902   15.658 1.00 47.53  ? 252 ASP A CB  1 
ATOM   1830 C  CG  . ASP A 1 252 ? 20.640  7.074   14.245 1.00 61.12  ? 252 ASP A CG  1 
ATOM   1831 O  OD1 . ASP A 1 252 ? 19.949  7.690   13.391 1.00 61.97  ? 252 ASP A OD1 1 
ATOM   1832 O  OD2 . ASP A 1 252 ? 21.770  6.615   13.997 1.00 70.11  ? 252 ASP A OD2 1 
ATOM   1833 N  N   . GLY A 1 253 ? 18.013  7.007   18.009 1.00 44.79  ? 253 GLY A N   1 
ATOM   1834 C  CA  . GLY A 1 253 ? 17.633  6.696   19.377 1.00 42.87  ? 253 GLY A CA  1 
ATOM   1835 C  C   . GLY A 1 253 ? 18.811  6.965   20.267 1.00 44.36  ? 253 GLY A C   1 
ATOM   1836 O  O   . GLY A 1 253 ? 18.964  6.319   21.303 1.00 43.75  ? 253 GLY A O   1 
ATOM   1837 N  N   . ARG A 1 254 ? 19.654  7.926   19.830 1.00 39.11  ? 254 ARG A N   1 
ATOM   1838 C  CA  . ARG A 1 254 ? 20.869  8.384   20.487 1.00 36.88  ? 254 ARG A CA  1 
ATOM   1839 C  C   . ARG A 1 254 ? 20.691  9.607   21.399 1.00 40.74  ? 254 ARG A C   1 
ATOM   1840 O  O   . ARG A 1 254 ? 21.684  10.114  21.920 1.00 40.23  ? 254 ARG A O   1 
ATOM   1841 C  CB  . ARG A 1 254 ? 21.982  8.622   19.454 1.00 34.75  ? 254 ARG A CB  1 
ATOM   1842 C  CG  . ARG A 1 254 ? 21.640  9.531   18.257 1.00 32.72  ? 254 ARG A CG  1 
ATOM   1843 C  CD  . ARG A 1 254 ? 22.874  9.814   17.402 1.00 20.52  ? 254 ARG A CD  1 
ATOM   1844 N  NE  . ARG A 1 254 ? 23.104  8.820   16.348 1.00 21.84  ? 254 ARG A NE  1 
ATOM   1845 C  CZ  . ARG A 1 254 ? 23.785  7.678   16.490 1.00 35.56  ? 254 ARG A CZ  1 
ATOM   1846 N  NH1 . ARG A 1 254 ? 24.306  7.345   17.665 1.00 21.69  ? 254 ARG A NH1 1 
ATOM   1847 N  NH2 . ARG A 1 254 ? 23.950  6.866   15.459 1.00 23.92  ? 254 ARG A NH2 1 
ATOM   1848 N  N   . VAL A 1 255 ? 19.451  10.057  21.631 1.00 38.37  ? 255 VAL A N   1 
ATOM   1849 C  CA  . VAL A 1 255 ? 19.215  11.241  22.469 1.00 38.54  ? 255 VAL A CA  1 
ATOM   1850 C  C   . VAL A 1 255 ? 18.647  10.974  23.894 1.00 42.29  ? 255 VAL A C   1 
ATOM   1851 O  O   . VAL A 1 255 ? 17.617  10.308  24.052 1.00 43.52  ? 255 VAL A O   1 
ATOM   1852 C  CB  . VAL A 1 255 ? 18.533  12.428  21.685 1.00 43.38  ? 255 VAL A CB  1 
ATOM   1853 C  CG1 . VAL A 1 255 ? 18.077  13.576  22.594 1.00 42.47  ? 255 VAL A CG1 1 
ATOM   1854 C  CG2 . VAL A 1 255 ? 19.455  12.961  20.594 1.00 43.62  ? 255 VAL A CG2 1 
ATOM   1855 N  N   . ILE A 1 256 ? 19.345  11.491  24.917 1.00 36.33  ? 256 ILE A N   1 
ATOM   1856 C  CA  . ILE A 1 256 ? 18.889  11.449  26.298 1.00 36.17  ? 256 ILE A CA  1 
ATOM   1857 C  C   . ILE A 1 256 ? 18.513  12.911  26.503 1.00 41.44  ? 256 ILE A C   1 
ATOM   1858 O  O   . ILE A 1 256 ? 19.389  13.776  26.379 1.00 40.65  ? 256 ILE A O   1 
ATOM   1859 C  CB  . ILE A 1 256 ? 20.005  10.936  27.289 1.00 38.73  ? 256 ILE A CB  1 
ATOM   1860 C  CG1 . ILE A 1 256 ? 20.117  9.401   27.278 1.00 38.69  ? 256 ILE A CG1 1 
ATOM   1861 C  CG2 . ILE A 1 256 ? 19.774  11.412  28.730 1.00 39.47  ? 256 ILE A CG2 1 
ATOM   1862 C  CD1 . ILE A 1 256 ? 21.519  8.899   27.357 1.00 41.87  ? 256 ILE A CD1 1 
ATOM   1863 N  N   . ARG A 1 257 ? 17.209  13.200  26.717 1.00 39.14  ? 257 ARG A N   1 
ATOM   1864 C  CA  . ARG A 1 257 ? 16.727  14.582  26.862 1.00 39.12  ? 257 ARG A CA  1 
ATOM   1865 C  C   . ARG A 1 257 ? 16.262  14.892  28.266 1.00 44.74  ? 257 ARG A C   1 
ATOM   1866 O  O   . ARG A 1 257 ? 15.383  14.202  28.795 1.00 45.18  ? 257 ARG A O   1 
ATOM   1867 C  CB  . ARG A 1 257 ? 15.656  14.931  25.807 1.00 38.04  ? 257 ARG A CB  1 
ATOM   1868 C  CG  . ARG A 1 257 ? 14.926  16.243  26.084 1.00 39.82  ? 257 ARG A CG  1 
ATOM   1869 C  CD  . ARG A 1 257 ? 14.213  16.803  24.877 1.00 32.29  ? 257 ARG A CD  1 
ATOM   1870 N  NE  . ARG A 1 257 ? 14.413  18.243  24.796 1.00 34.73  ? 257 ARG A NE  1 
ATOM   1871 C  CZ  . ARG A 1 257 ? 13.539  19.144  25.230 1.00 53.37  ? 257 ARG A CZ  1 
ATOM   1872 N  NH1 . ARG A 1 257 ? 12.372  18.759  25.728 1.00 48.24  ? 257 ARG A NH1 1 
ATOM   1873 N  NH2 . ARG A 1 257 ? 13.810  20.440  25.132 1.00 37.50  ? 257 ARG A NH2 1 
ATOM   1874 N  N   . ALA A 1 258 ? 16.846  15.954  28.857 1.00 41.72  ? 258 ALA A N   1 
ATOM   1875 C  CA  . ALA A 1 258 ? 16.554  16.401  30.223 1.00 41.11  ? 258 ALA A CA  1 
ATOM   1876 C  C   . ALA A 1 258 ? 15.694  17.646  30.234 1.00 46.42  ? 258 ALA A C   1 
ATOM   1877 O  O   . ALA A 1 258 ? 16.099  18.698  29.732 1.00 46.74  ? 258 ALA A O   1 
ATOM   1878 C  CB  . ALA A 1 258 ? 17.844  16.636  30.997 1.00 40.58  ? 258 ALA A CB  1 
ATOM   1879 N  N   . ASP A 1 259 ? 14.497  17.514  30.806 1.00 43.44  ? 259 ASP A N   1 
ATOM   1880 C  CA  . ASP A 1 259 ? 13.542  18.603  30.946 1.00 44.20  ? 259 ASP A CA  1 
ATOM   1881 C  C   . ASP A 1 259 ? 13.394  18.986  32.403 1.00 48.24  ? 259 ASP A C   1 
ATOM   1882 O  O   . ASP A 1 259 ? 13.517  18.131  33.292 1.00 46.90  ? 259 ASP A O   1 
ATOM   1883 C  CB  . ASP A 1 259 ? 12.193  18.210  30.365 1.00 47.11  ? 259 ASP A CB  1 
ATOM   1884 C  CG  . ASP A 1 259 ? 12.169  18.259  28.862 1.00 57.53  ? 259 ASP A CG  1 
ATOM   1885 O  OD1 . ASP A 1 259 ? 11.818  19.340  28.305 1.00 57.33  ? 259 ASP A OD1 1 
ATOM   1886 O  OD2 . ASP A 1 259 ? 12.496  17.221  28.232 1.00 64.80  ? 259 ASP A OD2 1 
ATOM   1887 N  N   . SER A 1 260 ? 13.116  20.272  32.653 1.00 45.74  ? 260 SER A N   1 
ATOM   1888 C  CA  . SER A 1 260 ? 12.962  20.761  34.018 1.00 45.52  ? 260 SER A CA  1 
ATOM   1889 C  C   . SER A 1 260 ? 11.670  21.517  34.261 1.00 49.56  ? 260 SER A C   1 
ATOM   1890 O  O   . SER A 1 260 ? 11.216  22.267  33.404 1.00 49.95  ? 260 SER A O   1 
ATOM   1891 C  CB  . SER A 1 260 ? 14.152  21.631  34.406 1.00 48.45  ? 260 SER A CB  1 
ATOM   1892 O  OG  . SER A 1 260 ? 14.120  21.910  35.794 1.00 54.92  ? 260 SER A OG  1 
ATOM   1893 N  N   . PHE A 1 261 ? 11.095  21.336  35.447 1.00 46.06  ? 261 PHE A N   1 
ATOM   1894 C  CA  . PHE A 1 261 ? 9.909   22.075  35.853 1.00 47.47  ? 261 PHE A CA  1 
ATOM   1895 C  C   . PHE A 1 261 ? 10.348  23.191  36.807 1.00 52.43  ? 261 PHE A C   1 
ATOM   1896 O  O   . PHE A 1 261 ? 9.514   23.971  37.281 1.00 52.33  ? 261 PHE A O   1 
ATOM   1897 C  CB  . PHE A 1 261 ? 8.861   21.149  36.505 1.00 49.53  ? 261 PHE A CB  1 
ATOM   1898 C  CG  . PHE A 1 261 ? 7.915   20.473  35.542 1.00 51.76  ? 261 PHE A CG  1 
ATOM   1899 C  CD1 . PHE A 1 261 ? 7.331   21.185  34.496 1.00 56.01  ? 261 PHE A CD1 1 
ATOM   1900 C  CD2 . PHE A 1 261 ? 7.559   19.143  35.713 1.00 53.64  ? 261 PHE A CD2 1 
ATOM   1901 C  CE1 . PHE A 1 261 ? 6.453   20.561  33.603 1.00 57.77  ? 261 PHE A CE1 1 
ATOM   1902 C  CE2 . PHE A 1 261 ? 6.673   18.520  34.825 1.00 57.70  ? 261 PHE A CE2 1 
ATOM   1903 C  CZ  . PHE A 1 261 ? 6.128   19.234  33.774 1.00 56.85  ? 261 PHE A CZ  1 
ATOM   1904 N  N   . SER A 1 262 ? 11.681  23.266  37.068 1.00 49.18  ? 262 SER A N   1 
ATOM   1905 C  CA  . SER A 1 262 ? 12.292  24.247  37.966 1.00 49.06  ? 262 SER A CA  1 
ATOM   1906 C  C   . SER A 1 262 ? 12.131  25.654  37.477 1.00 53.99  ? 262 SER A C   1 
ATOM   1907 O  O   . SER A 1 262 ? 11.793  26.527  38.274 1.00 55.03  ? 262 SER A O   1 
ATOM   1908 C  CB  . SER A 1 262 ? 13.762  23.933  38.234 1.00 51.19  ? 262 SER A CB  1 
ATOM   1909 O  OG  . SER A 1 262 ? 13.893  22.874  39.171 1.00 60.05  ? 262 SER A OG  1 
ATOM   1910 N  N   . LYS A 1 263 ? 12.305  25.875  36.168 1.00 49.85  ? 263 LYS A N   1 
ATOM   1911 C  CA  . LYS A 1 263 ? 12.195  27.225  35.622 1.00 49.94  ? 263 LYS A CA  1 
ATOM   1912 C  C   . LYS A 1 263 ? 10.779  27.754  35.379 1.00 54.56  ? 263 LYS A C   1 
ATOM   1913 O  O   . LYS A 1 263 ? 10.596  28.966  35.238 1.00 54.90  ? 263 LYS A O   1 
ATOM   1914 C  CB  . LYS A 1 263 ? 13.092  27.381  34.396 1.00 50.07  ? 263 LYS A CB  1 
ATOM   1915 C  CG  . LYS A 1 263 ? 14.383  28.129  34.693 1.00 42.42  ? 263 LYS A CG  1 
ATOM   1916 C  CD  . LYS A 1 263 ? 15.368  27.386  35.639 1.00 52.40  ? 263 LYS A CD  1 
ATOM   1917 C  CE  . LYS A 1 263 ? 15.829  26.030  35.121 1.00 53.41  ? 263 LYS A CE  1 
ATOM   1918 N  NZ  . LYS A 1 263 ? 17.098  25.573  35.740 1.00 40.54  ? 263 LYS A NZ  1 
ATOM   1919 N  N   . ILE A 1 264 ? 9.779   26.863  35.354 1.00 50.22  ? 264 ILE A N   1 
ATOM   1920 C  CA  . ILE A 1 264 ? 8.405   27.269  35.059 1.00 50.91  ? 264 ILE A CA  1 
ATOM   1921 C  C   . ILE A 1 264 ? 7.370   26.930  36.124 1.00 53.58  ? 264 ILE A C   1 
ATOM   1922 O  O   . ILE A 1 264 ? 6.394   27.671  36.276 1.00 54.30  ? 264 ILE A O   1 
ATOM   1923 C  CB  . ILE A 1 264 ? 7.967   26.820  33.637 1.00 54.14  ? 264 ILE A CB  1 
ATOM   1924 C  CG1 . ILE A 1 264 ? 8.079   25.281  33.476 1.00 53.98  ? 264 ILE A CG1 1 
ATOM   1925 C  CG2 . ILE A 1 264 ? 8.754   27.577  32.556 1.00 53.34  ? 264 ILE A CG2 1 
ATOM   1926 C  CD1 . ILE A 1 264 ? 7.204   24.676  32.416 1.00 66.68  ? 264 ILE A CD1 1 
ATOM   1927 N  N   . ILE A 1 265 ? 7.551   25.799  36.821 1.00 48.21  ? 265 ILE A N   1 
ATOM   1928 C  CA  . ILE A 1 265 ? 6.595   25.345  37.833 1.00 47.98  ? 265 ILE A CA  1 
ATOM   1929 C  C   . ILE A 1 265 ? 7.089   25.492  39.282 1.00 50.58  ? 265 ILE A C   1 
ATOM   1930 O  O   . ILE A 1 265 ? 6.377   26.118  40.070 1.00 51.32  ? 265 ILE A O   1 
ATOM   1931 C  CB  . ILE A 1 265 ? 5.915   23.987  37.464 1.00 50.17  ? 265 ILE A CB  1 
ATOM   1932 C  CG1 . ILE A 1 265 ? 4.646   24.233  36.608 1.00 51.41  ? 265 ILE A CG1 1 
ATOM   1933 C  CG2 . ILE A 1 265 ? 5.569   23.155  38.700 1.00 50.15  ? 265 ILE A CG2 1 
ATOM   1934 C  CD1 . ILE A 1 265 ? 4.791   24.024  35.153 1.00 50.93  ? 265 ILE A CD1 1 
ATOM   1935 N  N   . SER A 1 266 ? 8.300   24.938  39.620 1.00 43.42  ? 266 SER A N   1 
ATOM   1936 C  CA  . SER A 1 266 ? 8.942   25.005  40.945 1.00 40.99  ? 266 SER A CA  1 
ATOM   1937 C  C   . SER A 1 266 ? 10.320  24.334  41.028 1.00 43.06  ? 266 SER A C   1 
ATOM   1938 O  O   . SER A 1 266 ? 10.468  23.115  40.842 1.00 41.92  ? 266 SER A O   1 
ATOM   1939 C  CB  . SER A 1 266 ? 8.025   24.487  42.054 1.00 42.05  ? 266 SER A CB  1 
ATOM   1940 O  OG  . SER A 1 266 ? 8.683   24.402  43.308 1.00 41.91  ? 266 SER A OG  1 
ATOM   1941 N  N   . SER A 1 267 ? 11.317  25.143  41.379 1.00 38.82  ? 267 SER A N   1 
ATOM   1942 C  CA  . SER A 1 267 ? 12.688  24.704  41.581 1.00 37.17  ? 267 SER A CA  1 
ATOM   1943 C  C   . SER A 1 267 ? 12.839  23.931  42.896 1.00 40.72  ? 267 SER A C   1 
ATOM   1944 O  O   . SER A 1 267 ? 13.535  22.913  42.949 1.00 39.15  ? 267 SER A O   1 
ATOM   1945 C  CB  . SER A 1 267 ? 13.623  25.899  41.526 1.00 41.19  ? 267 SER A CB  1 
ATOM   1946 O  OG  . SER A 1 267 ? 13.449  26.767  42.633 1.00 54.75  ? 267 SER A OG  1 
ATOM   1947 N  N   . GLY A 1 268 ? 12.143  24.401  43.922 1.00 38.29  ? 268 GLY A N   1 
ATOM   1948 C  CA  . GLY A 1 268 ? 12.129  23.776  45.234 1.00 38.37  ? 268 GLY A CA  1 
ATOM   1949 C  C   . GLY A 1 268 ? 11.454  22.417  45.316 1.00 42.81  ? 268 GLY A C   1 
ATOM   1950 O  O   . GLY A 1 268 ? 11.911  21.569  46.094 1.00 41.69  ? 268 GLY A O   1 
ATOM   1951 N  N   . LEU A 1 269 ? 10.356  22.187  44.528 1.00 39.58  ? 269 LEU A N   1 
ATOM   1952 C  CA  . LEU A 1 269 ? 9.644   20.904  44.541 1.00 39.09  ? 269 LEU A CA  1 
ATOM   1953 C  C   . LEU A 1 269 ? 10.492  19.698  44.141 1.00 43.00  ? 269 LEU A C   1 
ATOM   1954 O  O   . LEU A 1 269 ? 10.167  18.590  44.574 1.00 44.92  ? 269 LEU A O   1 
ATOM   1955 C  CB  . LEU A 1 269 ? 8.347   20.922  43.740 1.00 40.41  ? 269 LEU A CB  1 
ATOM   1956 C  CG  . LEU A 1 269 ? 7.165   21.730  44.296 1.00 47.60  ? 269 LEU A CG  1 
ATOM   1957 C  CD1 . LEU A 1 269 ? 5.959   21.679  43.334 1.00 49.24  ? 269 LEU A CD1 1 
ATOM   1958 C  CD2 . LEU A 1 269 ? 6.777   21.319  45.720 1.00 49.62  ? 269 LEU A CD2 1 
ATOM   1959 N  N   . ARG A 1 270 ? 11.585  19.903  43.348 1.00 36.01  ? 270 ARG A N   1 
ATOM   1960 C  CA  . ARG A 1 270 ? 12.534  18.863  42.889 1.00 32.56  ? 270 ARG A CA  1 
ATOM   1961 C  C   . ARG A 1 270 ? 11.882  17.808  41.984 1.00 34.25  ? 270 ARG A C   1 
ATOM   1962 O  O   . ARG A 1 270 ? 11.925  16.615  42.278 1.00 32.07  ? 270 ARG A O   1 
ATOM   1963 C  CB  . ARG A 1 270 ? 13.297  18.200  44.066 1.00 28.32  ? 270 ARG A CB  1 
ATOM   1964 C  CG  . ARG A 1 270 ? 14.056  19.128  45.007 1.00 33.72  ? 270 ARG A CG  1 
ATOM   1965 C  CD  . ARG A 1 270 ? 14.888  20.205  44.317 1.00 38.36  ? 270 ARG A CD  1 
ATOM   1966 N  NE  . ARG A 1 270 ? 15.995  19.694  43.508 1.00 32.55  ? 270 ARG A NE  1 
ATOM   1967 C  CZ  . ARG A 1 270 ? 16.230  20.075  42.257 1.00 48.04  ? 270 ARG A CZ  1 
ATOM   1968 N  NH1 . ARG A 1 270 ? 15.440  20.963  41.666 1.00 37.51  ? 270 ARG A NH1 1 
ATOM   1969 N  NH2 . ARG A 1 270 ? 17.250  19.562  41.582 1.00 39.70  ? 270 ARG A NH2 1 
ATOM   1970 N  N   . ILE A 1 271 ? 11.229  18.257  40.910 1.00 31.97  ? 271 ILE A N   1 
ATOM   1971 C  CA  . ILE A 1 271 ? 10.546  17.361  39.984 1.00 32.23  ? 271 ILE A CA  1 
ATOM   1972 C  C   . ILE A 1 271 ? 10.995  17.687  38.580 1.00 37.92  ? 271 ILE A C   1 
ATOM   1973 O  O   . ILE A 1 271 ? 10.559  18.699  38.014 1.00 38.65  ? 271 ILE A O   1 
ATOM   1974 C  CB  . ILE A 1 271 ? 8.980   17.367  40.127 1.00 36.19  ? 271 ILE A CB  1 
ATOM   1975 C  CG1 . ILE A 1 271 ? 8.457   17.198  41.606 1.00 37.75  ? 271 ILE A CG1 1 
ATOM   1976 C  CG2 . ILE A 1 271 ? 8.303   16.388  39.162 1.00 34.64  ? 271 ILE A CG2 1 
ATOM   1977 C  CD1 . ILE A 1 271 ? 8.685   15.778  42.362 1.00 47.53  ? 271 ILE A CD1 1 
ATOM   1978 N  N   . GLY A 1 272 ? 11.872  16.836  38.050 1.00 34.50  ? 272 GLY A N   1 
ATOM   1979 C  CA  . GLY A 1 272 ? 12.384  16.926  36.686 1.00 35.12  ? 272 GLY A CA  1 
ATOM   1980 C  C   . GLY A 1 272 ? 11.997  15.709  35.867 1.00 39.72  ? 272 GLY A C   1 
ATOM   1981 O  O   . GLY A 1 272 ? 11.489  14.734  36.430 1.00 39.07  ? 272 GLY A O   1 
ATOM   1982 N  N   . PHE A 1 273 ? 12.235  15.738  34.535 1.00 37.56  ? 273 PHE A N   1 
ATOM   1983 C  CA  . PHE A 1 273 ? 11.898  14.587  33.683 1.00 38.60  ? 273 PHE A CA  1 
ATOM   1984 C  C   . PHE A 1 273 ? 12.781  14.281  32.486 1.00 44.51  ? 273 PHE A C   1 
ATOM   1985 O  O   . PHE A 1 273 ? 12.882  15.073  31.539 1.00 45.80  ? 273 PHE A O   1 
ATOM   1986 C  CB  . PHE A 1 273 ? 10.406  14.514  33.317 1.00 41.59  ? 273 PHE A CB  1 
ATOM   1987 C  CG  . PHE A 1 273 ? 9.873   15.590  32.401 1.00 43.57  ? 273 PHE A CG  1 
ATOM   1988 C  CD1 . PHE A 1 273 ? 9.556   16.854  32.895 1.00 46.49  ? 273 PHE A CD1 1 
ATOM   1989 C  CD2 . PHE A 1 273 ? 9.597   15.312  31.068 1.00 45.32  ? 273 PHE A CD2 1 
ATOM   1990 C  CE1 . PHE A 1 273 ? 9.012   17.833  32.062 1.00 47.92  ? 273 PHE A CE1 1 
ATOM   1991 C  CE2 . PHE A 1 273 ? 9.030   16.282  30.242 1.00 49.23  ? 273 PHE A CE2 1 
ATOM   1992 C  CZ  . PHE A 1 273 ? 8.735   17.535  30.746 1.00 47.70  ? 273 PHE A CZ  1 
ATOM   1993 N  N   . LEU A 1 274 ? 13.339  13.061  32.509 1.00 40.08  ? 274 LEU A N   1 
ATOM   1994 C  CA  . LEU A 1 274 ? 14.220  12.469  31.504 1.00 38.98  ? 274 LEU A CA  1 
ATOM   1995 C  C   . LEU A 1 274 ? 13.417  11.707  30.456 1.00 40.62  ? 274 LEU A C   1 
ATOM   1996 O  O   . LEU A 1 274 ? 12.500  10.949  30.814 1.00 39.48  ? 274 LEU A O   1 
ATOM   1997 C  CB  . LEU A 1 274 ? 15.149  11.496  32.232 1.00 38.30  ? 274 LEU A CB  1 
ATOM   1998 C  CG  . LEU A 1 274 ? 16.650  11.579  31.994 1.00 41.97  ? 274 LEU A CG  1 
ATOM   1999 C  CD1 . LEU A 1 274 ? 17.172  13.031  31.992 1.00 41.04  ? 274 LEU A CD1 1 
ATOM   2000 C  CD2 . LEU A 1 274 ? 17.372  10.711  33.018 1.00 42.74  ? 274 LEU A CD2 1 
ATOM   2001 N  N   . THR A 1 275 ? 13.766  11.927  29.157 1.00 35.91  ? 275 THR A N   1 
ATOM   2002 C  CA  . THR A 1 275 ? 13.143  11.299  27.970 1.00 35.13  ? 275 THR A CA  1 
ATOM   2003 C  C   . THR A 1 275 ? 14.235  10.746  27.036 1.00 34.15  ? 275 THR A C   1 
ATOM   2004 O  O   . THR A 1 275 ? 15.051  11.502  26.498 1.00 30.87  ? 275 THR A O   1 
ATOM   2005 C  CB  . THR A 1 275 ? 12.190  12.268  27.254 1.00 44.10  ? 275 THR A CB  1 
ATOM   2006 O  OG1 . THR A 1 275 ? 11.554  13.155  28.183 1.00 42.01  ? 275 THR A OG1 1 
ATOM   2007 C  CG2 . THR A 1 275 ? 11.161  11.547  26.433 1.00 44.32  ? 275 THR A CG2 1 
ATOM   2008 N  N   . GLY A 1 276 ? 14.274  9.427   26.907 1.00 31.54  ? 276 GLY A N   1 
ATOM   2009 C  CA  . GLY A 1 276 ? 15.292  8.758   26.096 1.00 31.91  ? 276 GLY A CA  1 
ATOM   2010 C  C   . GLY A 1 276 ? 15.064  7.281   25.814 1.00 36.34  ? 276 GLY A C   1 
ATOM   2011 O  O   . GLY A 1 276 ? 14.001  6.745   26.150 1.00 35.31  ? 276 GLY A O   1 
ATOM   2012 N  N   . PRO A 1 277 ? 16.056  6.598   25.175 1.00 34.45  ? 277 PRO A N   1 
ATOM   2013 C  CA  . PRO A 1 277 ? 15.895  5.163   24.870 1.00 35.72  ? 277 PRO A CA  1 
ATOM   2014 C  C   . PRO A 1 277 ? 15.617  4.297   26.099 1.00 42.88  ? 277 PRO A C   1 
ATOM   2015 O  O   . PRO A 1 277 ? 16.353  4.360   27.103 1.00 43.20  ? 277 PRO A O   1 
ATOM   2016 C  CB  . PRO A 1 277 ? 17.226  4.779   24.208 1.00 37.15  ? 277 PRO A CB  1 
ATOM   2017 C  CG  . PRO A 1 277 ? 18.189  5.852   24.595 1.00 40.27  ? 277 PRO A CG  1 
ATOM   2018 C  CD  . PRO A 1 277 ? 17.361  7.097   24.693 1.00 35.67  ? 277 PRO A CD  1 
ATOM   2019 N  N   . LYS A 1 278 ? 14.516  3.505   26.020 1.00 39.41  ? 278 LYS A N   1 
ATOM   2020 C  CA  . LYS A 1 278 ? 14.051  2.567   27.043 1.00 37.78  ? 278 LYS A CA  1 
ATOM   2021 C  C   . LYS A 1 278 ? 15.248  1.877   27.756 1.00 38.87  ? 278 LYS A C   1 
ATOM   2022 O  O   . LYS A 1 278 ? 15.369  2.065   28.965 1.00 37.01  ? 278 LYS A O   1 
ATOM   2023 C  CB  . LYS A 1 278 ? 13.023  1.563   26.445 1.00 40.64  ? 278 LYS A CB  1 
ATOM   2024 C  CG  . LYS A 1 278 ? 12.086  0.866   27.437 1.00 49.87  ? 278 LYS A CG  1 
ATOM   2025 C  CD  . LYS A 1 278 ? 12.629  -0.483  27.925 1.00 59.61  ? 278 LYS A CD  1 
ATOM   2026 C  CE  . LYS A 1 278 ? 11.553  -1.350  28.553 1.00 74.65  ? 278 LYS A CE  1 
ATOM   2027 N  NZ  . LYS A 1 278 ? 12.065  -2.688  28.989 1.00 79.55  ? 278 LYS A NZ  1 
ATOM   2028 N  N   . PRO A 1 279 ? 16.206  1.218   27.050 1.00 34.62  ? 279 PRO A N   1 
ATOM   2029 C  CA  . PRO A 1 279 ? 17.311  0.571   27.770 1.00 33.81  ? 279 PRO A CA  1 
ATOM   2030 C  C   . PRO A 1 279 ? 18.143  1.486   28.664 1.00 37.10  ? 279 PRO A C   1 
ATOM   2031 O  O   . PRO A 1 279 ? 18.483  1.094   29.791 1.00 36.23  ? 279 PRO A O   1 
ATOM   2032 C  CB  . PRO A 1 279 ? 18.137  -0.075  26.653 1.00 36.29  ? 279 PRO A CB  1 
ATOM   2033 C  CG  . PRO A 1 279 ? 17.673  0.554   25.393 1.00 41.33  ? 279 PRO A CG  1 
ATOM   2034 C  CD  . PRO A 1 279 ? 16.267  0.897   25.609 1.00 37.21  ? 279 PRO A CD  1 
ATOM   2035 N  N   . LEU A 1 280 ? 18.431  2.712   28.175 1.00 33.14  ? 280 LEU A N   1 
ATOM   2036 C  CA  . LEU A 1 280 ? 19.222  3.722   28.881 1.00 30.88  ? 280 LEU A CA  1 
ATOM   2037 C  C   . LEU A 1 280 ? 18.475  4.357   30.010 1.00 32.49  ? 280 LEU A C   1 
ATOM   2038 O  O   . LEU A 1 280 ? 19.032  4.472   31.098 1.00 30.18  ? 280 LEU A O   1 
ATOM   2039 C  CB  . LEU A 1 280 ? 19.755  4.763   27.919 1.00 30.89  ? 280 LEU A CB  1 
ATOM   2040 C  CG  . LEU A 1 280 ? 20.799  4.255   26.943 1.00 35.85  ? 280 LEU A CG  1 
ATOM   2041 C  CD1 . LEU A 1 280 ? 21.527  5.405   26.309 1.00 36.78  ? 280 LEU A CD1 1 
ATOM   2042 C  CD2 . LEU A 1 280 ? 21.813  3.342   27.620 1.00 34.96  ? 280 LEU A CD2 1 
ATOM   2043 N  N   . ILE A 1 281 ? 17.198  4.710   29.785 1.00 30.28  ? 281 ILE A N   1 
ATOM   2044 C  CA  . ILE A 1 281 ? 16.332  5.254   30.835 1.00 30.29  ? 281 ILE A CA  1 
ATOM   2045 C  C   . ILE A 1 281 ? 16.204  4.227   31.989 1.00 35.84  ? 281 ILE A C   1 
ATOM   2046 O  O   . ILE A 1 281 ? 16.372  4.599   33.150 1.00 34.40  ? 281 ILE A O   1 
ATOM   2047 C  CB  . ILE A 1 281 ? 14.970  5.727   30.250 1.00 33.86  ? 281 ILE A CB  1 
ATOM   2048 C  CG1 . ILE A 1 281 ? 15.152  6.968   29.333 1.00 34.37  ? 281 ILE A CG1 1 
ATOM   2049 C  CG2 . ILE A 1 281 ? 13.924  5.998   31.337 1.00 33.79  ? 281 ILE A CG2 1 
ATOM   2050 C  CD1 . ILE A 1 281 ? 15.758  8.361   30.008 1.00 35.21  ? 281 ILE A CD1 1 
ATOM   2051 N  N   . GLU A 1 282 ? 16.002  2.924   31.636 1.00 34.51  ? 282 GLU A N   1 
ATOM   2052 C  CA  . GLU A 1 282 ? 15.879  1.752   32.523 1.00 34.36  ? 282 GLU A CA  1 
ATOM   2053 C  C   . GLU A 1 282 ? 17.158  1.575   33.367 1.00 36.35  ? 282 GLU A C   1 
ATOM   2054 O  O   . GLU A 1 282 ? 17.091  1.210   34.545 1.00 34.36  ? 282 GLU A O   1 
ATOM   2055 C  CB  . GLU A 1 282 ? 15.517  0.506   31.673 1.00 37.08  ? 282 GLU A CB  1 
ATOM   2056 C  CG  . GLU A 1 282 ? 15.652  -0.869  32.317 1.00 55.77  ? 282 GLU A CG  1 
ATOM   2057 C  CD  . GLU A 1 282 ? 16.452  -1.862  31.483 1.00 95.65  ? 282 GLU A CD  1 
ATOM   2058 O  OE1 . GLU A 1 282 ? 15.892  -2.925  31.123 1.00 92.54  ? 282 GLU A OE1 1 
ATOM   2059 O  OE2 . GLU A 1 282 ? 17.634  -1.569  31.178 1.00 94.91  ? 282 GLU A OE2 1 
ATOM   2060 N  N   . ARG A 1 283 ? 18.312  1.908   32.771 1.00 33.82  ? 283 ARG A N   1 
ATOM   2061 C  CA  . ARG A 1 283 ? 19.603  1.889   33.448 1.00 32.96  ? 283 ARG A CA  1 
ATOM   2062 C  C   . ARG A 1 283 ? 19.624  2.983   34.531 1.00 36.11  ? 283 ARG A C   1 
ATOM   2063 O  O   . ARG A 1 283 ? 20.059  2.698   35.656 1.00 35.66  ? 283 ARG A O   1 
ATOM   2064 C  CB  . ARG A 1 283 ? 20.740  2.087   32.443 1.00 32.31  ? 283 ARG A CB  1 
ATOM   2065 C  CG  . ARG A 1 283 ? 21.959  1.249   32.748 1.00 37.51  ? 283 ARG A CG  1 
ATOM   2066 C  CD  . ARG A 1 283 ? 21.787  -0.154  32.256 1.00 45.40  ? 283 ARG A CD  1 
ATOM   2067 N  NE  . ARG A 1 283 ? 21.782  -1.128  33.346 1.00 51.63  ? 283 ARG A NE  1 
ATOM   2068 C  CZ  . ARG A 1 283 ? 20.913  -2.129  33.458 1.00 51.27  ? 283 ARG A CZ  1 
ATOM   2069 N  NH1 . ARG A 1 283 ? 19.928  -2.269  32.576 1.00 43.22  ? 283 ARG A NH1 1 
ATOM   2070 N  NH2 . ARG A 1 283 ? 21.021  -2.996  34.451 1.00 15.49  ? 283 ARG A NH2 1 
ATOM   2071 N  N   . VAL A 1 284 ? 19.098  4.213   34.224 1.00 31.15  ? 284 VAL A N   1 
ATOM   2072 C  CA  . VAL A 1 284 ? 19.018  5.258   35.259 1.00 29.30  ? 284 VAL A CA  1 
ATOM   2073 C  C   . VAL A 1 284 ? 17.988  4.902   36.344 1.00 31.77  ? 284 VAL A C   1 
ATOM   2074 O  O   . VAL A 1 284 ? 18.333  4.948   37.527 1.00 30.55  ? 284 VAL A O   1 
ATOM   2075 C  CB  . VAL A 1 284 ? 19.020  6.750   34.819 1.00 32.47  ? 284 VAL A CB  1 
ATOM   2076 C  CG1 . VAL A 1 284 ? 20.011  7.005   33.690 1.00 32.26  ? 284 VAL A CG1 1 
ATOM   2077 C  CG2 . VAL A 1 284 ? 17.631  7.252   34.450 1.00 33.05  ? 284 VAL A CG2 1 
ATOM   2078 N  N   . ILE A 1 285 ? 16.773  4.445   35.939 1.00 27.67  ? 285 ILE A N   1 
ATOM   2079 C  CA  . ILE A 1 285 ? 15.705  4.043   36.869 1.00 27.50  ? 285 ILE A CA  1 
ATOM   2080 C  C   . ILE A 1 285 ? 16.231  3.108   37.993 1.00 31.97  ? 285 ILE A C   1 
ATOM   2081 O  O   . ILE A 1 285 ? 15.903  3.331   39.170 1.00 30.41  ? 285 ILE A O   1 
ATOM   2082 C  CB  . ILE A 1 285 ? 14.410  3.518   36.157 1.00 30.65  ? 285 ILE A CB  1 
ATOM   2083 C  CG1 . ILE A 1 285 ? 13.840  4.576   35.192 1.00 31.27  ? 285 ILE A CG1 1 
ATOM   2084 C  CG2 . ILE A 1 285 ? 13.340  3.115   37.177 1.00 30.54  ? 285 ILE A CG2 1 
ATOM   2085 C  CD1 . ILE A 1 285 ? 12.836  4.097   34.118 1.00 33.57  ? 285 ILE A CD1 1 
ATOM   2086 N  N   . LEU A 1 286 ? 17.097  2.122   37.630 1.00 29.31  ? 286 LEU A N   1 
ATOM   2087 C  CA  . LEU A 1 286 ? 17.673  1.170   38.588 1.00 29.40  ? 286 LEU A CA  1 
ATOM   2088 C  C   . LEU A 1 286 ? 18.608  1.842   39.565 1.00 34.00  ? 286 LEU A C   1 
ATOM   2089 O  O   . LEU A 1 286 ? 18.689  1.438   40.732 1.00 33.31  ? 286 LEU A O   1 
ATOM   2090 C  CB  . LEU A 1 286 ? 18.402  0.010   37.896 1.00 29.70  ? 286 LEU A CB  1 
ATOM   2091 C  CG  . LEU A 1 286 ? 17.545  -1.004  37.171 1.00 35.39  ? 286 LEU A CG  1 
ATOM   2092 C  CD1 . LEU A 1 286 ? 18.404  -1.970  36.435 1.00 35.95  ? 286 LEU A CD1 1 
ATOM   2093 C  CD2 . LEU A 1 286 ? 16.648  -1.755  38.131 1.00 39.13  ? 286 LEU A CD2 1 
ATOM   2094 N  N   . HIS A 1 287 ? 19.320  2.867   39.098 1.00 30.81  ? 287 HIS A N   1 
ATOM   2095 C  CA  . HIS A 1 287 ? 20.234  3.573   39.977 1.00 30.33  ? 287 HIS A CA  1 
ATOM   2096 C  C   . HIS A 1 287 ? 19.447  4.337   41.013 1.00 32.28  ? 287 HIS A C   1 
ATOM   2097 O  O   . HIS A 1 287 ? 19.834  4.330   42.185 1.00 29.80  ? 287 HIS A O   1 
ATOM   2098 C  CB  . HIS A 1 287 ? 21.119  4.522   39.172 1.00 31.53  ? 287 HIS A CB  1 
ATOM   2099 C  CG  . HIS A 1 287 ? 22.361  4.950   39.878 1.00 34.50  ? 287 HIS A CG  1 
ATOM   2100 N  ND1 . HIS A 1 287 ? 23.423  5.472   39.181 1.00 36.42  ? 287 HIS A ND1 1 
ATOM   2101 C  CD2 . HIS A 1 287 ? 22.674  4.909   41.195 1.00 36.11  ? 287 HIS A CD2 1 
ATOM   2102 C  CE1 . HIS A 1 287 ? 24.356  5.715   40.086 1.00 35.86  ? 287 HIS A CE1 1 
ATOM   2103 N  NE2 . HIS A 1 287 ? 23.941  5.405   41.313 1.00 35.98  ? 287 HIS A NE2 1 
ATOM   2104 N  N   . ILE A 1 288 ? 18.325  4.984   40.572 1.00 30.09  ? 288 ILE A N   1 
ATOM   2105 C  CA  . ILE A 1 288 ? 17.442  5.778   41.440 1.00 29.93  ? 288 ILE A CA  1 
ATOM   2106 C  C   . ILE A 1 288 ? 16.709  4.902   42.471 1.00 31.54  ? 288 ILE A C   1 
ATOM   2107 O  O   . ILE A 1 288 ? 16.438  5.359   43.592 1.00 29.89  ? 288 ILE A O   1 
ATOM   2108 C  CB  . ILE A 1 288 ? 16.607  6.936   40.769 1.00 33.74  ? 288 ILE A CB  1 
ATOM   2109 C  CG1 . ILE A 1 288 ? 15.073  6.728   40.821 1.00 36.39  ? 288 ILE A CG1 1 
ATOM   2110 C  CG2 . ILE A 1 288 ? 17.131  7.423   39.392 1.00 31.98  ? 288 ILE A CG2 1 
ATOM   2111 C  CD1 . ILE A 1 288 ? 14.199  8.085   41.227 1.00 50.46  ? 288 ILE A CD1 1 
ATOM   2112 N  N   . GLN A 1 289 ? 16.506  3.605   42.109 1.00 26.93  ? 289 GLN A N   1 
ATOM   2113 C  CA  . GLN A 1 289 ? 15.915  2.580   42.960 1.00 26.14  ? 289 GLN A CA  1 
ATOM   2114 C  C   . GLN A 1 289 ? 16.771  2.378   44.192 1.00 30.38  ? 289 GLN A C   1 
ATOM   2115 O  O   . GLN A 1 289 ? 16.219  2.248   45.274 1.00 31.03  ? 289 GLN A O   1 
ATOM   2116 C  CB  . GLN A 1 289 ? 15.748  1.264   42.212 1.00 27.42  ? 289 GLN A CB  1 
ATOM   2117 C  CG  . GLN A 1 289 ? 14.385  0.635   42.406 1.00 43.02  ? 289 GLN A CG  1 
ATOM   2118 C  CD  . GLN A 1 289 ? 13.810  0.094   41.117 1.00 71.65  ? 289 GLN A CD  1 
ATOM   2119 O  OE1 . GLN A 1 289 ? 14.396  -0.773  40.436 1.00 66.74  ? 289 GLN A OE1 1 
ATOM   2120 N  NE2 . GLN A 1 289 ? 12.607  0.551   40.793 1.00 68.08  ? 289 GLN A NE2 1 
ATOM   2121 N  N   . VAL A 1 290 ? 18.109  2.405   44.050 1.00 26.80  ? 290 VAL A N   1 
ATOM   2122 C  CA  . VAL A 1 290 ? 19.031  2.281   45.195 1.00 25.71  ? 290 VAL A CA  1 
ATOM   2123 C  C   . VAL A 1 290 ? 19.498  3.623   45.807 1.00 29.12  ? 290 VAL A C   1 
ATOM   2124 O  O   . VAL A 1 290 ? 20.207  3.609   46.816 1.00 27.28  ? 290 VAL A O   1 
ATOM   2125 C  CB  . VAL A 1 290 ? 20.192  1.262   45.001 1.00 28.31  ? 290 VAL A CB  1 
ATOM   2126 C  CG1 . VAL A 1 290 ? 19.669  -0.158  45.018 1.00 27.60  ? 290 VAL A CG1 1 
ATOM   2127 C  CG2 . VAL A 1 290 ? 21.005  1.541   43.738 1.00 28.22  ? 290 VAL A CG2 1 
ATOM   2128 N  N   . SER A 1 291 ? 19.082  4.763   45.217 1.00 28.26  ? 291 SER A N   1 
ATOM   2129 C  CA  . SER A 1 291 ? 19.483  6.111   45.659 1.00 29.67  ? 291 SER A CA  1 
ATOM   2130 C  C   . SER A 1 291 ? 18.392  6.889   46.448 1.00 36.04  ? 291 SER A C   1 
ATOM   2131 O  O   . SER A 1 291 ? 18.462  6.979   47.677 1.00 36.64  ? 291 SER A O   1 
ATOM   2132 C  CB  . SER A 1 291 ? 20.019  6.925   44.479 1.00 33.99  ? 291 SER A CB  1 
ATOM   2133 O  OG  . SER A 1 291 ? 20.062  8.317   44.760 1.00 45.54  ? 291 SER A OG  1 
ATOM   2134 N  N   . THR A 1 292 ? 17.394  7.442   45.735 1.00 31.56  ? 292 THR A N   1 
ATOM   2135 C  CA  . THR A 1 292 ? 16.298  8.213   46.316 1.00 30.84  ? 292 THR A CA  1 
ATOM   2136 C  C   . THR A 1 292 ? 15.000  7.397   46.377 1.00 33.17  ? 292 THR A C   1 
ATOM   2137 O  O   . THR A 1 292 ? 14.027  7.851   46.988 1.00 33.31  ? 292 THR A O   1 
ATOM   2138 C  CB  . THR A 1 292 ? 16.072  9.488   45.473 1.00 38.56  ? 292 THR A CB  1 
ATOM   2139 O  OG1 . THR A 1 292 ? 16.073  9.142   44.079 1.00 40.62  ? 292 THR A OG1 1 
ATOM   2140 C  CG2 . THR A 1 292 ? 17.093  10.588  45.761 1.00 33.23  ? 292 THR A CG2 1 
ATOM   2141 N  N   . LEU A 1 293 ? 14.985  6.205   45.736 1.00 27.88  ? 293 LEU A N   1 
ATOM   2142 C  CA  . LEU A 1 293 ? 13.833  5.312   45.548 1.00 27.83  ? 293 LEU A CA  1 
ATOM   2143 C  C   . LEU A 1 293 ? 12.876  5.895   44.499 1.00 31.86  ? 293 LEU A C   1 
ATOM   2144 O  O   . LEU A 1 293 ? 12.677  5.263   43.469 1.00 31.84  ? 293 LEU A O   1 
ATOM   2145 C  CB  . LEU A 1 293 ? 13.073  4.897   46.831 1.00 28.19  ? 293 LEU A CB  1 
ATOM   2146 C  CG  . LEU A 1 293 ? 13.842  4.239   47.993 1.00 32.25  ? 293 LEU A CG  1 
ATOM   2147 C  CD1 . LEU A 1 293 ? 12.885  3.747   49.066 1.00 32.16  ? 293 LEU A CD1 1 
ATOM   2148 C  CD2 . LEU A 1 293 ? 14.655  3.065   47.540 1.00 34.30  ? 293 LEU A CD2 1 
ATOM   2149 N  N   . HIS A 1 294 ? 12.325  7.102   44.736 1.00 27.99  ? 294 HIS A N   1 
ATOM   2150 C  CA  . HIS A 1 294 ? 11.394  7.795   43.841 1.00 29.07  ? 294 HIS A CA  1 
ATOM   2151 C  C   . HIS A 1 294 ? 11.314  9.293   44.200 1.00 36.21  ? 294 HIS A C   1 
ATOM   2152 O  O   . HIS A 1 294 ? 11.620  9.643   45.349 1.00 35.03  ? 294 HIS A O   1 
ATOM   2153 C  CB  . HIS A 1 294 ? 9.979   7.189   43.957 1.00 30.66  ? 294 HIS A CB  1 
ATOM   2154 C  CG  . HIS A 1 294 ? 9.379   7.359   45.317 1.00 34.16  ? 294 HIS A CG  1 
ATOM   2155 N  ND1 . HIS A 1 294 ? 9.500   6.382   46.278 1.00 35.48  ? 294 HIS A ND1 1 
ATOM   2156 C  CD2 . HIS A 1 294 ? 8.705   8.405   45.844 1.00 35.94  ? 294 HIS A CD2 1 
ATOM   2157 C  CE1 . HIS A 1 294 ? 8.896   6.862   47.350 1.00 35.05  ? 294 HIS A CE1 1 
ATOM   2158 N  NE2 . HIS A 1 294 ? 8.395   8.069   47.132 1.00 35.84  ? 294 HIS A NE2 1 
ATOM   2159 N  N   . PRO A 1 295 ? 10.838  10.191  43.287 1.00 35.20  ? 295 PRO A N   1 
ATOM   2160 C  CA  . PRO A 1 295 ? 10.661  11.587  43.697 1.00 35.48  ? 295 PRO A CA  1 
ATOM   2161 C  C   . PRO A 1 295 ? 9.407   11.692  44.568 1.00 40.39  ? 295 PRO A C   1 
ATOM   2162 O  O   . PRO A 1 295 ? 8.469   10.887  44.419 1.00 40.00  ? 295 PRO A O   1 
ATOM   2163 C  CB  . PRO A 1 295 ? 10.502  12.355  42.369 1.00 37.61  ? 295 PRO A CB  1 
ATOM   2164 C  CG  . PRO A 1 295 ? 10.121  11.366  41.367 1.00 42.14  ? 295 PRO A CG  1 
ATOM   2165 C  CD  . PRO A 1 295 ? 10.387  9.978   41.891 1.00 37.40  ? 295 PRO A CD  1 
ATOM   2166 N  N   . SER A 1 296 ? 9.409   12.685  45.482 1.00 36.69  ? 296 SER A N   1 
ATOM   2167 C  CA  . SER A 1 296 ? 8.319   12.995  46.401 1.00 36.86  ? 296 SER A CA  1 
ATOM   2168 C  C   . SER A 1 296 ? 6.963   12.712  45.766 1.00 40.48  ? 296 SER A C   1 
ATOM   2169 O  O   . SER A 1 296 ? 6.571   13.394  44.820 1.00 40.44  ? 296 SER A O   1 
ATOM   2170 C  CB  . SER A 1 296 ? 8.414   14.456  46.827 1.00 40.83  ? 296 SER A CB  1 
ATOM   2171 O  OG  . SER A 1 296 ? 7.219   14.914  47.437 1.00 51.76  ? 296 SER A OG  1 
ATOM   2172 N  N   . THR A 1 297 ? 6.274   11.683  46.250 1.00 37.41  ? 297 THR A N   1 
ATOM   2173 C  CA  . THR A 1 297 ? 4.953   11.347  45.728 1.00 39.74  ? 297 THR A CA  1 
ATOM   2174 C  C   . THR A 1 297 ? 3.974   12.522  45.903 1.00 47.28  ? 297 THR A C   1 
ATOM   2175 O  O   . THR A 1 297 ? 3.206   12.821  44.984 1.00 46.95  ? 297 THR A O   1 
ATOM   2176 C  CB  . THR A 1 297 ? 4.500   9.950   46.175 1.00 50.71  ? 297 THR A CB  1 
ATOM   2177 O  OG1 . THR A 1 297 ? 3.081   9.868   46.314 1.00 55.70  ? 297 THR A OG1 1 
ATOM   2178 C  CG2 . THR A 1 297 ? 5.167   9.508   47.415 1.00 47.24  ? 297 THR A CG2 1 
ATOM   2179 N  N   . PHE A 1 298 ? 4.099   13.249  47.037 1.00 45.87  ? 298 PHE A N   1 
ATOM   2180 C  CA  . PHE A 1 298 ? 3.324   14.444  47.354 1.00 47.39  ? 298 PHE A CA  1 
ATOM   2181 C  C   . PHE A 1 298 ? 3.473   15.499  46.246 1.00 51.76  ? 298 PHE A C   1 
ATOM   2182 O  O   . PHE A 1 298 ? 2.469   15.932  45.690 1.00 53.41  ? 298 PHE A O   1 
ATOM   2183 C  CB  . PHE A 1 298 ? 3.758   15.025  48.712 1.00 49.25  ? 298 PHE A CB  1 
ATOM   2184 C  CG  . PHE A 1 298 ? 2.778   16.020  49.301 1.00 53.43  ? 298 PHE A CG  1 
ATOM   2185 C  CD1 . PHE A 1 298 ? 2.781   17.350  48.897 1.00 57.21  ? 298 PHE A CD1 1 
ATOM   2186 C  CD2 . PHE A 1 298 ? 1.858   15.629  50.264 1.00 57.70  ? 298 PHE A CD2 1 
ATOM   2187 C  CE1 . PHE A 1 298 ? 1.860   18.258  49.424 1.00 59.60  ? 298 PHE A CE1 1 
ATOM   2188 C  CE2 . PHE A 1 298 ? 0.955   16.550  50.808 1.00 61.76  ? 298 PHE A CE2 1 
ATOM   2189 C  CZ  . PHE A 1 298 ? 0.966   17.856  50.386 1.00 59.87  ? 298 PHE A CZ  1 
ATOM   2190 N  N   . ASN A 1 299 ? 4.716   15.886  45.915 1.00 46.89  ? 299 ASN A N   1 
ATOM   2191 C  CA  . ASN A 1 299 ? 5.021   16.900  44.890 1.00 46.92  ? 299 ASN A CA  1 
ATOM   2192 C  C   . ASN A 1 299 ? 4.655   16.480  43.448 1.00 48.47  ? 299 ASN A C   1 
ATOM   2193 O  O   . ASN A 1 299 ? 4.271   17.329  42.640 1.00 47.57  ? 299 ASN A O   1 
ATOM   2194 C  CB  . ASN A 1 299 ? 6.499   17.333  44.970 1.00 47.90  ? 299 ASN A CB  1 
ATOM   2195 C  CG  . ASN A 1 299 ? 6.955   17.850  46.316 1.00 53.62  ? 299 ASN A CG  1 
ATOM   2196 O  OD1 . ASN A 1 299 ? 8.116   17.699  46.692 1.00 30.36  ? 299 ASN A OD1 1 
ATOM   2197 N  ND2 . ASN A 1 299 ? 6.064   18.489  47.063 1.00 50.80  ? 299 ASN A ND2 1 
ATOM   2198 N  N   . GLN A 1 300 ? 4.808   15.180  43.134 1.00 43.08  ? 300 GLN A N   1 
ATOM   2199 C  CA  . GLN A 1 300 ? 4.473   14.600  41.835 1.00 43.03  ? 300 GLN A CA  1 
ATOM   2200 C  C   . GLN A 1 300 ? 2.962   14.670  41.603 1.00 48.76  ? 300 GLN A C   1 
ATOM   2201 O  O   . GLN A 1 300 ? 2.519   14.908  40.483 1.00 49.83  ? 300 GLN A O   1 
ATOM   2202 C  CB  . GLN A 1 300 ? 4.866   13.135  41.816 1.00 43.57  ? 300 GLN A CB  1 
ATOM   2203 C  CG  . GLN A 1 300 ? 6.334   12.842  41.670 1.00 44.82  ? 300 GLN A CG  1 
ATOM   2204 C  CD  . GLN A 1 300 ? 6.456   11.365  41.467 1.00 43.52  ? 300 GLN A CD  1 
ATOM   2205 O  OE1 . GLN A 1 300 ? 6.305   10.872  40.347 1.00 32.64  ? 300 GLN A OE1 1 
ATOM   2206 N  NE2 . GLN A 1 300 ? 6.602   10.621  42.561 1.00 28.62  ? 300 GLN A NE2 1 
ATOM   2207 N  N   . LEU A 1 301 ? 2.181   14.416  42.670 1.00 44.71  ? 301 LEU A N   1 
ATOM   2208 C  CA  . LEU A 1 301 ? 0.720   14.466  42.706 1.00 45.15  ? 301 LEU A CA  1 
ATOM   2209 C  C   . LEU A 1 301 ? 0.322   15.934  42.638 1.00 45.86  ? 301 LEU A C   1 
ATOM   2210 O  O   . LEU A 1 301 ? -0.607  16.273  41.920 1.00 45.45  ? 301 LEU A O   1 
ATOM   2211 C  CB  . LEU A 1 301 ? 0.244   13.840  44.046 1.00 45.65  ? 301 LEU A CB  1 
ATOM   2212 C  CG  . LEU A 1 301 ? -0.812  12.701  44.070 1.00 50.84  ? 301 LEU A CG  1 
ATOM   2213 C  CD1 . LEU A 1 301 ? -0.673  11.734  42.895 1.00 50.55  ? 301 LEU A CD1 1 
ATOM   2214 C  CD2 . LEU A 1 301 ? -0.714  11.913  45.364 1.00 51.18  ? 301 LEU A CD2 1 
ATOM   2215 N  N   . MET A 1 302 ? 1.057   16.801  43.372 1.00 41.48  ? 302 MET A N   1 
ATOM   2216 C  CA  . MET A 1 302 ? 0.874   18.252  43.435 1.00 42.69  ? 302 MET A CA  1 
ATOM   2217 C  C   . MET A 1 302 ? 0.962   18.831  42.030 1.00 46.17  ? 302 MET A C   1 
ATOM   2218 O  O   . MET A 1 302 ? 0.040   19.547  41.611 1.00 47.91  ? 302 MET A O   1 
ATOM   2219 C  CB  . MET A 1 302 ? 1.963   18.885  44.309 1.00 44.13  ? 302 MET A CB  1 
ATOM   2220 C  CG  . MET A 1 302 ? 1.448   19.572  45.538 1.00 48.92  ? 302 MET A CG  1 
ATOM   2221 S  SD  . MET A 1 302 ? 2.825   20.297  46.456 1.00 51.85  ? 302 MET A SD  1 
ATOM   2222 C  CE  . MET A 1 302 ? 2.995   21.828  45.607 1.00 49.14  ? 302 MET A CE  1 
ATOM   2223 N  N   . ILE A 1 303 ? 2.061   18.488  41.287 1.00 38.94  ? 303 ILE A N   1 
ATOM   2224 C  CA  . ILE A 1 303 ? 2.273   18.924  39.904 1.00 37.08  ? 303 ILE A CA  1 
ATOM   2225 C  C   . ILE A 1 303 ? 1.186   18.293  39.082 1.00 40.27  ? 303 ILE A C   1 
ATOM   2226 O  O   . ILE A 1 303 ? 0.307   19.034  38.642 1.00 41.73  ? 303 ILE A O   1 
ATOM   2227 C  CB  . ILE A 1 303 ? 3.710   18.678  39.336 1.00 37.77  ? 303 ILE A CB  1 
ATOM   2228 C  CG1 . ILE A 1 303 ? 4.743   19.566  40.059 1.00 37.34  ? 303 ILE A CG1 1 
ATOM   2229 C  CG2 . ILE A 1 303 ? 3.765   18.909  37.813 1.00 38.00  ? 303 ILE A CG2 1 
ATOM   2230 C  CD1 . ILE A 1 303 ? 6.162   19.569  39.483 1.00 43.43  ? 303 ILE A CD1 1 
ATOM   2231 N  N   . SER A 1 304 ? 1.171   16.931  38.969 1.00 34.83  ? 304 SER A N   1 
ATOM   2232 C  CA  . SER A 1 304 ? 0.179   16.195  38.178 1.00 36.29  ? 304 SER A CA  1 
ATOM   2233 C  C   . SER A 1 304 ? -1.256  16.769  38.221 1.00 45.24  ? 304 SER A C   1 
ATOM   2234 O  O   . SER A 1 304 ? -1.729  17.301  37.204 1.00 45.44  ? 304 SER A O   1 
ATOM   2235 C  CB  . SER A 1 304 ? 0.199   14.701  38.477 1.00 38.04  ? 304 SER A CB  1 
ATOM   2236 O  OG  . SER A 1 304 ? -0.533  13.972  37.504 1.00 44.03  ? 304 SER A OG  1 
ATOM   2237 N  N   . GLN A 1 305 ? -1.897  16.743  39.412 1.00 44.38  ? 305 GLN A N   1 
ATOM   2238 C  CA  . GLN A 1 305 ? -3.262  17.215  39.611 1.00 46.83  ? 305 GLN A CA  1 
ATOM   2239 C  C   . GLN A 1 305 ? -3.492  18.581  39.012 1.00 52.30  ? 305 GLN A C   1 
ATOM   2240 O  O   . GLN A 1 305 ? -4.478  18.749  38.284 1.00 55.24  ? 305 GLN A O   1 
ATOM   2241 C  CB  . GLN A 1 305 ? -3.692  17.155  41.088 1.00 48.68  ? 305 GLN A CB  1 
ATOM   2242 C  CG  . GLN A 1 305 ? -5.205  16.988  41.235 1.00 71.82  ? 305 GLN A CG  1 
ATOM   2243 C  CD  . GLN A 1 305 ? -5.623  16.280  42.498 1.00 95.86  ? 305 GLN A CD  1 
ATOM   2244 O  OE1 . GLN A 1 305 ? -5.040  15.259  42.912 1.00 89.91  ? 305 GLN A OE1 1 
ATOM   2245 N  NE2 . GLN A 1 305 ? -6.690  16.781  43.106 1.00 90.83  ? 305 GLN A NE2 1 
ATOM   2246 N  N   . LEU A 1 306 ? -2.558  19.529  39.256 1.00 46.46  ? 306 LEU A N   1 
ATOM   2247 C  CA  . LEU A 1 306 ? -2.653  20.899  38.735 1.00 47.06  ? 306 LEU A CA  1 
ATOM   2248 C  C   . LEU A 1 306 ? -2.588  20.968  37.197 1.00 52.22  ? 306 LEU A C   1 
ATOM   2249 O  O   . LEU A 1 306 ? -3.509  21.496  36.564 1.00 52.48  ? 306 LEU A O   1 
ATOM   2250 C  CB  . LEU A 1 306 ? -1.609  21.837  39.398 1.00 45.33  ? 306 LEU A CB  1 
ATOM   2251 C  CG  . LEU A 1 306 ? -1.022  22.935  38.503 1.00 49.07  ? 306 LEU A CG  1 
ATOM   2252 C  CD1 . LEU A 1 306 ? -1.804  24.229  38.598 1.00 50.79  ? 306 LEU A CD1 1 
ATOM   2253 C  CD2 . LEU A 1 306 ? 0.475   23.100  38.719 1.00 48.74  ? 306 LEU A CD2 1 
ATOM   2254 N  N   . LEU A 1 307 ? -1.510  20.420  36.607 1.00 49.16  ? 307 LEU A N   1 
ATOM   2255 C  CA  . LEU A 1 307 ? -1.321  20.488  35.174 1.00 50.14  ? 307 LEU A CA  1 
ATOM   2256 C  C   . LEU A 1 307 ? -2.238  19.565  34.367 1.00 57.35  ? 307 LEU A C   1 
ATOM   2257 O  O   . LEU A 1 307 ? -2.364  19.721  33.145 1.00 56.89  ? 307 LEU A O   1 
ATOM   2258 C  CB  . LEU A 1 307 ? 0.172   20.559  34.771 1.00 48.18  ? 307 LEU A CB  1 
ATOM   2259 C  CG  . LEU A 1 307 ? 0.974   19.322  34.394 1.00 50.58  ? 307 LEU A CG  1 
ATOM   2260 C  CD1 . LEU A 1 307 ? 2.408   19.702  34.079 1.00 48.74  ? 307 LEU A CD1 1 
ATOM   2261 C  CD2 . LEU A 1 307 ? 0.975   18.331  35.464 1.00 50.93  ? 307 LEU A CD2 1 
ATOM   2262 N  N   . HIS A 1 308 ? -2.989  18.695  35.098 1.00 56.62  ? 308 HIS A N   1 
ATOM   2263 C  CA  . HIS A 1 308 ? -4.046  17.839  34.548 1.00 58.31  ? 308 HIS A CA  1 
ATOM   2264 C  C   . HIS A 1 308 ? -5.297  18.690  34.343 1.00 65.49  ? 308 HIS A C   1 
ATOM   2265 O  O   . HIS A 1 308 ? -5.727  18.866  33.196 1.00 65.70  ? 308 HIS A O   1 
ATOM   2266 C  CB  . HIS A 1 308 ? -4.346  16.630  35.444 1.00 58.25  ? 308 HIS A CB  1 
ATOM   2267 C  CG  . HIS A 1 308 ? -3.778  15.358  34.903 1.00 60.47  ? 308 HIS A CG  1 
ATOM   2268 N  ND1 . HIS A 1 308 ? -2.422  15.100  34.941 1.00 60.03  ? 308 HIS A ND1 1 
ATOM   2269 C  CD2 . HIS A 1 308 ? -4.401  14.317  34.307 1.00 63.36  ? 308 HIS A CD2 1 
ATOM   2270 C  CE1 . HIS A 1 308 ? -2.266  13.904  34.397 1.00 59.13  ? 308 HIS A CE1 1 
ATOM   2271 N  NE2 . HIS A 1 308 ? -3.423  13.400  33.984 1.00 61.34  ? 308 HIS A NE2 1 
ATOM   2272 N  N   . GLU A 1 309 ? -5.828  19.286  35.438 1.00 64.08  ? 309 GLU A N   1 
ATOM   2273 C  CA  . GLU A 1 309 ? -7.004  20.151  35.370 1.00 67.76  ? 309 GLU A CA  1 
ATOM   2274 C  C   . GLU A 1 309 ? -6.774  21.404  34.482 1.00 75.95  ? 309 GLU A C   1 
ATOM   2275 O  O   . GLU A 1 309 ? -7.741  22.001  34.001 1.00 79.42  ? 309 GLU A O   1 
ATOM   2276 C  CB  . GLU A 1 309 ? -7.533  20.500  36.773 1.00 69.88  ? 309 GLU A CB  1 
ATOM   2277 C  CG  . GLU A 1 309 ? -9.047  20.744  36.816 1.00 85.65  ? 309 GLU A CG  1 
ATOM   2278 C  CD  . GLU A 1 309 ? -10.036 19.579  36.793 1.00 102.08 ? 309 GLU A CD  1 
ATOM   2279 O  OE1 . GLU A 1 309 ? -11.259 19.853  36.736 1.00 87.29  ? 309 GLU A OE1 1 
ATOM   2280 O  OE2 . GLU A 1 309 ? -9.605  18.403  36.857 1.00 88.25  ? 309 GLU A OE2 1 
ATOM   2281 N  N   . TRP A 1 310 ? -5.499  21.755  34.211 1.00 70.88  ? 310 TRP A N   1 
ATOM   2282 C  CA  . TRP A 1 310 ? -5.119  22.878  33.350 1.00 70.82  ? 310 TRP A CA  1 
ATOM   2283 C  C   . TRP A 1 310 ? -5.298  22.516  31.880 1.00 74.61  ? 310 TRP A C   1 
ATOM   2284 O  O   . TRP A 1 310 ? -5.921  23.269  31.123 1.00 75.09  ? 310 TRP A O   1 
ATOM   2285 C  CB  . TRP A 1 310 ? -3.633  23.199  33.555 1.00 67.23  ? 310 TRP A CB  1 
ATOM   2286 C  CG  . TRP A 1 310 ? -3.311  24.446  34.318 1.00 68.07  ? 310 TRP A CG  1 
ATOM   2287 C  CD1 . TRP A 1 310 ? -4.185  25.317  34.903 1.00 72.97  ? 310 TRP A CD1 1 
ATOM   2288 C  CD2 . TRP A 1 310 ? -2.000  24.929  34.617 1.00 65.72  ? 310 TRP A CD2 1 
ATOM   2289 N  NE1 . TRP A 1 310 ? -3.495  26.319  35.544 1.00 71.84  ? 310 TRP A NE1 1 
ATOM   2290 C  CE2 . TRP A 1 310 ? -2.151  26.098  35.395 1.00 70.55  ? 310 TRP A CE2 1 
ATOM   2291 C  CE3 . TRP A 1 310 ? -0.707  24.486  34.302 1.00 64.37  ? 310 TRP A CE3 1 
ATOM   2292 C  CZ2 . TRP A 1 310 ? -1.059  26.827  35.865 1.00 68.14  ? 310 TRP A CZ2 1 
ATOM   2293 C  CZ3 . TRP A 1 310 ? 0.370   25.216  34.762 1.00 64.40  ? 310 TRP A CZ3 1 
ATOM   2294 C  CH2 . TRP A 1 310 ? 0.189   26.351  35.563 1.00 65.75  ? 310 TRP A CH2 1 
ATOM   2295 N  N   . GLY A 1 311 ? -4.696  21.385  31.497 1.00 70.20  ? 311 GLY A N   1 
ATOM   2296 C  CA  . GLY A 1 311 ? -4.650  20.886  30.129 1.00 70.59  ? 311 GLY A CA  1 
ATOM   2297 C  C   . GLY A 1 311 ? -3.418  21.419  29.427 1.00 73.25  ? 311 GLY A C   1 
ATOM   2298 O  O   . GLY A 1 311 ? -2.674  22.205  30.017 1.00 72.35  ? 311 GLY A O   1 
ATOM   2299 N  N   . GLU A 1 312 ? -3.179  21.008  28.168 1.00 69.23  ? 312 GLU A N   1 
ATOM   2300 C  CA  . GLU A 1 312 ? -2.016  21.503  27.419 1.00 67.09  ? 312 GLU A CA  1 
ATOM   2301 C  C   . GLU A 1 312 ? -2.178  23.000  27.089 1.00 70.09  ? 312 GLU A C   1 
ATOM   2302 O  O   . GLU A 1 312 ? -1.178  23.722  27.021 1.00 68.81  ? 312 GLU A O   1 
ATOM   2303 C  CB  . GLU A 1 312 ? -1.724  20.648  26.174 1.00 68.20  ? 312 GLU A CB  1 
ATOM   2304 C  CG  . GLU A 1 312 ? -0.406  19.896  26.281 1.00 76.00  ? 312 GLU A CG  1 
ATOM   2305 C  CD  . GLU A 1 312 ? -0.494  18.382  26.191 1.00 91.35  ? 312 GLU A CD  1 
ATOM   2306 O  OE1 . GLU A 1 312 ? -0.886  17.867  25.116 1.00 85.72  ? 312 GLU A OE1 1 
ATOM   2307 O  OE2 . GLU A 1 312 ? -0.160  17.710  27.195 1.00 72.30  ? 312 GLU A OE2 1 
ATOM   2308 N  N   . GLU A 1 313 ? -3.444  23.467  26.952 1.00 66.17  ? 313 GLU A N   1 
ATOM   2309 C  CA  . GLU A 1 313 ? -3.771  24.866  26.722 1.00 66.23  ? 313 GLU A CA  1 
ATOM   2310 C  C   . GLU A 1 313 ? -3.503  25.622  28.022 1.00 67.01  ? 313 GLU A C   1 
ATOM   2311 O  O   . GLU A 1 313 ? -2.837  26.659  28.002 1.00 65.40  ? 313 GLU A O   1 
ATOM   2312 C  CB  . GLU A 1 313 ? -5.234  25.026  26.274 1.00 70.46  ? 313 GLU A CB  1 
ATOM   2313 N  N   . GLY A 1 314 ? -3.963  25.054  29.140 1.00 62.85  ? 314 GLY A N   1 
ATOM   2314 C  CA  . GLY A 1 314 ? -3.751  25.609  30.471 1.00 62.10  ? 314 GLY A CA  1 
ATOM   2315 C  C   . GLY A 1 314 ? -2.276  25.775  30.763 1.00 64.20  ? 314 GLY A C   1 
ATOM   2316 O  O   . GLY A 1 314 ? -1.858  26.810  31.286 1.00 64.16  ? 314 GLY A O   1 
ATOM   2317 N  N   . PHE A 1 315 ? -1.477  24.770  30.350 1.00 58.81  ? 315 PHE A N   1 
ATOM   2318 C  CA  . PHE A 1 315 ? -0.028  24.718  30.492 1.00 56.13  ? 315 PHE A CA  1 
ATOM   2319 C  C   . PHE A 1 315 ? 0.633   25.737  29.569 1.00 61.79  ? 315 PHE A C   1 
ATOM   2320 O  O   . PHE A 1 315 ? 1.493   26.498  30.021 1.00 59.51  ? 315 PHE A O   1 
ATOM   2321 C  CB  . PHE A 1 315 ? 0.477   23.298  30.194 1.00 56.11  ? 315 PHE A CB  1 
ATOM   2322 C  CG  . PHE A 1 315 ? 1.978   23.129  30.247 1.00 54.91  ? 315 PHE A CG  1 
ATOM   2323 C  CD1 . PHE A 1 315 ? 2.648   23.083  31.469 1.00 56.29  ? 315 PHE A CD1 1 
ATOM   2324 C  CD2 . PHE A 1 315 ? 2.718   22.979  29.078 1.00 55.51  ? 315 PHE A CD2 1 
ATOM   2325 C  CE1 . PHE A 1 315 ? 4.040   22.948  31.516 1.00 54.98  ? 315 PHE A CE1 1 
ATOM   2326 C  CE2 . PHE A 1 315 ? 4.109   22.842  29.124 1.00 56.22  ? 315 PHE A CE2 1 
ATOM   2327 C  CZ  . PHE A 1 315 ? 4.761   22.829  30.341 1.00 53.13  ? 315 PHE A CZ  1 
ATOM   2328 N  N   . MET A 1 316 ? 0.231   25.757  28.281 1.00 62.42  ? 316 MET A N   1 
ATOM   2329 C  CA  . MET A 1 316 ? 0.779   26.709  27.307 1.00 63.77  ? 316 MET A CA  1 
ATOM   2330 C  C   . MET A 1 316 ? 0.450   28.177  27.592 1.00 67.99  ? 316 MET A C   1 
ATOM   2331 O  O   . MET A 1 316 ? 1.258   29.047  27.263 1.00 66.96  ? 316 MET A O   1 
ATOM   2332 C  CB  . MET A 1 316 ? 0.518   26.303  25.847 1.00 67.65  ? 316 MET A CB  1 
ATOM   2333 C  CG  . MET A 1 316 ? 1.791   25.930  25.107 1.00 70.30  ? 316 MET A CG  1 
ATOM   2334 S  SD  . MET A 1 316 ? 2.655   24.563  25.916 1.00 72.57  ? 316 MET A SD  1 
ATOM   2335 C  CE  . MET A 1 316 ? 4.215   24.654  25.130 1.00 67.71  ? 316 MET A CE  1 
ATOM   2336 N  N   . ALA A 1 317 ? -0.699  28.446  28.252 1.00 64.94  ? 317 ALA A N   1 
ATOM   2337 C  CA  . ALA A 1 317 ? -1.050  29.795  28.668 1.00 65.59  ? 317 ALA A CA  1 
ATOM   2338 C  C   . ALA A 1 317 ? 0.007   30.176  29.691 1.00 67.59  ? 317 ALA A C   1 
ATOM   2339 O  O   . ALA A 1 317 ? 0.784   31.088  29.446 1.00 65.72  ? 317 ALA A O   1 
ATOM   2340 C  CB  . ALA A 1 317 ? -2.427  29.809  29.305 1.00 68.27  ? 317 ALA A CB  1 
ATOM   2341 N  N   . HIS A 1 318 ? 0.135   29.375  30.759 1.00 65.11  ? 318 HIS A N   1 
ATOM   2342 C  CA  . HIS A 1 318 ? 1.126   29.576  31.813 1.00 64.30  ? 318 HIS A CA  1 
ATOM   2343 C  C   . HIS A 1 318 ? 2.520   29.806  31.261 1.00 67.40  ? 318 HIS A C   1 
ATOM   2344 O  O   . HIS A 1 318 ? 3.162   30.771  31.678 1.00 66.55  ? 318 HIS A O   1 
ATOM   2345 C  CB  . HIS A 1 318 ? 1.114   28.413  32.811 1.00 64.28  ? 318 HIS A CB  1 
ATOM   2346 C  CG  . HIS A 1 318 ? 2.105   28.547  33.923 1.00 66.08  ? 318 HIS A CG  1 
ATOM   2347 N  ND1 . HIS A 1 318 ? 2.173   29.689  34.695 1.00 68.42  ? 318 HIS A ND1 1 
ATOM   2348 C  CD2 . HIS A 1 318 ? 3.008   27.650  34.385 1.00 66.13  ? 318 HIS A CD2 1 
ATOM   2349 C  CE1 . HIS A 1 318 ? 3.127   29.461  35.584 1.00 66.35  ? 318 HIS A CE1 1 
ATOM   2350 N  NE2 . HIS A 1 318 ? 3.653   28.244  35.441 1.00 65.17  ? 318 HIS A NE2 1 
ATOM   2351 N  N   . VAL A 1 319 ? 2.973   28.958  30.301 1.00 63.59  ? 319 VAL A N   1 
ATOM   2352 C  CA  . VAL A 1 319 ? 4.291   29.144  29.707 1.00 62.31  ? 319 VAL A CA  1 
ATOM   2353 C  C   . VAL A 1 319 ? 4.441   30.494  29.018 1.00 70.39  ? 319 VAL A C   1 
ATOM   2354 O  O   . VAL A 1 319 ? 5.415   31.190  29.304 1.00 69.43  ? 319 VAL A O   1 
ATOM   2355 C  CB  . VAL A 1 319 ? 4.901   27.949  28.952 1.00 64.30  ? 319 VAL A CB  1 
ATOM   2356 C  CG1 . VAL A 1 319 ? 4.788   26.677  29.778 1.00 63.04  ? 319 VAL A CG1 1 
ATOM   2357 C  CG2 . VAL A 1 319 ? 4.295   27.766  27.567 1.00 65.38  ? 319 VAL A CG2 1 
ATOM   2358 N  N   . ASP A 1 320 ? 3.419   30.920  28.221 1.00 70.19  ? 320 ASP A N   1 
ATOM   2359 C  CA  . ASP A 1 320 ? 3.404   32.230  27.548 1.00 71.75  ? 320 ASP A CA  1 
ATOM   2360 C  C   . ASP A 1 320 ? 3.502   33.358  28.587 1.00 76.09  ? 320 ASP A C   1 
ATOM   2361 O  O   . ASP A 1 320 ? 4.331   34.259  28.426 1.00 75.77  ? 320 ASP A O   1 
ATOM   2362 C  CB  . ASP A 1 320 ? 2.130   32.423  26.692 1.00 76.14  ? 320 ASP A CB  1 
ATOM   2363 C  CG  . ASP A 1 320 ? 1.943   31.478  25.518 1.00 86.31  ? 320 ASP A CG  1 
ATOM   2364 O  OD1 . ASP A 1 320 ? 2.826   30.599  25.307 1.00 84.58  ? 320 ASP A OD1 1 
ATOM   2365 O  OD2 . ASP A 1 320 ? 0.891   31.587  24.831 1.00 92.59  ? 320 ASP A OD2 1 
ATOM   2366 N  N   . ARG A 1 321 ? 2.684   33.271  29.674 1.00 72.13  ? 321 ARG A N   1 
ATOM   2367 C  CA  . ARG A 1 321 ? 2.646   34.234  30.779 1.00 71.44  ? 321 ARG A CA  1 
ATOM   2368 C  C   . ARG A 1 321 ? 4.062   34.426  31.333 1.00 72.12  ? 321 ARG A C   1 
ATOM   2369 O  O   . ARG A 1 321 ? 4.511   35.566  31.492 1.00 71.96  ? 321 ARG A O   1 
ATOM   2370 C  CB  . ARG A 1 321 ? 1.685   33.767  31.901 1.00 71.07  ? 321 ARG A CB  1 
ATOM   2371 C  CG  . ARG A 1 321 ? 0.206   33.695  31.505 1.00 84.84  ? 321 ARG A CG  1 
ATOM   2372 C  CD  . ARG A 1 321 ? -0.723  33.490  32.700 1.00 99.53  ? 321 ARG A CD  1 
ATOM   2373 N  NE  . ARG A 1 321 ? -0.688  32.123  33.236 1.00 109.35 ? 321 ARG A NE  1 
ATOM   2374 C  CZ  . ARG A 1 321 ? -1.765  31.377  33.481 1.00 121.35 ? 321 ARG A CZ  1 
ATOM   2375 N  NH1 . ARG A 1 321 ? -2.982  31.856  33.251 1.00 110.66 ? 321 ARG A NH1 1 
ATOM   2376 N  NH2 . ARG A 1 321 ? -1.631  30.146  33.961 1.00 100.98 ? 321 ARG A NH2 1 
ATOM   2377 N  N   . VAL A 1 322 ? 4.781   33.304  31.562 1.00 65.78  ? 322 VAL A N   1 
ATOM   2378 C  CA  . VAL A 1 322 ? 6.142   33.324  32.095 1.00 63.08  ? 322 VAL A CA  1 
ATOM   2379 C  C   . VAL A 1 322 ? 7.190   33.838  31.097 1.00 63.37  ? 322 VAL A C   1 
ATOM   2380 O  O   . VAL A 1 322 ? 8.004   34.680  31.488 1.00 62.03  ? 322 VAL A O   1 
ATOM   2381 C  CB  . VAL A 1 322 ? 6.538   32.076  32.953 1.00 65.63  ? 322 VAL A CB  1 
ATOM   2382 C  CG1 . VAL A 1 322 ? 6.373   30.767  32.198 1.00 64.61  ? 322 VAL A CG1 1 
ATOM   2383 C  CG2 . VAL A 1 322 ? 7.941   32.192  33.542 1.00 63.87  ? 322 VAL A CG2 1 
ATOM   2384 N  N   . ILE A 1 323 ? 7.116   33.424  29.805 1.00 58.34  ? 323 ILE A N   1 
ATOM   2385 C  CA  . ILE A 1 323 ? 8.065   33.918  28.790 1.00 57.16  ? 323 ILE A CA  1 
ATOM   2386 C  C   . ILE A 1 323 ? 8.015   35.445  28.670 1.00 61.71  ? 323 ILE A C   1 
ATOM   2387 O  O   . ILE A 1 323 ? 9.068   36.077  28.578 1.00 60.08  ? 323 ILE A O   1 
ATOM   2388 C  CB  . ILE A 1 323 ? 7.996   33.250  27.388 1.00 60.26  ? 323 ILE A CB  1 
ATOM   2389 C  CG1 . ILE A 1 323 ? 7.582   31.783  27.446 1.00 60.75  ? 323 ILE A CG1 1 
ATOM   2390 C  CG2 . ILE A 1 323 ? 9.340   33.390  26.681 1.00 59.03  ? 323 ILE A CG2 1 
ATOM   2391 C  CD1 . ILE A 1 323 ? 6.873   31.234  26.179 1.00 74.03  ? 323 ILE A CD1 1 
ATOM   2392 N  N   . ASP A 1 324 ? 6.806   36.039  28.691 1.00 60.18  ? 324 ASP A N   1 
ATOM   2393 C  CA  . ASP A 1 324 ? 6.728   37.484  28.570 1.00 61.56  ? 324 ASP A CA  1 
ATOM   2394 C  C   . ASP A 1 324 ? 7.082   38.252  29.836 1.00 64.71  ? 324 ASP A C   1 
ATOM   2395 O  O   . ASP A 1 324 ? 7.222   39.476  29.790 1.00 66.38  ? 324 ASP A O   1 
ATOM   2396 C  CB  . ASP A 1 324 ? 5.513   38.008  27.757 1.00 66.12  ? 324 ASP A CB  1 
ATOM   2397 C  CG  . ASP A 1 324 ? 4.160   38.068  28.435 1.00 77.58  ? 324 ASP A CG  1 
ATOM   2398 O  OD1 . ASP A 1 324 ? 3.331   38.903  28.019 1.00 79.11  ? 324 ASP A OD1 1 
ATOM   2399 O  OD2 . ASP A 1 324 ? 3.912   37.251  29.346 1.00 84.58  ? 324 ASP A OD2 1 
ATOM   2400 N  N   . PHE A 1 325 ? 7.348   37.538  30.936 1.00 58.04  ? 325 PHE A N   1 
ATOM   2401 C  CA  . PHE A 1 325 ? 7.827   38.211  32.137 1.00 56.61  ? 325 PHE A CA  1 
ATOM   2402 C  C   . PHE A 1 325 ? 9.333   38.424  31.945 1.00 58.27  ? 325 PHE A C   1 
ATOM   2403 O  O   . PHE A 1 325 ? 9.796   39.565  31.924 1.00 58.46  ? 325 PHE A O   1 
ATOM   2404 C  CB  . PHE A 1 325 ? 7.521   37.404  33.411 1.00 57.10  ? 325 PHE A CB  1 
ATOM   2405 C  CG  . PHE A 1 325 ? 8.286   37.874  34.625 1.00 57.05  ? 325 PHE A CG  1 
ATOM   2406 C  CD1 . PHE A 1 325 ? 7.892   39.008  35.318 1.00 60.36  ? 325 PHE A CD1 1 
ATOM   2407 C  CD2 . PHE A 1 325 ? 9.420   37.198  35.057 1.00 57.31  ? 325 PHE A CD2 1 
ATOM   2408 C  CE1 . PHE A 1 325 ? 8.612   39.454  36.429 1.00 60.32  ? 325 PHE A CE1 1 
ATOM   2409 C  CE2 . PHE A 1 325 ? 10.143  37.653  36.163 1.00 59.28  ? 325 PHE A CE2 1 
ATOM   2410 C  CZ  . PHE A 1 325 ? 9.734   38.780  36.840 1.00 57.84  ? 325 PHE A CZ  1 
ATOM   2411 N  N   . TYR A 1 326 ? 10.069  37.315  31.754 1.00 52.49  ? 326 TYR A N   1 
ATOM   2412 C  CA  . TYR A 1 326 ? 11.506  37.255  31.525 1.00 50.92  ? 326 TYR A CA  1 
ATOM   2413 C  C   . TYR A 1 326 ? 11.922  37.997  30.245 1.00 54.67  ? 326 TYR A C   1 
ATOM   2414 O  O   . TYR A 1 326 ? 13.093  38.369  30.118 1.00 53.13  ? 326 TYR A O   1 
ATOM   2415 C  CB  . TYR A 1 326 ? 11.957  35.790  31.459 1.00 51.24  ? 326 TYR A CB  1 
ATOM   2416 C  CG  . TYR A 1 326 ? 11.977  35.090  32.799 1.00 54.36  ? 326 TYR A CG  1 
ATOM   2417 C  CD1 . TYR A 1 326 ? 13.159  34.970  33.528 1.00 55.82  ? 326 TYR A CD1 1 
ATOM   2418 C  CD2 . TYR A 1 326 ? 10.832  34.488  33.311 1.00 56.26  ? 326 TYR A CD2 1 
ATOM   2419 C  CE1 . TYR A 1 326 ? 13.200  34.268  34.737 1.00 56.09  ? 326 TYR A CE1 1 
ATOM   2420 C  CE2 . TYR A 1 326 ? 10.856  33.798  34.525 1.00 56.74  ? 326 TYR A CE2 1 
ATOM   2421 C  CZ  . TYR A 1 326 ? 12.043  33.690  35.237 1.00 62.91  ? 326 TYR A CZ  1 
ATOM   2422 O  OH  . TYR A 1 326 ? 12.060  33.014  36.439 1.00 60.14  ? 326 TYR A OH  1 
ATOM   2423 N  N   . SER A 1 327 ? 10.972  38.181  29.285 1.00 52.11  ? 327 SER A N   1 
ATOM   2424 C  CA  . SER A 1 327 ? 11.185  38.920  28.027 1.00 51.99  ? 327 SER A CA  1 
ATOM   2425 C  C   . SER A 1 327 ? 11.433  40.390  28.399 1.00 55.22  ? 327 SER A C   1 
ATOM   2426 O  O   . SER A 1 327 ? 12.432  40.975  27.986 1.00 53.58  ? 327 SER A O   1 
ATOM   2427 C  CB  . SER A 1 327 ? 9.975   38.788  27.099 1.00 55.50  ? 327 SER A CB  1 
ATOM   2428 O  OG  . SER A 1 327 ? 10.351  38.490  25.764 1.00 58.97  ? 327 SER A OG  1 
ATOM   2429 N  N   . ASN A 1 328 ? 10.574  40.931  29.274 1.00 52.41  ? 328 ASN A N   1 
ATOM   2430 C  CA  . ASN A 1 328 ? 10.701  42.268  29.823 1.00 52.89  ? 328 ASN A CA  1 
ATOM   2431 C  C   . ASN A 1 328 ? 11.904  42.346  30.745 1.00 53.73  ? 328 ASN A C   1 
ATOM   2432 O  O   . ASN A 1 328 ? 12.592  43.351  30.737 1.00 53.88  ? 328 ASN A O   1 
ATOM   2433 C  CB  . ASN A 1 328 ? 9.421   42.672  30.532 1.00 57.52  ? 328 ASN A CB  1 
ATOM   2434 C  CG  . ASN A 1 328 ? 8.216   42.649  29.625 1.00 90.99  ? 328 ASN A CG  1 
ATOM   2435 O  OD1 . ASN A 1 328 ? 7.136   42.205  30.021 1.00 85.78  ? 328 ASN A OD1 1 
ATOM   2436 N  ND2 . ASN A 1 328 ? 8.373   43.110  28.379 1.00 86.54  ? 328 ASN A ND2 1 
ATOM   2437 N  N   . GLN A 1 329 ? 12.205  41.269  31.480 1.00 48.34  ? 329 GLN A N   1 
ATOM   2438 C  CA  . GLN A 1 329 ? 13.384  41.198  32.350 1.00 46.21  ? 329 GLN A CA  1 
ATOM   2439 C  C   . GLN A 1 329 ? 14.661  41.260  31.490 1.00 47.40  ? 329 GLN A C   1 
ATOM   2440 O  O   . GLN A 1 329 ? 15.596  41.976  31.843 1.00 45.93  ? 329 GLN A O   1 
ATOM   2441 C  CB  . GLN A 1 329 ? 13.343  39.939  33.234 1.00 46.03  ? 329 GLN A CB  1 
ATOM   2442 C  CG  . GLN A 1 329 ? 12.227  39.932  34.301 1.00 52.27  ? 329 GLN A CG  1 
ATOM   2443 C  CD  . GLN A 1 329 ? 12.454  40.851  35.488 1.00 60.23  ? 329 GLN A CD  1 
ATOM   2444 O  OE1 . GLN A 1 329 ? 11.593  41.660  35.864 1.00 54.42  ? 329 GLN A OE1 1 
ATOM   2445 N  NE2 . GLN A 1 329 ? 13.596  40.723  36.138 1.00 48.15  ? 329 GLN A NE2 1 
ATOM   2446 N  N   . LYS A 1 330 ? 14.655  40.569  30.327 1.00 43.67  ? 330 LYS A N   1 
ATOM   2447 C  CA  . LYS A 1 330 ? 15.730  40.585  29.321 1.00 42.95  ? 330 LYS A CA  1 
ATOM   2448 C  C   . LYS A 1 330 ? 15.818  42.025  28.763 1.00 45.78  ? 330 LYS A C   1 
ATOM   2449 O  O   . LYS A 1 330 ? 16.891  42.642  28.822 1.00 45.05  ? 330 LYS A O   1 
ATOM   2450 C  CB  . LYS A 1 330 ? 15.438  39.559  28.189 1.00 45.80  ? 330 LYS A CB  1 
ATOM   2451 C  CG  . LYS A 1 330 ? 16.198  39.793  26.865 1.00 58.74  ? 330 LYS A CG  1 
ATOM   2452 C  CD  . LYS A 1 330 ? 15.470  39.223  25.626 1.00 67.48  ? 330 LYS A CD  1 
ATOM   2453 C  CE  . LYS A 1 330 ? 14.415  40.161  25.065 1.00 69.65  ? 330 LYS A CE  1 
ATOM   2454 N  NZ  . LYS A 1 330 ? 13.338  39.424  24.348 1.00 65.34  ? 330 LYS A NZ  1 
ATOM   2455 N  N   . ASP A 1 331 ? 14.659  42.570  28.289 1.00 40.44  ? 331 ASP A N   1 
ATOM   2456 C  CA  . ASP A 1 331 ? 14.545  43.932  27.781 1.00 39.86  ? 331 ASP A CA  1 
ATOM   2457 C  C   . ASP A 1 331 ? 15.180  44.860  28.809 1.00 42.39  ? 331 ASP A C   1 
ATOM   2458 O  O   . ASP A 1 331 ? 16.140  45.538  28.464 1.00 43.18  ? 331 ASP A O   1 
ATOM   2459 C  CB  . ASP A 1 331 ? 13.071  44.331  27.511 1.00 42.50  ? 331 ASP A CB  1 
ATOM   2460 C  CG  . ASP A 1 331 ? 12.302  43.570  26.424 1.00 45.69  ? 331 ASP A CG  1 
ATOM   2461 O  OD1 . ASP A 1 331 ? 12.919  43.223  25.372 1.00 44.44  ? 331 ASP A OD1 1 
ATOM   2462 O  OD2 . ASP A 1 331 ? 11.068  43.368  26.599 1.00 47.45  ? 331 ASP A OD2 1 
ATOM   2463 N  N   . ALA A 1 332 ? 14.742  44.773  30.088 1.00 38.32  ? 332 ALA A N   1 
ATOM   2464 C  CA  . ALA A 1 332 ? 15.192  45.575  31.232 1.00 38.36  ? 332 ALA A CA  1 
ATOM   2465 C  C   . ALA A 1 332 ? 16.697  45.604  31.481 1.00 40.46  ? 332 ALA A C   1 
ATOM   2466 O  O   . ALA A 1 332 ? 17.290  46.682  31.516 1.00 40.16  ? 332 ALA A O   1 
ATOM   2467 C  CB  . ALA A 1 332 ? 14.465  45.145  32.493 1.00 38.73  ? 332 ALA A CB  1 
ATOM   2468 N  N   . ILE A 1 333 ? 17.311  44.432  31.674 1.00 38.09  ? 333 ILE A N   1 
ATOM   2469 C  CA  . ILE A 1 333 ? 18.749  44.323  31.942 1.00 37.58  ? 333 ILE A CA  1 
ATOM   2470 C  C   . ILE A 1 333 ? 19.575  44.893  30.787 1.00 43.70  ? 333 ILE A C   1 
ATOM   2471 O  O   . ILE A 1 333 ? 20.592  45.554  31.020 1.00 44.11  ? 333 ILE A O   1 
ATOM   2472 C  CB  . ILE A 1 333 ? 19.157  42.882  32.352 1.00 38.39  ? 333 ILE A CB  1 
ATOM   2473 C  CG1 . ILE A 1 333 ? 20.582  42.836  32.905 1.00 37.19  ? 333 ILE A CG1 1 
ATOM   2474 C  CG2 . ILE A 1 333 ? 18.970  41.883  31.204 1.00 39.31  ? 333 ILE A CG2 1 
ATOM   2475 C  CD1 . ILE A 1 333 ? 20.834  41.790  33.965 1.00 46.77  ? 333 ILE A CD1 1 
ATOM   2476 N  N   . LEU A 1 334 ? 19.121  44.643  29.552 1.00 40.02  ? 334 LEU A N   1 
ATOM   2477 C  CA  . LEU A 1 334 ? 19.782  45.129  28.362 1.00 40.38  ? 334 LEU A CA  1 
ATOM   2478 C  C   . LEU A 1 334 ? 19.645  46.671  28.331 1.00 48.15  ? 334 LEU A C   1 
ATOM   2479 O  O   . LEU A 1 334 ? 20.643  47.378  28.183 1.00 47.80  ? 334 LEU A O   1 
ATOM   2480 C  CB  . LEU A 1 334 ? 19.114  44.471  27.154 1.00 40.53  ? 334 LEU A CB  1 
ATOM   2481 C  CG  . LEU A 1 334 ? 19.791  43.290  26.452 1.00 43.92  ? 334 LEU A CG  1 
ATOM   2482 C  CD1 . LEU A 1 334 ? 20.880  42.647  27.264 1.00 42.61  ? 334 LEU A CD1 1 
ATOM   2483 C  CD2 . LEU A 1 334 ? 18.779  42.273  26.056 1.00 46.51  ? 334 LEU A CD2 1 
ATOM   2484 N  N   . ALA A 1 335 ? 18.430  47.184  28.588 1.00 47.18  ? 335 ALA A N   1 
ATOM   2485 C  CA  . ALA A 1 335 ? 18.156  48.615  28.654 1.00 49.25  ? 335 ALA A CA  1 
ATOM   2486 C  C   . ALA A 1 335 ? 19.041  49.301  29.726 1.00 53.53  ? 335 ALA A C   1 
ATOM   2487 O  O   . ALA A 1 335 ? 19.220  50.527  29.702 1.00 55.01  ? 335 ALA A O   1 
ATOM   2488 C  CB  . ALA A 1 335 ? 16.681  48.840  28.952 1.00 51.49  ? 335 ALA A CB  1 
ATOM   2489 N  N   . ALA A 1 336 ? 19.620  48.488  30.631 1.00 47.90  ? 336 ALA A N   1 
ATOM   2490 C  CA  . ALA A 1 336 ? 20.508  48.917  31.709 1.00 47.21  ? 336 ALA A CA  1 
ATOM   2491 C  C   . ALA A 1 336 ? 21.959  48.830  31.249 1.00 48.03  ? 336 ALA A C   1 
ATOM   2492 O  O   . ALA A 1 336 ? 22.723  49.789  31.371 1.00 46.02  ? 336 ALA A O   1 
ATOM   2493 C  CB  . ALA A 1 336 ? 20.283  48.040  32.941 1.00 47.13  ? 336 ALA A CB  1 
ATOM   2494 N  N   . ALA A 1 337 ? 22.325  47.668  30.699 1.00 44.63  ? 337 ALA A N   1 
ATOM   2495 C  CA  . ALA A 1 337 ? 23.653  47.399  30.156 1.00 43.57  ? 337 ALA A CA  1 
ATOM   2496 C  C   . ALA A 1 337 ? 24.004  48.479  29.107 1.00 47.64  ? 337 ALA A C   1 
ATOM   2497 O  O   . ALA A 1 337 ? 25.086  49.054  29.176 1.00 46.96  ? 337 ALA A O   1 
ATOM   2498 C  CB  . ALA A 1 337 ? 23.701  45.993  29.555 1.00 42.71  ? 337 ALA A CB  1 
ATOM   2499 N  N   . ASP A 1 338 ? 23.038  48.828  28.225 1.00 44.17  ? 338 ASP A N   1 
ATOM   2500 C  CA  . ASP A 1 338 ? 23.182  49.866  27.211 1.00 45.22  ? 338 ASP A CA  1 
ATOM   2501 C  C   . ASP A 1 338 ? 23.614  51.168  27.879 1.00 48.78  ? 338 ASP A C   1 
ATOM   2502 O  O   . ASP A 1 338 ? 24.629  51.743  27.481 1.00 48.90  ? 338 ASP A O   1 
ATOM   2503 C  CB  . ASP A 1 338 ? 21.854  50.072  26.459 1.00 49.16  ? 338 ASP A CB  1 
ATOM   2504 C  CG  . ASP A 1 338 ? 21.415  48.962  25.513 1.00 67.95  ? 338 ASP A CG  1 
ATOM   2505 O  OD1 . ASP A 1 338 ? 22.092  47.893  25.477 1.00 67.89  ? 338 ASP A OD1 1 
ATOM   2506 O  OD2 . ASP A 1 338 ? 20.385  49.149  24.818 1.00 78.42  ? 338 ASP A OD2 1 
ATOM   2507 N  N   . LYS A 1 339 ? 22.881  51.580  28.939 1.00 44.03  ? 339 LYS A N   1 
ATOM   2508 C  CA  . LYS A 1 339 ? 23.118  52.777  29.751 1.00 44.00  ? 339 LYS A CA  1 
ATOM   2509 C  C   . LYS A 1 339 ? 24.477  52.747  30.458 1.00 45.03  ? 339 LYS A C   1 
ATOM   2510 O  O   . LYS A 1 339 ? 25.309  53.606  30.189 1.00 43.76  ? 339 LYS A O   1 
ATOM   2511 C  CB  . LYS A 1 339 ? 21.975  52.947  30.773 1.00 46.06  ? 339 LYS A CB  1 
ATOM   2512 C  CG  . LYS A 1 339 ? 22.097  54.129  31.728 1.00 46.87  ? 339 LYS A CG  1 
ATOM   2513 C  CD  . LYS A 1 339 ? 20.776  54.354  32.473 1.00 51.01  ? 339 LYS A CD  1 
ATOM   2514 C  CE  . LYS A 1 339 ? 20.798  55.550  33.392 1.00 51.04  ? 339 LYS A CE  1 
ATOM   2515 N  NZ  . LYS A 1 339 ? 19.976  55.330  34.617 1.00 52.24  ? 339 LYS A NZ  1 
ATOM   2516 N  N   . TRP A 1 340 ? 24.716  51.755  31.327 1.00 41.92  ? 340 TRP A N   1 
ATOM   2517 C  CA  . TRP A 1 340 ? 25.965  51.719  32.089 1.00 41.55  ? 340 TRP A CA  1 
ATOM   2518 C  C   . TRP A 1 340 ? 27.197  51.031  31.484 1.00 42.64  ? 340 TRP A C   1 
ATOM   2519 O  O   . TRP A 1 340 ? 28.318  51.505  31.716 1.00 42.55  ? 340 TRP A O   1 
ATOM   2520 C  CB  . TRP A 1 340 ? 25.728  51.358  33.551 1.00 40.48  ? 340 TRP A CB  1 
ATOM   2521 C  CG  . TRP A 1 340 ? 24.707  52.239  34.213 1.00 42.81  ? 340 TRP A CG  1 
ATOM   2522 C  CD1 . TRP A 1 340 ? 23.389  51.952  34.422 1.00 45.73  ? 340 TRP A CD1 1 
ATOM   2523 C  CD2 . TRP A 1 340 ? 24.913  53.568  34.717 1.00 44.12  ? 340 TRP A CD2 1 
ATOM   2524 N  NE1 . TRP A 1 340 ? 22.768  53.004  35.062 1.00 46.49  ? 340 TRP A NE1 1 
ATOM   2525 C  CE2 . TRP A 1 340 ? 23.681  54.008  35.257 1.00 48.04  ? 340 TRP A CE2 1 
ATOM   2526 C  CE3 . TRP A 1 340 ? 26.035  54.405  34.829 1.00 45.05  ? 340 TRP A CE3 1 
ATOM   2527 C  CZ2 . TRP A 1 340 ? 23.541  55.243  35.882 1.00 48.36  ? 340 TRP A CZ2 1 
ATOM   2528 C  CZ3 . TRP A 1 340 ? 25.892  55.625  35.457 1.00 47.20  ? 340 TRP A CZ3 1 
ATOM   2529 C  CH2 . TRP A 1 340 ? 24.660  56.030  35.977 1.00 48.68  ? 340 TRP A CH2 1 
ATOM   2530 N  N   . LEU A 1 341 ? 27.012  49.965  30.696 1.00 37.76  ? 341 LEU A N   1 
ATOM   2531 C  CA  . LEU A 1 341 ? 28.169  49.306  30.080 1.00 36.52  ? 341 LEU A CA  1 
ATOM   2532 C  C   . LEU A 1 341 ? 28.540  49.882  28.701 1.00 39.67  ? 341 LEU A C   1 
ATOM   2533 O  O   . LEU A 1 341 ? 29.225  49.229  27.910 1.00 36.93  ? 341 LEU A O   1 
ATOM   2534 C  CB  . LEU A 1 341 ? 28.071  47.758  30.101 1.00 35.20  ? 341 LEU A CB  1 
ATOM   2535 C  CG  . LEU A 1 341 ? 28.037  47.016  31.468 1.00 38.31  ? 341 LEU A CG  1 
ATOM   2536 C  CD1 . LEU A 1 341 ? 28.771  47.769  32.583 1.00 39.19  ? 341 LEU A CD1 1 
ATOM   2537 C  CD2 . LEU A 1 341 ? 26.641  46.742  31.905 1.00 40.46  ? 341 LEU A CD2 1 
ATOM   2538 N  N   . THR A 1 342 ? 28.124  51.159  28.481 1.00 40.74  ? 342 THR A N   1 
ATOM   2539 C  CA  . THR A 1 342 ? 28.333  52.108  27.363 1.00 42.51  ? 342 THR A CA  1 
ATOM   2540 C  C   . THR A 1 342 ? 29.275  51.563  26.297 1.00 45.65  ? 342 THR A C   1 
ATOM   2541 O  O   . THR A 1 342 ? 28.850  51.410  25.165 1.00 46.18  ? 342 THR A O   1 
ATOM   2542 C  CB  . THR A 1 342 ? 28.742  53.549  27.916 1.00 56.05  ? 342 THR A CB  1 
ATOM   2543 O  OG1 . THR A 1 342 ? 28.208  53.747  29.239 1.00 59.47  ? 342 THR A OG1 1 
ATOM   2544 C  CG2 . THR A 1 342 ? 28.318  54.751  26.973 1.00 50.49  ? 342 THR A CG2 1 
ATOM   2545 N  N   . GLY A 1 343 ? 30.516  51.268  26.697 1.00 41.38  ? 343 GLY A N   1 
ATOM   2546 C  CA  . GLY A 1 343 ? 31.596  50.663  25.919 1.00 40.90  ? 343 GLY A CA  1 
ATOM   2547 C  C   . GLY A 1 343 ? 32.680  50.122  26.852 1.00 44.44  ? 343 GLY A C   1 
ATOM   2548 O  O   . GLY A 1 343 ? 33.883  50.255  26.582 1.00 45.05  ? 343 GLY A O   1 
ATOM   2549 N  N   . LEU A 1 344 ? 32.256  49.543  27.985 1.00 37.70  ? 344 LEU A N   1 
ATOM   2550 C  CA  . LEU A 1 344 ? 33.135  49.039  29.023 1.00 36.32  ? 344 LEU A CA  1 
ATOM   2551 C  C   . LEU A 1 344 ? 33.118  47.531  28.967 1.00 40.67  ? 344 LEU A C   1 
ATOM   2552 O  O   . LEU A 1 344 ? 33.916  46.867  29.645 1.00 40.03  ? 344 LEU A O   1 
ATOM   2553 C  CB  . LEU A 1 344 ? 32.584  49.484  30.382 1.00 36.69  ? 344 LEU A CB  1 
ATOM   2554 C  CG  . LEU A 1 344 ? 32.810  50.912  30.806 1.00 43.13  ? 344 LEU A CG  1 
ATOM   2555 C  CD1 . LEU A 1 344 ? 31.719  51.811  30.295 1.00 45.61  ? 344 LEU A CD1 1 
ATOM   2556 C  CD2 . LEU A 1 344 ? 32.752  51.023  32.288 1.00 46.75  ? 344 LEU A CD2 1 
ATOM   2557 N  N   . ALA A 1 345 ? 32.152  46.981  28.214 1.00 37.71  ? 345 ALA A N   1 
ATOM   2558 C  CA  . ALA A 1 345 ? 31.975  45.541  28.078 1.00 36.86  ? 345 ALA A CA  1 
ATOM   2559 C  C   . ALA A 1 345 ? 31.194  45.158  26.830 1.00 41.70  ? 345 ALA A C   1 
ATOM   2560 O  O   . ALA A 1 345 ? 30.667  46.028  26.135 1.00 43.02  ? 345 ALA A O   1 
ATOM   2561 C  CB  . ALA A 1 345 ? 31.307  44.970  29.324 1.00 36.98  ? 345 ALA A CB  1 
ATOM   2562 N  N   . GLU A 1 346 ? 31.129  43.849  26.546 1.00 37.26  ? 346 GLU A N   1 
ATOM   2563 C  CA  . GLU A 1 346 ? 30.406  43.306  25.398 1.00 36.89  ? 346 GLU A CA  1 
ATOM   2564 C  C   . GLU A 1 346 ? 29.399  42.235  25.791 1.00 40.42  ? 346 GLU A C   1 
ATOM   2565 O  O   . GLU A 1 346 ? 29.632  41.472  26.738 1.00 38.53  ? 346 GLU A O   1 
ATOM   2566 C  CB  . GLU A 1 346 ? 31.372  42.803  24.330 1.00 37.71  ? 346 GLU A CB  1 
ATOM   2567 C  CG  . GLU A 1 346 ? 31.672  43.889  23.318 1.00 47.74  ? 346 GLU A CG  1 
ATOM   2568 C  CD  . GLU A 1 346 ? 33.023  43.796  22.647 1.00 66.41  ? 346 GLU A CD  1 
ATOM   2569 O  OE1 . GLU A 1 346 ? 33.230  44.525  21.647 1.00 65.83  ? 346 GLU A OE1 1 
ATOM   2570 O  OE2 . GLU A 1 346 ? 33.880  43.016  23.130 1.00 51.37  ? 346 GLU A OE2 1 
ATOM   2571 N  N   . TRP A 1 347 ? 28.256  42.219  25.084 1.00 38.00  ? 347 TRP A N   1 
ATOM   2572 C  CA  . TRP A 1 347 ? 27.197  41.265  25.330 1.00 38.36  ? 347 TRP A CA  1 
ATOM   2573 C  C   . TRP A 1 347 ? 26.316  40.958  24.133 1.00 46.37  ? 347 TRP A C   1 
ATOM   2574 O  O   . TRP A 1 347 ? 26.082  41.798  23.275 1.00 46.09  ? 347 TRP A O   1 
ATOM   2575 C  CB  . TRP A 1 347 ? 26.356  41.652  26.543 1.00 37.44  ? 347 TRP A CB  1 
ATOM   2576 C  CG  . TRP A 1 347 ? 25.605  42.922  26.359 1.00 40.34  ? 347 TRP A CG  1 
ATOM   2577 C  CD1 . TRP A 1 347 ? 24.309  43.061  25.959 1.00 44.21  ? 347 TRP A CD1 1 
ATOM   2578 C  CD2 . TRP A 1 347 ? 26.113  44.247  26.559 1.00 41.26  ? 347 TRP A CD2 1 
ATOM   2579 N  NE1 . TRP A 1 347 ? 23.966  44.397  25.927 1.00 45.38  ? 347 TRP A NE1 1 
ATOM   2580 C  CE2 . TRP A 1 347 ? 25.058  45.147  26.285 1.00 46.71  ? 347 TRP A CE2 1 
ATOM   2581 C  CE3 . TRP A 1 347 ? 27.354  44.762  26.974 1.00 42.30  ? 347 TRP A CE3 1 
ATOM   2582 C  CZ2 . TRP A 1 347 ? 25.209  46.529  26.401 1.00 47.04  ? 347 TRP A CZ2 1 
ATOM   2583 C  CZ3 . TRP A 1 347 ? 27.502  46.125  27.086 1.00 44.96  ? 347 TRP A CZ3 1 
ATOM   2584 C  CH2 . TRP A 1 347 ? 26.430  46.994  26.830 1.00 47.01  ? 347 TRP A CH2 1 
ATOM   2585 N  N   . HIS A 1 348 ? 25.834  39.719  24.100 1.00 46.84  ? 348 HIS A N   1 
ATOM   2586 C  CA  . HIS A 1 348 ? 24.926  39.182  23.109 1.00 48.60  ? 348 HIS A CA  1 
ATOM   2587 C  C   . HIS A 1 348 ? 23.526  39.226  23.693 1.00 50.19  ? 348 HIS A C   1 
ATOM   2588 O  O   . HIS A 1 348 ? 23.371  38.955  24.887 1.00 49.68  ? 348 HIS A O   1 
ATOM   2589 C  CB  . HIS A 1 348 ? 25.316  37.731  22.806 1.00 50.17  ? 348 HIS A CB  1 
ATOM   2590 C  CG  . HIS A 1 348 ? 26.329  37.616  21.719 1.00 55.53  ? 348 HIS A CG  1 
ATOM   2591 N  ND1 . HIS A 1 348 ? 26.014  37.929  20.398 1.00 59.34  ? 348 HIS A ND1 1 
ATOM   2592 C  CD2 . HIS A 1 348 ? 27.616  37.205  21.778 1.00 58.05  ? 348 HIS A CD2 1 
ATOM   2593 C  CE1 . HIS A 1 348 ? 27.126  37.727  19.710 1.00 59.45  ? 348 HIS A CE1 1 
ATOM   2594 N  NE2 . HIS A 1 348 ? 28.111  37.268  20.491 1.00 58.87  ? 348 HIS A NE2 1 
ATOM   2595 N  N   . VAL A 1 349 ? 22.509  39.556  22.875 1.00 45.36  ? 349 VAL A N   1 
ATOM   2596 C  CA  . VAL A 1 349 ? 21.126  39.583  23.357 1.00 45.06  ? 349 VAL A CA  1 
ATOM   2597 C  C   . VAL A 1 349 ? 20.728  38.127  23.725 1.00 50.59  ? 349 VAL A C   1 
ATOM   2598 O  O   . VAL A 1 349 ? 20.782  37.265  22.848 1.00 50.27  ? 349 VAL A O   1 
ATOM   2599 C  CB  . VAL A 1 349 ? 20.144  40.243  22.359 1.00 48.84  ? 349 VAL A CB  1 
ATOM   2600 C  CG1 . VAL A 1 349 ? 18.770  40.432  22.984 1.00 48.71  ? 349 VAL A CG1 1 
ATOM   2601 C  CG2 . VAL A 1 349 ? 20.679  41.572  21.856 1.00 49.48  ? 349 VAL A CG2 1 
ATOM   2602 N  N   . PRO A 1 350 ? 20.433  37.821  25.022 1.00 48.58  ? 350 PRO A N   1 
ATOM   2603 C  CA  . PRO A 1 350 ? 20.099  36.439  25.405 1.00 47.82  ? 350 PRO A CA  1 
ATOM   2604 C  C   . PRO A 1 350 ? 18.913  35.878  24.640 1.00 53.03  ? 350 PRO A C   1 
ATOM   2605 O  O   . PRO A 1 350 ? 17.818  36.466  24.614 1.00 53.91  ? 350 PRO A O   1 
ATOM   2606 C  CB  . PRO A 1 350 ? 19.833  36.539  26.915 1.00 49.39  ? 350 PRO A CB  1 
ATOM   2607 C  CG  . PRO A 1 350 ? 19.454  37.945  27.146 1.00 55.27  ? 350 PRO A CG  1 
ATOM   2608 C  CD  . PRO A 1 350 ? 20.334  38.719  26.191 1.00 51.29  ? 350 PRO A CD  1 
ATOM   2609 N  N   . ALA A 1 351 ? 19.170  34.753  23.969 1.00 49.27  ? 351 ALA A N   1 
ATOM   2610 C  CA  . ALA A 1 351 ? 18.203  34.084  23.116 1.00 50.02  ? 351 ALA A CA  1 
ATOM   2611 C  C   . ALA A 1 351 ? 17.036  33.529  23.893 1.00 56.71  ? 351 ALA A C   1 
ATOM   2612 O  O   . ALA A 1 351 ? 15.887  33.695  23.487 1.00 58.23  ? 351 ALA A O   1 
ATOM   2613 C  CB  . ALA A 1 351 ? 18.888  32.986  22.325 1.00 49.84  ? 351 ALA A CB  1 
ATOM   2614 N  N   . ALA A 1 352 ? 17.341  32.877  25.021 1.00 53.93  ? 352 ALA A N   1 
ATOM   2615 C  CA  . ALA A 1 352 ? 16.397  32.214  25.913 1.00 53.93  ? 352 ALA A CA  1 
ATOM   2616 C  C   . ALA A 1 352 ? 16.981  32.146  27.320 1.00 55.59  ? 352 ALA A C   1 
ATOM   2617 O  O   . ALA A 1 352 ? 18.153  32.477  27.534 1.00 53.76  ? 352 ALA A O   1 
ATOM   2618 C  CB  . ALA A 1 352 ? 16.123  30.798  25.403 1.00 54.55  ? 352 ALA A CB  1 
ATOM   2619 N  N   . GLY A 1 353 ? 16.158  31.704  28.260 1.00 52.08  ? 353 GLY A N   1 
ATOM   2620 C  CA  . GLY A 1 353 ? 16.578  31.522  29.637 1.00 50.61  ? 353 GLY A CA  1 
ATOM   2621 C  C   . GLY A 1 353 ? 16.487  32.763  30.480 1.00 53.43  ? 353 GLY A C   1 
ATOM   2622 O  O   . GLY A 1 353 ? 15.612  33.610  30.265 1.00 53.44  ? 353 GLY A O   1 
ATOM   2623 N  N   . MET A 1 354 ? 17.432  32.873  31.423 1.00 48.50  ? 354 MET A N   1 
ATOM   2624 C  CA  . MET A 1 354 ? 17.477  33.916  32.434 1.00 48.54  ? 354 MET A CA  1 
ATOM   2625 C  C   . MET A 1 354 ? 18.857  34.523  32.713 1.00 47.06  ? 354 MET A C   1 
ATOM   2626 O  O   . MET A 1 354 ? 19.026  35.195  33.747 1.00 45.52  ? 354 MET A O   1 
ATOM   2627 C  CB  . MET A 1 354 ? 16.843  33.382  33.735 1.00 51.64  ? 354 MET A CB  1 
ATOM   2628 C  CG  . MET A 1 354 ? 17.485  32.096  34.259 1.00 54.94  ? 354 MET A CG  1 
ATOM   2629 S  SD  . MET A 1 354 ? 16.877  31.624  35.893 1.00 60.33  ? 354 MET A SD  1 
ATOM   2630 C  CE  . MET A 1 354 ? 15.166  31.375  35.509 1.00 58.53  ? 354 MET A CE  1 
ATOM   2631 N  N   . PHE A 1 355 ? 19.839  34.298  31.810 1.00 40.85  ? 355 PHE A N   1 
ATOM   2632 C  CA  . PHE A 1 355 ? 21.185  34.838  32.036 1.00 39.50  ? 355 PHE A CA  1 
ATOM   2633 C  C   . PHE A 1 355 ? 21.687  35.805  30.981 1.00 46.71  ? 355 PHE A C   1 
ATOM   2634 O  O   . PHE A 1 355 ? 21.428  35.607  29.788 1.00 49.29  ? 355 PHE A O   1 
ATOM   2635 C  CB  . PHE A 1 355 ? 22.223  33.728  32.279 1.00 38.94  ? 355 PHE A CB  1 
ATOM   2636 C  CG  . PHE A 1 355 ? 21.841  32.732  33.355 1.00 39.35  ? 355 PHE A CG  1 
ATOM   2637 C  CD1 . PHE A 1 355 ? 21.690  33.134  34.679 1.00 41.30  ? 355 PHE A CD1 1 
ATOM   2638 C  CD2 . PHE A 1 355 ? 21.640  31.385  33.043 1.00 40.22  ? 355 PHE A CD2 1 
ATOM   2639 C  CE1 . PHE A 1 355 ? 21.331  32.214  35.662 1.00 41.48  ? 355 PHE A CE1 1 
ATOM   2640 C  CE2 . PHE A 1 355 ? 21.280  30.465  34.034 1.00 41.58  ? 355 PHE A CE2 1 
ATOM   2641 C  CZ  . PHE A 1 355 ? 21.136  30.882  35.334 1.00 39.83  ? 355 PHE A CZ  1 
ATOM   2642 N  N   . LEU A 1 356 ? 22.408  36.866  31.429 1.00 40.92  ? 356 LEU A N   1 
ATOM   2643 C  CA  . LEU A 1 356 ? 23.110  37.811  30.567 1.00 39.63  ? 356 LEU A CA  1 
ATOM   2644 C  C   . LEU A 1 356 ? 24.610  37.552  30.800 1.00 40.45  ? 356 LEU A C   1 
ATOM   2645 O  O   . LEU A 1 356 ? 25.073  37.554  31.950 1.00 38.71  ? 356 LEU A O   1 
ATOM   2646 C  CB  . LEU A 1 356 ? 22.734  39.271  30.848 1.00 40.74  ? 356 LEU A CB  1 
ATOM   2647 C  CG  . LEU A 1 356 ? 23.547  40.337  30.073 1.00 46.12  ? 356 LEU A CG  1 
ATOM   2648 C  CD1 . LEU A 1 356 ? 23.190  40.374  28.587 1.00 46.37  ? 356 LEU A CD1 1 
ATOM   2649 C  CD2 . LEU A 1 356 ? 23.368  41.692  30.679 1.00 50.84  ? 356 LEU A CD2 1 
ATOM   2650 N  N   . TRP A 1 357 ? 25.336  37.237  29.714 1.00 36.55  ? 357 TRP A N   1 
ATOM   2651 C  CA  . TRP A 1 357 ? 26.757  36.909  29.740 1.00 36.20  ? 357 TRP A CA  1 
ATOM   2652 C  C   . TRP A 1 357 ? 27.549  38.088  29.186 1.00 41.23  ? 357 TRP A C   1 
ATOM   2653 O  O   . TRP A 1 357 ? 27.464  38.375  27.983 1.00 42.62  ? 357 TRP A O   1 
ATOM   2654 C  CB  . TRP A 1 357 ? 26.976  35.609  28.963 1.00 34.66  ? 357 TRP A CB  1 
ATOM   2655 C  CG  . TRP A 1 357 ? 28.382  35.088  28.849 1.00 35.68  ? 357 TRP A CG  1 
ATOM   2656 C  CD1 . TRP A 1 357 ? 29.097  34.950  27.697 1.00 39.03  ? 357 TRP A CD1 1 
ATOM   2657 C  CD2 . TRP A 1 357 ? 29.167  34.464  29.882 1.00 34.90  ? 357 TRP A CD2 1 
ATOM   2658 N  NE1 . TRP A 1 357 ? 30.276  34.287  27.945 1.00 38.03  ? 357 TRP A NE1 1 
ATOM   2659 C  CE2 . TRP A 1 357 ? 30.348  33.982  29.279 1.00 38.49  ? 357 TRP A CE2 1 
ATOM   2660 C  CE3 . TRP A 1 357 ? 29.007  34.302  31.270 1.00 35.87  ? 357 TRP A CE3 1 
ATOM   2661 C  CZ2 . TRP A 1 357 ? 31.358  33.346  30.009 1.00 37.00  ? 357 TRP A CZ2 1 
ATOM   2662 C  CZ3 . TRP A 1 357 ? 30.026  33.699  31.997 1.00 36.50  ? 357 TRP A CZ3 1 
ATOM   2663 C  CH2 . TRP A 1 357 ? 31.178  33.222  31.366 1.00 36.90  ? 357 TRP A CH2 1 
ATOM   2664 N  N   . ILE A 1 358 ? 28.303  38.773  30.093 1.00 36.53  ? 358 ILE A N   1 
ATOM   2665 C  CA  . ILE A 1 358 ? 29.075  40.014  29.904 1.00 36.92  ? 358 ILE A CA  1 
ATOM   2666 C  C   . ILE A 1 358 ? 30.618  39.844  29.782 1.00 41.02  ? 358 ILE A C   1 
ATOM   2667 O  O   . ILE A 1 358 ? 31.224  39.283  30.701 1.00 41.10  ? 358 ILE A O   1 
ATOM   2668 C  CB  . ILE A 1 358 ? 28.713  40.937  31.102 1.00 40.41  ? 358 ILE A CB  1 
ATOM   2669 C  CG1 . ILE A 1 358 ? 27.201  41.314  31.106 1.00 41.28  ? 358 ILE A CG1 1 
ATOM   2670 C  CG2 . ILE A 1 358 ? 29.629  42.171  31.186 1.00 42.00  ? 358 ILE A CG2 1 
ATOM   2671 C  CD1 . ILE A 1 358 ? 26.615  41.570  32.491 1.00 46.53  ? 358 ILE A CD1 1 
ATOM   2672 N  N   . LYS A 1 359 ? 31.257  40.387  28.687 1.00 36.14  ? 359 LYS A N   1 
ATOM   2673 C  CA  . LYS A 1 359 ? 32.726  40.355  28.526 1.00 34.39  ? 359 LYS A CA  1 
ATOM   2674 C  C   . LYS A 1 359 ? 33.264  41.713  28.866 1.00 40.56  ? 359 LYS A C   1 
ATOM   2675 O  O   . LYS A 1 359 ? 33.132  42.618  28.062 1.00 42.18  ? 359 LYS A O   1 
ATOM   2676 C  CB  . LYS A 1 359 ? 33.195  39.980  27.115 1.00 34.38  ? 359 LYS A CB  1 
ATOM   2677 C  CG  . LYS A 1 359 ? 34.714  39.768  27.081 1.00 35.52  ? 359 LYS A CG  1 
ATOM   2678 C  CD  . LYS A 1 359 ? 35.271  39.508  25.683 1.00 50.55  ? 359 LYS A CD  1 
ATOM   2679 C  CE  . LYS A 1 359 ? 36.772  39.259  25.673 1.00 65.48  ? 359 LYS A CE  1 
ATOM   2680 N  NZ  . LYS A 1 359 ? 37.277  38.853  24.324 1.00 74.31  ? 359 LYS A NZ  1 
ATOM   2681 N  N   . VAL A 1 360 ? 33.876  41.854  30.042 1.00 37.55  ? 360 VAL A N   1 
ATOM   2682 C  CA  . VAL A 1 360 ? 34.441  43.101  30.560 1.00 38.03  ? 360 VAL A CA  1 
ATOM   2683 C  C   . VAL A 1 360 ? 35.671  43.433  29.747 1.00 43.22  ? 360 VAL A C   1 
ATOM   2684 O  O   . VAL A 1 360 ? 36.647  42.666  29.740 1.00 42.76  ? 360 VAL A O   1 
ATOM   2685 C  CB  . VAL A 1 360 ? 34.758  43.001  32.068 1.00 41.59  ? 360 VAL A CB  1 
ATOM   2686 C  CG1 . VAL A 1 360 ? 35.135  44.358  32.629 1.00 42.63  ? 360 VAL A CG1 1 
ATOM   2687 C  CG2 . VAL A 1 360 ? 33.587  42.404  32.847 1.00 40.77  ? 360 VAL A CG2 1 
ATOM   2688 N  N   . LYS A 1 361 ? 35.586  44.551  29.014 1.00 41.38  ? 361 LYS A N   1 
ATOM   2689 C  CA  . LYS A 1 361 ? 36.637  45.031  28.125 1.00 42.36  ? 361 LYS A CA  1 
ATOM   2690 C  C   . LYS A 1 361 ? 37.815  45.555  28.922 1.00 50.60  ? 361 LYS A C   1 
ATOM   2691 O  O   . LYS A 1 361 ? 37.630  46.320  29.874 1.00 51.78  ? 361 LYS A O   1 
ATOM   2692 C  CB  . LYS A 1 361 ? 36.123  46.175  27.236 1.00 44.99  ? 361 LYS A CB  1 
ATOM   2693 C  CG  . LYS A 1 361 ? 35.209  45.813  26.078 1.00 52.34  ? 361 LYS A CG  1 
ATOM   2694 C  CD  . LYS A 1 361 ? 35.236  46.973  25.056 1.00 59.28  ? 361 LYS A CD  1 
ATOM   2695 C  CE  . LYS A 1 361 ? 34.139  46.901  24.022 1.00 66.23  ? 361 LYS A CE  1 
ATOM   2696 N  NZ  . LYS A 1 361 ? 34.481  47.659  22.791 1.00 70.53  ? 361 LYS A NZ  1 
ATOM   2697 N  N   . GLY A 1 362 ? 39.013  45.192  28.488 1.00 49.42  ? 362 GLY A N   1 
ATOM   2698 C  CA  . GLY A 1 362 ? 40.255  45.703  29.062 1.00 51.21  ? 362 GLY A CA  1 
ATOM   2699 C  C   . GLY A 1 362 ? 40.668  45.143  30.400 1.00 56.63  ? 362 GLY A C   1 
ATOM   2700 O  O   . GLY A 1 362 ? 41.397  45.804  31.154 1.00 57.70  ? 362 GLY A O   1 
ATOM   2701 N  N   . ILE A 1 363 ? 40.239  43.913  30.680 1.00 52.01  ? 363 ILE A N   1 
ATOM   2702 C  CA  . ILE A 1 363 ? 40.557  43.233  31.917 1.00 51.54  ? 363 ILE A CA  1 
ATOM   2703 C  C   . ILE A 1 363 ? 40.696  41.743  31.643 1.00 57.65  ? 363 ILE A C   1 
ATOM   2704 O  O   . ILE A 1 363 ? 39.871  41.180  30.917 1.00 57.23  ? 363 ILE A O   1 
ATOM   2705 C  CB  . ILE A 1 363 ? 39.540  43.632  33.028 1.00 53.94  ? 363 ILE A CB  1 
ATOM   2706 C  CG1 . ILE A 1 363 ? 40.250  44.048  34.318 1.00 54.95  ? 363 ILE A CG1 1 
ATOM   2707 C  CG2 . ILE A 1 363 ? 38.412  42.631  33.263 1.00 53.06  ? 363 ILE A CG2 1 
ATOM   2708 C  CD1 . ILE A 1 363 ? 40.880  45.475  34.258 1.00 65.41  ? 363 ILE A CD1 1 
ATOM   2709 N  N   . ASN A 1 364 ? 41.782  41.126  32.150 1.00 55.50  ? 364 ASN A N   1 
ATOM   2710 C  CA  . ASN A 1 364 ? 42.072  39.703  31.931 1.00 54.91  ? 364 ASN A CA  1 
ATOM   2711 C  C   . ASN A 1 364 ? 41.245  38.827  32.871 1.00 58.41  ? 364 ASN A C   1 
ATOM   2712 O  O   . ASN A 1 364 ? 40.703  37.806  32.449 1.00 56.92  ? 364 ASN A O   1 
ATOM   2713 C  CB  . ASN A 1 364 ? 43.574  39.396  32.108 1.00 54.96  ? 364 ASN A CB  1 
ATOM   2714 C  CG  . ASN A 1 364 ? 44.510  40.420  31.538 1.00 79.88  ? 364 ASN A CG  1 
ATOM   2715 O  OD1 . ASN A 1 364 ? 44.494  40.723  30.335 1.00 69.45  ? 364 ASN A OD1 1 
ATOM   2716 N  ND2 . ASN A 1 364 ? 45.358  40.966  32.402 1.00 79.16  ? 364 ASN A ND2 1 
ATOM   2717 N  N   . ASP A 1 365 ? 41.196  39.211  34.153 1.00 55.56  ? 365 ASP A N   1 
ATOM   2718 C  CA  . ASP A 1 365 ? 40.464  38.499  35.187 1.00 54.79  ? 365 ASP A CA  1 
ATOM   2719 C  C   . ASP A 1 365 ? 39.521  39.458  35.884 1.00 60.56  ? 365 ASP A C   1 
ATOM   2720 O  O   . ASP A 1 365 ? 39.896  40.587  36.217 1.00 61.67  ? 365 ASP A O   1 
ATOM   2721 C  CB  . ASP A 1 365 ? 41.420  37.854  36.196 1.00 56.49  ? 365 ASP A CB  1 
ATOM   2722 C  CG  . ASP A 1 365 ? 40.696  37.184  37.337 1.00 66.75  ? 365 ASP A CG  1 
ATOM   2723 O  OD1 . ASP A 1 365 ? 40.612  37.803  38.439 1.00 67.20  ? 365 ASP A OD1 1 
ATOM   2724 O  OD2 . ASP A 1 365 ? 40.134  36.085  37.114 1.00 73.74  ? 365 ASP A OD2 1 
ATOM   2725 N  N   . VAL A 1 366 ? 38.298  38.989  36.118 1.00 56.33  ? 366 VAL A N   1 
ATOM   2726 C  CA  . VAL A 1 366 ? 37.253  39.774  36.737 1.00 55.63  ? 366 VAL A CA  1 
ATOM   2727 C  C   . VAL A 1 366 ? 36.870  39.294  38.141 1.00 58.09  ? 366 VAL A C   1 
ATOM   2728 O  O   . VAL A 1 366 ? 36.356  40.090  38.913 1.00 57.82  ? 366 VAL A O   1 
ATOM   2729 C  CB  . VAL A 1 366 ? 36.060  39.901  35.758 1.00 59.28  ? 366 VAL A CB  1 
ATOM   2730 C  CG1 . VAL A 1 366 ? 34.977  38.853  36.014 1.00 57.92  ? 366 VAL A CG1 1 
ATOM   2731 C  CG2 . VAL A 1 366 ? 35.488  41.301  35.797 1.00 60.31  ? 366 VAL A CG2 1 
ATOM   2732 N  N   . LYS A 1 367 ? 37.114  38.005  38.462 1.00 54.41  ? 367 LYS A N   1 
ATOM   2733 C  CA  . LYS A 1 367 ? 36.787  37.365  39.738 1.00 54.53  ? 367 LYS A CA  1 
ATOM   2734 C  C   . LYS A 1 367 ? 37.097  38.272  40.925 1.00 62.12  ? 367 LYS A C   1 
ATOM   2735 O  O   . LYS A 1 367 ? 36.245  38.428  41.799 1.00 61.10  ? 367 LYS A O   1 
ATOM   2736 C  CB  . LYS A 1 367 ? 37.516  36.012  39.860 1.00 56.60  ? 367 LYS A CB  1 
ATOM   2737 C  CG  . LYS A 1 367 ? 37.137  35.173  41.089 1.00 68.62  ? 367 LYS A CG  1 
ATOM   2738 C  CD  . LYS A 1 367 ? 38.020  33.931  41.254 1.00 75.55  ? 367 LYS A CD  1 
ATOM   2739 C  CE  . LYS A 1 367 ? 39.158  34.107  42.237 1.00 86.57  ? 367 LYS A CE  1 
ATOM   2740 N  NZ  . LYS A 1 367 ? 40.300  34.867  41.661 1.00 97.38  ? 367 LYS A NZ  1 
ATOM   2741 N  N   . GLU A 1 368 ? 38.297  38.902  40.921 1.00 62.44  ? 368 GLU A N   1 
ATOM   2742 C  CA  . GLU A 1 368 ? 38.778  39.846  41.934 1.00 64.16  ? 368 GLU A CA  1 
ATOM   2743 C  C   . GLU A 1 368 ? 37.730  40.945  42.170 1.00 67.73  ? 368 GLU A C   1 
ATOM   2744 O  O   . GLU A 1 368 ? 37.116  40.952  43.238 1.00 66.27  ? 368 GLU A O   1 
ATOM   2745 C  CB  . GLU A 1 368 ? 40.157  40.422  41.509 1.00 67.16  ? 368 GLU A CB  1 
ATOM   2746 C  CG  . GLU A 1 368 ? 40.657  41.653  42.267 1.00 85.89  ? 368 GLU A CG  1 
ATOM   2747 C  CD  . GLU A 1 368 ? 41.228  41.461  43.662 1.00 118.84 ? 368 GLU A CD  1 
ATOM   2748 O  OE1 . GLU A 1 368 ? 42.388  41.880  43.887 1.00 122.40 ? 368 GLU A OE1 1 
ATOM   2749 O  OE2 . GLU A 1 368 ? 40.497  40.959  44.546 1.00 116.16 ? 368 GLU A OE2 1 
ATOM   2750 N  N   . LEU A 1 369 ? 37.459  41.798  41.134 1.00 65.27  ? 369 LEU A N   1 
ATOM   2751 C  CA  . LEU A 1 369 ? 36.490  42.908  41.172 1.00 65.48  ? 369 LEU A CA  1 
ATOM   2752 C  C   . LEU A 1 369 ? 34.992  42.507  41.200 1.00 70.89  ? 369 LEU A C   1 
ATOM   2753 O  O   . LEU A 1 369 ? 34.136  43.207  40.651 1.00 71.55  ? 369 LEU A O   1 
ATOM   2754 C  CB  . LEU A 1 369 ? 36.808  43.993  40.120 1.00 65.68  ? 369 LEU A CB  1 
ATOM   2755 C  CG  . LEU A 1 369 ? 36.671  43.640  38.647 1.00 68.30  ? 369 LEU A CG  1 
ATOM   2756 C  CD1 . LEU A 1 369 ? 35.423  44.259  38.058 1.00 67.73  ? 369 LEU A CD1 1 
ATOM   2757 C  CD2 . LEU A 1 369 ? 37.875  44.130  37.879 1.00 70.63  ? 369 LEU A CD2 1 
ATOM   2758 N  N   . ILE A 1 370 ? 34.692  41.387  41.877 1.00 67.38  ? 370 ILE A N   1 
ATOM   2759 C  CA  . ILE A 1 370 ? 33.364  40.813  42.056 1.00 66.81  ? 370 ILE A CA  1 
ATOM   2760 C  C   . ILE A 1 370 ? 33.238  40.427  43.523 1.00 72.80  ? 370 ILE A C   1 
ATOM   2761 O  O   . ILE A 1 370 ? 32.586  41.135  44.289 1.00 73.89  ? 370 ILE A O   1 
ATOM   2762 C  CB  . ILE A 1 370 ? 33.122  39.636  41.056 1.00 68.65  ? 370 ILE A CB  1 
ATOM   2763 C  CG1 . ILE A 1 370 ? 32.807  40.150  39.644 1.00 69.41  ? 370 ILE A CG1 1 
ATOM   2764 C  CG2 . ILE A 1 370 ? 32.052  38.651  41.530 1.00 68.83  ? 370 ILE A CG2 1 
ATOM   2765 C  CD1 . ILE A 1 370 ? 31.613  41.174  39.546 1.00 83.46  ? 370 ILE A CD1 1 
ATOM   2766 N  N   . GLU A 1 371 ? 33.944  39.357  43.925 1.00 69.37  ? 371 GLU A N   1 
ATOM   2767 C  CA  . GLU A 1 371 ? 33.957  38.829  45.286 1.00 69.42  ? 371 GLU A CA  1 
ATOM   2768 C  C   . GLU A 1 371 ? 34.877  39.628  46.240 1.00 75.85  ? 371 GLU A C   1 
ATOM   2769 O  O   . GLU A 1 371 ? 35.130  39.181  47.361 1.00 76.73  ? 371 GLU A O   1 
ATOM   2770 C  CB  . GLU A 1 371 ? 34.284  37.316  45.275 1.00 69.51  ? 371 GLU A CB  1 
ATOM   2771 C  CG  . GLU A 1 371 ? 35.597  36.967  44.594 1.00 77.44  ? 371 GLU A CG  1 
ATOM   2772 C  CD  . GLU A 1 371 ? 35.932  35.494  44.484 1.00 87.51  ? 371 GLU A CD  1 
ATOM   2773 O  OE1 . GLU A 1 371 ? 35.167  34.745  43.831 1.00 45.81  ? 371 GLU A OE1 1 
ATOM   2774 O  OE2 . GLU A 1 371 ? 37.005  35.105  44.999 1.00 91.09  ? 371 GLU A OE2 1 
ATOM   2775 N  N   . GLU A 1 372 ? 35.335  40.816  45.820 1.00 73.01  ? 372 GLU A N   1 
ATOM   2776 C  CA  . GLU A 1 372 ? 36.205  41.647  46.642 1.00 74.64  ? 372 GLU A CA  1 
ATOM   2777 C  C   . GLU A 1 372 ? 35.891  43.133  46.443 1.00 80.50  ? 372 GLU A C   1 
ATOM   2778 O  O   . GLU A 1 372 ? 36.026  43.915  47.392 1.00 81.69  ? 372 GLU A O   1 
ATOM   2779 C  CB  . GLU A 1 372 ? 37.698  41.319  46.376 1.00 76.22  ? 372 GLU A CB  1 
ATOM   2780 C  CG  . GLU A 1 372 ? 38.679  41.835  47.423 1.00 89.99  ? 372 GLU A CG  1 
ATOM   2781 C  CD  . GLU A 1 372 ? 39.592  40.785  48.035 1.00 114.35 ? 372 GLU A CD  1 
ATOM   2782 O  OE1 . GLU A 1 372 ? 40.584  40.402  47.373 1.00 110.19 ? 372 GLU A OE1 1 
ATOM   2783 O  OE2 . GLU A 1 372 ? 39.332  40.367  49.188 1.00 107.18 ? 372 GLU A OE2 1 
ATOM   2784 N  N   . LYS A 1 373 ? 35.475  43.526  45.222 1.00 76.15  ? 373 LYS A N   1 
ATOM   2785 C  CA  . LYS A 1 373 ? 35.142  44.922  44.927 1.00 76.23  ? 373 LYS A CA  1 
ATOM   2786 C  C   . LYS A 1 373 ? 33.627  45.140  44.814 1.00 77.97  ? 373 LYS A C   1 
ATOM   2787 O  O   . LYS A 1 373 ? 33.103  46.033  45.490 1.00 77.60  ? 373 LYS A O   1 
ATOM   2788 C  CB  . LYS A 1 373 ? 35.893  45.430  43.686 1.00 78.44  ? 373 LYS A CB  1 
ATOM   2789 N  N   . ALA A 1 374 ? 32.926  44.292  44.006 1.00 72.06  ? 374 ALA A N   1 
ATOM   2790 C  CA  . ALA A 1 374 ? 31.481  44.368  43.762 1.00 71.10  ? 374 ALA A CA  1 
ATOM   2791 C  C   . ALA A 1 374 ? 30.602  44.055  44.950 1.00 74.45  ? 374 ALA A C   1 
ATOM   2792 O  O   . ALA A 1 374 ? 29.601  44.741  45.143 1.00 75.08  ? 374 ALA A O   1 
ATOM   2793 C  CB  . ALA A 1 374 ? 31.084  43.505  42.578 1.00 70.66  ? 374 ALA A CB  1 
ATOM   2794 N  N   . VAL A 1 375 ? 30.935  43.005  45.715 1.00 69.78  ? 375 VAL A N   1 
ATOM   2795 C  CA  . VAL A 1 375 ? 30.163  42.569  46.885 1.00 69.41  ? 375 VAL A CA  1 
ATOM   2796 C  C   . VAL A 1 375 ? 30.057  43.641  47.967 1.00 74.21  ? 375 VAL A C   1 
ATOM   2797 O  O   . VAL A 1 375 ? 28.953  43.916  48.437 1.00 74.05  ? 375 VAL A O   1 
ATOM   2798 C  CB  . VAL A 1 375 ? 30.645  41.217  47.442 1.00 72.25  ? 375 VAL A CB  1 
ATOM   2799 C  CG1 . VAL A 1 375 ? 30.224  40.066  46.530 1.00 70.29  ? 375 VAL A CG1 1 
ATOM   2800 C  CG2 . VAL A 1 375 ? 32.158  41.226  47.675 1.00 72.40  ? 375 VAL A CG2 1 
ATOM   2801 N  N   . LYS A 1 376 ? 31.194  44.293  48.304 1.00 71.74  ? 376 LYS A N   1 
ATOM   2802 C  CA  . LYS A 1 376 ? 31.292  45.380  49.284 1.00 73.19  ? 376 LYS A CA  1 
ATOM   2803 C  C   . LYS A 1 376 ? 30.419  46.566  48.860 1.00 79.73  ? 376 LYS A C   1 
ATOM   2804 O  O   . LYS A 1 376 ? 30.175  47.484  49.651 1.00 82.45  ? 376 LYS A O   1 
ATOM   2805 C  CB  . LYS A 1 376 ? 32.756  45.825  49.446 1.00 75.68  ? 376 LYS A CB  1 
ATOM   2806 N  N   . MET A 1 377 ? 29.941  46.533  47.614 1.00 74.48  ? 377 MET A N   1 
ATOM   2807 C  CA  . MET A 1 377 ? 29.092  47.571  47.049 1.00 74.72  ? 377 MET A CA  1 
ATOM   2808 C  C   . MET A 1 377 ? 27.645  47.076  46.953 1.00 77.38  ? 377 MET A C   1 
ATOM   2809 O  O   . MET A 1 377 ? 26.833  47.629  46.214 1.00 76.99  ? 377 MET A O   1 
ATOM   2810 C  CB  . MET A 1 377 ? 29.634  47.990  45.680 1.00 76.70  ? 377 MET A CB  1 
ATOM   2811 C  CG  . MET A 1 377 ? 31.092  48.330  45.690 1.00 80.15  ? 377 MET A CG  1 
ATOM   2812 S  SD  . MET A 1 377 ? 31.373  50.085  45.864 1.00 85.86  ? 377 MET A SD  1 
ATOM   2813 C  CE  . MET A 1 377 ? 31.441  50.564  44.145 1.00 82.29  ? 377 MET A CE  1 
ATOM   2814 N  N   . GLY A 1 378 ? 27.341  46.026  47.698 1.00 73.78  ? 378 GLY A N   1 
ATOM   2815 C  CA  . GLY A 1 378 ? 26.005  45.452  47.741 1.00 74.23  ? 378 GLY A CA  1 
ATOM   2816 C  C   . GLY A 1 378 ? 25.484  44.863  46.449 1.00 79.14  ? 378 GLY A C   1 
ATOM   2817 O  O   . GLY A 1 378 ? 24.279  44.621  46.336 1.00 79.55  ? 378 GLY A O   1 
ATOM   2818 N  N   . VAL A 1 379 ? 26.382  44.636  45.460 1.00 75.12  ? 379 VAL A N   1 
ATOM   2819 C  CA  . VAL A 1 379 ? 26.043  44.076  44.146 1.00 74.05  ? 379 VAL A CA  1 
ATOM   2820 C  C   . VAL A 1 379 ? 26.826  42.792  43.943 1.00 75.76  ? 379 VAL A C   1 
ATOM   2821 O  O   . VAL A 1 379 ? 28.052  42.798  44.037 1.00 76.05  ? 379 VAL A O   1 
ATOM   2822 C  CB  . VAL A 1 379 ? 26.292  45.077  42.977 1.00 78.88  ? 379 VAL A CB  1 
ATOM   2823 C  CG1 . VAL A 1 379 ? 25.845  44.498  41.637 1.00 77.73  ? 379 VAL A CG1 1 
ATOM   2824 C  CG2 . VAL A 1 379 ? 25.600  46.411  43.227 1.00 80.78  ? 379 VAL A CG2 1 
ATOM   2825 N  N   . LEU A 1 380 ? 26.138  41.696  43.641 1.00 69.44  ? 380 LEU A N   1 
ATOM   2826 C  CA  . LEU A 1 380 ? 26.854  40.455  43.402 1.00 66.77  ? 380 LEU A CA  1 
ATOM   2827 C  C   . LEU A 1 380 ? 26.296  39.681  42.249 1.00 65.54  ? 380 LEU A C   1 
ATOM   2828 O  O   . LEU A 1 380 ? 25.089  39.418  42.195 1.00 65.28  ? 380 LEU A O   1 
ATOM   2829 C  CB  . LEU A 1 380 ? 26.971  39.584  44.662 1.00 66.94  ? 380 LEU A CB  1 
ATOM   2830 C  CG  . LEU A 1 380 ? 25.669  39.210  45.389 1.00 72.89  ? 380 LEU A CG  1 
ATOM   2831 C  CD1 . LEU A 1 380 ? 25.605  37.721  45.692 1.00 71.80  ? 380 LEU A CD1 1 
ATOM   2832 C  CD2 . LEU A 1 380 ? 25.491  40.035  46.653 1.00 77.97  ? 380 LEU A CD2 1 
ATOM   2833 N  N   . MET A 1 381 ? 27.194  39.344  41.309 1.00 57.81  ? 381 MET A N   1 
ATOM   2834 C  CA  . MET A 1 381 ? 26.955  38.513  40.124 1.00 54.59  ? 381 MET A CA  1 
ATOM   2835 C  C   . MET A 1 381 ? 28.179  37.579  39.918 1.00 55.13  ? 381 MET A C   1 
ATOM   2836 O  O   . MET A 1 381 ? 29.322  38.022  40.113 1.00 55.90  ? 381 MET A O   1 
ATOM   2837 C  CB  . MET A 1 381 ? 26.579  39.344  38.867 1.00 56.61  ? 381 MET A CB  1 
ATOM   2838 C  CG  . MET A 1 381 ? 27.679  40.253  38.356 1.00 59.72  ? 381 MET A CG  1 
ATOM   2839 S  SD  . MET A 1 381 ? 27.220  42.000  38.365 1.00 64.69  ? 381 MET A SD  1 
ATOM   2840 C  CE  . MET A 1 381 ? 26.796  42.242  36.655 1.00 61.24  ? 381 MET A CE  1 
ATOM   2841 N  N   . LEU A 1 382 ? 27.921  36.288  39.573 1.00 45.89  ? 382 LEU A N   1 
ATOM   2842 C  CA  . LEU A 1 382 ? 28.898  35.219  39.344 1.00 42.36  ? 382 LEU A CA  1 
ATOM   2843 C  C   . LEU A 1 382 ? 30.049  35.441  38.330 1.00 44.09  ? 382 LEU A C   1 
ATOM   2844 O  O   . LEU A 1 382 ? 29.782  35.625  37.129 1.00 43.51  ? 382 LEU A O   1 
ATOM   2845 C  CB  . LEU A 1 382 ? 28.147  33.957  38.907 1.00 41.31  ? 382 LEU A CB  1 
ATOM   2846 C  CG  . LEU A 1 382 ? 27.881  32.885  39.921 1.00 44.96  ? 382 LEU A CG  1 
ATOM   2847 C  CD1 . LEU A 1 382 ? 29.112  32.566  40.746 1.00 44.99  ? 382 LEU A CD1 1 
ATOM   2848 C  CD2 . LEU A 1 382 ? 26.717  33.236  40.786 1.00 47.68  ? 382 LEU A CD2 1 
ATOM   2849 N  N   . PRO A 1 383 ? 31.330  35.283  38.761 1.00 39.50  ? 383 PRO A N   1 
ATOM   2850 C  CA  . PRO A 1 383 ? 32.450  35.331  37.804 1.00 39.87  ? 383 PRO A CA  1 
ATOM   2851 C  C   . PRO A 1 383 ? 32.427  34.109  36.876 1.00 46.56  ? 383 PRO A C   1 
ATOM   2852 O  O   . PRO A 1 383 ? 32.055  33.006  37.306 1.00 46.91  ? 383 PRO A O   1 
ATOM   2853 C  CB  . PRO A 1 383 ? 33.691  35.266  38.707 1.00 41.35  ? 383 PRO A CB  1 
ATOM   2854 C  CG  . PRO A 1 383 ? 33.217  35.582  40.056 1.00 45.34  ? 383 PRO A CG  1 
ATOM   2855 C  CD  . PRO A 1 383 ? 31.830  35.058  40.126 1.00 40.68  ? 383 PRO A CD  1 
ATOM   2856 N  N   . GLY A 1 384 ? 32.852  34.321  35.628 1.00 44.34  ? 384 GLY A N   1 
ATOM   2857 C  CA  . GLY A 1 384 ? 32.887  33.328  34.552 1.00 43.56  ? 384 GLY A CA  1 
ATOM   2858 C  C   . GLY A 1 384 ? 33.690  32.063  34.791 1.00 46.39  ? 384 GLY A C   1 
ATOM   2859 O  O   . GLY A 1 384 ? 33.346  31.014  34.240 1.00 44.91  ? 384 GLY A O   1 
ATOM   2860 N  N   . ASN A 1 385 ? 34.766  32.144  35.615 1.00 43.23  ? 385 ASN A N   1 
ATOM   2861 C  CA  . ASN A 1 385 ? 35.656  31.019  35.974 1.00 42.37  ? 385 ASN A CA  1 
ATOM   2862 C  C   . ASN A 1 385 ? 34.894  29.707  36.169 1.00 43.06  ? 385 ASN A C   1 
ATOM   2863 O  O   . ASN A 1 385 ? 35.302  28.674  35.638 1.00 41.29  ? 385 ASN A O   1 
ATOM   2864 C  CB  . ASN A 1 385 ? 36.446  31.349  37.248 1.00 44.46  ? 385 ASN A CB  1 
ATOM   2865 C  CG  . ASN A 1 385 ? 37.248  32.615  37.139 1.00 84.02  ? 385 ASN A CG  1 
ATOM   2866 O  OD1 . ASN A 1 385 ? 36.708  33.710  36.891 1.00 81.00  ? 385 ASN A OD1 1 
ATOM   2867 N  ND2 . ASN A 1 385 ? 38.559  32.489  37.310 1.00 80.78  ? 385 ASN A ND2 1 
ATOM   2868 N  N   . ALA A 1 386 ? 33.740  29.797  36.870 1.00 39.02  ? 386 ALA A N   1 
ATOM   2869 C  CA  . ALA A 1 386 ? 32.805  28.732  37.253 1.00 38.12  ? 386 ALA A CA  1 
ATOM   2870 C  C   . ALA A 1 386 ? 32.275  27.868  36.089 1.00 41.11  ? 386 ALA A C   1 
ATOM   2871 O  O   . ALA A 1 386 ? 31.831  26.724  36.277 1.00 38.48  ? 386 ALA A O   1 
ATOM   2872 C  CB  . ALA A 1 386 ? 31.641  29.352  38.010 1.00 38.74  ? 386 ALA A CB  1 
ATOM   2873 N  N   . PHE A 1 387 ? 32.350  28.422  34.893 1.00 38.61  ? 387 PHE A N   1 
ATOM   2874 C  CA  . PHE A 1 387 ? 31.802  27.827  33.690 1.00 38.07  ? 387 PHE A CA  1 
ATOM   2875 C  C   . PHE A 1 387 ? 32.869  27.289  32.754 1.00 38.99  ? 387 PHE A C   1 
ATOM   2876 O  O   . PHE A 1 387 ? 32.666  27.236  31.542 1.00 38.54  ? 387 PHE A O   1 
ATOM   2877 C  CB  . PHE A 1 387 ? 30.851  28.847  33.026 1.00 40.53  ? 387 PHE A CB  1 
ATOM   2878 C  CG  . PHE A 1 387 ? 29.880  29.425  34.036 1.00 42.24  ? 387 PHE A CG  1 
ATOM   2879 C  CD1 . PHE A 1 387 ? 30.216  30.547  34.788 1.00 46.27  ? 387 PHE A CD1 1 
ATOM   2880 C  CD2 . PHE A 1 387 ? 28.665  28.802  34.291 1.00 44.29  ? 387 PHE A CD2 1 
ATOM   2881 C  CE1 . PHE A 1 387 ? 29.339  31.058  35.746 1.00 47.67  ? 387 PHE A CE1 1 
ATOM   2882 C  CE2 . PHE A 1 387 ? 27.775  29.333  35.224 1.00 47.73  ? 387 PHE A CE2 1 
ATOM   2883 C  CZ  . PHE A 1 387 ? 28.126  30.447  35.959 1.00 46.51  ? 387 PHE A CZ  1 
ATOM   2884 N  N   . TYR A 1 388 ? 33.998  26.850  33.325 1.00 33.30  ? 388 TYR A N   1 
ATOM   2885 C  CA  . TYR A 1 388 ? 35.092  26.288  32.538 1.00 32.77  ? 388 TYR A CA  1 
ATOM   2886 C  C   . TYR A 1 388 ? 35.735  25.099  33.218 1.00 35.32  ? 388 TYR A C   1 
ATOM   2887 O  O   . TYR A 1 388 ? 35.820  25.072  34.450 1.00 34.75  ? 388 TYR A O   1 
ATOM   2888 C  CB  . TYR A 1 388 ? 36.154  27.353  32.207 1.00 33.85  ? 388 TYR A CB  1 
ATOM   2889 C  CG  . TYR A 1 388 ? 35.637  28.481  31.341 1.00 34.40  ? 388 TYR A CG  1 
ATOM   2890 C  CD1 . TYR A 1 388 ? 35.486  28.319  29.968 1.00 35.63  ? 388 TYR A CD1 1 
ATOM   2891 C  CD2 . TYR A 1 388 ? 35.312  29.718  31.893 1.00 35.76  ? 388 TYR A CD2 1 
ATOM   2892 C  CE1 . TYR A 1 388 ? 34.997  29.352  29.167 1.00 36.85  ? 388 TYR A CE1 1 
ATOM   2893 C  CE2 . TYR A 1 388 ? 34.825  30.758  31.103 1.00 37.48  ? 388 TYR A CE2 1 
ATOM   2894 C  CZ  . TYR A 1 388 ? 34.663  30.571  29.738 1.00 43.97  ? 388 TYR A CZ  1 
ATOM   2895 O  OH  . TYR A 1 388 ? 34.160  31.588  28.957 1.00 42.04  ? 388 TYR A OH  1 
ATOM   2896 N  N   . VAL A 1 389 ? 36.216  24.122  32.428 1.00 30.62  ? 389 VAL A N   1 
ATOM   2897 C  CA  . VAL A 1 389 ? 36.909  22.991  33.034 1.00 30.56  ? 389 VAL A CA  1 
ATOM   2898 C  C   . VAL A 1 389 ? 38.099  23.550  33.858 1.00 36.46  ? 389 VAL A C   1 
ATOM   2899 O  O   . VAL A 1 389 ? 38.186  23.313  35.076 1.00 35.73  ? 389 VAL A O   1 
ATOM   2900 C  CB  . VAL A 1 389 ? 37.332  21.918  32.017 1.00 33.85  ? 389 VAL A CB  1 
ATOM   2901 C  CG1 . VAL A 1 389 ? 38.164  20.833  32.694 1.00 33.54  ? 389 VAL A CG1 1 
ATOM   2902 C  CG2 . VAL A 1 389 ? 36.116  21.319  31.323 1.00 32.97  ? 389 VAL A CG2 1 
ATOM   2903 N  N   . ASP A 1 390 ? 38.935  24.385  33.213 1.00 33.59  ? 390 ASP A N   1 
ATOM   2904 C  CA  . ASP A 1 390 ? 40.028  25.025  33.926 1.00 33.39  ? 390 ASP A CA  1 
ATOM   2905 C  C   . ASP A 1 390 ? 39.539  26.281  34.640 1.00 37.95  ? 390 ASP A C   1 
ATOM   2906 O  O   . ASP A 1 390 ? 39.503  27.375  34.076 1.00 37.09  ? 390 ASP A O   1 
ATOM   2907 C  CB  . ASP A 1 390 ? 41.200  25.310  32.993 1.00 35.32  ? 390 ASP A CB  1 
ATOM   2908 C  CG  . ASP A 1 390 ? 42.444  25.789  33.702 1.00 33.08  ? 390 ASP A CG  1 
ATOM   2909 O  OD1 . ASP A 1 390 ? 43.281  26.438  33.041 1.00 33.49  ? 390 ASP A OD1 1 
ATOM   2910 O  OD2 . ASP A 1 390 ? 42.600  25.481  34.913 1.00 29.57  ? 390 ASP A OD2 1 
ATOM   2911 N  N   . SER A 1 391 ? 39.137  26.108  35.890 1.00 36.77  ? 391 SER A N   1 
ATOM   2912 C  CA  . SER A 1 391 ? 38.637  27.214  36.707 1.00 37.21  ? 391 SER A CA  1 
ATOM   2913 C  C   . SER A 1 391 ? 39.742  28.191  37.120 1.00 44.16  ? 391 SER A C   1 
ATOM   2914 O  O   . SER A 1 391 ? 39.440  29.361  37.362 1.00 45.17  ? 391 SER A O   1 
ATOM   2915 C  CB  . SER A 1 391 ? 37.850  26.700  37.907 1.00 38.80  ? 391 SER A CB  1 
ATOM   2916 O  OG  . SER A 1 391 ? 38.427  25.515  38.430 1.00 50.55  ? 391 SER A OG  1 
ATOM   2917 N  N   . SER A 1 392 ? 41.015  27.738  37.135 1.00 41.95  ? 392 SER A N   1 
ATOM   2918 C  CA  . SER A 1 392 ? 42.172  28.559  37.500 1.00 43.63  ? 392 SER A CA  1 
ATOM   2919 C  C   . SER A 1 392 ? 42.448  29.704  36.501 1.00 50.01  ? 392 SER A C   1 
ATOM   2920 O  O   . SER A 1 392 ? 42.687  30.852  36.920 1.00 51.34  ? 392 SER A O   1 
ATOM   2921 C  CB  . SER A 1 392 ? 43.412  27.691  37.676 1.00 48.21  ? 392 SER A CB  1 
ATOM   2922 O  OG  . SER A 1 392 ? 44.006  27.359  36.430 1.00 59.07  ? 392 SER A OG  1 
ATOM   2923 N  N   . ALA A 1 393 ? 42.416  29.375  35.183 1.00 45.72  ? 393 ALA A N   1 
ATOM   2924 C  CA  . ALA A 1 393 ? 42.632  30.295  34.069 1.00 45.58  ? 393 ALA A CA  1 
ATOM   2925 C  C   . ALA A 1 393 ? 41.720  31.530  34.192 1.00 51.17  ? 393 ALA A C   1 
ATOM   2926 O  O   . ALA A 1 393 ? 40.527  31.396  34.519 1.00 51.74  ? 393 ALA A O   1 
ATOM   2927 C  CB  . ALA A 1 393 ? 42.373  29.586  32.755 1.00 45.76  ? 393 ALA A CB  1 
ATOM   2928 N  N   . PRO A 1 394 ? 42.280  32.738  33.962 1.00 47.01  ? 394 PRO A N   1 
ATOM   2929 C  CA  . PRO A 1 394 ? 41.467  33.973  34.087 1.00 45.91  ? 394 PRO A CA  1 
ATOM   2930 C  C   . PRO A 1 394 ? 40.251  34.133  33.156 1.00 44.50  ? 394 PRO A C   1 
ATOM   2931 O  O   . PRO A 1 394 ? 40.308  33.765  31.980 1.00 42.74  ? 394 PRO A O   1 
ATOM   2932 C  CB  . PRO A 1 394 ? 42.485  35.102  33.812 1.00 49.19  ? 394 PRO A CB  1 
ATOM   2933 C  CG  . PRO A 1 394 ? 43.632  34.442  33.078 1.00 54.32  ? 394 PRO A CG  1 
ATOM   2934 C  CD  . PRO A 1 394 ? 43.685  33.034  33.593 1.00 49.30  ? 394 PRO A CD  1 
ATOM   2935 N  N   . SER A 1 395 ? 39.166  34.748  33.677 1.00 39.21  ? 395 SER A N   1 
ATOM   2936 C  CA  . SER A 1 395 ? 37.989  35.097  32.885 1.00 38.11  ? 395 SER A CA  1 
ATOM   2937 C  C   . SER A 1 395 ? 37.566  36.550  33.042 1.00 42.81  ? 395 SER A C   1 
ATOM   2938 O  O   . SER A 1 395 ? 37.304  37.014  34.158 1.00 42.44  ? 395 SER A O   1 
ATOM   2939 C  CB  . SER A 1 395 ? 36.793  34.207  33.178 1.00 40.23  ? 395 SER A CB  1 
ATOM   2940 O  OG  . SER A 1 395 ? 35.891  34.302  32.086 1.00 47.54  ? 395 SER A OG  1 
ATOM   2941 N  N   . PRO A 1 396 ? 37.392  37.254  31.902 1.00 39.71  ? 396 PRO A N   1 
ATOM   2942 C  CA  . PRO A 1 396 ? 36.863  38.627  31.956 1.00 40.49  ? 396 PRO A CA  1 
ATOM   2943 C  C   . PRO A 1 396 ? 35.322  38.599  31.949 1.00 45.70  ? 396 PRO A C   1 
ATOM   2944 O  O   . PRO A 1 396 ? 34.682  39.571  31.555 1.00 46.93  ? 396 PRO A O   1 
ATOM   2945 C  CB  . PRO A 1 396 ? 37.357  39.199  30.634 1.00 42.74  ? 396 PRO A CB  1 
ATOM   2946 C  CG  . PRO A 1 396 ? 37.281  38.025  29.695 1.00 45.77  ? 396 PRO A CG  1 
ATOM   2947 C  CD  . PRO A 1 396 ? 37.623  36.817  30.506 1.00 40.48  ? 396 PRO A CD  1 
ATOM   2948 N  N   . TYR A 1 397 ? 34.727  37.456  32.317 1.00 41.01  ? 397 TYR A N   1 
ATOM   2949 C  CA  . TYR A 1 397 ? 33.301  37.249  32.214 1.00 39.65  ? 397 TYR A CA  1 
ATOM   2950 C  C   . TYR A 1 397 ? 32.469  37.335  33.451 1.00 44.89  ? 397 TYR A C   1 
ATOM   2951 O  O   . TYR A 1 397 ? 32.910  37.030  34.561 1.00 45.50  ? 397 TYR A O   1 
ATOM   2952 C  CB  . TYR A 1 397 ? 33.003  35.978  31.453 1.00 39.06  ? 397 TYR A CB  1 
ATOM   2953 C  CG  . TYR A 1 397 ? 33.216  36.102  29.962 1.00 39.97  ? 397 TYR A CG  1 
ATOM   2954 C  CD1 . TYR A 1 397 ? 34.370  35.612  29.361 1.00 41.52  ? 397 TYR A CD1 1 
ATOM   2955 C  CD2 . TYR A 1 397 ? 32.236  36.652  29.140 1.00 40.57  ? 397 TYR A CD2 1 
ATOM   2956 C  CE1 . TYR A 1 397 ? 34.571  35.719  27.988 1.00 41.64  ? 397 TYR A CE1 1 
ATOM   2957 C  CE2 . TYR A 1 397 ? 32.396  36.697  27.757 1.00 41.51  ? 397 TYR A CE2 1 
ATOM   2958 C  CZ  . TYR A 1 397 ? 33.577  36.249  27.187 1.00 47.30  ? 397 TYR A CZ  1 
ATOM   2959 O  OH  . TYR A 1 397 ? 33.768  36.300  25.825 1.00 48.56  ? 397 TYR A OH  1 
ATOM   2960 N  N   . LEU A 1 398 ? 31.227  37.738  33.232 1.00 40.86  ? 398 LEU A N   1 
ATOM   2961 C  CA  . LEU A 1 398 ? 30.228  37.886  34.250 1.00 40.42  ? 398 LEU A CA  1 
ATOM   2962 C  C   . LEU A 1 398 ? 28.980  37.238  33.772 1.00 45.03  ? 398 LEU A C   1 
ATOM   2963 O  O   . LEU A 1 398 ? 28.691  37.249  32.574 1.00 44.38  ? 398 LEU A O   1 
ATOM   2964 C  CB  . LEU A 1 398 ? 29.954  39.368  34.456 1.00 41.73  ? 398 LEU A CB  1 
ATOM   2965 C  CG  . LEU A 1 398 ? 30.923  40.091  35.351 1.00 47.18  ? 398 LEU A CG  1 
ATOM   2966 C  CD1 . LEU A 1 398 ? 30.545  41.554  35.453 1.00 48.38  ? 398 LEU A CD1 1 
ATOM   2967 C  CD2 . LEU A 1 398 ? 31.001  39.417  36.725 1.00 48.41  ? 398 LEU A CD2 1 
ATOM   2968 N  N   . ARG A 1 399 ? 28.224  36.681  34.706 1.00 42.67  ? 399 ARG A N   1 
ATOM   2969 C  CA  . ARG A 1 399 ? 26.939  36.076  34.406 1.00 42.47  ? 399 ARG A CA  1 
ATOM   2970 C  C   . ARG A 1 399 ? 25.938  36.820  35.291 1.00 45.65  ? 399 ARG A C   1 
ATOM   2971 O  O   . ARG A 1 399 ? 26.012  36.707  36.523 1.00 45.40  ? 399 ARG A O   1 
ATOM   2972 C  CB  . ARG A 1 399 ? 26.963  34.560  34.695 1.00 42.48  ? 399 ARG A CB  1 
ATOM   2973 C  CG  . ARG A 1 399 ? 25.705  33.845  34.217 1.00 54.74  ? 399 ARG A CG  1 
ATOM   2974 C  CD  . ARG A 1 399 ? 25.469  32.512  34.897 1.00 57.43  ? 399 ARG A CD  1 
ATOM   2975 N  NE  . ARG A 1 399 ? 25.150  32.647  36.317 1.00 66.27  ? 399 ARG A NE  1 
ATOM   2976 C  CZ  . ARG A 1 399 ? 24.510  31.720  37.019 1.00 72.98  ? 399 ARG A CZ  1 
ATOM   2977 N  NH1 . ARG A 1 399 ? 24.096  30.604  36.434 1.00 58.90  ? 399 ARG A NH1 1 
ATOM   2978 N  NH2 . ARG A 1 399 ? 24.271  31.903  38.312 1.00 47.30  ? 399 ARG A NH2 1 
ATOM   2979 N  N   . ALA A 1 400 ? 25.075  37.647  34.666 1.00 40.98  ? 400 ALA A N   1 
ATOM   2980 C  CA  . ALA A 1 400 ? 24.048  38.422  35.364 1.00 41.70  ? 400 ALA A CA  1 
ATOM   2981 C  C   . ALA A 1 400 ? 22.677  37.798  35.147 1.00 46.32  ? 400 ALA A C   1 
ATOM   2982 O  O   . ALA A 1 400 ? 22.340  37.418  34.025 1.00 45.49  ? 400 ALA A O   1 
ATOM   2983 C  CB  . ALA A 1 400 ? 24.051  39.867  34.890 1.00 43.80  ? 400 ALA A CB  1 
ATOM   2984 N  N   . SER A 1 401 ? 21.888  37.684  36.220 1.00 44.91  ? 401 SER A N   1 
ATOM   2985 C  CA  . SER A 1 401 ? 20.567  37.055  36.165 1.00 45.99  ? 401 SER A CA  1 
ATOM   2986 C  C   . SER A 1 401 ? 19.421  38.047  36.204 1.00 51.28  ? 401 SER A C   1 
ATOM   2987 O  O   . SER A 1 401 ? 19.240  38.781  37.190 1.00 52.44  ? 401 SER A O   1 
ATOM   2988 C  CB  . SER A 1 401 ? 20.412  36.007  37.265 1.00 50.90  ? 401 SER A CB  1 
ATOM   2989 O  OG  . SER A 1 401 ? 19.236  35.244  37.051 1.00 65.55  ? 401 SER A OG  1 
ATOM   2990 N  N   . PHE A 1 402 ? 18.628  38.051  35.130 1.00 46.78  ? 402 PHE A N   1 
ATOM   2991 C  CA  . PHE A 1 402 ? 17.475  38.934  35.031 1.00 46.91  ? 402 PHE A CA  1 
ATOM   2992 C  C   . PHE A 1 402 ? 16.233  38.264  35.594 1.00 53.99  ? 402 PHE A C   1 
ATOM   2993 O  O   . PHE A 1 402 ? 15.138  38.815  35.492 1.00 55.71  ? 402 PHE A O   1 
ATOM   2994 C  CB  . PHE A 1 402 ? 17.266  39.448  33.597 1.00 47.97  ? 402 PHE A CB  1 
ATOM   2995 C  CG  . PHE A 1 402 ? 17.269  38.439  32.475 1.00 47.06  ? 402 PHE A CG  1 
ATOM   2996 C  CD1 . PHE A 1 402 ? 16.105  37.769  32.118 1.00 49.38  ? 402 PHE A CD1 1 
ATOM   2997 C  CD2 . PHE A 1 402 ? 18.414  38.224  31.718 1.00 46.63  ? 402 PHE A CD2 1 
ATOM   2998 C  CE1 . PHE A 1 402 ? 16.096  36.875  31.048 1.00 49.36  ? 402 PHE A CE1 1 
ATOM   2999 C  CE2 . PHE A 1 402 ? 18.403  37.335  30.643 1.00 48.63  ? 402 PHE A CE2 1 
ATOM   3000 C  CZ  . PHE A 1 402 ? 17.244  36.670  30.313 1.00 47.25  ? 402 PHE A CZ  1 
ATOM   3001 N  N   . SER A 1 403 ? 16.407  37.085  36.221 1.00 50.07  ? 403 SER A N   1 
ATOM   3002 C  CA  . SER A 1 403 ? 15.315  36.316  36.799 1.00 50.23  ? 403 SER A CA  1 
ATOM   3003 C  C   . SER A 1 403 ? 14.556  37.020  37.930 1.00 56.43  ? 403 SER A C   1 
ATOM   3004 O  O   . SER A 1 403 ? 13.350  36.810  38.051 1.00 56.41  ? 403 SER A O   1 
ATOM   3005 C  CB  . SER A 1 403 ? 15.832  34.977  37.297 1.00 51.93  ? 403 SER A CB  1 
ATOM   3006 O  OG  . SER A 1 403 ? 16.380  35.105  38.600 1.00 60.56  ? 403 SER A OG  1 
ATOM   3007 N  N   . SER A 1 404 ? 15.245  37.831  38.760 1.00 54.45  ? 404 SER A N   1 
ATOM   3008 C  CA  . SER A 1 404 ? 14.598  38.426  39.929 1.00 56.07  ? 404 SER A CA  1 
ATOM   3009 C  C   . SER A 1 404 ? 14.665  39.922  40.116 1.00 60.14  ? 404 SER A C   1 
ATOM   3010 O  O   . SER A 1 404 ? 13.676  40.497  40.579 1.00 61.61  ? 404 SER A O   1 
ATOM   3011 C  CB  . SER A 1 404 ? 15.110  37.757  41.197 1.00 61.59  ? 404 SER A CB  1 
ATOM   3012 O  OG  . SER A 1 404 ? 16.496  38.024  41.352 1.00 76.95  ? 404 SER A OG  1 
ATOM   3013 N  N   . ALA A 1 405 ? 15.840  40.542  39.875 1.00 54.96  ? 405 ALA A N   1 
ATOM   3014 C  CA  . ALA A 1 405 ? 16.035  41.983  40.110 1.00 54.78  ? 405 ALA A CA  1 
ATOM   3015 C  C   . ALA A 1 405 ? 15.135  42.876  39.296 1.00 56.65  ? 405 ALA A C   1 
ATOM   3016 O  O   . ALA A 1 405 ? 14.803  42.567  38.156 1.00 55.82  ? 405 ALA A O   1 
ATOM   3017 C  CB  . ALA A 1 405 ? 17.482  42.376  39.899 1.00 54.84  ? 405 ALA A CB  1 
ATOM   3018 N  N   . SER A 1 406 ? 14.731  43.982  39.903 1.00 53.01  ? 406 SER A N   1 
ATOM   3019 C  CA  . SER A 1 406 ? 13.860  44.965  39.287 1.00 53.75  ? 406 SER A CA  1 
ATOM   3020 C  C   . SER A 1 406 ? 14.657  45.847  38.334 1.00 56.13  ? 406 SER A C   1 
ATOM   3021 O  O   . SER A 1 406 ? 15.864  45.997  38.521 1.00 53.79  ? 406 SER A O   1 
ATOM   3022 C  CB  . SER A 1 406 ? 13.173  45.809  40.371 1.00 58.45  ? 406 SER A CB  1 
ATOM   3023 O  OG  . SER A 1 406 ? 13.843  47.003  40.754 1.00 63.64  ? 406 SER A OG  1 
ATOM   3024 N  N   . PRO A 1 407 ? 14.006  46.503  37.353 1.00 54.95  ? 407 PRO A N   1 
ATOM   3025 C  CA  . PRO A 1 407 ? 14.733  47.472  36.512 1.00 55.96  ? 407 PRO A CA  1 
ATOM   3026 C  C   . PRO A 1 407 ? 15.522  48.534  37.321 1.00 58.70  ? 407 PRO A C   1 
ATOM   3027 O  O   . PRO A 1 407 ? 16.638  48.894  36.930 1.00 56.51  ? 407 PRO A O   1 
ATOM   3028 C  CB  . PRO A 1 407 ? 13.612  48.089  35.666 1.00 59.72  ? 407 PRO A CB  1 
ATOM   3029 C  CG  . PRO A 1 407 ? 12.573  46.985  35.587 1.00 63.33  ? 407 PRO A CG  1 
ATOM   3030 C  CD  . PRO A 1 407 ? 12.576  46.458  36.983 1.00 57.92  ? 407 PRO A CD  1 
ATOM   3031 N  N   . GLU A 1 408 ? 14.976  48.977  38.479 1.00 56.58  ? 408 GLU A N   1 
ATOM   3032 C  CA  . GLU A 1 408 ? 15.644  49.924  39.391 1.00 57.51  ? 408 GLU A CA  1 
ATOM   3033 C  C   . GLU A 1 408 ? 16.932  49.296  39.932 1.00 58.43  ? 408 GLU A C   1 
ATOM   3034 O  O   . GLU A 1 408 ? 18.001  49.917  39.887 1.00 57.38  ? 408 GLU A O   1 
ATOM   3035 C  CB  . GLU A 1 408 ? 14.734  50.326  40.578 1.00 60.68  ? 408 GLU A CB  1 
ATOM   3036 C  CG  . GLU A 1 408 ? 13.590  51.275  40.236 1.00 76.16  ? 408 GLU A CG  1 
ATOM   3037 C  CD  . GLU A 1 408 ? 12.360  50.651  39.598 1.00 107.75 ? 408 GLU A CD  1 
ATOM   3038 O  OE1 . GLU A 1 408 ? 12.137  49.429  39.770 1.00 106.61 ? 408 GLU A OE1 1 
ATOM   3039 O  OE2 . GLU A 1 408 ? 11.602  51.400  38.940 1.00 105.81 ? 408 GLU A OE2 1 
ATOM   3040 N  N   . GLN A 1 409 ? 16.811  48.044  40.416 1.00 52.77  ? 409 GLN A N   1 
ATOM   3041 C  CA  . GLN A 1 409 ? 17.883  47.241  40.987 1.00 49.97  ? 409 GLN A CA  1 
ATOM   3042 C  C   . GLN A 1 409 ? 18.964  47.030  39.953 1.00 51.97  ? 409 GLN A C   1 
ATOM   3043 O  O   . GLN A 1 409 ? 20.127  47.316  40.232 1.00 50.53  ? 409 GLN A O   1 
ATOM   3044 C  CB  . GLN A 1 409 ? 17.337  45.897  41.473 1.00 50.11  ? 409 GLN A CB  1 
ATOM   3045 C  CG  . GLN A 1 409 ? 16.222  46.009  42.501 1.00 52.38  ? 409 GLN A CG  1 
ATOM   3046 C  CD  . GLN A 1 409 ? 16.345  44.941  43.541 1.00 60.64  ? 409 GLN A CD  1 
ATOM   3047 O  OE1 . GLN A 1 409 ? 15.884  43.800  43.370 1.00 59.69  ? 409 GLN A OE1 1 
ATOM   3048 N  NE2 . GLN A 1 409 ? 17.011  45.286  44.626 1.00 41.91  ? 409 GLN A NE2 1 
ATOM   3049 N  N   . MET A 1 410 ? 18.572  46.604  38.736 1.00 48.95  ? 410 MET A N   1 
ATOM   3050 C  CA  . MET A 1 410 ? 19.490  46.401  37.610 1.00 48.42  ? 410 MET A CA  1 
ATOM   3051 C  C   . MET A 1 410 ? 20.275  47.682  37.335 1.00 51.65  ? 410 MET A C   1 
ATOM   3052 O  O   . MET A 1 410 ? 21.497  47.620  37.161 1.00 50.41  ? 410 MET A O   1 
ATOM   3053 C  CB  . MET A 1 410 ? 18.719  46.019  36.343 1.00 51.46  ? 410 MET A CB  1 
ATOM   3054 C  CG  . MET A 1 410 ? 18.270  44.598  36.305 1.00 54.81  ? 410 MET A CG  1 
ATOM   3055 S  SD  . MET A 1 410 ? 17.021  44.452  35.020 1.00 60.82  ? 410 MET A SD  1 
ATOM   3056 C  CE  . MET A 1 410 ? 16.573  42.761  35.209 1.00 56.20  ? 410 MET A CE  1 
ATOM   3057 N  N   . ASP A 1 411 ? 19.566  48.848  37.323 1.00 47.82  ? 411 ASP A N   1 
ATOM   3058 C  CA  . ASP A 1 411 ? 20.186  50.142  37.078 1.00 47.13  ? 411 ASP A CA  1 
ATOM   3059 C  C   . ASP A 1 411 ? 21.226  50.455  38.128 1.00 48.95  ? 411 ASP A C   1 
ATOM   3060 O  O   . ASP A 1 411 ? 22.375  50.736  37.785 1.00 47.81  ? 411 ASP A O   1 
ATOM   3061 C  CB  . ASP A 1 411 ? 19.153  51.256  36.961 1.00 50.24  ? 411 ASP A CB  1 
ATOM   3062 C  CG  . ASP A 1 411 ? 19.677  52.420  36.146 1.00 57.03  ? 411 ASP A CG  1 
ATOM   3063 O  OD1 . ASP A 1 411 ? 20.075  53.445  36.760 1.00 59.02  ? 411 ASP A OD1 1 
ATOM   3064 O  OD2 . ASP A 1 411 ? 19.727  52.294  34.891 1.00 55.08  ? 411 ASP A OD2 1 
ATOM   3065 N  N   . VAL A 1 412 ? 20.852  50.303  39.401 1.00 45.18  ? 412 VAL A N   1 
ATOM   3066 C  CA  . VAL A 1 412 ? 21.736  50.527  40.547 1.00 44.76  ? 412 VAL A CA  1 
ATOM   3067 C  C   . VAL A 1 412 ? 22.893  49.504  40.521 1.00 46.70  ? 412 VAL A C   1 
ATOM   3068 O  O   . VAL A 1 412 ? 24.031  49.849  40.842 1.00 44.67  ? 412 VAL A O   1 
ATOM   3069 C  CB  . VAL A 1 412 ? 20.915  50.585  41.876 1.00 48.39  ? 412 VAL A CB  1 
ATOM   3070 C  CG1 . VAL A 1 412 ? 21.769  50.332  43.119 1.00 47.51  ? 412 VAL A CG1 1 
ATOM   3071 C  CG2 . VAL A 1 412 ? 20.154  51.906  41.994 1.00 49.77  ? 412 VAL A CG2 1 
ATOM   3072 N  N   . ALA A 1 413 ? 22.621  48.293  40.034 1.00 44.35  ? 413 ALA A N   1 
ATOM   3073 C  CA  . ALA A 1 413 ? 23.677  47.287  39.946 1.00 44.30  ? 413 ALA A CA  1 
ATOM   3074 C  C   . ALA A 1 413 ? 24.719  47.648  38.858 1.00 51.58  ? 413 ALA A C   1 
ATOM   3075 O  O   . ALA A 1 413 ? 25.919  47.661  39.142 1.00 51.48  ? 413 ALA A O   1 
ATOM   3076 C  CB  . ALA A 1 413 ? 23.090  45.895  39.713 1.00 43.37  ? 413 ALA A CB  1 
ATOM   3077 N  N   . PHE A 1 414 ? 24.268  47.991  37.646 1.00 49.16  ? 414 PHE A N   1 
ATOM   3078 C  CA  . PHE A 1 414 ? 25.202  48.281  36.576 1.00 49.32  ? 414 PHE A CA  1 
ATOM   3079 C  C   . PHE A 1 414 ? 26.038  49.512  36.798 1.00 52.13  ? 414 PHE A C   1 
ATOM   3080 O  O   . PHE A 1 414 ? 27.248  49.475  36.558 1.00 51.78  ? 414 PHE A O   1 
ATOM   3081 C  CB  . PHE A 1 414 ? 24.540  48.200  35.198 1.00 52.74  ? 414 PHE A CB  1 
ATOM   3082 C  CG  . PHE A 1 414 ? 24.252  46.770  34.779 1.00 55.03  ? 414 PHE A CG  1 
ATOM   3083 C  CD1 . PHE A 1 414 ? 22.969  46.375  34.432 1.00 59.52  ? 414 PHE A CD1 1 
ATOM   3084 C  CD2 . PHE A 1 414 ? 25.258  45.803  34.788 1.00 57.32  ? 414 PHE A CD2 1 
ATOM   3085 C  CE1 . PHE A 1 414 ? 22.707  45.055  34.050 1.00 59.55  ? 414 PHE A CE1 1 
ATOM   3086 C  CE2 . PHE A 1 414 ? 24.988  44.481  34.413 1.00 59.23  ? 414 PHE A CE2 1 
ATOM   3087 C  CZ  . PHE A 1 414 ? 23.714  44.116  34.052 1.00 57.40  ? 414 PHE A CZ  1 
ATOM   3088 N  N   . GLN A 1 415 ? 25.411  50.570  37.360 1.00 47.07  ? 415 GLN A N   1 
ATOM   3089 C  CA  . GLN A 1 415 ? 26.037  51.844  37.717 1.00 45.62  ? 415 GLN A CA  1 
ATOM   3090 C  C   . GLN A 1 415 ? 27.257  51.577  38.613 1.00 47.99  ? 415 GLN A C   1 
ATOM   3091 O  O   . GLN A 1 415 ? 28.285  52.219  38.433 1.00 48.01  ? 415 GLN A O   1 
ATOM   3092 C  CB  . GLN A 1 415 ? 24.993  52.707  38.409 1.00 47.53  ? 415 GLN A CB  1 
ATOM   3093 C  CG  . GLN A 1 415 ? 25.434  54.080  38.849 1.00 60.77  ? 415 GLN A CG  1 
ATOM   3094 C  CD  . GLN A 1 415 ? 24.330  54.763  39.626 1.00 81.97  ? 415 GLN A CD  1 
ATOM   3095 O  OE1 . GLN A 1 415 ? 23.979  55.914  39.359 1.00 78.84  ? 415 GLN A OE1 1 
ATOM   3096 N  NE2 . GLN A 1 415 ? 23.750  54.071  40.609 1.00 75.09  ? 415 GLN A NE2 1 
ATOM   3097 N  N   . VAL A 1 416 ? 27.156  50.569  39.517 1.00 43.04  ? 416 VAL A N   1 
ATOM   3098 C  CA  . VAL A 1 416 ? 28.221  50.112  40.420 1.00 41.55  ? 416 VAL A CA  1 
ATOM   3099 C  C   . VAL A 1 416 ? 29.294  49.411  39.581 1.00 44.22  ? 416 VAL A C   1 
ATOM   3100 O  O   . VAL A 1 416 ? 30.431  49.860  39.543 1.00 44.43  ? 416 VAL A O   1 
ATOM   3101 C  CB  . VAL A 1 416 ? 27.679  49.143  41.513 1.00 43.30  ? 416 VAL A CB  1 
ATOM   3102 C  CG1 . VAL A 1 416 ? 28.808  48.541  42.343 1.00 41.94  ? 416 VAL A CG1 1 
ATOM   3103 C  CG2 . VAL A 1 416 ? 26.660  49.813  42.400 1.00 43.97  ? 416 VAL A CG2 1 
ATOM   3104 N  N   . LEU A 1 417 ? 28.927  48.280  38.955 1.00 38.74  ? 417 LEU A N   1 
ATOM   3105 C  CA  . LEU A 1 417 ? 29.773  47.443  38.113 1.00 37.15  ? 417 LEU A CA  1 
ATOM   3106 C  C   . LEU A 1 417 ? 30.667  48.299  37.207 1.00 39.48  ? 417 LEU A C   1 
ATOM   3107 O  O   . LEU A 1 417 ? 31.893  48.148  37.236 1.00 37.50  ? 417 LEU A O   1 
ATOM   3108 C  CB  . LEU A 1 417 ? 28.832  46.561  37.277 1.00 36.73  ? 417 LEU A CB  1 
ATOM   3109 C  CG  . LEU A 1 417 ? 29.295  45.232  36.699 1.00 40.49  ? 417 LEU A CG  1 
ATOM   3110 C  CD1 . LEU A 1 417 ? 29.004  45.176  35.233 1.00 41.30  ? 417 LEU A CD1 1 
ATOM   3111 C  CD2 . LEU A 1 417 ? 30.755  44.868  37.046 1.00 42.48  ? 417 LEU A CD2 1 
ATOM   3112 N  N   . ALA A 1 418 ? 30.037  49.249  36.471 1.00 37.72  ? 418 ALA A N   1 
ATOM   3113 C  CA  . ALA A 1 418 ? 30.677  50.184  35.561 1.00 38.19  ? 418 ALA A CA  1 
ATOM   3114 C  C   . ALA A 1 418 ? 31.786  50.939  36.286 1.00 42.63  ? 418 ALA A C   1 
ATOM   3115 O  O   . ALA A 1 418 ? 32.919  50.926  35.821 1.00 41.21  ? 418 ALA A O   1 
ATOM   3116 C  CB  . ALA A 1 418 ? 29.646  51.137  34.994 1.00 39.63  ? 418 ALA A CB  1 
ATOM   3117 N  N   . GLN A 1 419 ? 31.480  51.493  37.482 1.00 42.10  ? 419 GLN A N   1 
ATOM   3118 C  CA  . GLN A 1 419 ? 32.413  52.200  38.372 1.00 43.16  ? 419 GLN A CA  1 
ATOM   3119 C  C   . GLN A 1 419 ? 33.655  51.338  38.545 1.00 46.76  ? 419 GLN A C   1 
ATOM   3120 O  O   . GLN A 1 419 ? 34.783  51.807  38.330 1.00 47.24  ? 419 GLN A O   1 
ATOM   3121 C  CB  . GLN A 1 419 ? 31.778  52.364  39.778 1.00 44.82  ? 419 GLN A CB  1 
ATOM   3122 C  CG  . GLN A 1 419 ? 31.650  53.777  40.322 1.00 60.33  ? 419 GLN A CG  1 
ATOM   3123 C  CD  . GLN A 1 419 ? 32.927  54.563  40.275 1.00 65.80  ? 419 GLN A CD  1 
ATOM   3124 O  OE1 . GLN A 1 419 ? 32.964  55.653  39.678 1.00 60.99  ? 419 GLN A OE1 1 
ATOM   3125 N  NE2 . GLN A 1 419 ? 33.994  54.008  40.867 1.00 41.76  ? 419 GLN A NE2 1 
ATOM   3126 N  N   . LEU A 1 420 ? 33.424  50.055  38.912 1.00 40.76  ? 420 LEU A N   1 
ATOM   3127 C  CA  . LEU A 1 420 ? 34.481  49.101  39.178 1.00 39.50  ? 420 LEU A CA  1 
ATOM   3128 C  C   . LEU A 1 420 ? 35.271  48.762  37.954 1.00 42.41  ? 420 LEU A C   1 
ATOM   3129 O  O   . LEU A 1 420 ? 36.494  48.635  38.052 1.00 44.42  ? 420 LEU A O   1 
ATOM   3130 C  CB  . LEU A 1 420 ? 33.961  47.864  39.883 1.00 38.55  ? 420 LEU A CB  1 
ATOM   3131 C  CG  . LEU A 1 420 ? 33.120  48.151  41.108 1.00 43.90  ? 420 LEU A CG  1 
ATOM   3132 C  CD1 . LEU A 1 420 ? 32.176  47.015  41.380 1.00 42.99  ? 420 LEU A CD1 1 
ATOM   3133 C  CD2 . LEU A 1 420 ? 33.982  48.503  42.308 1.00 46.86  ? 420 LEU A CD2 1 
ATOM   3134 N  N   . ILE A 1 421 ? 34.611  48.704  36.789 1.00 36.00  ? 421 ILE A N   1 
ATOM   3135 C  CA  . ILE A 1 421 ? 35.319  48.440  35.541 1.00 34.58  ? 421 ILE A CA  1 
ATOM   3136 C  C   . ILE A 1 421 ? 36.341  49.537  35.319 1.00 37.01  ? 421 ILE A C   1 
ATOM   3137 O  O   . ILE A 1 421 ? 37.499  49.245  35.050 1.00 35.71  ? 421 ILE A O   1 
ATOM   3138 C  CB  . ILE A 1 421 ? 34.347  48.229  34.358 1.00 36.44  ? 421 ILE A CB  1 
ATOM   3139 C  CG1 . ILE A 1 421 ? 33.512  46.940  34.596 1.00 36.19  ? 421 ILE A CG1 1 
ATOM   3140 C  CG2 . ILE A 1 421 ? 35.093  48.159  33.019 1.00 35.43  ? 421 ILE A CG2 1 
ATOM   3141 C  CD1 . ILE A 1 421 ? 32.097  46.938  34.042 1.00 43.89  ? 421 ILE A CD1 1 
ATOM   3142 N  N   . LYS A 1 422 ? 35.940  50.778  35.569 1.00 36.51  ? 422 LYS A N   1 
ATOM   3143 C  CA  . LYS A 1 422 ? 36.783  51.962  35.410 1.00 37.66  ? 422 LYS A CA  1 
ATOM   3144 C  C   . LYS A 1 422 ? 37.999  51.943  36.328 1.00 40.24  ? 422 LYS A C   1 
ATOM   3145 O  O   . LYS A 1 422 ? 39.105  52.238  35.852 1.00 38.97  ? 422 LYS A O   1 
ATOM   3146 C  CB  . LYS A 1 422 ? 35.985  53.255  35.659 1.00 40.13  ? 422 LYS A CB  1 
ATOM   3147 C  CG  . LYS A 1 422 ? 34.692  53.387  34.885 1.00 40.25  ? 422 LYS A CG  1 
ATOM   3148 C  CD  . LYS A 1 422 ? 34.199  54.825  34.888 1.00 50.87  ? 422 LYS A CD  1 
ATOM   3149 C  CE  . LYS A 1 422 ? 33.354  55.208  36.074 1.00 56.62  ? 422 LYS A CE  1 
ATOM   3150 N  NZ  . LYS A 1 422 ? 32.781  56.553  35.865 1.00 63.29  ? 422 LYS A NZ  1 
ATOM   3151 N  N   . GLU A 1 423 ? 37.800  51.624  37.646 1.00 38.53  ? 423 GLU A N   1 
ATOM   3152 C  CA  . GLU A 1 423 ? 38.937  51.654  38.575 1.00 39.21  ? 423 GLU A CA  1 
ATOM   3153 C  C   . GLU A 1 423 ? 40.071  50.755  38.173 1.00 41.01  ? 423 GLU A C   1 
ATOM   3154 O  O   . GLU A 1 423 ? 41.231  51.190  38.098 1.00 40.66  ? 423 GLU A O   1 
ATOM   3155 C  CB  . GLU A 1 423 ? 38.598  51.635  40.092 1.00 40.74  ? 423 GLU A CB  1 
ATOM   3156 C  CG  . GLU A 1 423 ? 37.369  50.858  40.536 1.00 51.84  ? 423 GLU A CG  1 
ATOM   3157 C  CD  . GLU A 1 423 ? 36.621  51.467  41.712 1.00 72.09  ? 423 GLU A CD  1 
ATOM   3158 O  OE1 . GLU A 1 423 ? 37.123  51.381  42.855 1.00 60.14  ? 423 GLU A OE1 1 
ATOM   3159 O  OE2 . GLU A 1 423 ? 35.529  52.038  41.488 1.00 70.58  ? 423 GLU A OE2 1 
ATOM   3160 N  N   . SER A 1 424 ? 39.707  49.541  37.770 1.00 37.40  ? 424 SER A N   1 
ATOM   3161 C  CA  . SER A 1 424 ? 40.662  48.555  37.297 1.00 36.91  ? 424 SER A CA  1 
ATOM   3162 C  C   . SER A 1 424 ? 41.276  48.989  35.964 1.00 41.57  ? 424 SER A C   1 
ATOM   3163 O  O   . SER A 1 424 ? 42.383  48.555  35.643 1.00 41.66  ? 424 SER A O   1 
ATOM   3164 C  CB  . SER A 1 424 ? 40.001  47.193  37.208 1.00 38.67  ? 424 SER A CB  1 
ATOM   3165 O  OG  . SER A 1 424 ? 38.664  47.341  36.764 1.00 49.40  ? 424 SER A OG  1 
ATOM   3166 N  N   . LEU A 1 425 ? 40.597  49.910  35.229 1.00 38.51  ? 425 LEU A N   1 
ATOM   3167 C  CA  . LEU A 1 425 ? 41.133  50.428  33.968 1.00 38.27  ? 425 LEU A CA  1 
ATOM   3168 C  C   . LEU A 1 425 ? 42.166  51.485  34.241 1.00 43.28  ? 425 LEU A C   1 
ATOM   3169 O  O   . LEU A 1 425 ? 42.983  51.756  33.371 1.00 42.62  ? 425 LEU A O   1 
ATOM   3170 C  CB  . LEU A 1 425 ? 40.062  50.861  32.930 1.00 37.96  ? 425 LEU A CB  1 
ATOM   3171 C  CG  . LEU A 1 425 ? 39.233  49.713  32.293 1.00 40.51  ? 425 LEU A CG  1 
ATOM   3172 C  CD1 . LEU A 1 425 ? 38.041  50.225  31.551 1.00 40.87  ? 425 LEU A CD1 1 
ATOM   3173 C  CD2 . LEU A 1 425 ? 40.055  48.815  31.384 1.00 41.37  ? 425 LEU A CD2 1 
ATOM   3174 N  N   . LEU A 1 426 ? 42.228  51.975  35.487 1.00 42.15  ? 426 LEU A N   1 
ATOM   3175 C  CA  . LEU A 1 426 ? 43.221  52.981  35.895 1.00 44.62  ? 426 LEU A CA  1 
ATOM   3176 C  C   . LEU A 1 426 ? 44.510  52.401  36.540 1.00 49.82  ? 426 LEU A C   1 
ATOM   3177 O  O   . LEU A 1 426 ? 45.296  53.150  37.153 1.00 49.69  ? 426 LEU A O   1 
ATOM   3178 C  CB  . LEU A 1 426 ? 42.583  54.028  36.813 1.00 45.54  ? 426 LEU A CB  1 
ATOM   3179 C  CG  . LEU A 1 426 ? 41.385  54.765  36.260 1.00 50.29  ? 426 LEU A CG  1 
ATOM   3180 C  CD1 . LEU A 1 426 ? 40.764  55.605  37.326 1.00 51.28  ? 426 LEU A CD1 1 
ATOM   3181 C  CD2 . LEU A 1 426 ? 41.756  55.605  35.034 1.00 52.69  ? 426 LEU A CD2 1 
ATOM   3182 N  N   . VAL A 1 427 ? 44.729  51.073  36.355 1.00 45.56  ? 427 VAL A N   1 
ATOM   3183 C  CA  . VAL A 1 427 ? 45.868  50.319  36.887 1.00 44.88  ? 427 VAL A CA  1 
ATOM   3184 C  C   . VAL A 1 427 ? 47.077  50.275  35.925 1.00 77.34  ? 427 VAL A C   1 
ATOM   3185 O  O   . VAL A 1 427 ? 48.218  50.491  36.351 1.00 37.79  ? 427 VAL A O   1 
ATOM   3186 C  CB  . VAL A 1 427 ? 45.403  48.925  37.358 1.00 45.91  ? 427 VAL A CB  1 
ATOM   3187 C  CG1 . VAL A 1 427 ? 46.582  47.991  37.583 1.00 45.92  ? 427 VAL A CG1 1 
ATOM   3188 C  CG2 . VAL A 1 427 ? 44.560  49.040  38.618 1.00 44.82  ? 427 VAL A CG2 1 
ATOM   3189 N  N   . MET B 1 1   ? 41.544  11.287  64.400 1.00 86.24  ? 1   MET B N   1 
ATOM   3190 C  CA  . MET B 1 1   ? 41.759  10.249  63.388 1.00 85.02  ? 1   MET B CA  1 
ATOM   3191 C  C   . MET B 1 1   ? 41.712  10.808  61.948 1.00 86.82  ? 1   MET B C   1 
ATOM   3192 O  O   . MET B 1 1   ? 41.211  11.922  61.732 1.00 85.51  ? 1   MET B O   1 
ATOM   3193 C  CB  . MET B 1 1   ? 40.767  9.071   63.583 1.00 84.99  ? 1   MET B CB  1 
ATOM   3194 C  CG  . MET B 1 1   ? 39.401  9.252   62.905 1.00 84.52  ? 1   MET B CG  1 
ATOM   3195 S  SD  . MET B 1 1   ? 38.447  7.712   62.796 1.00 86.32  ? 1   MET B SD  1 
ATOM   3196 C  CE  . MET B 1 1   ? 39.431  6.780   61.624 1.00 83.90  ? 1   MET B CE  1 
ATOM   3197 N  N   . ASN B 1 2   ? 42.218  10.021  60.968 1.00 82.01  ? 2   ASN B N   1 
ATOM   3198 C  CA  . ASN B 1 2   ? 42.206  10.401  59.548 1.00 79.53  ? 2   ASN B CA  1 
ATOM   3199 C  C   . ASN B 1 2   ? 41.035  9.767   58.809 1.00 75.37  ? 2   ASN B C   1 
ATOM   3200 O  O   . ASN B 1 2   ? 40.797  8.563   58.942 1.00 74.93  ? 2   ASN B O   1 
ATOM   3201 C  CB  . ASN B 1 2   ? 43.529  10.056  58.843 1.00 83.94  ? 2   ASN B CB  1 
ATOM   3202 C  CG  . ASN B 1 2   ? 43.442  10.174  57.339 1.00 105.50 ? 2   ASN B CG  1 
ATOM   3203 O  OD1 . ASN B 1 2   ? 43.437  9.165   56.619 1.00 98.64  ? 2   ASN B OD1 1 
ATOM   3204 N  ND2 . ASN B 1 2   ? 43.235  11.399  56.852 1.00 95.20  ? 2   ASN B ND2 1 
ATOM   3205 N  N   . TYR B 1 3   ? 40.342  10.570  57.995 1.00 65.13  ? 3   TYR B N   1 
ATOM   3206 C  CA  . TYR B 1 3   ? 39.207  10.085  57.238 1.00 60.17  ? 3   TYR B CA  1 
ATOM   3207 C  C   . TYR B 1 3   ? 39.521  9.819   55.783 1.00 61.06  ? 3   TYR B C   1 
ATOM   3208 O  O   . TYR B 1 3   ? 38.770  9.098   55.120 1.00 57.42  ? 3   TYR B O   1 
ATOM   3209 C  CB  . TYR B 1 3   ? 38.028  11.042  57.397 1.00 59.26  ? 3   TYR B CB  1 
ATOM   3210 C  CG  . TYR B 1 3   ? 37.476  11.048  58.800 1.00 60.68  ? 3   TYR B CG  1 
ATOM   3211 C  CD1 . TYR B 1 3   ? 37.702  12.121  59.651 1.00 64.14  ? 3   TYR B CD1 1 
ATOM   3212 C  CD2 . TYR B 1 3   ? 36.805  9.940   59.312 1.00 60.03  ? 3   TYR B CD2 1 
ATOM   3213 C  CE1 . TYR B 1 3   ? 37.244  12.108  60.970 1.00 65.08  ? 3   TYR B CE1 1 
ATOM   3214 C  CE2 . TYR B 1 3   ? 36.353  9.911   60.633 1.00 60.46  ? 3   TYR B CE2 1 
ATOM   3215 C  CZ  . TYR B 1 3   ? 36.565  11.004  61.456 1.00 63.91  ? 3   TYR B CZ  1 
ATOM   3216 O  OH  . TYR B 1 3   ? 36.101  11.014  62.748 1.00 55.45  ? 3   TYR B OH  1 
ATOM   3217 N  N   . ALA B 1 4   ? 40.647  10.377  55.294 1.00 59.97  ? 4   ALA B N   1 
ATOM   3218 C  CA  . ALA B 1 4   ? 41.119  10.256  53.910 1.00 60.36  ? 4   ALA B CA  1 
ATOM   3219 C  C   . ALA B 1 4   ? 41.046  8.827   53.363 1.00 64.97  ? 4   ALA B C   1 
ATOM   3220 O  O   . ALA B 1 4   ? 40.545  8.608   52.254 1.00 63.26  ? 4   ALA B O   1 
ATOM   3221 C  CB  . ALA B 1 4   ? 42.534  10.792  53.796 1.00 63.95  ? 4   ALA B CB  1 
ATOM   3222 N  N   . ARG B 1 5   ? 41.511  7.862   54.179 1.00 63.18  ? 5   ARG B N   1 
ATOM   3223 C  CA  . ARG B 1 5   ? 41.543  6.420   53.951 1.00 62.89  ? 5   ARG B CA  1 
ATOM   3224 C  C   . ARG B 1 5   ? 40.203  5.861   53.430 1.00 63.72  ? 5   ARG B C   1 
ATOM   3225 O  O   . ARG B 1 5   ? 40.213  4.926   52.640 1.00 63.49  ? 5   ARG B O   1 
ATOM   3226 C  CB  . ARG B 1 5   ? 41.884  5.743   55.292 1.00 64.49  ? 5   ARG B CB  1 
ATOM   3227 C  CG  . ARG B 1 5   ? 42.402  4.319   55.176 1.00 73.05  ? 5   ARG B CG  1 
ATOM   3228 C  CD  . ARG B 1 5   ? 42.475  3.636   56.525 1.00 67.96  ? 5   ARG B CD  1 
ATOM   3229 N  NE  . ARG B 1 5   ? 41.767  2.360   56.489 1.00 70.52  ? 5   ARG B NE  1 
ATOM   3230 C  CZ  . ARG B 1 5   ? 41.512  1.613   57.555 1.00 85.33  ? 5   ARG B CZ  1 
ATOM   3231 N  NH1 . ARG B 1 5   ? 40.850  0.469   57.429 1.00 70.61  ? 5   ARG B NH1 1 
ATOM   3232 N  NH2 . ARG B 1 5   ? 41.909  2.006   58.759 1.00 74.18  ? 5   ARG B NH2 1 
ATOM   3233 N  N   . PHE B 1 6   ? 39.071  6.440   53.873 1.00 58.00  ? 6   PHE B N   1 
ATOM   3234 C  CA  . PHE B 1 6   ? 37.698  6.001   53.602 1.00 55.47  ? 6   PHE B CA  1 
ATOM   3235 C  C   . PHE B 1 6   ? 36.946  6.835   52.554 1.00 58.04  ? 6   PHE B C   1 
ATOM   3236 O  O   . PHE B 1 6   ? 35.716  6.731   52.441 1.00 56.08  ? 6   PHE B O   1 
ATOM   3237 C  CB  . PHE B 1 6   ? 36.918  6.009   54.926 1.00 56.67  ? 6   PHE B CB  1 
ATOM   3238 C  CG  . PHE B 1 6   ? 37.656  5.417   56.103 1.00 60.81  ? 6   PHE B CG  1 
ATOM   3239 C  CD1 . PHE B 1 6   ? 38.362  6.228   56.980 1.00 65.83  ? 6   PHE B CD1 1 
ATOM   3240 C  CD2 . PHE B 1 6   ? 37.651  4.047   56.329 1.00 64.42  ? 6   PHE B CD2 1 
ATOM   3241 C  CE1 . PHE B 1 6   ? 39.055  5.681   58.059 1.00 69.05  ? 6   PHE B CE1 1 
ATOM   3242 C  CE2 . PHE B 1 6   ? 38.334  3.501   57.415 1.00 69.70  ? 6   PHE B CE2 1 
ATOM   3243 C  CZ  . PHE B 1 6   ? 39.031  4.322   58.274 1.00 69.31  ? 6   PHE B CZ  1 
ATOM   3244 N  N   . ILE B 1 7   ? 37.680  7.686   51.808 1.00 54.11  ? 7   ILE B N   1 
ATOM   3245 C  CA  . ILE B 1 7   ? 37.135  8.602   50.796 1.00 50.67  ? 7   ILE B CA  1 
ATOM   3246 C  C   . ILE B 1 7   ? 37.816  8.317   49.461 1.00 54.19  ? 7   ILE B C   1 
ATOM   3247 O  O   . ILE B 1 7   ? 38.988  8.691   49.283 1.00 55.94  ? 7   ILE B O   1 
ATOM   3248 C  CB  . ILE B 1 7   ? 37.347  10.092  51.217 1.00 53.03  ? 7   ILE B CB  1 
ATOM   3249 C  CG1 . ILE B 1 7   ? 36.764  10.428  52.617 1.00 51.19  ? 7   ILE B CG1 1 
ATOM   3250 C  CG2 . ILE B 1 7   ? 36.841  11.043  50.148 1.00 52.56  ? 7   ILE B CG2 1 
ATOM   3251 C  CD1 . ILE B 1 7   ? 37.477  11.594  53.321 1.00 43.91  ? 7   ILE B CD1 1 
ATOM   3252 N  N   . THR B 1 8   ? 37.060  7.683   48.517 1.00 47.70  ? 8   THR B N   1 
ATOM   3253 C  CA  . THR B 1 8   ? 37.481  7.333   47.148 1.00 46.88  ? 8   THR B CA  1 
ATOM   3254 C  C   . THR B 1 8   ? 38.132  8.521   46.424 1.00 50.61  ? 8   THR B C   1 
ATOM   3255 O  O   . THR B 1 8   ? 37.823  9.677   46.726 1.00 49.75  ? 8   THR B O   1 
ATOM   3256 C  CB  . THR B 1 8   ? 36.286  6.804   46.292 1.00 52.34  ? 8   THR B CB  1 
ATOM   3257 O  OG1 . THR B 1 8   ? 35.196  7.726   46.259 1.00 51.04  ? 8   THR B OG1 1 
ATOM   3258 C  CG2 . THR B 1 8   ? 35.792  5.441   46.708 1.00 49.73  ? 8   THR B CG2 1 
ATOM   3259 N  N   . ALA B 1 9   ? 39.022  8.230   45.456 1.00 48.60  ? 9   ALA B N   1 
ATOM   3260 C  CA  . ALA B 1 9   ? 39.712  9.211   44.604 1.00 48.57  ? 9   ALA B CA  1 
ATOM   3261 C  C   . ALA B 1 9   ? 38.680  10.206  44.008 1.00 50.35  ? 9   ALA B C   1 
ATOM   3262 O  O   . ALA B 1 9   ? 38.878  11.428  44.089 1.00 49.52  ? 9   ALA B O   1 
ATOM   3263 C  CB  . ALA B 1 9   ? 40.459  8.483   43.492 1.00 50.45  ? 9   ALA B CB  1 
ATOM   3264 N  N   . ALA B 1 10  ? 37.541  9.660   43.496 1.00 45.18  ? 10  ALA B N   1 
ATOM   3265 C  CA  . ALA B 1 10  ? 36.422  10.397  42.917 1.00 43.07  ? 10  ALA B CA  1 
ATOM   3266 C  C   . ALA B 1 10  ? 35.703  11.218  43.992 1.00 45.75  ? 10  ALA B C   1 
ATOM   3267 O  O   . ALA B 1 10  ? 35.478  12.413  43.792 1.00 44.90  ? 10  ALA B O   1 
ATOM   3268 C  CB  . ALA B 1 10  ? 35.458  9.428   42.255 1.00 42.60  ? 10  ALA B CB  1 
ATOM   3269 N  N   . SER B 1 11  ? 35.372  10.597  45.138 1.00 41.87  ? 11  SER B N   1 
ATOM   3270 C  CA  . SER B 1 11  ? 34.727  11.303  46.243 1.00 41.71  ? 11  SER B CA  1 
ATOM   3271 C  C   . SER B 1 11  ? 35.612  12.490  46.713 1.00 49.87  ? 11  SER B C   1 
ATOM   3272 O  O   . SER B 1 11  ? 35.124  13.627  46.846 1.00 49.12  ? 11  SER B O   1 
ATOM   3273 C  CB  . SER B 1 11  ? 34.452  10.337  47.394 1.00 44.91  ? 11  SER B CB  1 
ATOM   3274 O  OG  . SER B 1 11  ? 34.043  10.972  48.592 1.00 52.02  ? 11  SER B OG  1 
ATOM   3275 N  N   . ALA B 1 12  ? 36.927  12.215  46.902 1.00 49.08  ? 12  ALA B N   1 
ATOM   3276 C  CA  . ALA B 1 12  ? 37.931  13.175  47.353 1.00 50.58  ? 12  ALA B CA  1 
ATOM   3277 C  C   . ALA B 1 12  ? 38.136  14.337  46.381 1.00 54.66  ? 12  ALA B C   1 
ATOM   3278 O  O   . ALA B 1 12  ? 38.358  15.467  46.830 1.00 53.80  ? 12  ALA B O   1 
ATOM   3279 C  CB  . ALA B 1 12  ? 39.241  12.458  47.622 1.00 53.51  ? 12  ALA B CB  1 
ATOM   3280 N  N   . ALA B 1 13  ? 38.028  14.053  45.053 1.00 52.29  ? 13  ALA B N   1 
ATOM   3281 C  CA  . ALA B 1 13  ? 38.182  15.017  43.943 1.00 52.82  ? 13  ALA B CA  1 
ATOM   3282 C  C   . ALA B 1 13  ? 37.327  16.282  44.111 1.00 55.07  ? 13  ALA B C   1 
ATOM   3283 O  O   . ALA B 1 13  ? 37.867  17.391  44.059 1.00 55.44  ? 13  ALA B O   1 
ATOM   3284 C  CB  . ALA B 1 13  ? 37.879  14.346  42.603 1.00 52.72  ? 13  ALA B CB  1 
ATOM   3285 N  N   . ARG B 1 14  ? 36.009  16.075  44.369 1.00 48.70  ? 14  ARG B N   1 
ATOM   3286 C  CA  . ARG B 1 14  ? 34.913  17.028  44.575 1.00 46.55  ? 14  ARG B CA  1 
ATOM   3287 C  C   . ARG B 1 14  ? 35.232  18.439  45.075 1.00 53.11  ? 14  ARG B C   1 
ATOM   3288 O  O   . ARG B 1 14  ? 36.073  18.637  45.959 1.00 54.30  ? 14  ARG B O   1 
ATOM   3289 C  CB  . ARG B 1 14  ? 33.815  16.401  45.438 1.00 41.98  ? 14  ARG B CB  1 
ATOM   3290 C  CG  . ARG B 1 14  ? 33.135  15.237  44.763 1.00 44.57  ? 14  ARG B CG  1 
ATOM   3291 C  CD  . ARG B 1 14  ? 31.737  14.992  45.296 1.00 44.70  ? 14  ARG B CD  1 
ATOM   3292 N  NE  . ARG B 1 14  ? 31.293  13.642  44.957 1.00 43.03  ? 14  ARG B NE  1 
ATOM   3293 C  CZ  . ARG B 1 14  ? 30.822  13.291  43.767 1.00 53.90  ? 14  ARG B CZ  1 
ATOM   3294 N  NH1 . ARG B 1 14  ? 30.695  14.195  42.804 1.00 48.20  ? 14  ARG B NH1 1 
ATOM   3295 N  NH2 . ARG B 1 14  ? 30.481  12.033  43.527 1.00 33.52  ? 14  ARG B NH2 1 
ATOM   3296 N  N   . ASN B 1 15  ? 34.512  19.418  44.515 1.00 50.51  ? 15  ASN B N   1 
ATOM   3297 C  CA  . ASN B 1 15  ? 34.629  20.829  44.855 1.00 52.31  ? 15  ASN B CA  1 
ATOM   3298 C  C   . ASN B 1 15  ? 33.250  21.521  44.987 1.00 58.89  ? 15  ASN B C   1 
ATOM   3299 O  O   . ASN B 1 15  ? 32.321  21.168  44.245 1.00 57.27  ? 15  ASN B O   1 
ATOM   3300 C  CB  . ASN B 1 15  ? 35.573  21.539  43.889 1.00 51.48  ? 15  ASN B CB  1 
ATOM   3301 C  CG  . ASN B 1 15  ? 37.022  21.191  44.165 1.00 75.99  ? 15  ASN B CG  1 
ATOM   3302 O  OD1 . ASN B 1 15  ? 37.526  21.353  45.293 1.00 69.97  ? 15  ASN B OD1 1 
ATOM   3303 N  ND2 . ASN B 1 15  ? 37.715  20.660  43.156 1.00 68.41  ? 15  ASN B ND2 1 
ATOM   3304 N  N   . PRO B 1 16  ? 33.081  22.472  45.953 1.00 58.04  ? 16  PRO B N   1 
ATOM   3305 C  CA  . PRO B 1 16  ? 31.755  23.120  46.133 1.00 57.29  ? 16  PRO B CA  1 
ATOM   3306 C  C   . PRO B 1 16  ? 31.312  24.058  44.997 1.00 63.50  ? 16  PRO B C   1 
ATOM   3307 O  O   . PRO B 1 16  ? 32.044  24.227  44.024 1.00 64.38  ? 16  PRO B O   1 
ATOM   3308 C  CB  . PRO B 1 16  ? 31.891  23.860  47.473 1.00 60.09  ? 16  PRO B CB  1 
ATOM   3309 C  CG  . PRO B 1 16  ? 33.241  23.446  48.053 1.00 65.61  ? 16  PRO B CG  1 
ATOM   3310 C  CD  . PRO B 1 16  ? 34.076  22.986  46.922 1.00 61.26  ? 16  PRO B CD  1 
ATOM   3311 N  N   . SER B 1 17  ? 30.102  24.662  45.123 1.00 60.54  ? 17  SER B N   1 
ATOM   3312 C  CA  . SER B 1 17  ? 29.461  25.599  44.179 1.00 99.38  ? 17  SER B CA  1 
ATOM   3313 C  C   . SER B 1 17  ? 30.410  26.643  43.542 1.00 131.02 ? 17  SER B C   1 
ATOM   3314 O  O   . SER B 1 17  ? 30.332  26.931  42.343 1.00 84.93  ? 17  SER B O   1 
ATOM   3315 C  CB  . SER B 1 17  ? 28.301  26.313  44.867 1.00 102.92 ? 17  SER B CB  1 
ATOM   3316 O  OG  . SER B 1 17  ? 28.748  27.093  45.966 1.00 114.02 ? 17  SER B OG  1 
ATOM   3317 N  N   . GLY B 1 29  ? 26.626  42.297  56.503 1.00 135.15 ? 29  GLY B N   1 
ATOM   3318 C  CA  . GLY B 1 29  ? 25.906  43.464  56.008 1.00 136.73 ? 29  GLY B CA  1 
ATOM   3319 C  C   . GLY B 1 29  ? 24.830  43.122  54.991 1.00 137.54 ? 29  GLY B C   1 
ATOM   3320 O  O   . GLY B 1 29  ? 25.077  43.240  53.787 1.00 136.33 ? 29  GLY B O   1 
ATOM   3321 N  N   . PRO B 1 30  ? 23.609  42.708  55.432 1.00 132.20 ? 30  PRO B N   1 
ATOM   3322 C  CA  . PRO B 1 30  ? 22.547  42.363  54.458 1.00 129.06 ? 30  PRO B CA  1 
ATOM   3323 C  C   . PRO B 1 30  ? 21.730  43.577  53.956 1.00 131.65 ? 30  PRO B C   1 
ATOM   3324 O  O   . PRO B 1 30  ? 22.221  44.709  54.047 1.00 134.71 ? 30  PRO B O   1 
ATOM   3325 C  CB  . PRO B 1 30  ? 21.694  41.322  55.217 1.00 128.92 ? 30  PRO B CB  1 
ATOM   3326 C  CG  . PRO B 1 30  ? 22.177  41.354  56.683 1.00 135.22 ? 30  PRO B CG  1 
ATOM   3327 C  CD  . PRO B 1 30  ? 23.141  42.500  56.819 1.00 134.27 ? 30  PRO B CD  1 
ATOM   3328 N  N   . LYS B 1 31  ? 20.495  43.340  53.409 1.00 123.32 ? 31  LYS B N   1 
ATOM   3329 C  CA  . LYS B 1 31  ? 19.531  44.342  52.892 1.00 123.49 ? 31  LYS B CA  1 
ATOM   3330 C  C   . LYS B 1 31  ? 20.024  45.114  51.664 1.00 124.87 ? 31  LYS B C   1 
ATOM   3331 O  O   . LYS B 1 31  ? 19.356  45.096  50.626 1.00 123.62 ? 31  LYS B O   1 
ATOM   3332 C  CB  . LYS B 1 31  ? 19.016  45.298  53.999 1.00 128.78 ? 31  LYS B CB  1 
ATOM   3333 C  CG  . LYS B 1 31  ? 17.662  45.952  53.698 1.00 130.85 ? 31  LYS B CG  1 
ATOM   3334 C  CD  . LYS B 1 31  ? 16.499  45.287  54.451 1.00 129.69 ? 31  LYS B CD  1 
ATOM   3335 C  CE  . LYS B 1 31  ? 15.760  44.250  53.636 1.00 124.74 ? 31  LYS B CE  1 
ATOM   3336 N  NZ  . LYS B 1 31  ? 14.619  43.668  54.391 1.00 125.82 ? 31  LYS B NZ  1 
ATOM   3337 N  N   . SER B 1 32  ? 21.197  45.773  51.780 1.00 120.32 ? 32  SER B N   1 
ATOM   3338 C  CA  . SER B 1 32  ? 21.863  46.520  50.710 1.00 119.78 ? 32  SER B CA  1 
ATOM   3339 C  C   . SER B 1 32  ? 22.275  45.581  49.548 1.00 116.27 ? 32  SER B C   1 
ATOM   3340 O  O   . SER B 1 32  ? 22.882  46.037  48.573 1.00 116.69 ? 32  SER B O   1 
ATOM   3341 C  CB  . SER B 1 32  ? 23.083  47.260  51.264 1.00 125.73 ? 32  SER B CB  1 
ATOM   3342 O  OG  . SER B 1 32  ? 24.071  46.364  51.751 1.00 131.74 ? 32  SER B OG  1 
ATOM   3343 N  N   . MET B 1 33  ? 21.907  44.279  49.652 1.00 105.65 ? 33  MET B N   1 
ATOM   3344 C  CA  . MET B 1 33  ? 22.208  43.231  48.679 1.00 100.36 ? 33  MET B CA  1 
ATOM   3345 C  C   . MET B 1 33  ? 21.245  43.136  47.514 1.00 96.31  ? 33  MET B C   1 
ATOM   3346 O  O   . MET B 1 33  ? 20.048  42.898  47.677 1.00 93.68  ? 33  MET B O   1 
ATOM   3347 C  CB  . MET B 1 33  ? 22.447  41.856  49.342 1.00 100.25 ? 33  MET B CB  1 
ATOM   3348 C  CG  . MET B 1 33  ? 23.701  41.800  50.208 1.00 105.40 ? 33  MET B CG  1 
ATOM   3349 S  SD  . MET B 1 33  ? 25.192  42.414  49.371 1.00 111.84 ? 33  MET B SD  1 
ATOM   3350 C  CE  . MET B 1 33  ? 25.936  43.370  50.705 1.00 112.19 ? 33  MET B CE  1 
ATOM   3351 N  N   . ILE B 1 34  ? 21.805  43.368  46.333 1.00 89.80  ? 34  ILE B N   1 
ATOM   3352 C  CA  . ILE B 1 34  ? 21.165  43.283  45.029 1.00 87.18  ? 34  ILE B CA  1 
ATOM   3353 C  C   . ILE B 1 34  ? 21.908  42.108  44.396 1.00 86.23  ? 34  ILE B C   1 
ATOM   3354 O  O   . ILE B 1 34  ? 23.137  42.025  44.503 1.00 84.33  ? 34  ILE B O   1 
ATOM   3355 C  CB  . ILE B 1 34  ? 21.291  44.623  44.202 1.00 92.38  ? 34  ILE B CB  1 
ATOM   3356 C  CG1 . ILE B 1 34  ? 20.690  45.832  44.954 1.00 95.58  ? 34  ILE B CG1 1 
ATOM   3357 C  CG2 . ILE B 1 34  ? 20.647  44.513  42.815 1.00 90.81  ? 34  ILE B CG2 1 
ATOM   3358 C  CD1 . ILE B 1 34  ? 21.699  46.794  45.522 1.00 104.03 ? 34  ILE B CD1 1 
ATOM   3359 N  N   . SER B 1 35  ? 21.166  41.170  43.808 1.00 81.31  ? 35  SER B N   1 
ATOM   3360 C  CA  . SER B 1 35  ? 21.798  40.009  43.212 1.00 79.49  ? 35  SER B CA  1 
ATOM   3361 C  C   . SER B 1 35  ? 21.385  39.654  41.817 1.00 83.65  ? 35  SER B C   1 
ATOM   3362 O  O   . SER B 1 35  ? 20.206  39.469  41.490 1.00 82.77  ? 35  SER B O   1 
ATOM   3363 C  CB  . SER B 1 35  ? 21.700  38.793  44.118 1.00 82.13  ? 35  SER B CB  1 
ATOM   3364 O  OG  . SER B 1 35  ? 22.473  39.014  45.284 1.00 94.77  ? 35  SER B OG  1 
ATOM   3365 N  N   . LEU B 1 36  ? 22.407  39.527  40.999 1.00 80.73  ? 36  LEU B N   1 
ATOM   3366 C  CA  . LEU B 1 36  ? 22.328  39.088  39.621 1.00 79.33  ? 36  LEU B CA  1 
ATOM   3367 C  C   . LEU B 1 36  ? 23.174  37.809  39.580 1.00 81.52  ? 36  LEU B C   1 
ATOM   3368 O  O   . LEU B 1 36  ? 23.566  37.349  38.510 1.00 81.20  ? 36  LEU B O   1 
ATOM   3369 C  CB  . LEU B 1 36  ? 22.918  40.168  38.703 1.00 81.17  ? 36  LEU B CB  1 
ATOM   3370 C  CG  . LEU B 1 36  ? 22.534  41.611  38.995 1.00 87.61  ? 36  LEU B CG  1 
ATOM   3371 C  CD1 . LEU B 1 36  ? 23.235  42.546  38.046 1.00 90.09  ? 36  LEU B CD1 1 
ATOM   3372 C  CD2 . LEU B 1 36  ? 21.041  41.811  38.906 1.00 88.65  ? 36  LEU B CD2 1 
ATOM   3373 N  N   . ALA B 1 37  ? 23.456  37.247  40.775 1.00 76.32  ? 37  ALA B N   1 
ATOM   3374 C  CA  . ALA B 1 37  ? 24.269  36.058  40.946 1.00 73.78  ? 37  ALA B CA  1 
ATOM   3375 C  C   . ALA B 1 37  ? 23.474  34.792  40.652 1.00 75.28  ? 37  ALA B C   1 
ATOM   3376 O  O   . ALA B 1 37  ? 23.508  34.323  39.513 1.00 74.64  ? 37  ALA B O   1 
ATOM   3377 C  CB  . ALA B 1 37  ? 24.881  36.029  42.338 1.00 74.72  ? 37  ALA B CB  1 
ATOM   3378 N  N   . GLY B 1 38  ? 22.751  34.287  41.657 1.00 70.51  ? 38  GLY B N   1 
ATOM   3379 C  CA  . GLY B 1 38  ? 21.936  33.075  41.608 1.00 68.05  ? 38  GLY B CA  1 
ATOM   3380 C  C   . GLY B 1 38  ? 21.012  32.946  40.414 1.00 72.12  ? 38  GLY B C   1 
ATOM   3381 O  O   . GLY B 1 38  ? 20.462  33.938  39.919 1.00 72.95  ? 38  GLY B O   1 
ATOM   3382 N  N   . GLY B 1 39  ? 20.874  31.711  39.947 1.00 67.55  ? 39  GLY B N   1 
ATOM   3383 C  CA  . GLY B 1 39  ? 20.059  31.373  38.785 1.00 66.69  ? 39  GLY B CA  1 
ATOM   3384 C  C   . GLY B 1 39  ? 18.663  30.893  39.112 1.00 67.69  ? 39  GLY B C   1 
ATOM   3385 O  O   . GLY B 1 39  ? 18.031  30.218  38.288 1.00 66.54  ? 39  GLY B O   1 
ATOM   3386 N  N   . LEU B 1 40  ? 18.189  31.241  40.331 1.00 61.72  ? 40  LEU B N   1 
ATOM   3387 C  CA  . LEU B 1 40  ? 16.872  30.908  40.873 1.00 59.62  ? 40  LEU B CA  1 
ATOM   3388 C  C   . LEU B 1 40  ? 15.762  31.462  39.968 1.00 64.52  ? 40  LEU B C   1 
ATOM   3389 O  O   . LEU B 1 40  ? 15.940  32.540  39.409 1.00 65.77  ? 40  LEU B O   1 
ATOM   3390 C  CB  . LEU B 1 40  ? 16.712  31.518  42.275 1.00 59.80  ? 40  LEU B CB  1 
ATOM   3391 C  CG  . LEU B 1 40  ? 17.844  31.294  43.265 1.00 63.53  ? 40  LEU B CG  1 
ATOM   3392 C  CD1 . LEU B 1 40  ? 18.719  32.532  43.383 1.00 65.80  ? 40  LEU B CD1 1 
ATOM   3393 C  CD2 . LEU B 1 40  ? 17.312  30.887  44.635 1.00 63.42  ? 40  LEU B CD2 1 
ATOM   3394 N  N   . PRO B 1 41  ? 14.614  30.774  39.793 1.00 60.73  ? 41  PRO B N   1 
ATOM   3395 C  CA  . PRO B 1 41  ? 13.537  31.369  38.982 1.00 62.31  ? 41  PRO B CA  1 
ATOM   3396 C  C   . PRO B 1 41  ? 12.748  32.415  39.790 1.00 69.26  ? 41  PRO B C   1 
ATOM   3397 O  O   . PRO B 1 41  ? 12.951  32.529  41.007 1.00 68.85  ? 41  PRO B O   1 
ATOM   3398 C  CB  . PRO B 1 41  ? 12.684  30.160  38.571 1.00 62.64  ? 41  PRO B CB  1 
ATOM   3399 C  CG  . PRO B 1 41  ? 12.995  29.103  39.559 1.00 64.87  ? 41  PRO B CG  1 
ATOM   3400 C  CD  . PRO B 1 41  ? 14.204  29.474  40.363 1.00 60.29  ? 41  PRO B CD  1 
ATOM   3401 N  N   . ASN B 1 42  ? 11.864  33.189  39.126 1.00 68.30  ? 42  ASN B N   1 
ATOM   3402 C  CA  . ASN B 1 42  ? 11.065  34.208  39.818 1.00 70.66  ? 42  ASN B CA  1 
ATOM   3403 C  C   . ASN B 1 42  ? 9.931   33.571  40.636 1.00 76.17  ? 42  ASN B C   1 
ATOM   3404 O  O   . ASN B 1 42  ? 9.251   32.678  40.127 1.00 74.63  ? 42  ASN B O   1 
ATOM   3405 C  CB  . ASN B 1 42  ? 10.536  35.259  38.859 1.00 72.30  ? 42  ASN B CB  1 
ATOM   3406 C  CG  . ASN B 1 42  ? 10.217  36.568  39.529 1.00 95.69  ? 42  ASN B CG  1 
ATOM   3407 O  OD1 . ASN B 1 42  ? 11.038  37.487  39.575 1.00 86.18  ? 42  ASN B OD1 1 
ATOM   3408 N  ND2 . ASN B 1 42  ? 9.018   36.683  40.078 1.00 93.15  ? 42  ASN B ND2 1 
ATOM   3409 N  N   . PRO B 1 43  ? 9.727   33.993  41.908 1.00 75.77  ? 43  PRO B N   1 
ATOM   3410 C  CA  . PRO B 1 43  ? 8.695   33.349  42.739 1.00 75.92  ? 43  PRO B CA  1 
ATOM   3411 C  C   . PRO B 1 43  ? 7.240   33.667  42.378 1.00 81.69  ? 43  PRO B C   1 
ATOM   3412 O  O   . PRO B 1 43  ? 6.396   32.759  42.407 1.00 81.98  ? 43  PRO B O   1 
ATOM   3413 C  CB  . PRO B 1 43  ? 9.060   33.792  44.153 1.00 78.32  ? 43  PRO B CB  1 
ATOM   3414 C  CG  . PRO B 1 43  ? 9.668   35.146  43.956 1.00 84.55  ? 43  PRO B CG  1 
ATOM   3415 C  CD  . PRO B 1 43  ? 10.463  35.018  42.680 1.00 79.09  ? 43  PRO B CD  1 
ATOM   3416 N  N   . ASN B 1 44  ? 6.948   34.935  42.022 1.00 77.94  ? 44  ASN B N   1 
ATOM   3417 C  CA  . ASN B 1 44  ? 5.609   35.392  41.641 1.00 79.07  ? 44  ASN B CA  1 
ATOM   3418 C  C   . ASN B 1 44  ? 5.084   34.692  40.363 1.00 79.44  ? 44  ASN B C   1 
ATOM   3419 O  O   . ASN B 1 44  ? 3.937   34.890  39.956 1.00 81.36  ? 44  ASN B O   1 
ATOM   3420 C  CB  . ASN B 1 44  ? 5.602   36.918  41.492 1.00 85.25  ? 44  ASN B CB  1 
ATOM   3421 C  CG  . ASN B 1 44  ? 5.771   37.676  42.794 1.00 117.86 ? 44  ASN B CG  1 
ATOM   3422 O  OD1 . ASN B 1 44  ? 4.875   38.417  43.225 1.00 112.99 ? 44  ASN B OD1 1 
ATOM   3423 N  ND2 . ASN B 1 44  ? 6.929   37.534  43.442 1.00 111.42 ? 44  ASN B ND2 1 
ATOM   3424 N  N   . MET B 1 45  ? 5.921   33.835  39.778 1.00 70.78  ? 45  MET B N   1 
ATOM   3425 C  CA  . MET B 1 45  ? 5.651   33.068  38.574 1.00 68.60  ? 45  MET B CA  1 
ATOM   3426 C  C   . MET B 1 45  ? 5.263   31.612  38.870 1.00 70.74  ? 45  MET B C   1 
ATOM   3427 O  O   . MET B 1 45  ? 4.914   30.887  37.939 1.00 70.20  ? 45  MET B O   1 
ATOM   3428 C  CB  . MET B 1 45  ? 6.893   33.111  37.673 1.00 69.34  ? 45  MET B CB  1 
ATOM   3429 C  CG  . MET B 1 45  ? 7.270   34.505  37.224 1.00 73.95  ? 45  MET B CG  1 
ATOM   3430 S  SD  . MET B 1 45  ? 6.302   35.017  35.801 1.00 79.56  ? 45  MET B SD  1 
ATOM   3431 C  CE  . MET B 1 45  ? 5.159   36.139  36.587 1.00 79.31  ? 45  MET B CE  1 
ATOM   3432 N  N   . PHE B 1 46  ? 5.329   31.178  40.153 1.00 65.75  ? 46  PHE B N   1 
ATOM   3433 C  CA  . PHE B 1 46  ? 5.008   29.806  40.565 1.00 62.91  ? 46  PHE B CA  1 
ATOM   3434 C  C   . PHE B 1 46  ? 3.489   29.533  40.650 1.00 65.04  ? 46  PHE B C   1 
ATOM   3435 O  O   . PHE B 1 46  ? 2.789   30.316  41.289 1.00 66.71  ? 46  PHE B O   1 
ATOM   3436 C  CB  . PHE B 1 46  ? 5.731   29.444  41.872 1.00 63.30  ? 46  PHE B CB  1 
ATOM   3437 C  CG  . PHE B 1 46  ? 7.241   29.385  41.781 1.00 63.62  ? 46  PHE B CG  1 
ATOM   3438 C  CD1 . PHE B 1 46  ? 8.035   29.988  42.746 1.00 66.97  ? 46  PHE B CD1 1 
ATOM   3439 C  CD2 . PHE B 1 46  ? 7.871   28.688  40.750 1.00 64.40  ? 46  PHE B CD2 1 
ATOM   3440 C  CE1 . PHE B 1 46  ? 9.432   29.911  42.673 1.00 67.00  ? 46  PHE B CE1 1 
ATOM   3441 C  CE2 . PHE B 1 46  ? 9.267   28.607  40.683 1.00 65.78  ? 46  PHE B CE2 1 
ATOM   3442 C  CZ  . PHE B 1 46  ? 10.037  29.219  41.642 1.00 64.15  ? 46  PHE B CZ  1 
ATOM   3443 N  N   . PRO B 1 47  ? 2.977   28.440  40.015 1.00 58.13  ? 47  PRO B N   1 
ATOM   3444 C  CA  . PRO B 1 47  ? 1.519   28.165  40.025 1.00 58.35  ? 47  PRO B CA  1 
ATOM   3445 C  C   . PRO B 1 47  ? 0.806   28.068  41.368 1.00 60.23  ? 47  PRO B C   1 
ATOM   3446 O  O   . PRO B 1 47  ? -0.312  28.548  41.493 1.00 60.61  ? 47  PRO B O   1 
ATOM   3447 C  CB  . PRO B 1 47  ? 1.399   26.835  39.279 1.00 59.08  ? 47  PRO B CB  1 
ATOM   3448 C  CG  . PRO B 1 47  ? 2.622   26.730  38.475 1.00 62.65  ? 47  PRO B CG  1 
ATOM   3449 C  CD  . PRO B 1 47  ? 3.703   27.444  39.203 1.00 57.58  ? 47  PRO B CD  1 
ATOM   3450 N  N   . PHE B 1 48  ? 1.418   27.416  42.350 1.00 55.54  ? 48  PHE B N   1 
ATOM   3451 C  CA  . PHE B 1 48  ? 0.798   27.245  43.662 1.00 56.09  ? 48  PHE B CA  1 
ATOM   3452 C  C   . PHE B 1 48  ? 1.071   28.478  44.521 1.00 61.35  ? 48  PHE B C   1 
ATOM   3453 O  O   . PHE B 1 48  ? 2.229   28.875  44.697 1.00 60.11  ? 48  PHE B O   1 
ATOM   3454 C  CB  . PHE B 1 48  ? 1.298   25.968  44.336 1.00 55.62  ? 48  PHE B CB  1 
ATOM   3455 C  CG  . PHE B 1 48  ? 1.534   24.804  43.413 1.00 55.62  ? 48  PHE B CG  1 
ATOM   3456 C  CD1 . PHE B 1 48  ? 2.769   24.619  42.806 1.00 57.23  ? 48  PHE B CD1 1 
ATOM   3457 C  CD2 . PHE B 1 48  ? 0.535   23.874  43.175 1.00 58.74  ? 48  PHE B CD2 1 
ATOM   3458 C  CE1 . PHE B 1 48  ? 2.996   23.529  41.961 1.00 57.51  ? 48  PHE B CE1 1 
ATOM   3459 C  CE2 . PHE B 1 48  ? 0.770   22.770  42.349 1.00 61.02  ? 48  PHE B CE2 1 
ATOM   3460 C  CZ  . PHE B 1 48  ? 2.002   22.605  41.750 1.00 57.46  ? 48  PHE B CZ  1 
ATOM   3461 N  N   . LYS B 1 49  ? 0.002   29.107  45.027 1.00 59.56  ? 49  LYS B N   1 
ATOM   3462 C  CA  . LYS B 1 49  ? 0.130   30.353  45.782 1.00 60.13  ? 49  LYS B CA  1 
ATOM   3463 C  C   . LYS B 1 49  ? 0.039   30.217  47.287 1.00 65.56  ? 49  LYS B C   1 
ATOM   3464 O  O   . LYS B 1 49  ? 0.781   30.906  47.989 1.00 65.08  ? 49  LYS B O   1 
ATOM   3465 C  CB  . LYS B 1 49  ? -0.823  31.431  45.235 1.00 62.97  ? 49  LYS B CB  1 
ATOM   3466 C  CG  . LYS B 1 49  ? -0.699  31.660  43.732 1.00 54.31  ? 49  LYS B CG  1 
ATOM   3467 C  CD  . LYS B 1 49  ? 0.708   32.082  43.302 1.00 57.51  ? 49  LYS B CD  1 
ATOM   3468 C  CE  . LYS B 1 49  ? 0.726   32.825  41.990 1.00 68.43  ? 49  LYS B CE  1 
ATOM   3469 N  NZ  . LYS B 1 49  ? 2.111   33.037  41.496 1.00 76.78  ? 49  LYS B NZ  1 
ATOM   3470 N  N   . THR B 1 50  ? -0.886  29.363  47.784 1.00 63.49  ? 50  THR B N   1 
ATOM   3471 C  CA  . THR B 1 50  ? -1.099  29.101  49.220 1.00 64.24  ? 50  THR B CA  1 
ATOM   3472 C  C   . THR B 1 50  ? -1.285  27.595  49.503 1.00 68.95  ? 50  THR B C   1 
ATOM   3473 O  O   . THR B 1 50  ? -1.608  26.840  48.583 1.00 68.46  ? 50  THR B O   1 
ATOM   3474 C  CB  . THR B 1 50  ? -2.242  29.957  49.841 1.00 67.64  ? 50  THR B CB  1 
ATOM   3475 O  OG1 . THR B 1 50  ? -3.409  29.154  50.069 1.00 67.36  ? 50  THR B OG1 1 
ATOM   3476 C  CG2 . THR B 1 50  ? -2.561  31.228  49.064 1.00 63.11  ? 50  THR B CG2 1 
ATOM   3477 N  N   . ALA B 1 51  ? -1.104  27.176  50.779 1.00 65.67  ? 51  ALA B N   1 
ATOM   3478 C  CA  . ALA B 1 51  ? -1.231  25.782  51.228 1.00 64.28  ? 51  ALA B CA  1 
ATOM   3479 C  C   . ALA B 1 51  ? -1.671  25.681  52.696 1.00 69.89  ? 51  ALA B C   1 
ATOM   3480 O  O   . ALA B 1 51  ? -1.206  26.465  53.533 1.00 70.45  ? 51  ALA B O   1 
ATOM   3481 C  CB  . ALA B 1 51  ? 0.089   25.042  51.033 1.00 61.92  ? 51  ALA B CB  1 
ATOM   3482 N  N   . VAL B 1 52  ? -2.560  24.708  53.007 1.00 66.23  ? 52  VAL B N   1 
ATOM   3483 C  CA  . VAL B 1 52  ? -3.042  24.456  54.375 1.00 66.56  ? 52  VAL B CA  1 
ATOM   3484 C  C   . VAL B 1 52  ? -3.250  22.955  54.700 1.00 67.70  ? 52  VAL B C   1 
ATOM   3485 O  O   . VAL B 1 52  ? -4.292  22.359  54.403 1.00 67.73  ? 52  VAL B O   1 
ATOM   3486 C  CB  . VAL B 1 52  ? -4.108  25.450  54.942 1.00 73.48  ? 52  VAL B CB  1 
ATOM   3487 C  CG1 . VAL B 1 52  ? -5.237  25.711  53.966 1.00 74.93  ? 52  VAL B CG1 1 
ATOM   3488 C  CG2 . VAL B 1 52  ? -4.642  25.012  56.301 1.00 74.38  ? 52  VAL B CG2 1 
ATOM   3489 N  N   . ILE B 1 53  ? -2.188  22.367  55.290 1.00 61.43  ? 53  ILE B N   1 
ATOM   3490 C  CA  . ILE B 1 53  ? -2.048  20.964  55.701 1.00 58.86  ? 53  ILE B CA  1 
ATOM   3491 C  C   . ILE B 1 53  ? -2.611  20.779  57.112 1.00 65.67  ? 53  ILE B C   1 
ATOM   3492 O  O   . ILE B 1 53  ? -2.359  21.599  57.998 1.00 65.69  ? 53  ILE B O   1 
ATOM   3493 C  CB  . ILE B 1 53  ? -0.559  20.479  55.595 1.00 57.81  ? 53  ILE B CB  1 
ATOM   3494 C  CG1 . ILE B 1 53  ? 0.036   20.776  54.209 1.00 56.25  ? 53  ILE B CG1 1 
ATOM   3495 C  CG2 . ILE B 1 53  ? -0.415  18.997  55.917 1.00 55.54  ? 53  ILE B CG2 1 
ATOM   3496 C  CD1 . ILE B 1 53  ? 1.312   21.477  54.235 1.00 55.94  ? 53  ILE B CD1 1 
ATOM   3497 N  N   . THR B 1 54  ? -3.378  19.698  57.309 1.00 64.21  ? 54  THR B N   1 
ATOM   3498 C  CA  . THR B 1 54  ? -3.959  19.377  58.607 1.00 65.29  ? 54  THR B CA  1 
ATOM   3499 C  C   . THR B 1 54  ? -3.114  18.338  59.331 1.00 69.01  ? 54  THR B C   1 
ATOM   3500 O  O   . THR B 1 54  ? -2.669  17.342  58.749 1.00 65.09  ? 54  THR B O   1 
ATOM   3501 C  CB  . THR B 1 54  ? -5.461  19.062  58.539 1.00 65.43  ? 54  THR B CB  1 
ATOM   3502 O  OG1 . THR B 1 54  ? -5.660  17.872  57.785 1.00 67.37  ? 54  THR B OG1 1 
ATOM   3503 C  CG2 . THR B 1 54  ? -6.266  20.184  57.945 1.00 59.46  ? 54  THR B CG2 1 
ATOM   3504 N  N   . VAL B 1 55  ? -2.859  18.627  60.601 1.00 69.25  ? 55  VAL B N   1 
ATOM   3505 C  CA  . VAL B 1 55  ? -2.075  17.803  61.501 1.00 68.97  ? 55  VAL B CA  1 
ATOM   3506 C  C   . VAL B 1 55  ? -3.017  17.057  62.464 1.00 76.74  ? 55  VAL B C   1 
ATOM   3507 O  O   . VAL B 1 55  ? -3.957  17.649  63.022 1.00 78.80  ? 55  VAL B O   1 
ATOM   3508 C  CB  . VAL B 1 55  ? -1.003  18.663  62.226 1.00 72.69  ? 55  VAL B CB  1 
ATOM   3509 C  CG1 . VAL B 1 55  ? -0.423  17.956  63.460 1.00 72.18  ? 55  VAL B CG1 1 
ATOM   3510 C  CG2 . VAL B 1 55  ? 0.099   19.079  61.258 1.00 70.46  ? 55  VAL B CG2 1 
ATOM   3511 N  N   . GLU B 1 56  ? -2.763  15.741  62.620 1.00 73.08  ? 56  GLU B N   1 
ATOM   3512 C  CA  . GLU B 1 56  ? -3.501  14.856  63.507 1.00 74.22  ? 56  GLU B CA  1 
ATOM   3513 C  C   . GLU B 1 56  ? -3.177  15.294  64.920 1.00 77.99  ? 56  GLU B C   1 
ATOM   3514 O  O   . GLU B 1 56  ? -1.996  15.346  65.301 1.00 74.95  ? 56  GLU B O   1 
ATOM   3515 C  CB  . GLU B 1 56  ? -3.112  13.376  63.257 1.00 74.06  ? 56  GLU B CB  1 
ATOM   3516 C  CG  . GLU B 1 56  ? -3.783  12.336  64.156 1.00 84.85  ? 56  GLU B CG  1 
ATOM   3517 C  CD  . GLU B 1 56  ? -5.226  11.923  63.898 1.00 90.89  ? 56  GLU B CD  1 
ATOM   3518 O  OE1 . GLU B 1 56  ? -5.928  12.593  63.100 1.00 55.45  ? 56  GLU B OE1 1 
ATOM   3519 O  OE2 . GLU B 1 56  ? -5.662  10.932  64.533 1.00 78.59  ? 56  GLU B OE2 1 
ATOM   3520 N  N   . ASN B 1 57  ? -4.241  15.709  65.649 1.00 77.64  ? 57  ASN B N   1 
ATOM   3521 C  CA  . ASN B 1 57  ? -4.199  16.170  67.036 1.00 78.88  ? 57  ASN B CA  1 
ATOM   3522 C  C   . ASN B 1 57  ? -2.970  17.090  67.238 1.00 81.08  ? 57  ASN B C   1 
ATOM   3523 O  O   . ASN B 1 57  ? -1.948  16.713  67.827 1.00 78.70  ? 57  ASN B O   1 
ATOM   3524 C  CB  . ASN B 1 57  ? -4.263  14.960  67.984 1.00 79.63  ? 57  ASN B CB  1 
ATOM   3525 C  CG  . ASN B 1 57  ? -5.221  13.871  67.506 1.00 95.29  ? 57  ASN B CG  1 
ATOM   3526 O  OD1 . ASN B 1 57  ? -6.324  14.143  67.001 1.00 87.28  ? 57  ASN B OD1 1 
ATOM   3527 N  ND2 . ASN B 1 57  ? -4.796  12.613  67.603 1.00 82.48  ? 57  ASN B ND2 1 
ATOM   3528 N  N   . GLY B 1 58  ? -3.077  18.255  66.605 1.00 77.77  ? 58  GLY B N   1 
ATOM   3529 C  CA  . GLY B 1 58  ? -2.057  19.294  66.560 1.00 76.26  ? 58  GLY B CA  1 
ATOM   3530 C  C   . GLY B 1 58  ? -2.434  20.412  65.607 1.00 77.76  ? 58  GLY B C   1 
ATOM   3531 O  O   . GLY B 1 58  ? -3.196  20.196  64.652 1.00 76.45  ? 58  GLY B O   1 
ATOM   3532 N  N   . LYS B 1 59  ? -1.898  21.624  65.868 1.00 73.90  ? 59  LYS B N   1 
ATOM   3533 C  CA  . LYS B 1 59  ? -2.198  22.804  65.064 1.00 74.32  ? 59  LYS B CA  1 
ATOM   3534 C  C   . LYS B 1 59  ? -1.787  22.705  63.604 1.00 75.11  ? 59  LYS B C   1 
ATOM   3535 O  O   . LYS B 1 59  ? -0.607  22.631  63.265 1.00 72.12  ? 59  LYS B O   1 
ATOM   3536 C  CB  . LYS B 1 59  ? -1.892  24.154  65.756 1.00 78.69  ? 59  LYS B CB  1 
ATOM   3537 C  CG  . LYS B 1 59  ? -0.456  24.365  66.231 1.00 91.84  ? 59  LYS B CG  1 
ATOM   3538 C  CD  . LYS B 1 59  ? -0.293  25.700  66.986 1.00 103.04 ? 59  LYS B CD  1 
ATOM   3539 C  CE  . LYS B 1 59  ? 0.117   26.872  66.110 1.00 110.49 ? 59  LYS B CE  1 
ATOM   3540 N  NZ  . LYS B 1 59  ? 1.564   26.836  65.755 1.00 108.37 ? 59  LYS B NZ  1 
ATOM   3541 N  N   . THR B 1 60  ? -2.816  22.613  62.760 1.00 71.94  ? 60  THR B N   1 
ATOM   3542 C  CA  . THR B 1 60  ? -2.797  22.488  61.307 1.00 69.81  ? 60  THR B CA  1 
ATOM   3543 C  C   . THR B 1 60  ? -1.931  23.572  60.665 1.00 69.50  ? 60  THR B C   1 
ATOM   3544 O  O   . THR B 1 60  ? -2.110  24.755  60.947 1.00 70.73  ? 60  THR B O   1 
ATOM   3545 C  CB  . THR B 1 60  ? -4.245  22.471  60.793 1.00 85.51  ? 60  THR B CB  1 
ATOM   3546 O  OG1 . THR B 1 60  ? -4.822  23.766  60.996 1.00 89.54  ? 60  THR B OG1 1 
ATOM   3547 C  CG2 . THR B 1 60  ? -5.106  21.399  61.500 1.00 85.68  ? 60  THR B CG2 1 
ATOM   3548 N  N   . ILE B 1 61  ? -0.967  23.143  59.840 1.00 61.22  ? 61  ILE B N   1 
ATOM   3549 C  CA  . ILE B 1 61  ? 0.016   23.983  59.152 1.00 58.75  ? 61  ILE B CA  1 
ATOM   3550 C  C   . ILE B 1 61  ? -0.595  24.840  58.037 1.00 63.28  ? 61  ILE B C   1 
ATOM   3551 O  O   . ILE B 1 61  ? -1.509  24.392  57.346 1.00 63.86  ? 61  ILE B O   1 
ATOM   3552 C  CB  . ILE B 1 61  ? 1.191   23.107  58.628 1.00 57.70  ? 61  ILE B CB  1 
ATOM   3553 C  CG1 . ILE B 1 61  ? 1.875   22.356  59.792 1.00 56.89  ? 61  ILE B CG1 1 
ATOM   3554 C  CG2 . ILE B 1 61  ? 2.201   23.946  57.853 1.00 56.57  ? 61  ILE B CG2 1 
ATOM   3555 C  CD1 . ILE B 1 61  ? 2.700   21.161  59.424 1.00 59.70  ? 61  ILE B CD1 1 
ATOM   3556 N  N   . GLN B 1 62  ? -0.059  26.067  57.866 1.00 58.72  ? 62  GLN B N   1 
ATOM   3557 C  CA  . GLN B 1 62  ? -0.404  27.022  56.815 1.00 58.24  ? 62  GLN B CA  1 
ATOM   3558 C  C   . GLN B 1 62  ? 0.885   27.499  56.166 1.00 59.13  ? 62  GLN B C   1 
ATOM   3559 O  O   . GLN B 1 62  ? 1.855   27.789  56.877 1.00 59.08  ? 62  GLN B O   1 
ATOM   3560 C  CB  . GLN B 1 62  ? -1.158  28.222  57.387 1.00 62.32  ? 62  GLN B CB  1 
ATOM   3561 C  CG  . GLN B 1 62  ? -2.652  28.088  57.270 1.00 67.43  ? 62  GLN B CG  1 
ATOM   3562 C  CD  . GLN B 1 62  ? -3.275  27.978  58.630 1.00 79.28  ? 62  GLN B CD  1 
ATOM   3563 O  OE1 . GLN B 1 62  ? -3.629  28.982  59.253 1.00 75.43  ? 62  GLN B OE1 1 
ATOM   3564 N  NE2 . GLN B 1 62  ? -3.421  26.757  59.121 1.00 68.68  ? 62  GLN B NE2 1 
ATOM   3565 N  N   . PHE B 1 63  ? 0.908   27.561  54.827 1.00 53.21  ? 63  PHE B N   1 
ATOM   3566 C  CA  . PHE B 1 63  ? 2.062   28.043  54.072 1.00 51.84  ? 63  PHE B CA  1 
ATOM   3567 C  C   . PHE B 1 63  ? 1.683   29.383  53.435 1.00 59.52  ? 63  PHE B C   1 
ATOM   3568 O  O   . PHE B 1 63  ? 1.184   29.430  52.300 1.00 59.03  ? 63  PHE B O   1 
ATOM   3569 C  CB  . PHE B 1 63  ? 2.539   27.006  53.027 1.00 51.03  ? 63  PHE B CB  1 
ATOM   3570 C  CG  . PHE B 1 63  ? 3.504   25.920  53.468 1.00 50.29  ? 63  PHE B CG  1 
ATOM   3571 C  CD1 . PHE B 1 63  ? 4.317   25.274  52.546 1.00 51.33  ? 63  PHE B CD1 1 
ATOM   3572 C  CD2 . PHE B 1 63  ? 3.572   25.515  54.802 1.00 52.19  ? 63  PHE B CD2 1 
ATOM   3573 C  CE1 . PHE B 1 63  ? 5.201   24.260  52.953 1.00 49.90  ? 63  PHE B CE1 1 
ATOM   3574 C  CE2 . PHE B 1 63  ? 4.456   24.504  55.202 1.00 52.32  ? 63  PHE B CE2 1 
ATOM   3575 C  CZ  . PHE B 1 63  ? 5.251   23.877  54.275 1.00 48.39  ? 63  PHE B CZ  1 
ATOM   3576 N  N   . GLY B 1 64  ? 1.891   30.457  54.207 1.00 59.35  ? 64  GLY B N   1 
ATOM   3577 C  CA  . GLY B 1 64  ? 1.588   31.836  53.826 1.00 62.22  ? 64  GLY B CA  1 
ATOM   3578 C  C   . GLY B 1 64  ? 2.183   32.252  52.498 1.00 66.14  ? 64  GLY B C   1 
ATOM   3579 O  O   . GLY B 1 64  ? 3.154   31.644  52.046 1.00 63.50  ? 64  GLY B O   1 
ATOM   3580 N  N   . GLU B 1 65  ? 1.607   33.294  51.862 1.00 65.17  ? 65  GLU B N   1 
ATOM   3581 C  CA  . GLU B 1 65  ? 2.033   33.808  50.550 1.00 64.58  ? 65  GLU B CA  1 
ATOM   3582 C  C   . GLU B 1 65  ? 3.546   33.675  50.371 1.00 65.29  ? 65  GLU B C   1 
ATOM   3583 O  O   . GLU B 1 65  ? 3.987   32.942  49.483 1.00 62.63  ? 65  GLU B O   1 
ATOM   3584 C  CB  . GLU B 1 65  ? 1.570   35.258  50.324 1.00 69.48  ? 65  GLU B CB  1 
ATOM   3585 C  CG  . GLU B 1 65  ? 0.147   35.571  50.768 1.00 87.10  ? 65  GLU B CG  1 
ATOM   3586 C  CD  . GLU B 1 65  ? -0.965  35.200  49.807 1.00 112.50 ? 65  GLU B CD  1 
ATOM   3587 O  OE1 . GLU B 1 65  ? -1.824  34.375  50.192 1.00 108.08 ? 65  GLU B OE1 1 
ATOM   3588 O  OE2 . GLU B 1 65  ? -1.013  35.778  48.696 1.00 107.36 ? 65  GLU B OE2 1 
ATOM   3589 N  N   . GLU B 1 66  ? 4.320   34.256  51.309 1.00 61.85  ? 66  GLU B N   1 
ATOM   3590 C  CA  . GLU B 1 66  ? 5.780   34.227  51.326 1.00 60.23  ? 66  GLU B CA  1 
ATOM   3591 C  C   . GLU B 1 66  ? 6.380   32.847  51.636 1.00 63.04  ? 66  GLU B C   1 
ATOM   3592 O  O   . GLU B 1 66  ? 7.269   32.404  50.913 1.00 60.78  ? 66  GLU B O   1 
ATOM   3593 C  CB  . GLU B 1 66  ? 6.305   35.260  52.319 1.00 63.34  ? 66  GLU B CB  1 
ATOM   3594 C  CG  . GLU B 1 66  ? 7.470   36.061  51.779 1.00 70.45  ? 66  GLU B CG  1 
ATOM   3595 C  CD  . GLU B 1 66  ? 7.088   37.189  50.845 1.00 79.87  ? 66  GLU B CD  1 
ATOM   3596 O  OE1 . GLU B 1 66  ? 7.652   37.238  49.729 1.00 55.91  ? 66  GLU B OE1 1 
ATOM   3597 O  OE2 . GLU B 1 66  ? 6.237   38.027  51.227 1.00 78.97  ? 66  GLU B OE2 1 
ATOM   3598 N  N   . MET B 1 67  ? 5.917   32.190  52.732 1.00 60.73  ? 67  MET B N   1 
ATOM   3599 C  CA  . MET B 1 67  ? 6.347   30.861  53.216 1.00 58.26  ? 67  MET B CA  1 
ATOM   3600 C  C   . MET B 1 67  ? 6.169   29.821  52.112 1.00 58.72  ? 67  MET B C   1 
ATOM   3601 O  O   . MET B 1 67  ? 6.999   28.929  51.970 1.00 55.39  ? 67  MET B O   1 
ATOM   3602 C  CB  . MET B 1 67  ? 5.553   30.496  54.505 1.00 61.87  ? 67  MET B CB  1 
ATOM   3603 C  CG  . MET B 1 67  ? 5.893   29.140  55.174 1.00 63.73  ? 67  MET B CG  1 
ATOM   3604 S  SD  . MET B 1 67  ? 7.635   28.686  55.481 1.00 66.61  ? 67  MET B SD  1 
ATOM   3605 C  CE  . MET B 1 67  ? 8.250   30.129  56.393 1.00 65.81  ? 67  MET B CE  1 
ATOM   3606 N  N   . MET B 1 68  ? 5.113   29.994  51.294 1.00 56.24  ? 68  MET B N   1 
ATOM   3607 C  CA  . MET B 1 68  ? 4.785   29.154  50.154 1.00 54.28  ? 68  MET B CA  1 
ATOM   3608 C  C   . MET B 1 68  ? 5.795   29.418  49.069 1.00 54.90  ? 68  MET B C   1 
ATOM   3609 O  O   . MET B 1 68  ? 6.319   28.459  48.512 1.00 52.80  ? 68  MET B O   1 
ATOM   3610 C  CB  . MET B 1 68  ? 3.347   29.418  49.666 1.00 58.73  ? 68  MET B CB  1 
ATOM   3611 C  CG  . MET B 1 68  ? 2.948   28.628  48.429 1.00 62.00  ? 68  MET B CG  1 
ATOM   3612 S  SD  . MET B 1 68  ? 3.209   26.843  48.510 1.00 64.05  ? 68  MET B SD  1 
ATOM   3613 C  CE  . MET B 1 68  ? 1.699   26.294  47.807 1.00 61.78  ? 68  MET B CE  1 
ATOM   3614 N  N   . LYS B 1 69  ? 6.107   30.705  48.795 1.00 51.16  ? 69  LYS B N   1 
ATOM   3615 C  CA  . LYS B 1 69  ? 7.109   31.072  47.785 1.00 49.75  ? 69  LYS B CA  1 
ATOM   3616 C  C   . LYS B 1 69  ? 8.458   30.423  48.124 1.00 51.36  ? 69  LYS B C   1 
ATOM   3617 O  O   . LYS B 1 69  ? 9.086   29.822  47.246 1.00 49.03  ? 69  LYS B O   1 
ATOM   3618 C  CB  . LYS B 1 69  ? 7.239   32.597  47.642 1.00 53.53  ? 69  LYS B CB  1 
ATOM   3619 C  CG  . LYS B 1 69  ? 6.091   33.241  46.866 1.00 60.17  ? 69  LYS B CG  1 
ATOM   3620 C  CD  . LYS B 1 69  ? 5.712   34.621  47.435 1.00 65.79  ? 69  LYS B CD  1 
ATOM   3621 C  CE  . LYS B 1 69  ? 6.257   35.781  46.650 1.00 61.61  ? 69  LYS B CE  1 
ATOM   3622 N  NZ  . LYS B 1 69  ? 6.080   37.034  47.401 1.00 59.90  ? 69  LYS B NZ  1 
ATOM   3623 N  N   . ARG B 1 70  ? 8.831   30.458  49.426 1.00 47.81  ? 70  ARG B N   1 
ATOM   3624 C  CA  . ARG B 1 70  ? 10.040  29.862  49.996 1.00 46.05  ? 70  ARG B CA  1 
ATOM   3625 C  C   . ARG B 1 70  ? 10.047  28.343  49.811 1.00 49.56  ? 70  ARG B C   1 
ATOM   3626 O  O   . ARG B 1 70  ? 11.087  27.751  49.469 1.00 47.64  ? 70  ARG B O   1 
ATOM   3627 C  CB  . ARG B 1 70  ? 10.101  30.175  51.486 1.00 45.45  ? 70  ARG B CB  1 
ATOM   3628 C  CG  . ARG B 1 70  ? 11.469  29.943  52.073 1.00 49.18  ? 70  ARG B CG  1 
ATOM   3629 C  CD  . ARG B 1 70  ? 11.379  29.494  53.507 1.00 47.62  ? 70  ARG B CD  1 
ATOM   3630 N  NE  . ARG B 1 70  ? 12.528  28.659  53.826 1.00 43.56  ? 70  ARG B NE  1 
ATOM   3631 C  CZ  . ARG B 1 70  ? 12.909  28.349  55.054 1.00 49.90  ? 70  ARG B CZ  1 
ATOM   3632 N  NH1 . ARG B 1 70  ? 12.246  28.821  56.099 1.00 41.25  ? 70  ARG B NH1 1 
ATOM   3633 N  NH2 . ARG B 1 70  ? 13.967  27.574  55.249 1.00 28.53  ? 70  ARG B NH2 1 
ATOM   3634 N  N   . ALA B 1 71  ? 8.867   27.727  50.042 1.00 46.90  ? 71  ALA B N   1 
ATOM   3635 C  CA  . ALA B 1 71  ? 8.624   26.292  49.929 1.00 45.18  ? 71  ALA B CA  1 
ATOM   3636 C  C   . ALA B 1 71  ? 8.778   25.773  48.516 1.00 47.86  ? 71  ALA B C   1 
ATOM   3637 O  O   . ALA B 1 71  ? 9.040   24.585  48.349 1.00 46.50  ? 71  ALA B O   1 
ATOM   3638 C  CB  . ALA B 1 71  ? 7.237   25.962  50.439 1.00 46.86  ? 71  ALA B CB  1 
ATOM   3639 N  N   . LEU B 1 72  ? 8.608   26.642  47.508 1.00 45.04  ? 72  LEU B N   1 
ATOM   3640 C  CA  . LEU B 1 72  ? 8.692   26.261  46.100 1.00 44.32  ? 72  LEU B CA  1 
ATOM   3641 C  C   . LEU B 1 72  ? 10.020  26.640  45.419 1.00 48.47  ? 72  LEU B C   1 
ATOM   3642 O  O   . LEU B 1 72  ? 10.236  26.270  44.261 1.00 47.90  ? 72  LEU B O   1 
ATOM   3643 C  CB  . LEU B 1 72  ? 7.498   26.835  45.313 1.00 45.77  ? 72  LEU B CB  1 
ATOM   3644 C  CG  . LEU B 1 72  ? 6.101   26.531  45.842 1.00 50.76  ? 72  LEU B CG  1 
ATOM   3645 C  CD1 . LEU B 1 72  ? 5.147   27.614  45.437 1.00 53.20  ? 72  LEU B CD1 1 
ATOM   3646 C  CD2 . LEU B 1 72  ? 5.611   25.147  45.414 1.00 50.09  ? 72  LEU B CD2 1 
ATOM   3647 N  N   . GLN B 1 73  ? 10.906  27.361  46.130 1.00 44.69  ? 73  GLN B N   1 
ATOM   3648 C  CA  . GLN B 1 73  ? 12.197  27.823  45.598 1.00 43.52  ? 73  GLN B CA  1 
ATOM   3649 C  C   . GLN B 1 73  ? 13.345  26.976  46.114 1.00 42.04  ? 73  GLN B C   1 
ATOM   3650 O  O   . GLN B 1 73  ? 13.172  26.327  47.149 1.00 41.07  ? 73  GLN B O   1 
ATOM   3651 C  CB  . GLN B 1 73  ? 12.406  29.298  45.994 1.00 47.01  ? 73  GLN B CB  1 
ATOM   3652 C  CG  . GLN B 1 73  ? 13.759  29.923  45.653 1.00 58.70  ? 73  GLN B CG  1 
ATOM   3653 C  CD  . GLN B 1 73  ? 13.956  30.031  44.180 1.00 76.13  ? 73  GLN B CD  1 
ATOM   3654 O  OE1 . GLN B 1 73  ? 14.364  29.069  43.535 1.00 74.17  ? 73  GLN B OE1 1 
ATOM   3655 N  NE2 . GLN B 1 73  ? 13.669  31.201  43.622 1.00 66.07  ? 73  GLN B NE2 1 
ATOM   3656 N  N   . TYR B 1 74  ? 14.522  27.017  45.419 1.00 34.87  ? 74  TYR B N   1 
ATOM   3657 C  CA  . TYR B 1 74  ? 15.749  26.304  45.803 1.00 33.04  ? 74  TYR B CA  1 
ATOM   3658 C  C   . TYR B 1 74  ? 16.104  26.599  47.270 1.00 39.65  ? 74  TYR B C   1 
ATOM   3659 O  O   . TYR B 1 74  ? 16.083  27.764  47.688 1.00 44.27  ? 74  TYR B O   1 
ATOM   3660 C  CB  . TYR B 1 74  ? 16.951  26.713  44.921 1.00 33.21  ? 74  TYR B CB  1 
ATOM   3661 C  CG  . TYR B 1 74  ? 16.908  26.254  43.477 1.00 32.93  ? 74  TYR B CG  1 
ATOM   3662 C  CD1 . TYR B 1 74  ? 17.049  24.908  43.146 1.00 32.32  ? 74  TYR B CD1 1 
ATOM   3663 C  CD2 . TYR B 1 74  ? 16.834  27.175  42.435 1.00 34.66  ? 74  TYR B CD2 1 
ATOM   3664 C  CE1 . TYR B 1 74  ? 17.045  24.484  41.818 1.00 30.10  ? 74  TYR B CE1 1 
ATOM   3665 C  CE2 . TYR B 1 74  ? 16.841  26.765  41.105 1.00 35.06  ? 74  TYR B CE2 1 
ATOM   3666 C  CZ  . TYR B 1 74  ? 16.948  25.417  40.800 1.00 38.63  ? 74  TYR B CZ  1 
ATOM   3667 O  OH  . TYR B 1 74  ? 16.905  25.014  39.485 1.00 38.61  ? 74  TYR B OH  1 
ATOM   3668 N  N   . SER B 1 75  ? 16.394  25.559  48.050 1.00 31.96  ? 75  SER B N   1 
ATOM   3669 C  CA  . SER B 1 75  ? 16.769  25.705  49.443 1.00 31.91  ? 75  SER B CA  1 
ATOM   3670 C  C   . SER B 1 75  ? 18.210  25.183  49.642 1.00 36.72  ? 75  SER B C   1 
ATOM   3671 O  O   . SER B 1 75  ? 18.769  24.643  48.688 1.00 33.82  ? 75  SER B O   1 
ATOM   3672 C  CB  . SER B 1 75  ? 15.752  25.004  50.342 1.00 35.82  ? 75  SER B CB  1 
ATOM   3673 O  OG  . SER B 1 75  ? 15.834  23.585  50.397 1.00 45.06  ? 75  SER B OG  1 
ATOM   3674 N  N   . PRO B 1 76  ? 18.865  25.335  50.823 1.00 37.92  ? 76  PRO B N   1 
ATOM   3675 C  CA  . PRO B 1 76  ? 20.242  24.834  50.951 1.00 38.18  ? 76  PRO B CA  1 
ATOM   3676 C  C   . PRO B 1 76  ? 20.362  23.353  50.671 1.00 42.52  ? 76  PRO B C   1 
ATOM   3677 O  O   . PRO B 1 76  ? 19.456  22.559  50.993 1.00 41.72  ? 76  PRO B O   1 
ATOM   3678 C  CB  . PRO B 1 76  ? 20.615  25.136  52.401 1.00 41.28  ? 76  PRO B CB  1 
ATOM   3679 C  CG  . PRO B 1 76  ? 19.689  26.195  52.830 1.00 47.89  ? 76  PRO B CG  1 
ATOM   3680 C  CD  . PRO B 1 76  ? 18.411  25.958  52.084 1.00 42.29  ? 76  PRO B CD  1 
ATOM   3681 N  N   . SER B 1 77  ? 21.511  23.016  50.066 1.00 39.16  ? 77  SER B N   1 
ATOM   3682 C  CA  . SER B 1 77  ? 21.980  21.699  49.642 1.00 37.16  ? 77  SER B CA  1 
ATOM   3683 C  C   . SER B 1 77  ? 21.952  20.603  50.750 1.00 38.16  ? 77  SER B C   1 
ATOM   3684 O  O   . SER B 1 77  ? 21.513  19.492  50.476 1.00 34.10  ? 77  SER B O   1 
ATOM   3685 C  CB  . SER B 1 77  ? 23.366  21.843  49.016 1.00 41.17  ? 77  SER B CB  1 
ATOM   3686 O  OG  . SER B 1 77  ? 23.699  20.775  48.149 1.00 48.61  ? 77  SER B OG  1 
ATOM   3687 N  N   . ALA B 1 78  ? 22.371  20.928  51.991 1.00 38.21  ? 78  ALA B N   1 
ATOM   3688 C  CA  . ALA B 1 78  ? 22.379  19.978  53.122 1.00 39.38  ? 78  ALA B CA  1 
ATOM   3689 C  C   . ALA B 1 78  ? 21.096  20.012  53.978 1.00 46.44  ? 78  ALA B C   1 
ATOM   3690 O  O   . ALA B 1 78  ? 21.067  19.442  55.079 1.00 46.17  ? 78  ALA B O   1 
ATOM   3691 C  CB  . ALA B 1 78  ? 23.597  20.211  54.005 1.00 41.29  ? 78  ALA B CB  1 
ATOM   3692 N  N   . GLY B 1 79  ? 20.057  20.668  53.456 1.00 44.21  ? 79  GLY B N   1 
ATOM   3693 C  CA  . GLY B 1 79  ? 18.775  20.824  54.136 1.00 43.82  ? 79  GLY B CA  1 
ATOM   3694 C  C   . GLY B 1 79  ? 18.508  22.222  54.673 1.00 46.53  ? 79  GLY B C   1 
ATOM   3695 O  O   . GLY B 1 79  ? 19.413  23.069  54.760 1.00 47.37  ? 79  GLY B O   1 
ATOM   3696 N  N   . ILE B 1 80  ? 17.247  22.470  55.042 1.00 39.95  ? 80  ILE B N   1 
ATOM   3697 C  CA  . ILE B 1 80  ? 16.861  23.766  55.576 1.00 39.88  ? 80  ILE B CA  1 
ATOM   3698 C  C   . ILE B 1 80  ? 17.408  23.962  56.999 1.00 42.49  ? 80  ILE B C   1 
ATOM   3699 O  O   . ILE B 1 80  ? 17.436  22.990  57.776 1.00 41.14  ? 80  ILE B O   1 
ATOM   3700 C  CB  . ILE B 1 80  ? 15.350  24.113  55.405 1.00 42.83  ? 80  ILE B CB  1 
ATOM   3701 C  CG1 . ILE B 1 80  ? 14.411  23.040  55.991 1.00 41.63  ? 80  ILE B CG1 1 
ATOM   3702 C  CG2 . ILE B 1 80  ? 15.027  24.414  53.953 1.00 42.65  ? 80  ILE B CG2 1 
ATOM   3703 C  CD1 . ILE B 1 80  ? 13.449  23.534  57.035 1.00 39.15  ? 80  ILE B CD1 1 
ATOM   3704 N  N   . PRO B 1 81  ? 17.893  25.200  57.316 1.00 37.97  ? 81  PRO B N   1 
ATOM   3705 C  CA  . PRO B 1 81  ? 18.476  25.467  58.641 1.00 37.66  ? 81  PRO B CA  1 
ATOM   3706 C  C   . PRO B 1 81  ? 17.666  24.981  59.835 1.00 40.11  ? 81  PRO B C   1 
ATOM   3707 O  O   . PRO B 1 81  ? 18.236  24.309  60.704 1.00 39.40  ? 81  PRO B O   1 
ATOM   3708 C  CB  . PRO B 1 81  ? 18.603  26.985  58.662 1.00 41.68  ? 81  PRO B CB  1 
ATOM   3709 C  CG  . PRO B 1 81  ? 18.719  27.387  57.266 1.00 46.36  ? 81  PRO B CG  1 
ATOM   3710 C  CD  . PRO B 1 81  ? 17.935  26.407  56.461 1.00 40.39  ? 81  PRO B CD  1 
ATOM   3711 N  N   . GLU B 1 82  ? 16.340  25.310  59.866 1.00 35.91  ? 82  GLU B N   1 
ATOM   3712 C  CA  . GLU B 1 82  ? 15.408  24.958  60.948 1.00 35.37  ? 82  GLU B CA  1 
ATOM   3713 C  C   . GLU B 1 82  ? 15.173  23.484  61.175 1.00 36.86  ? 82  GLU B C   1 
ATOM   3714 O  O   . GLU B 1 82  ? 14.955  23.099  62.321 1.00 36.70  ? 82  GLU B O   1 
ATOM   3715 C  CB  . GLU B 1 82  ? 14.125  25.816  61.023 1.00 37.93  ? 82  GLU B CB  1 
ATOM   3716 C  CG  . GLU B 1 82  ? 13.377  26.070  59.728 1.00 48.21  ? 82  GLU B CG  1 
ATOM   3717 C  CD  . GLU B 1 82  ? 14.040  27.076  58.809 1.00 71.83  ? 82  GLU B CD  1 
ATOM   3718 O  OE1 . GLU B 1 82  ? 14.864  26.650  57.969 1.00 57.38  ? 82  GLU B OE1 1 
ATOM   3719 O  OE2 . GLU B 1 82  ? 13.799  28.293  58.979 1.00 76.48  ? 82  GLU B OE2 1 
ATOM   3720 N  N   . LEU B 1 83  ? 15.266  22.645  60.117 1.00 31.61  ? 83  LEU B N   1 
ATOM   3721 C  CA  . LEU B 1 83  ? 15.179  21.186  60.296 1.00 29.91  ? 83  LEU B CA  1 
ATOM   3722 C  C   . LEU B 1 83  ? 16.529  20.778  60.894 1.00 35.57  ? 83  LEU B C   1 
ATOM   3723 O  O   . LEU B 1 83  ? 16.608  20.260  62.025 1.00 34.05  ? 83  LEU B O   1 
ATOM   3724 C  CB  . LEU B 1 83  ? 15.029  20.445  58.950 1.00 27.32  ? 83  LEU B CB  1 
ATOM   3725 C  CG  . LEU B 1 83  ? 13.816  19.534  58.701 1.00 29.32  ? 83  LEU B CG  1 
ATOM   3726 C  CD1 . LEU B 1 83  ? 14.107  18.582  57.581 1.00 26.56  ? 83  LEU B CD1 1 
ATOM   3727 C  CD2 . LEU B 1 83  ? 13.294  18.809  59.977 1.00 30.62  ? 83  LEU B CD2 1 
ATOM   3728 N  N   . LEU B 1 84  ? 17.599  21.081  60.112 1.00 33.29  ? 84  LEU B N   1 
ATOM   3729 C  CA  . LEU B 1 84  ? 18.996  20.820  60.422 1.00 34.00  ? 84  LEU B CA  1 
ATOM   3730 C  C   . LEU B 1 84  ? 19.365  21.190  61.872 1.00 43.14  ? 84  LEU B C   1 
ATOM   3731 O  O   . LEU B 1 84  ? 20.169  20.492  62.493 1.00 42.31  ? 84  LEU B O   1 
ATOM   3732 C  CB  . LEU B 1 84  ? 19.881  21.525  59.387 1.00 33.49  ? 84  LEU B CB  1 
ATOM   3733 C  CG  . LEU B 1 84  ? 21.068  20.746  58.796 1.00 36.31  ? 84  LEU B CG  1 
ATOM   3734 C  CD1 . LEU B 1 84  ? 20.740  19.295  58.525 1.00 34.62  ? 84  LEU B CD1 1 
ATOM   3735 C  CD2 . LEU B 1 84  ? 21.545  21.384  57.521 1.00 38.02  ? 84  LEU B CD2 1 
ATOM   3736 N  N   . SER B 1 85  ? 18.708  22.222  62.427 1.00 43.96  ? 85  SER B N   1 
ATOM   3737 C  CA  . SER B 1 85  ? 18.905  22.625  63.812 1.00 47.50  ? 85  SER B CA  1 
ATOM   3738 C  C   . SER B 1 85  ? 18.178  21.657  64.756 1.00 53.15  ? 85  SER B C   1 
ATOM   3739 O  O   . SER B 1 85  ? 18.798  21.110  65.675 1.00 52.78  ? 85  SER B O   1 
ATOM   3740 C  CB  . SER B 1 85  ? 18.409  24.051  64.033 1.00 54.88  ? 85  SER B CB  1 
ATOM   3741 O  OG  . SER B 1 85  ? 17.017  24.160  63.777 1.00 66.88  ? 85  SER B OG  1 
ATOM   3742 N  N   . TRP B 1 86  ? 16.859  21.444  64.514 1.00 50.83  ? 86  TRP B N   1 
ATOM   3743 C  CA  . TRP B 1 86  ? 15.980  20.588  65.323 1.00 50.97  ? 86  TRP B CA  1 
ATOM   3744 C  C   . TRP B 1 86  ? 16.565  19.210  65.406 1.00 50.81  ? 86  TRP B C   1 
ATOM   3745 O  O   . TRP B 1 86  ? 16.698  18.659  66.500 1.00 50.69  ? 86  TRP B O   1 
ATOM   3746 C  CB  . TRP B 1 86  ? 14.545  20.543  64.741 1.00 49.94  ? 86  TRP B CB  1 
ATOM   3747 C  CG  . TRP B 1 86  ? 13.490  20.085  65.717 1.00 52.13  ? 86  TRP B CG  1 
ATOM   3748 C  CD1 . TRP B 1 86  ? 12.697  20.875  66.499 1.00 57.02  ? 86  TRP B CD1 1 
ATOM   3749 C  CD2 . TRP B 1 86  ? 13.099  18.729  65.989 1.00 51.12  ? 86  TRP B CD2 1 
ATOM   3750 N  NE1 . TRP B 1 86  ? 11.850  20.097  67.257 1.00 56.76  ? 86  TRP B NE1 1 
ATOM   3751 C  CE2 . TRP B 1 86  ? 12.078  18.775  66.968 1.00 56.41  ? 86  TRP B CE2 1 
ATOM   3752 C  CE3 . TRP B 1 86  ? 13.497  17.477  65.481 1.00 50.55  ? 86  TRP B CE3 1 
ATOM   3753 C  CZ2 . TRP B 1 86  ? 11.449  17.620  67.451 1.00 55.23  ? 86  TRP B CZ2 1 
ATOM   3754 C  CZ3 . TRP B 1 86  ? 12.890  16.332  65.976 1.00 51.74  ? 86  TRP B CZ3 1 
ATOM   3755 C  CH2 . TRP B 1 86  ? 11.882  16.409  66.954 1.00 53.74  ? 86  TRP B CH2 1 
ATOM   3756 N  N   . LEU B 1 87  ? 16.986  18.695  64.239 1.00 44.33  ? 87  LEU B N   1 
ATOM   3757 C  CA  . LEU B 1 87  ? 17.601  17.388  64.077 1.00 41.57  ? 87  LEU B CA  1 
ATOM   3758 C  C   . LEU B 1 87  ? 18.881  17.261  64.885 1.00 44.49  ? 87  LEU B C   1 
ATOM   3759 O  O   . LEU B 1 87  ? 19.072  16.235  65.536 1.00 44.10  ? 87  LEU B O   1 
ATOM   3760 C  CB  . LEU B 1 87  ? 17.830  17.100  62.599 1.00 39.46  ? 87  LEU B CB  1 
ATOM   3761 C  CG  . LEU B 1 87  ? 16.735  16.318  61.858 1.00 41.95  ? 87  LEU B CG  1 
ATOM   3762 C  CD1 . LEU B 1 87  ? 15.481  16.078  62.709 1.00 42.36  ? 87  LEU B CD1 1 
ATOM   3763 C  CD2 . LEU B 1 87  ? 16.430  16.941  60.519 1.00 42.52  ? 87  LEU B CD2 1 
ATOM   3764 N  N   . LYS B 1 88  ? 19.705  18.332  64.924 1.00 40.14  ? 88  LYS B N   1 
ATOM   3765 C  CA  . LYS B 1 88  ? 20.926  18.348  65.723 1.00 40.28  ? 88  LYS B CA  1 
ATOM   3766 C  C   . LYS B 1 88  ? 20.521  18.182  67.191 1.00 45.32  ? 88  LYS B C   1 
ATOM   3767 O  O   . LYS B 1 88  ? 20.914  17.192  67.820 1.00 44.42  ? 88  LYS B O   1 
ATOM   3768 C  CB  . LYS B 1 88  ? 21.725  19.646  65.496 1.00 42.68  ? 88  LYS B CB  1 
ATOM   3769 C  CG  . LYS B 1 88  ? 23.138  19.657  66.088 1.00 43.79  ? 88  LYS B CG  1 
ATOM   3770 C  CD  . LYS B 1 88  ? 23.704  21.083  66.170 1.00 49.57  ? 88  LYS B CD  1 
ATOM   3771 C  CE  . LYS B 1 88  ? 24.924  21.230  67.053 1.00 54.21  ? 88  LYS B CE  1 
ATOM   3772 N  NZ  . LYS B 1 88  ? 26.195  21.191  66.277 1.00 59.33  ? 88  LYS B NZ  1 
ATOM   3773 N  N   . GLN B 1 89  ? 19.644  19.084  67.687 1.00 43.25  ? 89  GLN B N   1 
ATOM   3774 C  CA  . GLN B 1 89  ? 19.155  19.069  69.066 1.00 44.63  ? 89  GLN B CA  1 
ATOM   3775 C  C   . GLN B 1 89  ? 18.591  17.718  69.489 1.00 47.68  ? 89  GLN B C   1 
ATOM   3776 O  O   . GLN B 1 89  ? 18.946  17.233  70.568 1.00 46.54  ? 89  GLN B O   1 
ATOM   3777 C  CB  . GLN B 1 89  ? 18.162  20.209  69.320 1.00 47.16  ? 89  GLN B CB  1 
ATOM   3778 C  CG  . GLN B 1 89  ? 17.966  20.551  70.804 1.00 76.87  ? 89  GLN B CG  1 
ATOM   3779 C  CD  . GLN B 1 89  ? 19.220  20.581  71.673 1.00 101.12 ? 89  GLN B CD  1 
ATOM   3780 O  OE1 . GLN B 1 89  ? 19.291  19.906  72.702 1.00 94.60  ? 89  GLN B OE1 1 
ATOM   3781 N  NE2 . GLN B 1 89  ? 20.218  21.387  71.312 1.00 98.11  ? 89  GLN B NE2 1 
ATOM   3782 N  N   . LEU B 1 90  ? 17.783  17.085  68.594 1.00 44.38  ? 90  LEU B N   1 
ATOM   3783 C  CA  . LEU B 1 90  ? 17.156  15.774  68.788 1.00 43.45  ? 90  LEU B CA  1 
ATOM   3784 C  C   . LEU B 1 90  ? 18.183  14.692  69.060 1.00 47.31  ? 90  LEU B C   1 
ATOM   3785 O  O   . LEU B 1 90  ? 18.060  13.961  70.051 1.00 47.21  ? 90  LEU B O   1 
ATOM   3786 C  CB  . LEU B 1 90  ? 16.281  15.380  67.584 1.00 41.72  ? 90  LEU B CB  1 
ATOM   3787 C  CG  . LEU B 1 90  ? 15.614  13.992  67.687 1.00 46.09  ? 90  LEU B CG  1 
ATOM   3788 C  CD1 . LEU B 1 90  ? 14.404  14.007  68.614 1.00 47.63  ? 90  LEU B CD1 1 
ATOM   3789 C  CD2 . LEU B 1 90  ? 15.236  13.443  66.325 1.00 46.47  ? 90  LEU B CD2 1 
ATOM   3790 N  N   . GLN B 1 91  ? 19.198  14.610  68.173 1.00 43.18  ? 91  GLN B N   1 
ATOM   3791 C  CA  . GLN B 1 91  ? 20.295  13.637  68.207 1.00 42.67  ? 91  GLN B CA  1 
ATOM   3792 C  C   . GLN B 1 91  ? 21.144  13.731  69.489 1.00 47.66  ? 91  GLN B C   1 
ATOM   3793 O  O   . GLN B 1 91  ? 21.448  12.701  70.107 1.00 45.43  ? 91  GLN B O   1 
ATOM   3794 C  CB  . GLN B 1 91  ? 21.147  13.739  66.922 1.00 42.83  ? 91  GLN B CB  1 
ATOM   3795 C  CG  . GLN B 1 91  ? 20.375  13.441  65.620 1.00 48.63  ? 91  GLN B CG  1 
ATOM   3796 C  CD  . GLN B 1 91  ? 20.139  11.976  65.336 1.00 60.89  ? 91  GLN B CD  1 
ATOM   3797 O  OE1 . GLN B 1 91  ? 19.210  11.336  65.857 1.00 52.30  ? 91  GLN B OE1 1 
ATOM   3798 N  NE2 . GLN B 1 91  ? 20.921  11.439  64.421 1.00 55.06  ? 91  GLN B NE2 1 
ATOM   3799 N  N   . ILE B 1 92  ? 21.489  14.969  69.898 1.00 47.67  ? 92  ILE B N   1 
ATOM   3800 C  CA  . ILE B 1 92  ? 22.236  15.217  71.130 1.00 50.70  ? 92  ILE B CA  1 
ATOM   3801 C  C   . ILE B 1 92  ? 21.332  14.792  72.309 1.00 58.25  ? 92  ILE B C   1 
ATOM   3802 O  O   . ILE B 1 92  ? 21.799  14.068  73.199 1.00 60.28  ? 92  ILE B O   1 
ATOM   3803 C  CB  . ILE B 1 92  ? 22.726  16.695  71.283 1.00 55.39  ? 92  ILE B CB  1 
ATOM   3804 C  CG1 . ILE B 1 92  ? 23.311  17.273  69.973 1.00 55.30  ? 92  ILE B CG1 1 
ATOM   3805 C  CG2 . ILE B 1 92  ? 23.732  16.824  72.433 1.00 57.78  ? 92  ILE B CG2 1 
ATOM   3806 C  CD1 . ILE B 1 92  ? 23.139  18.859  69.822 1.00 63.14  ? 92  ILE B CD1 1 
ATOM   3807 N  N   . LYS B 1 93  ? 20.030  15.209  72.295 1.00 53.26  ? 93  LYS B N   1 
ATOM   3808 C  CA  . LYS B 1 93  ? 19.088  14.860  73.364 1.00 53.03  ? 93  LYS B CA  1 
ATOM   3809 C  C   . LYS B 1 93  ? 18.900  13.350  73.482 1.00 54.07  ? 93  LYS B C   1 
ATOM   3810 O  O   . LYS B 1 93  ? 19.007  12.819  74.583 1.00 54.69  ? 93  LYS B O   1 
ATOM   3811 C  CB  . LYS B 1 93  ? 17.749  15.586  73.207 1.00 55.45  ? 93  LYS B CB  1 
ATOM   3812 N  N   . LEU B 1 94  ? 18.715  12.659  72.346 1.00 47.94  ? 94  LEU B N   1 
ATOM   3813 C  CA  . LEU B 1 94  ? 18.543  11.206  72.298 1.00 46.54  ? 94  LEU B CA  1 
ATOM   3814 C  C   . LEU B 1 94  ? 19.750  10.380  72.680 1.00 54.16  ? 94  LEU B C   1 
ATOM   3815 O  O   . LEU B 1 94  ? 19.609  9.449   73.462 1.00 55.51  ? 94  LEU B O   1 
ATOM   3816 C  CB  . LEU B 1 94  ? 18.034  10.746  70.942 1.00 43.52  ? 94  LEU B CB  1 
ATOM   3817 C  CG  . LEU B 1 94  ? 16.549  10.637  70.874 1.00 46.62  ? 94  LEU B CG  1 
ATOM   3818 C  CD1 . LEU B 1 94  ? 16.063  11.006  69.529 1.00 44.49  ? 94  LEU B CD1 1 
ATOM   3819 C  CD2 . LEU B 1 94  ? 16.066  9.259   71.315 1.00 48.60  ? 94  LEU B CD2 1 
ATOM   3820 N  N   . HIS B 1 95  ? 20.911  10.657  72.096 1.00 52.08  ? 95  HIS B N   1 
ATOM   3821 C  CA  . HIS B 1 95  ? 22.101  9.858   72.363 1.00 53.22  ? 95  HIS B CA  1 
ATOM   3822 C  C   . HIS B 1 95  ? 23.365  10.687  72.182 1.00 58.14  ? 95  HIS B C   1 
ATOM   3823 O  O   . HIS B 1 95  ? 24.216  10.339  71.347 1.00 57.34  ? 95  HIS B O   1 
ATOM   3824 C  CB  . HIS B 1 95  ? 22.115  8.600   71.473 1.00 52.60  ? 95  HIS B CB  1 
ATOM   3825 C  CG  . HIS B 1 95  ? 21.514  8.850   70.137 1.00 54.30  ? 95  HIS B CG  1 
ATOM   3826 N  ND1 . HIS B 1 95  ? 20.327  8.259   69.768 1.00 55.10  ? 95  HIS B ND1 1 
ATOM   3827 C  CD2 . HIS B 1 95  ? 21.888  9.721   69.174 1.00 55.60  ? 95  HIS B CD2 1 
ATOM   3828 C  CE1 . HIS B 1 95  ? 20.045  8.736   68.567 1.00 53.32  ? 95  HIS B CE1 1 
ATOM   3829 N  NE2 . HIS B 1 95  ? 20.948  9.633   68.176 1.00 53.91  ? 95  HIS B NE2 1 
ATOM   3830 N  N   . ASN B 1 96  ? 23.468  11.788  72.996 1.00 55.15  ? 96  ASN B N   1 
ATOM   3831 C  CA  . ASN B 1 96  ? 24.575  12.746  73.123 1.00 55.80  ? 96  ASN B CA  1 
ATOM   3832 C  C   . ASN B 1 96  ? 25.870  12.133  72.621 1.00 60.02  ? 96  ASN B C   1 
ATOM   3833 O  O   . ASN B 1 96  ? 26.465  11.269  73.276 1.00 60.40  ? 96  ASN B O   1 
ATOM   3834 C  CB  . ASN B 1 96  ? 24.691  13.261  74.578 1.00 57.31  ? 96  ASN B CB  1 
ATOM   3835 C  CG  . ASN B 1 96  ? 25.926  14.066  74.956 1.00 73.28  ? 96  ASN B CG  1 
ATOM   3836 O  OD1 . ASN B 1 96  ? 26.903  14.203  74.213 1.00 67.08  ? 96  ASN B OD1 1 
ATOM   3837 N  ND2 . ASN B 1 96  ? 25.926  14.583  76.165 1.00 64.81  ? 96  ASN B ND2 1 
ATOM   3838 N  N   . PRO B 1 97  ? 26.250  12.515  71.390 1.00 56.15  ? 97  PRO B N   1 
ATOM   3839 C  CA  . PRO B 1 97  ? 27.441  11.930  70.774 1.00 55.88  ? 97  PRO B CA  1 
ATOM   3840 C  C   . PRO B 1 97  ? 28.706  12.551  71.348 1.00 60.98  ? 97  PRO B C   1 
ATOM   3841 O  O   . PRO B 1 97  ? 28.699  13.752  71.641 1.00 60.96  ? 97  PRO B O   1 
ATOM   3842 C  CB  . PRO B 1 97  ? 27.262  12.255  69.285 1.00 55.84  ? 97  PRO B CB  1 
ATOM   3843 C  CG  . PRO B 1 97  ? 25.862  12.818  69.152 1.00 58.81  ? 97  PRO B CG  1 
ATOM   3844 C  CD  . PRO B 1 97  ? 25.590  13.449  70.465 1.00 56.41  ? 97  PRO B CD  1 
ATOM   3845 N  N   . PRO B 1 98  ? 29.789  11.750  71.540 1.00 58.46  ? 98  PRO B N   1 
ATOM   3846 C  CA  . PRO B 1 98  ? 31.038  12.317  72.097 1.00 60.75  ? 98  PRO B CA  1 
ATOM   3847 C  C   . PRO B 1 98  ? 31.657  13.370  71.178 1.00 65.97  ? 98  PRO B C   1 
ATOM   3848 O  O   . PRO B 1 98  ? 32.308  14.325  71.629 1.00 68.08  ? 98  PRO B O   1 
ATOM   3849 C  CB  . PRO B 1 98  ? 31.971  11.099  72.204 1.00 62.82  ? 98  PRO B CB  1 
ATOM   3850 C  CG  . PRO B 1 98  ? 31.099  9.903   72.054 1.00 65.25  ? 98  PRO B CG  1 
ATOM   3851 C  CD  . PRO B 1 98  ? 29.937  10.312  71.228 1.00 58.64  ? 98  PRO B CD  1 
ATOM   3852 N  N   . THR B 1 99  ? 31.384  13.205  69.883 1.00 60.04  ? 99  THR B N   1 
ATOM   3853 C  CA  . THR B 1 99  ? 31.922  13.980  68.794 1.00 59.64  ? 99  THR B CA  1 
ATOM   3854 C  C   . THR B 1 99  ? 31.375  15.439  68.611 1.00 62.90  ? 99  THR B C   1 
ATOM   3855 O  O   . THR B 1 99  ? 31.941  16.195  67.811 1.00 62.45  ? 99  THR B O   1 
ATOM   3856 C  CB  . THR B 1 99  ? 32.042  13.031  67.589 1.00 66.83  ? 99  THR B CB  1 
ATOM   3857 O  OG1 . THR B 1 99  ? 33.378  13.036  67.077 1.00 68.75  ? 99  THR B OG1 1 
ATOM   3858 C  CG2 . THR B 1 99  ? 30.918  13.173  66.528 1.00 61.15  ? 99  THR B CG2 1 
ATOM   3859 N  N   . ILE B 1 100 ? 30.357  15.851  69.403 1.00 59.00  ? 100 ILE B N   1 
ATOM   3860 C  CA  . ILE B 1 100 ? 29.745  17.187  69.301 1.00 58.89  ? 100 ILE B CA  1 
ATOM   3861 C  C   . ILE B 1 100 ? 30.704  18.401  69.302 1.00 65.67  ? 100 ILE B C   1 
ATOM   3862 O  O   . ILE B 1 100 ? 30.657  19.206  68.367 1.00 66.25  ? 100 ILE B O   1 
ATOM   3863 C  CB  . ILE B 1 100 ? 28.438  17.415  70.125 1.00 61.48  ? 100 ILE B CB  1 
ATOM   3864 C  CG1 . ILE B 1 100 ? 28.677  17.481  71.635 1.00 65.12  ? 100 ILE B CG1 1 
ATOM   3865 C  CG2 . ILE B 1 100 ? 27.381  16.389  69.785 1.00 58.72  ? 100 ILE B CG2 1 
ATOM   3866 C  CD1 . ILE B 1 100 ? 27.462  18.044  72.463 1.00 77.47  ? 100 ILE B CD1 1 
ATOM   3867 N  N   . HIS B 1 101 ? 31.585  18.516  70.292 1.00 63.26  ? 101 HIS B N   1 
ATOM   3868 C  CA  . HIS B 1 101 ? 32.482  19.666  70.337 1.00 65.27  ? 101 HIS B CA  1 
ATOM   3869 C  C   . HIS B 1 101 ? 33.846  19.458  69.684 1.00 69.00  ? 101 HIS B C   1 
ATOM   3870 O  O   . HIS B 1 101 ? 34.634  20.407  69.604 1.00 70.24  ? 101 HIS B O   1 
ATOM   3871 C  CB  . HIS B 1 101 ? 32.595  20.207  71.765 1.00 69.38  ? 101 HIS B CB  1 
ATOM   3872 C  CG  . HIS B 1 101 ? 31.304  20.757  72.270 1.00 72.84  ? 101 HIS B CG  1 
ATOM   3873 N  ND1 . HIS B 1 101 ? 30.540  20.068  73.200 1.00 74.57  ? 101 HIS B ND1 1 
ATOM   3874 C  CD2 . HIS B 1 101 ? 30.649  21.888  71.912 1.00 74.79  ? 101 HIS B CD2 1 
ATOM   3875 C  CE1 . HIS B 1 101 ? 29.465  20.812  73.399 1.00 74.12  ? 101 HIS B CE1 1 
ATOM   3876 N  NE2 . HIS B 1 101 ? 29.484  21.915  72.640 1.00 74.58  ? 101 HIS B NE2 1 
ATOM   3877 N  N   . TYR B 1 102 ? 34.112  18.230  69.192 1.00 64.13  ? 102 TYR B N   1 
ATOM   3878 C  CA  . TYR B 1 102 ? 35.360  17.825  68.530 1.00 64.78  ? 102 TYR B CA  1 
ATOM   3879 C  C   . TYR B 1 102 ? 35.767  18.781  67.394 1.00 70.01  ? 102 TYR B C   1 
ATOM   3880 O  O   . TYR B 1 102 ? 34.877  19.268  66.694 1.00 68.27  ? 102 TYR B O   1 
ATOM   3881 C  CB  . TYR B 1 102 ? 35.183  16.418  67.932 1.00 63.46  ? 102 TYR B CB  1 
ATOM   3882 C  CG  . TYR B 1 102 ? 35.581  15.264  68.829 1.00 66.13  ? 102 TYR B CG  1 
ATOM   3883 C  CD1 . TYR B 1 102 ? 36.464  14.284  68.384 1.00 68.80  ? 102 TYR B CD1 1 
ATOM   3884 C  CD2 . TYR B 1 102 ? 35.025  15.113  70.096 1.00 67.01  ? 102 TYR B CD2 1 
ATOM   3885 C  CE1 . TYR B 1 102 ? 36.817  13.204  69.194 1.00 70.54  ? 102 TYR B CE1 1 
ATOM   3886 C  CE2 . TYR B 1 102 ? 35.353  14.026  70.905 1.00 68.55  ? 102 TYR B CE2 1 
ATOM   3887 C  CZ  . TYR B 1 102 ? 36.252  13.075  70.450 1.00 76.00  ? 102 TYR B CZ  1 
ATOM   3888 O  OH  . TYR B 1 102 ? 36.590  12.006  71.244 1.00 77.04  ? 102 TYR B OH  1 
ATOM   3889 N  N   . PRO B 1 103 ? 37.077  19.049  67.143 1.00 68.69  ? 103 PRO B N   1 
ATOM   3890 C  CA  . PRO B 1 103 ? 37.425  19.889  65.986 1.00 68.52  ? 103 PRO B CA  1 
ATOM   3891 C  C   . PRO B 1 103 ? 37.038  19.185  64.675 1.00 70.34  ? 103 PRO B C   1 
ATOM   3892 O  O   . PRO B 1 103 ? 37.152  17.955  64.616 1.00 68.77  ? 103 PRO B O   1 
ATOM   3893 C  CB  . PRO B 1 103 ? 38.943  20.055  66.103 1.00 73.11  ? 103 PRO B CB  1 
ATOM   3894 C  CG  . PRO B 1 103 ? 39.401  18.903  66.901 1.00 78.13  ? 103 PRO B CG  1 
ATOM   3895 C  CD  . PRO B 1 103 ? 38.287  18.561  67.840 1.00 72.70  ? 103 PRO B CD  1 
ATOM   3896 N  N   . PRO B 1 104 ? 36.543  19.903  63.627 1.00 66.30  ? 104 PRO B N   1 
ATOM   3897 C  CA  . PRO B 1 104 ? 36.217  19.217  62.357 1.00 63.26  ? 104 PRO B CA  1 
ATOM   3898 C  C   . PRO B 1 104 ? 37.448  18.495  61.814 1.00 67.49  ? 104 PRO B C   1 
ATOM   3899 O  O   . PRO B 1 104 ? 37.321  17.381  61.316 1.00 63.83  ? 104 PRO B O   1 
ATOM   3900 C  CB  . PRO B 1 104 ? 35.751  20.352  61.442 1.00 64.41  ? 104 PRO B CB  1 
ATOM   3901 C  CG  . PRO B 1 104 ? 36.325  21.595  62.035 1.00 71.91  ? 104 PRO B CG  1 
ATOM   3902 C  CD  . PRO B 1 104 ? 36.354  21.365  63.512 1.00 68.97  ? 104 PRO B CD  1 
ATOM   3903 N  N   . SER B 1 105 ? 38.654  19.113  62.015 1.00 68.65  ? 105 SER B N   1 
ATOM   3904 C  CA  . SER B 1 105 ? 40.002  18.611  61.707 1.00 70.38  ? 105 SER B CA  1 
ATOM   3905 C  C   . SER B 1 105 ? 40.041  17.122  62.105 1.00 75.09  ? 105 SER B C   1 
ATOM   3906 O  O   . SER B 1 105 ? 40.382  16.271  61.277 1.00 73.31  ? 105 SER B O   1 
ATOM   3907 C  CB  . SER B 1 105 ? 41.052  19.403  62.488 1.00 76.00  ? 105 SER B CB  1 
ATOM   3908 O  OG  . SER B 1 105 ? 40.748  20.791  62.515 1.00 81.94  ? 105 SER B OG  1 
ATOM   3909 N  N   . GLN B 1 106 ? 39.584  16.815  63.350 1.00 73.27  ? 106 GLN B N   1 
ATOM   3910 C  CA  . GLN B 1 106 ? 39.410  15.453  63.847 1.00 72.56  ? 106 GLN B CA  1 
ATOM   3911 C  C   . GLN B 1 106 ? 38.093  14.931  63.217 1.00 72.92  ? 106 GLN B C   1 
ATOM   3912 O  O   . GLN B 1 106 ? 38.116  14.694  62.009 1.00 72.78  ? 106 GLN B O   1 
ATOM   3913 C  CB  . GLN B 1 106 ? 39.454  15.383  65.379 1.00 75.47  ? 106 GLN B CB  1 
ATOM   3914 C  CG  . GLN B 1 106 ? 40.866  15.517  65.932 1.00 92.93  ? 106 GLN B CG  1 
ATOM   3915 C  CD  . GLN B 1 106 ? 41.108  14.554  67.069 1.00 120.03 ? 106 GLN B CD  1 
ATOM   3916 O  OE1 . GLN B 1 106 ? 40.600  14.719  68.189 1.00 116.59 ? 106 GLN B OE1 1 
ATOM   3917 N  NE2 . GLN B 1 106 ? 41.896  13.524  66.805 1.00 115.21 ? 106 GLN B NE2 1 
ATOM   3918 N  N   . GLY B 1 107 ? 36.968  14.850  63.947 1.00 65.21  ? 107 GLY B N   1 
ATOM   3919 C  CA  . GLY B 1 107 ? 35.733  14.368  63.326 1.00 60.68  ? 107 GLY B CA  1 
ATOM   3920 C  C   . GLY B 1 107 ? 34.403  14.889  63.827 1.00 60.43  ? 107 GLY B C   1 
ATOM   3921 O  O   . GLY B 1 107 ? 33.465  14.105  63.992 1.00 58.29  ? 107 GLY B O   1 
ATOM   3922 N  N   . GLN B 1 108 ? 34.288  16.211  64.013 1.00 56.29  ? 108 GLN B N   1 
ATOM   3923 C  CA  . GLN B 1 108 ? 33.095  16.923  64.497 1.00 54.82  ? 108 GLN B CA  1 
ATOM   3924 C  C   . GLN B 1 108 ? 31.788  16.348  63.972 1.00 55.18  ? 108 GLN B C   1 
ATOM   3925 O  O   . GLN B 1 108 ? 31.715  15.963  62.807 1.00 53.79  ? 108 GLN B O   1 
ATOM   3926 C  CB  . GLN B 1 108 ? 33.181  18.407  64.107 1.00 56.89  ? 108 GLN B CB  1 
ATOM   3927 C  CG  . GLN B 1 108 ? 32.216  19.328  64.834 1.00 68.98  ? 108 GLN B CG  1 
ATOM   3928 C  CD  . GLN B 1 108 ? 32.305  20.705  64.248 1.00 93.09  ? 108 GLN B CD  1 
ATOM   3929 O  OE1 . GLN B 1 108 ? 33.212  21.477  64.563 1.00 90.98  ? 108 GLN B OE1 1 
ATOM   3930 N  NE2 . GLN B 1 108 ? 31.393  21.026  63.342 1.00 87.09  ? 108 GLN B NE2 1 
ATOM   3931 N  N   . MET B 1 109 ? 30.754  16.325  64.821 1.00 50.67  ? 109 MET B N   1 
ATOM   3932 C  CA  . MET B 1 109 ? 29.433  15.838  64.460 1.00 47.99  ? 109 MET B CA  1 
ATOM   3933 C  C   . MET B 1 109 ? 28.807  16.781  63.460 1.00 52.08  ? 109 MET B C   1 
ATOM   3934 O  O   . MET B 1 109 ? 28.705  17.979  63.733 1.00 53.93  ? 109 MET B O   1 
ATOM   3935 C  CB  . MET B 1 109 ? 28.528  15.736  65.698 1.00 50.46  ? 109 MET B CB  1 
ATOM   3936 C  CG  . MET B 1 109 ? 27.242  14.961  65.426 1.00 51.48  ? 109 MET B CG  1 
ATOM   3937 S  SD  . MET B 1 109 ? 25.878  15.235  66.585 1.00 54.79  ? 109 MET B SD  1 
ATOM   3938 C  CE  . MET B 1 109 ? 25.672  16.987  66.444 1.00 52.22  ? 109 MET B CE  1 
ATOM   3939 N  N   . ASP B 1 110 ? 28.395  16.242  62.304 1.00 46.46  ? 110 ASP B N   1 
ATOM   3940 C  CA  . ASP B 1 110 ? 27.714  17.003  61.261 1.00 45.00  ? 110 ASP B CA  1 
ATOM   3941 C  C   . ASP B 1 110 ? 26.410  16.297  60.849 1.00 47.78  ? 110 ASP B C   1 
ATOM   3942 O  O   . ASP B 1 110 ? 26.282  15.070  60.965 1.00 47.36  ? 110 ASP B O   1 
ATOM   3943 C  CB  . ASP B 1 110 ? 28.638  17.290  60.062 1.00 46.59  ? 110 ASP B CB  1 
ATOM   3944 C  CG  . ASP B 1 110 ? 28.249  18.492  59.205 1.00 57.27  ? 110 ASP B CG  1 
ATOM   3945 O  OD1 . ASP B 1 110 ? 27.447  19.340  59.688 1.00 60.04  ? 110 ASP B OD1 1 
ATOM   3946 O  OD2 . ASP B 1 110 ? 28.784  18.615  58.066 1.00 57.00  ? 110 ASP B OD2 1 
ATOM   3947 N  N   . LEU B 1 111 ? 25.420  17.087  60.450 1.00 43.33  ? 111 LEU B N   1 
ATOM   3948 C  CA  . LEU B 1 111 ? 24.129  16.568  60.034 1.00 41.14  ? 111 LEU B CA  1 
ATOM   3949 C  C   . LEU B 1 111 ? 23.822  16.966  58.620 1.00 43.09  ? 111 LEU B C   1 
ATOM   3950 O  O   . LEU B 1 111 ? 24.224  18.025  58.140 1.00 43.52  ? 111 LEU B O   1 
ATOM   3951 C  CB  . LEU B 1 111 ? 23.003  16.967  60.986 1.00 41.76  ? 111 LEU B CB  1 
ATOM   3952 C  CG  . LEU B 1 111 ? 23.022  16.250  62.337 1.00 47.61  ? 111 LEU B CG  1 
ATOM   3953 C  CD1 . LEU B 1 111 ? 23.671  17.121  63.411 1.00 49.61  ? 111 LEU B CD1 1 
ATOM   3954 C  CD2 . LEU B 1 111 ? 21.613  15.821  62.764 1.00 50.10  ? 111 LEU B CD2 1 
ATOM   3955 N  N   . CYS B 1 112 ? 23.143  16.077  57.935 1.00 37.69  ? 112 CYS B N   1 
ATOM   3956 C  CA  . CYS B 1 112 ? 22.809  16.239  56.547 1.00 35.82  ? 112 CYS B CA  1 
ATOM   3957 C  C   . CYS B 1 112 ? 21.469  15.624  56.292 1.00 38.03  ? 112 CYS B C   1 
ATOM   3958 O  O   . CYS B 1 112 ? 21.267  14.429  56.516 1.00 36.73  ? 112 CYS B O   1 
ATOM   3959 C  CB  . CYS B 1 112 ? 23.882  15.596  55.677 1.00 35.83  ? 112 CYS B CB  1 
ATOM   3960 S  SG  . CYS B 1 112 ? 23.413  15.457  53.944 1.00 38.81  ? 112 CYS B SG  1 
ATOM   3961 N  N   . VAL B 1 113 ? 20.558  16.434  55.797 1.00 34.81  ? 113 VAL B N   1 
ATOM   3962 C  CA  . VAL B 1 113 ? 19.246  15.946  55.433 1.00 33.74  ? 113 VAL B CA  1 
ATOM   3963 C  C   . VAL B 1 113 ? 19.369  15.393  53.997 1.00 35.75  ? 113 VAL B C   1 
ATOM   3964 O  O   . VAL B 1 113 ? 19.912  16.045  53.078 1.00 34.33  ? 113 VAL B O   1 
ATOM   3965 C  CB  . VAL B 1 113 ? 18.121  17.007  55.624 1.00 38.34  ? 113 VAL B CB  1 
ATOM   3966 C  CG1 . VAL B 1 113 ? 16.761  16.464  55.175 1.00 37.72  ? 113 VAL B CG1 1 
ATOM   3967 C  CG2 . VAL B 1 113 ? 18.046  17.456  57.080 1.00 39.05  ? 113 VAL B CG2 1 
ATOM   3968 N  N   . THR B 1 114 ? 18.929  14.148  53.853 1.00 31.30  ? 114 THR B N   1 
ATOM   3969 C  CA  . THR B 1 114 ? 18.938  13.445  52.588 1.00 30.72  ? 114 THR B CA  1 
ATOM   3970 C  C   . THR B 1 114 ? 17.514  13.103  52.199 1.00 33.38  ? 114 THR B C   1 
ATOM   3971 O  O   . THR B 1 114 ? 16.650  12.909  53.071 1.00 30.82  ? 114 THR B O   1 
ATOM   3972 C  CB  . THR B 1 114 ? 19.826  12.185  52.647 1.00 45.06  ? 114 THR B CB  1 
ATOM   3973 O  OG1 . THR B 1 114 ? 19.374  11.324  53.698 1.00 51.47  ? 114 THR B OG1 1 
ATOM   3974 C  CG2 . THR B 1 114 ? 21.309  12.509  52.816 1.00 42.48  ? 114 THR B CG2 1 
ATOM   3975 N  N   . SER B 1 115 ? 17.280  13.028  50.861 1.00 31.01  ? 115 SER B N   1 
ATOM   3976 C  CA  . SER B 1 115 ? 16.007  12.653  50.242 1.00 30.29  ? 115 SER B CA  1 
ATOM   3977 C  C   . SER B 1 115 ? 15.810  11.133  50.536 1.00 37.16  ? 115 SER B C   1 
ATOM   3978 O  O   . SER B 1 115 ? 16.289  10.263  49.787 1.00 36.98  ? 115 SER B O   1 
ATOM   3979 C  CB  . SER B 1 115 ? 16.015  12.997  48.755 1.00 29.46  ? 115 SER B CB  1 
ATOM   3980 O  OG  . SER B 1 115 ? 16.496  14.315  48.520 1.00 29.64  ? 115 SER B OG  1 
ATOM   3981 N  N   . GLY B 1 116 ? 15.241  10.858  51.724 1.00 34.16  ? 116 GLY B N   1 
ATOM   3982 C  CA  . GLY B 1 116 ? 15.060  9.515   52.272 1.00 33.21  ? 116 GLY B CA  1 
ATOM   3983 C  C   . GLY B 1 116 ? 16.380  8.966   52.776 1.00 35.07  ? 116 GLY B C   1 
ATOM   3984 O  O   . GLY B 1 116 ? 17.442  9.374   52.280 1.00 33.48  ? 116 GLY B O   1 
ATOM   3985 N  N   . SER B 1 117 ? 16.341  8.038   53.763 1.00 32.10  ? 117 SER B N   1 
ATOM   3986 C  CA  . SER B 1 117 ? 17.575  7.431   54.303 1.00 32.97  ? 117 SER B CA  1 
ATOM   3987 C  C   . SER B 1 117 ? 18.421  6.626   53.270 1.00 39.32  ? 117 SER B C   1 
ATOM   3988 O  O   . SER B 1 117 ? 19.649  6.618   53.373 1.00 39.79  ? 117 SER B O   1 
ATOM   3989 C  CB  . SER B 1 117 ? 17.320  6.642   55.580 1.00 35.87  ? 117 SER B CB  1 
ATOM   3990 O  OG  . SER B 1 117 ? 17.300  5.248   55.332 1.00 45.37  ? 117 SER B OG  1 
ATOM   3991 N  N   . GLN B 1 118 ? 17.778  6.027   52.249 1.00 36.93  ? 118 GLN B N   1 
ATOM   3992 C  CA  . GLN B 1 118 ? 18.459  5.317   51.158 1.00 37.74  ? 118 GLN B CA  1 
ATOM   3993 C  C   . GLN B 1 118 ? 19.594  6.158   50.517 1.00 41.05  ? 118 GLN B C   1 
ATOM   3994 O  O   . GLN B 1 118 ? 20.656  5.604   50.197 1.00 40.38  ? 118 GLN B O   1 
ATOM   3995 C  CB  . GLN B 1 118 ? 17.452  4.902   50.065 1.00 39.42  ? 118 GLN B CB  1 
ATOM   3996 C  CG  . GLN B 1 118 ? 17.957  3.766   49.158 1.00 57.23  ? 118 GLN B CG  1 
ATOM   3997 C  CD  . GLN B 1 118 ? 18.194  2.456   49.891 1.00 72.00  ? 118 GLN B CD  1 
ATOM   3998 O  OE1 . GLN B 1 118 ? 17.351  1.988   50.672 1.00 62.91  ? 118 GLN B OE1 1 
ATOM   3999 N  NE2 . GLN B 1 118 ? 19.361  1.846   49.667 1.00 64.17  ? 118 GLN B NE2 1 
ATOM   4000 N  N   . GLN B 1 119 ? 19.346  7.489   50.332 1.00 36.41  ? 119 GLN B N   1 
ATOM   4001 C  CA  . GLN B 1 119 ? 20.293  8.434   49.741 1.00 35.13  ? 119 GLN B CA  1 
ATOM   4002 C  C   . GLN B 1 119 ? 21.560  8.544   50.560 1.00 37.56  ? 119 GLN B C   1 
ATOM   4003 O  O   . GLN B 1 119 ? 22.662  8.421   50.010 1.00 36.50  ? 119 GLN B O   1 
ATOM   4004 C  CB  . GLN B 1 119 ? 19.664  9.819   49.501 1.00 35.68  ? 119 GLN B CB  1 
ATOM   4005 C  CG  . GLN B 1 119 ? 20.439  10.588  48.426 1.00 39.09  ? 119 GLN B CG  1 
ATOM   4006 C  CD  . GLN B 1 119 ? 20.004  12.004  48.179 1.00 52.03  ? 119 GLN B CD  1 
ATOM   4007 O  OE1 . GLN B 1 119 ? 19.410  12.664  49.039 1.00 51.86  ? 119 GLN B OE1 1 
ATOM   4008 N  NE2 . GLN B 1 119 ? 20.341  12.522  47.000 1.00 35.97  ? 119 GLN B NE2 1 
ATOM   4009 N  N   . GLY B 1 120 ? 21.391  8.757   51.863 1.00 33.52  ? 120 GLY B N   1 
ATOM   4010 C  CA  . GLY B 1 120 ? 22.513  8.880   52.781 1.00 33.83  ? 120 GLY B CA  1 
ATOM   4011 C  C   . GLY B 1 120 ? 23.467  7.726   52.597 1.00 37.16  ? 120 GLY B C   1 
ATOM   4012 O  O   . GLY B 1 120 ? 24.600  7.914   52.141 1.00 37.12  ? 120 GLY B O   1 
ATOM   4013 N  N   . LEU B 1 121 ? 22.928  6.514   52.816 1.00 32.39  ? 121 LEU B N   1 
ATOM   4014 C  CA  . LEU B 1 121 ? 23.607  5.230   52.691 1.00 31.98  ? 121 LEU B CA  1 
ATOM   4015 C  C   . LEU B 1 121 ? 24.276  5.074   51.340 1.00 35.32  ? 121 LEU B C   1 
ATOM   4016 O  O   . LEU B 1 121 ? 25.477  4.810   51.293 1.00 34.69  ? 121 LEU B O   1 
ATOM   4017 C  CB  . LEU B 1 121 ? 22.603  4.099   52.901 1.00 31.50  ? 121 LEU B CB  1 
ATOM   4018 C  CG  . LEU B 1 121 ? 21.841  4.101   54.199 1.00 35.52  ? 121 LEU B CG  1 
ATOM   4019 C  CD1 . LEU B 1 121 ? 20.525  3.356   54.046 1.00 35.69  ? 121 LEU B CD1 1 
ATOM   4020 C  CD2 . LEU B 1 121 ? 22.676  3.535   55.310 1.00 37.65  ? 121 LEU B CD2 1 
ATOM   4021 N  N   . CYS B 1 122 ? 23.514  5.281   50.248 1.00 32.17  ? 122 CYS B N   1 
ATOM   4022 C  CA  . CYS B 1 122 ? 24.037  5.184   48.892 1.00 33.30  ? 122 CYS B CA  1 
ATOM   4023 C  C   . CYS B 1 122 ? 25.258  6.060   48.724 1.00 36.87  ? 122 CYS B C   1 
ATOM   4024 O  O   . CYS B 1 122 ? 26.356  5.532   48.564 1.00 37.82  ? 122 CYS B O   1 
ATOM   4025 C  CB  . CYS B 1 122 ? 22.971  5.517   47.859 1.00 33.96  ? 122 CYS B CB  1 
ATOM   4026 S  SG  . CYS B 1 122 ? 23.463  5.141   46.162 1.00 39.09  ? 122 CYS B SG  1 
ATOM   4027 N  N   . LYS B 1 123 ? 25.092  7.385   48.864 1.00 32.14  ? 123 LYS B N   1 
ATOM   4028 C  CA  . LYS B 1 123 ? 26.205  8.323   48.753 1.00 32.02  ? 123 LYS B CA  1 
ATOM   4029 C  C   . LYS B 1 123 ? 27.365  7.888   49.676 1.00 37.77  ? 123 LYS B C   1 
ATOM   4030 O  O   . LYS B 1 123 ? 28.513  7.899   49.231 1.00 39.22  ? 123 LYS B O   1 
ATOM   4031 C  CB  . LYS B 1 123 ? 25.763  9.776   49.025 1.00 32.23  ? 123 LYS B CB  1 
ATOM   4032 C  CG  . LYS B 1 123 ? 24.537  10.253  48.236 1.00 28.87  ? 123 LYS B CG  1 
ATOM   4033 C  CD  . LYS B 1 123 ? 24.885  10.838  46.872 1.00 33.71  ? 123 LYS B CD  1 
ATOM   4034 C  CE  . LYS B 1 123 ? 23.707  11.405  46.110 1.00 29.23  ? 123 LYS B CE  1 
ATOM   4035 N  NZ  . LYS B 1 123 ? 23.174  10.468  45.078 1.00 24.94  ? 123 LYS B NZ  1 
ATOM   4036 N  N   . VAL B 1 124 ? 27.058  7.405   50.906 1.00 33.57  ? 124 VAL B N   1 
ATOM   4037 C  CA  . VAL B 1 124 ? 28.084  6.926   51.837 1.00 34.41  ? 124 VAL B CA  1 
ATOM   4038 C  C   . VAL B 1 124 ? 28.909  5.791   51.213 1.00 41.18  ? 124 VAL B C   1 
ATOM   4039 O  O   . VAL B 1 124 ? 30.136  5.899   51.198 1.00 42.72  ? 124 VAL B O   1 
ATOM   4040 C  CB  . VAL B 1 124 ? 27.539  6.546   53.238 1.00 36.74  ? 124 VAL B CB  1 
ATOM   4041 C  CG1 . VAL B 1 124 ? 28.589  5.802   54.054 1.00 37.54  ? 124 VAL B CG1 1 
ATOM   4042 C  CG2 . VAL B 1 124 ? 27.065  7.767   53.996 1.00 35.79  ? 124 VAL B CG2 1 
ATOM   4043 N  N   . PHE B 1 125 ? 28.241  4.728   50.686 1.00 37.48  ? 125 PHE B N   1 
ATOM   4044 C  CA  . PHE B 1 125 ? 28.923  3.571   50.086 1.00 38.79  ? 125 PHE B CA  1 
ATOM   4045 C  C   . PHE B 1 125 ? 29.755  3.982   48.897 1.00 43.28  ? 125 PHE B C   1 
ATOM   4046 O  O   . PHE B 1 125 ? 30.866  3.478   48.718 1.00 44.92  ? 125 PHE B O   1 
ATOM   4047 C  CB  . PHE B 1 125 ? 27.942  2.470   49.641 1.00 40.69  ? 125 PHE B CB  1 
ATOM   4048 C  CG  . PHE B 1 125 ? 26.885  2.019   50.622 1.00 41.83  ? 125 PHE B CG  1 
ATOM   4049 C  CD1 . PHE B 1 125 ? 25.561  1.876   50.221 1.00 43.68  ? 125 PHE B CD1 1 
ATOM   4050 C  CD2 . PHE B 1 125 ? 27.223  1.682   51.930 1.00 44.58  ? 125 PHE B CD2 1 
ATOM   4051 C  CE1 . PHE B 1 125 ? 24.583  1.473   51.126 1.00 44.49  ? 125 PHE B CE1 1 
ATOM   4052 C  CE2 . PHE B 1 125 ? 26.245  1.265   52.835 1.00 46.92  ? 125 PHE B CE2 1 
ATOM   4053 C  CZ  . PHE B 1 125 ? 24.931  1.168   52.431 1.00 44.16  ? 125 PHE B CZ  1 
ATOM   4054 N  N   . GLU B 1 126 ? 29.206  4.901   48.085 1.00 38.21  ? 126 GLU B N   1 
ATOM   4055 C  CA  . GLU B 1 126 ? 29.828  5.451   46.879 1.00 37.97  ? 126 GLU B CA  1 
ATOM   4056 C  C   . GLU B 1 126 ? 31.051  6.293   47.229 1.00 42.62  ? 126 GLU B C   1 
ATOM   4057 O  O   . GLU B 1 126 ? 32.054  6.264   46.496 1.00 43.37  ? 126 GLU B O   1 
ATOM   4058 C  CB  . GLU B 1 126 ? 28.791  6.229   46.057 1.00 37.87  ? 126 GLU B CB  1 
ATOM   4059 C  CG  . GLU B 1 126 ? 27.768  5.285   45.439 1.00 45.51  ? 126 GLU B CG  1 
ATOM   4060 C  CD  . GLU B 1 126 ? 26.691  5.904   44.576 1.00 69.62  ? 126 GLU B CD  1 
ATOM   4061 O  OE1 . GLU B 1 126 ? 26.407  5.324   43.502 1.00 67.90  ? 126 GLU B OE1 1 
ATOM   4062 O  OE2 . GLU B 1 126 ? 26.108  6.939   44.981 1.00 62.74  ? 126 GLU B OE2 1 
ATOM   4063 N  N   . MET B 1 127 ? 30.988  6.978   48.398 1.00 38.41  ? 127 MET B N   1 
ATOM   4064 C  CA  . MET B 1 127 ? 32.075  7.785   48.950 1.00 38.92  ? 127 MET B CA  1 
ATOM   4065 C  C   . MET B 1 127 ? 33.241  6.891   49.341 1.00 42.28  ? 127 MET B C   1 
ATOM   4066 O  O   . MET B 1 127 ? 34.392  7.289   49.136 1.00 43.40  ? 127 MET B O   1 
ATOM   4067 C  CB  . MET B 1 127 ? 31.597  8.604   50.183 1.00 40.73  ? 127 MET B CB  1 
ATOM   4068 C  CG  . MET B 1 127 ? 32.740  9.219   51.026 1.00 45.93  ? 127 MET B CG  1 
ATOM   4069 S  SD  . MET B 1 127 ? 32.271  9.849   52.652 1.00 49.99  ? 127 MET B SD  1 
ATOM   4070 C  CE  . MET B 1 127 ? 31.666  8.400   53.400 1.00 46.71  ? 127 MET B CE  1 
ATOM   4071 N  N   . ILE B 1 128 ? 32.934  5.698   49.903 1.00 36.70  ? 128 ILE B N   1 
ATOM   4072 C  CA  . ILE B 1 128 ? 33.900  4.759   50.462 1.00 38.45  ? 128 ILE B CA  1 
ATOM   4073 C  C   . ILE B 1 128 ? 34.512  3.713   49.541 1.00 43.18  ? 128 ILE B C   1 
ATOM   4074 O  O   . ILE B 1 128 ? 35.747  3.614   49.449 1.00 44.12  ? 128 ILE B O   1 
ATOM   4075 C  CB  . ILE B 1 128 ? 33.317  4.103   51.742 1.00 41.75  ? 128 ILE B CB  1 
ATOM   4076 C  CG1 . ILE B 1 128 ? 32.906  5.156   52.785 1.00 41.38  ? 128 ILE B CG1 1 
ATOM   4077 C  CG2 . ILE B 1 128 ? 34.273  3.046   52.346 1.00 44.71  ? 128 ILE B CG2 1 
ATOM   4078 C  CD1 . ILE B 1 128 ? 31.989  4.613   53.806 1.00 47.68  ? 128 ILE B CD1 1 
ATOM   4079 N  N   . ILE B 1 129 ? 33.647  2.888   48.936 1.00 39.21  ? 129 ILE B N   1 
ATOM   4080 C  CA  . ILE B 1 129 ? 33.982  1.699   48.151 1.00 40.24  ? 129 ILE B CA  1 
ATOM   4081 C  C   . ILE B 1 129 ? 34.767  1.837   46.862 1.00 44.22  ? 129 ILE B C   1 
ATOM   4082 O  O   . ILE B 1 129 ? 34.300  2.480   45.924 1.00 42.81  ? 129 ILE B O   1 
ATOM   4083 C  CB  . ILE B 1 129 ? 32.740  0.775   48.013 1.00 42.55  ? 129 ILE B CB  1 
ATOM   4084 C  CG1 . ILE B 1 129 ? 32.291  0.253   49.396 1.00 42.64  ? 129 ILE B CG1 1 
ATOM   4085 C  CG2 . ILE B 1 129 ? 33.001  -0.386  47.057 1.00 45.58  ? 129 ILE B CG2 1 
ATOM   4086 C  CD1 . ILE B 1 129 ? 30.845  -0.022  49.526 1.00 48.32  ? 129 ILE B CD1 1 
ATOM   4087 N  N   . ASN B 1 130 ? 35.927  1.138   46.799 1.00 43.14  ? 130 ASN B N   1 
ATOM   4088 C  CA  . ASN B 1 130 ? 36.768  0.993   45.593 1.00 44.83  ? 130 ASN B CA  1 
ATOM   4089 C  C   . ASN B 1 130 ? 36.685  -0.475  45.197 1.00 51.07  ? 130 ASN B C   1 
ATOM   4090 O  O   . ASN B 1 130 ? 36.789  -1.328  46.082 1.00 52.57  ? 130 ASN B O   1 
ATOM   4091 C  CB  . ASN B 1 130 ? 38.247  1.371   45.819 1.00 43.20  ? 130 ASN B CB  1 
ATOM   4092 C  CG  . ASN B 1 130 ? 38.462  2.837   46.049 1.00 60.30  ? 130 ASN B CG  1 
ATOM   4093 O  OD1 . ASN B 1 130 ? 38.805  3.600   45.140 1.00 39.32  ? 130 ASN B OD1 1 
ATOM   4094 N  ND2 . ASN B 1 130 ? 38.235  3.273   47.280 1.00 62.54  ? 130 ASN B ND2 1 
ATOM   4095 N  N   . PRO B 1 131 ? 36.464  -0.811  43.908 1.00 46.85  ? 131 PRO B N   1 
ATOM   4096 C  CA  . PRO B 1 131 ? 36.396  -2.229  43.519 1.00 47.91  ? 131 PRO B CA  1 
ATOM   4097 C  C   . PRO B 1 131 ? 37.542  -3.053  44.100 1.00 55.91  ? 131 PRO B C   1 
ATOM   4098 O  O   . PRO B 1 131 ? 38.712  -2.722  43.914 1.00 57.69  ? 131 PRO B O   1 
ATOM   4099 C  CB  . PRO B 1 131 ? 36.442  -2.181  41.990 1.00 49.93  ? 131 PRO B CB  1 
ATOM   4100 C  CG  . PRO B 1 131 ? 36.892  -0.790  41.654 1.00 53.85  ? 131 PRO B CG  1 
ATOM   4101 C  CD  . PRO B 1 131 ? 36.323  0.057   42.732 1.00 47.42  ? 131 PRO B CD  1 
ATOM   4102 N  N   . GLY B 1 132 ? 37.182  -4.068  44.868 1.00 53.65  ? 132 GLY B N   1 
ATOM   4103 C  CA  . GLY B 1 132 ? 38.152  -4.932  45.521 1.00 56.47  ? 132 GLY B CA  1 
ATOM   4104 C  C   . GLY B 1 132 ? 38.227  -4.721  47.017 1.00 59.97  ? 132 GLY B C   1 
ATOM   4105 O  O   . GLY B 1 132 ? 38.720  -5.592  47.743 1.00 61.03  ? 132 GLY B O   1 
ATOM   4106 N  N   . ASP B 1 133 ? 37.727  -3.561  47.487 1.00 54.72  ? 133 ASP B N   1 
ATOM   4107 C  CA  . ASP B 1 133 ? 37.668  -3.193  48.904 1.00 53.93  ? 133 ASP B CA  1 
ATOM   4108 C  C   . ASP B 1 133 ? 36.901  -4.264  49.677 1.00 58.83  ? 133 ASP B C   1 
ATOM   4109 O  O   . ASP B 1 133 ? 36.082  -4.987  49.090 1.00 58.31  ? 133 ASP B O   1 
ATOM   4110 C  CB  . ASP B 1 133 ? 36.966  -1.826  49.073 1.00 52.91  ? 133 ASP B CB  1 
ATOM   4111 C  CG  . ASP B 1 133 ? 37.862  -0.598  49.035 1.00 61.03  ? 133 ASP B CG  1 
ATOM   4112 O  OD1 . ASP B 1 133 ? 38.900  -0.627  48.325 1.00 64.96  ? 133 ASP B OD1 1 
ATOM   4113 O  OD2 . ASP B 1 133 ? 37.521  0.394   49.693 1.00 60.89  ? 133 ASP B OD2 1 
ATOM   4114 N  N   . ASN B 1 134 ? 37.174  -4.391  50.978 1.00 56.55  ? 134 ASN B N   1 
ATOM   4115 C  CA  . ASN B 1 134 ? 36.460  -5.389  51.768 1.00 56.83  ? 134 ASN B CA  1 
ATOM   4116 C  C   . ASN B 1 134 ? 35.441  -4.732  52.690 1.00 59.30  ? 134 ASN B C   1 
ATOM   4117 O  O   . ASN B 1 134 ? 35.767  -3.760  53.380 1.00 58.82  ? 134 ASN B O   1 
ATOM   4118 C  CB  . ASN B 1 134 ? 37.428  -6.318  52.531 1.00 59.90  ? 134 ASN B CB  1 
ATOM   4119 C  CG  . ASN B 1 134 ? 38.233  -7.225  51.630 1.00 79.57  ? 134 ASN B CG  1 
ATOM   4120 O  OD1 . ASN B 1 134 ? 37.700  -8.101  50.938 1.00 74.06  ? 134 ASN B OD1 1 
ATOM   4121 N  ND2 . ASN B 1 134 ? 39.538  -7.023  51.600 1.00 71.49  ? 134 ASN B ND2 1 
ATOM   4122 N  N   . VAL B 1 135 ? 34.201  -5.242  52.681 1.00 54.40  ? 135 VAL B N   1 
ATOM   4123 C  CA  . VAL B 1 135 ? 33.144  -4.719  53.545 1.00 52.60  ? 135 VAL B CA  1 
ATOM   4124 C  C   . VAL B 1 135 ? 32.400  -5.804  54.320 1.00 57.10  ? 135 VAL B C   1 
ATOM   4125 O  O   . VAL B 1 135 ? 32.083  -6.855  53.763 1.00 56.67  ? 135 VAL B O   1 
ATOM   4126 C  CB  . VAL B 1 135 ? 32.208  -3.708  52.848 1.00 54.38  ? 135 VAL B CB  1 
ATOM   4127 C  CG1 . VAL B 1 135 ? 32.857  -2.341  52.778 1.00 54.22  ? 135 VAL B CG1 1 
ATOM   4128 C  CG2 . VAL B 1 135 ? 31.829  -4.168  51.459 1.00 53.96  ? 135 VAL B CG2 1 
ATOM   4129 N  N   . LEU B 1 136 ? 32.123  -5.555  55.611 1.00 54.13  ? 136 LEU B N   1 
ATOM   4130 C  CA  . LEU B 1 136 ? 31.424  -6.539  56.443 1.00 54.33  ? 136 LEU B CA  1 
ATOM   4131 C  C   . LEU B 1 136 ? 29.994  -6.136  56.804 1.00 55.90  ? 136 LEU B C   1 
ATOM   4132 O  O   . LEU B 1 136 ? 29.702  -4.957  57.020 1.00 52.78  ? 136 LEU B O   1 
ATOM   4133 C  CB  . LEU B 1 136 ? 32.211  -6.918  57.722 1.00 56.05  ? 136 LEU B CB  1 
ATOM   4134 C  CG  . LEU B 1 136 ? 33.699  -6.567  57.810 1.00 62.44  ? 136 LEU B CG  1 
ATOM   4135 C  CD1 . LEU B 1 136 ? 33.914  -5.356  58.687 1.00 62.22  ? 136 LEU B CD1 1 
ATOM   4136 C  CD2 . LEU B 1 136 ? 34.485  -7.721  58.365 1.00 67.01  ? 136 LEU B CD2 1 
ATOM   4137 N  N   . LEU B 1 137 ? 29.116  -7.152  56.882 1.00 53.83  ? 137 LEU B N   1 
ATOM   4138 C  CA  . LEU B 1 137 ? 27.698  -7.086  57.248 1.00 52.14  ? 137 LEU B CA  1 
ATOM   4139 C  C   . LEU B 1 137 ? 27.086  -8.516  57.489 1.00 56.70  ? 137 LEU B C   1 
ATOM   4140 O  O   . LEU B 1 137 ? 27.587  -9.521  56.975 1.00 55.87  ? 137 LEU B O   1 
ATOM   4141 C  CB  . LEU B 1 137 ? 26.886  -6.229  56.237 1.00 50.22  ? 137 LEU B CB  1 
ATOM   4142 C  CG  . LEU B 1 137 ? 26.280  -6.891  54.977 1.00 55.25  ? 137 LEU B CG  1 
ATOM   4143 C  CD1 . LEU B 1 137 ? 25.663  -5.856  54.065 1.00 53.72  ? 137 LEU B CD1 1 
ATOM   4144 C  CD2 . LEU B 1 137 ? 27.298  -7.648  54.175 1.00 59.53  ? 137 LEU B CD2 1 
ATOM   4145 N  N   . ASP B 1 138 ? 26.001  -8.575  58.271 1.00 54.20  ? 138 ASP B N   1 
ATOM   4146 C  CA  . ASP B 1 138 ? 25.302  -9.817  58.616 1.00 54.94  ? 138 ASP B CA  1 
ATOM   4147 C  C   . ASP B 1 138 ? 24.169  -10.198 57.628 1.00 58.43  ? 138 ASP B C   1 
ATOM   4148 O  O   . ASP B 1 138 ? 23.203  -9.444  57.456 1.00 58.41  ? 138 ASP B O   1 
ATOM   4149 C  CB  . ASP B 1 138 ? 24.794  -9.771  60.076 1.00 55.87  ? 138 ASP B CB  1 
ATOM   4150 C  CG  . ASP B 1 138 ? 23.824  -8.642  60.372 1.00 61.41  ? 138 ASP B CG  1 
ATOM   4151 O  OD1 . ASP B 1 138 ? 24.290  -7.513  60.643 1.00 60.20  ? 138 ASP B OD1 1 
ATOM   4152 O  OD2 . ASP B 1 138 ? 22.600  -8.879  60.294 1.00 67.91  ? 138 ASP B OD2 1 
ATOM   4153 N  N   . GLU B 1 139 ? 24.295  -11.359 56.981 1.00 52.82  ? 139 GLU B N   1 
ATOM   4154 C  CA  . GLU B 1 139 ? 23.247  -11.849 56.102 1.00 51.66  ? 139 GLU B CA  1 
ATOM   4155 C  C   . GLU B 1 139 ? 22.275  -12.644 56.997 1.00 56.37  ? 139 GLU B C   1 
ATOM   4156 O  O   . GLU B 1 139 ? 22.736  -13.359 57.889 1.00 57.78  ? 139 GLU B O   1 
ATOM   4157 C  CB  . GLU B 1 139 ? 23.813  -12.753 54.998 1.00 54.83  ? 139 GLU B CB  1 
ATOM   4158 C  CG  . GLU B 1 139 ? 24.823  -12.094 54.075 1.00 64.30  ? 139 GLU B CG  1 
ATOM   4159 C  CD  . GLU B 1 139 ? 25.268  -12.964 52.919 1.00 83.08  ? 139 GLU B CD  1 
ATOM   4160 O  OE1 . GLU B 1 139 ? 24.424  -13.268 52.046 1.00 88.36  ? 139 GLU B OE1 1 
ATOM   4161 O  OE2 . GLU B 1 139 ? 26.478  -13.271 52.836 1.00 73.43  ? 139 GLU B OE2 1 
ATOM   4162 N  N   . PRO B 1 140 ? 20.943  -12.558 56.816 1.00 52.27  ? 140 PRO B N   1 
ATOM   4163 C  CA  . PRO B 1 140 ? 20.228  -11.747 55.833 1.00 50.83  ? 140 PRO B CA  1 
ATOM   4164 C  C   . PRO B 1 140 ? 20.184  -10.287 56.244 1.00 55.82  ? 140 PRO B C   1 
ATOM   4165 O  O   . PRO B 1 140 ? 19.907  -9.948  57.405 1.00 55.67  ? 140 PRO B O   1 
ATOM   4166 C  CB  . PRO B 1 140 ? 18.852  -12.413 55.771 1.00 52.63  ? 140 PRO B CB  1 
ATOM   4167 C  CG  . PRO B 1 140 ? 18.634  -12.956 57.139 1.00 57.63  ? 140 PRO B CG  1 
ATOM   4168 C  CD  . PRO B 1 140 ? 20.007  -13.305 57.682 1.00 54.36  ? 140 PRO B CD  1 
ATOM   4169 N  N   . ALA B 1 141 ? 20.556  -9.433  55.301 1.00 52.65  ? 141 ALA B N   1 
ATOM   4170 C  CA  . ALA B 1 141 ? 20.545  -7.990  55.492 1.00 51.05  ? 141 ALA B CA  1 
ATOM   4171 C  C   . ALA B 1 141 ? 19.625  -7.407  54.452 1.00 52.41  ? 141 ALA B C   1 
ATOM   4172 O  O   . ALA B 1 141 ? 19.258  -8.086  53.485 1.00 51.27  ? 141 ALA B O   1 
ATOM   4173 C  CB  . ALA B 1 141 ? 21.946  -7.408  55.363 1.00 51.92  ? 141 ALA B CB  1 
ATOM   4174 N  N   . TYR B 1 142 ? 19.220  -6.161  54.685 1.00 48.06  ? 142 TYR B N   1 
ATOM   4175 C  CA  . TYR B 1 142 ? 18.313  -5.401  53.835 1.00 46.85  ? 142 TYR B CA  1 
ATOM   4176 C  C   . TYR B 1 142 ? 18.683  -5.443  52.329 1.00 50.43  ? 142 TYR B C   1 
ATOM   4177 O  O   . TYR B 1 142 ? 19.703  -4.907  51.893 1.00 48.34  ? 142 TYR B O   1 
ATOM   4178 C  CB  . TYR B 1 142 ? 18.120  -3.975  54.400 1.00 46.29  ? 142 TYR B CB  1 
ATOM   4179 C  CG  . TYR B 1 142 ? 17.331  -3.056  53.506 1.00 46.59  ? 142 TYR B CG  1 
ATOM   4180 C  CD1 . TYR B 1 142 ? 15.987  -3.292  53.248 1.00 49.36  ? 142 TYR B CD1 1 
ATOM   4181 C  CD2 . TYR B 1 142 ? 17.927  -1.949  52.911 1.00 45.64  ? 142 TYR B CD2 1 
ATOM   4182 C  CE1 . TYR B 1 142 ? 15.260  -2.464  52.396 1.00 50.44  ? 142 TYR B CE1 1 
ATOM   4183 C  CE2 . TYR B 1 142 ? 17.198  -1.089  52.094 1.00 45.23  ? 142 TYR B CE2 1 
ATOM   4184 C  CZ  . TYR B 1 142 ? 15.869  -1.363  51.822 1.00 52.14  ? 142 TYR B CZ  1 
ATOM   4185 O  OH  . TYR B 1 142 ? 15.134  -0.556  50.993 1.00 51.02  ? 142 TYR B OH  1 
ATOM   4186 N  N   . SER B 1 143 ? 17.843  -6.144  51.557 1.00 48.16  ? 143 SER B N   1 
ATOM   4187 C  CA  . SER B 1 143 ? 17.968  -6.331  50.115 1.00 48.05  ? 143 SER B CA  1 
ATOM   4188 C  C   . SER B 1 143 ? 18.463  -5.075  49.368 1.00 49.44  ? 143 SER B C   1 
ATOM   4189 O  O   . SER B 1 143 ? 19.307  -5.196  48.492 1.00 49.78  ? 143 SER B O   1 
ATOM   4190 C  CB  . SER B 1 143 ? 16.643  -6.822  49.533 1.00 51.98  ? 143 SER B CB  1 
ATOM   4191 O  OG  . SER B 1 143 ? 15.571  -5.931  49.811 1.00 57.93  ? 143 SER B OG  1 
ATOM   4192 N  N   . GLY B 1 144 ? 17.976  -3.897  49.756 1.00 43.58  ? 144 GLY B N   1 
ATOM   4193 C  CA  . GLY B 1 144 ? 18.328  -2.630  49.116 1.00 42.15  ? 144 GLY B CA  1 
ATOM   4194 C  C   . GLY B 1 144 ? 19.750  -2.127  49.300 1.00 43.57  ? 144 GLY B C   1 
ATOM   4195 O  O   . GLY B 1 144 ? 20.195  -1.256  48.547 1.00 40.83  ? 144 GLY B O   1 
ATOM   4196 N  N   . THR B 1 145 ? 20.440  -2.614  50.350 1.00 40.61  ? 145 THR B N   1 
ATOM   4197 C  CA  . THR B 1 145 ? 21.831  -2.255  50.658 1.00 39.85  ? 145 THR B CA  1 
ATOM   4198 C  C   . THR B 1 145 ? 22.724  -3.245  49.949 1.00 41.43  ? 145 THR B C   1 
ATOM   4199 O  O   . THR B 1 145 ? 23.838  -2.920  49.568 1.00 40.92  ? 145 THR B O   1 
ATOM   4200 C  CB  . THR B 1 145 ? 22.073  -2.081  52.176 1.00 49.15  ? 145 THR B CB  1 
ATOM   4201 O  OG1 . THR B 1 145 ? 23.461  -1.827  52.425 1.00 48.75  ? 145 THR B OG1 1 
ATOM   4202 C  CG2 . THR B 1 145 ? 21.635  -3.268  52.968 1.00 49.84  ? 145 THR B CG2 1 
ATOM   4203 N  N   . LEU B 1 146 ? 22.198  -4.436  49.718 1.00 37.96  ? 146 LEU B N   1 
ATOM   4204 C  CA  . LEU B 1 146 ? 22.873  -5.461  48.944 1.00 39.40  ? 146 LEU B CA  1 
ATOM   4205 C  C   . LEU B 1 146 ? 22.769  -5.004  47.471 1.00 47.14  ? 146 LEU B C   1 
ATOM   4206 O  O   . LEU B 1 146 ? 23.742  -5.105  46.707 1.00 49.06  ? 146 LEU B O   1 
ATOM   4207 C  CB  . LEU B 1 146 ? 22.172  -6.833  49.119 1.00 39.52  ? 146 LEU B CB  1 
ATOM   4208 C  CG  . LEU B 1 146 ? 22.239  -7.533  50.465 1.00 41.91  ? 146 LEU B CG  1 
ATOM   4209 C  CD1 . LEU B 1 146 ? 21.235  -8.641  50.521 1.00 41.61  ? 146 LEU B CD1 1 
ATOM   4210 C  CD2 . LEU B 1 146 ? 23.629  -8.055  50.745 1.00 43.49  ? 146 LEU B CD2 1 
ATOM   4211 N  N   . GLN B 1 147 ? 21.580  -4.470  47.101 1.00 43.38  ? 147 GLN B N   1 
ATOM   4212 C  CA  . GLN B 1 147 ? 21.267  -3.964  45.773 1.00 43.42  ? 147 GLN B CA  1 
ATOM   4213 C  C   . GLN B 1 147 ? 22.198  -2.807  45.480 1.00 47.43  ? 147 GLN B C   1 
ATOM   4214 O  O   . GLN B 1 147 ? 22.626  -2.661  44.339 1.00 49.22  ? 147 GLN B O   1 
ATOM   4215 C  CB  . GLN B 1 147 ? 19.810  -3.492  45.717 1.00 44.11  ? 147 GLN B CB  1 
ATOM   4216 C  CG  . GLN B 1 147 ? 18.812  -4.456  45.064 1.00 65.60  ? 147 GLN B CG  1 
ATOM   4217 C  CD  . GLN B 1 147 ? 17.448  -3.803  44.843 1.00 87.32  ? 147 GLN B CD  1 
ATOM   4218 O  OE1 . GLN B 1 147 ? 16.970  -3.675  43.708 1.00 82.66  ? 147 GLN B OE1 1 
ATOM   4219 N  NE2 . GLN B 1 147 ? 16.788  -3.363  45.917 1.00 77.74  ? 147 GLN B NE2 1 
ATOM   4220 N  N   . SER B 1 148 ? 22.571  -2.045  46.528 1.00 42.52  ? 148 SER B N   1 
ATOM   4221 C  CA  . SER B 1 148 ? 23.471  -0.893  46.479 1.00 42.36  ? 148 SER B CA  1 
ATOM   4222 C  C   . SER B 1 148 ? 24.939  -1.278  46.250 1.00 47.04  ? 148 SER B C   1 
ATOM   4223 O  O   . SER B 1 148 ? 25.621  -0.635  45.435 1.00 46.65  ? 148 SER B O   1 
ATOM   4224 C  CB  . SER B 1 148 ? 23.353  -0.077  47.768 1.00 47.33  ? 148 SER B CB  1 
ATOM   4225 O  OG  . SER B 1 148 ? 22.770  1.198   47.539 1.00 61.22  ? 148 SER B OG  1 
ATOM   4226 N  N   . LEU B 1 149 ? 25.433  -2.301  46.985 1.00 44.24  ? 149 LEU B N   1 
ATOM   4227 C  CA  . LEU B 1 149 ? 26.831  -2.736  46.916 1.00 45.51  ? 149 LEU B CA  1 
ATOM   4228 C  C   . LEU B 1 149 ? 27.157  -3.602  45.718 1.00 52.64  ? 149 LEU B C   1 
ATOM   4229 O  O   . LEU B 1 149 ? 28.245  -3.454  45.141 1.00 51.37  ? 149 LEU B O   1 
ATOM   4230 C  CB  . LEU B 1 149 ? 27.272  -3.438  48.200 1.00 46.02  ? 149 LEU B CB  1 
ATOM   4231 C  CG  . LEU B 1 149 ? 27.015  -2.747  49.524 1.00 49.71  ? 149 LEU B CG  1 
ATOM   4232 C  CD1 . LEU B 1 149 ? 27.650  -3.527  50.651 1.00 51.57  ? 149 LEU B CD1 1 
ATOM   4233 C  CD2 . LEU B 1 149 ? 27.470  -1.293  49.521 1.00 50.08  ? 149 LEU B CD2 1 
ATOM   4234 N  N   . HIS B 1 150 ? 26.223  -4.520  45.355 1.00 53.15  ? 150 HIS B N   1 
ATOM   4235 C  CA  . HIS B 1 150 ? 26.365  -5.432  44.223 1.00 56.74  ? 150 HIS B CA  1 
ATOM   4236 C  C   . HIS B 1 150 ? 27.095  -4.802  43.015 1.00 63.22  ? 150 HIS B C   1 
ATOM   4237 O  O   . HIS B 1 150 ? 28.052  -5.430  42.546 1.00 65.57  ? 150 HIS B O   1 
ATOM   4238 C  CB  . HIS B 1 150 ? 25.020  -6.046  43.789 1.00 58.43  ? 150 HIS B CB  1 
ATOM   4239 C  CG  . HIS B 1 150 ? 25.135  -6.926  42.569 1.00 64.46  ? 150 HIS B CG  1 
ATOM   4240 N  ND1 . HIS B 1 150 ? 24.791  -6.466  41.303 1.00 66.20  ? 150 HIS B ND1 1 
ATOM   4241 C  CD2 . HIS B 1 150 ? 25.595  -8.196  42.459 1.00 68.90  ? 150 HIS B CD2 1 
ATOM   4242 C  CE1 . HIS B 1 150 ? 25.030  -7.474  40.478 1.00 67.94  ? 150 HIS B CE1 1 
ATOM   4243 N  NE2 . HIS B 1 150 ? 25.519  -8.533  41.123 1.00 69.92  ? 150 HIS B NE2 1 
ATOM   4244 N  N   . PRO B 1 151 ? 26.714  -3.597  42.485 1.00 57.87  ? 151 PRO B N   1 
ATOM   4245 C  CA  . PRO B 1 151 ? 27.456  -3.072  41.327 1.00 58.08  ? 151 PRO B CA  1 
ATOM   4246 C  C   . PRO B 1 151 ? 28.788  -2.408  41.699 1.00 60.88  ? 151 PRO B C   1 
ATOM   4247 O  O   . PRO B 1 151 ? 29.752  -2.532  40.943 1.00 62.91  ? 151 PRO B O   1 
ATOM   4248 C  CB  . PRO B 1 151 ? 26.457  -2.118  40.651 1.00 58.27  ? 151 PRO B CB  1 
ATOM   4249 C  CG  . PRO B 1 151 ? 25.192  -2.142  41.526 1.00 61.12  ? 151 PRO B CG  1 
ATOM   4250 C  CD  . PRO B 1 151 ? 25.605  -2.688  42.846 1.00 56.59  ? 151 PRO B CD  1 
ATOM   4251 N  N   . LEU B 1 152 ? 28.865  -1.781  42.888 1.00 53.53  ? 152 LEU B N   1 
ATOM   4252 C  CA  . LEU B 1 152 ? 30.035  -1.076  43.417 1.00 52.46  ? 152 LEU B CA  1 
ATOM   4253 C  C   . LEU B 1 152 ? 31.370  -1.888  43.519 1.00 56.31  ? 152 LEU B C   1 
ATOM   4254 O  O   . LEU B 1 152 ? 32.411  -1.331  43.901 1.00 54.67  ? 152 LEU B O   1 
ATOM   4255 C  CB  . LEU B 1 152 ? 29.639  -0.402  44.732 1.00 50.99  ? 152 LEU B CB  1 
ATOM   4256 C  CG  . LEU B 1 152 ? 30.108  1.021   44.969 1.00 54.64  ? 152 LEU B CG  1 
ATOM   4257 C  CD1 . LEU B 1 152 ? 29.860  1.917   43.768 1.00 54.23  ? 152 LEU B CD1 1 
ATOM   4258 C  CD2 . LEU B 1 152 ? 29.433  1.593   46.191 1.00 55.40  ? 152 LEU B CD2 1 
ATOM   4259 N  N   . GLY B 1 153 ? 31.307  -3.170  43.124 1.00 54.29  ? 153 GLY B N   1 
ATOM   4260 C  CA  . GLY B 1 153 ? 32.417  -4.115  42.989 1.00 56.56  ? 153 GLY B CA  1 
ATOM   4261 C  C   . GLY B 1 153 ? 33.254  -4.467  44.198 1.00 62.89  ? 153 GLY B C   1 
ATOM   4262 O  O   . GLY B 1 153 ? 34.397  -4.900  44.044 1.00 64.42  ? 153 GLY B O   1 
ATOM   4263 N  N   . CYS B 1 154 ? 32.685  -4.332  45.404 1.00 60.07  ? 154 CYS B N   1 
ATOM   4264 C  CA  . CYS B 1 154 ? 33.330  -4.661  46.689 1.00 60.34  ? 154 CYS B CA  1 
ATOM   4265 C  C   . CYS B 1 154 ? 33.071  -6.108  47.026 1.00 63.82  ? 154 CYS B C   1 
ATOM   4266 O  O   . CYS B 1 154 ? 32.245  -6.752  46.382 1.00 64.14  ? 154 CYS B O   1 
ATOM   4267 C  CB  . CYS B 1 154 ? 32.787  -3.763  47.791 1.00 58.61  ? 154 CYS B CB  1 
ATOM   4268 S  SG  . CYS B 1 154 ? 30.989  -3.844  47.961 1.00 60.33  ? 154 CYS B SG  1 
ATOM   4269 N  N   . ASN B 1 155 ? 33.726  -6.598  48.081 1.00 59.21  ? 155 ASN B N   1 
ATOM   4270 C  CA  . ASN B 1 155 ? 33.540  -7.950  48.578 1.00 58.68  ? 155 ASN B CA  1 
ATOM   4271 C  C   . ASN B 1 155 ? 32.812  -7.867  49.880 1.00 59.68  ? 155 ASN B C   1 
ATOM   4272 O  O   . ASN B 1 155 ? 33.231  -7.117  50.768 1.00 59.12  ? 155 ASN B O   1 
ATOM   4273 C  CB  . ASN B 1 155 ? 34.876  -8.626  48.782 1.00 58.85  ? 155 ASN B CB  1 
ATOM   4274 C  CG  . ASN B 1 155 ? 35.473  -9.074  47.496 1.00 79.63  ? 155 ASN B CG  1 
ATOM   4275 O  OD1 . ASN B 1 155 ? 34.898  -9.894  46.768 1.00 73.75  ? 155 ASN B OD1 1 
ATOM   4276 N  ND2 . ASN B 1 155 ? 36.628  -8.523  47.179 1.00 74.40  ? 155 ASN B ND2 1 
ATOM   4277 N  N   . ILE B 1 156 ? 31.708  -8.613  49.999 1.00 54.61  ? 156 ILE B N   1 
ATOM   4278 C  CA  . ILE B 1 156 ? 30.934  -8.643  51.237 1.00 52.76  ? 156 ILE B CA  1 
ATOM   4279 C  C   . ILE B 1 156 ? 31.123  -9.884  52.070 1.00 56.82  ? 156 ILE B C   1 
ATOM   4280 O  O   . ILE B 1 156 ? 30.616  -10.950 51.727 1.00 56.81  ? 156 ILE B O   1 
ATOM   4281 C  CB  . ILE B 1 156 ? 29.481  -8.133  51.179 1.00 53.88  ? 156 ILE B CB  1 
ATOM   4282 C  CG1 . ILE B 1 156 ? 28.852  -8.282  49.780 1.00 54.33  ? 156 ILE B CG1 1 
ATOM   4283 C  CG2 . ILE B 1 156 ? 29.454  -6.694  51.649 1.00 54.01  ? 156 ILE B CG2 1 
ATOM   4284 C  CD1 . ILE B 1 156 ? 27.468  -7.537  49.548 1.00 60.76  ? 156 ILE B CD1 1 
ATOM   4285 N  N   . ILE B 1 157 ? 31.903  -9.731  53.152 1.00 54.30  ? 157 ILE B N   1 
ATOM   4286 C  CA  . ILE B 1 157 ? 32.220  -10.744 54.170 1.00 55.79  ? 157 ILE B CA  1 
ATOM   4287 C  C   . ILE B 1 157 ? 31.014  -10.842 55.150 1.00 60.87  ? 157 ILE B C   1 
ATOM   4288 O  O   . ILE B 1 157 ? 30.661  -9.850  55.812 1.00 59.49  ? 157 ILE B O   1 
ATOM   4289 C  CB  . ILE B 1 157 ? 33.534  -10.356 54.911 1.00 58.64  ? 157 ILE B CB  1 
ATOM   4290 C  CG1 . ILE B 1 157 ? 34.746  -10.443 53.975 1.00 59.73  ? 157 ILE B CG1 1 
ATOM   4291 C  CG2 . ILE B 1 157 ? 33.724  -11.182 56.182 1.00 59.94  ? 157 ILE B CG2 1 
ATOM   4292 C  CD1 . ILE B 1 157 ? 35.871  -9.485  54.294 1.00 63.39  ? 157 ILE B CD1 1 
ATOM   4293 N  N   . ASN B 1 158 ? 30.386  -12.021 55.227 1.00 58.08  ? 158 ASN B N   1 
ATOM   4294 C  CA  . ASN B 1 158 ? 29.249  -12.164 56.115 1.00 57.25  ? 158 ASN B CA  1 
ATOM   4295 C  C   . ASN B 1 158 ? 29.690  -12.435 57.546 1.00 62.95  ? 158 ASN B C   1 
ATOM   4296 O  O   . ASN B 1 158 ? 30.474  -13.359 57.795 1.00 65.56  ? 158 ASN B O   1 
ATOM   4297 C  CB  . ASN B 1 158 ? 28.270  -13.221 55.609 1.00 61.17  ? 158 ASN B CB  1 
ATOM   4298 C  CG  . ASN B 1 158 ? 27.059  -13.498 56.491 1.00 90.03  ? 158 ASN B CG  1 
ATOM   4299 O  OD1 . ASN B 1 158 ? 26.672  -12.715 57.373 1.00 84.53  ? 158 ASN B OD1 1 
ATOM   4300 N  ND2 . ASN B 1 158 ? 26.398  -14.617 56.228 1.00 83.16  ? 158 ASN B ND2 1 
ATOM   4301 N  N   . VAL B 1 159 ? 29.169  -11.615 58.486 1.00 56.73  ? 159 VAL B N   1 
ATOM   4302 C  CA  . VAL B 1 159 ? 29.421  -11.746 59.923 1.00 56.20  ? 159 VAL B CA  1 
ATOM   4303 C  C   . VAL B 1 159 ? 28.240  -12.515 60.471 1.00 59.40  ? 159 VAL B C   1 
ATOM   4304 O  O   . VAL B 1 159 ? 27.094  -12.185 60.159 1.00 56.23  ? 159 VAL B O   1 
ATOM   4305 C  CB  . VAL B 1 159 ? 29.623  -10.398 60.660 1.00 58.01  ? 159 VAL B CB  1 
ATOM   4306 C  CG1 . VAL B 1 159 ? 30.291  -10.611 62.008 1.00 58.73  ? 159 VAL B CG1 1 
ATOM   4307 C  CG2 . VAL B 1 159 ? 30.426  -9.408  59.817 1.00 57.43  ? 159 VAL B CG2 1 
ATOM   4308 N  N   . ALA B 1 160 ? 28.516  -13.583 61.228 1.00 59.36  ? 160 ALA B N   1 
ATOM   4309 C  CA  . ALA B 1 160 ? 27.471  -14.434 61.787 1.00 59.64  ? 160 ALA B CA  1 
ATOM   4310 C  C   . ALA B 1 160 ? 26.609  -13.678 62.788 1.00 62.81  ? 160 ALA B C   1 
ATOM   4311 O  O   . ALA B 1 160 ? 27.112  -12.849 63.548 1.00 62.96  ? 160 ALA B O   1 
ATOM   4312 C  CB  . ALA B 1 160 ? 28.073  -15.664 62.415 1.00 63.11  ? 160 ALA B CB  1 
ATOM   4313 N  N   . SER B 1 161 ? 25.302  -13.930 62.740 1.00 57.66  ? 161 SER B N   1 
ATOM   4314 C  CA  . SER B 1 161 ? 24.329  -13.245 63.575 1.00 55.42  ? 161 SER B CA  1 
ATOM   4315 C  C   . SER B 1 161 ? 23.310  -14.201 64.181 1.00 60.99  ? 161 SER B C   1 
ATOM   4316 O  O   . SER B 1 161 ? 23.041  -15.259 63.610 1.00 62.91  ? 161 SER B O   1 
ATOM   4317 C  CB  . SER B 1 161 ? 23.612  -12.203 62.736 1.00 54.93  ? 161 SER B CB  1 
ATOM   4318 O  OG  . SER B 1 161 ? 23.604  -12.648 61.390 1.00 63.15  ? 161 SER B OG  1 
ATOM   4319 N  N   . ASP B 1 162 ? 22.733  -13.816 65.328 1.00 56.09  ? 162 ASP B N   1 
ATOM   4320 C  CA  . ASP B 1 162 ? 21.698  -14.588 66.009 1.00 56.22  ? 162 ASP B CA  1 
ATOM   4321 C  C   . ASP B 1 162 ? 20.482  -13.727 66.402 1.00 58.43  ? 162 ASP B C   1 
ATOM   4322 O  O   . ASP B 1 162 ? 20.335  -12.599 65.910 1.00 55.86  ? 162 ASP B O   1 
ATOM   4323 C  CB  . ASP B 1 162 ? 22.274  -15.393 67.195 1.00 60.05  ? 162 ASP B CB  1 
ATOM   4324 C  CG  . ASP B 1 162 ? 23.064  -14.616 68.233 1.00 68.77  ? 162 ASP B CG  1 
ATOM   4325 O  OD1 . ASP B 1 162 ? 22.557  -13.584 68.715 1.00 68.01  ? 162 ASP B OD1 1 
ATOM   4326 O  OD2 . ASP B 1 162 ? 24.133  -15.107 68.652 1.00 75.39  ? 162 ASP B OD2 1 
ATOM   4327 N  N   . GLU B 1 163 ? 19.610  -14.268 67.284 1.00 55.73  ? 163 GLU B N   1 
ATOM   4328 C  CA  . GLU B 1 163 ? 18.403  -13.612 67.808 1.00 54.71  ? 163 GLU B CA  1 
ATOM   4329 C  C   . GLU B 1 163 ? 18.751  -12.254 68.420 1.00 58.09  ? 163 GLU B C   1 
ATOM   4330 O  O   . GLU B 1 163 ? 17.889  -11.378 68.487 1.00 57.23  ? 163 GLU B O   1 
ATOM   4331 C  CB  . GLU B 1 163 ? 17.670  -14.487 68.845 1.00 57.87  ? 163 GLU B CB  1 
ATOM   4332 C  CG  . GLU B 1 163 ? 17.948  -15.988 68.780 1.00 72.29  ? 163 GLU B CG  1 
ATOM   4333 C  CD  . GLU B 1 163 ? 19.136  -16.569 69.526 1.00 94.15  ? 163 GLU B CD  1 
ATOM   4334 O  OE1 . GLU B 1 163 ? 19.872  -17.371 68.903 1.00 73.95  ? 163 GLU B OE1 1 
ATOM   4335 O  OE2 . GLU B 1 163 ? 19.308  -16.263 70.733 1.00 87.34  ? 163 GLU B OE2 1 
ATOM   4336 N  N   . SER B 1 164 ? 20.018  -12.074 68.840 1.00 55.12  ? 164 SER B N   1 
ATOM   4337 C  CA  . SER B 1 164 ? 20.524  -10.802 69.360 1.00 54.71  ? 164 SER B CA  1 
ATOM   4338 C  C   . SER B 1 164 ? 21.344  -10.021 68.275 1.00 58.41  ? 164 SER B C   1 
ATOM   4339 O  O   . SER B 1 164 ? 22.032  -9.023  68.571 1.00 58.38  ? 164 SER B O   1 
ATOM   4340 C  CB  . SER B 1 164 ? 21.319  -11.027 70.636 1.00 58.86  ? 164 SER B CB  1 
ATOM   4341 O  OG  . SER B 1 164 ? 20.472  -11.689 71.558 1.00 70.40  ? 164 SER B OG  1 
ATOM   4342 N  N   . GLY B 1 165 ? 21.205  -10.459 67.029 1.00 52.29  ? 165 GLY B N   1 
ATOM   4343 C  CA  . GLY B 1 165 ? 21.927  -9.854  65.932 1.00 51.20  ? 165 GLY B CA  1 
ATOM   4344 C  C   . GLY B 1 165 ? 23.349  -10.364 65.823 1.00 56.27  ? 165 GLY B C   1 
ATOM   4345 O  O   . GLY B 1 165 ? 23.666  -11.448 66.316 1.00 56.56  ? 165 GLY B O   1 
ATOM   4346 N  N   . ILE B 1 166 ? 24.201  -9.574  65.136 1.00 53.20  ? 166 ILE B N   1 
ATOM   4347 C  CA  . ILE B 1 166 ? 25.614  -9.822  64.831 1.00 54.02  ? 166 ILE B CA  1 
ATOM   4348 C  C   . ILE B 1 166 ? 26.439  -10.241 66.043 1.00 57.78  ? 166 ILE B C   1 
ATOM   4349 O  O   . ILE B 1 166 ? 26.463  -9.530  67.052 1.00 56.43  ? 166 ILE B O   1 
ATOM   4350 C  CB  . ILE B 1 166 ? 26.266  -8.743  63.890 1.00 56.17  ? 166 ILE B CB  1 
ATOM   4351 C  CG1 . ILE B 1 166 ? 27.797  -8.569  64.133 1.00 58.40  ? 166 ILE B CG1 1 
ATOM   4352 C  CG2 . ILE B 1 166 ? 25.476  -7.403  63.860 1.00 53.99  ? 166 ILE B CG2 1 
ATOM   4353 C  CD1 . ILE B 1 166 ? 28.545  -7.566  63.216 1.00 68.23  ? 166 ILE B CD1 1 
ATOM   4354 N  N   . VAL B 1 167 ? 27.059  -11.442 65.931 1.00 55.22  ? 167 VAL B N   1 
ATOM   4355 C  CA  . VAL B 1 167 ? 27.864  -12.116 66.946 1.00 56.60  ? 167 VAL B CA  1 
ATOM   4356 C  C   . VAL B 1 167 ? 29.260  -11.514 67.008 1.00 61.59  ? 167 VAL B C   1 
ATOM   4357 O  O   . VAL B 1 167 ? 30.042  -11.704 66.066 1.00 60.14  ? 167 VAL B O   1 
ATOM   4358 C  CB  . VAL B 1 167 ? 27.892  -13.651 66.751 1.00 61.85  ? 167 VAL B CB  1 
ATOM   4359 C  CG1 . VAL B 1 167 ? 28.671  -14.336 67.872 1.00 64.18  ? 167 VAL B CG1 1 
ATOM   4360 C  CG2 . VAL B 1 167 ? 26.479  -14.215 66.654 1.00 60.75  ? 167 VAL B CG2 1 
ATOM   4361 N  N   . PRO B 1 168 ? 29.597  -10.806 68.131 1.00 60.25  ? 168 PRO B N   1 
ATOM   4362 C  CA  . PRO B 1 168 ? 30.930  -10.170 68.233 1.00 61.36  ? 168 PRO B CA  1 
ATOM   4363 C  C   . PRO B 1 168 ? 32.106  -11.122 68.058 1.00 67.75  ? 168 PRO B C   1 
ATOM   4364 O  O   . PRO B 1 168 ? 33.128  -10.736 67.481 1.00 67.08  ? 168 PRO B O   1 
ATOM   4365 C  CB  . PRO B 1 168 ? 30.908  -9.500  69.610 1.00 63.09  ? 168 PRO B CB  1 
ATOM   4366 C  CG  . PRO B 1 168 ? 29.483  -9.304  69.908 1.00 65.02  ? 168 PRO B CG  1 
ATOM   4367 C  CD  . PRO B 1 168 ? 28.772  -10.484 69.317 1.00 60.67  ? 168 PRO B CD  1 
ATOM   4368 N  N   . ASP B 1 169 ? 31.935  -12.376 68.492 1.00 67.01  ? 169 ASP B N   1 
ATOM   4369 C  CA  . ASP B 1 169 ? 32.982  -13.377 68.329 1.00 70.48  ? 169 ASP B CA  1 
ATOM   4370 C  C   . ASP B 1 169 ? 33.148  -13.784 66.851 1.00 72.69  ? 169 ASP B C   1 
ATOM   4371 O  O   . ASP B 1 169 ? 34.264  -14.130 66.447 1.00 75.51  ? 169 ASP B O   1 
ATOM   4372 C  CB  . ASP B 1 169 ? 32.767  -14.586 69.264 1.00 74.96  ? 169 ASP B CB  1 
ATOM   4373 C  CG  . ASP B 1 169 ? 32.731  -14.227 70.746 1.00 90.12  ? 169 ASP B CG  1 
ATOM   4374 O  OD1 . ASP B 1 169 ? 32.164  -13.153 71.092 1.00 89.95  ? 169 ASP B OD1 1 
ATOM   4375 O  OD2 . ASP B 1 169 ? 33.230  -15.034 71.564 1.00 98.09  ? 169 ASP B OD2 1 
ATOM   4376 N  N   . SER B 1 170 ? 32.067  -13.678 66.038 1.00 63.07  ? 170 SER B N   1 
ATOM   4377 C  CA  . SER B 1 170 ? 32.131  -14.022 64.621 1.00 61.00  ? 170 SER B CA  1 
ATOM   4378 C  C   . SER B 1 170 ? 33.130  -13.116 63.966 1.00 64.65  ? 170 SER B C   1 
ATOM   4379 O  O   . SER B 1 170 ? 34.127  -13.574 63.407 1.00 66.00  ? 170 SER B O   1 
ATOM   4380 C  CB  . SER B 1 170 ? 30.769  -13.849 63.965 1.00 59.11  ? 170 SER B CB  1 
ATOM   4381 O  OG  . SER B 1 170 ? 30.880  -13.915 62.554 1.00 60.95  ? 170 SER B OG  1 
ATOM   4382 N  N   . LEU B 1 171 ? 32.893  -11.819 64.131 1.00 59.57  ? 171 LEU B N   1 
ATOM   4383 C  CA  . LEU B 1 171 ? 33.701  -10.731 63.625 1.00 58.65  ? 171 LEU B CA  1 
ATOM   4384 C  C   . LEU B 1 171 ? 35.136  -10.893 64.086 1.00 64.00  ? 171 LEU B C   1 
ATOM   4385 O  O   . LEU B 1 171 ? 36.025  -10.810 63.249 1.00 63.92  ? 171 LEU B O   1 
ATOM   4386 C  CB  . LEU B 1 171 ? 33.082  -9.416  64.128 1.00 56.67  ? 171 LEU B CB  1 
ATOM   4387 C  CG  . LEU B 1 171 ? 33.612  -8.086  63.610 1.00 60.71  ? 171 LEU B CG  1 
ATOM   4388 C  CD1 . LEU B 1 171 ? 33.754  -8.080  62.099 1.00 60.85  ? 171 LEU B CD1 1 
ATOM   4389 C  CD2 . LEU B 1 171 ? 32.717  -6.944  64.071 1.00 60.34  ? 171 LEU B CD2 1 
ATOM   4390 N  N   . ARG B 1 172 ? 35.360  -11.208 65.385 1.00 62.18  ? 172 ARG B N   1 
ATOM   4391 C  CA  . ARG B 1 172 ? 36.704  -11.389 65.927 1.00 65.23  ? 172 ARG B CA  1 
ATOM   4392 C  C   . ARG B 1 172 ? 37.510  -12.397 65.130 1.00 72.67  ? 172 ARG B C   1 
ATOM   4393 O  O   . ARG B 1 172 ? 38.605  -12.048 64.684 1.00 73.78  ? 172 ARG B O   1 
ATOM   4394 C  CB  . ARG B 1 172 ? 36.695  -11.729 67.417 1.00 67.30  ? 172 ARG B CB  1 
ATOM   4395 C  CG  . ARG B 1 172 ? 38.032  -11.429 68.099 1.00 80.87  ? 172 ARG B CG  1 
ATOM   4396 C  CD  . ARG B 1 172 ? 37.903  -11.273 69.605 1.00 89.44  ? 172 ARG B CD  1 
ATOM   4397 N  NE  . ARG B 1 172 ? 37.223  -10.031 69.994 1.00 91.91  ? 172 ARG B NE  1 
ATOM   4398 C  CZ  . ARG B 1 172 ? 35.967  -9.958  70.433 1.00 101.67 ? 172 ARG B CZ  1 
ATOM   4399 N  NH1 . ARG B 1 172 ? 35.230  -11.057 70.547 1.00 88.60  ? 172 ARG B NH1 1 
ATOM   4400 N  NH2 . ARG B 1 172 ? 35.441  -8.786  70.764 1.00 83.67  ? 172 ARG B NH2 1 
ATOM   4401 N  N   . ASP B 1 173 ? 36.959  -13.610 64.881 1.00 70.36  ? 173 ASP B N   1 
ATOM   4402 C  CA  . ASP B 1 173 ? 37.707  -14.592 64.086 1.00 72.59  ? 173 ASP B CA  1 
ATOM   4403 C  C   . ASP B 1 173 ? 37.724  -14.316 62.584 1.00 70.86  ? 173 ASP B C   1 
ATOM   4404 O  O   . ASP B 1 173 ? 38.568  -14.853 61.867 1.00 71.33  ? 173 ASP B O   1 
ATOM   4405 C  CB  . ASP B 1 173 ? 37.524  -16.076 64.509 1.00 77.80  ? 173 ASP B CB  1 
ATOM   4406 C  CG  . ASP B 1 173 ? 36.163  -16.725 64.314 1.00 92.32  ? 173 ASP B CG  1 
ATOM   4407 O  OD1 . ASP B 1 173 ? 35.147  -16.130 64.748 1.00 90.39  ? 173 ASP B OD1 1 
ATOM   4408 O  OD2 . ASP B 1 173 ? 36.124  -17.884 63.841 1.00 102.54 ? 173 ASP B OD2 1 
ATOM   4409 N  N   . ILE B 1 174 ? 36.853  -13.393 62.137 1.00 62.76  ? 174 ILE B N   1 
ATOM   4410 C  CA  . ILE B 1 174 ? 36.806  -12.922 60.750 1.00 60.73  ? 174 ILE B CA  1 
ATOM   4411 C  C   . ILE B 1 174 ? 37.998  -11.954 60.554 1.00 64.33  ? 174 ILE B C   1 
ATOM   4412 O  O   . ILE B 1 174 ? 38.769  -12.124 59.599 1.00 64.90  ? 174 ILE B O   1 
ATOM   4413 C  CB  . ILE B 1 174 ? 35.412  -12.280 60.397 1.00 59.61  ? 174 ILE B CB  1 
ATOM   4414 C  CG1 . ILE B 1 174 ? 34.382  -13.366 60.039 1.00 59.54  ? 174 ILE B CG1 1 
ATOM   4415 C  CG2 . ILE B 1 174 ? 35.509  -11.219 59.280 1.00 56.70  ? 174 ILE B CG2 1 
ATOM   4416 C  CD1 . ILE B 1 174 ? 32.956  -12.984 60.241 1.00 61.20  ? 174 ILE B CD1 1 
ATOM   4417 N  N   . LEU B 1 175 ? 38.155  -10.973 61.497 1.00 58.52  ? 175 LEU B N   1 
ATOM   4418 C  CA  . LEU B 1 175 ? 39.203  -9.940  61.504 1.00 57.86  ? 175 LEU B CA  1 
ATOM   4419 C  C   . LEU B 1 175 ? 40.618  -10.491 61.759 1.00 66.87  ? 175 LEU B C   1 
ATOM   4420 O  O   . LEU B 1 175 ? 41.595  -9.799  61.449 1.00 66.82  ? 175 LEU B O   1 
ATOM   4421 C  CB  . LEU B 1 175 ? 38.874  -8.799  62.482 1.00 55.35  ? 175 LEU B CB  1 
ATOM   4422 C  CG  . LEU B 1 175 ? 37.582  -8.024  62.262 1.00 55.12  ? 175 LEU B CG  1 
ATOM   4423 C  CD1 . LEU B 1 175 ? 37.152  -7.364  63.517 1.00 53.79  ? 175 LEU B CD1 1 
ATOM   4424 C  CD2 . LEU B 1 175 ? 37.728  -6.984  61.184 1.00 56.47  ? 175 LEU B CD2 1 
ATOM   4425 N  N   . SER B 1 176 ? 40.724  -11.751 62.291 1.00 66.88  ? 176 SER B N   1 
ATOM   4426 C  CA  . SER B 1 176 ? 41.987  -12.471 62.529 1.00 70.57  ? 176 SER B CA  1 
ATOM   4427 C  C   . SER B 1 176 ? 42.766  -12.462 61.237 1.00 78.39  ? 176 SER B C   1 
ATOM   4428 O  O   . SER B 1 176 ? 43.990  -12.391 61.272 1.00 82.12  ? 176 SER B O   1 
ATOM   4429 C  CB  . SER B 1 176 ? 41.729  -13.930 62.889 1.00 73.56  ? 176 SER B CB  1 
ATOM   4430 O  OG  . SER B 1 176 ? 40.893  -14.081 64.018 1.00 78.30  ? 176 SER B OG  1 
ATOM   4431 N  N   . ARG B 1 177 ? 42.035  -12.533 60.098 1.00 73.68  ? 177 ARG B N   1 
ATOM   4432 C  CA  . ARG B 1 177 ? 42.533  -12.528 58.731 1.00 75.38  ? 177 ARG B CA  1 
ATOM   4433 C  C   . ARG B 1 177 ? 43.714  -11.591 58.588 1.00 83.21  ? 177 ARG B C   1 
ATOM   4434 O  O   . ARG B 1 177 ? 44.814  -12.032 58.239 1.00 86.68  ? 177 ARG B O   1 
ATOM   4435 C  CB  . ARG B 1 177 ? 41.398  -12.149 57.746 1.00 73.33  ? 177 ARG B CB  1 
ATOM   4436 C  CG  . ARG B 1 177 ? 40.994  -13.236 56.739 1.00 88.66  ? 177 ARG B CG  1 
ATOM   4437 C  CD  . ARG B 1 177 ? 40.285  -14.453 57.348 1.00 105.73 ? 177 ARG B CD  1 
ATOM   4438 N  NE  . ARG B 1 177 ? 41.215  -15.406 57.974 1.00 116.27 ? 177 ARG B NE  1 
ATOM   4439 C  CZ  . ARG B 1 177 ? 41.783  -16.438 57.353 1.00 127.61 ? 177 ARG B CZ  1 
ATOM   4440 N  NH1 . ARG B 1 177 ? 41.522  -16.678 56.074 1.00 115.65 ? 177 ARG B NH1 1 
ATOM   4441 N  NH2 . ARG B 1 177 ? 42.615  -17.237 58.006 1.00 111.93 ? 177 ARG B NH2 1 
ATOM   4442 N  N   . TRP B 1 178 ? 43.508  -10.323 58.940 1.00 78.53  ? 178 TRP B N   1 
ATOM   4443 C  CA  . TRP B 1 178 ? 44.541  -9.300  58.859 1.00 79.87  ? 178 TRP B CA  1 
ATOM   4444 C  C   . TRP B 1 178 ? 45.082  -9.003  60.255 1.00 83.02  ? 178 TRP B C   1 
ATOM   4445 O  O   . TRP B 1 178 ? 44.533  -9.479  61.258 1.00 82.20  ? 178 TRP B O   1 
ATOM   4446 C  CB  . TRP B 1 178 ? 43.982  -8.033  58.183 1.00 76.30  ? 178 TRP B CB  1 
ATOM   4447 C  CG  . TRP B 1 178 ? 43.051  -8.314  57.034 1.00 75.73  ? 178 TRP B CG  1 
ATOM   4448 C  CD1 . TRP B 1 178 ? 43.389  -8.458  55.721 1.00 79.35  ? 178 TRP B CD1 1 
ATOM   4449 C  CD2 . TRP B 1 178 ? 41.639  -8.543  57.113 1.00 73.10  ? 178 TRP B CD2 1 
ATOM   4450 N  NE1 . TRP B 1 178 ? 42.275  -8.762  54.975 1.00 76.87  ? 178 TRP B NE1 1 
ATOM   4451 C  CE2 . TRP B 1 178 ? 41.186  -8.827  55.805 1.00 76.58  ? 178 TRP B CE2 1 
ATOM   4452 C  CE3 . TRP B 1 178 ? 40.707  -8.550  58.168 1.00 72.89  ? 178 TRP B CE3 1 
ATOM   4453 C  CZ2 . TRP B 1 178 ? 39.837  -9.088  55.519 1.00 73.69  ? 178 TRP B CZ2 1 
ATOM   4454 C  CZ3 . TRP B 1 178 ? 39.377  -8.832  57.888 1.00 71.97  ? 178 TRP B CZ3 1 
ATOM   4455 C  CH2 . TRP B 1 178 ? 38.950  -9.082  56.575 1.00 71.84  ? 178 TRP B CH2 1 
ATOM   4456 N  N   . LYS B 1 179 ? 46.179  -8.254  60.320 1.00 80.06  ? 179 LYS B N   1 
ATOM   4457 C  CA  . LYS B 1 179 ? 46.754  -7.883  61.605 1.00 81.38  ? 179 LYS B CA  1 
ATOM   4458 C  C   . LYS B 1 179 ? 46.259  -6.470  61.942 1.00 83.11  ? 179 LYS B C   1 
ATOM   4459 O  O   . LYS B 1 179 ? 46.099  -5.671  61.016 1.00 80.61  ? 179 LYS B O   1 
ATOM   4460 C  CB  . LYS B 1 179 ? 48.298  -7.983  61.590 1.00 87.43  ? 179 LYS B CB  1 
ATOM   4461 C  CG  . LYS B 1 179 ? 48.876  -9.415  61.493 1.00 94.07  ? 179 LYS B CG  1 
ATOM   4462 C  CD  . LYS B 1 179 ? 48.548  -10.354 62.680 1.00 101.69 ? 179 LYS B CD  1 
ATOM   4463 C  CE  . LYS B 1 179 ? 49.282  -10.020 63.965 1.00 113.78 ? 179 LYS B CE  1 
ATOM   4464 N  NZ  . LYS B 1 179 ? 48.503  -10.404 65.178 1.00 118.23 ? 179 LYS B NZ  1 
ATOM   4465 N  N   . PRO B 1 180 ? 45.954  -6.144  63.231 1.00 79.98  ? 180 PRO B N   1 
ATOM   4466 C  CA  . PRO B 1 180 ? 45.419  -4.800  63.557 1.00 77.64  ? 180 PRO B CA  1 
ATOM   4467 C  C   . PRO B 1 180 ? 46.175  -3.607  62.979 1.00 82.13  ? 180 PRO B C   1 
ATOM   4468 O  O   . PRO B 1 180 ? 45.560  -2.568  62.726 1.00 79.36  ? 180 PRO B O   1 
ATOM   4469 C  CB  . PRO B 1 180 ? 45.411  -4.790  65.084 1.00 80.49  ? 180 PRO B CB  1 
ATOM   4470 C  CG  . PRO B 1 180 ? 45.197  -6.218  65.444 1.00 85.59  ? 180 PRO B CG  1 
ATOM   4471 C  CD  . PRO B 1 180 ? 46.007  -6.995  64.439 1.00 83.02  ? 180 PRO B CD  1 
ATOM   4472 N  N   . GLU B 1 181 ? 47.492  -3.781  62.728 1.00 81.49  ? 181 GLU B N   1 
ATOM   4473 C  CA  . GLU B 1 181 ? 48.382  -2.775  62.138 1.00 81.93  ? 181 GLU B CA  1 
ATOM   4474 C  C   . GLU B 1 181 ? 48.270  -2.729  60.605 1.00 83.23  ? 181 GLU B C   1 
ATOM   4475 O  O   . GLU B 1 181 ? 48.592  -1.696  60.020 1.00 82.41  ? 181 GLU B O   1 
ATOM   4476 C  CB  . GLU B 1 181 ? 49.850  -3.010  62.535 1.00 87.78  ? 181 GLU B CB  1 
ATOM   4477 C  CG  . GLU B 1 181 ? 50.071  -3.596  63.918 1.00 102.33 ? 181 GLU B CG  1 
ATOM   4478 C  CD  . GLU B 1 181 ? 50.103  -5.111  63.954 1.00 126.48 ? 181 GLU B CD  1 
ATOM   4479 O  OE1 . GLU B 1 181 ? 49.038  -5.726  63.718 1.00 111.93 ? 181 GLU B OE1 1 
ATOM   4480 O  OE2 . GLU B 1 181 ? 51.182  -5.683  64.236 1.00 124.97 ? 181 GLU B OE2 1 
ATOM   4481 N  N   . ASP B 1 182 ? 47.832  -3.839  59.954 1.00 78.50  ? 182 ASP B N   1 
ATOM   4482 C  CA  . ASP B 1 182 ? 47.688  -3.947  58.490 1.00 77.22  ? 182 ASP B CA  1 
ATOM   4483 C  C   . ASP B 1 182 ? 46.758  -2.876  57.879 1.00 78.82  ? 182 ASP B C   1 
ATOM   4484 O  O   . ASP B 1 182 ? 46.888  -2.558  56.690 1.00 77.14  ? 182 ASP B O   1 
ATOM   4485 C  CB  . ASP B 1 182 ? 47.266  -5.375  58.057 1.00 78.57  ? 182 ASP B CB  1 
ATOM   4486 C  CG  . ASP B 1 182 ? 48.383  -6.412  57.950 1.00 86.67  ? 182 ASP B CG  1 
ATOM   4487 O  OD1 . ASP B 1 182 ? 49.520  -6.033  57.580 1.00 88.06  ? 182 ASP B OD1 1 
ATOM   4488 O  OD2 . ASP B 1 182 ? 48.096  -7.615  58.138 1.00 90.97  ? 182 ASP B OD2 1 
ATOM   4489 N  N   . ALA B 1 183 ? 45.838  -2.312  58.713 1.00 74.33  ? 183 ALA B N   1 
ATOM   4490 C  CA  . ALA B 1 183 ? 44.882  -1.255  58.354 1.00 70.82  ? 183 ALA B CA  1 
ATOM   4491 C  C   . ALA B 1 183 ? 45.580  0.045   58.029 1.00 75.40  ? 183 ALA B C   1 
ATOM   4492 O  O   . ALA B 1 183 ? 45.068  0.810   57.221 1.00 73.58  ? 183 ALA B O   1 
ATOM   4493 C  CB  . ALA B 1 183 ? 43.886  -1.038  59.479 1.00 69.71  ? 183 ALA B CB  1 
ATOM   4494 N  N   . LYS B 1 184 ? 46.748  0.295   58.655 1.00 74.96  ? 184 LYS B N   1 
ATOM   4495 C  CA  . LYS B 1 184 ? 47.587  1.473   58.432 1.00 75.70  ? 184 LYS B CA  1 
ATOM   4496 C  C   . LYS B 1 184 ? 48.211  1.353   57.044 1.00 80.69  ? 184 LYS B C   1 
ATOM   4497 O  O   . LYS B 1 184 ? 48.064  2.269   56.237 1.00 79.26  ? 184 LYS B O   1 
ATOM   4498 C  CB  . LYS B 1 184 ? 48.678  1.603   59.524 1.00 80.92  ? 184 LYS B CB  1 
ATOM   4499 C  CG  . LYS B 1 184 ? 48.188  2.099   60.896 1.00 88.91  ? 184 LYS B CG  1 
ATOM   4500 C  CD  . LYS B 1 184 ? 47.630  0.985   61.811 1.00 94.60  ? 184 LYS B CD  1 
ATOM   4501 C  CE  . LYS B 1 184 ? 46.874  1.534   62.998 1.00 98.56  ? 184 LYS B CE  1 
ATOM   4502 N  NZ  . LYS B 1 184 ? 45.898  0.550   63.538 1.00 102.10 ? 184 LYS B NZ  1 
ATOM   4503 N  N   . ASN B 1 185 ? 48.828  0.191   56.749 1.00 80.12  ? 185 ASN B N   1 
ATOM   4504 C  CA  . ASN B 1 185 ? 49.469  -0.126  55.473 1.00 82.26  ? 185 ASN B CA  1 
ATOM   4505 C  C   . ASN B 1 185 ? 48.456  -0.181  54.308 1.00 85.94  ? 185 ASN B C   1 
ATOM   4506 O  O   . ASN B 1 185 ? 47.412  -0.831  54.423 1.00 83.34  ? 185 ASN B O   1 
ATOM   4507 C  CB  . ASN B 1 185 ? 50.287  -1.421  55.582 1.00 85.73  ? 185 ASN B CB  1 
ATOM   4508 C  CG  . ASN B 1 185 ? 50.781  -1.967  54.266 1.00 99.80  ? 185 ASN B CG  1 
ATOM   4509 O  OD1 . ASN B 1 185 ? 51.709  -1.438  53.645 1.00 90.86  ? 185 ASN B OD1 1 
ATOM   4510 N  ND2 . ASN B 1 185 ? 50.150  -3.033  53.808 1.00 90.29  ? 185 ASN B ND2 1 
ATOM   4511 N  N   . PRO B 1 186 ? 48.755  0.504   53.180 1.00 84.81  ? 186 PRO B N   1 
ATOM   4512 C  CA  . PRO B 1 186 ? 47.795  0.526   52.058 1.00 82.66  ? 186 PRO B CA  1 
ATOM   4513 C  C   . PRO B 1 186 ? 47.644  -0.787  51.283 1.00 87.97  ? 186 PRO B C   1 
ATOM   4514 O  O   . PRO B 1 186 ? 46.517  -1.157  50.928 1.00 85.56  ? 186 PRO B O   1 
ATOM   4515 C  CB  . PRO B 1 186 ? 48.320  1.661   51.168 1.00 84.75  ? 186 PRO B CB  1 
ATOM   4516 C  CG  . PRO B 1 186 ? 49.787  1.725   51.463 1.00 92.57  ? 186 PRO B CG  1 
ATOM   4517 C  CD  . PRO B 1 186 ? 49.939  1.350   52.902 1.00 89.00  ? 186 PRO B CD  1 
ATOM   4518 N  N   . GLN B 1 187 ? 48.780  -1.475  51.016 1.00 87.45  ? 187 GLN B N   1 
ATOM   4519 C  CA  . GLN B 1 187 ? 48.889  -2.729  50.259 1.00 88.20  ? 187 GLN B CA  1 
ATOM   4520 C  C   . GLN B 1 187 ? 47.967  -3.867  50.720 1.00 88.81  ? 187 GLN B C   1 
ATOM   4521 O  O   . GLN B 1 187 ? 47.491  -4.624  49.869 1.00 88.58  ? 187 GLN B O   1 
ATOM   4522 C  CB  . GLN B 1 187 ? 50.357  -3.171  50.130 1.00 94.09  ? 187 GLN B CB  1 
ATOM   4523 C  CG  . GLN B 1 187 ? 51.086  -2.564  48.920 1.00 113.77 ? 187 GLN B CG  1 
ATOM   4524 C  CD  . GLN B 1 187 ? 51.089  -1.047  48.873 1.00 133.93 ? 187 GLN B CD  1 
ATOM   4525 O  OE1 . GLN B 1 187 ? 50.371  -0.423  48.081 1.00 126.18 ? 187 GLN B OE1 1 
ATOM   4526 N  NE2 . GLN B 1 187 ? 51.879  -0.419  49.735 1.00 129.44 ? 187 GLN B NE2 1 
ATOM   4527 N  N   . LYS B 1 188 ? 47.695  -3.970  52.046 1.00 81.79  ? 188 LYS B N   1 
ATOM   4528 C  CA  . LYS B 1 188 ? 46.765  -4.952  52.604 1.00 78.95  ? 188 LYS B CA  1 
ATOM   4529 C  C   . LYS B 1 188 ? 45.366  -4.326  52.549 1.00 79.24  ? 188 LYS B C   1 
ATOM   4530 O  O   . LYS B 1 188 ? 45.218  -3.118  52.771 1.00 77.25  ? 188 LYS B O   1 
ATOM   4531 C  CB  . LYS B 1 188 ? 47.123  -5.308  54.053 1.00 81.22  ? 188 LYS B CB  1 
ATOM   4532 C  CG  . LYS B 1 188 ? 48.425  -6.069  54.218 1.00 87.92  ? 188 LYS B CG  1 
ATOM   4533 C  CD  . LYS B 1 188 ? 48.221  -7.580  54.273 1.00 92.34  ? 188 LYS B CD  1 
ATOM   4534 C  CE  . LYS B 1 188 ? 49.474  -8.312  54.709 1.00 91.07  ? 188 LYS B CE  1 
ATOM   4535 N  NZ  . LYS B 1 188 ? 49.304  -9.788  54.659 1.00 90.97  ? 188 LYS B NZ  1 
ATOM   4536 N  N   . ASN B 1 189 ? 44.344  -5.145  52.250 1.00 74.60  ? 189 ASN B N   1 
ATOM   4537 C  CA  . ASN B 1 189 ? 42.954  -4.693  52.152 1.00 70.79  ? 189 ASN B CA  1 
ATOM   4538 C  C   . ASN B 1 189 ? 42.098  -5.026  53.382 1.00 74.01  ? 189 ASN B C   1 
ATOM   4539 O  O   . ASN B 1 189 ? 41.252  -5.927  53.335 1.00 72.87  ? 189 ASN B O   1 
ATOM   4540 C  CB  . ASN B 1 189 ? 42.303  -5.172  50.844 1.00 69.13  ? 189 ASN B CB  1 
ATOM   4541 C  CG  . ASN B 1 189 ? 42.862  -4.527  49.600 1.00 96.82  ? 189 ASN B CG  1 
ATOM   4542 O  OD1 . ASN B 1 189 ? 43.869  -3.796  49.629 1.00 92.77  ? 189 ASN B OD1 1 
ATOM   4543 N  ND2 . ASN B 1 189 ? 42.225  -4.803  48.464 1.00 89.11  ? 189 ASN B ND2 1 
ATOM   4544 N  N   . THR B 1 190 ? 42.314  -4.286  54.487 1.00 70.73  ? 190 THR B N   1 
ATOM   4545 C  CA  . THR B 1 190 ? 41.517  -4.463  55.707 1.00 69.48  ? 190 THR B CA  1 
ATOM   4546 C  C   . THR B 1 190 ? 40.121  -3.837  55.468 1.00 70.77  ? 190 THR B C   1 
ATOM   4547 O  O   . THR B 1 190 ? 40.003  -2.924  54.628 1.00 70.00  ? 190 THR B O   1 
ATOM   4548 C  CB  . THR B 1 190 ? 42.213  -3.849  56.920 1.00 75.32  ? 190 THR B CB  1 
ATOM   4549 O  OG1 . THR B 1 190 ? 42.454  -2.465  56.674 1.00 75.90  ? 190 THR B OG1 1 
ATOM   4550 C  CG2 . THR B 1 190 ? 43.488  -4.569  57.280 1.00 74.68  ? 190 THR B CG2 1 
ATOM   4551 N  N   . PRO B 1 191 ? 39.052  -4.323  56.144 1.00 64.59  ? 191 PRO B N   1 
ATOM   4552 C  CA  . PRO B 1 191 ? 37.715  -3.757  55.896 1.00 61.26  ? 191 PRO B CA  1 
ATOM   4553 C  C   . PRO B 1 191 ? 37.599  -2.256  56.140 1.00 63.00  ? 191 PRO B C   1 
ATOM   4554 O  O   . PRO B 1 191 ? 38.106  -1.738  57.143 1.00 63.21  ? 191 PRO B O   1 
ATOM   4555 C  CB  . PRO B 1 191 ? 36.799  -4.562  56.817 1.00 62.59  ? 191 PRO B CB  1 
ATOM   4556 C  CG  . PRO B 1 191 ? 37.555  -5.784  57.144 1.00 69.36  ? 191 PRO B CG  1 
ATOM   4557 C  CD  . PRO B 1 191 ? 38.994  -5.415  57.133 1.00 67.01  ? 191 PRO B CD  1 
ATOM   4558 N  N   . LYS B 1 192 ? 36.959  -1.561  55.184 1.00 57.00  ? 192 LYS B N   1 
ATOM   4559 C  CA  . LYS B 1 192 ? 36.763  -0.105  55.200 1.00 55.06  ? 192 LYS B CA  1 
ATOM   4560 C  C   . LYS B 1 192 ? 35.616  0.344   56.132 1.00 54.67  ? 192 LYS B C   1 
ATOM   4561 O  O   . LYS B 1 192 ? 35.640  1.452   56.683 1.00 52.34  ? 192 LYS B O   1 
ATOM   4562 C  CB  . LYS B 1 192 ? 36.595  0.420   53.766 1.00 56.97  ? 192 LYS B CB  1 
ATOM   4563 C  CG  . LYS B 1 192 ? 37.914  0.468   52.974 1.00 77.67  ? 192 LYS B CG  1 
ATOM   4564 C  CD  . LYS B 1 192 ? 38.563  1.861   52.950 1.00 93.15  ? 192 LYS B CD  1 
ATOM   4565 C  CE  . LYS B 1 192 ? 38.014  2.760   51.856 1.00 109.61 ? 192 LYS B CE  1 
ATOM   4566 N  NZ  . LYS B 1 192 ? 38.821  2.694   50.607 1.00 120.58 ? 192 LYS B NZ  1 
ATOM   4567 N  N   . PHE B 1 193 ? 34.634  -0.548  56.317 1.00 50.12  ? 193 PHE B N   1 
ATOM   4568 C  CA  . PHE B 1 193 ? 33.484  -0.367  57.184 1.00 48.06  ? 193 PHE B CA  1 
ATOM   4569 C  C   . PHE B 1 193 ? 32.737  -1.672  57.451 1.00 52.40  ? 193 PHE B C   1 
ATOM   4570 O  O   . PHE B 1 193 ? 32.934  -2.692  56.775 1.00 53.67  ? 193 PHE B O   1 
ATOM   4571 C  CB  . PHE B 1 193 ? 32.506  0.707   56.639 1.00 47.44  ? 193 PHE B CB  1 
ATOM   4572 C  CG  . PHE B 1 193 ? 31.642  0.343   55.450 1.00 47.62  ? 193 PHE B CG  1 
ATOM   4573 C  CD1 . PHE B 1 193 ? 31.905  0.868   54.194 1.00 50.33  ? 193 PHE B CD1 1 
ATOM   4574 C  CD2 . PHE B 1 193 ? 30.505  -0.447  55.608 1.00 49.11  ? 193 PHE B CD2 1 
ATOM   4575 C  CE1 . PHE B 1 193 ? 31.080  0.563   53.104 1.00 50.15  ? 193 PHE B CE1 1 
ATOM   4576 C  CE2 . PHE B 1 193 ? 29.700  -0.777  54.512 1.00 50.59  ? 193 PHE B CE2 1 
ATOM   4577 C  CZ  . PHE B 1 193 ? 29.984  -0.258  53.271 1.00 48.19  ? 193 PHE B CZ  1 
ATOM   4578 N  N   . LEU B 1 194 ? 31.827  -1.589  58.414 1.00 46.97  ? 194 LEU B N   1 
ATOM   4579 C  CA  . LEU B 1 194 ? 30.872  -2.601  58.791 1.00 46.08  ? 194 LEU B CA  1 
ATOM   4580 C  C   . LEU B 1 194 ? 29.533  -1.885  58.773 1.00 49.95  ? 194 LEU B C   1 
ATOM   4581 O  O   . LEU B 1 194 ? 29.418  -0.771  59.290 1.00 49.55  ? 194 LEU B O   1 
ATOM   4582 C  CB  . LEU B 1 194 ? 31.165  -3.143  60.194 1.00 47.23  ? 194 LEU B CB  1 
ATOM   4583 C  CG  . LEU B 1 194 ? 30.045  -3.953  60.832 1.00 50.59  ? 194 LEU B CG  1 
ATOM   4584 C  CD1 . LEU B 1 194 ? 30.216  -5.436  60.588 1.00 51.60  ? 194 LEU B CD1 1 
ATOM   4585 C  CD2 . LEU B 1 194 ? 29.903  -3.617  62.284 1.00 52.24  ? 194 LEU B CD2 1 
ATOM   4586 N  N   . TYR B 1 195 ? 28.531  -2.517  58.170 1.00 46.35  ? 195 TYR B N   1 
ATOM   4587 C  CA  . TYR B 1 195 ? 27.163  -2.007  58.083 1.00 43.81  ? 195 TYR B CA  1 
ATOM   4588 C  C   . TYR B 1 195 ? 26.285  -2.889  58.924 1.00 48.31  ? 195 TYR B C   1 
ATOM   4589 O  O   . TYR B 1 195 ? 26.452  -4.110  58.881 1.00 49.23  ? 195 TYR B O   1 
ATOM   4590 C  CB  . TYR B 1 195 ? 26.683  -2.120  56.615 1.00 43.30  ? 195 TYR B CB  1 
ATOM   4591 C  CG  . TYR B 1 195 ? 25.194  -1.938  56.386 1.00 42.37  ? 195 TYR B CG  1 
ATOM   4592 C  CD1 . TYR B 1 195 ? 24.673  -0.703  56.014 1.00 42.97  ? 195 TYR B CD1 1 
ATOM   4593 C  CD2 . TYR B 1 195 ? 24.313  -3.018  56.472 1.00 42.40  ? 195 TYR B CD2 1 
ATOM   4594 C  CE1 . TYR B 1 195 ? 23.313  -0.532  55.767 1.00 41.84  ? 195 TYR B CE1 1 
ATOM   4595 C  CE2 . TYR B 1 195 ? 22.940  -2.846  56.289 1.00 41.72  ? 195 TYR B CE2 1 
ATOM   4596 C  CZ  . TYR B 1 195 ? 22.446  -1.601  55.912 1.00 46.91  ? 195 TYR B CZ  1 
ATOM   4597 O  OH  . TYR B 1 195 ? 21.113  -1.408  55.625 1.00 43.46  ? 195 TYR B OH  1 
ATOM   4598 N  N   . THR B 1 196 ? 25.281  -2.299  59.596 1.00 45.10  ? 196 THR B N   1 
ATOM   4599 C  CA  . THR B 1 196 ? 24.192  -3.046  60.256 1.00 46.03  ? 196 THR B CA  1 
ATOM   4600 C  C   . THR B 1 196 ? 22.910  -2.271  60.496 1.00 50.85  ? 196 THR B C   1 
ATOM   4601 O  O   . THR B 1 196 ? 22.925  -1.035  60.544 1.00 50.79  ? 196 THR B O   1 
ATOM   4602 C  CB  . THR B 1 196 ? 24.584  -3.979  61.438 1.00 49.98  ? 196 THR B CB  1 
ATOM   4603 O  OG1 . THR B 1 196 ? 23.520  -4.930  61.595 1.00 41.23  ? 196 THR B OG1 1 
ATOM   4604 C  CG2 . THR B 1 196 ? 24.819  -3.219  62.756 1.00 48.16  ? 196 THR B CG2 1 
ATOM   4605 N  N   . VAL B 1 197 ? 21.803  -3.017  60.628 1.00 47.89  ? 197 VAL B N   1 
ATOM   4606 C  CA  . VAL B 1 197 ? 20.522  -2.480  61.051 1.00 48.05  ? 197 VAL B CA  1 
ATOM   4607 C  C   . VAL B 1 197 ? 20.467  -3.011  62.478 1.00 55.30  ? 197 VAL B C   1 
ATOM   4608 O  O   . VAL B 1 197 ? 20.216  -4.214  62.699 1.00 56.97  ? 197 VAL B O   1 
ATOM   4609 C  CB  . VAL B 1 197 ? 19.284  -2.833  60.194 1.00 51.32  ? 197 VAL B CB  1 
ATOM   4610 C  CG1 . VAL B 1 197 ? 18.011  -2.314  60.868 1.00 50.85  ? 197 VAL B CG1 1 
ATOM   4611 C  CG2 . VAL B 1 197 ? 19.416  -2.250  58.786 1.00 50.02  ? 197 VAL B CG2 1 
ATOM   4612 N  N   . PRO B 1 198 ? 20.896  -2.166  63.444 1.00 50.40  ? 198 PRO B N   1 
ATOM   4613 C  CA  . PRO B 1 198 ? 20.996  -2.652  64.824 1.00 50.63  ? 198 PRO B CA  1 
ATOM   4614 C  C   . PRO B 1 198 ? 19.655  -2.864  65.514 1.00 52.32  ? 198 PRO B C   1 
ATOM   4615 O  O   . PRO B 1 198 ? 19.602  -3.630  66.468 1.00 53.36  ? 198 PRO B O   1 
ATOM   4616 C  CB  . PRO B 1 198 ? 21.910  -1.628  65.511 1.00 52.71  ? 198 PRO B CB  1 
ATOM   4617 C  CG  . PRO B 1 198 ? 22.266  -0.604  64.444 1.00 56.08  ? 198 PRO B CG  1 
ATOM   4618 C  CD  . PRO B 1 198 ? 21.276  -0.742  63.348 1.00 50.23  ? 198 PRO B CD  1 
ATOM   4619 N  N   . ASN B 1 199 ? 18.581  -2.218  65.039 1.00 45.75  ? 199 ASN B N   1 
ATOM   4620 C  CA  . ASN B 1 199 ? 17.276  -2.417  65.650 1.00 45.72  ? 199 ASN B CA  1 
ATOM   4621 C  C   . ASN B 1 199 ? 16.276  -3.001  64.650 1.00 48.45  ? 199 ASN B C   1 
ATOM   4622 O  O   . ASN B 1 199 ? 16.058  -2.397  63.588 1.00 48.63  ? 199 ASN B O   1 
ATOM   4623 C  CB  . ASN B 1 199 ? 16.730  -1.126  66.288 1.00 47.23  ? 199 ASN B CB  1 
ATOM   4624 C  CG  . ASN B 1 199 ? 17.572  -0.466  67.351 1.00 75.97  ? 199 ASN B CG  1 
ATOM   4625 O  OD1 . ASN B 1 199 ? 18.135  -1.093  68.267 1.00 73.81  ? 199 ASN B OD1 1 
ATOM   4626 N  ND2 . ASN B 1 199 ? 17.575  0.849   67.308 1.00 69.19  ? 199 ASN B ND2 1 
ATOM   4627 N  N   . GLY B 1 200 ? 15.673  -4.141  65.013 1.00 42.62  ? 200 GLY B N   1 
ATOM   4628 C  CA  . GLY B 1 200 ? 14.681  -4.839  64.207 1.00 41.80  ? 200 GLY B CA  1 
ATOM   4629 C  C   . GLY B 1 200 ? 15.072  -4.940  62.747 1.00 45.85  ? 200 GLY B C   1 
ATOM   4630 O  O   . GLY B 1 200 ? 14.382  -4.390  61.875 1.00 45.05  ? 200 GLY B O   1 
ATOM   4631 N  N   . ASN B 1 201 ? 16.222  -5.605  62.491 1.00 42.55  ? 201 ASN B N   1 
ATOM   4632 C  CA  . ASN B 1 201 ? 16.824  -5.782  61.173 1.00 41.86  ? 201 ASN B CA  1 
ATOM   4633 C  C   . ASN B 1 201 ? 15.870  -6.337  60.144 1.00 44.16  ? 201 ASN B C   1 
ATOM   4634 O  O   . ASN B 1 201 ? 15.116  -7.273  60.421 1.00 43.68  ? 201 ASN B O   1 
ATOM   4635 C  CB  . ASN B 1 201 ? 18.112  -6.643  61.256 1.00 46.73  ? 201 ASN B CB  1 
ATOM   4636 C  CG  . ASN B 1 201 ? 18.709  -7.146  59.931 1.00 58.08  ? 201 ASN B CG  1 
ATOM   4637 O  OD1 . ASN B 1 201 ? 18.450  -8.280  59.474 1.00 41.32  ? 201 ASN B OD1 1 
ATOM   4638 N  ND2 . ASN B 1 201 ? 19.564  -6.335  59.320 1.00 45.24  ? 201 ASN B ND2 1 
ATOM   4639 N  N   . ASN B 1 202 ? 15.922  -5.740  58.946 1.00 39.17  ? 202 ASN B N   1 
ATOM   4640 C  CA  . ASN B 1 202 ? 15.197  -6.193  57.776 1.00 38.92  ? 202 ASN B CA  1 
ATOM   4641 C  C   . ASN B 1 202 ? 16.108  -7.268  57.143 1.00 44.07  ? 202 ASN B C   1 
ATOM   4642 O  O   . ASN B 1 202 ? 17.265  -6.975  56.827 1.00 43.97  ? 202 ASN B O   1 
ATOM   4643 C  CB  . ASN B 1 202 ? 15.008  -5.033  56.824 1.00 39.68  ? 202 ASN B CB  1 
ATOM   4644 C  CG  . ASN B 1 202 ? 13.812  -5.146  55.932 1.00 64.18  ? 202 ASN B CG  1 
ATOM   4645 O  OD1 . ASN B 1 202 ? 13.179  -6.210  55.814 1.00 60.81  ? 202 ASN B OD1 1 
ATOM   4646 N  ND2 . ASN B 1 202 ? 13.477  -4.026  55.291 1.00 51.65  ? 202 ASN B ND2 1 
ATOM   4647 N  N   . PRO B 1 203 ? 15.705  -8.547  57.097 1.00 41.90  ? 203 PRO B N   1 
ATOM   4648 C  CA  . PRO B 1 203 ? 14.381  -9.110  57.394 1.00 42.43  ? 203 PRO B CA  1 
ATOM   4649 C  C   . PRO B 1 203 ? 14.187  -9.800  58.756 1.00 46.74  ? 203 PRO B C   1 
ATOM   4650 O  O   . PRO B 1 203 ? 13.044  -9.902  59.193 1.00 46.70  ? 203 PRO B O   1 
ATOM   4651 C  CB  . PRO B 1 203 ? 14.210  -10.102 56.247 1.00 45.27  ? 203 PRO B CB  1 
ATOM   4652 C  CG  . PRO B 1 203 ? 15.615  -10.670 56.061 1.00 50.42  ? 203 PRO B CG  1 
ATOM   4653 C  CD  . PRO B 1 203 ? 16.581  -9.573  56.497 1.00 44.65  ? 203 PRO B CD  1 
ATOM   4654 N  N   . THR B 1 204 ? 15.280  -10.302 59.394 1.00 43.41  ? 204 THR B N   1 
ATOM   4655 C  CA  . THR B 1 204 ? 15.335  -11.049 60.670 1.00 43.96  ? 204 THR B CA  1 
ATOM   4656 C  C   . THR B 1 204 ? 14.299  -10.610 61.713 1.00 46.94  ? 204 THR B C   1 
ATOM   4657 O  O   . THR B 1 204 ? 13.540  -11.433 62.234 1.00 46.82  ? 204 THR B O   1 
ATOM   4658 C  CB  . THR B 1 204 ? 16.749  -10.967 61.289 1.00 52.29  ? 204 THR B CB  1 
ATOM   4659 O  OG1 . THR B 1 204 ? 17.033  -9.625  61.696 1.00 47.28  ? 204 THR B OG1 1 
ATOM   4660 C  CG2 . THR B 1 204 ? 17.838  -11.466 60.359 1.00 54.43  ? 204 THR B CG2 1 
ATOM   4661 N  N   . GLY B 1 205 ? 14.293  -9.307  61.989 1.00 42.30  ? 205 GLY B N   1 
ATOM   4662 C  CA  . GLY B 1 205 ? 13.448  -8.677  62.989 1.00 41.27  ? 205 GLY B CA  1 
ATOM   4663 C  C   . GLY B 1 205 ? 14.222  -8.523  64.274 1.00 44.23  ? 205 GLY B C   1 
ATOM   4664 O  O   . GLY B 1 205 ? 13.740  -7.877  65.203 1.00 42.88  ? 205 GLY B O   1 
ATOM   4665 N  N   . ASN B 1 206 ? 15.441  -9.112  64.315 1.00 42.75  ? 206 ASN B N   1 
ATOM   4666 C  CA  . ASN B 1 206 ? 16.355  -9.109  65.461 1.00 44.47  ? 206 ASN B CA  1 
ATOM   4667 C  C   . ASN B 1 206 ? 17.058  -7.772  65.656 1.00 48.25  ? 206 ASN B C   1 
ATOM   4668 O  O   . ASN B 1 206 ? 17.274  -7.023  64.697 1.00 47.22  ? 206 ASN B O   1 
ATOM   4669 C  CB  . ASN B 1 206 ? 17.388  -10.245 65.363 1.00 49.61  ? 206 ASN B CB  1 
ATOM   4670 C  CG  . ASN B 1 206 ? 16.816  -11.625 65.149 1.00 84.84  ? 206 ASN B CG  1 
ATOM   4671 O  OD1 . ASN B 1 206 ? 17.336  -12.408 64.349 1.00 84.84  ? 206 ASN B OD1 1 
ATOM   4672 N  ND2 . ASN B 1 206 ? 15.737  -11.964 65.850 1.00 79.74  ? 206 ASN B ND2 1 
ATOM   4673 N  N   . SER B 1 207 ? 17.444  -7.499  66.907 1.00 45.38  ? 207 SER B N   1 
ATOM   4674 C  CA  . SER B 1 207 ? 18.102  -6.261  67.312 1.00 44.77  ? 207 SER B CA  1 
ATOM   4675 C  C   . SER B 1 207 ? 19.331  -6.522  68.223 1.00 49.52  ? 207 SER B C   1 
ATOM   4676 O  O   . SER B 1 207 ? 19.391  -7.552  68.904 1.00 50.27  ? 207 SER B O   1 
ATOM   4677 C  CB  . SER B 1 207 ? 17.083  -5.337  67.976 1.00 49.07  ? 207 SER B CB  1 
ATOM   4678 O  OG  . SER B 1 207 ? 17.627  -4.111  68.431 1.00 61.84  ? 207 SER B OG  1 
ATOM   4679 N  N   . LEU B 1 208 ? 20.303  -5.584  68.219 1.00 45.84  ? 208 LEU B N   1 
ATOM   4680 C  CA  . LEU B 1 208 ? 21.552  -5.662  68.990 1.00 47.61  ? 208 LEU B CA  1 
ATOM   4681 C  C   . LEU B 1 208 ? 21.414  -5.290  70.489 1.00 54.17  ? 208 LEU B C   1 
ATOM   4682 O  O   . LEU B 1 208 ? 20.464  -4.608  70.915 1.00 54.48  ? 208 LEU B O   1 
ATOM   4683 C  CB  . LEU B 1 208 ? 22.662  -4.820  68.322 1.00 47.15  ? 208 LEU B CB  1 
ATOM   4684 C  CG  . LEU B 1 208 ? 23.684  -5.604  67.493 1.00 52.68  ? 208 LEU B CG  1 
ATOM   4685 C  CD1 . LEU B 1 208 ? 23.816  -5.044  66.090 1.00 51.40  ? 208 LEU B CD1 1 
ATOM   4686 C  CD2 . LEU B 1 208 ? 25.015  -5.591  68.148 1.00 56.94  ? 208 LEU B CD2 1 
ATOM   4687 N  N   . THR B 1 209 ? 22.378  -5.746  71.285 1.00 50.48  ? 209 THR B N   1 
ATOM   4688 C  CA  . THR B 1 209 ? 22.384  -5.432  72.697 1.00 50.51  ? 209 THR B CA  1 
ATOM   4689 C  C   . THR B 1 209 ? 23.440  -4.376  72.943 1.00 53.80  ? 209 THR B C   1 
ATOM   4690 O  O   . THR B 1 209 ? 24.444  -4.327  72.228 1.00 51.83  ? 209 THR B O   1 
ATOM   4691 C  CB  . THR B 1 209 ? 22.652  -6.673  73.519 1.00 58.17  ? 209 THR B CB  1 
ATOM   4692 O  OG1 . THR B 1 209 ? 24.061  -6.802  73.684 1.00 59.27  ? 209 THR B OG1 1 
ATOM   4693 C  CG2 . THR B 1 209 ? 22.065  -7.929  72.899 1.00 57.43  ? 209 THR B CG2 1 
ATOM   4694 N  N   . SER B 1 210 ? 23.234  -3.568  73.991 1.00 52.31  ? 210 SER B N   1 
ATOM   4695 C  CA  . SER B 1 210 ? 24.150  -2.516  74.428 1.00 53.51  ? 210 SER B CA  1 
ATOM   4696 C  C   . SER B 1 210 ? 25.575  -3.080  74.603 1.00 58.34  ? 210 SER B C   1 
ATOM   4697 O  O   . SER B 1 210 ? 26.533  -2.451  74.147 1.00 58.97  ? 210 SER B O   1 
ATOM   4698 C  CB  . SER B 1 210 ? 23.651  -1.893  75.734 1.00 59.58  ? 210 SER B CB  1 
ATOM   4699 O  OG  . SER B 1 210 ? 24.363  -0.712  76.069 1.00 73.13  ? 210 SER B OG  1 
ATOM   4700 N  N   . GLU B 1 211 ? 25.699  -4.286  75.218 1.00 53.32  ? 211 GLU B N   1 
ATOM   4701 C  CA  . GLU B 1 211 ? 26.975  -4.939  75.445 1.00 53.06  ? 211 GLU B CA  1 
ATOM   4702 C  C   . GLU B 1 211 ? 27.668  -5.314  74.170 1.00 54.77  ? 211 GLU B C   1 
ATOM   4703 O  O   . GLU B 1 211 ? 28.797  -4.875  73.968 1.00 54.76  ? 211 GLU B O   1 
ATOM   4704 C  CB  . GLU B 1 211 ? 26.844  -6.117  76.399 1.00 55.91  ? 211 GLU B CB  1 
ATOM   4705 C  CG  . GLU B 1 211 ? 26.856  -5.671  77.848 1.00 71.49  ? 211 GLU B CG  1 
ATOM   4706 C  CD  . GLU B 1 211 ? 27.870  -4.604  78.237 1.00 93.87  ? 211 GLU B CD  1 
ATOM   4707 O  OE1 . GLU B 1 211 ? 27.438  -3.460  78.511 1.00 85.36  ? 211 GLU B OE1 1 
ATOM   4708 O  OE2 . GLU B 1 211 ? 29.088  -4.906  78.268 1.00 83.24  ? 211 GLU B OE2 1 
ATOM   4709 N  N   . ARG B 1 212 ? 26.995  -6.074  73.274 1.00 48.98  ? 212 ARG B N   1 
ATOM   4710 C  CA  . ARG B 1 212 ? 27.615  -6.438  72.000 1.00 47.40  ? 212 ARG B CA  1 
ATOM   4711 C  C   . ARG B 1 212 ? 27.888  -5.229  71.102 1.00 49.45  ? 212 ARG B C   1 
ATOM   4712 O  O   . ARG B 1 212 ? 28.870  -5.241  70.372 1.00 49.81  ? 212 ARG B O   1 
ATOM   4713 C  CB  . ARG B 1 212 ? 26.977  -7.651  71.300 1.00 45.56  ? 212 ARG B CB  1 
ATOM   4714 C  CG  . ARG B 1 212 ? 25.463  -7.678  71.203 1.00 52.16  ? 212 ARG B CG  1 
ATOM   4715 C  CD  . ARG B 1 212 ? 24.949  -8.786  70.285 1.00 54.80  ? 212 ARG B CD  1 
ATOM   4716 N  NE  . ARG B 1 212 ? 25.079  -10.132 70.859 1.00 45.40  ? 212 ARG B NE  1 
ATOM   4717 C  CZ  . ARG B 1 212 ? 24.967  -11.257 70.162 1.00 46.33  ? 212 ARG B CZ  1 
ATOM   4718 N  NH1 . ARG B 1 212 ? 24.734  -11.218 68.859 1.00 48.44  ? 212 ARG B NH1 1 
ATOM   4719 N  NH2 . ARG B 1 212 ? 25.093  -12.426 70.758 1.00 29.84  ? 212 ARG B NH2 1 
ATOM   4720 N  N   . LYS B 1 213 ? 27.116  -4.131  71.264 1.00 44.52  ? 213 LYS B N   1 
ATOM   4721 C  CA  . LYS B 1 213 ? 27.376  -2.863  70.565 1.00 43.14  ? 213 LYS B CA  1 
ATOM   4722 C  C   . LYS B 1 213 ? 28.733  -2.290  71.048 1.00 48.08  ? 213 LYS B C   1 
ATOM   4723 O  O   . LYS B 1 213 ? 29.473  -1.694  70.258 1.00 47.00  ? 213 LYS B O   1 
ATOM   4724 C  CB  . LYS B 1 213 ? 26.236  -1.844  70.788 1.00 44.06  ? 213 LYS B CB  1 
ATOM   4725 C  CG  . LYS B 1 213 ? 25.071  -1.953  69.804 1.00 50.84  ? 213 LYS B CG  1 
ATOM   4726 C  CD  . LYS B 1 213 ? 24.298  -0.644  69.714 1.00 59.87  ? 213 LYS B CD  1 
ATOM   4727 C  CE  . LYS B 1 213 ? 22.975  -0.825  69.009 1.00 78.61  ? 213 LYS B CE  1 
ATOM   4728 N  NZ  . LYS B 1 213 ? 22.286  0.468   68.747 1.00 88.97  ? 213 LYS B NZ  1 
ATOM   4729 N  N   . LYS B 1 214 ? 29.068  -2.534  72.338 1.00 46.75  ? 214 LYS B N   1 
ATOM   4730 C  CA  . LYS B 1 214 ? 30.334  -2.136  72.954 1.00 48.66  ? 214 LYS B CA  1 
ATOM   4731 C  C   . LYS B 1 214 ? 31.471  -2.963  72.320 1.00 54.56  ? 214 LYS B C   1 
ATOM   4732 O  O   . LYS B 1 214 ? 32.454  -2.386  71.837 1.00 54.42  ? 214 LYS B O   1 
ATOM   4733 C  CB  . LYS B 1 214 ? 30.299  -2.319  74.490 1.00 51.78  ? 214 LYS B CB  1 
ATOM   4734 C  CG  . LYS B 1 214 ? 29.314  -1.402  75.191 1.00 59.90  ? 214 LYS B CG  1 
ATOM   4735 C  CD  . LYS B 1 214 ? 29.496  -1.374  76.688 1.00 72.65  ? 214 LYS B CD  1 
ATOM   4736 C  CE  . LYS B 1 214 ? 28.507  -0.463  77.377 1.00 76.06  ? 214 LYS B CE  1 
ATOM   4737 N  NZ  . LYS B 1 214 ? 28.508  -0.680  78.850 1.00 81.56  ? 214 LYS B NZ  1 
ATOM   4738 N  N   . GLU B 1 215 ? 31.294  -4.308  72.274 1.00 51.82  ? 215 GLU B N   1 
ATOM   4739 C  CA  . GLU B 1 215 ? 32.251  -5.249  71.691 1.00 53.32  ? 215 GLU B CA  1 
ATOM   4740 C  C   . GLU B 1 215 ? 32.531  -4.867  70.226 1.00 57.05  ? 215 GLU B C   1 
ATOM   4741 O  O   . GLU B 1 215 ? 33.686  -4.648  69.862 1.00 58.73  ? 215 GLU B O   1 
ATOM   4742 C  CB  . GLU B 1 215 ? 31.753  -6.708  71.817 1.00 55.06  ? 215 GLU B CB  1 
ATOM   4743 C  CG  . GLU B 1 215 ? 31.935  -7.325  73.196 1.00 67.40  ? 215 GLU B CG  1 
ATOM   4744 C  CD  . GLU B 1 215 ? 31.575  -8.797  73.344 1.00 86.83  ? 215 GLU B CD  1 
ATOM   4745 O  OE1 . GLU B 1 215 ? 30.637  -9.098  74.120 1.00 64.74  ? 215 GLU B OE1 1 
ATOM   4746 O  OE2 . GLU B 1 215 ? 32.264  -9.653  72.735 1.00 80.04  ? 215 GLU B OE2 1 
ATOM   4747 N  N   . ILE B 1 216 ? 31.476  -4.699  69.419 1.00 50.95  ? 216 ILE B N   1 
ATOM   4748 C  CA  . ILE B 1 216 ? 31.622  -4.307  68.023 1.00 49.65  ? 216 ILE B CA  1 
ATOM   4749 C  C   . ILE B 1 216 ? 32.382  -2.974  67.909 1.00 55.88  ? 216 ILE B C   1 
ATOM   4750 O  O   . ILE B 1 216 ? 33.341  -2.910  67.134 1.00 57.03  ? 216 ILE B O   1 
ATOM   4751 C  CB  . ILE B 1 216 ? 30.271  -4.335  67.257 1.00 49.88  ? 216 ILE B CB  1 
ATOM   4752 C  CG1 . ILE B 1 216 ? 29.720  -5.767  67.190 1.00 49.83  ? 216 ILE B CG1 1 
ATOM   4753 C  CG2 . ILE B 1 216 ? 30.430  -3.765  65.843 1.00 49.74  ? 216 ILE B CG2 1 
ATOM   4754 C  CD1 . ILE B 1 216 ? 28.284  -5.851  66.950 1.00 52.68  ? 216 ILE B CD1 1 
ATOM   4755 N  N   . TYR B 1 217 ? 32.008  -1.943  68.712 1.00 52.00  ? 217 TYR B N   1 
ATOM   4756 C  CA  . TYR B 1 217 ? 32.716  -0.660  68.671 1.00 52.42  ? 217 TYR B CA  1 
ATOM   4757 C  C   . TYR B 1 217 ? 34.194  -0.826  69.014 1.00 59.45  ? 217 TYR B C   1 
ATOM   4758 O  O   . TYR B 1 217 ? 35.035  -0.219  68.351 1.00 58.67  ? 217 TYR B O   1 
ATOM   4759 C  CB  . TYR B 1 217 ? 32.061  0.421   69.560 1.00 53.34  ? 217 TYR B CB  1 
ATOM   4760 C  CG  . TYR B 1 217 ? 32.605  1.815   69.293 1.00 55.09  ? 217 TYR B CG  1 
ATOM   4761 C  CD1 . TYR B 1 217 ? 32.009  2.650   68.352 1.00 55.46  ? 217 TYR B CD1 1 
ATOM   4762 C  CD2 . TYR B 1 217 ? 33.738  2.281   69.955 1.00 57.96  ? 217 TYR B CD2 1 
ATOM   4763 C  CE1 . TYR B 1 217 ? 32.544  3.903   68.054 1.00 58.01  ? 217 TYR B CE1 1 
ATOM   4764 C  CE2 . TYR B 1 217 ? 34.274  3.538   69.679 1.00 59.35  ? 217 TYR B CE2 1 
ATOM   4765 C  CZ  . TYR B 1 217 ? 33.670  4.352   68.734 1.00 65.38  ? 217 TYR B CZ  1 
ATOM   4766 O  OH  . TYR B 1 217 ? 34.200  5.597   68.484 1.00 61.86  ? 217 TYR B OH  1 
ATOM   4767 N  N   . GLU B 1 218 ? 34.515  -1.647  70.036 1.00 59.33  ? 218 GLU B N   1 
ATOM   4768 C  CA  . GLU B 1 218 ? 35.916  -1.853  70.396 1.00 62.60  ? 218 GLU B CA  1 
ATOM   4769 C  C   . GLU B 1 218 ? 36.701  -2.734  69.417 1.00 67.04  ? 218 GLU B C   1 
ATOM   4770 O  O   . GLU B 1 218 ? 37.934  -2.762  69.462 1.00 69.33  ? 218 GLU B O   1 
ATOM   4771 C  CB  . GLU B 1 218 ? 36.169  -2.111  71.899 1.00 66.65  ? 218 GLU B CB  1 
ATOM   4772 C  CG  . GLU B 1 218 ? 35.423  -3.262  72.548 1.00 82.80  ? 218 GLU B CG  1 
ATOM   4773 C  CD  . GLU B 1 218 ? 35.443  -3.219  74.069 1.00 119.01 ? 218 GLU B CD  1 
ATOM   4774 O  OE1 . GLU B 1 218 ? 36.398  -3.768  74.666 1.00 122.69 ? 218 GLU B OE1 1 
ATOM   4775 O  OE2 . GLU B 1 218 ? 34.511  -2.628  74.664 1.00 116.25 ? 218 GLU B OE2 1 
ATOM   4776 N  N   . LEU B 1 219 ? 35.980  -3.385  68.477 1.00 61.00  ? 219 LEU B N   1 
ATOM   4777 C  CA  . LEU B 1 219 ? 36.572  -4.200  67.412 1.00 60.81  ? 219 LEU B CA  1 
ATOM   4778 C  C   . LEU B 1 219 ? 36.786  -3.314  66.212 1.00 62.59  ? 219 LEU B C   1 
ATOM   4779 O  O   . LEU B 1 219 ? 37.691  -3.549  65.417 1.00 62.70  ? 219 LEU B O   1 
ATOM   4780 C  CB  . LEU B 1 219 ? 35.675  -5.397  67.059 1.00 59.73  ? 219 LEU B CB  1 
ATOM   4781 C  CG  . LEU B 1 219 ? 36.357  -6.779  67.059 1.00 67.01  ? 219 LEU B CG  1 
ATOM   4782 C  CD1 . LEU B 1 219 ? 37.228  -7.009  68.304 1.00 70.13  ? 219 LEU B CD1 1 
ATOM   4783 C  CD2 . LEU B 1 219 ? 35.339  -7.886  66.958 1.00 68.62  ? 219 LEU B CD2 1 
ATOM   4784 N  N   . ALA B 1 220 ? 35.968  -2.257  66.116 1.00 57.91  ? 220 ALA B N   1 
ATOM   4785 C  CA  . ALA B 1 220 ? 36.032  -1.259  65.059 1.00 56.44  ? 220 ALA B CA  1 
ATOM   4786 C  C   . ALA B 1 220 ? 37.244  -0.380  65.252 1.00 63.95  ? 220 ALA B C   1 
ATOM   4787 O  O   . ALA B 1 220 ? 37.824  0.065   64.261 1.00 64.98  ? 220 ALA B O   1 
ATOM   4788 C  CB  . ALA B 1 220 ? 34.769  -0.427  65.044 1.00 54.28  ? 220 ALA B CB  1 
ATOM   4789 N  N   . ARG B 1 221 ? 37.652  -0.147  66.517 1.00 61.83  ? 221 ARG B N   1 
ATOM   4790 C  CA  . ARG B 1 221 ? 38.827  0.677   66.785 1.00 63.50  ? 221 ARG B CA  1 
ATOM   4791 C  C   . ARG B 1 221 ? 40.113  -0.090  66.556 1.00 70.10  ? 221 ARG B C   1 
ATOM   4792 O  O   . ARG B 1 221 ? 41.104  0.499   66.104 1.00 70.34  ? 221 ARG B O   1 
ATOM   4793 C  CB  . ARG B 1 221 ? 38.783  1.372   68.161 1.00 63.42  ? 221 ARG B CB  1 
ATOM   4794 C  CG  . ARG B 1 221 ? 38.603  0.438   69.337 1.00 76.77  ? 221 ARG B CG  1 
ATOM   4795 C  CD  . ARG B 1 221 ? 39.376  0.880   70.568 1.00 94.32  ? 221 ARG B CD  1 
ATOM   4796 N  NE  . ARG B 1 221 ? 39.037  0.076   71.749 1.00 102.35 ? 221 ARG B NE  1 
ATOM   4797 C  CZ  . ARG B 1 221 ? 39.611  -1.081  72.067 1.00 116.07 ? 221 ARG B CZ  1 
ATOM   4798 N  NH1 . ARG B 1 221 ? 40.564  -1.594  71.295 1.00 103.78 ? 221 ARG B NH1 1 
ATOM   4799 N  NH2 . ARG B 1 221 ? 39.234  -1.736  73.154 1.00 102.75 ? 221 ARG B NH2 1 
ATOM   4800 N  N   . LYS B 1 222 ? 40.083  -1.411  66.848 1.00 68.23  ? 222 LYS B N   1 
ATOM   4801 C  CA  . LYS B 1 222 ? 41.226  -2.322  66.722 1.00 70.69  ? 222 LYS B CA  1 
ATOM   4802 C  C   . LYS B 1 222 ? 41.680  -2.379  65.251 1.00 75.77  ? 222 LYS B C   1 
ATOM   4803 O  O   . LYS B 1 222 ? 42.683  -1.761  64.881 1.00 77.35  ? 222 LYS B O   1 
ATOM   4804 C  CB  . LYS B 1 222 ? 40.868  -3.711  67.298 1.00 71.53  ? 222 LYS B CB  1 
ATOM   4805 C  CG  . LYS B 1 222 ? 42.059  -4.598  67.601 1.00 70.67  ? 222 LYS B CG  1 
ATOM   4806 C  CD  . LYS B 1 222 ? 41.598  -5.845  68.343 1.00 75.93  ? 222 LYS B CD  1 
ATOM   4807 C  CE  . LYS B 1 222 ? 42.530  -7.032  68.220 1.00 72.73  ? 222 LYS B CE  1 
ATOM   4808 N  NZ  . LYS B 1 222 ? 41.779  -8.322  68.298 1.00 66.95  ? 222 LYS B NZ  1 
ATOM   4809 N  N   . TYR B 1 223 ? 40.891  -3.020  64.404 1.00 70.47  ? 223 TYR B N   1 
ATOM   4810 C  CA  . TYR B 1 223 ? 41.204  -3.108  62.995 1.00 70.18  ? 223 TYR B CA  1 
ATOM   4811 C  C   . TYR B 1 223 ? 40.530  -1.901  62.341 1.00 70.75  ? 223 TYR B C   1 
ATOM   4812 O  O   . TYR B 1 223 ? 39.650  -2.077  61.510 1.00 67.87  ? 223 TYR B O   1 
ATOM   4813 C  CB  . TYR B 1 223 ? 40.676  -4.437  62.424 1.00 71.54  ? 223 TYR B CB  1 
ATOM   4814 C  CG  . TYR B 1 223 ? 40.998  -5.655  63.264 1.00 76.47  ? 223 TYR B CG  1 
ATOM   4815 C  CD1 . TYR B 1 223 ? 42.040  -6.509  62.919 1.00 81.60  ? 223 TYR B CD1 1 
ATOM   4816 C  CD2 . TYR B 1 223 ? 40.228  -5.981  64.377 1.00 76.87  ? 223 TYR B CD2 1 
ATOM   4817 C  CE1 . TYR B 1 223 ? 42.331  -7.641  63.682 1.00 85.58  ? 223 TYR B CE1 1 
ATOM   4818 C  CE2 . TYR B 1 223 ? 40.503  -7.109  65.143 1.00 80.35  ? 223 TYR B CE2 1 
ATOM   4819 C  CZ  . TYR B 1 223 ? 41.560  -7.936  64.797 1.00 93.03  ? 223 TYR B CZ  1 
ATOM   4820 O  OH  . TYR B 1 223 ? 41.818  -9.055  65.559 1.00 97.61  ? 223 TYR B OH  1 
ATOM   4821 N  N   . ASP B 1 224 ? 40.943  -0.672  62.745 1.00 67.54  ? 224 ASP B N   1 
ATOM   4822 C  CA  . ASP B 1 224 ? 40.424  0.644   62.326 1.00 65.00  ? 224 ASP B CA  1 
ATOM   4823 C  C   . ASP B 1 224 ? 39.471  0.676   61.142 1.00 66.06  ? 224 ASP B C   1 
ATOM   4824 O  O   . ASP B 1 224 ? 39.912  0.744   59.988 1.00 67.39  ? 224 ASP B O   1 
ATOM   4825 C  CB  . ASP B 1 224 ? 41.536  1.704   62.167 1.00 68.31  ? 224 ASP B CB  1 
ATOM   4826 C  CG  . ASP B 1 224 ? 41.003  3.095   61.849 1.00 72.51  ? 224 ASP B CG  1 
ATOM   4827 O  OD1 . ASP B 1 224 ? 40.247  3.645   62.678 1.00 72.23  ? 224 ASP B OD1 1 
ATOM   4828 O  OD2 . ASP B 1 224 ? 41.316  3.618   60.755 1.00 74.43  ? 224 ASP B OD2 1 
ATOM   4829 N  N   . PHE B 1 225 ? 38.161  0.628   61.423 1.00 57.02  ? 225 PHE B N   1 
ATOM   4830 C  CA  . PHE B 1 225 ? 37.166  0.713   60.364 1.00 52.27  ? 225 PHE B CA  1 
ATOM   4831 C  C   . PHE B 1 225 ? 35.994  1.619   60.739 1.00 53.53  ? 225 PHE B C   1 
ATOM   4832 O  O   . PHE B 1 225 ? 35.973  2.194   61.829 1.00 53.59  ? 225 PHE B O   1 
ATOM   4833 C  CB  . PHE B 1 225 ? 36.733  -0.681  59.871 1.00 52.53  ? 225 PHE B CB  1 
ATOM   4834 C  CG  . PHE B 1 225 ? 36.151  -1.653  60.870 1.00 53.22  ? 225 PHE B CG  1 
ATOM   4835 C  CD1 . PHE B 1 225 ? 34.815  -1.578  61.240 1.00 53.71  ? 225 PHE B CD1 1 
ATOM   4836 C  CD2 . PHE B 1 225 ? 36.891  -2.740  61.314 1.00 56.94  ? 225 PHE B CD2 1 
ATOM   4837 C  CE1 . PHE B 1 225 ? 34.250  -2.535  62.079 1.00 54.20  ? 225 PHE B CE1 1 
ATOM   4838 C  CE2 . PHE B 1 225 ? 36.329  -3.693  62.162 1.00 59.44  ? 225 PHE B CE2 1 
ATOM   4839 C  CZ  . PHE B 1 225 ? 35.007  -3.595  62.522 1.00 55.28  ? 225 PHE B CZ  1 
ATOM   4840 N  N   . LEU B 1 226 ? 35.034  1.765   59.828 1.00 47.12  ? 226 LEU B N   1 
ATOM   4841 C  CA  . LEU B 1 226 ? 33.839  2.546   60.090 1.00 44.19  ? 226 LEU B CA  1 
ATOM   4842 C  C   . LEU B 1 226 ? 32.679  1.620   60.435 1.00 48.96  ? 226 LEU B C   1 
ATOM   4843 O  O   . LEU B 1 226 ? 32.682  0.461   60.037 1.00 50.10  ? 226 LEU B O   1 
ATOM   4844 C  CB  . LEU B 1 226 ? 33.495  3.367   58.853 1.00 41.90  ? 226 LEU B CB  1 
ATOM   4845 C  CG  . LEU B 1 226 ? 33.986  4.808   58.767 1.00 45.29  ? 226 LEU B CG  1 
ATOM   4846 C  CD1 . LEU B 1 226 ? 35.173  5.102   59.683 1.00 47.30  ? 226 LEU B CD1 1 
ATOM   4847 C  CD2 . LEU B 1 226 ? 34.278  5.174   57.337 1.00 44.81  ? 226 LEU B CD2 1 
ATOM   4848 N  N   . ILE B 1 227 ? 31.714  2.106   61.209 1.00 44.48  ? 227 ILE B N   1 
ATOM   4849 C  CA  . ILE B 1 227 ? 30.501  1.354   61.521 1.00 43.05  ? 227 ILE B CA  1 
ATOM   4850 C  C   . ILE B 1 227 ? 29.446  2.184   60.860 1.00 45.58  ? 227 ILE B C   1 
ATOM   4851 O  O   . ILE B 1 227 ? 29.342  3.371   61.166 1.00 45.39  ? 227 ILE B O   1 
ATOM   4852 C  CB  . ILE B 1 227 ? 30.179  1.199   63.046 1.00 46.71  ? 227 ILE B CB  1 
ATOM   4853 C  CG1 . ILE B 1 227 ? 31.400  0.778   63.888 1.00 49.14  ? 227 ILE B CG1 1 
ATOM   4854 C  CG2 . ILE B 1 227 ? 28.986  0.259   63.270 1.00 46.33  ? 227 ILE B CG2 1 
ATOM   4855 C  CD1 . ILE B 1 227 ? 31.232  0.895   65.409 1.00 48.79  ? 227 ILE B CD1 1 
ATOM   4856 N  N   . ILE B 1 228 ? 28.680  1.621   59.947 1.00 42.05  ? 228 ILE B N   1 
ATOM   4857 C  CA  . ILE B 1 228 ? 27.627  2.457   59.388 1.00 41.31  ? 228 ILE B CA  1 
ATOM   4858 C  C   . ILE B 1 228 ? 26.234  2.066   59.932 1.00 45.80  ? 228 ILE B C   1 
ATOM   4859 O  O   . ILE B 1 228 ? 25.631  1.066   59.515 1.00 45.44  ? 228 ILE B O   1 
ATOM   4860 C  CB  . ILE B 1 228 ? 27.758  2.848   57.888 1.00 43.72  ? 228 ILE B CB  1 
ATOM   4861 C  CG1 . ILE B 1 228 ? 27.213  1.807   56.936 1.00 43.04  ? 228 ILE B CG1 1 
ATOM   4862 C  CG2 . ILE B 1 228 ? 29.186  3.306   57.518 1.00 46.16  ? 228 ILE B CG2 1 
ATOM   4863 C  CD1 . ILE B 1 228 ? 26.047  2.331   56.343 1.00 48.69  ? 228 ILE B CD1 1 
ATOM   4864 N  N   . GLU B 1 229 ? 25.800  2.816   60.962 1.00 42.83  ? 229 GLU B N   1 
ATOM   4865 C  CA  . GLU B 1 229 ? 24.562  2.589   61.706 1.00 43.09  ? 229 GLU B CA  1 
ATOM   4866 C  C   . GLU B 1 229 ? 23.261  2.878   60.912 1.00 48.66  ? 229 GLU B C   1 
ATOM   4867 O  O   . GLU B 1 229 ? 22.695  3.969   61.054 1.00 49.10  ? 229 GLU B O   1 
ATOM   4868 C  CB  . GLU B 1 229 ? 24.623  3.336   63.067 1.00 44.99  ? 229 GLU B CB  1 
ATOM   4869 C  CG  . GLU B 1 229 ? 23.530  2.973   64.068 1.00 51.35  ? 229 GLU B CG  1 
ATOM   4870 C  CD  . GLU B 1 229 ? 23.746  3.354   65.524 1.00 72.78  ? 229 GLU B CD  1 
ATOM   4871 O  OE1 . GLU B 1 229 ? 24.309  4.441   65.802 1.00 57.50  ? 229 GLU B OE1 1 
ATOM   4872 O  OE2 . GLU B 1 229 ? 23.299  2.572   66.396 1.00 72.07  ? 229 GLU B OE2 1 
ATOM   4873 N  N   . ASP B 1 230 ? 22.772  1.904   60.095 1.00 45.33  ? 230 ASP B N   1 
ATOM   4874 C  CA  . ASP B 1 230 ? 21.509  2.105   59.365 1.00 44.54  ? 230 ASP B CA  1 
ATOM   4875 C  C   . ASP B 1 230 ? 20.361  1.744   60.295 1.00 49.39  ? 230 ASP B C   1 
ATOM   4876 O  O   . ASP B 1 230 ? 20.002  0.576   60.410 1.00 48.93  ? 230 ASP B O   1 
ATOM   4877 C  CB  . ASP B 1 230 ? 21.445  1.313   58.046 1.00 46.43  ? 230 ASP B CB  1 
ATOM   4878 C  CG  . ASP B 1 230 ? 20.261  1.675   57.143 1.00 60.43  ? 230 ASP B CG  1 
ATOM   4879 O  OD1 . ASP B 1 230 ? 19.750  2.822   57.245 1.00 61.20  ? 230 ASP B OD1 1 
ATOM   4880 O  OD2 . ASP B 1 230 ? 19.896  0.848   56.286 1.00 66.38  ? 230 ASP B OD2 1 
ATOM   4881 N  N   . ASP B 1 231 ? 19.804  2.746   60.988 1.00 47.33  ? 231 ASP B N   1 
ATOM   4882 C  CA  . ASP B 1 231 ? 18.768  2.491   61.982 1.00 48.00  ? 231 ASP B CA  1 
ATOM   4883 C  C   . ASP B 1 231 ? 17.350  3.062   61.703 1.00 55.73  ? 231 ASP B C   1 
ATOM   4884 O  O   . ASP B 1 231 ? 16.857  3.812   62.554 1.00 57.47  ? 231 ASP B O   1 
ATOM   4885 C  CB  . ASP B 1 231 ? 19.284  2.909   63.363 1.00 49.54  ? 231 ASP B CB  1 
ATOM   4886 C  CG  . ASP B 1 231 ? 18.827  2.019   64.494 1.00 55.86  ? 231 ASP B CG  1 
ATOM   4887 O  OD1 . ASP B 1 231 ? 17.747  1.405   64.368 1.00 57.60  ? 231 ASP B OD1 1 
ATOM   4888 O  OD2 . ASP B 1 231 ? 19.539  1.950   65.515 1.00 57.62  ? 231 ASP B OD2 1 
ATOM   4889 N  N   . PRO B 1 232 ? 16.630  2.689   60.594 1.00 51.50  ? 232 PRO B N   1 
ATOM   4890 C  CA  . PRO B 1 232 ? 15.264  3.231   60.384 1.00 50.46  ? 232 PRO B CA  1 
ATOM   4891 C  C   . PRO B 1 232 ? 14.225  2.802   61.427 1.00 53.29  ? 232 PRO B C   1 
ATOM   4892 O  O   . PRO B 1 232 ? 13.245  3.515   61.640 1.00 51.06  ? 232 PRO B O   1 
ATOM   4893 C  CB  . PRO B 1 232 ? 14.881  2.674   59.017 1.00 51.54  ? 232 PRO B CB  1 
ATOM   4894 C  CG  . PRO B 1 232 ? 15.702  1.440   58.873 1.00 55.96  ? 232 PRO B CG  1 
ATOM   4895 C  CD  . PRO B 1 232 ? 17.011  1.793   59.481 1.00 51.95  ? 232 PRO B CD  1 
ATOM   4896 N  N   . TYR B 1 233 ? 14.454  1.625   62.064 1.00 51.65  ? 233 TYR B N   1 
ATOM   4897 C  CA  . TYR B 1 233 ? 13.571  0.987   63.048 1.00 51.94  ? 233 TYR B CA  1 
ATOM   4898 C  C   . TYR B 1 233 ? 13.973  1.270   64.481 1.00 52.87  ? 233 TYR B C   1 
ATOM   4899 O  O   . TYR B 1 233 ? 13.651  0.497   65.379 1.00 52.93  ? 233 TYR B O   1 
ATOM   4900 C  CB  . TYR B 1 233 ? 13.364  -0.529  62.749 1.00 54.16  ? 233 TYR B CB  1 
ATOM   4901 C  CG  . TYR B 1 233 ? 12.892  -0.815  61.330 1.00 56.12  ? 233 TYR B CG  1 
ATOM   4902 C  CD1 . TYR B 1 233 ? 11.603  -0.477  60.919 1.00 58.23  ? 233 TYR B CD1 1 
ATOM   4903 C  CD2 . TYR B 1 233 ? 13.749  -1.382  60.388 1.00 56.53  ? 233 TYR B CD2 1 
ATOM   4904 C  CE1 . TYR B 1 233 ? 11.166  -0.731  59.620 1.00 58.91  ? 233 TYR B CE1 1 
ATOM   4905 C  CE2 . TYR B 1 233 ? 13.332  -1.612  59.076 1.00 57.17  ? 233 TYR B CE2 1 
ATOM   4906 C  CZ  . TYR B 1 233 ? 12.037  -1.287  58.696 1.00 64.10  ? 233 TYR B CZ  1 
ATOM   4907 O  OH  . TYR B 1 233 ? 11.613  -1.499  57.401 1.00 61.63  ? 233 TYR B OH  1 
ATOM   4908 N  N   . TYR B 1 234 ? 14.621  2.429   64.696 1.00 47.13  ? 234 TYR B N   1 
ATOM   4909 C  CA  . TYR B 1 234 ? 15.021  2.919   66.011 1.00 46.30  ? 234 TYR B CA  1 
ATOM   4910 C  C   . TYR B 1 234 ? 13.771  3.362   66.752 1.00 49.39  ? 234 TYR B C   1 
ATOM   4911 O  O   . TYR B 1 234 ? 13.507  2.848   67.826 1.00 48.97  ? 234 TYR B O   1 
ATOM   4912 C  CB  . TYR B 1 234 ? 16.014  4.073   65.874 1.00 46.67  ? 234 TYR B CB  1 
ATOM   4913 C  CG  . TYR B 1 234 ? 16.430  4.666   67.194 1.00 50.37  ? 234 TYR B CG  1 
ATOM   4914 C  CD1 . TYR B 1 234 ? 17.368  4.033   68.000 1.00 53.34  ? 234 TYR B CD1 1 
ATOM   4915 C  CD2 . TYR B 1 234 ? 15.904  5.879   67.633 1.00 52.15  ? 234 TYR B CD2 1 
ATOM   4916 C  CE1 . TYR B 1 234 ? 17.752  4.573   69.225 1.00 55.16  ? 234 TYR B CE1 1 
ATOM   4917 C  CE2 . TYR B 1 234 ? 16.290  6.436   68.853 1.00 54.19  ? 234 TYR B CE2 1 
ATOM   4918 C  CZ  . TYR B 1 234 ? 17.223  5.783   69.640 1.00 60.63  ? 234 TYR B CZ  1 
ATOM   4919 O  OH  . TYR B 1 234 ? 17.615  6.310   70.843 1.00 63.01  ? 234 TYR B OH  1 
ATOM   4920 N  N   . PHE B 1 235 ? 12.954  4.245   66.146 1.00 46.95  ? 235 PHE B N   1 
ATOM   4921 C  CA  . PHE B 1 235 ? 11.701  4.713   66.759 1.00 48.12  ? 235 PHE B CA  1 
ATOM   4922 C  C   . PHE B 1 235 ? 10.570  3.681   66.678 1.00 53.74  ? 235 PHE B C   1 
ATOM   4923 O  O   . PHE B 1 235 ? 9.445   3.993   67.072 1.00 54.82  ? 235 PHE B O   1 
ATOM   4924 C  CB  . PHE B 1 235 ? 11.250  6.103   66.217 1.00 49.18  ? 235 PHE B CB  1 
ATOM   4925 C  CG  . PHE B 1 235 ? 12.243  7.216   66.463 1.00 49.72  ? 235 PHE B CG  1 
ATOM   4926 C  CD1 . PHE B 1 235 ? 12.956  7.780   65.409 1.00 50.72  ? 235 PHE B CD1 1 
ATOM   4927 C  CD2 . PHE B 1 235 ? 12.506  7.663   67.751 1.00 51.09  ? 235 PHE B CD2 1 
ATOM   4928 C  CE1 . PHE B 1 235 ? 13.908  8.772   65.642 1.00 50.75  ? 235 PHE B CE1 1 
ATOM   4929 C  CE2 . PHE B 1 235 ? 13.468  8.638   67.980 1.00 53.57  ? 235 PHE B CE2 1 
ATOM   4930 C  CZ  . PHE B 1 235 ? 14.164  9.182   66.924 1.00 50.73  ? 235 PHE B CZ  1 
ATOM   4931 N  N   . LEU B 1 236 ? 10.864  2.464   66.172 1.00 49.68  ? 236 LEU B N   1 
ATOM   4932 C  CA  . LEU B 1 236 ? 9.885   1.385   66.061 1.00 50.11  ? 236 LEU B CA  1 
ATOM   4933 C  C   . LEU B 1 236 ? 10.216  0.191   66.954 1.00 53.59  ? 236 LEU B C   1 
ATOM   4934 O  O   . LEU B 1 236 ? 9.774   -0.925  66.678 1.00 54.13  ? 236 LEU B O   1 
ATOM   4935 C  CB  . LEU B 1 236 ? 9.727   0.961   64.606 1.00 49.71  ? 236 LEU B CB  1 
ATOM   4936 C  CG  . LEU B 1 236 ? 8.363   1.244   63.997 1.00 55.86  ? 236 LEU B CG  1 
ATOM   4937 C  CD1 . LEU B 1 236 ? 8.023   2.737   64.045 1.00 56.28  ? 236 LEU B CD1 1 
ATOM   4938 C  CD2 . LEU B 1 236 ? 8.307   0.762   62.553 1.00 59.00  ? 236 LEU B CD2 1 
ATOM   4939 N  N   . GLN B 1 237 ? 10.977  0.441   68.039 1.00 47.91  ? 237 GLN B N   1 
ATOM   4940 C  CA  . GLN B 1 237 ? 11.405  -0.556  69.006 1.00 47.18  ? 237 GLN B CA  1 
ATOM   4941 C  C   . GLN B 1 237 ? 10.261  -0.980  69.910 1.00 51.14  ? 237 GLN B C   1 
ATOM   4942 O  O   . GLN B 1 237 ? 9.553   -0.125  70.438 1.00 50.93  ? 237 GLN B O   1 
ATOM   4943 C  CB  . GLN B 1 237 ? 12.585  -0.015  69.836 1.00 48.43  ? 237 GLN B CB  1 
ATOM   4944 C  CG  . GLN B 1 237 ? 13.954  -0.132  69.165 1.00 54.57  ? 237 GLN B CG  1 
ATOM   4945 C  CD  . GLN B 1 237 ? 15.051  0.533   69.967 1.00 73.78  ? 237 GLN B CD  1 
ATOM   4946 O  OE1 . GLN B 1 237 ? 15.598  1.569   69.586 1.00 69.37  ? 237 GLN B OE1 1 
ATOM   4947 N  NE2 . GLN B 1 237 ? 15.434  -0.064  71.079 1.00 70.37  ? 237 GLN B NE2 1 
ATOM   4948 N  N   . PHE B 1 238 ? 10.093  -2.302  70.115 1.00 48.45  ? 238 PHE B N   1 
ATOM   4949 C  CA  . PHE B 1 238 ? 9.063   -2.870  71.007 1.00 49.38  ? 238 PHE B CA  1 
ATOM   4950 C  C   . PHE B 1 238 ? 9.595   -3.181  72.416 1.00 55.91  ? 238 PHE B C   1 
ATOM   4951 O  O   . PHE B 1 238 ? 8.996   -3.971  73.148 1.00 56.25  ? 238 PHE B O   1 
ATOM   4952 C  CB  . PHE B 1 238 ? 8.436   -4.123  70.384 1.00 50.82  ? 238 PHE B CB  1 
ATOM   4953 C  CG  . PHE B 1 238 ? 7.865   -3.905  69.010 1.00 50.44  ? 238 PHE B CG  1 
ATOM   4954 C  CD1 . PHE B 1 238 ? 8.376   -4.587  67.915 1.00 52.55  ? 238 PHE B CD1 1 
ATOM   4955 C  CD2 . PHE B 1 238 ? 6.806   -3.023  68.811 1.00 51.97  ? 238 PHE B CD2 1 
ATOM   4956 C  CE1 . PHE B 1 238 ? 7.834   -4.403  66.645 1.00 53.08  ? 238 PHE B CE1 1 
ATOM   4957 C  CE2 . PHE B 1 238 ? 6.272   -2.825  67.541 1.00 54.31  ? 238 PHE B CE2 1 
ATOM   4958 C  CZ  . PHE B 1 238 ? 6.786   -3.518  66.462 1.00 52.22  ? 238 PHE B CZ  1 
ATOM   4959 N  N   . ASN B 1 239 ? 10.735  -2.573  72.782 1.00 54.35  ? 239 ASN B N   1 
ATOM   4960 C  CA  . ASN B 1 239 ? 11.368  -2.758  74.083 1.00 55.96  ? 239 ASN B CA  1 
ATOM   4961 C  C   . ASN B 1 239 ? 11.072  -1.613  75.035 1.00 60.51  ? 239 ASN B C   1 
ATOM   4962 O  O   . ASN B 1 239 ? 10.772  -0.486  74.611 1.00 58.30  ? 239 ASN B O   1 
ATOM   4963 C  CB  . ASN B 1 239 ? 12.882  -3.045  73.960 1.00 59.15  ? 239 ASN B CB  1 
ATOM   4964 C  CG  . ASN B 1 239 ? 13.731  -1.992  73.275 1.00 86.86  ? 239 ASN B CG  1 
ATOM   4965 O  OD1 . ASN B 1 239 ? 13.279  -0.890  72.943 1.00 87.85  ? 239 ASN B OD1 1 
ATOM   4966 N  ND2 . ASN B 1 239 ? 15.012  -2.297  73.090 1.00 74.78  ? 239 ASN B ND2 1 
ATOM   4967 N  N   . LYS B 1 240 ? 11.169  -1.930  76.335 1.00 60.03  ? 240 LYS B N   1 
ATOM   4968 C  CA  . LYS B 1 240 ? 10.903  -1.061  77.484 1.00 61.10  ? 240 LYS B CA  1 
ATOM   4969 C  C   . LYS B 1 240 ? 11.582  0.295   77.387 1.00 65.56  ? 240 LYS B C   1 
ATOM   4970 O  O   . LYS B 1 240 ? 10.932  1.315   77.629 1.00 64.17  ? 240 LYS B O   1 
ATOM   4971 C  CB  . LYS B 1 240 ? 11.233  -1.793  78.804 1.00 64.44  ? 240 LYS B CB  1 
ATOM   4972 C  CG  . LYS B 1 240 ? 10.549  -3.166  78.981 1.00 65.71  ? 240 LYS B CG  1 
ATOM   4973 C  CD  . LYS B 1 240 ? 9.017   -3.204  78.661 1.00 73.14  ? 240 LYS B CD  1 
ATOM   4974 C  CE  . LYS B 1 240 ? 8.113   -2.386  79.568 1.00 79.58  ? 240 LYS B CE  1 
ATOM   4975 N  NZ  . LYS B 1 240 ? 6.733   -2.277  79.014 1.00 85.24  ? 240 LYS B NZ  1 
ATOM   4976 N  N   . PHE B 1 241 ? 12.876  0.296   76.986 1.00 64.22  ? 241 PHE B N   1 
ATOM   4977 C  CA  . PHE B 1 241 ? 13.708  1.481   76.764 1.00 64.79  ? 241 PHE B CA  1 
ATOM   4978 C  C   . PHE B 1 241 ? 14.729  1.233   75.655 1.00 65.38  ? 241 PHE B C   1 
ATOM   4979 O  O   . PHE B 1 241 ? 15.269  0.127   75.553 1.00 65.30  ? 241 PHE B O   1 
ATOM   4980 C  CB  . PHE B 1 241 ? 14.396  1.919   78.064 1.00 69.70  ? 241 PHE B CB  1 
ATOM   4981 C  CG  . PHE B 1 241 ? 15.765  1.350   78.353 1.00 73.38  ? 241 PHE B CG  1 
ATOM   4982 C  CD1 . PHE B 1 241 ? 15.926  0.003   78.663 1.00 78.43  ? 241 PHE B CD1 1 
ATOM   4983 C  CD2 . PHE B 1 241 ? 16.889  2.173   78.357 1.00 77.07  ? 241 PHE B CD2 1 
ATOM   4984 C  CE1 . PHE B 1 241 ? 17.193  -0.514  78.956 1.00 81.09  ? 241 PHE B CE1 1 
ATOM   4985 C  CE2 . PHE B 1 241 ? 18.154  1.657   78.654 1.00 81.42  ? 241 PHE B CE2 1 
ATOM   4986 C  CZ  . PHE B 1 241 ? 18.298  0.318   78.956 1.00 80.61  ? 241 PHE B CZ  1 
ATOM   4987 N  N   . ARG B 1 242 ? 15.004  2.260   74.842 1.00 59.20  ? 242 ARG B N   1 
ATOM   4988 C  CA  . ARG B 1 242 ? 15.947  2.136   73.730 1.00 57.19  ? 242 ARG B CA  1 
ATOM   4989 C  C   . ARG B 1 242 ? 17.414  2.023   74.111 1.00 59.38  ? 242 ARG B C   1 
ATOM   4990 O  O   . ARG B 1 242 ? 17.907  2.680   75.032 1.00 58.91  ? 242 ARG B O   1 
ATOM   4991 C  CB  . ARG B 1 242 ? 15.689  3.144   72.585 1.00 57.65  ? 242 ARG B CB  1 
ATOM   4992 C  CG  . ARG B 1 242 ? 15.654  4.616   73.014 1.00 70.85  ? 242 ARG B CG  1 
ATOM   4993 C  CD  . ARG B 1 242 ? 14.794  5.483   72.113 1.00 71.71  ? 242 ARG B CD  1 
ATOM   4994 N  NE  . ARG B 1 242 ? 13.378  5.129   72.176 1.00 81.05  ? 242 ARG B NE  1 
ATOM   4995 C  CZ  . ARG B 1 242 ? 12.413  5.837   71.605 1.00 103.22 ? 242 ARG B CZ  1 
ATOM   4996 N  NH1 . ARG B 1 242 ? 12.702  6.937   70.924 1.00 94.71  ? 242 ARG B NH1 1 
ATOM   4997 N  NH2 . ARG B 1 242 ? 11.148  5.453   71.715 1.00 95.49  ? 242 ARG B NH2 1 
ATOM   4998 N  N   . VAL B 1 243 ? 18.093  1.158   73.379 1.00 55.50  ? 243 VAL B N   1 
ATOM   4999 C  CA  . VAL B 1 243 ? 19.503  0.831   73.517 1.00 56.44  ? 243 VAL B CA  1 
ATOM   5000 C  C   . VAL B 1 243 ? 20.467  2.000   73.070 1.00 57.54  ? 243 VAL B C   1 
ATOM   5001 O  O   . VAL B 1 243 ? 20.184  2.672   72.047 1.00 54.39  ? 243 VAL B O   1 
ATOM   5002 C  CB  . VAL B 1 243 ? 19.753  -0.530  72.786 1.00 61.24  ? 243 VAL B CB  1 
ATOM   5003 C  CG1 . VAL B 1 243 ? 19.889  -0.392  71.253 1.00 60.00  ? 243 VAL B CG1 1 
ATOM   5004 C  CG2 . VAL B 1 243 ? 20.917  -1.297  73.388 1.00 62.51  ? 243 VAL B CG2 1 
ATOM   5005 N  N   . PRO B 1 244 ? 21.595  2.260   73.827 1.00 53.40  ? 244 PRO B N   1 
ATOM   5006 C  CA  . PRO B 1 244 ? 22.548  3.306   73.397 1.00 53.20  ? 244 PRO B CA  1 
ATOM   5007 C  C   . PRO B 1 244 ? 23.132  3.007   71.997 1.00 58.75  ? 244 PRO B C   1 
ATOM   5008 O  O   . PRO B 1 244 ? 23.773  1.960   71.801 1.00 59.96  ? 244 PRO B O   1 
ATOM   5009 C  CB  . PRO B 1 244 ? 23.625  3.284   74.496 1.00 55.71  ? 244 PRO B CB  1 
ATOM   5010 C  CG  . PRO B 1 244 ? 23.013  2.596   75.617 1.00 59.90  ? 244 PRO B CG  1 
ATOM   5011 C  CD  . PRO B 1 244 ? 22.079  1.600   75.054 1.00 54.60  ? 244 PRO B CD  1 
ATOM   5012 N  N   . THR B 1 245 ? 22.868  3.899   71.008 1.00 52.74  ? 245 THR B N   1 
ATOM   5013 C  CA  . THR B 1 245 ? 23.348  3.737   69.624 1.00 50.29  ? 245 THR B CA  1 
ATOM   5014 C  C   . THR B 1 245 ? 24.877  3.620   69.538 1.00 54.13  ? 245 THR B C   1 
ATOM   5015 O  O   . THR B 1 245 ? 25.581  3.934   70.510 1.00 55.39  ? 245 THR B O   1 
ATOM   5016 C  CB  . THR B 1 245 ? 22.864  4.891   68.742 1.00 51.33  ? 245 THR B CB  1 
ATOM   5017 O  OG1 . THR B 1 245 ? 23.303  6.134   69.288 1.00 50.29  ? 245 THR B OG1 1 
ATOM   5018 C  CG2 . THR B 1 245 ? 21.368  4.881   68.534 1.00 47.61  ? 245 THR B CG2 1 
ATOM   5019 N  N   . PHE B 1 246 ? 25.394  3.175   68.371 1.00 48.18  ? 246 PHE B N   1 
ATOM   5020 C  CA  . PHE B 1 246 ? 26.837  3.096   68.146 1.00 48.30  ? 246 PHE B CA  1 
ATOM   5021 C  C   . PHE B 1 246 ? 27.367  4.536   68.134 1.00 52.59  ? 246 PHE B C   1 
ATOM   5022 O  O   . PHE B 1 246 ? 28.493  4.793   68.567 1.00 54.02  ? 246 PHE B O   1 
ATOM   5023 C  CB  . PHE B 1 246 ? 27.150  2.415   66.809 1.00 48.75  ? 246 PHE B CB  1 
ATOM   5024 C  CG  . PHE B 1 246 ? 27.134  0.907   66.823 1.00 50.10  ? 246 PHE B CG  1 
ATOM   5025 C  CD1 . PHE B 1 246 ? 26.065  0.204   66.285 1.00 51.41  ? 246 PHE B CD1 1 
ATOM   5026 C  CD2 . PHE B 1 246 ? 28.207  0.190   67.333 1.00 53.75  ? 246 PHE B CD2 1 
ATOM   5027 C  CE1 . PHE B 1 246 ? 26.053  -1.190  66.289 1.00 52.80  ? 246 PHE B CE1 1 
ATOM   5028 C  CE2 . PHE B 1 246 ? 28.204  -1.204  67.323 1.00 57.01  ? 246 PHE B CE2 1 
ATOM   5029 C  CZ  . PHE B 1 246 ? 27.124  -1.885  66.807 1.00 53.94  ? 246 PHE B CZ  1 
ATOM   5030 N  N   . LEU B 1 247 ? 26.519  5.476   67.674 1.00 47.03  ? 247 LEU B N   1 
ATOM   5031 C  CA  . LEU B 1 247 ? 26.838  6.892   67.617 1.00 46.73  ? 247 LEU B CA  1 
ATOM   5032 C  C   . LEU B 1 247 ? 27.097  7.432   69.024 1.00 52.46  ? 247 LEU B C   1 
ATOM   5033 O  O   . LEU B 1 247 ? 28.058  8.184   69.201 1.00 54.84  ? 247 LEU B O   1 
ATOM   5034 C  CB  . LEU B 1 247 ? 25.706  7.659   66.921 1.00 44.87  ? 247 LEU B CB  1 
ATOM   5035 C  CG  . LEU B 1 247 ? 25.951  9.137   66.662 1.00 49.16  ? 247 LEU B CG  1 
ATOM   5036 C  CD1 . LEU B 1 247 ? 25.755  9.458   65.233 1.00 48.29  ? 247 LEU B CD1 1 
ATOM   5037 C  CD2 . LEU B 1 247 ? 24.984  9.960   67.414 1.00 51.33  ? 247 LEU B CD2 1 
ATOM   5038 N  N   . SER B 1 248 ? 26.269  7.029   70.026 1.00 47.25  ? 248 SER B N   1 
ATOM   5039 C  CA  . SER B 1 248 ? 26.389  7.463   71.432 1.00 47.78  ? 248 SER B CA  1 
ATOM   5040 C  C   . SER B 1 248 ? 27.745  7.034   72.052 1.00 53.01  ? 248 SER B C   1 
ATOM   5041 O  O   . SER B 1 248 ? 28.215  7.628   73.027 1.00 53.52  ? 248 SER B O   1 
ATOM   5042 C  CB  . SER B 1 248 ? 25.235  6.904   72.249 1.00 49.16  ? 248 SER B CB  1 
ATOM   5043 O  OG  . SER B 1 248 ? 25.181  5.490   72.143 1.00 51.46  ? 248 SER B OG  1 
ATOM   5044 N  N   . MET B 1 249 ? 28.381  6.029   71.432 1.00 49.00  ? 249 MET B N   1 
ATOM   5045 C  CA  . MET B 1 249 ? 29.676  5.468   71.821 1.00 49.87  ? 249 MET B CA  1 
ATOM   5046 C  C   . MET B 1 249 ? 30.814  6.056   70.988 1.00 54.35  ? 249 MET B C   1 
ATOM   5047 O  O   . MET B 1 249 ? 31.978  5.962   71.400 1.00 55.38  ? 249 MET B O   1 
ATOM   5048 C  CB  . MET B 1 249 ? 29.667  3.949   71.598 1.00 51.09  ? 249 MET B CB  1 
ATOM   5049 C  CG  . MET B 1 249 ? 28.469  3.264   72.137 1.00 52.90  ? 249 MET B CG  1 
ATOM   5050 S  SD  . MET B 1 249 ? 28.571  1.555   71.651 1.00 56.77  ? 249 MET B SD  1 
ATOM   5051 C  CE  . MET B 1 249 ? 27.614  0.813   72.969 1.00 54.33  ? 249 MET B CE  1 
ATOM   5052 N  N   . ASP B 1 250 ? 30.471  6.603   69.793 1.00 49.73  ? 250 ASP B N   1 
ATOM   5053 C  CA  . ASP B 1 250 ? 31.385  7.143   68.788 1.00 50.42  ? 250 ASP B CA  1 
ATOM   5054 C  C   . ASP B 1 250 ? 32.374  8.205   69.255 1.00 56.20  ? 250 ASP B C   1 
ATOM   5055 O  O   . ASP B 1 250 ? 32.272  9.380   68.892 1.00 55.89  ? 250 ASP B O   1 
ATOM   5056 C  CB  . ASP B 1 250 ? 30.649  7.526   67.493 1.00 50.85  ? 250 ASP B CB  1 
ATOM   5057 C  CG  . ASP B 1 250 ? 31.528  7.564   66.260 1.00 63.37  ? 250 ASP B CG  1 
ATOM   5058 O  OD1 . ASP B 1 250 ? 32.524  6.795   66.215 1.00 65.73  ? 250 ASP B OD1 1 
ATOM   5059 O  OD2 . ASP B 1 250 ? 31.164  8.287   65.290 1.00 66.16  ? 250 ASP B OD2 1 
ATOM   5060 N  N   . VAL B 1 251 ? 33.345  7.763   70.063 1.00 53.96  ? 251 VAL B N   1 
ATOM   5061 C  CA  . VAL B 1 251 ? 34.402  8.579   70.648 1.00 55.17  ? 251 VAL B CA  1 
ATOM   5062 C  C   . VAL B 1 251 ? 35.568  8.743   69.650 1.00 59.56  ? 251 VAL B C   1 
ATOM   5063 O  O   . VAL B 1 251 ? 36.286  9.745   69.701 1.00 59.56  ? 251 VAL B O   1 
ATOM   5064 C  CB  . VAL B 1 251 ? 34.827  7.980   72.008 1.00 60.42  ? 251 VAL B CB  1 
ATOM   5065 C  CG1 . VAL B 1 251 ? 35.632  6.697   71.837 1.00 60.90  ? 251 VAL B CG1 1 
ATOM   5066 C  CG2 . VAL B 1 251 ? 35.579  8.993   72.852 1.00 63.00  ? 251 VAL B CG2 1 
ATOM   5067 N  N   . ASP B 1 252 ? 35.726  7.755   68.738 1.00 55.94  ? 252 ASP B N   1 
ATOM   5068 C  CA  . ASP B 1 252 ? 36.750  7.709   67.694 1.00 56.45  ? 252 ASP B CA  1 
ATOM   5069 C  C   . ASP B 1 252 ? 36.274  8.437   66.445 1.00 57.72  ? 252 ASP B C   1 
ATOM   5070 O  O   . ASP B 1 252 ? 37.087  8.768   65.580 1.00 57.54  ? 252 ASP B O   1 
ATOM   5071 C  CB  . ASP B 1 252 ? 37.069  6.250   67.323 1.00 58.95  ? 252 ASP B CB  1 
ATOM   5072 C  CG  . ASP B 1 252 ? 38.133  5.576   68.161 1.00 80.84  ? 252 ASP B CG  1 
ATOM   5073 O  OD1 . ASP B 1 252 ? 37.838  5.227   69.335 1.00 84.99  ? 252 ASP B OD1 1 
ATOM   5074 O  OD2 . ASP B 1 252 ? 39.244  5.344   67.630 1.00 88.55  ? 252 ASP B OD2 1 
ATOM   5075 N  N   . GLY B 1 253 ? 34.965  8.656   66.348 1.00 52.55  ? 253 GLY B N   1 
ATOM   5076 C  CA  . GLY B 1 253 ? 34.369  9.302   65.186 1.00 50.69  ? 253 GLY B CA  1 
ATOM   5077 C  C   . GLY B 1 253 ? 34.356  8.400   63.963 1.00 52.55  ? 253 GLY B C   1 
ATOM   5078 O  O   . GLY B 1 253 ? 34.571  8.863   62.843 1.00 52.18  ? 253 GLY B O   1 
ATOM   5079 N  N   . ARG B 1 254 ? 34.098  7.114   64.168 1.00 47.62  ? 254 ARG B N   1 
ATOM   5080 C  CA  . ARG B 1 254 ? 34.052  6.115   63.109 1.00 46.78  ? 254 ARG B CA  1 
ATOM   5081 C  C   . ARG B 1 254 ? 32.618  5.674   62.734 1.00 48.49  ? 254 ARG B C   1 
ATOM   5082 O  O   . ARG B 1 254 ? 32.442  4.651   62.084 1.00 47.32  ? 254 ARG B O   1 
ATOM   5083 C  CB  . ARG B 1 254 ? 34.912  4.901   63.514 1.00 48.75  ? 254 ARG B CB  1 
ATOM   5084 C  CG  . ARG B 1 254 ? 34.580  4.297   64.884 1.00 50.96  ? 254 ARG B CG  1 
ATOM   5085 C  CD  . ARG B 1 254 ? 35.445  3.090   65.186 1.00 53.86  ? 254 ARG B CD  1 
ATOM   5086 N  NE  . ARG B 1 254 ? 36.784  3.444   65.661 1.00 57.84  ? 254 ARG B NE  1 
ATOM   5087 C  CZ  . ARG B 1 254 ? 37.880  3.435   64.908 1.00 75.12  ? 254 ARG B CZ  1 
ATOM   5088 N  NH1 . ARG B 1 254 ? 37.819  3.062   63.635 1.00 53.03  ? 254 ARG B NH1 1 
ATOM   5089 N  NH2 . ARG B 1 254 ? 39.051  3.776   65.428 1.00 74.48  ? 254 ARG B NH2 1 
ATOM   5090 N  N   . VAL B 1 255 ? 31.606  6.425   63.148 1.00 44.36  ? 255 VAL B N   1 
ATOM   5091 C  CA  . VAL B 1 255 ? 30.227  6.033   62.898 1.00 42.92  ? 255 VAL B CA  1 
ATOM   5092 C  C   . VAL B 1 255 ? 29.477  7.111   62.120 1.00 45.73  ? 255 VAL B C   1 
ATOM   5093 O  O   . VAL B 1 255 ? 29.527  8.294   62.475 1.00 46.45  ? 255 VAL B O   1 
ATOM   5094 C  CB  . VAL B 1 255 ? 29.498  5.669   64.245 1.00 48.00  ? 255 VAL B CB  1 
ATOM   5095 C  CG1 . VAL B 1 255 ? 27.988  5.439   64.081 1.00 46.26  ? 255 VAL B CG1 1 
ATOM   5096 C  CG2 . VAL B 1 255 ? 30.154  4.490   64.951 1.00 49.41  ? 255 VAL B CG2 1 
ATOM   5097 N  N   . ILE B 1 256 ? 28.772  6.681   61.072 1.00 39.76  ? 256 ILE B N   1 
ATOM   5098 C  CA  . ILE B 1 256 ? 27.848  7.496   60.311 1.00 38.40  ? 256 ILE B CA  1 
ATOM   5099 C  C   . ILE B 1 256 ? 26.538  6.789   60.608 1.00 42.65  ? 256 ILE B C   1 
ATOM   5100 O  O   . ILE B 1 256 ? 26.443  5.573   60.439 1.00 42.63  ? 256 ILE B O   1 
ATOM   5101 C  CB  . ILE B 1 256 ? 28.137  7.564   58.770 1.00 41.00  ? 256 ILE B CB  1 
ATOM   5102 C  CG1 . ILE B 1 256 ? 29.581  8.044   58.438 1.00 41.88  ? 256 ILE B CG1 1 
ATOM   5103 C  CG2 . ILE B 1 256 ? 27.078  8.438   58.041 1.00 40.50  ? 256 ILE B CG2 1 
ATOM   5104 C  CD1 . ILE B 1 256 ? 30.128  7.501   57.117 1.00 37.26  ? 256 ILE B CD1 1 
ATOM   5105 N  N   . ARG B 1 257 ? 25.564  7.519   61.122 1.00 39.68  ? 257 ARG B N   1 
ATOM   5106 C  CA  . ARG B 1 257 ? 24.260  6.953   61.435 1.00 38.61  ? 257 ARG B CA  1 
ATOM   5107 C  C   . ARG B 1 257 ? 23.183  7.529   60.513 1.00 43.24  ? 257 ARG B C   1 
ATOM   5108 O  O   . ARG B 1 257 ? 23.086  8.758   60.318 1.00 42.63  ? 257 ARG B O   1 
ATOM   5109 C  CB  . ARG B 1 257 ? 23.933  7.048   62.946 1.00 36.60  ? 257 ARG B CB  1 
ATOM   5110 C  CG  . ARG B 1 257 ? 22.546  7.604   63.309 1.00 37.99  ? 257 ARG B CG  1 
ATOM   5111 C  CD  . ARG B 1 257 ? 22.225  7.467   64.783 1.00 34.75  ? 257 ARG B CD  1 
ATOM   5112 N  NE  . ARG B 1 257 ? 21.522  6.211   65.057 1.00 38.15  ? 257 ARG B NE  1 
ATOM   5113 C  CZ  . ARG B 1 257 ? 20.232  6.120   65.369 1.00 55.18  ? 257 ARG B CZ  1 
ATOM   5114 N  NH1 . ARG B 1 257 ? 19.490  7.215   65.490 1.00 49.38  ? 257 ARG B NH1 1 
ATOM   5115 N  NH2 . ARG B 1 257 ? 19.684  4.937   65.605 1.00 38.73  ? 257 ARG B NH2 1 
ATOM   5116 N  N   . ALA B 1 258 ? 22.406  6.610   59.918 1.00 39.99  ? 258 ALA B N   1 
ATOM   5117 C  CA  . ALA B 1 258 ? 21.307  6.928   59.014 1.00 38.74  ? 258 ALA B CA  1 
ATOM   5118 C  C   . ALA B 1 258 ? 19.954  6.792   59.736 1.00 42.55  ? 258 ALA B C   1 
ATOM   5119 O  O   . ALA B 1 258 ? 19.670  5.756   60.355 1.00 41.64  ? 258 ALA B O   1 
ATOM   5120 C  CB  . ALA B 1 258 ? 21.362  6.043   57.770 1.00 38.50  ? 258 ALA B CB  1 
ATOM   5121 N  N   . ASP B 1 259 ? 19.146  7.875   59.683 1.00 39.27  ? 259 ASP B N   1 
ATOM   5122 C  CA  . ASP B 1 259 ? 17.802  7.956   60.281 1.00 38.97  ? 259 ASP B CA  1 
ATOM   5123 C  C   . ASP B 1 259 ? 16.750  8.171   59.209 1.00 41.69  ? 259 ASP B C   1 
ATOM   5124 O  O   . ASP B 1 259 ? 17.024  8.791   58.178 1.00 39.45  ? 259 ASP B O   1 
ATOM   5125 C  CB  . ASP B 1 259 ? 17.696  9.081   61.319 1.00 40.75  ? 259 ASP B CB  1 
ATOM   5126 C  CG  . ASP B 1 259 ? 18.718  9.002   62.413 1.00 44.79  ? 259 ASP B CG  1 
ATOM   5127 O  OD1 . ASP B 1 259 ? 18.398  8.445   63.469 1.00 43.94  ? 259 ASP B OD1 1 
ATOM   5128 O  OD2 . ASP B 1 259 ? 19.849  9.500   62.206 1.00 53.14  ? 259 ASP B OD2 1 
ATOM   5129 N  N   . SER B 1 260 ? 15.530  7.693   59.480 1.00 39.52  ? 260 SER B N   1 
ATOM   5130 C  CA  . SER B 1 260 ? 14.448  7.802   58.524 1.00 39.14  ? 260 SER B CA  1 
ATOM   5131 C  C   . SER B 1 260 ? 13.104  8.117   59.140 1.00 42.24  ? 260 SER B C   1 
ATOM   5132 O  O   . SER B 1 260 ? 12.611  7.337   59.963 1.00 42.13  ? 260 SER B O   1 
ATOM   5133 C  CB  . SER B 1 260 ? 14.345  6.514   57.714 1.00 42.74  ? 260 SER B CB  1 
ATOM   5134 O  OG  . SER B 1 260 ? 13.723  6.796   56.476 1.00 50.59  ? 260 SER B OG  1 
ATOM   5135 N  N   . PHE B 1 261 ? 12.461  9.207   58.659 1.00 37.83  ? 261 PHE B N   1 
ATOM   5136 C  CA  . PHE B 1 261 ? 11.108  9.573   59.087 1.00 38.13  ? 261 PHE B CA  1 
ATOM   5137 C  C   . PHE B 1 261 ? 10.089  8.692   58.331 1.00 43.05  ? 261 PHE B C   1 
ATOM   5138 O  O   . PHE B 1 261 ? 8.886   8.754   58.610 1.00 43.39  ? 261 PHE B O   1 
ATOM   5139 C  CB  . PHE B 1 261 ? 10.828  11.064  58.840 1.00 39.79  ? 261 PHE B CB  1 
ATOM   5140 C  CG  . PHE B 1 261 ? 11.641  12.034  59.669 1.00 41.39  ? 261 PHE B CG  1 
ATOM   5141 C  CD1 . PHE B 1 261 ? 11.445  12.139  61.043 1.00 45.17  ? 261 PHE B CD1 1 
ATOM   5142 C  CD2 . PHE B 1 261 ? 12.563  12.884  59.070 1.00 41.93  ? 261 PHE B CD2 1 
ATOM   5143 C  CE1 . PHE B 1 261 ? 12.185  13.052  61.804 1.00 45.86  ? 261 PHE B CE1 1 
ATOM   5144 C  CE2 . PHE B 1 261 ? 13.295  13.797  59.831 1.00 44.74  ? 261 PHE B CE2 1 
ATOM   5145 C  CZ  . PHE B 1 261 ? 13.097  13.878  61.190 1.00 43.73  ? 261 PHE B CZ  1 
ATOM   5146 N  N   . SER B 1 262 ? 10.605  7.848   57.392 1.00 38.48  ? 262 SER B N   1 
ATOM   5147 C  CA  . SER B 1 262 ? 9.891   6.911   56.521 1.00 37.72  ? 262 SER B CA  1 
ATOM   5148 C  C   . SER B 1 262 ? 8.871   5.994   57.192 1.00 42.58  ? 262 SER B C   1 
ATOM   5149 O  O   . SER B 1 262 ? 7.906   5.587   56.528 1.00 41.82  ? 262 SER B O   1 
ATOM   5150 C  CB  . SER B 1 262 ? 10.882  6.061   55.743 1.00 39.83  ? 262 SER B CB  1 
ATOM   5151 O  OG  . SER B 1 262 ? 10.547  6.016   54.369 1.00 49.54  ? 262 SER B OG  1 
ATOM   5152 N  N   . LYS B 1 263 ? 9.085   5.625   58.476 1.00 39.67  ? 263 LYS B N   1 
ATOM   5153 C  CA  . LYS B 1 263 ? 8.131   4.719   59.128 1.00 40.57  ? 263 LYS B CA  1 
ATOM   5154 C  C   . LYS B 1 263 ? 7.210   5.422   60.126 1.00 45.41  ? 263 LYS B C   1 
ATOM   5155 O  O   . LYS B 1 263 ? 6.089   4.948   60.355 1.00 46.00  ? 263 LYS B O   1 
ATOM   5156 C  CB  . LYS B 1 263 ? 8.824   3.499   59.775 1.00 42.93  ? 263 LYS B CB  1 
ATOM   5157 C  CG  . LYS B 1 263 ? 10.200  3.134   59.210 1.00 49.47  ? 263 LYS B CG  1 
ATOM   5158 C  CD  . LYS B 1 263 ? 10.111  2.228   58.008 1.00 49.42  ? 263 LYS B CD  1 
ATOM   5159 C  CE  . LYS B 1 263 ? 11.414  2.112   57.267 1.00 47.19  ? 263 LYS B CE  1 
ATOM   5160 N  NZ  . LYS B 1 263 ? 11.271  1.220   56.092 1.00 54.97  ? 263 LYS B NZ  1 
ATOM   5161 N  N   . ILE B 1 264 ? 7.664   6.572   60.667 1.00 40.80  ? 264 ILE B N   1 
ATOM   5162 C  CA  . ILE B 1 264 ? 6.976   7.352   61.701 1.00 41.46  ? 264 ILE B CA  1 
ATOM   5163 C  C   . ILE B 1 264 ? 6.250   8.669   61.282 1.00 47.98  ? 264 ILE B C   1 
ATOM   5164 O  O   . ILE B 1 264 ? 5.354   9.122   62.001 1.00 48.26  ? 264 ILE B O   1 
ATOM   5165 C  CB  . ILE B 1 264 ? 7.958   7.570   62.876 1.00 44.19  ? 264 ILE B CB  1 
ATOM   5166 C  CG1 . ILE B 1 264 ? 9.269   8.229   62.404 1.00 43.24  ? 264 ILE B CG1 1 
ATOM   5167 C  CG2 . ILE B 1 264 ? 8.246   6.245   63.579 1.00 45.30  ? 264 ILE B CG2 1 
ATOM   5168 C  CD1 . ILE B 1 264 ? 9.964   9.103   63.446 1.00 50.38  ? 264 ILE B CD1 1 
ATOM   5169 N  N   . ILE B 1 265 ? 6.670   9.298   60.156 1.00 45.19  ? 265 ILE B N   1 
ATOM   5170 C  CA  . ILE B 1 265 ? 6.137   10.574  59.652 1.00 45.22  ? 265 ILE B CA  1 
ATOM   5171 C  C   . ILE B 1 265 ? 5.647   10.461  58.204 1.00 52.15  ? 265 ILE B C   1 
ATOM   5172 O  O   . ILE B 1 265 ? 4.550   10.940  57.920 1.00 53.48  ? 265 ILE B O   1 
ATOM   5173 C  CB  . ILE B 1 265 ? 7.189   11.714  59.784 1.00 47.06  ? 265 ILE B CB  1 
ATOM   5174 C  CG1 . ILE B 1 265 ? 7.727   11.894  61.220 1.00 47.23  ? 265 ILE B CG1 1 
ATOM   5175 C  CG2 . ILE B 1 265 ? 6.722   13.039  59.127 1.00 48.12  ? 265 ILE B CG2 1 
ATOM   5176 C  CD1 . ILE B 1 265 ? 6.786   12.539  62.246 1.00 55.87  ? 265 ILE B CD1 1 
ATOM   5177 N  N   . SER B 1 266 ? 6.493   9.920   57.278 1.00 48.70  ? 266 SER B N   1 
ATOM   5178 C  CA  . SER B 1 266 ? 6.203   9.723   55.846 1.00 48.80  ? 266 SER B CA  1 
ATOM   5179 C  C   . SER B 1 266 ? 7.327   9.078   55.072 1.00 51.64  ? 266 SER B C   1 
ATOM   5180 O  O   . SER B 1 266 ? 8.483   9.513   55.142 1.00 50.61  ? 266 SER B O   1 
ATOM   5181 C  CB  . SER B 1 266 ? 5.796   11.012  55.133 1.00 53.72  ? 266 SER B CB  1 
ATOM   5182 O  OG  . SER B 1 266 ? 5.593   10.798  53.739 1.00 61.70  ? 266 SER B OG  1 
ATOM   5183 N  N   . SER B 1 267 ? 6.936   8.099   54.246 1.00 47.27  ? 267 SER B N   1 
ATOM   5184 C  CA  . SER B 1 267 ? 7.795   7.343   53.349 1.00 45.60  ? 267 SER B CA  1 
ATOM   5185 C  C   . SER B 1 267 ? 7.842   8.004   51.971 1.00 51.78  ? 267 SER B C   1 
ATOM   5186 O  O   . SER B 1 267 ? 8.849   7.884   51.263 1.00 51.74  ? 267 SER B O   1 
ATOM   5187 C  CB  . SER B 1 267 ? 7.278   5.916   53.223 1.00 46.42  ? 267 SER B CB  1 
ATOM   5188 O  OG  . SER B 1 267 ? 5.889   5.871   52.944 1.00 47.94  ? 267 SER B OG  1 
ATOM   5189 N  N   . GLY B 1 268 ? 6.751   8.699   51.623 1.00 48.55  ? 268 GLY B N   1 
ATOM   5190 C  CA  . GLY B 1 268 ? 6.562   9.375   50.347 1.00 47.33  ? 268 GLY B CA  1 
ATOM   5191 C  C   . GLY B 1 268 ? 7.239   10.714  50.214 1.00 48.40  ? 268 GLY B C   1 
ATOM   5192 O  O   . GLY B 1 268 ? 7.669   11.061  49.112 1.00 46.94  ? 268 GLY B O   1 
ATOM   5193 N  N   . LEU B 1 269 ? 7.335   11.477  51.340 1.00 44.29  ? 269 LEU B N   1 
ATOM   5194 C  CA  . LEU B 1 269 ? 7.974   12.812  51.411 1.00 42.95  ? 269 LEU B CA  1 
ATOM   5195 C  C   . LEU B 1 269 ? 9.483   12.816  51.134 1.00 44.68  ? 269 LEU B C   1 
ATOM   5196 O  O   . LEU B 1 269 ? 10.003  13.829  50.668 1.00 43.99  ? 269 LEU B O   1 
ATOM   5197 C  CB  . LEU B 1 269 ? 7.643   13.568  52.721 1.00 43.17  ? 269 LEU B CB  1 
ATOM   5198 C  CG  . LEU B 1 269 ? 6.183   14.001  52.952 1.00 47.53  ? 269 LEU B CG  1 
ATOM   5199 C  CD1 . LEU B 1 269 ? 6.016   14.615  54.298 1.00 47.47  ? 269 LEU B CD1 1 
ATOM   5200 C  CD2 . LEU B 1 269 ? 5.706   14.968  51.902 1.00 50.44  ? 269 LEU B CD2 1 
ATOM   5201 N  N   . ARG B 1 270 ? 10.167  11.674  51.375 1.00 40.85  ? 270 ARG B N   1 
ATOM   5202 C  CA  . ARG B 1 270 ? 11.601  11.431  51.102 1.00 39.72  ? 270 ARG B CA  1 
ATOM   5203 C  C   . ARG B 1 270 ? 12.526  12.308  51.942 1.00 43.02  ? 270 ARG B C   1 
ATOM   5204 O  O   . ARG B 1 270 ? 13.285  13.125  51.418 1.00 41.44  ? 270 ARG B O   1 
ATOM   5205 C  CB  . ARG B 1 270 ? 11.933  11.498  49.584 1.00 36.67  ? 270 ARG B CB  1 
ATOM   5206 C  CG  . ARG B 1 270 ? 11.013  10.672  48.674 1.00 40.27  ? 270 ARG B CG  1 
ATOM   5207 C  CD  . ARG B 1 270 ? 10.964  9.191   49.032 1.00 48.41  ? 270 ARG B CD  1 
ATOM   5208 N  NE  . ARG B 1 270 ? 12.294  8.582   49.102 1.00 49.16  ? 270 ARG B NE  1 
ATOM   5209 C  CZ  . ARG B 1 270 ? 12.690  7.743   50.052 1.00 58.99  ? 270 ARG B CZ  1 
ATOM   5210 N  NH1 . ARG B 1 270 ? 11.857  7.385   51.022 1.00 42.06  ? 270 ARG B NH1 1 
ATOM   5211 N  NH2 . ARG B 1 270 ? 13.918  7.248   50.035 1.00 50.29  ? 270 ARG B NH2 1 
ATOM   5212 N  N   . ILE B 1 271 ? 12.438  12.127  53.263 1.00 39.99  ? 271 ILE B N   1 
ATOM   5213 C  CA  . ILE B 1 271 ? 13.191  12.884  54.251 1.00 40.01  ? 271 ILE B CA  1 
ATOM   5214 C  C   . ILE B 1 271 ? 13.856  11.971  55.275 1.00 46.48  ? 271 ILE B C   1 
ATOM   5215 O  O   . ILE B 1 271 ? 13.185  11.309  56.088 1.00 46.78  ? 271 ILE B O   1 
ATOM   5216 C  CB  . ILE B 1 271 ? 12.315  13.985  54.906 1.00 43.38  ? 271 ILE B CB  1 
ATOM   5217 C  CG1 . ILE B 1 271 ? 11.694  14.945  53.851 1.00 43.72  ? 271 ILE B CG1 1 
ATOM   5218 C  CG2 . ILE B 1 271 ? 13.083  14.736  56.003 1.00 44.63  ? 271 ILE B CG2 1 
ATOM   5219 C  CD1 . ILE B 1 271 ? 12.656  15.873  52.990 1.00 47.26  ? 271 ILE B CD1 1 
ATOM   5220 N  N   . GLY B 1 272 ? 15.181  11.948  55.200 1.00 43.71  ? 272 GLY B N   1 
ATOM   5221 C  CA  . GLY B 1 272 ? 16.051  11.186  56.085 1.00 43.53  ? 272 GLY B CA  1 
ATOM   5222 C  C   . GLY B 1 272 ? 17.223  12.043  56.500 1.00 47.55  ? 272 GLY B C   1 
ATOM   5223 O  O   . GLY B 1 272 ? 17.499  13.067  55.862 1.00 48.63  ? 272 GLY B O   1 
ATOM   5224 N  N   . PHE B 1 273 ? 17.904  11.669  57.581 1.00 42.20  ? 273 PHE B N   1 
ATOM   5225 C  CA  . PHE B 1 273 ? 19.048  12.459  57.998 1.00 41.97  ? 273 PHE B CA  1 
ATOM   5226 C  C   . PHE B 1 273 ? 20.285  11.647  58.346 1.00 46.13  ? 273 PHE B C   1 
ATOM   5227 O  O   . PHE B 1 273 ? 20.199  10.534  58.879 1.00 45.96  ? 273 PHE B O   1 
ATOM   5228 C  CB  . PHE B 1 273 ? 18.690  13.568  59.004 1.00 44.31  ? 273 PHE B CB  1 
ATOM   5229 C  CG  . PHE B 1 273 ? 18.083  13.094  60.293 1.00 46.12  ? 273 PHE B CG  1 
ATOM   5230 C  CD1 . PHE B 1 273 ? 16.714  12.881  60.398 1.00 49.14  ? 273 PHE B CD1 1 
ATOM   5231 C  CD2 . PHE B 1 273 ? 18.875  12.873  61.412 1.00 49.86  ? 273 PHE B CD2 1 
ATOM   5232 C  CE1 . PHE B 1 273 ? 16.148  12.433  61.597 1.00 50.99  ? 273 PHE B CE1 1 
ATOM   5233 C  CE2 . PHE B 1 273 ? 18.306  12.433  62.614 1.00 53.74  ? 273 PHE B CE2 1 
ATOM   5234 C  CZ  . PHE B 1 273 ? 16.945  12.222  62.701 1.00 51.46  ? 273 PHE B CZ  1 
ATOM   5235 N  N   . LEU B 1 274 ? 21.442  12.199  58.005 1.00 42.13  ? 274 LEU B N   1 
ATOM   5236 C  CA  . LEU B 1 274 ? 22.705  11.514  58.180 1.00 41.92  ? 274 LEU B CA  1 
ATOM   5237 C  C   . LEU B 1 274 ? 23.559  12.130  59.264 1.00 44.96  ? 274 LEU B C   1 
ATOM   5238 O  O   . LEU B 1 274 ? 23.856  13.328  59.212 1.00 44.04  ? 274 LEU B O   1 
ATOM   5239 C  CB  . LEU B 1 274 ? 23.420  11.518  56.827 1.00 41.53  ? 274 LEU B CB  1 
ATOM   5240 C  CG  . LEU B 1 274 ? 24.216  10.298  56.448 1.00 45.78  ? 274 LEU B CG  1 
ATOM   5241 C  CD1 . LEU B 1 274 ? 23.367  9.041   56.431 1.00 44.69  ? 274 LEU B CD1 1 
ATOM   5242 C  CD2 . LEU B 1 274 ? 24.774  10.494  55.106 1.00 50.08  ? 274 LEU B CD2 1 
ATOM   5243 N  N   . THR B 1 275 ? 23.943  11.321  60.265 1.00 41.24  ? 275 THR B N   1 
ATOM   5244 C  CA  . THR B 1 275 ? 24.754  11.858  61.358 1.00 42.12  ? 275 THR B CA  1 
ATOM   5245 C  C   . THR B 1 275 ? 26.105  11.177  61.466 1.00 45.15  ? 275 THR B C   1 
ATOM   5246 O  O   . THR B 1 275 ? 26.198  10.057  61.963 1.00 44.81  ? 275 THR B O   1 
ATOM   5247 C  CB  . THR B 1 275 ? 23.963  11.975  62.674 1.00 49.59  ? 275 THR B CB  1 
ATOM   5248 O  OG1 . THR B 1 275 ? 22.570  12.197  62.409 1.00 49.77  ? 275 THR B OG1 1 
ATOM   5249 C  CG2 . THR B 1 275 ? 24.497  13.074  63.556 1.00 47.51  ? 275 THR B CG2 1 
ATOM   5250 N  N   . GLY B 1 276 ? 27.139  11.855  60.978 1.00 41.03  ? 276 GLY B N   1 
ATOM   5251 C  CA  . GLY B 1 276 ? 28.499  11.333  60.983 1.00 41.11  ? 276 GLY B CA  1 
ATOM   5252 C  C   . GLY B 1 276 ? 29.564  12.407  61.045 1.00 45.43  ? 276 GLY B C   1 
ATOM   5253 O  O   . GLY B 1 276 ? 29.222  13.593  61.117 1.00 43.23  ? 276 GLY B O   1 
ATOM   5254 N  N   . PRO B 1 277 ? 30.878  12.016  61.009 1.00 45.32  ? 277 PRO B N   1 
ATOM   5255 C  CA  . PRO B 1 277 ? 31.955  13.028  61.099 1.00 47.04  ? 277 PRO B CA  1 
ATOM   5256 C  C   . PRO B 1 277 ? 31.907  14.051  59.980 1.00 50.47  ? 277 PRO B C   1 
ATOM   5257 O  O   . PRO B 1 277 ? 31.620  13.684  58.828 1.00 50.50  ? 277 PRO B O   1 
ATOM   5258 C  CB  . PRO B 1 277 ? 33.244  12.197  61.067 1.00 50.13  ? 277 PRO B CB  1 
ATOM   5259 C  CG  . PRO B 1 277 ? 32.850  10.874  60.520 1.00 52.92  ? 277 PRO B CG  1 
ATOM   5260 C  CD  . PRO B 1 277 ? 31.438  10.647  60.931 1.00 47.13  ? 277 PRO B CD  1 
ATOM   5261 N  N   . LYS B 1 278 ? 32.148  15.332  60.323 1.00 46.03  ? 278 LYS B N   1 
ATOM   5262 C  CA  . LYS B 1 278 ? 32.121  16.444  59.372 1.00 45.07  ? 278 LYS B CA  1 
ATOM   5263 C  C   . LYS B 1 278 ? 32.806  16.125  58.003 1.00 48.18  ? 278 LYS B C   1 
ATOM   5264 O  O   . LYS B 1 278 ? 32.123  16.199  56.978 1.00 44.13  ? 278 LYS B O   1 
ATOM   5265 C  CB  . LYS B 1 278 ? 32.600  17.760  60.020 1.00 49.22  ? 278 LYS B CB  1 
ATOM   5266 C  CG  . LYS B 1 278 ? 32.244  19.012  59.217 1.00 68.28  ? 278 LYS B CG  1 
ATOM   5267 C  CD  . LYS B 1 278 ? 32.475  20.322  59.994 1.00 78.12  ? 278 LYS B CD  1 
ATOM   5268 C  CE  . LYS B 1 278 ? 32.384  21.565  59.128 1.00 82.54  ? 278 LYS B CE  1 
ATOM   5269 N  NZ  . LYS B 1 278 ? 33.420  21.595  58.051 1.00 87.19  ? 278 LYS B NZ  1 
ATOM   5270 N  N   . PRO B 1 279 ? 34.075  15.644  57.968 1.00 48.27  ? 279 PRO B N   1 
ATOM   5271 C  CA  . PRO B 1 279 ? 34.712  15.341  56.667 1.00 49.04  ? 279 PRO B CA  1 
ATOM   5272 C  C   . PRO B 1 279 ? 33.961  14.373  55.752 1.00 51.43  ? 279 PRO B C   1 
ATOM   5273 O  O   . PRO B 1 279 ? 33.854  14.607  54.536 1.00 50.32  ? 279 PRO B O   1 
ATOM   5274 C  CB  . PRO B 1 279 ? 36.073  14.775  57.074 1.00 53.14  ? 279 PRO B CB  1 
ATOM   5275 C  CG  . PRO B 1 279 ? 36.348  15.404  58.397 1.00 58.87  ? 279 PRO B CG  1 
ATOM   5276 C  CD  . PRO B 1 279 ? 35.030  15.444  59.080 1.00 52.21  ? 279 PRO B CD  1 
ATOM   5277 N  N   . LEU B 1 280 ? 33.450  13.285  56.348 1.00 46.85  ? 280 LEU B N   1 
ATOM   5278 C  CA  . LEU B 1 280 ? 32.680  12.257  55.659 1.00 44.42  ? 280 LEU B CA  1 
ATOM   5279 C  C   . LEU B 1 280 ? 31.332  12.839  55.217 1.00 46.01  ? 280 LEU B C   1 
ATOM   5280 O  O   . LEU B 1 280 ? 30.967  12.728  54.031 1.00 44.36  ? 280 LEU B O   1 
ATOM   5281 C  CB  . LEU B 1 280 ? 32.491  11.059  56.599 1.00 44.17  ? 280 LEU B CB  1 
ATOM   5282 C  CG  . LEU B 1 280 ? 33.381  9.831   56.359 1.00 49.78  ? 280 LEU B CG  1 
ATOM   5283 C  CD1 . LEU B 1 280 ? 34.843  10.182  56.162 1.00 51.51  ? 280 LEU B CD1 1 
ATOM   5284 C  CD2 . LEU B 1 280 ? 33.293  8.892   57.505 1.00 53.46  ? 280 LEU B CD2 1 
ATOM   5285 N  N   . ILE B 1 281 ? 30.630  13.524  56.161 1.00 40.48  ? 281 ILE B N   1 
ATOM   5286 C  CA  . ILE B 1 281 ? 29.341  14.153  55.890 1.00 37.93  ? 281 ILE B CA  1 
ATOM   5287 C  C   . ILE B 1 281 ? 29.468  15.194  54.765 1.00 42.60  ? 281 ILE B C   1 
ATOM   5288 O  O   . ILE B 1 281 ? 28.696  15.150  53.803 1.00 40.09  ? 281 ILE B O   1 
ATOM   5289 C  CB  . ILE B 1 281 ? 28.651  14.638  57.204 1.00 40.11  ? 281 ILE B CB  1 
ATOM   5290 C  CG1 . ILE B 1 281 ? 28.171  13.444  58.056 1.00 39.10  ? 281 ILE B CG1 1 
ATOM   5291 C  CG2 . ILE B 1 281 ? 27.503  15.634  56.973 1.00 39.59  ? 281 ILE B CG2 1 
ATOM   5292 C  CD1 . ILE B 1 281 ? 27.348  12.238  57.346 1.00 37.41  ? 281 ILE B CD1 1 
ATOM   5293 N  N   . GLU B 1 282 ? 30.509  16.044  54.845 1.00 42.29  ? 282 GLU B N   1 
ATOM   5294 C  CA  . GLU B 1 282 ? 30.839  17.087  53.868 1.00 43.69  ? 282 GLU B CA  1 
ATOM   5295 C  C   . GLU B 1 282 ? 30.910  16.492  52.449 1.00 48.06  ? 282 GLU B C   1 
ATOM   5296 O  O   . GLU B 1 282 ? 30.400  17.080  51.480 1.00 47.01  ? 282 GLU B O   1 
ATOM   5297 C  CB  . GLU B 1 282 ? 32.206  17.688  54.232 1.00 47.56  ? 282 GLU B CB  1 
ATOM   5298 C  CG  . GLU B 1 282 ? 32.403  19.141  53.845 1.00 62.08  ? 282 GLU B CG  1 
ATOM   5299 C  CD  . GLU B 1 282 ? 33.812  19.622  54.132 1.00 88.46  ? 282 GLU B CD  1 
ATOM   5300 O  OE1 . GLU B 1 282 ? 34.131  19.855  55.322 1.00 99.31  ? 282 GLU B OE1 1 
ATOM   5301 O  OE2 . GLU B 1 282 ? 34.609  19.722  53.171 1.00 69.30  ? 282 GLU B OE2 1 
ATOM   5302 N  N   . ARG B 1 283 ? 31.532  15.303  52.357 1.00 44.48  ? 283 ARG B N   1 
ATOM   5303 C  CA  . ARG B 1 283 ? 31.740  14.580  51.124 1.00 43.32  ? 283 ARG B CA  1 
ATOM   5304 C  C   . ARG B 1 283 ? 30.435  14.141  50.491 1.00 44.19  ? 283 ARG B C   1 
ATOM   5305 O  O   . ARG B 1 283 ? 30.276  14.342  49.290 1.00 43.84  ? 283 ARG B O   1 
ATOM   5306 C  CB  . ARG B 1 283 ? 32.713  13.420  51.360 1.00 45.35  ? 283 ARG B CB  1 
ATOM   5307 C  CG  . ARG B 1 283 ? 34.054  13.562  50.643 1.00 53.96  ? 283 ARG B CG  1 
ATOM   5308 C  CD  . ARG B 1 283 ? 34.991  14.596  51.240 1.00 61.62  ? 283 ARG B CD  1 
ATOM   5309 N  NE  . ARG B 1 283 ? 35.710  15.305  50.179 1.00 68.65  ? 283 ARG B NE  1 
ATOM   5310 C  CZ  . ARG B 1 283 ? 35.284  16.428  49.606 1.00 79.35  ? 283 ARG B CZ  1 
ATOM   5311 N  NH1 . ARG B 1 283 ? 34.153  16.996  50.004 1.00 59.02  ? 283 ARG B NH1 1 
ATOM   5312 N  NH2 . ARG B 1 283 ? 35.996  17.001  48.646 1.00 70.22  ? 283 ARG B NH2 1 
ATOM   5313 N  N   . VAL B 1 284 ? 29.477  13.617  51.291 1.00 39.16  ? 284 VAL B N   1 
ATOM   5314 C  CA  . VAL B 1 284 ? 28.143  13.206  50.789 1.00 37.15  ? 284 VAL B CA  1 
ATOM   5315 C  C   . VAL B 1 284 ? 27.317  14.418  50.324 1.00 38.53  ? 284 VAL B C   1 
ATOM   5316 O  O   . VAL B 1 284 ? 26.630  14.327  49.310 1.00 36.47  ? 284 VAL B O   1 
ATOM   5317 C  CB  . VAL B 1 284 ? 27.329  12.179  51.667 1.00 40.68  ? 284 VAL B CB  1 
ATOM   5318 C  CG1 . VAL B 1 284 ? 28.240  11.180  52.403 1.00 41.76  ? 284 VAL B CG1 1 
ATOM   5319 C  CG2 . VAL B 1 284 ? 26.366  12.856  52.641 1.00 39.74  ? 284 VAL B CG2 1 
ATOM   5320 N  N   . ILE B 1 285 ? 27.432  15.556  51.040 1.00 36.03  ? 285 ILE B N   1 
ATOM   5321 C  CA  . ILE B 1 285 ? 26.754  16.815  50.722 1.00 36.73  ? 285 ILE B CA  1 
ATOM   5322 C  C   . ILE B 1 285 ? 27.195  17.282  49.324 1.00 42.68  ? 285 ILE B C   1 
ATOM   5323 O  O   . ILE B 1 285 ? 26.348  17.652  48.498 1.00 40.33  ? 285 ILE B O   1 
ATOM   5324 C  CB  . ILE B 1 285 ? 27.041  17.894  51.827 1.00 41.08  ? 285 ILE B CB  1 
ATOM   5325 C  CG1 . ILE B 1 285 ? 26.226  17.618  53.106 1.00 40.53  ? 285 ILE B CG1 1 
ATOM   5326 C  CG2 . ILE B 1 285 ? 26.765  19.327  51.322 1.00 43.00  ? 285 ILE B CG2 1 
ATOM   5327 C  CD1 . ILE B 1 285 ? 26.739  18.275  54.370 1.00 42.93  ? 285 ILE B CD1 1 
ATOM   5328 N  N   . LEU B 1 286 ? 28.537  17.251  49.081 1.00 42.60  ? 286 LEU B N   1 
ATOM   5329 C  CA  . LEU B 1 286 ? 29.190  17.654  47.828 1.00 43.20  ? 286 LEU B CA  1 
ATOM   5330 C  C   . LEU B 1 286 ? 28.752  16.809  46.639 1.00 47.91  ? 286 LEU B C   1 
ATOM   5331 O  O   . LEU B 1 286 ? 28.687  17.330  45.513 1.00 48.92  ? 286 LEU B O   1 
ATOM   5332 C  CB  . LEU B 1 286 ? 30.727  17.672  47.958 1.00 44.19  ? 286 LEU B CB  1 
ATOM   5333 C  CG  . LEU B 1 286 ? 31.405  18.950  48.496 1.00 48.66  ? 286 LEU B CG  1 
ATOM   5334 C  CD1 . LEU B 1 286 ? 32.700  19.207  47.760 1.00 49.75  ? 286 LEU B CD1 1 
ATOM   5335 C  CD2 . LEU B 1 286 ? 30.511  20.192  48.386 1.00 48.24  ? 286 LEU B CD2 1 
ATOM   5336 N  N   . HIS B 1 287 ? 28.444  15.510  46.890 1.00 42.35  ? 287 HIS B N   1 
ATOM   5337 C  CA  . HIS B 1 287 ? 27.919  14.608  45.872 1.00 40.85  ? 287 HIS B CA  1 
ATOM   5338 C  C   . HIS B 1 287 ? 26.443  14.970  45.629 1.00 40.06  ? 287 HIS B C   1 
ATOM   5339 O  O   . HIS B 1 287 ? 26.052  15.135  44.475 1.00 38.75  ? 287 HIS B O   1 
ATOM   5340 C  CB  . HIS B 1 287 ? 28.074  13.147  46.307 1.00 42.12  ? 287 HIS B CB  1 
ATOM   5341 C  CG  . HIS B 1 287 ? 27.744  12.127  45.251 1.00 45.39  ? 287 HIS B CG  1 
ATOM   5342 N  ND1 . HIS B 1 287 ? 27.761  10.776  45.535 1.00 47.12  ? 287 HIS B ND1 1 
ATOM   5343 C  CD2 . HIS B 1 287 ? 27.426  12.291  43.944 1.00 47.35  ? 287 HIS B CD2 1 
ATOM   5344 C  CE1 . HIS B 1 287 ? 27.426  10.170  44.411 1.00 46.62  ? 287 HIS B CE1 1 
ATOM   5345 N  NE2 . HIS B 1 287 ? 27.236  11.039  43.421 1.00 46.96  ? 287 HIS B NE2 1 
ATOM   5346 N  N   . ILE B 1 288 ? 25.653  15.169  46.730 1.00 34.02  ? 288 ILE B N   1 
ATOM   5347 C  CA  . ILE B 1 288 ? 24.229  15.583  46.720 1.00 31.15  ? 288 ILE B CA  1 
ATOM   5348 C  C   . ILE B 1 288 ? 24.063  16.887  45.955 1.00 33.33  ? 288 ILE B C   1 
ATOM   5349 O  O   . ILE B 1 288 ? 23.029  17.130  45.333 1.00 31.04  ? 288 ILE B O   1 
ATOM   5350 C  CB  . ILE B 1 288 ? 23.655  15.667  48.166 1.00 32.50  ? 288 ILE B CB  1 
ATOM   5351 C  CG1 . ILE B 1 288 ? 23.375  14.250  48.683 1.00 31.33  ? 288 ILE B CG1 1 
ATOM   5352 C  CG2 . ILE B 1 288 ? 22.377  16.551  48.246 1.00 31.60  ? 288 ILE B CG2 1 
ATOM   5353 C  CD1 . ILE B 1 288 ? 23.445  14.096  50.126 1.00 37.50  ? 288 ILE B CD1 1 
ATOM   5354 N  N   . GLN B 1 289 ? 25.114  17.702  45.996 1.00 31.28  ? 289 GLN B N   1 
ATOM   5355 C  CA  . GLN B 1 289 ? 25.168  18.993  45.350 1.00 32.07  ? 289 GLN B CA  1 
ATOM   5356 C  C   . GLN B 1 289 ? 25.052  18.894  43.847 1.00 33.67  ? 289 GLN B C   1 
ATOM   5357 O  O   . GLN B 1 289 ? 24.385  19.742  43.268 1.00 34.23  ? 289 GLN B O   1 
ATOM   5358 C  CB  . GLN B 1 289 ? 26.414  19.773  45.785 1.00 35.29  ? 289 GLN B CB  1 
ATOM   5359 C  CG  . GLN B 1 289 ? 26.131  21.261  45.969 1.00 49.45  ? 289 GLN B CG  1 
ATOM   5360 C  CD  . GLN B 1 289 ? 27.358  22.023  46.358 1.00 61.74  ? 289 GLN B CD  1 
ATOM   5361 O  OE1 . GLN B 1 289 ? 28.074  22.580  45.507 1.00 55.15  ? 289 GLN B OE1 1 
ATOM   5362 N  NE2 . GLN B 1 289 ? 27.619  22.052  47.656 1.00 52.98  ? 289 GLN B NE2 1 
ATOM   5363 N  N   . VAL B 1 290 ? 25.654  17.860  43.221 1.00 27.57  ? 290 VAL B N   1 
ATOM   5364 C  CA  . VAL B 1 290 ? 25.585  17.620  41.765 1.00 26.63  ? 290 VAL B CA  1 
ATOM   5365 C  C   . VAL B 1 290 ? 24.504  16.600  41.404 1.00 29.28  ? 290 VAL B C   1 
ATOM   5366 O  O   . VAL B 1 290 ? 24.241  16.346  40.232 1.00 28.08  ? 290 VAL B O   1 
ATOM   5367 C  CB  . VAL B 1 290 ? 26.948  17.223  41.147 1.00 31.03  ? 290 VAL B CB  1 
ATOM   5368 C  CG1 . VAL B 1 290 ? 27.798  18.443  40.856 1.00 31.41  ? 290 VAL B CG1 1 
ATOM   5369 C  CG2 . VAL B 1 290 ? 27.698  16.213  42.020 1.00 31.26  ? 290 VAL B CG2 1 
ATOM   5370 N  N   . SER B 1 291 ? 23.878  16.036  42.426 1.00 27.57  ? 291 SER B N   1 
ATOM   5371 C  CA  . SER B 1 291 ? 22.870  14.992  42.358 1.00 27.86  ? 291 SER B CA  1 
ATOM   5372 C  C   . SER B 1 291 ? 21.421  15.533  42.312 1.00 30.95  ? 291 SER B C   1 
ATOM   5373 O  O   . SER B 1 291 ? 20.885  15.758  41.234 1.00 30.54  ? 291 SER B O   1 
ATOM   5374 C  CB  . SER B 1 291 ? 23.076  14.045  43.541 1.00 34.48  ? 291 SER B CB  1 
ATOM   5375 O  OG  . SER B 1 291 ? 22.187  12.940  43.558 1.00 55.11  ? 291 SER B OG  1 
ATOM   5376 N  N   . THR B 1 292 ? 20.795  15.710  43.478 1.00 27.05  ? 292 THR B N   1 
ATOM   5377 C  CA  . THR B 1 292 ? 19.416  16.151  43.628 1.00 27.10  ? 292 THR B CA  1 
ATOM   5378 C  C   . THR B 1 292 ? 19.368  17.606  44.064 1.00 34.76  ? 292 THR B C   1 
ATOM   5379 O  O   . THR B 1 292 ? 18.280  18.145  44.306 1.00 35.16  ? 292 THR B O   1 
ATOM   5380 C  CB  . THR B 1 292 ? 18.738  15.266  44.711 1.00 31.23  ? 292 THR B CB  1 
ATOM   5381 O  OG1 . THR B 1 292 ? 19.631  15.057  45.831 1.00 23.24  ? 292 THR B OG1 1 
ATOM   5382 C  CG2 . THR B 1 292 ? 18.219  13.934  44.148 1.00 27.74  ? 292 THR B CG2 1 
ATOM   5383 N  N   . LEU B 1 293 ? 20.556  18.228  44.219 1.00 33.63  ? 293 LEU B N   1 
ATOM   5384 C  CA  . LEU B 1 293 ? 20.781  19.589  44.728 1.00 35.01  ? 293 LEU B CA  1 
ATOM   5385 C  C   . LEU B 1 293 ? 20.444  19.726  46.218 1.00 40.71  ? 293 LEU B C   1 
ATOM   5386 O  O   . LEU B 1 293 ? 21.330  20.128  46.964 1.00 42.53  ? 293 LEU B O   1 
ATOM   5387 C  CB  . LEU B 1 293 ? 20.119  20.719  43.907 1.00 35.65  ? 293 LEU B CB  1 
ATOM   5388 C  CG  . LEU B 1 293 ? 20.437  20.844  42.416 1.00 40.23  ? 293 LEU B CG  1 
ATOM   5389 C  CD1 . LEU B 1 293 ? 19.830  22.111  41.863 1.00 40.85  ? 293 LEU B CD1 1 
ATOM   5390 C  CD2 . LEU B 1 293 ? 21.911  20.896  42.165 1.00 43.11  ? 293 LEU B CD2 1 
ATOM   5391 N  N   . HIS B 1 294 ? 19.186  19.405  46.653 1.00 35.70  ? 294 HIS B N   1 
ATOM   5392 C  CA  . HIS B 1 294 ? 18.704  19.496  48.051 1.00 35.01  ? 294 HIS B CA  1 
ATOM   5393 C  C   . HIS B 1 294 ? 17.385  18.736  48.248 1.00 37.81  ? 294 HIS B C   1 
ATOM   5394 O  O   . HIS B 1 294 ? 16.609  18.654  47.287 1.00 38.72  ? 294 HIS B O   1 
ATOM   5395 C  CB  . HIS B 1 294 ? 18.443  20.965  48.416 1.00 37.08  ? 294 HIS B CB  1 
ATOM   5396 C  CG  . HIS B 1 294 ? 17.368  21.607  47.588 1.00 41.16  ? 294 HIS B CG  1 
ATOM   5397 N  ND1 . HIS B 1 294 ? 17.653  22.194  46.363 1.00 43.37  ? 294 HIS B ND1 1 
ATOM   5398 C  CD2 . HIS B 1 294 ? 16.037  21.705  47.819 1.00 43.17  ? 294 HIS B CD2 1 
ATOM   5399 C  CE1 . HIS B 1 294 ? 16.502  22.664  45.914 1.00 43.18  ? 294 HIS B CE1 1 
ATOM   5400 N  NE2 . HIS B 1 294 ? 15.499  22.375  46.747 1.00 43.56  ? 294 HIS B NE2 1 
ATOM   5401 N  N   . PRO B 1 295 ? 17.020  18.275  49.476 1.00 32.34  ? 295 PRO B N   1 
ATOM   5402 C  CA  . PRO B 1 295 ? 15.704  17.634  49.643 1.00 31.37  ? 295 PRO B CA  1 
ATOM   5403 C  C   . PRO B 1 295 ? 14.566  18.640  49.391 1.00 37.00  ? 295 PRO B C   1 
ATOM   5404 O  O   . PRO B 1 295 ? 14.733  19.831  49.660 1.00 37.43  ? 295 PRO B O   1 
ATOM   5405 C  CB  . PRO B 1 295 ? 15.732  17.146  51.103 1.00 32.36  ? 295 PRO B CB  1 
ATOM   5406 C  CG  . PRO B 1 295 ? 17.148  17.084  51.462 1.00 36.52  ? 295 PRO B CG  1 
ATOM   5407 C  CD  . PRO B 1 295 ? 17.768  18.247  50.746 1.00 33.40  ? 295 PRO B CD  1 
ATOM   5408 N  N   . SER B 1 296 ? 13.432  18.167  48.835 1.00 34.20  ? 296 SER B N   1 
ATOM   5409 C  CA  . SER B 1 296 ? 12.251  18.994  48.545 1.00 34.97  ? 296 SER B CA  1 
ATOM   5410 C  C   . SER B 1 296 ? 11.956  19.941  49.710 1.00 40.51  ? 296 SER B C   1 
ATOM   5411 O  O   . SER B 1 296 ? 11.594  19.495  50.794 1.00 39.65  ? 296 SER B O   1 
ATOM   5412 C  CB  . SER B 1 296 ? 11.041  18.113  48.250 1.00 37.31  ? 296 SER B CB  1 
ATOM   5413 O  OG  . SER B 1 296 ? 9.845   18.873  48.280 1.00 43.50  ? 296 SER B OG  1 
ATOM   5414 N  N   . THR B 1 297 ? 12.191  21.236  49.498 1.00 39.83  ? 297 THR B N   1 
ATOM   5415 C  CA  . THR B 1 297 ? 12.004  22.279  50.517 1.00 41.25  ? 297 THR B CA  1 
ATOM   5416 C  C   . THR B 1 297 ? 10.602  22.283  51.113 1.00 45.92  ? 297 THR B C   1 
ATOM   5417 O  O   . THR B 1 297 ? 10.488  22.291  52.347 1.00 45.71  ? 297 THR B O   1 
ATOM   5418 C  CB  . THR B 1 297 ? 12.552  23.658  50.074 1.00 48.95  ? 297 THR B CB  1 
ATOM   5419 O  OG1 . THR B 1 297 ? 11.557  24.673  50.192 1.00 52.12  ? 297 THR B OG1 1 
ATOM   5420 C  CG2 . THR B 1 297 ? 13.093  23.656  48.674 1.00 45.08  ? 297 THR B CG2 1 
ATOM   5421 N  N   . PHE B 1 298 ? 9.544   22.227  50.240 1.00 42.26  ? 298 PHE B N   1 
ATOM   5422 C  CA  . PHE B 1 298 ? 8.123   22.199  50.643 1.00 42.84  ? 298 PHE B CA  1 
ATOM   5423 C  C   . PHE B 1 298 ? 7.893   21.124  51.733 1.00 45.01  ? 298 PHE B C   1 
ATOM   5424 O  O   . PHE B 1 298 ? 7.499   21.438  52.862 1.00 44.09  ? 298 PHE B O   1 
ATOM   5425 C  CB  . PHE B 1 298 ? 7.215   21.954  49.416 1.00 44.81  ? 298 PHE B CB  1 
ATOM   5426 C  CG  . PHE B 1 298 ? 5.726   22.057  49.682 1.00 47.94  ? 298 PHE B CG  1 
ATOM   5427 C  CD1 . PHE B 1 298 ? 5.018   20.982  50.211 1.00 50.30  ? 298 PHE B CD1 1 
ATOM   5428 C  CD2 . PHE B 1 298 ? 5.026   23.217  49.375 1.00 51.89  ? 298 PHE B CD2 1 
ATOM   5429 C  CE1 . PHE B 1 298 ? 3.653   21.091  50.479 1.00 52.51  ? 298 PHE B CE1 1 
ATOM   5430 C  CE2 . PHE B 1 298 ? 3.654   23.316  49.630 1.00 55.85  ? 298 PHE B CE2 1 
ATOM   5431 C  CZ  . PHE B 1 298 ? 2.978   22.249  50.172 1.00 53.37  ? 298 PHE B CZ  1 
ATOM   5432 N  N   . ASN B 1 299 ? 8.212   19.866  51.386 1.00 40.41  ? 299 ASN B N   1 
ATOM   5433 C  CA  . ASN B 1 299 ? 8.120   18.714  52.270 1.00 39.06  ? 299 ASN B CA  1 
ATOM   5434 C  C   . ASN B 1 299 ? 8.897   19.011  53.530 1.00 43.51  ? 299 ASN B C   1 
ATOM   5435 O  O   . ASN B 1 299 ? 8.276   19.027  54.580 1.00 45.52  ? 299 ASN B O   1 
ATOM   5436 C  CB  . ASN B 1 299 ? 8.629   17.457  51.578 1.00 35.47  ? 299 ASN B CB  1 
ATOM   5437 C  CG  . ASN B 1 299 ? 7.947   17.108  50.265 1.00 57.50  ? 299 ASN B CG  1 
ATOM   5438 O  OD1 . ASN B 1 299 ? 8.474   16.310  49.484 1.00 54.28  ? 299 ASN B OD1 1 
ATOM   5439 N  ND2 . ASN B 1 299 ? 6.739   17.637  50.007 1.00 45.15  ? 299 ASN B ND2 1 
ATOM   5440 N  N   . GLN B 1 300 ? 10.201  19.403  53.422 1.00 38.14  ? 300 GLN B N   1 
ATOM   5441 C  CA  . GLN B 1 300 ? 11.058  19.773  54.559 1.00 37.10  ? 300 GLN B CA  1 
ATOM   5442 C  C   . GLN B 1 300 ? 10.355  20.760  55.488 1.00 41.14  ? 300 GLN B C   1 
ATOM   5443 O  O   . GLN B 1 300 ? 10.392  20.582  56.709 1.00 41.05  ? 300 GLN B O   1 
ATOM   5444 C  CB  . GLN B 1 300 ? 12.387  20.360  54.082 1.00 37.80  ? 300 GLN B CB  1 
ATOM   5445 C  CG  . GLN B 1 300 ? 13.507  19.348  54.020 1.00 50.80  ? 300 GLN B CG  1 
ATOM   5446 C  CD  . GLN B 1 300 ? 14.860  19.998  53.845 1.00 72.01  ? 300 GLN B CD  1 
ATOM   5447 O  OE1 . GLN B 1 300 ? 15.643  20.106  54.791 1.00 63.67  ? 300 GLN B OE1 1 
ATOM   5448 N  NE2 . GLN B 1 300 ? 15.184  20.415  52.624 1.00 70.03  ? 300 GLN B NE2 1 
ATOM   5449 N  N   . LEU B 1 301 ? 9.653   21.749  54.905 1.00 36.99  ? 301 LEU B N   1 
ATOM   5450 C  CA  . LEU B 1 301 ? 8.926   22.734  55.684 1.00 38.28  ? 301 LEU B CA  1 
ATOM   5451 C  C   . LEU B 1 301 ? 7.738   22.113  56.412 1.00 41.63  ? 301 LEU B C   1 
ATOM   5452 O  O   . LEU B 1 301 ? 7.585   22.401  57.586 1.00 41.98  ? 301 LEU B O   1 
ATOM   5453 C  CB  . LEU B 1 301 ? 8.527   23.955  54.833 1.00 39.79  ? 301 LEU B CB  1 
ATOM   5454 C  CG  . LEU B 1 301 ? 9.240   25.333  55.047 1.00 45.47  ? 301 LEU B CG  1 
ATOM   5455 C  CD1 . LEU B 1 301 ? 10.076  25.399  56.326 1.00 46.37  ? 301 LEU B CD1 1 
ATOM   5456 C  CD2 . LEU B 1 301 ? 10.017  25.777  53.819 1.00 43.87  ? 301 LEU B CD2 1 
ATOM   5457 N  N   . MET B 1 302 ? 6.962   21.201  55.767 1.00 38.36  ? 302 MET B N   1 
ATOM   5458 C  CA  . MET B 1 302 ? 5.817   20.503  56.406 1.00 39.38  ? 302 MET B CA  1 
ATOM   5459 C  C   . MET B 1 302 ? 6.303   19.712  57.637 1.00 46.60  ? 302 MET B C   1 
ATOM   5460 O  O   . MET B 1 302 ? 5.649   19.751  58.684 1.00 48.54  ? 302 MET B O   1 
ATOM   5461 C  CB  . MET B 1 302 ? 5.141   19.461  55.484 1.00 40.50  ? 302 MET B CB  1 
ATOM   5462 C  CG  . MET B 1 302 ? 4.700   19.925  54.123 1.00 43.91  ? 302 MET B CG  1 
ATOM   5463 S  SD  . MET B 1 302 ? 4.425   18.477  53.033 1.00 46.42  ? 302 MET B SD  1 
ATOM   5464 C  CE  . MET B 1 302 ? 2.987   17.710  53.788 1.00 44.14  ? 302 MET B CE  1 
ATOM   5465 N  N   . ILE B 1 303 ? 7.429   18.959  57.484 1.00 41.98  ? 303 ILE B N   1 
ATOM   5466 C  CA  . ILE B 1 303 ? 8.043   18.127  58.529 1.00 41.10  ? 303 ILE B CA  1 
ATOM   5467 C  C   . ILE B 1 303 ? 8.598   18.995  59.671 1.00 46.16  ? 303 ILE B C   1 
ATOM   5468 O  O   . ILE B 1 303 ? 8.243   18.770  60.839 1.00 46.05  ? 303 ILE B O   1 
ATOM   5469 C  CB  . ILE B 1 303 ? 9.100   17.171  57.919 1.00 41.82  ? 303 ILE B CB  1 
ATOM   5470 C  CG1 . ILE B 1 303 ? 8.430   16.236  56.935 1.00 41.41  ? 303 ILE B CG1 1 
ATOM   5471 C  CG2 . ILE B 1 303 ? 9.843   16.361  58.987 1.00 41.59  ? 303 ILE B CG2 1 
ATOM   5472 C  CD1 . ILE B 1 303 ? 9.120   16.147  55.701 1.00 47.98  ? 303 ILE B CD1 1 
ATOM   5473 N  N   . SER B 1 304 ? 9.453   19.988  59.325 1.00 42.22  ? 304 SER B N   1 
ATOM   5474 C  CA  . SER B 1 304 ? 10.059  20.885  60.306 1.00 42.88  ? 304 SER B CA  1 
ATOM   5475 C  C   . SER B 1 304 ? 8.980   21.620  61.078 1.00 48.37  ? 304 SER B C   1 
ATOM   5476 O  O   . SER B 1 304 ? 8.992   21.572  62.310 1.00 49.44  ? 304 SER B O   1 
ATOM   5477 C  CB  . SER B 1 304 ? 11.032  21.864  59.649 1.00 45.40  ? 304 SER B CB  1 
ATOM   5478 O  OG  . SER B 1 304 ? 11.860  22.510  60.604 1.00 51.30  ? 304 SER B OG  1 
ATOM   5479 N  N   . GLN B 1 305 ? 8.004   22.218  60.364 1.00 44.98  ? 305 GLN B N   1 
ATOM   5480 C  CA  . GLN B 1 305 ? 6.918   22.973  60.988 1.00 47.23  ? 305 GLN B CA  1 
ATOM   5481 C  C   . GLN B 1 305 ? 6.073   22.166  61.988 1.00 52.06  ? 305 GLN B C   1 
ATOM   5482 O  O   . GLN B 1 305 ? 5.745   22.673  63.065 1.00 52.75  ? 305 GLN B O   1 
ATOM   5483 C  CB  . GLN B 1 305 ? 6.108   23.769  59.956 1.00 49.28  ? 305 GLN B CB  1 
ATOM   5484 C  CG  . GLN B 1 305 ? 6.871   25.021  59.488 1.00 64.73  ? 305 GLN B CG  1 
ATOM   5485 C  CD  . GLN B 1 305 ? 6.188   25.794  58.387 1.00 87.10  ? 305 GLN B CD  1 
ATOM   5486 O  OE1 . GLN B 1 305 ? 6.671   25.845  57.250 1.00 82.53  ? 305 GLN B OE1 1 
ATOM   5487 N  NE2 . GLN B 1 305 ? 5.074   26.452  58.708 1.00 80.49  ? 305 GLN B NE2 1 
ATOM   5488 N  N   . LEU B 1 306 ? 5.833   20.880  61.673 1.00 47.59  ? 306 LEU B N   1 
ATOM   5489 C  CA  . LEU B 1 306 ? 5.133   19.921  62.528 1.00 47.43  ? 306 LEU B CA  1 
ATOM   5490 C  C   . LEU B 1 306 ? 5.976   19.654  63.794 1.00 51.90  ? 306 LEU B C   1 
ATOM   5491 O  O   . LEU B 1 306 ? 5.480   19.834  64.905 1.00 53.16  ? 306 LEU B O   1 
ATOM   5492 C  CB  . LEU B 1 306 ? 4.910   18.606  61.736 1.00 45.37  ? 306 LEU B CB  1 
ATOM   5493 C  CG  . LEU B 1 306 ? 4.433   17.374  62.515 1.00 48.88  ? 306 LEU B CG  1 
ATOM   5494 C  CD1 . LEU B 1 306 ? 2.951   17.419  62.743 1.00 49.90  ? 306 LEU B CD1 1 
ATOM   5495 C  CD2 . LEU B 1 306 ? 4.821   16.094  61.796 1.00 48.33  ? 306 LEU B CD2 1 
ATOM   5496 N  N   . LEU B 1 307 ? 7.253   19.241  63.599 1.00 46.95  ? 307 LEU B N   1 
ATOM   5497 C  CA  . LEU B 1 307 ? 8.241   18.910  64.631 1.00 46.51  ? 307 LEU B CA  1 
ATOM   5498 C  C   . LEU B 1 307 ? 8.502   20.031  65.633 1.00 54.78  ? 307 LEU B C   1 
ATOM   5499 O  O   . LEU B 1 307 ? 8.653   19.751  66.823 1.00 54.41  ? 307 LEU B O   1 
ATOM   5500 C  CB  . LEU B 1 307 ? 9.552   18.498  63.961 1.00 44.06  ? 307 LEU B CB  1 
ATOM   5501 C  CG  . LEU B 1 307 ? 9.923   17.026  63.923 1.00 46.32  ? 307 LEU B CG  1 
ATOM   5502 C  CD1 . LEU B 1 307 ? 8.761   16.105  64.259 1.00 46.76  ? 307 LEU B CD1 1 
ATOM   5503 C  CD2 . LEU B 1 307 ? 10.500  16.677  62.602 1.00 46.47  ? 307 LEU B CD2 1 
ATOM   5504 N  N   . HIS B 1 308 ? 8.574   21.290  65.152 1.00 54.80  ? 308 HIS B N   1 
ATOM   5505 C  CA  . HIS B 1 308 ? 8.784   22.457  66.007 1.00 57.85  ? 308 HIS B CA  1 
ATOM   5506 C  C   . HIS B 1 308 ? 7.573   22.644  66.942 1.00 62.78  ? 308 HIS B C   1 
ATOM   5507 O  O   . HIS B 1 308 ? 7.765   22.820  68.152 1.00 63.71  ? 308 HIS B O   1 
ATOM   5508 C  CB  . HIS B 1 308 ? 9.039   23.719  65.165 1.00 60.09  ? 308 HIS B CB  1 
ATOM   5509 C  CG  . HIS B 1 308 ? 10.383  23.771  64.508 1.00 63.05  ? 308 HIS B CG  1 
ATOM   5510 N  ND1 . HIS B 1 308 ? 11.550  23.572  65.229 1.00 65.25  ? 308 HIS B ND1 1 
ATOM   5511 C  CD2 . HIS B 1 308 ? 10.708  24.073  63.229 1.00 64.79  ? 308 HIS B CD2 1 
ATOM   5512 C  CE1 . HIS B 1 308 ? 12.540  23.714  64.362 1.00 64.05  ? 308 HIS B CE1 1 
ATOM   5513 N  NE2 . HIS B 1 308 ? 12.083  24.010  63.143 1.00 63.93  ? 308 HIS B NE2 1 
ATOM   5514 N  N   . GLU B 1 309 ? 6.333   22.540  66.375 1.00 58.40  ? 309 GLU B N   1 
ATOM   5515 C  CA  . GLU B 1 309 ? 5.037   22.653  67.064 1.00 59.63  ? 309 GLU B CA  1 
ATOM   5516 C  C   . GLU B 1 309 ? 4.872   21.583  68.142 1.00 62.17  ? 309 GLU B C   1 
ATOM   5517 O  O   . GLU B 1 309 ? 4.539   21.913  69.280 1.00 62.12  ? 309 GLU B O   1 
ATOM   5518 C  CB  . GLU B 1 309 ? 3.879   22.543  66.058 1.00 60.75  ? 309 GLU B CB  1 
ATOM   5519 C  CG  . GLU B 1 309 ? 3.511   23.853  65.390 1.00 75.98  ? 309 GLU B CG  1 
ATOM   5520 C  CD  . GLU B 1 309 ? 2.768   23.718  64.074 1.00 102.08 ? 309 GLU B CD  1 
ATOM   5521 O  OE1 . GLU B 1 309 ? 2.147   22.654  63.845 1.00 82.31  ? 309 GLU B OE1 1 
ATOM   5522 O  OE2 . GLU B 1 309 ? 2.814   24.677  63.266 1.00 103.16 ? 309 GLU B OE2 1 
ATOM   5523 N  N   . TRP B 1 310 ? 5.086   20.298  67.755 1.00 57.37  ? 310 TRP B N   1 
ATOM   5524 C  CA  . TRP B 1 310 ? 5.015   19.106  68.600 1.00 56.89  ? 310 TRP B CA  1 
ATOM   5525 C  C   . TRP B 1 310 ? 6.079   19.184  69.680 1.00 61.89  ? 310 TRP B C   1 
ATOM   5526 O  O   . TRP B 1 310 ? 5.828   18.808  70.826 1.00 62.87  ? 310 TRP B O   1 
ATOM   5527 C  CB  . TRP B 1 310 ? 5.313   17.852  67.762 1.00 53.27  ? 310 TRP B CB  1 
ATOM   5528 C  CG  . TRP B 1 310 ? 4.150   17.158  67.121 1.00 54.45  ? 310 TRP B CG  1 
ATOM   5529 C  CD1 . TRP B 1 310 ? 2.833   17.494  67.206 1.00 59.31  ? 310 TRP B CD1 1 
ATOM   5530 C  CD2 . TRP B 1 310 ? 4.216   16.009  66.263 1.00 52.83  ? 310 TRP B CD2 1 
ATOM   5531 N  NE1 . TRP B 1 310 ? 2.071   16.631  66.444 1.00 58.30  ? 310 TRP B NE1 1 
ATOM   5532 C  CE2 . TRP B 1 310 ? 2.893   15.691  65.882 1.00 57.46  ? 310 TRP B CE2 1 
ATOM   5533 C  CE3 . TRP B 1 310 ? 5.274   15.227  65.756 1.00 52.27  ? 310 TRP B CE3 1 
ATOM   5534 C  CZ2 . TRP B 1 310 ? 2.596   14.609  65.046 1.00 55.54  ? 310 TRP B CZ2 1 
ATOM   5535 C  CZ3 . TRP B 1 310 ? 4.976   14.144  64.944 1.00 52.44  ? 310 TRP B CZ3 1 
ATOM   5536 C  CH2 . TRP B 1 310 ? 3.656   13.862  64.573 1.00 53.80  ? 310 TRP B CH2 1 
ATOM   5537 N  N   . GLY B 1 311 ? 7.271   19.640  69.296 1.00 58.14  ? 311 GLY B N   1 
ATOM   5538 C  CA  . GLY B 1 311 ? 8.423   19.688  70.185 1.00 58.92  ? 311 GLY B CA  1 
ATOM   5539 C  C   . GLY B 1 311 ? 8.958   18.284  70.393 1.00 62.47  ? 311 GLY B C   1 
ATOM   5540 O  O   . GLY B 1 311 ? 8.448   17.325  69.781 1.00 61.05  ? 311 GLY B O   1 
ATOM   5541 N  N   . GLU B 1 312 ? 9.996   18.131  71.242 1.00 58.79  ? 312 GLU B N   1 
ATOM   5542 C  CA  . GLU B 1 312 ? 10.504  16.779  71.451 1.00 56.57  ? 312 GLU B CA  1 
ATOM   5543 C  C   . GLU B 1 312 ? 9.516   15.875  72.174 1.00 60.34  ? 312 GLU B C   1 
ATOM   5544 O  O   . GLU B 1 312 ? 9.379   14.727  71.769 1.00 59.17  ? 312 GLU B O   1 
ATOM   5545 C  CB  . GLU B 1 312 ? 11.984  16.693  71.860 1.00 57.62  ? 312 GLU B CB  1 
ATOM   5546 C  CG  . GLU B 1 312 ? 12.838  16.568  70.603 1.00 65.63  ? 312 GLU B CG  1 
ATOM   5547 C  CD  . GLU B 1 312 ? 14.287  17.021  70.621 1.00 82.29  ? 312 GLU B CD  1 
ATOM   5548 O  OE1 . GLU B 1 312 ? 14.650  17.951  69.855 1.00 58.30  ? 312 GLU B OE1 1 
ATOM   5549 O  OE2 . GLU B 1 312 ? 15.083  16.363  71.326 1.00 79.76  ? 312 GLU B OE2 1 
ATOM   5550 N  N   . GLU B 1 313 ? 8.673   16.455  73.062 1.00 57.66  ? 313 GLU B N   1 
ATOM   5551 C  CA  . GLU B 1 313 ? 7.594   15.756  73.762 1.00 58.04  ? 313 GLU B CA  1 
ATOM   5552 C  C   . GLU B 1 313 ? 6.535   15.253  72.766 1.00 58.65  ? 313 GLU B C   1 
ATOM   5553 O  O   . GLU B 1 313 ? 6.264   14.053  72.721 1.00 58.02  ? 313 GLU B O   1 
ATOM   5554 C  CB  . GLU B 1 313 ? 6.945   16.676  74.816 1.00 62.68  ? 313 GLU B CB  1 
ATOM   5555 C  CG  . GLU B 1 313 ? 5.899   15.990  75.689 1.00 78.11  ? 313 GLU B CG  1 
ATOM   5556 C  CD  . GLU B 1 313 ? 4.552   16.687  75.776 1.00 101.26 ? 313 GLU B CD  1 
ATOM   5557 O  OE1 . GLU B 1 313 ? 4.414   17.621  76.600 1.00 102.35 ? 313 GLU B OE1 1 
ATOM   5558 O  OE2 . GLU B 1 313 ? 3.624   16.272  75.045 1.00 89.68  ? 313 GLU B OE2 1 
ATOM   5559 N  N   . GLY B 1 314 ? 5.974   16.163  71.978 1.00 53.53  ? 314 GLY B N   1 
ATOM   5560 C  CA  . GLY B 1 314 ? 4.943   15.852  70.993 1.00 52.20  ? 314 GLY B CA  1 
ATOM   5561 C  C   . GLY B 1 314 ? 5.344   14.845  69.943 1.00 52.31  ? 314 GLY B C   1 
ATOM   5562 O  O   . GLY B 1 314 ? 4.518   14.013  69.560 1.00 49.79  ? 314 GLY B O   1 
ATOM   5563 N  N   . PHE B 1 315 ? 6.618   14.929  69.470 1.00 48.91  ? 315 PHE B N   1 
ATOM   5564 C  CA  . PHE B 1 315 ? 7.209   14.008  68.489 1.00 47.55  ? 315 PHE B CA  1 
ATOM   5565 C  C   . PHE B 1 315 ? 7.321   12.617  69.110 1.00 51.47  ? 315 PHE B C   1 
ATOM   5566 O  O   . PHE B 1 315 ? 7.016   11.605  68.453 1.00 49.26  ? 315 PHE B O   1 
ATOM   5567 C  CB  . PHE B 1 315 ? 8.609   14.487  68.042 1.00 48.99  ? 315 PHE B CB  1 
ATOM   5568 C  CG  . PHE B 1 315 ? 9.489   13.383  67.480 1.00 49.11  ? 315 PHE B CG  1 
ATOM   5569 C  CD1 . PHE B 1 315 ? 9.448   13.059  66.130 1.00 50.34  ? 315 PHE B CD1 1 
ATOM   5570 C  CD2 . PHE B 1 315 ? 10.344  12.654  68.312 1.00 51.56  ? 315 PHE B CD2 1 
ATOM   5571 C  CE1 . PHE B 1 315 ? 10.244  12.027  65.619 1.00 50.35  ? 315 PHE B CE1 1 
ATOM   5572 C  CE2 . PHE B 1 315 ? 11.124  11.609  67.803 1.00 52.99  ? 315 PHE B CE2 1 
ATOM   5573 C  CZ  . PHE B 1 315 ? 11.073  11.305  66.459 1.00 49.82  ? 315 PHE B CZ  1 
ATOM   5574 N  N   . MET B 1 316 ? 7.830   12.583  70.367 1.00 49.23  ? 316 MET B N   1 
ATOM   5575 C  CA  . MET B 1 316 ? 8.010   11.372  71.150 1.00 48.83  ? 316 MET B CA  1 
ATOM   5576 C  C   . MET B 1 316 ? 6.677   10.704  71.414 1.00 51.36  ? 316 MET B C   1 
ATOM   5577 O  O   . MET B 1 316 ? 6.575   9.489   71.241 1.00 48.73  ? 316 MET B O   1 
ATOM   5578 C  CB  . MET B 1 316 ? 8.774   11.662  72.447 1.00 52.88  ? 316 MET B CB  1 
ATOM   5579 C  CG  . MET B 1 316 ? 10.290  11.818  72.247 1.00 56.32  ? 316 MET B CG  1 
ATOM   5580 S  SD  . MET B 1 316 ? 11.095  10.608  71.154 1.00 58.90  ? 316 MET B SD  1 
ATOM   5581 C  CE  . MET B 1 316 ? 10.771  9.057   72.075 1.00 56.15  ? 316 MET B CE  1 
ATOM   5582 N  N   . ALA B 1 317 ? 5.638   11.521  71.742 1.00 50.07  ? 317 ALA B N   1 
ATOM   5583 C  CA  . ALA B 1 317 ? 4.246   11.110  71.971 1.00 51.54  ? 317 ALA B CA  1 
ATOM   5584 C  C   . ALA B 1 317 ? 3.670   10.363  70.760 1.00 56.85  ? 317 ALA B C   1 
ATOM   5585 O  O   . ALA B 1 317 ? 2.926   9.394   70.935 1.00 56.60  ? 317 ALA B O   1 
ATOM   5586 C  CB  . ALA B 1 317 ? 3.394   12.326  72.278 1.00 53.94  ? 317 ALA B CB  1 
ATOM   5587 N  N   . HIS B 1 318 ? 4.044   10.811  69.538 1.00 53.91  ? 318 HIS B N   1 
ATOM   5588 C  CA  . HIS B 1 318 ? 3.634   10.221  68.274 1.00 52.95  ? 318 HIS B CA  1 
ATOM   5589 C  C   . HIS B 1 318 ? 4.363   8.901   68.019 1.00 54.68  ? 318 HIS B C   1 
ATOM   5590 O  O   . HIS B 1 318 ? 3.732   7.959   67.527 1.00 53.80  ? 318 HIS B O   1 
ATOM   5591 C  CB  . HIS B 1 318 ? 3.822   11.208  67.111 1.00 53.50  ? 318 HIS B CB  1 
ATOM   5592 C  CG  . HIS B 1 318 ? 3.351   10.666  65.792 1.00 56.76  ? 318 HIS B CG  1 
ATOM   5593 N  ND1 . HIS B 1 318 ? 2.009   10.710  65.426 1.00 60.04  ? 318 HIS B ND1 1 
ATOM   5594 C  CD2 . HIS B 1 318 ? 4.053   10.059  64.803 1.00 56.99  ? 318 HIS B CD2 1 
ATOM   5595 C  CE1 . HIS B 1 318 ? 1.945   10.142  64.230 1.00 58.20  ? 318 HIS B CE1 1 
ATOM   5596 N  NE2 . HIS B 1 318 ? 3.147   9.730   63.817 1.00 56.78  ? 318 HIS B NE2 1 
ATOM   5597 N  N   . VAL B 1 319 ? 5.679   8.817   68.335 1.00 50.14  ? 319 VAL B N   1 
ATOM   5598 C  CA  . VAL B 1 319 ? 6.386   7.548   68.104 1.00 49.10  ? 319 VAL B CA  1 
ATOM   5599 C  C   . VAL B 1 319 ? 5.868   6.451   69.019 1.00 51.43  ? 319 VAL B C   1 
ATOM   5600 O  O   . VAL B 1 319 ? 5.780   5.299   68.607 1.00 49.67  ? 319 VAL B O   1 
ATOM   5601 C  CB  . VAL B 1 319 ? 7.938   7.580   67.952 1.00 53.03  ? 319 VAL B CB  1 
ATOM   5602 C  CG1 . VAL B 1 319 ? 8.378   8.601   66.908 1.00 52.04  ? 319 VAL B CG1 1 
ATOM   5603 C  CG2 . VAL B 1 319 ? 8.649   7.811   69.282 1.00 54.20  ? 319 VAL B CG2 1 
ATOM   5604 N  N   . ASP B 1 320 ? 5.448   6.831   70.232 1.00 49.07  ? 320 ASP B N   1 
ATOM   5605 C  CA  . ASP B 1 320 ? 4.865   5.904   71.187 1.00 49.72  ? 320 ASP B CA  1 
ATOM   5606 C  C   . ASP B 1 320 ? 3.531   5.431   70.635 1.00 52.39  ? 320 ASP B C   1 
ATOM   5607 O  O   . ASP B 1 320 ? 3.286   4.226   70.626 1.00 52.80  ? 320 ASP B O   1 
ATOM   5608 C  CB  . ASP B 1 320 ? 4.726   6.551   72.574 1.00 53.60  ? 320 ASP B CB  1 
ATOM   5609 C  CG  . ASP B 1 320 ? 6.011   6.571   73.396 1.00 67.12  ? 320 ASP B CG  1 
ATOM   5610 O  OD1 . ASP B 1 320 ? 7.058   6.059   72.897 1.00 65.61  ? 320 ASP B OD1 1 
ATOM   5611 O  OD2 . ASP B 1 320 ? 5.972   7.081   74.548 1.00 77.00  ? 320 ASP B OD2 1 
ATOM   5612 N  N   . ARG B 1 321 ? 2.728   6.356   70.071 1.00 47.41  ? 321 ARG B N   1 
ATOM   5613 C  CA  . ARG B 1 321 ? 1.446   6.035   69.447 1.00 47.40  ? 321 ARG B CA  1 
ATOM   5614 C  C   . ARG B 1 321 ? 1.601   5.020   68.307 1.00 48.25  ? 321 ARG B C   1 
ATOM   5615 O  O   . ARG B 1 321 ? 0.825   4.063   68.262 1.00 48.44  ? 321 ARG B O   1 
ATOM   5616 C  CB  . ARG B 1 321 ? 0.726   7.305   68.965 1.00 50.66  ? 321 ARG B CB  1 
ATOM   5617 C  CG  . ARG B 1 321 ? -0.026  8.053   70.067 1.00 70.92  ? 321 ARG B CG  1 
ATOM   5618 C  CD  . ARG B 1 321 ? -0.825  9.229   69.523 1.00 88.20  ? 321 ARG B CD  1 
ATOM   5619 N  NE  . ARG B 1 321 ? -0.240  10.531  69.869 1.00 96.40  ? 321 ARG B NE  1 
ATOM   5620 C  CZ  . ARG B 1 321 ? 0.294   11.377  68.989 1.00 104.49 ? 321 ARG B CZ  1 
ATOM   5621 N  NH1 . ARG B 1 321 ? 0.791   12.537  69.395 1.00 90.67  ? 321 ARG B NH1 1 
ATOM   5622 N  NH2 . ARG B 1 321 ? 0.339   11.065  67.698 1.00 84.90  ? 321 ARG B NH2 1 
ATOM   5623 N  N   . VAL B 1 322 ? 2.610   5.203   67.413 1.00 42.33  ? 322 VAL B N   1 
ATOM   5624 C  CA  . VAL B 1 322 ? 2.848   4.256   66.317 1.00 41.30  ? 322 VAL B CA  1 
ATOM   5625 C  C   . VAL B 1 322 ? 3.362   2.923   66.863 1.00 43.79  ? 322 VAL B C   1 
ATOM   5626 O  O   . VAL B 1 322 ? 2.862   1.883   66.449 1.00 44.12  ? 322 VAL B O   1 
ATOM   5627 C  CB  . VAL B 1 322 ? 3.633   4.765   65.044 1.00 44.56  ? 322 VAL B CB  1 
ATOM   5628 C  CG1 . VAL B 1 322 ? 3.060   6.068   64.485 1.00 44.67  ? 322 VAL B CG1 1 
ATOM   5629 C  CG2 . VAL B 1 322 ? 5.133   4.905   65.291 1.00 43.53  ? 322 VAL B CG2 1 
ATOM   5630 N  N   . ILE B 1 323 ? 4.311   2.952   67.826 1.00 39.18  ? 323 ILE B N   1 
ATOM   5631 C  CA  . ILE B 1 323 ? 4.869   1.743   68.445 1.00 38.95  ? 323 ILE B CA  1 
ATOM   5632 C  C   . ILE B 1 323 ? 3.749   0.811   68.930 1.00 44.97  ? 323 ILE B C   1 
ATOM   5633 O  O   . ILE B 1 323 ? 3.674   -0.340  68.487 1.00 44.62  ? 323 ILE B O   1 
ATOM   5634 C  CB  . ILE B 1 323 ? 5.972   2.084   69.496 1.00 41.60  ? 323 ILE B CB  1 
ATOM   5635 C  CG1 . ILE B 1 323 ? 7.380   1.932   68.874 1.00 40.44  ? 323 ILE B CG1 1 
ATOM   5636 C  CG2 . ILE B 1 323 ? 5.849   1.301   70.808 1.00 42.74  ? 323 ILE B CG2 1 
ATOM   5637 C  CD1 . ILE B 1 323 ? 8.521   2.787   69.573 1.00 46.22  ? 323 ILE B CD1 1 
ATOM   5638 N  N   . ASP B 1 324 ? 2.823   1.366   69.727 1.00 43.55  ? 324 ASP B N   1 
ATOM   5639 C  CA  . ASP B 1 324 ? 1.661   0.690   70.285 1.00 45.92  ? 324 ASP B CA  1 
ATOM   5640 C  C   . ASP B 1 324 ? 0.867   -0.037  69.178 1.00 50.34  ? 324 ASP B C   1 
ATOM   5641 O  O   . ASP B 1 324 ? 0.607   -1.233  69.295 1.00 50.40  ? 324 ASP B O   1 
ATOM   5642 C  CB  . ASP B 1 324 ? 0.795   1.703   71.081 1.00 50.03  ? 324 ASP B CB  1 
ATOM   5643 C  CG  . ASP B 1 324 ? 1.400   2.267   72.388 1.00 68.06  ? 324 ASP B CG  1 
ATOM   5644 O  OD1 . ASP B 1 324 ? 2.377   1.665   72.919 1.00 69.23  ? 324 ASP B OD1 1 
ATOM   5645 O  OD2 . ASP B 1 324 ? 0.867   3.279   72.905 1.00 76.26  ? 324 ASP B OD2 1 
ATOM   5646 N  N   . PHE B 1 325 ? 0.580   0.661   68.066 1.00 47.09  ? 325 PHE B N   1 
ATOM   5647 C  CA  . PHE B 1 325 ? -0.120  0.105   66.909 1.00 46.92  ? 325 PHE B CA  1 
ATOM   5648 C  C   . PHE B 1 325 ? 0.659   -1.078  66.352 1.00 51.55  ? 325 PHE B C   1 
ATOM   5649 O  O   . PHE B 1 325 ? 0.113   -2.177  66.292 1.00 53.17  ? 325 PHE B O   1 
ATOM   5650 C  CB  . PHE B 1 325 ? -0.332  1.176   65.812 1.00 47.63  ? 325 PHE B CB  1 
ATOM   5651 C  CG  . PHE B 1 325 ? -0.969  0.648   64.546 1.00 49.29  ? 325 PHE B CG  1 
ATOM   5652 C  CD1 . PHE B 1 325 ? -2.352  0.606   64.408 1.00 53.94  ? 325 PHE B CD1 1 
ATOM   5653 C  CD2 . PHE B 1 325 ? -0.186  0.167   63.502 1.00 50.20  ? 325 PHE B CD2 1 
ATOM   5654 C  CE1 . PHE B 1 325 ? -2.941  0.107   63.245 1.00 54.91  ? 325 PHE B CE1 1 
ATOM   5655 C  CE2 . PHE B 1 325 ? -0.777  -0.365  62.353 1.00 53.30  ? 325 PHE B CE2 1 
ATOM   5656 C  CZ  . PHE B 1 325 ? -2.150  -0.385  62.231 1.00 52.90  ? 325 PHE B CZ  1 
ATOM   5657 N  N   . TYR B 1 326 ? 1.934   -0.864  65.961 1.00 46.38  ? 326 TYR B N   1 
ATOM   5658 C  CA  . TYR B 1 326 ? 2.765   -1.916  65.383 1.00 45.47  ? 326 TYR B CA  1 
ATOM   5659 C  C   . TYR B 1 326 ? 3.010   -3.109  66.307 1.00 48.54  ? 326 TYR B C   1 
ATOM   5660 O  O   . TYR B 1 326 ? 3.306   -4.203  65.816 1.00 47.32  ? 326 TYR B O   1 
ATOM   5661 C  CB  . TYR B 1 326 ? 4.073   -1.354  64.843 1.00 45.65  ? 326 TYR B CB  1 
ATOM   5662 C  CG  . TYR B 1 326 ? 3.937   -0.572  63.556 1.00 48.19  ? 326 TYR B CG  1 
ATOM   5663 C  CD1 . TYR B 1 326 ? 3.987   -1.211  62.319 1.00 49.89  ? 326 TYR B CD1 1 
ATOM   5664 C  CD2 . TYR B 1 326 ? 3.871   0.817   63.569 1.00 49.91  ? 326 TYR B CD2 1 
ATOM   5665 C  CE1 . TYR B 1 326 ? 3.919   -0.487  61.125 1.00 51.83  ? 326 TYR B CE1 1 
ATOM   5666 C  CE2 . TYR B 1 326 ? 3.801   1.554   62.383 1.00 50.92  ? 326 TYR B CE2 1 
ATOM   5667 C  CZ  . TYR B 1 326 ? 3.830   0.900   61.160 1.00 59.67  ? 326 TYR B CZ  1 
ATOM   5668 O  OH  . TYR B 1 326 ? 3.789   1.646   59.994 1.00 57.66  ? 326 TYR B OH  1 
ATOM   5669 N  N   . SER B 1 327 ? 2.861   -2.904  67.633 1.00 45.50  ? 327 SER B N   1 
ATOM   5670 C  CA  . SER B 1 327 ? 3.016   -3.942  68.649 1.00 46.24  ? 327 SER B CA  1 
ATOM   5671 C  C   . SER B 1 327 ? 1.858   -4.933  68.607 1.00 50.11  ? 327 SER B C   1 
ATOM   5672 O  O   . SER B 1 327 ? 2.097   -6.134  68.637 1.00 49.40  ? 327 SER B O   1 
ATOM   5673 C  CB  . SER B 1 327 ? 3.144   -3.325  70.035 1.00 52.11  ? 327 SER B CB  1 
ATOM   5674 O  OG  . SER B 1 327 ? 4.001   -4.103  70.854 1.00 65.49  ? 327 SER B OG  1 
ATOM   5675 N  N   . ASN B 1 328 ? 0.611   -4.439  68.488 1.00 47.78  ? 328 ASN B N   1 
ATOM   5676 C  CA  . ASN B 1 328 ? -0.588  -5.286  68.378 1.00 49.71  ? 328 ASN B CA  1 
ATOM   5677 C  C   . ASN B 1 328 ? -0.594  -6.073  67.058 1.00 52.83  ? 328 ASN B C   1 
ATOM   5678 O  O   . ASN B 1 328 ? -1.103  -7.186  67.016 1.00 54.93  ? 328 ASN B O   1 
ATOM   5679 C  CB  . ASN B 1 328 ? -1.873  -4.458  68.511 1.00 52.83  ? 328 ASN B CB  1 
ATOM   5680 C  CG  . ASN B 1 328 ? -1.898  -3.523  69.696 1.00 87.46  ? 328 ASN B CG  1 
ATOM   5681 O  OD1 . ASN B 1 328 ? -2.392  -2.391  69.595 1.00 85.78  ? 328 ASN B OD1 1 
ATOM   5682 N  ND2 . ASN B 1 328 ? -1.346  -3.960  70.841 1.00 79.26  ? 328 ASN B ND2 1 
ATOM   5683 N  N   . GLN B 1 329 ? -0.034  -5.482  65.992 1.00 46.34  ? 329 GLN B N   1 
ATOM   5684 C  CA  . GLN B 1 329 ? 0.117   -6.083  64.672 1.00 45.14  ? 329 GLN B CA  1 
ATOM   5685 C  C   . GLN B 1 329 ? 1.145   -7.231  64.768 1.00 48.73  ? 329 GLN B C   1 
ATOM   5686 O  O   . GLN B 1 329 ? 0.984   -8.258  64.110 1.00 50.05  ? 329 GLN B O   1 
ATOM   5687 C  CB  . GLN B 1 329 ? 0.570   -5.010  63.661 1.00 44.23  ? 329 GLN B CB  1 
ATOM   5688 C  CG  . GLN B 1 329 ? -0.567  -4.197  63.023 1.00 58.58  ? 329 GLN B CG  1 
ATOM   5689 C  CD  . GLN B 1 329 ? -1.277  -4.904  61.869 1.00 78.33  ? 329 GLN B CD  1 
ATOM   5690 O  OE1 . GLN B 1 329 ? -2.383  -5.438  62.017 1.00 73.84  ? 329 GLN B OE1 1 
ATOM   5691 N  NE2 . GLN B 1 329 ? -0.689  -4.878  60.676 1.00 69.47  ? 329 GLN B NE2 1 
ATOM   5692 N  N   . LYS B 1 330 ? 2.200   -7.038  65.597 1.00 42.94  ? 330 LYS B N   1 
ATOM   5693 C  CA  . LYS B 1 330 ? 3.265   -8.002  65.911 1.00 41.10  ? 330 LYS B CA  1 
ATOM   5694 C  C   . LYS B 1 330 ? 2.518   -9.132  66.626 1.00 43.67  ? 330 LYS B C   1 
ATOM   5695 O  O   . LYS B 1 330 ? 2.461   -10.250 66.116 1.00 42.73  ? 330 LYS B O   1 
ATOM   5696 C  CB  . LYS B 1 330 ? 4.359   -7.303  66.793 1.00 41.57  ? 330 LYS B CB  1 
ATOM   5697 C  CG  . LYS B 1 330 ? 5.464   -8.186  67.406 1.00 42.29  ? 330 LYS B CG  1 
ATOM   5698 C  CD  . LYS B 1 330 ? 6.091   -7.650  68.736 1.00 48.23  ? 330 LYS B CD  1 
ATOM   5699 C  CE  . LYS B 1 330 ? 5.153   -6.890  69.669 1.00 55.83  ? 330 LYS B CE  1 
ATOM   5700 N  NZ  . LYS B 1 330 ? 5.213   -7.295  71.105 1.00 57.11  ? 330 LYS B NZ  1 
ATOM   5701 N  N   . ASP B 1 331 ? 1.789   -8.776  67.696 1.00 40.66  ? 331 ASP B N   1 
ATOM   5702 C  CA  . ASP B 1 331 ? 0.936   -9.685  68.461 1.00 42.43  ? 331 ASP B CA  1 
ATOM   5703 C  C   . ASP B 1 331 ? -0.046  -10.443 67.548 1.00 47.08  ? 331 ASP B C   1 
ATOM   5704 O  O   . ASP B 1 331 ? -0.299  -11.610 67.787 1.00 49.01  ? 331 ASP B O   1 
ATOM   5705 C  CB  . ASP B 1 331 ? 0.176   -8.909  69.561 1.00 44.73  ? 331 ASP B CB  1 
ATOM   5706 C  CG  . ASP B 1 331 ? 1.051   -8.234  70.615 1.00 52.43  ? 331 ASP B CG  1 
ATOM   5707 O  OD1 . ASP B 1 331 ? 2.295   -8.383  70.552 1.00 52.14  ? 331 ASP B OD1 1 
ATOM   5708 O  OD2 . ASP B 1 331 ? 0.498   -7.539  71.482 1.00 58.20  ? 331 ASP B OD2 1 
ATOM   5709 N  N   . ALA B 1 332 ? -0.534  -9.800  66.479 1.00 42.51  ? 332 ALA B N   1 
ATOM   5710 C  CA  . ALA B 1 332 ? -1.473  -10.375 65.526 1.00 43.36  ? 332 ALA B CA  1 
ATOM   5711 C  C   . ALA B 1 332 ? -0.815  -11.446 64.674 1.00 49.35  ? 332 ALA B C   1 
ATOM   5712 O  O   . ALA B 1 332 ? -1.231  -12.606 64.736 1.00 50.81  ? 332 ALA B O   1 
ATOM   5713 C  CB  . ALA B 1 332 ? -2.073  -9.282  64.647 1.00 42.98  ? 332 ALA B CB  1 
ATOM   5714 N  N   . ILE B 1 333 ? 0.215   -11.070 63.884 1.00 45.89  ? 333 ILE B N   1 
ATOM   5715 C  CA  . ILE B 1 333 ? 0.935   -11.994 62.992 1.00 45.98  ? 333 ILE B CA  1 
ATOM   5716 C  C   . ILE B 1 333 ? 1.533   -13.181 63.759 1.00 51.87  ? 333 ILE B C   1 
ATOM   5717 O  O   . ILE B 1 333 ? 1.532   -14.305 63.245 1.00 52.94  ? 333 ILE B O   1 
ATOM   5718 C  CB  . ILE B 1 333 ? 1.936   -11.283 62.026 1.00 46.35  ? 333 ILE B CB  1 
ATOM   5719 C  CG1 . ILE B 1 333 ? 2.214   -12.136 60.785 1.00 47.29  ? 333 ILE B CG1 1 
ATOM   5720 C  CG2 . ILE B 1 333 ? 3.235   -10.892 62.718 1.00 45.36  ? 333 ILE B CG2 1 
ATOM   5721 C  CD1 . ILE B 1 333 ? 2.483   -11.363 59.537 1.00 54.40  ? 333 ILE B CD1 1 
ATOM   5722 N  N   . LEU B 1 334 ? 2.002   -12.926 64.998 1.00 48.11  ? 334 LEU B N   1 
ATOM   5723 C  CA  . LEU B 1 334 ? 2.582   -13.956 65.835 1.00 49.84  ? 334 LEU B CA  1 
ATOM   5724 C  C   . LEU B 1 334 ? 1.515   -15.022 66.135 1.00 61.05  ? 334 LEU B C   1 
ATOM   5725 O  O   . LEU B 1 334 ? 1.710   -16.203 65.794 1.00 62.27  ? 334 LEU B O   1 
ATOM   5726 C  CB  . LEU B 1 334 ? 3.156   -13.336 67.112 1.00 48.59  ? 334 LEU B CB  1 
ATOM   5727 C  CG  . LEU B 1 334 ? 4.674   -13.103 67.203 1.00 50.91  ? 334 LEU B CG  1 
ATOM   5728 C  CD1 . LEU B 1 334 ? 5.436   -13.671 66.028 1.00 50.50  ? 334 LEU B CD1 1 
ATOM   5729 C  CD2 . LEU B 1 334 ? 4.987   -11.665 67.403 1.00 50.20  ? 334 LEU B CD2 1 
ATOM   5730 N  N   . ALA B 1 335 ? 0.340   -14.563 66.648 1.00 60.34  ? 335 ALA B N   1 
ATOM   5731 C  CA  . ALA B 1 335 ? -0.842  -15.373 66.949 1.00 63.29  ? 335 ALA B CA  1 
ATOM   5732 C  C   . ALA B 1 335 ? -1.339  -16.098 65.691 1.00 71.45  ? 335 ALA B C   1 
ATOM   5733 O  O   . ALA B 1 335 ? -1.867  -17.212 65.783 1.00 73.94  ? 335 ALA B O   1 
ATOM   5734 C  CB  . ALA B 1 335 ? -1.943  -14.493 67.516 1.00 64.15  ? 335 ALA B CB  1 
ATOM   5735 N  N   . ALA B 1 336 ? -1.136  -15.469 64.517 1.00 67.99  ? 336 ALA B N   1 
ATOM   5736 C  CA  . ALA B 1 336 ? -1.509  -16.029 63.228 1.00 69.54  ? 336 ALA B CA  1 
ATOM   5737 C  C   . ALA B 1 336 ? -0.654  -17.267 62.941 1.00 73.55  ? 336 ALA B C   1 
ATOM   5738 O  O   . ALA B 1 336 ? -1.220  -18.336 62.698 1.00 75.23  ? 336 ALA B O   1 
ATOM   5739 C  CB  . ALA B 1 336 ? -1.337  -14.983 62.130 1.00 68.63  ? 336 ALA B CB  1 
ATOM   5740 N  N   . ALA B 1 337 ? 0.698   -17.140 63.026 1.00 67.61  ? 337 ALA B N   1 
ATOM   5741 C  CA  . ALA B 1 337 ? 1.606   -18.264 62.803 1.00 67.83  ? 337 ALA B CA  1 
ATOM   5742 C  C   . ALA B 1 337 ? 1.378   -19.300 63.897 1.00 75.07  ? 337 ALA B C   1 
ATOM   5743 O  O   . ALA B 1 337 ? 1.130   -20.473 63.584 1.00 77.19  ? 337 ALA B O   1 
ATOM   5744 C  CB  . ALA B 1 337 ? 3.046   -17.797 62.800 1.00 66.01  ? 337 ALA B CB  1 
ATOM   5745 N  N   . ASP B 1 338 ? 1.335   -18.840 65.180 1.00 70.39  ? 338 ASP B N   1 
ATOM   5746 C  CA  . ASP B 1 338 ? 1.068   -19.681 66.351 1.00 71.12  ? 338 ASP B CA  1 
ATOM   5747 C  C   . ASP B 1 338 ? -0.007  -20.691 66.062 1.00 75.53  ? 338 ASP B C   1 
ATOM   5748 O  O   . ASP B 1 338 ? 0.184   -21.863 66.349 1.00 76.90  ? 338 ASP B O   1 
ATOM   5749 C  CB  . ASP B 1 338 ? 0.655   -18.828 67.548 1.00 72.19  ? 338 ASP B CB  1 
ATOM   5750 C  CG  . ASP B 1 338 ? 1.781   -18.647 68.525 1.00 82.42  ? 338 ASP B CG  1 
ATOM   5751 O  OD1 . ASP B 1 338 ? 1.769   -19.333 69.570 1.00 84.60  ? 338 ASP B OD1 1 
ATOM   5752 O  OD2 . ASP B 1 338 ? 2.718   -17.862 68.215 1.00 86.41  ? 338 ASP B OD2 1 
ATOM   5753 N  N   . LYS B 1 339 ? -1.097  -20.241 65.418 1.00 72.08  ? 339 LYS B N   1 
ATOM   5754 C  CA  . LYS B 1 339 ? -2.255  -21.041 65.038 1.00 74.89  ? 339 LYS B CA  1 
ATOM   5755 C  C   . LYS B 1 339 ? -1.910  -22.132 64.025 1.00 82.32  ? 339 LYS B C   1 
ATOM   5756 O  O   . LYS B 1 339 ? -1.847  -23.322 64.373 1.00 83.64  ? 339 LYS B O   1 
ATOM   5757 C  CB  . LYS B 1 339 ? -3.377  -20.127 64.494 1.00 75.80  ? 339 LYS B CB  1 
ATOM   5758 C  CG  . LYS B 1 339 ? -4.771  -20.732 64.576 1.00 78.44  ? 339 LYS B CG  1 
ATOM   5759 C  CD  . LYS B 1 339 ? -5.835  -19.811 64.009 1.00 78.76  ? 339 LYS B CD  1 
ATOM   5760 C  CE  . LYS B 1 339 ? -7.218  -20.385 64.165 1.00 84.01  ? 339 LYS B CE  1 
ATOM   5761 N  NZ  . LYS B 1 339 ? -8.225  -19.613 63.405 1.00 88.99  ? 339 LYS B NZ  1 
ATOM   5762 N  N   . TRP B 1 340 ? -1.668  -21.704 62.781 1.00 80.10  ? 340 TRP B N   1 
ATOM   5763 C  CA  . TRP B 1 340 ? -1.446  -22.555 61.617 1.00 82.69  ? 340 TRP B CA  1 
ATOM   5764 C  C   . TRP B 1 340 ? -0.019  -23.045 61.394 1.00 82.98  ? 340 TRP B C   1 
ATOM   5765 O  O   . TRP B 1 340 ? 0.167   -24.184 60.968 1.00 84.61  ? 340 TRP B O   1 
ATOM   5766 C  CB  . TRP B 1 340 ? -1.971  -21.864 60.338 1.00 82.27  ? 340 TRP B CB  1 
ATOM   5767 C  CG  . TRP B 1 340 ? -3.249  -21.087 60.501 1.00 84.61  ? 340 TRP B CG  1 
ATOM   5768 C  CD1 . TRP B 1 340 ? -3.367  -19.780 60.872 1.00 85.55  ? 340 TRP B CD1 1 
ATOM   5769 C  CD2 . TRP B 1 340 ? -4.581  -21.553 60.247 1.00 87.72  ? 340 TRP B CD2 1 
ATOM   5770 N  NE1 . TRP B 1 340 ? -4.692  -19.411 60.898 1.00 86.66  ? 340 TRP B NE1 1 
ATOM   5771 C  CE2 . TRP B 1 340 ? -5.459  -20.477 60.511 1.00 91.35  ? 340 TRP B CE2 1 
ATOM   5772 C  CE3 . TRP B 1 340 ? -5.121  -22.777 59.826 1.00 92.61  ? 340 TRP B CE3 1 
ATOM   5773 C  CZ2 . TRP B 1 340 ? -6.847  -20.587 60.361 1.00 93.32  ? 340 TRP B CZ2 1 
ATOM   5774 C  CZ3 . TRP B 1 340 ? -6.496  -22.887 59.688 1.00 96.88  ? 340 TRP B CZ3 1 
ATOM   5775 C  CH2 . TRP B 1 340 ? -7.343  -21.803 59.963 1.00 96.79  ? 340 TRP B CH2 1 
ATOM   5776 N  N   . LEU B 1 341 ? 0.971   -22.195 61.649 1.00 74.84  ? 341 LEU B N   1 
ATOM   5777 C  CA  . LEU B 1 341 ? 2.368   -22.483 61.356 1.00 73.38  ? 341 LEU B CA  1 
ATOM   5778 C  C   . LEU B 1 341 ? 3.183   -23.316 62.328 1.00 78.23  ? 341 LEU B C   1 
ATOM   5779 O  O   . LEU B 1 341 ? 4.237   -23.799 61.916 1.00 77.71  ? 341 LEU B O   1 
ATOM   5780 C  CB  . LEU B 1 341 ? 3.103   -21.199 60.939 1.00 70.14  ? 341 LEU B CB  1 
ATOM   5781 C  CG  . LEU B 1 341 ? 3.269   -20.952 59.437 1.00 73.74  ? 341 LEU B CG  1 
ATOM   5782 C  CD1 . LEU B 1 341 ? 1.930   -20.805 58.726 1.00 74.73  ? 341 LEU B CD1 1 
ATOM   5783 C  CD2 . LEU B 1 341 ? 4.126   -19.738 59.191 1.00 72.66  ? 341 LEU B CD2 1 
ATOM   5784 N  N   . THR B 1 342 ? 2.725   -23.512 63.587 1.00 76.77  ? 342 THR B N   1 
ATOM   5785 C  CA  . THR B 1 342 ? 3.454   -24.333 64.580 1.00 78.57  ? 342 THR B CA  1 
ATOM   5786 C  C   . THR B 1 342 ? 3.774   -25.721 64.040 1.00 87.69  ? 342 THR B C   1 
ATOM   5787 O  O   . THR B 1 342 ? 2.924   -26.359 63.411 1.00 89.43  ? 342 THR B O   1 
ATOM   5788 C  CB  . THR B 1 342 ? 2.695   -24.479 65.912 1.00 86.01  ? 342 THR B CB  1 
ATOM   5789 O  OG1 . THR B 1 342 ? 1.287   -24.583 65.676 1.00 88.54  ? 342 THR B OG1 1 
ATOM   5790 C  CG2 . THR B 1 342 ? 3.020   -23.375 66.907 1.00 80.94  ? 342 THR B CG2 1 
ATOM   5791 N  N   . GLY B 1 343 ? 5.011   -26.154 64.255 1.00 86.06  ? 343 GLY B N   1 
ATOM   5792 C  CA  . GLY B 1 343 ? 5.479   -27.461 63.805 1.00 89.10  ? 343 GLY B CA  1 
ATOM   5793 C  C   . GLY B 1 343 ? 5.812   -27.528 62.328 1.00 93.43  ? 343 GLY B C   1 
ATOM   5794 O  O   . GLY B 1 343 ? 6.529   -28.434 61.905 1.00 94.83  ? 343 GLY B O   1 
ATOM   5795 N  N   . LEU B 1 344 ? 5.280   -26.590 61.533 1.00 88.81  ? 344 LEU B N   1 
ATOM   5796 C  CA  . LEU B 1 344 ? 5.516   -26.505 60.089 1.00 89.13  ? 344 LEU B CA  1 
ATOM   5797 C  C   . LEU B 1 344 ? 6.588   -25.442 59.796 1.00 90.29  ? 344 LEU B C   1 
ATOM   5798 O  O   . LEU B 1 344 ? 7.226   -25.459 58.740 1.00 89.43  ? 344 LEU B O   1 
ATOM   5799 C  CB  . LEU B 1 344 ? 4.211   -26.155 59.328 1.00 89.42  ? 344 LEU B CB  1 
ATOM   5800 C  CG  . LEU B 1 344 ? 2.858   -26.704 59.837 1.00 96.28  ? 344 LEU B CG  1 
ATOM   5801 C  CD1 . LEU B 1 344 ? 1.732   -26.257 58.925 1.00 96.34  ? 344 LEU B CD1 1 
ATOM   5802 C  CD2 . LEU B 1 344 ? 2.850   -28.228 59.918 1.00 102.32 ? 344 LEU B CD2 1 
ATOM   5803 N  N   . ALA B 1 345 ? 6.774   -24.523 60.749 1.00 85.07  ? 345 ALA B N   1 
ATOM   5804 C  CA  . ALA B 1 345 ? 7.711   -23.419 60.645 1.00 82.08  ? 345 ALA B CA  1 
ATOM   5805 C  C   . ALA B 1 345 ? 8.455   -23.108 61.942 1.00 84.75  ? 345 ALA B C   1 
ATOM   5806 O  O   . ALA B 1 345 ? 8.036   -23.506 63.033 1.00 85.13  ? 345 ALA B O   1 
ATOM   5807 C  CB  . ALA B 1 345 ? 6.974   -22.180 60.177 1.00 80.67  ? 345 ALA B CB  1 
ATOM   5808 N  N   . GLU B 1 346 ? 9.565   -22.373 61.791 1.00 79.43  ? 346 GLU B N   1 
ATOM   5809 C  CA  . GLU B 1 346 ? 10.422  -21.848 62.850 1.00 77.64  ? 346 GLU B CA  1 
ATOM   5810 C  C   . GLU B 1 346 ? 10.436  -20.325 62.647 1.00 76.77  ? 346 GLU B C   1 
ATOM   5811 O  O   . GLU B 1 346 ? 10.528  -19.863 61.501 1.00 74.29  ? 346 GLU B O   1 
ATOM   5812 C  CB  . GLU B 1 346 ? 11.852  -22.418 62.733 1.00 79.85  ? 346 GLU B CB  1 
ATOM   5813 C  CG  . GLU B 1 346 ? 12.030  -23.799 63.341 1.00 93.08  ? 346 GLU B CG  1 
ATOM   5814 C  CD  . GLU B 1 346 ? 13.316  -24.504 62.951 1.00 115.99 ? 346 GLU B CD  1 
ATOM   5815 O  OE1 . GLU B 1 346 ? 13.319  -25.200 61.910 1.00 119.73 ? 346 GLU B OE1 1 
ATOM   5816 O  OE2 . GLU B 1 346 ? 14.317  -24.376 63.695 1.00 103.30 ? 346 GLU B OE2 1 
ATOM   5817 N  N   . TRP B 1 347 ? 10.291  -19.554 63.748 1.00 71.44  ? 347 TRP B N   1 
ATOM   5818 C  CA  . TRP B 1 347 ? 10.290  -18.085 63.718 1.00 68.14  ? 347 TRP B CA  1 
ATOM   5819 C  C   . TRP B 1 347 ? 10.659  -17.478 65.060 1.00 70.84  ? 347 TRP B C   1 
ATOM   5820 O  O   . TRP B 1 347 ? 10.346  -18.051 66.109 1.00 72.04  ? 347 TRP B O   1 
ATOM   5821 C  CB  . TRP B 1 347 ? 8.930   -17.523 63.239 1.00 66.02  ? 347 TRP B CB  1 
ATOM   5822 C  CG  . TRP B 1 347 ? 7.783   -17.721 64.193 1.00 67.80  ? 347 TRP B CG  1 
ATOM   5823 C  CD1 . TRP B 1 347 ? 7.430   -16.913 65.237 1.00 69.83  ? 347 TRP B CD1 1 
ATOM   5824 C  CD2 . TRP B 1 347 ? 6.809   -18.771 64.151 1.00 69.91  ? 347 TRP B CD2 1 
ATOM   5825 N  NE1 . TRP B 1 347 ? 6.318   -17.416 65.872 1.00 71.02  ? 347 TRP B NE1 1 
ATOM   5826 C  CE2 . TRP B 1 347 ? 5.912   -18.555 65.223 1.00 74.48  ? 347 TRP B CE2 1 
ATOM   5827 C  CE3 . TRP B 1 347 ? 6.614   -19.887 63.317 1.00 72.96  ? 347 TRP B CE3 1 
ATOM   5828 C  CZ2 . TRP B 1 347 ? 4.848   -19.422 65.493 1.00 76.11  ? 347 TRP B CZ2 1 
ATOM   5829 C  CZ3 . TRP B 1 347 ? 5.550   -20.732 63.571 1.00 76.67  ? 347 TRP B CZ3 1 
ATOM   5830 C  CH2 . TRP B 1 347 ? 4.683   -20.500 64.649 1.00 77.85  ? 347 TRP B CH2 1 
ATOM   5831 N  N   . HIS B 1 348 ? 11.280  -16.294 65.022 1.00 65.39  ? 348 HIS B N   1 
ATOM   5832 C  CA  . HIS B 1 348 ? 11.632  -15.527 66.218 1.00 64.84  ? 348 HIS B CA  1 
ATOM   5833 C  C   . HIS B 1 348 ? 10.585  -14.446 66.434 1.00 64.46  ? 348 HIS B C   1 
ATOM   5834 O  O   . HIS B 1 348 ? 9.681   -14.288 65.611 1.00 64.38  ? 348 HIS B O   1 
ATOM   5835 C  CB  . HIS B 1 348 ? 13.017  -14.867 66.067 1.00 65.43  ? 348 HIS B CB  1 
ATOM   5836 C  CG  . HIS B 1 348 ? 14.145  -15.771 66.435 1.00 70.89  ? 348 HIS B CG  1 
ATOM   5837 N  ND1 . HIS B 1 348 ? 14.334  -16.188 67.739 1.00 74.22  ? 348 HIS B ND1 1 
ATOM   5838 C  CD2 . HIS B 1 348 ? 15.105  -16.318 65.650 1.00 73.52  ? 348 HIS B CD2 1 
ATOM   5839 C  CE1 . HIS B 1 348 ? 15.364  -17.015 67.697 1.00 75.25  ? 348 HIS B CE1 1 
ATOM   5840 N  NE2 . HIS B 1 348 ? 15.880  -17.102 66.467 1.00 75.09  ? 348 HIS B NE2 1 
ATOM   5841 N  N   . VAL B 1 349 ? 10.709  -13.692 67.527 1.00 57.37  ? 349 VAL B N   1 
ATOM   5842 C  CA  . VAL B 1 349 ? 9.809   -12.587 67.794 1.00 54.71  ? 349 VAL B CA  1 
ATOM   5843 C  C   . VAL B 1 349 ? 10.565  -11.294 67.471 1.00 54.30  ? 349 VAL B C   1 
ATOM   5844 O  O   . VAL B 1 349 ? 11.744  -11.156 67.827 1.00 53.17  ? 349 VAL B O   1 
ATOM   5845 C  CB  . VAL B 1 349 ? 9.197   -12.627 69.217 1.00 59.65  ? 349 VAL B CB  1 
ATOM   5846 C  CG1 . VAL B 1 349 ? 10.211  -12.240 70.298 1.00 60.00  ? 349 VAL B CG1 1 
ATOM   5847 C  CG2 . VAL B 1 349 ? 7.953   -11.765 69.306 1.00 58.58  ? 349 VAL B CG2 1 
ATOM   5848 N  N   . PRO B 1 350 ? 9.938   -10.361 66.736 1.00 48.47  ? 350 PRO B N   1 
ATOM   5849 C  CA  . PRO B 1 350 ? 10.630  -9.120  66.416 1.00 46.38  ? 350 PRO B CA  1 
ATOM   5850 C  C   . PRO B 1 350 ? 10.895  -8.315  67.674 1.00 52.32  ? 350 PRO B C   1 
ATOM   5851 O  O   . PRO B 1 350 ? 10.094  -8.327  68.613 1.00 53.14  ? 350 PRO B O   1 
ATOM   5852 C  CB  . PRO B 1 350 ? 9.640   -8.403  65.506 1.00 47.04  ? 350 PRO B CB  1 
ATOM   5853 C  CG  . PRO B 1 350 ? 8.755   -9.482  64.984 1.00 52.84  ? 350 PRO B CG  1 
ATOM   5854 C  CD  . PRO B 1 350 ? 8.583   -10.357 66.160 1.00 50.26  ? 350 PRO B CD  1 
ATOM   5855 N  N   . ALA B 1 351 ? 12.068  -7.670  67.702 1.00 49.44  ? 351 ALA B N   1 
ATOM   5856 C  CA  . ALA B 1 351 ? 12.552  -6.786  68.763 1.00 48.86  ? 351 ALA B CA  1 
ATOM   5857 C  C   . ALA B 1 351 ? 12.039  -5.347  68.491 1.00 51.60  ? 351 ALA B C   1 
ATOM   5858 O  O   . ALA B 1 351 ? 11.666  -4.616  69.414 1.00 51.54  ? 351 ALA B O   1 
ATOM   5859 C  CB  . ALA B 1 351 ? 14.074  -6.813  68.780 1.00 49.00  ? 351 ALA B CB  1 
ATOM   5860 N  N   . ALA B 1 352 ? 11.995  -4.988  67.197 1.00 46.50  ? 352 ALA B N   1 
ATOM   5861 C  CA  . ALA B 1 352 ? 11.596  -3.716  66.611 1.00 44.52  ? 352 ALA B CA  1 
ATOM   5862 C  C   . ALA B 1 352 ? 11.249  -3.993  65.133 1.00 47.48  ? 352 ALA B C   1 
ATOM   5863 O  O   . ALA B 1 352 ? 11.391  -5.132  64.669 1.00 47.95  ? 352 ALA B O   1 
ATOM   5864 C  CB  . ALA B 1 352 ? 12.763  -2.744  66.695 1.00 44.33  ? 352 ALA B CB  1 
ATOM   5865 N  N   . GLY B 1 353 ? 10.805  -2.969  64.408 1.00 42.10  ? 353 GLY B N   1 
ATOM   5866 C  CA  . GLY B 1 353 ? 10.494  -3.120  62.994 1.00 41.31  ? 353 GLY B CA  1 
ATOM   5867 C  C   . GLY B 1 353 ? 9.112   -3.644  62.680 1.00 46.43  ? 353 GLY B C   1 
ATOM   5868 O  O   . GLY B 1 353 ? 8.279   -3.824  63.575 1.00 46.13  ? 353 GLY B O   1 
ATOM   5869 N  N   . MET B 1 354 ? 8.873   -3.887  61.384 1.00 44.21  ? 354 MET B N   1 
ATOM   5870 C  CA  . MET B 1 354 ? 7.592   -4.340  60.819 1.00 45.16  ? 354 MET B CA  1 
ATOM   5871 C  C   . MET B 1 354 ? 7.617   -5.691  60.063 1.00 45.04  ? 354 MET B C   1 
ATOM   5872 O  O   . MET B 1 354 ? 6.702   -5.960  59.283 1.00 43.28  ? 354 MET B O   1 
ATOM   5873 C  CB  . MET B 1 354 ? 6.980   -3.219  59.950 1.00 47.77  ? 354 MET B CB  1 
ATOM   5874 C  CG  . MET B 1 354 ? 7.965   -2.597  58.960 1.00 51.50  ? 354 MET B CG  1 
ATOM   5875 S  SD  . MET B 1 354 ? 7.217   -1.336  57.895 1.00 56.43  ? 354 MET B SD  1 
ATOM   5876 C  CE  . MET B 1 354 ? 7.205   0.082   59.027 1.00 52.97  ? 354 MET B CE  1 
ATOM   5877 N  N   . PHE B 1 355 ? 8.625   -6.549  60.324 1.00 40.89  ? 355 PHE B N   1 
ATOM   5878 C  CA  . PHE B 1 355 ? 8.746   -7.819  59.615 1.00 41.60  ? 355 PHE B CA  1 
ATOM   5879 C  C   . PHE B 1 355 ? 8.951   -9.030  60.481 1.00 48.51  ? 355 PHE B C   1 
ATOM   5880 O  O   . PHE B 1 355 ? 9.659   -8.970  61.486 1.00 48.47  ? 355 PHE B O   1 
ATOM   5881 C  CB  . PHE B 1 355 ? 9.861   -7.774  58.580 1.00 42.62  ? 355 PHE B CB  1 
ATOM   5882 C  CG  . PHE B 1 355 ? 9.773   -6.615  57.625 1.00 43.77  ? 355 PHE B CG  1 
ATOM   5883 C  CD1 . PHE B 1 355 ? 8.890   -6.645  56.547 1.00 48.46  ? 355 PHE B CD1 1 
ATOM   5884 C  CD2 . PHE B 1 355 ? 10.588  -5.500  57.784 1.00 44.34  ? 355 PHE B CD2 1 
ATOM   5885 C  CE1 . PHE B 1 355 ? 8.817   -5.570  55.651 1.00 48.22  ? 355 PHE B CE1 1 
ATOM   5886 C  CE2 . PHE B 1 355 ? 10.503  -4.425  56.901 1.00 46.71  ? 355 PHE B CE2 1 
ATOM   5887 C  CZ  . PHE B 1 355 ? 9.623   -4.469  55.834 1.00 45.56  ? 355 PHE B CZ  1 
ATOM   5888 N  N   . LEU B 1 356 ? 8.356   -10.156 60.043 1.00 46.76  ? 356 LEU B N   1 
ATOM   5889 C  CA  . LEU B 1 356 ? 8.459   -11.481 60.644 1.00 47.62  ? 356 LEU B CA  1 
ATOM   5890 C  C   . LEU B 1 356 ? 9.232   -12.399 59.682 1.00 51.77  ? 356 LEU B C   1 
ATOM   5891 O  O   . LEU B 1 356 ? 8.886   -12.544 58.503 1.00 49.65  ? 356 LEU B O   1 
ATOM   5892 C  CB  . LEU B 1 356 ? 7.057   -12.049 60.998 1.00 48.99  ? 356 LEU B CB  1 
ATOM   5893 C  CG  . LEU B 1 356 ? 6.928   -13.504 61.550 1.00 54.70  ? 356 LEU B CG  1 
ATOM   5894 C  CD1 . LEU B 1 356 ? 7.801   -13.739 62.777 1.00 54.63  ? 356 LEU B CD1 1 
ATOM   5895 C  CD2 . LEU B 1 356 ? 5.468   -13.845 61.871 1.00 55.74  ? 356 LEU B CD2 1 
ATOM   5896 N  N   . TRP B 1 357 ? 10.322  -12.957 60.201 1.00 50.83  ? 357 TRP B N   1 
ATOM   5897 C  CA  . TRP B 1 357 ? 11.208  -13.884 59.513 1.00 52.32  ? 357 TRP B CA  1 
ATOM   5898 C  C   . TRP B 1 357 ? 10.744  -15.294 59.906 1.00 60.05  ? 357 TRP B C   1 
ATOM   5899 O  O   . TRP B 1 357 ? 10.669  -15.620 61.102 1.00 59.54  ? 357 TRP B O   1 
ATOM   5900 C  CB  . TRP B 1 357 ? 12.653  -13.623 59.959 1.00 50.32  ? 357 TRP B CB  1 
ATOM   5901 C  CG  . TRP B 1 357 ? 13.752  -14.091 59.054 1.00 51.62  ? 357 TRP B CG  1 
ATOM   5902 C  CD1 . TRP B 1 357 ? 14.943  -14.632 59.441 1.00 55.22  ? 357 TRP B CD1 1 
ATOM   5903 C  CD2 . TRP B 1 357 ? 13.839  -13.909 57.631 1.00 51.35  ? 357 TRP B CD2 1 
ATOM   5904 N  NE1 . TRP B 1 357 ? 15.749  -14.844 58.348 1.00 55.00  ? 357 TRP B NE1 1 
ATOM   5905 C  CE2 . TRP B 1 357 ? 15.099  -14.404 57.222 1.00 56.00  ? 357 TRP B CE2 1 
ATOM   5906 C  CE3 . TRP B 1 357 ? 12.965  -13.392 56.653 1.00 51.74  ? 357 TRP B CE3 1 
ATOM   5907 C  CZ2 . TRP B 1 357 ? 15.507  -14.395 55.879 1.00 55.15  ? 357 TRP B CZ2 1 
ATOM   5908 C  CZ3 . TRP B 1 357 ? 13.363  -13.412 55.323 1.00 52.91  ? 357 TRP B CZ3 1 
ATOM   5909 C  CH2 . TRP B 1 357 ? 14.621  -13.901 54.951 1.00 54.15  ? 357 TRP B CH2 1 
ATOM   5910 N  N   . ILE B 1 358 ? 10.345  -16.089 58.887 1.00 59.18  ? 358 ILE B N   1 
ATOM   5911 C  CA  . ILE B 1 358 ? 9.829   -17.455 59.029 1.00 61.86  ? 358 ILE B CA  1 
ATOM   5912 C  C   . ILE B 1 358 ? 10.776  -18.445 58.312 1.00 67.33  ? 358 ILE B C   1 
ATOM   5913 O  O   . ILE B 1 358 ? 11.365  -18.104 57.287 1.00 65.64  ? 358 ILE B O   1 
ATOM   5914 C  CB  . ILE B 1 358 ? 8.351   -17.556 58.510 1.00 65.70  ? 358 ILE B CB  1 
ATOM   5915 C  CG1 . ILE B 1 358 ? 7.462   -16.439 59.075 1.00 64.80  ? 358 ILE B CG1 1 
ATOM   5916 C  CG2 . ILE B 1 358 ? 7.719   -18.921 58.793 1.00 68.63  ? 358 ILE B CG2 1 
ATOM   5917 C  CD1 . ILE B 1 358 ? 6.645   -15.739 58.030 1.00 71.08  ? 358 ILE B CD1 1 
ATOM   5918 N  N   . LYS B 1 359 ? 10.924  -19.659 58.867 1.00 66.00  ? 359 LYS B N   1 
ATOM   5919 C  CA  . LYS B 1 359 ? 11.758  -20.702 58.293 1.00 67.52  ? 359 LYS B CA  1 
ATOM   5920 C  C   . LYS B 1 359 ? 10.902  -21.951 58.110 1.00 76.01  ? 359 LYS B C   1 
ATOM   5921 O  O   . LYS B 1 359 ? 10.423  -22.512 59.103 1.00 77.60  ? 359 LYS B O   1 
ATOM   5922 C  CB  . LYS B 1 359 ? 12.965  -20.992 59.201 1.00 69.19  ? 359 LYS B CB  1 
ATOM   5923 C  CG  . LYS B 1 359 ? 14.035  -21.868 58.565 1.00 68.31  ? 359 LYS B CG  1 
ATOM   5924 C  CD  . LYS B 1 359 ? 14.938  -22.415 59.639 1.00 75.05  ? 359 LYS B CD  1 
ATOM   5925 C  CE  . LYS B 1 359 ? 15.968  -23.388 59.125 1.00 84.11  ? 359 LYS B CE  1 
ATOM   5926 N  NZ  . LYS B 1 359 ? 16.337  -24.388 60.172 1.00 89.79  ? 359 LYS B NZ  1 
ATOM   5927 N  N   . VAL B 1 360 ? 10.697  -22.375 56.840 1.00 73.43  ? 360 VAL B N   1 
ATOM   5928 C  CA  . VAL B 1 360 ? 9.923   -23.575 56.504 1.00 75.40  ? 360 VAL B CA  1 
ATOM   5929 C  C   . VAL B 1 360 ? 10.740  -24.815 56.816 1.00 81.16  ? 360 VAL B C   1 
ATOM   5930 O  O   . VAL B 1 360 ? 11.877  -24.956 56.345 1.00 79.94  ? 360 VAL B O   1 
ATOM   5931 C  CB  . VAL B 1 360 ? 9.300   -23.599 55.079 1.00 79.66  ? 360 VAL B CB  1 
ATOM   5932 C  CG1 . VAL B 1 360 ? 8.143   -22.616 54.968 1.00 77.66  ? 360 VAL B CG1 1 
ATOM   5933 C  CG2 . VAL B 1 360 ? 10.341  -23.347 53.988 1.00 78.98  ? 360 VAL B CG2 1 
ATOM   5934 N  N   . LYS B 1 361 ? 10.167  -25.685 57.659 1.00 80.46  ? 361 LYS B N   1 
ATOM   5935 C  CA  . LYS B 1 361 ? 10.791  -26.925 58.113 1.00 82.89  ? 361 LYS B CA  1 
ATOM   5936 C  C   . LYS B 1 361 ? 11.014  -27.942 57.000 1.00 90.82  ? 361 LYS B C   1 
ATOM   5937 O  O   . LYS B 1 361 ? 12.082  -28.557 56.949 1.00 91.82  ? 361 LYS B O   1 
ATOM   5938 C  CB  . LYS B 1 361 ? 9.993   -27.545 59.268 1.00 85.87  ? 361 LYS B CB  1 
ATOM   5939 C  CG  . LYS B 1 361 ? 10.169  -26.800 60.576 1.00 89.14  ? 361 LYS B CG  1 
ATOM   5940 C  CD  . LYS B 1 361 ? 9.620   -27.575 61.742 1.00 95.01  ? 361 LYS B CD  1 
ATOM   5941 C  CE  . LYS B 1 361 ? 9.653   -26.760 63.009 1.00 103.85 ? 361 LYS B CE  1 
ATOM   5942 N  NZ  . LYS B 1 361 ? 8.905   -27.415 64.112 1.00 113.93 ? 361 LYS B NZ  1 
ATOM   5943 N  N   . GLY B 1 362 ? 10.022  -28.090 56.121 1.00 89.42  ? 362 GLY B N   1 
ATOM   5944 C  CA  . GLY B 1 362 ? 10.026  -29.076 55.045 1.00 92.93  ? 362 GLY B CA  1 
ATOM   5945 C  C   . GLY B 1 362 ? 10.886  -28.788 53.842 1.00 98.11  ? 362 GLY B C   1 
ATOM   5946 O  O   . GLY B 1 362 ? 11.641  -29.657 53.396 1.00 99.70  ? 362 GLY B O   1 
ATOM   5947 N  N   . ILE B 1 363 ? 10.741  -27.584 53.290 1.00 94.00  ? 363 ILE B N   1 
ATOM   5948 C  CA  . ILE B 1 363 ? 11.440  -27.144 52.084 1.00 94.19  ? 363 ILE B CA  1 
ATOM   5949 C  C   . ILE B 1 363 ? 12.838  -26.595 52.408 1.00 98.42  ? 363 ILE B C   1 
ATOM   5950 O  O   . ILE B 1 363 ? 13.183  -26.433 53.581 1.00 96.94  ? 363 ILE B O   1 
ATOM   5951 C  CB  . ILE B 1 363 ? 10.552  -26.162 51.240 1.00 95.86  ? 363 ILE B CB  1 
ATOM   5952 C  CG1 . ILE B 1 363 ? 9.055   -26.561 51.291 1.00 98.09  ? 363 ILE B CG1 1 
ATOM   5953 C  CG2 . ILE B 1 363 ? 11.016  -26.081 49.768 1.00 97.53  ? 363 ILE B CG2 1 
ATOM   5954 C  CD1 . ILE B 1 363 ? 8.119   -25.460 51.718 1.00 104.35 ? 363 ILE B CD1 1 
ATOM   5955 N  N   . ASN B 1 364 ? 13.650  -26.376 51.354 1.00 96.95  ? 364 ASN B N   1 
ATOM   5956 C  CA  . ASN B 1 364 ? 15.009  -25.841 51.364 1.00 96.10  ? 364 ASN B CA  1 
ATOM   5957 C  C   . ASN B 1 364 ? 15.041  -24.557 50.534 1.00 99.12  ? 364 ASN B C   1 
ATOM   5958 O  O   . ASN B 1 364 ? 15.987  -23.783 50.665 1.00 96.48  ? 364 ASN B O   1 
ATOM   5959 C  CB  . ASN B 1 364 ? 15.996  -26.865 50.779 1.00 101.73 ? 364 ASN B CB  1 
ATOM   5960 C  CG  . ASN B 1 364 ? 16.215  -28.157 51.561 1.00 127.31 ? 364 ASN B CG  1 
ATOM   5961 O  OD1 . ASN B 1 364 ? 17.005  -29.009 51.145 1.00 124.20 ? 364 ASN B OD1 1 
ATOM   5962 N  ND2 . ASN B 1 364 ? 15.555  -28.352 52.703 1.00 117.49 ? 364 ASN B ND2 1 
ATOM   5963 N  N   . ASP B 1 365 ? 14.019  -24.353 49.662 1.00 98.40  ? 365 ASP B N   1 
ATOM   5964 C  CA  . ASP B 1 365 ? 13.825  -23.162 48.816 1.00 97.41  ? 365 ASP B CA  1 
ATOM   5965 C  C   . ASP B 1 365 ? 12.349  -22.757 48.746 1.00 103.93 ? 365 ASP B C   1 
ATOM   5966 O  O   . ASP B 1 365 ? 11.587  -23.259 47.918 1.00 105.00 ? 365 ASP B O   1 
ATOM   5967 C  CB  . ASP B 1 365 ? 14.432  -23.310 47.403 1.00 100.53 ? 365 ASP B CB  1 
ATOM   5968 C  CG  . ASP B 1 365 ? 14.241  -22.088 46.509 1.00 108.28 ? 365 ASP B CG  1 
ATOM   5969 O  OD1 . ASP B 1 365 ? 13.889  -22.269 45.319 1.00 109.18 ? 365 ASP B OD1 1 
ATOM   5970 O  OD2 . ASP B 1 365 ? 14.435  -20.948 47.003 1.00 113.07 ? 365 ASP B OD2 1 
ATOM   5971 N  N   . VAL B 1 366 ? 11.972  -21.811 49.605 1.00 101.33 ? 366 VAL B N   1 
ATOM   5972 C  CA  . VAL B 1 366 ? 10.617  -21.282 49.737 1.00 101.82 ? 366 VAL B CA  1 
ATOM   5973 C  C   . VAL B 1 366 ? 10.061  -20.581 48.479 1.00 108.18 ? 366 VAL B C   1 
ATOM   5974 O  O   . VAL B 1 366 ? 8.840   -20.414 48.369 1.00 108.06 ? 366 VAL B O   1 
ATOM   5975 C  CB  . VAL B 1 366 ? 10.486  -20.445 51.031 1.00 103.57 ? 366 VAL B CB  1 
ATOM   5976 C  CG1 . VAL B 1 366 ? 10.772  -18.964 50.784 1.00 100.36 ? 366 VAL B CG1 1 
ATOM   5977 C  CG2 . VAL B 1 366 ? 9.123   -20.654 51.674 1.00 104.23 ? 366 VAL B CG2 1 
ATOM   5978 N  N   . LYS B 1 367 ? 10.949  -20.197 47.522 1.00 106.41 ? 367 LYS B N   1 
ATOM   5979 C  CA  . LYS B 1 367 ? 10.532  -19.568 46.266 1.00 106.81 ? 367 LYS B CA  1 
ATOM   5980 C  C   . LYS B 1 367 ? 9.601   -20.508 45.502 1.00 117.60 ? 367 LYS B C   1 
ATOM   5981 O  O   . LYS B 1 367 ? 8.845   -20.049 44.662 1.00 116.67 ? 367 LYS B O   1 
ATOM   5982 C  CB  . LYS B 1 367 ? 11.730  -19.130 45.402 1.00 107.58 ? 367 LYS B CB  1 
ATOM   5983 C  CG  . LYS B 1 367 ? 11.563  -17.722 44.801 1.00 107.86 ? 367 LYS B CG  1 
ATOM   5984 C  CD  . LYS B 1 367 ? 10.984  -17.706 43.372 1.00 110.29 ? 367 LYS B CD  1 
ATOM   5985 C  CE  . LYS B 1 367 ? 9.981   -16.592 43.123 1.00 106.68 ? 367 LYS B CE  1 
ATOM   5986 N  NZ  . LYS B 1 367 ? 10.622  -15.271 42.886 1.00 106.45 ? 367 LYS B NZ  1 
ATOM   5987 N  N   . GLU B 1 368 ? 9.604   -21.811 45.863 1.00 120.35 ? 368 GLU B N   1 
ATOM   5988 C  CA  . GLU B 1 368 ? 8.727   -22.837 45.306 1.00 125.08 ? 368 GLU B CA  1 
ATOM   5989 C  C   . GLU B 1 368 ? 7.269   -22.535 45.667 1.00 130.11 ? 368 GLU B C   1 
ATOM   5990 O  O   . GLU B 1 368 ? 6.456   -22.329 44.763 1.00 130.42 ? 368 GLU B O   1 
ATOM   5991 C  CB  . GLU B 1 368 ? 9.134   -24.237 45.816 1.00 129.66 ? 368 GLU B CB  1 
ATOM   5992 C  CG  . GLU B 1 368 ? 10.004  -25.024 44.849 1.00 147.08 ? 368 GLU B CG  1 
ATOM   5993 C  CD  . GLU B 1 368 ? 11.446  -24.565 44.757 1.00 175.66 ? 368 GLU B CD  1 
ATOM   5994 O  OE1 . GLU B 1 368 ? 12.291  -25.122 45.495 1.00 180.25 ? 368 GLU B OE1 1 
ATOM   5995 O  OE2 . GLU B 1 368 ? 11.731  -23.654 43.947 1.00 169.50 ? 368 GLU B OE2 1 
ATOM   5996 N  N   . LEU B 1 369 ? 6.954   -22.465 46.984 1.00 126.62 ? 369 LEU B N   1 
ATOM   5997 C  CA  . LEU B 1 369 ? 5.607   -22.177 47.491 1.00 126.95 ? 369 LEU B CA  1 
ATOM   5998 C  C   . LEU B 1 369 ? 5.145   -20.778 47.074 1.00 129.48 ? 369 LEU B C   1 
ATOM   5999 O  O   . LEU B 1 369 ? 3.978   -20.596 46.729 1.00 130.11 ? 369 LEU B O   1 
ATOM   6000 C  CB  . LEU B 1 369 ? 5.551   -22.330 49.023 1.00 126.36 ? 369 LEU B CB  1 
ATOM   6001 C  CG  . LEU B 1 369 ? 4.253   -22.914 49.594 1.00 133.05 ? 369 LEU B CG  1 
ATOM   6002 C  CD1 . LEU B 1 369 ? 4.400   -24.392 49.879 1.00 136.02 ? 369 LEU B CD1 1 
ATOM   6003 C  CD2 . LEU B 1 369 ? 3.865   -22.218 50.877 1.00 133.80 ? 369 LEU B CD2 1 
ATOM   6004 N  N   . ILE B 1 370 ? 6.073   -19.811 47.062 1.00 123.80 ? 370 ILE B N   1 
ATOM   6005 C  CA  . ILE B 1 370 ? 5.780   -18.438 46.680 1.00 121.95 ? 370 ILE B CA  1 
ATOM   6006 C  C   . ILE B 1 370 ? 5.557   -18.268 45.159 1.00 128.64 ? 370 ILE B C   1 
ATOM   6007 O  O   . ILE B 1 370 ? 4.671   -17.500 44.771 1.00 128.28 ? 370 ILE B O   1 
ATOM   6008 C  CB  . ILE B 1 370 ? 6.767   -17.429 47.351 1.00 122.05 ? 370 ILE B CB  1 
ATOM   6009 C  CG1 . ILE B 1 370 ? 6.804   -17.608 48.896 1.00 121.85 ? 370 ILE B CG1 1 
ATOM   6010 C  CG2 . ILE B 1 370 ? 6.505   -15.956 46.965 1.00 120.49 ? 370 ILE B CG2 1 
ATOM   6011 C  CD1 . ILE B 1 370 ? 5.420   -17.451 49.705 1.00 128.59 ? 370 ILE B CD1 1 
ATOM   6012 N  N   . GLU B 1 371 ? 6.307   -19.020 44.304 1.00 127.29 ? 371 GLU B N   1 
ATOM   6013 C  CA  . GLU B 1 371 ? 6.151   -18.939 42.836 1.00 128.17 ? 371 GLU B CA  1 
ATOM   6014 C  C   . GLU B 1 371 ? 4.832   -19.517 42.331 1.00 132.52 ? 371 GLU B C   1 
ATOM   6015 O  O   . GLU B 1 371 ? 4.144   -18.863 41.544 1.00 131.92 ? 371 GLU B O   1 
ATOM   6016 C  CB  . GLU B 1 371 ? 7.384   -19.471 42.031 1.00 130.72 ? 371 GLU B CB  1 
ATOM   6017 C  CG  . GLU B 1 371 ? 7.519   -20.985 41.848 1.00 143.78 ? 371 GLU B CG  1 
ATOM   6018 C  CD  . GLU B 1 371 ? 8.737   -21.467 41.077 1.00 155.69 ? 371 GLU B CD  1 
ATOM   6019 O  OE1 . GLU B 1 371 ? 8.804   -21.228 39.850 1.00 134.26 ? 371 GLU B OE1 1 
ATOM   6020 O  OE2 . GLU B 1 371 ? 9.605   -22.126 41.695 1.00 149.71 ? 371 GLU B OE2 1 
ATOM   6021 N  N   . GLU B 1 372 ? 4.485   -20.735 42.783 1.00 129.77 ? 372 GLU B N   1 
ATOM   6022 C  CA  . GLU B 1 372 ? 3.264   -21.390 42.342 1.00 131.72 ? 372 GLU B CA  1 
ATOM   6023 C  C   . GLU B 1 372 ? 2.036   -21.082 43.189 1.00 132.80 ? 372 GLU B C   1 
ATOM   6024 O  O   . GLU B 1 372 ? 1.411   -20.046 42.978 1.00 130.82 ? 372 GLU B O   1 
ATOM   6025 C  CB  . GLU B 1 372 ? 3.455   -22.886 41.955 1.00 136.69 ? 372 GLU B CB  1 
ATOM   6026 C  CG  . GLU B 1 372 ? 4.132   -23.771 42.992 1.00 143.40 ? 372 GLU B CG  1 
ATOM   6027 C  CD  . GLU B 1 372 ? 4.763   -25.039 42.448 1.00 153.73 ? 372 GLU B CD  1 
ATOM   6028 O  OE1 . GLU B 1 372 ? 4.019   -25.909 41.941 1.00 146.05 ? 372 GLU B OE1 1 
ATOM   6029 O  OE2 . GLU B 1 372 ? 6.002   -25.175 42.559 1.00 137.99 ? 372 GLU B OE2 1 
ATOM   6030 N  N   . LYS B 1 373 ? 1.719   -21.941 44.159 1.00 129.02 ? 373 LYS B N   1 
ATOM   6031 C  CA  . LYS B 1 373 ? 0.539   -21.840 45.004 1.00 128.41 ? 373 LYS B CA  1 
ATOM   6032 C  C   . LYS B 1 373 ? 0.216   -20.487 45.654 1.00 127.01 ? 373 LYS B C   1 
ATOM   6033 O  O   . LYS B 1 373 ? -0.925  -20.045 45.524 1.00 127.49 ? 373 LYS B O   1 
ATOM   6034 C  CB  . LYS B 1 373 ? 0.425   -23.036 45.947 1.00 132.61 ? 373 LYS B CB  1 
ATOM   6035 C  CG  . LYS B 1 373 ? -0.254  -24.247 45.299 1.00 146.61 ? 373 LYS B CG  1 
ATOM   6036 C  CD  . LYS B 1 373 ? 0.719   -25.197 44.595 1.00 152.75 ? 373 LYS B CD  1 
ATOM   6037 C  CE  . LYS B 1 373 ? 0.011   -26.373 43.972 1.00 163.66 ? 373 LYS B CE  1 
ATOM   6038 N  NZ  . LYS B 1 373 ? -0.537  -27.302 44.996 1.00 173.47 ? 373 LYS B NZ  1 
ATOM   6039 N  N   . ALA B 1 374 ? 1.209   -19.789 46.257 1.00 117.95 ? 374 ALA B N   1 
ATOM   6040 C  CA  . ALA B 1 374 ? 0.999   -18.468 46.876 1.00 113.40 ? 374 ALA B CA  1 
ATOM   6041 C  C   . ALA B 1 374 ? 0.322   -17.489 45.923 1.00 114.06 ? 374 ALA B C   1 
ATOM   6042 O  O   . ALA B 1 374 ? -0.635  -16.816 46.305 1.00 112.89 ? 374 ALA B O   1 
ATOM   6043 C  CB  . ALA B 1 374 ? 2.317   -17.890 47.355 1.00 111.00 ? 374 ALA B CB  1 
ATOM   6044 N  N   . VAL B 1 375 ? 0.803   -17.458 44.671 1.00 109.61 ? 375 VAL B N   1 
ATOM   6045 C  CA  . VAL B 1 375 ? 0.297   -16.622 43.585 1.00 108.63 ? 375 VAL B CA  1 
ATOM   6046 C  C   . VAL B 1 375 ? -1.208  -16.885 43.365 1.00 114.50 ? 375 VAL B C   1 
ATOM   6047 O  O   . VAL B 1 375 ? -2.002  -15.948 43.502 1.00 113.35 ? 375 VAL B O   1 
ATOM   6048 C  CB  . VAL B 1 375 ? 1.165   -16.800 42.303 1.00 112.25 ? 375 VAL B CB  1 
ATOM   6049 C  CG1 . VAL B 1 375 ? 0.504   -16.188 41.071 1.00 112.76 ? 375 VAL B CG1 1 
ATOM   6050 C  CG2 . VAL B 1 375 ? 2.562   -16.226 42.507 1.00 108.92 ? 375 VAL B CG2 1 
ATOM   6051 N  N   . LYS B 1 376 ? -1.592  -18.168 43.101 1.00 113.27 ? 376 LYS B N   1 
ATOM   6052 C  CA  . LYS B 1 376 ? -2.978  -18.602 42.856 1.00 115.28 ? 376 LYS B CA  1 
ATOM   6053 C  C   . LYS B 1 376 ? -3.782  -18.977 44.112 1.00 118.39 ? 376 LYS B C   1 
ATOM   6054 O  O   . LYS B 1 376 ? -4.517  -19.969 44.134 1.00 120.63 ? 376 LYS B O   1 
ATOM   6055 C  CB  . LYS B 1 376 ? -3.076  -19.633 41.710 1.00 120.59 ? 376 LYS B CB  1 
ATOM   6056 C  CG  . LYS B 1 376 ? -3.425  -19.002 40.356 1.00 130.15 ? 376 LYS B CG  1 
ATOM   6057 C  CD  . LYS B 1 376 ? -2.217  -18.377 39.647 1.00 132.24 ? 376 LYS B CD  1 
ATOM   6058 C  CE  . LYS B 1 376 ? -2.555  -17.093 38.933 1.00 132.14 ? 376 LYS B CE  1 
ATOM   6059 N  NZ  . LYS B 1 376 ? -1.402  -16.597 38.141 1.00 134.05 ? 376 LYS B NZ  1 
ATOM   6060 N  N   . MET B 1 377 ? -3.633  -18.132 45.154 1.00 111.44 ? 377 MET B N   1 
ATOM   6061 C  CA  . MET B 1 377 ? -4.309  -18.162 46.452 1.00 110.69 ? 377 MET B CA  1 
ATOM   6062 C  C   . MET B 1 377 ? -4.536  -16.693 46.914 1.00 111.19 ? 377 MET B C   1 
ATOM   6063 O  O   . MET B 1 377 ? -5.052  -16.452 48.007 1.00 110.23 ? 377 MET B O   1 
ATOM   6064 C  CB  . MET B 1 377 ? -3.496  -18.957 47.490 1.00 112.22 ? 377 MET B CB  1 
ATOM   6065 C  CG  . MET B 1 377 ? -3.451  -20.464 47.256 1.00 118.61 ? 377 MET B CG  1 
ATOM   6066 S  SD  . MET B 1 377 ? -4.937  -21.349 47.737 1.00 126.29 ? 377 MET B SD  1 
ATOM   6067 C  CE  . MET B 1 377 ? -4.378  -23.023 47.570 1.00 125.84 ? 377 MET B CE  1 
ATOM   6068 N  N   . GLY B 1 378 ? -4.136  -15.742 46.065 1.00 106.09 ? 378 GLY B N   1 
ATOM   6069 C  CA  . GLY B 1 378 ? -4.299  -14.304 46.270 1.00 104.08 ? 378 GLY B CA  1 
ATOM   6070 C  C   . GLY B 1 378 ? -3.537  -13.654 47.412 1.00 106.19 ? 378 GLY B C   1 
ATOM   6071 O  O   . GLY B 1 378 ? -3.684  -12.444 47.632 1.00 103.36 ? 378 GLY B O   1 
ATOM   6072 N  N   . VAL B 1 379 ? -2.711  -14.448 48.139 1.00 103.71 ? 379 VAL B N   1 
ATOM   6073 C  CA  . VAL B 1 379 ? -1.897  -14.022 49.294 1.00 100.97 ? 379 VAL B CA  1 
ATOM   6074 C  C   . VAL B 1 379 ? -0.375  -14.111 49.027 1.00 102.50 ? 379 VAL B C   1 
ATOM   6075 O  O   . VAL B 1 379 ? 0.150   -15.214 48.839 1.00 103.55 ? 379 VAL B O   1 
ATOM   6076 C  CB  . VAL B 1 379 ? -2.326  -14.701 50.631 1.00 105.89 ? 379 VAL B CB  1 
ATOM   6077 C  CG1 . VAL B 1 379 ? -3.777  -14.386 50.958 1.00 107.44 ? 379 VAL B CG1 1 
ATOM   6078 C  CG2 . VAL B 1 379 ? -2.116  -16.214 50.601 1.00 107.82 ? 379 VAL B CG2 1 
ATOM   6079 N  N   . LEU B 1 380 ? 0.332   -12.961 48.990 1.00 95.43  ? 380 LEU B N   1 
ATOM   6080 C  CA  . LEU B 1 380 ? 1.770   -13.003 48.698 1.00 93.41  ? 380 LEU B CA  1 
ATOM   6081 C  C   . LEU B 1 380 ? 2.749   -12.376 49.691 1.00 92.68  ? 380 LEU B C   1 
ATOM   6082 O  O   . LEU B 1 380 ? 2.560   -11.243 50.133 1.00 90.75  ? 380 LEU B O   1 
ATOM   6083 C  CB  . LEU B 1 380 ? 2.083   -12.640 47.242 1.00 93.57  ? 380 LEU B CB  1 
ATOM   6084 C  CG  . LEU B 1 380 ? 1.843   -13.784 46.236 1.00 101.37 ? 380 LEU B CG  1 
ATOM   6085 C  CD1 . LEU B 1 380 ? 1.063   -13.310 45.022 1.00 102.50 ? 380 LEU B CD1 1 
ATOM   6086 C  CD2 . LEU B 1 380 ? 3.144   -14.459 45.842 1.00 104.06 ? 380 LEU B CD2 1 
ATOM   6087 N  N   . MET B 1 381 ? 3.816   -13.141 50.012 1.00 86.86  ? 381 MET B N   1 
ATOM   6088 C  CA  . MET B 1 381 ? 4.887   -12.788 50.946 1.00 83.24  ? 381 MET B CA  1 
ATOM   6089 C  C   . MET B 1 381 ? 6.291   -13.128 50.423 1.00 84.10  ? 381 MET B C   1 
ATOM   6090 O  O   . MET B 1 381 ? 6.516   -14.235 49.928 1.00 85.72  ? 381 MET B O   1 
ATOM   6091 C  CB  . MET B 1 381 ? 4.635   -13.419 52.316 1.00 86.15  ? 381 MET B CB  1 
ATOM   6092 C  CG  . MET B 1 381 ? 4.076   -14.822 52.253 1.00 92.65  ? 381 MET B CG  1 
ATOM   6093 S  SD  . MET B 1 381 ? 3.255   -15.287 53.796 1.00 98.09  ? 381 MET B SD  1 
ATOM   6094 C  CE  . MET B 1 381 ? 4.667   -15.613 54.837 1.00 93.73  ? 381 MET B CE  1 
ATOM   6095 N  N   . LEU B 1 382 ? 7.225   -12.161 50.555 1.00 76.47  ? 382 LEU B N   1 
ATOM   6096 C  CA  . LEU B 1 382 ? 8.633   -12.171 50.118 1.00 75.06  ? 382 LEU B CA  1 
ATOM   6097 C  C   . LEU B 1 382 ? 9.512   -13.410 50.420 1.00 82.01  ? 382 LEU B C   1 
ATOM   6098 O  O   . LEU B 1 382 ? 9.665   -13.789 51.586 1.00 82.70  ? 382 LEU B O   1 
ATOM   6099 C  CB  . LEU B 1 382 ? 9.329   -10.912 50.634 1.00 72.36  ? 382 LEU B CB  1 
ATOM   6100 C  CG  . LEU B 1 382 ? 9.967   -10.012 49.596 1.00 76.15  ? 382 LEU B CG  1 
ATOM   6101 C  CD1 . LEU B 1 382 ? 8.924   -9.305  48.742 1.00 76.20  ? 382 LEU B CD1 1 
ATOM   6102 C  CD2 . LEU B 1 382 ? 10.762  -8.939  50.257 1.00 77.00  ? 382 LEU B CD2 1 
ATOM   6103 N  N   . PRO B 1 383 ? 10.171  -14.008 49.395 1.00 79.68  ? 383 PRO B N   1 
ATOM   6104 C  CA  . PRO B 1 383 ? 11.070  -15.144 49.659 1.00 80.72  ? 383 PRO B CA  1 
ATOM   6105 C  C   . PRO B 1 383 ? 12.456  -14.636 50.081 1.00 82.14  ? 383 PRO B C   1 
ATOM   6106 O  O   . PRO B 1 383 ? 12.946  -13.628 49.549 1.00 80.60  ? 383 PRO B O   1 
ATOM   6107 C  CB  . PRO B 1 383 ? 11.115  -15.882 48.313 1.00 84.44  ? 383 PRO B CB  1 
ATOM   6108 C  CG  . PRO B 1 383 ? 10.220  -15.087 47.367 1.00 88.15  ? 383 PRO B CG  1 
ATOM   6109 C  CD  . PRO B 1 383 ? 10.127  -13.721 47.952 1.00 81.37  ? 383 PRO B CD  1 
ATOM   6110 N  N   . GLY B 1 384 ? 13.057  -15.346 51.034 1.00 77.34  ? 384 GLY B N   1 
ATOM   6111 C  CA  . GLY B 1 384 ? 14.336  -15.031 51.668 1.00 75.22  ? 384 GLY B CA  1 
ATOM   6112 C  C   . GLY B 1 384 ? 15.511  -14.653 50.798 1.00 75.99  ? 384 GLY B C   1 
ATOM   6113 O  O   . GLY B 1 384 ? 16.213  -13.686 51.096 1.00 72.53  ? 384 GLY B O   1 
ATOM   6114 N  N   . ASN B 1 385 ? 15.734  -15.428 49.732 1.00 74.50  ? 385 ASN B N   1 
ATOM   6115 C  CA  . ASN B 1 385 ? 16.831  -15.276 48.762 1.00 74.28  ? 385 ASN B CA  1 
ATOM   6116 C  C   . ASN B 1 385 ? 17.221  -13.840 48.381 1.00 71.38  ? 385 ASN B C   1 
ATOM   6117 O  O   . ASN B 1 385 ? 18.412  -13.556 48.233 1.00 70.34  ? 385 ASN B O   1 
ATOM   6118 C  CB  . ASN B 1 385 ? 16.657  -16.195 47.520 1.00 81.35  ? 385 ASN B CB  1 
ATOM   6119 C  CG  . ASN B 1 385 ? 15.234  -16.564 47.135 1.00 108.00 ? 385 ASN B CG  1 
ATOM   6120 O  OD1 . ASN B 1 385 ? 14.800  -17.726 47.265 1.00 99.98  ? 385 ASN B OD1 1 
ATOM   6121 N  ND2 . ASN B 1 385 ? 14.494  -15.590 46.616 1.00 99.07  ? 385 ASN B ND2 1 
ATOM   6122 N  N   . ALA B 1 386 ? 16.235  -12.933 48.304 1.00 63.59  ? 386 ALA B N   1 
ATOM   6123 C  CA  . ALA B 1 386 ? 16.446  -11.520 47.976 1.00 60.76  ? 386 ALA B CA  1 
ATOM   6124 C  C   . ALA B 1 386 ? 17.360  -10.802 48.971 1.00 60.80  ? 386 ALA B C   1 
ATOM   6125 O  O   . ALA B 1 386 ? 17.987  -9.795  48.632 1.00 57.58  ? 386 ALA B O   1 
ATOM   6126 C  CB  . ALA B 1 386 ? 15.106  -10.806 47.904 1.00 60.74  ? 386 ALA B CB  1 
ATOM   6127 N  N   . PHE B 1 387 ? 17.426  -11.352 50.197 1.00 57.80  ? 387 PHE B N   1 
ATOM   6128 C  CA  . PHE B 1 387 ? 18.167  -10.841 51.354 1.00 55.58  ? 387 PHE B CA  1 
ATOM   6129 C  C   . PHE B 1 387 ? 19.554  -11.426 51.530 1.00 57.72  ? 387 PHE B C   1 
ATOM   6130 O  O   . PHE B 1 387 ? 20.148  -11.281 52.602 1.00 57.14  ? 387 PHE B O   1 
ATOM   6131 C  CB  . PHE B 1 387 ? 17.327  -11.025 52.623 1.00 56.74  ? 387 PHE B CB  1 
ATOM   6132 C  CG  . PHE B 1 387 ? 16.052  -10.245 52.515 1.00 56.97  ? 387 PHE B CG  1 
ATOM   6133 C  CD1 . PHE B 1 387 ? 16.045  -8.867  52.717 1.00 59.15  ? 387 PHE B CD1 1 
ATOM   6134 C  CD2 . PHE B 1 387 ? 14.872  -10.867 52.136 1.00 59.99  ? 387 PHE B CD2 1 
ATOM   6135 C  CE1 . PHE B 1 387 ? 14.870  -8.132  52.588 1.00 59.74  ? 387 PHE B CE1 1 
ATOM   6136 C  CE2 . PHE B 1 387 ? 13.699  -10.134 51.992 1.00 62.82  ? 387 PHE B CE2 1 
ATOM   6137 C  CZ  . PHE B 1 387 ? 13.705  -8.770  52.218 1.00 59.89  ? 387 PHE B CZ  1 
ATOM   6138 N  N   . TYR B 1 388 ? 20.097  -12.029 50.469 1.00 53.01  ? 388 TYR B N   1 
ATOM   6139 C  CA  . TYR B 1 388 ? 21.417  -12.629 50.549 1.00 53.20  ? 388 TYR B CA  1 
ATOM   6140 C  C   . TYR B 1 388 ? 22.336  -12.197 49.411 1.00 59.54  ? 388 TYR B C   1 
ATOM   6141 O  O   . TYR B 1 388 ? 21.859  -11.969 48.291 1.00 60.02  ? 388 TYR B O   1 
ATOM   6142 C  CB  . TYR B 1 388 ? 21.301  -14.159 50.637 1.00 54.50  ? 388 TYR B CB  1 
ATOM   6143 C  CG  . TYR B 1 388 ? 20.680  -14.656 51.929 1.00 52.01  ? 388 TYR B CG  1 
ATOM   6144 C  CD1 . TYR B 1 388 ? 19.298  -14.798 52.054 1.00 52.80  ? 388 TYR B CD1 1 
ATOM   6145 C  CD2 . TYR B 1 388 ? 21.474  -15.037 53.006 1.00 51.61  ? 388 TYR B CD2 1 
ATOM   6146 C  CE1 . TYR B 1 388 ? 18.722  -15.265 53.234 1.00 51.77  ? 388 TYR B CE1 1 
ATOM   6147 C  CE2 . TYR B 1 388 ? 20.909  -15.508 54.187 1.00 52.07  ? 388 TYR B CE2 1 
ATOM   6148 C  CZ  . TYR B 1 388 ? 19.532  -15.628 54.296 1.00 55.94  ? 388 TYR B CZ  1 
ATOM   6149 O  OH  . TYR B 1 388 ? 18.970  -16.110 55.457 1.00 54.76  ? 388 TYR B OH  1 
ATOM   6150 N  N   . VAL B 1 389 ? 23.665  -12.080 49.719 1.00 56.35  ? 389 VAL B N   1 
ATOM   6151 C  CA  . VAL B 1 389 ? 24.769  -11.724 48.803 1.00 56.15  ? 389 VAL B CA  1 
ATOM   6152 C  C   . VAL B 1 389 ? 24.645  -12.615 47.558 1.00 62.70  ? 389 VAL B C   1 
ATOM   6153 O  O   . VAL B 1 389 ? 24.724  -12.114 46.440 1.00 62.79  ? 389 VAL B O   1 
ATOM   6154 C  CB  . VAL B 1 389 ? 26.167  -11.824 49.504 1.00 60.30  ? 389 VAL B CB  1 
ATOM   6155 C  CG1 . VAL B 1 389 ? 27.318  -11.665 48.521 1.00 60.66  ? 389 VAL B CG1 1 
ATOM   6156 C  CG2 . VAL B 1 389 ? 26.298  -10.801 50.629 1.00 58.28  ? 389 VAL B CG2 1 
ATOM   6157 N  N   . ASP B 1 390 ? 24.361  -13.912 47.762 1.00 61.01  ? 390 ASP B N   1 
ATOM   6158 C  CA  . ASP B 1 390 ? 24.109  -14.853 46.684 1.00 62.66  ? 390 ASP B CA  1 
ATOM   6159 C  C   . ASP B 1 390 ? 22.604  -15.185 46.686 1.00 69.02  ? 390 ASP B C   1 
ATOM   6160 O  O   . ASP B 1 390 ? 22.115  -15.966 47.512 1.00 69.72  ? 390 ASP B O   1 
ATOM   6161 C  CB  . ASP B 1 390 ? 25.018  -16.089 46.805 1.00 66.21  ? 390 ASP B CB  1 
ATOM   6162 C  CG  . ASP B 1 390 ? 24.663  -17.282 45.937 1.00 66.01  ? 390 ASP B CG  1 
ATOM   6163 O  OD1 . ASP B 1 390 ? 24.417  -17.086 44.725 1.00 63.16  ? 390 ASP B OD1 1 
ATOM   6164 O  OD2 . ASP B 1 390 ? 24.709  -18.418 46.453 1.00 70.66  ? 390 ASP B OD2 1 
ATOM   6165 N  N   . SER B 1 391 ? 21.873  -14.501 45.787 1.00 65.80  ? 391 SER B N   1 
ATOM   6166 C  CA  . SER B 1 391 ? 20.429  -14.612 45.547 1.00 65.32  ? 391 SER B CA  1 
ATOM   6167 C  C   . SER B 1 391 ? 20.033  -16.001 44.954 1.00 71.90  ? 391 SER B C   1 
ATOM   6168 O  O   . SER B 1 391 ? 19.021  -16.571 45.374 1.00 70.79  ? 391 SER B O   1 
ATOM   6169 C  CB  . SER B 1 391 ? 19.970  -13.459 44.646 1.00 66.16  ? 391 SER B CB  1 
ATOM   6170 O  OG  . SER B 1 391 ? 18.699  -13.630 44.038 1.00 73.45  ? 391 SER B OG  1 
ATOM   6171 N  N   . SER B 1 392 ? 20.845  -16.536 43.999 1.00 71.48  ? 392 SER B N   1 
ATOM   6172 C  CA  . SER B 1 392 ? 20.624  -17.815 43.297 1.00 74.86  ? 392 SER B CA  1 
ATOM   6173 C  C   . SER B 1 392 ? 20.484  -19.030 44.231 1.00 81.94  ? 392 SER B C   1 
ATOM   6174 O  O   . SER B 1 392 ? 19.813  -20.010 43.887 1.00 84.09  ? 392 SER B O   1 
ATOM   6175 C  CB  . SER B 1 392 ? 21.726  -18.062 42.267 1.00 80.21  ? 392 SER B CB  1 
ATOM   6176 O  OG  . SER B 1 392 ? 22.953  -18.472 42.853 1.00 89.74  ? 392 SER B OG  1 
ATOM   6177 N  N   . ALA B 1 393 ? 21.121  -18.955 45.407 1.00 77.78  ? 393 ALA B N   1 
ATOM   6178 C  CA  . ALA B 1 393 ? 21.106  -20.004 46.413 1.00 79.07  ? 393 ALA B CA  1 
ATOM   6179 C  C   . ALA B 1 393 ? 19.682  -20.320 46.882 1.00 82.55  ? 393 ALA B C   1 
ATOM   6180 O  O   . ALA B 1 393 ? 18.835  -19.422 46.926 1.00 80.43  ? 393 ALA B O   1 
ATOM   6181 C  CB  . ALA B 1 393 ? 21.962  -19.585 47.599 1.00 78.71  ? 393 ALA B CB  1 
ATOM   6182 N  N   . PRO B 1 394 ? 19.401  -21.585 47.247 1.00 81.05  ? 394 PRO B N   1 
ATOM   6183 C  CA  . PRO B 1 394 ? 18.066  -21.916 47.772 1.00 80.56  ? 394 PRO B CA  1 
ATOM   6184 C  C   . PRO B 1 394 ? 17.887  -21.366 49.188 1.00 80.22  ? 394 PRO B C   1 
ATOM   6185 O  O   . PRO B 1 394 ? 18.825  -21.412 49.992 1.00 78.43  ? 394 PRO B O   1 
ATOM   6186 C  CB  . PRO B 1 394 ? 18.059  -23.453 47.783 1.00 86.39  ? 394 PRO B CB  1 
ATOM   6187 C  CG  . PRO B 1 394 ? 19.334  -23.887 47.074 1.00 93.01  ? 394 PRO B CG  1 
ATOM   6188 C  CD  . PRO B 1 394 ? 20.286  -22.766 47.262 1.00 86.02  ? 394 PRO B CD  1 
ATOM   6189 N  N   . SER B 1 395 ? 16.697  -20.827 49.491 1.00 75.65  ? 395 SER B N   1 
ATOM   6190 C  CA  . SER B 1 395 ? 16.438  -20.277 50.825 1.00 74.04  ? 395 SER B CA  1 
ATOM   6191 C  C   . SER B 1 395 ? 15.078  -20.665 51.393 1.00 76.86  ? 395 SER B C   1 
ATOM   6192 O  O   . SER B 1 395 ? 14.054  -20.333 50.790 1.00 76.13  ? 395 SER B O   1 
ATOM   6193 C  CB  . SER B 1 395 ? 16.618  -18.762 50.855 1.00 75.80  ? 395 SER B CB  1 
ATOM   6194 O  OG  . SER B 1 395 ? 16.550  -18.295 52.194 1.00 85.26  ? 395 SER B OG  1 
ATOM   6195 N  N   . PRO B 1 396 ? 15.046  -21.316 52.580 1.00 72.80  ? 396 PRO B N   1 
ATOM   6196 C  CA  . PRO B 1 396 ? 13.756  -21.702 53.172 1.00 73.13  ? 396 PRO B CA  1 
ATOM   6197 C  C   . PRO B 1 396 ? 13.199  -20.627 54.113 1.00 75.20  ? 396 PRO B C   1 
ATOM   6198 O  O   . PRO B 1 396 ? 12.553  -20.954 55.109 1.00 76.01  ? 396 PRO B O   1 
ATOM   6199 C  CB  . PRO B 1 396 ? 14.108  -22.985 53.922 1.00 77.28  ? 396 PRO B CB  1 
ATOM   6200 C  CG  . PRO B 1 396 ? 15.569  -22.841 54.272 1.00 81.04  ? 396 PRO B CG  1 
ATOM   6201 C  CD  . PRO B 1 396 ? 16.174  -21.760 53.425 1.00 74.45  ? 396 PRO B CD  1 
ATOM   6202 N  N   . TYR B 1 397 ? 13.446  -19.343 53.792 1.00 68.50  ? 397 TYR B N   1 
ATOM   6203 C  CA  . TYR B 1 397 ? 13.054  -18.228 54.640 1.00 65.50  ? 397 TYR B CA  1 
ATOM   6204 C  C   . TYR B 1 397 ? 11.985  -17.300 54.099 1.00 66.51  ? 397 TYR B C   1 
ATOM   6205 O  O   . TYR B 1 397 ? 12.017  -16.920 52.937 1.00 65.72  ? 397 TYR B O   1 
ATOM   6206 C  CB  . TYR B 1 397 ? 14.289  -17.464 55.093 1.00 65.49  ? 397 TYR B CB  1 
ATOM   6207 C  CG  . TYR B 1 397 ? 15.051  -18.149 56.208 1.00 68.94  ? 397 TYR B CG  1 
ATOM   6208 C  CD1 . TYR B 1 397 ? 14.777  -17.863 57.546 1.00 70.41  ? 397 TYR B CD1 1 
ATOM   6209 C  CD2 . TYR B 1 397 ? 16.059  -19.065 55.929 1.00 71.63  ? 397 TYR B CD2 1 
ATOM   6210 C  CE1 . TYR B 1 397 ? 15.500  -18.461 58.577 1.00 72.79  ? 397 TYR B CE1 1 
ATOM   6211 C  CE2 . TYR B 1 397 ? 16.764  -19.696 56.951 1.00 74.19  ? 397 TYR B CE2 1 
ATOM   6212 C  CZ  . TYR B 1 397 ? 16.487  -19.386 58.275 1.00 83.23  ? 397 TYR B CZ  1 
ATOM   6213 O  OH  . TYR B 1 397 ? 17.192  -20.006 59.279 1.00 87.47  ? 397 TYR B OH  1 
ATOM   6214 N  N   . LEU B 1 398 ? 11.046  -16.911 54.959 1.00 62.27  ? 398 LEU B N   1 
ATOM   6215 C  CA  . LEU B 1 398 ? 9.946   -16.041 54.564 1.00 61.22  ? 398 LEU B CA  1 
ATOM   6216 C  C   . LEU B 1 398 ? 9.869   -14.715 55.292 1.00 64.34  ? 398 LEU B C   1 
ATOM   6217 O  O   . LEU B 1 398 ? 9.927   -14.682 56.528 1.00 65.25  ? 398 LEU B O   1 
ATOM   6218 C  CB  . LEU B 1 398 ? 8.611   -16.771 54.711 1.00 62.66  ? 398 LEU B CB  1 
ATOM   6219 C  CG  . LEU B 1 398 ? 8.204   -17.609 53.535 1.00 68.55  ? 398 LEU B CG  1 
ATOM   6220 C  CD1 . LEU B 1 398 ? 6.964   -18.363 53.853 1.00 70.52  ? 398 LEU B CD1 1 
ATOM   6221 C  CD2 . LEU B 1 398 ? 8.045   -16.767 52.266 1.00 69.26  ? 398 LEU B CD2 1 
ATOM   6222 N  N   . ARG B 1 399 ? 9.675   -13.625 54.534 1.00 57.55  ? 399 ARG B N   1 
ATOM   6223 C  CA  . ARG B 1 399 ? 9.520   -12.321 55.153 1.00 55.15  ? 399 ARG B CA  1 
ATOM   6224 C  C   . ARG B 1 399 ? 8.059   -11.919 55.095 1.00 60.49  ? 399 ARG B C   1 
ATOM   6225 O  O   . ARG B 1 399 ? 7.501   -11.802 54.009 1.00 61.65  ? 399 ARG B O   1 
ATOM   6226 C  CB  . ARG B 1 399 ? 10.422  -11.255 54.505 1.00 51.58  ? 399 ARG B CB  1 
ATOM   6227 C  CG  . ARG B 1 399 ? 10.560  -10.013 55.384 1.00 53.01  ? 399 ARG B CG  1 
ATOM   6228 C  CD  . ARG B 1 399 ? 11.134  -8.824  54.661 1.00 54.76  ? 399 ARG B CD  1 
ATOM   6229 N  NE  . ARG B 1 399 ? 10.153  -8.183  53.786 1.00 61.23  ? 399 ARG B NE  1 
ATOM   6230 C  CZ  . ARG B 1 399 ? 10.350  -7.023  53.171 1.00 66.47  ? 399 ARG B CZ  1 
ATOM   6231 N  NH1 . ARG B 1 399 ? 11.483  -6.358  53.342 1.00 37.42  ? 399 ARG B NH1 1 
ATOM   6232 N  NH2 . ARG B 1 399 ? 9.406   -6.508  52.396 1.00 61.26  ? 399 ARG B NH2 1 
ATOM   6233 N  N   . ALA B 1 400 ? 7.431   -11.729 56.254 1.00 56.74  ? 400 ALA B N   1 
ATOM   6234 C  CA  . ALA B 1 400 ? 6.044   -11.293 56.304 1.00 57.16  ? 400 ALA B CA  1 
ATOM   6235 C  C   . ALA B 1 400 ? 5.996   -9.940  56.993 1.00 60.57  ? 400 ALA B C   1 
ATOM   6236 O  O   . ALA B 1 400 ? 6.757   -9.702  57.930 1.00 58.98  ? 400 ALA B O   1 
ATOM   6237 C  CB  . ALA B 1 400 ? 5.201   -12.303 57.052 1.00 60.11  ? 400 ALA B CB  1 
ATOM   6238 N  N   . SER B 1 401 ? 5.148   -9.033  56.493 1.00 57.94  ? 401 SER B N   1 
ATOM   6239 C  CA  . SER B 1 401 ? 5.034   -7.688  57.043 1.00 56.48  ? 401 SER B CA  1 
ATOM   6240 C  C   . SER B 1 401 ? 3.750   -7.554  57.795 1.00 61.60  ? 401 SER B C   1 
ATOM   6241 O  O   . SER B 1 401 ? 2.673   -7.800  57.253 1.00 63.46  ? 401 SER B O   1 
ATOM   6242 C  CB  . SER B 1 401 ? 5.129   -6.626  55.946 1.00 59.07  ? 401 SER B CB  1 
ATOM   6243 O  OG  . SER B 1 401 ? 4.685   -5.345  56.369 1.00 66.66  ? 401 SER B OG  1 
ATOM   6244 N  N   . PHE B 1 402 ? 3.867   -7.155  59.046 1.00 56.72  ? 402 PHE B N   1 
ATOM   6245 C  CA  . PHE B 1 402 ? 2.725   -6.912  59.902 1.00 56.89  ? 402 PHE B CA  1 
ATOM   6246 C  C   . PHE B 1 402 ? 2.534   -5.393  60.005 1.00 62.71  ? 402 PHE B C   1 
ATOM   6247 O  O   . PHE B 1 402 ? 2.093   -4.894  61.033 1.00 63.24  ? 402 PHE B O   1 
ATOM   6248 C  CB  . PHE B 1 402 ? 2.930   -7.576  61.279 1.00 58.00  ? 402 PHE B CB  1 
ATOM   6249 C  CG  . PHE B 1 402 ? 4.210   -7.218  61.997 1.00 56.52  ? 402 PHE B CG  1 
ATOM   6250 C  CD1 . PHE B 1 402 ? 4.243   -6.178  62.915 1.00 58.23  ? 402 PHE B CD1 1 
ATOM   6251 C  CD2 . PHE B 1 402 ? 5.375   -7.941  61.778 1.00 56.47  ? 402 PHE B CD2 1 
ATOM   6252 C  CE1 . PHE B 1 402 ? 5.427   -5.851  63.579 1.00 57.78  ? 402 PHE B CE1 1 
ATOM   6253 C  CE2 . PHE B 1 402 ? 6.547   -7.629  62.461 1.00 57.61  ? 402 PHE B CE2 1 
ATOM   6254 C  CZ  . PHE B 1 402 ? 6.572   -6.580  63.344 1.00 55.33  ? 402 PHE B CZ  1 
ATOM   6255 N  N   . SER B 1 403 ? 2.888   -4.649  58.947 1.00 59.63  ? 403 SER B N   1 
ATOM   6256 C  CA  . SER B 1 403 ? 2.754   -3.189  58.986 1.00 59.17  ? 403 SER B CA  1 
ATOM   6257 C  C   . SER B 1 403 ? 1.345   -2.734  58.678 1.00 64.08  ? 403 SER B C   1 
ATOM   6258 O  O   . SER B 1 403 ? 0.819   -1.860  59.367 1.00 63.44  ? 403 SER B O   1 
ATOM   6259 C  CB  . SER B 1 403 ? 3.738   -2.510  58.034 1.00 61.20  ? 403 SER B CB  1 
ATOM   6260 O  OG  . SER B 1 403 ? 3.501   -2.855  56.679 1.00 71.03  ? 403 SER B OG  1 
ATOM   6261 N  N   . SER B 1 404 ? 0.732   -3.345  57.652 1.00 61.38  ? 404 SER B N   1 
ATOM   6262 C  CA  . SER B 1 404 ? -0.569  -2.939  57.149 1.00 61.71  ? 404 SER B CA  1 
ATOM   6263 C  C   . SER B 1 404 ? -1.619  -4.049  57.038 1.00 65.74  ? 404 SER B C   1 
ATOM   6264 O  O   . SER B 1 404 ? -2.781  -3.721  56.805 1.00 67.51  ? 404 SER B O   1 
ATOM   6265 C  CB  . SER B 1 404 ? -0.395  -2.240  55.798 1.00 64.79  ? 404 SER B CB  1 
ATOM   6266 O  OG  . SER B 1 404 ? 0.718   -1.358  55.759 1.00 71.26  ? 404 SER B OG  1 
ATOM   6267 N  N   . ALA B 1 405 ? -1.247  -5.338  57.180 1.00 60.46  ? 405 ALA B N   1 
ATOM   6268 C  CA  . ALA B 1 405 ? -2.237  -6.420  57.038 1.00 61.33  ? 405 ALA B CA  1 
ATOM   6269 C  C   . ALA B 1 405 ? -3.190  -6.555  58.222 1.00 63.86  ? 405 ALA B C   1 
ATOM   6270 O  O   . ALA B 1 405 ? -2.766  -6.418  59.367 1.00 63.54  ? 405 ALA B O   1 
ATOM   6271 C  CB  . ALA B 1 405 ? -1.548  -7.736  56.767 1.00 62.43  ? 405 ALA B CB  1 
ATOM   6272 N  N   . SER B 1 406 ? -4.474  -6.809  57.945 1.00 60.20  ? 406 SER B N   1 
ATOM   6273 C  CA  . SER B 1 406 ? -5.509  -6.977  58.969 1.00 61.54  ? 406 SER B CA  1 
ATOM   6274 C  C   . SER B 1 406 ? -5.352  -8.295  59.727 1.00 67.00  ? 406 SER B C   1 
ATOM   6275 O  O   . SER B 1 406 ? -5.168  -9.330  59.085 1.00 67.63  ? 406 SER B O   1 
ATOM   6276 C  CB  . SER B 1 406 ? -6.909  -6.907  58.350 1.00 66.58  ? 406 SER B CB  1 
ATOM   6277 O  OG  . SER B 1 406 ? -7.690  -8.083  58.532 1.00 71.38  ? 406 SER B OG  1 
ATOM   6278 N  N   . PRO B 1 407 ? -5.531  -8.311  61.073 1.00 64.44  ? 407 PRO B N   1 
ATOM   6279 C  CA  . PRO B 1 407 ? -5.467  -9.589  61.807 1.00 65.10  ? 407 PRO B CA  1 
ATOM   6280 C  C   . PRO B 1 407 ? -6.306  -10.683 61.149 1.00 69.56  ? 407 PRO B C   1 
ATOM   6281 O  O   . PRO B 1 407 ? -5.840  -11.812 61.015 1.00 69.63  ? 407 PRO B O   1 
ATOM   6282 C  CB  . PRO B 1 407 ? -6.003  -9.234  63.208 1.00 67.72  ? 407 PRO B CB  1 
ATOM   6283 C  CG  . PRO B 1 407 ? -6.518  -7.831  63.126 1.00 71.96  ? 407 PRO B CG  1 
ATOM   6284 C  CD  . PRO B 1 407 ? -5.782  -7.185  61.996 1.00 65.76  ? 407 PRO B CD  1 
ATOM   6285 N  N   . GLU B 1 408 ? -7.510  -10.323 60.676 1.00 66.69  ? 408 GLU B N   1 
ATOM   6286 C  CA  . GLU B 1 408 ? -8.413  -11.244 59.998 1.00 68.67  ? 408 GLU B CA  1 
ATOM   6287 C  C   . GLU B 1 408 ? -7.822  -11.733 58.687 1.00 69.12  ? 408 GLU B C   1 
ATOM   6288 O  O   . GLU B 1 408 ? -7.872  -12.931 58.430 1.00 69.17  ? 408 GLU B O   1 
ATOM   6289 C  CB  . GLU B 1 408 ? -9.816  -10.634 59.816 1.00 72.32  ? 408 GLU B CB  1 
ATOM   6290 C  CG  . GLU B 1 408 ? -10.605 -10.505 61.117 1.00 83.55  ? 408 GLU B CG  1 
ATOM   6291 C  CD  . GLU B 1 408 ? -11.381 -11.737 61.548 1.00 94.18  ? 408 GLU B CD  1 
ATOM   6292 O  OE1 . GLU B 1 408 ? -12.502 -11.947 61.031 1.00 86.40  ? 408 GLU B OE1 1 
ATOM   6293 O  OE2 . GLU B 1 408 ? -10.882 -12.478 62.424 1.00 81.17  ? 408 GLU B OE2 1 
ATOM   6294 N  N   . GLN B 1 409 ? -7.205  -10.839 57.893 1.00 63.90  ? 409 GLN B N   1 
ATOM   6295 C  CA  . GLN B 1 409 ? -6.583  -11.266 56.631 1.00 63.67  ? 409 GLN B CA  1 
ATOM   6296 C  C   . GLN B 1 409 ? -5.228  -11.956 56.814 1.00 68.72  ? 409 GLN B C   1 
ATOM   6297 O  O   . GLN B 1 409 ? -4.759  -12.650 55.908 1.00 68.85  ? 409 GLN B O   1 
ATOM   6298 C  CB  . GLN B 1 409 ? -6.615  -10.190 55.527 1.00 63.20  ? 409 GLN B CB  1 
ATOM   6299 C  CG  . GLN B 1 409 ? -5.606  -9.050  55.621 1.00 58.73  ? 409 GLN B CG  1 
ATOM   6300 C  CD  . GLN B 1 409 ? -6.075  -7.791  54.903 1.00 73.68  ? 409 GLN B CD  1 
ATOM   6301 O  OE1 . GLN B 1 409 ? -5.475  -6.707  55.005 1.00 72.08  ? 409 GLN B OE1 1 
ATOM   6302 N  NE2 . GLN B 1 409 ? -7.175  -7.878  54.183 1.00 63.93  ? 409 GLN B NE2 1 
ATOM   6303 N  N   . MET B 1 410 ? -4.639  -11.808 58.017 1.00 65.51  ? 410 MET B N   1 
ATOM   6304 C  CA  . MET B 1 410 ? -3.396  -12.462 58.421 1.00 64.76  ? 410 MET B CA  1 
ATOM   6305 C  C   . MET B 1 410 ? -3.706  -13.947 58.659 1.00 72.08  ? 410 MET B C   1 
ATOM   6306 O  O   . MET B 1 410 ? -2.934  -14.815 58.253 1.00 71.49  ? 410 MET B O   1 
ATOM   6307 C  CB  . MET B 1 410 ? -2.859  -11.839 59.719 1.00 65.43  ? 410 MET B CB  1 
ATOM   6308 C  CG  . MET B 1 410 ? -2.091  -10.565 59.523 1.00 66.29  ? 410 MET B CG  1 
ATOM   6309 S  SD  . MET B 1 410 ? -1.653  -9.892  61.138 1.00 69.27  ? 410 MET B SD  1 
ATOM   6310 C  CE  . MET B 1 410 ? -0.519  -8.668  60.667 1.00 63.14  ? 410 MET B CE  1 
ATOM   6311 N  N   . ASP B 1 411 ? -4.857  -14.220 59.307 1.00 71.97  ? 411 ASP B N   1 
ATOM   6312 C  CA  . ASP B 1 411 ? -5.352  -15.553 59.632 1.00 75.29  ? 411 ASP B CA  1 
ATOM   6313 C  C   . ASP B 1 411 ? -5.514  -16.405 58.364 1.00 82.48  ? 411 ASP B C   1 
ATOM   6314 O  O   . ASP B 1 411 ? -5.083  -17.554 58.358 1.00 82.02  ? 411 ASP B O   1 
ATOM   6315 C  CB  . ASP B 1 411 ? -6.673  -15.446 60.429 1.00 79.24  ? 411 ASP B CB  1 
ATOM   6316 C  CG  . ASP B 1 411 ? -7.319  -16.771 60.794 1.00 94.14  ? 411 ASP B CG  1 
ATOM   6317 O  OD1 . ASP B 1 411 ? -8.433  -17.050 60.287 1.00 97.23  ? 411 ASP B OD1 1 
ATOM   6318 O  OD2 . ASP B 1 411 ? -6.718  -17.525 61.589 1.00 101.03 ? 411 ASP B OD2 1 
ATOM   6319 N  N   . VAL B 1 412 ? -6.078  -15.821 57.286 1.00 82.27  ? 412 VAL B N   1 
ATOM   6320 C  CA  . VAL B 1 412 ? -6.306  -16.510 56.002 1.00 85.35  ? 412 VAL B CA  1 
ATOM   6321 C  C   . VAL B 1 412 ? -5.016  -16.700 55.197 1.00 88.24  ? 412 VAL B C   1 
ATOM   6322 O  O   . VAL B 1 412 ? -4.807  -17.785 54.643 1.00 89.62  ? 412 VAL B O   1 
ATOM   6323 C  CB  . VAL B 1 412 ? -7.465  -15.939 55.132 1.00 91.38  ? 412 VAL B CB  1 
ATOM   6324 C  CG1 . VAL B 1 412 ? -8.174  -17.059 54.369 1.00 94.55  ? 412 VAL B CG1 1 
ATOM   6325 C  CG2 . VAL B 1 412 ? -8.472  -15.153 55.971 1.00 91.96  ? 412 VAL B CG2 1 
ATOM   6326 N  N   . ALA B 1 413 ? -4.153  -15.655 55.142 1.00 81.55  ? 413 ALA B N   1 
ATOM   6327 C  CA  . ALA B 1 413 ? -2.856  -15.713 54.454 1.00 79.58  ? 413 ALA B CA  1 
ATOM   6328 C  C   . ALA B 1 413 ? -2.009  -16.864 55.036 1.00 84.79  ? 413 ALA B C   1 
ATOM   6329 O  O   . ALA B 1 413 ? -1.448  -17.665 54.279 1.00 85.44  ? 413 ALA B O   1 
ATOM   6330 C  CB  . ALA B 1 413 ? -2.122  -14.385 54.595 1.00 76.76  ? 413 ALA B CB  1 
ATOM   6331 N  N   . PHE B 1 414 ? -1.996  -16.976 56.386 1.00 80.85  ? 414 PHE B N   1 
ATOM   6332 C  CA  . PHE B 1 414 ? -1.286  -18.003 57.137 1.00 81.16  ? 414 PHE B CA  1 
ATOM   6333 C  C   . PHE B 1 414 ? -2.002  -19.345 57.100 1.00 90.71  ? 414 PHE B C   1 
ATOM   6334 O  O   . PHE B 1 414 ? -1.352  -20.381 57.248 1.00 91.38  ? 414 PHE B O   1 
ATOM   6335 C  CB  . PHE B 1 414 ? -1.028  -17.535 58.571 1.00 81.04  ? 414 PHE B CB  1 
ATOM   6336 C  CG  . PHE B 1 414 ? 0.241   -16.732 58.698 1.00 79.08  ? 414 PHE B CG  1 
ATOM   6337 C  CD1 . PHE B 1 414 ? 0.299   -15.418 58.262 1.00 80.18  ? 414 PHE B CD1 1 
ATOM   6338 C  CD2 . PHE B 1 414 ? 1.383   -17.292 59.246 1.00 80.14  ? 414 PHE B CD2 1 
ATOM   6339 C  CE1 . PHE B 1 414 ? 1.481   -14.684 58.364 1.00 78.59  ? 414 PHE B CE1 1 
ATOM   6340 C  CE2 . PHE B 1 414 ? 2.560   -16.555 59.356 1.00 80.30  ? 414 PHE B CE2 1 
ATOM   6341 C  CZ  . PHE B 1 414 ? 2.602   -15.256 58.919 1.00 76.58  ? 414 PHE B CZ  1 
ATOM   6342 N  N   . GLN B 1 415 ? -3.337  -19.333 56.888 1.00 90.96  ? 415 GLN B N   1 
ATOM   6343 C  CA  . GLN B 1 415 ? -4.142  -20.554 56.761 1.00 95.00  ? 415 GLN B CA  1 
ATOM   6344 C  C   . GLN B 1 415 ? -3.738  -21.205 55.442 1.00 100.06 ? 415 GLN B C   1 
ATOM   6345 O  O   . GLN B 1 415 ? -3.576  -22.428 55.386 1.00 102.70 ? 415 GLN B O   1 
ATOM   6346 C  CB  . GLN B 1 415 ? -5.651  -20.222 56.778 1.00 98.37  ? 415 GLN B CB  1 
ATOM   6347 C  CG  . GLN B 1 415 ? -6.603  -21.383 56.478 1.00 117.62 ? 415 GLN B CG  1 
ATOM   6348 C  CD  . GLN B 1 415 ? -8.026  -20.895 56.371 1.00 135.05 ? 415 GLN B CD  1 
ATOM   6349 O  OE1 . GLN B 1 415 ? -8.783  -20.886 57.347 1.00 128.33 ? 415 GLN B OE1 1 
ATOM   6350 N  NE2 . GLN B 1 415 ? -8.413  -20.446 55.183 1.00 128.05 ? 415 GLN B NE2 1 
ATOM   6351 N  N   . VAL B 1 416 ? -3.529  -20.367 54.405 1.00 93.77  ? 416 VAL B N   1 
ATOM   6352 C  CA  . VAL B 1 416 ? -3.110  -20.771 53.070 1.00 94.02  ? 416 VAL B CA  1 
ATOM   6353 C  C   . VAL B 1 416 ? -1.726  -21.429 53.136 1.00 95.75  ? 416 VAL B C   1 
ATOM   6354 O  O   . VAL B 1 416 ? -1.615  -22.629 52.872 1.00 97.50  ? 416 VAL B O   1 
ATOM   6355 C  CB  . VAL B 1 416 ? -3.192  -19.572 52.084 1.00 96.64  ? 416 VAL B CB  1 
ATOM   6356 C  CG1 . VAL B 1 416 ? -2.347  -19.797 50.838 1.00 96.30  ? 416 VAL B CG1 1 
ATOM   6357 C  CG2 . VAL B 1 416 ? -4.639  -19.284 51.699 1.00 98.59  ? 416 VAL B CG2 1 
ATOM   6358 N  N   . LEU B 1 417 ? -0.706  -20.665 53.570 1.00 88.98  ? 417 LEU B N   1 
ATOM   6359 C  CA  . LEU B 1 417 ? 0.687   -21.094 53.691 1.00 88.27  ? 417 LEU B CA  1 
ATOM   6360 C  C   . LEU B 1 417 ? 0.849   -22.443 54.353 1.00 96.26  ? 417 LEU B C   1 
ATOM   6361 O  O   . LEU B 1 417 ? 1.585   -23.282 53.841 1.00 96.53  ? 417 LEU B O   1 
ATOM   6362 C  CB  . LEU B 1 417 ? 1.479   -20.056 54.482 1.00 85.15  ? 417 LEU B CB  1 
ATOM   6363 C  CG  . LEU B 1 417 ? 2.967   -20.076 54.233 1.00 88.85  ? 417 LEU B CG  1 
ATOM   6364 C  CD1 . LEU B 1 417 ? 3.362   -18.908 53.400 1.00 87.36  ? 417 LEU B CD1 1 
ATOM   6365 C  CD2 . LEU B 1 417 ? 3.728   -20.037 55.511 1.00 89.95  ? 417 LEU B CD2 1 
ATOM   6366 N  N   . ALA B 1 418 ? 0.155   -22.637 55.491 1.00 96.01  ? 418 ALA B N   1 
ATOM   6367 C  CA  . ALA B 1 418 ? 0.181   -23.833 56.323 1.00 99.08  ? 418 ALA B CA  1 
ATOM   6368 C  C   . ALA B 1 418 ? -0.109  -25.102 55.562 1.00 109.68 ? 418 ALA B C   1 
ATOM   6369 O  O   . ALA B 1 418 ? 0.778   -25.954 55.482 1.00 110.65 ? 418 ALA B O   1 
ATOM   6370 C  CB  . ALA B 1 418 ? -0.779  -23.689 57.486 1.00 100.21 ? 418 ALA B CB  1 
ATOM   6371 N  N   . GLN B 1 419 ? -1.324  -25.233 54.979 1.00 110.48 ? 419 GLN B N   1 
ATOM   6372 C  CA  . GLN B 1 419 ? -1.664  -26.462 54.260 1.00 114.90 ? 419 GLN B CA  1 
ATOM   6373 C  C   . GLN B 1 419 ? -0.968  -26.633 52.915 1.00 118.32 ? 419 GLN B C   1 
ATOM   6374 O  O   . GLN B 1 419 ? -0.961  -27.744 52.380 1.00 121.52 ? 419 GLN B O   1 
ATOM   6375 C  CB  . GLN B 1 419 ? -3.167  -26.846 54.304 1.00 119.80 ? 419 GLN B CB  1 
ATOM   6376 C  CG  . GLN B 1 419 ? -4.067  -26.203 53.250 1.00 142.52 ? 419 GLN B CG  1 
ATOM   6377 C  CD  . GLN B 1 419 ? -4.745  -24.928 53.696 1.00 163.96 ? 419 GLN B CD  1 
ATOM   6378 O  OE1 . GLN B 1 419 ? -5.396  -24.856 54.748 1.00 160.77 ? 419 GLN B OE1 1 
ATOM   6379 N  NE2 . GLN B 1 419 ? -4.671  -23.911 52.856 1.00 154.71 ? 419 GLN B NE2 1 
ATOM   6380 N  N   . LEU B 1 420 ? -0.311  -25.566 52.415 1.00 110.48 ? 420 LEU B N   1 
ATOM   6381 C  CA  . LEU B 1 420 ? 0.475   -25.655 51.186 1.00 110.07 ? 420 LEU B CA  1 
ATOM   6382 C  C   . LEU B 1 420 ? 1.804   -26.357 51.476 1.00 113.22 ? 420 LEU B C   1 
ATOM   6383 O  O   . LEU B 1 420 ? 2.220   -27.209 50.684 1.00 114.83 ? 420 LEU B O   1 
ATOM   6384 C  CB  . LEU B 1 420 ? 0.701   -24.287 50.533 1.00 107.02 ? 420 LEU B CB  1 
ATOM   6385 C  CG  . LEU B 1 420 ? -0.511  -23.622 49.877 1.00 112.36 ? 420 LEU B CG  1 
ATOM   6386 C  CD1 . LEU B 1 420 ? -0.119  -22.299 49.251 1.00 109.53 ? 420 LEU B CD1 1 
ATOM   6387 C  CD2 . LEU B 1 420 ? -1.179  -24.531 48.849 1.00 118.34 ? 420 LEU B CD2 1 
ATOM   6388 N  N   . ILE B 1 421 ? 2.450   -26.027 52.633 1.00 106.68 ? 421 ILE B N   1 
ATOM   6389 C  CA  . ILE B 1 421 ? 3.696   -26.669 53.088 1.00 105.82 ? 421 ILE B CA  1 
ATOM   6390 C  C   . ILE B 1 421 ? 3.352   -28.138 53.372 1.00 111.81 ? 421 ILE B C   1 
ATOM   6391 O  O   . ILE B 1 421 ? 4.093   -29.028 52.953 1.00 113.24 ? 421 ILE B O   1 
ATOM   6392 C  CB  . ILE B 1 421 ? 4.363   -25.960 54.316 1.00 105.70 ? 421 ILE B CB  1 
ATOM   6393 C  CG1 . ILE B 1 421 ? 4.633   -24.469 54.048 1.00 102.06 ? 421 ILE B CG1 1 
ATOM   6394 C  CG2 . ILE B 1 421 ? 5.666   -26.671 54.745 1.00 107.00 ? 421 ILE B CG2 1 
ATOM   6395 C  CD1 . ILE B 1 421 ? 4.612   -23.620 55.295 1.00 105.56 ? 421 ILE B CD1 1 
ATOM   6396 N  N   . LYS B 1 422 ? 2.175   -28.375 54.007 1.00 108.40 ? 422 LYS B N   1 
ATOM   6397 C  CA  . LYS B 1 422 ? 1.629   -29.701 54.319 1.00 111.36 ? 422 LYS B CA  1 
ATOM   6398 C  C   . LYS B 1 422 ? 1.348   -30.514 53.049 1.00 118.33 ? 422 LYS B C   1 
ATOM   6399 O  O   . LYS B 1 422 ? 1.320   -31.744 53.110 1.00 120.95 ? 422 LYS B O   1 
ATOM   6400 C  CB  . LYS B 1 422 ? 0.362   -29.584 55.179 1.00 113.42 ? 422 LYS B CB  1 
ATOM   6401 C  CG  . LYS B 1 422 ? 0.358   -30.527 56.378 1.00 120.27 ? 422 LYS B CG  1 
ATOM   6402 C  CD  . LYS B 1 422 ? -0.301  -31.887 56.080 1.00 125.57 ? 422 LYS B CD  1 
ATOM   6403 C  CE  . LYS B 1 422 ? -0.521  -32.704 57.326 1.00 118.71 ? 422 LYS B CE  1 
ATOM   6404 N  NZ  . LYS B 1 422 ? -1.528  -32.070 58.216 1.00 118.91 ? 422 LYS B NZ  1 
ATOM   6405 N  N   . GLU B 1 423 ? 1.154   -29.819 51.902 1.00 114.35 ? 423 GLU B N   1 
ATOM   6406 C  CA  . GLU B 1 423 ? 0.929   -30.407 50.577 1.00 116.97 ? 423 GLU B CA  1 
ATOM   6407 C  C   . GLU B 1 423 ? 2.276   -30.636 49.878 1.00 120.43 ? 423 GLU B C   1 
ATOM   6408 O  O   . GLU B 1 423 ? 2.393   -31.537 49.040 1.00 123.34 ? 423 GLU B O   1 
ATOM   6409 C  CB  . GLU B 1 423 ? 0.026   -29.495 49.724 1.00 117.45 ? 423 GLU B CB  1 
ATOM   6410 C  CG  . GLU B 1 423 ? -1.184  -30.197 49.122 1.00 131.62 ? 423 GLU B CG  1 
ATOM   6411 C  CD  . GLU B 1 423 ? -2.236  -30.727 50.081 1.00 152.13 ? 423 GLU B CD  1 
ATOM   6412 O  OE1 . GLU B 1 423 ? -2.716  -29.949 50.938 1.00 137.18 ? 423 GLU B OE1 1 
ATOM   6413 O  OE2 . GLU B 1 423 ? -2.617  -31.913 49.942 1.00 151.62 ? 423 GLU B OE2 1 
ATOM   6414 N  N   . SER B 1 424 ? 3.294   -29.839 50.263 1.00 112.78 ? 424 SER B N   1 
ATOM   6415 C  CA  . SER B 1 424 ? 4.655   -29.880 49.726 1.00 111.66 ? 424 SER B CA  1 
ATOM   6416 C  C   . SER B 1 424 ? 5.608   -30.765 50.546 1.00 115.17 ? 424 SER B C   1 
ATOM   6417 O  O   . SER B 1 424 ? 6.754   -30.975 50.146 1.00 114.23 ? 424 SER B O   1 
ATOM   6418 C  CB  . SER B 1 424 ? 5.204   -28.464 49.616 1.00 111.65 ? 424 SER B CB  1 
ATOM   6419 O  OG  . SER B 1 424 ? 4.256   -27.641 48.960 1.00 121.61 ? 424 SER B OG  1 
ATOM   6420 N  N   . LEU B 1 425 ? 5.129   -31.290 51.678 1.00 112.78 ? 425 LEU B N   1 
ATOM   6421 C  CA  . LEU B 1 425 ? 5.896   -32.172 52.558 1.00 118.15 ? 425 LEU B CA  1 
ATOM   6422 C  C   . LEU B 1 425 ? 5.908   -33.634 52.053 1.00 142.37 ? 425 LEU B C   1 
ATOM   6423 O  O   . LEU B 1 425 ? 6.575   -34.482 52.690 1.00 143.75 ? 425 LEU B O   1 
ATOM   6424 C  CB  . LEU B 1 425 ? 5.336   -32.099 53.995 1.00 117.69 ? 425 LEU B CB  1 
ATOM   6425 C  CG  . LEU B 1 425 ? 5.849   -30.967 54.881 1.00 117.71 ? 425 LEU B CG  1 
ATOM   6426 C  CD1 . LEU B 1 425 ? 4.828   -30.607 55.930 1.00 117.31 ? 425 LEU B CD1 1 
ATOM   6427 C  CD2 . LEU B 1 425 ? 7.145   -31.348 55.558 1.00 119.70 ? 425 LEU B CD2 1 
HETATM 6428 N  N3  . 09M C 2 .   ? 22.378  28.180  39.554 1.00 59.88  ? 440 09M A N3  1 
HETATM 6429 C  C4  . 09M C 2 .   ? 20.229  23.906  36.122 1.00 41.52  ? 440 09M A C4  1 
HETATM 6430 N  N2  . 09M C 2 .   ? 20.847  26.013  37.189 1.00 46.87  ? 440 09M A N2  1 
HETATM 6431 C  C7  . 09M C 2 .   ? 22.075  27.691  38.362 1.00 57.14  ? 440 09M A C7  1 
HETATM 6432 C  C6  . 09M C 2 .   ? 21.091  26.665  38.315 1.00 51.76  ? 440 09M A C6  1 
HETATM 6433 C  C9  . 09M C 2 .   ? 20.801  26.875  40.663 1.00 53.80  ? 440 09M A C9  1 
HETATM 6434 C  C13 . 09M C 2 .   ? 20.576  27.055  43.045 1.00 53.07  ? 440 09M A C13 1 
HETATM 6435 C  C8  . 09M C 2 .   ? 20.478  26.302  39.420 1.00 52.34  ? 440 09M A C8  1 
HETATM 6436 C  C16 . 09M C 2 .   ? 21.064  23.317  33.953 1.00 36.74  ? 440 09M A C16 1 
HETATM 6437 O  O7  . 09M C 2 .   ? 16.730  23.026  38.758 1.00 41.18  ? 440 09M A O7  1 
HETATM 6438 P  P   . 09M C 2 .   ? 16.890  21.684  38.105 1.00 41.21  ? 440 09M A P   1 
HETATM 6439 O  O1  . 09M C 2 .   ? 17.216  20.592  39.079 1.00 40.41  ? 440 09M A O1  1 
HETATM 6440 O  O2  . 09M C 2 .   ? 15.761  21.348  37.174 1.00 43.68  ? 440 09M A O2  1 
HETATM 6441 O  O3  . 09M C 2 .   ? 18.159  21.782  37.136 1.00 36.12  ? 440 09M A O3  1 
HETATM 6442 C  C1  . 09M C 2 .   ? 19.339  22.104  37.614 1.00 35.09  ? 440 09M A C1  1 
HETATM 6443 C  C2  . 09M C 2 .   ? 20.007  22.553  36.350 1.00 38.42  ? 440 09M A C2  1 
HETATM 6444 C  C3  . 09M C 2 .   ? 20.354  21.668  35.365 1.00 37.59  ? 440 09M A C3  1 
HETATM 6445 N  N1  . 09M C 2 .   ? 20.868  22.019  34.188 1.00 36.71  ? 440 09M A N1  1 
HETATM 6446 C  C17 . 09M C 2 .   ? 21.510  23.713  32.582 1.00 35.93  ? 440 09M A C17 1 
HETATM 6447 C  C15 . 09M C 2 .   ? 20.784  24.287  34.917 1.00 39.19  ? 440 09M A C15 1 
HETATM 6448 O  O6  . 09M C 2 .   ? 21.112  25.555  34.700 1.00 38.86  ? 440 09M A O6  1 
HETATM 6449 C  C5  . 09M C 2 .   ? 19.856  24.957  37.141 1.00 44.48  ? 440 09M A C5  1 
HETATM 6450 C  C14 . 09M C 2 .   ? 20.192  26.497  41.853 1.00 52.78  ? 440 09M A C14 1 
HETATM 6451 C  C12 . 09M C 2 .   ? 21.556  28.006  43.081 1.00 53.50  ? 440 09M A C12 1 
HETATM 6452 C  C11 . 09M C 2 .   ? 22.177  28.418  41.923 1.00 54.35  ? 440 09M A C11 1 
HETATM 6453 C  C10 . 09M C 2 .   ? 21.800  27.849  40.720 1.00 56.45  ? 440 09M A C10 1 
HETATM 6454 O  O5  . 09M C 2 .   ? 23.454  29.055  39.614 1.00 62.98  ? 440 09M A O5  1 
HETATM 6455 O  O4  . 09M C 2 .   ? 22.578  28.160  37.365 1.00 58.94  ? 440 09M A O4  1 
HETATM 6456 CL CL  . CL  D 3 .   ? 41.512  6.652   20.412 1.00 35.53  ? 441 CL  A CL  1 
HETATM 6457 N  N3  . 09M E 2 .   ? 10.865  -2.635  51.307 1.00 76.89  ? 440 09M B N3  1 
HETATM 6458 C  C4  . 09M E 2 .   ? 14.609  0.951   54.382 1.00 51.42  ? 440 09M B C4  1 
HETATM 6459 N  N2  . 09M E 2 .   ? 12.766  -0.240  53.338 1.00 63.86  ? 440 09M B N2  1 
HETATM 6460 C  C7  . 09M E 2 .   ? 11.682  -2.168  52.356 1.00 73.89  ? 440 09M B C7  1 
HETATM 6461 C  C6  . 09M E 2 .   ? 11.882  -0.703  52.441 1.00 70.70  ? 440 09M B C6  1 
HETATM 6462 C  C9  . 09M E 2 .   ? 10.358  -0.387  50.509 1.00 75.30  ? 440 09M B C9  1 
HETATM 6463 C  C13 . 09M E 2 .   ? 8.838   -0.063  48.653 1.00 76.89  ? 440 09M B C13 1 
HETATM 6464 C  C8  . 09M E 2 .   ? 11.217  0.125   51.546 1.00 73.18  ? 440 09M B C8  1 
HETATM 6465 C  C16 . 09M E 2 .   ? 16.137  -0.297  55.779 1.00 50.55  ? 440 09M B C16 1 
HETATM 6466 O  O7  . 09M E 2 .   ? 12.580  5.145   53.010 1.00 40.71  ? 440 09M B O7  1 
HETATM 6467 P  P   . 09M E 2 .   ? 14.046  5.432   53.268 1.00 43.05  ? 440 09M B P   1 
HETATM 6468 O  O1  . 09M E 2 .   ? 14.266  6.585   54.221 1.00 43.59  ? 440 09M B O1  1 
HETATM 6469 O  O2  . 09M E 2 .   ? 14.838  5.598   51.988 1.00 44.88  ? 440 09M B O2  1 
HETATM 6470 O  O3  . 09M E 2 .   ? 14.620  4.129   54.048 1.00 42.78  ? 440 09M B O3  1 
HETATM 6471 C  C1  . 09M E 2 .   ? 15.464  3.147   53.384 1.00 45.22  ? 440 09M B C1  1 
HETATM 6472 C  C2  . 09M E 2 .   ? 15.625  1.902   54.211 1.00 47.95  ? 440 09M B C2  1 
HETATM 6473 C  C3  . 09M E 2 .   ? 16.830  1.678   54.835 1.00 48.22  ? 440 09M B C3  1 
HETATM 6474 N  N1  . 09M E 2 .   ? 17.097  0.619   55.604 1.00 48.65  ? 440 09M B N1  1 
HETATM 6475 C  C17 . 09M E 2 .   ? 16.460  -1.478  56.644 1.00 51.42  ? 440 09M B C17 1 
HETATM 6476 C  C15 . 09M E 2 .   ? 14.873  -0.170  55.186 1.00 51.77  ? 440 09M B C15 1 
HETATM 6477 O  O6  . 09M E 2 .   ? 13.935  -1.144  55.407 1.00 53.38  ? 440 09M B O6  1 
HETATM 6478 C  C5  . 09M E 2 .   ? 13.263  1.077   53.701 1.00 57.16  ? 440 09M B C5  1 
HETATM 6479 C  C14 . 09M E 2 .   ? 9.667   0.457   49.632 1.00 75.10  ? 440 09M B C14 1 
HETATM 6480 C  C12 . 09M E 2 .   ? 8.689   -1.430  48.516 1.00 78.16  ? 440 09M B C12 1 
HETATM 6481 C  C11 . 09M E 2 .   ? 9.362   -2.296  49.364 1.00 78.90  ? 440 09M B C11 1 
HETATM 6482 C  C10 . 09M E 2 .   ? 10.184  -1.775  50.364 1.00 77.85  ? 440 09M B C10 1 
HETATM 6483 O  O5  . 09M E 2 .   ? 10.770  -4.022  51.166 1.00 77.08  ? 440 09M B O5  1 
HETATM 6484 O  O4  . 09M E 2 .   ? 12.170  -2.957  53.160 1.00 72.91  ? 440 09M B O4  1 
HETATM 6485 CL CL  . CL  F 3 .   ? 44.138  -8.170  51.942 1.00 60.83  ? 441 CL  B CL  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 1.2842 0.5598 0.4492 -0.2096 -0.0202 0.0013  1   MET A N   
2    C CA  . MET A 1   ? 1.2541 0.5523 0.4644 -0.1864 -0.0114 -0.0037 1   MET A CA  
3    C C   . MET A 1   ? 1.2950 0.5929 0.5206 -0.1737 -0.0038 -0.0128 1   MET A C   
4    O O   . MET A 1   ? 1.2912 0.5922 0.5120 -0.1794 -0.0129 -0.0110 1   MET A O   
5    C CB  . MET A 1   ? 1.2450 0.5848 0.4959 -0.1792 -0.0252 0.0067  1   MET A CB  
6    C CG  . MET A 1   ? 1.2944 0.6376 0.5455 -0.1814 -0.0266 0.0129  1   MET A CG  
7    S SD  . MET A 1   ? 1.3079 0.6740 0.6045 -0.1590 -0.0178 0.0102  1   MET A SD  
8    C CE  . MET A 1   ? 1.2762 0.6155 0.5663 -0.1490 0.0062  -0.0060 1   MET A CE  
9    N N   . ASN A 2   ? 1.2266 0.5218 0.4717 -0.1567 0.0123  -0.0219 2   ASN A N   
10   C CA  . ASN A 2   ? 1.1950 0.4911 0.4587 -0.1425 0.0197  -0.0301 2   ASN A CA  
11   C C   . ASN A 2   ? 1.1391 0.4698 0.4515 -0.1254 0.0167  -0.0286 2   ASN A C   
12   O O   . ASN A 2   ? 1.1292 0.4650 0.4606 -0.1148 0.0262  -0.0315 2   ASN A O   
13   C CB  . ASN A 2   ? 1.2751 0.5398 0.5230 -0.1364 0.0405  -0.0413 2   ASN A CB  
14   C CG  . ASN A 2   ? 1.6283 0.8957 0.8987 -0.1206 0.0469  -0.0485 2   ASN A CG  
15   O OD1 . ASN A 2   ? 1.5807 0.8486 0.8480 -0.1226 0.0390  -0.0483 2   ASN A OD1 
16   N ND2 . ASN A 2   ? 1.4957 0.7660 0.7903 -0.1050 0.0607  -0.0542 2   ASN A ND2 
17   N N   . TYR A 3   ? 1.0126 0.3661 0.3437 -0.1237 0.0037  -0.0240 3   TYR A N   
18   C CA  . TYR A 3   ? 0.9403 0.3249 0.3141 -0.1090 -0.0004 -0.0222 3   TYR A CA  
19   C C   . TYR A 3   ? 0.9478 0.3299 0.3413 -0.0932 0.0097  -0.0313 3   TYR A C   
20   O O   . TYR A 3   ? 0.9134 0.3131 0.3388 -0.0801 0.0122  -0.0322 3   TYR A O   
21   C CB  . TYR A 3   ? 0.9284 0.3368 0.3121 -0.1144 -0.0170 -0.0132 3   TYR A CB  
22   C CG  . TYR A 3   ? 0.9628 0.3802 0.3375 -0.1265 -0.0274 -0.0025 3   TYR A CG  
23   C CD1 . TYR A 3   ? 1.0192 0.4264 0.3632 -0.1448 -0.0363 0.0030  3   TYR A CD1 
24   C CD2 . TYR A 3   ? 0.9682 0.4017 0.3627 -0.1203 -0.0282 0.0023  3   TYR A CD2 
25   C CE1 . TYR A 3   ? 1.0267 0.4424 0.3626 -0.1565 -0.0472 0.0140  3   TYR A CE1 
26   C CE2 . TYR A 3   ? 0.9915 0.4328 0.3782 -0.1308 -0.0384 0.0130  3   TYR A CE2 
27   C CZ  . TYR A 3   ? 1.0524 0.4851 0.4102 -0.1489 -0.0482 0.0190  3   TYR A CZ  
28   O OH  . TYR A 3   ? 1.0166 0.4572 0.3670 -0.1597 -0.0593 0.0305  3   TYR A OH  
29   N N   . ALA A 4   ? 0.9052 0.2630 0.2775 -0.0951 0.0161  -0.0380 4   ALA A N   
30   C CA  . ALA A 4   ? 0.8849 0.2365 0.2717 -0.0812 0.0252  -0.0460 4   ALA A CA  
31   C C   . ALA A 4   ? 0.9291 0.2854 0.3403 -0.0676 0.0373  -0.0501 4   ALA A C   
32   O O   . ALA A 4   ? 0.9162 0.2853 0.3570 -0.0541 0.0384  -0.0526 4   ALA A O   
33   C CB  . ALA A 4   ? 0.9209 0.2388 0.2738 -0.0869 0.0327  -0.0520 4   ALA A CB  
34   N N   . ARG A 5   ? 0.8746 0.2214 0.2736 -0.0722 0.0455  -0.0499 5   ARG A N   
35   C CA  . ARG A 5   ? 0.8603 0.2105 0.2799 -0.0614 0.0581  -0.0534 5   ARG A CA  
36   C C   . ARG A 5   ? 0.8794 0.2603 0.3365 -0.0526 0.0516  -0.0495 5   ARG A C   
37   O O   . ARG A 5   ? 0.8524 0.2413 0.3360 -0.0404 0.0587  -0.0529 5   ARG A O   
38   C CB  . ARG A 5   ? 0.9010 0.2294 0.2939 -0.0695 0.0702  -0.0550 5   ARG A CB  
39   C CG  . ARG A 5   ? 1.0440 0.3769 0.4221 -0.0824 0.0617  -0.0475 5   ARG A CG  
40   C CD  . ARG A 5   ? 1.1670 0.4786 0.5233 -0.0880 0.0758  -0.0500 5   ARG A CD  
41   N NE  . ARG A 5   ? 1.2209 0.5504 0.6027 -0.0816 0.0787  -0.0479 5   ARG A NE  
42   C CZ  . ARG A 5   ? 1.3475 0.6756 0.7164 -0.0908 0.0764  -0.0427 5   ARG A CZ  
43   N NH1 . ARG A 5   ? 1.1513 0.4951 0.5440 -0.0846 0.0791  -0.0410 5   ARG A NH1 
44   N NH2 . ARG A 5   ? 1.1074 0.4182 0.4389 -0.1070 0.0705  -0.0387 5   ARG A NH2 
45   N N   . PHE A 6   ? 0.8430 0.2409 0.3025 -0.0587 0.0380  -0.0418 6   PHE A N   
46   C CA  . PHE A 6   ? 0.8143 0.2389 0.3053 -0.0514 0.0315  -0.0373 6   PHE A CA  
47   C C   . PHE A 6   ? 0.8533 0.2943 0.3688 -0.0422 0.0241  -0.0376 6   PHE A C   
48   O O   . PHE A 6   ? 0.8083 0.2678 0.3507 -0.0340 0.0209  -0.0358 6   PHE A O   
49   C CB  . PHE A 6   ? 0.8338 0.2680 0.3164 -0.0609 0.0209  -0.0284 6   PHE A CB  
50   C CG  . PHE A 6   ? 0.8755 0.2925 0.3306 -0.0719 0.0261  -0.0268 6   PHE A CG  
51   C CD1 . PHE A 6   ? 0.9209 0.3202 0.3410 -0.0864 0.0227  -0.0248 6   PHE A CD1 
52   C CD2 . PHE A 6   ? 0.8946 0.3122 0.3571 -0.0691 0.0338  -0.0269 6   PHE A CD2 
53   C CE1 . PHE A 6   ? 0.9609 0.3425 0.3528 -0.0978 0.0267  -0.0230 6   PHE A CE1 
54   C CE2 . PHE A 6   ? 0.9488 0.3492 0.3838 -0.0801 0.0384  -0.0252 6   PHE A CE2 
55   C CZ  . PHE A 6   ? 0.9485 0.3307 0.3480 -0.0944 0.0346  -0.0232 6   PHE A CZ  
56   N N   . ILE A 7   ? 0.8429 0.2742 0.3464 -0.0441 0.0218  -0.0403 7   ILE A N   
57   C CA  . ILE A 7   ? 0.8249 0.2664 0.3441 -0.0377 0.0147  -0.0410 7   ILE A CA  
58   C C   . ILE A 7   ? 0.8365 0.2730 0.3720 -0.0257 0.0220  -0.0477 7   ILE A C   
59   O O   . ILE A 7   ? 0.8382 0.2574 0.3653 -0.0237 0.0336  -0.0528 7   ILE A O   
60   C CB  . ILE A 7   ? 0.8851 0.3202 0.3807 -0.0488 0.0062  -0.0384 7   ILE A CB  
61   C CG1 . ILE A 7   ? 0.8853 0.3420 0.3879 -0.0540 -0.0059 -0.0296 7   ILE A CG1 
62   C CG2 . ILE A 7   ? 0.9015 0.3283 0.3950 -0.0455 0.0048  -0.0428 7   ILE A CG2 
63   C CD1 . ILE A 7   ? 1.1087 0.5616 0.5884 -0.0673 -0.0141 -0.0253 7   ILE A CD1 
64   N N   . THR A 8   ? 0.7422 0.1944 0.3018 -0.0176 0.0151  -0.0471 8   THR A N   
65   C CA  . THR A 8   ? 0.7098 0.1615 0.2880 -0.0066 0.0177  -0.0515 8   THR A CA  
66   C C   . THR A 8   ? 0.7288 0.1667 0.2908 -0.0087 0.0147  -0.0539 8   THR A C   
67   O O   . THR A 8   ? 0.6880 0.1281 0.2371 -0.0164 0.0061  -0.0509 8   THR A O   
68   C CB  . THR A 8   ? 0.8103 0.2825 0.4158 0.0002  0.0097  -0.0490 8   THR A CB  
69   O OG1 . THR A 8   ? 0.8378 0.3153 0.4381 -0.0034 -0.0006 -0.0463 8   THR A OG1 
70   C CG2 . THR A 8   ? 0.7705 0.2568 0.3895 0.0007  0.0102  -0.0454 8   THR A CG2 
71   N N   . ALA A 9   ? 0.7131 0.1377 0.2775 -0.0014 0.0216  -0.0589 9   ALA A N   
72   C CA  . ALA A 9   ? 0.7213 0.1284 0.2698 -0.0017 0.0203  -0.0619 9   ALA A CA  
73   C C   . ALA A 9   ? 0.7554 0.1716 0.3054 -0.0042 0.0074  -0.0593 9   ALA A C   
74   O O   . ALA A 9   ? 0.7533 0.1580 0.2794 -0.0127 0.0035  -0.0591 9   ALA A O   
75   C CB  . ALA A 9   ? 0.7339 0.1329 0.2971 0.0104  0.0279  -0.0660 9   ALA A CB  
76   N N   . ALA A 10  ? 0.6962 0.1320 0.2726 0.0022  0.0009  -0.0571 10  ALA A N   
77   C CA  . ALA A 10  ? 0.6869 0.1313 0.2657 0.0004  -0.0101 -0.0548 10  ALA A CA  
78   C C   . ALA A 10  ? 0.7622 0.2136 0.3259 -0.0109 -0.0154 -0.0503 10  ALA A C   
79   O O   . ALA A 10  ? 0.7757 0.2235 0.3266 -0.0166 -0.0214 -0.0495 10  ALA A O   
80   C CB  . ALA A 10  ? 0.6682 0.1293 0.2745 0.0084  -0.0145 -0.0534 10  ALA A CB  
81   N N   . SER A 11  ? 0.7011 0.1618 0.2658 -0.0147 -0.0133 -0.0469 11  SER A N   
82   C CA  . SER A 11  ? 0.6895 0.1588 0.2426 -0.0252 -0.0190 -0.0412 11  SER A CA  
83   C C   . SER A 11  ? 0.7539 0.2066 0.2770 -0.0366 -0.0198 -0.0416 11  SER A C   
84   O O   . SER A 11  ? 0.7288 0.1871 0.2440 -0.0442 -0.0272 -0.0379 11  SER A O   
85   C CB  . SER A 11  ? 0.7089 0.1877 0.2665 -0.0270 -0.0165 -0.0374 11  SER A CB  
86   O OG  . SER A 11  ? 0.7962 0.2947 0.3638 -0.0288 -0.0240 -0.0309 11  SER A OG  
87   N N   . ALA A 12  ? 0.7331 0.1644 0.2387 -0.0380 -0.0114 -0.0460 12  ALA A N   
88   C CA  . ALA A 12  ? 0.7422 0.1525 0.2149 -0.0495 -0.0111 -0.0470 12  ALA A CA  
89   C C   . ALA A 12  ? 0.8030 0.2040 0.2691 -0.0491 -0.0151 -0.0496 12  ALA A C   
90   O O   . ALA A 12  ? 0.8199 0.2120 0.2626 -0.0608 -0.0198 -0.0481 12  ALA A O   
91   C CB  . ALA A 12  ? 0.7692 0.1562 0.2255 -0.0491 0.0009  -0.0520 12  ALA A CB  
92   N N   . ALA A 13  ? 0.7496 0.1541 0.2368 -0.0366 -0.0147 -0.0527 13  ALA A N   
93   C CA  . ALA A 13  ? 0.7575 0.1531 0.2403 -0.0350 -0.0192 -0.0549 13  ALA A CA  
94   C C   . ALA A 13  ? 0.7956 0.2109 0.2872 -0.0389 -0.0296 -0.0502 13  ALA A C   
95   O O   . ALA A 13  ? 0.7747 0.1866 0.2671 -0.0368 -0.0340 -0.0515 13  ALA A O   
96   C CB  . ALA A 13  ? 0.7640 0.1545 0.2653 -0.0205 -0.0149 -0.0593 13  ALA A CB  
97   N N   . ARG A 14  ? 0.7569 0.1923 0.2555 -0.0441 -0.0330 -0.0445 14  ARG A N   
98   C CA  . ARG A 14  ? 0.7364 0.1912 0.2442 -0.0475 -0.0408 -0.0394 14  ARG A CA  
99   C C   . ARG A 14  ? 0.8119 0.2604 0.2961 -0.0612 -0.0454 -0.0371 14  ARG A C   
100  O O   . ARG A 14  ? 0.8291 0.2611 0.2892 -0.0701 -0.0435 -0.0379 14  ARG A O   
101  C CB  . ARG A 14  ? 0.7102 0.1893 0.2368 -0.0462 -0.0420 -0.0335 14  ARG A CB  
102  C CG  . ARG A 14  ? 0.7962 0.2825 0.3476 -0.0329 -0.0387 -0.0356 14  ARG A CG  
103  C CD  . ARG A 14  ? 0.8377 0.3462 0.4091 -0.0294 -0.0419 -0.0306 14  ARG A CD  
104  N NE  . ARG A 14  ? 0.8827 0.3925 0.4719 -0.0185 -0.0412 -0.0338 14  ARG A NE  
105  C CZ  . ARG A 14  ? 0.9106 0.4240 0.5153 -0.0109 -0.0377 -0.0348 14  ARG A CZ  
106  N NH1 . ARG A 14  ? 0.4027 0.1336 0.1363 0.0005  -0.0270 0.0000  14  ARG A NH1 
107  N NH2 . ARG A 14  ? 0.8044 0.3202 0.4089 -0.0122 -0.0337 -0.0332 14  ARG A NH2 
108  N N   . ASN A 15  ? 0.7804 0.2390 0.2690 -0.0636 -0.0511 -0.0346 15  ASN A N   
109  C CA  . ASN A 15  ? 0.8067 0.2599 0.2738 -0.0773 -0.0559 -0.0322 15  ASN A CA  
110  C C   . ASN A 15  ? 0.8864 0.3642 0.3654 -0.0823 -0.0615 -0.0254 15  ASN A C   
111  O O   . ASN A 15  ? 0.8794 0.3689 0.3781 -0.0735 -0.0614 -0.0255 15  ASN A O   
112  C CB  . ASN A 15  ? 0.7910 0.2182 0.2403 -0.0768 -0.0552 -0.0386 15  ASN A CB  
113  C CG  . ASN A 15  ? 1.0259 0.4253 0.4474 -0.0820 -0.0511 -0.0426 15  ASN A CG  
114  O OD1 . ASN A 15  ? 1.1245 0.5191 0.5248 -0.0959 -0.0529 -0.0396 15  ASN A OD1 
115  N ND2 . ASN A 15  ? 0.7966 0.1767 0.2176 -0.0713 -0.0452 -0.0490 15  ASN A ND2 
116  N N   . PRO A 16  ? 0.8601 0.3448 0.3262 -0.0971 -0.0663 -0.0192 16  PRO A N   
117  C CA  . PRO A 16  ? 0.9118 0.4213 0.3904 -0.1025 -0.0711 -0.0119 16  PRO A CA  
118  C C   . PRO A 16  ? 1.1674 0.6701 0.6417 -0.1027 -0.0718 -0.0151 16  PRO A C   
119  O O   . PRO A 16  ? 0.5905 0.1101 0.0825 -0.0984 -0.0717 -0.0126 16  PRO A O   
120  C CB  . PRO A 16  ? 0.9420 0.4553 0.4034 -0.1201 -0.0767 -0.0050 16  PRO A CB  
121  C CG  . PRO A 16  ? 0.9927 0.4731 0.4224 -0.1260 -0.0749 -0.0114 16  PRO A CG  
122  C CD  . PRO A 16  ? 0.9133 0.3821 0.3516 -0.1104 -0.0675 -0.0185 16  PRO A CD  
123  N N   . ILE A 34  ? 1.2288 1.0887 0.8450 -0.2765 -0.0709 0.1079  34  ILE A N   
124  C CA  . ILE A 34  ? 1.2347 1.0639 0.8308 -0.2698 -0.0596 0.0951  34  ILE A CA  
125  C C   . ILE A 34  ? 1.2992 1.0797 0.8606 -0.2603 -0.0631 0.0798  34  ILE A C   
126  O O   . ILE A 34  ? 1.3089 1.0599 0.8344 -0.2736 -0.0725 0.0746  34  ILE A O   
127  C CB  . ILE A 34  ? 1.2883 1.1151 0.8668 -0.2909 -0.0581 0.0963  34  ILE A CB  
128  C CG1 . ILE A 34  ? 1.2860 1.1646 0.9035 -0.2993 -0.0533 0.1122  34  ILE A CG1 
129  C CG2 . ILE A 34  ? 1.2948 1.0877 0.8503 -0.2842 -0.0471 0.0835  34  ILE A CG2 
130  C CD1 . ILE A 34  ? 1.4058 1.3081 1.0255 -0.3227 -0.0678 0.1249  34  ILE A CD1 
131  N N   . SER A 35  ? 1.2469 1.0192 0.8197 -0.2375 -0.0553 0.0732  35  SER A N   
132  C CA  . SER A 35  ? 1.2504 0.9813 0.7962 -0.2275 -0.0585 0.0601  35  SER A CA  
133  C C   . SER A 35  ? 1.2967 1.0032 0.8362 -0.2111 -0.0482 0.0491  35  SER A C   
134  O O   . SER A 35  ? 1.2662 0.9867 0.8313 -0.1944 -0.0392 0.0500  35  SER A O   
135  C CB  . SER A 35  ? 1.2883 1.0241 0.8437 -0.2195 -0.0657 0.0622  35  SER A CB  
136  O OG  . SER A 35  ? 1.4069 1.1690 0.9987 -0.2019 -0.0583 0.0670  35  SER A OG  
137  N N   . LEU A 36  ? 1.2818 0.9492 0.7851 -0.2163 -0.0506 0.0389  36  LEU A N   
138  C CA  . LEU A 36  ? 1.2836 0.9213 0.7736 -0.2037 -0.0441 0.0280  36  LEU A CA  
139  C C   . LEU A 36  ? 1.3094 0.9229 0.7908 -0.1905 -0.0497 0.0201  36  LEU A C   
140  O O   . LEU A 36  ? 1.3057 0.8945 0.7774 -0.1792 -0.0467 0.0116  36  LEU A O   
141  C CB  . LEU A 36  ? 1.3121 0.9207 0.7679 -0.2168 -0.0446 0.0223  36  LEU A CB  
142  C CG  . LEU A 36  ? 1.3854 1.0150 0.8450 -0.2333 -0.0397 0.0297  36  LEU A CG  
143  C CD1 . LEU A 36  ? 1.4158 1.0164 0.8368 -0.2515 -0.0458 0.0258  36  LEU A CD1 
144  C CD2 . LEU A 36  ? 1.4140 1.0542 0.8897 -0.2249 -0.0251 0.0299  36  LEU A CD2 
145  N N   . ALA A 37  ? 1.2446 0.8655 0.7293 -0.1928 -0.0578 0.0236  37  ALA A N   
146  C CA  . ALA A 37  ? 1.2232 0.8252 0.7023 -0.1816 -0.0625 0.0174  37  ALA A CA  
147  C C   . ALA A 37  ? 1.2315 0.8482 0.7393 -0.1623 -0.0561 0.0177  37  ALA A C   
148  O O   . ALA A 37  ? 1.2131 0.8092 0.7160 -0.1497 -0.0562 0.0101  37  ALA A O   
149  C CB  . ALA A 37  ? 1.2336 0.8411 0.7073 -0.1918 -0.0717 0.0221  37  ALA A CB  
150  N N   . GLY A 38  ? 1.1727 0.8250 0.7104 -0.1604 -0.0505 0.0271  38  GLY A N   
151  C CA  . GLY A 38  ? 1.1475 0.8177 0.7144 -0.1433 -0.0437 0.0296  38  GLY A CA  
152  C C   . GLY A 38  ? 1.1733 0.8236 0.7379 -0.1285 -0.0359 0.0210  38  GLY A C   
153  O O   . GLY A 38  ? 1.1805 0.8318 0.7469 -0.1276 -0.0270 0.0206  38  GLY A O   
154  N N   . GLY A 39  ? 1.0915 0.7246 0.6527 -0.1174 -0.0390 0.0148  39  GLY A N   
155  C CA  . GLY A 39  ? 1.0797 0.6934 0.6387 -0.1038 -0.0336 0.0072  39  GLY A CA  
156  C C   . GLY A 39  ? 1.0934 0.7272 0.6798 -0.0906 -0.0244 0.0115  39  GLY A C   
157  O O   . GLY A 39  ? 1.0774 0.7013 0.6680 -0.0782 -0.0234 0.0074  39  GLY A O   
158  N N   . LEU A 40  ? 1.0280 0.6901 0.6334 -0.0933 -0.0172 0.0202  40  LEU A N   
159  C CA  . LEU A 40  ? 1.0009 0.6850 0.6345 -0.0809 -0.0071 0.0261  40  LEU A CA  
160  C C   . LEU A 40  ? 1.0430 0.7264 0.6776 -0.0789 0.0062  0.0257  40  LEU A C   
161  O O   . LEU A 40  ? 1.0510 0.7410 0.6804 -0.0908 0.0082  0.0282  40  LEU A O   
162  C CB  . LEU A 40  ? 0.9880 0.7098 0.6484 -0.0840 -0.0093 0.0388  40  LEU A CB  
163  C CG  . LEU A 40  ? 1.0332 0.7582 0.6938 -0.0863 -0.0214 0.0409  40  LEU A CG  
164  C CD1 . LEU A 40  ? 1.0505 0.7755 0.6946 -0.1048 -0.0316 0.0428  40  LEU A CD1 
165  C CD2 . LEU A 40  ? 1.0170 0.7727 0.7090 -0.0782 -0.0202 0.0516  40  LEU A CD2 
166  N N   . PRO A 41  ? 0.9955 0.6715 0.6369 -0.0647 0.0163  0.0230  41  PRO A N   
167  C CA  . PRO A 41  ? 1.0066 0.6791 0.6468 -0.0625 0.0310  0.0222  41  PRO A CA  
168  C C   . PRO A 41  ? 1.0443 0.7538 0.7123 -0.0639 0.0406  0.0337  41  PRO A C   
169  O O   . PRO A 41  ? 1.0223 0.7611 0.7156 -0.0618 0.0368  0.0430  41  PRO A O   
170  C CB  . PRO A 41  ? 1.0313 0.6875 0.6728 -0.0467 0.0383  0.0176  41  PRO A CB  
171  C CG  . PRO A 41  ? 1.0727 0.7410 0.7308 -0.0393 0.0305  0.0209  41  PRO A CG  
172  C CD  . PRO A 41  ? 1.0110 0.6784 0.6585 -0.0509 0.0152  0.0200  41  PRO A CD  
173  N N   . ASN A 42  ? 1.0139 0.7221 0.6773 -0.0678 0.0530  0.0336  42  ASN A N   
174  C CA  . ASN A 42  ? 1.0051 0.7492 0.6965 -0.0690 0.0643  0.0447  42  ASN A CA  
175  C C   . ASN A 42  ? 1.0547 0.8190 0.7776 -0.0515 0.0741  0.0516  42  ASN A C   
176  O O   . ASN A 42  ? 1.0536 0.7964 0.7699 -0.0386 0.0833  0.0456  42  ASN A O   
177  C CB  . ASN A 42  ? 0.9899 0.7237 0.6680 -0.0747 0.0781  0.0417  42  ASN A CB  
178  C CG  . ASN A 42  ? 1.0740 0.8471 0.7810 -0.0791 0.0883  0.0537  42  ASN A CG  
179  O OD1 . ASN A 42  ? 0.9273 0.7205 0.6617 -0.0666 0.1030  0.0603  42  ASN A OD1 
180  N ND2 . ASN A 42  ? 0.9698 0.7547 0.6719 -0.0969 0.0808  0.0573  42  ASN A ND2 
181  N N   . PRO A 43  ? 1.0044 0.8090 0.7606 -0.0515 0.0712  0.0646  43  PRO A N   
182  C CA  . PRO A 43  ? 0.9911 0.8157 0.7787 -0.0341 0.0791  0.0724  43  PRO A CA  
183  C C   . PRO A 43  ? 1.0423 0.8700 0.8428 -0.0223 0.1017  0.0743  43  PRO A C   
184  O O   . PRO A 43  ? 1.0479 0.8665 0.8550 -0.0058 0.1106  0.0731  43  PRO A O   
185  C CB  . PRO A 43  ? 1.0015 0.8687 0.8193 -0.0403 0.0689  0.0869  43  PRO A CB  
186  C CG  . PRO A 43  ? 1.0657 0.9412 0.8735 -0.0605 0.0632  0.0884  43  PRO A CG  
187  C CD  . PRO A 43  ? 1.0203 0.8519 0.7851 -0.0678 0.0592  0.0732  43  PRO A CD  
188  N N   . ASN A 44  ? 0.9866 0.8237 0.7877 -0.0312 0.1116  0.0764  44  ASN A N   
189  C CA  . ASN A 44  ? 0.9864 0.8277 0.7992 -0.0220 0.1351  0.0786  44  ASN A CA  
190  C C   . ASN A 44  ? 1.0015 0.7963 0.7817 -0.0143 0.1474  0.0649  44  ASN A C   
191  O O   . ASN A 44  ? 1.0104 0.8021 0.7943 -0.0070 0.1684  0.0652  44  ASN A O   
192  C CB  . ASN A 44  ? 1.0208 0.8862 0.8425 -0.0362 0.1410  0.0850  44  ASN A CB  
193  C CG  . ASN A 44  ? 1.2952 1.2093 1.1523 -0.0437 0.1305  0.1003  44  ASN A CG  
194  O OD1 . ASN A 44  ? 1.2547 1.2065 1.1495 -0.0383 0.1420  0.1131  44  ASN A OD1 
195  N ND2 . ASN A 44  ? 1.1482 1.0622 0.9935 -0.0571 0.1086  0.0999  44  ASN A ND2 
196  N N   . MET A 45  ? 0.9197 0.6788 0.6686 -0.0159 0.1345  0.0536  45  MET A N   
197  C CA  . MET A 45  ? 0.9173 0.6303 0.6322 -0.0112 0.1411  0.0408  45  MET A CA  
198  C C   . MET A 45  ? 0.9627 0.6609 0.6799 0.0054  0.1428  0.0383  45  MET A C   
199  O O   . MET A 45  ? 0.9747 0.6354 0.6651 0.0097  0.1491  0.0286  45  MET A O   
200  C CB  . MET A 45  ? 0.9431 0.6248 0.6200 -0.0257 0.1256  0.0301  45  MET A CB  
201  C CG  . MET A 45  ? 0.9862 0.6678 0.6489 -0.0418 0.1278  0.0294  45  MET A CG  
202  S SD  . MET A 45  ? 1.0491 0.7144 0.7002 -0.0391 0.1542  0.0265  45  MET A SD  
203  C CE  . MET A 45  ? 0.9999 0.7178 0.6911 -0.0433 0.1648  0.0410  45  MET A CE  
204  N N   . PHE A 46  ? 0.9028 0.6288 0.6502 0.0137  0.1367  0.0471  46  PHE A N   
205  C CA  . PHE A 46  ? 0.8989 0.6133 0.6502 0.0289  0.1376  0.0459  46  PHE A CA  
206  C C   . PHE A 46  ? 0.9330 0.6516 0.7015 0.0451  0.1605  0.0507  46  PHE A C   
207  O O   . PHE A 46  ? 0.9186 0.6713 0.7171 0.0476  0.1707  0.0615  46  PHE A O   
208  C CB  . PHE A 46  ? 0.9106 0.6507 0.6843 0.0301  0.1212  0.0533  46  PHE A CB  
209  C CG  . PHE A 46  ? 0.9369 0.6720 0.6944 0.0157  0.0999  0.0490  46  PHE A CG  
210  C CD1 . PHE A 46  ? 0.9930 0.6903 0.7163 0.0109  0.0921  0.0363  46  PHE A CD1 
211  C CD2 . PHE A 46  ? 0.9615 0.7290 0.7380 0.0073  0.0874  0.0580  46  PHE A CD2 
212  C CE1 . PHE A 46  ? 0.9972 0.6893 0.7068 -0.0007 0.0738  0.0325  46  PHE A CE1 
213  C CE2 . PHE A 46  ? 0.9957 0.7552 0.7548 -0.0054 0.0692  0.0536  46  PHE A CE2 
214  C CZ  . PHE A 46  ? 0.9777 0.6996 0.7042 -0.0085 0.0633  0.0408  46  PHE A CZ  
215  N N   . PRO A 47  ? 0.8926 0.5770 0.6427 0.0559  0.1692  0.0433  47  PRO A N   
216  C CA  . PRO A 47  ? 0.9001 0.5821 0.6614 0.0715  0.1932  0.0468  47  PRO A CA  
217  C C   . PRO A 47  ? 0.9178 0.6356 0.7217 0.0867  0.1993  0.0605  47  PRO A C   
218  O O   . PRO A 47  ? 0.9199 0.6539 0.7444 0.0954  0.2190  0.0676  47  PRO A O   
219  C CB  . PRO A 47  ? 0.9396 0.5725 0.6656 0.0767  0.1968  0.0350  47  PRO A CB  
220  C CG  . PRO A 47  ? 0.9826 0.6042 0.6939 0.0687  0.1733  0.0292  47  PRO A CG  
221  C CD  . PRO A 47  ? 0.9152 0.5586 0.6304 0.0532  0.1587  0.0310  47  PRO A CD  
222  N N   . PHE A 48  ? 0.8370 0.5652 0.6533 0.0906  0.1835  0.0643  48  PHE A N   
223  C CA  . PHE A 48  ? 0.8095 0.5692 0.6644 0.1049  0.1864  0.0777  48  PHE A CA  
224  C C   . PHE A 48  ? 0.7858 0.5948 0.6770 0.0999  0.1842  0.0914  48  PHE A C   
225  O O   . PHE A 48  ? 0.7496 0.5752 0.6416 0.0851  0.1655  0.0930  48  PHE A O   
226  C CB  . PHE A 48  ? 0.8255 0.5811 0.6792 0.1068  0.1681  0.0773  48  PHE A CB  
227  C CG  . PHE A 48  ? 0.8693 0.5783 0.6867 0.1082  0.1660  0.0638  48  PHE A CG  
228  C CD1 . PHE A 48  ? 0.9442 0.6279 0.7542 0.1230  0.1817  0.0614  48  PHE A CD1 
229  C CD2 . PHE A 48  ? 0.9065 0.5972 0.6979 0.0946  0.1482  0.0542  48  PHE A CD2 
230  C CE1 . PHE A 48  ? 0.9784 0.6196 0.7546 0.1226  0.1786  0.0496  48  PHE A CE1 
231  C CE2 . PHE A 48  ? 0.9673 0.6180 0.7283 0.0954  0.1453  0.0430  48  PHE A CE2 
232  C CZ  . PHE A 48  ? 0.9676 0.5942 0.7210 0.1086  0.1599  0.0409  48  PHE A CZ  
233  N N   . LYS A 49  ? 0.7252 0.5567 0.6455 0.1115  0.2039  0.1014  49  LYS A N   
234  C CA  . LYS A 49  ? 0.6957 0.5763 0.6532 0.1065  0.2041  0.1155  49  LYS A CA  
235  C C   . LYS A 49  ? 0.7069 0.6316 0.7085 0.1140  0.1951  0.1328  49  LYS A C   
236  O O   . LYS A 49  ? 0.6803 0.6378 0.6982 0.1007  0.1791  0.1409  49  LYS A O   
237  C CB  . LYS A 49  ? 0.7362 0.6207 0.6995 0.1088  0.2287  0.1165  49  LYS A CB  
238  C CG  . LYS A 49  ? 0.7818 0.6289 0.7009 0.0947  0.2324  0.1010  49  LYS A CG  
239  C CD  . LYS A 49  ? 0.8260 0.6875 0.7373 0.0718  0.2144  0.1002  49  LYS A CD  
240  C CE  . LYS A 49  ? 0.8723 0.6919 0.7362 0.0583  0.2138  0.0844  49  LYS A CE  
241  N NZ  . LYS A 49  ? 0.9002 0.7244 0.7501 0.0379  0.1911  0.0818  49  LYS A NZ  
242  N N   . THR A 50  ? 0.6638 0.5884 0.6835 0.1344  0.2048  0.1388  50  THR A N   
243  C CA  . THR A 50  ? 0.6474 0.6107 0.7076 0.1428  0.1953  0.1557  50  THR A CA  
244  C C   . THR A 50  ? 0.6779 0.6173 0.7311 0.1582  0.1943  0.1537  50  THR A C   
245  O O   . THR A 50  ? 0.6761 0.5755 0.7038 0.1677  0.2087  0.1428  50  THR A O   
246  C CB  . THR A 50  ? 0.8049 0.8129 0.9142 0.1538  0.2108  0.1734  50  THR A CB  
247  O OG1 . THR A 50  ? 0.8521 0.8415 0.9644 0.1749  0.2374  0.1721  50  THR A OG1 
248  C CG2 . THR A 50  ? 0.7918 0.8301 0.9139 0.1380  0.2118  0.1779  50  THR A CG2 
249  N N   . ALA A 51  ? 0.6269 0.5895 0.7010 0.1597  0.1772  0.1646  51  ALA A N   
250  C CA  . ALA A 51  ? 0.6347 0.5774 0.7044 0.1738  0.1752  0.1643  51  ALA A CA  
251  C C   . ALA A 51  ? 0.7005 0.6816 0.8150 0.1870  0.1722  0.1843  51  ALA A C   
252  O O   . ALA A 51  ? 0.6753 0.6997 0.8199 0.1790  0.1603  0.1981  51  ALA A O   
253  C CB  . ALA A 51  ? 0.6298 0.5474 0.6663 0.1609  0.1541  0.1533  51  ALA A CB  
254  N N   . VAL A 52  ? 0.6814 0.6451 0.7990 0.2069  0.1829  0.1862  52  VAL A N   
255  C CA  . VAL A 52  ? 0.6844 0.6769 0.8402 0.2216  0.1803  0.2043  52  VAL A CA  
256  C C   . VAL A 52  ? 0.7531 0.7113 0.8876 0.2307  0.1755  0.1990  52  VAL A C   
257  O O   . VAL A 52  ? 0.7668 0.6841 0.8761 0.2410  0.1913  0.1878  52  VAL A O   
258  C CB  . VAL A 52  ? 0.7500 0.7705 0.9473 0.2401  0.2025  0.2184  52  VAL A CB  
259  C CG1 . VAL A 52  ? 0.7723 0.7622 0.9501 0.2474  0.2302  0.2063  52  VAL A CG1 
260  C CG2 . VAL A 52  ? 0.7515 0.7829 0.9781 0.2616  0.2049  0.2334  52  VAL A CG2 
261  N N   . ILE A 53  ? 0.7021 0.6750 0.8431 0.2242  0.1528  0.2063  53  ILE A N   
262  C CA  . ILE A 53  ? 0.7032 0.6480 0.8250 0.2294  0.1446  0.2026  53  ILE A CA  
263  C C   . ILE A 53  ? 0.7600 0.7323 0.9167 0.2419  0.1375  0.2221  53  ILE A C   
264  O O   . ILE A 53  ? 0.7359 0.7432 0.9127 0.2315  0.1185  0.2341  53  ILE A O   
265  C CB  . ILE A 53  ? 0.7253 0.6510 0.8116 0.2084  0.1244  0.1894  53  ILE A CB  
266  C CG1 . ILE A 53  ? 0.7377 0.6271 0.7865 0.2005  0.1337  0.1695  53  ILE A CG1 
267  C CG2 . ILE A 53  ? 0.7348 0.6397 0.8067 0.2115  0.1131  0.1884  53  ILE A CG2 
268  C CD1 . ILE A 53  ? 0.8180 0.6916 0.8340 0.1788  0.1156  0.1561  53  ILE A CD1 
269  N N   . THR A 54  ? 0.7466 0.7011 0.9085 0.2637  0.1525  0.2255  54  THR A N   
270  C CA  . THR A 54  ? 0.7531 0.7293 0.9464 0.2775  0.1465  0.2441  54  THR A CA  
271  C C   . THR A 54  ? 0.8541 0.8104 1.0249 0.2716  0.1276  0.2413  54  THR A C   
272  O O   . THR A 54  ? 0.8435 0.7595 0.9738 0.2646  0.1266  0.2241  54  THR A O   
273  C CB  . THR A 54  ? 0.7323 0.7032 0.9464 0.3046  0.1709  0.2519  54  THR A CB  
274  O OG1 . THR A 54  ? 0.6792 0.5961 0.8550 0.3128  0.1847  0.2362  54  THR A OG1 
275  C CG2 . THR A 54  ? 0.6876 0.6872 0.9327 0.3114  0.1894  0.2586  54  THR A CG2 
276  N N   . VAL A 55  ? 0.8583 0.8441 1.0564 0.2739  0.1123  0.2592  55  VAL A N   
277  C CA  . VAL A 55  ? 0.8780 0.8516 1.0603 0.2680  0.0930  0.2605  55  VAL A CA  
278  C C   . VAL A 55  ? 0.9772 0.9617 1.1875 0.2878  0.0937  0.2788  55  VAL A C   
279  O O   . VAL A 55  ? 0.9755 1.0006 1.2285 0.2963  0.0945  0.2973  55  VAL A O   
280  C CB  . VAL A 55  ? 0.9175 0.9166 1.0986 0.2436  0.0679  0.2634  55  VAL A CB  
281  C CG1 . VAL A 55  ? 0.9151 0.9158 1.0937 0.2395  0.0473  0.2726  55  VAL A CG1 
282  C CG2 . VAL A 55  ? 0.9080 0.8835 1.0512 0.2246  0.0655  0.2426  55  VAL A CG2 
283  N N   . GLU A 56  ? 0.9766 0.9255 1.1635 0.2949  0.0929  0.2743  56  GLU A N   
284  C CA  . GLU A 56  ? 1.0032 0.9567 1.2118 0.3136  0.0925  0.2912  56  GLU A CA  
285  C C   . GLU A 56  ? 1.0547 1.0397 1.2792 0.3020  0.0657  0.3068  56  GLU A C   
286  O O   . GLU A 56  ? 1.0304 1.0094 1.2294 0.2804  0.0482  0.2985  56  GLU A O   
287  C CB  . GLU A 56  ? 1.0411 0.9434 1.2164 0.3238  0.1008  0.2808  56  GLU A CB  
288  C CG  . GLU A 56  ? 1.2070 1.1061 1.4047 0.3503  0.1129  0.2953  56  GLU A CG  
289  C CD  . GLU A 56  ? 1.5413 1.3987 1.7109 0.3570  0.1114  0.2917  56  GLU A CD  
290  O OE1 . GLU A 56  ? 1.4274 1.2444 1.5544 0.3472  0.1131  0.2727  56  GLU A OE1 
291  O OE2 . GLU A 56  ? 1.5101 1.3752 1.7009 0.3725  0.1090  0.3086  56  GLU A OE2 
292  N N   . ASN A 57  ? 1.0176 1.0362 1.2847 0.3164  0.0628  0.3300  57  ASN A N   
293  C CA  . ASN A 57  ? 1.0045 1.0574 1.2931 0.3077  0.0374  0.3493  57  ASN A CA  
294  C C   . ASN A 57  ? 1.0134 1.0951 1.3011 0.2806  0.0193  0.3481  57  ASN A C   
295  O O   . ASN A 57  ? 1.0032 1.0912 1.2797 0.2630  -0.0039 0.3523  57  ASN A O   
296  C CB  . ASN A 57  ? 1.0366 1.0600 1.2997 0.3073  0.0246  0.3498  57  ASN A CB  
297  C CG  . ASN A 57  ? 1.3845 1.3734 1.6415 0.3318  0.0414  0.3493  57  ASN A CG  
298  O OD1 . ASN A 57  ? 1.3038 1.2534 1.5254 0.3296  0.0386  0.3396  57  ASN A OD1 
299  N ND2 . ASN A 57  ? 1.3115 1.3138 1.6026 0.3555  0.0594  0.3604  57  ASN A ND2 
300  N N   . GLY A 58  ? 0.9397 1.0347 1.2359 0.2775  0.0317  0.3415  58  GLY A N   
301  C CA  . GLY A 58  ? 0.9090 1.0293 1.2053 0.2543  0.0203  0.3391  58  GLY A CA  
302  C C   . GLY A 58  ? 0.9390 1.0852 1.2658 0.2624  0.0387  0.3422  58  GLY A C   
303  O O   . GLY A 58  ? 0.9531 1.0926 1.2959 0.2856  0.0608  0.3441  58  GLY A O   
304  N N   . LYS A 59  ? 0.8534 1.0276 1.1869 0.2434  0.0308  0.3425  59  LYS A N   
305  C CA  . LYS A 59  ? 0.8310 1.0322 1.1932 0.2480  0.0475  0.3455  59  LYS A CA  
306  C C   . LYS A 59  ? 0.8383 1.0021 1.1697 0.2509  0.0705  0.3224  59  LYS A C   
307  O O   . LYS A 59  ? 0.8498 0.9685 1.1496 0.2596  0.0800  0.3082  59  LYS A O   
308  C CB  . LYS A 59  ? 0.8445 1.0897 1.2251 0.2256  0.0298  0.3557  59  LYS A CB  
309  N N   . THR A 60  ? 0.7361 0.9185 1.0772 0.2433  0.0794  0.3196  60  THR A N   
310  C CA  . THR A 60  ? 0.7136 0.8625 1.0254 0.2437  0.0995  0.2989  60  THR A CA  
311  C C   . THR A 60  ? 0.7188 0.8694 1.0075 0.2173  0.0887  0.2876  60  THR A C   
312  O O   . THR A 60  ? 0.6948 0.8853 1.0059 0.2031  0.0757  0.2993  60  THR A O   
313  C CB  . THR A 60  ? 0.7382 0.8933 1.0770 0.2663  0.1287  0.3032  60  THR A CB  
314  O OG1 . THR A 60  ? 0.6502 0.7601 0.9514 0.2687  0.1478  0.2818  60  THR A OG1 
315  C CG2 . THR A 60  ? 0.7140 0.9218 1.0972 0.2632  0.1323  0.3183  60  THR A CG2 
316  N N   . ILE A 61  ? 0.6652 0.7720 0.9082 0.2097  0.0922  0.2657  61  ILE A N   
317  C CA  . ILE A 61  ? 0.6473 0.7521 0.8666 0.1859  0.0827  0.2546  61  ILE A CA  
318  C C   . ILE A 61  ? 0.7202 0.8254 0.9418 0.1875  0.1034  0.2479  61  ILE A C   
319  O O   . ILE A 61  ? 0.7352 0.8197 0.9549 0.2049  0.1260  0.2425  61  ILE A O   
320  C CB  . ILE A 61  ? 0.6712 0.7360 0.8423 0.1718  0.0697  0.2367  61  ILE A CB  
321  C CG1 . ILE A 61  ? 0.6712 0.7251 0.8370 0.1767  0.0567  0.2413  61  ILE A CG1 
322  C CG2 . ILE A 61  ? 0.6624 0.7396 0.8207 0.1462  0.0526  0.2336  61  ILE A CG2 
323  C CD1 . ILE A 61  ? 0.7221 0.7296 0.8442 0.1725  0.0539  0.2229  61  ILE A CD1 
324  N N   . GLN A 62  ? 0.6669 0.7969 0.8938 0.1694  0.0961  0.2498  62  GLN A N   
325  C CA  . GLN A 62  ? 0.6671 0.7996 0.8948 0.1672  0.1135  0.2440  62  GLN A CA  
326  C C   . GLN A 62  ? 0.7162 0.8334 0.9081 0.1427  0.1014  0.2299  62  GLN A C   
327  O O   . GLN A 62  ? 0.6932 0.8240 0.8809 0.1252  0.0791  0.2338  62  GLN A O   
328  C CB  . GLN A 62  ? 0.6828 0.8693 0.9617 0.1702  0.1186  0.2641  62  GLN A CB  
329  C CG  . GLN A 62  ? 0.9042 1.1117 1.2252 0.1956  0.1305  0.2810  62  GLN A CG  
330  C CD  . GLN A 62  ? 1.1880 1.3775 1.5129 0.2167  0.1621  0.2757  62  GLN A CD  
331  O OE1 . GLN A 62  ? 1.1309 1.3138 1.4462 0.2122  0.1777  0.2668  62  GLN A OE1 
332  N NE2 . GLN A 62  ? 1.0861 1.2681 1.4260 0.2404  0.1727  0.2823  62  GLN A NE2 
333  N N   . PHE A 63  ? 0.6883 0.7733 0.8515 0.1418  0.1162  0.2132  63  PHE A N   
334  C CA  . PHE A 63  ? 0.6797 0.7482 0.8097 0.1209  0.1086  0.1996  63  PHE A CA  
335  C C   . PHE A 63  ? 0.7311 0.8129 0.8732 0.1206  0.1268  0.2004  63  PHE A C   
336  O O   . PHE A 63  ? 0.7370 0.7948 0.8697 0.1331  0.1485  0.1923  63  PHE A O   
337  C CB  . PHE A 63  ? 0.7073 0.7225 0.7901 0.1201  0.1090  0.1791  63  PHE A CB  
338  C CG  . PHE A 63  ? 0.7203 0.7201 0.7828 0.1129  0.0883  0.1749  63  PHE A CG  
339  C CD1 . PHE A 63  ? 0.7452 0.7747 0.8283 0.1078  0.0705  0.1889  63  PHE A CD1 
340  C CD2 . PHE A 63  ? 0.7501 0.7057 0.7731 0.1109  0.0870  0.1575  63  PHE A CD2 
341  C CE1 . PHE A 63  ? 0.7514 0.7645 0.8137 0.1009  0.0531  0.1847  63  PHE A CE1 
342  C CE2 . PHE A 63  ? 0.7746 0.7167 0.7803 0.1046  0.0696  0.1538  63  PHE A CE2 
343  C CZ  . PHE A 63  ? 0.7411 0.7111 0.7657 0.0999  0.0537  0.1671  63  PHE A CZ  
344  N N   . GLY A 64  ? 0.6759 0.7975 0.8407 0.1066  0.1185  0.2118  64  GLY A N   
345  C CA  . GLY A 64  ? 0.6803 0.8198 0.8583 0.1025  0.1338  0.2140  64  GLY A CA  
346  C C   . GLY A 64  ? 0.7432 0.8492 0.8773 0.0862  0.1338  0.1957  64  GLY A C   
347  O O   . GLY A 64  ? 0.7238 0.7942 0.8203 0.0797  0.1224  0.1822  64  GLY A O   
348  N N   . GLU A 65  ? 0.7379 0.8557 0.8774 0.0794  0.1464  0.1959  65  GLU A N   
349  C CA  . GLU A 65  ? 0.7531 0.8418 0.8529 0.0631  0.1472  0.1803  65  GLU A CA  
350  C C   . GLU A 65  ? 0.7838 0.8597 0.8537 0.0427  0.1209  0.1736  65  GLU A C   
351  O O   . GLU A 65  ? 0.7656 0.7993 0.7967 0.0412  0.1161  0.1581  65  GLU A O   
352  C CB  . GLU A 65  ? 0.7800 0.8975 0.8990 0.0547  0.1596  0.1871  65  GLU A CB  
353  C CG  . GLU A 65  ? 0.9638 1.0924 1.1109 0.0745  0.1881  0.1930  65  GLU A CG  
354  C CD  . GLU A 65  ? 1.2875 1.3683 1.4006 0.0836  0.2101  0.1763  65  GLU A CD  
355  O OE1 . GLU A 65  ? 1.2679 1.3385 1.3911 0.1053  0.2281  0.1771  65  GLU A OE1 
356  O OE2 . GLU A 65  ? 1.2089 1.2616 1.2844 0.0688  0.2094  0.1628  65  GLU A OE2 
357  N N   . GLU A 66  ? 0.7301 0.8436 0.8203 0.0281  0.1043  0.1866  66  GLU A N   
358  C CA  . GLU A 66  ? 0.7179 0.8259 0.7849 0.0076  0.0800  0.1837  66  GLU A CA  
359  C C   . GLU A 66  ? 0.7445 0.8299 0.7950 0.0129  0.0664  0.1787  66  GLU A C   
360  O O   . GLU A 66  ? 0.7327 0.7893 0.7470 0.0008  0.0539  0.1669  66  GLU A O   
361  C CB  . GLU A 66  ? 0.7319 0.8880 0.8282 -0.0082 0.0667  0.2013  66  GLU A CB  
362  C CG  . GLU A 66  ? 0.8555 1.0373 0.9688 -0.0168 0.0784  0.2072  66  GLU A CG  
363  C CD  . GLU A 66  ? 1.1785 1.3262 1.2513 -0.0292 0.0841  0.1906  66  GLU A CD  
364  O OE1 . GLU A 66  ? 1.2171 1.3513 1.2607 -0.0490 0.0673  0.1848  66  GLU A OE1 
365  O OE2 . GLU A 66  ? 1.1131 1.2442 1.1809 -0.0186 0.1056  0.1830  66  GLU A OE2 
366  N N   . MET A 67  ? 0.6989 0.7965 0.7753 0.0308  0.0690  0.1878  67  MET A N   
367  C CA  . MET A 67  ? 0.6986 0.7746 0.7599 0.0363  0.0573  0.1836  67  MET A CA  
368  C C   . MET A 67  ? 0.7021 0.7280 0.7269 0.0444  0.0662  0.1642  67  MET A C   
369  O O   . MET A 67  ? 0.6715 0.6710 0.6680 0.0388  0.0538  0.1546  67  MET A O   
370  C CB  . MET A 67  ? 0.7355 0.8377 0.8337 0.0525  0.0569  0.1994  67  MET A CB  
371  C CG  . MET A 67  ? 0.7833 0.8686 0.8672 0.0542  0.0413  0.1976  67  MET A CG  
372  S SD  . MET A 67  ? 0.8284 0.9252 0.9000 0.0295  0.0124  0.2028  67  MET A SD  
373  C CE  . MET A 67  ? 0.7864 0.9427 0.9109 0.0297  0.0061  0.2295  67  MET A CE  
374  N N   . MET A 68  ? 0.6522 0.6653 0.6772 0.0567  0.0878  0.1589  68  MET A N   
375  C CA  . MET A 68  ? 0.6442 0.6103 0.6350 0.0636  0.0977  0.1415  68  MET A CA  
376  C C   . MET A 68  ? 0.6474 0.5871 0.6000 0.0456  0.0889  0.1275  68  MET A C   
377  O O   . MET A 68  ? 0.6205 0.5260 0.5436 0.0451  0.0826  0.1153  68  MET A O   
378  C CB  . MET A 68  ? 0.6885 0.6483 0.6875 0.0784  0.1232  0.1404  68  MET A CB  
379  C CG  . MET A 68  ? 0.7454 0.6563 0.7101 0.0867  0.1331  0.1244  68  MET A CG  
380  S SD  . MET A 68  ? 0.7928 0.6857 0.7560 0.1022  0.1284  0.1238  68  MET A SD  
381  C CE  . MET A 68  ? 0.7720 0.6366 0.7284 0.1210  0.1548  0.1182  68  MET A CE  
382  N N   . LYS A 69  ? 0.5997 0.5564 0.5539 0.0306  0.0878  0.1301  69  LYS A N   
383  C CA  . LYS A 69  ? 0.5949 0.5278 0.5134 0.0129  0.0788  0.1181  69  LYS A CA  
384  C C   . LYS A 69  ? 0.6491 0.5750 0.5526 0.0031  0.0570  0.1160  69  LYS A C   
385  O O   . LYS A 69  ? 0.6593 0.5514 0.5290 -0.0030 0.0508  0.1026  69  LYS A O   
386  C CB  . LYS A 69  ? 0.6056 0.5594 0.5296 -0.0019 0.0815  0.1227  69  LYS A CB  
387  C CG  . LYS A 69  ? 0.6192 0.5670 0.5449 0.0052  0.1042  0.1198  69  LYS A CG  
388  C CD  . LYS A 69  ? 0.7680 0.7326 0.6944 -0.0115 0.1065  0.1228  69  LYS A CD  
389  C CE  . LYS A 69  ? 0.9592 0.9368 0.9049 -0.0031 0.1305  0.1272  69  LYS A CE  
390  N NZ  . LYS A 69  ? 1.0354 1.0652 1.0315 0.0022  0.1347  0.1463  69  LYS A NZ  
391  N N   . ARG A 70  ? 0.5758 0.5324 0.5046 0.0028  0.0462  0.1294  70  ARG A N   
392  C CA  . ARG A 70  ? 0.5539 0.5045 0.4695 -0.0058 0.0270  0.1286  70  ARG A CA  
393  C C   . ARG A 70  ? 0.5976 0.5154 0.4965 0.0070  0.0286  0.1182  70  ARG A C   
394  O O   . ARG A 70  ? 0.5864 0.4742 0.4546 0.0005  0.0217  0.1059  70  ARG A O   
395  C CB  . ARG A 70  ? 0.5228 0.5127 0.4694 -0.0083 0.0159  0.1464  70  ARG A CB  
396  C CG  . ARG A 70  ? 0.5519 0.5400 0.4805 -0.0265 -0.0048 0.1468  70  ARG A CG  
397  C CD  . ARG A 70  ? 0.5041 0.5151 0.4517 -0.0263 -0.0178 0.1604  70  ARG A CD  
398  N NE  . ARG A 70  ? 0.5070 0.4939 0.4245 -0.0362 -0.0324 0.1532  70  ARG A NE  
399  C CZ  . ARG A 70  ? 0.6484 0.6435 0.5699 -0.0389 -0.0454 0.1612  70  ARG A CZ  
400  N NH1 . ARG A 70  ? 0.3596 0.3884 0.3151 -0.0330 -0.0478 0.1780  70  ARG A NH1 
401  N NH2 . ARG A 70  ? 0.5519 0.5210 0.4431 -0.0473 -0.0558 0.1528  70  ARG A NH2 
402  N N   . ALA A 71  ? 0.5668 0.4889 0.4856 0.0255  0.0394  0.1228  71  ALA A N   
403  C CA  . ALA A 71  ? 0.5696 0.4630 0.4760 0.0386  0.0421  0.1147  71  ALA A CA  
404  C C   . ALA A 71  ? 0.6466 0.4987 0.5189 0.0382  0.0475  0.0974  71  ALA A C   
405  O O   . ALA A 71  ? 0.6392 0.4662 0.4933 0.0404  0.0417  0.0891  71  ALA A O   
406  C CB  . ALA A 71  ? 0.5799 0.4848 0.5132 0.0581  0.0555  0.1232  71  ALA A CB  
407  N N   . LEU A 72  ? 0.6235 0.4690 0.4874 0.0347  0.0579  0.0925  72  LEU A N   
408  C CA  . LEU A 72  ? 0.6280 0.4346 0.4596 0.0336  0.0631  0.0773  72  LEU A CA  
409  C C   . LEU A 72  ? 0.7040 0.4950 0.5085 0.0170  0.0499  0.0687  72  LEU A C   
410  O O   . LEU A 72  ? 0.7219 0.4796 0.4991 0.0161  0.0501  0.0564  72  LEU A O   
411  C CB  . LEU A 72  ? 0.6343 0.4357 0.4665 0.0392  0.0824  0.0757  72  LEU A CB  
412  C CG  . LEU A 72  ? 0.6871 0.4930 0.5395 0.0582  0.0994  0.0814  72  LEU A CG  
413  C CD1 . LEU A 72  ? 0.7027 0.4952 0.5471 0.0617  0.1185  0.0770  72  LEU A CD1 
414  C CD2 . LEU A 72  ? 0.6900 0.4710 0.5327 0.0697  0.0981  0.0761  72  LEU A CD2 
415  N N   . GLN A 73  ? 0.6484 0.4622 0.4596 0.0039  0.0383  0.0754  73  GLN A N   
416  C CA  . GLN A 73  ? 0.6372 0.4369 0.4229 -0.0121 0.0256  0.0685  73  GLN A CA  
417  C C   . GLN A 73  ? 0.6619 0.4532 0.4396 -0.0135 0.0117  0.0664  73  GLN A C   
418  O O   . GLN A 73  ? 0.6307 0.4336 0.4256 -0.0045 0.0107  0.0726  73  GLN A O   
419  C CB  . GLN A 73  ? 0.6506 0.4764 0.4440 -0.0272 0.0214  0.0767  73  GLN A CB  
420  C CG  . GLN A 73  ? 0.7125 0.5207 0.4767 -0.0443 0.0102  0.0693  73  GLN A CG  
421  C CD  . GLN A 73  ? 0.8632 0.6399 0.6010 -0.0456 0.0167  0.0571  73  GLN A CD  
422  O OE1 . GLN A 73  ? 0.7101 0.4558 0.4273 -0.0411 0.0147  0.0464  73  GLN A OE1 
423  N NE2 . GLN A 73  ? 0.7989 0.5836 0.5370 -0.0528 0.0242  0.0591  73  GLN A NE2 
424  N N   . TYR A 74  ? 0.6227 0.3924 0.3735 -0.0245 0.0018  0.0575  74  TYR A N   
425  C CA  . TYR A 74  ? 0.6102 0.3677 0.3483 -0.0282 -0.0103 0.0538  74  TYR A CA  
426  C C   . TYR A 74  ? 0.7134 0.4985 0.4670 -0.0345 -0.0194 0.0656  74  TYR A C   
427  O O   . TYR A 74  ? 0.7152 0.5269 0.4834 -0.0418 -0.0199 0.0755  74  TYR A O   
428  C CB  . TYR A 74  ? 0.6124 0.3460 0.3211 -0.0403 -0.0172 0.0442  74  TYR A CB  
429  C CG  . TYR A 74  ? 0.6193 0.3207 0.3080 -0.0356 -0.0130 0.0320  74  TYR A CG  
430  C CD1 . TYR A 74  ? 0.6305 0.3128 0.3144 -0.0258 -0.0134 0.0254  74  TYR A CD1 
431  C CD2 . TYR A 74  ? 0.6368 0.3258 0.3093 -0.0429 -0.0104 0.0271  74  TYR A CD2 
432  C CE1 . TYR A 74  ? 0.6218 0.2755 0.2878 -0.0228 -0.0114 0.0151  74  TYR A CE1 
433  C CE2 . TYR A 74  ? 0.6537 0.3120 0.3060 -0.0399 -0.0087 0.0165  74  TYR A CE2 
434  C CZ  . TYR A 74  ? 0.7041 0.3454 0.3538 -0.0299 -0.0097 0.0108  74  TYR A CZ  
435  O OH  . TYR A 74  ? 0.6888 0.3011 0.3197 -0.0279 -0.0094 0.0015  74  TYR A OH  
436  N N   . SER A 75  ? 0.6899 0.4685 0.4399 -0.0327 -0.0269 0.0649  75  SER A N   
437  C CA  . SER A 75  ? 0.6943 0.4942 0.4548 -0.0390 -0.0365 0.0756  75  SER A CA  
438  C C   . SER A 75  ? 0.7598 0.5426 0.4962 -0.0503 -0.0481 0.0707  75  SER A C   
439  O O   . SER A 75  ? 0.7415 0.4957 0.4568 -0.0492 -0.0476 0.0587  75  SER A O   
440  C CB  . SER A 75  ? 0.7366 0.5528 0.5223 -0.0253 -0.0330 0.0841  75  SER A CB  
441  O OG  . SER A 75  ? 0.9172 0.7136 0.6946 -0.0172 -0.0339 0.0779  75  SER A OG  
442  N N   . PRO A 76  ? 0.7285 0.5285 0.4681 -0.0610 -0.0582 0.0805  76  PRO A N   
443  C CA  . PRO A 76  ? 0.7379 0.5203 0.4520 -0.0730 -0.0681 0.0765  76  PRO A CA  
444  C C   . PRO A 76  ? 0.7955 0.5457 0.4882 -0.0687 -0.0675 0.0640  76  PRO A C   
445  O O   . PRO A 76  ? 0.8230 0.5553 0.4910 -0.0801 -0.0729 0.0587  76  PRO A O   
446  C CB  . PRO A 76  ? 0.7608 0.5664 0.4869 -0.0793 -0.0771 0.0900  76  PRO A CB  
447  C CG  . PRO A 76  ? 0.8121 0.6507 0.5667 -0.0776 -0.0748 0.1020  76  PRO A CG  
448  C CD  . PRO A 76  ? 0.7438 0.5798 0.5096 -0.0638 -0.0613 0.0964  76  PRO A CD  
449  N N   . SER A 77  ? 0.7071 0.4499 0.4089 -0.0533 -0.0613 0.0600  77  SER A N   
450  C CA  . SER A 77  ? 0.7041 0.4199 0.3908 -0.0479 -0.0601 0.0493  77  SER A CA  
451  C C   . SER A 77  ? 0.7563 0.4740 0.4460 -0.0458 -0.0635 0.0533  77  SER A C   
452  O O   . SER A 77  ? 0.7565 0.4641 0.4499 -0.0347 -0.0591 0.0488  77  SER A O   
453  C CB  . SER A 77  ? 0.7595 0.4506 0.4192 -0.0569 -0.0627 0.0394  77  SER A CB  
454  O OG  . SER A 77  ? 0.7949 0.4623 0.4452 -0.0495 -0.0598 0.0291  77  SER A OG  
455  N N   . ALA A 78  ? 0.7203 0.4496 0.4069 -0.0571 -0.0718 0.0619  78  ALA A N   
456  C CA  . ALA A 78  ? 0.7176 0.4491 0.4062 -0.0560 -0.0757 0.0671  78  ALA A CA  
457  C C   . ALA A 78  ? 0.7627 0.5214 0.4798 -0.0478 -0.0754 0.0796  78  ALA A C   
458  O O   . ALA A 78  ? 0.7726 0.5350 0.4949 -0.0446 -0.0781 0.0852  78  ALA A O   
459  C CB  . ALA A 78  ? 0.7421 0.4701 0.4108 -0.0729 -0.0852 0.0707  78  ALA A CB  
460  N N   . GLY A 79  ? 0.7000 0.4764 0.4348 -0.0440 -0.0714 0.0839  79  GLY A N   
461  C CA  . GLY A 79  ? 0.6792 0.4826 0.4434 -0.0350 -0.0692 0.0960  79  GLY A CA  
462  C C   . GLY A 79  ? 0.6931 0.5251 0.4718 -0.0437 -0.0733 0.1075  79  GLY A C   
463  O O   . GLY A 79  ? 0.6820 0.5141 0.4457 -0.0600 -0.0809 0.1080  79  GLY A O   
464  N N   . ILE A 80  ? 0.6260 0.4824 0.4344 -0.0329 -0.0678 0.1172  80  ILE A N   
465  C CA  . ILE A 80  ? 0.6254 0.5142 0.4549 -0.0390 -0.0701 0.1300  80  ILE A CA  
466  C C   . ILE A 80  ? 0.7040 0.6123 0.5370 -0.0522 -0.0855 0.1439  80  ILE A C   
467  O O   . ILE A 80  ? 0.7109 0.6173 0.5455 -0.0479 -0.0902 0.1482  80  ILE A O   
468  C CB  . ILE A 80  ? 0.6582 0.5660 0.5187 -0.0225 -0.0574 0.1357  80  ILE A CB  
469  C CG1 . ILE A 80  ? 0.6708 0.5887 0.5528 -0.0076 -0.0559 0.1448  80  ILE A CG1 
470  C CG2 . ILE A 80  ? 0.6538 0.5379 0.5035 -0.0136 -0.0439 0.1214  80  ILE A CG2 
471  C CD1 . ILE A 80  ? 0.7479 0.7033 0.6670 -0.0011 -0.0540 0.1620  80  ILE A CD1 
472  N N   . PRO A 81  ? 0.6518 0.5751 0.4814 -0.0701 -0.0941 0.1500  81  PRO A N   
473  C CA  . PRO A 81  ? 0.6456 0.5831 0.4724 -0.0859 -0.1103 0.1625  81  PRO A CA  
474  C C   . PRO A 81  ? 0.6455 0.6075 0.4984 -0.0793 -0.1167 0.1787  81  PRO A C   
475  O O   . PRO A 81  ? 0.6350 0.5911 0.4739 -0.0885 -0.1286 0.1832  81  PRO A O   
476  C CB  . PRO A 81  ? 0.6753 0.6316 0.5036 -0.1030 -0.1157 0.1685  81  PRO A CB  
477  C CG  . PRO A 81  ? 0.7271 0.6862 0.5678 -0.0928 -0.1009 0.1621  81  PRO A CG  
478  C CD  . PRO A 81  ? 0.6680 0.5936 0.4931 -0.0783 -0.0901 0.1458  81  PRO A CD  
479  N N   . GLU A 82  ? 0.5677 0.5559 0.4573 -0.0638 -0.1086 0.1877  82  GLU A N   
480  C CA  . GLU A 82  ? 0.5594 0.5733 0.4788 -0.0545 -0.1132 0.2043  82  GLU A CA  
481  C C   . GLU A 82  ? 0.5690 0.5612 0.4834 -0.0387 -0.1087 0.1993  82  GLU A C   
482  O O   . GLU A 82  ? 0.5296 0.5309 0.4524 -0.0373 -0.1179 0.2108  82  GLU A O   
483  C CB  . GLU A 82  ? 0.5730 0.6258 0.5352 -0.0452 -0.1066 0.2179  82  GLU A CB  
484  C CG  . GLU A 82  ? 0.7119 0.7583 0.6823 -0.0304 -0.0868 0.2077  82  GLU A CG  
485  C CD  . GLU A 82  ? 0.9272 0.9637 0.8784 -0.0431 -0.0833 0.1968  82  GLU A CD  
486  O OE1 . GLU A 82  ? 0.7635 0.7644 0.6802 -0.0472 -0.0820 0.1803  82  GLU A OE1 
487  O OE2 . GLU A 82  ? 0.8547 0.9188 0.8251 -0.0494 -0.0822 0.2052  82  GLU A OE2 
488  N N   . LEU A 83  ? 0.5227 0.4849 0.4211 -0.0282 -0.0957 0.1821  83  LEU A N   
489  C CA  . LEU A 83  ? 0.5161 0.4546 0.4055 -0.0158 -0.0915 0.1756  83  LEU A CA  
490  C C   . LEU A 83  ? 0.6008 0.5186 0.4590 -0.0304 -0.1034 0.1716  83  LEU A C   
491  O O   . LEU A 83  ? 0.5901 0.5051 0.4480 -0.0276 -0.1090 0.1775  83  LEU A O   
492  C CB  . LEU A 83  ? 0.4985 0.4110 0.3783 -0.0034 -0.0758 0.1589  83  LEU A CB  
493  C CG  . LEU A 83  ? 0.5370 0.4247 0.4089 0.0102  -0.0696 0.1515  83  LEU A CG  
494  C CD1 . LEU A 83  ? 0.5337 0.4377 0.4323 0.0250  -0.0680 0.1649  83  LEU A CD1 
495  C CD2 . LEU A 83  ? 0.5415 0.4067 0.4047 0.0197  -0.0557 0.1364  83  LEU A CD2 
496  N N   . LEU A 84  ? 0.5822 0.4851 0.4135 -0.0464 -0.1070 0.1622  84  LEU A N   
497  C CA  . LEU A 84  ? 0.6057 0.4865 0.4043 -0.0614 -0.1164 0.1573  84  LEU A CA  
498  C C   . LEU A 84  ? 0.7242 0.6222 0.5242 -0.0747 -0.1325 0.1734  84  LEU A C   
499  O O   . LEU A 84  ? 0.7420 0.6229 0.5225 -0.0796 -0.1384 0.1728  84  LEU A O   
500  C CB  . LEU A 84  ? 0.6087 0.4713 0.3805 -0.0748 -0.1158 0.1452  84  LEU A CB  
501  C CG  . LEU A 84  ? 0.6650 0.4960 0.4189 -0.0666 -0.1042 0.1265  84  LEU A CG  
502  C CD1 . LEU A 84  ? 0.6685 0.4855 0.3999 -0.0793 -0.1043 0.1170  84  LEU A CD1 
503  C CD2 . LEU A 84  ? 0.7000 0.5049 0.4351 -0.0638 -0.1037 0.1193  84  LEU A CD2 
504  N N   . SER A 85  ? 0.6989 0.6308 0.5224 -0.0807 -0.1396 0.1884  85  SER A N   
505  C CA  . SER A 85  ? 0.7106 0.6632 0.5391 -0.0940 -0.1566 0.2060  85  SER A CA  
506  C C   . SER A 85  ? 0.7530 0.7162 0.6024 -0.0804 -0.1590 0.2175  85  SER A C   
507  O O   . SER A 85  ? 0.7488 0.7034 0.5822 -0.0891 -0.1703 0.2230  85  SER A O   
508  C CB  . SER A 85  ? 0.7606 0.7489 0.6121 -0.1035 -0.1628 0.2190  85  SER A CB  
509  O OG  . SER A 85  ? 0.8935 0.9111 0.7870 -0.0854 -0.1541 0.2276  85  SER A OG  
510  N N   . TRP A 86  ? 0.7077 0.6870 0.5905 -0.0591 -0.1476 0.2207  86  TRP A N   
511  C CA  . TRP A 86  ? 0.7136 0.7024 0.6186 -0.0431 -0.1476 0.2315  86  TRP A CA  
512  C C   . TRP A 86  ? 0.7404 0.6945 0.6181 -0.0399 -0.1463 0.2217  86  TRP A C   
513  O O   . TRP A 86  ? 0.7393 0.6950 0.6166 -0.0414 -0.1564 0.2323  86  TRP A O   
514  C CB  . TRP A 86  ? 0.6970 0.7012 0.6364 -0.0204 -0.1319 0.2330  86  TRP A CB  
515  C CG  . TRP A 86  ? 0.7211 0.7459 0.6915 -0.0056 -0.1340 0.2497  86  TRP A CG  
516  C CD1 . TRP A 86  ? 0.7600 0.8248 0.7676 -0.0032 -0.1401 0.2698  86  TRP A CD1 
517  C CD2 . TRP A 86  ? 0.7264 0.7322 0.6929 0.0082  -0.1307 0.2486  86  TRP A CD2 
518  N NE1 . TRP A 86  ? 0.7579 0.8293 0.7856 0.0126  -0.1406 0.2814  86  TRP A NE1 
519  C CE2 . TRP A 86  ? 0.7796 0.8141 0.7810 0.0193  -0.1352 0.2686  86  TRP A CE2 
520  C CE3 . TRP A 86  ? 0.7430 0.7108 0.6805 0.0122  -0.1244 0.2331  86  TRP A CE3 
521  C CZ2 . TRP A 86  ? 0.7767 0.8004 0.7819 0.0337  -0.1338 0.2731  86  TRP A CZ2 
522  C CZ3 . TRP A 86  ? 0.7688 0.7270 0.7103 0.0254  -0.1230 0.2374  86  TRP A CZ3 
523  C CH2 . TRP A 86  ? 0.7838 0.7685 0.7578 0.0363  -0.1275 0.2569  86  TRP A CH2 
524  N N   . LEU A 87  ? 0.6722 0.5953 0.5270 -0.0366 -0.1345 0.2020  87  LEU A N   
525  C CA  . LEU A 87  ? 0.6573 0.5463 0.4850 -0.0349 -0.1314 0.1903  87  LEU A CA  
526  C C   . LEU A 87  ? 0.6947 0.5701 0.4910 -0.0559 -0.1449 0.1914  87  LEU A C   
527  O O   . LEU A 87  ? 0.6888 0.5531 0.4749 -0.0562 -0.1499 0.1951  87  LEU A O   
528  C CB  . LEU A 87  ? 0.6419 0.5059 0.4559 -0.0282 -0.1167 0.1703  87  LEU A CB  
529  C CG  . LEU A 87  ? 0.6844 0.5385 0.5107 -0.0070 -0.1028 0.1642  87  LEU A CG  
530  C CD1 . LEU A 87  ? 0.6854 0.5643 0.5451 0.0072  -0.1018 0.1794  87  LEU A CD1 
531  C CD2 . LEU A 87  ? 0.6839 0.5267 0.5075 -0.0013 -0.0901 0.1496  87  LEU A CD2 
532  N N   . LYS A 88  ? 0.6382 0.5141 0.4182 -0.0739 -0.1510 0.1892  88  LYS A N   
533  C CA  . LYS A 88  ? 0.6574 0.5190 0.4049 -0.0954 -0.1636 0.1907  88  LYS A CA  
534  C C   . LYS A 88  ? 0.7259 0.6039 0.4817 -0.1006 -0.1787 0.2098  88  LYS A C   
535  O O   . LYS A 88  ? 0.7140 0.5710 0.4459 -0.1066 -0.1834 0.2092  88  LYS A O   
536  C CB  . LYS A 88  ? 0.6906 0.5564 0.4254 -0.1135 -0.1691 0.1895  88  LYS A CB  
537  C CG  . LYS A 88  ? 0.8432 0.6825 0.5350 -0.1354 -0.1778 0.1855  88  LYS A CG  
538  C CD  . LYS A 88  ? 0.8813 0.7319 0.5630 -0.1572 -0.1900 0.1929  88  LYS A CD  
539  C CE  . LYS A 88  ? 0.9238 0.7463 0.5612 -0.1790 -0.1993 0.1910  88  LYS A CE  
540  N NZ  . LYS A 88  ? 0.9985 0.8244 0.6193 -0.2012 -0.2091 0.1946  88  LYS A NZ  
541  N N   . GLN A 89  ? 0.6881 0.6038 0.4797 -0.0968 -0.1852 0.2269  89  GLN A N   
542  C CA  . GLN A 89  ? 0.6939 0.6314 0.5011 -0.0997 -0.2003 0.2475  89  GLN A CA  
543  C C   . GLN A 89  ? 0.7444 0.6691 0.5530 -0.0858 -0.1975 0.2489  89  GLN A C   
544  O O   . GLN A 89  ? 0.7551 0.6763 0.5517 -0.0951 -0.2108 0.2593  89  GLN A O   
545  C CB  . GLN A 89  ? 0.7021 0.6842 0.5539 -0.0937 -0.2041 0.2644  89  GLN A CB  
546  C CG  . GLN A 89  ? 1.0555 1.0562 0.9038 -0.1161 -0.2169 0.2721  89  GLN A CG  
547  C CD  . GLN A 89  ? 1.3630 1.3469 1.1738 -0.1412 -0.2343 0.2762  89  GLN A CD  
548  O OE1 . GLN A 89  ? 1.3404 1.3331 1.1543 -0.1461 -0.2488 0.2917  89  GLN A OE1 
549  N NE2 . GLN A 89  ? 1.2110 1.1671 0.9831 -0.1573 -0.2328 0.2619  89  GLN A NE2 
550  N N   . LEU A 90  ? 0.6891 0.6043 0.5093 -0.0645 -0.1804 0.2380  90  LEU A N   
551  C CA  . LEU A 90  ? 0.6766 0.5770 0.4984 -0.0491 -0.1747 0.2372  90  LEU A CA  
552  C C   . LEU A 90  ? 0.6953 0.5582 0.4760 -0.0591 -0.1743 0.2248  90  LEU A C   
553  O O   . LEU A 90  ? 0.6835 0.5373 0.4550 -0.0602 -0.1810 0.2316  90  LEU A O   
554  C CB  . LEU A 90  ? 0.6569 0.5552 0.4985 -0.0265 -0.1560 0.2274  90  LEU A CB  
555  C CG  . LEU A 90  ? 0.7109 0.5978 0.5603 -0.0081 -0.1487 0.2280  90  LEU A CG  
556  C CD1 . LEU A 90  ? 0.7143 0.6276 0.5927 -0.0003 -0.1582 0.2500  90  LEU A CD1 
557  C CD2 . LEU A 90  ? 0.7167 0.5954 0.5771 0.0101  -0.1299 0.2153  90  LEU A CD2 
558  N N   . GLN A 91  ? 0.6338 0.4750 0.3898 -0.0664 -0.1665 0.2072  91  GLN A N   
559  C CA  . GLN A 91  ? 0.6400 0.4457 0.3578 -0.0756 -0.1640 0.1946  91  GLN A CA  
560  C C   . GLN A 91  ? 0.7485 0.5482 0.4412 -0.0960 -0.1801 0.2047  91  GLN A C   
561  O O   . GLN A 91  ? 0.7775 0.5547 0.4490 -0.0983 -0.1802 0.2026  91  GLN A O   
562  C CB  . GLN A 91  ? 0.6359 0.4219 0.3352 -0.0788 -0.1529 0.1755  91  GLN A CB  
563  C CG  . GLN A 91  ? 0.6326 0.4170 0.3502 -0.0595 -0.1370 0.1642  91  GLN A CG  
564  C CD  . GLN A 91  ? 0.8710 0.6374 0.5877 -0.0459 -0.1279 0.1581  91  GLN A CD  
565  O OE1 . GLN A 91  ? 0.8866 0.6277 0.5846 -0.0456 -0.1188 0.1433  91  GLN A OE1 
566  N NE2 . GLN A 91  ? 0.5761 0.3556 0.3150 -0.0335 -0.1291 0.1693  91  GLN A NE2 
567  N N   . ILE A 92  ? 0.6999 0.5202 0.3954 -0.1110 -0.1940 0.2167  92  ILE A N   
568  C CA  . ILE A 92  ? 0.7172 0.5345 0.3895 -0.1325 -0.2118 0.2286  92  ILE A CA  
569  C C   . ILE A 92  ? 0.8102 0.6440 0.5032 -0.1249 -0.2216 0.2466  92  ILE A C   
570  O O   . ILE A 92  ? 0.8334 0.6463 0.5024 -0.1311 -0.2267 0.2486  92  ILE A O   
571  C CB  . ILE A 92  ? 0.7541 0.5915 0.4273 -0.1503 -0.2237 0.2366  92  ILE A CB  
572  C CG1 . ILE A 92  ? 0.7574 0.5759 0.4085 -0.1573 -0.2136 0.2185  92  ILE A CG1 
573  C CG2 . ILE A 92  ? 0.7749 0.6114 0.4257 -0.1733 -0.2440 0.2511  92  ILE A CG2 
574  C CD1 . ILE A 92  ? 0.7026 0.5485 0.3749 -0.1605 -0.2152 0.2218  92  ILE A CD1 
575  N N   . LYS A 93  ? 0.7600 0.6293 0.4975 -0.1099 -0.2227 0.2591  93  LYS A N   
576  C CA  . LYS A 93  ? 0.7596 0.6478 0.5226 -0.0996 -0.2314 0.2776  93  LYS A CA  
577  C C   . LYS A 93  ? 0.7879 0.6522 0.5434 -0.0855 -0.2228 0.2722  93  LYS A C   
578  O O   . LYS A 93  ? 0.7914 0.6650 0.5601 -0.0797 -0.2316 0.2874  93  LYS A O   
579  C CB  . LYS A 93  ? 0.7864 0.7156 0.5998 -0.0836 -0.2298 0.2897  93  LYS A CB  
580  C CG  . LYS A 93  ? 1.1580 1.1235 0.9915 -0.0964 -0.2499 0.3124  93  LYS A CG  
581  C CD  . LYS A 93  ? 1.3375 1.3200 1.1922 -0.0896 -0.2631 0.3341  93  LYS A CD  
582  C CE  . LYS A 93  ? 1.5007 1.5239 1.3819 -0.1006 -0.2829 0.3579  93  LYS A CE  
583  N NZ  . LYS A 93  ? 1.5846 1.6466 1.5131 -0.0868 -0.2751 0.3636  93  LYS A NZ  
584  N N   . LEU A 94  ? 0.7234 0.5580 0.4594 -0.0797 -0.2060 0.2513  94  LEU A N   
585  C CA  . LEU A 94  ? 0.7098 0.5199 0.4373 -0.0672 -0.1960 0.2438  94  LEU A CA  
586  C C   . LEU A 94  ? 0.8003 0.5732 0.4831 -0.0816 -0.1935 0.2309  94  LEU A C   
587  O O   . LEU A 94  ? 0.8143 0.5688 0.4830 -0.0803 -0.1938 0.2322  94  LEU A O   
588  C CB  . LEU A 94  ? 0.6755 0.4848 0.4233 -0.0460 -0.1769 0.2310  94  LEU A CB  
589  C CG  . LEU A 94  ? 0.7086 0.5281 0.4869 -0.0230 -0.1708 0.2383  94  LEU A CG  
590  C CD1 . LEU A 94  ? 0.7157 0.5646 0.5203 -0.0204 -0.1854 0.2621  94  LEU A CD1 
591  C CD2 . LEU A 94  ? 0.6806 0.5080 0.4815 -0.0069 -0.1552 0.2288  94  LEU A CD2 
592  N N   . HIS A 95  ? 0.7706 0.5310 0.4308 -0.0947 -0.1899 0.2182  95  HIS A N   
593  C CA  . HIS A 95  ? 0.7881 0.5122 0.4066 -0.1071 -0.1846 0.2045  95  HIS A CA  
594  C C   . HIS A 95  ? 0.8578 0.5723 0.4441 -0.1316 -0.1958 0.2068  95  HIS A C   
595  O O   . HIS A 95  ? 0.8712 0.5540 0.4208 -0.1425 -0.1918 0.1974  95  HIS A O   
596  C CB  . HIS A 95  ? 0.7807 0.4887 0.3964 -0.0977 -0.1657 0.1837  95  HIS A CB  
597  C CG  . HIS A 95  ? 0.8021 0.5210 0.4497 -0.0749 -0.1552 0.1814  95  HIS A CG  
598  N ND1 . HIS A 95  ? 0.8265 0.5362 0.4776 -0.0640 -0.1515 0.1834  95  HIS A ND1 
599  C CD2 . HIS A 95  ? 0.8047 0.5429 0.4806 -0.0624 -0.1490 0.1792  95  HIS A CD2 
600  C CE1 . HIS A 95  ? 0.8024 0.5242 0.4824 -0.0452 -0.1427 0.1815  95  HIS A CE1 
601  N NE2 . HIS A 95  ? 0.7925 0.5315 0.4881 -0.0435 -0.1406 0.1788  95  HIS A NE2 
602  N N   . ASN A 96  ? 0.8119 0.5521 0.4103 -0.1410 -0.2090 0.2188  96  ASN A N   
603  C CA  . ASN A 96  ? 0.8341 0.5660 0.4011 -0.1664 -0.2212 0.2220  96  ASN A CA  
604  C C   . ASN A 96  ? 0.9054 0.5967 0.4299 -0.1755 -0.2090 0.2025  96  ASN A C   
605  O O   . ASN A 96  ? 0.9284 0.5930 0.4169 -0.1894 -0.2127 0.2025  96  ASN A O   
606  C CB  . ASN A 96  ? 0.8461 0.5829 0.4035 -0.1803 -0.2413 0.2415  96  ASN A CB  
607  C CG  . ASN A 96  ? 1.0918 0.8286 0.6244 -0.2067 -0.2576 0.2494  96  ASN A CG  
608  O OD1 . ASN A 96  ? 0.9746 0.7442 0.5309 -0.2118 -0.2716 0.2648  96  ASN A OD1 
609  N ND2 . ASN A 96  ? 1.0457 0.7449 0.5291 -0.2248 -0.2560 0.2398  96  ASN A ND2 
610  N N   . PRO A 97  ? 0.8348 0.5197 0.3645 -0.1654 -0.1927 0.1856  97  PRO A N   
611  C CA  . PRO A 97  ? 0.8413 0.4890 0.3351 -0.1712 -0.1799 0.1677  97  PRO A CA  
612  C C   . PRO A 97  ? 0.9355 0.5641 0.3889 -0.1962 -0.1880 0.1680  97  PRO A C   
613  O O   . PRO A 97  ? 0.9082 0.5546 0.3661 -0.2068 -0.1997 0.1765  97  PRO A O   
614  C CB  . PRO A 97  ? 0.8275 0.4790 0.3410 -0.1555 -0.1646 0.1533  97  PRO A CB  
615  C CG  . PRO A 97  ? 0.8499 0.5362 0.4086 -0.1384 -0.1667 0.1625  97  PRO A CG  
616  C CD  . PRO A 97  ? 0.8085 0.5180 0.3751 -0.1490 -0.1854 0.1823  97  PRO A CD  
617  N N   . PRO A 98  ? 0.9483 0.5403 0.3613 -0.2065 -0.1824 0.1600  98  PRO A N   
618  C CA  . PRO A 98  ? 0.9909 0.5577 0.3586 -0.2312 -0.1885 0.1591  98  PRO A CA  
619  C C   . PRO A 98  ? 1.0489 0.6126 0.4106 -0.2355 -0.1836 0.1495  98  PRO A C   
620  O O   . PRO A 98  ? 1.0679 0.6296 0.4091 -0.2549 -0.1953 0.1555  98  PRO A O   
621  C CB  . PRO A 98  ? 1.0362 0.5628 0.3672 -0.2347 -0.1759 0.1478  98  PRO A CB  
622  C CG  . PRO A 98  ? 1.0690 0.6049 0.4258 -0.2165 -0.1705 0.1495  98  PRO A CG  
623  C CD  . PRO A 98  ? 0.9698 0.5403 0.3755 -0.1962 -0.1686 0.1506  98  PRO A CD  
624  N N   . THR A 99  ? 0.9776 0.5413 0.3577 -0.2176 -0.1672 0.1354  99  THR A N   
625  C CA  . THR A 99  ? 0.9730 0.5318 0.3506 -0.2171 -0.1595 0.1241  99  THR A CA  
626  C C   . THR A 99  ? 1.0098 0.5996 0.4093 -0.2210 -0.1713 0.1336  99  THR A C   
627  O O   . THR A 99  ? 1.0005 0.5837 0.3915 -0.2250 -0.1674 0.1257  99  THR A O   
628  C CB  . THR A 99  ? 1.1340 0.6886 0.5306 -0.1956 -0.1410 0.1092  99  THR A CB  
629  O OG1 . THR A 99  ? 1.1702 0.7518 0.6062 -0.1781 -0.1417 0.1157  99  THR A OG1 
630  C CG2 . THR A 99  ? 1.1502 0.6689 0.5175 -0.1961 -0.1271 0.0970  99  THR A CG2 
631  N N   . ILE A 100 ? 0.9593 0.5823 0.3870 -0.2198 -0.1853 0.1506  100 ILE A N   
632  C CA  . ILE A 100 ? 0.9459 0.6042 0.4003 -0.2231 -0.1973 0.1628  100 ILE A CA  
633  C C   . ILE A 100 ? 0.9872 0.6365 0.4147 -0.2442 -0.2040 0.1620  100 ILE A C   
634  O O   . ILE A 100 ? 0.9682 0.6313 0.4122 -0.2401 -0.2006 0.1584  100 ILE A O   
635  C CB  . ILE A 100 ? 0.9920 0.6817 0.4720 -0.2232 -0.2134 0.1837  100 ILE A CB  
636  C CG1 . ILE A 100 ? 0.9751 0.7066 0.4923 -0.2220 -0.2228 0.1963  100 ILE A CG1 
637  C CG2 . ILE A 100 ? 1.0736 0.7460 0.5174 -0.2455 -0.2280 0.1936  100 ILE A CG2 
638  C CD1 . ILE A 100 ? 1.0837 0.8492 0.6299 -0.2216 -0.2388 0.2182  100 ILE A CD1 
639  N N   . HIS A 101 ? 0.9590 0.5822 0.3425 -0.2672 -0.2126 0.1646  101 HIS A N   
640  C CA  . HIS A 101 ? 0.9700 0.5797 0.3211 -0.2904 -0.2202 0.1648  101 HIS A CA  
641  C C   . HIS A 101 ? 1.0013 0.5623 0.3038 -0.2985 -0.2073 0.1472  101 HIS A C   
642  O O   . HIS A 101 ? 1.0173 0.5587 0.2835 -0.3202 -0.2136 0.1473  101 HIS A O   
643  C CB  . HIS A 101 ? 1.0086 0.6282 0.3464 -0.3136 -0.2427 0.1839  101 HIS A CB  
644  C CG  . HIS A 101 ? 1.0271 0.6974 0.4136 -0.3082 -0.2566 0.2026  101 HIS A CG  
645  N ND1 . HIS A 101 ? 1.0438 0.7329 0.4522 -0.3011 -0.2649 0.2161  101 HIS A ND1 
646  C CD2 . HIS A 101 ? 1.0306 0.7348 0.4471 -0.3086 -0.2625 0.2099  101 HIS A CD2 
647  C CE1 . HIS A 101 ? 1.0159 0.7502 0.4679 -0.2966 -0.2752 0.2313  101 HIS A CE1 
648  N NE2 . HIS A 101 ? 1.0120 0.7575 0.4710 -0.3010 -0.2738 0.2281  101 HIS A NE2 
649  N N   . TYR A 102 ? 0.9312 0.4727 0.2334 -0.2812 -0.1889 0.1325  102 TYR A N   
650  C CA  . TYR A 102 ? 0.9554 0.4526 0.2176 -0.2847 -0.1740 0.1156  102 TYR A CA  
651  C C   . TYR A 102 ? 1.0385 0.5322 0.2991 -0.2846 -0.1687 0.1068  102 TYR A C   
652  O O   . TYR A 102 ? 1.0132 0.5393 0.3125 -0.2732 -0.1704 0.1097  102 TYR A O   
653  C CB  . TYR A 102 ? 0.9419 0.4297 0.2179 -0.2624 -0.1555 0.1032  102 TYR A CB  
654  C CG  . TYR A 102 ? 0.9724 0.4442 0.2330 -0.2636 -0.1535 0.1050  102 TYR A CG  
655  C CD1 . TYR A 102 ? 0.9952 0.4468 0.2534 -0.2496 -0.1352 0.0918  102 TYR A CD1 
656  C CD2 . TYR A 102 ? 0.9854 0.4647 0.2369 -0.2782 -0.1704 0.1207  102 TYR A CD2 
657  C CE1 . TYR A 102 ? 0.9984 0.4364 0.2438 -0.2506 -0.1327 0.0935  102 TYR A CE1 
658  C CE2 . TYR A 102 ? 1.0004 0.4649 0.2380 -0.2790 -0.1688 0.1226  102 TYR A CE2 
659  C CZ  . TYR A 102 ? 1.0413 0.4848 0.2754 -0.2653 -0.1494 0.1087  102 TYR A CZ  
660  O OH  . TYR A 102 ? 1.0371 0.4659 0.2576 -0.2663 -0.1469 0.1104  102 TYR A OH  
661  N N   . PRO A 103 ? 1.0298 0.4827 0.2470 -0.2950 -0.1601 0.0949  103 PRO A N   
662  C CA  . PRO A 103 ? 1.0191 0.4669 0.2363 -0.2920 -0.1535 0.0855  103 PRO A CA  
663  C C   . PRO A 103 ? 1.0333 0.4965 0.2909 -0.2643 -0.1396 0.0761  103 PRO A C   
664  O O   . PRO A 103 ? 1.0102 0.4735 0.2816 -0.2499 -0.1312 0.0727  103 PRO A O   
665  C CB  . PRO A 103 ? 1.0810 0.4772 0.2444 -0.3035 -0.1431 0.0734  103 PRO A CB  
666  C CG  . PRO A 103 ? 1.1667 0.5449 0.2964 -0.3216 -0.1508 0.0808  103 PRO A CG  
667  C CD  . PRO A 103 ? 1.0852 0.4931 0.2510 -0.3087 -0.1544 0.0890  103 PRO A CD  
668  N N   . PRO A 104 ? 0.9919 0.4681 0.2687 -0.2568 -0.1373 0.0721  104 PRO A N   
669  C CA  . PRO A 104 ? 0.9638 0.4525 0.2765 -0.2315 -0.1249 0.0635  104 PRO A CA  
670  C C   . PRO A 104 ? 1.0393 0.4974 0.3390 -0.2198 -0.1077 0.0494  104 PRO A C   
671  O O   . PRO A 104 ? 0.9993 0.4680 0.3231 -0.2044 -0.1018 0.0483  104 PRO A O   
672  C CB  . PRO A 104 ? 0.9700 0.4667 0.2910 -0.2311 -0.1257 0.0607  104 PRO A CB  
673  C CG  . PRO A 104 ? 1.0372 0.5448 0.3451 -0.2534 -0.1420 0.0732  104 PRO A CG  
674  C CD  . PRO A 104 ? 1.0197 0.4985 0.2854 -0.2714 -0.1458 0.0752  104 PRO A CD  
675  N N   . SER A 105 ? 1.0503 0.4697 0.3097 -0.2289 -0.1002 0.0399  105 SER A N   
676  C CA  . SER A 105 ? 1.0705 0.4563 0.3112 -0.2210 -0.0830 0.0267  105 SER A CA  
677  C C   . SER A 105 ? 1.1322 0.5119 0.3692 -0.2191 -0.0786 0.0282  105 SER A C   
678  O O   . SER A 105 ? 1.1148 0.4803 0.3548 -0.2061 -0.0634 0.0185  105 SER A O   
679  C CB  . SER A 105 ? 1.1712 0.5163 0.3627 -0.2370 -0.0793 0.0205  105 SER A CB  
680  O OG  . SER A 105 ? 1.3653 0.6992 0.5236 -0.2594 -0.0898 0.0293  105 SER A OG  
681  N N   . GLN A 106 ? 1.1020 0.4917 0.3312 -0.2332 -0.0921 0.0406  106 GLN A N   
682  C CA  . GLN A 106 ? 1.1056 0.4902 0.3290 -0.2340 -0.0907 0.0440  106 GLN A CA  
683  C C   . GLN A 106 ? 1.0910 0.5103 0.3598 -0.2171 -0.0929 0.0499  106 GLN A C   
684  O O   . GLN A 106 ? 1.0794 0.4969 0.3459 -0.2173 -0.0929 0.0539  106 GLN A O   
685  C CB  . GLN A 106 ? 1.1653 0.5352 0.3498 -0.2591 -0.1035 0.0539  106 GLN A CB  
686  C CG  . GLN A 106 ? 1.4416 0.7652 0.5716 -0.2756 -0.0967 0.0457  106 GLN A CG  
687  C CD  . GLN A 106 ? 1.7727 1.0620 0.8862 -0.2651 -0.0739 0.0300  106 GLN A CD  
688  O OE1 . GLN A 106 ? 1.8177 1.0788 0.9070 -0.2670 -0.0640 0.0201  106 GLN A OE1 
689  N NE2 . GLN A 106 ? 1.5781 0.8687 0.7045 -0.2537 -0.0646 0.0278  106 GLN A NE2 
690  N N   . GLY A 107 ? 1.0121 0.4593 0.3192 -0.2025 -0.0936 0.0496  107 GLY A N   
691  C CA  . GLY A 107 ? 0.9727 0.4506 0.3227 -0.1850 -0.0940 0.0538  107 GLY A CA  
692  C C   . GLY A 107 ? 0.9872 0.5001 0.3616 -0.1877 -0.1102 0.0693  107 GLY A C   
693  O O   . GLY A 107 ? 0.9409 0.4732 0.3413 -0.1772 -0.1119 0.0754  107 GLY A O   
694  N N   . GLN A 108 ? 0.9569 0.4780 0.3235 -0.2016 -0.1216 0.0760  108 GLN A N   
695  C CA  . GLN A 108 ? 0.9422 0.4985 0.3322 -0.2062 -0.1375 0.0917  108 GLN A CA  
696  C C   . GLN A 108 ? 0.9815 0.5688 0.4183 -0.1847 -0.1345 0.0943  108 GLN A C   
697  O O   . GLN A 108 ? 0.9837 0.5705 0.4361 -0.1698 -0.1233 0.0838  108 GLN A O   
698  C CB  . GLN A 108 ? 0.9571 0.5182 0.3398 -0.2183 -0.1442 0.0933  108 GLN A CB  
699  C CG  . GLN A 108 ? 0.9743 0.5740 0.3838 -0.2233 -0.1595 0.1095  108 GLN A CG  
700  C CD  . GLN A 108 ? 1.2272 0.8252 0.6205 -0.2396 -0.1659 0.1105  108 GLN A CD  
701  O OE1 . GLN A 108 ? 1.1343 0.7332 0.5360 -0.2328 -0.1589 0.1024  108 GLN A OE1 
702  N NE2 . GLN A 108 ? 1.2165 0.8097 0.5838 -0.2625 -0.1797 0.1203  108 GLN A NE2 
703  N N   . MET A 109 ? 0.9088 0.5209 0.3666 -0.1830 -0.1444 0.1083  109 MET A N   
704  C CA  . MET A 109 ? 0.8564 0.4954 0.3566 -0.1625 -0.1409 0.1112  109 MET A CA  
705  C C   . MET A 109 ? 0.8913 0.5516 0.4167 -0.1554 -0.1393 0.1100  109 MET A C   
706  O O   . MET A 109 ? 0.8756 0.5498 0.4005 -0.1675 -0.1489 0.1176  109 MET A O   
707  C CB  . MET A 109 ? 0.8700 0.5302 0.3870 -0.1619 -0.1518 0.1274  109 MET A CB  
708  C CG  . MET A 109 ? 0.8650 0.5506 0.4236 -0.1407 -0.1476 0.1310  109 MET A CG  
709  S SD  . MET A 109 ? 0.8994 0.6224 0.4874 -0.1410 -0.1634 0.1538  109 MET A SD  
710  C CE  . MET A 109 ? 0.8601 0.6046 0.4523 -0.1555 -0.1738 0.1613  109 MET A CE  
711  N N   . ASP A 110 ? 0.8441 0.5033 0.3875 -0.1372 -0.1267 0.0996  110 ASP A N   
712  C CA  . ASP A 110 ? 0.8314 0.5060 0.3971 -0.1282 -0.1226 0.0965  110 ASP A CA  
713  C C   . ASP A 110 ? 0.8761 0.5658 0.4746 -0.1076 -0.1157 0.0966  110 ASP A C   
714  O O   . ASP A 110 ? 0.8740 0.5502 0.4714 -0.0984 -0.1086 0.0908  110 ASP A O   
715  C CB  . ASP A 110 ? 0.8543 0.5041 0.4007 -0.1288 -0.1136 0.0811  110 ASP A CB  
716  C CG  . ASP A 110 ? 0.8884 0.5496 0.4432 -0.1303 -0.1144 0.0802  110 ASP A CG  
717  O OD1 . ASP A 110 ? 0.8943 0.5803 0.4617 -0.1373 -0.1237 0.0921  110 ASP A OD1 
718  O OD2 . ASP A 110 ? 0.8965 0.5414 0.4443 -0.1254 -0.1060 0.0681  110 ASP A OD2 
719  N N   . LEU A 111 ? 0.8265 0.5428 0.4529 -0.1011 -0.1171 0.1032  111 LEU A N   
720  C CA  . LEU A 111 ? 0.8076 0.5380 0.4645 -0.0818 -0.1101 0.1041  111 LEU A CA  
721  C C   . LEU A 111 ? 0.8404 0.5685 0.5054 -0.0731 -0.1008 0.0938  111 LEU A C   
722  O O   . LEU A 111 ? 0.8279 0.5530 0.4819 -0.0822 -0.1021 0.0901  111 LEU A O   
723  C CB  . LEU A 111 ? 0.8070 0.5698 0.4914 -0.0793 -0.1177 0.1210  111 LEU A CB  
724  C CG  . LEU A 111 ? 0.8805 0.6479 0.5670 -0.0799 -0.1250 0.1321  111 LEU A CG  
725  C CD1 . LEU A 111 ? 0.9034 0.6729 0.5706 -0.1007 -0.1393 0.1418  111 LEU A CD1 
726  C CD2 . LEU A 111 ? 0.9076 0.7029 0.6296 -0.0661 -0.1253 0.1445  111 LEU A CD2 
727  N N   . CYS A 112 ? 0.7850 0.5129 0.4673 -0.0561 -0.0918 0.0894  112 CYS A N   
728  C CA  . CYS A 112 ? 0.7654 0.4885 0.4542 -0.0471 -0.0829 0.0797  112 CYS A CA  
729  C C   . CYS A 112 ? 0.7655 0.4972 0.4783 -0.0300 -0.0757 0.0812  112 CYS A C   
730  O O   . CYS A 112 ? 0.7767 0.4991 0.4907 -0.0221 -0.0724 0.0794  112 CYS A O   
731  C CB  . CYS A 112 ? 0.7761 0.4707 0.4434 -0.0481 -0.0776 0.0652  112 CYS A CB  
732  S SG  . CYS A 112 ? 0.8168 0.5027 0.4863 -0.0412 -0.0698 0.0537  112 CYS A SG  
733  N N   . VAL A 113 ? 0.6650 0.4124 0.3951 -0.0247 -0.0726 0.0842  113 VAL A N   
734  C CA  . VAL A 113 ? 0.6310 0.3840 0.3816 -0.0085 -0.0642 0.0852  113 VAL A CA  
735  C C   . VAL A 113 ? 0.6337 0.3633 0.3747 -0.0019 -0.0558 0.0708  113 VAL A C   
736  O O   . VAL A 113 ? 0.6300 0.3505 0.3595 -0.0073 -0.0550 0.0629  113 VAL A O   
737  C CB  . VAL A 113 ? 0.6740 0.4525 0.4472 -0.0048 -0.0622 0.0944  113 VAL A CB  
738  C CG1 . VAL A 113 ? 0.6649 0.4469 0.4576 0.0127  -0.0528 0.0967  113 VAL A CG1 
739  C CG2 . VAL A 113 ? 0.6742 0.4783 0.4569 -0.0145 -0.0727 0.1092  113 VAL A CG2 
740  N N   . THR A 114 ? 0.5602 0.2793 0.3050 0.0091  -0.0504 0.0678  114 THR A N   
741  C CA  . THR A 114 ? 0.5411 0.2388 0.2784 0.0153  -0.0435 0.0555  114 THR A CA  
742  C C   . THR A 114 ? 0.5677 0.2663 0.3189 0.0285  -0.0351 0.0561  114 THR A C   
743  O O   . THR A 114 ? 0.5605 0.2753 0.3279 0.0347  -0.0338 0.0663  114 THR A O   
744  C CB  . THR A 114 ? 0.5742 0.2537 0.2988 0.0138  -0.0441 0.0491  114 THR A CB  
745  O OG1 . THR A 114 ? 0.5262 0.2088 0.2578 0.0190  -0.0443 0.0558  114 THR A OG1 
746  C CG2 . THR A 114 ? 0.5564 0.2301 0.2636 0.0009  -0.0499 0.0464  114 THR A CG2 
747  N N   . SER A 115 ? 0.5108 0.1915 0.2551 0.0327  -0.0295 0.0458  115 SER A N   
748  C CA  . SER A 115 ? 0.5145 0.1899 0.2663 0.0442  -0.0209 0.0448  115 SER A CA  
749  C C   . SER A 115 ? 0.6084 0.2712 0.3596 0.0511  -0.0188 0.0438  115 SER A C   
750  O O   . SER A 115 ? 0.6010 0.2444 0.3435 0.0531  -0.0161 0.0351  115 SER A O   
751  C CB  . SER A 115 ? 0.5574 0.2188 0.2997 0.0435  -0.0173 0.0353  115 SER A CB  
752  O OG  . SER A 115 ? 0.7016 0.3746 0.4439 0.0366  -0.0191 0.0371  115 SER A OG  
753  N N   . GLY A 116 ? 0.5748 0.2495 0.3351 0.0533  -0.0211 0.0535  116 GLY A N   
754  C CA  . GLY A 116 ? 0.5628 0.2286 0.3221 0.0577  -0.0208 0.0550  116 GLY A CA  
755  C C   . GLY A 116 ? 0.5895 0.2521 0.3380 0.0477  -0.0278 0.0530  116 GLY A C   
756  O O   . GLY A 116 ? 0.5589 0.2181 0.2976 0.0390  -0.0309 0.0467  116 GLY A O   
757  N N   . SER A 117 ? 0.5492 0.2107 0.2979 0.0488  -0.0298 0.0583  117 SER A N   
758  C CA  . SER A 117 ? 0.5384 0.1944 0.2749 0.0394  -0.0350 0.0567  117 SER A CA  
759  C C   . SER A 117 ? 0.5767 0.2138 0.3015 0.0364  -0.0320 0.0442  117 SER A C   
760  O O   . SER A 117 ? 0.5740 0.2067 0.2878 0.0276  -0.0348 0.0405  117 SER A O   
761  C CB  . SER A 117 ? 0.5744 0.2318 0.3127 0.0413  -0.0372 0.0654  117 SER A CB  
762  O OG  . SER A 117 ? 0.7040 0.3450 0.4397 0.0475  -0.0317 0.0609  117 SER A OG  
763  N N   . GLN A 118 ? 0.5203 0.1462 0.2474 0.0436  -0.0263 0.0380  118 GLN A N   
764  C CA  . GLN A 118 ? 0.5218 0.1321 0.2419 0.0417  -0.0241 0.0273  118 GLN A CA  
765  C C   . GLN A 118 ? 0.5799 0.1905 0.2940 0.0350  -0.0265 0.0211  118 GLN A C   
766  O O   . GLN A 118 ? 0.5606 0.1621 0.2681 0.0306  -0.0266 0.0143  118 GLN A O   
767  C CB  . GLN A 118 ? 0.5422 0.1417 0.2653 0.0498  -0.0189 0.0237  118 GLN A CB  
768  C CG  . GLN A 118 ? 0.6433 0.2273 0.3614 0.0480  -0.0176 0.0147  118 GLN A CG  
769  C CD  . GLN A 118 ? 0.8137 0.3916 0.5298 0.0464  -0.0169 0.0150  118 GLN A CD  
770  O OE1 . GLN A 118 ? 0.7930 0.3713 0.5104 0.0498  -0.0157 0.0213  118 GLN A OE1 
771  N NE2 . GLN A 118 ? 0.6907 0.2629 0.4039 0.0412  -0.0173 0.0086  118 GLN A NE2 
772  N N   . GLN A 119 ? 0.5516 0.1724 0.2685 0.0344  -0.0280 0.0237  119 GLN A N   
773  C CA  . GLN A 119 ? 0.5560 0.1764 0.2657 0.0277  -0.0306 0.0189  119 GLN A CA  
774  C C   . GLN A 119 ? 0.5929 0.2145 0.2927 0.0181  -0.0348 0.0196  119 GLN A C   
775  O O   . GLN A 119 ? 0.5842 0.1961 0.2746 0.0133  -0.0352 0.0126  119 GLN A O   
776  C CB  . GLN A 119 ? 0.5715 0.2037 0.2862 0.0282  -0.0309 0.0228  119 GLN A CB  
777  C CG  . GLN A 119 ? 0.6182 0.2510 0.3234 0.0193  -0.0347 0.0196  119 GLN A CG  
778  C CD  . GLN A 119 ? 0.7335 0.3697 0.4405 0.0201  -0.0333 0.0189  119 GLN A CD  
779  O OE1 . GLN A 119 ? 0.7723 0.4240 0.4876 0.0204  -0.0330 0.0263  119 GLN A OE1 
780  N NE2 . GLN A 119 ? 0.4882 0.1103 0.1872 0.0194  -0.0327 0.0104  119 GLN A NE2 
781  N N   . GLY A 120 ? 0.5348 0.1671 0.2362 0.0156  -0.0378 0.0285  120 GLY A N   
782  C CA  . GLY A 120 ? 0.5374 0.1696 0.2269 0.0056  -0.0421 0.0307  120 GLY A CA  
783  C C   . GLY A 120 ? 0.6168 0.2332 0.2971 0.0040  -0.0388 0.0238  120 GLY A C   
784  O O   . GLY A 120 ? 0.6199 0.2270 0.2878 -0.0025 -0.0386 0.0181  120 GLY A O   
785  N N   . LEU A 121 ? 0.5835 0.1958 0.2701 0.0104  -0.0353 0.0241  121 LEU A N   
786  C CA  . LEU A 121 ? 0.5864 0.1855 0.2674 0.0095  -0.0311 0.0186  121 LEU A CA  
787  C C   . LEU A 121 ? 0.6161 0.2051 0.2963 0.0103  -0.0276 0.0085  121 LEU A C   
788  O O   . LEU A 121 ? 0.5931 0.1734 0.2644 0.0055  -0.0252 0.0038  121 LEU A O   
789  C CB  . LEU A 121 ? 0.5890 0.1860 0.2783 0.0166  -0.0282 0.0209  121 LEU A CB  
790  C CG  . LEU A 121 ? 0.6558 0.2599 0.3464 0.0172  -0.0310 0.0311  121 LEU A CG  
791  C CD1 . LEU A 121 ? 0.6602 0.2618 0.3609 0.0269  -0.0278 0.0331  121 LEU A CD1 
792  C CD2 . LEU A 121 ? 0.6739 0.2722 0.3510 0.0087  -0.0319 0.0329  121 LEU A CD2 
793  N N   . CYS A 122 ? 0.5792 0.1685 0.2685 0.0167  -0.0270 0.0055  122 CYS A N   
794  C CA  . CYS A 122 ? 0.5834 0.1641 0.2738 0.0181  -0.0254 -0.0029 122 CYS A CA  
795  C C   . CYS A 122 ? 0.6231 0.2008 0.3034 0.0120  -0.0269 -0.0063 122 CYS A C   
796  O O   . CYS A 122 ? 0.6361 0.2051 0.3125 0.0103  -0.0240 -0.0115 122 CYS A O   
797  C CB  . CYS A 122 ? 0.5935 0.1742 0.2915 0.0242  -0.0259 -0.0041 122 CYS A CB  
798  S SG  . CYS A 122 ? 0.6493 0.2186 0.3503 0.0261  -0.0256 -0.0130 122 CYS A SG  
799  N N   . LYS A 123 ? 0.5619 0.1466 0.2373 0.0084  -0.0308 -0.0027 123 LYS A N   
800  C CA  . LYS A 123 ? 0.5655 0.1456 0.2282 0.0015  -0.0327 -0.0053 123 LYS A CA  
801  C C   . LYS A 123 ? 0.6049 0.1766 0.2544 -0.0051 -0.0305 -0.0065 123 LYS A C   
802  O O   . LYS A 123 ? 0.5737 0.1336 0.2141 -0.0075 -0.0282 -0.0125 123 LYS A O   
803  C CB  . LYS A 123 ? 0.6011 0.1924 0.2615 -0.0027 -0.0375 0.0005  123 LYS A CB  
804  C CG  . LYS A 123 ? 0.6296 0.2174 0.2869 -0.0034 -0.0391 -0.0038 123 LYS A CG  
805  C CD  . LYS A 123 ? 0.5114 0.1026 0.1806 0.0044  -0.0381 -0.0042 123 LYS A CD  
806  C CE  . LYS A 123 ? 0.6908 0.2686 0.3588 0.0076  -0.0372 -0.0123 123 LYS A CE  
807  N NZ  . LYS A 123 ? 1.0278 0.6051 0.7052 0.0147  -0.0359 -0.0131 123 LYS A NZ  
808  N N   . VAL A 124 ? 0.5877 0.1637 0.2355 -0.0076 -0.0307 -0.0007 124 VAL A N   
809  C CA  . VAL A 124 ? 0.6008 0.1676 0.2338 -0.0146 -0.0282 -0.0008 124 VAL A CA  
810  C C   . VAL A 124 ? 0.6361 0.1911 0.2719 -0.0105 -0.0203 -0.0086 124 VAL A C   
811  O O   . VAL A 124 ? 0.6307 0.1736 0.2550 -0.0140 -0.0163 -0.0138 124 VAL A O   
812  C CB  . VAL A 124 ? 0.6415 0.2156 0.2729 -0.0178 -0.0311 0.0081  124 VAL A CB  
813  C CG1 . VAL A 124 ? 0.6506 0.2121 0.2637 -0.0259 -0.0280 0.0074  124 VAL A CG1 
814  C CG2 . VAL A 124 ? 0.6347 0.2229 0.2660 -0.0222 -0.0393 0.0168  124 VAL A CG2 
815  N N   . PHE A 125 ? 0.5868 0.1454 0.2386 -0.0029 -0.0181 -0.0093 125 PHE A N   
816  C CA  . PHE A 125 ? 0.5850 0.1365 0.2444 0.0012  -0.0115 -0.0154 125 PHE A CA  
817  C C   . PHE A 125 ? 0.6569 0.2022 0.3173 0.0032  -0.0104 -0.0220 125 PHE A C   
818  O O   . PHE A 125 ? 0.6802 0.2159 0.3360 0.0022  -0.0044 -0.0266 125 PHE A O   
819  C CB  . PHE A 125 ? 0.5906 0.1476 0.2667 0.0082  -0.0117 -0.0145 125 PHE A CB  
820  C CG  . PHE A 125 ? 0.6046 0.1651 0.2812 0.0079  -0.0117 -0.0085 125 PHE A CG  
821  C CD1 . PHE A 125 ? 0.6230 0.1879 0.3103 0.0138  -0.0135 -0.0057 125 PHE A CD1 
822  C CD2 . PHE A 125 ? 0.6422 0.1991 0.3062 0.0017  -0.0097 -0.0054 125 PHE A CD2 
823  C CE1 . PHE A 125 ? 0.6417 0.2080 0.3286 0.0142  -0.0134 0.0002  125 PHE A CE1 
824  C CE2 . PHE A 125 ? 0.6790 0.2380 0.3426 0.0015  -0.0105 0.0008  125 PHE A CE2 
825  C CZ  . PHE A 125 ? 0.6445 0.2084 0.3203 0.0082  -0.0122 0.0037  125 PHE A CZ  
826  N N   . GLU A 126 ? 0.5982 0.1478 0.2631 0.0059  -0.0159 -0.0220 126 GLU A N   
827  C CA  . GLU A 126 ? 0.5948 0.1381 0.2600 0.0078  -0.0167 -0.0274 126 GLU A CA  
828  C C   . GLU A 126 ? 0.6568 0.1890 0.3047 0.0022  -0.0139 -0.0301 126 GLU A C   
829  O O   . GLU A 126 ? 0.6562 0.1793 0.3054 0.0047  -0.0087 -0.0351 126 GLU A O   
830  C CB  . GLU A 126 ? 0.6002 0.1488 0.2693 0.0100  -0.0230 -0.0262 126 GLU A CB  
831  C CG  . GLU A 126 ? 0.6656 0.2182 0.3501 0.0164  -0.0239 -0.0261 126 GLU A CG  
832  C CD  . GLU A 126 ? 0.9076 0.4600 0.5955 0.0194  -0.0285 -0.0271 126 GLU A CD  
833  O OE1 . GLU A 126 ? 0.8916 0.4424 0.5893 0.0236  -0.0291 -0.0284 126 GLU A OE1 
834  O OE2 . GLU A 126 ? 0.8111 0.3642 0.4908 0.0167  -0.0315 -0.0263 126 GLU A OE2 
835  N N   . MET A 127 ? 0.6163 0.1491 0.2481 -0.0057 -0.0168 -0.0260 127 MET A N   
836  C CA  . MET A 127 ? 0.6164 0.1360 0.2264 -0.0134 -0.0149 -0.0279 127 MET A CA  
837  C C   . MET A 127 ? 0.6359 0.1433 0.2351 -0.0163 -0.0064 -0.0304 127 MET A C   
838  O O   . MET A 127 ? 0.6322 0.1248 0.2105 -0.0226 -0.0036 -0.0327 127 MET A O   
839  C CB  . MET A 127 ? 0.6458 0.1704 0.2416 -0.0227 -0.0220 -0.0221 127 MET A CB  
840  C CG  . MET A 127 ? 0.6787 0.2104 0.2697 -0.0285 -0.0240 -0.0151 127 MET A CG  
841  S SD  . MET A 127 ? 0.7376 0.2592 0.2986 -0.0437 -0.0273 -0.0121 127 MET A SD  
842  C CE  . MET A 127 ? 0.6965 0.2277 0.2566 -0.0486 -0.0305 -0.0030 127 MET A CE  
843  N N   . ILE A 128 ? 0.5890 0.1008 0.2004 -0.0123 -0.0019 -0.0299 128 ILE A N   
844  C CA  . ILE A 128 ? 0.5998 0.1008 0.2018 -0.0152 0.0073  -0.0318 128 ILE A CA  
845  C C   . ILE A 128 ? 0.6654 0.1630 0.2831 -0.0073 0.0166  -0.0374 128 ILE A C   
846  O O   . ILE A 128 ? 0.6541 0.1377 0.2626 -0.0078 0.0258  -0.0419 128 ILE A O   
847  C CB  . ILE A 128 ? 0.6192 0.1266 0.2168 -0.0204 0.0049  -0.0251 128 ILE A CB  
848  C CG1 . ILE A 128 ? 0.6061 0.1121 0.1828 -0.0308 -0.0023 -0.0198 128 ILE A CG1 
849  C CG2 . ILE A 128 ? 0.6417 0.1400 0.2345 -0.0220 0.0150  -0.0268 128 ILE A CG2 
850  C CD1 . ILE A 128 ? 0.5274 0.0452 0.1063 -0.0335 -0.0090 -0.0118 128 ILE A CD1 
851  N N   . ILE A 129 ? 0.6275 0.1377 0.2687 -0.0001 0.0140  -0.0367 129 ILE A N   
852  C CA  . ILE A 129 ? 0.6264 0.1385 0.2872 0.0067  0.0205  -0.0401 129 ILE A CA  
853  C C   . ILE A 129 ? 0.6733 0.1826 0.3453 0.0133  0.0215  -0.0447 129 ILE A C   
854  O O   . ILE A 129 ? 0.6501 0.1642 0.3298 0.0167  0.0132  -0.0445 129 ILE A O   
855  C CB  . ILE A 129 ? 0.6521 0.1769 0.3305 0.0095  0.0174  -0.0368 129 ILE A CB  
856  C CG1 . ILE A 129 ? 0.6702 0.1945 0.3379 0.0037  0.0197  -0.0327 129 ILE A CG1 
857  C CG2 . ILE A 129 ? 0.6390 0.1686 0.3409 0.0158  0.0214  -0.0395 129 ILE A CG2 
858  C CD1 . ILE A 129 ? 0.7652 0.2944 0.4236 0.0002  0.0113  -0.0270 129 ILE A CD1 
859  N N   . ASN A 130 ? 0.6463 0.1475 0.3202 0.0156  0.0324  -0.0484 130 ASN A N   
860  C CA  . ASN A 130 ? 0.6444 0.1442 0.3342 0.0235  0.0358  -0.0519 130 ASN A CA  
861  C C   . ASN A 130 ? 0.7130 0.2239 0.4273 0.0274  0.0409  -0.0512 130 ASN A C   
862  O O   . ASN A 130 ? 0.7123 0.2231 0.4223 0.0233  0.0479  -0.0504 130 ASN A O   
863  C CB  . ASN A 130 ? 0.5787 0.0763 0.2547 0.0226  0.0465  -0.0517 130 ASN A CB  
864  C CG  . ASN A 130 ? 0.7589 0.2268 0.4038 0.0168  0.0438  -0.0566 130 ASN A CG  
865  O OD1 . ASN A 130 ? 0.6544 0.1198 0.2952 0.0177  0.0358  -0.0570 130 ASN A OD1 
866  N ND2 . ASN A 130 ? 0.7535 0.2103 0.3753 0.0088  0.0502  -0.0566 130 ASN A ND2 
867  N N   . PRO A 131 ? 0.6752 0.1959 0.4149 0.0341  0.0371  -0.0511 131 PRO A N   
868  C CA  . PRO A 131 ? 0.6703 0.2024 0.4339 0.0364  0.0419  -0.0500 131 PRO A CA  
869  C C   . PRO A 131 ? 0.7296 0.2559 0.4930 0.0369  0.0582  -0.0523 131 PRO A C   
870  O O   . PRO A 131 ? 0.7283 0.2459 0.4908 0.0416  0.0655  -0.0552 131 PRO A O   
871  C CB  . PRO A 131 ? 0.6822 0.2229 0.4702 0.0431  0.0346  -0.0494 131 PRO A CB  
872  C CG  . PRO A 131 ? 0.7509 0.2809 0.5266 0.0457  0.0304  -0.0514 131 PRO A CG  
873  C CD  . PRO A 131 ? 0.6937 0.2148 0.4406 0.0389  0.0279  -0.0516 131 PRO A CD  
874  N N   . GLY A 132 ? 0.6831 0.2120 0.4447 0.0320  0.0644  -0.0510 132 GLY A N   
875  C CA  . GLY A 132 ? 0.7063 0.2290 0.4654 0.0310  0.0809  -0.0531 132 GLY A CA  
876  C C   . GLY A 132 ? 0.8017 0.3117 0.5306 0.0220  0.0857  -0.0530 132 GLY A C   
877  O O   . GLY A 132 ? 0.8053 0.3113 0.5312 0.0189  0.0981  -0.0537 132 GLY A O   
878  N N   . ASP A 133 ? 0.7662 0.2702 0.4729 0.0173  0.0753  -0.0516 133 ASP A N   
879  C CA  . ASP A 133 ? 0.7652 0.2581 0.4422 0.0079  0.0756  -0.0499 133 ASP A CA  
880  C C   . ASP A 133 ? 0.7874 0.2873 0.4675 0.0035  0.0753  -0.0462 133 ASP A C   
881  O O   . ASP A 133 ? 0.7552 0.2692 0.4558 0.0066  0.0686  -0.0437 133 ASP A O   
882  C CB  . ASP A 133 ? 0.7793 0.2710 0.4407 0.0048  0.0620  -0.0476 133 ASP A CB  
883  C CG  . ASP A 133 ? 0.9173 0.3971 0.5651 0.0056  0.0618  -0.0509 133 ASP A CG  
884  O OD1 . ASP A 133 ? 0.9300 0.3987 0.5766 0.0089  0.0734  -0.0554 133 ASP A OD1 
885  O OD2 . ASP A 133 ? 0.9712 0.4521 0.6095 0.0031  0.0506  -0.0488 133 ASP A OD2 
886  N N   . ASN A 134 ? 0.7465 0.2342 0.4035 -0.0044 0.0822  -0.0455 134 ASN A N   
887  C CA  . ASN A 134 ? 0.7316 0.2224 0.3869 -0.0094 0.0823  -0.0416 134 ASN A CA  
888  C C   . ASN A 134 ? 0.7908 0.2820 0.4301 -0.0146 0.0695  -0.0360 134 ASN A C   
889  O O   . ASN A 134 ? 0.8058 0.2875 0.4225 -0.0197 0.0660  -0.0351 134 ASN A O   
890  C CB  . ASN A 134 ? 0.6776 0.1543 0.3172 -0.0154 0.0975  -0.0436 134 ASN A CB  
891  C CG  . ASN A 134 ? 0.7384 0.2186 0.3994 -0.0096 0.1115  -0.0480 134 ASN A CG  
892  O OD1 . ASN A 134 ? 0.5914 0.0864 0.2789 -0.0060 0.1118  -0.0468 134 ASN A OD1 
893  N ND2 . ASN A 134 ? 0.6827 0.1491 0.3331 -0.0086 0.1235  -0.0527 134 ASN A ND2 
894  N N   . VAL A 135 ? 0.7367 0.2389 0.3882 -0.0134 0.0623  -0.0316 135 VAL A N   
895  C CA  . VAL A 135 ? 0.7289 0.2329 0.3687 -0.0168 0.0509  -0.0252 135 VAL A CA  
896  C C   . VAL A 135 ? 0.8037 0.3050 0.4375 -0.0215 0.0526  -0.0208 135 VAL A C   
897  O O   . VAL A 135 ? 0.7910 0.2957 0.4391 -0.0198 0.0581  -0.0218 135 VAL A O   
898  C CB  . VAL A 135 ? 0.7354 0.2516 0.3883 -0.0108 0.0384  -0.0228 135 VAL A CB  
899  C CG1 . VAL A 135 ? 0.7197 0.2358 0.3736 -0.0077 0.0365  -0.0268 135 VAL A CG1 
900  C CG2 . VAL A 135 ? 0.7161 0.2420 0.3921 -0.0050 0.0369  -0.0227 135 VAL A CG2 
901  N N   . LEU A 136 ? 0.7632 0.2577 0.3748 -0.0283 0.0476  -0.0155 136 LEU A N   
902  C CA  . LEU A 136 ? 0.7505 0.2402 0.3523 -0.0333 0.0475  -0.0101 136 LEU A CA  
903  C C   . LEU A 136 ? 0.7276 0.2277 0.3376 -0.0291 0.0350  -0.0031 136 LEU A C   
904  O O   . LEU A 136 ? 0.6887 0.1955 0.2989 -0.0270 0.0257  -0.0001 136 LEU A O   
905  C CB  . LEU A 136 ? 0.7736 0.2471 0.3446 -0.0442 0.0506  -0.0082 136 LEU A CB  
906  C CG  . LEU A 136 ? 0.8300 0.2894 0.3900 -0.0484 0.0659  -0.0154 136 LEU A CG  
907  C CD1 . LEU A 136 ? 0.8510 0.2921 0.3763 -0.0598 0.0667  -0.0136 136 LEU A CD1 
908  C CD2 . LEU A 136 ? 0.8564 0.3143 0.4261 -0.0482 0.0776  -0.0178 136 LEU A CD2 
909  N N   . LEU A 137 ? 0.6624 0.1637 0.2810 -0.0273 0.0360  -0.0009 137 LEU A N   
910  C CA  . LEU A 137 ? 0.6355 0.1441 0.2645 -0.0215 0.0274  0.0045  137 LEU A CA  
911  C C   . LEU A 137 ? 0.7020 0.2041 0.3298 -0.0236 0.0312  0.0069  137 LEU A C   
912  O O   . LEU A 137 ? 0.7057 0.2037 0.3368 -0.0265 0.0409  0.0023  137 LEU A O   
913  C CB  . LEU A 137 ? 0.6118 0.1302 0.2630 -0.0136 0.0266  -0.0006 137 LEU A CB  
914  C CG  . LEU A 137 ? 0.6554 0.1799 0.3197 -0.0065 0.0201  0.0022  137 LEU A CG  
915  C CD1 . LEU A 137 ? 0.6413 0.1742 0.3153 -0.0009 0.0148  -0.0001 137 LEU A CD1 
916  C CD2 . LEU A 137 ? 0.6740 0.1968 0.3503 -0.0058 0.0250  -0.0006 137 LEU A CD2 
917  N N   . ASP A 138 ? 0.6613 0.1629 0.2856 -0.0216 0.0238  0.0145  138 ASP A N   
918  C CA  . ASP A 138 ? 0.6694 0.1632 0.2912 -0.0230 0.0262  0.0175  138 ASP A CA  
919  C C   . ASP A 138 ? 0.7208 0.2197 0.3607 -0.0148 0.0234  0.0168  138 ASP A C   
920  O O   . ASP A 138 ? 0.6766 0.1830 0.3240 -0.0077 0.0163  0.0189  138 ASP A O   
921  C CB  . ASP A 138 ? 0.7114 0.1978 0.3148 -0.0266 0.0201  0.0270  138 ASP A CB  
922  C CG  . ASP A 138 ? 0.8551 0.3485 0.4640 -0.0187 0.0093  0.0349  138 ASP A CG  
923  O OD1 . ASP A 138 ? 0.8175 0.3197 0.4265 -0.0175 0.0028  0.0375  138 ASP A OD1 
924  O OD2 . ASP A 138 ? 0.9988 0.4884 0.6120 -0.0138 0.0080  0.0385  138 ASP A OD2 
925  N N   . GLU A 139 ? 0.7077 0.2025 0.3543 -0.0165 0.0295  0.0135  139 GLU A N   
926  C CA  . GLU A 139 ? 0.6964 0.1919 0.3560 -0.0113 0.0273  0.0128  139 GLU A CA  
927  C C   . GLU A 139 ? 0.7818 0.2649 0.4297 -0.0125 0.0262  0.0192  139 GLU A C   
928  O O   . GLU A 139 ? 0.7874 0.2624 0.4229 -0.0198 0.0309  0.0208  139 GLU A O   
929  C CB  . GLU A 139 ? 0.7007 0.1995 0.3749 -0.0140 0.0337  0.0060  139 GLU A CB  
930  C CG  . GLU A 139 ? 0.7874 0.2978 0.4765 -0.0110 0.0337  0.0001  139 GLU A CG  
931  C CD  . GLU A 139 ? 1.1497 0.6653 0.8556 -0.0138 0.0395  -0.0051 139 GLU A CD  
932  O OE1 . GLU A 139 ? 1.1681 0.6868 0.8865 -0.0112 0.0353  -0.0062 139 GLU A OE1 
933  O OE2 . GLU A 139 ? 1.0143 0.5305 0.7206 -0.0189 0.0486  -0.0075 139 GLU A OE2 
934  N N   . PRO A 140 ? 0.7526 0.2319 0.4020 -0.0055 0.0208  0.0233  140 PRO A N   
935  C CA  . PRO A 140 ? 0.7434 0.2289 0.4042 0.0029  0.0161  0.0219  140 PRO A CA  
936  C C   . PRO A 140 ? 0.8138 0.3090 0.4750 0.0082  0.0105  0.0251  140 PRO A C   
937  O O   . PRO A 140 ? 0.8159 0.3100 0.4678 0.0087  0.0072  0.0323  140 PRO A O   
938  C CB  . PRO A 140 ? 0.7720 0.2446 0.4289 0.0068  0.0149  0.0255  140 PRO A CB  
939  C CG  . PRO A 140 ? 0.8357 0.2974 0.4778 0.0034  0.0158  0.0319  140 PRO A CG  
940  C CD  . PRO A 140 ? 0.7870 0.2521 0.4241 -0.0058 0.0200  0.0298  140 PRO A CD  
941  N N   . ALA A 141 ? 0.7745 0.2797 0.4468 0.0111  0.0092  0.0200  141 ALA A N   
942  C CA  . ALA A 141 ? 0.7645 0.2803 0.4389 0.0149  0.0044  0.0217  141 ALA A CA  
943  C C   . ALA A 141 ? 0.7952 0.3137 0.4785 0.0231  0.0014  0.0210  141 ALA A C   
944  O O   . ALA A 141 ? 0.7864 0.2977 0.4735 0.0247  0.0030  0.0180  141 ALA A O   
945  C CB  . ALA A 141 ? 0.7666 0.2894 0.4430 0.0100  0.0065  0.0156  141 ALA A CB  
946  N N   . TYR A 142 ? 0.7337 0.2618 0.4193 0.0272  -0.0028 0.0240  142 TYR A N   
947  C CA  . TYR A 142 ? 0.7069 0.2376 0.3998 0.0348  -0.0046 0.0235  142 TYR A CA  
948  C C   . TYR A 142 ? 0.7306 0.2594 0.4299 0.0339  -0.0034 0.0148  142 TYR A C   
949  O O   . TYR A 142 ? 0.7078 0.2421 0.4100 0.0293  -0.0031 0.0097  142 TYR A O   
950  C CB  . TYR A 142 ? 0.7004 0.2440 0.3956 0.0374  -0.0088 0.0278  142 TYR A CB  
951  C CG  . TYR A 142 ? 0.6975 0.2443 0.3998 0.0447  -0.0095 0.0271  142 TYR A CG  
952  C CD1 . TYR A 142 ? 0.6985 0.2557 0.4045 0.0439  -0.0118 0.0248  142 TYR A CD1 
953  C CD2 . TYR A 142 ? 0.7194 0.2569 0.4224 0.0520  -0.0070 0.0290  142 TYR A CD2 
954  C CE1 . TYR A 142 ? 0.6893 0.2487 0.4004 0.0499  -0.0117 0.0243  142 TYR A CE1 
955  C CE2 . TYR A 142 ? 0.7297 0.2680 0.4369 0.0584  -0.0061 0.0282  142 TYR A CE2 
956  C CZ  . TYR A 142 ? 0.7963 0.3461 0.5079 0.0572  -0.0084 0.0258  142 TYR A CZ  
957  O OH  . TYR A 142 ? 0.8160 0.3657 0.5305 0.0628  -0.0068 0.0249  142 TYR A OH  
958  N N   . SER A 143 ? 0.6842 0.2038 0.3846 0.0382  -0.0027 0.0135  143 SER A N   
959  C CA  . SER A 143 ? 0.6660 0.1819 0.3711 0.0370  -0.0031 0.0066  143 SER A CA  
960  C C   . SER A 143 ? 0.6745 0.2006 0.3848 0.0374  -0.0058 0.0032  143 SER A C   
961  O O   . SER A 143 ? 0.6644 0.1938 0.3799 0.0332  -0.0064 -0.0021 143 SER A O   
962  C CB  . SER A 143 ? 0.7053 0.2077 0.4061 0.0417  -0.0025 0.0071  143 SER A CB  
963  O OG  . SER A 143 ? 0.8310 0.3221 0.5246 0.0427  0.0001  0.0115  143 SER A OG  
964  N N   . GLY A 144 ? 0.6135 0.1450 0.3227 0.0425  -0.0072 0.0069  144 GLY A N   
965  C CA  . GLY A 144 ? 0.6022 0.1428 0.3144 0.0428  -0.0098 0.0047  144 GLY A CA  
966  C C   . GLY A 144 ? 0.6290 0.1775 0.3421 0.0369  -0.0108 0.0019  144 GLY A C   
967  O O   . GLY A 144 ? 0.6114 0.1615 0.3271 0.0354  -0.0124 -0.0032 144 GLY A O   
968  N N   . THR A 145 ? 0.6041 0.1551 0.3133 0.0334  -0.0097 0.0052  145 THR A N   
969  C CA  . THR A 145 ? 0.6134 0.1684 0.3203 0.0275  -0.0091 0.0022  145 THR A CA  
970  C C   . THR A 145 ? 0.6981 0.2484 0.4097 0.0244  -0.0056 -0.0040 145 THR A C   
971  O O   . THR A 145 ? 0.7131 0.2655 0.4265 0.0222  -0.0049 -0.0086 145 THR A O   
972  C CB  . THR A 145 ? 0.6568 0.2157 0.3549 0.0237  -0.0099 0.0080  145 THR A CB  
973  O OG1 . THR A 145 ? 0.5670 0.1196 0.2606 0.0207  -0.0066 0.0097  145 THR A OG1 
974  C CG2 . THR A 145 ? 0.6311 0.1977 0.3290 0.0273  -0.0142 0.0156  145 THR A CG2 
975  N N   . LEU A 146 ? 0.6467 0.1907 0.3610 0.0243  -0.0032 -0.0039 146 LEU A N   
976  C CA  . LEU A 146 ? 0.6318 0.1739 0.3539 0.0210  0.0000  -0.0088 146 LEU A CA  
977  C C   . LEU A 146 ? 0.6492 0.1929 0.3799 0.0230  -0.0035 -0.0134 146 LEU A C   
978  O O   . LEU A 146 ? 0.6312 0.1784 0.3693 0.0213  -0.0021 -0.0175 146 LEU A O   
979  C CB  . LEU A 146 ? 0.6395 0.1742 0.3622 0.0198  0.0019  -0.0072 146 LEU A CB  
980  C CG  . LEU A 146 ? 0.7177 0.2485 0.4316 0.0167  0.0057  -0.0029 146 LEU A CG  
981  C CD1 . LEU A 146 ? 0.7370 0.2579 0.4483 0.0170  0.0060  -0.0003 146 LEU A CD1 
982  C CD2 . LEU A 146 ? 0.7362 0.2689 0.4513 0.0107  0.0118  -0.0057 146 LEU A CD2 
983  N N   . GLN A 147 ? 0.6130 0.1533 0.3419 0.0269  -0.0076 -0.0124 147 GLN A N   
984  C CA  . GLN A 147 ? 0.6068 0.1456 0.3400 0.0285  -0.0120 -0.0159 147 GLN A CA  
985  C C   . GLN A 147 ? 0.6565 0.2016 0.3900 0.0289  -0.0137 -0.0183 147 GLN A C   
986  O O   . GLN A 147 ? 0.6424 0.1875 0.3820 0.0286  -0.0166 -0.0221 147 GLN A O   
987  C CB  . GLN A 147 ? 0.6217 0.1525 0.3483 0.0323  -0.0139 -0.0137 147 GLN A CB  
988  C CG  . GLN A 147 ? 0.8521 0.3716 0.5773 0.0310  -0.0135 -0.0133 147 GLN A CG  
989  C CD  . GLN A 147 ? 1.3085 0.8163 1.0250 0.0347  -0.0147 -0.0126 147 GLN A CD  
990  O OE1 . GLN A 147 ? 1.2077 0.7156 0.9216 0.0374  -0.0167 -0.0138 147 GLN A OE1 
991  N NE2 . GLN A 147 ? 1.3240 0.8194 1.0341 0.0347  -0.0127 -0.0107 147 GLN A NE2 
992  N N   . SER A 148 ? 0.6174 0.1672 0.3438 0.0290  -0.0126 -0.0155 148 SER A N   
993  C CA  . SER A 148 ? 0.6173 0.1715 0.3404 0.0281  -0.0141 -0.0172 148 SER A CA  
994  C C   . SER A 148 ? 0.6788 0.2332 0.4053 0.0251  -0.0108 -0.0213 148 SER A C   
995  O O   . SER A 148 ? 0.6758 0.2295 0.4059 0.0258  -0.0125 -0.0251 148 SER A O   
996  C CB  . SER A 148 ? 0.6581 0.2172 0.3722 0.0272  -0.0143 -0.0120 148 SER A CB  
997  O OG  . SER A 148 ? 0.7535 0.3157 0.4658 0.0298  -0.0178 -0.0102 148 SER A OG  
998  N N   . LEU A 149 ? 0.6263 0.1803 0.3513 0.0223  -0.0055 -0.0201 149 LEU A N   
999  C CA  . LEU A 149 ? 0.6196 0.1726 0.3466 0.0196  0.0005  -0.0234 149 LEU A CA  
1000 C C   . LEU A 149 ? 0.6563 0.2104 0.3994 0.0210  0.0021  -0.0270 149 LEU A C   
1001 O O   . LEU A 149 ? 0.6474 0.2018 0.3953 0.0211  0.0062  -0.0303 149 LEU A O   
1002 C CB  . LEU A 149 ? 0.6307 0.1815 0.3496 0.0155  0.0061  -0.0205 149 LEU A CB  
1003 C CG  . LEU A 149 ? 0.6956 0.2458 0.3983 0.0125  0.0042  -0.0161 149 LEU A CG  
1004 C CD1 . LEU A 149 ? 0.7014 0.2484 0.3968 0.0089  0.0075  -0.0118 149 LEU A CD1 
1005 C CD2 . LEU A 149 ? 0.7147 0.2622 0.4068 0.0093  0.0055  -0.0186 149 LEU A CD2 
1006 N N   . HIS A 150 ? 0.6262 0.1805 0.3775 0.0218  -0.0010 -0.0259 150 HIS A N   
1007 C CA  . HIS A 150 ? 0.6401 0.1971 0.4081 0.0219  -0.0012 -0.0281 150 HIS A CA  
1008 C C   . HIS A 150 ? 0.6724 0.2316 0.4493 0.0246  -0.0047 -0.0313 150 HIS A C   
1009 O O   . HIS A 150 ? 0.6822 0.2452 0.4700 0.0251  0.0002  -0.0331 150 HIS A O   
1010 C CB  . HIS A 150 ? 0.6690 0.2233 0.4405 0.0208  -0.0055 -0.0261 150 HIS A CB  
1011 C CG  . HIS A 150 ? 0.7269 0.2849 0.5156 0.0195  -0.0082 -0.0274 150 HIS A CG  
1012 N ND1 . HIS A 150 ? 0.7592 0.3140 0.5503 0.0199  -0.0168 -0.0277 150 HIS A ND1 
1013 C CD2 . HIS A 150 ? 0.7608 0.3259 0.5652 0.0176  -0.0034 -0.0280 150 HIS A CD2 
1014 C CE1 . HIS A 150 ? 0.7572 0.3179 0.5658 0.0177  -0.0185 -0.0278 150 HIS A CE1 
1015 N NE2 . HIS A 150 ? 0.7621 0.3305 0.5809 0.0167  -0.0102 -0.0279 150 HIS A NE2 
1016 N N   . PRO A 151 ? 0.5900 0.1463 0.3623 0.0267  -0.0123 -0.0317 151 PRO A N   
1017 C CA  . PRO A 151 ? 0.5764 0.1332 0.3559 0.0291  -0.0161 -0.0343 151 PRO A CA  
1018 C C   . PRO A 151 ? 0.5802 0.1364 0.3554 0.0305  -0.0107 -0.0366 151 PRO A C   
1019 O O   . PRO A 151 ? 0.5710 0.1273 0.3546 0.0333  -0.0113 -0.0386 151 PRO A O   
1020 C CB  . PRO A 151 ? 0.5994 0.1507 0.3687 0.0299  -0.0240 -0.0341 151 PRO A CB  
1021 C CG  . PRO A 151 ? 0.6569 0.2068 0.4126 0.0291  -0.0218 -0.0317 151 PRO A CG  
1022 C CD  . PRO A 151 ? 0.6055 0.1572 0.3658 0.0273  -0.0170 -0.0298 151 PRO A CD  
1023 N N   . LEU A 152 ? 0.4954 0.0885 0.2570 0.0260  -0.0062 -0.0293 152 LEU A N   
1024 C CA  . LEU A 152 ? 0.4926 0.0893 0.2436 0.0248  -0.0014 -0.0292 152 LEU A CA  
1025 C C   . LEU A 152 ? 0.6101 0.1593 0.3679 0.0287  0.0085  -0.0402 152 LEU A C   
1026 O O   . LEU A 152 ? 0.6121 0.1548 0.3624 0.0296  0.0122  -0.0428 152 LEU A O   
1027 C CB  . LEU A 152 ? 0.4767 0.0890 0.2105 0.0204  -0.0008 -0.0231 152 LEU A CB  
1028 C CG  . LEU A 152 ? 0.4866 0.0883 0.2059 0.0197  -0.0056 -0.0236 152 LEU A CG  
1029 C CD1 . LEU A 152 ? 0.4706 0.0882 0.1948 0.0218  -0.0137 -0.0214 152 LEU A CD1 
1030 C CD2 . LEU A 152 ? 0.4459 0.0841 0.1523 0.0146  -0.0057 -0.0132 152 LEU A CD2 
1031 N N   . GLY A 153 ? 0.5898 0.1448 0.3628 0.0287  0.0127  -0.0394 153 GLY A N   
1032 C CA  . GLY A 153 ? 0.6013 0.1581 0.3867 0.0303  0.0228  -0.0413 153 GLY A CA  
1033 C C   . GLY A 153 ? 0.6798 0.2313 0.4531 0.0265  0.0345  -0.0419 153 GLY A C   
1034 O O   . GLY A 153 ? 0.6723 0.2228 0.4526 0.0280  0.0452  -0.0440 153 GLY A O   
1035 N N   . CYS A 154 ? 0.6565 0.2041 0.4115 0.0215  0.0328  -0.0396 154 CYS A N   
1036 C CA  . CYS A 154 ? 0.6543 0.1951 0.3943 0.0163  0.0424  -0.0394 154 CYS A CA  
1037 C C   . CYS A 154 ? 0.6907 0.2363 0.4424 0.0143  0.0486  -0.0381 154 CYS A C   
1038 O O   . CYS A 154 ? 0.6514 0.2056 0.4195 0.0157  0.0431  -0.0364 154 CYS A O   
1039 C CB  . CYS A 154 ? 0.6451 0.1805 0.3619 0.0114  0.0371  -0.0363 154 CYS A CB  
1040 S SG  . CYS A 154 ? 0.6682 0.2111 0.3889 0.0117  0.0264  -0.0311 154 CYS A SG  
1041 N N   . ASN A 155 ? 0.6762 0.2146 0.4173 0.0101  0.0602  -0.0391 155 ASN A N   
1042 C CA  . ASN A 155 ? 0.6809 0.2212 0.4278 0.0064  0.0683  -0.0379 155 ASN A CA  
1043 C C   . ASN A 155 ? 0.7300 0.2635 0.4552 0.0002  0.0648  -0.0340 155 ASN A C   
1044 O O   . ASN A 155 ? 0.7330 0.2556 0.4347 -0.0040 0.0668  -0.0338 155 ASN A O   
1045 C CB  . ASN A 155 ? 0.7193 0.2537 0.4653 0.0056  0.0845  -0.0414 155 ASN A CB  
1046 C CG  . ASN A 155 ? 1.1384 0.6801 0.9084 0.0129  0.0895  -0.0444 155 ASN A CG  
1047 O OD1 . ASN A 155 ? 1.0889 0.6448 0.8860 0.0160  0.0864  -0.0430 155 ASN A OD1 
1048 N ND2 . ASN A 155 ? 1.0568 0.5882 0.8169 0.0155  0.0972  -0.0480 155 ASN A ND2 
1049 N N   . ILE A 156 ? 0.6665 0.2054 0.3985 -0.0005 0.0585  -0.0304 156 ILE A N   
1050 C CA  . ILE A 156 ? 0.6599 0.1922 0.3730 -0.0052 0.0549  -0.0259 156 ILE A CA  
1051 C C   . ILE A 156 ? 0.7478 0.2744 0.4554 -0.0114 0.0655  -0.0253 156 ILE A C   
1052 O O   . ILE A 156 ? 0.7600 0.2920 0.4835 -0.0119 0.0688  -0.0254 156 ILE A O   
1053 C CB  . ILE A 156 ? 0.6752 0.2122 0.3930 -0.0024 0.0432  -0.0219 156 ILE A CB  
1054 C CG1 . ILE A 156 ? 0.6575 0.2010 0.3861 0.0039  0.0350  -0.0238 156 ILE A CG1 
1055 C CG2 . ILE A 156 ? 0.6789 0.2097 0.3768 -0.0052 0.0384  -0.0164 156 ILE A CG2 
1056 C CD1 . ILE A 156 ? 0.6838 0.2289 0.4106 0.0071  0.0241  -0.0201 156 ILE A CD1 
1057 N N   . ILE A 157 ? 0.7001 0.2149 0.3846 -0.0171 0.0712  -0.0250 157 ILE A N   
1058 C CA  . ILE A 157 ? 0.6949 0.2013 0.3696 -0.0241 0.0818  -0.0245 157 ILE A CA  
1059 C C   . ILE A 157 ? 0.7173 0.2192 0.3783 -0.0278 0.0735  -0.0180 157 ILE A C   
1060 O O   . ILE A 157 ? 0.7094 0.2070 0.3538 -0.0288 0.0653  -0.0143 157 ILE A O   
1061 C CB  . ILE A 157 ? 0.7495 0.2419 0.4027 -0.0293 0.0929  -0.0276 157 ILE A CB  
1062 C CG1 . ILE A 157 ? 0.7383 0.2328 0.4018 -0.0237 0.0993  -0.0335 157 ILE A CG1 
1063 C CG2 . ILE A 157 ? 0.7835 0.2669 0.4282 -0.0364 0.1060  -0.0279 157 ILE A CG2 
1064 C CD1 . ILE A 157 ? 0.7422 0.2189 0.3788 -0.0286 0.1082  -0.0364 157 ILE A CD1 
1065 N N   . ASN A 158 ? 0.6600 0.1634 0.3291 -0.0294 0.0749  -0.0161 158 ASN A N   
1066 C CA  . ASN A 158 ? 0.6652 0.1629 0.3217 -0.0317 0.0672  -0.0095 158 ASN A CA  
1067 C C   . ASN A 158 ? 0.7429 0.2257 0.3726 -0.0403 0.0715  -0.0063 158 ASN A C   
1068 O O   . ASN A 158 ? 0.7426 0.2185 0.3674 -0.0465 0.0834  -0.0086 158 ASN A O   
1069 C CB  . ASN A 158 ? 0.6649 0.1668 0.3368 -0.0304 0.0655  -0.0083 158 ASN A CB  
1070 C CG  . ASN A 158 ? 0.8752 0.3686 0.5339 -0.0318 0.0588  -0.0015 158 ASN A CG  
1071 O OD1 . ASN A 158 ? 0.7890 0.2799 0.4362 -0.0293 0.0501  0.0032  158 ASN A OD1 
1072 N ND2 . ASN A 158 ? 0.7532 0.2418 0.4132 -0.0362 0.0630  -0.0005 158 ASN A ND2 
1073 N N   . VAL A 159 ? 0.7161 0.1941 0.3288 -0.0411 0.0616  -0.0003 159 VAL A N   
1074 C CA  . VAL A 159 ? 0.7519 0.2152 0.3369 -0.0497 0.0620  0.0046  159 VAL A CA  
1075 C C   . VAL A 159 ? 0.8594 0.3177 0.4401 -0.0506 0.0570  0.0114  159 VAL A C   
1076 O O   . VAL A 159 ? 0.8596 0.3237 0.4471 -0.0441 0.0464  0.0164  159 VAL A O   
1077 C CB  . VAL A 159 ? 0.7978 0.2590 0.3657 -0.0516 0.0534  0.0082  159 VAL A CB  
1078 C CG1 . VAL A 159 ? 0.8158 0.2598 0.3527 -0.0627 0.0543  0.0129  159 VAL A CG1 
1079 C CG2 . VAL A 159 ? 0.7848 0.2504 0.3577 -0.0495 0.0569  0.0015  159 VAL A CG2 
1080 N N   . ALA A 160 ? 0.8577 0.3037 0.4256 -0.0587 0.0655  0.0117  160 ALA A N   
1081 C CA  . ALA A 160 ? 0.8700 0.3077 0.4306 -0.0606 0.0618  0.0181  160 ALA A CA  
1082 C C   . ALA A 160 ? 0.9247 0.3581 0.4707 -0.0593 0.0484  0.0278  160 ALA A C   
1083 O O   . ALA A 160 ? 0.9326 0.3598 0.4591 -0.0649 0.0453  0.0310  160 ALA A O   
1084 C CB  . ALA A 160 ? 0.9018 0.3251 0.4469 -0.0712 0.0737  0.0168  160 ALA A CB  
1085 N N   . SER A 161 ? 0.8671 0.3037 0.4229 -0.0519 0.0404  0.0328  161 SER A N   
1086 C CA  . SER A 161 ? 0.8641 0.2991 0.4118 -0.0481 0.0280  0.0430  161 SER A CA  
1087 C C   . SER A 161 ? 0.9041 0.3240 0.4387 -0.0504 0.0263  0.0502  161 SER A C   
1088 O O   . SER A 161 ? 0.9080 0.3170 0.4355 -0.0574 0.0351  0.0471  161 SER A O   
1089 C CB  . SER A 161 ? 0.8989 0.3483 0.4678 -0.0358 0.0207  0.0437  161 SER A CB  
1090 O OG  . SER A 161 ? 1.0117 0.4594 0.5930 -0.0310 0.0236  0.0413  161 SER A OG  
1091 N N   . ASP A 162 ? 0.8461 0.2659 0.3783 -0.0443 0.0151  0.0601  162 ASP A N   
1092 C CA  . ASP A 162 ? 0.8474 0.2533 0.3686 -0.0434 0.0110  0.0689  162 ASP A CA  
1093 C C   . ASP A 162 ? 0.9099 0.3228 0.4367 -0.0333 -0.0015 0.0794  162 ASP A C   
1094 O O   . ASP A 162 ? 0.8994 0.3285 0.4387 -0.0282 -0.0061 0.0792  162 ASP A O   
1095 C CB  . ASP A 162 ? 0.8847 0.2726 0.3785 -0.0564 0.0135  0.0722  162 ASP A CB  
1096 C CG  . ASP A 162 ? 0.9005 0.2876 0.3769 -0.0635 0.0070  0.0775  162 ASP A CG  
1097 O OD1 . ASP A 162 ? 0.8775 0.2752 0.3596 -0.0574 -0.0046 0.0851  162 ASP A OD1 
1098 O OD2 . ASP A 162 ? 0.9977 0.3718 0.4528 -0.0759 0.0131  0.0752  162 ASP A OD2 
1099 N N   . GLU A 163 ? 0.8867 0.2872 0.4044 -0.0304 -0.0066 0.0891  163 GLU A N   
1100 C CA  . GLU A 163 ? 0.8845 0.2900 0.4080 -0.0198 -0.0177 0.1011  163 GLU A CA  
1101 C C   . GLU A 163 ? 0.9402 0.3606 0.4640 -0.0216 -0.0275 0.1076  163 GLU A C   
1102 O O   . GLU A 163 ? 0.9281 0.3640 0.4690 -0.0111 -0.0343 0.1131  163 GLU A O   
1103 C CB  . GLU A 163 ? 0.9272 0.3130 0.4345 -0.0201 -0.0209 0.1108  163 GLU A CB  
1104 N N   . SER A 164 ? 0.9055 0.3208 0.4103 -0.0354 -0.0274 0.1063  164 SER A N   
1105 C CA  . SER A 164 ? 0.9155 0.3420 0.4163 -0.0401 -0.0367 0.1118  164 SER A CA  
1106 C C   . SER A 164 ? 0.9855 0.4265 0.4970 -0.0413 -0.0324 0.1016  164 SER A C   
1107 O O   . SER A 164 ? 0.9896 0.4396 0.4973 -0.0461 -0.0396 0.1051  164 SER A O   
1108 C CB  . SER A 164 ? 0.9969 0.4070 0.4674 -0.0549 -0.0404 0.1174  164 SER A CB  
1109 O OG  . SER A 164 ? 1.1880 0.5862 0.6509 -0.0521 -0.0462 0.1283  164 SER A OG  
1110 N N   . GLY A 165 ? 0.9389 0.3820 0.4639 -0.0369 -0.0217 0.0899  165 GLY A N   
1111 C CA  . GLY A 165 ? 0.9237 0.3793 0.4605 -0.0364 -0.0173 0.0801  165 GLY A CA  
1112 C C   . GLY A 165 ? 0.9896 0.4362 0.5160 -0.0462 -0.0055 0.0689  165 GLY A C   
1113 O O   . GLY A 165 ? 1.0010 0.4337 0.5182 -0.0510 0.0024  0.0661  165 GLY A O   
1114 N N   . ILE A 166 ? 0.9366 0.3910 0.4648 -0.0489 -0.0037 0.0627  166 ILE A N   
1115 C CA  . ILE A 166 ? 0.9390 0.3858 0.4590 -0.0568 0.0085  0.0521  166 ILE A CA  
1116 C C   . ILE A 166 ? 1.0284 0.4556 0.5180 -0.0701 0.0111  0.0552  166 ILE A C   
1117 O O   . ILE A 166 ? 1.0535 0.4769 0.5271 -0.0751 0.0006  0.0648  166 ILE A O   
1118 C CB  . ILE A 166 ? 0.9638 0.4207 0.4906 -0.0561 0.0098  0.0452  166 ILE A CB  
1119 C CG1 . ILE A 166 ? 0.9935 0.4416 0.4952 -0.0677 0.0082  0.0464  166 ILE A CG1 
1120 C CG2 . ILE A 166 ? 0.9403 0.4159 0.4895 -0.0452 0.0016  0.0469  166 ILE A CG2 
1121 C CD1 . ILE A 166 ? 1.1691 0.6024 0.6556 -0.0761 0.0223  0.0373  166 ILE A CD1 
1122 N N   . VAL A 167 ? 0.9731 0.3883 0.4556 -0.0759 0.0247  0.0479  167 VAL A N   
1123 C CA  . VAL A 167 ? 0.9865 0.3806 0.4385 -0.0891 0.0298  0.0495  167 VAL A CA  
1124 C C   . VAL A 167 ? 1.0052 0.3927 0.4406 -0.0976 0.0358  0.0436  167 VAL A C   
1125 O O   . VAL A 167 ? 0.9884 0.3767 0.4320 -0.0967 0.0492  0.0334  167 VAL A O   
1126 C CB  . VAL A 167 ? 1.0448 0.4293 0.4977 -0.0915 0.0427  0.0447  167 VAL A CB  
1127 C CG1 . VAL A 167 ? 1.0733 0.4345 0.4931 -0.1059 0.0501  0.0455  167 VAL A CG1 
1128 C CG2 . VAL A 167 ? 1.0378 0.4260 0.5044 -0.0835 0.0364  0.0504  167 VAL A CG2 
1129 N N   . PRO A 168 ? 0.9589 0.3392 0.3707 -0.1059 0.0262  0.0502  168 PRO A N   
1130 C CA  . PRO A 168 ? 0.9615 0.3318 0.3536 -0.1148 0.0324  0.0443  168 PRO A CA  
1131 C C   . PRO A 168 ? 1.0028 0.3570 0.3840 -0.1206 0.0527  0.0339  168 PRO A C   
1132 O O   . PRO A 168 ? 0.9776 0.3312 0.3607 -0.1201 0.0626  0.0250  168 PRO A O   
1133 C CB  . PRO A 168 ? 1.0093 0.3671 0.3700 -0.1270 0.0194  0.0548  168 PRO A CB  
1134 C CG  . PRO A 168 ? 1.0536 0.4283 0.4323 -0.1186 0.0025  0.0664  168 PRO A CG  
1135 C CD  . PRO A 168 ? 0.9837 0.3643 0.3855 -0.1080 0.0090  0.0639  168 PRO A CD  
1136 N N   . ASP A 169 ? 0.9711 0.3134 0.3435 -0.1250 0.0592  0.0352  169 ASP A N   
1137 C CA  . ASP A 169 ? 0.9781 0.3059 0.3415 -0.1308 0.0793  0.0267  169 ASP A CA  
1138 C C   . ASP A 169 ? 0.9833 0.3276 0.3807 -0.1202 0.0916  0.0167  169 ASP A C   
1139 O O   . ASP A 169 ? 0.9925 0.3292 0.3857 -0.1231 0.1080  0.0082  169 ASP A O   
1140 C CB  . ASP A 169 ? 1.0196 0.3332 0.3683 -0.1377 0.0814  0.0316  169 ASP A CB  
1141 C CG  . ASP A 169 ? 1.1847 0.4741 0.4912 -0.1523 0.0749  0.0394  169 ASP A CG  
1142 O OD1 . ASP A 169 ? 1.2029 0.4861 0.4901 -0.1582 0.0682  0.0413  169 ASP A OD1 
1143 O OD2 . ASP A 169 ? 1.2738 0.5492 0.5650 -0.1587 0.0761  0.0438  169 ASP A OD2 
1144 N N   . SER A 170 ? 0.8766 0.2425 0.3071 -0.1079 0.0838  0.0180  170 SER A N   
1145 C CA  . SER A 170 ? 0.8375 0.2202 0.3012 -0.0981 0.0923  0.0100  170 SER A CA  
1146 C C   . SER A 170 ? 0.9225 0.3098 0.3894 -0.0950 0.0946  0.0041  170 SER A C   
1147 O O   . SER A 170 ? 0.9312 0.3157 0.4022 -0.0952 0.1100  -0.0040 170 SER A O   
1148 C CB  . SER A 170 ? 0.8310 0.2317 0.3221 -0.0874 0.0809  0.0137  170 SER A CB  
1149 O OG  . SER A 170 ? 0.9254 0.3431 0.4470 -0.0781 0.0849  0.0070  170 SER A OG  
1150 N N   . LEU A 171 ? 0.8749 0.2676 0.3378 -0.0930 0.0796  0.0089  171 LEU A N   
1151 C CA  . LEU A 171 ? 0.8578 0.2529 0.3191 -0.0914 0.0785  0.0050  171 LEU A CA  
1152 C C   . LEU A 171 ? 0.9533 0.3261 0.3857 -0.1017 0.0925  -0.0004 171 LEU A C   
1153 O O   . LEU A 171 ? 0.9576 0.3300 0.3967 -0.0984 0.1035  -0.0086 171 LEU A O   
1154 C CB  . LEU A 171 ? 0.8484 0.2488 0.3020 -0.0921 0.0597  0.0136  171 LEU A CB  
1155 C CG  . LEU A 171 ? 0.8946 0.2986 0.3452 -0.0917 0.0547  0.0116  171 LEU A CG  
1156 C CD1 . LEU A 171 ? 0.8657 0.2851 0.3463 -0.0799 0.0593  0.0039  171 LEU A CD1 
1157 C CD2 . LEU A 171 ? 0.8936 0.3074 0.3425 -0.0920 0.0357  0.0218  171 LEU A CD2 
1158 N N   . ARG A 172 ? 0.9307 0.2833 0.3306 -0.1141 0.0931  0.0041  172 ARG A N   
1159 C CA  . ARG A 172 ? 0.9641 0.2902 0.3296 -0.1261 0.1067  -0.0001 172 ARG A CA  
1160 C C   . ARG A 172 ? 1.0309 0.3549 0.4095 -0.1226 0.1293  -0.0100 172 ARG A C   
1161 O O   . ARG A 172 ? 1.0494 0.3600 0.4152 -0.1250 0.1429  -0.0171 172 ARG A O   
1162 C CB  . ARG A 172 ? 0.9846 0.2916 0.3168 -0.1393 0.1014  0.0078  172 ARG A CB  
1163 C CG  . ARG A 172 ? 1.1288 0.4038 0.4179 -0.1543 0.1140  0.0047  172 ARG A CG  
1164 C CD  . ARG A 172 ? 1.3467 0.6046 0.6079 -0.1661 0.1092  0.0128  172 ARG A CD  
1165 N NE  . ARG A 172 ? 1.5844 0.8446 0.8599 -0.1635 0.1207  0.0107  172 ARG A NE  
1166 C CZ  . ARG A 172 ? 1.8970 1.1439 1.1535 -0.1720 0.1183  0.0171  172 ARG A CZ  
1167 N NH1 . ARG A 172 ? 1.7900 1.0206 1.0129 -0.1833 0.1043  0.0263  172 ARG A NH1 
1168 N NH2 . ARG A 172 ? 1.7870 1.0367 1.0579 -0.1698 0.1293  0.0147  172 ARG A NH2 
1169 N N   . ASP A 173 ? 0.9741 0.3115 0.3790 -0.1169 0.1332  -0.0101 173 ASP A N   
1170 C CA  . ASP A 173 ? 0.9778 0.3177 0.4005 -0.1135 0.1536  -0.0180 173 ASP A CA  
1171 C C   . ASP A 173 ? 0.9519 0.3106 0.4069 -0.1010 0.1560  -0.0239 173 ASP A C   
1172 O O   . ASP A 173 ? 0.9542 0.3082 0.4128 -0.0992 0.1731  -0.0312 173 ASP A O   
1173 C CB  . ASP A 173 ? 1.0158 0.3650 0.4568 -0.1127 0.1554  -0.0155 173 ASP A CB  
1174 C CG  . ASP A 173 ? 1.3624 0.6943 0.7743 -0.1240 0.1508  -0.0084 173 ASP A CG  
1175 O OD1 . ASP A 173 ? 1.4406 0.7483 0.8142 -0.1354 0.1538  -0.0074 173 ASP A OD1 
1176 O OD2 . ASP A 173 ? 1.4598 0.8006 0.8854 -0.1219 0.1437  -0.0037 173 ASP A OD2 
1177 N N   . ILE A 174 ? 0.8454 0.2240 0.3232 -0.0920 0.1394  -0.0207 174 ILE A N   
1178 C CA  . ILE A 174 ? 0.8176 0.2134 0.3252 -0.0804 0.1401  -0.0258 174 ILE A CA  
1179 C C   . ILE A 174 ? 0.8773 0.2598 0.3673 -0.0815 0.1466  -0.0309 174 ILE A C   
1180 O O   . ILE A 174 ? 0.8814 0.2661 0.3860 -0.0755 0.1600  -0.0377 174 ILE A O   
1181 C CB  . ILE A 174 ? 0.8213 0.2383 0.3530 -0.0715 0.1214  -0.0214 174 ILE A CB  
1182 C CG1 . ILE A 174 ? 0.8086 0.2359 0.3577 -0.0700 0.1175  -0.0174 174 ILE A CG1 
1183 C CG2 . ILE A 174 ? 0.7964 0.2284 0.3551 -0.0606 0.1214  -0.0266 174 ILE A CG2 
1184 C CD1 . ILE A 174 ? 0.8247 0.2608 0.3777 -0.0664 0.0988  -0.0102 174 ILE A CD1 
1185 N N   . LEU A 175 ? 0.8233 0.1910 0.2810 -0.0897 0.1373  -0.0273 175 LEU A N   
1186 C CA  . LEU A 175 ? 0.8325 0.1844 0.2677 -0.0928 0.1412  -0.0313 175 LEU A CA  
1187 C C   . LEU A 175 ? 0.9229 0.2516 0.3382 -0.0978 0.1643  -0.0386 175 LEU A C   
1188 O O   . LEU A 175 ? 0.8987 0.2178 0.3081 -0.0951 0.1730  -0.0446 175 LEU A O   
1189 C CB  . LEU A 175 ? 0.8396 0.1823 0.2451 -0.1024 0.1244  -0.0242 175 LEU A CB  
1190 C CG  . LEU A 175 ? 0.8599 0.2255 0.2871 -0.0950 0.1046  -0.0190 175 LEU A CG  
1191 C CD1 . LEU A 175 ? 0.8772 0.2386 0.2814 -0.1042 0.0877  -0.0097 175 LEU A CD1 
1192 C CD2 . LEU A 175 ? 0.8531 0.2250 0.2930 -0.0873 0.1051  -0.0245 175 LEU A CD2 
1193 N N   . SER A 176 ? 0.9210 0.2407 0.3275 -0.1043 0.1753  -0.0381 176 SER A N   
1194 C CA  . SER A 176 ? 0.9445 0.2421 0.3324 -0.1099 0.1993  -0.0443 176 SER A CA  
1195 C C   . SER A 176 ? 0.9822 0.2905 0.4022 -0.0975 0.2172  -0.0521 176 SER A C   
1196 O O   . SER A 176 ? 1.0034 0.2949 0.4122 -0.0997 0.2396  -0.0577 176 SER A O   
1197 C CB  . SER A 176 ? 0.9694 0.2613 0.3487 -0.1182 0.2046  -0.0410 176 SER A CB  
1198 O OG  . SER A 176 ? 0.9820 0.2980 0.4023 -0.1094 0.2095  -0.0416 176 SER A OG  
1199 N N   . ARG A 177 ? 0.8842 0.2204 0.3443 -0.0844 0.2074  -0.0518 177 ARG A N   
1200 C CA  . ARG A 177 ? 0.8609 0.2108 0.3553 -0.0716 0.2195  -0.0574 177 ARG A CA  
1201 C C   . ARG A 177 ? 0.9706 0.3009 0.4436 -0.0705 0.2262  -0.0626 177 ARG A C   
1202 O O   . ARG A 177 ? 0.9928 0.3152 0.4707 -0.0655 0.2465  -0.0686 177 ARG A O   
1203 C CB  . ARG A 177 ? 0.7927 0.1739 0.3282 -0.0604 0.2031  -0.0546 177 ARG A CB  
1204 N N   . TRP A 178 ? 0.9500 0.2707 0.3972 -0.0759 0.2099  -0.0599 178 TRP A N   
1205 C CA  . TRP A 178 ? 0.9738 0.2737 0.3957 -0.0770 0.2128  -0.0641 178 TRP A CA  
1206 C C   . TRP A 178 ? 1.0839 0.3462 0.4507 -0.0928 0.2207  -0.0652 178 TRP A C   
1207 O O   . TRP A 178 ? 1.1009 0.3526 0.4489 -0.1029 0.2252  -0.0629 178 TRP A O   
1208 C CB  . TRP A 178 ? 0.9273 0.2408 0.3559 -0.0740 0.1899  -0.0603 178 TRP A CB  
1209 C CG  . TRP A 178 ? 0.8966 0.2410 0.3725 -0.0593 0.1824  -0.0601 178 TRP A CG  
1210 C CD1 . TRP A 178 ? 0.9243 0.2743 0.4204 -0.0479 0.1870  -0.0646 178 TRP A CD1 
1211 C CD2 . TRP A 178 ? 0.8615 0.2331 0.3661 -0.0554 0.1668  -0.0544 178 TRP A CD2 
1212 N NE1 . TRP A 178 ? 0.8779 0.2572 0.4139 -0.0379 0.1752  -0.0621 178 TRP A NE1 
1213 C CE2 . TRP A 178 ? 0.8788 0.2710 0.4196 -0.0424 0.1630  -0.0561 178 TRP A CE2 
1214 C CE3 . TRP A 178 ? 0.8718 0.2505 0.3742 -0.0616 0.1564  -0.0480 178 TRP A CE3 
1215 C CZ2 . TRP A 178 ? 0.8355 0.2535 0.4078 -0.0365 0.1496  -0.0521 178 TRP A CZ2 
1216 C CZ3 . TRP A 178 ? 0.8506 0.2549 0.3854 -0.0545 0.1442  -0.0442 178 TRP A CZ3 
1217 C CH2 . TRP A 178 ? 0.8317 0.2546 0.3999 -0.0426 0.1410  -0.0464 178 TRP A CH2 
1218 N N   . LYS A 179 ? 1.0548 0.2953 0.3943 -0.0955 0.2222  -0.0687 179 LYS A N   
1219 C CA  . LYS A 179 ? 1.1062 0.3088 0.3899 -0.1115 0.2268  -0.0697 179 LYS A CA  
1220 C C   . LYS A 179 ? 1.1943 0.3961 0.4601 -0.1180 0.2035  -0.0648 179 LYS A C   
1221 O O   . LYS A 179 ? 1.1659 0.3860 0.4574 -0.1076 0.1945  -0.0653 179 LYS A O   
1222 C CB  . LYS A 179 ? 1.1703 0.3436 0.4351 -0.1092 0.2530  -0.0790 179 LYS A CB  
1223 C CG  . LYS A 179 ? 1.3165 0.4749 0.5729 -0.1121 0.2777  -0.0827 179 LYS A CG  
1224 C CD  . LYS A 179 ? 1.3982 0.5697 0.6948 -0.0950 0.2996  -0.0888 179 LYS A CD  
1225 C CE  . LYS A 179 ? 1.4393 0.6391 0.7753 -0.0899 0.3041  -0.0862 179 LYS A CE  
1226 N NZ  . LYS A 179 ? 1.3888 0.6307 0.7779 -0.0770 0.2867  -0.0822 179 LYS A NZ  
1227 N N   . PRO A 180 ? 1.1946 0.3769 0.4179 -0.1356 0.1925  -0.0595 180 PRO A N   
1228 C CA  . PRO A 180 ? 1.1793 0.3653 0.3902 -0.1421 0.1695  -0.0537 180 PRO A CA  
1229 C C   . PRO A 180 ? 1.2287 0.4021 0.4297 -0.1393 0.1721  -0.0592 180 PRO A C   
1230 O O   . PRO A 180 ? 1.2172 0.4038 0.4237 -0.1398 0.1533  -0.0549 180 PRO A O   
1231 C CB  . PRO A 180 ? 1.2379 0.3998 0.4013 -0.1625 0.1620  -0.0476 180 PRO A CB  
1232 C CG  . PRO A 180 ? 1.3060 0.4674 0.4731 -0.1635 0.1726  -0.0470 180 PRO A CG  
1233 C CD  . PRO A 180 ? 1.2541 0.4128 0.4410 -0.1507 0.1986  -0.0573 180 PRO A CD  
1234 N N   . GLU A 181 ? 1.1970 0.3455 0.3852 -0.1356 0.1958  -0.0685 181 GLU A N   
1235 C CA  . GLU A 181 ? 1.2060 0.3388 0.3836 -0.1317 0.2006  -0.0743 181 GLU A CA  
1236 C C   . GLU A 181 ? 1.2283 0.3945 0.4588 -0.1120 0.1965  -0.0757 181 GLU A C   
1237 O O   . GLU A 181 ? 1.2302 0.3992 0.4608 -0.1105 0.1849  -0.0753 181 GLU A O   
1238 C CB  . GLU A 181 ? 1.2656 0.3588 0.4121 -0.1327 0.2286  -0.0837 181 GLU A CB  
1239 C CG  . GLU A 181 ? 1.4163 0.4787 0.5205 -0.1480 0.2411  -0.0843 181 GLU A CG  
1240 C CD  . GLU A 181 ? 1.5999 0.6751 0.7308 -0.1404 0.2573  -0.0858 181 GLU A CD  
1241 O OE1 . GLU A 181 ? 1.5346 0.6216 0.6670 -0.1480 0.2473  -0.0793 181 GLU A OE1 
1242 O OE2 . GLU A 181 ? 1.3927 0.4658 0.5430 -0.1271 0.2802  -0.0930 181 GLU A OE2 
1243 N N   . ASP A 182 ? 1.1355 0.3269 0.4098 -0.0983 0.2048  -0.0767 182 ASP A N   
1244 C CA  . ASP A 182 ? 1.0866 0.3098 0.4127 -0.0799 0.2019  -0.0776 182 ASP A CA  
1245 C C   . ASP A 182 ? 1.1201 0.3655 0.4625 -0.0773 0.1780  -0.0728 182 ASP A C   
1246 O O   . ASP A 182 ? 1.1131 0.3721 0.4841 -0.0642 0.1772  -0.0753 182 ASP A O   
1247 C CB  . ASP A 182 ? 1.0780 0.3275 0.4448 -0.0709 0.2079  -0.0765 182 ASP A CB  
1248 C CG  . ASP A 182 ? 1.1811 0.4134 0.5395 -0.0715 0.2334  -0.0813 182 ASP A CG  
1249 O OD1 . ASP A 182 ? 1.2207 0.4180 0.5414 -0.0774 0.2490  -0.0865 182 ASP A OD1 
1250 O OD2 . ASP A 182 ? 1.1713 0.4235 0.5590 -0.0670 0.2382  -0.0797 182 ASP A OD2 
1251 N N   . ALA A 183 ? 1.0579 0.3070 0.3828 -0.0896 0.1589  -0.0656 183 ALA A N   
1252 C CA  . ALA A 183 ? 1.0147 0.2847 0.3531 -0.0884 0.1368  -0.0604 183 ALA A CA  
1253 C C   . ALA A 183 ? 1.0481 0.3017 0.3697 -0.0886 0.1366  -0.0645 183 ALA A C   
1254 O O   . ALA A 183 ? 0.9929 0.2648 0.3376 -0.0807 0.1258  -0.0636 183 ALA A O   
1255 C CB  . ALA A 183 ? 1.0271 0.3008 0.3467 -0.1025 0.1192  -0.0515 183 ALA A CB  
1256 N N   . LYS A 184 ? 1.0660 0.2828 0.3456 -0.0976 0.1496  -0.0693 184 LYS A N   
1257 C CA  . LYS A 184 ? 1.0880 0.2813 0.3440 -0.0991 0.1524  -0.0740 184 LYS A CA  
1258 C C   . LYS A 184 ? 1.1399 0.3363 0.4253 -0.0804 0.1672  -0.0810 184 LYS A C   
1259 O O   . LYS A 184 ? 1.1513 0.3419 0.4357 -0.0758 0.1645  -0.0836 184 LYS A O   
1260 C CB  . LYS A 184 ? 1.1635 0.3120 0.3623 -0.1148 0.1642  -0.0774 184 LYS A CB  
1261 C CG  . LYS A 184 ? 1.4008 0.5400 0.5641 -0.1354 0.1513  -0.0703 184 LYS A CG  
1262 C CD  . LYS A 184 ? 1.6077 0.6991 0.7141 -0.1502 0.1671  -0.0748 184 LYS A CD  
1263 C CE  . LYS A 184 ? 1.7339 0.8139 0.8045 -0.1709 0.1565  -0.0676 184 LYS A CE  
1264 N NZ  . LYS A 184 ? 1.7485 0.8452 0.8390 -0.1681 0.1599  -0.0645 184 LYS A NZ  
1265 N N   . ASN A 185 ? 1.0820 0.2869 0.3930 -0.0701 0.1826  -0.0837 185 ASN A N   
1266 C CA  . ASN A 185 ? 1.0813 0.2895 0.4216 -0.0526 0.1980  -0.0894 185 ASN A CA  
1267 C C   . ASN A 185 ? 1.1150 0.3602 0.5080 -0.0371 0.1880  -0.0872 185 ASN A C   
1268 O O   . ASN A 185 ? 1.0839 0.3551 0.5104 -0.0314 0.1875  -0.0845 185 ASN A O   
1269 C CB  . ASN A 185 ? 1.1292 0.3243 0.4687 -0.0493 0.2231  -0.0938 185 ASN A CB  
1270 C CG  . ASN A 185 ? 1.4220 0.6180 0.7901 -0.0313 0.2414  -0.0992 185 ASN A CG  
1271 O OD1 . ASN A 185 ? 1.2601 0.4681 0.6556 -0.0229 0.2560  -0.1003 185 ASN A OD1 
1272 N ND2 . ASN A 185 ? 1.3709 0.5534 0.7326 -0.0251 0.2416  -0.1024 185 ASN A ND2 
1273 N N   . PRO A 186 ? 1.0831 0.3283 0.4834 -0.0295 0.1821  -0.0887 186 PRO A N   
1274 C CA  . PRO A 186 ? 1.0434 0.3198 0.4929 -0.0140 0.1752  -0.0873 186 PRO A CA  
1275 C C   . PRO A 186 ? 1.1039 0.3801 0.5772 -0.0012 0.1969  -0.0913 186 PRO A C   
1276 O O   . PRO A 186 ? 1.1571 0.4043 0.6079 0.0000  0.2150  -0.0965 186 PRO A O   
1277 C CB  . PRO A 186 ? 1.0665 0.3333 0.5072 -0.0112 0.1669  -0.0888 186 PRO A CB  
1278 C CG  . PRO A 186 ? 1.1539 0.3885 0.5414 -0.0274 0.1658  -0.0899 186 PRO A CG  
1279 C CD  . PRO A 186 ? 1.1306 0.3450 0.4942 -0.0346 0.1830  -0.0922 186 PRO A CD  
1280 N N   . GLN A 187 ? 1.0050 0.3113 0.5202 0.0066  0.1965  -0.0885 187 GLN A N   
1281 C CA  . GLN A 187 ? 0.9882 0.3020 0.5328 0.0175  0.2158  -0.0905 187 GLN A CA  
1282 C C   . GLN A 187 ? 1.0187 0.3438 0.5667 0.0098  0.2180  -0.0878 187 GLN A C   
1283 O O   . GLN A 187 ? 1.0047 0.3434 0.5811 0.0161  0.2305  -0.0878 187 GLN A O   
1284 C CB  . GLN A 187 ? 1.0314 0.3130 0.5545 0.0213  0.2407  -0.0968 187 GLN A CB  
1285 C CG  . GLN A 187 ? 0.8066 0.0917 0.3484 0.0350  0.2447  -0.0957 187 GLN A CG  
1286 C CD  . GLN A 187 ? 1.2041 0.4431 0.7117 0.0377  0.2681  -0.1054 187 GLN A CD  
1287 O OE1 . GLN A 187 ? 1.2381 0.4748 0.7649 0.0495  0.2892  -0.1078 187 GLN A OE1 
1288 N NE2 . GLN A 187 ? 1.2117 0.4185 0.6684 0.0250  0.2652  -0.1080 187 GLN A NE2 
1289 N N   . LYS A 188 ? 0.9749 0.2934 0.4928 -0.0046 0.2060  -0.0851 188 LYS A N   
1290 C CA  . LYS A 188 ? 0.9641 0.2914 0.4794 -0.0138 0.2032  -0.0814 188 LYS A CA  
1291 C C   . LYS A 188 ? 0.9583 0.3095 0.4871 -0.0159 0.1783  -0.0753 188 LYS A C   
1292 O O   . LYS A 188 ? 0.9354 0.2802 0.4434 -0.0218 0.1645  -0.0737 188 LYS A O   
1293 C CB  . LYS A 188 ? 1.0203 0.3156 0.4854 -0.0291 0.2114  -0.0828 188 LYS A CB  
1294 C CG  . LYS A 188 ? 0.9854 0.2557 0.4358 -0.0277 0.2385  -0.0890 188 LYS A CG  
1295 C CD  . LYS A 188 ? 1.0054 0.2898 0.4810 -0.0246 0.2523  -0.0886 188 LYS A CD  
1296 C CE  . LYS A 188 ? 1.0651 0.3306 0.5379 -0.0188 0.2812  -0.0947 188 LYS A CE  
1297 N NZ  . LYS A 188 ? 1.1983 0.4875 0.7213 -0.0006 0.2877  -0.0954 188 LYS A NZ  
1298 N N   . ASN A 189 ? 0.8888 0.2675 0.4535 -0.0106 0.1733  -0.0720 189 ASN A N   
1299 C CA  . ASN A 189 ? 0.8624 0.2626 0.4415 -0.0109 0.1519  -0.0666 189 ASN A CA  
1300 C C   . ASN A 189 ? 0.9027 0.3041 0.4655 -0.0220 0.1437  -0.0617 189 ASN A C   
1301 O O   . ASN A 189 ? 0.8912 0.3096 0.4746 -0.0210 0.1408  -0.0584 189 ASN A O   
1302 C CB  . ASN A 189 ? 0.8703 0.2977 0.4950 0.0009  0.1472  -0.0654 189 ASN A CB  
1303 C CG  . ASN A 189 ? 1.2347 0.6761 0.8688 0.0031  0.1270  -0.0622 189 ASN A CG  
1304 O OD1 . ASN A 189 ? 1.2048 0.6595 0.8445 -0.0002 0.1148  -0.0576 189 ASN A OD1 
1305 N ND2 . ASN A 189 ? 1.1647 0.6006 0.7972 0.0081  0.1236  -0.0645 189 ASN A ND2 
1306 N N   . THR A 190 ? 0.8582 0.2407 0.3832 -0.0330 0.1393  -0.0605 190 THR A N   
1307 C CA  . THR A 190 ? 0.8479 0.2296 0.3539 -0.0443 0.1298  -0.0546 190 THR A CA  
1308 C C   . THR A 190 ? 0.8424 0.2475 0.3676 -0.0415 0.1099  -0.0486 190 THR A C   
1309 O O   . THR A 190 ? 0.8327 0.2469 0.3712 -0.0350 0.1018  -0.0493 190 THR A O   
1310 C CB  . THR A 190 ? 0.9403 0.2953 0.4007 -0.0575 0.1295  -0.0543 190 THR A CB  
1311 O OG1 . THR A 190 ? 0.9826 0.3323 0.4353 -0.0561 0.1233  -0.0561 190 THR A OG1 
1312 C CG2 . THR A 190 ? 0.8911 0.2192 0.3255 -0.0635 0.1499  -0.0591 190 THR A CG2 
1313 N N   . PRO A 191 ? 0.7586 0.1727 0.2854 -0.0458 0.1025  -0.0426 191 PRO A N   
1314 C CA  . PRO A 191 ? 0.7296 0.1639 0.2731 -0.0426 0.0850  -0.0367 191 PRO A CA  
1315 C C   . PRO A 191 ? 0.8023 0.2369 0.3340 -0.0451 0.0719  -0.0343 191 PRO A C   
1316 O O   . PRO A 191 ? 0.8179 0.2372 0.3190 -0.0554 0.0701  -0.0326 191 PRO A O   
1317 C CB  . PRO A 191 ? 0.7455 0.1797 0.2794 -0.0497 0.0815  -0.0305 191 PRO A CB  
1318 C CG  . PRO A 191 ? 0.8022 0.2255 0.3321 -0.0519 0.0978  -0.0343 191 PRO A CG  
1319 C CD  . PRO A 191 ? 0.7761 0.1805 0.2881 -0.0537 0.1100  -0.0407 191 PRO A CD  
1320 N N   . LYS A 192 ? 0.7576 0.2083 0.3122 -0.0366 0.0633  -0.0343 192 LYS A N   
1321 C CA  . LYS A 192 ? 0.7656 0.2178 0.3103 -0.0394 0.0515  -0.0318 192 LYS A CA  
1322 C C   . LYS A 192 ? 0.8615 0.3214 0.3979 -0.0460 0.0385  -0.0230 192 LYS A C   
1323 O O   . LYS A 192 ? 0.8677 0.3205 0.3812 -0.0552 0.0321  -0.0195 192 LYS A O   
1324 C CB  . LYS A 192 ? 0.7544 0.2181 0.3215 -0.0296 0.0469  -0.0347 192 LYS A CB  
1325 C CG  . LYS A 192 ? 0.7637 0.2112 0.3175 -0.0297 0.0537  -0.0409 192 LYS A CG  
1326 C CD  . LYS A 192 ? 0.7234 0.1781 0.2939 -0.0213 0.0489  -0.0435 192 LYS A CD  
1327 C CE  . LYS A 192 ? 0.7005 0.1368 0.2607 -0.0193 0.0597  -0.0501 192 LYS A CE  
1328 N NZ  . LYS A 192 ? 0.8614 0.2962 0.4214 -0.0164 0.0531  -0.0519 192 LYS A NZ  
1329 N N   . PHE A 193 ? 0.8282 0.3014 0.3823 -0.0418 0.0352  -0.0188 193 PHE A N   
1330 C CA  . PHE A 193 ? 0.8279 0.3093 0.3783 -0.0457 0.0241  -0.0097 193 PHE A CA  
1331 C C   . PHE A 193 ? 0.8719 0.3569 0.4316 -0.0436 0.0263  -0.0065 193 PHE A C   
1332 O O   . PHE A 193 ? 0.8503 0.3368 0.4261 -0.0377 0.0346  -0.0112 193 PHE A O   
1333 C CB  . PHE A 193 ? 0.8287 0.3276 0.3949 -0.0403 0.0120  -0.0057 193 PHE A CB  
1334 C CG  . PHE A 193 ? 0.8252 0.3370 0.4203 -0.0285 0.0121  -0.0082 193 PHE A CG  
1335 C CD1 . PHE A 193 ? 0.8560 0.3708 0.4625 -0.0226 0.0125  -0.0138 193 PHE A CD1 
1336 C CD2 . PHE A 193 ? 0.8403 0.3594 0.4488 -0.0241 0.0110  -0.0046 193 PHE A CD2 
1337 C CE1 . PHE A 193 ? 0.8444 0.3696 0.4748 -0.0133 0.0114  -0.0155 193 PHE A CE1 
1338 C CE2 . PHE A 193 ? 0.8517 0.3798 0.4833 -0.0149 0.0109  -0.0070 193 PHE A CE2 
1339 C CZ  . PHE A 193 ? 0.8134 0.3446 0.4555 -0.0099 0.0107  -0.0123 193 PHE A CZ  
1340 N N   . LEU A 194 ? 0.8232 0.3103 0.3734 -0.0487 0.0177  0.0022  194 LEU A N   
1341 C CA  . LEU A 194 ? 0.8138 0.3051 0.3723 -0.0462 0.0165  0.0071  194 LEU A CA  
1342 C C   . LEU A 194 ? 0.8475 0.3562 0.4232 -0.0392 0.0048  0.0135  194 LEU A C   
1343 O O   . LEU A 194 ? 0.8544 0.3694 0.4256 -0.0416 -0.0041 0.0181  194 LEU A O   
1344 C CB  . LEU A 194 ? 0.8385 0.3176 0.3726 -0.0566 0.0155  0.0131  194 LEU A CB  
1345 C CG  . LEU A 194 ? 0.8842 0.3677 0.4260 -0.0537 0.0119  0.0200  194 LEU A CG  
1346 C CD1 . LEU A 194 ? 0.8941 0.3665 0.4339 -0.0550 0.0241  0.0153  194 LEU A CD1 
1347 C CD2 . LEU A 194 ? 0.9033 0.3861 0.4290 -0.0607 0.0002  0.0312  194 LEU A CD2 
1348 N N   . TYR A 195 ? 0.7663 0.2820 0.3611 -0.0308 0.0055  0.0139  195 TYR A N   
1349 C CA  . TYR A 195 ? 0.7238 0.2533 0.3349 -0.0228 -0.0029 0.0193  195 TYR A CA  
1350 C C   . TYR A 195 ? 0.7589 0.2873 0.3701 -0.0215 -0.0054 0.0268  195 TYR A C   
1351 O O   . TYR A 195 ? 0.7387 0.2591 0.3501 -0.0216 0.0013  0.0243  195 TYR A O   
1352 C CB  . TYR A 195 ? 0.7034 0.2389 0.3350 -0.0139 0.0002  0.0124  195 TYR A CB  
1353 C CG  . TYR A 195 ? 0.6972 0.2434 0.3436 -0.0055 -0.0063 0.0169  195 TYR A CG  
1354 C CD1 . TYR A 195 ? 0.7258 0.2821 0.3753 -0.0037 -0.0132 0.0201  195 TYR A CD1 
1355 C CD2 . TYR A 195 ? 0.6888 0.2337 0.3447 0.0001  -0.0048 0.0182  195 TYR A CD2 
1356 C CE1 . TYR A 195 ? 0.7351 0.3004 0.3977 0.0045  -0.0173 0.0244  195 TYR A CE1 
1357 C CE2 . TYR A 195 ? 0.6887 0.2403 0.3554 0.0080  -0.0093 0.0224  195 TYR A CE2 
1358 C CZ  . TYR A 195 ? 0.7485 0.3104 0.4191 0.0107  -0.0150 0.0253  195 TYR A CZ  
1359 O OH  . TYR A 195 ? 0.6358 0.2036 0.3169 0.0190  -0.0175 0.0293  195 TYR A OH  
1360 N N   . THR A 196 ? 0.7178 0.2544 0.3293 -0.0202 -0.0150 0.0365  196 THR A N   
1361 C CA  . THR A 196 ? 0.7217 0.2576 0.3341 -0.0173 -0.0185 0.0451  196 THR A CA  
1362 C C   . THR A 196 ? 0.7260 0.2760 0.3523 -0.0090 -0.0269 0.0539  196 THR A C   
1363 O O   . THR A 196 ? 0.6813 0.2433 0.3123 -0.0089 -0.0324 0.0562  196 THR A O   
1364 C CB  . THR A 196 ? 0.8694 0.3930 0.4595 -0.0278 -0.0192 0.0500  196 THR A CB  
1365 O OG1 . THR A 196 ? 0.9396 0.4577 0.5309 -0.0243 -0.0191 0.0552  196 THR A OG1 
1366 C CG2 . THR A 196 ? 0.8445 0.3727 0.4222 -0.0351 -0.0297 0.0591  196 THR A CG2 
1367 N N   . VAL A 197 ? 0.6894 0.2370 0.3219 -0.0021 -0.0269 0.0590  197 VAL A N   
1368 C CA  . VAL A 197 ? 0.6852 0.2434 0.3301 0.0069  -0.0331 0.0687  197 VAL A CA  
1369 C C   . VAL A 197 ? 0.7590 0.3126 0.3920 0.0024  -0.0390 0.0796  197 VAL A C   
1370 O O   . VAL A 197 ? 0.7803 0.3218 0.4087 0.0043  -0.0361 0.0812  197 VAL A O   
1371 C CB  . VAL A 197 ? 0.7150 0.2720 0.3748 0.0192  -0.0286 0.0664  197 VAL A CB  
1372 C CG1 . VAL A 197 ? 0.7110 0.2783 0.3824 0.0288  -0.0337 0.0775  197 VAL A CG1 
1373 C CG2 . VAL A 197 ? 0.6942 0.2545 0.3631 0.0217  -0.0241 0.0560  197 VAL A CG2 
1374 N N   . PRO A 198 ? 0.6971 0.2580 0.3217 -0.0056 -0.0475 0.0867  198 PRO A N   
1375 C CA  . PRO A 198 ? 0.7068 0.2614 0.3166 -0.0124 -0.0543 0.0973  198 PRO A CA  
1376 C C   . PRO A 198 ? 0.7237 0.2821 0.3438 -0.0026 -0.0595 0.1094  198 PRO A C   
1377 O O   . PRO A 198 ? 0.7438 0.2926 0.3504 -0.0074 -0.0638 0.1169  198 PRO A O   
1378 C CB  . PRO A 198 ? 0.7312 0.2934 0.3304 -0.0238 -0.0630 0.1018  198 PRO A CB  
1379 C CG  . PRO A 198 ? 0.7615 0.3402 0.3778 -0.0185 -0.0634 0.0988  198 PRO A CG  
1380 C CD  . PRO A 198 ? 0.6898 0.2632 0.3158 -0.0105 -0.0519 0.0859  198 PRO A CD  
1381 N N   . ASN A 199 ? 0.6407 0.2112 0.2830 0.0108  -0.0585 0.1113  199 ASN A N   
1382 C CA  . ASN A 199 ? 0.6500 0.2234 0.3036 0.0221  -0.0617 0.1227  199 ASN A CA  
1383 C C   . ASN A 199 ? 0.7026 0.2706 0.3688 0.0355  -0.0523 0.1167  199 ASN A C   
1384 O O   . ASN A 199 ? 0.7112 0.2888 0.3909 0.0411  -0.0485 0.1111  199 ASN A O   
1385 C CB  . ASN A 199 ? 0.6497 0.2459 0.3183 0.0254  -0.0720 0.1362  199 ASN A CB  
1386 C CG  . ASN A 199 ? 0.9826 0.5823 0.6376 0.0124  -0.0840 0.1461  199 ASN A CG  
1387 O OD1 . ASN A 199 ? 0.9153 0.4999 0.5523 0.0060  -0.0870 0.1502  199 ASN A OD1 
1388 N ND2 . ASN A 199 ? 0.9048 0.5238 0.5668 0.0075  -0.0915 0.1507  199 ASN A ND2 
1389 N N   . GLY A 200 ? 0.6241 0.1750 0.2838 0.0396  -0.0488 0.1182  200 GLY A N   
1390 C CA  . GLY A 200 ? 0.6062 0.1468 0.2729 0.0509  -0.0402 0.1134  200 GLY A CA  
1391 C C   . GLY A 200 ? 0.6180 0.1545 0.2861 0.0493  -0.0319 0.0984  200 GLY A C   
1392 O O   . GLY A 200 ? 0.5860 0.1279 0.2667 0.0580  -0.0278 0.0944  200 GLY A O   
1393 N N   . ASN A 201 ? 0.5872 0.1194 0.2435 0.0375  -0.0287 0.0872  201 ASN A N   
1394 C CA  . ASN A 201 ? 0.5834 0.1090 0.2404 0.0351  -0.0220 0.0758  201 ASN A CA  
1395 C C   . ASN A 201 ? 0.6521 0.1668 0.3153 0.0436  -0.0157 0.0712  201 ASN A C   
1396 O O   . ASN A 201 ? 0.6280 0.1275 0.2852 0.0462  -0.0130 0.0731  201 ASN A O   
1397 C CB  . ASN A 201 ? 0.6157 0.1305 0.2582 0.0227  -0.0187 0.0699  201 ASN A CB  
1398 C CG  . ASN A 201 ? 0.8449 0.3576 0.4916 0.0200  -0.0117 0.0572  201 ASN A CG  
1399 O OD1 . ASN A 201 ? 0.7604 0.2613 0.4047 0.0184  -0.0061 0.0523  201 ASN A OD1 
1400 N ND2 . ASN A 201 ? 0.6919 0.2161 0.3456 0.0192  -0.0124 0.0521  201 ASN A ND2 
1401 N N   . ASN A 202 ? 0.6474 0.1696 0.3209 0.0469  -0.0137 0.0644  202 ASN A N   
1402 C CA  . ASN A 202 ? 0.6606 0.1732 0.3379 0.0523  -0.0083 0.0578  202 ASN A CA  
1403 C C   . ASN A 202 ? 0.7290 0.2330 0.3998 0.0426  -0.0049 0.0491  202 ASN A C   
1404 O O   . ASN A 202 ? 0.7295 0.2418 0.4010 0.0355  -0.0053 0.0443  202 ASN A O   
1405 C CB  . ASN A 202 ? 0.7187 0.2427 0.4067 0.0560  -0.0083 0.0532  202 ASN A CB  
1406 C CG  . ASN A 202 ? 1.1810 0.6940 0.8710 0.0623  -0.0036 0.0480  202 ASN A CG  
1407 O OD1 . ASN A 202 ? 1.2211 0.7172 0.9042 0.0617  -0.0002 0.0453  202 ASN A OD1 
1408 N ND2 . ASN A 202 ? 1.0306 0.5518 0.7284 0.0676  -0.0034 0.0469  202 ASN A ND2 
1409 N N   . PRO A 203 ? 0.7035 0.1911 0.3669 0.0412  -0.0013 0.0483  203 PRO A N   
1410 C CA  . PRO A 203 ? 0.7213 0.1938 0.3805 0.0488  0.0006  0.0527  203 PRO A CA  
1411 C C   . PRO A 203 ? 0.7946 0.2561 0.4428 0.0490  -0.0004 0.0615  203 PRO A C   
1412 O O   . PRO A 203 ? 0.7839 0.2320 0.4283 0.0569  0.0012  0.0663  203 PRO A O   
1413 C CB  . PRO A 203 ? 0.7408 0.2006 0.3976 0.0444  0.0049  0.0440  203 PRO A CB  
1414 C CG  . PRO A 203 ? 0.7856 0.2510 0.4423 0.0330  0.0058  0.0386  203 PRO A CG  
1415 C CD  . PRO A 203 ? 0.7216 0.2037 0.3816 0.0314  0.0024  0.0407  203 PRO A CD  
1416 N N   . THR A 204 ? 0.7585 0.2235 0.4000 0.0401  -0.0026 0.0634  204 THR A N   
1417 C CA  . THR A 204 ? 0.7591 0.2127 0.3870 0.0364  -0.0038 0.0706  204 THR A CA  
1418 C C   . THR A 204 ? 0.8251 0.2813 0.4527 0.0441  -0.0099 0.0834  204 THR A C   
1419 O O   . THR A 204 ? 0.8463 0.2875 0.4632 0.0454  -0.0104 0.0901  204 THR A O   
1420 C CB  . THR A 204 ? 0.6246 0.0789 0.2435 0.0230  -0.0026 0.0668  204 THR A CB  
1421 O OG1 . THR A 204 ? 0.5743 0.0685 0.1966 0.0191  -0.0079 0.0608  204 THR A OG1 
1422 C CG2 . THR A 204 ? 0.4910 0.0476 0.1247 0.0141  0.0040  0.0254  204 THR A CG2 
1423 N N   . GLY A 205 ? 0.7508 0.2261 0.3900 0.0485  -0.0147 0.0872  205 GLY A N   
1424 C CA  . GLY A 205 ? 0.7480 0.2316 0.3915 0.0554  -0.0216 0.1004  205 GLY A CA  
1425 C C   . GLY A 205 ? 0.7796 0.2647 0.4111 0.0453  -0.0285 0.1072  205 GLY A C   
1426 O O   . GLY A 205 ? 0.7634 0.2535 0.3963 0.0493  -0.0359 0.1198  205 GLY A O   
1427 N N   . ASN A 206 ? 0.7405 0.2206 0.3598 0.0320  -0.0260 0.0992  206 ASN A N   
1428 C CA  . ASN A 206 ? 0.7661 0.2430 0.3689 0.0205  -0.0309 0.1041  206 ASN A CA  
1429 C C   . ASN A 206 ? 0.8536 0.3491 0.4602 0.0160  -0.0378 0.1065  206 ASN A C   
1430 O O   . ASN A 206 ? 0.8557 0.3629 0.4731 0.0168  -0.0353 0.0989  206 ASN A O   
1431 C CB  . ASN A 206 ? 0.7499 0.2117 0.3368 0.0083  -0.0234 0.0948  206 ASN A CB  
1432 C CG  . ASN A 206 ? 1.0064 0.4491 0.5875 0.0095  -0.0164 0.0916  206 ASN A CG  
1433 O OD1 . ASN A 206 ? 0.8956 0.3322 0.4736 0.0025  -0.0085 0.0816  206 ASN A OD1 
1434 N ND2 . ASN A 206 ? 0.8834 0.3155 0.4623 0.0176  -0.0189 0.1002  206 ASN A ND2 
1435 N N   . SER A 207 ? 0.8248 0.3224 0.4220 0.0109  -0.0474 0.1180  207 SER A N   
1436 C CA  . SER A 207 ? 0.8168 0.3303 0.4142 0.0044  -0.0559 0.1225  207 SER A CA  
1437 C C   . SER A 207 ? 0.9126 0.4142 0.4843 -0.0122 -0.0572 0.1211  207 SER A C   
1438 O O   . SER A 207 ? 0.9569 0.4404 0.5121 -0.0170 -0.0550 0.1222  207 SER A O   
1439 C CB  . SER A 207 ? 0.8458 0.3730 0.4541 0.0113  -0.0675 0.1388  207 SER A CB  
1440 O OG  . SER A 207 ? 0.9072 0.4482 0.5404 0.0266  -0.0656 0.1404  207 SER A OG  
1441 N N   . LEU A 208 ? 0.8675 0.3772 0.4335 -0.0215 -0.0605 0.1190  208 LEU A N   
1442 C CA  . LEU A 208 ? 0.8955 0.3912 0.4338 -0.0377 -0.0614 0.1181  208 LEU A CA  
1443 C C   . LEU A 208 ? 0.9685 0.4648 0.4953 -0.0436 -0.0759 0.1342  208 LEU A C   
1444 O O   . LEU A 208 ? 0.9636 0.4752 0.5083 -0.0342 -0.0851 0.1458  208 LEU A O   
1445 C CB  . LEU A 208 ? 0.8997 0.3992 0.4325 -0.0461 -0.0579 0.1085  208 LEU A CB  
1446 C CG  . LEU A 208 ? 0.9710 0.4618 0.5041 -0.0462 -0.0429 0.0924  208 LEU A CG  
1447 C CD1 . LEU A 208 ? 0.9672 0.4667 0.5037 -0.0489 -0.0408 0.0845  208 LEU A CD1 
1448 C CD2 . LEU A 208 ? 1.0231 0.4912 0.5313 -0.0572 -0.0347 0.0879  208 LEU A CD2 
1449 N N   . THR A 209 ? 0.9367 0.4157 0.4335 -0.0593 -0.0775 0.1351  209 THR A N   
1450 C CA  . THR A 209 ? 0.9407 0.4151 0.4190 -0.0692 -0.0917 0.1496  209 THR A CA  
1451 C C   . THR A 209 ? 0.9632 0.4409 0.4263 -0.0835 -0.0978 0.1494  209 THR A C   
1452 O O   . THR A 209 ? 0.9279 0.4017 0.3859 -0.0877 -0.0875 0.1360  209 THR A O   
1453 C CB  . THR A 209 ? 1.0620 0.5085 0.5115 -0.0785 -0.0870 0.1489  209 THR A CB  
1454 O OG1 . THR A 209 ? 1.0790 0.5094 0.5039 -0.0925 -0.0772 0.1371  209 THR A OG1 
1455 C CG2 . THR A 209 ? 1.0142 0.4527 0.4742 -0.0671 -0.0769 0.1444  209 THR A CG2 
1456 N N   . SER A 210 ? 0.9518 0.4350 0.4062 -0.0918 -0.1146 0.1644  210 SER A N   
1457 C CA  . SER A 210 ? 0.9613 0.4450 0.3965 -0.1081 -0.1225 0.1660  210 SER A CA  
1458 C C   . SER A 210 ? 1.0068 0.4609 0.4045 -0.1238 -0.1118 0.1542  210 SER A C   
1459 O O   . SER A 210 ? 0.9820 0.4333 0.3708 -0.1305 -0.1057 0.1442  210 SER A O   
1460 C CB  . SER A 210 ? 1.0343 0.5242 0.4618 -0.1166 -0.1432 0.1855  210 SER A CB  
1461 O OG  . SER A 210 ? 1.1634 0.6829 0.6267 -0.1027 -0.1536 0.1980  210 SER A OG  
1462 N N   . GLU A 211 ? 0.9806 0.4117 0.3564 -0.1289 -0.1083 0.1554  211 GLU A N   
1463 C CA  . GLU A 211 ? 1.0030 0.4041 0.3425 -0.1434 -0.0965 0.1452  211 GLU A CA  
1464 C C   . GLU A 211 ? 0.9937 0.3920 0.3410 -0.1383 -0.0764 0.1264  211 GLU A C   
1465 O O   . GLU A 211 ? 0.9981 0.3871 0.3275 -0.1482 -0.0707 0.1183  211 GLU A O   
1466 C CB  . GLU A 211 ? 1.0546 0.4332 0.3724 -0.1485 -0.0962 0.1506  211 GLU A CB  
1467 C CG  . GLU A 211 ? 1.3019 0.6479 0.5732 -0.1689 -0.0902 0.1461  211 GLU A CG  
1468 C CD  . GLU A 211 ? 1.7036 1.0432 0.9494 -0.1852 -0.0963 0.1463  211 GLU A CD  
1469 O OE1 . GLU A 211 ? 1.5933 0.9174 0.8217 -0.1919 -0.0811 0.1324  211 GLU A OE1 
1470 O OE2 . GLU A 211 ? 1.6711 1.0213 0.9150 -0.1910 -0.1161 0.1606  211 GLU A OE2 
1471 N N   . ARG A 212 ? 0.8829 0.2893 0.2571 -0.1228 -0.0666 0.1203  212 ARG A N   
1472 C CA  . ARG A 212 ? 0.8488 0.2554 0.2353 -0.1166 -0.0491 0.1041  212 ARG A CA  
1473 C C   . ARG A 212 ? 0.8746 0.2954 0.2720 -0.1151 -0.0493 0.0983  212 ARG A C   
1474 O O   . ARG A 212 ? 0.8647 0.2755 0.2524 -0.1196 -0.0368 0.0863  212 ARG A O   
1475 C CB  . ARG A 212 ? 0.8342 0.2515 0.2508 -0.1001 -0.0437 0.1019  212 ARG A CB  
1476 C CG  . ARG A 212 ? 0.9527 0.3517 0.3581 -0.1017 -0.0363 0.1014  212 ARG A CG  
1477 C CD  . ARG A 212 ? 0.9573 0.3648 0.3906 -0.0873 -0.0281 0.0954  212 ARG A CD  
1478 N NE  . ARG A 212 ? 1.0050 0.3964 0.4289 -0.0884 -0.0238 0.0975  212 ARG A NE  
1479 C CZ  . ARG A 212 ? 1.0748 0.4635 0.5107 -0.0828 -0.0124 0.0898  212 ARG A CZ  
1480 N NH1 . ARG A 212 ? 0.7914 0.1929 0.2500 -0.0753 -0.0043 0.0794  212 ARG A NH1 
1481 N NH2 . ARG A 212 ? 0.8735 0.2462 0.2979 -0.0854 -0.0095 0.0927  212 ARG A NH2 
1482 N N   . LYS A 213 ? 0.8185 0.2622 0.2358 -0.1089 -0.0631 0.1073  213 LYS A N   
1483 C CA  . LYS A 213 ? 0.8014 0.2596 0.2293 -0.1080 -0.0650 0.1032  213 LYS A CA  
1484 C C   . LYS A 213 ? 0.9244 0.3654 0.3182 -0.1257 -0.0653 0.1007  213 LYS A C   
1485 O O   . LYS A 213 ? 0.9339 0.3724 0.3259 -0.1267 -0.0567 0.0899  213 LYS A O   
1486 C CB  . LYS A 213 ? 0.8001 0.2851 0.2527 -0.1004 -0.0802 0.1154  213 LYS A CB  
1487 C CG  . LYS A 213 ? 0.7764 0.2797 0.2653 -0.0812 -0.0765 0.1138  213 LYS A CG  
1488 C CD  . LYS A 213 ? 0.8112 0.3413 0.3246 -0.0741 -0.0884 0.1236  213 LYS A CD  
1489 C CE  . LYS A 213 ? 0.9641 0.5079 0.5071 -0.0563 -0.0881 0.1283  213 LYS A CE  
1490 N NZ  . LYS A 213 ? 1.0421 0.6121 0.6088 -0.0495 -0.0991 0.1398  213 LYS A NZ  
1491 N N   . LYS A 214 ? 0.9188 0.3453 0.2831 -0.1401 -0.0749 0.1107  214 LYS A N   
1492 C CA  . LYS A 214 ? 0.9451 0.3501 0.2702 -0.1594 -0.0758 0.1091  214 LYS A CA  
1493 C C   . LYS A 214 ? 0.9911 0.3712 0.2970 -0.1629 -0.0549 0.0933  214 LYS A C   
1494 O O   . LYS A 214 ? 0.9837 0.3548 0.2763 -0.1687 -0.0479 0.0845  214 LYS A O   
1495 C CB  . LYS A 214 ? 0.9980 0.3910 0.2946 -0.1744 -0.0911 0.1237  214 LYS A CB  
1496 C CG  . LYS A 214 ? 0.9546 0.3729 0.2676 -0.1742 -0.1131 0.1404  214 LYS A CG  
1497 C CD  . LYS A 214 ? 1.0659 0.4766 0.3608 -0.1839 -0.1287 0.1567  214 LYS A CD  
1498 C CE  . LYS A 214 ? 1.0935 0.5363 0.4207 -0.1752 -0.1475 0.1736  214 LYS A CE  
1499 N NZ  . LYS A 214 ? 1.1032 0.5402 0.4141 -0.1847 -0.1647 0.1911  214 LYS A NZ  
1500 N N   . GLU A 215 ? 0.9444 0.3152 0.2521 -0.1581 -0.0442 0.0897  215 GLU A N   
1501 C CA  . GLU A 215 ? 0.9511 0.3019 0.2469 -0.1595 -0.0231 0.0758  215 GLU A CA  
1502 C C   . GLU A 215 ? 0.9748 0.3388 0.2972 -0.1475 -0.0118 0.0633  215 GLU A C   
1503 O O   . GLU A 215 ? 1.0061 0.3543 0.3120 -0.1529 0.0011  0.0531  215 GLU A O   
1504 C CB  . GLU A 215 ? 0.9666 0.3109 0.2663 -0.1553 -0.0160 0.0762  215 GLU A CB  
1505 C CG  . GLU A 215 ? 1.1132 0.4360 0.3790 -0.1692 -0.0225 0.0856  215 GLU A CG  
1506 C CD  . GLU A 215 ? 1.5654 0.8892 0.8423 -0.1625 -0.0229 0.0908  215 GLU A CD  
1507 O OE1 . GLU A 215 ? 1.6363 0.9607 0.9066 -0.1654 -0.0388 0.1047  215 GLU A OE1 
1508 O OE2 . GLU A 215 ? 1.5101 0.8339 0.8020 -0.1547 -0.0077 0.0815  215 GLU A OE2 
1509 N N   . ILE A 216 ? 0.8581 0.2491 0.2196 -0.1316 -0.0167 0.0647  216 ILE A N   
1510 C CA  . ILE A 216 ? 0.8218 0.2270 0.2104 -0.1196 -0.0087 0.0546  216 ILE A CA  
1511 C C   . ILE A 216 ? 0.8538 0.2592 0.2324 -0.1254 -0.0123 0.0522  216 ILE A C   
1512 O O   . ILE A 216 ? 0.8304 0.2276 0.2062 -0.1247 0.0003  0.0410  216 ILE A O   
1513 C CB  . ILE A 216 ? 0.8366 0.2675 0.2640 -0.1032 -0.0146 0.0580  216 ILE A CB  
1514 C CG1 . ILE A 216 ? 0.8463 0.2745 0.2805 -0.0985 -0.0122 0.0613  216 ILE A CG1 
1515 C CG2 . ILE A 216 ? 0.8119 0.2555 0.2654 -0.0918 -0.0067 0.0474  216 ILE A CG2 
1516 C CD1 . ILE A 216 ? 0.8841 0.3327 0.3454 -0.0860 -0.0235 0.0703  216 ILE A CD1 
1517 N N   . TYR A 217 ? 0.8282 0.2425 0.2013 -0.1314 -0.0296 0.0633  217 TYR A N   
1518 C CA  . TYR A 217 ? 0.8384 0.2519 0.1987 -0.1395 -0.0350 0.0626  217 TYR A CA  
1519 C C   . TYR A 217 ? 0.9301 0.3119 0.2498 -0.1543 -0.0249 0.0555  217 TYR A C   
1520 O O   . TYR A 217 ? 0.9120 0.2863 0.2242 -0.1560 -0.0180 0.0470  217 TYR A O   
1521 C CB  . TYR A 217 ? 0.8573 0.2855 0.2168 -0.1461 -0.0560 0.0775  217 TYR A CB  
1522 C CG  . TYR A 217 ? 0.8839 0.3148 0.2353 -0.1534 -0.0616 0.0765  217 TYR A CG  
1523 C CD1 . TYR A 217 ? 0.8785 0.3320 0.2599 -0.1420 -0.0629 0.0739  217 TYR A CD1 
1524 C CD2 . TYR A 217 ? 0.9217 0.3293 0.2324 -0.1724 -0.0642 0.0771  217 TYR A CD2 
1525 C CE1 . TYR A 217 ? 0.8878 0.3415 0.2600 -0.1492 -0.0669 0.0721  217 TYR A CE1 
1526 C CE2 . TYR A 217 ? 0.9239 0.3309 0.2245 -0.1799 -0.0684 0.0753  217 TYR A CE2 
1527 C CZ  . TYR A 217 ? 0.9344 0.3652 0.2665 -0.1682 -0.0699 0.0729  217 TYR A CZ  
1528 O OH  . TYR A 217 ? 0.8710 0.3009 0.1929 -0.1759 -0.0742 0.0714  217 TYR A OH  
1529 N N   . GLU A 218 ? 0.9403 0.3015 0.2318 -0.1653 -0.0238 0.0593  218 GLU A N   
1530 C CA  . GLU A 218 ? 0.9818 0.3089 0.2308 -0.1801 -0.0126 0.0529  218 GLU A CA  
1531 C C   . GLU A 218 ? 1.0140 0.3317 0.2701 -0.1716 0.0103  0.0374  218 GLU A C   
1532 O O   . GLU A 218 ? 1.0122 0.3096 0.2449 -0.1783 0.0203  0.0293  218 GLU A O   
1533 C CB  . GLU A 218 ? 1.0330 0.3416 0.2548 -0.1914 -0.0150 0.0601  218 GLU A CB  
1534 C CG  . GLU A 218 ? 1.2864 0.5621 0.4561 -0.2130 -0.0159 0.0612  218 GLU A CG  
1535 C CD  . GLU A 218 ? 1.5808 0.8615 0.7377 -0.2241 -0.0348 0.0699  218 GLU A CD  
1536 O OE1 . GLU A 218 ? 1.4050 0.6992 0.5650 -0.2288 -0.0549 0.0847  218 GLU A OE1 
1537 O OE2 . GLU A 218 ? 1.5775 0.8480 0.7209 -0.2286 -0.0295 0.0624  218 GLU A OE2 
1538 N N   . LEU A 219 ? 0.9483 0.2819 0.2384 -0.1565 0.0178  0.0339  219 LEU A N   
1539 C CA  . LEU A 219 ? 0.9290 0.2612 0.2359 -0.1462 0.0375  0.0211  219 LEU A CA  
1540 C C   . LEU A 219 ? 0.9664 0.3099 0.2911 -0.1379 0.0387  0.0146  219 LEU A C   
1541 O O   . LEU A 219 ? 0.9806 0.3116 0.3008 -0.1360 0.0545  0.0042  219 LEU A O   
1542 C CB  . LEU A 219 ? 0.8964 0.2454 0.2357 -0.1338 0.0406  0.0216  219 LEU A CB  
1543 C CG  . LEU A 219 ? 0.9761 0.3062 0.2976 -0.1404 0.0520  0.0205  219 LEU A CG  
1544 C CD1 . LEU A 219 ? 0.9597 0.3026 0.2995 -0.1347 0.0448  0.0279  219 LEU A CD1 
1545 C CD2 . LEU A 219 ? 1.0070 0.3267 0.3312 -0.1372 0.0746  0.0080  219 LEU A CD2 
1546 N N   . ALA A 220 ? 0.8802 0.2464 0.2241 -0.1331 0.0223  0.0213  220 ALA A N   
1547 C CA  . ALA A 220 ? 0.8449 0.2226 0.2048 -0.1261 0.0211  0.0165  220 ALA A CA  
1548 C C   . ALA A 220 ? 0.8967 0.2519 0.2222 -0.1385 0.0235  0.0129  220 ALA A C   
1549 O O   . ALA A 220 ? 0.8720 0.2246 0.2023 -0.1334 0.0310  0.0046  220 ALA A O   
1550 C CB  . ALA A 220 ? 0.8258 0.2310 0.2105 -0.1201 0.0036  0.0254  220 ALA A CB  
1551 N N   . ARG A 221 ? 0.8856 0.2224 0.1745 -0.1551 0.0171  0.0193  221 ARG A N   
1552 C CA  . ARG A 221 ? 0.9068 0.2174 0.1548 -0.1706 0.0177  0.0175  221 ARG A CA  
1553 C C   . ARG A 221 ? 0.9589 0.2392 0.1846 -0.1722 0.0406  0.0053  221 ARG A C   
1554 O O   . ARG A 221 ? 0.9329 0.2003 0.1490 -0.1717 0.0494  -0.0029 221 ARG A O   
1555 C CB  . ARG A 221 ? 0.9206 0.2219 0.1379 -0.1882 0.0023  0.0296  221 ARG A CB  
1556 C CG  . ARG A 221 ? 1.0863 0.3898 0.2885 -0.1997 -0.0140 0.0363  221 ARG A CG  
1557 C CD  . ARG A 221 ? 1.3224 0.5962 0.4739 -0.2225 -0.0197 0.0419  221 ARG A CD  
1558 N NE  . ARG A 221 ? 1.5010 0.7878 0.6467 -0.2343 -0.0431 0.0553  221 ARG A NE  
1559 C CZ  . ARG A 221 ? 1.7630 1.0716 0.9239 -0.2351 -0.0606 0.0695  221 ARG A CZ  
1560 N NH1 . ARG A 221 ? 1.6961 1.0179 0.8537 -0.2460 -0.0814 0.0821  221 ARG A NH1 
1561 N NH2 . ARG A 221 ? 1.5669 0.8844 0.7472 -0.2249 -0.0575 0.0717  221 ARG A NH2 
1562 N N   . LYS A 222 ? 0.9396 0.2088 0.1579 -0.1737 0.0510  0.0045  222 LYS A N   
1563 C CA  . LYS A 222 ? 0.9648 0.2065 0.1637 -0.1753 0.0745  -0.0060 222 LYS A CA  
1564 C C   . LYS A 222 ? 1.0495 0.2997 0.2778 -0.1591 0.0894  -0.0168 222 LYS A C   
1565 O O   . LYS A 222 ? 1.0897 0.3173 0.2982 -0.1611 0.1034  -0.0251 222 LYS A O   
1566 C CB  . LYS A 222 ? 0.9713 0.2079 0.1681 -0.1770 0.0818  -0.0041 222 LYS A CB  
1567 C CG  . LYS A 222 ? 0.8538 0.0765 0.0528 -0.1736 0.1044  -0.0222 222 LYS A CG  
1568 C CD  . LYS A 222 ? 0.9385 0.1369 0.1041 -0.1849 0.1145  -0.0122 222 LYS A CD  
1569 C CE  . LYS A 222 ? 1.1181 0.2939 0.2722 -0.1846 0.1425  -0.0228 222 LYS A CE  
1570 N NZ  . LYS A 222 ? 1.1681 0.3233 0.2943 -0.1966 0.1492  -0.0200 222 LYS A NZ  
1571 N N   . TYR A 223 ? 0.9801 0.2620 0.2543 -0.1435 0.0854  -0.0160 223 TYR A N   
1572 C CA  . TYR A 223 ? 0.9657 0.2589 0.2715 -0.1280 0.0971  -0.0248 223 TYR A CA  
1573 C C   . TYR A 223 ? 1.0135 0.3203 0.3333 -0.1222 0.0864  -0.0251 223 TYR A C   
1574 O O   . TYR A 223 ? 1.0017 0.3155 0.3445 -0.1101 0.0945  -0.0320 223 TYR A O   
1575 C CB  . TYR A 223 ? 0.9639 0.2784 0.3073 -0.1160 0.1017  -0.0251 223 TYR A CB  
1576 C CG  . TYR A 223 ? 1.0234 0.3201 0.3507 -0.1219 0.1174  -0.0273 223 TYR A CG  
1577 C CD1 . TYR A 223 ? 1.0624 0.3453 0.3890 -0.1183 0.1401  -0.0367 223 TYR A CD1 
1578 C CD2 . TYR A 223 ? 1.0464 0.3380 0.3566 -0.1318 0.1101  -0.0196 223 TYR A CD2 
1579 C CE1 . TYR A 223 ? 1.0942 0.3600 0.4048 -0.1245 0.1559  -0.0388 223 TYR A CE1 
1580 C CE2 . TYR A 223 ? 1.0880 0.3609 0.3799 -0.1386 0.1248  -0.0217 223 TYR A CE2 
1581 C CZ  . TYR A 223 ? 1.2045 0.4647 0.4967 -0.1352 0.1482  -0.0315 223 TYR A CZ  
1582 O OH  . TYR A 223 ? 1.2605 0.5029 0.5355 -0.1421 0.1639  -0.0335 223 TYR A OH  
1583 N N   . ASP A 224 ? 0.9808 0.2896 0.2846 -0.1319 0.0685  -0.0172 224 ASP A N   
1584 C CA  . ASP A 224 ? 0.9669 0.2872 0.2786 -0.1299 0.0567  -0.0160 224 ASP A CA  
1585 C C   . ASP A 224 ? 0.9839 0.3335 0.3414 -0.1124 0.0539  -0.0178 224 ASP A C   
1586 O O   . ASP A 224 ? 0.9843 0.3327 0.3524 -0.1041 0.0614  -0.0253 224 ASP A O   
1587 C CB  . ASP A 224 ? 1.0209 0.3125 0.2976 -0.1388 0.0634  -0.0219 224 ASP A CB  
1588 C CG  . ASP A 224 ? 1.1293 0.4298 0.4092 -0.1392 0.0510  -0.0203 224 ASP A CG  
1589 O OD1 . ASP A 224 ? 1.1042 0.4307 0.4033 -0.1382 0.0337  -0.0118 224 ASP A OD1 
1590 O OD2 . ASP A 224 ? 1.2534 0.5349 0.5174 -0.1397 0.0594  -0.0276 224 ASP A OD2 
1591 N N   . PHE A 225 ? 0.8999 0.2739 0.2829 -0.1069 0.0433  -0.0108 225 PHE A N   
1592 C CA  . PHE A 225 ? 0.8552 0.2555 0.2779 -0.0922 0.0388  -0.0113 225 PHE A CA  
1593 C C   . PHE A 225 ? 0.9081 0.3284 0.3399 -0.0934 0.0203  -0.0015 225 PHE A C   
1594 O O   . PHE A 225 ? 0.9122 0.3290 0.3240 -0.1048 0.0106  0.0068  225 PHE A O   
1595 C CB  . PHE A 225 ? 0.8498 0.2603 0.3005 -0.0810 0.0479  -0.0143 225 PHE A CB  
1596 C CG  . PHE A 225 ? 0.8601 0.2699 0.3064 -0.0852 0.0471  -0.0086 225 PHE A CG  
1597 C CD1 . PHE A 225 ? 0.8697 0.2982 0.3322 -0.0820 0.0340  0.0000  225 PHE A CD1 
1598 C CD2 . PHE A 225 ? 0.8864 0.2755 0.3114 -0.0923 0.0601  -0.0117 225 PHE A CD2 
1599 C CE1 . PHE A 225 ? 0.8730 0.2987 0.3294 -0.0859 0.0328  0.0058  225 PHE A CE1 
1600 C CE2 . PHE A 225 ? 0.9183 0.3050 0.3365 -0.0972 0.0588  -0.0060 225 PHE A CE2 
1601 C CZ  . PHE A 225 ? 0.8751 0.2801 0.3095 -0.0937 0.0449  0.0027  225 PHE A CZ  
1602 N N   . LEU A 226 ? 0.8456 0.2865 0.3071 -0.0821 0.0154  -0.0021 226 LEU A N   
1603 C CA  . LEU A 226 ? 0.8158 0.2779 0.2917 -0.0803 0.0002  0.0063  226 LEU A CA  
1604 C C   . LEU A 226 ? 0.8565 0.3337 0.3522 -0.0740 -0.0038 0.0127  226 LEU A C   
1605 O O   . LEU A 226 ? 0.8405 0.3153 0.3466 -0.0678 0.0053  0.0087  226 LEU A O   
1606 C CB  . LEU A 226 ? 0.7848 0.2582 0.2813 -0.0708 -0.0005 0.0014  226 LEU A CB  
1607 C CG  . LEU A 226 ? 0.8326 0.3060 0.3173 -0.0774 -0.0084 0.0029  226 LEU A CG  
1608 C CD1 . LEU A 226 ? 0.8725 0.3211 0.3212 -0.0907 -0.0046 0.0006  226 LEU A CD1 
1609 C CD2 . LEU A 226 ? 0.8201 0.2994 0.3224 -0.0678 -0.0063 -0.0036 226 LEU A CD2 
1610 N N   . ILE A 227 ? 0.8026 0.2945 0.3027 -0.0760 -0.0174 0.0234  227 ILE A N   
1611 C CA  . ILE A 227 ? 0.7840 0.2896 0.3027 -0.0689 -0.0220 0.0305  227 ILE A CA  
1612 C C   . ILE A 227 ? 0.7989 0.3263 0.3416 -0.0604 -0.0302 0.0346  227 ILE A C   
1613 O O   . ILE A 227 ? 0.7894 0.3261 0.3289 -0.0656 -0.0405 0.0419  227 ILE A O   
1614 C CB  . ILE A 227 ? 0.8441 0.3456 0.3473 -0.0773 -0.0288 0.0409  227 ILE A CB  
1615 C CG1 . ILE A 227 ? 0.8781 0.3544 0.3522 -0.0877 -0.0198 0.0368  227 ILE A CG1 
1616 C CG2 . ILE A 227 ? 0.8217 0.3362 0.3471 -0.0669 -0.0318 0.0471  227 ILE A CG2 
1617 C CD1 . ILE A 227 ? 0.9511 0.4204 0.4057 -0.0978 -0.0275 0.0474  227 ILE A CD1 
1618 N N   . ILE A 228 ? 0.7553 0.2904 0.3215 -0.0480 -0.0256 0.0304  228 ILE A N   
1619 C CA  . ILE A 228 ? 0.7340 0.2880 0.3228 -0.0389 -0.0318 0.0344  228 ILE A CA  
1620 C C   . ILE A 228 ? 0.7770 0.3388 0.3766 -0.0333 -0.0357 0.0433  228 ILE A C   
1621 O O   . ILE A 228 ? 0.7597 0.3157 0.3652 -0.0278 -0.0296 0.0406  228 ILE A O   
1622 C CB  . ILE A 228 ? 0.7503 0.3081 0.3551 -0.0301 -0.0272 0.0256  228 ILE A CB  
1623 C CG1 . ILE A 228 ? 0.7553 0.3264 0.3833 -0.0186 -0.0293 0.0284  228 ILE A CG1 
1624 C CG2 . ILE A 228 ? 0.7311 0.2749 0.3329 -0.0292 -0.0164 0.0147  228 ILE A CG2 
1625 C CD1 . ILE A 228 ? 0.9676 0.5554 0.6029 -0.0178 -0.0385 0.0379  228 ILE A CD1 
1626 N N   . GLU A 229 ? 0.7354 0.3091 0.3355 -0.0362 -0.0462 0.0548  229 GLU A N   
1627 C CA  . GLU A 229 ? 0.7247 0.3068 0.3339 -0.0315 -0.0518 0.0658  229 GLU A CA  
1628 C C   . GLU A 229 ? 0.7648 0.3623 0.3990 -0.0186 -0.0521 0.0674  229 GLU A C   
1629 O O   . GLU A 229 ? 0.7619 0.3747 0.4047 -0.0184 -0.0583 0.0727  229 GLU A O   
1630 C CB  . GLU A 229 ? 0.7523 0.3417 0.3515 -0.0412 -0.0638 0.0783  229 GLU A CB  
1631 C CG  . GLU A 229 ? 0.8849 0.4731 0.4823 -0.0407 -0.0685 0.0888  229 GLU A CG  
1632 C CD  . GLU A 229 ? 1.1360 0.7384 0.7343 -0.0459 -0.0825 0.1043  229 GLU A CD  
1633 O OE1 . GLU A 229 ? 0.9635 0.5635 0.5433 -0.0600 -0.0893 0.1072  229 GLU A OE1 
1634 O OE2 . GLU A 229 ? 1.1637 0.7783 0.7801 -0.0362 -0.0866 0.1141  229 GLU A OE2 
1635 N N   . ASP A 230 ? 0.7083 0.3007 0.3532 -0.0086 -0.0449 0.0625  230 ASP A N   
1636 C CA  . ASP A 230 ? 0.6892 0.2918 0.3545 0.0035  -0.0438 0.0632  230 ASP A CA  
1637 C C   . ASP A 230 ? 0.7665 0.3742 0.4394 0.0098  -0.0474 0.0746  230 ASP A C   
1638 O O   . ASP A 230 ? 0.7672 0.3635 0.4379 0.0133  -0.0434 0.0739  230 ASP A O   
1639 C CB  . ASP A 230 ? 0.7014 0.2937 0.3716 0.0094  -0.0349 0.0520  230 ASP A CB  
1640 C CG  . ASP A 230 ? 0.8516 0.4499 0.5386 0.0209  -0.0330 0.0517  230 ASP A CG  
1641 O OD1 . ASP A 230 ? 0.8508 0.4631 0.5468 0.0240  -0.0369 0.0574  230 ASP A OD1 
1642 O OD2 . ASP A 230 ? 0.9286 0.5172 0.6190 0.0262  -0.0272 0.0460  230 ASP A OD2 
1643 N N   . ASP A 231 ? 0.7511 0.3759 0.4330 0.0109  -0.0552 0.0857  231 ASP A N   
1644 C CA  . ASP A 231 ? 0.7701 0.4009 0.4605 0.0175  -0.0594 0.0984  231 ASP A CA  
1645 C C   . ASP A 231 ? 0.8155 0.4617 0.5293 0.0311  -0.0587 0.1052  231 ASP A C   
1646 O O   . ASP A 231 ? 0.8011 0.4656 0.5261 0.0322  -0.0661 0.1176  231 ASP A O   
1647 C CB  . ASP A 231 ? 0.8168 0.4504 0.4952 0.0068  -0.0696 0.1091  231 ASP A CB  
1648 C CG  . ASP A 231 ? 1.0637 0.6890 0.7392 0.0105  -0.0713 0.1173  231 ASP A CG  
1649 O OD1 . ASP A 231 ? 1.0733 0.6890 0.7547 0.0210  -0.0637 0.1137  231 ASP A OD1 
1650 O OD2 . ASP A 231 ? 1.1955 0.8219 0.8606 0.0019  -0.0806 0.1273  231 ASP A OD2 
1651 N N   . PRO A 232 ? 0.7628 0.4006 0.4836 0.0416  -0.0494 0.0976  232 PRO A N   
1652 C CA  . PRO A 232 ? 0.7483 0.3965 0.4884 0.0549  -0.0462 0.1027  232 PRO A CA  
1653 C C   . PRO A 232 ? 0.7758 0.4260 0.5247 0.0646  -0.0475 0.1152  232 PRO A C   
1654 O O   . PRO A 232 ? 0.7685 0.4340 0.5354 0.0738  -0.0473 0.1238  232 PRO A O   
1655 C CB  . PRO A 232 ? 0.7632 0.3967 0.5019 0.0604  -0.0363 0.0900  232 PRO A CB  
1656 C CG  . PRO A 232 ? 0.8165 0.4318 0.5394 0.0537  -0.0345 0.0820  232 PRO A CG  
1657 C CD  . PRO A 232 ? 0.7699 0.3889 0.4815 0.0411  -0.0414 0.0840  232 PRO A CD  
1658 N N   . TYR A 233 ? 0.7329 0.3678 0.4697 0.0628  -0.0483 0.1166  233 TYR A N   
1659 C CA  . TYR A 233 ? 0.7424 0.3755 0.4853 0.0723  -0.0496 0.1285  233 TYR A CA  
1660 C C   . TYR A 233 ? 0.8101 0.4534 0.5502 0.0648  -0.0619 0.1419  233 TYR A C   
1661 O O   . TYR A 233 ? 0.8188 0.4525 0.5530 0.0668  -0.0647 0.1494  233 TYR A O   
1662 C CB  . TYR A 233 ? 0.7571 0.3642 0.4877 0.0760  -0.0424 0.1221  233 TYR A CB  
1663 C CG  . TYR A 233 ? 0.7454 0.3401 0.4737 0.0786  -0.0325 0.1079  233 TYR A CG  
1664 C CD1 . TYR A 233 ? 0.7574 0.3423 0.4728 0.0680  -0.0306 0.0956  233 TYR A CD1 
1665 C CD2 . TYR A 233 ? 0.7481 0.3399 0.4867 0.0915  -0.0250 0.1073  233 TYR A CD2 
1666 C CE1 . TYR A 233 ? 0.7460 0.3206 0.4604 0.0699  -0.0231 0.0838  233 TYR A CE1 
1667 C CE2 . TYR A 233 ? 0.7561 0.3347 0.4901 0.0925  -0.0171 0.0948  233 TYR A CE2 
1668 C CZ  . TYR A 233 ? 0.8635 0.4347 0.5863 0.0815  -0.0172 0.0835  233 TYR A CZ  
1669 O OH  . TYR A 233 ? 0.8939 0.4533 0.6136 0.0822  -0.0110 0.0725  233 TYR A OH  
1670 N N   . TYR A 234 ? 0.7501 0.4116 0.4925 0.0551  -0.0697 0.1450  234 TYR A N   
1671 C CA  . TYR A 234 ? 0.7434 0.4157 0.4814 0.0450  -0.0830 0.1575  234 TYR A CA  
1672 C C   . TYR A 234 ? 0.8265 0.5168 0.5865 0.0559  -0.0889 0.1752  234 TYR A C   
1673 O O   . TYR A 234 ? 0.8353 0.5222 0.5903 0.0546  -0.0967 0.1863  234 TYR A O   
1674 C CB  . TYR A 234 ? 0.7272 0.4122 0.4608 0.0314  -0.0887 0.1549  234 TYR A CB  
1675 C CG  . TYR A 234 ? 0.7352 0.4337 0.4654 0.0200  -0.1037 0.1691  234 TYR A CG  
1676 C CD1 . TYR A 234 ? 0.7733 0.4564 0.4792 0.0078  -0.1102 0.1713  234 TYR A CD1 
1677 C CD2 . TYR A 234 ? 0.7271 0.4538 0.4781 0.0207  -0.1115 0.1809  234 TYR A CD2 
1678 C CE1 . TYR A 234 ? 0.7849 0.4784 0.4852 -0.0038 -0.1251 0.1851  234 TYR A CE1 
1679 C CE2 . TYR A 234 ? 0.7380 0.4779 0.4862 0.0090  -0.1268 0.1951  234 TYR A CE2 
1680 C CZ  . TYR A 234 ? 0.8097 0.5321 0.5315 -0.0036 -0.1340 0.1971  234 TYR A CZ  
1681 O OH  . TYR A 234 ? 0.8313 0.5646 0.5476 -0.0164 -0.1502 0.2116  234 TYR A OH  
1682 N N   . PHE A 235 ? 0.7953 0.5041 0.5798 0.0671  -0.0847 0.1781  235 PHE A N   
1683 C CA  . PHE A 235 ? 0.8022 0.5313 0.6126 0.0794  -0.0884 0.1951  235 PHE A CA  
1684 C C   . PHE A 235 ? 0.8585 0.5715 0.6707 0.0939  -0.0830 0.1996  235 PHE A C   
1685 O O   . PHE A 235 ? 0.8697 0.5935 0.6950 0.1003  -0.0901 0.2159  235 PHE A O   
1686 C CB  . PHE A 235 ? 0.8106 0.5632 0.6462 0.0871  -0.0833 0.1963  235 PHE A CB  
1687 C CG  . PHE A 235 ? 0.8252 0.5975 0.6605 0.0714  -0.0927 0.1976  235 PHE A CG  
1688 C CD1 . PHE A 235 ? 0.8660 0.6571 0.7055 0.0617  -0.1084 0.2129  235 PHE A CD1 
1689 C CD2 . PHE A 235 ? 0.8527 0.6224 0.6807 0.0651  -0.0869 0.1834  235 PHE A CD2 
1690 C CE1 . PHE A 235 ? 0.8777 0.6841 0.7134 0.0455  -0.1175 0.2139  235 PHE A CE1 
1691 C CE2 . PHE A 235 ? 0.8867 0.6714 0.7114 0.0499  -0.0955 0.1844  235 PHE A CE2 
1692 C CZ  . PHE A 235 ? 0.8665 0.6690 0.6943 0.0398  -0.1106 0.1994  235 PHE A CZ  
1693 N N   . LEU A 236 ? 0.7983 0.4841 0.5949 0.0973  -0.0716 0.1854  236 LEU A N   
1694 C CA  . LEU A 236 ? 0.7931 0.4563 0.5847 0.1092  -0.0643 0.1857  236 LEU A CA  
1695 C C   . LEU A 236 ? 0.8650 0.5087 0.6338 0.1003  -0.0705 0.1872  236 LEU A C   
1696 O O   . LEU A 236 ? 0.8680 0.4858 0.6205 0.1011  -0.0628 0.1778  236 LEU A O   
1697 C CB  . LEU A 236 ? 0.7779 0.4219 0.5624 0.1141  -0.0500 0.1692  236 LEU A CB  
1698 C CG  . LEU A 236 ? 0.8304 0.4822 0.6349 0.1295  -0.0403 0.1701  236 LEU A CG  
1699 C CD1 . LEU A 236 ? 0.8136 0.4684 0.6172 0.1248  -0.0343 0.1566  236 LEU A CD1 
1700 C CD2 . LEU A 236 ? 0.8892 0.5171 0.6897 0.1434  -0.0301 0.1694  236 LEU A CD2 
1701 N N   . GLN A 237 ? 0.8337 0.4888 0.6003 0.0911  -0.0844 0.1995  237 GLN A N   
1702 C CA  . GLN A 237 ? 0.8489 0.4850 0.5919 0.0815  -0.0908 0.2020  237 GLN A CA  
1703 C C   . GLN A 237 ? 0.9496 0.5833 0.7006 0.0933  -0.0954 0.2182  237 GLN A C   
1704 O O   . GLN A 237 ? 0.9436 0.6006 0.7155 0.0987  -0.1044 0.2343  237 GLN A O   
1705 C CB  . GLN A 237 ? 0.8622 0.5071 0.5917 0.0620  -0.1033 0.2047  237 GLN A CB  
1706 C CG  . GLN A 237 ? 0.9575 0.5894 0.6654 0.0478  -0.0979 0.1872  237 GLN A CG  
1707 C CD  . GLN A 237 ? 1.2747 0.9154 0.9700 0.0298  -0.1094 0.1904  237 GLN A CD  
1708 O OE1 . GLN A 237 ? 1.1914 0.8507 0.8961 0.0257  -0.1120 0.1895  237 GLN A OE1 
1709 N NE2 . GLN A 237 ? 1.2695 0.8952 0.9409 0.0178  -0.1164 0.1945  237 GLN A NE2 
1710 N N   . PHE A 238 ? 0.9559 0.5616 0.6908 0.0971  -0.0893 0.2146  238 PHE A N   
1711 C CA  . PHE A 238 ? 0.9967 0.5937 0.7346 0.1085  -0.0927 0.2289  238 PHE A CA  
1712 C C   . PHE A 238 ? 1.1233 0.7175 0.8452 0.0958  -0.1083 0.2410  238 PHE A C   
1713 O O   . PHE A 238 ? 1.1331 0.7227 0.8579 0.1037  -0.1145 0.2557  238 PHE A O   
1714 C CB  . PHE A 238 ? 1.0275 0.5927 0.7517 0.1166  -0.0796 0.2195  238 PHE A CB  
1715 C CG  . PHE A 238 ? 1.0282 0.5902 0.7607 0.1255  -0.0647 0.2059  238 PHE A CG  
1716 C CD1 . PHE A 238 ? 1.0609 0.6019 0.7745 0.1181  -0.0555 0.1886  238 PHE A CD1 
1717 C CD2 . PHE A 238 ? 1.0454 0.6251 0.8046 0.1411  -0.0599 0.2111  238 PHE A CD2 
1718 C CE1 . PHE A 238 ? 1.0626 0.5993 0.7821 0.1252  -0.0433 0.1768  238 PHE A CE1 
1719 C CE2 . PHE A 238 ? 1.0712 0.6450 0.8346 0.1483  -0.0462 0.1986  238 PHE A CE2 
1720 C CZ  . PHE A 238 ? 1.0456 0.5973 0.7881 0.1400  -0.0387 0.1817  238 PHE A CZ  
1721 N N   . ASN A 239 ? 1.1177 0.7144 0.8225 0.0761  -0.1145 0.2351  239 ASN A N   
1722 C CA  . ASN A 239 ? 1.1460 0.7363 0.8275 0.0584  -0.1277 0.2417  239 ASN A CA  
1723 C C   . ASN A 239 ? 1.2178 0.8286 0.9107 0.0569  -0.1459 0.2632  239 ASN A C   
1724 O O   . ASN A 239 ? 1.2266 0.8267 0.8971 0.0433  -0.1573 0.2705  239 ASN A O   
1725 C CB  . ASN A 239 ? 1.1665 0.7551 0.8294 0.0397  -0.1262 0.2275  239 ASN A CB  
1726 C CG  . ASN A 239 ? 1.6058 1.1777 1.2599 0.0399  -0.1096 0.2069  239 ASN A CG  
1727 O OD1 . ASN A 239 ? 1.5598 1.1169 1.2161 0.0514  -0.0993 0.2019  239 ASN A OD1 
1728 N ND2 . ASN A 239 ? 1.5275 1.1010 1.1712 0.0270  -0.1071 0.1950  239 ASN A ND2 
1729 N N   . LYS A 240 ? 1.1781 0.8181 0.9054 0.0700  -0.1485 0.2738  240 LYS A N   
1730 C CA  . LYS A 240 ? 1.1926 0.8603 0.9395 0.0698  -0.1659 0.2952  240 LYS A CA  
1731 C C   . LYS A 240 ? 1.2349 0.9200 0.9760 0.0502  -0.1750 0.2930  240 LYS A C   
1732 O O   . LYS A 240 ? 1.2182 0.9235 0.9782 0.0530  -0.1695 0.2872  240 LYS A O   
1733 C CB  . LYS A 240 ? 1.2572 0.9132 0.9926 0.0682  -0.1795 0.3123  240 LYS A CB  
1734 N N   . PHE A 241 ? 1.1861 0.8599 0.8978 0.0298  -0.1875 0.2961  241 PHE A N   
1735 C CA  . PHE A 241 ? 1.1673 0.8527 0.8685 0.0102  -0.1956 0.2934  241 PHE A CA  
1736 C C   . PHE A 241 ? 1.1375 0.8050 0.8178 0.0023  -0.1808 0.2698  241 PHE A C   
1737 O O   . PHE A 241 ? 1.1388 0.7764 0.7906 -0.0038 -0.1735 0.2589  241 PHE A O   
1738 C CB  . PHE A 241 ? 1.2271 0.9092 0.9063 -0.0086 -0.2158 0.3079  241 PHE A CB  
1739 C CG  . PHE A 241 ? 1.2726 0.9765 0.9788 0.0016  -0.2308 0.3325  241 PHE A CG  
1740 C CD1 . PHE A 241 ? 1.3044 1.0472 1.0486 0.0083  -0.2381 0.3452  241 PHE A CD1 
1741 C CD2 . PHE A 241 ? 1.3445 1.0304 1.0404 0.0060  -0.2366 0.3431  241 PHE A CD2 
1742 C CE1 . PHE A 241 ? 1.3309 1.0961 1.1043 0.0196  -0.2511 0.3688  241 PHE A CE1 
1743 C CE2 . PHE A 241 ? 1.3956 1.1019 1.1189 0.0173  -0.2502 0.3666  241 PHE A CE2 
1744 C CZ  . PHE A 241 ? 1.3550 1.1017 1.1180 0.0243  -0.2574 0.3795  241 PHE A CZ  
1745 N N   . ARG A 242 ? 1.0280 0.7144 0.7260 0.0048  -0.1748 0.2623  242 ARG A N   
1746 C CA  . ARG A 242 ? 0.9952 0.6690 0.6799 0.0000  -0.1608 0.2408  242 ARG A CA  
1747 C C   . ARG A 242 ? 1.0129 0.6667 0.6598 -0.0224 -0.1639 0.2328  242 ARG A C   
1748 O O   . ARG A 242 ? 1.0129 0.6727 0.6481 -0.0376 -0.1786 0.2430  242 ARG A O   
1749 C CB  . ARG A 242 ? 0.9771 0.6765 0.6875 0.0055  -0.1566 0.2370  242 ARG A CB  
1750 C CG  . ARG A 242 ? 1.0526 0.7666 0.7976 0.0288  -0.1476 0.2400  242 ARG A CG  
1751 C CD  . ARG A 242 ? 1.0503 0.7838 0.8149 0.0327  -0.1406 0.2327  242 ARG A CD  
1752 N NE  . ARG A 242 ? 1.0732 0.8303 0.8423 0.0190  -0.1536 0.2411  242 ARG A NE  
1753 C CZ  . ARG A 242 ? 1.1583 0.9464 0.9558 0.0234  -0.1632 0.2584  242 ARG A CZ  
1754 N NH1 . ARG A 242 ? 1.0909 0.8903 0.9164 0.0430  -0.1600 0.2690  242 ARG A NH1 
1755 N NH2 . ARG A 242 ? 0.7752 0.5830 0.5736 0.0083  -0.1757 0.2655  242 ARG A NH2 
1756 N N   . VAL A 243 ? 0.9432 0.5725 0.5708 -0.0245 -0.1498 0.2149  243 VAL A N   
1757 C CA  . VAL A 243 ? 0.9486 0.5551 0.5401 -0.0434 -0.1481 0.2048  243 VAL A CA  
1758 C C   . VAL A 243 ? 0.9905 0.6070 0.5790 -0.0538 -0.1483 0.1974  243 VAL A C   
1759 O O   . VAL A 243 ? 0.9658 0.5956 0.5756 -0.0439 -0.1402 0.1896  243 VAL A O   
1760 C CB  . VAL A 243 ? 0.9902 0.5703 0.5680 -0.0397 -0.1316 0.1891  243 VAL A CB  
1761 C CG1 . VAL A 243 ? 1.0027 0.5580 0.5436 -0.0581 -0.1279 0.1794  243 VAL A CG1 
1762 C CG2 . VAL A 243 ? 0.9956 0.5663 0.5781 -0.0282 -0.1308 0.1962  243 VAL A CG2 
1763 N N   . PRO A 244 ? 0.9506 0.5578 0.5100 -0.0743 -0.1571 0.1993  244 PRO A N   
1764 C CA  . PRO A 244 ? 0.9370 0.5493 0.4892 -0.0853 -0.1570 0.1919  244 PRO A CA  
1765 C C   . PRO A 244 ? 0.9355 0.5352 0.4841 -0.0814 -0.1390 0.1713  244 PRO A C   
1766 O O   . PRO A 244 ? 0.9443 0.5226 0.4806 -0.0791 -0.1276 0.1615  244 PRO A O   
1767 C CB  . PRO A 244 ? 0.9943 0.5890 0.5083 -0.1082 -0.1674 0.1966  244 PRO A CB  
1768 C CG  . PRO A 244 ? 1.0673 0.6604 0.5791 -0.1082 -0.1791 0.2127  244 PRO A CG  
1769 C CD  . PRO A 244 ? 0.9972 0.5860 0.5262 -0.0891 -0.1672 0.2081  244 PRO A CD  
1770 N N   . THR A 245 ? 0.8350 0.4486 0.3953 -0.0807 -0.1369 0.1656  245 THR A N   
1771 C CA  . THR A 245 ? 0.7964 0.4023 0.3583 -0.0756 -0.1216 0.1476  245 THR A CA  
1772 C C   . THR A 245 ? 0.8506 0.4341 0.3798 -0.0912 -0.1163 0.1358  245 THR A C   
1773 O O   . THR A 245 ? 0.8571 0.4340 0.3624 -0.1077 -0.1257 0.1416  245 THR A O   
1774 C CB  . THR A 245 ? 0.7533 0.3851 0.3481 -0.0631 -0.1205 0.1476  245 THR A CB  
1775 O OG1 . THR A 245 ? 0.6496 0.2969 0.2443 -0.0735 -0.1309 0.1539  245 THR A OG1 
1776 C CG2 . THR A 245 ? 0.7233 0.3727 0.3482 -0.0464 -0.1225 0.1580  245 THR A CG2 
1777 N N   . PHE A 246 ? 0.8147 0.3861 0.3428 -0.0859 -0.1011 0.1196  246 PHE A N   
1778 C CA  . PHE A 246 ? 0.8352 0.3862 0.3362 -0.0977 -0.0938 0.1078  246 PHE A CA  
1779 C C   . PHE A 246 ? 0.9075 0.4682 0.4038 -0.1074 -0.1023 0.1103  246 PHE A C   
1780 O O   . PHE A 246 ? 0.9212 0.4650 0.3868 -0.1234 -0.1043 0.1088  246 PHE A O   
1781 C CB  . PHE A 246 ? 0.8417 0.3835 0.3500 -0.0879 -0.0769 0.0915  246 PHE A CB  
1782 C CG  . PHE A 246 ? 0.8710 0.3956 0.3727 -0.0849 -0.0666 0.0863  246 PHE A CG  
1783 C CD1 . PHE A 246 ? 0.8947 0.4252 0.4201 -0.0699 -0.0594 0.0823  246 PHE A CD1 
1784 C CD2 . PHE A 246 ? 0.9269 0.4283 0.3969 -0.0979 -0.0639 0.0854  246 PHE A CD2 
1785 C CE1 . PHE A 246 ? 0.9149 0.4301 0.4342 -0.0684 -0.0503 0.0780  246 PHE A CE1 
1786 C CE2 . PHE A 246 ? 0.9693 0.4555 0.4335 -0.0958 -0.0539 0.0809  246 PHE A CE2 
1787 C CZ  . PHE A 246 ? 0.9276 0.4215 0.4172 -0.0812 -0.0474 0.0774  246 PHE A CZ  
1788 N N   . LEU A 247 ? 0.8641 0.4510 0.3897 -0.0983 -0.1072 0.1149  247 LEU A N   
1789 C CA  . LEU A 247 ? 0.8645 0.4653 0.3911 -0.1064 -0.1159 0.1191  247 LEU A CA  
1790 C C   . LEU A 247 ? 0.9348 0.5397 0.4465 -0.1219 -0.1324 0.1343  247 LEU A C   
1791 O O   . LEU A 247 ? 0.9547 0.5532 0.4442 -0.1380 -0.1384 0.1348  247 LEU A O   
1792 C CB  . LEU A 247 ? 0.8388 0.4681 0.4024 -0.0921 -0.1169 0.1224  247 LEU A CB  
1793 C CG  . LEU A 247 ? 0.9053 0.5502 0.4724 -0.1000 -0.1244 0.1258  247 LEU A CG  
1794 C CD1 . LEU A 247 ? 0.9120 0.5376 0.4573 -0.1074 -0.1165 0.1113  247 LEU A CD1 
1795 C CD2 . LEU A 247 ? 0.9315 0.6045 0.5353 -0.0857 -0.1245 0.1303  247 LEU A CD2 
1796 N N   . SER A 248 ? 0.8799 0.4941 0.4026 -0.1175 -0.1401 0.1470  248 SER A N   
1797 C CA  . SER A 248 ? 0.8967 0.5160 0.4079 -0.1312 -0.1573 0.1636  248 SER A CA  
1798 C C   . SER A 248 ? 0.9959 0.5825 0.4611 -0.1506 -0.1579 0.1599  248 SER A C   
1799 O O   . SER A 248 ? 1.0341 0.6196 0.4797 -0.1679 -0.1726 0.1709  248 SER A O   
1800 C CB  . SER A 248 ? 0.9379 0.5716 0.4719 -0.1195 -0.1634 0.1769  248 SER A CB  
1801 O OG  . SER A 248 ? 1.0944 0.7039 0.6074 -0.1213 -0.1599 0.1754  248 SER A OG  
1802 N N   . MET A 249 ? 0.9347 0.4945 0.3822 -0.1482 -0.1417 0.1445  249 MET A N   
1803 C CA  . MET A 249 ? 0.9509 0.4767 0.3541 -0.1651 -0.1379 0.1387  249 MET A CA  
1804 C C   . MET A 249 ? 0.9884 0.4942 0.3703 -0.1712 -0.1254 0.1226  249 MET A C   
1805 O O   . MET A 249 ? 1.0125 0.4873 0.3584 -0.1825 -0.1178 0.1153  249 MET A O   
1806 C CB  . MET A 249 ? 0.9836 0.4919 0.3790 -0.1601 -0.1296 0.1363  249 MET A CB  
1807 C CG  . MET A 249 ? 1.0064 0.5105 0.4185 -0.1437 -0.1108 0.1215  249 MET A CG  
1808 S SD  . MET A 249 ? 1.0723 0.5608 0.4805 -0.1375 -0.1026 0.1208  249 MET A SD  
1809 C CE  . MET A 249 ? 1.0820 0.5338 0.4374 -0.1600 -0.1001 0.1180  249 MET A CE  
1810 N N   . ASP A 250 ? 0.9103 0.4325 0.3134 -0.1638 -0.1231 0.1176  250 ASP A N   
1811 C CA  . ASP A 250 ? 0.9062 0.4120 0.2949 -0.1661 -0.1112 0.1027  250 ASP A CA  
1812 C C   . ASP A 250 ? 0.9829 0.4718 0.3354 -0.1870 -0.1174 0.1031  250 ASP A C   
1813 O O   . ASP A 250 ? 0.9721 0.4717 0.3306 -0.1893 -0.1214 0.1025  250 ASP A O   
1814 C CB  . ASP A 250 ? 0.8852 0.4116 0.3100 -0.1485 -0.1045 0.0958  250 ASP A CB  
1815 C CG  . ASP A 250 ? 0.9399 0.4491 0.3562 -0.1455 -0.0896 0.0793  250 ASP A CG  
1816 O OD1 . ASP A 250 ? 0.9379 0.4202 0.3305 -0.1491 -0.0780 0.0703  250 ASP A OD1 
1817 O OD2 . ASP A 250 ? 1.0066 0.5298 0.4420 -0.1383 -0.0887 0.0756  250 ASP A OD2 
1818 N N   . VAL A 251 ? 0.9657 0.4250 0.2780 -0.2025 -0.1168 0.1030  251 VAL A N   
1819 C CA  . VAL A 251 ? 1.0011 0.4353 0.2696 -0.2245 -0.1209 0.1024  251 VAL A CA  
1820 C C   . VAL A 251 ? 1.0542 0.4729 0.3136 -0.2223 -0.1069 0.0871  251 VAL A C   
1821 O O   . VAL A 251 ? 1.0439 0.4621 0.2914 -0.2330 -0.1139 0.0883  251 VAL A O   
1822 C CB  . VAL A 251 ? 1.0912 0.4911 0.3166 -0.2390 -0.1181 0.1026  251 VAL A CB  
1823 C CG1 . VAL A 251 ? 1.1319 0.4978 0.3069 -0.2607 -0.1176 0.0984  251 VAL A CG1 
1824 C CG2 . VAL A 251 ? 1.0968 0.5091 0.3256 -0.2443 -0.1349 0.1195  251 VAL A CG2 
1825 N N   . ASP A 252 ? 1.0320 0.4379 0.2968 -0.2090 -0.0876 0.0732  252 ASP A N   
1826 C CA  . ASP A 252 ? 1.0396 0.4290 0.2974 -0.2045 -0.0723 0.0582  252 ASP A CA  
1827 C C   . ASP A 252 ? 1.0801 0.4946 0.3690 -0.1943 -0.0759 0.0570  252 ASP A C   
1828 O O   . ASP A 252 ? 1.1179 0.5229 0.3899 -0.2027 -0.0773 0.0538  252 ASP A O   
1829 C CB  . ASP A 252 ? 1.0569 0.4308 0.3181 -0.1920 -0.0518 0.0459  252 ASP A CB  
1830 C CG  . ASP A 252 ? 1.2527 0.5943 0.4752 -0.2042 -0.0445 0.0444  252 ASP A CG  
1831 O OD1 . ASP A 252 ? 1.2684 0.6097 0.4763 -0.2161 -0.0573 0.0560  252 ASP A OD1 
1832 O OD2 . ASP A 252 ? 1.3799 0.6966 0.5872 -0.2018 -0.0260 0.0323  252 ASP A OD2 
1833 N N   . GLY A 253 ? 0.9752 0.4201 0.3065 -0.1777 -0.0780 0.0603  253 GLY A N   
1834 C CA  . GLY A 253 ? 0.9327 0.4014 0.2947 -0.1670 -0.0803 0.0591  253 GLY A CA  
1835 C C   . GLY A 253 ? 0.9436 0.4130 0.3287 -0.1482 -0.0651 0.0472  253 GLY A C   
1836 O O   . GLY A 253 ? 0.9306 0.4041 0.3276 -0.1412 -0.0611 0.0404  253 GLY A O   
1837 N N   . ARG A 254 ? 0.8772 0.3415 0.2674 -0.1411 -0.0572 0.0452  254 ARG A N   
1838 C CA  . ARG A 254 ? 0.8417 0.3063 0.2534 -0.1248 -0.0433 0.0354  254 ARG A CA  
1839 C C   . ARG A 254 ? 0.8686 0.3606 0.3188 -0.1098 -0.0470 0.0402  254 ARG A C   
1840 O O   . ARG A 254 ? 0.8561 0.3486 0.3237 -0.0975 -0.0369 0.0333  254 ARG A O   
1841 C CB  . ARG A 254 ? 0.8301 0.2694 0.2209 -0.1278 -0.0305 0.0293  254 ARG A CB  
1842 C CG  . ARG A 254 ? 0.8117 0.2453 0.1862 -0.1372 -0.0363 0.0385  254 ARG A CG  
1843 C CD  . ARG A 254 ? 0.6565 0.0788 0.0445 -0.1360 -0.0241 0.0113  254 ARG A CD  
1844 N NE  . ARG A 254 ? 0.6997 0.0863 0.0438 -0.1518 -0.0177 0.0105  254 ARG A NE  
1845 C CZ  . ARG A 254 ? 0.8968 0.2561 0.1983 -0.1537 -0.0025 0.0160  254 ARG A CZ  
1846 N NH1 . ARG A 254 ? 0.7010 0.0764 0.0469 -0.1386 0.0017  -0.0003 254 ARG A NH1 
1847 N NH2 . ARG A 254 ? 0.7625 0.0940 0.0523 -0.1670 0.0009  0.0009  254 ARG A NH2 
1848 N N   . VAL A 255 ? 0.8266 0.3409 0.2905 -0.1105 -0.0608 0.0521  255 VAL A N   
1849 C CA  . VAL A 255 ? 0.8095 0.3471 0.3076 -0.0960 -0.0633 0.0570  255 VAL A CA  
1850 C C   . VAL A 255 ? 0.8412 0.4000 0.3657 -0.0865 -0.0661 0.0568  255 VAL A C   
1851 O O   . VAL A 255 ? 0.8536 0.4232 0.3769 -0.0934 -0.0752 0.0627  255 VAL A O   
1852 C CB  . VAL A 255 ? 0.8675 0.4134 0.3673 -0.0985 -0.0728 0.0704  255 VAL A CB  
1853 C CG1 . VAL A 255 ? 0.8365 0.4064 0.3708 -0.0835 -0.0760 0.0769  255 VAL A CG1 
1854 C CG2 . VAL A 255 ? 0.8845 0.4085 0.3645 -0.1025 -0.0657 0.0676  255 VAL A CG2 
1855 N N   . ILE A 256 ? 0.7565 0.3202 0.3035 -0.0718 -0.0581 0.0502  256 ILE A N   
1856 C CA  . ILE A 256 ? 0.7403 0.3222 0.3118 -0.0621 -0.0597 0.0501  256 ILE A CA  
1857 C C   . ILE A 256 ? 0.7950 0.3915 0.3878 -0.0521 -0.0622 0.0581  256 ILE A C   
1858 O O   . ILE A 256 ? 0.7866 0.3750 0.3827 -0.0457 -0.0556 0.0547  256 ILE A O   
1859 C CB  . ILE A 256 ? 0.7735 0.3468 0.3513 -0.0538 -0.0495 0.0368  256 ILE A CB  
1860 C CG1 . ILE A 256 ? 0.7833 0.3444 0.3423 -0.0624 -0.0483 0.0304  256 ILE A CG1 
1861 C CG2 . ILE A 256 ? 0.7685 0.3580 0.3733 -0.0410 -0.0493 0.0366  256 ILE A CG2 
1862 C CD1 . ILE A 256 ? 0.8320 0.3742 0.3845 -0.0590 -0.0368 0.0183  256 ILE A CD1 
1863 N N   . ARG A 257 ? 0.7547 0.3718 0.3607 -0.0516 -0.0716 0.0696  257 ARG A N   
1864 C CA  . ARG A 257 ? 0.7433 0.3738 0.3693 -0.0415 -0.0740 0.0787  257 ARG A CA  
1865 C C   . ARG A 257 ? 0.8002 0.4473 0.4523 -0.0288 -0.0719 0.0792  257 ARG A C   
1866 O O   . ARG A 257 ? 0.7985 0.4603 0.4578 -0.0311 -0.0766 0.0830  257 ARG A O   
1867 C CB  . ARG A 257 ? 0.7279 0.3679 0.3495 -0.0496 -0.0857 0.0936  257 ARG A CB  
1868 C CG  . ARG A 257 ? 0.7363 0.3941 0.3825 -0.0379 -0.0892 0.1049  257 ARG A CG  
1869 C CD  . ARG A 257 ? 0.6412 0.3039 0.2819 -0.0446 -0.1002 0.1193  257 ARG A CD  
1870 N NE  . ARG A 257 ? 0.6688 0.3300 0.3207 -0.0329 -0.0977 0.1239  257 ARG A NE  
1871 C CZ  . ARG A 257 ? 0.8906 0.5703 0.5670 -0.0216 -0.1010 0.1349  257 ARG A CZ  
1872 N NH1 . ARG A 257 ? 0.8116 0.5155 0.5059 -0.0209 -0.1073 0.1434  257 ARG A NH1 
1873 N NH2 . ARG A 257 ? 0.6893 0.3631 0.3723 -0.0111 -0.0977 0.1381  257 ARG A NH2 
1874 N N   . ALA A 258 ? 0.7591 0.4025 0.4237 -0.0161 -0.0647 0.0756  258 ALA A N   
1875 C CA  . ALA A 258 ? 0.7406 0.3945 0.4267 -0.0034 -0.0608 0.0750  258 ALA A CA  
1876 C C   . ALA A 258 ? 0.7980 0.4649 0.5008 0.0055  -0.0635 0.0870  258 ALA A C   
1877 O O   . ALA A 258 ? 0.8054 0.4642 0.5063 0.0091  -0.0623 0.0897  258 ALA A O   
1878 C CB  . ALA A 258 ? 0.7385 0.3776 0.4256 0.0040  -0.0512 0.0628  258 ALA A CB  
1879 N N   . ASP A 259 ? 0.7480 0.4351 0.4674 0.0091  -0.0667 0.0947  259 ASP A N   
1880 C CA  . ASP A 259 ? 0.7460 0.4482 0.4852 0.0193  -0.0682 0.1070  259 ASP A CA  
1881 C C   . ASP A 259 ? 0.7905 0.4961 0.5464 0.0327  -0.0594 0.1035  259 ASP A C   
1882 O O   . ASP A 259 ? 0.7735 0.4796 0.5290 0.0312  -0.0560 0.0957  259 ASP A O   
1883 C CB  . ASP A 259 ? 0.7726 0.4977 0.5197 0.0123  -0.0791 0.1210  259 ASP A CB  
1884 C CG  . ASP A 259 ? 0.9109 0.6321 0.6429 0.0013  -0.0888 0.1283  259 ASP A CG  
1885 O OD1 . ASP A 259 ? 0.9053 0.6289 0.6440 0.0071  -0.0917 0.1382  259 ASP A OD1 
1886 O OD2 . ASP A 259 ? 1.0125 0.7259 0.7238 -0.0135 -0.0932 0.1242  259 ASP A OD2 
1887 N N   . SER A 260 ? 0.7544 0.4606 0.5231 0.0456  -0.0553 0.1092  260 SER A N   
1888 C CA  . SER A 260 ? 0.7476 0.4531 0.5290 0.0586  -0.0455 0.1060  260 SER A CA  
1889 C C   . SER A 260 ? 0.7849 0.5090 0.5890 0.0698  -0.0446 0.1194  260 SER A C   
1890 O O   . SER A 260 ? 0.7861 0.5157 0.5962 0.0730  -0.0492 0.1306  260 SER A O   
1891 C CB  . SER A 260 ? 0.7959 0.4768 0.5682 0.0651  -0.0375 0.0964  260 SER A CB  
1892 O OG  . SER A 260 ? 0.8774 0.5533 0.6562 0.0748  -0.0282 0.0911  260 SER A OG  
1893 N N   . PHE A 261 ? 0.7334 0.4664 0.5502 0.0764  -0.0379 0.1183  261 PHE A N   
1894 C CA  . PHE A 261 ? 0.7377 0.4877 0.5781 0.0892  -0.0336 0.1300  261 PHE A CA  
1895 C C   . PHE A 261 ? 0.8075 0.5373 0.6472 0.1038  -0.0205 0.1243  261 PHE A C   
1896 O O   . PHE A 261 ? 0.7980 0.5354 0.6550 0.1172  -0.0134 0.1322  261 PHE A O   
1897 C CB  . PHE A 261 ? 0.7511 0.5247 0.6062 0.0866  -0.0334 0.1335  261 PHE A CB  
1898 C CG  . PHE A 261 ? 0.7670 0.5676 0.6320 0.0762  -0.0462 0.1463  261 PHE A CG  
1899 C CD1 . PHE A 261 ? 0.8128 0.6261 0.6892 0.0787  -0.0541 0.1611  261 PHE A CD1 
1900 C CD2 . PHE A 261 ? 0.7874 0.6005 0.6501 0.0636  -0.0509 0.1443  261 PHE A CD2 
1901 C CE1 . PHE A 261 ? 0.8240 0.6622 0.7086 0.0676  -0.0675 0.1737  261 PHE A CE1 
1902 C CE2 . PHE A 261 ? 0.8284 0.6655 0.6985 0.0523  -0.0636 0.1565  261 PHE A CE2 
1903 C CZ  . PHE A 261 ? 0.8097 0.6595 0.6908 0.0541  -0.0722 0.1713  261 PHE A CZ  
1904 N N   . SER A 262 ? 0.7821 0.4853 0.6014 0.1009  -0.0172 0.1108  262 SER A N   
1905 C CA  . SER A 262 ? 0.7906 0.4700 0.6034 0.1113  -0.0061 0.1037  262 SER A CA  
1906 C C   . SER A 262 ? 0.8541 0.5262 0.6711 0.1222  -0.0036 0.1121  262 SER A C   
1907 O O   . SER A 262 ? 0.8687 0.5316 0.6904 0.1351  0.0068  0.1130  262 SER A O   
1908 C CB  . SER A 262 ? 0.8324 0.4884 0.6242 0.1035  -0.0056 0.0890  262 SER A CB  
1909 O OG  . SER A 262 ? 0.9458 0.6019 0.7338 0.0987  -0.0035 0.0801  262 SER A OG  
1910 N N   . LYS A 263 ? 0.8018 0.4765 0.6158 0.1172  -0.0127 0.1185  263 LYS A N   
1911 C CA  . LYS A 263 ? 0.8054 0.4707 0.6212 0.1270  -0.0112 0.1267  263 LYS A CA  
1912 C C   . LYS A 263 ? 0.8490 0.5357 0.6885 0.1382  -0.0121 0.1436  263 LYS A C   
1913 O O   . LYS A 263 ? 0.8554 0.5323 0.6981 0.1501  -0.0080 0.1503  263 LYS A O   
1914 C CB  . LYS A 263 ? 0.8168 0.4700 0.6158 0.1173  -0.0190 0.1253  263 LYS A CB  
1915 C CG  . LYS A 263 ? 0.7362 0.3589 0.5165 0.1176  -0.0124 0.1138  263 LYS A CG  
1916 C CD  . LYS A 263 ? 0.8696 0.4822 0.6393 0.1106  -0.0084 0.0984  263 LYS A CD  
1917 C CE  . LYS A 263 ? 0.8816 0.5030 0.6448 0.0957  -0.0163 0.0932  263 LYS A CE  
1918 N NZ  . LYS A 263 ? 0.7277 0.3342 0.4786 0.0893  -0.0131 0.0787  263 LYS A NZ  
1919 N N   . ILE A 264 ? 0.7786 0.4943 0.6352 0.1348  -0.0172 0.1507  264 ILE A N   
1920 C CA  . ILE A 264 ? 0.7700 0.5112 0.6531 0.1442  -0.0196 0.1682  264 ILE A CA  
1921 C C   . ILE A 264 ? 0.7898 0.5511 0.6950 0.1522  -0.0112 0.1715  264 ILE A C   
1922 O O   . ILE A 264 ? 0.7869 0.5613 0.7149 0.1665  -0.0063 0.1839  264 ILE A O   
1923 C CB  . ILE A 264 ? 0.8031 0.5643 0.6898 0.1326  -0.0366 0.1800  264 ILE A CB  
1924 C CG1 . ILE A 264 ? 0.7997 0.5728 0.6786 0.1145  -0.0447 0.1741  264 ILE A CG1 
1925 C CG2 . ILE A 264 ? 0.8061 0.5465 0.6740 0.1293  -0.0425 0.1805  264 ILE A CG2 
1926 C CD1 . ILE A 264 ? 0.9486 0.7481 0.8369 0.1038  -0.0600 0.1879  264 ILE A CD1 
1927 N N   . ILE A 265 ? 0.7227 0.4871 0.6221 0.1429  -0.0096 0.1612  265 ILE A N   
1928 C CA  . ILE A 265 ? 0.7072 0.4905 0.6254 0.1480  -0.0016 0.1636  265 ILE A CA  
1929 C C   . ILE A 265 ? 0.7515 0.5117 0.6586 0.1547  0.0141  0.1499  265 ILE A C   
1930 O O   . ILE A 265 ? 0.7553 0.5179 0.6769 0.1691  0.0268  0.1543  265 ILE A O   
1931 C CB  . ILE A 265 ? 0.7221 0.5349 0.6493 0.1334  -0.0127 0.1682  265 ILE A CB  
1932 C CG1 . ILE A 265 ? 0.7171 0.5635 0.6726 0.1361  -0.0216 0.1887  265 ILE A CG1 
1933 C CG2 . ILE A 265 ? 0.7186 0.5376 0.6494 0.1320  -0.0038 0.1612  265 ILE A CG2 
1934 C CD1 . ILE A 265 ? 0.7122 0.5628 0.6602 0.1248  -0.0385 0.1958  265 ILE A CD1 
1935 N N   . SER A 266 ? 0.6771 0.4143 0.5582 0.1443  0.0134  0.1340  266 SER A N   
1936 C CA  . SER A 266 ? 0.6599 0.3719 0.5255 0.1475  0.0255  0.1203  266 SER A CA  
1937 C C   . SER A 266 ? 0.7014 0.3930 0.5416 0.1343  0.0204  0.1054  266 SER A C   
1938 O O   . SER A 266 ? 0.6848 0.3866 0.5212 0.1215  0.0123  0.1017  266 SER A O   
1939 C CB  . SER A 266 ? 0.6649 0.3900 0.5428 0.1511  0.0349  0.1207  266 SER A CB  
1940 O OG  . SER A 266 ? 0.6781 0.3775 0.5369 0.1509  0.0445  0.1069  266 SER A OG  
1941 N N   . SER A 267 ? 0.6634 0.3252 0.4863 0.1378  0.0258  0.0969  267 SER A N   
1942 C CA  . SER A 267 ? 0.6567 0.2978 0.4577 0.1275  0.0225  0.0833  267 SER A CA  
1943 C C   . SER A 267 ? 0.7069 0.3403 0.4999 0.1244  0.0280  0.0733  267 SER A C   
1944 O O   . SER A 267 ? 0.6916 0.3219 0.4739 0.1131  0.0219  0.0648  267 SER A O   
1945 C CB  . SER A 267 ? 0.7214 0.3351 0.5085 0.1317  0.0259  0.0794  267 SER A CB  
1946 O OG  . SER A 267 ? 0.9015 0.4956 0.6833 0.1422  0.0385  0.0766  267 SER A OG  
1947 N N   . GLY A 268 ? 0.6756 0.3057 0.4736 0.1345  0.0398  0.0750  268 GLY A N   
1948 C CA  . GLY A 268 ? 0.6822 0.3039 0.4718 0.1323  0.0463  0.0667  268 GLY A CA  
1949 C C   . GLY A 268 ? 0.7275 0.3730 0.5259 0.1240  0.0416  0.0679  268 GLY A C   
1950 O O   . GLY A 268 ? 0.7210 0.3569 0.5060 0.1160  0.0407  0.0584  268 GLY A O   
1951 N N   . LEU A 269 ? 0.6691 0.3453 0.4895 0.1252  0.0380  0.0801  269 LEU A N   
1952 C CA  . LEU A 269 ? 0.6520 0.3521 0.4811 0.1162  0.0330  0.0826  269 LEU A CA  
1953 C C   . LEU A 269 ? 0.7076 0.4045 0.5215 0.1007  0.0213  0.0744  269 LEU A C   
1954 O O   . LEU A 269 ? 0.7300 0.4348 0.5422 0.0929  0.0199  0.0717  269 LEU A O   
1955 C CB  . LEU A 269 ? 0.6487 0.3827 0.5042 0.1188  0.0294  0.0981  269 LEU A CB  
1956 C CG  . LEU A 269 ? 0.7282 0.4745 0.6056 0.1339  0.0421  0.1082  269 LEU A CG  
1957 C CD1 . LEU A 269 ? 0.7272 0.5106 0.6331 0.1346  0.0351  0.1250  269 LEU A CD1 
1958 C CD2 . LEU A 269 ? 0.7563 0.4976 0.6313 0.1360  0.0551  0.1024  269 LEU A CD2 
1959 N N   . ARG A 270 ? 0.6272 0.3113 0.4296 0.0965  0.0140  0.0703  270 ARG A N   
1960 C CA  . ARG A 270 ? 0.5903 0.2686 0.3782 0.0834  0.0042  0.0624  270 ARG A CA  
1961 C C   . ARG A 270 ? 0.6018 0.3035 0.3959 0.0732  -0.0055 0.0688  270 ARG A C   
1962 O O   . ARG A 270 ? 0.5761 0.2794 0.3628 0.0637  -0.0090 0.0639  270 ARG A O   
1963 C CB  . ARG A 270 ? 0.5485 0.2075 0.3201 0.0793  0.0069  0.0498  270 ARG A CB  
1964 C CG  . ARG A 270 ? 0.6293 0.2619 0.3901 0.0863  0.0147  0.0426  270 ARG A CG  
1965 C CD  . ARG A 270 ? 0.6931 0.3136 0.4508 0.0900  0.0136  0.0428  270 ARG A CD  
1966 N NE  . ARG A 270 ? 0.6239 0.2397 0.3732 0.0810  0.0047  0.0377  270 ARG A NE  
1967 C CZ  . ARG A 270 ? 0.8179 0.4377 0.5698 0.0800  0.0002  0.0419  270 ARG A CZ  
1968 N NH1 . ARG A 270 ? 0.6780 0.3066 0.4406 0.0873  0.0021  0.0518  270 ARG A NH1 
1969 N NH2 . ARG A 270 ? 0.7166 0.3314 0.4605 0.0718  -0.0061 0.0368  270 ARG A NH2 
1970 N N   . ILE A 271 ? 0.5629 0.2818 0.3699 0.0747  -0.0102 0.0804  271 ILE A N   
1971 C CA  . ILE A 271 ? 0.5573 0.2980 0.3693 0.0639  -0.0204 0.0881  271 ILE A CA  
1972 C C   . ILE A 271 ? 0.6319 0.3705 0.4384 0.0597  -0.0288 0.0919  271 ILE A C   
1973 O O   . ILE A 271 ? 0.6348 0.3806 0.4529 0.0671  -0.0292 0.1017  271 ILE A O   
1974 C CB  . ILE A 271 ? 0.5898 0.3598 0.4255 0.0673  -0.0194 0.1014  271 ILE A CB  
1975 C CG1 . ILE A 271 ? 0.6070 0.3782 0.4491 0.0734  -0.0078 0.0982  271 ILE A CG1 
1976 C CG2 . ILE A 271 ? 0.5619 0.3537 0.4005 0.0536  -0.0316 0.1095  271 ILE A CG2 
1977 C CD1 . ILE A 271 ? 0.7374 0.5033 0.5652 0.0620  -0.0085 0.0883  271 ILE A CD1 
1978 N N   . GLY A 272 ? 0.5985 0.3258 0.3867 0.0483  -0.0347 0.0841  272 GLY A N   
1979 C CA  . GLY A 272 ? 0.6112 0.3337 0.3895 0.0416  -0.0421 0.0862  272 GLY A CA  
1980 C C   . GLY A 272 ? 0.6690 0.4012 0.4390 0.0266  -0.0519 0.0891  272 GLY A C   
1981 O O   . GLY A 272 ? 0.6578 0.3983 0.4282 0.0209  -0.0529 0.0879  272 GLY A O   
1982 N N   . PHE A 273 ? 0.6460 0.3751 0.4058 0.0190  -0.0591 0.0928  273 PHE A N   
1983 C CA  . PHE A 273 ? 0.6618 0.3960 0.4090 0.0032  -0.0685 0.0956  273 PHE A CA  
1984 C C   . PHE A 273 ? 0.7501 0.4668 0.4744 -0.0068 -0.0725 0.0915  273 PHE A C   
1985 O O   . PHE A 273 ? 0.7678 0.4821 0.4903 -0.0062 -0.0753 0.0973  273 PHE A O   
1986 C CB  . PHE A 273 ? 0.6853 0.4472 0.4477 -0.0009 -0.0769 0.1110  273 PHE A CB  
1987 C CG  . PHE A 273 ? 0.7031 0.4759 0.4765 0.0029  -0.0824 0.1245  273 PHE A CG  
1988 C CD1 . PHE A 273 ? 0.7308 0.5104 0.5252 0.0191  -0.0764 0.1300  273 PHE A CD1 
1989 C CD2 . PHE A 273 ? 0.7280 0.5037 0.4900 -0.0101 -0.0941 0.1326  273 PHE A CD2 
1990 C CE1 . PHE A 273 ? 0.7420 0.5316 0.5472 0.0233  -0.0820 0.1435  273 PHE A CE1 
1991 C CE2 . PHE A 273 ? 0.7706 0.5571 0.5431 -0.0070 -0.1007 0.1465  273 PHE A CE2 
1992 C CZ  . PHE A 273 ? 0.7410 0.5351 0.5361 0.0102  -0.0947 0.1521  273 PHE A CZ  
1993 N N   . LEU A 274 ? 0.7042 0.4087 0.4100 -0.0167 -0.0727 0.0823  274 LEU A N   
1994 C CA  . LEU A 274 ? 0.7049 0.3902 0.3861 -0.0272 -0.0742 0.0764  274 LEU A CA  
1995 C C   . LEU A 274 ? 0.7279 0.4196 0.3961 -0.0429 -0.0847 0.0849  274 LEU A C   
1996 O O   . LEU A 274 ? 0.7076 0.4131 0.3795 -0.0490 -0.0896 0.0891  274 LEU A O   
1997 C CB  . LEU A 274 ? 0.7056 0.3743 0.3754 -0.0283 -0.0681 0.0625  274 LEU A CB  
1998 C CG  . LEU A 274 ? 0.7632 0.4095 0.4221 -0.0254 -0.0609 0.0514  274 LEU A CG  
1999 C CD1 . LEU A 274 ? 0.7475 0.3928 0.4189 -0.0141 -0.0564 0.0525  274 LEU A CD1 
2000 C CD2 . LEU A 274 ? 0.7776 0.4133 0.4331 -0.0235 -0.0556 0.0399  274 LEU A CD2 
2001 N N   . THR A 275 ? 0.6774 0.3580 0.3289 -0.0504 -0.0883 0.0874  275 THR A N   
2002 C CA  . THR A 275 ? 0.6739 0.3545 0.3065 -0.0673 -0.0989 0.0953  275 THR A CA  
2003 C C   . THR A 275 ? 0.6814 0.3332 0.2829 -0.0765 -0.0952 0.0860  275 THR A C   
2004 O O   . THR A 275 ? 0.6457 0.2846 0.2424 -0.0722 -0.0902 0.0830  275 THR A O   
2005 C CB  . THR A 275 ? 0.7776 0.4758 0.4221 -0.0675 -0.1084 0.1113  275 THR A CB  
2006 O OG1 . THR A 275 ? 0.7330 0.4534 0.4096 -0.0527 -0.1066 0.1177  275 THR A OG1 
2007 C CG2 . THR A 275 ? 0.7812 0.4886 0.4141 -0.0849 -0.1219 0.1223  275 THR A CG2 
2008 N N   . GLY A 276 ? 0.6592 0.2996 0.2396 -0.0884 -0.0962 0.0807  276 GLY A N   
2009 C CA  . GLY A 276 ? 0.6838 0.2950 0.2338 -0.0965 -0.0905 0.0710  276 GLY A CA  
2010 C C   . GLY A 276 ? 0.7532 0.3513 0.2763 -0.1121 -0.0937 0.0680  276 GLY A C   
2011 O O   . GLY A 276 ? 0.7337 0.3471 0.2608 -0.1191 -0.1023 0.0749  276 GLY A O   
2012 N N   . PRO A 277 ? 0.7485 0.3171 0.2431 -0.1181 -0.0861 0.0580  277 PRO A N   
2013 C CA  . PRO A 277 ? 0.7805 0.3315 0.2451 -0.1330 -0.0879 0.0546  277 PRO A CA  
2014 C C   . PRO A 277 ? 0.8657 0.4238 0.3398 -0.1301 -0.0875 0.0502  277 PRO A C   
2015 O O   . PRO A 277 ? 0.8644 0.4222 0.3547 -0.1161 -0.0786 0.0414  277 PRO A O   
2016 C CB  . PRO A 277 ? 0.8180 0.3364 0.2572 -0.1340 -0.0756 0.0430  277 PRO A CB  
2017 C CG  . PRO A 277 ? 0.8482 0.3708 0.3109 -0.1169 -0.0661 0.0381  277 PRO A CG  
2018 C CD  . PRO A 277 ? 0.7725 0.3221 0.2608 -0.1115 -0.0747 0.0497  277 PRO A CD  
2019 N N   . LYS A 278 ? 0.8229 0.3879 0.2868 -0.1442 -0.0979 0.0572  278 LYS A N   
2020 C CA  . LYS A 278 ? 0.7990 0.3699 0.2667 -0.1457 -0.0994 0.0548  278 LYS A CA  
2021 C C   . LYS A 278 ? 0.8223 0.3710 0.2835 -0.1366 -0.0868 0.0397  278 LYS A C   
2022 O O   . LYS A 278 ? 0.7869 0.3476 0.2718 -0.1240 -0.0832 0.0363  278 LYS A O   
2023 C CB  . LYS A 278 ? 0.8445 0.4126 0.2870 -0.1674 -0.1108 0.0620  278 LYS A CB  
2024 C CG  . LYS A 278 ? 0.9520 0.5375 0.4052 -0.1714 -0.1164 0.0653  278 LYS A CG  
2025 C CD  . LYS A 278 ? 1.0924 0.6515 0.5210 -0.1758 -0.1104 0.0537  278 LYS A CD  
2026 C CE  . LYS A 278 ? 1.2782 0.8505 0.7077 -0.1862 -0.1182 0.0586  278 LYS A CE  
2027 N NZ  . LYS A 278 ? 1.3594 0.9025 0.7606 -0.1920 -0.1131 0.0479  278 LYS A NZ  
2028 N N   . PRO A 279 ? 0.7888 0.3057 0.2208 -0.1410 -0.0791 0.0308  279 PRO A N   
2029 C CA  . PRO A 279 ? 0.7853 0.2840 0.2153 -0.1311 -0.0677 0.0178  279 PRO A CA  
2030 C C   . PRO A 279 ? 0.8126 0.3224 0.2744 -0.1114 -0.0602 0.0130  279 PRO A C   
2031 O O   . PRO A 279 ? 0.7980 0.3079 0.2708 -0.1027 -0.0567 0.0069  279 PRO A O   
2032 C CB  . PRO A 279 ? 0.8399 0.3043 0.2347 -0.1389 -0.0601 0.0112  279 PRO A CB  
2033 C CG  . PRO A 279 ? 0.9072 0.3730 0.2903 -0.1494 -0.0657 0.0196  279 PRO A CG  
2034 C CD  . PRO A 279 ? 0.8407 0.3352 0.2381 -0.1561 -0.0803 0.0323  279 PRO A CD  
2035 N N   . LEU A 280 ? 0.7553 0.2736 0.2303 -0.1053 -0.0587 0.0164  280 LEU A N   
2036 C CA  . LEU A 280 ? 0.7142 0.2419 0.2171 -0.0884 -0.0522 0.0127  280 LEU A CA  
2037 C C   . LEU A 280 ? 0.7165 0.2702 0.2478 -0.0803 -0.0574 0.0178  280 LEU A C   
2038 O O   . LEU A 280 ? 0.6811 0.2368 0.2288 -0.0688 -0.0527 0.0119  280 LEU A O   
2039 C CB  . LEU A 280 ? 0.7149 0.2401 0.2187 -0.0863 -0.0486 0.0146  280 LEU A CB  
2040 C CG  . LEU A 280 ? 0.7950 0.2926 0.2744 -0.0903 -0.0389 0.0070  280 LEU A CG  
2041 C CD1 . LEU A 280 ? 0.8042 0.3016 0.2916 -0.0846 -0.0332 0.0072  280 LEU A CD1 
2042 C CD2 . LEU A 280 ? 0.7893 0.2717 0.2675 -0.0834 -0.0296 -0.0042 280 LEU A CD2 
2043 N N   . ILE A 281 ? 0.6803 0.2532 0.2170 -0.0868 -0.0671 0.0291  281 ILE A N   
2044 C CA  . ILE A 281 ? 0.6632 0.2614 0.2263 -0.0798 -0.0712 0.0350  281 ILE A CA  
2045 C C   . ILE A 281 ? 0.7345 0.3306 0.2969 -0.0797 -0.0703 0.0293  281 ILE A C   
2046 O O   . ILE A 281 ? 0.7071 0.3111 0.2887 -0.0685 -0.0669 0.0265  281 ILE A O   
2047 C CB  . ILE A 281 ? 0.6991 0.3190 0.2683 -0.0876 -0.0817 0.0493  281 ILE A CB  
2048 C CG1 . ILE A 281 ? 0.7032 0.3257 0.2769 -0.0846 -0.0825 0.0551  281 ILE A CG1 
2049 C CG2 . ILE A 281 ? 0.6810 0.3270 0.2759 -0.0820 -0.0849 0.0557  281 ILE A CG2 
2050 C CD1 . ILE A 281 ? 0.7023 0.3327 0.3027 -0.0662 -0.0756 0.0536  281 ILE A CD1 
2051 N N   . GLU A 282 ? 0.7310 0.3124 0.2677 -0.0928 -0.0729 0.0271  282 GLU A N   
2052 C CA  . GLU A 282 ? 0.7343 0.3083 0.2628 -0.0958 -0.0727 0.0218  282 GLU A CA  
2053 C C   . GLU A 282 ? 0.7628 0.3221 0.2961 -0.0830 -0.0637 0.0103  282 GLU A C   
2054 O O   . GLU A 282 ? 0.7341 0.2960 0.2752 -0.0785 -0.0632 0.0072  282 GLU A O   
2055 C CB  . GLU A 282 ? 0.7858 0.3419 0.2810 -0.1134 -0.0767 0.0219  282 GLU A CB  
2056 C CG  . GLU A 282 ? 1.0342 0.5730 0.5120 -0.1180 -0.0753 0.0148  282 GLU A CG  
2057 C CD  . GLU A 282 ? 1.5617 1.0666 1.0061 -0.1248 -0.0702 0.0071  282 GLU A CD  
2058 O OE1 . GLU A 282 ? 1.5356 1.0273 0.9532 -0.1397 -0.0746 0.0080  282 GLU A OE1 
2059 O OE2 . GLU A 282 ? 1.5568 1.0479 1.0014 -0.1154 -0.0615 0.0004  282 GLU A OE2 
2060 N N   . ARG A 283 ? 0.7365 0.2816 0.2667 -0.0772 -0.0568 0.0047  283 ARG A N   
2061 C CA  . ARG A 283 ? 0.7266 0.2605 0.2651 -0.0648 -0.0489 -0.0047 283 ARG A CA  
2062 C C   . ARG A 283 ? 0.7508 0.3031 0.3182 -0.0524 -0.0487 -0.0033 283 ARG A C   
2063 O O   . ARG A 283 ? 0.7438 0.2927 0.3185 -0.0454 -0.0469 -0.0086 283 ARG A O   
2064 C CB  . ARG A 283 ? 0.7263 0.2444 0.2569 -0.0626 -0.0413 -0.0093 283 ARG A CB  
2065 C CG  . ARG A 283 ? 0.8015 0.2985 0.3251 -0.0574 -0.0336 -0.0193 283 ARG A CG  
2066 C CD  . ARG A 283 ? 0.9186 0.3943 0.4119 -0.0683 -0.0333 -0.0219 283 ARG A CD  
2067 N NE  . ARG A 283 ? 1.0006 0.4695 0.4918 -0.0663 -0.0345 -0.0262 283 ARG A NE  
2068 C CZ  . ARG A 283 ? 1.0049 0.4668 0.4764 -0.0772 -0.0397 -0.0249 283 ARG A CZ  
2069 N NH1 . ARG A 283 ? 0.9086 0.3715 0.3621 -0.0916 -0.0450 -0.0188 283 ARG A NH1 
2070 N NH2 . ARG A 283 ? 0.4994 0.0474 0.0417 -0.0598 -0.0308 0.0040  283 ARG A NH2 
2071 N N   . VAL A 284 ? 0.6772 0.2472 0.2592 -0.0501 -0.0510 0.0043  284 VAL A N   
2072 C CA  . VAL A 284 ? 0.6407 0.2254 0.2471 -0.0388 -0.0502 0.0059  284 VAL A CA  
2073 C C   . VAL A 284 ? 0.6660 0.2626 0.2785 -0.0398 -0.0539 0.0088  284 VAL A C   
2074 O O   . VAL A 284 ? 0.6483 0.2430 0.2694 -0.0323 -0.0514 0.0041  284 VAL A O   
2075 C CB  . VAL A 284 ? 0.6722 0.2681 0.2934 -0.0326 -0.0493 0.0115  284 VAL A CB  
2076 C CG1 . VAL A 284 ? 0.6767 0.2593 0.2897 -0.0329 -0.0448 0.0081  284 VAL A CG1 
2077 C CG2 . VAL A 284 ? 0.6715 0.2864 0.2979 -0.0376 -0.0557 0.0231  284 VAL A CG2 
2078 N N   . ILE A 285 ? 0.6126 0.2199 0.2188 -0.0506 -0.0601 0.0163  285 ILE A N   
2079 C CA  . ILE A 285 ? 0.6042 0.2244 0.2161 -0.0533 -0.0632 0.0199  285 ILE A CA  
2080 C C   . ILE A 285 ? 0.6684 0.2737 0.2726 -0.0517 -0.0605 0.0109  285 ILE A C   
2081 O O   . ILE A 285 ? 0.6423 0.2550 0.2582 -0.0462 -0.0591 0.0107  285 ILE A O   
2082 C CB  . ILE A 285 ? 0.6422 0.2755 0.2469 -0.0675 -0.0710 0.0295  285 ILE A CB  
2083 C CG1 . ILE A 285 ? 0.6413 0.2906 0.2562 -0.0680 -0.0747 0.0398  285 ILE A CG1 
2084 C CG2 . ILE A 285 ? 0.6322 0.2816 0.2467 -0.0696 -0.0728 0.0336  285 ILE A CG2 
2085 C CD1 . ILE A 285 ? 0.6714 0.3293 0.2749 -0.0840 -0.0840 0.0494  285 ILE A CD1 
2086 N N   . LEU A 286 ? 0.6488 0.2317 0.2331 -0.0556 -0.0593 0.0034  286 LEU A N   
2087 C CA  . LEU A 286 ? 0.6585 0.2248 0.2338 -0.0540 -0.0576 -0.0047 286 LEU A CA  
2088 C C   . LEU A 286 ? 0.7127 0.2760 0.3032 -0.0407 -0.0534 -0.0100 286 LEU A C   
2089 O O   . LEU A 286 ? 0.7057 0.2637 0.2962 -0.0381 -0.0535 -0.0137 286 LEU A O   
2090 C CB  . LEU A 286 ? 0.6783 0.2203 0.2297 -0.0599 -0.0563 -0.0108 286 LEU A CB  
2091 C CG  . LEU A 286 ? 0.7597 0.2968 0.2882 -0.0755 -0.0610 -0.0073 286 LEU A CG  
2092 C CD1 . LEU A 286 ? 0.7840 0.2937 0.2882 -0.0792 -0.0574 -0.0139 286 LEU A CD1 
2093 C CD2 . LEU A 286 ? 0.8070 0.3484 0.3313 -0.0819 -0.0651 -0.0057 286 LEU A CD2 
2094 N N   . HIS A 287 ? 0.6677 0.2332 0.2697 -0.0331 -0.0502 -0.0103 287 HIS A N   
2095 C CA  . HIS A 287 ? 0.6581 0.2204 0.2738 -0.0218 -0.0470 -0.0148 287 HIS A CA  
2096 C C   . HIS A 287 ? 0.6737 0.2498 0.3031 -0.0174 -0.0474 -0.0111 287 HIS A C   
2097 O O   . HIS A 287 ? 0.6434 0.2131 0.2759 -0.0123 -0.0466 -0.0152 287 HIS A O   
2098 C CB  . HIS A 287 ? 0.6709 0.2324 0.2946 -0.0163 -0.0433 -0.0155 287 HIS A CB  
2099 C CG  . HIS A 287 ? 0.7077 0.2615 0.3416 -0.0070 -0.0405 -0.0213 287 HIS A CG  
2100 N ND1 . HIS A 287 ? 0.7313 0.2815 0.3711 -0.0029 -0.0366 -0.0233 287 HIS A ND1 
2101 C CD2 . HIS A 287 ? 0.7281 0.2774 0.3666 -0.0023 -0.0417 -0.0247 287 HIS A CD2 
2102 C CE1 . HIS A 287 ? 0.7227 0.2678 0.3720 0.0039  -0.0361 -0.0275 287 HIS A CE1 
2103 N NE2 . HIS A 287 ? 0.7250 0.2688 0.3732 0.0044  -0.0395 -0.0284 287 HIS A NE2 
2104 N N   . ILE A 288 ? 0.6373 0.2316 0.2743 -0.0196 -0.0484 -0.0027 288 ILE A N   
2105 C CA  . ILE A 288 ? 0.6257 0.2344 0.2770 -0.0147 -0.0470 0.0021  288 ILE A CA  
2106 C C   . ILE A 288 ? 0.6477 0.2572 0.2936 -0.0193 -0.0481 0.0016  288 ILE A C   
2107 O O   . ILE A 288 ? 0.6235 0.2355 0.2769 -0.0138 -0.0449 0.0014  288 ILE A O   
2108 C CB  . ILE A 288 ? 0.6628 0.2907 0.3283 -0.0123 -0.0467 0.0116  288 ILE A CB  
2109 C CG1 . ILE A 288 ? 0.6885 0.3359 0.3584 -0.0187 -0.0496 0.0205  288 ILE A CG1 
2110 C CG2 . ILE A 288 ? 0.6416 0.2675 0.3060 -0.0125 -0.0474 0.0131  288 ILE A CG2 
2111 C CD1 . ILE A 288 ? 0.8534 0.5191 0.5448 -0.0096 -0.0455 0.0280  288 ILE A CD1 
2112 N N   . GLN A 289 ? 0.5966 0.2002 0.2263 -0.0297 -0.0520 0.0006  289 GLN A N   
2113 C CA  . GLN A 289 ? 0.5909 0.1916 0.2107 -0.0364 -0.0536 -0.0005 289 GLN A CA  
2114 C C   . GLN A 289 ? 0.6516 0.2352 0.2676 -0.0303 -0.0516 -0.0085 289 GLN A C   
2115 O O   . GLN A 289 ? 0.6594 0.2443 0.2752 -0.0309 -0.0505 -0.0085 289 GLN A O   
2116 C CB  . GLN A 289 ? 0.6168 0.2085 0.2165 -0.0485 -0.0580 -0.0012 289 GLN A CB  
2117 C CG  . GLN A 289 ? 0.8130 0.4146 0.4069 -0.0595 -0.0612 0.0038  289 GLN A CG  
2118 C CD  . GLN A 289 ? 1.1765 0.7848 0.7610 -0.0719 -0.0664 0.0100  289 GLN A CD  
2119 O OE1 . GLN A 289 ? 1.1273 0.7174 0.6911 -0.0788 -0.0685 0.0062  289 GLN A OE1 
2120 N NE2 . GLN A 289 ? 1.1180 0.7518 0.7169 -0.0756 -0.0686 0.0202  289 GLN A NE2 
2121 N N   . VAL A 290 ? 0.6122 0.1803 0.2260 -0.0248 -0.0512 -0.0148 290 VAL A N   
2122 C CA  . VAL A 290 ? 0.6043 0.1565 0.2160 -0.0190 -0.0509 -0.0215 290 VAL A CA  
2123 C C   . VAL A 290 ? 0.6417 0.1964 0.2682 -0.0091 -0.0479 -0.0219 290 VAL A C   
2124 O O   . VAL A 290 ? 0.6233 0.1653 0.2479 -0.0053 -0.0486 -0.0266 290 VAL A O   
2125 C CB  . VAL A 290 ? 0.6478 0.1801 0.2477 -0.0194 -0.0530 -0.0279 290 VAL A CB  
2126 C CG1 . VAL A 290 ? 0.6483 0.1713 0.2291 -0.0288 -0.0559 -0.0289 290 VAL A CG1 
2127 C CG2 . VAL A 290 ? 0.6460 0.1776 0.2486 -0.0177 -0.0513 -0.0284 290 VAL A CG2 
2128 N N   . SER A 291 ? 0.6215 0.1911 0.2610 -0.0056 -0.0450 -0.0168 291 SER A N   
2129 C CA  . SER A 291 ? 0.6353 0.2055 0.2867 0.0033  -0.0416 -0.0168 291 SER A CA  
2130 C C   . SER A 291 ? 0.7104 0.2903 0.3686 0.0062  -0.0373 -0.0123 291 SER A C   
2131 O O   . SER A 291 ? 0.7226 0.2928 0.3766 0.0082  -0.0357 -0.0155 291 SER A O   
2132 C CB  . SER A 291 ? 0.6855 0.2607 0.3455 0.0066  -0.0405 -0.0149 291 SER A CB  
2133 O OG  . SER A 291 ? 0.8269 0.4055 0.4979 0.0140  -0.0368 -0.0128 291 SER A OG  
2134 N N   . THR A 292 ? 0.6442 0.2425 0.3124 0.0064  -0.0352 -0.0047 292 THR A N   
2135 C CA  . THR A 292 ? 0.6278 0.2381 0.3058 0.0105  -0.0298 0.0008  292 THR A CA  
2136 C C   . THR A 292 ? 0.6524 0.2776 0.3303 0.0030  -0.0304 0.0061  292 THR A C   
2137 O O   . THR A 292 ? 0.6473 0.2838 0.3344 0.0060  -0.0249 0.0110  292 THR A O   
2138 C CB  . THR A 292 ? 0.7169 0.3389 0.4094 0.0172  -0.0271 0.0071  292 THR A CB  
2139 O OG1 . THR A 292 ? 0.7398 0.3708 0.4329 0.0118  -0.0322 0.0108  292 THR A OG1 
2140 C CG2 . THR A 292 ? 0.6537 0.2617 0.3474 0.0251  -0.0244 0.0029  292 THR A CG2 
2141 N N   . LEU A 293 ? 0.5891 0.2137 0.2565 -0.0068 -0.0365 0.0054  293 LEU A N   
2142 C CA  . LEU A 293 ? 0.5848 0.2228 0.2497 -0.0168 -0.0391 0.0107  293 LEU A CA  
2143 C C   . LEU A 293 ? 0.6228 0.2851 0.3026 -0.0180 -0.0404 0.0214  293 LEU A C   
2144 O O   . LEU A 293 ? 0.6231 0.2900 0.2967 -0.0270 -0.0466 0.0245  293 LEU A O   
2145 C CB  . LEU A 293 ? 0.5897 0.2289 0.2524 -0.0190 -0.0352 0.0105  293 LEU A CB  
2146 C CG  . LEU A 293 ? 0.6547 0.2698 0.3007 -0.0195 -0.0349 0.0011  293 LEU A CG  
2147 C CD1 . LEU A 293 ? 0.6539 0.2721 0.2959 -0.0244 -0.0313 0.0023  293 LEU A CD1 
2148 C CD2 . LEU A 293 ? 0.6918 0.2905 0.3208 -0.0260 -0.0418 -0.0045 293 LEU A CD2 
2149 N N   . HIS A 294 ? 0.5631 0.2391 0.2614 -0.0088 -0.0347 0.0272  294 HIS A N   
2150 C CA  . HIS A 294 ? 0.5629 0.2630 0.2786 -0.0077 -0.0359 0.0387  294 HIS A CA  
2151 C C   . HIS A 294 ? 0.6464 0.3505 0.3788 0.0065  -0.0281 0.0417  294 HIS A C   
2152 O O   . HIS A 294 ? 0.6365 0.3279 0.3666 0.0133  -0.0209 0.0359  294 HIS A O   
2153 C CB  . HIS A 294 ? 0.5730 0.2954 0.2966 -0.0157 -0.0371 0.0471  294 HIS A CB  
2154 C CG  . HIS A 294 ? 0.6138 0.3395 0.3448 -0.0104 -0.0279 0.0467  294 HIS A CG  
2155 N ND1 . HIS A 294 ? 0.6404 0.3521 0.3557 -0.0161 -0.0265 0.0394  294 HIS A ND1 
2156 C CD2 . HIS A 294 ? 0.6256 0.3641 0.3759 0.0003  -0.0192 0.0525  294 HIS A CD2 
2157 C CE1 . HIS A 294 ? 0.6302 0.3468 0.3550 -0.0096 -0.0169 0.0408  294 HIS A CE1 
2158 N NE2 . HIS A 294 ? 0.6277 0.3602 0.3738 0.0006  -0.0116 0.0484  294 HIS A NE2 
2159 N N   . PRO A 295 ? 0.6230 0.3435 0.3709 0.0108  -0.0293 0.0512  295 PRO A N   
2160 C CA  . PRO A 295 ? 0.6209 0.3436 0.3836 0.0248  -0.0209 0.0544  295 PRO A CA  
2161 C C   . PRO A 295 ? 0.6723 0.4120 0.4502 0.0286  -0.0134 0.0608  295 PRO A C   
2162 O O   . PRO A 295 ? 0.6592 0.4180 0.4428 0.0199  -0.0170 0.0670  295 PRO A O   
2163 C CB  . PRO A 295 ? 0.6404 0.3750 0.4135 0.0268  -0.0259 0.0633  295 PRO A CB  
2164 C CG  . PRO A 295 ? 0.6952 0.4420 0.4639 0.0133  -0.0361 0.0682  295 PRO A CG  
2165 C CD  . PRO A 295 ? 0.6446 0.3807 0.3957 0.0028  -0.0382 0.0599  295 PRO A CD  
2166 N N   . SER A 296 ? 0.6262 0.3580 0.4099 0.0410  -0.0025 0.0592  296 SER A N   
2167 C CA  . SER A 296 ? 0.6195 0.3637 0.4174 0.0474  0.0082  0.0645  296 SER A CA  
2168 C C   . SER A 296 ? 0.6465 0.4253 0.4664 0.0435  0.0049  0.0782  296 SER A C   
2169 O O   . SER A 296 ? 0.6353 0.4302 0.4711 0.0475  0.0010  0.0881  296 SER A O   
2170 C CB  . SER A 296 ? 0.6707 0.4052 0.4756 0.0630  0.0191  0.0651  296 SER A CB  
2171 O OG  . SER A 296 ? 0.7973 0.5483 0.6212 0.0712  0.0302  0.0732  296 SER A OG  
2172 N N   . THR A 297 ? 0.6037 0.3937 0.4239 0.0347  0.0053  0.0792  297 THR A N   
2173 C CA  . THR A 297 ? 0.6144 0.4391 0.4565 0.0292  0.0016  0.0929  297 THR A CA  
2174 C C   . THR A 297 ? 0.6930 0.5386 0.5648 0.0438  0.0117  0.1043  297 THR A C   
2175 O O   . THR A 297 ? 0.6727 0.5452 0.5661 0.0442  0.0057  0.1177  297 THR A O   
2176 C CB  . THR A 297 ? 0.7543 0.5847 0.5877 0.0145  -0.0012 0.0911  297 THR A CB  
2177 O OG1 . THR A 297 ? 0.7997 0.6593 0.6572 0.0153  0.0053  0.1018  297 THR A OG1 
2178 C CG2 . THR A 297 ? 0.7291 0.5292 0.5367 0.0122  0.0033  0.0766  297 THR A CG2 
2179 N N   . PHE A 298 ? 0.6806 0.5107 0.5514 0.0563  0.0269  0.0989  298 PHE A N   
2180 C CA  . PHE A 298 ? 0.6879 0.5298 0.5828 0.0728  0.0399  0.1076  298 PHE A CA  
2181 C C   . PHE A 298 ? 0.7376 0.5844 0.6445 0.0817  0.0346  0.1152  298 PHE A C   
2182 O O   . PHE A 298 ? 0.7394 0.6153 0.6746 0.0872  0.0343  0.1297  298 PHE A O   
2183 C CB  . PHE A 298 ? 0.7259 0.5387 0.6066 0.0827  0.0562  0.0971  298 PHE A CB  
2184 C CG  . PHE A 298 ? 0.7676 0.5914 0.6711 0.0986  0.0734  0.1051  298 PHE A CG  
2185 C CD1 . PHE A 298 ? 0.8122 0.6337 0.7277 0.1139  0.0784  0.1107  298 PHE A CD1 
2186 C CD2 . PHE A 298 ? 0.8153 0.6500 0.7271 0.0984  0.0858  0.1070  298 PHE A CD2 
2187 C CE1 . PHE A 298 ? 0.8324 0.6630 0.7691 0.1297  0.0955  0.1185  298 PHE A CE1 
2188 C CE2 . PHE A 298 ? 0.8565 0.7005 0.7897 0.1140  0.1037  0.1143  298 PHE A CE2 
2189 C CZ  . PHE A 298 ? 0.8292 0.6707 0.7749 0.1300  0.1086  0.1200  298 PHE A CZ  
2190 N N   . ASN A 299 ? 0.6920 0.5114 0.5782 0.0826  0.0300  0.1062  299 ASN A N   
2191 C CA  . ASN A 299 ? 0.6904 0.5092 0.5830 0.0901  0.0252  0.1119  299 ASN A CA  
2192 C C   . ASN A 299 ? 0.6991 0.5416 0.6010 0.0800  0.0089  0.1223  299 ASN A C   
2193 O O   . ASN A 299 ? 0.6784 0.5330 0.5962 0.0871  0.0057  0.1331  299 ASN A O   
2194 C CB  . ASN A 299 ? 0.7234 0.5062 0.5903 0.0919  0.0251  0.0988  299 ASN A CB  
2195 C CG  . ASN A 299 ? 0.8096 0.5651 0.6628 0.0998  0.0389  0.0884  299 ASN A CG  
2196 O OD1 . ASN A 299 ? 0.5320 0.2603 0.3614 0.0955  0.0372  0.0761  299 ASN A OD1 
2197 N ND2 . ASN A 299 ? 0.7671 0.5284 0.6345 0.1113  0.0530  0.0934  299 ASN A ND2 
2198 N N   . GLN A 300 ? 0.6341 0.4798 0.5232 0.0632  -0.0016 0.1188  300 GLN A N   
2199 C CA  . GLN A 300 ? 0.6262 0.4906 0.5182 0.0505  -0.0172 0.1275  300 GLN A CA  
2200 C C   . GLN A 300 ? 0.6754 0.5784 0.5991 0.0513  -0.0186 0.1448  300 GLN A C   
2201 O O   . GLN A 300 ? 0.6789 0.6000 0.6144 0.0483  -0.0294 0.1570  300 GLN A O   
2202 C CB  . GLN A 300 ? 0.6431 0.4996 0.5128 0.0329  -0.0248 0.1191  300 GLN A CB  
2203 C CG  . GLN A 300 ? 0.6795 0.5036 0.5200 0.0286  -0.0280 0.1048  300 GLN A CG  
2204 C CD  . GLN A 300 ? 0.6700 0.4914 0.4924 0.0114  -0.0364 0.1002  300 GLN A CD  
2205 O OE1 . GLN A 300 ? 0.5309 0.3605 0.3487 -0.0001 -0.0478 0.1057  300 GLN A OE1 
2206 N NE2 . GLN A 300 ? 0.4885 0.2987 0.3001 0.0087  -0.0308 0.0912  300 GLN A NE2 
2207 N N   . LEU A 301 ? 0.6156 0.5310 0.5524 0.0543  -0.0080 0.1461  301 LEU A N   
2208 C CA  . LEU A 301 ? 0.5971 0.5508 0.5676 0.0563  -0.0061 0.1621  301 LEU A CA  
2209 C C   . LEU A 301 ? 0.5952 0.5570 0.5905 0.0762  0.0021  0.1719  301 LEU A C   
2210 O O   . LEU A 301 ? 0.5707 0.5630 0.5932 0.0781  -0.0044 0.1884  301 LEU A O   
2211 C CB  . LEU A 301 ? 0.6020 0.5584 0.5742 0.0551  0.0065  0.1573  301 LEU A CB  
2212 C CG  . LEU A 301 ? 0.6541 0.6402 0.6376 0.0396  0.0009  0.1651  301 LEU A CG  
2213 C CD1 . LEU A 301 ? 0.6535 0.6444 0.6228 0.0197  -0.0193 0.1675  301 LEU A CD1 
2214 C CD2 . LEU A 301 ? 0.6684 0.6400 0.6360 0.0350  0.0115  0.1534  301 LEU A CD2 
2215 N N   . MET A 302 ? 0.5530 0.4857 0.5373 0.0906  0.0157  0.1617  302 MET A N   
2216 C CA  . MET A 302 ? 0.5638 0.4940 0.5642 0.1107  0.0259  0.1678  302 MET A CA  
2217 C C   . MET A 302 ? 0.6032 0.5411 0.6100 0.1110  0.0119  0.1778  302 MET A C   
2218 O O   . MET A 302 ? 0.6069 0.5701 0.6436 0.1207  0.0119  0.1938  302 MET A O   
2219 C CB  . MET A 302 ? 0.6043 0.4932 0.5794 0.1198  0.0381  0.1520  302 MET A CB  
2220 C CG  . MET A 302 ? 0.6640 0.5471 0.6477 0.1345  0.0589  0.1507  302 MET A CG  
2221 S SD  . MET A 302 ? 0.7299 0.5612 0.6788 0.1419  0.0700  0.1325  302 MET A SD  
2222 C CE  . MET A 302 ? 0.6941 0.5198 0.6533 0.1581  0.0707  0.1410  302 MET A CE  
2223 N N   . ILE A 303 ? 0.5282 0.4445 0.5070 0.0999  0.0001  0.1688  303 ILE A N   
2224 C CA  . ILE A 303 ? 0.5037 0.4228 0.4822 0.0974  -0.0136 0.1767  303 ILE A CA  
2225 C C   . ILE A 303 ? 0.5254 0.4811 0.5235 0.0861  -0.0273 0.1922  303 ILE A C   
2226 O O   . ILE A 303 ? 0.5267 0.5061 0.5527 0.0950  -0.0292 0.2084  303 ILE A O   
2227 C CB  . ILE A 303 ? 0.5347 0.4218 0.4788 0.0883  -0.0210 0.1632  303 ILE A CB  
2228 C CG1 . ILE A 303 ? 0.5453 0.3989 0.4747 0.1010  -0.0083 0.1509  303 ILE A CG1 
2229 C CG2 . ILE A 303 ? 0.5359 0.4291 0.4787 0.0819  -0.0364 0.1726  303 ILE A CG2 
2230 C CD1 . ILE A 303 ? 0.6421 0.4660 0.5422 0.0941  -0.0136 0.1385  303 ILE A CD1 
2231 N N   . SER A 304 ? 0.4591 0.4202 0.4442 0.0671  -0.0362 0.1882  304 SER A N   
2232 C CA  . SER A 304 ? 0.4618 0.4558 0.4614 0.0529  -0.0508 0.2027  304 SER A CA  
2233 C C   . SER A 304 ? 0.5476 0.5812 0.5902 0.0628  -0.0486 0.2224  304 SER A C   
2234 O O   . SER A 304 ? 0.5389 0.5902 0.5975 0.0639  -0.0597 0.2375  304 SER A O   
2235 C CB  . SER A 304 ? 0.4895 0.4836 0.4721 0.0339  -0.0554 0.1953  304 SER A CB  
2236 O OG  . SER A 304 ? 0.5553 0.5742 0.5435 0.0169  -0.0723 0.2080  304 SER A OG  
2237 N N   . GLN A 305 ? 0.5265 0.5720 0.5876 0.0714  -0.0335 0.2222  305 GLN A N   
2238 C CA  . GLN A 305 ? 0.5303 0.6145 0.6346 0.0818  -0.0283 0.2403  305 GLN A CA  
2239 C C   . GLN A 305 ? 0.5904 0.6808 0.7160 0.0995  -0.0280 0.2527  305 GLN A C   
2240 O O   . GLN A 305 ? 0.6056 0.7314 0.7620 0.0992  -0.0379 0.2722  305 GLN A O   
2241 C CB  . GLN A 305 ? 0.5487 0.6363 0.6647 0.0908  -0.0079 0.2352  305 GLN A CB  
2242 C CG  . GLN A 305 ? 0.8117 0.9471 0.9701 0.0910  -0.0068 0.2537  305 GLN A CG  
2243 C CD  . GLN A 305 ? 1.1134 1.2538 1.2751 0.0890  0.0083  0.2475  305 GLN A CD  
2244 O OE1 . GLN A 305 ? 1.0547 1.1752 1.1860 0.0746  0.0072  0.2330  305 GLN A OE1 
2245 N NE2 . GLN A 305 ? 1.0276 1.1963 1.2275 0.1030  0.0225  0.2593  305 GLN A NE2 
2246 N N   . LEU A 306 ? 0.5338 0.5895 0.6421 0.1134  -0.0184 0.2420  306 LEU A N   
2247 C CA  . LEU A 306 ? 0.5365 0.5914 0.6602 0.1311  -0.0170 0.2523  306 LEU A CA  
2248 C C   . LEU A 306 ? 0.6002 0.6628 0.7212 0.1212  -0.0388 0.2633  306 LEU A C   
2249 O O   . LEU A 306 ? 0.5835 0.6752 0.7354 0.1274  -0.0458 0.2828  306 LEU A O   
2250 C CB  . LEU A 306 ? 0.5362 0.5487 0.6375 0.1461  -0.0014 0.2372  306 LEU A CB  
2251 C CG  . LEU A 306 ? 0.5918 0.5867 0.6860 0.1546  -0.0068 0.2406  306 LEU A CG  
2252 C CD1 . LEU A 306 ? 0.5994 0.6056 0.7247 0.1777  0.0038  0.2546  306 LEU A CD1 
2253 C CD2 . LEU A 306 ? 0.6160 0.5659 0.6701 0.1521  -0.0037 0.2210  306 LEU A CD2 
2254 N N   . LEU A 307 ? 0.5826 0.6189 0.6665 0.1059  -0.0493 0.2511  307 LEU A N   
2255 C CA  . LEU A 307 ? 0.5977 0.6348 0.6725 0.0956  -0.0685 0.2593  307 LEU A CA  
2256 C C   . LEU A 307 ? 0.6738 0.7448 0.7606 0.0769  -0.0870 0.2738  307 LEU A C   
2257 O O   . LEU A 307 ? 0.6665 0.7438 0.7512 0.0689  -0.1038 0.2850  307 LEU A O   
2258 C CB  . LEU A 307 ? 0.6006 0.5956 0.6343 0.0902  -0.0703 0.2427  307 LEU A CB  
2259 C CG  . LEU A 307 ? 0.6479 0.6265 0.6473 0.0682  -0.0797 0.2301  307 LEU A CG  
2260 C CD1 . LEU A 307 ? 0.6485 0.5881 0.6152 0.0682  -0.0784 0.2160  307 LEU A CD1 
2261 C CD2 . LEU A 307 ? 0.6546 0.6321 0.6485 0.0628  -0.0712 0.2186  307 LEU A CD2 
2262 N N   . HIS A 308 ? 0.6517 0.7460 0.7534 0.0707  -0.0834 0.2752  308 HIS A N   
2263 C CA  . HIS A 308 ? 0.6552 0.7865 0.7739 0.0536  -0.0990 0.2904  308 HIS A CA  
2264 C C   . HIS A 308 ? 0.7167 0.8882 0.8834 0.0669  -0.1007 0.3139  308 HIS A C   
2265 O O   . HIS A 308 ? 0.7102 0.8998 0.8862 0.0593  -0.1192 0.3303  308 HIS A O   
2266 C CB  . HIS A 308 ? 0.6527 0.7922 0.7683 0.0418  -0.0937 0.2827  308 HIS A CB  
2267 C CG  . HIS A 308 ? 0.6980 0.8224 0.7772 0.0164  -0.1074 0.2739  308 HIS A CG  
2268 N ND1 . HIS A 308 ? 0.7203 0.8023 0.7583 0.0123  -0.1044 0.2538  308 HIS A ND1 
2269 C CD2 . HIS A 308 ? 0.7277 0.8734 0.8062 -0.0055 -0.1236 0.2830  308 HIS A CD2 
2270 C CE1 . HIS A 308 ? 0.7184 0.7963 0.7319 -0.0106 -0.1175 0.2509  308 HIS A CE1 
2271 N NE2 . HIS A 308 ? 0.7275 0.8412 0.7620 -0.0227 -0.1297 0.2679  308 HIS A NE2 
2272 N N   . GLU A 309 ? 0.6852 0.8682 0.8812 0.0875  -0.0811 0.3157  309 GLU A N   
2273 C CA  . GLU A 309 ? 0.7031 0.9236 0.9478 0.1036  -0.0793 0.3378  309 GLU A CA  
2274 C C   . GLU A 309 ? 0.8090 1.0199 1.0571 0.1169  -0.0855 0.3471  309 GLU A C   
2275 O O   . GLU A 309 ? 0.8293 1.0731 1.1151 0.1255  -0.0921 0.3688  309 GLU A O   
2276 C CB  . GLU A 309 ? 0.7179 0.9481 0.9892 0.1229  -0.0542 0.3359  309 GLU A CB  
2277 C CG  . GLU A 309 ? 0.8816 1.1642 1.2087 0.1317  -0.0534 0.3599  309 GLU A CG  
2278 C CD  . GLU A 309 ? 1.0685 1.3932 1.4168 0.1124  -0.0636 0.3709  309 GLU A CD  
2279 O OE1 . GLU A 309 ? 0.8500 1.2198 1.2470 0.1199  -0.0640 0.3923  309 GLU A OE1 
2280 O OE2 . GLU A 309 ? 0.9076 1.2206 1.2250 0.0903  -0.0704 0.3586  309 GLU A OE2 
2281 N N   . TRP A 310 ? 0.7725 0.9394 0.9814 0.1174  -0.0847 0.3314  310 TRP A N   
2282 C CA  . TRP A 310 ? 0.7786 0.9296 0.9827 0.1274  -0.0906 0.3375  310 TRP A CA  
2283 C C   . TRP A 310 ? 0.8250 0.9879 1.0220 0.1083  -0.1172 0.3504  310 TRP A C   
2284 O O   . TRP A 310 ? 0.8176 0.9982 1.0372 0.1155  -0.1273 0.3695  310 TRP A O   
2285 C CB  . TRP A 310 ? 0.7644 0.8642 0.9257 0.1301  -0.0814 0.3150  310 TRP A CB  
2286 C CG  . TRP A 310 ? 0.7810 0.8588 0.9466 0.1552  -0.0612 0.3097  310 TRP A CG  
2287 C CD1 . TRP A 310 ? 0.8249 0.9206 1.0270 0.1774  -0.0480 0.3215  310 TRP A CD1 
2288 C CD2 . TRP A 310 ? 0.7782 0.8102 0.9087 0.1600  -0.0513 0.2907  310 TRP A CD2 
2289 N NE1 . TRP A 310 ? 0.8266 0.8875 1.0154 0.1954  -0.0302 0.3105  310 TRP A NE1 
2290 C CE2 . TRP A 310 ? 0.8378 0.8599 0.9830 0.1845  -0.0325 0.2916  310 TRP A CE2 
2291 C CE3 . TRP A 310 ? 0.7862 0.7846 0.8748 0.1458  -0.0560 0.2732  310 TRP A CE3 
2292 C CZ2 . TRP A 310 ? 0.8307 0.8101 0.9482 0.1936  -0.0198 0.2758  310 TRP A CZ2 
2293 C CZ3 . TRP A 310 ? 0.8075 0.7669 0.8724 0.1555  -0.0435 0.2583  310 TRP A CZ3 
2294 C CH2 . TRP A 310 ? 0.8233 0.7732 0.9018 0.1783  -0.0259 0.2594  310 TRP A CH2 
2295 N N   . GLY A 311 ? 0.7850 0.9346 0.9478 0.0843  -0.1277 0.3394  311 GLY A N   
2296 C CA  . GLY A 311 ? 0.7958 0.9467 0.9397 0.0625  -0.1517 0.3471  311 GLY A CA  
2297 C C   . GLY A 311 ? 0.8561 0.9649 0.9622 0.0622  -0.1536 0.3361  311 GLY A C   
2298 O O   . GLY A 311 ? 0.8561 0.9384 0.9545 0.0792  -0.1372 0.3240  311 GLY A O   
2299 N N   . GLU A 312 ? 0.8163 0.9170 0.8969 0.0424  -0.1730 0.3399  312 GLU A N   
2300 C CA  . GLU A 312 ? 0.8145 0.8757 0.8589 0.0410  -0.1746 0.3300  312 GLU A CA  
2301 C C   . GLU A 312 ? 0.8468 0.9072 0.9090 0.0608  -0.1738 0.3423  312 GLU A C   
2302 O O   . GLU A 312 ? 0.8492 0.8756 0.8897 0.0693  -0.1655 0.3311  312 GLU A O   
2303 C CB  . GLU A 312 ? 0.8443 0.8937 0.8533 0.0140  -0.1936 0.3298  312 GLU A CB  
2304 C CG  . GLU A 312 ? 0.9695 0.9821 0.9360 0.0030  -0.1857 0.3054  312 GLU A CG  
2305 C CD  . GLU A 312 ? 1.1702 1.1850 1.1155 -0.0221 -0.1954 0.3014  312 GLU A CD  
2306 O OE1 . GLU A 312 ? 1.0992 1.1226 1.0351 -0.0404 -0.2147 0.3140  312 GLU A OE1 
2307 O OE2 . GLU A 312 ? 0.9354 0.9408 0.8709 -0.0239 -0.1840 0.2854  312 GLU A OE2 
2308 N N   . GLU A 313 ? 0.7708 0.8691 0.8742 0.0689  -0.1816 0.3655  313 GLU A N   
2309 C CA  . GLU A 313 ? 0.7629 0.8645 0.8889 0.0898  -0.1806 0.3796  313 GLU A CA  
2310 C C   . GLU A 313 ? 0.7724 0.8620 0.9115 0.1153  -0.1547 0.3688  313 GLU A C   
2311 O O   . GLU A 313 ? 0.7652 0.8265 0.8930 0.1296  -0.1464 0.3639  313 GLU A O   
2312 C CB  . GLU A 313 ? 0.7862 0.9350 0.9560 0.0914  -0.1957 0.4079  313 GLU A CB  
2313 N N   . GLY A 314 ? 0.7074 0.8151 0.8656 0.1189  -0.1421 0.3639  314 GLY A N   
2314 C CA  . GLY A 314 ? 0.6989 0.7944 0.8663 0.1404  -0.1169 0.3524  314 GLY A CA  
2315 C C   . GLY A 314 ? 0.7558 0.8029 0.8805 0.1399  -0.1062 0.3285  314 GLY A C   
2316 O O   . GLY A 314 ? 0.7636 0.7878 0.8865 0.1588  -0.0910 0.3227  314 GLY A O   
2317 N N   . PHE A 315 ? 0.7047 0.7355 0.7945 0.1178  -0.1148 0.3155  315 PHE A N   
2318 C CA  . PHE A 315 ? 0.6985 0.6866 0.7477 0.1136  -0.1073 0.2934  315 PHE A CA  
2319 C C   . PHE A 315 ? 0.7846 0.7472 0.8160 0.1175  -0.1123 0.2953  315 PHE A C   
2320 O O   . PHE A 315 ? 0.7708 0.7028 0.7874 0.1288  -0.0990 0.2832  315 PHE A O   
2321 C CB  . PHE A 315 ? 0.7095 0.6917 0.7305 0.0890  -0.1161 0.2821  315 PHE A CB  
2322 C CG  . PHE A 315 ? 0.7213 0.6626 0.7024 0.0831  -0.1100 0.2605  315 PHE A CG  
2323 C CD1 . PHE A 315 ? 0.7475 0.6701 0.7210 0.0912  -0.0925 0.2431  315 PHE A CD1 
2324 C CD2 . PHE A 315 ? 0.7454 0.6672 0.6964 0.0686  -0.1218 0.2579  315 PHE A CD2 
2325 C CE1 . PHE A 315 ? 0.7540 0.6413 0.6938 0.0859  -0.0876 0.2245  315 PHE A CE1 
2326 C CE2 . PHE A 315 ? 0.7774 0.6637 0.6949 0.0639  -0.1151 0.2388  315 PHE A CE2 
2327 C CZ  . PHE A 315 ? 0.7448 0.6154 0.6584 0.0728  -0.0985 0.2226  315 PHE A CZ  
2328 N N   . MET A 316 ? 0.7885 0.7629 0.8202 0.1073  -0.1317 0.3108  316 MET A N   
2329 C CA  . MET A 316 ? 0.8192 0.7704 0.8332 0.1094  -0.1381 0.3145  316 MET A CA  
2330 C C   . MET A 316 ? 0.8664 0.8147 0.9021 0.1345  -0.1289 0.3238  316 MET A C   
2331 O O   . MET A 316 ? 0.8707 0.7880 0.8854 0.1396  -0.1259 0.3187  316 MET A O   
2332 C CB  . MET A 316 ? 0.8697 0.8291 0.8718 0.0895  -0.1616 0.3273  316 MET A CB  
2333 C CG  . MET A 316 ? 0.9306 0.8542 0.8862 0.0724  -0.1653 0.3123  316 MET A CG  
2334 S SD  . MET A 316 ? 0.9717 0.8821 0.9035 0.0590  -0.1553 0.2880  316 MET A SD  
2335 C CE  . MET A 316 ? 0.9406 0.8056 0.8266 0.0503  -0.1526 0.2713  316 MET A CE  
2336 N N   . ALA A 317 ? 0.8039 0.7829 0.8807 0.1504  -0.1229 0.3367  317 ALA A N   
2337 C CA  . ALA A 317 ? 0.8062 0.7814 0.9045 0.1764  -0.1110 0.3448  317 ALA A CA  
2338 C C   . ALA A 317 ? 0.8516 0.7894 0.9272 0.1856  -0.0899 0.3228  317 ALA A C   
2339 O O   . ALA A 317 ? 0.8460 0.7511 0.8998 0.1912  -0.0863 0.3173  317 ALA A O   
2340 C CB  . ALA A 317 ? 0.8106 0.8265 0.9570 0.1904  -0.1060 0.3606  317 ALA A CB  
2341 N N   . HIS A 318 ? 0.8192 0.7599 0.8950 0.1835  -0.0778 0.3094  318 HIS A N   
2342 C CA  . HIS A 318 ? 0.8273 0.7346 0.8811 0.1896  -0.0589 0.2883  318 HIS A CA  
2343 C C   . HIS A 318 ? 0.8931 0.7614 0.9065 0.1803  -0.0617 0.2744  318 HIS A C   
2344 O O   . HIS A 318 ? 0.8965 0.7349 0.8974 0.1925  -0.0493 0.2667  318 HIS A O   
2345 C CB  . HIS A 318 ? 0.8238 0.7409 0.8777 0.1811  -0.0518 0.2762  318 HIS A CB  
2346 C CG  . HIS A 318 ? 0.8655 0.7491 0.8960 0.1852  -0.0345 0.2550  318 HIS A CG  
2347 N ND1 . HIS A 318 ? 0.9014 0.7642 0.9339 0.2052  -0.0173 0.2522  318 HIS A ND1 
2348 C CD2 . HIS A 318 ? 0.8797 0.7480 0.8849 0.1714  -0.0327 0.2369  318 HIS A CD2 
2349 C CE1 . HIS A 318 ? 0.8926 0.7283 0.9001 0.2017  -0.0066 0.2326  318 HIS A CE1 
2350 N NE2 . HIS A 318 ? 0.8816 0.7207 0.8737 0.1821  -0.0155 0.2232  318 HIS A NE2 
2351 N N   . VAL A 319 ? 0.8517 0.7199 0.8445 0.1588  -0.0776 0.2721  319 VAL A N   
2352 C CA  . VAL A 319 ? 0.8595 0.6927 0.8154 0.1494  -0.0798 0.2597  319 VAL A CA  
2353 C C   . VAL A 319 ? 0.9689 0.7847 0.9207 0.1597  -0.0818 0.2685  319 VAL A C   
2354 O O   . VAL A 319 ? 0.9745 0.7576 0.9060 0.1653  -0.0714 0.2569  319 VAL A O   
2355 C CB  . VAL A 319 ? 0.8942 0.7244 0.8246 0.1251  -0.0918 0.2516  319 VAL A CB  
2356 C CG1 . VAL A 319 ? 0.8732 0.7158 0.8062 0.1171  -0.0875 0.2415  319 VAL A CG1 
2357 C CG2 . VAL A 319 ? 0.9014 0.7491 0.8337 0.1128  -0.1121 0.2683  319 VAL A CG2 
2358 N N   . ASP A 320 ? 0.9520 0.7900 0.9249 0.1636  -0.0943 0.2899  320 ASP A N   
2359 C CA  . ASP A 320 ? 0.9771 0.8004 0.9486 0.1747  -0.0973 0.3011  320 ASP A CA  
2360 C C   . ASP A 320 ? 1.0358 0.8406 1.0149 0.1981  -0.0774 0.2969  320 ASP A C   
2361 O O   . ASP A 320 ? 1.0505 0.8215 1.0071 0.2025  -0.0722 0.2908  320 ASP A O   
2362 C CB  . ASP A 320 ? 1.0123 0.8682 1.0124 0.1772  -0.1136 0.3265  320 ASP A CB  
2363 C CG  . ASP A 320 ? 1.1389 1.0110 1.1297 0.1536  -0.1354 0.3339  320 ASP A CG  
2364 O OD1 . ASP A 320 ? 1.1322 0.9891 1.0924 0.1347  -0.1374 0.3185  320 ASP A OD1 
2365 O OD2 . ASP A 320 ? 1.2011 1.1013 1.2156 0.1539  -0.1503 0.3554  320 ASP A OD2 
2366 N N   . ARG A 321 ? 0.9691 0.7942 0.9774 0.2119  -0.0656 0.2995  321 ARG A N   
2367 C CA  . ARG A 321 ? 0.9632 0.7718 0.9793 0.2341  -0.0448 0.2956  321 ARG A CA  
2368 C C   . ARG A 321 ? 0.9981 0.7647 0.9775 0.2302  -0.0330 0.2730  321 ARG A C   
2369 O O   . ARG A 321 ? 1.0100 0.7464 0.9776 0.2427  -0.0228 0.2703  321 ARG A O   
2370 C CB  . ARG A 321 ? 0.9385 0.7755 0.9864 0.2437  -0.0335 0.2981  321 ARG A CB  
2371 C CG  . ARG A 321 ? 1.0838 0.9653 1.1744 0.2505  -0.0426 0.3217  321 ARG A CG  
2372 C CD  . ARG A 321 ? 1.2514 1.1556 1.3746 0.2652  -0.0262 0.3246  321 ARG A CD  
2373 N NE  . ARG A 321 ? 1.3706 1.2914 1.4928 0.2499  -0.0258 0.3142  321 ARG A NE  
2374 C CZ  . ARG A 321 ? 1.4978 1.4610 1.6520 0.2463  -0.0310 0.3257  321 ARG A CZ  
2375 N NH1 . ARG A 321 ? 1.3384 1.3348 1.5312 0.2572  -0.0371 0.3486  321 ARG A NH1 
2376 N NH2 . ARG A 321 ? 1.2385 1.2115 1.3868 0.2316  -0.0302 0.3148  321 ARG A NH2 
2377 N N   . VAL A 322 ? 0.9247 0.6891 0.8857 0.2120  -0.0352 0.2576  322 VAL A N   
2378 C CA  . VAL A 322 ? 0.9130 0.6420 0.8419 0.2064  -0.0257 0.2367  322 VAL A CA  
2379 C C   . VAL A 322 ? 0.9356 0.6371 0.8350 0.1970  -0.0332 0.2327  322 VAL A C   
2380 O O   . VAL A 322 ? 0.9359 0.6047 0.8162 0.2026  -0.0230 0.2233  322 VAL A O   
2381 C CB  . VAL A 322 ? 0.9455 0.6794 0.8686 0.1956  -0.0208 0.2211  322 VAL A CB  
2382 C CG1 . VAL A 322 ? 0.9255 0.6822 0.8474 0.1757  -0.0364 0.2221  322 VAL A CG1 
2383 C CG2 . VAL A 322 ? 0.9452 0.6429 0.8385 0.1922  -0.0107 0.2013  322 VAL A CG2 
2384 N N   . ILE A 323 ? 0.8694 0.5827 0.7645 0.1832  -0.0506 0.2409  323 ILE A N   
2385 C CA  . ILE A 323 ? 0.8726 0.5599 0.7392 0.1737  -0.0572 0.2380  323 ILE A CA  
2386 C C   . ILE A 323 ? 0.9379 0.6037 0.8031 0.1899  -0.0521 0.2458  323 ILE A C   
2387 O O   . ILE A 323 ? 0.9368 0.5699 0.7761 0.1876  -0.0471 0.2361  323 ILE A O   
2388 C CB  . ILE A 323 ? 0.9105 0.6104 0.7688 0.1554  -0.0760 0.2457  323 ILE A CB  
2389 C CG1 . ILE A 323 ? 0.9057 0.6317 0.7708 0.1415  -0.0826 0.2430  323 ILE A CG1 
2390 C CG2 . ILE A 323 ? 0.9169 0.5857 0.7403 0.1426  -0.0779 0.2353  323 ILE A CG2 
2391 C CD1 . ILE A 323 ? 1.0641 0.8139 0.9347 0.1289  -0.1021 0.2588  323 ILE A CD1 
2392 N N   . ASP A 324 ? 0.9033 0.5868 0.7963 0.2062  -0.0529 0.2635  324 ASP A N   
2393 C CA  . ASP A 324 ? 0.9288 0.5903 0.8201 0.2227  -0.0477 0.2716  324 ASP A CA  
2394 C C   . ASP A 324 ? 0.9795 0.6141 0.8649 0.2379  -0.0271 0.2607  324 ASP A C   
2395 O O   . ASP A 324 ? 1.0134 0.6204 0.8882 0.2491  -0.0214 0.2635  324 ASP A O   
2396 C CB  . ASP A 324 ? 0.9703 0.6541 0.8879 0.2334  -0.0588 0.2960  324 ASP A CB  
2397 C CG  . ASP A 324 ? 1.0911 0.8069 1.0497 0.2508  -0.0532 0.3087  324 ASP A CG  
2398 O OD1 . ASP A 324 ? 1.0984 0.8276 1.0797 0.2639  -0.0590 0.3285  324 ASP A OD1 
2399 O OD2 . ASP A 324 ? 1.1724 0.9004 1.1409 0.2511  -0.0433 0.2993  324 ASP A OD2 
2400 N N   . PHE A 325 ? 0.8935 0.5313 0.7804 0.2363  -0.0164 0.2471  325 PHE A N   
2401 C CA  . PHE A 325 ? 0.8895 0.4972 0.7643 0.2474  0.0024  0.2350  325 PHE A CA  
2402 C C   . PHE A 325 ? 0.9345 0.5074 0.7722 0.2337  0.0025  0.2193  325 PHE A C   
2403 O O   . PHE A 325 ? 0.9534 0.4941 0.7738 0.2406  0.0087  0.2181  325 PHE A O   
2404 C CB  . PHE A 325 ? 0.8868 0.5084 0.7744 0.2499  0.0135  0.2265  325 PHE A CB  
2405 C CG  . PHE A 325 ? 0.9048 0.4916 0.7711 0.2544  0.0305  0.2103  325 PHE A CG  
2406 C CD1 . PHE A 325 ? 0.9536 0.5190 0.8210 0.2741  0.0459  0.2135  325 PHE A CD1 
2407 C CD2 . PHE A 325 ? 0.9200 0.4937 0.7637 0.2386  0.0310  0.1924  325 PHE A CD2 
2408 C CE1 . PHE A 325 ? 0.9727 0.5028 0.8164 0.2765  0.0609  0.1987  325 PHE A CE1 
2409 C CE2 . PHE A 325 ? 0.9628 0.5038 0.7856 0.2413  0.0450  0.1784  325 PHE A CE2 
2410 C CZ  . PHE A 325 ? 0.9525 0.4711 0.7741 0.2595  0.0596  0.1815  325 PHE A CZ  
2411 N N   . TYR A 326 ? 0.8626 0.4427 0.6891 0.2143  -0.0045 0.2081  326 TYR A N   
2412 C CA  . TYR A 326 ? 0.8614 0.4159 0.6575 0.1992  -0.0053 0.1934  326 TYR A CA  
2413 C C   . TYR A 326 ? 0.9198 0.4581 0.6992 0.1941  -0.0141 0.1998  326 TYR A C   
2414 O O   . TYR A 326 ? 0.9179 0.4288 0.6719 0.1858  -0.0115 0.1892  326 TYR A O   
2415 C CB  . TYR A 326 ? 0.8604 0.4325 0.6541 0.1813  -0.0120 0.1836  326 TYR A CB  
2416 C CG  . TYR A 326 ? 0.8965 0.4732 0.6957 0.1827  -0.0022 0.1723  326 TYR A CG  
2417 C CD1 . TYR A 326 ? 0.9294 0.4830 0.7084 0.1760  0.0049  0.1555  326 TYR A CD1 
2418 C CD2 . TYR A 326 ? 0.9027 0.5078 0.7273 0.1894  -0.0010 0.1786  326 TYR A CD2 
2419 C CE1 . TYR A 326 ? 0.9308 0.4876 0.7129 0.1760  0.0125  0.1453  326 TYR A CE1 
2420 C CE2 . TYR A 326 ? 0.9068 0.5148 0.7342 0.1895  0.0078  0.1681  326 TYR A CE2 
2421 C CZ  . TYR A 326 ? 1.0007 0.5837 0.8059 0.1828  0.0143  0.1514  326 TYR A CZ  
2422 O OH  . TYR A 326 ? 0.9647 0.5491 0.7711 0.1824  0.0220  0.1416  326 TYR A OH  
2423 N N   . SER A 327 ? 0.8767 0.4327 0.6704 0.1978  -0.0252 0.2175  327 SER A N   
2424 C CA  . SER A 327 ? 0.8851 0.4266 0.6638 0.1937  -0.0346 0.2261  327 SER A CA  
2425 C C   . SER A 327 ? 0.9412 0.4487 0.7083 0.2081  -0.0237 0.2266  327 SER A C   
2426 O O   . SER A 327 ? 0.9392 0.4173 0.6794 0.2006  -0.0228 0.2200  327 SER A O   
2427 C CB  . SER A 327 ? 0.9132 0.4829 0.7126 0.1960  -0.0491 0.2463  327 SER A CB  
2428 O OG  . SER A 327 ? 0.9635 0.5316 0.7453 0.1786  -0.0634 0.2492  327 SER A OG  
2429 N N   . ASN A 328 ? 0.8982 0.4084 0.6847 0.2283  -0.0136 0.2329  328 ASN A N   
2430 C CA  . ASN A 328 ? 0.9188 0.3957 0.6951 0.2441  -0.0007 0.2329  328 ASN A CA  
2431 C C   . ASN A 328 ? 0.9478 0.3950 0.6988 0.2376  0.0114  0.2131  328 ASN A C   
2432 O O   . ASN A 328 ? 0.9693 0.3810 0.6967 0.2391  0.0170  0.2094  328 ASN A O   
2433 C CB  . ASN A 328 ? 0.9633 0.4536 0.7686 0.2671  0.0082  0.2445  328 ASN A CB  
2434 C CG  . ASN A 328 ? 1.3677 0.8887 1.2007 0.2741  -0.0047 0.2661  328 ASN A CG  
2435 O OD1 . ASN A 328 ? 1.2800 0.8340 1.1451 0.2828  -0.0043 0.2747  328 ASN A OD1 
2436 N ND2 . ASN A 328 ? 1.3185 0.8298 1.1398 0.2696  -0.0170 0.2757  328 ASN A ND2 
2437 N N   . GLN A 329 ? 0.8737 0.3348 0.6283 0.2289  0.0141  0.2007  329 GLN A N   
2438 C CA  . GLN A 329 ? 0.8625 0.2989 0.5944 0.2205  0.0232  0.1822  329 GLN A CA  
2439 C C   . GLN A 329 ? 0.8919 0.3109 0.5981 0.2024  0.0159  0.1750  329 GLN A C   
2440 O O   . GLN A 329 ? 0.8918 0.2785 0.5748 0.1996  0.0229  0.1660  329 GLN A O   
2441 C CB  . GLN A 329 ? 0.8491 0.3073 0.5925 0.2147  0.0255  0.1724  329 GLN A CB  
2442 C CG  . GLN A 329 ? 0.9168 0.3872 0.6819 0.2316  0.0362  0.1766  329 GLN A CG  
2443 C CD  . GLN A 329 ? 1.0339 0.4700 0.7846 0.2433  0.0530  0.1700  329 GLN A CD  
2444 O OE1 . GLN A 329 ? 0.9591 0.3888 0.7197 0.2621  0.0625  0.1792  329 GLN A OE1 
2445 N NE2 . GLN A 329 ? 0.8966 0.3094 0.6236 0.2325  0.0574  0.1541  329 GLN A NE2 
2446 N N   . LYS A 330 ? 0.8367 0.2763 0.5463 0.1902  0.0023  0.1799  330 LYS A N   
2447 C CA  . LYS A 330 ? 0.8394 0.2659 0.5266 0.1731  -0.0047 0.1752  330 LYS A CA  
2448 C C   . LYS A 330 ? 0.8904 0.2877 0.5615 0.1794  -0.0038 0.1830  330 LYS A C   
2449 O O   . LYS A 330 ? 0.8987 0.2671 0.5458 0.1720  0.0006  0.1743  330 LYS A O   
2450 C CB  . LYS A 330 ? 0.8637 0.3183 0.5583 0.1606  -0.0187 0.1809  330 LYS A CB  
2451 C CG  . LYS A 330 ? 1.0394 0.4804 0.7121 0.1464  -0.0267 0.1823  330 LYS A CG  
2452 C CD  . LYS A 330 ? 1.1401 0.6041 0.8197 0.1396  -0.0414 0.1949  330 LYS A CD  
2453 C CE  . LYS A 330 ? 1.1640 0.6295 0.8531 0.1528  -0.0478 0.2140  330 LYS A CE  
2454 N NZ  . LYS A 330 ? 1.0933 0.5902 0.7990 0.1493  -0.0619 0.2272  330 LYS A NZ  
2455 N N   . ASP A 331 ? 0.8154 0.2204 0.5008 0.1934  -0.0081 0.2002  331 ASP A N   
2456 C CA  . ASP A 331 ? 0.8192 0.2023 0.4929 0.2009  -0.0070 0.2076  331 ASP A CA  
2457 C C   . ASP A 331 ? 0.8711 0.2133 0.5261 0.2090  0.0073  0.2000  331 ASP A C   
2458 O O   . ASP A 331 ? 0.8998 0.2126 0.5282 0.2003  0.0084  0.1947  331 ASP A O   
2459 C CB  . ASP A 331 ? 0.8406 0.2358 0.5384 0.2207  -0.0119 0.2298  331 ASP A CB  
2460 C CG  . ASP A 331 ? 0.8639 0.2934 0.5788 0.2142  -0.0287 0.2429  331 ASP A CG  
2461 O OD1 . ASP A 331 ? 0.8545 0.2820 0.5520 0.1962  -0.0391 0.2413  331 ASP A OD1 
2462 O OD2 . ASP A 331 ? 0.8670 0.3241 0.6118 0.2270  -0.0314 0.2556  331 ASP A OD2 
2463 N N   . ALA A 332 ? 0.8043 0.1770 0.4747 0.2134  0.0221  0.1836  332 ALA A N   
2464 C CA  . ALA A 332 ? 0.8205 0.1635 0.4734 0.2192  0.0373  0.1733  332 ALA A CA  
2465 C C   . ALA A 332 ? 0.8763 0.1627 0.4984 0.2104  0.0361  0.1700  332 ALA A C   
2466 O O   . ALA A 332 ? 0.8877 0.1523 0.4861 0.2066  0.0423  0.1626  332 ALA A O   
2467 C CB  . ALA A 332 ? 0.8166 0.1678 0.4873 0.2323  0.0472  0.1730  332 ALA A CB  
2468 N N   . ILE A 333 ? 0.8344 0.1514 0.4613 0.1929  0.0335  0.1548  333 ILE A N   
2469 C CA  . ILE A 333 ? 0.8421 0.1388 0.4471 0.1765  0.0345  0.1411  333 ILE A CA  
2470 C C   . ILE A 333 ? 0.9347 0.2064 0.5191 0.1662  0.0277  0.1457  333 ILE A C   
2471 O O   . ILE A 333 ? 0.9574 0.1999 0.5186 0.1581  0.0322  0.1378  333 ILE A O   
2472 C CB  . ILE A 333 ? 0.8423 0.1577 0.4585 0.1667  0.0308  0.1337  333 ILE A CB  
2473 C CG1 . ILE A 333 ? 0.8395 0.1370 0.4367 0.1515  0.0336  0.1188  333 ILE A CG1 
2474 C CG2 . ILE A 333 ? 0.8387 0.1862 0.4687 0.1581  0.0187  0.1390  333 ILE A CG2 
2475 C CD1 . ILE A 333 ? 0.9536 0.2641 0.5592 0.1477  0.0364  0.1078  333 ILE A CD1 
2476 N N   . LEU A 334 ? 0.8795 0.1693 0.4719 0.1641  0.0173  0.1562  334 LEU A N   
2477 C CA  . LEU A 334 ? 0.8951 0.1706 0.4686 0.1526  0.0112  0.1590  334 LEU A CA  
2478 C C   . LEU A 334 ? 1.0116 0.2507 0.5673 0.1633  0.0163  0.1660  334 LEU A C   
2479 O O   . LEU A 334 ? 1.0250 0.2352 0.5558 0.1537  0.0192  0.1604  334 LEU A O   
2480 C CB  . LEU A 334 ? 0.8834 0.1866 0.4698 0.1494  -0.0012 0.1698  334 LEU A CB  
2481 C CG  . LEU A 334 ? 0.9201 0.2430 0.5057 0.1301  -0.0081 0.1630  334 LEU A CG  
2482 C CD1 . LEU A 334 ? 0.9038 0.2279 0.4874 0.1200  -0.0018 0.1464  334 LEU A CD1 
2483 C CD2 . LEU A 334 ? 0.9343 0.2916 0.5414 0.1318  -0.0174 0.1713  334 LEU A CD2 
2484 N N   . ALA A 335 ? 0.9946 0.2344 0.5635 0.1835  0.0188  0.1776  335 ALA A N   
2485 C CA  . ALA A 335 ? 1.0374 0.2424 0.5913 0.1969  0.0250  0.1851  335 ALA A CA  
2486 C C   . ALA A 335 ? 1.1120 0.2802 0.6418 0.1948  0.0375  0.1723  335 ALA A C   
2487 O O   . ALA A 335 ? 1.1503 0.2814 0.6582 0.2003  0.0428  0.1754  335 ALA A O   
2488 C CB  . ALA A 335 ? 1.0537 0.2712 0.6317 0.2203  0.0274  0.1987  335 ALA A CB  
2489 N N   . ALA A 336 ? 1.0366 0.2142 0.5690 0.1855  0.0412  0.1583  336 ALA A N   
2490 C CA  . ALA A 336 ? 1.0453 0.1925 0.5561 0.1802  0.0510  0.1455  336 ALA A CA  
2491 C C   . ALA A 336 ? 1.0648 0.2034 0.5569 0.1573  0.0465  0.1360  336 ALA A C   
2492 O O   . ALA A 336 ? 1.0600 0.1632 0.5254 0.1512  0.0507  0.1323  336 ALA A O   
2493 C CB  . ALA A 336 ? 1.0337 0.1974 0.5595 0.1838  0.0568  0.1371  336 ALA A CB  
2494 N N   . ALA A 337 ? 1.0060 0.1773 0.5124 0.1445  0.0383  0.1324  337 ALA A N   
2495 C CA  . ALA A 337 ? 0.9967 0.1672 0.4914 0.1231  0.0343  0.1241  337 ALA A CA  
2496 C C   . ALA A 337 ? 1.0645 0.2089 0.5366 0.1181  0.0322  0.1307  337 ALA A C   
2497 O O   . ALA A 337 ? 1.0708 0.1915 0.5218 0.1053  0.0349  0.1240  337 ALA A O   
2498 C CB  . ALA A 337 ? 0.9660 0.1759 0.4810 0.1142  0.0264  0.1224  337 ALA A CB  
2499 N N   . ASP A 338 ? 1.0183 0.1653 0.4946 0.1288  0.0274  0.1445  338 ASP A N   
2500 C CA  . ASP A 338 ? 1.0472 0.1689 0.5022 0.1261  0.0246  0.1526  338 ASP A CA  
2501 C C   . ASP A 338 ? 1.1158 0.1933 0.5445 0.1289  0.0335  0.1500  338 ASP A C   
2502 O O   . ASP A 338 ? 1.1330 0.1871 0.5379 0.1146  0.0338  0.1464  338 ASP A O   
2503 C CB  . ASP A 338 ? 1.0897 0.2215 0.5566 0.1411  0.0179  0.1693  338 ASP A CB  
2504 C CG  . ASP A 338 ? 1.3084 0.4785 0.7948 0.1356  0.0069  0.1744  338 ASP A CG  
2505 O OD1 . ASP A 338 ? 1.2995 0.4893 0.7907 0.1204  0.0053  0.1642  338 ASP A OD1 
2506 O OD2 . ASP A 338 ? 1.4344 0.6141 0.9309 0.1463  -0.0003 0.1889  338 ASP A OD2 
2507 N N   . LYS A 339 ? 1.0585 0.1239 0.4905 0.1465  0.0415  0.1512  339 LYS A N   
2508 C CA  . LYS A 339 ? 1.0791 0.1071 0.4857 0.1507  0.0519  0.1462  339 LYS A CA  
2509 C C   . LYS A 339 ? 1.1058 0.1114 0.4939 0.1329  0.0554  0.1335  339 LYS A C   
2510 O O   . LYS A 339 ? 1.1054 0.0900 0.4672 0.1204  0.0566  0.1287  339 LYS A O   
2511 C CB  . LYS A 339 ? 1.1048 0.1225 0.5226 0.1747  0.0603  0.1523  339 LYS A CB  
2512 C CG  . LYS A 339 ? 1.1403 0.1100 0.5304 0.1820  0.0727  0.1491  339 LYS A CG  
2513 C CD  . LYS A 339 ? 1.1884 0.1570 0.5927 0.2076  0.0820  0.1559  339 LYS A CD  
2514 C CE  . LYS A 339 ? 1.2156 0.1331 0.5905 0.2171  0.0958  0.1538  339 LYS A CE  
2515 N NZ  . LYS A 339 ? 1.2263 0.1458 0.6130 0.2336  0.1076  0.1515  339 LYS A NZ  
2516 N N   . TRP A 340 ? 1.0484 0.0914 0.4528 0.1270  0.0571  0.1194  340 TRP A N   
2517 C CA  . TRP A 340 ? 1.0531 0.0827 0.4427 0.1102  0.0595  0.1067  340 TRP A CA  
2518 C C   . TRP A 340 ? 1.0641 0.0994 0.4568 0.0890  0.0522  0.1035  340 TRP A C   
2519 O O   . TRP A 340 ? 1.0763 0.0908 0.4496 0.0734  0.0536  0.0966  340 TRP A O   
2520 C CB  . TRP A 340 ? 1.0341 0.0750 0.4290 0.1155  0.0663  0.0968  340 TRP A CB  
2521 C CG  . TRP A 340 ? 1.0787 0.0841 0.4637 0.1368  0.0760  0.1044  340 TRP A CG  
2522 C CD1 . TRP A 340 ? 1.1093 0.1130 0.5152 0.1595  0.0788  0.1159  340 TRP A CD1 
2523 C CD2 . TRP A 340 ? 1.1212 0.0823 0.4727 0.1385  0.0846  0.1027  340 TRP A CD2 
2524 N NE1 . TRP A 340 ? 1.1366 0.1041 0.5258 0.1757  0.0900  0.1196  340 TRP A NE1 
2525 C CE2 . TRP A 340 ? 1.1826 0.1064 0.5362 0.1650  0.0934  0.1148  340 TRP A CE2 
2526 C CE3 . TRP A 340 ? 1.1583 0.0770 0.4766 0.1234  0.0855  0.0984  340 TRP A CE3 
2527 C CZ2 . TRP A 340 ? 1.2096 0.0949 0.5331 0.1722  0.1049  0.1131  340 TRP A CZ2 
2528 C CZ3 . TRP A 340 ? 1.2138 0.0790 0.5005 0.1310  0.0953  0.1000  340 TRP A CZ3 
2529 C CH2 . TRP A 340 ? 1.2371 0.0868 0.5259 0.1553  0.1053  0.1066  340 TRP A CH2 
2530 N N   . LEU A 341 ? 0.9714 0.0737 0.3898 0.0845  0.0460  0.0977  341 LEU A N   
2531 C CA  . LEU A 341 ? 0.9480 0.0691 0.3706 0.0648  0.0411  0.0912  341 LEU A CA  
2532 C C   . LEU A 341 ? 1.0064 0.0884 0.4124 0.0572  0.0375  0.1049  341 LEU A C   
2533 O O   . LEU A 341 ? 0.9576 0.0743 0.3711 0.0427  0.0341  0.0975  341 LEU A O   
2534 C CB  . LEU A 341 ? 0.9075 0.0708 0.3591 0.0635  0.0368  0.0876  341 LEU A CB  
2535 C CG  . LEU A 341 ? 0.9483 0.0960 0.4113 0.0685  0.0388  0.0867  341 LEU A CG  
2536 C CD1 . LEU A 341 ? 0.9761 0.0934 0.4195 0.0624  0.0440  0.0794  341 LEU A CD1 
2537 C CD2 . LEU A 341 ? 0.9676 0.1251 0.4445 0.0880  0.0404  0.0924  341 LEU A CD2 
2538 N N   . THR A 342 ? 1.0350 0.0925 0.4203 0.0645  0.0399  0.1100  342 THR A N   
2539 C CA  . THR A 342 ? 1.0759 0.1010 0.4382 0.0594  0.0380  0.1198  342 THR A CA  
2540 C C   . THR A 342 ? 1.1102 0.1510 0.4732 0.0399  0.0340  0.1171  342 THR A C   
2541 O O   . THR A 342 ? 1.1140 0.1631 0.4777 0.0402  0.0289  0.1251  342 THR A O   
2542 C CB  . THR A 342 ? 1.2744 0.2505 0.6047 0.0578  0.0445  0.1188  342 THR A CB  
2543 O OG1 . THR A 342 ? 1.3216 0.2855 0.6523 0.0710  0.0506  0.1159  342 THR A OG1 
2544 C CG2 . THR A 342 ? 1.2227 0.1666 0.5292 0.0630  0.0437  0.1303  342 THR A CG2 
2545 N N   . GLY A 343 ? 1.0553 0.0995 0.4174 0.0231  0.0365  0.1063  343 GLY A N   
2546 C CA  . GLY A 343 ? 1.0422 0.1036 0.4080 0.0037  0.0354  0.1012  343 GLY A CA  
2547 C C   . GLY A 343 ? 1.0799 0.1529 0.4559 -0.0080 0.0381  0.0894  343 GLY A C   
2548 O O   . GLY A 343 ? 1.0905 0.1609 0.4602 -0.0259 0.0400  0.0845  343 GLY A O   
2549 N N   . LEU A 344 ? 0.9851 0.0705 0.3768 0.0020  0.0382  0.0853  344 LEU A N   
2550 C CA  . LEU A 344 ? 0.9592 0.0598 0.3609 -0.0067 0.0394  0.0739  344 LEU A CA  
2551 C C   . LEU A 344 ? 0.9929 0.1290 0.4235 -0.0065 0.0367  0.0712  344 LEU A C   
2552 O O   . LEU A 344 ? 0.9754 0.1267 0.4189 -0.0149 0.0366  0.0631  344 LEU A O   
2553 C CB  . LEU A 344 ? 0.9714 0.0566 0.3660 0.0047  0.0418  0.0715  344 LEU A CB  
2554 C CG  . LEU A 344 ? 1.0820 0.1124 0.4446 0.0023  0.0456  0.0750  344 LEU A CG  
2555 C CD1 . LEU A 344 ? 1.1258 0.1329 0.4741 0.0188  0.0476  0.0850  344 LEU A CD1 
2556 C CD2 . LEU A 344 ? 1.1346 0.1504 0.4913 0.0045  0.0481  0.0689  344 LEU A CD2 
2557 N N   . ALA A 345 ? 0.9461 0.0995 0.3870 0.0034  0.0339  0.0773  345 ALA A N   
2558 C CA  . ALA A 345 ? 0.9147 0.1049 0.3808 0.0046  0.0312  0.0744  345 ALA A CA  
2559 C C   . ALA A 345 ? 0.9707 0.1739 0.4398 0.0085  0.0276  0.0822  345 ALA A C   
2560 O O   . ALA A 345 ? 0.9990 0.1835 0.4523 0.0125  0.0264  0.0908  345 ALA A O   
2561 C CB  . ALA A 345 ? 0.9079 0.1088 0.3886 0.0170  0.0307  0.0716  345 ALA A CB  
2562 N N   . GLU A 346 ? 0.8979 0.1319 0.3860 0.0069  0.0253  0.0794  346 GLU A N   
2563 C CA  . GLU A 346 ? 0.8875 0.1356 0.3783 0.0087  0.0210  0.0862  346 GLU A CA  
2564 C C   . GLU A 346 ? 0.9170 0.1907 0.4282 0.0198  0.0170  0.0872  346 GLU A C   
2565 O O   . GLU A 346 ? 0.8831 0.1715 0.4094 0.0206  0.0184  0.0795  346 GLU A O   
2566 C CB  . GLU A 346 ? 0.8961 0.1525 0.3841 -0.0075 0.0230  0.0824  346 GLU A CB  
2567 C CG  . GLU A 346 ? 1.0392 0.2715 0.5032 -0.0152 0.0238  0.0883  346 GLU A CG  
2568 C CD  . GLU A 346 ? 1.2785 0.5088 0.7360 -0.0332 0.0299  0.0822  346 GLU A CD  
2569 O OE1 . GLU A 346 ? 1.2843 0.4959 0.7212 -0.0410 0.0309  0.0869  346 GLU A OE1 
2570 O OE2 . GLU A 346 ? 1.0772 0.3242 0.5504 -0.0395 0.0338  0.0730  346 GLU A OE2 
2571 N N   . TRP A 347 ? 0.8847 0.1632 0.3958 0.0278  0.0114  0.0974  347 TRP A N   
2572 C CA  . TRP A 347 ? 0.8749 0.1780 0.4047 0.0375  0.0068  0.1003  347 TRP A CA  
2573 C C   . TRP A 347 ? 0.9736 0.2864 0.5019 0.0381  -0.0007 0.1107  347 TRP A C   
2574 O O   . TRP A 347 ? 0.9805 0.2769 0.4936 0.0379  -0.0035 0.1195  347 TRP A O   
2575 C CB  . TRP A 347 ? 0.8613 0.1613 0.4000 0.0537  0.0081  0.1023  347 TRP A CB  
2576 C CG  . TRP A 347 ? 0.9090 0.1872 0.4365 0.0645  0.0076  0.1130  347 TRP A CG  
2577 C CD1 . TRP A 347 ? 0.9537 0.2385 0.4876 0.0765  0.0021  0.1254  347 TRP A CD1 
2578 C CD2 . TRP A 347 ? 0.9382 0.1835 0.4459 0.0642  0.0125  0.1129  347 TRP A CD2 
2579 N NE1 . TRP A 347 ? 0.9819 0.2399 0.5023 0.0853  0.0039  0.1332  347 TRP A NE1 
2580 C CE2 . TRP A 347 ? 1.0134 0.2453 0.5160 0.0778  0.0104  0.1253  347 TRP A CE2 
2581 C CE3 . TRP A 347 ? 0.9625 0.1883 0.4565 0.0535  0.0181  0.1039  347 TRP A CE3 
2582 C CZ2 . TRP A 347 ? 1.0360 0.2333 0.5181 0.0814  0.0146  0.1284  347 TRP A CZ2 
2583 C CZ3 . TRP A 347 ? 1.0143 0.2066 0.4876 0.0556  0.0216  0.1069  347 TRP A CZ3 
2584 C CH2 . TRP A 347 ? 1.0476 0.2245 0.5141 0.0699  0.0203  0.1187  347 TRP A CH2 
2585 N N   . HIS A 348 ? 0.9659 0.3047 0.5091 0.0382  -0.0046 0.1100  348 HIS A N   
2586 C CA  . HIS A 348 ? 0.9836 0.3356 0.5275 0.0377  -0.0131 0.1195  348 HIS A CA  
2587 C C   . HIS A 348 ? 0.9940 0.3583 0.5546 0.0541  -0.0180 0.1286  348 HIS A C   
2588 O O   . HIS A 348 ? 0.9799 0.3524 0.5553 0.0623  -0.0140 0.1233  348 HIS A O   
2589 C CB  . HIS A 348 ? 0.9950 0.3670 0.5444 0.0270  -0.0136 0.1122  348 HIS A CB  
2590 C CG  . HIS A 348 ? 1.0719 0.4343 0.6036 0.0109  -0.0106 0.1082  348 HIS A CG  
2591 N ND1 . HIS A 348 ? 1.1299 0.4817 0.6431 0.0044  -0.0158 0.1172  348 HIS A ND1 
2592 C CD2 . HIS A 348 ? 1.1043 0.4668 0.6347 0.0002  -0.0028 0.0965  348 HIS A CD2 
2593 C CE1 . HIS A 348 ? 1.1383 0.4824 0.6380 -0.0100 -0.0097 0.1101  348 HIS A CE1 
2594 N NE2 . HIS A 348 ? 1.1247 0.4762 0.6358 -0.0126 -0.0015 0.0978  348 HIS A NE2 
2595 N N   . VAL A 349 ? 0.9328 0.2989 0.4917 0.0587  -0.0265 0.1426  349 VAL A N   
2596 C CA  . VAL A 349 ? 0.9177 0.2988 0.4958 0.0745  -0.0312 0.1529  349 VAL A CA  
2597 C C   . VAL A 349 ? 0.9716 0.3828 0.5680 0.0726  -0.0339 0.1490  349 VAL A C   
2598 O O   . VAL A 349 ? 0.9655 0.3875 0.5571 0.0608  -0.0400 0.1497  349 VAL A O   
2599 C CB  . VAL A 349 ? 0.9679 0.3460 0.5418 0.0791  -0.0410 0.1701  349 VAL A CB  
2600 C CG1 . VAL A 349 ? 0.9537 0.3464 0.5506 0.0978  -0.0439 0.1813  349 VAL A CG1 
2601 C CG2 . VAL A 349 ? 0.9942 0.3403 0.5454 0.0776  -0.0387 0.1729  349 VAL A CG2 
2602 N N   . PRO A 350 ? 0.9367 0.3585 0.5508 0.0825  -0.0286 0.1437  350 PRO A N   
2603 C CA  . PRO A 350 ? 0.9130 0.3614 0.5426 0.0798  -0.0309 0.1394  350 PRO A CA  
2604 C C   . PRO A 350 ? 0.9688 0.4387 0.6074 0.0796  -0.0421 0.1521  350 PRO A C   
2605 O O   . PRO A 350 ? 0.9746 0.4498 0.6240 0.0915  -0.0465 0.1653  350 PRO A O   
2606 C CB  . PRO A 350 ? 0.9268 0.3781 0.5716 0.0927  -0.0234 0.1348  350 PRO A CB  
2607 C CG  . PRO A 350 ? 1.0088 0.4408 0.6504 0.1057  -0.0198 0.1421  350 PRO A CG  
2608 C CD  . PRO A 350 ? 0.9739 0.3823 0.5926 0.0962  -0.0202 0.1417  350 PRO A CD  
2609 N N   . ALA A 351 ? 0.9192 0.4003 0.5525 0.0656  -0.0469 0.1485  351 ALA A N   
2610 C CA  . ALA A 351 ? 0.9215 0.4209 0.5583 0.0608  -0.0588 0.1596  351 ALA A CA  
2611 C C   . ALA A 351 ? 0.9889 0.5144 0.6512 0.0708  -0.0618 0.1652  351 ALA A C   
2612 O O   . ALA A 351 ? 1.0002 0.5389 0.6735 0.0765  -0.0707 0.1801  351 ALA A O   
2613 C CB  . ALA A 351 ? 0.9241 0.4244 0.5453 0.0428  -0.0608 0.1522  351 ALA A CB  
2614 N N   . ALA A 352 ? 0.9480 0.4809 0.6202 0.0730  -0.0544 0.1537  352 ALA A N   
2615 C CA  . ALA A 352 ? 0.9324 0.4891 0.6275 0.0810  -0.0549 0.1561  352 ALA A CA  
2616 C C   . ALA A 352 ? 0.9537 0.5045 0.6541 0.0873  -0.0431 0.1428  352 ALA A C   
2617 O O   . ALA A 352 ? 0.9417 0.4723 0.6287 0.0839  -0.0361 0.1321  352 ALA A O   
2618 C CB  . ALA A 352 ? 0.9339 0.5097 0.6290 0.0681  -0.0630 0.1559  352 ALA A CB  
2619 N N   . GLY A 353 ? 0.8967 0.4655 0.6165 0.0956  -0.0414 0.1440  353 GLY A N   
2620 C CA  . GLY A 353 ? 0.8783 0.4423 0.6024 0.1008  -0.0313 0.1322  353 GLY A CA  
2621 C C   . GLY A 353 ? 0.9186 0.4662 0.6451 0.1155  -0.0222 0.1331  353 GLY A C   
2622 O O   . GLY A 353 ? 0.9155 0.4646 0.6505 0.1267  -0.0231 0.1454  353 GLY A O   
2623 N N   . MET A 354 ? 0.8649 0.3953 0.5826 0.1149  -0.0136 0.1201  354 MET A N   
2624 C CA  . MET A 354 ? 0.8726 0.3834 0.5883 0.1269  -0.0036 0.1181  354 MET A CA  
2625 C C   . MET A 354 ? 0.8698 0.3523 0.5658 0.1213  0.0019  0.1071  354 MET A C   
2626 O O   . MET A 354 ? 0.8579 0.3224 0.5492 0.1287  0.0104  0.1028  354 MET A O   
2627 C CB  . MET A 354 ? 0.9036 0.4254 0.6332 0.1349  0.0024  0.1151  354 MET A CB  
2628 C CG  . MET A 354 ? 0.9433 0.4728 0.6714 0.1241  0.0017  0.1029  354 MET A CG  
2629 S SD  . MET A 354 ? 1.0060 0.5412 0.7449 0.1327  0.0100  0.0982  354 MET A SD  
2630 C CE  . MET A 354 ? 0.9650 0.5305 0.7282 0.1418  0.0064  0.1139  354 MET A CE  
2631 N N   . PHE A 355 ? 0.7967 0.2747 0.4807 0.1078  -0.0024 0.1028  355 PHE A N   
2632 C CA  . PHE A 355 ? 0.7930 0.2470 0.4606 0.1013  0.0024  0.0932  355 PHE A CA  
2633 C C   . PHE A 355 ? 0.8952 0.3317 0.5478 0.0969  0.0010  0.0974  355 PHE A C   
2634 O O   . PHE A 355 ? 0.9254 0.3706 0.5769 0.0923  -0.0056 0.1045  355 PHE A O   
2635 C CB  . PHE A 355 ? 0.7841 0.2446 0.4510 0.0890  0.0020  0.0809  355 PHE A CB  
2636 C CG  . PHE A 355 ? 0.7802 0.2555 0.4593 0.0919  0.0030  0.0760  355 PHE A CG  
2637 C CD1 . PHE A 355 ? 0.8081 0.2730 0.4879 0.1003  0.0094  0.0727  355 PHE A CD1 
2638 C CD2 . PHE A 355 ? 0.7813 0.2785 0.4686 0.0855  -0.0021 0.0745  355 PHE A CD2 
2639 C CE1 . PHE A 355 ? 0.8033 0.2805 0.4924 0.1023  0.0105  0.0683  355 PHE A CE1 
2640 C CE2 . PHE A 355 ? 0.7911 0.3006 0.4882 0.0876  -0.0013 0.0702  355 PHE A CE2 
2641 C CZ  . PHE A 355 ? 0.7717 0.2717 0.4700 0.0959  0.0049  0.0671  355 PHE A CZ  
2642 N N   . LEU A 356 ? 0.8352 0.2453 0.4742 0.0976  0.0071  0.0932  356 LEU A N   
2643 C CA  . LEU A 356 ? 0.8314 0.2211 0.4532 0.0915  0.0070  0.0951  356 LEU A CA  
2644 C C   . LEU A 356 ? 0.8472 0.2291 0.4608 0.0779  0.0097  0.0828  356 LEU A C   
2645 O O   . LEU A 356 ? 0.8275 0.2022 0.4411 0.0785  0.0140  0.0749  356 LEU A O   
2646 C CB  . LEU A 356 ? 0.8573 0.2215 0.4691 0.1027  0.0116  0.1014  356 LEU A CB  
2647 C CG  . LEU A 356 ? 0.9410 0.2795 0.5319 0.0955  0.0123  0.1024  356 LEU A CG  
2648 C CD1 . LEU A 356 ? 0.9432 0.2878 0.5310 0.0918  0.0051  0.1121  356 LEU A CD1 
2649 C CD2 . LEU A 356 ? 1.0147 0.3238 0.5933 0.1059  0.0187  0.1052  356 LEU A CD2 
2650 N N   . TRP A 357 ? 0.7986 0.1838 0.4064 0.0654  0.0069  0.0814  357 TRP A N   
2651 C CA  . TRP A 357 ? 0.7964 0.1789 0.4002 0.0522  0.0095  0.0711  357 TRP A CA  
2652 C C   . TRP A 357 ? 0.8740 0.2325 0.4600 0.0458  0.0122  0.0721  357 TRP A C   
2653 O O   . TRP A 357 ? 0.8958 0.2507 0.4729 0.0420  0.0100  0.0784  357 TRP A O   
2654 C CB  . TRP A 357 ? 0.7675 0.1713 0.3781 0.0433  0.0064  0.0686  357 TRP A CB  
2655 C CG  . TRP A 357 ? 0.7799 0.1855 0.3903 0.0305  0.0096  0.0590  357 TRP A CG  
2656 C CD1 . TRP A 357 ? 0.8252 0.2298 0.4278 0.0194  0.0109  0.0584  357 TRP A CD1 
2657 C CD2 . TRP A 357 ? 0.7645 0.1765 0.3849 0.0277  0.0119  0.0493  357 TRP A CD2 
2658 N NE1 . TRP A 357 ? 0.8081 0.2194 0.4175 0.0109  0.0147  0.0491  357 TRP A NE1 
2659 C CE2 . TRP A 357 ? 0.8085 0.2247 0.4293 0.0158  0.0145  0.0438  357 TRP A CE2 
2660 C CE3 . TRP A 357 ? 0.7738 0.1869 0.4021 0.0340  0.0120  0.0452  357 TRP A CE3 
2661 C CZ2 . TRP A 357 ? 0.7835 0.2071 0.4151 0.0108  0.0165  0.0350  357 TRP A CZ2 
2662 C CZ3 . TRP A 357 ? 0.7775 0.1958 0.4135 0.0278  0.0131  0.0363  357 TRP A CZ3 
2663 C CH2 . TRP A 357 ? 0.7795 0.2041 0.4185 0.0168  0.0149  0.0317  357 TRP A CH2 
2664 N N   . ILE A 358 ? 0.8225 0.1633 0.4020 0.0439  0.0166  0.0662  358 ILE A N   
2665 C CA  . ILE A 358 ? 0.8424 0.1566 0.4036 0.0379  0.0197  0.0664  358 ILE A CA  
2666 C C   . ILE A 358 ? 0.8950 0.2090 0.4547 0.0218  0.0219  0.0580  358 ILE A C   
2667 O O   . ILE A 358 ? 0.8903 0.2118 0.4594 0.0186  0.0225  0.0504  358 ILE A O   
2668 C CB  . ILE A 358 ? 0.8967 0.1889 0.4500 0.0476  0.0231  0.0667  358 ILE A CB  
2669 C CG1 . ILE A 358 ? 0.9075 0.1982 0.4629 0.0646  0.0226  0.0766  358 ILE A CG1 
2670 C CG2 . ILE A 358 ? 0.9336 0.1957 0.4664 0.0398  0.0265  0.0650  358 ILE A CG2 
2671 C CD1 . ILE A 358 ? 0.9762 0.2583 0.5334 0.0764  0.0269  0.0749  358 ILE A CD1 
2672 N N   . LYS A 359 ? 0.8403 0.1449 0.3880 0.0117  0.0233  0.0601  359 LYS A N   
2673 C CA  . LYS A 359 ? 0.8184 0.1227 0.3655 -0.0036 0.0265  0.0534  359 LYS A CA  
2674 C C   . LYS A 359 ? 0.9118 0.1878 0.4413 -0.0079 0.0289  0.0538  359 LYS A C   
2675 O O   . LYS A 359 ? 0.9442 0.2018 0.4566 -0.0091 0.0297  0.0598  359 LYS A O   
2676 C CB  . LYS A 359 ? 0.8164 0.1288 0.3612 -0.0136 0.0281  0.0545  359 LYS A CB  
2677 C CG  . LYS A 359 ? 0.8273 0.1447 0.3775 -0.0283 0.0328  0.0472  359 LYS A CG  
2678 C CD  . LYS A 359 ? 1.0177 0.3397 0.5633 -0.0387 0.0368  0.0479  359 LYS A CD  
2679 C CE  . LYS A 359 ? 1.2017 0.5306 0.7558 -0.0524 0.0429  0.0413  359 LYS A CE  
2680 N NZ  . LYS A 359 ? 1.3130 0.6471 0.8632 -0.0619 0.0489  0.0412  359 LYS A NZ  
2681 N N   . VAL A 360 ? 0.8748 0.1454 0.4065 -0.0110 0.0295  0.0479  360 VAL A N   
2682 C CA  . VAL A 360 ? 0.8968 0.1383 0.4099 -0.0166 0.0313  0.0475  360 VAL A CA  
2683 C C   . VAL A 360 ? 0.9649 0.2041 0.4732 -0.0331 0.0337  0.0463  360 VAL A C   
2684 O O   . VAL A 360 ? 0.9466 0.2066 0.4713 -0.0429 0.0343  0.0410  360 VAL A O   
2685 C CB  . VAL A 360 ? 0.9424 0.1793 0.4583 -0.0167 0.0301  0.0416  360 VAL A CB  
2686 C CG1 . VAL A 360 ? 0.9752 0.1775 0.4671 -0.0223 0.0318  0.0419  360 VAL A CG1 
2687 C CG2 . VAL A 360 ? 0.9275 0.1707 0.4507 -0.0008 0.0289  0.0422  360 VAL A CG2 
2688 N N   . LYS A 361 ? 0.9571 0.1715 0.4435 -0.0356 0.0355  0.0517  361 LYS A N   
2689 C CA  . LYS A 361 ? 0.9747 0.1827 0.4523 -0.0514 0.0387  0.0517  361 LYS A CA  
2690 C C   . LYS A 361 ? 1.0835 0.2812 0.5577 -0.0645 0.0394  0.0469  361 LYS A C   
2691 O O   . LYS A 361 ? 1.1107 0.2854 0.5712 -0.0616 0.0381  0.0467  361 LYS A O   
2692 C CB  . LYS A 361 ? 1.0256 0.2061 0.4777 -0.0495 0.0396  0.0597  361 LYS A CB  
2693 C CG  . LYS A 361 ? 1.1157 0.3051 0.5678 -0.0425 0.0382  0.0660  361 LYS A CG  
2694 C CD  . LYS A 361 ? 1.2216 0.3834 0.6473 -0.0477 0.0395  0.0729  361 LYS A CD  
2695 C CE  . LYS A 361 ? 1.3111 0.4738 0.7314 -0.0385 0.0359  0.0818  361 LYS A CE  
2696 N NZ  . LYS A 361 ? 1.3801 0.5225 0.7772 -0.0482 0.0372  0.0872  361 LYS A NZ  
2697 N N   . GLY A 362 ? 1.0599 0.2729 0.5450 -0.0794 0.0420  0.0435  362 GLY A N   
2698 C CA  . GLY A 362 ? 1.0851 0.2916 0.5690 -0.0949 0.0421  0.0402  362 GLY A CA  
2699 C C   . GLY A 362 ? 1.1439 0.3631 0.6445 -0.0956 0.0377  0.0348  362 GLY A C   
2700 O O   . GLY A 362 ? 1.1651 0.3698 0.6576 -0.1061 0.0355  0.0334  362 GLY A O   
2701 N N   . ILE A 363 ? 1.0693 0.3149 0.5921 -0.0859 0.0360  0.0321  363 ILE A N   
2702 C CA  . ILE A 363 ? 1.0532 0.3126 0.5927 -0.0857 0.0312  0.0274  363 ILE A CA  
2703 C C   . ILE A 363 ? 1.1087 0.4043 0.6776 -0.0821 0.0316  0.0243  363 ILE A C   
2704 O O   . ILE A 363 ? 1.0995 0.4040 0.6709 -0.0718 0.0334  0.0258  363 ILE A O   
2705 C CB  . ILE A 363 ? 1.0961 0.3335 0.6200 -0.0741 0.0277  0.0276  363 ILE A CB  
2706 C CG1 . ILE A 363 ? 1.1141 0.3402 0.6337 -0.0836 0.0229  0.0243  363 ILE A CG1 
2707 C CG2 . ILE A 363 ? 1.0761 0.3285 0.6113 -0.0571 0.0266  0.0273  363 ILE A CG2 
2708 C CD1 . ILE A 363 ? 1.2649 0.4606 0.7599 -0.0975 0.0236  0.0262  363 ILE A CD1 
2709 N N   . ASN A 364 ? 1.0675 0.3833 0.6580 -0.0914 0.0297  0.0206  364 ASN A N   
2710 C CA  . ASN A 364 ? 1.0395 0.3885 0.6585 -0.0887 0.0308  0.0175  364 ASN A CA  
2711 C C   . ASN A 364 ? 1.0789 0.4353 0.7051 -0.0758 0.0255  0.0152  364 ASN A C   
2712 O O   . ASN A 364 ? 1.0509 0.4240 0.6877 -0.0669 0.0271  0.0144  364 ASN A O   
2713 C CB  . ASN A 364 ? 1.0261 0.3944 0.6677 -0.1024 0.0306  0.0155  364 ASN A CB  
2714 C CG  . ASN A 364 ? 1.3469 0.7067 0.9816 -0.1176 0.0349  0.0178  364 ASN A CG  
2715 O OD1 . ASN A 364 ? 1.2181 0.5753 0.8455 -0.1199 0.0425  0.0196  364 ASN A OD1 
2716 N ND2 . ASN A 364 ? 1.3393 0.6935 0.9748 -0.1295 0.0297  0.0181  364 ASN A ND2 
2717 N N   . ASP A 365 ? 1.0497 0.3926 0.6688 -0.0761 0.0193  0.0141  365 ASP A N   
2718 C CA  . ASP A 365 ? 1.0374 0.3838 0.6604 -0.0655 0.0144  0.0118  365 ASP A CA  
2719 C C   . ASP A 365 ? 1.1297 0.4452 0.7263 -0.0588 0.0133  0.0134  365 ASP A C   
2720 O O   . ASP A 365 ? 1.1583 0.4489 0.7359 -0.0667 0.0127  0.0145  365 ASP A O   
2721 C CB  . ASP A 365 ? 1.0479 0.4091 0.6894 -0.0727 0.0080  0.0085  365 ASP A CB  
2722 C CG  . ASP A 365 ? 1.1771 0.5391 0.8199 -0.0632 0.0028  0.0060  365 ASP A CG  
2723 O OD1 . ASP A 365 ? 1.1954 0.5359 0.8220 -0.0653 -0.0018 0.0054  365 ASP A OD1 
2724 O OD2 . ASP A 365 ? 1.2545 0.6357 0.9114 -0.0537 0.0038  0.0046  365 ASP A OD2 
2725 N N   . VAL A 366 ? 1.0761 0.3927 0.6714 -0.0443 0.0135  0.0135  366 VAL A N   
2726 C CA  . VAL A 366 ? 1.0833 0.3735 0.6567 -0.0347 0.0144  0.0154  366 VAL A CA  
2727 C C   . VAL A 366 ? 1.1151 0.4029 0.6889 -0.0295 0.0106  0.0119  366 VAL A C   
2728 O O   . VAL A 366 ? 1.1278 0.3883 0.6807 -0.0260 0.0116  0.0122  366 VAL A O   
2729 C CB  . VAL A 366 ? 1.1315 0.4208 0.6999 -0.0224 0.0189  0.0204  366 VAL A CB  
2730 C CG1 . VAL A 366 ? 1.1068 0.4093 0.6845 -0.0080 0.0183  0.0205  366 VAL A CG1 
2731 C CG2 . VAL A 366 ? 1.1645 0.4206 0.7065 -0.0202 0.0222  0.0248  366 VAL A CG2 
2732 N N   . LYS A 367 ? 1.0524 0.3666 0.6482 -0.0291 0.0068  0.0086  367 LYS A N   
2733 C CA  . LYS A 367 ? 1.0531 0.3680 0.6509 -0.0250 0.0028  0.0051  367 LYS A CA  
2734 C C   . LYS A 367 ? 1.1665 0.4514 0.7423 -0.0315 0.0001  0.0037  367 LYS A C   
2735 O O   . LYS A 367 ? 1.1640 0.4320 0.7256 -0.0235 0.0016  0.0029  367 LYS A O   
2736 C CB  . LYS A 367 ? 1.0606 0.4055 0.6845 -0.0293 -0.0022 0.0019  367 LYS A CB  
2737 C CG  . LYS A 367 ? 1.2104 0.5589 0.8377 -0.0243 -0.0068 -0.0013 367 LYS A CG  
2738 C CD  . LYS A 367 ? 1.2812 0.6561 0.9332 -0.0296 -0.0126 -0.0040 367 LYS A CD  
2739 C CE  . LYS A 367 ? 1.4226 0.7917 1.0750 -0.0426 -0.0205 -0.0053 367 LYS A CE  
2740 N NZ  . LYS A 367 ? 1.5567 0.9286 1.2148 -0.0548 -0.0204 -0.0033 367 LYS A NZ  
2741 N N   . GLU A 368 ? 1.1746 0.4517 0.7463 -0.0467 -0.0031 0.0037  368 GLU A N   
2742 C CA  . GLU A 368 ? 1.2143 0.4610 0.7626 -0.0568 -0.0065 0.0028  368 GLU A CA  
2743 C C   . GLU A 368 ? 1.2817 0.4925 0.7993 -0.0478 0.0004  0.0043  368 GLU A C   
2744 O O   . GLU A 368 ? 1.2740 0.4669 0.7769 -0.0426 0.0007  0.0023  368 GLU A O   
2745 C CB  . GLU A 368 ? 1.2512 0.4986 0.8020 -0.0746 -0.0098 0.0041  368 GLU A CB  
2746 C CG  . GLU A 368 ? 1.5101 0.7216 1.0316 -0.0873 -0.0127 0.0043  368 GLU A CG  
2747 C CD  . GLU A 368 ? 1.9312 1.1358 1.4483 -0.0982 -0.0224 0.0019  368 GLU A CD  
2748 O OE1 . GLU A 368 ? 1.9755 1.1804 1.4945 -0.1159 -0.0293 0.0031  368 GLU A OE1 
2749 O OE2 . GLU A 368 ? 1.9022 1.0994 1.4121 -0.0900 -0.0234 -0.0007 368 GLU A OE2 
2750 N N   . LEU A 369 ? 1.2568 0.4577 0.7655 -0.0447 0.0066  0.0083  369 LEU A N   
2751 C CA  . LEU A 369 ? 1.2798 0.4471 0.7612 -0.0348 0.0139  0.0110  369 LEU A CA  
2752 C C   . LEU A 369 ? 1.3454 0.5175 0.8307 -0.0146 0.0195  0.0126  369 LEU A C   
2753 O O   . LEU A 369 ? 1.3617 0.5201 0.8367 -0.0037 0.0260  0.0172  369 LEU A O   
2754 C CB  . LEU A 369 ? 1.2915 0.4439 0.7603 -0.0399 0.0174  0.0152  369 LEU A CB  
2755 C CG  . LEU A 369 ? 1.3102 0.4876 0.7973 -0.0358 0.0196  0.0189  369 LEU A CG  
2756 C CD1 . LEU A 369 ? 1.3117 0.4748 0.7870 -0.0199 0.0261  0.0243  369 LEU A CD1 
2757 C CD2 . LEU A 369 ? 1.3403 0.5173 0.8261 -0.0520 0.0185  0.0200  369 LEU A CD2 
2758 N N   . ILE A 370 ? 1.2894 0.4808 0.7899 -0.0102 0.0167  0.0094  370 ILE A N   
2759 C CA  . ILE A 370 ? 1.2770 0.4772 0.7844 0.0067  0.0210  0.0105  370 ILE A CA  
2760 C C   . ILE A 370 ? 1.3593 0.5486 0.8582 0.0066  0.0196  0.0057  370 ILE A C   
2761 O O   . ILE A 370 ? 1.3906 0.5501 0.8670 0.0131  0.0258  0.0056  370 ILE A O   
2762 C CB  . ILE A 370 ? 1.2770 0.5173 0.8141 0.0115  0.0189  0.0120  370 ILE A CB  
2763 C CG1 . ILE A 370 ? 1.2849 0.5286 0.8236 0.0156  0.0223  0.0180  370 ILE A CG1 
2764 C CG2 . ILE A 370 ? 1.2701 0.5261 0.8188 0.0239  0.0201  0.0114  370 ILE A CG2 
2765 C CD1 . ILE A 370 ? 1.4763 0.6966 0.9983 0.0295  0.0295  0.0237  370 ILE A CD1 
2766 N N   . GLU A 371 ? 1.3033 0.5141 0.8184 -0.0018 0.0117  0.0017  371 GLU A N   
2767 C CA  . GLU A 371 ? 1.3085 0.5121 0.8172 -0.0042 0.0083  -0.0028 371 GLU A CA  
2768 C C   . GLU A 371 ? 1.4092 0.5806 0.8922 -0.0189 0.0042  -0.0054 371 GLU A C   
2769 O O   . GLU A 371 ? 1.4252 0.5891 0.9009 -0.0241 -0.0005 -0.0090 371 GLU A O   
2770 C CB  . GLU A 371 ? 1.2882 0.5279 0.8250 -0.0065 0.0009  -0.0051 371 GLU A CB  
2771 C CG  . GLU A 371 ? 1.3755 0.6361 0.9308 -0.0194 -0.0063 -0.0051 371 GLU A CG  
2772 C CD  . GLU A 371 ? 1.4816 0.7775 1.0657 -0.0197 -0.0119 -0.0068 371 GLU A CD  
2773 O OE1 . GLU A 371 ? 0.9420 0.2582 0.5405 -0.0091 -0.0082 -0.0057 371 GLU A OE1 
2774 O OE2 . GLU A 371 ? 1.5218 0.8248 1.1142 -0.0310 -0.0202 -0.0086 371 GLU A OE2 
2775 N N   . GLU A 372 ? 1.3854 0.5361 0.8526 -0.0263 0.0056  -0.0033 372 GLU A N   
2776 C CA  . GLU A 372 ? 1.4254 0.5442 0.8662 -0.0421 0.0013  -0.0051 372 GLU A CA  
2777 C C   . GLU A 372 ? 1.5231 0.6028 0.9329 -0.0407 0.0094  -0.0028 372 GLU A C   
2778 O O   . GLU A 372 ? 1.5614 0.6031 0.9393 -0.0487 0.0096  -0.0047 372 GLU A O   
2779 C CB  . GLU A 372 ? 1.4326 0.5725 0.8911 -0.0604 -0.0102 -0.0051 372 GLU A CB  
2780 C CG  . GLU A 372 ? 1.6226 0.7371 1.0593 -0.0790 -0.0187 -0.0068 372 GLU A CG  
2781 C CD  . GLU A 372 ? 1.9161 1.0553 1.3736 -0.0903 -0.0315 -0.0082 372 GLU A CD  
2782 O OE1 . GLU A 372 ? 1.8453 1.0127 1.3286 -0.0995 -0.0377 -0.0062 372 GLU A OE1 
2783 O OE2 . GLU A 372 ? 1.8322 0.9611 1.2792 -0.0901 -0.0352 -0.0110 372 GLU A OE2 
2784 N N   . LYS A 373 ? 1.4631 0.5499 0.8803 -0.0311 0.0159  0.0015  373 LYS A N   
2785 C CA  . LYS A 373 ? 1.4856 0.5359 0.8747 -0.0282 0.0237  0.0045  373 LYS A CA  
2786 C C   . LYS A 373 ? 1.5120 0.5536 0.8970 -0.0060 0.0351  0.0075  373 LYS A C   
2787 O O   . LYS A 373 ? 1.5302 0.5327 0.8855 -0.0006 0.0430  0.0073  373 LYS A O   
2788 C CB  . LYS A 373 ? 1.5090 0.5672 0.9043 -0.0374 0.0216  0.0080  373 LYS A CB  
2789 N N   . ALA A 374 ? 1.4150 0.4931 0.8299 0.0065  0.0360  0.0104  374 ALA A N   
2790 C CA  . ALA A 374 ? 1.4013 0.4803 0.8200 0.0274  0.0451  0.0148  374 ALA A CA  
2791 C C   . ALA A 374 ? 1.4492 0.5182 0.8613 0.0381  0.0511  0.0122  374 ALA A C   
2792 O O   . ALA A 374 ? 1.4689 0.5160 0.8678 0.0526  0.0615  0.0154  374 ALA A O   
2793 C CB  . ALA A 374 ? 1.3709 0.4919 0.8221 0.0343  0.0425  0.0188  374 ALA A CB  
2794 N N   . VAL A 375 ? 1.3811 0.4668 0.8035 0.0319  0.0451  0.0070  375 VAL A N   
2795 C CA  . VAL A 375 ? 1.3810 0.4590 0.7973 0.0403  0.0503  0.0040  375 VAL A CA  
2796 C C   . VAL A 375 ? 1.4715 0.4993 0.8488 0.0393  0.0582  0.0014  375 VAL A C   
2797 O O   . VAL A 375 ? 1.4780 0.4898 0.8459 0.0544  0.0699  0.0026  375 VAL A O   
2798 C CB  . VAL A 375 ? 1.4021 0.5071 0.8359 0.0323  0.0411  -0.0008 375 VAL A CB  
2799 C CG1 . VAL A 375 ? 1.3500 0.5010 0.8199 0.0396  0.0379  0.0019  375 VAL A CG1 
2800 C CG2 . VAL A 375 ? 1.4072 0.5083 0.8352 0.0113  0.0297  -0.0045 375 VAL A CG2 
2801 N N   . LYS A 376 ? 1.4566 0.4586 0.8107 0.0216  0.0525  -0.0015 376 LYS A N   
2802 C CA  . LYS A 376 ? 1.5066 0.4561 0.8184 0.0166  0.0585  -0.0043 376 LYS A CA  
2803 C C   . LYS A 376 ? 1.6045 0.5254 0.8994 0.0319  0.0723  0.0004  376 LYS A C   
2804 O O   . LYS A 376 ? 1.6660 0.5413 0.9256 0.0342  0.0819  -0.0013 376 LYS A O   
2805 C CB  . LYS A 376 ? 1.5489 0.4827 0.8439 -0.0071 0.0475  -0.0066 376 LYS A CB  
2806 N N   . MET A 377 ? 1.5214 0.4680 0.8405 0.0424  0.0733  0.0067  377 MET A N   
2807 C CA  . MET A 377 ? 1.5346 0.4605 0.8438 0.0581  0.0846  0.0129  377 MET A CA  
2808 C C   . MET A 377 ? 1.5543 0.5006 0.8853 0.0811  0.0937  0.0172  377 MET A C   
2809 O O   . MET A 377 ? 1.5480 0.4929 0.8843 0.0965  0.1008  0.0245  377 MET A O   
2810 C CB  . MET A 377 ? 1.5523 0.4907 0.8714 0.0530  0.0786  0.0180  377 MET A CB  
2811 C CG  . MET A 377 ? 1.6048 0.5314 0.9092 0.0295  0.0690  0.0144  377 MET A CG  
2812 S SD  . MET A 377 ? 1.7138 0.5782 0.9702 0.0241  0.0761  0.0151  377 MET A SD  
2813 C CE  . MET A 377 ? 1.6596 0.5376 0.9293 0.0281  0.0751  0.0233  377 MET A CE  
2814 N N   . GLY A 378 ? 1.4978 0.4636 0.8419 0.0827  0.0929  0.0133  378 GLY A N   
2815 C CA  . GLY A 378 ? 1.4891 0.4765 0.8548 0.1022  0.1011  0.0171  378 GLY A CA  
2816 C C   . GLY A 378 ? 1.5238 0.5562 0.9268 0.1111  0.0964  0.0244  378 GLY A C   
2817 O O   . GLY A 378 ? 1.5183 0.5657 0.9384 0.1287  0.1038  0.0299  378 GLY A O   
2818 N N   . VAL A 379 ? 1.4617 0.5154 0.8772 0.0986  0.0844  0.0249  379 VAL A N   
2819 C CA  . VAL A 379 ? 1.4243 0.5180 0.8711 0.1038  0.0787  0.0314  379 VAL A CA  
2820 C C   . VAL A 379 ? 1.4270 0.5564 0.8950 0.0904  0.0667  0.0269  379 VAL A C   
2821 O O   . VAL A 379 ? 1.4352 0.5591 0.8950 0.0738  0.0596  0.0218  379 VAL A O   
2822 C CB  . VAL A 379 ? 1.4911 0.5744 0.9316 0.1034  0.0777  0.0377  379 VAL A CB  
2823 C CG1 . VAL A 379 ? 1.4541 0.5754 0.9239 0.1099  0.0728  0.0453  379 VAL A CG1 
2824 C CG2 . VAL A 379 ? 1.5375 0.5791 0.9528 0.1156  0.0897  0.0418  379 VAL A CG2 
2825 N N   . LEU A 380 ? 1.3257 0.4916 0.8211 0.0976  0.0646  0.0291  380 LEU A N   
2826 C CA  . LEU A 380 ? 1.2747 0.4729 0.7895 0.0861  0.0541  0.0250  380 LEU A CA  
2827 C C   . LEU A 380 ? 1.2378 0.4729 0.7796 0.0915  0.0502  0.0307  380 LEU A C   
2828 O O   . LEU A 380 ? 1.2261 0.4741 0.7800 0.1052  0.0545  0.0358  380 LEU A O   
2829 C CB  . LEU A 380 ? 1.2759 0.4769 0.7905 0.0822  0.0528  0.0179  380 LEU A CB  
2830 C CG  . LEU A 380 ? 1.3493 0.5526 0.8678 0.0966  0.0612  0.0192  380 LEU A CG  
2831 C CD1 . LEU A 380 ? 1.3183 0.5529 0.8568 0.0941  0.0555  0.0159  380 LEU A CD1 
2832 C CD2 . LEU A 380 ? 1.4368 0.5997 0.9261 0.0984  0.0702  0.0154  380 LEU A CD2 
2833 N N   . MET A 381 ? 1.1316 0.3828 0.6819 0.0802  0.0424  0.0300  381 MET A N   
2834 C CA  . MET A 381 ? 1.0724 0.3570 0.6448 0.0807  0.0373  0.0340  381 MET A CA  
2835 C C   . MET A 381 ? 1.0701 0.3726 0.6521 0.0656  0.0296  0.0277  381 MET A C   
2836 O O   . MET A 381 ? 1.0882 0.3762 0.6596 0.0540  0.0277  0.0236  381 MET A O   
2837 C CB  . MET A 381 ? 1.0998 0.3808 0.6702 0.0854  0.0383  0.0426  381 MET A CB  
2838 C CG  . MET A 381 ? 1.1516 0.4118 0.7056 0.0744  0.0373  0.0416  381 MET A CG  
2839 S SD  . MET A 381 ? 1.2359 0.4567 0.7653 0.0834  0.0449  0.0478  381 MET A SD  
2840 C CE  . MET A 381 ? 1.1855 0.4191 0.7222 0.0859  0.0416  0.0576  381 MET A CE  
2841 N N   . LEU A 382 ? 0.9362 0.2694 0.5381 0.0658  0.0255  0.0271  382 LEU A N   
2842 C CA  . LEU A 382 ? 0.8807 0.2337 0.4949 0.0546  0.0194  0.0218  382 LEU A CA  
2843 C C   . LEU A 382 ? 0.9018 0.2570 0.5165 0.0431  0.0170  0.0213  382 LEU A C   
2844 O O   . LEU A 382 ? 0.8918 0.2532 0.5083 0.0444  0.0175  0.0265  382 LEU A O   
2845 C CB  . LEU A 382 ? 0.8518 0.2339 0.4840 0.0591  0.0170  0.0233  382 LEU A CB  
2846 C CG  . LEU A 382 ? 0.8921 0.2846 0.5317 0.0607  0.0154  0.0187  382 LEU A CG  
2847 C CD1 . LEU A 382 ? 0.8955 0.2815 0.5323 0.0505  0.0119  0.0111  382 LEU A CD1 
2848 C CD2 . LEU A 382 ? 0.9313 0.3146 0.5659 0.0724  0.0206  0.0214  382 LEU A CD2 
2849 N N   . PRO A 383 ? 0.8441 0.1973 0.4592 0.0313  0.0139  0.0155  383 PRO A N   
2850 C CA  . PRO A 383 ? 0.8451 0.2050 0.4648 0.0202  0.0126  0.0149  383 PRO A CA  
2851 C C   . PRO A 383 ? 0.9146 0.3026 0.5520 0.0199  0.0113  0.0149  383 PRO A C   
2852 O O   . PRO A 383 ? 0.9101 0.3137 0.5585 0.0238  0.0092  0.0127  383 PRO A O   
2853 C CB  . PRO A 383 ? 0.8648 0.2206 0.4856 0.0091  0.0088  0.0092  383 PRO A CB  
2854 C CG  . PRO A 383 ? 0.9256 0.2631 0.5340 0.0133  0.0086  0.0075  383 PRO A CG  
2855 C CD  . PRO A 383 ? 0.8627 0.2082 0.4747 0.0269  0.0112  0.0097  383 PRO A CD  
2856 N N   . GLY A 384 ? 0.8850 0.2769 0.5228 0.0145  0.0130  0.0173  384 GLY A N   
2857 C CA  . GLY A 384 ? 0.8643 0.2774 0.5134 0.0129  0.0132  0.0176  384 GLY A CA  
2858 C C   . GLY A 384 ? 0.8882 0.3204 0.5540 0.0077  0.0116  0.0117  384 GLY A C   
2859 O O   . GLY A 384 ? 0.8615 0.3098 0.5352 0.0095  0.0117  0.0115  384 GLY A O   
2860 N N   . ASN A 385 ? 0.8474 0.2772 0.5182 0.0010  0.0098  0.0073  385 ASN A N   
2861 C CA  . ASN A 385 ? 0.8247 0.2719 0.5132 -0.0035 0.0077  0.0024  385 ASN A CA  
2862 C C   . ASN A 385 ? 0.8258 0.2878 0.5226 0.0038  0.0059  0.0008  385 ASN A C   
2863 O O   . ASN A 385 ? 0.7941 0.2720 0.5028 0.0019  0.0071  -0.0014 385 ASN A O   
2864 C CB  . ASN A 385 ? 0.8533 0.2929 0.5433 -0.0089 0.0031  -0.0005 385 ASN A CB  
2865 C CG  . ASN A 385 ? 1.3626 0.7865 1.0434 -0.0177 0.0041  0.0010  385 ASN A CG  
2866 O OD1 . ASN A 385 ? 1.3364 0.7417 0.9995 -0.0158 0.0067  0.0043  385 ASN A OD1 
2867 N ND2 . ASN A 385 ? 1.3150 0.7462 1.0080 -0.0277 0.0018  -0.0010 385 ASN A ND2 
2868 N N   . ALA A 386 ? 0.7794 0.2348 0.4684 0.0121  0.0039  0.0022  386 ALA A N   
2869 C CA  . ALA A 386 ? 0.7628 0.2292 0.4566 0.0191  0.0019  0.0015  386 ALA A CA  
2870 C C   . ALA A 386 ? 0.7943 0.2755 0.4922 0.0207  0.0036  0.0034  386 ALA A C   
2871 O O   . ALA A 386 ? 0.7550 0.2480 0.4590 0.0233  0.0017  0.0017  386 ALA A O   
2872 C CB  . ALA A 386 ? 0.7782 0.2324 0.4613 0.0274  0.0019  0.0042  386 ALA A CB  
2873 N N   . PHE A 387 ? 0.7654 0.2439 0.4577 0.0180  0.0068  0.0070  387 PHE A N   
2874 C CA  . PHE A 387 ? 0.7560 0.2437 0.4468 0.0181  0.0081  0.0098  387 PHE A CA  
2875 C C   . PHE A 387 ? 0.7640 0.2582 0.4594 0.0101  0.0121  0.0068  387 PHE A C   
2876 O O   . PHE A 387 ? 0.7603 0.2552 0.4489 0.0073  0.0146  0.0095  387 PHE A O   
2877 C CB  . PHE A 387 ? 0.7942 0.2727 0.4729 0.0218  0.0084  0.0174  387 PHE A CB  
2878 C CG  . PHE A 387 ? 0.8193 0.2905 0.4952 0.0309  0.0065  0.0203  387 PHE A CG  
2879 C CD1 . PHE A 387 ? 0.8781 0.3322 0.5476 0.0318  0.0078  0.0197  387 PHE A CD1 
2880 C CD2 . PHE A 387 ? 0.8408 0.3218 0.5202 0.0381  0.0041  0.0232  387 PHE A CD2 
2881 C CE1 . PHE A 387 ? 0.9003 0.3451 0.5656 0.0405  0.0079  0.0217  387 PHE A CE1 
2882 C CE2 . PHE A 387 ? 0.8870 0.3616 0.5649 0.0470  0.0042  0.0258  387 PHE A CE2 
2883 C CZ  . PHE A 387 ? 0.8805 0.3361 0.5508 0.0485  0.0067  0.0248  387 PHE A CZ  
2884 N N   . TYR A 388 ? 0.6864 0.1853 0.3936 0.0063  0.0126  0.0013  388 TYR A N   
2885 C CA  . TYR A 388 ? 0.6745 0.1809 0.3896 -0.0002 0.0179  -0.0018 388 TYR A CA  
2886 C C   . TYR A 388 ? 0.6976 0.2158 0.4286 0.0003  0.0169  -0.0070 388 TYR A C   
2887 O O   . TYR A 388 ? 0.6884 0.2065 0.4253 0.0027  0.0114  -0.0086 388 TYR A O   
2888 C CB  . TYR A 388 ? 0.6905 0.1900 0.4057 -0.0075 0.0218  -0.0013 388 TYR A CB  
2889 C CG  . TYR A 388 ? 0.7074 0.1940 0.4057 -0.0089 0.0238  0.0040  388 TYR A CG  
2890 C CD1 . TYR A 388 ? 0.7258 0.2123 0.4156 -0.0123 0.0287  0.0059  388 TYR A CD1 
2891 C CD2 . TYR A 388 ? 0.7326 0.2048 0.4214 -0.0071 0.0208  0.0072  388 TYR A CD2 
2892 C CE1 . TYR A 388 ? 0.7511 0.2248 0.4243 -0.0138 0.0294  0.0115  388 TYR A CE1 
2893 C CE2 . TYR A 388 ? 0.7640 0.2230 0.4369 -0.0075 0.0223  0.0127  388 TYR A CE2 
2894 C CZ  . TYR A 388 ? 0.8481 0.3086 0.5139 -0.0109 0.0260  0.0151  388 TYR A CZ  
2895 O OH  . TYR A 388 ? 0.8337 0.2805 0.4831 -0.0115 0.0264  0.0213  388 TYR A OH  
2896 N N   . VAL A 389 ? 0.6335 0.1600 0.3701 -0.0019 0.0222  -0.0095 389 VAL A N   
2897 C CA  . VAL A 389 ? 0.6238 0.1608 0.3766 -0.0006 0.0218  -0.0139 389 VAL A CA  
2898 C C   . VAL A 389 ? 0.6928 0.2320 0.4604 -0.0040 0.0196  -0.0149 389 VAL A C   
2899 O O   . VAL A 389 ? 0.6804 0.2216 0.4555 -0.0016 0.0126  -0.0162 389 VAL A O   
2900 C CB  . VAL A 389 ? 0.6624 0.2054 0.4183 -0.0022 0.0299  -0.0165 389 VAL A CB  
2901 C CG1 . VAL A 389 ? 0.6485 0.2018 0.4241 -0.0003 0.0301  -0.0205 389 VAL A CG1 
2902 C CG2 . VAL A 389 ? 0.6577 0.1976 0.3974 -0.0002 0.0297  -0.0155 389 VAL A CG2 
2903 N N   . ASP A 390 ? 0.6563 0.1938 0.4261 -0.0104 0.0247  -0.0136 390 ASP A N   
2904 C CA  . ASP A 390 ? 0.6486 0.1883 0.4316 -0.0154 0.0219  -0.0135 390 ASP A CA  
2905 C C   . ASP A 390 ? 0.7160 0.2409 0.4852 -0.0166 0.0158  -0.0110 390 ASP A C   
2906 O O   . ASP A 390 ? 0.7122 0.2269 0.4701 -0.0207 0.0188  -0.0084 390 ASP A O   
2907 C CB  . ASP A 390 ? 0.6674 0.2135 0.4612 -0.0225 0.0307  -0.0133 390 ASP A CB  
2908 C CG  . ASP A 390 ? 0.6307 0.1835 0.4426 -0.0288 0.0275  -0.0126 390 ASP A CG  
2909 O OD1 . ASP A 390 ? 0.6340 0.1882 0.4503 -0.0363 0.0334  -0.0111 390 ASP A OD1 
2910 O OD2 . ASP A 390 ? 0.5813 0.1386 0.4034 -0.0269 0.0187  -0.0133 390 ASP A OD2 
2911 N N   . SER A 391 ? 0.7025 0.2241 0.4706 -0.0129 0.0077  -0.0118 391 SER A N   
2912 C CA  . SER A 391 ? 0.7186 0.2233 0.4717 -0.0131 0.0027  -0.0099 391 SER A CA  
2913 C C   . SER A 391 ? 0.8073 0.3066 0.5638 -0.0225 0.0005  -0.0090 391 SER A C   
2914 O O   . SER A 391 ? 0.8315 0.3132 0.5716 -0.0247 -0.0003 -0.0070 391 SER A O   
2915 C CB  . SER A 391 ? 0.7414 0.2426 0.4902 -0.0069 -0.0039 -0.0114 391 SER A CB  
2916 O OG  . SER A 391 ? 0.8803 0.3948 0.6456 -0.0065 -0.0075 -0.0142 391 SER A OG  
2917 N N   . SER A 392 ? 0.7674 0.2815 0.5451 -0.0281 0.0000  -0.0100 392 SER A N   
2918 C CA  . SER A 392 ? 0.7866 0.2997 0.5715 -0.0387 -0.0029 -0.0084 392 SER A CA  
2919 C C   . SER A 392 ? 0.8732 0.3780 0.6489 -0.0455 0.0039  -0.0060 392 SER A C   
2920 O O   . SER A 392 ? 0.8988 0.3887 0.6632 -0.0527 0.0005  -0.0042 392 SER A O   
2921 C CB  . SER A 392 ? 0.8276 0.3626 0.6414 -0.0419 -0.0043 -0.0089 392 SER A CB  
2922 O OG  . SER A 392 ? 0.9563 0.5050 0.7830 -0.0424 0.0063  -0.0090 392 SER A OG  
2923 N N   . ALA A 393 ? 0.8155 0.3280 0.5937 -0.0440 0.0135  -0.0061 393 ALA A N   
2924 C CA  . ALA A 393 ? 0.8194 0.3244 0.5879 -0.0502 0.0211  -0.0039 393 ALA A CA  
2925 C C   . ALA A 393 ? 0.9077 0.3879 0.6487 -0.0493 0.0188  -0.0014 393 ALA A C   
2926 O O   . ALA A 393 ? 0.9217 0.3938 0.6503 -0.0401 0.0160  -0.0013 393 ALA A O   
2927 C CB  . ALA A 393 ? 0.8187 0.3318 0.5882 -0.0467 0.0308  -0.0047 393 ALA A CB  
2928 N N   . PRO A 394 ? 0.8622 0.3300 0.5939 -0.0586 0.0204  0.0010  394 PRO A N   
2929 C CA  . PRO A 394 ? 0.8661 0.3075 0.5708 -0.0572 0.0188  0.0037  394 PRO A CA  
2930 C C   . PRO A 394 ? 0.8568 0.2894 0.5447 -0.0489 0.0232  0.0060  394 PRO A C   
2931 O O   . PRO A 394 ? 0.8305 0.2719 0.5214 -0.0497 0.0295  0.0065  394 PRO A O   
2932 C CB  . PRO A 394 ? 0.9125 0.3442 0.6122 -0.0705 0.0206  0.0057  394 PRO A CB  
2933 C CG  . PRO A 394 ? 0.9619 0.4169 0.6852 -0.0775 0.0265  0.0048  394 PRO A CG  
2934 C CD  . PRO A 394 ? 0.8834 0.3603 0.6293 -0.0708 0.0239  0.0018  394 PRO A CD  
2935 N N   . SER A 395 ? 0.8021 0.2161 0.4716 -0.0415 0.0199  0.0081  395 SER A N   
2936 C CA  . SER A 395 ? 0.7967 0.2009 0.4504 -0.0337 0.0225  0.0120  395 SER A CA  
2937 C C   . SER A 395 ? 0.8731 0.2495 0.5039 -0.0333 0.0223  0.0160  395 SER A C   
2938 O O   . SER A 395 ? 0.8758 0.2380 0.4986 -0.0302 0.0189  0.0154  395 SER A O   
2939 C CB  . SER A 395 ? 0.8199 0.2321 0.4766 -0.0214 0.0198  0.0120  395 SER A CB  
2940 O OG  . SER A 395 ? 0.9163 0.3265 0.5634 -0.0163 0.0222  0.0166  395 SER A OG  
2941 N N   . PRO A 396 ? 0.8415 0.2079 0.4594 -0.0356 0.0264  0.0202  396 PRO A N   
2942 C CA  . PRO A 396 ? 0.8686 0.2067 0.4632 -0.0333 0.0265  0.0247  396 PRO A CA  
2943 C C   . PRO A 396 ? 0.9384 0.2717 0.5261 -0.0182 0.0251  0.0290  396 PRO A C   
2944 O O   . PRO A 396 ? 0.9667 0.2794 0.5369 -0.0136 0.0261  0.0344  396 PRO A O   
2945 C CB  . PRO A 396 ? 0.9018 0.2346 0.4876 -0.0417 0.0311  0.0278  396 PRO A CB  
2946 C CG  . PRO A 396 ? 0.9278 0.2842 0.5271 -0.0405 0.0332  0.0271  396 PRO A CG  
2947 C CD  . PRO A 396 ? 0.8462 0.2242 0.4677 -0.0399 0.0313  0.0212  396 PRO A CD  
2948 N N   . TYR A 397 ? 0.8676 0.2207 0.4699 -0.0106 0.0229  0.0273  397 TYR A N   
2949 C CA  . TYR A 397 ? 0.8502 0.2054 0.4509 0.0027  0.0215  0.0318  397 TYR A CA  
2950 C C   . TYR A 397 ? 0.9192 0.2675 0.5188 0.0132  0.0200  0.0315  397 TYR A C   
2951 O O   . TYR A 397 ? 0.9252 0.2740 0.5295 0.0110  0.0186  0.0261  397 TYR A O   
2952 C CB  . TYR A 397 ? 0.8302 0.2098 0.4440 0.0038  0.0206  0.0318  397 TYR A CB  
2953 C CG  . TYR A 397 ? 0.8437 0.2239 0.4511 -0.0027 0.0230  0.0352  397 TYR A CG  
2954 C CD1 . TYR A 397 ? 0.8581 0.2478 0.4719 -0.0139 0.0265  0.0308  397 TYR A CD1 
2955 C CD2 . TYR A 397 ? 0.8582 0.2298 0.4534 0.0026  0.0218  0.0432  397 TYR A CD2 
2956 C CE1 . TYR A 397 ? 0.8630 0.2510 0.4683 -0.0206 0.0299  0.0335  397 TYR A CE1 
2957 C CE2 . TYR A 397 ? 0.8731 0.2442 0.4600 -0.0043 0.0233  0.0465  397 TYR A CE2 
2958 C CZ  . TYR A 397 ? 0.9430 0.3209 0.5335 -0.0163 0.0279  0.0412  397 TYR A CZ  
2959 O OH  . TYR A 397 ? 0.9636 0.3383 0.5432 -0.0239 0.0307  0.0440  397 TYR A OH  
2960 N N   . LEU A 398 ? 0.8721 0.2147 0.4658 0.0247  0.0204  0.0381  398 LEU A N   
2961 C CA  . LEU A 398 ? 0.8692 0.2051 0.4615 0.0369  0.0210  0.0395  398 LEU A CA  
2962 C C   . LEU A 398 ? 0.9184 0.2720 0.5207 0.0471  0.0193  0.0452  398 LEU A C   
2963 O O   . LEU A 398 ? 0.9084 0.2678 0.5100 0.0465  0.0179  0.0510  398 LEU A O   
2964 C CB  . LEU A 398 ? 0.9027 0.2077 0.4752 0.0414  0.0245  0.0437  398 LEU A CB  
2965 C CG  . LEU A 398 ? 0.9838 0.2660 0.5429 0.0335  0.0261  0.0382  398 LEU A CG  
2966 C CD1 . LEU A 398 ? 1.0176 0.2664 0.5543 0.0391  0.0304  0.0428  398 LEU A CD1 
2967 C CD2 . LEU A 398 ? 0.9956 0.2826 0.5611 0.0346  0.0250  0.0318  398 LEU A CD2 
2968 N N   . ARG A 399 ? 0.8829 0.2447 0.4936 0.0556  0.0192  0.0441  399 ARG A N   
2969 C CA  . ARG A 399 ? 0.8706 0.2505 0.4924 0.0654  0.0175  0.0502  399 ARG A CA  
2970 C C   . ARG A 399 ? 0.9169 0.2828 0.5346 0.0790  0.0218  0.0542  399 ARG A C   
2971 O O   . ARG A 399 ? 0.9166 0.2756 0.5329 0.0811  0.0246  0.0487  399 ARG A O   
2972 C CB  . ARG A 399 ? 0.8575 0.2622 0.4946 0.0625  0.0143  0.0450  399 ARG A CB  
2973 C CG  . ARG A 399 ? 1.0020 0.4273 0.6503 0.0696  0.0114  0.0516  399 ARG A CG  
2974 C CD  . ARG A 399 ? 1.0257 0.4700 0.6864 0.0694  0.0095  0.0467  399 ARG A CD  
2975 N NE  . ARG A 399 ? 1.1399 0.5771 0.8011 0.0767  0.0129  0.0439  399 ARG A NE  
2976 C CZ  . ARG A 399 ? 1.2168 0.6684 0.8878 0.0802  0.0121  0.0423  399 ARG A CZ  
2977 N NH1 . ARG A 399 ? 1.0277 0.5015 0.7087 0.0774  0.0076  0.0437  399 ARG A NH1 
2978 N NH2 . ARG A 399 ? 0.8955 0.3375 0.5640 0.0860  0.0162  0.0395  399 ARG A NH2 
2979 N N   . ALA A 400 ? 0.8612 0.2204 0.4754 0.0880  0.0228  0.0639  400 ALA A N   
2980 C CA  . ALA A 400 ? 0.8755 0.2215 0.4873 0.1029  0.0284  0.0692  400 ALA A CA  
2981 C C   . ALA A 400 ? 0.9196 0.2904 0.5500 0.1136  0.0264  0.0772  400 ALA A C   
2982 O O   . ALA A 400 ? 0.9008 0.2890 0.5387 0.1113  0.0202  0.0836  400 ALA A O   
2983 C CB  . ALA A 400 ? 0.9167 0.2356 0.5120 0.1067  0.0314  0.0752  400 ALA A CB  
2984 N N   . SER A 401 ? 0.8990 0.2713 0.5361 0.1242  0.0317  0.0772  401 SER A N   
2985 C CA  . SER A 401 ? 0.8975 0.2954 0.5546 0.1340  0.0303  0.0851  401 SER A CA  
2986 C C   . SER A 401 ? 0.9662 0.3556 0.6264 0.1509  0.0361  0.0958  401 SER A C   
2987 O O   . SER A 401 ? 0.9916 0.3581 0.6426 0.1594  0.0457  0.0937  401 SER A O   
2988 C CB  . SER A 401 ? 0.9518 0.3638 0.6184 0.1335  0.0319  0.0782  401 SER A CB  
2989 O OG  . SER A 401 ? 1.1212 0.5614 0.8080 0.1401  0.0293  0.0861  401 SER A OG  
2990 N N   . PHE A 402 ? 0.8991 0.3064 0.5721 0.1556  0.0303  0.1077  402 PHE A N   
2991 C CA  . PHE A 402 ? 0.8992 0.3032 0.5799 0.1726  0.0345  0.1202  402 PHE A CA  
2992 C C   . PHE A 402 ? 0.9722 0.4023 0.6768 0.1830  0.0369  0.1254  402 PHE A C   
2993 O O   . PHE A 402 ? 0.9879 0.4230 0.7056 0.1980  0.0401  0.1373  402 PHE A O   
2994 C CB  . PHE A 402 ? 0.9119 0.3184 0.5923 0.1723  0.0262  0.1319  402 PHE A CB  
2995 C CG  . PHE A 402 ? 0.8887 0.3222 0.5773 0.1601  0.0137  0.1349  402 PHE A CG  
2996 C CD1 . PHE A 402 ? 0.9001 0.3650 0.6112 0.1645  0.0075  0.1449  402 PHE A CD1 
2997 C CD2 . PHE A 402 ? 0.8908 0.3171 0.5637 0.1440  0.0085  0.1285  402 PHE A CD2 
2998 C CE1 . PHE A 402 ? 0.8916 0.3776 0.6061 0.1521  -0.0043 0.1479  402 PHE A CE1 
2999 C CE2 . PHE A 402 ? 0.9078 0.3551 0.5848 0.1328  -0.0017 0.1312  402 PHE A CE2 
3000 C CZ  . PHE A 402 ? 0.8745 0.3501 0.5706 0.1365  -0.0084 0.1408  402 PHE A CZ  
3001 N N   . SER A 403 ? 0.9151 0.3615 0.6258 0.1753  0.0359  0.1168  403 SER A N   
3002 C CA  . SER A 403 ? 0.9013 0.3734 0.6337 0.1826  0.0381  0.1206  403 SER A CA  
3003 C C   . SER A 403 ? 0.9830 0.4423 0.7188 0.1995  0.0522  0.1226  403 SER A C   
3004 O O   . SER A 403 ? 0.9679 0.4496 0.7261 0.2101  0.0545  0.1318  403 SER A O   
3005 C CB  . SER A 403 ? 0.9184 0.4036 0.6511 0.1699  0.0349  0.1094  403 SER A CB  
3006 O OG  . SER A 403 ? 1.0396 0.5028 0.7588 0.1701  0.0441  0.0981  403 SER A OG  
3007 N N   . SER A 404 ? 0.9773 0.4009 0.6907 0.2014  0.0619  0.1143  404 SER A N   
3008 C CA  . SER A 404 ? 1.0039 0.4107 0.7158 0.2163  0.0771  0.1144  404 SER A CA  
3009 C C   . SER A 404 ? 1.0741 0.4433 0.7678 0.2271  0.0871  0.1166  404 SER A C   
3010 O O   . SER A 404 ? 1.0914 0.4560 0.7935 0.2445  0.0985  0.1238  404 SER A O   
3011 C CB  . SER A 404 ? 1.0804 0.4785 0.7812 0.2090  0.0824  0.1007  404 SER A CB  
3012 O OG  . SER A 404 ? 1.2932 0.6632 0.9674 0.1964  0.0802  0.0898  404 SER A OG  
3013 N N   . ALA A 405 ? 1.0266 0.3673 0.6945 0.2169  0.0843  0.1099  405 ALA A N   
3014 C CA  . ALA A 405 ? 1.0456 0.3451 0.6905 0.2248  0.0937  0.1106  405 ALA A CA  
3015 C C   . ALA A 405 ? 1.0656 0.3657 0.7210 0.2402  0.0949  0.1255  405 ALA A C   
3016 O O   . ALA A 405 ? 1.0412 0.3668 0.7128 0.2381  0.0833  0.1345  405 ALA A O   
3017 C CB  . ALA A 405 ? 1.0642 0.3378 0.6818 0.2084  0.0885  0.1012  405 ALA A CB  
3018 N N   . SER A 406 ? 1.0328 0.3032 0.6779 0.2558  0.1090  0.1285  406 SER A N   
3019 C CA  . SER A 406 ? 1.0409 0.3064 0.6948 0.2735  0.1125  0.1431  406 SER A CA  
3020 C C   . SER A 406 ? 1.0869 0.3270 0.7187 0.2668  0.1058  0.1448  406 SER A C   
3021 O O   . SER A 406 ? 1.0751 0.2895 0.6793 0.2520  0.1047  0.1332  406 SER A O   
3022 C CB  . SER A 406 ? 1.1113 0.3500 0.7595 0.2930  0.1323  0.1445  406 SER A CB  
3023 O OG  . SER A 406 ? 1.2061 0.3933 0.8185 0.2941  0.1416  0.1391  406 SER A OG  
3024 N N   . PRO A 407 ? 1.0670 0.3115 0.7095 0.2777  0.1018  0.1595  407 PRO A N   
3025 C CA  . PRO A 407 ? 1.0979 0.3125 0.7157 0.2724  0.0972  0.1613  407 PRO A CA  
3026 C C   . PRO A 407 ? 1.1629 0.3243 0.7430 0.2715  0.1095  0.1516  407 PRO A C   
3027 O O   . PRO A 407 ? 1.1509 0.2906 0.7058 0.2560  0.1040  0.1452  407 PRO A O   
3028 C CB  . PRO A 407 ? 1.1359 0.3603 0.7729 0.2903  0.0951  0.1801  407 PRO A CB  
3029 C CG  . PRO A 407 ? 1.1518 0.4268 0.8278 0.2948  0.0893  0.1876  407 PRO A CG  
3030 C CD  . PRO A 407 ? 1.0829 0.3582 0.7596 0.2955  0.1012  0.1760  407 PRO A CD  
3031 N N   . GLU A 408 ? 1.1447 0.2853 0.7200 0.2865  0.1262  0.1498  408 GLU A N   
3032 C CA  . GLU A 408 ? 1.1868 0.2745 0.7238 0.2852  0.1388  0.1401  408 GLU A CA  
3033 C C   . GLU A 408 ? 1.2071 0.2886 0.7245 0.2616  0.1338  0.1237  408 GLU A C   
3034 O O   . GLU A 408 ? 1.2151 0.2636 0.7015 0.2485  0.1321  0.1169  408 GLU A O   
3035 C CB  . GLU A 408 ? 1.2332 0.3025 0.7699 0.3054  0.1587  0.1409  408 GLU A CB  
3036 C CG  . GLU A 408 ? 1.4272 0.4897 0.9767 0.3309  0.1676  0.1566  408 GLU A CG  
3037 C CD  . GLU A 408 ? 1.7944 0.9090 1.3908 0.3439  0.1616  0.1713  408 GLU A CD  
3038 O OE1 . GLU A 408 ? 1.7589 0.9127 1.3792 0.3382  0.1571  0.1684  408 GLU A OE1 
3039 O OE2 . GLU A 408 ? 1.7652 0.8807 1.3742 0.3596  0.1610  0.1864  408 GLU A OE2 
3040 N N   . GLN A 409 ? 1.1177 0.2326 0.6548 0.2561  0.1308  0.1182  409 GLN A N   
3041 C CA  . GLN A 409 ? 1.0854 0.2021 0.6111 0.2355  0.1253  0.1040  409 GLN A CA  
3042 C C   . GLN A 409 ? 1.1087 0.2350 0.6307 0.2167  0.1100  0.1019  409 GLN A C   
3043 O O   . GLN A 409 ? 1.1073 0.2089 0.6038 0.2013  0.1081  0.0926  409 GLN A O   
3044 C CB  . GLN A 409 ? 1.0652 0.2211 0.6178 0.2358  0.1238  0.1016  409 GLN A CB  
3045 C CG  . GLN A 409 ? 1.0922 0.2449 0.6531 0.2545  0.1395  0.1044  409 GLN A CG  
3046 C CD  . GLN A 409 ? 1.1925 0.3563 0.7553 0.2468  0.1414  0.0941  409 GLN A CD  
3047 O OE1 . GLN A 409 ? 1.1575 0.3624 0.7482 0.2455  0.1352  0.0959  409 GLN A OE1 
3048 N NE2 . GLN A 409 ? 0.9774 0.1067 0.5083 0.2390  0.1490  0.0827  409 GLN A NE2 
3049 N N   . MET A 410 ? 1.0509 0.2115 0.5973 0.2179  0.0994  0.1114  410 MET A N   
3050 C CA  . MET A 410 ? 1.0416 0.2125 0.5857 0.2013  0.0860  0.1108  410 MET A CA  
3051 C C   . MET A 410 ? 1.1068 0.2362 0.6196 0.1960  0.0878  0.1100  410 MET A C   
3052 O O   . MET A 410 ? 1.0984 0.2204 0.5965 0.1775  0.0819  0.1021  410 MET A O   
3053 C CB  . MET A 410 ? 1.0600 0.2653 0.6300 0.2068  0.0766  0.1236  410 MET A CB  
3054 C CG  . MET A 410 ? 1.0784 0.3277 0.6764 0.2039  0.0700  0.1232  410 MET A CG  
3055 S SD  . MET A 410 ? 1.1341 0.4170 0.7598 0.2136  0.0606  0.1411  410 MET A SD  
3056 C CE  . MET A 410 ? 1.0511 0.3801 0.7042 0.2077  0.0541  0.1383  410 MET A CE  
3057 N N   . ASP A 411 ? 1.0707 0.1727 0.5738 0.2127  0.0965  0.1186  411 ASP A N   
3058 C CA  . ASP A 411 ? 1.0867 0.1457 0.5582 0.2093  0.0992  0.1189  411 ASP A CA  
3059 C C   . ASP A 411 ? 1.1315 0.1560 0.5724 0.1964  0.1047  0.1056  411 ASP A C   
3060 O O   . ASP A 411 ? 1.1288 0.1378 0.5500 0.1790  0.0991  0.1005  411 ASP A O   
3061 C CB  . ASP A 411 ? 1.1348 0.1712 0.6030 0.2313  0.1081  0.1310  411 ASP A CB  
3062 C CG  . ASP A 411 ? 1.2399 0.2442 0.6829 0.2269  0.1053  0.1355  411 ASP A CG  
3063 O OD1 . ASP A 411 ? 1.2916 0.2489 0.7019 0.2269  0.1146  0.1312  411 ASP A OD1 
3064 O OD2 . ASP A 411 ? 1.2051 0.2293 0.6583 0.2217  0.0936  0.1428  411 ASP A OD2 
3065 N N   . VAL A 412 ? 1.0880 0.1030 0.5257 0.2032  0.1149  0.0999  412 VAL A N   
3066 C CA  . VAL A 412 ? 1.1029 0.0871 0.5108 0.1904  0.1200  0.0871  412 VAL A CA  
3067 C C   . VAL A 412 ? 1.1182 0.1241 0.5319 0.1679  0.1076  0.0779  412 VAL A C   
3068 O O   . VAL A 412 ? 1.1088 0.0906 0.4979 0.1510  0.1052  0.0700  412 VAL A O   
3069 C CB  . VAL A 412 ? 1.1571 0.1219 0.5596 0.2051  0.1349  0.0847  412 VAL A CB  
3070 C CG1 . VAL A 412 ? 1.1614 0.1043 0.5395 0.1896  0.1368  0.0711  412 VAL A CG1 
3071 C CG2 . VAL A 412 ? 1.1934 0.1190 0.5785 0.2245  0.1490  0.0922  412 VAL A CG2 
3072 N N   . ALA A 413 ? 1.0618 0.1151 0.5081 0.1671  0.0993  0.0795  413 ALA A N   
3073 C CA  . ALA A 413 ? 1.0505 0.1279 0.5047 0.1474  0.0884  0.0713  413 ALA A CA  
3074 C C   . ALA A 413 ? 1.1466 0.2210 0.5923 0.1319  0.0797  0.0717  413 ALA A C   
3075 O O   . ALA A 413 ? 1.1534 0.2174 0.5853 0.1143  0.0760  0.0635  413 ALA A O   
3076 C CB  . ALA A 413 ? 1.0113 0.1367 0.4999 0.1508  0.0828  0.0730  413 ALA A CB  
3077 N N   . PHE A 414 ? 1.1108 0.1930 0.5639 0.1382  0.0768  0.0816  414 PHE A N   
3078 C CA  . PHE A 414 ? 1.1161 0.1965 0.5613 0.1235  0.0694  0.0822  414 PHE A CA  
3079 C C   . PHE A 414 ? 1.1778 0.2138 0.5892 0.1148  0.0731  0.0792  414 PHE A C   
3080 O O   . PHE A 414 ? 1.1769 0.2109 0.5797 0.0958  0.0679  0.0734  414 PHE A O   
3081 C CB  . PHE A 414 ? 1.1470 0.2486 0.6081 0.1303  0.0639  0.0935  414 PHE A CB  
3082 C CG  . PHE A 414 ? 1.1504 0.2986 0.6419 0.1287  0.0565  0.0936  414 PHE A CG  
3083 C CD1 . PHE A 414 ? 1.1921 0.3639 0.7056 0.1441  0.0557  0.1029  414 PHE A CD1 
3084 C CD2 . PHE A 414 ? 1.1706 0.3386 0.6687 0.1117  0.0507  0.0846  414 PHE A CD2 
3085 C CE1 . PHE A 414 ? 1.1706 0.3829 0.7093 0.1412  0.0486  0.1030  414 PHE A CE1 
3086 C CE2 . PHE A 414 ? 1.1733 0.3807 0.6966 0.1103  0.0446  0.0845  414 PHE A CE2 
3087 C CZ  . PHE A 414 ? 1.1369 0.3652 0.6789 0.1244  0.0435  0.0934  414 PHE A CZ  
3088 N N   . GLN A 415 ? 1.1324 0.1320 0.5241 0.1284  0.0830  0.0827  415 GLN A N   
3089 C CA  . GLN A 415 ? 1.1429 0.0931 0.4975 0.1222  0.0884  0.0802  415 GLN A CA  
3090 C C   . GLN A 415 ? 1.1805 0.1216 0.5213 0.1021  0.0860  0.0681  415 GLN A C   
3091 O O   . GLN A 415 ? 1.1954 0.1144 0.5145 0.0859  0.0833  0.0652  415 GLN A O   
3092 C CB  . GLN A 415 ? 1.1826 0.1001 0.5232 0.1429  0.1012  0.0846  415 GLN A CB  
3093 C CG  . GLN A 415 ? 1.3831 0.2439 0.6819 0.1393  0.1087  0.0826  415 GLN A CG  
3094 C CD  . GLN A 415 ? 1.6658 0.4961 0.9526 0.1609  0.1235  0.0856  415 GLN A CD  
3095 O OE1 . GLN A 415 ? 1.6457 0.4389 0.9108 0.1710  0.1307  0.0917  415 GLN A OE1 
3096 N NE2 . GLN A 415 ? 1.5697 0.4137 0.8696 0.1688  0.1291  0.0815  415 GLN A NE2 
3097 N N   . VAL A 416 ? 1.1061 0.0678 0.4617 0.1021  0.0857  0.0618  416 VAL A N   
3098 C CA  . VAL A 416 ? 1.0886 0.0534 0.4365 0.0837  0.0818  0.0506  416 VAL A CA  
3099 C C   . VAL A 416 ? 1.1080 0.0994 0.4729 0.0661  0.0702  0.0489  416 VAL A C   
3100 O O   . VAL A 416 ? 1.1213 0.0970 0.4699 0.0485  0.0665  0.0454  416 VAL A O   
3101 C CB  . VAL A 416 ? 1.1029 0.0783 0.4641 0.0912  0.0844  0.0465  416 VAL A CB  
3102 C CG1 . VAL A 416 ? 1.0847 0.0655 0.4433 0.0719  0.0773  0.0368  416 VAL A CG1 
3103 C CG2 . VAL A 416 ? 1.1293 0.0703 0.4712 0.1075  0.0978  0.0476  416 VAL A CG2 
3104 N N   . LEU A 417 ? 1.0086 0.0568 0.4063 0.0694  0.0652  0.0493  417 LEU A N   
3105 C CA  . LEU A 417 ? 0.9695 0.0546 0.3872 0.0556  0.0561  0.0471  417 LEU A CA  
3106 C C   . LEU A 417 ? 1.0146 0.0684 0.4169 0.0436  0.0538  0.0512  417 LEU A C   
3107 O O   . LEU A 417 ? 0.9855 0.0524 0.3869 0.0252  0.0490  0.0448  417 LEU A O   
3108 C CB  . LEU A 417 ? 0.9430 0.0634 0.3893 0.0676  0.0540  0.0529  417 LEU A CB  
3109 C CG  . LEU A 417 ? 0.9728 0.1208 0.4450 0.0599  0.0462  0.0524  417 LEU A CG  
3110 C CD1 . LEU A 417 ? 0.9750 0.1381 0.4559 0.0624  0.0434  0.0602  417 LEU A CD1 
3111 C CD2 . LEU A 417 ? 0.9968 0.1488 0.4683 0.0402  0.0416  0.0442  417 LEU A CD2 
3112 N N   . ALA A 418 ? 0.9955 0.0520 0.3856 0.0522  0.0578  0.0558  418 ALA A N   
3113 C CA  . ALA A 418 ? 1.0132 0.0521 0.3858 0.0425  0.0567  0.0587  418 ALA A CA  
3114 C C   . ALA A 418 ? 1.0976 0.0795 0.4426 0.0269  0.0574  0.0566  418 ALA A C   
3115 O O   . ALA A 418 ? 1.0782 0.0655 0.4222 0.0087  0.0529  0.0540  418 ALA A O   
3116 C CB  . ALA A 418 ? 1.0440 0.0569 0.4050 0.0586  0.0614  0.0691  418 ALA A CB  
3117 N N   . GLN A 419 ? 1.1084 0.0584 0.4328 0.0324  0.0632  0.0538  419 GLN A N   
3118 C CA  . GLN A 419 ? 1.1433 0.0583 0.4385 0.0169  0.0638  0.0478  419 GLN A CA  
3119 C C   . GLN A 419 ? 1.1743 0.1169 0.4855 -0.0034 0.0550  0.0412  419 GLN A C   
3120 O O   . GLN A 419 ? 1.1879 0.1199 0.4870 -0.0224 0.0513  0.0394  419 GLN A O   
3121 C CB  . GLN A 419 ? 1.1783 0.0673 0.4575 0.0269  0.0707  0.0443  419 GLN A CB  
3122 C CG  . GLN A 419 ? 1.4077 0.2394 0.6452 0.0292  0.0790  0.0453  419 GLN A CG  
3123 C CD  . GLN A 419 ? 1.4950 0.2995 0.7055 0.0057  0.0748  0.0421  419 GLN A CD  
3124 O OE1 . GLN A 419 ? 1.4526 0.2257 0.6390 0.0041  0.0779  0.0464  419 GLN A OE1 
3125 N NE2 . GLN A 419 ? 1.1636 0.0436 0.3793 -0.0122 0.0670  0.0296  419 GLN A NE2 
3126 N N   . LEU A 420 ? 1.0765 0.0557 0.4163 0.0013  0.0518  0.0380  420 LEU A N   
3127 C CA  . LEU A 420 ? 1.0447 0.0526 0.4035 -0.0145 0.0438  0.0321  420 LEU A CA  
3128 C C   . LEU A 420 ? 1.0663 0.1018 0.4433 -0.0256 0.0392  0.0337  420 LEU A C   
3129 O O   . LEU A 420 ? 1.0883 0.1309 0.4686 -0.0440 0.0340  0.0302  420 LEU A O   
3130 C CB  . LEU A 420 ? 1.0159 0.0515 0.3974 -0.0055 0.0423  0.0287  420 LEU A CB  
3131 C CG  . LEU A 420 ? 1.0985 0.1073 0.4622 0.0058  0.0484  0.0269  420 LEU A CG  
3132 C CD1 . LEU A 420 ? 1.0687 0.1075 0.4573 0.0199  0.0491  0.0263  420 LEU A CD1 
3133 C CD2 . LEU A 420 ? 1.1532 0.1343 0.4930 -0.0098 0.0457  0.0208  420 LEU A CD2 
3134 N N   . ILE A 421 ? 0.9675 0.0454 0.3549 -0.0148 0.0413  0.0362  421 ILE A N   
3135 C CA  . ILE A 421 ? 0.9334 0.0461 0.3344 -0.0247 0.0383  0.0360  421 ILE A CA  
3136 C C   . ILE A 421 ? 0.9847 0.0595 0.3623 -0.0418 0.0384  0.0374  421 ILE A C   
3137 O O   . ILE A 421 ? 0.9543 0.0600 0.3424 -0.0570 0.0348  0.0330  421 ILE A O   
3138 C CB  . ILE A 421 ? 0.9577 0.0583 0.3684 -0.0124 0.0401  0.0459  421 ILE A CB  
3139 C CG1 . ILE A 421 ? 0.9384 0.0611 0.3757 0.0004  0.0386  0.0467  421 ILE A CG1 
3140 C CG2 . ILE A 421 ? 0.9353 0.0590 0.3520 -0.0241 0.0386  0.0462  421 ILE A CG2 
3141 C CD1 . ILE A 421 ? 1.0345 0.1573 0.4759 0.0190  0.0406  0.0549  421 ILE A CD1 
3142 N N   . LYS A 422 ? 0.9967 0.0472 0.3431 -0.0371 0.0426  0.0378  422 LYS A N   
3143 C CA  . LYS A 422 ? 1.0320 0.0487 0.3502 -0.0521 0.0432  0.0385  422 LYS A CA  
3144 C C   . LYS A 422 ? 1.0795 0.0567 0.3928 -0.0738 0.0387  0.0372  422 LYS A C   
3145 O O   . LYS A 422 ? 1.0565 0.0564 0.3679 -0.0904 0.0359  0.0345  422 LYS A O   
3146 C CB  . LYS A 422 ? 1.0947 0.0519 0.3779 -0.0424 0.0495  0.0439  422 LYS A CB  
3147 C CG  . LYS A 422 ? 1.0968 0.0494 0.3833 -0.0220 0.0537  0.0516  422 LYS A CG  
3148 C CD  . LYS A 422 ? 1.2709 0.1411 0.5207 -0.0156 0.0600  0.0617  422 LYS A CD  
3149 C CE  . LYS A 422 ? 1.3582 0.2005 0.5927 -0.0003 0.0665  0.0606  422 LYS A CE  
3150 N NZ  . LYS A 422 ? 1.4662 0.2659 0.6724 0.0121  0.0735  0.0676  422 LYS A NZ  
3151 N N   . GLU A 423 ? 1.0522 0.0487 0.3631 -0.0688 0.0372  0.0302  423 GLU A N   
3152 C CA  . GLU A 423 ? 1.0666 0.0524 0.3708 -0.0884 0.0311  0.0262  423 GLU A CA  
3153 C C   . GLU A 423 ? 1.0758 0.0704 0.4121 -0.1063 0.0246  0.0275  423 GLU A C   
3154 O O   . GLU A 423 ? 1.0729 0.0678 0.4040 -0.1261 0.0208  0.0269  423 GLU A O   
3155 C CB  . GLU A 423 ? 1.1016 0.0564 0.3898 -0.0862 0.0307  0.0230  423 GLU A CB  
3156 C CG  . GLU A 423 ? 1.2426 0.1841 0.5429 -0.0659 0.0350  0.0241  423 GLU A CG  
3157 C CD  . GLU A 423 ? 1.5236 0.4231 0.7924 -0.0576 0.0408  0.0222  423 GLU A CD  
3158 O OE1 . GLU A 423 ? 1.3800 0.2677 0.6374 -0.0688 0.0364  0.0173  423 GLU A OE1 
3159 O OE2 . GLU A 423 ? 1.5161 0.3942 0.7715 -0.0397 0.0499  0.0258  423 GLU A OE2 
3160 N N   . SER A 424 ? 0.9983 0.0550 0.3679 -0.0935 0.0239  0.0251  424 SER A N   
3161 C CA  . SER A 424 ? 0.9685 0.0626 0.3714 -0.1043 0.0194  0.0241  424 SER A CA  
3162 C C   . SER A 424 ? 1.0307 0.1135 0.4354 -0.1159 0.0225  0.0289  424 SER A C   
3163 O O   . SER A 424 ? 1.0164 0.1247 0.4417 -0.1302 0.0198  0.0279  424 SER A O   
3164 C CB  . SER A 424 ? 0.9741 0.0878 0.4073 -0.0915 0.0193  0.0240  424 SER A CB  
3165 O OG  . SER A 424 ? 1.1146 0.2209 0.5413 -0.0727 0.0250  0.0274  424 SER A OG  
3166 N N   . LEU A 425 ? 1.0083 0.0649 0.3901 -0.1088 0.0282  0.0334  425 LEU A N   
3167 C CA  . LEU A 425 ? 1.0069 0.0627 0.3846 -0.1186 0.0313  0.0369  425 LEU A CA  
3168 C C   . LEU A 425 ? 1.0864 0.1160 0.4420 -0.1393 0.0297  0.0369  425 LEU A C   
3169 O O   . LEU A 425 ? 1.0749 0.1111 0.4332 -0.1532 0.0312  0.0387  425 LEU A O   
3170 C CB  . LEU A 425 ? 1.0097 0.0581 0.3746 -0.1031 0.0365  0.0418  425 LEU A CB  
3171 C CG  . LEU A 425 ? 1.0244 0.0999 0.4149 -0.0879 0.0374  0.0439  425 LEU A CG  
3172 C CD1 . LEU A 425 ? 1.0399 0.0979 0.4152 -0.0727 0.0407  0.0505  425 LEU A CD1 
3173 C CD2 . LEU A 425 ? 1.0144 0.1266 0.4310 -0.0977 0.0377  0.0425  425 LEU A CD2 
3174 N N   . LEU A 426 ? 1.0882 0.0901 0.4233 -0.1431 0.0265  0.0347  426 LEU A N   
3175 C CA  . LEU A 426 ? 1.1370 0.1108 0.4478 -0.1646 0.0237  0.0346  426 LEU A CA  
3176 C C   . LEU A 426 ? 1.1869 0.1865 0.5195 -0.1839 0.0155  0.0317  426 LEU A C   
3177 O O   . LEU A 426 ? 1.1998 0.1760 0.5122 -0.2023 0.0109  0.0315  426 LEU A O   
3178 C CB  . LEU A 426 ? 1.1796 0.1015 0.4491 -0.1600 0.0252  0.0344  426 LEU A CB  
3179 C CG  . LEU A 426 ? 1.2580 0.1491 0.5036 -0.1417 0.0332  0.0384  426 LEU A CG  
3180 C CD1 . LEU A 426 ? 1.2978 0.1425 0.5081 -0.1350 0.0357  0.0372  426 LEU A CD1 
3181 C CD2 . LEU A 426 ? 1.2988 0.1744 0.5286 -0.1510 0.0364  0.0431  426 LEU A CD2 
3182 N N   . VAL A 427 ? 1.1034 0.1507 0.4769 -0.1800 0.0134  0.0299  427 VAL A N   
3183 C CA  . VAL A 427 ? 1.0750 0.1536 0.4766 -0.1947 0.0056  0.0280  427 VAL A CA  
3184 C C   . VAL A 427 ? 1.4704 0.5750 0.8931 -0.2116 0.0069  0.0304  427 VAL A C   
3185 O O   . VAL A 427 ? 0.9564 0.0971 0.3822 -0.2236 0.0001  0.0284  427 VAL A O   
3186 C CB  . VAL A 427 ? 1.0670 0.1785 0.4987 -0.1802 0.0028  0.0249  427 VAL A CB  
3187 C CG1 . VAL A 427 ? 1.0426 0.1925 0.5096 -0.1933 -0.0044 0.0241  427 VAL A CG1 
3188 C CG2 . VAL A 427 ? 1.0696 0.1539 0.4793 -0.1695 0.0003  0.0224  427 VAL A CG2 
3189 N N   . MET B 1   ? 0.9961 1.4081 0.8725 -0.0770 -0.2065 0.1721  1   MET B N   
3190 C CA  . MET B 1   ? 0.9636 1.3943 0.8727 -0.0406 -0.1874 0.1880  1   MET B CA  
3191 C C   . MET B 1   ? 0.9842 1.4029 0.9116 -0.0387 -0.1695 0.1829  1   MET B C   
3192 O O   . MET B 1   ? 0.9867 1.3675 0.8948 -0.0610 -0.1688 0.1635  1   MET B O   
3193 C CB  . MET B 1   ? 0.9847 1.3748 0.8698 -0.0095 -0.1742 0.1833  1   MET B CB  
3194 C CG  . MET B 1   ? 1.0111 1.3316 0.8687 -0.0027 -0.1551 0.1594  1   MET B CG  
3195 S SD  . MET B 1   ? 1.0523 1.3349 0.8927 0.0352  -0.1374 0.1594  1   MET B SD  
3196 C CE  . MET B 1   ? 0.9937 1.3164 0.8778 0.0671  -0.1224 0.1834  1   MET B CE  
3197 N N   . ASN B 2   ? 0.9016 1.3503 0.8640 -0.0108 -0.1541 0.2006  2   ASN B N   
3198 C CA  . ASN B 2   ? 0.8678 1.3072 0.8468 -0.0052 -0.1353 0.1980  2   ASN B CA  
3199 C C   . ASN B 2   ? 0.8436 1.2220 0.7983 0.0201  -0.1136 0.1830  2   ASN B C   
3200 O O   . ASN B 2   ? 0.8433 1.2123 0.7914 0.0477  -0.1060 0.1881  2   ASN B O   
3201 C CB  . ASN B 2   ? 0.8848 1.3907 0.9138 0.0095  -0.1290 0.2251  2   ASN B CB  
3202 C CG  . ASN B 2   ? 1.1587 1.6501 1.1998 0.0228  -0.1056 0.2231  2   ASN B CG  
3203 O OD1 . ASN B 2   ? 1.0720 1.5569 1.1191 0.0568  -0.0860 0.2297  2   ASN B OD1 
3204 N ND2 . ASN B 2   ? 1.0346 1.5104 1.0721 -0.0041 -0.1066 0.2113  2   ASN B ND2 
3205 N N   . TYR B 3   ? 0.7315 1.0697 0.6735 0.0101  -0.1038 0.1659  3   TYR B N   
3206 C CA  . TYR B 3   ? 0.6945 0.9775 0.6141 0.0300  -0.0851 0.1519  3   TYR B CA  
3207 C C   . TYR B 3   ? 0.6970 0.9860 0.6371 0.0483  -0.0652 0.1591  3   TYR B C   
3208 O O   . TYR B 3   ? 0.6685 0.9201 0.5932 0.0701  -0.0492 0.1523  3   TYR B O   
3209 C CB  . TYR B 3   ? 0.7125 0.9410 0.5983 0.0096  -0.0876 0.1274  3   TYR B CB  
3210 C CG  . TYR B 3   ? 0.7462 0.9562 0.6030 -0.0009 -0.1016 0.1178  3   TYR B CG  
3211 C CD1 . TYR B 3   ? 0.7927 1.0060 0.6384 -0.0320 -0.1189 0.1110  3   TYR B CD1 
3212 C CD2 . TYR B 3   ? 0.7505 0.9406 0.5896 0.0198  -0.0976 0.1167  3   TYR B CD2 
3213 C CE1 . TYR B 3   ? 0.8203 1.0166 0.6360 -0.0412 -0.1310 0.1024  3   TYR B CE1 
3214 C CE2 . TYR B 3   ? 0.7697 0.9457 0.5819 0.0107  -0.1097 0.1096  3   TYR B CE2 
3215 C CZ  . TYR B 3   ? 0.8165 0.9957 0.6162 -0.0193 -0.1261 0.1021  3   TYR B CZ  
3216 O OH  . TYR B 3   ? 0.7252 0.8878 0.4939 -0.0286 -0.1369 0.0941  3   TYR B OH  
3217 N N   . ALA B 4   ? 0.6562 0.9928 0.6298 0.0387  -0.0662 0.1733  4   ALA B N   
3218 C CA  . ALA B 4   ? 0.6495 0.9992 0.6448 0.0536  -0.0471 0.1823  4   ALA B CA  
3219 C C   . ALA B 4   ? 0.7112 1.0520 0.7055 0.0923  -0.0283 0.1893  4   ALA B C   
3220 O O   . ALA B 4   ? 0.7054 1.0114 0.6869 0.1060  -0.0105 0.1815  4   ALA B O   
3221 C CB  . ALA B 4   ? 0.6583 1.0760 0.6956 0.0407  -0.0531 0.2031  4   ALA B CB  
3222 N N   . ARG B 5   ? 0.6759 1.0447 0.6800 0.1092  -0.0331 0.2037  5   ARG B N   
3223 C CA  . ARG B 5   ? 0.6752 1.0371 0.6774 0.1462  -0.0179 0.2130  5   ARG B CA  
3224 C C   . ARG B 5   ? 0.7229 1.0129 0.6853 0.1593  -0.0045 0.1932  5   ARG B C   
3225 O O   . ARG B 5   ? 0.7266 1.0008 0.6849 0.1870  0.0144  0.1973  5   ARG B O   
3226 C CB  . ARG B 5   ? 0.6850 1.0735 0.6916 0.1519  -0.0327 0.2254  5   ARG B CB  
3227 C CG  . ARG B 5   ? 0.7870 1.1861 0.8024 0.1907  -0.0188 0.2431  5   ARG B CG  
3228 C CD  . ARG B 5   ? 0.7195 1.1321 0.7306 0.1958  -0.0338 0.2527  5   ARG B CD  
3229 N NE  . ARG B 5   ? 0.7756 1.1427 0.7613 0.2261  -0.0197 0.2510  5   ARG B NE  
3230 C CZ  . ARG B 5   ? 0.9732 1.3278 0.9412 0.2321  -0.0289 0.2536  5   ARG B CZ  
3231 N NH1 . ARG B 5   ? 0.8100 1.1190 0.7538 0.2583  -0.0147 0.2519  5   ARG B NH1 
3232 N NH2 . ARG B 5   ? 0.8205 1.2057 0.7922 0.2107  -0.0524 0.2577  5   ARG B NH2 
3233 N N   . PHE B 6   ? 0.6745 0.9220 0.6073 0.1392  -0.0143 0.1727  6   PHE B N   
3234 C CA  . PHE B 6   ? 0.6759 0.8598 0.5720 0.1462  -0.0061 0.1543  6   PHE B CA  
3235 C C   . PHE B 6   ? 0.7243 0.8738 0.6072 0.1343  0.0013  0.1382  6   PHE B C   
3236 O O   . PHE B 6   ? 0.7254 0.8262 0.5793 0.1333  0.0039  0.1222  6   PHE B O   
3237 C CB  . PHE B 6   ? 0.7053 0.8691 0.5788 0.1338  -0.0215 0.1445  6   PHE B CB  
3238 C CG  . PHE B 6   ? 0.7419 0.9421 0.6264 0.1392  -0.0334 0.1601  6   PHE B CG  
3239 C CD1 . PHE B 6   ? 0.7862 1.0284 0.6865 0.1170  -0.0522 0.1665  6   PHE B CD1 
3240 C CD2 . PHE B 6   ? 0.7935 0.9840 0.6704 0.1655  -0.0265 0.1689  6   PHE B CD2 
3241 C CE1 . PHE B 6   ? 0.8117 1.0902 0.7216 0.1214  -0.0648 0.1822  6   PHE B CE1 
3242 C CE2 . PHE B 6   ? 0.8457 1.0703 0.7324 0.1715  -0.0379 0.1851  6   PHE B CE2 
3243 C CZ  . PHE B 6   ? 0.8198 1.0902 0.7235 0.1495  -0.0576 0.1920  6   PHE B CZ  
3244 N N   . ILE B 7   ? 0.6579 0.8349 0.5630 0.1245  0.0042  0.1438  7   ILE B N   
3245 C CA  . ILE B 7   ? 0.6263 0.7767 0.5221 0.1121  0.0104  0.1318  7   ILE B CA  
3246 C C   . ILE B 7   ? 0.6614 0.8260 0.5715 0.1287  0.0289  0.1421  7   ILE B C   
3247 O O   . ILE B 7   ? 0.6570 0.8701 0.5984 0.1249  0.0294  0.1574  7   ILE B O   
3248 C CB  . ILE B 7   ? 0.6483 0.8135 0.5530 0.0797  -0.0043 0.1280  7   ILE B CB  
3249 C CG1 . ILE B 7   ? 0.6351 0.7869 0.5230 0.0627  -0.0222 0.1178  7   ILE B CG1 
3250 C CG2 . ILE B 7   ? 0.6543 0.7923 0.5504 0.0687  0.0030  0.1182  7   ILE B CG2 
3251 C CD1 . ILE B 7   ? 0.5284 0.7100 0.4299 0.0331  -0.0388 0.1205  7   ILE B CD1 
3252 N N   . THR B 8   ? 0.6014 0.7237 0.4873 0.1455  0.0441  0.1337  8   THR B N   
3253 C CA  . THR B 8   ? 0.5903 0.7126 0.4783 0.1628  0.0640  0.1398  8   THR B CA  
3254 C C   . THR B 8   ? 0.6214 0.7713 0.5303 0.1465  0.0660  0.1454  8   THR B C   
3255 O O   . THR B 8   ? 0.6114 0.7582 0.5209 0.1206  0.0534  0.1382  8   THR B O   
3256 C CB  . THR B 8   ? 0.6919 0.7549 0.5420 0.1723  0.0745  0.1245  8   THR B CB  
3257 O OG1 . THR B 8   ? 0.6913 0.7237 0.5243 0.1509  0.0649  0.1089  8   THR B OG1 
3258 C CG2 . THR B 8   ? 0.6753 0.7100 0.5044 0.1922  0.0782  0.1219  8   THR B CG2 
3259 N N   . ALA B 9   ? 0.5826 0.7569 0.5069 0.1623  0.0832  0.1587  9   ALA B N   
3260 C CA  . ALA B 9   ? 0.5664 0.7682 0.5108 0.1500  0.0890  0.1667  9   ALA B CA  
3261 C C   . ALA B 9   ? 0.6107 0.7709 0.5314 0.1298  0.0856  0.1506  9   ALA B C   
3262 O O   . ALA B 9   ? 0.5907 0.7658 0.5250 0.1047  0.0763  0.1517  9   ALA B O   
3263 C CB  . ALA B 9   ? 0.5836 0.7993 0.5340 0.1764  0.1131  0.1790  9   ALA B CB  
3264 N N   . ALA B 10  ? 0.5751 0.6818 0.4596 0.1400  0.0918  0.1360  10  ALA B N   
3265 C CA  . ALA B 10  ? 0.5705 0.6357 0.4303 0.1257  0.0891  0.1216  10  ALA B CA  
3266 C C   . ALA B 10  ? 0.6098 0.6622 0.4664 0.1033  0.0696  0.1110  10  ALA B C   
3267 O O   . ALA B 10  ? 0.6012 0.6466 0.4580 0.0836  0.0643  0.1074  10  ALA B O   
3268 C CB  . ALA B 10  ? 0.5921 0.6102 0.4163 0.1427  0.0988  0.1109  10  ALA B CB  
3269 N N   . SER B 11  ? 0.5637 0.6114 0.4157 0.1069  0.0599  0.1066  11  SER B N   
3270 C CA  . SER B 11  ? 0.5675 0.6032 0.4141 0.0877  0.0430  0.0966  11  SER B CA  
3271 C C   . SER B 11  ? 0.6512 0.7215 0.5223 0.0645  0.0327  0.1036  11  SER B C   
3272 O O   . SER B 11  ? 0.6501 0.7023 0.5139 0.0441  0.0249  0.0952  11  SER B O   
3273 C CB  . SER B 11  ? 0.6116 0.6436 0.4511 0.0972  0.0362  0.0942  11  SER B CB  
3274 O OG  . SER B 11  ? 0.7043 0.7320 0.5402 0.0794  0.0204  0.0867  11  SER B OG  
3275 N N   . ALA B 12  ? 0.6149 0.7349 0.5150 0.0682  0.0336  0.1200  12  ALA B N   
3276 C CA  . ALA B 12  ? 0.6115 0.7722 0.5382 0.0457  0.0233  0.1297  12  ALA B CA  
3277 C C   . ALA B 12  ? 0.6611 0.8216 0.5941 0.0299  0.0288  0.1320  12  ALA B C   
3278 O O   . ALA B 12  ? 0.6455 0.8132 0.5855 0.0031  0.0172  0.1314  12  ALA B O   
3279 C CB  . ALA B 12  ? 0.6191 0.8367 0.5775 0.0572  0.0245  0.1493  12  ALA B CB  
3280 N N   . ALA B 13  ? 0.6371 0.7855 0.5640 0.0457  0.0465  0.1342  13  ALA B N   
3281 C CA  . ALA B 13  ? 0.6440 0.7894 0.5735 0.0347  0.0549  0.1378  13  ALA B CA  
3282 C C   . ALA B 13  ? 0.6910 0.7987 0.6029 0.0107  0.0447  0.1249  13  ALA B C   
3283 O O   . ALA B 13  ? 0.6867 0.8079 0.6118 -0.0122 0.0401  0.1304  13  ALA B O   
3284 C CB  . ALA B 13  ? 0.6545 0.7804 0.5682 0.0576  0.0743  0.1380  13  ALA B CB  
3285 N N   . ARG B 14  ? 0.6354 0.6968 0.5181 0.0165  0.0413  0.1087  14  ARG B N   
3286 C CA  . ARG B 14  ? 0.6298 0.6480 0.4907 0.0022  0.0338  0.0948  14  ARG B CA  
3287 C C   . ARG B 14  ? 0.7112 0.7288 0.5777 -0.0266 0.0235  0.0943  14  ARG B C   
3288 O O   . ARG B 14  ? 0.7109 0.7583 0.5940 -0.0410 0.0132  0.0992  14  ARG B O   
3289 C CB  . ARG B 14  ? 0.5881 0.5785 0.4286 0.0109  0.0271  0.0813  14  ARG B CB  
3290 C CG  . ARG B 14  ? 0.6319 0.6046 0.4571 0.0348  0.0373  0.0783  14  ARG B CG  
3291 C CD  . ARG B 14  ? 0.6535 0.5896 0.4553 0.0387  0.0319  0.0642  14  ARG B CD  
3292 N NE  . ARG B 14  ? 0.6395 0.5660 0.4293 0.0597  0.0390  0.0629  14  ARG B NE  
3293 C CZ  . ARG B 14  ? 0.7889 0.6953 0.5637 0.0696  0.0484  0.0615  14  ARG B CZ  
3294 N NH1 . ARG B 14  ? 0.7217 0.6169 0.4927 0.0619  0.0516  0.0621  14  ARG B NH1 
3295 N NH2 . ARG B 14  ? 0.5392 0.4343 0.3003 0.0865  0.0543  0.0598  14  ARG B NH2 
3296 N N   . ASN B 15  ? 0.6959 0.6769 0.5463 -0.0351 0.0256  0.0882  15  ASN B N   
3297 C CA  . ASN B 15  ? 0.7242 0.6906 0.5725 -0.0614 0.0180  0.0859  15  ASN B CA  
3298 C C   . ASN B 15  ? 0.8352 0.7471 0.6552 -0.0628 0.0161  0.0714  15  ASN B C   
3299 O O   . ASN B 15  ? 0.8267 0.7162 0.6333 -0.0457 0.0238  0.0681  15  ASN B O   
3300 C CB  . ASN B 15  ? 0.7013 0.6879 0.5667 -0.0739 0.0247  0.1001  15  ASN B CB  
3301 C CG  . ASN B 15  ? 0.9820 1.0262 0.8791 -0.0813 0.0221  0.1145  15  ASN B CG  
3302 O OD1 . ASN B 15  ? 0.8972 0.9589 0.8025 -0.0969 0.0084  0.1135  15  ASN B OD1 
3303 N ND2 . ASN B 15  ? 0.8691 0.9458 0.7843 -0.0690 0.0353  0.1288  15  ASN B ND2 
3304 N N   . PRO B 16  ? 0.8352 0.7254 0.6446 -0.0823 0.0060  0.0628  16  PRO B N   
3305 C CA  . PRO B 16  ? 0.8517 0.6903 0.6347 -0.0804 0.0063  0.0499  16  PRO B CA  
3306 C C   . PRO B 16  ? 0.9427 0.7522 0.7177 -0.0814 0.0149  0.0534  16  PRO B C   
3307 O O   . PRO B 16  ? 0.9432 0.7714 0.7316 -0.0847 0.0211  0.0656  16  PRO B O   
3308 C CB  . PRO B 16  ? 0.8955 0.7198 0.6679 -0.1015 -0.0052 0.0406  16  PRO B CB  
3309 C CG  . PRO B 16  ? 0.9420 0.8150 0.7361 -0.1138 -0.0141 0.0487  16  PRO B CG  
3310 C CD  . PRO B 16  ? 0.8658 0.7767 0.6852 -0.1069 -0.0058 0.0647  16  PRO B CD  
3311 N N   . SER B 17  ? 0.9273 0.6922 0.6808 -0.0773 0.0162  0.0439  17  SER B N   
3312 C CA  . SER B 17  ? 1.4339 1.1653 1.1766 -0.0756 0.0236  0.0470  17  SER B CA  
3313 C C   . SER B 17  ? 1.8329 1.5633 1.5818 -0.0965 0.0256  0.0571  17  SER B C   
3314 O O   . SER B 17  ? 1.2477 0.9792 1.0000 -0.0922 0.0337  0.0678  17  SER B O   
3315 C CB  . SER B 17  ? 1.5014 1.1873 1.2220 -0.0724 0.0229  0.0353  17  SER B CB  
3316 O OG  . SER B 17  ? 1.6506 1.3202 1.3616 -0.0920 0.0159  0.0268  17  SER B OG  
3317 N N   . GLY B 29  ? 2.3862 1.1884 1.5606 -0.2898 0.0450  -0.1565 29  GLY B N   
3318 C CA  . GLY B 29  ? 2.4400 1.1652 1.5898 -0.2764 0.0645  -0.1549 29  GLY B CA  
3319 C C   . GLY B 29  ? 2.4311 1.1782 1.6166 -0.2302 0.0809  -0.1383 29  GLY B C   
3320 O O   . GLY B 29  ? 2.3971 1.1675 1.6153 -0.2294 0.0807  -0.1191 29  GLY B O   
3321 N N   . PRO B 30  ? 2.3674 1.1087 1.5471 -0.1916 0.0954  -0.1443 30  PRO B N   
3322 C CA  . PRO B 30  ? 2.3071 1.0740 1.5225 -0.1489 0.1093  -0.1270 30  PRO B CA  
3323 C C   . PRO B 30  ? 2.3737 1.0638 1.5646 -0.1277 0.1309  -0.1229 30  PRO B C   
3324 O O   . PRO B 30  ? 2.4488 1.0688 1.6009 -0.1512 0.1333  -0.1297 30  PRO B O   
3325 C CB  . PRO B 30  ? 2.2900 1.0943 1.5139 -0.1216 0.1128  -0.1340 30  PRO B CB  
3326 C CG  . PRO B 30  ? 2.3955 1.1687 1.5735 -0.1451 0.1067  -0.1577 30  PRO B CG  
3327 C CD  . PRO B 30  ? 2.4148 1.1304 1.5564 -0.1856 0.0996  -0.1655 30  PRO B CD  
3328 N N   . LYS B 31  ? 2.2559 0.9598 1.4698 -0.0840 0.1460  -0.1104 31  LYS B N   
3329 C CA  . LYS B 31  ? 2.2835 0.9263 1.4824 -0.0545 0.1679  -0.1023 31  LYS B CA  
3330 C C   . LYS B 31  ? 2.3043 0.9279 1.5121 -0.0657 0.1672  -0.0847 31  LYS B C   
3331 O O   . LYS B 31  ? 2.2749 0.9129 1.5092 -0.0370 0.1757  -0.0649 31  LYS B O   
3332 C CB  . LYS B 31  ? 2.4011 0.9525 1.5395 -0.0481 0.1856  -0.1225 31  LYS B CB  
3333 C CG  . LYS B 31  ? 2.4450 0.9510 1.5757 -0.0026 0.2117  -0.1138 31  LYS B CG  
3334 C CD  . LYS B 31  ? 2.4182 0.9520 1.5575 0.0345  0.2238  -0.1180 31  LYS B CD  
3335 C CE  . LYS B 31  ? 2.3069 0.9252 1.5074 0.0638  0.2213  -0.0957 31  LYS B CE  
3336 N NZ  . LYS B 31  ? 2.3094 0.9535 1.5177 0.0970  0.2333  -0.0992 31  LYS B NZ  
3337 N N   . SER B 32  ? 2.2640 0.8577 1.4498 -0.1085 0.1563  -0.0908 32  SER B N   
3338 C CA  . SER B 32  ? 2.2614 0.8368 1.4529 -0.1272 0.1540  -0.0751 32  SER B CA  
3339 C C   . SER B 32  ? 2.1671 0.8333 1.4173 -0.1259 0.1417  -0.0533 32  SER B C   
3340 O O   . SER B 32  ? 2.1698 0.8330 1.4307 -0.1393 0.1398  -0.0373 32  SER B O   
3341 C CB  . SER B 32  ? 2.3630 0.8950 1.5192 -0.1777 0.1428  -0.0882 32  SER B CB  
3342 O OG  . SER B 32  ? 2.4095 1.0095 1.5865 -0.2073 0.1211  -0.0942 32  SER B OG  
3343 N N   . MET B 33  ? 1.9954 0.7382 1.2806 -0.1090 0.1348  -0.0526 33  MET B N   
3344 C CA  . MET B 33  ? 1.8828 0.7111 1.2194 -0.1054 0.1239  -0.0351 33  MET B CA  
3345 C C   . MET B 33  ? 1.8169 0.6628 1.1795 -0.0694 0.1338  -0.0144 33  MET B C   
3346 O O   . MET B 33  ? 1.7818 0.6295 1.1481 -0.0347 0.1439  -0.0139 33  MET B O   
3347 C CB  . MET B 33  ? 1.8498 0.7498 1.2095 -0.1092 0.1103  -0.0437 33  MET B CB  
3348 C CG  . MET B 33  ? 1.9184 0.8224 1.2638 -0.1505 0.0950  -0.0577 33  MET B CG  
3349 S SD  . MET B 33  ? 1.9970 0.9025 1.3498 -0.1928 0.0844  -0.0457 33  MET B SD  
3350 C CE  . MET B 33  ? 2.0420 0.8794 1.3414 -0.2333 0.0785  -0.0686 33  MET B CE  
3351 N N   . ILE B 34  ? 1.7243 0.5837 1.1041 -0.0797 0.1305  0.0038  34  ILE B N   
3352 C CA  . ILE B 34  ? 1.6750 0.5574 1.0802 -0.0534 0.1359  0.0264  34  ILE B CA  
3353 C C   . ILE B 34  ? 1.6226 0.5878 1.0661 -0.0655 0.1211  0.0344  34  ILE B C   
3354 O O   . ILE B 34  ? 1.5925 0.5734 1.0383 -0.0990 0.1108  0.0310  34  ILE B O   
3355 C CB  . ILE B 34  ? 1.7672 0.5887 1.1539 -0.0579 0.1454  0.0408  34  ILE B CB  
3356 C CG1 . ILE B 34  ? 1.8531 0.5829 1.1957 -0.0481 0.1612  0.0306  34  ILE B CG1 
3357 C CG2 . ILE B 34  ? 1.7293 0.5792 1.1419 -0.0318 0.1492  0.0660  34  ILE B CG2 
3358 C CD1 . ILE B 34  ? 1.9940 0.6598 1.2988 -0.0865 0.1600  0.0185  34  ILE B CD1 
3359 N N   . SER B 35  ? 1.5328 0.5514 1.0052 -0.0387 0.1201  0.0441  35  SER B N   
3360 C CA  . SER B 35  ? 1.4745 0.5667 0.9791 -0.0470 0.1080  0.0505  35  SER B CA  
3361 C C   . SER B 35  ? 1.5078 0.6351 1.0355 -0.0291 0.1086  0.0714  35  SER B C   
3362 O O   . SER B 35  ? 1.4921 0.6260 1.0269 0.0009  0.1135  0.0788  35  SER B O   
3363 C CB  . SER B 35  ? 1.4893 0.6258 1.0055 -0.0435 0.1003  0.0361  35  SER B CB  
3364 O OG  . SER B 35  ? 1.6637 0.7776 1.1596 -0.0683 0.0959  0.0181  35  SER B OG  
3365 N N   . LEU B 36  ? 1.4583 0.6115 0.9978 -0.0492 0.1031  0.0814  36  LEU B N   
3366 C CA  . LEU B 36  ? 1.4212 0.6128 0.9802 -0.0392 0.1020  0.1005  36  LEU B CA  
3367 C C   . LEU B 36  ? 1.4193 0.6768 1.0013 -0.0508 0.0918  0.0969  36  LEU B C   
3368 O O   . LEU B 36  ? 1.3981 0.6922 0.9948 -0.0504 0.0901  0.1101  36  LEU B O   
3369 C CB  . LEU B 36  ? 1.4584 0.6181 1.0077 -0.0536 0.1072  0.1162  36  LEU B CB  
3370 C CG  . LEU B 36  ? 1.5745 0.6582 1.0959 -0.0493 0.1178  0.1183  36  LEU B CG  
3371 C CD1 . LEU B 36  ? 1.6172 0.6750 1.1309 -0.0655 0.1221  0.1356  36  LEU B CD1 
3372 C CD2 . LEU B 36  ? 1.5927 0.6630 1.1127 -0.0119 0.1250  0.1243  36  LEU B CD2 
3373 N N   . ALA B 37  ? 1.3488 0.6192 0.9317 -0.0600 0.0858  0.0791  37  ALA B N   
3374 C CA  . ALA B 37  ? 1.2907 0.6188 0.8937 -0.0702 0.0766  0.0745  37  ALA B CA  
3375 C C   . ALA B 37  ? 1.2900 0.6613 0.9090 -0.0456 0.0742  0.0755  37  ALA B C   
3376 O O   . ALA B 37  ? 1.2679 0.6690 0.8990 -0.0390 0.0741  0.0883  37  ALA B O   
3377 C CB  . ALA B 37  ? 1.3071 0.6294 0.9024 -0.0898 0.0704  0.0569  37  ALA B CB  
3378 N N   . GLY B 38  ? 1.2302 0.6021 0.8467 -0.0335 0.0726  0.0623  38  GLY B N   
3379 C CA  . GLY B 38  ? 1.1822 0.5914 0.8120 -0.0128 0.0697  0.0611  38  GLY B CA  
3380 C C   . GLY B 38  ? 1.2282 0.6475 0.8645 0.0078  0.0723  0.0761  38  GLY B C   
3381 O O   . GLY B 38  ? 1.2524 0.6395 0.8800 0.0157  0.0786  0.0861  38  GLY B O   
3382 N N   . GLY B 39  ? 1.1510 0.6145 0.8012 0.0155  0.0671  0.0780  39  GLY B N   
3383 C CA  . GLY B 39  ? 1.1328 0.6129 0.7881 0.0320  0.0668  0.0914  39  GLY B CA  
3384 C C   . GLY B 39  ? 1.1422 0.6286 0.8013 0.0531  0.0658  0.0899  39  GLY B C   
3385 O O   . GLY B 39  ? 1.1172 0.6284 0.7825 0.0641  0.0621  0.0987  39  GLY B O   
3386 N N   . LEU B 40  ? 1.0755 0.5398 0.7297 0.0576  0.0692  0.0790  40  LEU B N   
3387 C CA  . LEU B 40  ? 1.0458 0.5147 0.7047 0.0772  0.0705  0.0770  40  LEU B CA  
3388 C C   . LEU B 40  ? 1.1088 0.5719 0.7709 0.0962  0.0736  0.0941  40  LEU B C   
3389 O O   . LEU B 40  ? 1.1370 0.5711 0.7907 0.0956  0.0786  0.1037  40  LEU B O   
3390 C CB  . LEU B 40  ? 1.0631 0.4987 0.7104 0.0778  0.0772  0.0634  40  LEU B CB  
3391 C CG  . LEU B 40  ? 1.1139 0.5465 0.7535 0.0571  0.0740  0.0474  40  LEU B CG  
3392 C CD1 . LEU B 40  ? 1.1626 0.5522 0.7852 0.0408  0.0782  0.0452  40  LEU B CD1 
3393 C CD2 . LEU B 40  ? 1.1137 0.5464 0.7495 0.0631  0.0754  0.0333  40  LEU B CD2 
3394 N N   . PRO B 41  ? 1.0476 0.5380 0.7219 0.1125  0.0705  0.0997  41  PRO B N   
3395 C CA  . PRO B 41  ? 1.0669 0.5543 0.7461 0.1311  0.0726  0.1180  41  PRO B CA  
3396 C C   . PRO B 41  ? 1.1681 0.6202 0.8434 0.1477  0.0845  0.1180  41  PRO B C   
3397 O O   . PRO B 41  ? 1.1722 0.6043 0.8394 0.1440  0.0902  0.1021  41  PRO B O   
3398 C CB  . PRO B 41  ? 1.0506 0.5846 0.7449 0.1384  0.0632  0.1233  41  PRO B CB  
3399 C CG  . PRO B 41  ? 1.0723 0.6235 0.7690 0.1294  0.0601  0.1058  41  PRO B CG  
3400 C CD  . PRO B 41  ? 1.0273 0.5517 0.7118 0.1146  0.0648  0.0910  41  PRO B CD  
3401 N N   . ASN B 42  ? 1.1575 0.6007 0.8369 0.1668  0.0888  0.1361  42  ASN B N   
3402 C CA  . ASN B 42  ? 1.2005 0.6084 0.8758 0.1866  0.1024  0.1379  42  ASN B CA  
3403 C C   . ASN B 42  ? 1.2560 0.6912 0.9470 0.2029  0.1045  0.1347  42  ASN B C   
3404 O O   . ASN B 42  ? 1.2142 0.6971 0.9244 0.2074  0.0949  0.1437  42  ASN B O   
3405 C CB  . ASN B 42  ? 1.2279 0.6163 0.9028 0.2032  0.1074  0.1601  42  ASN B CB  
3406 C CG  . ASN B 42  ? 1.5479 0.8796 1.2082 0.2185  0.1243  0.1598  42  ASN B CG  
3407 O OD1 . ASN B 42  ? 1.4512 0.7337 1.0897 0.2075  0.1306  0.1556  42  ASN B OD1 
3408 N ND2 . ASN B 42  ? 1.5107 0.8469 1.1818 0.2440  0.1330  0.1644  42  ASN B ND2 
3409 N N   . PRO B 43  ? 1.2639 0.6696 0.9453 0.2103  0.1169  0.1218  43  PRO B N   
3410 C CA  . PRO B 43  ? 1.2515 0.6855 0.9478 0.2248  0.1202  0.1188  43  PRO B CA  
3411 C C   . PRO B 43  ? 1.3115 0.7638 1.0284 0.2540  0.1261  0.1398  43  PRO B C   
3412 O O   . PRO B 43  ? 1.2914 0.7924 1.0312 0.2607  0.1205  0.1456  43  PRO B O   
3413 C CB  . PRO B 43  ? 1.3031 0.6954 0.9772 0.2216  0.1322  0.0980  43  PRO B CB  
3414 C CG  . PRO B 43  ? 1.4100 0.7425 1.0600 0.2192  0.1408  0.0979  43  PRO B CG  
3415 C CD  . PRO B 43  ? 1.3354 0.6803 0.9893 0.2035  0.1284  0.1083  43  PRO B CD  
3416 N N   . ASN B 44  ? 1.2788 0.6938 0.9888 0.2711  0.1370  0.1525  44  ASN B N   
3417 C CA  . ASN B 44  ? 1.2813 0.7116 1.0115 0.3016  0.1437  0.1756  44  ASN B CA  
3418 C C   . ASN B 44  ? 1.2582 0.7464 1.0138 0.3014  0.1262  0.1969  44  ASN B C   
3419 O O   . ASN B 44  ? 1.2672 0.7800 1.0442 0.3245  0.1277  0.2191  44  ASN B O   
3420 C CB  . ASN B 44  ? 1.3858 0.7554 1.0980 0.3183  0.1595  0.1837  44  ASN B CB  
3421 C CG  . ASN B 44  ? 1.8270 1.1380 1.5131 0.3241  0.1789  0.1651  44  ASN B CG  
3422 O OD1 . ASN B 44  ? 1.7711 1.0632 1.4587 0.3531  0.1964  0.1720  44  ASN B OD1 
3423 N ND2 . ASN B 44  ? 1.7643 1.0445 1.4245 0.2971  0.1766  0.1416  44  ASN B ND2 
3424 N N   . MET B 45  ? 1.1422 0.6526 0.8945 0.2752  0.1099  0.1899  45  MET B N   
3425 C CA  . MET B 45  ? 1.0935 0.6523 0.8607 0.2687  0.0921  0.2051  45  MET B CA  
3426 C C   . MET B 45  ? 1.0980 0.7086 0.8813 0.2589  0.0806  0.1984  45  MET B C   
3427 O O   . MET B 45  ? 1.0739 0.7254 0.8680 0.2528  0.0653  0.2100  45  MET B O   
3428 C CB  . MET B 45  ? 1.1151 0.6569 0.8626 0.2466  0.0839  0.2018  45  MET B CB  
3429 C CG  . MET B 45  ? 1.1951 0.6879 0.9266 0.2532  0.0934  0.2112  45  MET B CG  
3430 S SD  . MET B 45  ? 1.2550 0.7683 0.9997 0.2731  0.0878  0.2451  45  MET B SD  
3431 C CE  . MET B 45  ? 1.2598 0.7418 1.0117 0.3076  0.1080  0.2548  45  MET B CE  
3432 N N   . PHE B 46  ? 1.0366 0.6432 0.8185 0.2561  0.0876  0.1798  46  PHE B N   
3433 C CA  . PHE B 46  ? 0.9819 0.6317 0.7767 0.2460  0.0785  0.1724  46  PHE B CA  
3434 C C   . PHE B 46  ? 0.9841 0.6784 0.8086 0.2643  0.0784  0.1894  46  PHE B C   
3435 O O   . PHE B 46  ? 1.0066 0.6891 0.8390 0.2871  0.0937  0.1953  46  PHE B O   
3436 C CB  . PHE B 46  ? 0.9987 0.6274 0.7790 0.2349  0.0853  0.1473  46  PHE B CB  
3437 C CG  . PHE B 46  ? 1.0201 0.6204 0.7768 0.2126  0.0815  0.1315  46  PHE B CG  
3438 C CD1 . PHE B 46  ? 1.0836 0.6408 0.8202 0.2079  0.0921  0.1145  46  PHE B CD1 
3439 C CD2 . PHE B 46  ? 1.0248 0.6434 0.7788 0.1956  0.0672  0.1335  46  PHE B CD2 
3440 C CE1 . PHE B 46  ? 1.0964 0.6343 0.8152 0.1861  0.0874  0.1019  46  PHE B CE1 
3441 C CE2 . PHE B 46  ? 1.0552 0.6531 0.7910 0.1764  0.0649  0.1206  46  PHE B CE2 
3442 C CZ  . PHE B 46  ? 1.0522 0.6125 0.7727 0.1715  0.0745  0.1057  46  PHE B CZ  
3443 N N   . PRO B 47  ? 0.8747 0.6191 0.7149 0.2544  0.0617  0.1978  47  PRO B N   
3444 C CA  . PRO B 47  ? 0.8508 0.6438 0.7225 0.2688  0.0596  0.2164  47  PRO B CA  
3445 C C   . PRO B 47  ? 0.8672 0.6685 0.7529 0.2821  0.0741  0.2114  47  PRO B C   
3446 O O   . PRO B 47  ? 0.8563 0.6804 0.7664 0.3047  0.0817  0.2295  47  PRO B O   
3447 C CB  . PRO B 47  ? 0.8440 0.6800 0.7208 0.2469  0.0382  0.2187  47  PRO B CB  
3448 C CG  . PRO B 47  ? 0.9068 0.7171 0.7565 0.2285  0.0297  0.2092  47  PRO B CG  
3449 C CD  . PRO B 47  ? 0.8671 0.6250 0.6958 0.2292  0.0444  0.1915  47  PRO B CD  
3450 N N   . PHE B 48  ? 0.8173 0.6039 0.6889 0.2689  0.0779  0.1887  48  PHE B N   
3451 C CA  . PHE B 48  ? 0.8187 0.6125 0.7000 0.2797  0.0920  0.1830  48  PHE B CA  
3452 C C   . PHE B 48  ? 0.9086 0.6499 0.7726 0.2979  0.1140  0.1743  48  PHE B C   
3453 O O   . PHE B 48  ? 0.9183 0.6125 0.7533 0.2874  0.1164  0.1575  48  PHE B O   
3454 C CB  . PHE B 48  ? 0.8123 0.6157 0.6852 0.2574  0.0855  0.1643  48  PHE B CB  
3455 C CG  . PHE B 48  ? 0.8018 0.6350 0.6765 0.2342  0.0637  0.1660  48  PHE B CG  
3456 C CD1 . PHE B 48  ? 0.8384 0.6470 0.6891 0.2160  0.0544  0.1542  48  PHE B CD1 
3457 C CD2 . PHE B 48  ? 0.8161 0.7007 0.7149 0.2298  0.0532  0.1792  48  PHE B CD2 
3458 C CE1 . PHE B 48  ? 0.8353 0.6664 0.6832 0.1960  0.0364  0.1548  48  PHE B CE1 
3459 C CE2 . PHE B 48  ? 0.8396 0.7449 0.7341 0.2069  0.0334  0.1789  48  PHE B CE2 
3460 C CZ  . PHE B 48  ? 0.8131 0.6895 0.6807 0.1912  0.0260  0.1661  48  PHE B CZ  
3461 N N   . LYS B 49  ? 0.8777 0.6265 0.7588 0.3252  0.1305  0.1864  49  LYS B N   
3462 C CA  . LYS B 49  ? 0.9093 0.6039 0.7713 0.3456  0.1533  0.1797  49  LYS B CA  
3463 C C   . LYS B 49  ? 0.9872 0.6661 0.8377 0.3507  0.1704  0.1628  49  LYS B C   
3464 O O   . LYS B 49  ? 1.0112 0.6324 0.8292 0.3513  0.1830  0.1450  49  LYS B O   
3465 C CB  . LYS B 49  ? 0.9385 0.6354 0.8188 0.3768  0.1637  0.2049  49  LYS B CB  
3466 C CG  . LYS B 49  ? 0.8220 0.5315 0.7101 0.3722  0.1468  0.2228  49  LYS B CG  
3467 C CD  . LYS B 49  ? 0.8912 0.5489 0.7450 0.3528  0.1410  0.2082  49  LYS B CD  
3468 C CE  . LYS B 49  ? 1.0311 0.6820 0.8867 0.3597  0.1346  0.2282  49  LYS B CE  
3469 N NZ  . LYS B 49  ? 1.1608 0.7704 0.9862 0.3371  0.1274  0.2151  49  LYS B NZ  
3470 N N   . THR B 50  ? 0.9359 0.6649 0.8115 0.3537  0.1710  0.1688  50  THR B N   
3471 C CA  . THR B 50  ? 0.9509 0.6725 0.8173 0.3587  0.1874  0.1548  50  THR B CA  
3472 C C   . THR B 50  ? 0.9891 0.7601 0.8705 0.3384  0.1745  0.1520  50  THR B C   
3473 O O   . THR B 50  ? 0.9596 0.7766 0.8649 0.3264  0.1556  0.1653  50  THR B O   
3474 C CB  . THR B 50  ? 0.9899 0.7109 0.8693 0.3950  0.2134  0.1676  50  THR B CB  
3475 O OG1 . THR B 50  ? 0.9514 0.7389 0.8691 0.4018  0.2135  0.1842  50  THR B OG1 
3476 C CG2 . THR B 50  ? 0.9388 0.6370 0.8221 0.4196  0.2215  0.1843  50  THR B CG2 
3477 N N   . ALA B 51  ? 0.9568 0.7162 0.8221 0.3345  0.1850  0.1352  51  ALA B N   
3478 C CA  . ALA B 51  ? 0.9229 0.7214 0.7979 0.3161  0.1757  0.1314  51  ALA B CA  
3479 C C   . ALA B 51  ? 0.9982 0.7924 0.8650 0.3265  0.1960  0.1230  51  ALA B C   
3480 O O   . ALA B 51  ? 1.0328 0.7760 0.8682 0.3358  0.2125  0.1077  51  ALA B O   
3481 C CB  . ALA B 51  ? 0.9063 0.6882 0.7582 0.2854  0.1569  0.1136  51  ALA B CB  
3482 N N   . VAL B 52  ? 0.9254 0.7723 0.8186 0.3234  0.1946  0.1332  52  VAL B N   
3483 C CA  . VAL B 52  ? 0.9299 0.7810 0.8179 0.3312  0.2131  0.1276  52  VAL B CA  
3484 C C   . VAL B 52  ? 0.9262 0.8196 0.8265 0.3088  0.2011  0.1283  52  VAL B C   
3485 O O   . VAL B 52  ? 0.8953 0.8452 0.8328 0.3091  0.1970  0.1481  52  VAL B O   
3486 C CB  . VAL B 52  ? 1.0128 0.8661 0.9130 0.3668  0.2414  0.1396  52  VAL B CB  
3487 C CG1 . VAL B 52  ? 0.9975 0.9043 0.9453 0.3832  0.2393  0.1695  52  VAL B CG1 
3488 C CG2 . VAL B 52  ? 1.0229 0.8857 0.9174 0.3723  0.2599  0.1343  52  VAL B CG2 
3489 N N   . ILE B 53  ? 0.8674 0.7314 0.7352 0.2882  0.1944  0.1069  53  ILE B N   
3490 C CA  . ILE B 53  ? 0.8269 0.7147 0.6949 0.2653  0.1832  0.1028  53  ILE B CA  
3491 C C   . ILE B 53  ? 0.9136 0.8064 0.7754 0.2746  0.2036  0.1002  53  ILE B C   
3492 O O   . ILE B 53  ? 0.9365 0.7893 0.7703 0.2884  0.2217  0.0875  53  ILE B O   
3493 C CB  . ILE B 53  ? 0.8356 0.6890 0.6719 0.2409  0.1662  0.0830  53  ILE B CB  
3494 C CG1 . ILE B 53  ? 0.8182 0.6620 0.6569 0.2343  0.1498  0.0850  53  ILE B CG1 
3495 C CG2 . ILE B 53  ? 0.7988 0.6754 0.6361 0.2185  0.1538  0.0811  53  ILE B CG2 
3496 C CD1 . ILE B 53  ? 0.8423 0.6349 0.6484 0.2306  0.1491  0.0675  53  ILE B CD1 
3497 N N   . THR B 54  ? 0.8710 0.8116 0.7572 0.2658  0.2006  0.1123  54  THR B N   
3498 C CA  . THR B 54  ? 0.8823 0.8337 0.7649 0.2725  0.2194  0.1122  54  THR B CA  
3499 C C   . THR B 54  ? 0.9444 0.8794 0.7985 0.2491  0.2106  0.0964  54  THR B C   
3500 O O   . THR B 54  ? 0.8895 0.8361 0.7475 0.2258  0.1892  0.0964  54  THR B O   
3501 C CB  . THR B 54  ? 0.8480 0.8620 0.7760 0.2823  0.2276  0.1377  54  THR B CB  
3502 O OG1 . THR B 54  ? 0.8509 0.9057 0.8033 0.2576  0.2047  0.1488  54  THR B OG1 
3503 C CG2 . THR B 54  ? 0.7589 0.7870 0.7132 0.3102  0.2395  0.1539  54  THR B CG2 
3504 N N   . VAL B 55  ? 0.9683 0.8724 0.7905 0.2566  0.2277  0.0826  55  VAL B N   
3505 C CA  . VAL B 55  ? 0.9814 0.8668 0.7724 0.2388  0.2229  0.0679  55  VAL B CA  
3506 C C   . VAL B 55  ? 1.0652 0.9840 0.8664 0.2403  0.2367  0.0779  55  VAL B C   
3507 O O   . VAL B 55  ? 1.0841 1.0152 0.8946 0.2622  0.2600  0.0859  55  VAL B O   
3508 C CB  . VAL B 55  ? 1.0642 0.8899 0.8076 0.2427  0.2297  0.0449  55  VAL B CB  
3509 C CG1 . VAL B 55  ? 1.0742 0.8843 0.7841 0.2303  0.2310  0.0321  55  VAL B CG1 
3510 C CG2 . VAL B 55  ? 1.0486 0.8460 0.7826 0.2328  0.2114  0.0356  55  VAL B CG2 
3511 N N   . GLU B 56  ? 1.0145 0.9478 0.8145 0.2174  0.2228  0.0785  56  GLU B N   
3512 C CA  . GLU B 56  ? 1.0169 0.9795 0.8237 0.2133  0.2327  0.0878  56  GLU B CA  
3513 C C   . GLU B 56  ? 1.0900 1.0176 0.8558 0.2233  0.2517  0.0730  56  GLU B C   
3514 O O   . GLU B 56  ? 1.0780 0.9641 0.8057 0.2142  0.2435  0.0545  56  GLU B O   
3515 C CB  . GLU B 56  ? 1.0099 0.9853 0.8189 0.1851  0.2115  0.0902  56  GLU B CB  
3516 C CG  . GLU B 56  ? 1.1355 1.1387 0.9499 0.1769  0.2197  0.1006  56  GLU B CG  
3517 C CD  . GLU B 56  ? 1.1773 1.2384 1.0375 0.1767  0.2250  0.1250  56  GLU B CD  
3518 O OE1 . GLU B 56  ? 0.7096 0.7957 0.6015 0.1890  0.2267  0.1364  56  GLU B OE1 
3519 O OE2 . GLU B 56  ? 1.0130 1.0957 0.8773 0.1639  0.2276  0.1339  56  GLU B OE2 
3520 N N   . ASN B 57  ? 1.0772 1.0221 0.8508 0.2433  0.2778  0.0818  57  ASN B N   
3521 C CA  . ASN B 57  ? 1.1160 1.0309 0.8502 0.2558  0.3005  0.0697  57  ASN B CA  
3522 C C   . ASN B 57  ? 1.1800 1.0322 0.8686 0.2582  0.2975  0.0455  57  ASN B C   
3523 O O   . ASN B 57  ? 1.1723 0.9940 0.8240 0.2424  0.2868  0.0299  57  ASN B O   
3524 C CB  . ASN B 57  ? 1.1257 1.0532 0.8469 0.2395  0.3003  0.0716  57  ASN B CB  
3525 C CG  . ASN B 57  ? 1.2892 1.2754 1.0561 0.2277  0.2944  0.0949  57  ASN B CG  
3526 O OD1 . ASN B 57  ? 1.1598 1.1879 0.9686 0.2396  0.3035  0.1134  57  ASN B OD1 
3527 N ND2 . ASN B 57  ? 1.1277 1.1179 0.8881 0.2030  0.2778  0.0953  57  ASN B ND2 
3528 N N   . GLY B 58  ? 1.1406 0.9778 0.8363 0.2764  0.3045  0.0448  58  GLY B N   
3529 C CA  . GLY B 58  ? 1.1529 0.9327 0.8120 0.2793  0.3022  0.0248  58  GLY B CA  
3530 C C   . GLY B 58  ? 1.1665 0.9414 0.8467 0.2982  0.3073  0.0311  58  GLY B C   
3531 O O   . GLY B 58  ? 1.1194 0.9387 0.8465 0.3020  0.3017  0.0508  58  GLY B O   
3532 N N   . LYS B 59  ? 1.1484 0.8672 0.7920 0.3094  0.3174  0.0148  59  LYS B N   
3533 C CA  . LYS B 59  ? 1.1545 0.8583 0.8109 0.3295  0.3248  0.0197  59  LYS B CA  
3534 C C   . LYS B 59  ? 1.1498 0.8686 0.8355 0.3172  0.2995  0.0272  59  LYS B C   
3535 O O   . LYS B 59  ? 1.1268 0.8200 0.7934 0.2966  0.2795  0.0141  59  LYS B O   
3536 C CB  . LYS B 59  ? 1.2483 0.8848 0.8565 0.3461  0.3453  0.0016  59  LYS B CB  
3537 C CG  . LYS B 59  ? 1.4512 1.0314 1.0067 0.3242  0.3324  -0.0241 59  LYS B CG  
3538 C CD  . LYS B 59  ? 1.6333 1.1449 1.1370 0.3398  0.3548  -0.0420 59  LYS B CD  
3539 C CE  . LYS B 59  ? 1.7433 1.2133 1.2415 0.3460  0.3528  -0.0459 59  LYS B CE  
3540 N NZ  . LYS B 59  ? 1.7320 1.1754 1.2100 0.3159  0.3257  -0.0604 59  LYS B NZ  
3541 N N   . THR B 60  ? 1.0774 0.8441 0.8117 0.3292  0.3004  0.0502  60  THR B N   
3542 C CA  . THR B 60  ? 1.0304 0.8229 0.7994 0.3216  0.2793  0.0630  60  THR B CA  
3543 C C   . THR B 60  ? 1.0504 0.7926 0.7979 0.3229  0.2734  0.0518  60  THR B C   
3544 O O   . THR B 60  ? 1.0850 0.7886 0.8137 0.3443  0.2928  0.0470  60  THR B O   
3545 C CB  . THR B 60  ? 1.1931 1.0427 1.0133 0.3405  0.2880  0.0904  60  THR B CB  
3546 O OG1 . THR B 60  ? 1.2525 1.0799 1.0695 0.3730  0.3131  0.0940  60  THR B OG1 
3547 C CG2 . THR B 60  ? 1.1711 1.0715 1.0128 0.3371  0.2948  0.1022  60  THR B CG2 
3548 N N   . ILE B 61  ? 0.9459 0.6863 0.6938 0.2994  0.2476  0.0473  61  ILE B N   
3549 C CA  . ILE B 61  ? 0.9352 0.6328 0.6643 0.2945  0.2384  0.0374  61  ILE B CA  
3550 C C   . ILE B 61  ? 0.9808 0.6865 0.7371 0.3131  0.2411  0.0543  61  ILE B C   
3551 O O   . ILE B 61  ? 0.9571 0.7146 0.7545 0.3184  0.2366  0.0752  61  ILE B O   
3552 C CB  . ILE B 61  ? 0.9234 0.6226 0.6463 0.2642  0.2114  0.0290  61  ILE B CB  
3553 C CG1 . ILE B 61  ? 0.9282 0.6133 0.6199 0.2482  0.2098  0.0122  61  ILE B CG1 
3554 C CG2 . ILE B 61  ? 0.9263 0.5883 0.6349 0.2582  0.2017  0.0216  61  ILE B CG2 
3555 C CD1 . ILE B 61  ? 0.9568 0.6601 0.6515 0.2226  0.1868  0.0096  61  ILE B CD1 
3556 N N   . GLN B 62  ? 0.9486 0.6020 0.6804 0.3217  0.2477  0.0457  62  GLN B N   
3557 C CA  . GLN B 62  ? 0.9385 0.5867 0.6876 0.3387  0.2501  0.0597  62  GLN B CA  
3558 C C   . GLN B 62  ? 0.9715 0.5777 0.6974 0.3216  0.2353  0.0479  62  GLN B C   
3559 O O   . GLN B 62  ? 1.0001 0.5584 0.6861 0.3100  0.2368  0.0268  62  GLN B O   
3560 C CB  . GLN B 62  ? 1.0037 0.6216 0.7426 0.3716  0.2796  0.0623  62  GLN B CB  
3561 C CG  . GLN B 62  ? 1.0357 0.7084 0.8180 0.3967  0.2925  0.0871  62  GLN B CG  
3562 C CD  . GLN B 62  ? 1.1897 0.8622 0.9602 0.4109  0.3166  0.0820  62  GLN B CD  
3563 O OE1 . GLN B 62  ? 1.1624 0.7936 0.9098 0.4359  0.3426  0.0771  62  GLN B OE1 
3564 N NE2 . GLN B 62  ? 1.0367 0.7526 0.8201 0.3954  0.3094  0.0831  62  GLN B NE2 
3565 N N   . PHE B 63  ? 0.8818 0.5079 0.6321 0.3184  0.2204  0.0620  63  PHE B N   
3566 C CA  . PHE B 63  ? 0.8820 0.4734 0.6145 0.3032  0.2071  0.0542  63  PHE B CA  
3567 C C   . PHE B 63  ? 0.9880 0.5515 0.7223 0.3259  0.2188  0.0653  63  PHE B C   
3568 O O   . PHE B 63  ? 0.9615 0.5554 0.7258 0.3333  0.2113  0.0855  63  PHE B O   
3569 C CB  . PHE B 63  ? 0.8521 0.4821 0.6046 0.2803  0.1812  0.0602  63  PHE B CB  
3570 C CG  . PHE B 63  ? 0.8458 0.4807 0.5841 0.2532  0.1668  0.0447  63  PHE B CG  
3571 C CD1 . PHE B 63  ? 0.8527 0.5015 0.5962 0.2326  0.1461  0.0452  63  PHE B CD1 
3572 C CD2 . PHE B 63  ? 0.8791 0.5055 0.5983 0.2498  0.1749  0.0310  63  PHE B CD2 
3573 C CE1 . PHE B 63  ? 0.8369 0.4905 0.5685 0.2107  0.1343  0.0326  63  PHE B CE1 
3574 C CE2 . PHE B 63  ? 0.8829 0.5151 0.5901 0.2266  0.1614  0.0190  63  PHE B CE2 
3575 C CZ  . PHE B 63  ? 0.8259 0.4722 0.5407 0.2081  0.1415  0.0204  63  PHE B CZ  
3576 N N   . GLY B 64  ? 1.0170 0.5212 0.7168 0.3370  0.2375  0.0524  64  GLY B N   
3577 C CA  . GLY B 64  ? 1.0697 0.5326 0.7619 0.3602  0.2528  0.0599  64  GLY B CA  
3578 C C   . GLY B 64  ? 1.1200 0.5748 0.8183 0.3513  0.2376  0.0686  64  GLY B C   
3579 O O   . GLY B 64  ? 1.0842 0.5484 0.7802 0.3235  0.2169  0.0619  64  GLY B O   
3580 N N   . GLU B 65  ? 1.1112 0.5481 0.8168 0.3759  0.2489  0.0846  65  GLU B N   
3581 C CA  . GLU B 65  ? 1.1046 0.5329 0.8162 0.3713  0.2368  0.0964  65  GLU B CA  
3582 C C   . GLU B 65  ? 1.1326 0.5312 0.8171 0.3373  0.2206  0.0783  65  GLU B C   
3583 O O   . GLU B 65  ? 1.0816 0.5153 0.7828 0.3186  0.1998  0.0840  65  GLU B O   
3584 C CB  . GLU B 65  ? 1.1847 0.5674 0.8880 0.4010  0.2566  0.1079  65  GLU B CB  
3585 C CG  . GLU B 65  ? 1.3926 0.7977 1.1192 0.4387  0.2777  0.1248  65  GLU B CG  
3586 C CD  . GLU B 65  ? 1.6762 1.1460 1.4523 0.4560  0.2703  0.1566  65  GLU B CD  
3587 O OE1 . GLU B 65  ? 1.5890 1.1193 1.3981 0.4650  0.2711  0.1676  65  GLU B OE1 
3588 O OE2 . GLU B 65  ? 1.6128 1.0724 1.3942 0.4612  0.2644  0.1717  65  GLU B OE2 
3589 N N   . GLU B 66  ? 1.1228 0.4615 0.7657 0.3281  0.2298  0.0560  66  GLU B N   
3590 C CA  . GLU B 66  ? 1.1208 0.4305 0.7370 0.2955  0.2160  0.0384  66  GLU B CA  
3591 C C   . GLU B 66  ? 1.1395 0.4925 0.7634 0.2699  0.1979  0.0283  66  GLU B C   
3592 O O   . GLU B 66  ? 1.1038 0.4723 0.7334 0.2478  0.1798  0.0284  66  GLU B O   
3593 C CB  . GLU B 66  ? 1.2012 0.4356 0.7698 0.2929  0.2309  0.0183  66  GLU B CB  
3594 C CG  . GLU B 66  ? 1.3149 0.5020 0.8599 0.2723  0.2236  0.0128  66  GLU B CG  
3595 C CD  . GLU B 66  ? 1.4431 0.6004 0.9912 0.2915  0.2327  0.0301  66  GLU B CD  
3596 O OE1 . GLU B 66  ? 1.1319 0.3002 0.6923 0.2789  0.2188  0.0406  66  GLU B OE1 
3597 O OE2 . GLU B 66  ? 1.4471 0.5692 0.9844 0.3201  0.2545  0.0339  66  GLU B OE2 
3598 N N   . MET B 67  ? 1.1050 0.4750 0.7272 0.2737  0.2043  0.0198  67  MET B N   
3599 C CA  . MET B 67  ? 1.0593 0.4675 0.6867 0.2533  0.1904  0.0107  67  MET B CA  
3600 C C   . MET B 67  ? 1.0326 0.5008 0.6975 0.2469  0.1724  0.0265  67  MET B C   
3601 O O   . MET B 67  ? 0.9839 0.4711 0.6495 0.2242  0.1558  0.0202  67  MET B O   
3602 C CB  . MET B 67  ? 1.1042 0.5203 0.7263 0.2663  0.2050  0.0046  67  MET B CB  
3603 C CG  . MET B 67  ? 1.1148 0.5669 0.7396 0.2478  0.1933  -0.0040 67  MET B CG  
3604 S SD  . MET B 67  ? 1.1669 0.6007 0.7634 0.2123  0.1750  -0.0243 67  MET B SD  
3605 C CE  . MET B 67  ? 1.1999 0.5553 0.7452 0.2115  0.1899  -0.0436 67  MET B CE  
3606 N N   . MET B 68  ? 0.9824 0.4778 0.6765 0.2674  0.1758  0.0475  68  MET B N   
3607 C CA  . MET B 68  ? 0.9288 0.4777 0.6559 0.2631  0.1595  0.0643  68  MET B CA  
3608 C C   . MET B 68  ? 0.9433 0.4785 0.6642 0.2471  0.1460  0.0653  68  MET B C   
3609 O O   . MET B 68  ? 0.9043 0.4685 0.6333 0.2287  0.1292  0.0651  68  MET B O   
3610 C CB  . MET B 68  ? 0.9647 0.5442 0.7226 0.2898  0.1674  0.0874  68  MET B CB  
3611 C CG  . MET B 68  ? 0.9774 0.6113 0.7668 0.2839  0.1492  0.1056  68  MET B CG  
3612 S SD  . MET B 68  ? 0.9858 0.6645 0.7835 0.2576  0.1305  0.0982  68  MET B SD  
3613 C CE  . MET B 68  ? 0.9216 0.6646 0.7610 0.2688  0.1249  0.1237  68  MET B CE  
3614 N N   . LYS B 69  ? 0.9173 0.4054 0.6213 0.2537  0.1543  0.0660  69  LYS B N   
3615 C CA  . LYS B 69  ? 0.9075 0.3790 0.6037 0.2381  0.1434  0.0678  69  LYS B CA  
3616 C C   . LYS B 69  ? 0.9347 0.4021 0.6146 0.2092  0.1318  0.0497  69  LYS B C   
3617 O O   . LYS B 69  ? 0.8952 0.3848 0.5830 0.1937  0.1171  0.0533  69  LYS B O   
3618 C CB  . LYS B 69  ? 0.9807 0.3956 0.6576 0.2491  0.1564  0.0703  69  LYS B CB  
3619 C CG  . LYS B 69  ? 1.0548 0.4791 0.7522 0.2768  0.1637  0.0940  69  LYS B CG  
3620 C CD  . LYS B 69  ? 1.1520 0.5183 0.8293 0.2990  0.1859  0.0937  69  LYS B CD  
3621 C CE  . LYS B 69  ? 1.1207 0.4394 0.7808 0.2972  0.1877  0.0993  69  LYS B CE  
3622 N NZ  . LYS B 69  ? 1.1314 0.3824 0.7621 0.3132  0.2095  0.0924  69  LYS B NZ  
3623 N N   . ARG B 70  ? 0.9054 0.3483 0.5631 0.2031  0.1385  0.0313  70  ARG B N   
3624 C CA  . ARG B 70  ? 0.8889 0.3298 0.5312 0.1777  0.1284  0.0146  70  ARG B CA  
3625 C C   . ARG B 70  ? 0.9086 0.4031 0.5715 0.1691  0.1150  0.0167  70  ARG B C   
3626 O O   . ARG B 70  ? 0.8806 0.3870 0.5426 0.1497  0.1022  0.0125  70  ARG B O   
3627 C CB  . ARG B 70  ? 0.9017 0.3089 0.5163 0.1773  0.1394  -0.0030 70  ARG B CB  
3628 C CG  . ARG B 70  ? 0.9604 0.3545 0.5538 0.1504  0.1295  -0.0194 70  ARG B CG  
3629 C CD  . ARG B 70  ? 0.9480 0.3378 0.5234 0.1485  0.1341  -0.0342 70  ARG B CD  
3630 N NE  . ARG B 70  ? 0.8919 0.2999 0.4632 0.1244  0.1189  -0.0434 70  ARG B NE  
3631 C CZ  . ARG B 70  ? 0.9809 0.3832 0.5319 0.1153  0.1183  -0.0573 70  ARG B CZ  
3632 N NH1 . ARG B 70  ? 0.8873 0.2631 0.4171 0.1276  0.1331  -0.0653 70  ARG B NH1 
3633 N NH2 . ARG B 70  ? 0.7035 0.1264 0.2542 0.0949  0.1037  -0.0625 70  ARG B NH2 
3634 N N   . ALA B 71  ? 0.8582 0.3842 0.5394 0.1841  0.1188  0.0242  71  ALA B N   
3635 C CA  . ALA B 71  ? 0.8145 0.3880 0.5141 0.1776  0.1079  0.0273  71  ALA B CA  
3636 C C   . ALA B 71  ? 0.8336 0.4348 0.5500 0.1707  0.0939  0.0393  71  ALA B C   
3637 O O   . ALA B 71  ? 0.8048 0.4343 0.5278 0.1591  0.0829  0.0380  71  ALA B O   
3638 C CB  . ALA B 71  ? 0.8221 0.4204 0.5379 0.1951  0.1167  0.0348  71  ALA B CB  
3639 N N   . LEU B 72  ? 0.7998 0.3907 0.5208 0.1783  0.0949  0.0512  72  LEU B N   
3640 C CA  . LEU B 72  ? 0.7786 0.3931 0.5121 0.1729  0.0825  0.0638  72  LEU B CA  
3641 C C   . LEU B 72  ? 0.8431 0.4360 0.5625 0.1579  0.0770  0.0601  72  LEU B C   
3642 O O   . LEU B 72  ? 0.8282 0.4382 0.5535 0.1523  0.0674  0.0692  72  LEU B O   
3643 C CB  . LEU B 72  ? 0.7869 0.4140 0.5383 0.1922  0.0856  0.0837  72  LEU B CB  
3644 C CG  . LEU B 72  ? 0.8340 0.4894 0.6051 0.2086  0.0915  0.0919  72  LEU B CG  
3645 C CD1 . LEU B 72  ? 0.8622 0.5138 0.6455 0.2318  0.1007  0.1094  72  LEU B CD1 
3646 C CD2 . LEU B 72  ? 0.8036 0.5074 0.5921 0.1993  0.0778  0.0977  72  LEU B CD2 
3647 N N   . GLN B 73  ? 0.8140 0.3704 0.5138 0.1503  0.0828  0.0472  73  GLN B N   
3648 C CA  . GLN B 73  ? 0.8099 0.3460 0.4975 0.1345  0.0788  0.0444  73  GLN B CA  
3649 C C   . GLN B 73  ? 0.7901 0.3361 0.4713 0.1152  0.0712  0.0312  73  GLN B C   
3650 O O   . GLN B 73  ? 0.7753 0.3302 0.4549 0.1148  0.0716  0.0217  73  GLN B O   
3651 C CB  . GLN B 73  ? 0.8769 0.3629 0.5465 0.1376  0.0901  0.0410  73  GLN B CB  
3652 C CG  . GLN B 73  ? 1.0380 0.4986 0.6936 0.1188  0.0873  0.0375  73  GLN B CG  
3653 C CD  . GLN B 73  ? 1.2513 0.7250 0.9165 0.1173  0.0816  0.0527  73  GLN B CD  
3654 O OE1 . GLN B 73  ? 1.2120 0.7194 0.8868 0.1089  0.0719  0.0550  73  GLN B OE1 
3655 N NE2 . GLN B 73  ? 1.1349 0.5801 0.7953 0.1262  0.0884  0.0635  73  GLN B NE2 
3656 N N   . TYR B 74  ? 0.7006 0.2457 0.3785 0.1000  0.0651  0.0319  74  TYR B N   
3657 C CA  . TYR B 74  ? 0.6747 0.2316 0.3491 0.0824  0.0582  0.0221  74  TYR B CA  
3658 C C   . TYR B 74  ? 0.7701 0.3065 0.4298 0.0757  0.0614  0.0073  74  TYR B C   
3659 O O   . TYR B 74  ? 0.8456 0.3453 0.4910 0.0760  0.0687  0.0034  74  TYR B O   
3660 C CB  . TYR B 74  ? 0.6789 0.2315 0.3513 0.0684  0.0549  0.0265  74  TYR B CB  
3661 C CG  . TYR B 74  ? 0.6647 0.2396 0.3468 0.0711  0.0507  0.0393  74  TYR B CG  
3662 C CD1 . TYR B 74  ? 0.6438 0.2512 0.3330 0.0697  0.0441  0.0393  74  TYR B CD1 
3663 C CD2 . TYR B 74  ? 0.6921 0.2522 0.3727 0.0739  0.0536  0.0512  74  TYR B CD2 
3664 C CE1 . TYR B 74  ? 0.6092 0.2328 0.3017 0.0711  0.0407  0.0496  74  TYR B CE1 
3665 C CE2 . TYR B 74  ? 0.6891 0.2685 0.3744 0.0752  0.0495  0.0627  74  TYR B CE2 
3666 C CZ  . TYR B 74  ? 0.7223 0.3330 0.4124 0.0735  0.0431  0.0612  74  TYR B CZ  
3667 O OH  . TYR B 74  ? 0.7172 0.3428 0.4068 0.0747  0.0396  0.0714  74  TYR B OH  
3668 N N   . SER B 75  ? 0.6654 0.2228 0.3261 0.0700  0.0562  -0.0007 75  SER B N   
3669 C CA  . SER B 75  ? 0.6753 0.2171 0.3202 0.0623  0.0573  -0.0143 75  SER B CA  
3670 C C   . SER B 75  ? 0.7309 0.2887 0.3756 0.0435  0.0477  -0.0190 75  SER B C   
3671 O O   . SER B 75  ? 0.6816 0.2637 0.3396 0.0402  0.0423  -0.0114 75  SER B O   
3672 C CB  . SER B 75  ? 0.7214 0.2730 0.3665 0.0744  0.0611  -0.0185 75  SER B CB  
3673 O OG  . SER B 75  ? 0.8232 0.4098 0.4791 0.0731  0.0538  -0.0177 75  SER B OG  
3674 N N   . PRO B 76  ? 0.7551 0.3012 0.3844 0.0310  0.0453  -0.0303 76  PRO B N   
3675 C CA  . PRO B 76  ? 0.7499 0.3177 0.3831 0.0138  0.0352  -0.0317 76  PRO B CA  
3676 C C   . PRO B 76  ? 0.7859 0.3938 0.4359 0.0192  0.0298  -0.0266 76  PRO B C   
3677 O O   . PRO B 76  ? 0.7721 0.3893 0.4239 0.0315  0.0317  -0.0273 76  PRO B O   
3678 C CB  . PRO B 76  ? 0.8017 0.3527 0.4139 0.0028  0.0331  -0.0446 76  PRO B CB  
3679 C CG  . PRO B 76  ? 0.9066 0.4139 0.4992 0.0093  0.0435  -0.0505 76  PRO B CG  
3680 C CD  . PRO B 76  ? 0.8291 0.3423 0.4354 0.0317  0.0516  -0.0419 76  PRO B CD  
3681 N N   . SER B 77  ? 0.7322 0.3621 0.3936 0.0097  0.0240  -0.0208 77  SER B N   
3682 C CA  . SER B 77  ? 0.6904 0.3551 0.3662 0.0133  0.0197  -0.0151 77  SER B CA  
3683 C C   . SER B 77  ? 0.6987 0.3791 0.3719 0.0158  0.0155  -0.0203 77  SER B C   
3684 O O   . SER B 77  ? 0.6399 0.3364 0.3195 0.0262  0.0156  -0.0168 77  SER B O   
3685 C CB  . SER B 77  ? 0.7322 0.4138 0.4184 0.0012  0.0162  -0.0086 77  SER B CB  
3686 O OG  . SER B 77  ? 0.8128 0.5226 0.5118 0.0084  0.0157  -0.0012 77  SER B OG  
3687 N N   . ALA B 78  ? 0.7059 0.3789 0.3670 0.0057  0.0117  -0.0284 78  ALA B N   
3688 C CA  . ALA B 78  ? 0.7181 0.4044 0.3739 0.0072  0.0074  -0.0326 78  ALA B CA  
3689 C C   . ALA B 78  ? 0.8189 0.4858 0.4598 0.0163  0.0132  -0.0400 78  ALA B C   
3690 O O   . ALA B 78  ? 0.8172 0.4888 0.4482 0.0154  0.0105  -0.0447 78  ALA B O   
3691 C CB  . ALA B 78  ? 0.7413 0.4359 0.3917 -0.0097 -0.0016 -0.0357 78  ALA B CB  
3692 N N   . GLY B 79  ? 0.7974 0.4448 0.4375 0.0256  0.0216  -0.0395 79  GLY B N   
3693 C CA  . GLY B 79  ? 0.8015 0.4326 0.4310 0.0364  0.0297  -0.0443 79  GLY B CA  
3694 C C   . GLY B 79  ? 0.8547 0.4488 0.4645 0.0337  0.0364  -0.0526 79  GLY B C   
3695 O O   . GLY B 79  ? 0.8737 0.4520 0.4740 0.0194  0.0329  -0.0566 79  GLY B O   
3696 N N   . ILE B 80  ? 0.7785 0.3578 0.3816 0.0474  0.0468  -0.0548 80  ILE B N   
3697 C CA  . ILE B 80  ? 0.7981 0.3375 0.3796 0.0489  0.0563  -0.0628 80  ILE B CA  
3698 C C   . ILE B 80  ? 0.8463 0.3687 0.3994 0.0364  0.0539  -0.0761 80  ILE B C   
3699 O O   . ILE B 80  ? 0.8231 0.3660 0.3742 0.0356  0.0497  -0.0778 80  ILE B O   
3700 C CB  . ILE B 80  ? 0.8377 0.3667 0.4230 0.0702  0.0704  -0.0588 80  ILE B CB  
3701 C CG1 . ILE B 80  ? 0.8127 0.3652 0.4039 0.0811  0.0739  -0.0572 80  ILE B CG1 
3702 C CG2 . ILE B 80  ? 0.8258 0.3618 0.4329 0.0783  0.0713  -0.0462 80  ILE B CG2 
3703 C CD1 . ILE B 80  ? 0.7928 0.3246 0.3701 0.0956  0.0893  -0.0614 80  ILE B CD1 
3704 N N   . PRO B 81  ? 0.8100 0.2938 0.3390 0.0252  0.0558  -0.0851 81  PRO B N   
3705 C CA  . PRO B 81  ? 0.8227 0.2879 0.3202 0.0099  0.0516  -0.0984 81  PRO B CA  
3706 C C   . PRO B 81  ? 0.8611 0.3225 0.3405 0.0203  0.0592  -0.1053 81  PRO B C   
3707 O O   . PRO B 81  ? 0.8506 0.3271 0.3195 0.0099  0.0502  -0.1094 81  PRO B O   
3708 C CB  . PRO B 81  ? 0.8989 0.3135 0.3712 0.0011  0.0570  -0.1066 81  PRO B CB  
3709 C CG  . PRO B 81  ? 0.9491 0.3671 0.4452 0.0038  0.0574  -0.0954 81  PRO B CG  
3710 C CD  . PRO B 81  ? 0.8514 0.3046 0.3786 0.0246  0.0611  -0.0830 81  PRO B CD  
3711 N N   . GLU B 82  ? 0.8149 0.2583 0.2914 0.0413  0.0762  -0.1050 82  GLU B N   
3712 C CA  . GLU B 82  ? 0.8148 0.2539 0.2751 0.0539  0.0873  -0.1101 82  GLU B CA  
3713 C C   . GLU B 82  ? 0.8124 0.2964 0.2917 0.0581  0.0820  -0.1027 82  GLU B C   
3714 O O   . GLU B 82  ? 0.8176 0.3004 0.2766 0.0579  0.0846  -0.1090 82  GLU B O   
3715 C CB  . GLU B 82  ? 0.8603 0.2688 0.3121 0.0757  0.1085  -0.1110 82  GLU B CB  
3716 C CG  . GLU B 82  ? 0.9754 0.3961 0.4603 0.0925  0.1144  -0.0968 82  GLU B CG  
3717 C CD  . GLU B 82  ? 1.2830 0.6781 0.7680 0.0853  0.1115  -0.0956 82  GLU B CD  
3718 O OE1 . GLU B 82  ? 1.0863 0.5040 0.5897 0.0716  0.0968  -0.0898 82  GLU B OE1 
3719 O OE2 . GLU B 82  ? 1.3641 0.7138 0.8281 0.0930  0.1247  -0.1007 82  GLU B OE2 
3720 N N   . LEU B 83  ? 0.7220 0.2426 0.2365 0.0605  0.0742  -0.0899 83  LEU B N   
3721 C CA  . LEU B 83  ? 0.6824 0.2416 0.2127 0.0619  0.0678  -0.0829 83  LEU B CA  
3722 C C   . LEU B 83  ? 0.7551 0.3229 0.2736 0.0433  0.0528  -0.0875 83  LEU B C   
3723 O O   . LEU B 83  ? 0.7406 0.3119 0.2414 0.0400  0.0511  -0.0918 83  LEU B O   
3724 C CB  . LEU B 83  ? 0.6277 0.2171 0.1931 0.0671  0.0628  -0.0695 83  LEU B CB  
3725 C CG  . LEU B 83  ? 0.6380 0.2526 0.2234 0.0807  0.0680  -0.0597 83  LEU B CG  
3726 C CD1 . LEU B 83  ? 0.5857 0.2278 0.1954 0.0780  0.0578  -0.0498 83  LEU B CD1 
3727 C CD2 . LEU B 83  ? 0.6567 0.2779 0.2290 0.0834  0.0725  -0.0624 83  LEU B CD2 
3728 N N   . LEU B 84  ? 0.7216 0.2932 0.2500 0.0310  0.0423  -0.0854 84  LEU B N   
3729 C CA  . LEU B 84  ? 0.7272 0.3126 0.2519 0.0129  0.0271  -0.0865 84  LEU B CA  
3730 C C   . LEU B 84  ? 0.8610 0.4278 0.3504 0.0005  0.0239  -0.0983 84  LEU B C   
3731 O O   . LEU B 84  ? 0.8443 0.4326 0.3308 -0.0101 0.0115  -0.0969 84  LEU B O   
3732 C CB  . LEU B 84  ? 0.7172 0.3008 0.2545 0.0022  0.0211  -0.0833 84  LEU B CB  
3733 C CG  . LEU B 84  ? 0.7329 0.3534 0.2933 -0.0061 0.0081  -0.0738 84  LEU B CG  
3734 C CD1 . LEU B 84  ? 0.6947 0.3461 0.2747 0.0072  0.0079  -0.0646 84  LEU B CD1 
3735 C CD2 . LEU B 84  ? 0.7495 0.3688 0.3263 -0.0108 0.0074  -0.0683 84  LEU B CD2 
3736 N N   . SER B 85  ? 0.8939 0.4210 0.3552 0.0035  0.0356  -0.1092 85  SER B N   
3737 C CA  . SER B 85  ? 0.9603 0.4632 0.3812 -0.0073 0.0346  -0.1221 85  SER B CA  
3738 C C   . SER B 85  ? 1.0302 0.5466 0.4429 0.0042  0.0402  -0.1213 85  SER B C   
3739 O O   . SER B 85  ? 1.0265 0.5552 0.4236 -0.0065 0.0299  -0.1231 85  SER B O   
3740 C CB  . SER B 85  ? 1.0819 0.5313 0.4720 -0.0070 0.0474  -0.1347 85  SER B CB  
3741 O OG  . SER B 85  ? 1.2348 0.6734 0.6328 0.0172  0.0664  -0.1319 85  SER B OG  
3742 N N   . TRP B 86  ? 0.9969 0.5132 0.4211 0.0255  0.0563  -0.1171 86  TRP B N   
3743 C CA  . TRP B 86  ? 0.9962 0.5249 0.4153 0.0375  0.0647  -0.1148 86  TRP B CA  
3744 C C   . TRP B 86  ? 0.9759 0.5437 0.4111 0.0323  0.0510  -0.1053 86  TRP B C   
3745 O O   . TRP B 86  ? 0.9797 0.5520 0.3942 0.0285  0.0484  -0.1074 86  TRP B O   
3746 C CB  . TRP B 86  ? 0.9746 0.5075 0.4156 0.0594  0.0816  -0.1074 86  TRP B CB  
3747 C CG  . TRP B 86  ? 1.0055 0.5407 0.4343 0.0717  0.0954  -0.1073 86  TRP B CG  
3748 C CD1 . TRP B 86  ? 1.0868 0.5915 0.4881 0.0818  0.1135  -0.1158 86  TRP B CD1 
3749 C CD2 . TRP B 86  ? 0.9767 0.5456 0.4200 0.0755  0.0937  -0.0974 86  TRP B CD2 
3750 N NE1 . TRP B 86  ? 1.0788 0.5997 0.4779 0.0915  0.1233  -0.1114 86  TRP B NE1 
3751 C CE2 . TRP B 86  ? 1.0530 0.6128 0.4776 0.0868  0.1109  -0.0998 86  TRP B CE2 
3752 C CE3 . TRP B 86  ? 0.9494 0.5528 0.4183 0.0710  0.0806  -0.0863 86  TRP B CE3 
3753 C CZ2 . TRP B 86  ? 1.0266 0.6128 0.4591 0.0918  0.1144  -0.0908 86  TRP B CZ2 
3754 C CZ3 . TRP B 86  ? 0.9557 0.5805 0.4296 0.0759  0.0837  -0.0783 86  TRP B CZ3 
3755 C CH2 . TRP B 86  ? 0.9894 0.6066 0.4460 0.0852  0.0999  -0.0803 86  TRP B CH2 
3756 N N   . LEU B 87  ? 0.8737 0.4673 0.3432 0.0322  0.0425  -0.0949 87  LEU B N   
3757 C CA  . LEU B 87  ? 0.8210 0.4495 0.3090 0.0296  0.0304  -0.0845 87  LEU B CA  
3758 C C   . LEU B 87  ? 0.8617 0.4966 0.3323 0.0132  0.0154  -0.0874 87  LEU B C   
3759 O O   . LEU B 87  ? 0.8519 0.5051 0.3186 0.0134  0.0101  -0.0823 87  LEU B O   
3760 C CB  . LEU B 87  ? 0.7768 0.4231 0.2993 0.0327  0.0265  -0.0751 87  LEU B CB  
3761 C CG  . LEU B 87  ? 0.7959 0.4566 0.3416 0.0472  0.0341  -0.0657 87  LEU B CG  
3762 C CD1 . LEU B 87  ? 0.8068 0.4613 0.3415 0.0573  0.0469  -0.0669 87  LEU B CD1 
3763 C CD2 . LEU B 87  ? 0.7967 0.4552 0.3638 0.0518  0.0368  -0.0620 87  LEU B CD2 
3764 N N   . LYS B 88  ? 0.8162 0.4346 0.2742 -0.0016 0.0088  -0.0952 88  LYS B N   
3765 C CA  . LYS B 88  ? 0.8211 0.4470 0.2621 -0.0203 -0.0071 -0.0977 88  LYS B CA  
3766 C C   . LYS B 88  ? 0.9017 0.5145 0.3057 -0.0215 -0.0045 -0.1050 88  LYS B C   
3767 O O   . LYS B 88  ? 0.8829 0.5200 0.2850 -0.0232 -0.0136 -0.0983 88  LYS B O   
3768 C CB  . LYS B 88  ? 0.8619 0.4669 0.2930 -0.0380 -0.0129 -0.1058 88  LYS B CB  
3769 C CG  . LYS B 88  ? 0.8734 0.4950 0.2955 -0.0606 -0.0325 -0.1053 88  LYS B CG  
3770 C CD  . LYS B 88  ? 0.9662 0.5538 0.3634 -0.0814 -0.0361 -0.1176 88  LYS B CD  
3771 C CE  . LYS B 88  ? 1.0278 0.6263 0.4058 -0.1074 -0.0559 -0.1197 88  LYS B CE  
3772 N NZ  . LYS B 88  ? 1.0680 0.7055 0.4809 -0.1196 -0.0707 -0.1071 88  LYS B NZ  
3773 N N   . GLN B 89  ? 0.8978 0.4722 0.2732 -0.0175 0.0099  -0.1174 89  GLN B N   
3774 C CA  . GLN B 89  ? 0.9347 0.4908 0.2701 -0.0173 0.0160  -0.1259 89  GLN B CA  
3775 C C   . GLN B 89  ? 0.9615 0.5442 0.3057 -0.0047 0.0193  -0.1155 89  GLN B C   
3776 O O   . GLN B 89  ? 0.9533 0.5419 0.2730 -0.0116 0.0122  -0.1158 89  GLN B O   
3777 C CB  . GLN B 89  ? 0.9913 0.5014 0.2992 -0.0096 0.0355  -0.1392 89  GLN B CB  
3778 C CG  . GLN B 89  ? 1.3953 0.8757 0.6498 -0.0155 0.0402  -0.1525 89  GLN B CG  
3779 C CD  . GLN B 89  ? 1.7115 1.1933 0.9373 -0.0408 0.0193  -0.1578 89  GLN B CD  
3780 O OE1 . GLN B 89  ? 1.6330 1.1252 0.8363 -0.0443 0.0142  -0.1569 89  GLN B OE1 
3781 N NE2 . GLN B 89  ? 1.6771 1.1489 0.9017 -0.0599 0.0064  -0.1625 89  GLN B NE2 
3782 N N   . LEU B 90  ? 0.9027 0.5019 0.2816 0.0121  0.0286  -0.1053 90  LEU B N   
3783 C CA  . LEU B 90  ? 0.8789 0.5018 0.2704 0.0235  0.0327  -0.0941 90  LEU B CA  
3784 C C   . LEU B 90  ? 0.9162 0.5678 0.3137 0.0160  0.0156  -0.0844 90  LEU B C   
3785 O O   . LEU B 90  ? 0.9188 0.5766 0.2982 0.0165  0.0149  -0.0812 90  LEU B O   
3786 C CB  . LEU B 90  ? 0.8402 0.4757 0.2694 0.0380  0.0418  -0.0849 90  LEU B CB  
3787 C CG  . LEU B 90  ? 0.8833 0.5416 0.3265 0.0470  0.0453  -0.0727 90  LEU B CG  
3788 C CD1 . LEU B 90  ? 0.9119 0.5599 0.3379 0.0562  0.0627  -0.0748 90  LEU B CD1 
3789 C CD2 . LEU B 90  ? 0.8694 0.5455 0.3508 0.0538  0.0449  -0.0624 90  LEU B CD2 
3790 N N   . GLN B 91  ? 0.8497 0.5187 0.2722 0.0100  0.0027  -0.0789 91  GLN B N   
3791 C CA  . GLN B 91  ? 0.8289 0.5282 0.2640 0.0053  -0.0132 -0.0676 91  GLN B CA  
3792 C C   . GLN B 91  ? 0.9017 0.6032 0.3058 -0.0089 -0.0260 -0.0707 91  GLN B C   
3793 O O   . GLN B 91  ? 0.8682 0.5889 0.2689 -0.0069 -0.0328 -0.0610 91  GLN B O   
3794 C CB  . GLN B 91  ? 0.8148 0.5301 0.2824 0.0027  -0.0210 -0.0622 91  GLN B CB  
3795 C CG  . GLN B 91  ? 0.8778 0.5949 0.3750 0.0164  -0.0108 -0.0570 91  GLN B CG  
3796 C CD  . GLN B 91  ? 1.0215 0.7574 0.5347 0.0276  -0.0101 -0.0444 91  GLN B CD  
3797 O OE1 . GLN B 91  ? 0.9168 0.6479 0.4224 0.0351  -0.0016 -0.0426 91  GLN B OE1 
3798 N NE2 . GLN B 91  ? 0.9334 0.6892 0.4696 0.0292  -0.0175 -0.0353 91  GLN B NE2 
3799 N N   . ILE B 92  ? 0.9179 0.5970 0.2966 -0.0234 -0.0292 -0.0839 92  ILE B N   
3800 C CA  . ILE B 92  ? 0.9687 0.6457 0.3119 -0.0401 -0.0422 -0.0889 92  ILE B CA  
3801 C C   . ILE B 92  ? 1.0797 0.7434 0.3901 -0.0328 -0.0322 -0.0916 92  ILE B C   
3802 O O   . ILE B 92  ? 1.1040 0.7854 0.4008 -0.0366 -0.0427 -0.0843 92  ILE B O   
3803 C CB  . ILE B 92  ? 1.0463 0.6946 0.3639 -0.0597 -0.0469 -0.1043 92  ILE B CB  
3804 C CG1 . ILE B 92  ? 1.0319 0.6868 0.3824 -0.0651 -0.0512 -0.1023 92  ILE B CG1 
3805 C CG2 . ILE B 92  ? 1.0859 0.7394 0.3702 -0.0809 -0.0654 -0.1071 92  ILE B CG2 
3806 C CD1 . ILE B 92  ? 1.1539 0.7637 0.4813 -0.0764 -0.0448 -0.1192 92  ILE B CD1 
3807 N N   . LYS B 93  ? 1.0297 0.6649 0.3292 -0.0211 -0.0114 -0.1001 93  LYS B N   
3808 C CA  . LYS B 93  ? 1.0408 0.6638 0.3103 -0.0132 0.0012  -0.1023 93  LYS B CA  
3809 C C   . LYS B 93  ? 1.0380 0.6912 0.3254 -0.0031 -0.0002 -0.0854 93  LYS B C   
3810 O O   . LYS B 93  ? 1.0534 0.7108 0.3137 -0.0065 -0.0046 -0.0824 93  LYS B O   
3811 C CB  . LYS B 93  ? 1.0839 0.6767 0.3461 -0.0002 0.0251  -0.1118 93  LYS B CB  
3812 N N   . LEU B 94  ? 0.9397 0.6121 0.2699 0.0079  0.0021  -0.0742 94  LEU B N   
3813 C CA  . LEU B 94  ? 0.9079 0.6039 0.2564 0.0172  0.0013  -0.0582 94  LEU B CA  
3814 C C   . LEU B 94  ? 0.9958 0.7166 0.3453 0.0113  -0.0175 -0.0467 94  LEU B C   
3815 O O   . LEU B 94  ? 1.0145 0.7429 0.3518 0.0150  -0.0179 -0.0375 94  LEU B O   
3816 C CB  . LEU B 94  ? 0.8530 0.5580 0.2424 0.0283  0.0081  -0.0510 94  LEU B CB  
3817 C CG  . LEU B 94  ? 0.8944 0.5900 0.2869 0.0393  0.0272  -0.0510 94  LEU B CG  
3818 C CD1 . LEU B 94  ? 0.8574 0.5521 0.2811 0.0454  0.0336  -0.0518 94  LEU B CD1 
3819 C CD2 . LEU B 94  ? 0.9147 0.6229 0.3089 0.0452  0.0302  -0.0377 94  LEU B CD2 
3820 N N   . HIS B 95  ? 0.9591 0.6944 0.3255 0.0034  -0.0322 -0.0452 95  HIS B N   
3821 C CA  . HIS B 95  ? 0.9614 0.7259 0.3349 0.0001  -0.0499 -0.0317 95  HIS B CA  
3822 C C   . HIS B 95  ? 1.0182 0.7951 0.3958 -0.0155 -0.0665 -0.0348 95  HIS B C   
3823 O O   . HIS B 95  ? 0.9887 0.7915 0.3984 -0.0135 -0.0752 -0.0242 95  HIS B O   
3824 C CB  . HIS B 95  ? 0.9356 0.7185 0.3444 0.0150  -0.0479 -0.0160 95  HIS B CB  
3825 C CG  . HIS B 95  ? 0.9507 0.7252 0.3873 0.0219  -0.0371 -0.0199 95  HIS B CG  
3826 N ND1 . HIS B 95  ? 0.9609 0.7258 0.4067 0.0334  -0.0230 -0.0170 95  HIS B ND1 
3827 C CD2 . HIS B 95  ? 0.9620 0.7351 0.4154 0.0169  -0.0387 -0.0265 95  HIS B CD2 
3828 C CE1 . HIS B 95  ? 0.9325 0.6926 0.4009 0.0358  -0.0176 -0.0215 95  HIS B CE1 
3829 N NE2 . HIS B 95  ? 0.9372 0.7008 0.4103 0.0268  -0.0259 -0.0274 95  HIS B NE2 
3830 N N   . ASN B 96  ? 0.9987 0.7555 0.3411 -0.0317 -0.0700 -0.0494 96  ASN B N   
3831 C CA  . ASN B 96  ? 1.0081 0.7697 0.3424 -0.0527 -0.0865 -0.0553 96  ASN B CA  
3832 C C   . ASN B 96  ? 1.0355 0.8409 0.4043 -0.0546 -0.1036 -0.0383 96  ASN B C   
3833 O O   . ASN B 96  ? 1.0323 0.8643 0.3983 -0.0541 -0.1157 -0.0251 96  ASN B O   
3834 C CB  . ASN B 96  ? 1.0507 0.7946 0.3324 -0.0689 -0.0936 -0.0657 96  ASN B CB  
3835 C CG  . ASN B 96  ? 1.2540 1.0092 0.5211 -0.0945 -0.1159 -0.0684 96  ASN B CG  
3836 O OD1 . ASN B 96  ? 1.1578 0.9357 0.4551 -0.1031 -0.1273 -0.0630 96  ASN B OD1 
3837 N ND2 . ASN B 96  ? 1.1676 0.9084 0.3865 -0.1085 -0.1231 -0.0762 96  ASN B ND2 
3838 N N   . PRO B 97  ? 0.9719 0.7860 0.3757 -0.0537 -0.1027 -0.0368 97  PRO B N   
3839 C CA  . PRO B 97  ? 0.9418 0.7989 0.3823 -0.0521 -0.1154 -0.0196 97  PRO B CA  
3840 C C   . PRO B 97  ? 1.0016 0.8813 0.4343 -0.0756 -0.1369 -0.0179 97  PRO B C   
3841 O O   . PRO B 97  ? 1.0178 0.8732 0.4252 -0.0952 -0.1399 -0.0334 97  PRO B O   
3842 C CB  . PRO B 97  ? 0.9315 0.7844 0.4056 -0.0444 -0.1047 -0.0209 97  PRO B CB  
3843 C CG  . PRO B 97  ? 0.9887 0.7995 0.4464 -0.0379 -0.0862 -0.0357 97  PRO B CG  
3844 C CD  . PRO B 97  ? 0.9813 0.7678 0.3941 -0.0517 -0.0888 -0.0487 97  PRO B CD  
3845 N N   . PRO B 98  ? 0.9477 0.8732 0.4003 -0.0742 -0.1521 0.0013  98  PRO B N   
3846 C CA  . PRO B 98  ? 0.9685 0.9230 0.4169 -0.0987 -0.1750 0.0054  98  PRO B CA  
3847 C C   . PRO B 98  ? 1.0252 0.9853 0.4960 -0.1143 -0.1784 0.0011  98  PRO B C   
3848 O O   . PRO B 98  ? 1.0567 1.0187 0.5115 -0.1417 -0.1935 -0.0051 98  PRO B O   
3849 C CB  . PRO B 98  ? 0.9683 0.9747 0.4439 -0.0866 -0.1865 0.0308  98  PRO B CB  
3850 C CG  . PRO B 98  ? 1.0016 0.9956 0.4819 -0.0580 -0.1699 0.0369  98  PRO B CG  
3851 C CD  . PRO B 98  ? 0.9317 0.8843 0.4120 -0.0505 -0.1490 0.0210  98  PRO B CD  
3852 N N   . THR B 99  ? 0.9393 0.8981 0.4439 -0.0979 -0.1638 0.0039  99  THR B N   
3853 C CA  . THR B 99  ? 0.9225 0.8891 0.4544 -0.1070 -0.1635 0.0033  99  THR B CA  
3854 C C   . THR B 99  ? 0.9875 0.9074 0.4950 -0.1251 -0.1577 -0.0182 99  THR B C   
3855 O O   . THR B 99  ? 0.9734 0.8997 0.4999 -0.1378 -0.1602 -0.0181 99  THR B O   
3856 C CB  . THR B 99  ? 0.9915 0.9811 0.5668 -0.0817 -0.1523 0.0180  99  THR B CB  
3857 O OG1 . THR B 99  ? 0.9875 1.0262 0.5987 -0.0879 -0.1636 0.0343  99  THR B OG1 
3858 C CG2 . THR B 99  ? 0.9303 0.8827 0.5106 -0.0682 -0.1314 0.0073  99  THR B CG2 
3859 N N   . ILE B 100 ? 0.9678 0.8415 0.4323 -0.1268 -0.1501 -0.0355 100 ILE B N   
3860 C CA  . ILE B 100 ? 0.9921 0.8157 0.4297 -0.1396 -0.1418 -0.0558 100 ILE B CA  
3861 C C   . ILE B 100 ? 1.0808 0.9029 0.5114 -0.1712 -0.1562 -0.0611 100 ILE B C   
3862 O O   . ILE B 100 ? 1.0899 0.8946 0.5328 -0.1754 -0.1490 -0.0660 100 ILE B O   
3863 C CB  . ILE B 100 ? 1.0563 0.8305 0.4492 -0.1329 -0.1281 -0.0726 100 ILE B CB  
3864 C CG1 . ILE B 100 ? 1.1192 0.8875 0.4674 -0.1492 -0.1410 -0.0785 100 ILE B CG1 
3865 C CG2 . ILE B 100 ? 1.0168 0.7903 0.4240 -0.1032 -0.1111 -0.0672 100 ILE B CG2 
3866 C CD1 . ILE B 100 ? 1.3118 1.0233 0.6086 -0.1471 -0.1260 -0.0987 100 ILE B CD1 
3867 N N   . HIS B 101 ? 1.0499 0.8916 0.4621 -0.1941 -0.1771 -0.0589 101 HIS B N   
3868 C CA  . HIS B 101 ? 1.0792 0.9186 0.4823 -0.2279 -0.1924 -0.0641 101 HIS B CA  
3869 C C   . HIS B 101 ? 1.0898 0.9905 0.5414 -0.2380 -0.2076 -0.0436 101 HIS B C   
3870 O O   . HIS B 101 ? 1.1052 1.0081 0.5554 -0.2675 -0.2199 -0.0458 101 HIS B O   
3871 C CB  . HIS B 101 ? 1.1577 0.9736 0.5049 -0.2532 -0.2066 -0.0771 101 HIS B CB  
3872 C CG  . HIS B 101 ? 1.2408 0.9887 0.5379 -0.2467 -0.1888 -0.0998 101 HIS B CG  
3873 N ND1 . HIS B 101 ? 1.2766 1.0132 0.5435 -0.2325 -0.1834 -0.1033 101 HIS B ND1 
3874 C CD2 . HIS B 101 ? 1.2919 0.9824 0.5676 -0.2497 -0.1736 -0.1177 101 HIS B CD2 
3875 C CE1 . HIS B 101 ? 1.3041 0.9793 0.5328 -0.2277 -0.1649 -0.1234 101 HIS B CE1 
3876 N NE2 . HIS B 101 ? 1.3186 0.9636 0.5514 -0.2367 -0.1582 -0.1325 101 HIS B NE2 
3877 N N   . TYR B 102 ? 0.9979 0.9468 0.4920 -0.2135 -0.2054 -0.0235 102 TYR B N   
3878 C CA  . TYR B 102 ? 0.9681 0.9805 0.5127 -0.2155 -0.2161 -0.0010 102 TYR B CA  
3879 C C   . TYR B 102 ? 1.0277 1.0369 0.5954 -0.2291 -0.2121 -0.0022 102 TYR B C   
3880 O O   . TYR B 102 ? 1.0236 0.9870 0.5834 -0.2202 -0.1940 -0.0152 102 TYR B O   
3881 C CB  . TYR B 102 ? 0.9294 0.9714 0.5102 -0.1789 -0.2041 0.0156  102 TYR B CB  
3882 C CG  . TYR B 102 ? 0.9501 1.0300 0.5326 -0.1681 -0.2152 0.0310  102 TYR B CG  
3883 C CD1 . TYR B 102 ? 0.9498 1.0873 0.5770 -0.1517 -0.2185 0.0556  102 TYR B CD1 
3884 C CD2 . TYR B 102 ? 0.9841 1.0397 0.5224 -0.1712 -0.2200 0.0218  102 TYR B CD2 
3885 C CE1 . TYR B 102 ? 0.9604 1.1307 0.5891 -0.1391 -0.2278 0.0714  102 TYR B CE1 
3886 C CE2 . TYR B 102 ? 0.9924 1.0810 0.5312 -0.1599 -0.2295 0.0373  102 TYR B CE2 
3887 C CZ  . TYR B 102 ? 1.0525 1.1981 0.6370 -0.1437 -0.2337 0.0624  102 TYR B CZ  
3888 O OH  . TYR B 102 ? 1.0553 1.2320 0.6400 -0.1312 -0.2428 0.0793  102 TYR B OH  
3889 N N   . PRO B 103 ? 0.9842 1.0431 0.5827 -0.2496 -0.2279 0.0128  103 PRO B N   
3890 C CA  . PRO B 103 ? 0.9751 1.0311 0.5972 -0.2606 -0.2217 0.0134  103 PRO B CA  
3891 C C   . PRO B 103 ? 0.9842 1.0462 0.6422 -0.2266 -0.1997 0.0215  103 PRO B C   
3892 O O   . PRO B 103 ? 0.9451 1.0415 0.6264 -0.2005 -0.1964 0.0358  103 PRO B O   
3893 C CB  . PRO B 103 ? 1.0015 1.1220 0.6541 -0.2864 -0.2435 0.0323  103 PRO B CB  
3894 C CG  . PRO B 103 ? 1.0449 1.2153 0.7086 -0.2740 -0.2556 0.0485  103 PRO B CG  
3895 C CD  . PRO B 103 ? 1.0074 1.1310 0.6239 -0.2623 -0.2511 0.0321  103 PRO B CD  
3896 N N   . PRO B 104 ? 0.9444 0.9704 0.6042 -0.2256 -0.1844 0.0128  104 PRO B N   
3897 C CA  . PRO B 104 ? 0.8931 0.9258 0.5844 -0.1950 -0.1650 0.0208  104 PRO B CA  
3898 C C   . PRO B 104 ? 0.9073 1.0093 0.6478 -0.1875 -0.1691 0.0456  104 PRO B C   
3899 O O   . PRO B 104 ? 0.8486 0.9679 0.6088 -0.1572 -0.1582 0.0553  104 PRO B O   
3900 C CB  . PRO B 104 ? 0.9245 0.9140 0.6086 -0.2044 -0.1537 0.0097  104 PRO B CB  
3901 C CG  . PRO B 104 ? 1.0303 1.0082 0.6938 -0.2432 -0.1695 0.0025  104 PRO B CG  
3902 C CD  . PRO B 104 ? 1.0027 0.9816 0.6363 -0.2529 -0.1848 -0.0032 104 PRO B CD  
3903 N N   . SER B 105 ? 0.9027 1.0448 0.6608 -0.2160 -0.1855 0.0562  105 SER B N   
3904 C CA  . SER B 105 ? 0.8837 1.1002 0.6902 -0.2144 -0.1925 0.0820  105 SER B CA  
3905 C C   . SER B 105 ? 0.9285 1.1779 0.7468 -0.1847 -0.1925 0.0948  105 SER B C   
3906 O O   . SER B 105 ? 0.8827 1.1665 0.7364 -0.1589 -0.1814 0.1114  105 SER B O   
3907 C CB  . SER B 105 ? 0.9417 1.1932 0.7529 -0.2543 -0.2163 0.0887  105 SER B CB  
3908 O OG  . SER B 105 ? 1.0503 1.2469 0.8160 -0.2849 -0.2243 0.0669  105 SER B OG  
3909 N N   . GLN B 106 ? 0.9226 1.1542 0.7069 -0.1869 -0.2027 0.0861  106 GLN B N   
3910 C CA  . GLN B 106 ? 0.9070 1.1564 0.6934 -0.1590 -0.2018 0.0957  106 GLN B CA  
3911 C C   . GLN B 106 ? 0.9330 1.1320 0.7055 -0.1290 -0.1784 0.0837  106 GLN B C   
3912 O O   . GLN B 106 ? 0.9212 1.1248 0.7195 -0.1118 -0.1628 0.0895  106 GLN B O   
3913 C CB  . GLN B 106 ? 0.9536 1.2053 0.7087 -0.1746 -0.2218 0.0926  106 GLN B CB  
3914 C CG  . GLN B 106 ? 1.1437 1.4637 0.9235 -0.1955 -0.2456 0.1129  106 GLN B CG  
3915 C CD  . GLN B 106 ? 1.4812 1.8279 1.2515 -0.1867 -0.2592 0.1239  106 GLN B CD  
3916 O OE1 . GLN B 106 ? 1.4622 1.7795 1.1881 -0.2012 -0.2701 0.1105  106 GLN B OE1 
3917 N NE2 . GLN B 106 ? 1.3885 1.7902 1.1986 -0.1616 -0.2580 0.1492  106 GLN B NE2 
3918 N N   . GLY B 107 ? 0.8647 1.0161 0.5970 -0.1250 -0.1755 0.0669  107 GLY B N   
3919 C CA  . GLY B 107 ? 0.8249 0.9336 0.5472 -0.0990 -0.1546 0.0572  107 GLY B CA  
3920 C C   . GLY B 107 ? 0.8562 0.9043 0.5356 -0.1030 -0.1483 0.0345  107 GLY B C   
3921 O O   . GLY B 107 ? 0.8410 0.8666 0.5070 -0.0825 -0.1381 0.0306  107 GLY B O   
3922 N N   . GLN B 108 ? 0.8202 0.8401 0.4783 -0.1287 -0.1529 0.0201  108 GLN B N   
3923 C CA  . GLN B 108 ? 0.8354 0.7960 0.4514 -0.1341 -0.1460 -0.0018 108 GLN B CA  
3924 C C   . GLN B 108 ? 0.8520 0.7807 0.4641 -0.1067 -0.1259 -0.0079 108 GLN B C   
3925 O O   . GLN B 108 ? 0.8225 0.7593 0.4620 -0.0904 -0.1149 -0.0008 108 GLN B O   
3926 C CB  . GLN B 108 ? 0.8743 0.8069 0.4803 -0.1584 -0.1466 -0.0133 108 GLN B CB  
3927 C CG  . GLN B 108 ? 1.0634 0.9362 0.6215 -0.1691 -0.1427 -0.0354 108 GLN B CG  
3928 C CD  . GLN B 108 ? 1.3811 1.2227 0.9334 -0.1877 -0.1396 -0.0446 108 GLN B CD  
3929 O OE1 . GLN B 108 ? 1.3538 1.2024 0.9007 -0.2170 -0.1540 -0.0449 108 GLN B OE1 
3930 N NE2 . GLN B 108 ? 1.3154 1.1236 0.8700 -0.1718 -0.1212 -0.0507 108 GLN B NE2 
3931 N N   . MET B 109 ? 0.8183 0.7114 0.3955 -0.1028 -0.1213 -0.0207 109 MET B N   
3932 C CA  . MET B 109 ? 0.7957 0.6600 0.3678 -0.0798 -0.1034 -0.0263 109 MET B CA  
3933 C C   . MET B 109 ? 0.8574 0.6897 0.4319 -0.0799 -0.0909 -0.0356 109 MET B C   
3934 O O   . MET B 109 ? 0.8979 0.7008 0.4505 -0.0971 -0.0921 -0.0479 109 MET B O   
3935 C CB  . MET B 109 ? 0.8493 0.6852 0.3829 -0.0784 -0.1011 -0.0373 109 MET B CB  
3936 C CG  . MET B 109 ? 0.8681 0.6859 0.4019 -0.0544 -0.0842 -0.0385 109 MET B CG  
3937 S SD  . MET B 109 ? 0.9381 0.7151 0.4284 -0.0515 -0.0747 -0.0533 109 MET B SD  
3938 C CE  . MET B 109 ? 0.9269 0.6620 0.3951 -0.0674 -0.0701 -0.0711 109 MET B CE  
3939 N N   . ASP B 110 ? 0.7768 0.6129 0.3758 -0.0609 -0.0791 -0.0294 110 ASP B N   
3940 C CA  . ASP B 110 ? 0.7661 0.5745 0.3692 -0.0574 -0.0669 -0.0357 110 ASP B CA  
3941 C C   . ASP B 110 ? 0.8064 0.5988 0.4100 -0.0348 -0.0526 -0.0369 110 ASP B C   
3942 O O   . ASP B 110 ? 0.7935 0.6024 0.4036 -0.0211 -0.0519 -0.0295 110 ASP B O   
3943 C CB  . ASP B 110 ? 0.7688 0.5996 0.4018 -0.0620 -0.0682 -0.0260 110 ASP B CB  
3944 C CG  . ASP B 110 ? 0.9147 0.7154 0.5461 -0.0676 -0.0600 -0.0328 110 ASP B CG  
3945 O OD1 . ASP B 110 ? 0.9718 0.7325 0.5768 -0.0715 -0.0550 -0.0461 110 ASP B OD1 
3946 O OD2 . ASP B 110 ? 0.8978 0.7145 0.5534 -0.0679 -0.0580 -0.0242 110 ASP B OD2 
3947 N N   . LEU B 111 ? 0.7642 0.5233 0.3589 -0.0318 -0.0418 -0.0459 111 LEU B N   
3948 C CA  . LEU B 111 ? 0.7404 0.4861 0.3367 -0.0132 -0.0292 -0.0466 111 LEU B CA  
3949 C C   . LEU B 111 ? 0.7615 0.5006 0.3753 -0.0071 -0.0215 -0.0439 111 LEU B C   
3950 O O   . LEU B 111 ? 0.7705 0.4981 0.3850 -0.0173 -0.0218 -0.0464 111 LEU B O   
3951 C CB  . LEU B 111 ? 0.7676 0.4830 0.3362 -0.0109 -0.0220 -0.0578 111 LEU B CB  
3952 C CG  . LEU B 111 ? 0.8454 0.5681 0.3956 -0.0115 -0.0269 -0.0587 111 LEU B CG  
3953 C CD1 . LEU B 111 ? 0.8831 0.5953 0.4065 -0.0307 -0.0362 -0.0674 111 LEU B CD1 
3954 C CD2 . LEU B 111 ? 0.8862 0.5929 0.4246 0.0023  -0.0146 -0.0621 111 LEU B CD2 
3955 N N   . CYS B 112 ? 0.6865 0.4324 0.3130 0.0083  -0.0153 -0.0380 112 CYS B N   
3956 C CA  . CYS B 112 ? 0.6589 0.4015 0.3007 0.0153  -0.0088 -0.0340 112 CYS B CA  
3957 C C   . CYS B 112 ? 0.6899 0.4240 0.3312 0.0292  -0.0007 -0.0337 112 CYS B C   
3958 O O   . CYS B 112 ? 0.6692 0.4146 0.3118 0.0366  -0.0011 -0.0298 112 CYS B O   
3959 C CB  . CYS B 112 ? 0.6433 0.4127 0.3053 0.0166  -0.0125 -0.0236 112 CYS B CB  
3960 S SG  . CYS B 112 ? 0.6774 0.4434 0.3536 0.0269  -0.0044 -0.0181 112 CYS B SG  
3961 N N   . VAL B 113 ? 0.6559 0.3708 0.2959 0.0326  0.0066  -0.0368 113 VAL B N   
3962 C CA  . VAL B 113 ? 0.6424 0.3536 0.2857 0.0445  0.0136  -0.0347 113 VAL B CA  
3963 C C   . VAL B 113 ? 0.6588 0.3814 0.3182 0.0493  0.0132  -0.0265 113 VAL B C   
3964 O O   . VAL B 113 ? 0.6387 0.3603 0.3052 0.0459  0.0127  -0.0241 113 VAL B O   
3965 C CB  . VAL B 113 ? 0.7111 0.3993 0.3465 0.0484  0.0222  -0.0398 113 VAL B CB  
3966 C CG1 . VAL B 113 ? 0.6989 0.3910 0.3435 0.0602  0.0285  -0.0346 113 VAL B CG1 
3967 C CG2 . VAL B 113 ? 0.7320 0.4058 0.3460 0.0444  0.0241  -0.0490 113 VAL B CG2 
3968 N N   . THR B 114 ? 0.5983 0.3302 0.2606 0.0559  0.0133  -0.0222 114 THR B N   
3969 C CA  . THR B 114 ? 0.5858 0.3244 0.2570 0.0602  0.0132  -0.0158 114 THR B CA  
3970 C C   . THR B 114 ? 0.6204 0.3551 0.2929 0.0657  0.0166  -0.0136 114 THR B C   
3971 O O   . THR B 114 ? 0.5899 0.3229 0.2582 0.0676  0.0190  -0.0153 114 THR B O   
3972 C CB  . THR B 114 ? 0.7632 0.5143 0.4346 0.0620  0.0097  -0.0119 114 THR B CB  
3973 O OG1 . THR B 114 ? 0.8469 0.5983 0.5104 0.0642  0.0093  -0.0127 114 THR B OG1 
3974 C CG2 . THR B 114 ? 0.7251 0.4881 0.4010 0.0570  0.0057  -0.0107 114 THR B CG2 
3975 N N   . SER B 115 ? 0.5884 0.3234 0.2665 0.0675  0.0166  -0.0089 115 SER B N   
3976 C CA  . SER B 115 ? 0.5783 0.3136 0.2590 0.0704  0.0174  -0.0048 115 SER B CA  
3977 C C   . SER B 115 ? 0.6663 0.4047 0.3410 0.0703  0.0154  -0.0037 115 SER B C   
3978 O O   . SER B 115 ? 0.6661 0.4031 0.3360 0.0703  0.0135  -0.0016 115 SER B O   
3979 C CB  . SER B 115 ? 0.5669 0.3013 0.2512 0.0706  0.0163  -0.0002 115 SER B CB  
3980 O OG  . SER B 115 ? 0.5698 0.2989 0.2577 0.0697  0.0182  -0.0008 115 SER B OG  
3981 N N   . GLY B 116 ? 0.6287 0.3684 0.3008 0.0705  0.0172  -0.0053 116 GLY B N   
3982 C CA  . GLY B 116 ? 0.6189 0.3590 0.2838 0.0697  0.0161  -0.0039 116 GLY B CA  
3983 C C   . GLY B 116 ? 0.6448 0.3847 0.3029 0.0708  0.0143  -0.0052 116 GLY B C   
3984 O O   . GLY B 116 ? 0.6231 0.3651 0.2840 0.0713  0.0130  -0.0058 116 GLY B O   
3985 N N   . SER B 117 ? 0.6101 0.3494 0.2603 0.0712  0.0142  -0.0042 117 SER B N   
3986 C CA  . SER B 117 ? 0.6221 0.3638 0.2668 0.0738  0.0119  -0.0031 117 SER B CA  
3987 C C   . SER B 117 ? 0.7040 0.4426 0.3475 0.0783  0.0114  0.0006  117 SER B C   
3988 O O   . SER B 117 ? 0.7064 0.4531 0.3525 0.0818  0.0101  0.0025  117 SER B O   
3989 C CB  . SER B 117 ? 0.6624 0.4033 0.2974 0.0741  0.0122  -0.0014 117 SER B CB  
3990 O OG  . SER B 117 ? 0.7882 0.5201 0.4157 0.0764  0.0125  0.0035  117 SER B OG  
3991 N N   . GLN B 118 ? 0.6786 0.4064 0.3181 0.0778  0.0127  0.0018  118 GLN B N   
3992 C CA  . GLN B 118 ? 0.6939 0.4130 0.3272 0.0825  0.0142  0.0039  118 GLN B CA  
3993 C C   . GLN B 118 ? 0.7290 0.4589 0.3718 0.0856  0.0150  0.0041  118 GLN B C   
3994 O O   . GLN B 118 ? 0.7209 0.4517 0.3617 0.0929  0.0176  0.0073  118 GLN B O   
3995 C CB  . GLN B 118 ? 0.7223 0.4277 0.3478 0.0777  0.0140  0.0035  118 GLN B CB  
3996 C CG  . GLN B 118 ? 0.9596 0.6463 0.5687 0.0819  0.0167  0.0045  118 GLN B CG  
3997 C CD  . GLN B 118 ? 1.1555 0.8285 0.7518 0.0862  0.0187  0.0069  118 GLN B CD  
3998 O OE1 . GLN B 118 ? 1.0430 0.7117 0.6357 0.0805  0.0169  0.0078  118 GLN B OE1 
3999 N NE2 . GLN B 118 ? 1.0606 0.7272 0.6505 0.0972  0.0234  0.0093  118 GLN B NE2 
4000 N N   . GLN B 119 ? 0.6644 0.4018 0.3173 0.0806  0.0138  0.0016  119 GLN B N   
4001 C CA  . GLN B 119 ? 0.6419 0.3887 0.3041 0.0805  0.0144  0.0023  119 GLN B CA  
4002 C C   . GLN B 119 ? 0.6653 0.4274 0.3344 0.0818  0.0129  0.0042  119 GLN B C   
4003 O O   . GLN B 119 ? 0.6470 0.4185 0.3215 0.0858  0.0149  0.0084  119 GLN B O   
4004 C CB  . GLN B 119 ? 0.6466 0.3932 0.3157 0.0746  0.0137  -0.0003 119 GLN B CB  
4005 C CG  . GLN B 119 ? 0.6868 0.4368 0.3616 0.0740  0.0155  0.0020  119 GLN B CG  
4006 C CD  . GLN B 119 ? 0.8493 0.5971 0.5305 0.0690  0.0153  0.0008  119 GLN B CD  
4007 O OE1 . GLN B 119 ? 0.8480 0.5924 0.5302 0.0664  0.0145  -0.0028 119 GLN B OE1 
4008 N NE2 . GLN B 119 ? 0.6451 0.3927 0.3289 0.0683  0.0172  0.0041  119 GLN B NE2 
4009 N N   . GLY B 120 ? 0.6131 0.3789 0.2815 0.0782  0.0095  0.0018  120 GLY B N   
4010 C CA  . GLY B 120 ? 0.6100 0.3921 0.2832 0.0770  0.0055  0.0039  120 GLY B CA  
4011 C C   . GLY B 120 ? 0.6488 0.4395 0.3234 0.0867  0.0069  0.0115  120 GLY B C   
4012 O O   . GLY B 120 ? 0.6393 0.4461 0.3250 0.0889  0.0075  0.0165  120 GLY B O   
4013 N N   . LEU B 121 ? 0.5966 0.3745 0.2597 0.0932  0.0089  0.0129  121 LEU B N   
4014 C CA  . LEU B 121 ? 0.5930 0.3699 0.2521 0.1051  0.0122  0.0201  121 LEU B CA  
4015 C C   . LEU B 121 ? 0.6342 0.4109 0.2969 0.1124  0.0186  0.0231  121 LEU B C   
4016 O O   . LEU B 121 ? 0.6175 0.4112 0.2893 0.1210  0.0207  0.0306  121 LEU B O   
4017 C CB  . LEU B 121 ? 0.6005 0.3537 0.2426 0.1075  0.0145  0.0192  121 LEU B CB  
4018 C CG  . LEU B 121 ? 0.6538 0.4057 0.2903 0.1015  0.0104  0.0173  121 LEU B CG  
4019 C CD1 . LEU B 121 ? 0.6679 0.3970 0.2911 0.0986  0.0131  0.0152  121 LEU B CD1 
4020 C CD2 . LEU B 121 ? 0.6772 0.4405 0.3127 0.1074  0.0075  0.0243  121 LEU B CD2 
4021 N N   . CYS B 122 ? 0.6022 0.3623 0.2580 0.1092  0.0218  0.0182  122 CYS B N   
4022 C CA  . CYS B 122 ? 0.6180 0.3747 0.2724 0.1152  0.0287  0.0201  122 CYS B CA  
4023 C C   . CYS B 122 ? 0.6477 0.4317 0.3214 0.1154  0.0292  0.0251  122 CYS B C   
4024 O O   . CYS B 122 ? 0.6535 0.4503 0.3331 0.1264  0.0341  0.0326  122 CYS B O   
4025 C CB  . CYS B 122 ? 0.6357 0.3745 0.2803 0.1083  0.0292  0.0144  122 CYS B CB  
4026 S SG  . CYS B 122 ? 0.7087 0.4352 0.3412 0.1159  0.0384  0.0159  122 CYS B SG  
4027 N N   . LYS B 123 ? 0.5812 0.3748 0.2653 0.1035  0.0244  0.0219  123 LYS B N   
4028 C CA  . LYS B 123 ? 0.5652 0.3839 0.2676 0.0992  0.0236  0.0266  123 LYS B CA  
4029 C C   . LYS B 123 ? 0.6253 0.4699 0.3398 0.1040  0.0208  0.0344  123 LYS B C   
4030 O O   . LYS B 123 ? 0.6315 0.4985 0.3602 0.1091  0.0247  0.0429  123 LYS B O   
4031 C CB  . LYS B 123 ? 0.5662 0.3847 0.2736 0.0842  0.0177  0.0210  123 LYS B CB  
4032 C CG  . LYS B 123 ? 0.5344 0.3304 0.2320 0.0808  0.0194  0.0153  123 LYS B CG  
4033 C CD  . LYS B 123 ? 0.5940 0.3912 0.2957 0.0792  0.0241  0.0184  123 LYS B CD  
4034 C CE  . LYS B 123 ? 0.5469 0.3245 0.2394 0.0763  0.0245  0.0148  123 LYS B CE  
4035 N NZ  . LYS B 123 ? 0.5018 0.2661 0.1798 0.0836  0.0288  0.0153  123 LYS B NZ  
4036 N N   . VAL B 124 ? 0.5747 0.4175 0.2835 0.1039  0.0148  0.0332  124 VAL B N   
4037 C CA  . VAL B 124 ? 0.5737 0.4414 0.2923 0.1089  0.0107  0.0420  124 VAL B CA  
4038 C C   . VAL B 124 ? 0.6562 0.5304 0.3782 0.1278  0.0199  0.0522  124 VAL B C   
4039 O O   . VAL B 124 ? 0.6585 0.5647 0.4000 0.1318  0.0202  0.0625  124 VAL B O   
4040 C CB  . VAL B 124 ? 0.6089 0.4706 0.3166 0.1062  0.0034  0.0395  124 VAL B CB  
4041 C CG1 . VAL B 124 ? 0.6080 0.4944 0.3238 0.1149  -0.0002 0.0511  124 VAL B CG1 
4042 C CG2 . VAL B 124 ? 0.5977 0.4588 0.3034 0.0889  -0.0047 0.0310  124 VAL B CG2 
4043 N N   . PHE B 125 ? 0.6258 0.4695 0.3287 0.1390  0.0278  0.0497  125 PHE B N   
4044 C CA  . PHE B 125 ? 0.6448 0.4848 0.3442 0.1588  0.0388  0.0579  125 PHE B CA  
4045 C C   . PHE B 125 ? 0.6932 0.5474 0.4039 0.1638  0.0476  0.0622  125 PHE B C   
4046 O O   . PHE B 125 ? 0.7033 0.5776 0.4258 0.1790  0.0550  0.0736  125 PHE B O   
4047 C CB  . PHE B 125 ? 0.6927 0.4894 0.3637 0.1656  0.0453  0.0519  125 PHE B CB  
4048 C CG  . PHE B 125 ? 0.7186 0.4955 0.3752 0.1588  0.0385  0.0469  125 PHE B CG  
4049 C CD1 . PHE B 125 ? 0.7588 0.5044 0.3964 0.1500  0.0383  0.0371  125 PHE B CD1 
4050 C CD2 . PHE B 125 ? 0.7470 0.5381 0.4088 0.1615  0.0324  0.0533  125 PHE B CD2 
4051 C CE1 . PHE B 125 ? 0.7775 0.5086 0.4043 0.1433  0.0330  0.0340  125 PHE B CE1 
4052 C CE2 . PHE B 125 ? 0.7874 0.5605 0.4348 0.1552  0.0275  0.0495  125 PHE B CE2 
4053 C CZ  . PHE B 125 ? 0.7677 0.5115 0.3988 0.1461  0.0284  0.0400  125 PHE B CZ  
4054 N N   . GLU B 126 ? 0.6332 0.4778 0.3406 0.1518  0.0477  0.0543  126 GLU B N   
4055 C CA  . GLU B 126 ? 0.6242 0.4792 0.3394 0.1533  0.0560  0.0575  126 GLU B CA  
4056 C C   . GLU B 126 ? 0.6578 0.5578 0.4038 0.1482  0.0526  0.0675  126 GLU B C   
4057 O O   . GLU B 126 ? 0.6562 0.5768 0.4148 0.1574  0.0623  0.0769  126 GLU B O   
4058 C CB  . GLU B 126 ? 0.6347 0.4669 0.3372 0.1406  0.0548  0.0474  126 GLU B CB  
4059 C CG  . GLU B 126 ? 0.7547 0.5469 0.4275 0.1456  0.0590  0.0399  126 GLU B CG  
4060 C CD  . GLU B 126 ? 1.0711 0.8432 0.7309 0.1343  0.0569  0.0319  126 GLU B CD  
4061 O OE1 . GLU B 126 ? 1.0640 0.8130 0.7026 0.1395  0.0642  0.0295  126 GLU B OE1 
4062 O OE2 . GLU B 126 ? 0.9789 0.7570 0.6479 0.1207  0.0481  0.0284  126 GLU B OE2 
4063 N N   . MET B 127 ? 0.5959 0.5112 0.3525 0.1334  0.0390  0.0660  127 MET B N   
4064 C CA  . MET B 127 ? 0.5796 0.5365 0.3627 0.1235  0.0317  0.0746  127 MET B CA  
4065 C C   . MET B 127 ? 0.6056 0.5951 0.4057 0.1395  0.0344  0.0896  127 MET B C   
4066 O O   . MET B 127 ? 0.5984 0.6269 0.4238 0.1384  0.0356  0.1014  127 MET B O   
4067 C CB  . MET B 127 ? 0.6033 0.5595 0.3846 0.1043  0.0165  0.0672  127 MET B CB  
4068 C CG  . MET B 127 ? 0.6477 0.6455 0.4518 0.0921  0.0058  0.0760  127 MET B CG  
4069 S SD  . MET B 127 ? 0.7043 0.6973 0.4978 0.0728  -0.0114 0.0672  127 MET B SD  
4070 C CE  . MET B 127 ? 0.6717 0.6528 0.4505 0.0905  -0.0110 0.0685  127 MET B CE  
4071 N N   . ILE B 128 ? 0.5445 0.5187 0.3312 0.1541  0.0357  0.0905  128 ILE B N   
4072 C CA  . ILE B 128 ? 0.5533 0.5543 0.3532 0.1716  0.0373  0.1055  128 ILE B CA  
4073 C C   . ILE B 128 ? 0.6142 0.6127 0.4139 0.1981  0.0553  0.1149  128 ILE B C   
4074 O O   . ILE B 128 ? 0.6038 0.6432 0.4293 0.2093  0.0601  0.1309  128 ILE B O   
4075 C CB  . ILE B 128 ? 0.6046 0.5915 0.3901 0.1723  0.0279  0.1032  128 ILE B CB  
4076 C CG1 . ILE B 128 ? 0.5976 0.5913 0.3833 0.1477  0.0111  0.0954  128 ILE B CG1 
4077 C CG2 . ILE B 128 ? 0.6296 0.6420 0.4272 0.1926  0.0295  0.1205  128 ILE B CG2 
4078 C CD1 . ILE B 128 ? 0.6931 0.6614 0.4570 0.1467  0.0050  0.0890  128 ILE B CD1 
4079 N N   . ILE B 129 ? 0.5901 0.5404 0.3595 0.2082  0.0652  0.1056  129 ILE B N   
4080 C CA  . ILE B 129 ? 0.6138 0.5447 0.3703 0.2342  0.0831  0.1108  129 ILE B CA  
4081 C C   . ILE B 129 ? 0.6577 0.6005 0.4220 0.2456  0.0994  0.1167  129 ILE B C   
4082 O O   . ILE B 129 ? 0.6485 0.5756 0.4026 0.2348  0.1025  0.1073  129 ILE B O   
4083 C CB  . ILE B 129 ? 0.6758 0.5475 0.3932 0.2370  0.0862  0.0980  129 ILE B CB  
4084 C CG1 . ILE B 129 ? 0.6806 0.5464 0.3929 0.2353  0.0750  0.0990  129 ILE B CG1 
4085 C CG2 . ILE B 129 ? 0.7321 0.5722 0.4275 0.2609  0.1057  0.0998  129 ILE B CG2 
4086 C CD1 . ILE B 129 ? 0.7773 0.5982 0.4604 0.2237  0.0703  0.0848  129 ILE B CD1 
4087 N N   . ASN B 130 ? 0.6299 0.5987 0.4105 0.2696  0.1113  0.1332  130 ASN B N   
4088 C CA  . ASN B 130 ? 0.6462 0.6250 0.4321 0.2873  0.1315  0.1410  130 ASN B CA  
4089 C C   . ASN B 130 ? 0.7498 0.6852 0.5054 0.3156  0.1492  0.1410  130 ASN B C   
4090 O O   . ASN B 130 ? 0.7702 0.7022 0.5250 0.3284  0.1467  0.1476  130 ASN B O   
4091 C CB  . ASN B 130 ? 0.5874 0.6349 0.4190 0.2944  0.1334  0.1624  130 ASN B CB  
4092 C CG  . ASN B 130 ? 0.7811 0.8694 0.6407 0.2653  0.1175  0.1631  130 ASN B CG  
4093 O OD1 . ASN B 130 ? 0.5064 0.6108 0.3768 0.2577  0.1239  0.1646  130 ASN B OD1 
4094 N ND2 . ASN B 130 ? 0.8016 0.9041 0.6704 0.2477  0.0967  0.1618  130 ASN B ND2 
4095 N N   . PRO B 131 ? 0.7185 0.6162 0.4452 0.3252  0.1667  0.1332  131 PRO B N   
4096 C CA  . PRO B 131 ? 0.7598 0.6087 0.4519 0.3515  0.1845  0.1318  131 PRO B CA  
4097 C C   . PRO B 131 ? 0.8442 0.7220 0.5583 0.3812  0.1945  0.1522  131 PRO B C   
4098 O O   . PRO B 131 ? 0.8387 0.7670 0.5861 0.3942  0.2040  0.1685  131 PRO B O   
4099 C CB  . PRO B 131 ? 0.8015 0.6259 0.4698 0.3578  0.2032  0.1252  131 PRO B CB  
4100 C CG  . PRO B 131 ? 0.8230 0.6983 0.5248 0.3409  0.1979  0.1300  131 PRO B CG  
4101 C CD  . PRO B 131 ? 0.7280 0.6241 0.4497 0.3131  0.1720  0.1262  131 PRO B CD  
4102 N N   . GLY B 132 ? 0.8298 0.6800 0.5285 0.3903  0.1909  0.1528  132 GLY B N   
4103 C CA  . GLY B 132 ? 0.8518 0.7248 0.5688 0.4194  0.1987  0.1730  132 GLY B CA  
4104 C C   . GLY B 132 ? 0.8756 0.7844 0.6187 0.4088  0.1766  0.1820  132 GLY B C   
4105 O O   . GLY B 132 ? 0.8870 0.7982 0.6337 0.4303  0.1794  0.1959  132 GLY B O   
4106 N N   . ASP B 133 ? 0.7954 0.7296 0.5542 0.3760  0.1551  0.1742  133 ASP B N   
4107 C CA  . ASP B 133 ? 0.7686 0.7337 0.5468 0.3601  0.1323  0.1792  133 ASP B CA  
4108 C C   . ASP B 133 ? 0.8566 0.7744 0.6042 0.3662  0.1293  0.1753  133 ASP B C   
4109 O O   . ASP B 133 ? 0.8840 0.7393 0.5920 0.3695  0.1389  0.1617  133 ASP B O   
4110 C CB  . ASP B 133 ? 0.7505 0.7257 0.5340 0.3235  0.1137  0.1647  133 ASP B CB  
4111 C CG  . ASP B 133 ? 0.8191 0.8568 0.6428 0.3104  0.1071  0.1735  133 ASP B CG  
4112 O OD1 . ASP B 133 ? 0.8524 0.9194 0.6962 0.3272  0.1218  0.1864  133 ASP B OD1 
4113 O OD2 . ASP B 133 ? 0.8080 0.8638 0.6418 0.2832  0.0883  0.1676  133 ASP B OD2 
4114 N N   . ASN B 134 ? 0.8126 0.7594 0.5768 0.3669  0.1157  0.1877  134 ASN B N   
4115 C CA  . ASN B 134 ? 0.8404 0.7434 0.5757 0.3719  0.1129  0.1857  134 ASN B CA  
4116 C C   . ASN B 134 ? 0.8756 0.7742 0.6035 0.3407  0.0915  0.1732  134 ASN B C   
4117 O O   . ASN B 134 ? 0.8445 0.7916 0.5990 0.3236  0.0750  0.1770  134 ASN B O   
4118 C CB  . ASN B 134 ? 0.8673 0.7921 0.6165 0.4014  0.1172  0.2097  134 ASN B CB  
4119 C CG  . ASN B 134 ? 1.1218 1.0336 0.8680 0.4371  0.1429  0.2204  134 ASN B CG  
4120 O OD1 . ASN B 134 ? 1.0867 0.9332 0.7939 0.4492  0.1592  0.2104  134 ASN B OD1 
4121 N ND2 . ASN B 134 ? 0.9856 0.9589 0.7719 0.4543  0.1476  0.2411  134 ASN B ND2 
4122 N N   . VAL B 135 ? 0.8453 0.6852 0.5363 0.3324  0.0923  0.1580  135 VAL B N   
4123 C CA  . VAL B 135 ? 0.8281 0.6604 0.5100 0.3052  0.0751  0.1464  135 VAL B CA  
4124 C C   . VAL B 135 ? 0.9082 0.6992 0.5620 0.3089  0.0741  0.1469  135 VAL B C   
4125 O O   . VAL B 135 ? 0.9285 0.6699 0.5547 0.3227  0.0877  0.1449  135 VAL B O   
4126 C CB  . VAL B 135 ? 0.8576 0.6764 0.5324 0.2799  0.0712  0.1265  135 VAL B CB  
4127 C CG1 . VAL B 135 ? 0.8270 0.6984 0.5345 0.2668  0.0628  0.1280  135 VAL B CG1 
4128 C CG2 . VAL B 135 ? 0.8750 0.6496 0.5257 0.2872  0.0872  0.1168  135 VAL B CG2 
4129 N N   . LEU B 136 ? 0.8629 0.6726 0.5214 0.2957  0.0583  0.1497  136 LEU B N   
4130 C CA  . LEU B 136 ? 0.8856 0.6601 0.5186 0.2977  0.0567  0.1521  136 LEU B CA  
4131 C C   . LEU B 136 ? 0.9207 0.6688 0.5344 0.2709  0.0486  0.1350  136 LEU B C   
4132 O O   . LEU B 136 ? 0.8688 0.6418 0.4948 0.2501  0.0379  0.1259  136 LEU B O   
4133 C CB  . LEU B 136 ? 0.8907 0.7012 0.5379 0.3072  0.0471  0.1715  136 LEU B CB  
4134 C CG  . LEU B 136 ? 0.9408 0.8087 0.6230 0.3241  0.0460  0.1902  136 LEU B CG  
4135 C CD1 . LEU B 136 ? 0.9120 0.8349 0.6174 0.3044  0.0257  0.1933  136 LEU B CD1 
4136 C CD2 . LEU B 136 ? 1.0007 0.8645 0.6809 0.3547  0.0539  0.2117  136 LEU B CD2 
4137 N N   . LEU B 137 ? 0.9217 0.6187 0.5047 0.2722  0.0545  0.1320  137 LEU B N   
4138 C CA  . LEU B 137 ? 0.9166 0.5850 0.4795 0.2499  0.0494  0.1194  137 LEU B CA  
4139 C C   . LEU B 137 ? 1.0025 0.6183 0.5335 0.2568  0.0567  0.1238  137 LEU B C   
4140 O O   . LEU B 137 ? 1.0055 0.5935 0.5240 0.2779  0.0688  0.1312  137 LEU B O   
4141 C CB  . LEU B 137 ? 0.8961 0.5546 0.4575 0.2318  0.0500  0.1012  137 LEU B CB  
4142 C CG  . LEU B 137 ? 0.9855 0.5929 0.5210 0.2330  0.0616  0.0921  137 LEU B CG  
4143 C CD1 . LEU B 137 ? 0.9641 0.5738 0.5032 0.2150  0.0591  0.0770  137 LEU B CD1 
4144 C CD2 . LEU B 137 ? 1.0455 0.6397 0.5765 0.2583  0.0754  0.0995  137 LEU B CD2 
4145 N N   . ASP B 138 ? 0.9801 0.5816 0.4975 0.2389  0.0504  0.1195  138 ASP B N   
4146 C CA  . ASP B 138 ? 1.0153 0.5691 0.5031 0.2400  0.0557  0.1238  138 ASP B CA  
4147 C C   . ASP B 138 ? 1.0843 0.5883 0.5473 0.2257  0.0619  0.1100  138 ASP B C   
4148 O O   . ASP B 138 ? 1.0813 0.5910 0.5469 0.2031  0.0558  0.0981  138 ASP B O   
4149 C CB  . ASP B 138 ? 1.0229 0.5909 0.5091 0.2296  0.0461  0.1302  138 ASP B CB  
4150 C CG  . ASP B 138 ? 1.0827 0.6727 0.5777 0.2042  0.0369  0.1174  138 ASP B CG  
4151 O OD1 . ASP B 138 ? 1.0455 0.6786 0.5631 0.2006  0.0291  0.1145  138 ASP B OD1 
4152 O OD2 . ASP B 138 ? 1.1792 0.7426 0.6585 0.1880  0.0381  0.1106  138 ASP B OD2 
4153 N N   . GLU B 139 ? 1.0378 0.4932 0.4758 0.2389  0.0739  0.1121  139 GLU B N   
4154 C CA  . GLU B 139 ? 1.0496 0.4540 0.4592 0.2239  0.0787  0.1000  139 GLU B CA  
4155 C C   . GLU B 139 ? 1.1259 0.5009 0.5150 0.2103  0.0762  0.1043  139 GLU B C   
4156 O O   . GLU B 139 ? 1.1482 0.5159 0.5311 0.2243  0.0786  0.1187  139 GLU B O   
4157 C CB  . GLU B 139 ? 1.1133 0.4714 0.4986 0.2427  0.0934  0.0994  139 GLU B CB  
4158 C CG  . GLU B 139 ? 1.2193 0.6022 0.6214 0.2554  0.0982  0.0949  139 GLU B CG  
4159 C CD  . GLU B 139 ? 1.4832 0.8168 0.8569 0.2738  0.1148  0.0928  139 GLU B CD  
4160 O OE1 . GLU B 139 ? 1.5754 0.8630 0.9188 0.2591  0.1178  0.0796  139 GLU B OE1 
4161 O OE2 . GLU B 139 ? 1.3547 0.6984 0.7369 0.3027  0.1249  0.1043  139 GLU B OE2 
4162 N N   . PRO B 140 ? 1.0823 0.4422 0.4616 0.1834  0.0716  0.0941  140 PRO B N   
4163 C CA  . PRO B 140 ? 1.0591 0.4274 0.4448 0.1648  0.0675  0.0789  140 PRO B CA  
4164 C C   . PRO B 140 ? 1.0909 0.5189 0.5113 0.1573  0.0578  0.0754  140 PRO B C   
4165 O O   . PRO B 140 ? 1.0764 0.5305 0.5084 0.1517  0.0518  0.0808  140 PRO B O   
4166 C CB  . PRO B 140 ? 1.1025 0.4326 0.4645 0.1405  0.0660  0.0747  140 PRO B CB  
4167 C CG  . PRO B 140 ? 1.1673 0.4965 0.5260 0.1396  0.0649  0.0871  140 PRO B CG  
4168 C CD  . PRO B 140 ? 1.1228 0.4579 0.4846 0.1690  0.0701  0.0997  140 PRO B CD  
4169 N N   . ALA B 141 ? 1.0397 0.4869 0.4740 0.1586  0.0572  0.0669  141 ALA B N   
4170 C CA  . ALA B 141 ? 0.9925 0.4902 0.4571 0.1515  0.0490  0.0623  141 ALA B CA  
4171 C C   . ALA B 141 ? 1.0105 0.5052 0.4755 0.1339  0.0463  0.0500  141 ALA B C   
4172 O O   . ALA B 141 ? 1.0159 0.4733 0.4586 0.1296  0.0504  0.0450  141 ALA B O   
4173 C CB  . ALA B 141 ? 0.9864 0.5155 0.4710 0.1702  0.0504  0.0663  141 ALA B CB  
4174 N N   . TYR B 142 ? 0.9353 0.4675 0.4233 0.1233  0.0391  0.0456  142 TYR B N   
4175 C CA  . TYR B 142 ? 0.9158 0.4543 0.4099 0.1074  0.0352  0.0361  142 TYR B CA  
4176 C C   . TYR B 142 ? 0.9702 0.4913 0.4547 0.1115  0.0391  0.0300  142 TYR B C   
4177 O O   . TYR B 142 ? 0.9344 0.4720 0.4301 0.1243  0.0418  0.0299  142 TYR B O   
4178 C CB  . TYR B 142 ? 0.8854 0.4670 0.4065 0.1020  0.0292  0.0338  142 TYR B CB  
4179 C CG  . TYR B 142 ? 0.8825 0.4743 0.4133 0.0899  0.0258  0.0259  142 TYR B CG  
4180 C CD1 . TYR B 142 ? 0.9231 0.5045 0.4479 0.0735  0.0232  0.0239  142 TYR B CD1 
4181 C CD2 . TYR B 142 ? 0.8580 0.4714 0.4046 0.0944  0.0248  0.0219  142 TYR B CD2 
4182 C CE1 . TYR B 142 ? 0.9295 0.5228 0.4642 0.0637  0.0194  0.0187  142 TYR B CE1 
4183 C CE2 . TYR B 142 ? 0.8471 0.4692 0.4021 0.0845  0.0217  0.0163  142 TYR B CE2 
4184 C CZ  . TYR B 142 ? 0.9400 0.5523 0.4889 0.0701  0.0189  0.0150  142 TYR B CZ  
4185 O OH  . TYR B 142 ? 0.9193 0.5423 0.4771 0.0613  0.0151  0.0115  142 TYR B OH  
4186 N N   . SER B 143 ? 0.9607 0.4470 0.4220 0.0997  0.0397  0.0255  143 SER B N   
4187 C CA  . SER B 143 ? 0.9737 0.4352 0.4169 0.1000  0.0431  0.0186  143 SER B CA  
4188 C C   . SER B 143 ? 0.9744 0.4668 0.4374 0.1046  0.0422  0.0146  143 SER B C   
4189 O O   . SER B 143 ? 0.9855 0.4667 0.4393 0.1172  0.0494  0.0131  143 SER B O   
4190 C CB  . SER B 143 ? 1.0392 0.4738 0.4620 0.0775  0.0380  0.0135  143 SER B CB  
4191 O OG  . SER B 143 ? 1.0960 0.5637 0.5414 0.0608  0.0287  0.0130  143 SER B OG  
4192 N N   . GLY B 144 ? 0.8789 0.4085 0.3683 0.0955  0.0347  0.0138  144 GLY B N   
4193 C CA  . GLY B 144 ? 0.8452 0.4028 0.3536 0.0974  0.0332  0.0107  144 GLY B CA  
4194 C C   . GLY B 144 ? 0.8503 0.4303 0.3748 0.1146  0.0378  0.0145  144 GLY B C   
4195 O O   . GLY B 144 ? 0.8070 0.4024 0.3417 0.1170  0.0387  0.0125  144 GLY B O   
4196 N N   . THR B 145 ? 0.8096 0.3951 0.3382 0.1251  0.0397  0.0213  145 THR B N   
4197 C CA  . THR B 145 ? 0.7856 0.3970 0.3314 0.1406  0.0426  0.0274  145 THR B CA  
4198 C C   . THR B 145 ? 0.8186 0.4071 0.3485 0.1580  0.0534  0.0307  145 THR B C   
4199 O O   . THR B 145 ? 0.8013 0.4094 0.3442 0.1705  0.0582  0.0347  145 THR B O   
4200 C CB  . THR B 145 ? 0.8913 0.5256 0.4507 0.1421  0.0374  0.0338  145 THR B CB  
4201 O OG1 . THR B 145 ? 0.8703 0.5340 0.4480 0.1544  0.0381  0.0404  145 THR B OG1 
4202 C CG2 . THR B 145 ? 0.9144 0.5235 0.4556 0.1459  0.0395  0.0392  145 THR B CG2 
4203 N N   . LEU B 146 ? 0.7986 0.3444 0.2994 0.1581  0.0580  0.0292  146 LEU B N   
4204 C CA  . LEU B 146 ? 0.8357 0.3483 0.3132 0.1745  0.0703  0.0305  146 LEU B CA  
4205 C C   . LEU B 146 ? 0.9397 0.4438 0.4077 0.1697  0.0734  0.0219  146 LEU B C   
4206 O O   . LEU B 146 ? 0.9666 0.4673 0.4301 0.1857  0.0842  0.0234  146 LEU B O   
4207 C CB  . LEU B 146 ? 0.8655 0.3271 0.3091 0.1718  0.0735  0.0297  146 LEU B CB  
4208 C CG  . LEU B 146 ? 0.8960 0.3556 0.3408 0.1763  0.0719  0.0390  146 LEU B CG  
4209 C CD1 . LEU B 146 ? 0.9188 0.3304 0.3319 0.1635  0.0717  0.0360  146 LEU B CD1 
4210 C CD2 . LEU B 146 ? 0.9141 0.3761 0.3620 0.2035  0.0816  0.0503  146 LEU B CD2 
4211 N N   . GLN B 147 ? 0.8931 0.3962 0.3588 0.1481  0.0641  0.0141  147 GLN B N   
4212 C CA  . GLN B 147 ? 0.8989 0.3958 0.3549 0.1400  0.0639  0.0066  147 GLN B CA  
4213 C C   . GLN B 147 ? 0.9275 0.4638 0.4108 0.1480  0.0657  0.0094  147 GLN B C   
4214 O O   . GLN B 147 ? 0.9557 0.4853 0.4290 0.1525  0.0723  0.0068  147 GLN B O   
4215 C CB  . GLN B 147 ? 0.9066 0.4059 0.3634 0.1161  0.0515  0.0014  147 GLN B CB  
4216 C CG  . GLN B 147 ? 1.2053 0.6605 0.6268 0.1021  0.0495  -0.0041 147 GLN B CG  
4217 C CD  . GLN B 147 ? 1.4746 0.9418 0.9013 0.0795  0.0372  -0.0077 147 GLN B CD  
4218 O OE1 . GLN B 147 ? 1.4273 0.8790 0.8346 0.0708  0.0351  -0.0129 147 GLN B OE1 
4219 N NE2 . GLN B 147 ? 1.3349 0.8313 0.7874 0.0702  0.0291  -0.0041 147 GLN B NE2 
4220 N N   . SER B 148 ? 0.8418 0.4170 0.3569 0.1494  0.0606  0.0150  148 SER B N   
4221 C CA  . SER B 148 ? 0.8171 0.4318 0.3606 0.1539  0.0607  0.0188  148 SER B CA  
4222 C C   . SER B 148 ? 0.8724 0.4948 0.4200 0.1752  0.0725  0.0264  148 SER B C   
4223 O O   . SER B 148 ? 0.8598 0.4972 0.4155 0.1797  0.0780  0.0276  148 SER B O   
4224 C CB  . SER B 148 ? 0.8602 0.5079 0.4304 0.1467  0.0509  0.0215  148 SER B CB  
4225 O OG  . SER B 148 ? 1.0255 0.6911 0.6096 0.1332  0.0440  0.0172  148 SER B OG  
4226 N N   . LEU B 149 ? 0.8412 0.4552 0.3844 0.1890  0.0769  0.0332  149 LEU B N   
4227 C CA  . LEU B 149 ? 0.8510 0.4766 0.4017 0.2122  0.0884  0.0434  149 LEU B CA  
4228 C C   . LEU B 149 ? 0.9630 0.5522 0.4850 0.2268  0.1042  0.0414  149 LEU B C   
4229 O O   . LEU B 149 ? 0.9372 0.5446 0.4698 0.2423  0.1150  0.0476  149 LEU B O   
4230 C CB  . LEU B 149 ? 0.8532 0.4850 0.4105 0.2231  0.0869  0.0534  149 LEU B CB  
4231 C CG  . LEU B 149 ? 0.8808 0.5462 0.4616 0.2110  0.0724  0.0563  149 LEU B CG  
4232 C CD1 . LEU B 149 ? 0.8996 0.5741 0.4858 0.2258  0.0727  0.0689  149 LEU B CD1 
4233 C CD2 . LEU B 149 ? 0.8604 0.5709 0.4714 0.2018  0.0657  0.0567  149 LEU B CD2 
4234 N N   . HIS B 150 ? 0.9991 0.5365 0.4837 0.2214  0.1061  0.0329  150 HIS B N   
4235 C CA  . HIS B 150 ? 1.0724 0.5637 0.5197 0.2328  0.1209  0.0283  150 HIS B CA  
4236 C C   . HIS B 150 ? 1.1484 0.6544 0.5991 0.2404  0.1309  0.0278  150 HIS B C   
4237 O O   . HIS B 150 ? 1.1850 0.6802 0.6260 0.2637  0.1480  0.0330  150 HIS B O   
4238 C CB  . HIS B 150 ? 1.1242 0.5638 0.5321 0.2145  0.1161  0.0161  150 HIS B CB  
4239 C CG  . HIS B 150 ? 1.2328 0.6203 0.5961 0.2231  0.1305  0.0091  150 HIS B CG  
4240 N ND1 . HIS B 150 ? 1.2635 0.6422 0.6098 0.2130  0.1310  0.0002  150 HIS B ND1 
4241 C CD2 . HIS B 150 ? 1.3152 0.6563 0.6465 0.2416  0.1453  0.0101  150 HIS B CD2 
4242 C CE1 . HIS B 150 ? 1.3173 0.6441 0.6198 0.2244  0.1457  -0.0050 150 HIS B CE1 
4243 N NE2 . HIS B 150 ? 1.3547 0.6556 0.6464 0.2422  0.1554  0.0003  150 HIS B NE2 
4244 N N   . PRO B 151 ? 1.0687 0.5981 0.5322 0.2233  0.1225  0.0230  151 PRO B N   
4245 C CA  . PRO B 151 ? 1.0672 0.6082 0.5314 0.2313  0.1336  0.0240  151 PRO B CA  
4246 C C   . PRO B 151 ? 1.0707 0.6658 0.5767 0.2451  0.1385  0.0373  151 PRO B C   
4247 O O   . PRO B 151 ? 1.0948 0.6956 0.5997 0.2622  0.1544  0.0426  151 PRO B O   
4248 C CB  . PRO B 151 ? 1.0705 0.6129 0.5306 0.2074  0.1219  0.0152  151 PRO B CB  
4249 C CG  . PRO B 151 ? 1.1096 0.6434 0.5694 0.1880  0.1052  0.0100  151 PRO B CG  
4250 C CD  . PRO B 151 ? 1.0432 0.5875 0.5193 0.1979  0.1046  0.0174  151 PRO B CD  
4251 N N   . LEU B 152 ? 0.9529 0.5869 0.4940 0.2377  0.1256  0.0434  152 LEU B N   
4252 C CA  . LEU B 152 ? 0.9074 0.5962 0.4898 0.2449  0.1256  0.0562  152 LEU B CA  
4253 C C   . LEU B 152 ? 0.9494 0.6502 0.5401 0.2736  0.1413  0.0699  152 LEU B C   
4254 O O   . LEU B 152 ? 0.8996 0.6508 0.5269 0.2796  0.1413  0.0827  152 LEU B O   
4255 C CB  . LEU B 152 ? 0.8712 0.5874 0.4786 0.2289  0.1073  0.0572  152 LEU B CB  
4256 C CG  . LEU B 152 ? 0.8904 0.6536 0.5322 0.2157  0.0985  0.0609  152 LEU B CG  
4257 C CD1 . LEU B 152 ? 0.8886 0.6473 0.5246 0.2051  0.1007  0.0546  152 LEU B CD1 
4258 C CD2 . LEU B 152 ? 0.8924 0.6669 0.5458 0.1985  0.0813  0.0576  152 LEU B CD2 
4259 N N   . GLY B 153 ? 0.9512 0.6047 0.5069 0.2903  0.1548  0.0673  153 GLY B N   
4260 C CA  . GLY B 153 ? 0.9822 0.6319 0.5349 0.3215  0.1741  0.0786  153 GLY B CA  
4261 C C   . GLY B 153 ? 1.0402 0.7256 0.6238 0.3371  0.1722  0.0953  153 GLY B C   
4262 O O   . GLY B 153 ? 1.0485 0.7537 0.6456 0.3632  0.1875  0.1093  153 GLY B O   
4263 N N   . CYS B 154 ? 0.9985 0.6920 0.5919 0.3225  0.1540  0.0948  154 CYS B N   
4264 C CA  . CYS B 154 ? 0.9826 0.7084 0.6017 0.3333  0.1481  0.1102  154 CYS B CA  
4265 C C   . CYS B 154 ? 1.0531 0.7302 0.6417 0.3501  0.1557  0.1118  154 CYS B C   
4266 O O   . CYS B 154 ? 1.0906 0.7084 0.6381 0.3472  0.1620  0.0989  154 CYS B O   
4267 C CB  . CYS B 154 ? 0.9435 0.6995 0.5838 0.3074  0.1252  0.1077  154 CYS B CB  
4268 S SG  . CYS B 154 ? 0.9934 0.6988 0.6000 0.2817  0.1133  0.0883  154 CYS B SG  
4269 N N   . ASN B 155 ? 0.9802 0.6817 0.5877 0.3654  0.1535  0.1280  155 ASN B N   
4270 C CA  . ASN B 155 ? 0.9968 0.6547 0.5780 0.3821  0.1598  0.1326  155 ASN B CA  
4271 C C   . ASN B 155 ? 1.0063 0.6698 0.5913 0.3637  0.1402  0.1323  155 ASN B C   
4272 O O   . ASN B 155 ? 0.9692 0.6881 0.5889 0.3565  0.1263  0.1414  155 ASN B O   
4273 C CB  . ASN B 155 ? 0.9856 0.6661 0.5842 0.4175  0.1741  0.1541  155 ASN B CB  
4274 C CG  . ASN B 155 ? 1.2633 0.9179 0.8444 0.4414  0.1990  0.1537  155 ASN B CG  
4275 O OD1 . ASN B 155 ? 1.2274 0.8127 0.7620 0.4466  0.2116  0.1419  155 ASN B OD1 
4276 N ND2 . ASN B 155 ? 1.1670 0.8764 0.7835 0.4550  0.2067  0.1664  155 ASN B ND2 
4277 N N   . ILE B 156 ? 0.9736 0.5797 0.5216 0.3546  0.1391  0.1218  156 ILE B N   
4278 C CA  . ILE B 156 ? 0.9506 0.5565 0.4976 0.3379  0.1229  0.1216  156 ILE B CA  
4279 C C   . ILE B 156 ? 1.0149 0.5962 0.5478 0.3568  0.1275  0.1348  156 ILE B C   
4280 O O   . ILE B 156 ? 1.0480 0.5675 0.5432 0.3631  0.1381  0.1302  156 ILE B O   
4281 C CB  . ILE B 156 ? 0.9775 0.5612 0.5084 0.3057  0.1112  0.1033  156 ILE B CB  
4282 C CG1 . ILE B 156 ? 1.0085 0.5465 0.5091 0.2995  0.1207  0.0877  156 ILE B CG1 
4283 C CG2 . ILE B 156 ? 0.9497 0.5884 0.5140 0.2858  0.0953  0.1010  156 ILE B CG2 
4284 C CD1 . ILE B 156 ? 1.0948 0.6254 0.5884 0.2670  0.1080  0.0710  156 ILE B CD1 
4285 N N   . ILE B 157 ? 0.9568 0.5869 0.5194 0.3658  0.1194  0.1521  157 ILE B N   
4286 C CA  . ILE B 157 ? 0.9808 0.6015 0.5374 0.3842  0.1205  0.1690  157 ILE B CA  
4287 C C   . ILE B 157 ? 1.0584 0.6574 0.5971 0.3602  0.1066  0.1622  157 ILE B C   
4288 O O   . ILE B 157 ? 1.0224 0.6587 0.5792 0.3374  0.0900  0.1577  157 ILE B O   
4289 C CB  . ILE B 157 ? 0.9794 0.6705 0.5781 0.4001  0.1143  0.1909  157 ILE B CB  
4290 C CG1 . ILE B 157 ? 0.9794 0.6930 0.5971 0.4267  0.1306  0.2007  157 ILE B CG1 
4291 C CG2 . ILE B 157 ? 0.9982 0.6867 0.5924 0.4141  0.1103  0.2090  157 ILE B CG2 
4292 C CD1 . ILE B 157 ? 0.9819 0.7779 0.6488 0.4278  0.1208  0.2152  157 ILE B CD1 
4293 N N   . ASN B 158 ? 1.0557 0.5931 0.5578 0.3647  0.1143  0.1614  158 ASN B N   
4294 C CA  . ASN B 158 ? 1.0571 0.5751 0.5430 0.3423  0.1030  0.1566  158 ASN B CA  
4295 C C   . ASN B 158 ? 1.1164 0.6616 0.6138 0.3513  0.0946  0.1757  158 ASN B C   
4296 O O   . ASN B 158 ? 1.1538 0.6895 0.6476 0.3791  0.1036  0.1931  158 ASN B O   
4297 C CB  . ASN B 158 ? 1.1470 0.5886 0.5885 0.3364  0.1125  0.1468  158 ASN B CB  
4298 C CG  . ASN B 158 ? 1.5257 0.9452 0.9498 0.3141  0.1030  0.1443  158 ASN B CG  
4299 O OD1 . ASN B 158 ? 1.4369 0.8954 0.8794 0.2956  0.0885  0.1432  158 ASN B OD1 
4300 N ND2 . ASN B 158 ? 1.4733 0.8271 0.8594 0.3143  0.1119  0.1431  158 ASN B ND2 
4301 N N   . VAL B 159 ? 1.0227 0.6006 0.5321 0.3282  0.0778  0.1727  159 VAL B N   
4302 C CA  . VAL B 159 ? 1.0047 0.6095 0.5211 0.3307  0.0670  0.1886  159 VAL B CA  
4303 C C   . VAL B 159 ? 1.0728 0.6279 0.5562 0.3181  0.0675  0.1855  159 VAL B C   
4304 O O   . VAL B 159 ? 1.0436 0.5779 0.5150 0.2938  0.0656  0.1684  159 VAL B O   
4305 C CB  . VAL B 159 ? 0.9967 0.6654 0.5422 0.3132  0.0493  0.1869  159 VAL B CB  
4306 C CG1 . VAL B 159 ? 0.9919 0.6940 0.5457 0.3218  0.0389  0.2069  159 VAL B CG1 
4307 C CG2 . VAL B 159 ? 0.9653 0.6757 0.5410 0.3155  0.0490  0.1833  159 VAL B CG2 
4308 N N   . ALA B 160 ? 1.0840 0.6188 0.5527 0.3353  0.0711  0.2032  160 ALA B N   
4309 C CA  . ALA B 160 ? 1.1148 0.6003 0.5510 0.3245  0.0728  0.2035  160 ALA B CA  
4310 C C   . ALA B 160 ? 1.1450 0.6566 0.5850 0.2971  0.0583  0.1979  160 ALA B C   
4311 O O   . ALA B 160 ? 1.1212 0.6872 0.5837 0.2949  0.0461  0.2031  160 ALA B O   
4312 C CB  . ALA B 160 ? 1.1712 0.6336 0.5930 0.3506  0.0795  0.2261  160 ALA B CB  
4313 N N   . SER B 161 ? 1.1000 0.5733 0.5175 0.2753  0.0601  0.1868  161 SER B N   
4314 C CA  . SER B 161 ? 1.0645 0.5576 0.4834 0.2496  0.0498  0.1803  161 SER B CA  
4315 C C   . SER B 161 ? 1.1595 0.6089 0.5490 0.2390  0.0536  0.1852  161 SER B C   
4316 O O   . SER B 161 ? 1.2099 0.6049 0.5756 0.2437  0.0641  0.1866  161 SER B O   
4317 C CB  . SER B 161 ? 1.0508 0.5550 0.4813 0.2284  0.0473  0.1591  161 SER B CB  
4318 O OG  . SER B 161 ? 1.1699 0.6380 0.5914 0.2332  0.0573  0.1508  161 SER B OG  
4319 N N   . ASP B 162 ? 1.0902 0.5616 0.4793 0.2239  0.0456  0.1876  162 ASP B N   
4320 C CA  . ASP B 162 ? 1.1116 0.5492 0.4755 0.2105  0.0488  0.1929  162 ASP B CA  
4321 C C   . ASP B 162 ? 1.1311 0.5888 0.5002 0.1826  0.0440  0.1804  162 ASP B C   
4322 O O   . ASP B 162 ? 1.0820 0.5692 0.4714 0.1738  0.0397  0.1655  162 ASP B O   
4323 C CB  . ASP B 162 ? 1.1654 0.6004 0.5160 0.2260  0.0478  0.2155  162 ASP B CB  
4324 C CG  . ASP B 162 ? 1.2511 0.7432 0.6188 0.2338  0.0359  0.2243  162 ASP B CG  
4325 O OD1 . ASP B 162 ? 1.2263 0.7537 0.6042 0.2161  0.0280  0.2141  162 ASP B OD1 
4326 O OD2 . ASP B 162 ? 1.3326 0.8316 0.7004 0.2568  0.0346  0.2427  162 ASP B OD2 
4327 N N   . GLU B 163 ? 1.1086 0.5497 0.4593 0.1698  0.0460  0.1874  163 GLU B N   
4328 C CA  . GLU B 163 ? 1.0885 0.5477 0.4426 0.1455  0.0441  0.1789  163 GLU B CA  
4329 C C   . GLU B 163 ? 1.1071 0.6204 0.4798 0.1450  0.0352  0.1734  163 GLU B C   
4330 O O   . GLU B 163 ? 1.0865 0.6195 0.4684 0.1284  0.0344  0.1615  163 GLU B O   
4331 C CB  . GLU B 163 ? 1.1440 0.5799 0.4749 0.1353  0.0487  0.1915  163 GLU B CB  
4332 C CG  . GLU B 163 ? 1.3531 0.7350 0.6586 0.1445  0.0559  0.2056  163 GLU B CG  
4333 C CD  . GLU B 163 ? 1.6347 1.0131 0.9295 0.1693  0.0548  0.2252  163 GLU B CD  
4334 O OE1 . GLU B 163 ? 1.3924 0.7381 0.6793 0.1879  0.0598  0.2310  163 GLU B OE1 
4335 O OE2 . GLU B 163 ? 1.5397 0.9466 0.8323 0.1707  0.0496  0.2353  163 GLU B OE2 
4336 N N   . SER B 164 ? 1.0597 0.5967 0.4380 0.1631  0.0286  0.1822  164 SER B N   
4337 C CA  . SER B 164 ? 1.0330 0.6188 0.4269 0.1619  0.0185  0.1768  164 SER B CA  
4338 C C   . SER B 164 ? 1.0645 0.6714 0.4836 0.1690  0.0148  0.1663  164 SER B C   
4339 O O   . SER B 164 ? 1.0463 0.6924 0.4794 0.1697  0.0055  0.1633  164 SER B O   
4340 C CB  . SER B 164 ? 1.0828 0.6872 0.4664 0.1724  0.0113  0.1938  164 SER B CB  
4341 O OG  . SER B 164 ? 1.2426 0.8292 0.6030 0.1627  0.0157  0.2012  164 SER B OG  
4342 N N   . GLY B 165 ? 0.9950 0.5744 0.4173 0.1716  0.0220  0.1602  165 GLY B N   
4343 C CA  . GLY B 165 ? 0.9690 0.5638 0.4124 0.1785  0.0207  0.1514  165 GLY B CA  
4344 C C   . GLY B 165 ? 1.0290 0.6306 0.4785 0.2031  0.0202  0.1652  165 GLY B C   
4345 O O   . GLY B 165 ? 1.0449 0.6252 0.4791 0.2167  0.0237  0.1811  165 GLY B O   
4346 N N   . ILE B 166 ? 0.9723 0.6037 0.4453 0.2093  0.0168  0.1600  166 ILE B N   
4347 C CA  . ILE B 166 ? 0.9723 0.6208 0.4595 0.2326  0.0169  0.1722  166 ILE B CA  
4348 C C   . ILE B 166 ? 1.0130 0.6835 0.4988 0.2459  0.0098  0.1928  166 ILE B C   
4349 O O   . ILE B 166 ? 0.9846 0.6872 0.4725 0.2345  -0.0018 0.1936  166 ILE B O   
4350 C CB  . ILE B 166 ? 0.9796 0.6605 0.4942 0.2326  0.0145  0.1625  166 ILE B CB  
4351 C CG1 . ILE B 166 ? 0.9849 0.7117 0.5222 0.2496  0.0077  0.1777  166 ILE B CG1 
4352 C CG2 . ILE B 166 ? 0.9442 0.6410 0.4660 0.2077  0.0085  0.1436  166 ILE B CG2 
4353 C CD1 . ILE B 166 ? 1.0890 0.8489 0.6544 0.2506  0.0064  0.1715  166 ILE B CD1 
4354 N N   . VAL B 167 ? 0.9902 0.6391 0.4690 0.2701  0.0176  0.2096  167 VAL B N   
4355 C CA  . VAL B 167 ? 1.0039 0.6667 0.4798 0.2882  0.0131  0.2332  167 VAL B CA  
4356 C C   . VAL B 167 ? 1.0375 0.7583 0.5444 0.3012  0.0039  0.2437  167 VAL B C   
4357 O O   . VAL B 167 ? 1.0125 0.7368 0.5357 0.3195  0.0117  0.2472  167 VAL B O   
4358 C CB  . VAL B 167 ? 1.0955 0.7053 0.5492 0.3095  0.0270  0.2470  167 VAL B CB  
4359 C CG1 . VAL B 167 ? 1.1209 0.7461 0.5715 0.3291  0.0219  0.2737  167 VAL B CG1 
4360 C CG2 . VAL B 167 ? 1.1104 0.6639 0.5339 0.2920  0.0349  0.2365  167 VAL B CG2 
4361 N N   . PRO B 168 ? 1.0026 0.7699 0.5167 0.2912  -0.0128 0.2496  168 PRO B N   
4362 C CA  . PRO B 168 ? 0.9861 0.8141 0.5311 0.2990  -0.0243 0.2602  168 PRO B CA  
4363 C C   . PRO B 168 ? 1.0589 0.8979 0.6174 0.3321  -0.0194 0.2854  168 PRO B C   
4364 O O   . PRO B 168 ? 1.0265 0.9063 0.6158 0.3428  -0.0213 0.2918  168 PRO B O   
4365 C CB  . PRO B 168 ? 0.9986 0.8611 0.5372 0.2807  -0.0427 0.2625  168 PRO B CB  
4366 C CG  . PRO B 168 ? 1.0447 0.8700 0.5560 0.2590  -0.0390 0.2447  168 PRO B CG  
4367 C CD  . PRO B 168 ? 1.0149 0.7823 0.5082 0.2704  -0.0217 0.2458  168 PRO B CD  
4368 N N   . ASP B 169 ? 1.0700 0.8708 0.6055 0.3489  -0.0114 0.3003  169 ASP B N   
4369 C CA  . ASP B 169 ? 1.1102 0.9129 0.6549 0.3840  -0.0037 0.3253  169 ASP B CA  
4370 C C   . ASP B 169 ? 1.1472 0.9173 0.6972 0.4017  0.0163  0.3184  169 ASP B C   
4371 O O   . ASP B 169 ? 1.1690 0.9601 0.7399 0.4301  0.0226  0.3356  169 ASP B O   
4372 C CB  . ASP B 169 ? 1.1879 0.9564 0.7038 0.3969  -0.0011 0.3444  169 ASP B CB  
4373 C CG  . ASP B 169 ? 1.3708 1.1741 0.8794 0.3822  -0.0206 0.3540  169 ASP B CG  
4374 O OD1 . ASP B 169 ? 1.3635 1.1843 0.8697 0.3520  -0.0316 0.3354  169 ASP B OD1 
4375 O OD2 . ASP B 169 ? 1.4718 1.2812 0.9740 0.4012  -0.0240 0.3799  169 ASP B OD2 
4376 N N   . SER B 170 ? 1.0471 0.7700 0.5792 0.3845  0.0259  0.2936  170 SER B N   
4377 C CA  . SER B 170 ? 1.0329 0.7208 0.5639 0.3977  0.0441  0.2845  170 SER B CA  
4378 C C   . SER B 170 ? 1.0481 0.7913 0.6169 0.4028  0.0415  0.2840  170 SER B C   
4379 O O   . SER B 170 ? 1.0571 0.8096 0.6410 0.4316  0.0524  0.2979  170 SER B O   
4380 C CB  . SER B 170 ? 1.0336 0.6716 0.5407 0.3727  0.0499  0.2582  170 SER B CB  
4381 O OG  . SER B 170 ? 1.0652 0.6780 0.5724 0.3811  0.0645  0.2471  170 SER B OG  
4382 N N   . LEU B 171 ? 0.9656 0.7478 0.5500 0.3751  0.0270  0.2698  171 LEU B N   
4383 C CA  . LEU B 171 ? 0.9239 0.7612 0.5435 0.3709  0.0211  0.2667  171 LEU B CA  
4384 C C   . LEU B 171 ? 0.9624 0.8571 0.6123 0.3936  0.0153  0.2938  171 LEU B C   
4385 O O   . LEU B 171 ? 0.9443 0.8643 0.6200 0.4095  0.0233  0.2997  171 LEU B O   
4386 C CB  . LEU B 171 ? 0.8896 0.7514 0.5122 0.3355  0.0043  0.2493  171 LEU B CB  
4387 C CG  . LEU B 171 ? 0.9156 0.8231 0.5679 0.3213  -0.0026 0.2397  171 LEU B CG  
4388 C CD1 . LEU B 171 ? 0.9206 0.8105 0.5808 0.3319  0.0142  0.2314  171 LEU B CD1 
4389 C CD2 . LEU B 171 ? 0.9135 0.8224 0.5569 0.2875  -0.0146 0.2192  171 LEU B CD2 
4390 N N   . ARG B 172 ? 0.9338 0.8486 0.5801 0.3968  0.0027  0.3121  172 ARG B N   
4391 C CA  . ARG B 172 ? 0.9428 0.9169 0.6187 0.4181  -0.0052 0.3409  172 ARG B CA  
4392 C C   . ARG B 172 ? 1.0370 1.0003 0.7239 0.4580  0.0151  0.3585  172 ARG B C   
4393 O O   . ARG B 172 ? 1.0210 1.0372 0.7450 0.4710  0.0157  0.3704  172 ARG B O   
4394 C CB  . ARG B 172 ? 0.9685 0.9568 0.6318 0.4161  -0.0210 0.3579  172 ARG B CB  
4395 C CG  . ARG B 172 ? 1.1016 1.1711 0.8001 0.4223  -0.0392 0.3827  172 ARG B CG  
4396 C CD  . ARG B 172 ? 1.2083 1.2987 0.8914 0.4068  -0.0607 0.3920  172 ARG B CD  
4397 N NE  . ARG B 172 ? 1.2443 1.3352 0.9126 0.3670  -0.0745 0.3666  172 ARG B NE  
4398 C CZ  . ARG B 172 ? 1.3973 1.4380 1.0278 0.3496  -0.0725 0.3498  172 ARG B CZ  
4399 N NH1 . ARG B 172 ? 1.2593 1.2446 0.8625 0.3655  -0.0586 0.3552  172 ARG B NH1 
4400 N NH2 . ARG B 172 ? 1.1715 1.2165 0.7911 0.3165  -0.0835 0.3281  172 ARG B NH2 
4401 N N   . ASP B 173 ? 1.0420 0.9353 0.6961 0.4766  0.0331  0.3593  173 ASP B N   
4402 C CA  . ASP B 173 ? 1.0749 0.9492 0.7339 0.5164  0.0552  0.3745  173 ASP B CA  
4403 C C   . ASP B 173 ? 1.0584 0.9128 0.7212 0.5191  0.0728  0.3564  173 ASP B C   
4404 O O   . ASP B 173 ? 1.0603 0.9150 0.7350 0.5517  0.0907  0.3691  173 ASP B O   
4405 C CB  . ASP B 173 ? 1.1706 0.9877 0.7978 0.5432  0.0675  0.3910  173 ASP B CB  
4406 C CG  . ASP B 173 ? 1.4004 1.1293 0.9780 0.5296  0.0773  0.3714  173 ASP B CG  
4407 O OD1 . ASP B 173 ? 1.3829 1.1053 0.9462 0.4950  0.0638  0.3543  173 ASP B OD1 
4408 O OD2 . ASP B 173 ? 1.5591 1.2256 1.1112 0.5544  0.0980  0.3758  173 ASP B OD2 
4409 N N   . ILE B 174 ? 0.9620 0.8054 0.6171 0.4851  0.0672  0.3282  174 ILE B N   
4410 C CA  . ILE B 174 ? 0.9390 0.7702 0.5983 0.4815  0.0800  0.3097  174 ILE B CA  
4411 C C   . ILE B 174 ? 0.9409 0.8541 0.6493 0.4834  0.0727  0.3199  174 ILE B C   
4412 O O   . ILE B 174 ? 0.9396 0.8621 0.6641 0.5065  0.0893  0.3263  174 ILE B O   
4413 C CB  . ILE B 174 ? 0.9463 0.7384 0.5804 0.4447  0.0753  0.2783  174 ILE B CB  
4414 C CG1 . ILE B 174 ? 0.9896 0.6955 0.5773 0.4476  0.0898  0.2678  174 ILE B CG1 
4415 C CG2 . ILE B 174 ? 0.8966 0.7091 0.5487 0.4309  0.0775  0.2613  174 ILE B CG2 
4416 C CD1 . ILE B 174 ? 1.0292 0.7035 0.5927 0.4129  0.0808  0.2459  174 ILE B CD1 
4417 N N   . LEU B 175 ? 0.8407 0.8120 0.5708 0.4589  0.0484  0.3225  175 LEU B N   
4418 C CA  . LEU B 175 ? 0.7904 0.8423 0.5658 0.4521  0.0362  0.3318  175 LEU B CA  
4419 C C   . LEU B 175 ? 0.8750 0.9815 0.6844 0.4854  0.0383  0.3658  175 LEU B C   
4420 O O   . LEU B 175 ? 0.8389 1.0107 0.6891 0.4857  0.0341  0.3760  175 LEU B O   
4421 C CB  . LEU B 175 ? 0.7456 0.8323 0.5253 0.4143  0.0096  0.3228  175 LEU B CB  
4422 C CG  . LEU B 175 ? 0.7632 0.8120 0.5189 0.3806  0.0061  0.2913  175 LEU B CG  
4423 C CD1 . LEU B 175 ? 0.7443 0.8088 0.4906 0.3525  -0.0161 0.2863  175 LEU B CD1 
4424 C CD2 . LEU B 175 ? 0.7662 0.8361 0.5432 0.3673  0.0090  0.2780  175 LEU B CD2 
4425 N N   . SER B 176 ? 0.8894 0.9691 0.6826 0.5142  0.0457  0.3845  176 SER B N   
4426 C CA  . SER B 176 ? 0.9121 1.0352 0.7340 0.5522  0.0508  0.4192  176 SER B CA  
4427 C C   . SER B 176 ? 0.9980 1.1356 0.8448 0.5764  0.0727  0.4235  176 SER B C   
4428 O O   . SER B 176 ? 1.0082 1.2139 0.8979 0.5974  0.0725  0.4500  176 SER B O   
4429 C CB  . SER B 176 ? 0.9804 1.0449 0.7698 0.5818  0.0638  0.4321  176 SER B CB  
4430 O OG  . SER B 176 ? 1.0542 1.1026 0.8183 0.5626  0.0459  0.4308  176 SER B OG  
4431 N N   . ARG B 177 ? 0.9685 1.0430 0.7878 0.5731  0.0917  0.3980  177 ARG B N   
4432 C CA  . ARG B 177 ? 0.9873 1.0588 0.8181 0.5928  0.1154  0.3956  177 ARG B CA  
4433 C C   . ARG B 177 ? 1.0361 1.2017 0.9236 0.5913  0.1077  0.4113  177 ARG B C   
4434 O O   . ARG B 177 ? 1.0577 1.2608 0.9750 0.6265  0.1221  0.4364  177 ARG B O   
4435 C CB  . ARG B 177 ? 0.9946 1.0014 0.7902 0.5695  0.1242  0.3603  177 ARG B CB  
4436 C CG  . ARG B 177 ? 1.2319 1.1523 0.9846 0.5947  0.1528  0.3512  177 ARG B CG  
4437 C CD  . ARG B 177 ? 1.4836 1.3381 1.1955 0.6061  0.1559  0.3546  177 ARG B CD  
4438 N NE  . ARG B 177 ? 1.6057 1.4795 1.3324 0.6470  0.1642  0.3873  177 ARG B NE  
4439 C CZ  . ARG B 177 ? 1.7671 1.6015 1.4800 0.6880  0.1919  0.3980  177 ARG B CZ  
4440 N NH1 . ARG B 177 ? 1.6475 1.4185 1.3281 0.6923  0.2140  0.3775  177 ARG B NH1 
4441 N NH2 . ARG B 177 ? 1.5554 1.4125 1.2850 0.7256  0.1981  0.4298  177 ARG B NH2 
4442 N N   . TRP B 178 ? 0.9585 1.1638 0.8613 0.5509  0.0847  0.3987  178 TRP B N   
4443 C CA  . TRP B 178 ? 0.9289 1.2224 0.8835 0.5408  0.0739  0.4113  178 TRP B CA  
4444 C C   . TRP B 178 ? 0.9380 1.2982 0.9181 0.5291  0.0454  0.4322  178 TRP B C   
4445 O O   . TRP B 178 ? 0.9452 1.2788 0.8991 0.5258  0.0341  0.4331  178 TRP B O   
4446 C CB  . TRP B 178 ? 0.8859 1.1749 0.8380 0.5030  0.0684  0.3831  178 TRP B CB  
4447 C CG  . TRP B 178 ? 0.9188 1.1274 0.8312 0.5051  0.0899  0.3570  178 TRP B CG  
4448 C CD1 . TRP B 178 ? 0.9684 1.1635 0.8831 0.5243  0.1148  0.3544  178 TRP B CD1 
4449 C CD2 . TRP B 178 ? 0.9277 1.0591 0.7908 0.4882  0.0886  0.3314  178 TRP B CD2 
4450 N NE1 . TRP B 178 ? 0.9800 1.0928 0.8478 0.5190  0.1275  0.3281  178 TRP B NE1 
4451 C CE2 . TRP B 178 ? 0.9994 1.0736 0.8368 0.4968  0.1115  0.3142  178 TRP B CE2 
4452 C CE3 . TRP B 178 ? 0.9418 1.0480 0.7795 0.4664  0.0705  0.3221  178 TRP B CE3 
4453 C CZ2 . TRP B 178 ? 1.0044 1.0010 0.7944 0.4821  0.1148  0.2887  178 TRP B CZ2 
4454 C CZ3 . TRP B 178 ? 0.9706 1.0007 0.7633 0.4540  0.0758  0.2976  178 TRP B CZ3 
4455 C CH2 . TRP B 178 ? 0.9936 0.9717 0.7643 0.4607  0.0967  0.2814  178 TRP B CH2 
4456 N N   . LYS B 179 ? 0.8548 1.3022 0.8851 0.5230  0.0340  0.4504  179 LYS B N   
4457 C CA  . LYS B 179 ? 0.8404 1.3564 0.8953 0.5082  0.0046  0.4703  179 LYS B CA  
4458 C C   . LYS B 179 ? 0.8592 1.3887 0.9100 0.4564  -0.0201 0.4473  179 LYS B C   
4459 O O   . LYS B 179 ? 0.8268 1.3523 0.8836 0.4397  -0.0133 0.4297  179 LYS B O   
4460 C CB  . LYS B 179 ? 0.8666 1.4749 0.9803 0.5326  0.0047  0.5080  179 LYS B CB  
4461 C CG  . LYS B 179 ? 0.9509 1.5528 1.0706 0.5873  0.0267  0.5364  179 LYS B CG  
4462 C CD  . LYS B 179 ? 1.0643 1.6416 1.1577 0.5997  0.0161  0.5489  179 LYS B CD  
4463 C CE  . LYS B 179 ? 1.1787 1.8406 1.3039 0.5870  -0.0158 0.5755  179 LYS B CE  
4464 N NZ  . LYS B 179 ? 1.2605 1.8859 1.3460 0.5778  -0.0328 0.5734  179 LYS B NZ  
4465 N N   . PRO B 180 ? 0.8210 1.3606 0.8573 0.4307  -0.0472 0.4459  180 PRO B N   
4466 C CA  . PRO B 180 ? 0.7934 1.3368 0.8197 0.3822  -0.0685 0.4219  180 PRO B CA  
4467 C C   . PRO B 180 ? 0.8183 1.4189 0.8835 0.3606  -0.0742 0.4217  180 PRO B C   
4468 O O   . PRO B 180 ? 0.7962 1.3722 0.8468 0.3288  -0.0780 0.3952  180 PRO B O   
4469 C CB  . PRO B 180 ? 0.8242 1.3934 0.8409 0.3668  -0.0963 0.4325  180 PRO B CB  
4470 C CG  . PRO B 180 ? 0.9081 1.4402 0.9037 0.4022  -0.0847 0.4462  180 PRO B CG  
4471 C CD  . PRO B 180 ? 0.8635 1.4043 0.8865 0.4447  -0.0582 0.4647  180 PRO B CD  
4472 N N   . GLU B 181 ? 0.7685 1.4439 0.8837 0.3796  -0.0727 0.4523  181 GLU B N   
4473 C CA  . GLU B 181 ? 0.7380 1.4778 0.8973 0.3627  -0.0766 0.4588  181 GLU B CA  
4474 C C   . GLU B 181 ? 0.7631 1.4730 0.9262 0.3764  -0.0471 0.4467  181 GLU B C   
4475 O O   . GLU B 181 ? 0.7350 1.4755 0.9206 0.3532  -0.0496 0.4413  181 GLU B O   
4476 C CB  . GLU B 181 ? 0.7613 1.5982 0.9756 0.3788  -0.0859 0.4992  181 GLU B CB  
4477 C CG  . GLU B 181 ? 0.9379 1.8015 1.1486 0.3837  -0.1077 0.5198  181 GLU B CG  
4478 C CD  . GLU B 181 ? 1.2554 2.0927 1.4578 0.4342  -0.0882 0.5385  181 GLU B CD  
4479 O OE1 . GLU B 181 ? 1.1157 1.8659 1.2711 0.4452  -0.0725 0.5174  181 GLU B OE1 
4480 O OE2 . GLU B 181 ? 1.2006 2.1042 1.4436 0.4623  -0.0888 0.5750  181 GLU B OE2 
4481 N N   . ASP B 182 ? 0.7312 1.3807 0.8706 0.4130  -0.0195 0.4428  182 ASP B N   
4482 C CA  . ASP B 182 ? 0.7279 1.3423 0.8638 0.4291  0.0101  0.4313  182 ASP B CA  
4483 C C   . ASP B 182 ? 0.7706 1.3421 0.8821 0.3931  0.0083  0.3973  182 ASP B C   
4484 O O   . ASP B 182 ? 0.7480 1.3150 0.8681 0.3966  0.0264  0.3911  182 ASP B O   
4485 C CB  . ASP B 182 ? 0.7772 1.3253 0.8826 0.4718  0.0376  0.4314  182 ASP B CB  
4486 C CG  . ASP B 182 ? 0.8557 1.4443 0.9929 0.5188  0.0542  0.4660  182 ASP B CG  
4487 O OD1 . ASP B 182 ? 0.8315 1.4956 1.0187 0.5252  0.0568  0.4874  182 ASP B OD1 
4488 O OD2 . ASP B 182 ? 0.9346 1.4760 1.0458 0.5506  0.0674  0.4715  182 ASP B OD2 
4489 N N   . ALA B 183 ? 0.7337 1.2756 0.8150 0.3594  -0.0131 0.3768  183 ALA B N   
4490 C CA  . ALA B 183 ? 0.7107 1.2124 0.7676 0.3242  -0.0179 0.3456  183 ALA B CA  
4491 C C   . ALA B 183 ? 0.7387 1.2962 0.8301 0.2965  -0.0276 0.3479  183 ALA B C   
4492 O O   . ALA B 183 ? 0.7288 1.2575 0.8095 0.2793  -0.0211 0.3276  183 ALA B O   
4493 C CB  . ALA B 183 ? 0.7204 1.1871 0.7413 0.2990  -0.0380 0.3286  183 ALA B CB  
4494 N N   . LYS B 184 ? 0.6925 1.3304 0.8254 0.2915  -0.0437 0.3736  184 LYS B N   
4495 C CA  . LYS B 184 ? 0.6681 1.3692 0.8391 0.2643  -0.0548 0.3810  184 LYS B CA  
4496 C C   . LYS B 184 ? 0.7159 1.4348 0.9152 0.2872  -0.0280 0.3909  184 LYS B C   
4497 O O   . LYS B 184 ? 0.6992 1.4114 0.9008 0.2667  -0.0234 0.3776  184 LYS B O   
4498 C CB  . LYS B 184 ? 0.6941 1.4789 0.9016 0.2546  -0.0800 0.4088  184 LYS B CB  
4499 C CG  . LYS B 184 ? 0.8073 1.5832 0.9875 0.2209  -0.1106 0.3977  184 LYS B CG  
4500 C CD  . LYS B 184 ? 0.8998 1.6441 1.0505 0.2429  -0.1132 0.4011  184 LYS B CD  
4501 C CE  . LYS B 184 ? 0.9726 1.6878 1.0842 0.2098  -0.1374 0.3824  184 LYS B CE  
4502 N NZ  . LYS B 184 ? 1.0515 1.7061 1.1217 0.2299  -0.1311 0.3747  184 LYS B NZ  
4503 N N   . ASN B 185 ? 0.6976 1.4328 0.9139 0.3312  -0.0087 0.4132  185 ASN B N   
4504 C CA  . ASN B 185 ? 0.7116 1.4622 0.9519 0.3604  0.0205  0.4250  185 ASN B CA  
4505 C C   . ASN B 185 ? 0.7996 1.4673 0.9984 0.3651  0.0435  0.3963  185 ASN B C   
4506 O O   . ASN B 185 ? 0.8063 1.4007 0.9594 0.3734  0.0482  0.3778  185 ASN B O   
4507 C CB  . ASN B 185 ? 0.7385 1.5182 1.0005 0.4087  0.0358  0.4550  185 ASN B CB  
4508 C CG  . ASN B 185 ? 0.9103 1.6933 1.1882 0.4452  0.0705  0.4655  185 ASN B CG  
4509 O OD1 . ASN B 185 ? 0.7610 1.6085 1.0829 0.4429  0.0762  0.4818  185 ASN B OD1 
4510 N ND2 . ASN B 185 ? 0.8264 1.5379 1.0664 0.4789  0.0949  0.4560  185 ASN B ND2 
4511 N N   . PRO B 186 ? 0.7763 1.4560 0.9902 0.3585  0.0574  0.3932  186 PRO B N   
4512 C CA  . PRO B 186 ? 0.7880 1.3914 0.9612 0.3605  0.0771  0.3665  186 PRO B CA  
4513 C C   . PRO B 186 ? 0.8785 1.4350 1.0291 0.4057  0.1080  0.3678  186 PRO B C   
4514 O O   . PRO B 186 ? 0.8906 1.3676 0.9927 0.4076  0.1162  0.3436  186 PRO B O   
4515 C CB  . PRO B 186 ? 0.7937 1.4331 0.9933 0.3395  0.0811  0.3672  186 PRO B CB  
4516 C CG  . PRO B 186 ? 0.8409 1.5766 1.0999 0.3463  0.0775  0.4013  186 PRO B CG  
4517 C CD  . PRO B 186 ? 0.7835 1.5472 1.0510 0.3456  0.0542  0.4140  186 PRO B CD  
4518 N N   . GLN B 187 ? 0.8441 1.4497 1.0291 0.4413  0.1251  0.3963  187 GLN B N   
4519 C CA  . GLN B 187 ? 0.8717 1.4400 1.0394 0.4885  0.1574  0.4020  187 GLN B CA  
4520 C C   . GLN B 187 ? 0.9214 1.4128 1.0403 0.5061  0.1600  0.3897  187 GLN B C   
4521 O O   . GLN B 187 ? 0.9535 1.3780 1.0342 0.5292  0.1845  0.3775  187 GLN B O   
4522 C CB  . GLN B 187 ? 0.9027 1.5492 1.1230 0.5226  0.1722  0.4387  187 GLN B CB  
4523 C CG  . GLN B 187 ? 1.1290 1.8153 1.3782 0.5245  0.1920  0.4463  187 GLN B CG  
4524 C CD  . GLN B 187 ? 1.3642 2.0895 1.6350 0.4758  0.1708  0.4390  187 GLN B CD  
4525 O OE1 . GLN B 187 ? 1.2896 1.9712 1.5334 0.4555  0.1757  0.4154  187 GLN B OE1 
4526 N NE2 . GLN B 187 ? 1.2648 2.0708 1.5826 0.4550  0.1460  0.4591  187 GLN B NE2 
4527 N N   . LYS B 188 ? 0.8309 1.3290 0.9479 0.4932  0.1346  0.3923  188 LYS B N   
4528 C CA  . LYS B 188 ? 0.8339 1.2609 0.9049 0.5040  0.1340  0.3808  188 LYS B CA  
4529 C C   . LYS B 188 ? 0.8726 1.2368 0.9013 0.4675  0.1222  0.3462  188 LYS B C   
4530 O O   . LYS B 188 ? 0.8341 1.2255 0.8756 0.4304  0.1026  0.3372  188 LYS B O   
4531 C CB  . LYS B 188 ? 0.8442 1.3097 0.9322 0.5065  0.1126  0.4008  188 LYS B CB  
4532 C CG  . LYS B 188 ? 0.8952 1.4213 1.0241 0.5460  0.1234  0.4375  188 LYS B CG  
4533 C CD  . LYS B 188 ? 0.9806 1.4488 1.0789 0.5895  0.1448  0.4437  188 LYS B CD  
4534 C CE  . LYS B 188 ? 0.9295 1.4609 1.0698 0.6296  0.1528  0.4828  188 LYS B CE  
4535 N NZ  . LYS B 188 ? 0.9600 1.4285 1.0680 0.6749  0.1776  0.4889  188 LYS B NZ  
4536 N N   . ASN B 189 ? 0.8586 1.1388 0.8370 0.4779  0.1345  0.3277  189 ASN B N   
4537 C CA  . ASN B 189 ? 0.8443 1.0633 0.7822 0.4473  0.1255  0.2967  189 ASN B CA  
4538 C C   . ASN B 189 ? 0.9030 1.0926 0.8165 0.4345  0.1066  0.2898  189 ASN B C   
4539 O O   . ASN B 189 ? 0.9246 1.0467 0.7973 0.4447  0.1151  0.2790  189 ASN B O   
4540 C CB  . ASN B 189 ? 0.8602 1.0083 0.7583 0.4598  0.1500  0.2786  189 ASN B CB  
4541 C CG  . ASN B 189 ? 1.1982 1.3680 1.1124 0.4604  0.1650  0.2779  189 ASN B CG  
4542 O OD1 . ASN B 189 ? 1.1078 1.3496 1.0675 0.4561  0.1609  0.2943  189 ASN B OD1 
4543 N ND2 . ASN B 189 ? 1.1341 1.2419 1.0098 0.4648  0.1828  0.2596  189 ASN B ND2 
4544 N N   . THR B 190 ? 0.8370 1.0767 0.7737 0.4107  0.0808  0.2962  190 THR B N   
4545 C CA  . THR B 190 ? 0.8362 1.0534 0.7501 0.3957  0.0619  0.2898  190 THR B CA  
4546 C C   . THR B 190 ? 0.8827 1.0447 0.7616 0.3656  0.0567  0.2588  190 THR B C   
4547 O O   . THR B 190 ? 0.8701 1.0350 0.7545 0.3486  0.0588  0.2462  190 THR B O   
4548 C CB  . THR B 190 ? 0.8764 1.1631 0.8222 0.3793  0.0367  0.3057  190 THR B CB  
4549 O OG1 . THR B 190 ? 0.8634 1.1885 0.8317 0.3492  0.0256  0.2987  190 THR B OG1 
4550 C CG2 . THR B 190 ? 0.8388 1.1804 0.8183 0.4100  0.0397  0.3386  190 THR B CG2 
4551 N N   . PRO B 191 ? 0.8328 0.9450 0.6764 0.3596  0.0511  0.2476  191 PRO B N   
4552 C CA  . PRO B 191 ? 0.8169 0.8805 0.6303 0.3331  0.0474  0.2203  191 PRO B CA  
4553 C C   . PRO B 191 ? 0.8236 0.9183 0.6516 0.2989  0.0300  0.2097  191 PRO B C   
4554 O O   . PRO B 191 ? 0.8052 0.9449 0.6516 0.2860  0.0119  0.2186  191 PRO B O   
4555 C CB  . PRO B 191 ? 0.8583 0.8797 0.6399 0.3332  0.0423  0.2167  191 PRO B CB  
4556 C CG  . PRO B 191 ? 0.9412 0.9673 0.7267 0.3662  0.0511  0.2390  191 PRO B CG  
4557 C CD  . PRO B 191 ? 0.8728 0.9706 0.7026 0.3771  0.0490  0.2604  191 PRO B CD  
4558 N N   . LYS B 192 ? 0.7595 0.8285 0.5776 0.2847  0.0358  0.1910  192 LYS B N   
4559 C CA  . LYS B 192 ? 0.7254 0.8134 0.5534 0.2536  0.0230  0.1792  192 LYS B CA  
4560 C C   . LYS B 192 ? 0.7366 0.7994 0.5413 0.2296  0.0081  0.1635  192 LYS B C   
4561 O O   . LYS B 192 ? 0.6962 0.7828 0.5097 0.2054  -0.0070 0.1589  192 LYS B O   
4562 C CB  . LYS B 192 ? 0.7552 0.8271 0.5823 0.2508  0.0361  0.1684  192 LYS B CB  
4563 C CG  . LYS B 192 ? 0.9918 1.1081 0.8511 0.2658  0.0468  0.1850  192 LYS B CG  
4564 C CD  . LYS B 192 ? 1.1610 1.3275 1.0507 0.2417  0.0349  0.1877  192 LYS B CD  
4565 C CE  . LYS B 192 ? 1.3793 1.5241 1.2614 0.2265  0.0412  0.1722  192 LYS B CE  
4566 N NZ  . LYS B 192 ? 1.5076 1.6684 1.4054 0.2436  0.0601  0.1817  192 LYS B NZ  
4567 N N   . PHE B 193 ? 0.7054 0.7192 0.4795 0.2367  0.0133  0.1562  193 PHE B N   
4568 C CA  . PHE B 193 ? 0.6963 0.6833 0.4466 0.2190  0.0030  0.1434  193 PHE B CA  
4569 C C   . PHE B 193 ? 0.7754 0.7179 0.4978 0.2331  0.0104  0.1437  193 PHE B C   
4570 O O   . PHE B 193 ? 0.8008 0.7216 0.5166 0.2553  0.0249  0.1497  193 PHE B O   
4571 C CB  . PHE B 193 ? 0.6990 0.6639 0.4397 0.1965  0.0019  0.1228  193 PHE B CB  
4572 C CG  . PHE B 193 ? 0.7220 0.6423 0.4448 0.2015  0.0162  0.1112  193 PHE B CG  
4573 C CD1 . PHE B 193 ? 0.7519 0.6759 0.4847 0.2012  0.0242  0.1075  193 PHE B CD1 
4574 C CD2 . PHE B 193 ? 0.7655 0.6404 0.4600 0.2030  0.0201  0.1035  193 PHE B CD2 
4575 C CE1 . PHE B 193 ? 0.7700 0.6527 0.4829 0.2035  0.0354  0.0965  193 PHE B CE1 
4576 C CE2 . PHE B 193 ? 0.8035 0.6385 0.4801 0.2043  0.0309  0.0929  193 PHE B CE2 
4577 C CZ  . PHE B 193 ? 0.7690 0.6081 0.4540 0.2045  0.0380  0.0892  193 PHE B CZ  
4578 N N   . LEU B 194 ? 0.7184 0.6441 0.4221 0.2188  0.0013  0.1361  194 LEU B N   
4579 C CA  . LEU B 194 ? 0.7312 0.6132 0.4066 0.2241  0.0060  0.1339  194 LEU B CA  
4580 C C   . LEU B 194 ? 0.7939 0.6508 0.4534 0.2015  0.0029  0.1146  194 LEU B C   
4581 O O   . LEU B 194 ? 0.7798 0.6574 0.4455 0.1831  -0.0079 0.1080  194 LEU B O   
4582 C CB  . LEU B 194 ? 0.7422 0.6387 0.4136 0.2296  -0.0030 0.1480  194 LEU B CB  
4583 C CG  . LEU B 194 ? 0.8083 0.6642 0.4495 0.2256  -0.0022 0.1437  194 LEU B CG  
4584 C CD1 . LEU B 194 ? 0.8374 0.6596 0.4636 0.2487  0.0101  0.1545  194 LEU B CD1 
4585 C CD2 . LEU B 194 ? 0.8235 0.7011 0.4604 0.2131  -0.0170 0.1471  194 LEU B CD2 
4586 N N   . TYR B 195 ? 0.7700 0.5822 0.4087 0.2027  0.0126  0.1061  195 TYR B N   
4587 C CA  . TYR B 195 ? 0.7506 0.5386 0.3753 0.1838  0.0114  0.0902  195 TYR B CA  
4588 C C   . TYR B 195 ? 0.8241 0.5851 0.4264 0.1822  0.0113  0.0916  195 TYR B C   
4589 O O   . TYR B 195 ? 0.8467 0.5867 0.4372 0.1973  0.0178  0.1011  195 TYR B O   
4590 C CB  . TYR B 195 ? 0.7560 0.5152 0.3741 0.1850  0.0219  0.0810  195 TYR B CB  
4591 C CG  . TYR B 195 ? 0.7586 0.4898 0.3616 0.1687  0.0221  0.0676  195 TYR B CG  
4592 C CD1 . TYR B 195 ? 0.7595 0.5015 0.3718 0.1535  0.0181  0.0567  195 TYR B CD1 
4593 C CD2 . TYR B 195 ? 0.7791 0.4729 0.3591 0.1687  0.0266  0.0669  195 TYR B CD2 
4594 C CE1 . TYR B 195 ? 0.7557 0.4766 0.3574 0.1405  0.0186  0.0466  195 TYR B CE1 
4595 C CE2 . TYR B 195 ? 0.7802 0.4548 0.3501 0.1526  0.0259  0.0567  195 TYR B CE2 
4596 C CZ  . TYR B 195 ? 0.8367 0.5267 0.4188 0.1396  0.0221  0.0470  195 TYR B CZ  
4597 O OH  . TYR B 195 ? 0.8002 0.4754 0.3757 0.1259  0.0218  0.0388  195 TYR B OH  
4598 N N   . THR B 196 ? 0.7871 0.5445 0.3820 0.1646  0.0061  0.0823  196 THR B N   
4599 C CA  . THR B 196 ? 0.8152 0.5450 0.3886 0.1597  0.0079  0.0821  196 THR B CA  
4600 C C   . THR B 196 ? 0.8795 0.6044 0.4483 0.1411  0.0061  0.0698  196 THR B C   
4601 O O   . THR B 196 ? 0.8679 0.6136 0.4482 0.1315  0.0013  0.0619  196 THR B O   
4602 C CB  . THR B 196 ? 0.8683 0.5993 0.4313 0.1690  0.0053  0.0965  196 THR B CB  
4603 O OG1 . THR B 196 ? 0.7774 0.4708 0.3185 0.1667  0.0115  0.0969  196 THR B OG1 
4604 C CG2 . THR B 196 ? 0.8345 0.5958 0.3996 0.1596  -0.0059 0.0977  196 THR B CG2 
4605 N N   . VAL B 197 ? 0.8570 0.5537 0.4090 0.1361  0.0107  0.0691  197 VAL B N   
4606 C CA  . VAL B 197 ? 0.8613 0.5555 0.4090 0.1206  0.0106  0.0611  197 VAL B CA  
4607 C C   . VAL B 197 ? 0.9569 0.6528 0.4912 0.1213  0.0084  0.0699  197 VAL B C   
4608 O O   . VAL B 197 ? 0.9907 0.6636 0.5102 0.1257  0.0124  0.0784  197 VAL B O   
4609 C CB  . VAL B 197 ? 0.9134 0.5817 0.4550 0.1120  0.0164  0.0554  197 VAL B CB  
4610 C CG1 . VAL B 197 ? 0.9063 0.5792 0.4465 0.0983  0.0168  0.0511  197 VAL B CG1 
4611 C CG2 . VAL B 197 ? 0.8930 0.5616 0.4460 0.1115  0.0174  0.0474  197 VAL B CG2 
4612 N N   . PRO B 198 ? 0.8853 0.6072 0.4225 0.1180  0.0016  0.0690  198 PRO B N   
4613 C CA  . PRO B 198 ? 0.8919 0.6177 0.4139 0.1192  -0.0015 0.0782  198 PRO B CA  
4614 C C   . PRO B 198 ? 0.9236 0.6340 0.4301 0.1095  0.0041  0.0769  198 PRO B C   
4615 O O   . PRO B 198 ? 0.9446 0.6478 0.4352 0.1121  0.0045  0.0872  198 PRO B O   
4616 C CB  . PRO B 198 ? 0.9060 0.6630 0.4335 0.1161  -0.0113 0.0760  198 PRO B CB  
4617 C CG  . PRO B 198 ? 0.9384 0.7064 0.4859 0.1138  -0.0125 0.0664  198 PRO B CG  
4618 C CD  . PRO B 198 ? 0.8708 0.6163 0.4215 0.1115  -0.0036 0.0595  198 PRO B CD  
4619 N N   . ASN B 199 ? 0.8398 0.5467 0.3518 0.0990  0.0089  0.0660  199 ASN B N   
4620 C CA  . ASN B 199 ? 0.8462 0.5434 0.3474 0.0901  0.0154  0.0663  199 ASN B CA  
4621 C C   . ASN B 199 ? 0.8860 0.5634 0.3914 0.0846  0.0216  0.0653  199 ASN B C   
4622 O O   . ASN B 199 ? 0.8827 0.5626 0.4024 0.0817  0.0218  0.0569  199 ASN B O   
4623 C CB  . ASN B 199 ? 0.8599 0.5732 0.3613 0.0822  0.0166  0.0568  199 ASN B CB  
4624 C CG  . ASN B 199 ? 1.2213 0.9513 0.7139 0.0834  0.0097  0.0553  199 ASN B CG  
4625 O OD1 . ASN B 199 ? 1.1979 0.9305 0.6760 0.0872  0.0053  0.0648  199 ASN B OD1 
4626 N ND2 . ASN B 199 ? 1.1299 0.8703 0.6287 0.0788  0.0085  0.0436  199 ASN B ND2 
4627 N N   . GLY B 200 ? 0.8232 0.4812 0.3149 0.0816  0.0260  0.0744  200 GLY B N   
4628 C CA  . GLY B 200 ? 0.8197 0.4571 0.3114 0.0726  0.0307  0.0749  200 GLY B CA  
4629 C C   . GLY B 200 ? 0.8725 0.4978 0.3719 0.0755  0.0289  0.0695  200 GLY B C   
4630 O O   . GLY B 200 ? 0.8568 0.4868 0.3682 0.0675  0.0291  0.0618  200 GLY B O   
4631 N N   . ASN B 201 ? 0.8377 0.4493 0.3298 0.0886  0.0274  0.0743  201 ASN B N   
4632 C CA  . ASN B 201 ? 0.8324 0.4305 0.3276 0.0951  0.0274  0.0702  201 ASN B CA  
4633 C C   . ASN B 201 ? 0.8724 0.4445 0.3611 0.0834  0.0302  0.0664  201 ASN B C   
4634 O O   . ASN B 201 ? 0.8788 0.4282 0.3528 0.0745  0.0330  0.0719  201 ASN B O   
4635 C CB  . ASN B 201 ? 0.9020 0.4863 0.3873 0.1130  0.0283  0.0795  201 ASN B CB  
4636 C CG  . ASN B 201 ? 1.0544 0.6161 0.5361 0.1223  0.0319  0.0771  201 ASN B CG  
4637 O OD1 . ASN B 201 ? 0.8618 0.3844 0.3238 0.1229  0.0372  0.0800  201 ASN B OD1 
4638 N ND2 . ASN B 201 ? 0.8790 0.4625 0.3773 0.1296  0.0299  0.0720  201 ASN B ND2 
4639 N N   . ASN B 202 ? 0.8048 0.3804 0.3034 0.0822  0.0288  0.0574  202 ASN B N   
4640 C CA  . ASN B 202 ? 0.8122 0.3636 0.3028 0.0715  0.0296  0.0529  202 ASN B CA  
4641 C C   . ASN B 202 ? 0.8960 0.4117 0.3666 0.0840  0.0337  0.0553  202 ASN B C   
4642 O O   . ASN B 202 ? 0.8899 0.4141 0.3665 0.0999  0.0348  0.0546  202 ASN B O   
4643 C CB  . ASN B 202 ? 0.8091 0.3812 0.3173 0.0674  0.0264  0.0435  202 ASN B CB  
4644 C CG  . ASN B 202 ? 1.1235 0.6855 0.6294 0.0503  0.0244  0.0398  202 ASN B CG  
4645 O OD1 . ASN B 202 ? 1.0963 0.6300 0.5843 0.0399  0.0252  0.0430  202 ASN B OD1 
4646 N ND2 . ASN B 202 ? 0.9511 0.5366 0.4749 0.0463  0.0212  0.0339  202 ASN B ND2 
4647 N N   . PRO B 203 ? 0.8901 0.3656 0.3362 0.0789  0.0372  0.0596  203 PRO B N   
4648 C CA  . PRO B 203 ? 0.9051 0.3657 0.3415 0.0583  0.0365  0.0623  203 PRO B CA  
4649 C C   . PRO B 203 ? 0.9648 0.4191 0.3921 0.0578  0.0391  0.0738  203 PRO B C   
4650 O O   . PRO B 203 ? 0.9631 0.4204 0.3910 0.0398  0.0383  0.0767  203 PRO B O   
4651 C CB  . PRO B 203 ? 0.9655 0.3788 0.3758 0.0519  0.0385  0.0583  203 PRO B CB  
4652 C CG  . PRO B 203 ? 1.0432 0.4332 0.4395 0.0764  0.0450  0.0606  203 PRO B CG  
4653 C CD  . PRO B 203 ? 0.9454 0.3817 0.3692 0.0933  0.0433  0.0615  203 PRO B CD  
4654 N N   . THR B 204 ? 0.9280 0.3744 0.3470 0.0772  0.0423  0.0817  204 THR B N   
4655 C CA  . THR B 204 ? 0.9421 0.3793 0.3488 0.0807  0.0449  0.0947  204 THR B CA  
4656 C C   . THR B 204 ? 0.9679 0.4316 0.3840 0.0654  0.0433  0.0980  204 THR B C   
4657 O O   . THR B 204 ? 0.9779 0.4214 0.3795 0.0537  0.0462  0.1059  204 THR B O   
4658 C CB  . THR B 204 ? 1.0415 0.4933 0.4520 0.1053  0.0449  0.1021  204 THR B CB  
4659 O OG1 . THR B 204 ? 0.9535 0.4543 0.3886 0.1072  0.0392  0.0977  204 THR B OG1 
4660 C CG2 . THR B 204 ? 1.0792 0.5073 0.4818 0.1242  0.0491  0.1018  204 THR B CG2 
4661 N N   . GLY B 205 ? 0.8870 0.3942 0.3260 0.0659  0.0396  0.0920  205 GLY B N   
4662 C CA  . GLY B 205 ? 0.8612 0.3972 0.3098 0.0558  0.0399  0.0937  205 GLY B CA  
4663 C C   . GLY B 205 ? 0.8946 0.4468 0.3393 0.0684  0.0393  0.1008  205 GLY B C   
4664 O O   . GLY B 205 ? 0.8673 0.4449 0.3172 0.0635  0.0400  0.1009  205 GLY B O   
4665 N N   . ASN B 206 ? 0.8837 0.4220 0.3186 0.0854  0.0381  0.1070  206 ASN B N   
4666 C CA  . ASN B 206 ? 0.9023 0.4554 0.3321 0.0988  0.0353  0.1163  206 ASN B CA  
4667 C C   . ASN B 206 ? 0.9309 0.5238 0.3785 0.1045  0.0288  0.1088  206 ASN B C   
4668 O O   . ASN B 206 ? 0.9092 0.5123 0.3728 0.1050  0.0268  0.0983  206 ASN B O   
4669 C CB  . ASN B 206 ? 0.9811 0.5069 0.3968 0.1163  0.0367  0.1277  206 ASN B CB  
4670 C CG  . ASN B 206 ? 1.4507 0.9290 0.8438 0.1113  0.0435  0.1352  206 ASN B CG  
4671 O OD1 . ASN B 206 ? 1.4652 0.9103 0.8481 0.1208  0.0471  0.1365  206 ASN B OD1 
4672 N ND2 . ASN B 206 ? 1.3917 0.8636 0.7746 0.0962  0.0463  0.1404  206 ASN B ND2 
4673 N N   . SER B 207 ? 0.8897 0.5027 0.3318 0.1078  0.0252  0.1149  207 SER B N   
4674 C CA  . SER B 207 ? 0.8667 0.5147 0.3198 0.1101  0.0179  0.1086  207 SER B CA  
4675 C C   . SER B 207 ? 0.9248 0.5863 0.3705 0.1229  0.0106  0.1208  207 SER B C   
4676 O O   . SER B 207 ? 0.9450 0.5912 0.3740 0.1285  0.0123  0.1348  207 SER B O   
4677 C CB  . SER B 207 ? 0.9163 0.5796 0.3686 0.0966  0.0201  0.1003  207 SER B CB  
4678 O OG  . SER B 207 ? 1.0672 0.7578 0.5247 0.0968  0.0136  0.0929  207 SER B OG  
4679 N N   . LEU B 208 ? 0.8640 0.5551 0.3227 0.1267  0.0021  0.1165  208 LEU B N   
4680 C CA  . LEU B 208 ? 0.8799 0.5926 0.3364 0.1371  -0.0075 0.1283  208 LEU B CA  
4681 C C   . LEU B 208 ? 0.9643 0.6920 0.4021 0.1295  -0.0130 0.1312  208 LEU B C   
4682 O O   . LEU B 208 ? 0.9714 0.6978 0.4006 0.1163  -0.0091 0.1209  208 LEU B O   
4683 C CB  . LEU B 208 ? 0.8574 0.5976 0.3367 0.1418  -0.0151 0.1237  208 LEU B CB  
4684 C CG  . LEU B 208 ? 0.9245 0.6605 0.4166 0.1599  -0.0132 0.1336  208 LEU B CG  
4685 C CD1 . LEU B 208 ? 0.9003 0.6395 0.4130 0.1590  -0.0105 0.1215  208 LEU B CD1 
4686 C CD2 . LEU B 208 ? 0.9664 0.7325 0.4645 0.1718  -0.0233 0.1486  208 LEU B CD2 
4687 N N   . THR B 209 ? 0.9151 0.6573 0.3456 0.1390  -0.0216 0.1463  209 THR B N   
4688 C CA  . THR B 209 ? 0.9177 0.6746 0.3270 0.1322  -0.0285 0.1502  209 THR B CA  
4689 C C   . THR B 209 ? 0.9443 0.7373 0.3624 0.1290  -0.0429 0.1466  209 THR B C   
4690 O O   . THR B 209 ? 0.9062 0.7162 0.3468 0.1380  -0.0486 0.1507  209 THR B O   
4691 C CB  . THR B 209 ? 1.0239 0.7714 0.4151 0.1430  -0.0292 0.1715  209 THR B CB  
4692 O OG1 . THR B 209 ? 1.0257 0.8002 0.4263 0.1554  -0.0417 0.1849  209 THR B OG1 
4693 C CG2 . THR B 209 ? 1.0279 0.7374 0.4169 0.1507  -0.0166 0.1787  209 THR B CG2 
4694 N N   . SER B 210 ? 0.9282 0.7326 0.3267 0.1158  -0.0486 0.1397  210 SER B N   
4695 C CA  . SER B 210 ? 0.9329 0.7683 0.3321 0.1076  -0.0637 0.1351  210 SER B CA  
4696 C C   . SER B 210 ? 0.9808 0.8446 0.3913 0.1195  -0.0775 0.1548  210 SER B C   
4697 O O   . SER B 210 ? 0.9727 0.8639 0.4041 0.1177  -0.0877 0.1532  210 SER B O   
4698 C CB  . SER B 210 ? 1.0212 0.8560 0.3865 0.0935  -0.0665 0.1282  210 SER B CB  
4699 O OG  . SER B 210 ? 1.1863 1.0438 0.5484 0.0811  -0.0802 0.1191  210 SER B OG  
4700 N N   . GLU B 211 ? 0.9233 0.7809 0.3217 0.1322  -0.0771 0.1748  211 GLU B N   
4701 C CA  . GLU B 211 ? 0.9075 0.7919 0.3165 0.1470  -0.0888 0.1970  211 GLU B CA  
4702 C C   . GLU B 211 ? 0.9160 0.8057 0.3592 0.1629  -0.0848 0.2021  211 GLU B C   
4703 O O   . GLU B 211 ? 0.8962 0.8230 0.3615 0.1646  -0.0964 0.2067  211 GLU B O   
4704 C CB  . GLU B 211 ? 0.9554 0.8281 0.3406 0.1573  -0.0881 0.2174  211 GLU B CB  
4705 C CG  . GLU B 211 ? 1.1581 1.0463 0.5120 0.1438  -0.1002 0.2193  211 GLU B CG  
4706 C CD  . GLU B 211 ? 1.4260 1.3563 0.7844 0.1313  -0.1202 0.2155  211 GLU B CD  
4707 O OE1 . GLU B 211 ? 1.3238 1.2517 0.6677 0.1114  -0.1217 0.1948  211 GLU B OE1 
4708 O OE2 . GLU B 211 ? 1.2738 1.2392 0.6496 0.1412  -0.1340 0.2338  211 GLU B OE2 
4709 N N   . ARG B 212 ? 0.8534 0.7069 0.3007 0.1731  -0.0684 0.2006  212 ARG B N   
4710 C CA  . ARG B 212 ? 0.8242 0.6775 0.2994 0.1890  -0.0624 0.2040  212 ARG B CA  
4711 C C   . ARG B 212 ? 0.8354 0.7087 0.3347 0.1790  -0.0651 0.1873  212 ARG B C   
4712 O O   . ARG B 212 ? 0.8240 0.7193 0.3491 0.1905  -0.0669 0.1942  212 ARG B O   
4713 C CB  . ARG B 212 ? 0.8184 0.6254 0.2873 0.2020  -0.0455 0.2073  212 ARG B CB  
4714 C CG  . ARG B 212 ? 0.9212 0.6899 0.3708 0.1874  -0.0345 0.1928  212 ARG B CG  
4715 C CD  . ARG B 212 ? 0.9706 0.6947 0.4167 0.1971  -0.0196 0.1944  212 ARG B CD  
4716 N NE  . ARG B 212 ? 0.8655 0.5659 0.2936 0.2121  -0.0156 0.2147  212 ARG B NE  
4717 C CZ  . ARG B 212 ? 0.8924 0.5531 0.3150 0.2252  -0.0038 0.2207  212 ARG B CZ  
4718 N NH1 . ARG B 212 ? 0.9218 0.5639 0.3548 0.2249  0.0044  0.2077  212 ARG B NH1 
4719 N NH2 . ARG B 212 ? 0.6475 0.3342 0.1521 0.2214  0.0236  0.1633  212 ARG B NH2 
4720 N N   . LYS B 213 ? 0.7771 0.6468 0.2677 0.1578  -0.0660 0.1672  213 LYS B N   
4721 C CA  . LYS B 213 ? 0.7473 0.6350 0.2568 0.1458  -0.0698 0.1516  213 LYS B CA  
4722 C C   . LYS B 213 ? 0.7899 0.7248 0.3122 0.1426  -0.0876 0.1606  213 LYS B C   
4723 O O   . LYS B 213 ? 0.7601 0.7175 0.3082 0.1415  -0.0909 0.1580  213 LYS B O   
4724 C CB  . LYS B 213 ? 0.7701 0.6407 0.2632 0.1258  -0.0663 0.1302  213 LYS B CB  
4725 C CG  . LYS B 213 ? 0.8660 0.7033 0.3624 0.1254  -0.0507 0.1177  213 LYS B CG  
4726 C CD  . LYS B 213 ? 0.9825 0.8159 0.4764 0.1083  -0.0489 0.0973  213 LYS B CD  
4727 C CE  . LYS B 213 ? 1.2307 1.0335 0.7228 0.1067  -0.0344 0.0878  213 LYS B CE  
4728 N NZ  . LYS B 213 ? 1.3627 1.1625 0.8551 0.0934  -0.0314 0.0698  213 LYS B NZ  
4729 N N   . LYS B 214 ? 0.7736 0.7248 0.2778 0.1409  -0.0994 0.1729  214 LYS B N   
4730 C CA  . LYS B 214 ? 0.7789 0.7775 0.2925 0.1368  -0.1187 0.1849  214 LYS B CA  
4731 C C   . LYS B 214 ? 0.8345 0.8588 0.3799 0.1603  -0.1189 0.2068  214 LYS B C   
4732 O O   . LYS B 214 ? 0.8107 0.8727 0.3844 0.1584  -0.1271 0.2103  214 LYS B O   
4733 C CB  . LYS B 214 ? 0.8267 0.8323 0.3082 0.1297  -0.1307 0.1934  214 LYS B CB  
4734 C CG  . LYS B 214 ? 0.9475 0.9321 0.3963 0.1067  -0.1307 0.1720  214 LYS B CG  
4735 C CD  . LYS B 214 ? 1.1170 1.1117 0.5316 0.0975  -0.1438 0.1792  214 LYS B CD  
4736 C CE  . LYS B 214 ? 1.1800 1.1502 0.5596 0.0766  -0.1408 0.1568  214 LYS B CE  
4737 N NZ  . LYS B 214 ? 1.2630 1.2332 0.6026 0.0709  -0.1487 0.1644  214 LYS B NZ  
4738 N N   . GLU B 215 ? 0.8091 0.8105 0.3492 0.1826  -0.1081 0.2214  215 GLU B N   
4739 C CA  . GLU B 215 ? 0.8149 0.8310 0.3800 0.2097  -0.1040 0.2429  215 GLU B CA  
4740 C C   . GLU B 215 ? 0.8515 0.8697 0.4462 0.2143  -0.0942 0.2336  215 GLU B C   
4741 O O   . GLU B 215 ? 0.8484 0.9098 0.4732 0.2207  -0.1007 0.2446  215 GLU B O   
4742 C CB  . GLU B 215 ? 0.8569 0.8319 0.4032 0.2303  -0.0907 0.2553  215 GLU B CB  
4743 C CG  . GLU B 215 ? 1.0169 1.0018 0.5421 0.2344  -0.1012 0.2747  215 GLU B CG  
4744 C CD  . GLU B 215 ? 1.2833 1.2265 0.7891 0.2547  -0.0885 0.2894  215 GLU B CD  
4745 O OE1 . GLU B 215 ? 1.0237 0.9385 0.4975 0.2444  -0.0866 0.2858  215 GLU B OE1 
4746 O OE2 . GLU B 215 ? 1.1936 1.1327 0.7149 0.2811  -0.0800 0.3056  215 GLU B OE2 
4747 N N   . ILE B 216 ? 0.7913 0.7671 0.3776 0.2085  -0.0798 0.2136  216 ILE B N   
4748 C CA  . ILE B 216 ? 0.7679 0.7415 0.3771 0.2110  -0.0702 0.2035  216 ILE B CA  
4749 C C   . ILE B 216 ? 0.8241 0.8430 0.4561 0.1944  -0.0832 0.1979  216 ILE B C   
4750 O O   . ILE B 216 ? 0.8194 0.8665 0.4810 0.2048  -0.0817 0.2064  216 ILE B O   
4751 C CB  . ILE B 216 ? 0.7933 0.7152 0.3866 0.2044  -0.0552 0.1831  216 ILE B CB  
4752 C CG1 . ILE B 216 ? 0.8138 0.6918 0.3877 0.2212  -0.0421 0.1910  216 ILE B CG1 
4753 C CG2 . ILE B 216 ? 0.7842 0.7066 0.3991 0.2048  -0.0472 0.1723  216 ILE B CG2 
4754 C CD1 . ILE B 216 ? 0.8720 0.7053 0.4244 0.2089  -0.0328 0.1745  216 ILE B CD1 
4755 N N   . TYR B 217 ? 0.7775 0.8033 0.3949 0.1689  -0.0953 0.1851  217 TYR B N   
4756 C CA  . TYR B 217 ? 0.7646 0.8280 0.3991 0.1502  -0.1083 0.1794  217 TYR B CA  
4757 C C   . TYR B 217 ? 0.8265 0.9463 0.4862 0.1573  -0.1224 0.2026  217 TYR B C   
4758 O O   . TYR B 217 ? 0.7956 0.9489 0.4845 0.1531  -0.1262 0.2046  217 TYR B O   
4759 C CB  . TYR B 217 ? 0.7882 0.8424 0.3960 0.1225  -0.1181 0.1615  217 TYR B CB  
4760 C CG  . TYR B 217 ? 0.7974 0.8769 0.4189 0.1009  -0.1285 0.1514  217 TYR B CG  
4761 C CD1 . TYR B 217 ? 0.8081 0.8651 0.4339 0.0915  -0.1190 0.1322  217 TYR B CD1 
4762 C CD2 . TYR B 217 ? 0.8153 0.9413 0.4455 0.0890  -0.1484 0.1623  217 TYR B CD2 
4763 C CE1 . TYR B 217 ? 0.8297 0.9066 0.4676 0.0718  -0.1277 0.1241  217 TYR B CE1 
4764 C CE2 . TYR B 217 ? 0.8218 0.9693 0.4641 0.0669  -0.1582 0.1537  217 TYR B CE2 
4765 C CZ  . TYR B 217 ? 0.9059 1.0268 0.5513 0.0585  -0.1473 0.1344  217 TYR B CZ  
4766 O OH  . TYR B 217 ? 0.8522 0.9906 0.5074 0.0359  -0.1567 0.1266  217 TYR B OH  
4767 N N   . GLU B 218 ? 0.8239 0.9567 0.4738 0.1680  -0.1302 0.2215  218 GLU B N   
4768 C CA  . GLU B 218 ? 0.8370 1.0285 0.5131 0.1762  -0.1446 0.2466  218 GLU B CA  
4769 C C   . GLU B 218 ? 0.8766 1.0842 0.5863 0.2071  -0.1321 0.2656  218 GLU B C   
4770 O O   . GLU B 218 ? 0.8769 1.1401 0.6174 0.2147  -0.1419 0.2866  218 GLU B O   
4771 C CB  . GLU B 218 ? 0.8879 1.1006 0.5437 0.1707  -0.1630 0.2607  218 GLU B CB  
4772 C CG  . GLU B 218 ? 1.1145 1.2902 0.7411 0.1871  -0.1551 0.2685  218 GLU B CG  
4773 C CD  . GLU B 218 ? 1.5787 1.7674 1.1757 0.1732  -0.1734 0.2749  218 GLU B CD  
4774 O OE1 . GLU B 218 ? 1.6083 1.8380 1.2153 0.1842  -0.1867 0.3008  218 GLU B OE1 
4775 O OE2 . GLU B 218 ? 1.5647 1.7241 1.1282 0.1517  -0.1746 0.2545  218 GLU B OE2 
4776 N N   . LEU B 219 ? 0.8182 0.9774 0.5219 0.2238  -0.1100 0.2575  219 LEU B N   
4777 C CA  . LEU B 219 ? 0.8072 0.9681 0.5353 0.2534  -0.0938 0.2706  219 LEU B CA  
4778 C C   . LEU B 219 ? 0.8189 0.9894 0.5699 0.2445  -0.0876 0.2573  219 LEU B C   
4779 O O   . LEU B 219 ? 0.8011 0.9988 0.5825 0.2624  -0.0801 0.2703  219 LEU B O   
4780 C CB  . LEU B 219 ? 0.8230 0.9209 0.5257 0.2732  -0.0741 0.2677  219 LEU B CB  
4781 C CG  . LEU B 219 ? 0.9132 1.0110 0.6220 0.3088  -0.0648 0.2940  219 LEU B CG  
4782 C CD1 . LEU B 219 ? 0.9351 1.0794 0.6501 0.3139  -0.0829 0.3192  219 LEU B CD1 
4783 C CD2 . LEU B 219 ? 0.9678 0.9963 0.6432 0.3210  -0.0482 0.2886  219 LEU B CD2 
4784 N N   . ALA B 220 ? 0.7715 0.9210 0.5077 0.2170  -0.0907 0.2325  220 ALA B N   
4785 C CA  . ALA B 220 ? 0.7458 0.8999 0.4988 0.2041  -0.0864 0.2178  220 ALA B CA  
4786 C C   . ALA B 220 ? 0.8097 1.0270 0.5931 0.1907  -0.1027 0.2281  220 ALA B C   
4787 O O   . ALA B 220 ? 0.8069 1.0446 0.6173 0.1912  -0.0969 0.2284  220 ALA B O   
4788 C CB  . ALA B 220 ? 0.7410 0.8538 0.4674 0.1802  -0.0856 0.1908  220 ALA B CB  
4789 N N   . ARG B 221 ? 0.7735 1.0231 0.5524 0.1780  -0.1231 0.2374  221 ARG B N   
4790 C CA  . ARG B 221 ? 0.7644 1.0769 0.5713 0.1616  -0.1415 0.2484  221 ARG B CA  
4791 C C   . ARG B 221 ? 0.8173 1.1835 0.6628 0.1873  -0.1408 0.2788  221 ARG B C   
4792 O O   . ARG B 221 ? 0.7917 1.2083 0.6727 0.1809  -0.1461 0.2882  221 ARG B O   
4793 C CB  . ARG B 221 ? 0.7665 1.0922 0.5508 0.1329  -0.1652 0.2440  221 ARG B CB  
4794 C CG  . ARG B 221 ? 0.9447 1.2662 0.7058 0.1439  -0.1721 0.2567  221 ARG B CG  
4795 C CD  . ARG B 221 ? 1.1504 1.5224 0.9111 0.1247  -0.1994 0.2696  221 ARG B CD  
4796 N NE  . ARG B 221 ? 1.2663 1.6264 0.9961 0.1315  -0.2063 0.2784  221 ARG B NE  
4797 C CZ  . ARG B 221 ? 1.4289 1.8114 1.1699 0.1587  -0.2066 0.3056  221 ARG B CZ  
4798 N NH1 . ARG B 221 ? 1.2472 1.6657 1.0302 0.1837  -0.1994 0.3268  221 ARG B NH1 
4799 N NH2 . ARG B 221 ? 1.2755 1.6437 0.9850 0.1624  -0.2130 0.3125  221 ARG B NH2 
4800 N N   . LYS B 222 ? 0.7998 1.1542 0.6386 0.2170  -0.1329 0.2949  222 LYS B N   
4801 C CA  . LYS B 222 ? 0.8050 1.2041 0.6767 0.2482  -0.1295 0.3262  222 LYS B CA  
4802 C C   . LYS B 222 ? 0.8579 1.2617 0.7594 0.2662  -0.1087 0.3277  222 LYS B C   
4803 O O   . LYS B 222 ? 0.8469 1.3066 0.7856 0.2593  -0.1144 0.3376  222 LYS B O   
4804 C CB  . LYS B 222 ? 0.8338 1.2014 0.6827 0.2757  -0.1224 0.3388  222 LYS B CB  
4805 C CG  . LYS B 222 ? 0.7962 1.2145 0.6746 0.3061  -0.1244 0.3744  222 LYS B CG  
4806 C CD  . LYS B 222 ? 0.8854 1.2653 0.7342 0.3287  -0.1192 0.3851  222 LYS B CD  
4807 C CE  . LYS B 222 ? 0.8289 1.2329 0.7018 0.3707  -0.1091 0.4178  222 LYS B CE  
4808 N NZ  . LYS B 222 ? 0.7895 1.1262 0.6281 0.3963  -0.0918 0.4195  222 LYS B NZ  
4809 N N   . TYR B 223 ? 0.8170 1.1608 0.6996 0.2851  -0.0854 0.3162  223 TYR B N   
4810 C CA  . TYR B 223 ? 0.8086 1.1473 0.7107 0.3017  -0.0642 0.3148  223 TYR B CA  
4811 C C   . TYR B 223 ? 0.8268 1.1421 0.7192 0.2712  -0.0646 0.2865  223 TYR B C   
4812 O O   . TYR B 223 ? 0.8185 1.0749 0.6855 0.2730  -0.0497 0.2671  223 TYR B O   
4813 C CB  . TYR B 223 ? 0.8530 1.1324 0.7327 0.3345  -0.0401 0.3148  223 TYR B CB  
4814 C CG  . TYR B 223 ? 0.9168 1.1980 0.7908 0.3611  -0.0407 0.3380  223 TYR B CG  
4815 C CD1 . TYR B 223 ? 0.9624 1.2742 0.8637 0.3971  -0.0291 0.3652  223 TYR B CD1 
4816 C CD2 . TYR B 223 ? 0.9436 1.1932 0.7837 0.3521  -0.0508 0.3335  223 TYR B CD2 
4817 C CE1 . TYR B 223 ? 1.0152 1.3260 0.9105 0.4238  -0.0288 0.3881  223 TYR B CE1 
4818 C CE2 . TYR B 223 ? 0.9906 1.2388 0.8235 0.3767  -0.0508 0.3559  223 TYR B CE2 
4819 C CZ  . TYR B 223 ? 1.1321 1.4102 0.9926 0.4128  -0.0403 0.3834  223 TYR B CZ  
4820 O OH  . TYR B 223 ? 1.1941 1.4683 1.0464 0.4387  -0.0399 0.4068  223 TYR B OH  
4821 N N   . ASP B 224 ? 0.7648 1.1257 0.6759 0.2420  -0.0828 0.2849  224 ASP B N   
4822 C CA  . ASP B 224 ? 0.7403 1.0858 0.6438 0.2098  -0.0869 0.2606  224 ASP B CA  
4823 C C   . ASP B 224 ? 0.7791 1.0664 0.6645 0.2133  -0.0667 0.2391  224 ASP B C   
4824 O O   . ASP B 224 ? 0.7867 1.0817 0.6920 0.2245  -0.0521 0.2419  224 ASP B O   
4825 C CB  . ASP B 224 ? 0.7486 1.1578 0.6893 0.1902  -0.0991 0.2695  224 ASP B CB  
4826 C CG  . ASP B 224 ? 0.8118 1.2018 0.7415 0.1557  -0.1048 0.2454  224 ASP B CG  
4827 O OD1 . ASP B 224 ? 0.8287 1.1890 0.7268 0.1339  -0.1164 0.2285  224 ASP B OD1 
4828 O OD2 . ASP B 224 ? 0.8244 1.2276 0.7758 0.1518  -0.0964 0.2440  224 ASP B OD2 
4829 N N   . PHE B 225 ? 0.6959 0.9269 0.5437 0.2034  -0.0659 0.2185  225 PHE B N   
4830 C CA  . PHE B 225 ? 0.6593 0.8375 0.4892 0.2035  -0.0496 0.1983  225 PHE B CA  
4831 C C   . PHE B 225 ? 0.6956 0.8396 0.4985 0.1758  -0.0572 0.1746  225 PHE B C   
4832 O O   . PHE B 225 ? 0.6942 0.8525 0.4895 0.1565  -0.0741 0.1725  225 PHE B O   
4833 C CB  . PHE B 225 ? 0.6823 0.8180 0.4957 0.2330  -0.0308 0.2012  225 PHE B CB  
4834 C CG  . PHE B 225 ? 0.7092 0.8169 0.4961 0.2413  -0.0333 0.2043  225 PHE B CG  
4835 C CD1 . PHE B 225 ? 0.7412 0.8037 0.4958 0.2258  -0.0353 0.1858  225 PHE B CD1 
4836 C CD2 . PHE B 225 ? 0.7495 0.8711 0.5429 0.2677  -0.0303 0.2266  225 PHE B CD2 
4837 C CE1 . PHE B 225 ? 0.7652 0.7995 0.4948 0.2337  -0.0353 0.1895  225 PHE B CE1 
4838 C CE2 . PHE B 225 ? 0.8002 0.8911 0.5670 0.2761  -0.0310 0.2303  225 PHE B CE2 
4839 C CZ  . PHE B 225 ? 0.7730 0.8198 0.5077 0.2583  -0.0333 0.2115  225 PHE B CZ  
4840 N N   . LEU B 226 ? 0.6345 0.7339 0.4221 0.1743  -0.0445 0.1572  226 LEU B N   
4841 C CA  . LEU B 226 ? 0.6169 0.6821 0.3802 0.1525  -0.0485 0.1360  226 LEU B CA  
4842 C C   . LEU B 226 ? 0.7026 0.7215 0.4360 0.1612  -0.0418 0.1298  226 LEU B C   
4843 O O   . LEU B 226 ? 0.7236 0.7264 0.4535 0.1831  -0.0306 0.1379  226 LEU B O   
4844 C CB  . LEU B 226 ? 0.5912 0.6415 0.3594 0.1443  -0.0398 0.1228  226 LEU B CB  
4845 C CG  . LEU B 226 ? 0.6203 0.6969 0.4037 0.1209  -0.0495 0.1183  226 LEU B CG  
4846 C CD1 . LEU B 226 ? 0.6221 0.7506 0.4243 0.1121  -0.0658 0.1327  226 LEU B CD1 
4847 C CD2 . LEU B 226 ? 0.6082 0.6865 0.4080 0.1242  -0.0378 0.1172  226 LEU B CD2 
4848 N N   . ILE B 227 ? 0.6606 0.6578 0.3717 0.1441  -0.0480 0.1163  227 ILE B N   
4849 C CA  . ILE B 227 ? 0.6655 0.6205 0.3495 0.1484  -0.0414 0.1097  227 ILE B CA  
4850 C C   . ILE B 227 ? 0.7096 0.6369 0.3853 0.1348  -0.0361 0.0907  227 ILE B C   
4851 O O   . ILE B 227 ? 0.7050 0.6399 0.3799 0.1163  -0.0438 0.0811  227 ILE B O   
4852 C CB  . ILE B 227 ? 0.7183 0.6741 0.3825 0.1412  -0.0520 0.1119  227 ILE B CB  
4853 C CG1 . ILE B 227 ? 0.7323 0.7273 0.4075 0.1497  -0.0627 0.1320  227 ILE B CG1 
4854 C CG2 . ILE B 227 ? 0.7361 0.6496 0.3748 0.1465  -0.0432 0.1076  227 ILE B CG2 
4855 C CD1 . ILE B 227 ? 0.7315 0.7352 0.3872 0.1374  -0.0767 0.1335  227 ILE B CD1 
4856 N N   . ILE B 228 ? 0.6781 0.5730 0.3465 0.1429  -0.0236 0.0854  228 ILE B N   
4857 C CA  . ILE B 228 ? 0.6783 0.5512 0.3400 0.1293  -0.0204 0.0689  228 ILE B CA  
4858 C C   . ILE B 228 ? 0.7535 0.5948 0.3921 0.1251  -0.0175 0.0617  228 ILE B C   
4859 O O   . ILE B 228 ? 0.7611 0.5762 0.3893 0.1339  -0.0093 0.0630  228 ILE B O   
4860 C CB  . ILE B 228 ? 0.7060 0.5751 0.3800 0.1306  -0.0127 0.0641  228 ILE B CB  
4861 C CG1 . ILE B 228 ? 0.7112 0.5492 0.3750 0.1430  -0.0007 0.0635  228 ILE B CG1 
4862 C CG2 . ILE B 228 ? 0.7163 0.6225 0.4149 0.1325  -0.0157 0.0728  228 ILE B CG2 
4863 C CD1 . ILE B 228 ? 0.7933 0.6080 0.4485 0.1321  0.0021  0.0505  228 ILE B CD1 
4864 N N   . GLU B 229 ? 0.7177 0.5625 0.3470 0.1115  -0.0245 0.0553  229 GLU B N   
4865 C CA  . GLU B 229 ? 0.7352 0.5577 0.3443 0.1065  -0.0220 0.0498  229 GLU B CA  
4866 C C   . GLU B 229 ? 0.8149 0.6129 0.4209 0.1014  -0.0136 0.0386  229 GLU B C   
4867 O O   . GLU B 229 ? 0.8211 0.6183 0.4263 0.0906  -0.0142 0.0285  229 GLU B O   
4868 C CB  . GLU B 229 ? 0.7588 0.5939 0.3567 0.0948  -0.0311 0.0468  229 GLU B CB  
4869 C CG  . GLU B 229 ? 0.8529 0.6698 0.4283 0.0914  -0.0280 0.0440  229 GLU B CG  
4870 C CD  . GLU B 229 ? 1.1264 0.9543 0.6848 0.0833  -0.0365 0.0442  229 GLU B CD  
4871 O OE1 . GLU B 229 ? 0.9281 0.7694 0.4871 0.0725  -0.0442 0.0379  229 GLU B OE1 
4872 O OE2 . GLU B 229 ? 1.1255 0.9459 0.6670 0.0866  -0.0353 0.0504  229 GLU B OE2 
4873 N N   . ASP B 230 ? 0.7806 0.5578 0.3837 0.1089  -0.0059 0.0409  230 ASP B N   
4874 C CA  . ASP B 230 ? 0.7780 0.5357 0.3788 0.1028  0.0001  0.0324  230 ASP B CA  
4875 C C   . ASP B 230 ? 0.8482 0.5938 0.4345 0.0974  0.0023  0.0317  230 ASP B C   
4876 O O   . ASP B 230 ? 0.8513 0.5807 0.4271 0.1013  0.0056  0.0378  230 ASP B O   
4877 C CB  . ASP B 230 ? 0.8075 0.5477 0.4088 0.1098  0.0061  0.0340  230 ASP B CB  
4878 C CG  . ASP B 230 ? 0.9896 0.7154 0.5908 0.1018  0.0098  0.0260  230 ASP B CG  
4879 O OD1 . ASP B 230 ? 0.9941 0.7288 0.6023 0.0935  0.0083  0.0192  230 ASP B OD1 
4880 O OD2 . ASP B 230 ? 1.0744 0.7798 0.6680 0.1040  0.0140  0.0269  230 ASP B OD2 
4881 N N   . ASP B 231 ? 0.8207 0.5727 0.4050 0.0887  0.0013  0.0247  231 ASP B N   
4882 C CA  . ASP B 231 ? 0.8362 0.5807 0.4070 0.0843  0.0048  0.0249  231 ASP B CA  
4883 C C   . ASP B 231 ? 0.9352 0.6734 0.5090 0.0776  0.0114  0.0181  231 ASP B C   
4884 O O   . ASP B 231 ? 0.9579 0.7000 0.5256 0.0735  0.0137  0.0134  231 ASP B O   
4885 C CB  . ASP B 231 ? 0.8556 0.6119 0.4148 0.0821  -0.0002 0.0253  231 ASP B CB  
4886 C CG  . ASP B 231 ? 0.9435 0.6937 0.4850 0.0830  0.0017  0.0326  231 ASP B CG  
4887 O OD1 . ASP B 231 ? 0.9713 0.7080 0.5094 0.0814  0.0089  0.0343  231 ASP B OD1 
4888 O OD2 . ASP B 231 ? 0.9662 0.7261 0.4969 0.0840  -0.0045 0.0374  231 ASP B OD2 
4889 N N   . PRO B 232 ? 0.8822 0.6108 0.4636 0.0766  0.0149  0.0182  232 PRO B N   
4890 C CA  . PRO B 232 ? 0.8669 0.5958 0.4544 0.0706  0.0203  0.0145  232 PRO B CA  
4891 C C   . PRO B 232 ? 0.9060 0.6341 0.4847 0.0670  0.0259  0.0184  232 PRO B C   
4892 O O   . PRO B 232 ? 0.8737 0.6084 0.4578 0.0642  0.0314  0.0157  232 PRO B O   
4893 C CB  . PRO B 232 ? 0.8814 0.6011 0.4758 0.0690  0.0202  0.0162  232 PRO B CB  
4894 C CG  . PRO B 232 ? 0.9450 0.6518 0.5293 0.0738  0.0180  0.0219  232 PRO B CG  
4895 C CD  . PRO B 232 ? 0.8910 0.6083 0.4745 0.0805  0.0142  0.0219  232 PRO B CD  
4896 N N   . TYR B 233 ? 0.8924 0.6125 0.4577 0.0679  0.0253  0.0260  233 TYR B N   
4897 C CA  . TYR B 233 ? 0.9003 0.6180 0.4551 0.0639  0.0308  0.0321  233 TYR B CA  
4898 C C   . TYR B 233 ? 0.9152 0.6389 0.4547 0.0662  0.0311  0.0324  233 TYR B C   
4899 O O   . TYR B 233 ? 0.9218 0.6413 0.4478 0.0648  0.0343  0.0398  233 TYR B O   
4900 C CB  . TYR B 233 ? 0.9368 0.6368 0.4843 0.0614  0.0309  0.0412  233 TYR B CB  
4901 C CG  . TYR B 233 ? 0.9614 0.6523 0.5187 0.0566  0.0298  0.0399  233 TYR B CG  
4902 C CD1 . TYR B 233 ? 0.9813 0.6804 0.5507 0.0476  0.0329  0.0393  233 TYR B CD1 
4903 C CD2 . TYR B 233 ? 0.9728 0.6484 0.5267 0.0615  0.0258  0.0398  233 TYR B CD2 
4904 C CE1 . TYR B 233 ? 0.9901 0.6821 0.5662 0.0414  0.0300  0.0385  233 TYR B CE1 
4905 C CE2 . TYR B 233 ? 0.9831 0.6480 0.5411 0.0563  0.0247  0.0375  233 TYR B CE2 
4906 C CZ  . TYR B 233 ? 1.0648 0.7378 0.6330 0.0452  0.0257  0.0368  233 TYR B CZ  
4907 O OH  . TYR B 233 ? 1.0359 0.6997 0.6062 0.0383  0.0228  0.0350  233 TYR B OH  
4908 N N   . TYR B 234 ? 0.8395 0.5720 0.3792 0.0683  0.0279  0.0243  234 TYR B N   
4909 C CA  . TYR B 234 ? 0.8332 0.5707 0.3553 0.0683  0.0268  0.0221  234 TYR B CA  
4910 C C   . TYR B 234 ? 0.8746 0.6126 0.3895 0.0655  0.0378  0.0196  234 TYR B C   
4911 O O   . TYR B 234 ? 0.8753 0.6120 0.3732 0.0647  0.0414  0.0250  234 TYR B O   
4912 C CB  . TYR B 234 ? 0.8350 0.5789 0.3592 0.0681  0.0199  0.0132  234 TYR B CB  
4913 C CG  . TYR B 234 ? 0.8882 0.6350 0.3907 0.0652  0.0173  0.0092  234 TYR B CG  
4914 C CD1 . TYR B 234 ? 0.9286 0.6809 0.4172 0.0659  0.0088  0.0165  234 TYR B CD1 
4915 C CD2 . TYR B 234 ? 0.9153 0.6577 0.4086 0.0619  0.0232  -0.0018 234 TYR B CD2 
4916 C CE1 . TYR B 234 ? 0.9586 0.7136 0.4237 0.0612  0.0047  0.0128  234 TYR B CE1 
4917 C CE2 . TYR B 234 ? 0.9504 0.6908 0.4178 0.0577  0.0207  -0.0070 234 TYR B CE2 
4918 C CZ  . TYR B 234 ? 1.0344 0.7820 0.4874 0.0561  0.0105  0.0001  234 TYR B CZ  
4919 O OH  . TYR B 234 ? 1.0746 0.8206 0.4990 0.0501  0.0064  -0.0048 234 TYR B OH  
4920 N N   . PHE B 235 ? 0.8382 0.5788 0.3670 0.0652  0.0443  0.0131  235 PHE B N   
4921 C CA  . PHE B 235 ? 0.8529 0.5967 0.3788 0.0653  0.0571  0.0119  235 PHE B CA  
4922 C C   . PHE B 235 ? 0.9198 0.6680 0.4540 0.0621  0.0638  0.0229  235 PHE B C   
4923 O O   . PHE B 235 ? 0.9299 0.6860 0.4672 0.0625  0.0755  0.0244  235 PHE B O   
4924 C CB  . PHE B 235 ? 0.8617 0.6071 0.3997 0.0684  0.0625  0.0027  235 PHE B CB  
4925 C CG  . PHE B 235 ? 0.8753 0.6128 0.4011 0.0689  0.0576  -0.0086 235 PHE B CG  
4926 C CD1 . PHE B 235 ? 0.8837 0.6199 0.4234 0.0686  0.0501  -0.0132 235 PHE B CD1 
4927 C CD2 . PHE B 235 ? 0.9041 0.6347 0.4023 0.0680  0.0598  -0.0142 235 PHE B CD2 
4928 C CE1 . PHE B 235 ? 0.8902 0.6192 0.4188 0.0662  0.0448  -0.0227 235 PHE B CE1 
4929 C CE2 . PHE B 235 ? 0.9430 0.6648 0.4278 0.0650  0.0534  -0.0247 235 PHE B CE2 
4930 C CZ  . PHE B 235 ? 0.9015 0.6231 0.4028 0.0636  0.0458  -0.0285 235 PHE B CZ  
4931 N N   . LEU B 236 ? 0.8691 0.6117 0.4066 0.0587  0.0571  0.0308  236 LEU B N   
4932 C CA  . LEU B 236 ? 0.8728 0.6155 0.4155 0.0523  0.0616  0.0415  236 LEU B CA  
4933 C C   . LEU B 236 ? 0.9273 0.6593 0.4495 0.0505  0.0606  0.0508  236 LEU B C   
4934 O O   . LEU B 236 ? 0.9365 0.6603 0.4597 0.0441  0.0608  0.0600  236 LEU B O   
4935 C CB  . LEU B 236 ? 0.8632 0.6022 0.4235 0.0480  0.0559  0.0429  236 LEU B CB  
4936 C CG  . LEU B 236 ? 0.9293 0.6827 0.5106 0.0423  0.0614  0.0455  236 LEU B CG  
4937 C CD1 . LEU B 236 ? 0.9261 0.6937 0.5188 0.0494  0.0669  0.0378  236 LEU B CD1 
4938 C CD2 . LEU B 236 ? 0.9676 0.7142 0.5600 0.0357  0.0535  0.0470  236 LEU B CD2 
4939 N N   . GLN B 237 ? 0.8625 0.5934 0.3645 0.0553  0.0591  0.0489  237 GLN B N   
4940 C CA  . GLN B 237 ? 0.8633 0.5857 0.3437 0.0556  0.0574  0.0584  237 GLN B CA  
4941 C C   . GLN B 237 ? 0.9154 0.6407 0.3870 0.0504  0.0691  0.0665  237 GLN B C   
4942 O O   . GLN B 237 ? 0.9090 0.6458 0.3803 0.0507  0.0787  0.0618  237 GLN B O   
4943 C CB  . GLN B 237 ? 0.8844 0.6093 0.3466 0.0610  0.0504  0.0537  237 GLN B CB  
4944 C CG  . GLN B 237 ? 0.9610 0.6838 0.4285 0.0660  0.0375  0.0529  237 GLN B CG  
4945 C CD  . GLN B 237 ? 1.2065 0.9375 0.6594 0.0684  0.0292  0.0486  237 GLN B CD  
4946 O OE1 . GLN B 237 ? 1.1458 0.8834 0.6065 0.0682  0.0241  0.0385  237 GLN B OE1 
4947 N NE2 . GLN B 237 ? 1.1708 0.9015 0.6015 0.0693  0.0266  0.0570  237 GLN B NE2 
4948 N N   . PHE B 238 ? 0.8880 0.6017 0.3512 0.0461  0.0694  0.0793  238 PHE B N   
4949 C CA  . PHE B 238 ? 0.9021 0.6182 0.3559 0.0396  0.0806  0.0899  238 PHE B CA  
4950 C C   . PHE B 238 ? 0.9965 0.7080 0.4198 0.0432  0.0813  0.0960  238 PHE B C   
4951 O O   . PHE B 238 ? 1.0060 0.7141 0.4172 0.0380  0.0891  0.1078  238 PHE B O   
4952 C CB  . PHE B 238 ? 0.9217 0.6255 0.3835 0.0294  0.0812  0.1010  238 PHE B CB  
4953 C CG  . PHE B 238 ? 0.9064 0.6153 0.3950 0.0235  0.0794  0.0962  238 PHE B CG  
4954 C CD1 . PHE B 238 ? 0.9382 0.6279 0.4306 0.0215  0.0702  0.0958  238 PHE B CD1 
4955 C CD2 . PHE B 238 ? 0.9110 0.6438 0.4197 0.0206  0.0873  0.0928  238 PHE B CD2 
4956 C CE1 . PHE B 238 ? 0.9365 0.6303 0.4500 0.0146  0.0676  0.0916  238 PHE B CE1 
4957 C CE2 . PHE B 238 ? 0.9300 0.6701 0.4634 0.0149  0.0842  0.0901  238 PHE B CE2 
4958 C CZ  . PHE B 238 ? 0.9096 0.6302 0.4443 0.0109  0.0736  0.0892  238 PHE B CZ  
4959 N N   . ASN B 239 ? 0.9806 0.6929 0.3914 0.0510  0.0725  0.0889  239 ASN B N   
4960 C CA  . ASN B 239 ? 1.0118 0.7222 0.3923 0.0541  0.0701  0.0942  239 ASN B CA  
4961 C C   . ASN B 239 ? 1.0716 0.7923 0.4353 0.0545  0.0775  0.0847  239 ASN B C   
4962 O O   . ASN B 239 ? 1.0372 0.7650 0.4130 0.0553  0.0816  0.0717  239 ASN B O   
4963 C CB  . ASN B 239 ? 1.0555 0.7615 0.4303 0.0611  0.0542  0.0963  239 ASN B CB  
4964 C CG  . ASN B 239 ? 1.3987 1.1134 0.7880 0.0647  0.0447  0.0828  239 ASN B CG  
4965 O OD1 . ASN B 239 ? 1.4061 1.1282 0.8037 0.0625  0.0489  0.0697  239 ASN B OD1 
4966 N ND2 . ASN B 239 ? 1.2450 0.9593 0.6369 0.0708  0.0322  0.0870  239 ASN B ND2 
4967 N N   . LYS B 240 ? 1.0766 0.7952 0.4093 0.0544  0.0796  0.0918  240 LYS B N   
4968 C CA  . LYS B 240 ? 1.0978 0.8206 0.4032 0.0545  0.0877  0.0846  240 LYS B CA  
4969 C C   . LYS B 240 ? 1.1550 0.8799 0.4562 0.0565  0.0812  0.0667  240 LYS B C   
4970 O O   . LYS B 240 ? 1.1389 0.8645 0.4348 0.0572  0.0930  0.0554  240 LYS B O   
4971 C CB  . LYS B 240 ? 1.1537 0.8717 0.4232 0.0539  0.0862  0.0970  240 LYS B CB  
4972 C CG  . LYS B 240 ? 1.1715 0.8837 0.4415 0.0507  0.0940  0.1161  240 LYS B CG  
4973 C CD  . LYS B 240 ? 1.2569 0.9751 0.5471 0.0455  0.1125  0.1182  240 LYS B CD  
4974 C CE  . LYS B 240 ? 1.3402 1.0681 0.6153 0.0459  0.1306  0.1126  240 LYS B CE  
4975 N NZ  . LYS B 240 ? 1.3976 1.1385 0.7028 0.0427  0.1463  0.1145  240 LYS B NZ  
4976 N N   . PHE B 241 ? 1.1365 0.8621 0.4414 0.0576  0.0630  0.0648  241 PHE B N   
4977 C CA  . PHE B 241 ? 1.1434 0.8712 0.4470 0.0569  0.0534  0.0496  241 PHE B CA  
4978 C C   . PHE B 241 ? 1.1403 0.8733 0.4708 0.0590  0.0383  0.0512  241 PHE B C   
4979 O O   . PHE B 241 ? 1.1373 0.8713 0.4724 0.0623  0.0308  0.0649  241 PHE B O   
4980 C CB  . PHE B 241 ? 1.2194 0.9462 0.4829 0.0533  0.0463  0.0463  241 PHE B CB  
4981 C CG  . PHE B 241 ? 1.2659 1.0009 0.5216 0.0529  0.0265  0.0563  241 PHE B CG  
4982 C CD1 . PHE B 241 ? 1.3303 1.0664 0.5833 0.0570  0.0240  0.0754  241 PHE B CD1 
4983 C CD2 . PHE B 241 ? 1.3119 1.0541 0.5622 0.0483  0.0106  0.0478  241 PHE B CD2 
4984 C CE1 . PHE B 241 ? 1.3627 1.1086 0.6096 0.0592  0.0063  0.0867  241 PHE B CE1 
4985 C CE2 . PHE B 241 ? 1.3639 1.1199 0.6099 0.0485  -0.0080 0.0593  241 PHE B CE2 
4986 C CZ  . PHE B 241 ? 1.3532 1.1118 0.5980 0.0552  -0.0098 0.0791  241 PHE B CZ  
4987 N N   . ARG B 242 ? 1.0558 0.7908 0.4028 0.0582  0.0350  0.0379  242 ARG B N   
4988 C CA  . ARG B 242 ? 1.0196 0.7608 0.3927 0.0604  0.0227  0.0390  242 ARG B CA  
4989 C C   . ARG B 242 ? 1.0465 0.7985 0.4113 0.0600  0.0052  0.0436  242 ARG B C   
4990 O O   . ARG B 242 ? 1.0473 0.8028 0.3882 0.0541  -0.0016 0.0378  242 ARG B O   
4991 C CB  . ARG B 242 ? 1.0174 0.7578 0.4153 0.0600  0.0260  0.0265  242 ARG B CB  
4992 C CG  . ARG B 242 ? 1.1910 0.9268 0.5742 0.0554  0.0284  0.0104  242 ARG B CG  
4993 C CD  . ARG B 242 ? 1.1970 0.9276 0.6000 0.0574  0.0396  0.0011  242 ARG B CD  
4994 N NE  . ARG B 242 ? 1.3144 1.0436 0.7215 0.0608  0.0557  0.0057  242 ARG B NE  
4995 C CZ  . ARG B 242 ? 1.5907 1.3187 1.0126 0.0638  0.0678  0.0001  242 ARG B CZ  
4996 N NH1 . ARG B 242 ? 1.4811 1.2048 0.9126 0.0644  0.0661  -0.0108 242 ARG B NH1 
4997 N NH2 . ARG B 242 ? 1.4891 1.2217 0.9173 0.0662  0.0818  0.0068  242 ARG B NH2 
4998 N N   . VAL B 243 ? 0.9891 0.7462 0.3734 0.0664  -0.0019 0.0546  243 VAL B N   
4999 C CA  . VAL B 243 ? 0.9954 0.7678 0.3813 0.0696  -0.0176 0.0637  243 VAL B CA  
5000 C C   . VAL B 243 ? 1.0006 0.7875 0.3983 0.0642  -0.0287 0.0532  243 VAL B C   
5001 O O   . VAL B 243 ? 0.9555 0.7380 0.3730 0.0629  -0.0238 0.0427  243 VAL B O   
5002 C CB  . VAL B 243 ? 1.0518 0.8201 0.4550 0.0809  -0.0171 0.0789  243 VAL B CB  
5003 C CG1 . VAL B 243 ? 1.0260 0.7934 0.4602 0.0849  -0.0159 0.0740  243 VAL B CG1 
5004 C CG2 . VAL B 243 ? 1.0664 0.8472 0.4617 0.0881  -0.0289 0.0955  243 VAL B CG2 
5005 N N   . PRO B 244 ? 0.9460 0.7510 0.3317 0.0596  -0.0441 0.0569  244 PRO B N   
5006 C CA  . PRO B 244 ? 0.9344 0.7546 0.3326 0.0518  -0.0554 0.0487  244 PRO B CA  
5007 C C   . PRO B 244 ? 0.9888 0.8187 0.4246 0.0605  -0.0562 0.0536  244 PRO B C   
5008 O O   . PRO B 244 ? 0.9966 0.8369 0.4448 0.0720  -0.0596 0.0695  244 PRO B O   
5009 C CB  . PRO B 244 ? 0.9649 0.8068 0.3451 0.0459  -0.0729 0.0573  244 PRO B CB  
5010 C CG  . PRO B 244 ? 1.0316 0.8630 0.3812 0.0479  -0.0686 0.0638  244 PRO B CG  
5011 C CD  . PRO B 244 ? 0.9662 0.7807 0.3277 0.0602  -0.0531 0.0701  244 PRO B CD  
5012 N N   . THR B 245 ? 0.9093 0.7332 0.3614 0.0562  -0.0515 0.0406  245 THR B N   
5013 C CA  . THR B 245 ? 0.8650 0.6960 0.3497 0.0633  -0.0507 0.0434  245 THR B CA  
5014 C C   . THR B 245 ? 0.8983 0.7598 0.3986 0.0652  -0.0650 0.0548  245 THR B C   
5015 O O   . THR B 245 ? 0.9129 0.7919 0.3998 0.0571  -0.0778 0.0581  245 THR B O   
5016 C CB  . THR B 245 ? 0.8785 0.6987 0.3732 0.0564  -0.0447 0.0277  245 THR B CB  
5017 O OG1 . THR B 245 ? 0.8681 0.6929 0.3498 0.0422  -0.0529 0.0177  245 THR B OG1 
5018 C CG2 . THR B 245 ? 0.8414 0.6372 0.3305 0.0583  -0.0296 0.0201  245 THR B CG2 
5019 N N   . PHE B 246 ? 0.8111 0.6805 0.3392 0.0758  -0.0627 0.0615  246 PHE B N   
5020 C CA  . PHE B 246 ? 0.7948 0.6974 0.3431