data_3UF2
# 
_entry.id   3UF2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UF2         
RCSB  RCSB068673   
WWPDB D_1000068673 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1HMC . unspecified 
PDB 3UEZ . unspecified 
PDB 3UF5 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UF2 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Elegheert, J.'  1 
'Savvides, S.N.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            19 
_citation.page_first                938 
_citation.page_last                 947 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22902366 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2367 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Elegheert, J.'    1  
primary 'Bracke, N.'       2  
primary 'Pouliot, P.'      3  
primary 'Gutsche, I.'      4  
primary 'Shkumatov, A.V.'  5  
primary 'Tarbouriech, N.'  6  
primary 'Verstraete, K.'   7  
primary 'Bekaert, A.'      8  
primary 'Burmeister, W.P.' 9  
primary 'Svergun, D.I.'    10 
primary 'Lambrecht, B.N.'  11 
primary 'Vergauwen, B.'    12 
primary 'Savvides, S.N.'   13 
# 
_cell.entry_id           3UF2 
_cell.length_a           61.150 
_cell.length_b           104.490 
_cell.length_c           116.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.29 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UF2 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Macrophage colony-stimulating factor 1' 17868.219 10  ? ? 'UNP RESIDUES 33-181' ? 
2 water   nat water                                    18.015    169 ? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CSF-1, M-CSF, MCSF, Lanimostim, Processed macrophage colony-stimulating factor 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIA
IVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIA
IVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   GLU n 
1 6   GLU n 
1 7   VAL n 
1 8   SER n 
1 9   GLU n 
1 10  TYR n 
1 11  CYS n 
1 12  SER n 
1 13  HIS n 
1 14  MET n 
1 15  ILE n 
1 16  GLY n 
1 17  SER n 
1 18  GLY n 
1 19  HIS n 
1 20  LEU n 
1 21  GLN n 
1 22  SER n 
1 23  LEU n 
1 24  GLN n 
1 25  ARG n 
1 26  LEU n 
1 27  ILE n 
1 28  ASP n 
1 29  SER n 
1 30  GLN n 
1 31  MET n 
1 32  GLU n 
1 33  THR n 
1 34  SER n 
1 35  CYS n 
1 36  GLN n 
1 37  ILE n 
1 38  THR n 
1 39  PHE n 
1 40  GLU n 
1 41  PHE n 
1 42  VAL n 
1 43  ASP n 
1 44  GLN n 
1 45  GLU n 
1 46  GLN n 
1 47  LEU n 
1 48  LYS n 
1 49  ASP n 
1 50  PRO n 
1 51  VAL n 
1 52  CYS n 
1 53  TYR n 
1 54  LEU n 
1 55  LYS n 
1 56  LYS n 
1 57  ALA n 
1 58  PHE n 
1 59  LEU n 
1 60  LEU n 
1 61  VAL n 
1 62  GLN n 
1 63  ASP n 
1 64  ILE n 
1 65  MET n 
1 66  GLU n 
1 67  ASP n 
1 68  THR n 
1 69  MET n 
1 70  ARG n 
1 71  PHE n 
1 72  ARG n 
1 73  ASP n 
1 74  ASN n 
1 75  THR n 
1 76  PRO n 
1 77  ASN n 
1 78  ALA n 
1 79  ILE n 
1 80  ALA n 
1 81  ILE n 
1 82  VAL n 
1 83  GLN n 
1 84  LEU n 
1 85  GLN n 
1 86  GLU n 
1 87  LEU n 
1 88  SER n 
1 89  LEU n 
1 90  ARG n 
1 91  LEU n 
1 92  LYS n 
1 93  SER n 
1 94  CYS n 
1 95  PHE n 
1 96  THR n 
1 97  LYS n 
1 98  ASP n 
1 99  TYR n 
1 100 GLU n 
1 101 GLU n 
1 102 HIS n 
1 103 ASP n 
1 104 LYS n 
1 105 ALA n 
1 106 CYS n 
1 107 VAL n 
1 108 ARG n 
1 109 THR n 
1 110 PHE n 
1 111 TYR n 
1 112 GLU n 
1 113 THR n 
1 114 PRO n 
1 115 LEU n 
1 116 GLN n 
1 117 LEU n 
1 118 LEU n 
1 119 GLU n 
1 120 LYS n 
1 121 VAL n 
1 122 LYS n 
1 123 ASN n 
1 124 VAL n 
1 125 PHE n 
1 126 ASN n 
1 127 GLU n 
1 128 THR n 
1 129 LYS n 
1 130 ASN n 
1 131 LEU n 
1 132 LEU n 
1 133 ASP n 
1 134 LYS n 
1 135 ASP n 
1 136 TRP n 
1 137 ASN n 
1 138 ILE n 
1 139 PHE n 
1 140 SER n 
1 141 LYS n 
1 142 ASN n 
1 143 CYS n 
1 144 ASN n 
1 145 ASN n 
1 146 SER n 
1 147 PHE n 
1 148 ALA n 
1 149 GLU n 
1 150 CYS n 
1 151 SER n 
1 152 SER n 
1 153 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CSF1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) CodonPlus RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CSF1_HUMAN 
_struct_ref.pdbx_db_accession          P09603 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQL
QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
;
_struct_ref.pdbx_align_begin           33 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3UF2 A 5 ? 153 ? P09603 33 ? 181 ? 1 149 
2  1 3UF2 B 5 ? 153 ? P09603 33 ? 181 ? 1 149 
3  1 3UF2 C 5 ? 153 ? P09603 33 ? 181 ? 1 149 
4  1 3UF2 D 5 ? 153 ? P09603 33 ? 181 ? 1 149 
5  1 3UF2 E 5 ? 153 ? P09603 33 ? 181 ? 1 149 
6  1 3UF2 F 5 ? 153 ? P09603 33 ? 181 ? 1 149 
7  1 3UF2 G 5 ? 153 ? P09603 33 ? 181 ? 1 149 
8  1 3UF2 H 5 ? 153 ? P09603 33 ? 181 ? 1 149 
9  1 3UF2 I 5 ? 153 ? P09603 33 ? 181 ? 1 149 
10 1 3UF2 J 5 ? 153 ? P09603 33 ? 181 ? 1 149 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3UF2 GLY A 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 1  
1  3UF2 SER A 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 2  
1  3UF2 HIS A 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 3  
1  3UF2 MET A 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  4  
2  3UF2 GLY B 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 5  
2  3UF2 SER B 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 6  
2  3UF2 HIS B 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 7  
2  3UF2 MET B 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  8  
3  3UF2 GLY C 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 9  
3  3UF2 SER C 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 10 
3  3UF2 HIS C 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 11 
3  3UF2 MET C 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  12 
4  3UF2 GLY D 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 13 
4  3UF2 SER D 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 14 
4  3UF2 HIS D 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 15 
4  3UF2 MET D 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  16 
5  3UF2 GLY E 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 17 
5  3UF2 SER E 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 18 
5  3UF2 HIS E 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 19 
5  3UF2 MET E 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  20 
6  3UF2 GLY F 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 21 
6  3UF2 SER F 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 22 
6  3UF2 HIS F 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 23 
6  3UF2 MET F 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  24 
7  3UF2 GLY G 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 25 
7  3UF2 SER G 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 26 
7  3UF2 HIS G 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 27 
7  3UF2 MET G 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  28 
8  3UF2 GLY H 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 29 
8  3UF2 SER H 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 30 
8  3UF2 HIS H 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 31 
8  3UF2 MET H 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  32 
9  3UF2 GLY I 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 33 
9  3UF2 SER I 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 34 
9  3UF2 HIS I 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 35 
9  3UF2 MET I 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  36 
10 3UF2 GLY J 1 ? UNP P09603 ? ? 'EXPRESSION TAG' -3 37 
10 3UF2 SER J 2 ? UNP P09603 ? ? 'EXPRESSION TAG' -2 38 
10 3UF2 HIS J 3 ? UNP P09603 ? ? 'EXPRESSION TAG' -1 39 
10 3UF2 MET J 4 ? UNP P09603 ? ? 'EXPRESSION TAG' 0  40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3UF2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'0.1M magnesium chloride, 0.1M sodium citrate pH 5.0, 15% w/v PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-04-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3UF2 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.75 
_reflns.number_obs                   36596 
_reflns.number_all                   36596 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.75 
_reflns_shell.d_res_low                   3.00 
_reflns_shell.percent_possible_all        98.9 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3UF2 
_refine.ls_number_reflns_obs                     36555 
_refine.ls_number_reflns_all                     36555 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.942 
_refine.ls_d_res_high                            2.750 
_refine.ls_percent_reflns_obs                    99.62 
_refine.ls_R_factor_obs                          0.1423 
_refine.ls_R_factor_all                          0.1423 
_refine.ls_R_factor_R_work                       0.1373 
_refine.ls_R_factor_R_free                       0.1903 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.02 
_refine.ls_number_reflns_R_free                  3663 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -11.3668 
_refine.aniso_B[2][2]                            -15.4315 
_refine.aniso_B[3][3]                            -17.9221 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            1.9836 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.325 
_refine.solvent_model_param_bsol                 25.940 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.86 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 30.17 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11351 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             169 
_refine_hist.number_atoms_total               11520 
_refine_hist.d_res_high                       2.750 
_refine_hist.d_res_low                        24.942 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.002  ? ? 11662 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.487  ? ? 15665 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.183 ? ? 4413  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.034  ? ? 1775  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.001  ? ? 2021  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' 20 2.7509 2.7983  1568 0.1823 87.00 0.2749 . . 175 . . . . 
'X-RAY DIFFRACTION' 20 2.7983 2.8491  1639 0.1828 90.00 0.2819 . . 182 . . . . 
'X-RAY DIFFRACTION' 20 2.8491 2.9038  1661 0.1843 90.00 0.2764 . . 184 . . . . 
'X-RAY DIFFRACTION' 20 2.9038 2.9630  1630 0.1727 90.00 0.2245 . . 181 . . . . 
'X-RAY DIFFRACTION' 20 2.9630 3.0273  1661 0.1718 90.00 0.2535 . . 185 . . . . 
'X-RAY DIFFRACTION' 20 3.0273 3.0976  1624 0.1632 90.00 0.2576 . . 180 . . . . 
'X-RAY DIFFRACTION' 20 3.0976 3.1749  1636 0.1629 90.00 0.2247 . . 182 . . . . 
'X-RAY DIFFRACTION' 20 3.1749 3.2606  1652 0.1494 90.00 0.2341 . . 184 . . . . 
'X-RAY DIFFRACTION' 20 3.2606 3.3563  1639 0.1415 90.00 0.2401 . . 182 . . . . 
'X-RAY DIFFRACTION' 20 3.3563 3.4644  1645 0.1355 90.00 0.1876 . . 183 . . . . 
'X-RAY DIFFRACTION' 20 3.4644 3.5878  1657 0.1307 90.00 0.1978 . . 184 . . . . 
'X-RAY DIFFRACTION' 20 3.5878 3.7310  1633 0.1275 90.00 0.1847 . . 181 . . . . 
'X-RAY DIFFRACTION' 20 3.7310 3.9002  1655 0.1200 90.00 0.1754 . . 184 . . . . 
'X-RAY DIFFRACTION' 20 3.9002 4.1050  1645 0.1118 90.00 0.1656 . . 183 . . . . 
'X-RAY DIFFRACTION' 20 4.1050 4.3609  1659 0.1082 90.00 0.1561 . . 184 . . . . 
'X-RAY DIFFRACTION' 20 4.3609 4.6956  1662 0.1055 90.00 0.1377 . . 185 . . . . 
'X-RAY DIFFRACTION' 20 4.6956 5.1643  1634 0.1185 90.00 0.1375 . . 182 . . . . 
'X-RAY DIFFRACTION' 20 5.1643 5.9029  1656 0.1386 90.00 0.1686 . . 184 . . . . 
'X-RAY DIFFRACTION' 20 5.9029 7.4047  1669 0.1598 90.00 0.1892 . . 185 . . . . 
'X-RAY DIFFRACTION' 20 7.4047 24.9432 1670 0.1360 88.00 0.1621 . . 186 . . . . 
# 
_struct.entry_id                  3UF2 
_struct.title                     'Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine' 
_struct.pdbx_descriptor           'Macrophage colony-stimulating factor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UF2 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            'hematopoietic cytokine, RTKIII, Four-helix bundle, cytokine' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 8   ? SER A 12  ? SER A 4   SER A 8   5 ? 5  
HELX_P HELX_P2  2  GLY A 16  ? SER A 29  ? GLY A 12  SER A 25  1 ? 14 
HELX_P HELX_P3  3  ASP A 49  ? THR A 68  ? ASP A 45  THR A 64  1 ? 20 
HELX_P HELX_P4  4  THR A 75  ? LYS A 92  ? THR A 71  LYS A 88  1 ? 18 
HELX_P HELX_P5  5  THR A 113 ? ASP A 135 ? THR A 109 ASP A 131 1 ? 23 
HELX_P HELX_P6  6  ASN A 137 ? LYS A 141 ? ASN A 133 LYS A 137 5 ? 5  
HELX_P HELX_P7  7  CYS A 143 ? GLU A 149 ? CYS A 139 GLU A 145 1 ? 7  
HELX_P HELX_P8  8  GLY B 16  ? GLN B 30  ? GLY B 12  GLN B 26  1 ? 15 
HELX_P HELX_P9  9  ASP B 49  ? THR B 68  ? ASP B 45  THR B 64  1 ? 20 
HELX_P HELX_P10 10 THR B 75  ? LYS B 92  ? THR B 71  LYS B 88  1 ? 18 
HELX_P HELX_P11 11 SER B 93  ? PHE B 95  ? SER B 89  PHE B 91  5 ? 3  
HELX_P HELX_P12 12 THR B 113 ? ASP B 135 ? THR B 109 ASP B 131 1 ? 23 
HELX_P HELX_P13 13 ASN B 137 ? LYS B 141 ? ASN B 133 LYS B 137 5 ? 5  
HELX_P HELX_P14 14 CYS B 143 ? GLU B 149 ? CYS B 139 GLU B 145 1 ? 7  
HELX_P HELX_P15 15 GLY C 16  ? SER C 29  ? GLY C 12  SER C 25  1 ? 14 
HELX_P HELX_P16 16 ASP C 49  ? THR C 68  ? ASP C 45  THR C 64  1 ? 20 
HELX_P HELX_P17 17 THR C 75  ? LYS C 92  ? THR C 71  LYS C 88  1 ? 18 
HELX_P HELX_P18 18 SER C 93  ? PHE C 95  ? SER C 89  PHE C 91  5 ? 3  
HELX_P HELX_P19 19 THR C 113 ? ASP C 135 ? THR C 109 ASP C 131 1 ? 23 
HELX_P HELX_P20 20 ASN C 137 ? LYS C 141 ? ASN C 133 LYS C 137 5 ? 5  
HELX_P HELX_P21 21 CYS C 143 ? GLU C 149 ? CYS C 139 GLU C 145 1 ? 7  
HELX_P HELX_P22 22 GLY D 16  ? SER D 29  ? GLY D 12  SER D 25  1 ? 14 
HELX_P HELX_P23 23 ASP D 49  ? THR D 68  ? ASP D 45  THR D 64  1 ? 20 
HELX_P HELX_P24 24 THR D 75  ? LYS D 92  ? THR D 71  LYS D 88  1 ? 18 
HELX_P HELX_P25 25 THR D 113 ? ASP D 135 ? THR D 109 ASP D 131 1 ? 23 
HELX_P HELX_P26 26 ASN D 137 ? LYS D 141 ? ASN D 133 LYS D 137 5 ? 5  
HELX_P HELX_P27 27 CYS D 143 ? GLU D 149 ? CYS D 139 GLU D 145 1 ? 7  
HELX_P HELX_P28 28 GLU E 9   ? MET E 14  ? GLU E 5   MET E 10  5 ? 6  
HELX_P HELX_P29 29 GLY E 16  ? SER E 29  ? GLY E 12  SER E 25  1 ? 14 
HELX_P HELX_P30 30 ASP E 49  ? THR E 68  ? ASP E 45  THR E 64  1 ? 20 
HELX_P HELX_P31 31 THR E 75  ? LYS E 92  ? THR E 71  LYS E 88  1 ? 18 
HELX_P HELX_P32 32 THR E 113 ? ASP E 133 ? THR E 109 ASP E 129 1 ? 21 
HELX_P HELX_P33 33 ASN E 137 ? LYS E 141 ? ASN E 133 LYS E 137 5 ? 5  
HELX_P HELX_P34 34 CYS E 143 ? CYS E 150 ? CYS E 139 CYS E 146 1 ? 8  
HELX_P HELX_P35 35 GLU F 9   ? MET F 14  ? GLU F 5   MET F 10  5 ? 6  
HELX_P HELX_P36 36 GLY F 16  ? SER F 29  ? GLY F 12  SER F 25  1 ? 14 
HELX_P HELX_P37 37 ASP F 49  ? THR F 68  ? ASP F 45  THR F 64  1 ? 20 
HELX_P HELX_P38 38 THR F 75  ? LYS F 92  ? THR F 71  LYS F 88  1 ? 18 
HELX_P HELX_P39 39 SER F 93  ? PHE F 95  ? SER F 89  PHE F 91  5 ? 3  
HELX_P HELX_P40 40 THR F 113 ? ASP F 135 ? THR F 109 ASP F 131 1 ? 23 
HELX_P HELX_P41 41 ASN F 137 ? LYS F 141 ? ASN F 133 LYS F 137 5 ? 5  
HELX_P HELX_P42 42 CYS F 143 ? GLU F 149 ? CYS F 139 GLU F 145 1 ? 7  
HELX_P HELX_P43 43 TYR G 10  ? MET G 14  ? TYR G 6   MET G 10  5 ? 5  
HELX_P HELX_P44 44 GLY G 16  ? SER G 29  ? GLY G 12  SER G 25  1 ? 14 
HELX_P HELX_P45 45 ASP G 49  ? THR G 68  ? ASP G 45  THR G 64  1 ? 20 
HELX_P HELX_P46 46 THR G 75  ? LYS G 92  ? THR G 71  LYS G 88  1 ? 18 
HELX_P HELX_P47 47 SER G 93  ? PHE G 95  ? SER G 89  PHE G 91  5 ? 3  
HELX_P HELX_P48 48 THR G 113 ? ASP G 135 ? THR G 109 ASP G 131 1 ? 23 
HELX_P HELX_P49 49 ASN G 137 ? LYS G 141 ? ASN G 133 LYS G 137 5 ? 5  
HELX_P HELX_P50 50 CYS G 143 ? GLU G 149 ? CYS G 139 GLU G 145 1 ? 7  
HELX_P HELX_P51 51 GLU H 9   ? MET H 14  ? GLU H 5   MET H 10  5 ? 6  
HELX_P HELX_P52 52 GLY H 16  ? GLN H 30  ? GLY H 12  GLN H 26  1 ? 15 
HELX_P HELX_P53 53 ASP H 49  ? THR H 68  ? ASP H 45  THR H 64  1 ? 20 
HELX_P HELX_P54 54 THR H 75  ? LYS H 92  ? THR H 71  LYS H 88  1 ? 18 
HELX_P HELX_P55 55 SER H 93  ? PHE H 95  ? SER H 89  PHE H 91  5 ? 3  
HELX_P HELX_P56 56 THR H 113 ? ASP H 135 ? THR H 109 ASP H 131 1 ? 23 
HELX_P HELX_P57 57 ASN H 137 ? LYS H 141 ? ASN H 133 LYS H 137 5 ? 5  
HELX_P HELX_P58 58 CYS H 143 ? CYS H 150 ? CYS H 139 CYS H 146 1 ? 8  
HELX_P HELX_P59 59 SER I 8   ? MET I 14  ? SER I 4   MET I 10  5 ? 7  
HELX_P HELX_P60 60 GLY I 16  ? SER I 29  ? GLY I 12  SER I 25  1 ? 14 
HELX_P HELX_P61 61 ASP I 49  ? THR I 68  ? ASP I 45  THR I 64  1 ? 20 
HELX_P HELX_P62 62 THR I 75  ? LYS I 92  ? THR I 71  LYS I 88  1 ? 18 
HELX_P HELX_P63 63 THR I 113 ? ASP I 135 ? THR I 109 ASP I 131 1 ? 23 
HELX_P HELX_P64 64 ASN I 137 ? LYS I 141 ? ASN I 133 LYS I 137 5 ? 5  
HELX_P HELX_P65 65 CYS I 143 ? ALA I 148 ? CYS I 139 ALA I 144 1 ? 6  
HELX_P HELX_P66 66 SER J 8   ? SER J 12  ? SER J 4   SER J 8   5 ? 5  
HELX_P HELX_P67 67 GLY J 16  ? SER J 29  ? GLY J 12  SER J 25  1 ? 14 
HELX_P HELX_P68 68 ASP J 49  ? THR J 68  ? ASP J 45  THR J 64  1 ? 20 
HELX_P HELX_P69 69 THR J 75  ? LYS J 92  ? THR J 71  LYS J 88  1 ? 18 
HELX_P HELX_P70 70 THR J 113 ? ASP J 135 ? THR J 109 ASP J 131 1 ? 23 
HELX_P HELX_P71 71 ASN J 137 ? LYS J 141 ? ASN J 133 LYS J 137 5 ? 5  
HELX_P HELX_P72 72 CYS J 143 ? GLU J 149 ? CYS J 139 GLU J 145 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 11  SG ? ? ? 1_555 A CYS 94  SG ? ? A CYS 7   A CYS 90  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf2  disulf ? ? A CYS 35  SG ? ? ? 1_555 B CYS 35  SG ? ? A CYS 31  B CYS 31  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3  disulf ? ? A CYS 52  SG ? ? ? 1_555 A CYS 143 SG ? ? A CYS 48  A CYS 139 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf4  disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 150 SG ? ? A CYS 102 A CYS 146 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf5  disulf ? ? B CYS 11  SG ? ? ? 1_555 B CYS 94  SG ? ? B CYS 7   B CYS 90  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6  disulf ? ? B CYS 52  SG ? ? ? 1_555 B CYS 143 SG ? ? B CYS 48  B CYS 139 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf7  disulf ? ? B CYS 106 SG ? ? ? 1_555 B CYS 150 SG ? ? B CYS 102 B CYS 146 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf8  disulf ? ? C CYS 11  SG ? ? ? 1_555 C CYS 94  SG ? ? C CYS 7   C CYS 90  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf9  disulf ? ? C CYS 35  SG ? ? ? 1_555 D CYS 35  SG ? ? C CYS 31  D CYS 31  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf10 disulf ? ? C CYS 52  SG ? ? ? 1_555 C CYS 143 SG ? ? C CYS 48  C CYS 139 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf11 disulf ? ? C CYS 106 SG ? ? ? 1_555 C CYS 150 SG ? ? C CYS 102 C CYS 146 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf12 disulf ? ? D CYS 11  SG ? ? ? 1_555 D CYS 94  SG ? ? D CYS 7   D CYS 90  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf13 disulf ? ? D CYS 52  SG ? ? ? 1_555 D CYS 143 SG ? ? D CYS 48  D CYS 139 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf14 disulf ? ? D CYS 106 SG ? ? ? 1_555 D CYS 150 SG ? ? D CYS 102 D CYS 146 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf15 disulf ? ? E CYS 11  SG ? ? ? 1_555 E CYS 94  SG ? ? E CYS 7   E CYS 90  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf16 disulf ? ? E CYS 35  SG ? ? ? 1_555 F CYS 35  SG ? ? E CYS 31  F CYS 31  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf17 disulf ? ? E CYS 52  SG ? ? ? 1_555 E CYS 143 SG ? ? E CYS 48  E CYS 139 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf18 disulf ? ? E CYS 106 SG ? ? ? 1_555 E CYS 150 SG ? ? E CYS 102 E CYS 146 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf19 disulf ? ? F CYS 11  SG ? ? ? 1_555 F CYS 94  SG ? ? F CYS 7   F CYS 90  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf20 disulf ? ? F CYS 52  SG ? ? ? 1_555 F CYS 143 SG ? ? F CYS 48  F CYS 139 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf21 disulf ? ? F CYS 106 SG ? ? ? 1_555 F CYS 150 SG ? ? F CYS 102 F CYS 146 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf22 disulf ? ? G CYS 11  SG ? ? ? 1_555 G CYS 94  SG ? ? G CYS 7   G CYS 90  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf23 disulf ? ? G CYS 35  SG ? ? ? 1_555 H CYS 35  SG ? ? G CYS 31  H CYS 31  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf24 disulf ? ? G CYS 52  SG ? ? ? 1_555 G CYS 143 SG ? ? G CYS 48  G CYS 139 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf25 disulf ? ? G CYS 106 SG ? ? ? 1_555 G CYS 150 SG ? ? G CYS 102 G CYS 146 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf26 disulf ? ? H CYS 11  SG ? ? ? 1_555 H CYS 94  SG ? ? H CYS 7   H CYS 90  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf27 disulf ? ? H CYS 52  SG ? ? ? 1_555 H CYS 143 SG ? ? H CYS 48  H CYS 139 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf28 disulf ? ? H CYS 106 SG ? ? ? 1_555 H CYS 150 SG ? ? H CYS 102 H CYS 146 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf29 disulf ? ? I CYS 11  SG ? ? ? 1_555 I CYS 94  SG ? ? I CYS 7   I CYS 90  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf30 disulf ? ? I CYS 35  SG ? ? ? 1_555 J CYS 35  SG ? ? I CYS 31  J CYS 31  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf31 disulf ? ? I CYS 52  SG ? ? ? 1_555 I CYS 143 SG ? ? I CYS 48  I CYS 139 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf32 disulf ? ? I CYS 106 SG ? ? ? 1_555 I CYS 150 SG ? ? I CYS 102 I CYS 146 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf33 disulf ? ? J CYS 11  SG ? ? ? 1_555 J CYS 94  SG ? ? J CYS 7   J CYS 90  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf34 disulf ? ? J CYS 52  SG ? ? ? 1_555 J CYS 143 SG ? ? J CYS 48  J CYS 139 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf35 disulf ? ? J CYS 106 SG ? ? ? 1_555 J CYS 150 SG ? ? J CYS 102 J CYS 146 1_555 ? ? ? ? ? ? ? 2.032 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 37  ? VAL A 42  ? ILE A 33  VAL A 38  
A 2 VAL A 107 ? GLU A 112 ? VAL A 103 GLU A 108 
B 1 ILE B 37  ? VAL B 42  ? ILE B 33  VAL B 38  
B 2 VAL B 107 ? GLU B 112 ? VAL B 103 GLU B 108 
C 1 ILE C 37  ? VAL C 42  ? ILE C 33  VAL C 38  
C 2 VAL C 107 ? GLU C 112 ? VAL C 103 GLU C 108 
D 1 ILE D 37  ? VAL D 42  ? ILE D 33  VAL D 38  
D 2 VAL D 107 ? GLU D 112 ? VAL D 103 GLU D 108 
E 1 ILE E 37  ? VAL E 42  ? ILE E 33  VAL E 38  
E 2 VAL E 107 ? GLU E 112 ? VAL E 103 GLU E 108 
F 1 ILE F 37  ? VAL F 42  ? ILE F 33  VAL F 38  
F 2 VAL F 107 ? GLU F 112 ? VAL F 103 GLU F 108 
G 1 ILE G 37  ? VAL G 42  ? ILE G 33  VAL G 38  
G 2 VAL G 107 ? GLU G 112 ? VAL G 103 GLU G 108 
H 1 ILE H 37  ? VAL H 42  ? ILE H 33  VAL H 38  
H 2 VAL H 107 ? GLU H 112 ? VAL H 103 GLU H 108 
I 1 ILE I 37  ? VAL I 42  ? ILE I 33  VAL I 38  
I 2 VAL I 107 ? GLU I 112 ? VAL I 103 GLU I 108 
J 1 ILE J 37  ? VAL J 42  ? ILE J 33  VAL J 38  
J 2 VAL J 107 ? GLU J 112 ? VAL J 103 GLU J 108 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 39 ? N PHE A 35 O PHE A 110 ? O PHE A 106 
B 1 2 N ILE B 37 ? N ILE B 33 O GLU B 112 ? O GLU B 108 
C 1 2 N ILE C 37 ? N ILE C 33 O GLU C 112 ? O GLU C 108 
D 1 2 N ILE D 37 ? N ILE D 33 O GLU D 112 ? O GLU D 108 
E 1 2 N ILE E 37 ? N ILE E 33 O GLU E 112 ? O GLU E 108 
F 1 2 N ILE F 37 ? N ILE F 33 O GLU F 112 ? O GLU F 108 
G 1 2 N PHE G 39 ? N PHE G 35 O PHE G 110 ? O PHE G 106 
H 1 2 N ILE H 37 ? N ILE H 33 O GLU H 112 ? O GLU H 108 
I 1 2 N PHE I 39 ? N PHE I 35 O PHE I 110 ? O PHE I 106 
J 1 2 N PHE J 39 ? N PHE J 35 O PHE J 110 ? O PHE J 106 
# 
_database_PDB_matrix.entry_id          3UF2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UF2 
_atom_sites.fract_transf_matrix[1][1]   0.016353 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004472 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009570 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008919 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A 1 7   ? -15.671 -10.593 87.996  1.00 92.80  ? 3   VAL A N   1 
ATOM   2     C CA  . VAL A 1 7   ? -16.442 -10.440 86.768  1.00 86.85  ? 3   VAL A CA  1 
ATOM   3     C C   . VAL A 1 7   ? -17.847 -11.008 86.937  1.00 82.67  ? 3   VAL A C   1 
ATOM   4     O O   . VAL A 1 7   ? -18.067 -11.930 87.725  1.00 87.86  ? 3   VAL A O   1 
ATOM   5     C CB  . VAL A 1 7   ? -15.751 -11.140 85.583  1.00 89.79  ? 3   VAL A CB  1 
ATOM   6     C CG1 . VAL A 1 7   ? -16.501 -10.873 84.284  1.00 97.61  ? 3   VAL A CG1 1 
ATOM   7     C CG2 . VAL A 1 7   ? -14.307 -10.680 85.471  1.00 87.87  ? 3   VAL A CG2 1 
ATOM   8     N N   . SER A 1 8   ? -18.792 -10.445 86.191  1.00 77.44  ? 4   SER A N   1 
ATOM   9     C CA  . SER A 1 8   ? -20.192 -10.846 86.272  1.00 74.59  ? 4   SER A CA  1 
ATOM   10    C C   . SER A 1 8   ? -20.723 -11.267 84.901  1.00 76.83  ? 4   SER A C   1 
ATOM   11    O O   . SER A 1 8   ? -19.991 -11.252 83.910  1.00 66.21  ? 4   SER A O   1 
ATOM   12    C CB  . SER A 1 8   ? -21.033 -9.694  86.832  1.00 55.75  ? 4   SER A CB  1 
ATOM   13    O OG  . SER A 1 8   ? -20.816 -8.499  86.102  1.00 53.67  ? 4   SER A OG  1 
ATOM   14    N N   . GLU A 1 9   ? -22.000 -11.641 84.855  1.00 75.41  ? 5   GLU A N   1 
ATOM   15    C CA  . GLU A 1 9   ? -22.655 -12.007 83.602  1.00 68.20  ? 5   GLU A CA  1 
ATOM   16    C C   . GLU A 1 9   ? -23.016 -10.754 82.806  1.00 70.21  ? 5   GLU A C   1 
ATOM   17    O O   . GLU A 1 9   ? -23.695 -10.826 81.781  1.00 71.80  ? 5   GLU A O   1 
ATOM   18    C CB  . GLU A 1 9   ? -23.911 -12.834 83.879  1.00 56.97  ? 5   GLU A CB  1 
ATOM   19    C CG  . GLU A 1 9   ? -24.456 -13.554 82.653  1.00 65.12  ? 5   GLU A CG  1 
ATOM   20    C CD  . GLU A 1 9   ? -25.703 -14.365 82.950  1.00 82.63  ? 5   GLU A CD  1 
ATOM   21    O OE1 . GLU A 1 9   ? -26.113 -14.425 84.129  1.00 79.49  ? 5   GLU A OE1 1 
ATOM   22    O OE2 . GLU A 1 9   ? -26.275 -14.941 81.999  1.00 95.55  ? 5   GLU A OE2 1 
ATOM   23    N N   . TYR A 1 10  ? -22.559 -9.605  83.295  1.00 72.37  ? 6   TYR A N   1 
ATOM   24    C CA  . TYR A 1 10  ? -22.740 -8.330  82.615  1.00 65.71  ? 6   TYR A CA  1 
ATOM   25    C C   . TYR A 1 10  ? -22.018 -8.303  81.270  1.00 51.73  ? 6   TYR A C   1 
ATOM   26    O O   . TYR A 1 10  ? -22.334 -7.484  80.404  1.00 54.27  ? 6   TYR A O   1 
ATOM   27    C CB  . TYR A 1 10  ? -22.210 -7.211  83.511  1.00 74.49  ? 6   TYR A CB  1 
ATOM   28    C CG  . TYR A 1 10  ? -22.292 -5.825  82.915  1.00 84.94  ? 6   TYR A CG  1 
ATOM   29    C CD1 . TYR A 1 10  ? -23.467 -5.365  82.343  1.00 83.01  ? 6   TYR A CD1 1 
ATOM   30    C CD2 . TYR A 1 10  ? -21.198 -4.968  82.944  1.00 88.76  ? 6   TYR A CD2 1 
ATOM   31    C CE1 . TYR A 1 10  ? -23.552 -4.097  81.805  1.00 79.37  ? 6   TYR A CE1 1 
ATOM   32    C CE2 . TYR A 1 10  ? -21.273 -3.693  82.407  1.00 86.79  ? 6   TYR A CE2 1 
ATOM   33    C CZ  . TYR A 1 10  ? -22.454 -3.264  81.838  1.00 80.89  ? 6   TYR A CZ  1 
ATOM   34    O OH  . TYR A 1 10  ? -22.539 -1.996  81.306  1.00 74.96  ? 6   TYR A OH  1 
ATOM   35    N N   . CYS A 1 11  ? -21.056 -9.206  81.098  1.00 31.22  ? 7   CYS A N   1 
ATOM   36    C CA  . CYS A 1 11  ? -20.223 -9.227  79.901  1.00 25.20  ? 7   CYS A CA  1 
ATOM   37    C C   . CYS A 1 11  ? -20.663 -10.321 78.930  1.00 40.24  ? 7   CYS A C   1 
ATOM   38    O O   . CYS A 1 11  ? -20.148 -10.408 77.815  1.00 46.34  ? 7   CYS A O   1 
ATOM   39    C CB  . CYS A 1 11  ? -18.755 -9.442  80.285  1.00 30.91  ? 7   CYS A CB  1 
ATOM   40    S SG  . CYS A 1 11  ? -18.197 -8.487  81.727  1.00 39.54  ? 7   CYS A SG  1 
ATOM   41    N N   . SER A 1 12  ? -21.613 -11.151 79.355  1.00 42.28  ? 8   SER A N   1 
ATOM   42    C CA  . SER A 1 12  ? -22.063 -12.283 78.546  1.00 51.60  ? 8   SER A CA  1 
ATOM   43    C C   . SER A 1 12  ? -22.413 -11.853 77.124  1.00 65.55  ? 8   SER A C   1 
ATOM   44    O O   . SER A 1 12  ? -22.013 -12.501 76.157  1.00 91.90  ? 8   SER A O   1 
ATOM   45    C CB  . SER A 1 12  ? -23.264 -12.971 79.201  1.00 62.51  ? 8   SER A CB  1 
ATOM   46    O OG  . SER A 1 12  ? -23.682 -14.100 78.450  1.00 72.73  ? 8   SER A OG  1 
ATOM   47    N N   . HIS A 1 13  ? -23.157 -10.760 76.999  1.00 54.87  ? 9   HIS A N   1 
ATOM   48    C CA  . HIS A 1 13  ? -23.492 -10.219 75.687  1.00 63.99  ? 9   HIS A CA  1 
ATOM   49    C C   . HIS A 1 13  ? -23.305 -8.708  75.672  1.00 67.46  ? 9   HIS A C   1 
ATOM   50    O O   . HIS A 1 13  ? -24.260 -7.952  75.492  1.00 74.12  ? 9   HIS A O   1 
ATOM   51    C CB  . HIS A 1 13  ? -24.924 -10.589 75.295  1.00 71.50  ? 9   HIS A CB  1 
ATOM   52    C CG  . HIS A 1 13  ? -25.070 -12.004 74.818  1.00 78.30  ? 9   HIS A CG  1 
ATOM   53    N ND1 . HIS A 1 13  ? -24.719 -13.087 75.588  1.00 79.89  ? 9   HIS A ND1 1 
ATOM   54    C CD2 . HIS A 1 13  ? -25.529 -12.502 73.644  1.00 70.18  ? 9   HIS A CD2 1 
ATOM   55    C CE1 . HIS A 1 13  ? -24.955 -14.201 74.910  1.00 72.72  ? 9   HIS A CE1 1 
ATOM   56    N NE2 . HIS A 1 13  ? -25.446 -13.872 73.732  1.00 63.82  ? 9   HIS A NE2 1 
ATOM   57    N N   . MET A 1 14  ? -22.062 -8.280  75.865  1.00 61.28  ? 10  MET A N   1 
ATOM   58    C CA  . MET A 1 14  ? -21.724 -6.865  75.850  1.00 53.70  ? 10  MET A CA  1 
ATOM   59    C C   . MET A 1 14  ? -21.493 -6.414  74.415  1.00 64.01  ? 10  MET A C   1 
ATOM   60    O O   . MET A 1 14  ? -21.952 -5.347  74.002  1.00 69.71  ? 10  MET A O   1 
ATOM   61    C CB  . MET A 1 14  ? -20.462 -6.618  76.678  1.00 39.51  ? 10  MET A CB  1 
ATOM   62    C CG  . MET A 1 14  ? -20.192 -5.158  77.005  1.00 35.99  ? 10  MET A CG  1 
ATOM   63    S SD  . MET A 1 14  ? -21.025 -4.614  78.511  1.00 59.66  ? 10  MET A SD  1 
ATOM   64    C CE  . MET A 1 14  ? -22.664 -4.205  77.903  1.00 69.30  ? 10  MET A CE  1 
ATOM   65    N N   . ILE A 1 15  ? -20.778 -7.241  73.659  1.00 44.69  ? 11  ILE A N   1 
ATOM   66    C CA  . ILE A 1 15  ? -20.492 -6.952  72.263  1.00 32.33  ? 11  ILE A CA  1 
ATOM   67    C C   . ILE A 1 15  ? -21.554 -7.584  71.373  1.00 37.06  ? 11  ILE A C   1 
ATOM   68    O O   . ILE A 1 15  ? -21.567 -8.798  71.176  1.00 37.91  ? 11  ILE A O   1 
ATOM   69    C CB  . ILE A 1 15  ? -19.109 -7.491  71.854  1.00 28.40  ? 11  ILE A CB  1 
ATOM   70    C CG1 . ILE A 1 15  ? -18.028 -6.942  72.793  1.00 20.87  ? 11  ILE A CG1 1 
ATOM   71    C CG2 . ILE A 1 15  ? -18.805 -7.129  70.406  1.00 8.08   ? 11  ILE A CG2 1 
ATOM   72    C CD1 . ILE A 1 15  ? -16.658 -7.550  72.570  1.00 27.24  ? 11  ILE A CD1 1 
ATOM   73    N N   . GLY A 1 16  ? -22.448 -6.754  70.846  1.00 53.70  ? 12  GLY A N   1 
ATOM   74    C CA  . GLY A 1 16  ? -23.501 -7.224  69.965  1.00 53.95  ? 12  GLY A CA  1 
ATOM   75    C C   . GLY A 1 16  ? -23.124 -7.114  68.501  1.00 51.22  ? 12  GLY A C   1 
ATOM   76    O O   . GLY A 1 16  ? -22.149 -6.450  68.150  1.00 58.17  ? 12  GLY A O   1 
ATOM   77    N N   . SER A 1 17  ? -23.906 -7.766  67.647  1.00 62.27  ? 13  SER A N   1 
ATOM   78    C CA  . SER A 1 17  ? -23.653 -7.763  66.210  1.00 58.20  ? 13  SER A CA  1 
ATOM   79    C C   . SER A 1 17  ? -23.642 -6.347  65.650  1.00 53.17  ? 13  SER A C   1 
ATOM   80    O O   . SER A 1 17  ? -22.957 -6.065  64.666  1.00 41.61  ? 13  SER A O   1 
ATOM   81    C CB  . SER A 1 17  ? -24.711 -8.590  65.487  1.00 42.65  ? 13  SER A CB  1 
ATOM   82    O OG  . SER A 1 17  ? -24.696 -9.929  65.942  1.00 57.34  ? 13  SER A OG  1 
ATOM   83    N N   . GLY A 1 18  ? -24.409 -5.460  66.276  1.00 52.46  ? 14  GLY A N   1 
ATOM   84    C CA  . GLY A 1 18  ? -24.471 -4.076  65.848  1.00 55.44  ? 14  GLY A CA  1 
ATOM   85    C C   . GLY A 1 18  ? -23.091 -3.452  65.765  1.00 53.12  ? 14  GLY A C   1 
ATOM   86    O O   . GLY A 1 18  ? -22.821 -2.642  64.879  1.00 58.51  ? 14  GLY A O   1 
ATOM   87    N N   . HIS A 1 19  ? -22.216 -3.833  66.692  1.00 39.49  ? 15  HIS A N   1 
ATOM   88    C CA  . HIS A 1 19  ? -20.863 -3.295  66.736  1.00 29.84  ? 15  HIS A CA  1 
ATOM   89    C C   . HIS A 1 19  ? -20.024 -3.829  65.582  1.00 38.73  ? 15  HIS A C   1 
ATOM   90    O O   . HIS A 1 19  ? -19.389 -3.064  64.854  1.00 42.51  ? 15  HIS A O   1 
ATOM   91    C CB  . HIS A 1 19  ? -20.196 -3.647  68.066  1.00 29.18  ? 15  HIS A CB  1 
ATOM   92    C CG  . HIS A 1 19  ? -20.874 -3.048  69.258  1.00 38.99  ? 15  HIS A CG  1 
ATOM   93    N ND1 . HIS A 1 19  ? -21.649 -3.790  70.124  1.00 35.31  ? 15  HIS A ND1 1 
ATOM   94    C CD2 . HIS A 1 19  ? -20.900 -1.778  69.725  1.00 47.90  ? 15  HIS A CD2 1 
ATOM   95    C CE1 . HIS A 1 19  ? -22.118 -3.003  71.076  1.00 36.04  ? 15  HIS A CE1 1 
ATOM   96    N NE2 . HIS A 1 19  ? -21.679 -1.777  70.857  1.00 39.50  ? 15  HIS A NE2 1 
ATOM   97    N N   . LEU A 1 20  ? -20.026 -5.146  65.419  1.00 35.96  ? 16  LEU A N   1 
ATOM   98    C CA  . LEU A 1 20  ? -19.252 -5.785  64.364  1.00 30.71  ? 16  LEU A CA  1 
ATOM   99    C C   . LEU A 1 20  ? -19.699 -5.278  62.998  1.00 42.22  ? 16  LEU A C   1 
ATOM   100   O O   . LEU A 1 20  ? -18.885 -5.111  62.089  1.00 59.02  ? 16  LEU A O   1 
ATOM   101   C CB  . LEU A 1 20  ? -19.411 -7.304  64.432  1.00 36.47  ? 16  LEU A CB  1 
ATOM   102   C CG  . LEU A 1 20  ? -19.129 -7.953  65.790  1.00 50.19  ? 16  LEU A CG  1 
ATOM   103   C CD1 . LEU A 1 20  ? -19.131 -9.464  65.659  1.00 60.81  ? 16  LEU A CD1 1 
ATOM   104   C CD2 . LEU A 1 20  ? -17.810 -7.465  66.368  1.00 60.17  ? 16  LEU A CD2 1 
ATOM   105   N N   . GLN A 1 21  ? -20.997 -5.025  62.864  1.00 48.00  ? 17  GLN A N   1 
ATOM   106   C CA  . GLN A 1 21  ? -21.573 -4.605  61.591  1.00 54.57  ? 17  GLN A CA  1 
ATOM   107   C C   . GLN A 1 21  ? -21.314 -3.127  61.304  1.00 57.71  ? 17  GLN A C   1 
ATOM   108   O O   . GLN A 1 21  ? -21.312 -2.707  60.144  1.00 56.74  ? 17  GLN A O   1 
ATOM   109   C CB  . GLN A 1 21  ? -23.074 -4.905  61.568  1.00 49.00  ? 17  GLN A CB  1 
ATOM   110   C CG  . GLN A 1 21  ? -23.387 -6.387  61.412  1.00 49.37  ? 17  GLN A CG  1 
ATOM   111   C CD  . GLN A 1 21  ? -24.824 -6.733  61.754  1.00 54.77  ? 17  GLN A CD  1 
ATOM   112   O OE1 . GLN A 1 21  ? -25.562 -5.915  62.303  1.00 56.23  ? 17  GLN A OE1 1 
ATOM   113   N NE2 . GLN A 1 21  ? -25.226 -7.959  61.434  1.00 50.71  ? 17  GLN A NE2 1 
ATOM   114   N N   . SER A 1 22  ? -21.098 -2.341  62.354  1.00 49.57  ? 18  SER A N   1 
ATOM   115   C CA  . SER A 1 22  ? -20.711 -0.947  62.179  1.00 44.06  ? 18  SER A CA  1 
ATOM   116   C C   . SER A 1 22  ? -19.230 -0.869  61.822  1.00 44.82  ? 18  SER A C   1 
ATOM   117   O O   . SER A 1 22  ? -18.793 0.064   61.149  1.00 66.67  ? 18  SER A O   1 
ATOM   118   C CB  . SER A 1 22  ? -21.004 -0.128  63.439  1.00 45.54  ? 18  SER A CB  1 
ATOM   119   O OG  . SER A 1 22  ? -20.180 -0.514  64.527  1.00 45.50  ? 18  SER A OG  1 
ATOM   120   N N   . LEU A 1 23  ? -18.468 -1.862  62.267  1.00 39.91  ? 19  LEU A N   1 
ATOM   121   C CA  . LEU A 1 23  ? -17.047 -1.943  61.949  1.00 42.19  ? 19  LEU A CA  1 
ATOM   122   C C   . LEU A 1 23  ? -16.840 -2.331  60.490  1.00 44.57  ? 19  LEU A C   1 
ATOM   123   O O   . LEU A 1 23  ? -16.029 -1.725  59.791  1.00 52.96  ? 19  LEU A O   1 
ATOM   124   C CB  . LEU A 1 23  ? -16.351 -2.951  62.865  1.00 44.36  ? 19  LEU A CB  1 
ATOM   125   C CG  . LEU A 1 23  ? -15.728 -2.356  64.127  1.00 44.90  ? 19  LEU A CG  1 
ATOM   126   C CD1 . LEU A 1 23  ? -15.495 -3.428  65.177  1.00 45.93  ? 19  LEU A CD1 1 
ATOM   127   C CD2 . LEU A 1 23  ? -14.424 -1.652  63.786  1.00 39.81  ? 19  LEU A CD2 1 
ATOM   128   N N   . GLN A 1 24  ? -17.575 -3.339  60.031  1.00 31.04  ? 20  GLN A N   1 
ATOM   129   C CA  . GLN A 1 24  ? -17.478 -3.770  58.641  1.00 39.98  ? 20  GLN A CA  1 
ATOM   130   C C   . GLN A 1 24  ? -17.884 -2.627  57.715  1.00 42.92  ? 20  GLN A C   1 
ATOM   131   O O   . GLN A 1 24  ? -17.251 -2.393  56.686  1.00 36.11  ? 20  GLN A O   1 
ATOM   132   C CB  . GLN A 1 24  ? -18.361 -4.993  58.387  1.00 43.26  ? 20  GLN A CB  1 
ATOM   133   C CG  . GLN A 1 24  ? -18.147 -5.630  57.021  1.00 48.91  ? 20  GLN A CG  1 
ATOM   134   C CD  . GLN A 1 24  ? -16.728 -6.139  56.828  1.00 56.54  ? 20  GLN A CD  1 
ATOM   135   O OE1 . GLN A 1 24  ? -16.292 -7.069  57.507  1.00 73.36  ? 20  GLN A OE1 1 
ATOM   136   N NE2 . GLN A 1 24  ? -15.998 -5.527  55.901  1.00 39.99  ? 20  GLN A NE2 1 
ATOM   137   N N   . ARG A 1 25  ? -18.946 -1.920  58.086  1.00 41.39  ? 21  ARG A N   1 
ATOM   138   C CA  A ARG A 1 25  ? -19.410 -0.772  57.319  0.73 42.18  ? 21  ARG A CA  1 
ATOM   139   C CA  B ARG A 1 25  ? -19.405 -0.769  57.319  0.27 43.01  ? 21  ARG A CA  1 
ATOM   140   C C   . ARG A 1 25  ? -18.336 0.308   57.313  1.00 39.24  ? 21  ARG A C   1 
ATOM   141   O O   . ARG A 1 25  ? -18.091 0.955   56.293  1.00 44.15  ? 21  ARG A O   1 
ATOM   142   C CB  A ARG A 1 25  ? -20.701 -0.222  57.927  0.73 47.94  ? 21  ARG A CB  1 
ATOM   143   C CB  B ARG A 1 25  ? -20.687 -0.213  57.928  0.27 47.38  ? 21  ARG A CB  1 
ATOM   144   C CG  A ARG A 1 25  ? -21.418 0.795   57.056  0.73 51.21  ? 21  ARG A CG  1 
ATOM   145   C CG  B ARG A 1 25  ? -21.219 1.032   57.232  0.27 50.10  ? 21  ARG A CG  1 
ATOM   146   C CD  A ARG A 1 25  ? -22.711 1.270   57.700  0.73 63.68  ? 21  ARG A CD  1 
ATOM   147   C CD  B ARG A 1 25  ? -22.641 1.316   57.670  0.27 59.96  ? 21  ARG A CD  1 
ATOM   148   N NE  A ARG A 1 25  ? -23.460 0.169   58.309  0.73 65.49  ? 21  ARG A NE  1 
ATOM   149   N NE  B ARG A 1 25  ? -23.371 0.066   57.848  0.27 63.88  ? 21  ARG A NE  1 
ATOM   150   C CZ  A ARG A 1 25  ? -23.629 -0.014  59.619  0.73 59.68  ? 21  ARG A CZ  1 
ATOM   151   C CZ  B ARG A 1 25  ? -23.835 -0.682  56.853  0.27 62.33  ? 21  ARG A CZ  1 
ATOM   152   N NH1 A ARG A 1 25  ? -23.120 0.832   60.508  0.73 57.14  ? 21  ARG A NH1 1 
ATOM   153   N NH1 B ARG A 1 25  ? -23.669 -0.307  55.590  0.27 62.50  ? 21  ARG A NH1 1 
ATOM   154   N NH2 A ARG A 1 25  ? -24.328 -1.055  60.048  0.73 63.41  ? 21  ARG A NH2 1 
ATOM   155   N NH2 B ARG A 1 25  ? -24.474 -1.809  57.122  0.27 62.41  ? 21  ARG A NH2 1 
ATOM   156   N N   . LEU A 1 26  ? -17.701 0.491   58.463  1.00 40.87  ? 22  LEU A N   1 
ATOM   157   C CA  . LEU A 1 26  ? -16.629 1.458   58.609  1.00 47.36  ? 22  LEU A CA  1 
ATOM   158   C C   . LEU A 1 26  ? -15.465 1.070   57.697  1.00 57.30  ? 22  LEU A C   1 
ATOM   159   O O   . LEU A 1 26  ? -14.770 1.932   57.160  1.00 60.66  ? 22  LEU A O   1 
ATOM   160   C CB  . LEU A 1 26  ? -16.191 1.506   60.073  1.00 40.70  ? 22  LEU A CB  1 
ATOM   161   C CG  . LEU A 1 26  ? -15.203 2.585   60.503  1.00 41.92  ? 22  LEU A CG  1 
ATOM   162   C CD1 . LEU A 1 26  ? -15.475 2.980   61.945  1.00 36.10  ? 22  LEU A CD1 1 
ATOM   163   C CD2 . LEU A 1 26  ? -13.777 2.089   60.349  1.00 50.82  ? 22  LEU A CD2 1 
ATOM   164   N N   . ILE A 1 27  ? -15.273 -0.234  57.516  1.00 51.11  ? 23  ILE A N   1 
ATOM   165   C CA  . ILE A 1 27  ? -14.199 -0.759  56.674  1.00 34.37  ? 23  ILE A CA  1 
ATOM   166   C C   . ILE A 1 27  ? -14.510 -0.653  55.181  1.00 34.70  ? 23  ILE A C   1 
ATOM   167   O O   . ILE A 1 27  ? -13.643 -0.304  54.381  1.00 34.53  ? 23  ILE A O   1 
ATOM   168   C CB  . ILE A 1 27  ? -13.927 -2.239  56.997  1.00 33.93  ? 23  ILE A CB  1 
ATOM   169   C CG1 . ILE A 1 27  ? -13.266 -2.370  58.369  1.00 25.88  ? 23  ILE A CG1 1 
ATOM   170   C CG2 . ILE A 1 27  ? -13.034 -2.866  55.931  1.00 46.19  ? 23  ILE A CG2 1 
ATOM   171   C CD1 . ILE A 1 27  ? -13.170 -3.797  58.869  1.00 15.82  ? 23  ILE A CD1 1 
ATOM   172   N N   . ASP A 1 28  ? -15.748 -0.969  54.813  1.00 36.76  ? 24  ASP A N   1 
ATOM   173   C CA  . ASP A 1 28  ? -16.155 -0.994  53.411  1.00 46.89  ? 24  ASP A CA  1 
ATOM   174   C C   . ASP A 1 28  ? -16.160 0.406   52.796  1.00 48.98  ? 24  ASP A C   1 
ATOM   175   O O   . ASP A 1 28  ? -16.079 0.559   51.575  1.00 55.61  ? 24  ASP A O   1 
ATOM   176   C CB  . ASP A 1 28  ? -17.553 -1.606  53.276  1.00 59.47  ? 24  ASP A CB  1 
ATOM   177   C CG  . ASP A 1 28  ? -17.618 -3.045  53.757  1.00 58.63  ? 24  ASP A CG  1 
ATOM   178   O OD1 . ASP A 1 28  ? -16.615 -3.778  53.612  1.00 44.27  ? 24  ASP A OD1 1 
ATOM   179   O OD2 . ASP A 1 28  ? -18.681 -3.445  54.279  1.00 62.13  ? 24  ASP A OD2 1 
ATOM   180   N N   . SER A 1 29  ? -16.270 1.421   53.647  1.00 36.43  ? 25  SER A N   1 
ATOM   181   C CA  . SER A 1 29  ? -16.349 2.806   53.195  1.00 22.34  ? 25  SER A CA  1 
ATOM   182   C C   . SER A 1 29  ? -14.975 3.402   52.915  1.00 29.51  ? 25  SER A C   1 
ATOM   183   O O   . SER A 1 29  ? -14.860 4.432   52.246  1.00 36.57  ? 25  SER A O   1 
ATOM   184   C CB  . SER A 1 29  ? -17.075 3.663   54.237  1.00 38.37  ? 25  SER A CB  1 
ATOM   185   O OG  . SER A 1 29  ? -16.423 3.614   55.496  1.00 28.97  ? 25  SER A OG  1 
ATOM   186   N N   . GLN A 1 30  ? -13.933 2.758   53.429  1.00 39.21  ? 26  GLN A N   1 
ATOM   187   C CA  . GLN A 1 30  ? -12.576 3.257   53.255  1.00 38.21  ? 26  GLN A CA  1 
ATOM   188   C C   . GLN A 1 30  ? -12.079 2.982   51.845  1.00 33.56  ? 26  GLN A C   1 
ATOM   189   O O   . GLN A 1 30  ? -12.446 1.981   51.230  1.00 24.70  ? 26  GLN A O   1 
ATOM   190   C CB  . GLN A 1 30  ? -11.634 2.614   54.273  1.00 39.88  ? 26  GLN A CB  1 
ATOM   191   C CG  . GLN A 1 30  ? -11.990 2.928   55.708  1.00 34.00  ? 26  GLN A CG  1 
ATOM   192   C CD  . GLN A 1 30  ? -12.172 4.413   55.937  1.00 41.80  ? 26  GLN A CD  1 
ATOM   193   O OE1 . GLN A 1 30  ? -11.226 5.192   55.814  1.00 19.22  ? 26  GLN A OE1 1 
ATOM   194   N NE2 . GLN A 1 30  ? -13.397 4.816   56.255  1.00 44.20  ? 26  GLN A NE2 1 
ATOM   195   N N   . MET A 1 31  ? -11.243 3.882   51.339  1.00 42.27  ? 27  MET A N   1 
ATOM   196   C CA  . MET A 1 31  ? -10.670 3.732   50.011  1.00 32.99  ? 27  MET A CA  1 
ATOM   197   C C   . MET A 1 31  ? -9.529  2.727   50.076  1.00 36.26  ? 27  MET A C   1 
ATOM   198   O O   . MET A 1 31  ? -8.714  2.757   50.998  1.00 42.79  ? 27  MET A O   1 
ATOM   199   C CB  . MET A 1 31  ? -10.164 5.079   49.494  1.00 36.85  ? 27  MET A CB  1 
ATOM   200   C CG  . MET A 1 31  ? -9.912  5.116   47.994  1.00 61.91  ? 27  MET A CG  1 
ATOM   201   S SD  . MET A 1 31  ? -9.534  6.773   47.388  1.00 52.89  ? 27  MET A SD  1 
ATOM   202   C CE  . MET A 1 31  ? -7.942  7.050   48.151  1.00 42.66  ? 27  MET A CE  1 
ATOM   203   N N   . GLU A 1 32  ? -9.482  1.834   49.094  1.00 31.47  ? 28  GLU A N   1 
ATOM   204   C CA  . GLU A 1 32  ? -8.479  0.781   49.058  1.00 45.75  ? 28  GLU A CA  1 
ATOM   205   C C   . GLU A 1 32  ? -7.162  1.343   48.536  1.00 68.75  ? 28  GLU A C   1 
ATOM   206   O O   . GLU A 1 32  ? -7.035  1.651   47.351  1.00 81.92  ? 28  GLU A O   1 
ATOM   207   C CB  . GLU A 1 32  ? -8.961  -0.367  48.171  1.00 58.23  ? 28  GLU A CB  1 
ATOM   208   C CG  . GLU A 1 32  ? -10.344 -0.885  48.551  1.00 54.47  ? 28  GLU A CG  1 
ATOM   209   C CD  . GLU A 1 32  ? -10.882 -1.910  47.573  1.00 60.26  ? 28  GLU A CD  1 
ATOM   210   O OE1 . GLU A 1 32  ? -11.954 -2.488  47.850  1.00 65.17  ? 28  GLU A OE1 1 
ATOM   211   O OE2 . GLU A 1 32  ? -10.239 -2.135  46.527  1.00 70.47  ? 28  GLU A OE2 1 
ATOM   212   N N   . THR A 1 33  ? -6.186  1.478   49.429  1.00 78.26  ? 29  THR A N   1 
ATOM   213   C CA  . THR A 1 33  ? -4.924  2.126   49.092  1.00 79.20  ? 29  THR A CA  1 
ATOM   214   C C   . THR A 1 33  ? -3.723  1.221   49.352  1.00 80.18  ? 29  THR A C   1 
ATOM   215   O O   . THR A 1 33  ? -3.809  0.252   50.106  1.00 80.76  ? 29  THR A O   1 
ATOM   216   C CB  . THR A 1 33  ? -4.741  3.422   49.899  1.00 77.23  ? 29  THR A CB  1 
ATOM   217   O OG1 . THR A 1 33  ? -4.797  3.127   51.300  1.00 73.19  ? 29  THR A OG1 1 
ATOM   218   C CG2 . THR A 1 33  ? -5.832  4.425   49.552  1.00 78.15  ? 29  THR A CG2 1 
ATOM   219   N N   . SER A 1 34  ? -2.602  1.556   48.720  1.00 80.96  ? 30  SER A N   1 
ATOM   220   C CA  . SER A 1 34  ? -1.361  0.807   48.880  1.00 76.13  ? 30  SER A CA  1 
ATOM   221   C C   . SER A 1 34  ? -0.568  1.310   50.084  1.00 62.20  ? 30  SER A C   1 
ATOM   222   O O   . SER A 1 34  ? 0.336   0.631   50.573  1.00 70.02  ? 30  SER A O   1 
ATOM   223   C CB  . SER A 1 34  ? -0.510  0.935   47.615  1.00 79.99  ? 30  SER A CB  1 
ATOM   224   O OG  . SER A 1 34  ? -0.293  2.298   47.288  1.00 81.54  ? 30  SER A OG  1 
ATOM   225   N N   . CYS A 1 35  ? -0.916  2.505   50.553  1.00 48.32  ? 31  CYS A N   1 
ATOM   226   C CA  . CYS A 1 35  ? -0.209  3.155   51.652  1.00 52.78  ? 31  CYS A CA  1 
ATOM   227   C C   . CYS A 1 35  ? -0.085  2.256   52.875  1.00 41.96  ? 31  CYS A C   1 
ATOM   228   O O   . CYS A 1 35  ? -0.866  1.326   53.059  1.00 47.63  ? 31  CYS A O   1 
ATOM   229   C CB  . CYS A 1 35  ? -0.942  4.431   52.054  1.00 66.11  ? 31  CYS A CB  1 
ATOM   230   S SG  . CYS A 1 35  ? -2.531  4.124   52.854  1.00 36.87  ? 31  CYS A SG  1 
ATOM   231   N N   . GLN A 1 36  ? 0.895   2.557   53.719  1.00 32.99  ? 32  GLN A N   1 
ATOM   232   C CA  . GLN A 1 36  ? 1.090   1.823   54.960  1.00 32.20  ? 32  GLN A CA  1 
ATOM   233   C C   . GLN A 1 36  ? 1.274   2.804   56.111  1.00 44.34  ? 32  GLN A C   1 
ATOM   234   O O   . GLN A 1 36  ? 1.984   3.802   55.979  1.00 40.49  ? 32  GLN A O   1 
ATOM   235   C CB  . GLN A 1 36  ? 2.303   0.899   54.849  1.00 33.17  ? 32  GLN A CB  1 
ATOM   236   C CG  . GLN A 1 36  ? 2.082   -0.309  53.950  1.00 39.40  ? 32  GLN A CG  1 
ATOM   237   C CD  . GLN A 1 36  ? 3.357   -1.097  53.716  1.00 50.27  ? 32  GLN A CD  1 
ATOM   238   O OE1 . GLN A 1 36  ? 4.380   -0.538  53.317  1.00 41.86  ? 32  GLN A OE1 1 
ATOM   239   N NE2 . GLN A 1 36  ? 3.305   -2.401  53.967  1.00 56.56  ? 32  GLN A NE2 1 
ATOM   240   N N   . ILE A 1 37  ? 0.623   2.518   57.235  1.00 44.00  ? 33  ILE A N   1 
ATOM   241   C CA  . ILE A 1 37  ? 0.694   3.388   58.402  1.00 34.80  ? 33  ILE A CA  1 
ATOM   242   C C   . ILE A 1 37  ? 1.324   2.671   59.590  1.00 45.62  ? 33  ILE A C   1 
ATOM   243   O O   . ILE A 1 37  ? 1.497   1.451   59.581  1.00 39.30  ? 33  ILE A O   1 
ATOM   244   C CB  . ILE A 1 37  ? -0.700  3.895   58.822  1.00 34.40  ? 33  ILE A CB  1 
ATOM   245   C CG1 . ILE A 1 37  ? -1.555  2.737   59.347  1.00 36.12  ? 33  ILE A CG1 1 
ATOM   246   C CG2 . ILE A 1 37  ? -1.386  4.591   57.651  1.00 23.80  ? 33  ILE A CG2 1 
ATOM   247   C CD1 . ILE A 1 37  ? -2.851  3.170   59.979  1.00 30.26  ? 33  ILE A CD1 1 
ATOM   248   N N   . THR A 1 38  ? 1.650   3.443   60.619  1.00 56.77  ? 34  THR A N   1 
ATOM   249   C CA  . THR A 1 38  ? 2.295   2.915   61.811  1.00 43.21  ? 34  THR A CA  1 
ATOM   250   C C   . THR A 1 38  ? 1.301   2.815   62.965  1.00 37.61  ? 34  THR A C   1 
ATOM   251   O O   . THR A 1 38  ? 0.492   3.719   63.179  1.00 40.84  ? 34  THR A O   1 
ATOM   252   C CB  . THR A 1 38  ? 3.466   3.818   62.240  1.00 52.68  ? 34  THR A CB  1 
ATOM   253   O OG1 . THR A 1 38  ? 4.320   4.067   61.116  1.00 54.58  ? 34  THR A OG1 1 
ATOM   254   C CG2 . THR A 1 38  ? 4.270   3.166   63.350  1.00 43.82  ? 34  THR A CG2 1 
ATOM   255   N N   . PHE A 1 39  ? 1.366   1.711   63.703  1.00 30.01  ? 35  PHE A N   1 
ATOM   256   C CA  . PHE A 1 39  ? 0.548   1.535   64.900  1.00 35.77  ? 35  PHE A CA  1 
ATOM   257   C C   . PHE A 1 39  ? 1.108   0.408   65.764  1.00 35.73  ? 35  PHE A C   1 
ATOM   258   O O   . PHE A 1 39  ? 1.687   -0.548  65.250  1.00 33.52  ? 35  PHE A O   1 
ATOM   259   C CB  . PHE A 1 39  ? -0.906  1.239   64.527  1.00 35.24  ? 35  PHE A CB  1 
ATOM   260   C CG  . PHE A 1 39  ? -1.092  -0.043  63.764  1.00 46.00  ? 35  PHE A CG  1 
ATOM   261   C CD1 . PHE A 1 39  ? -1.278  -1.242  64.432  1.00 48.76  ? 35  PHE A CD1 1 
ATOM   262   C CD2 . PHE A 1 39  ? -1.085  -0.048  62.380  1.00 38.01  ? 35  PHE A CD2 1 
ATOM   263   C CE1 . PHE A 1 39  ? -1.453  -2.423  63.731  1.00 36.04  ? 35  PHE A CE1 1 
ATOM   264   C CE2 . PHE A 1 39  ? -1.259  -1.224  61.674  1.00 24.89  ? 35  PHE A CE2 1 
ATOM   265   C CZ  . PHE A 1 39  ? -1.443  -2.412  62.351  1.00 30.27  ? 35  PHE A CZ  1 
ATOM   266   N N   . GLU A 1 40  ? 0.934   0.524   67.076  1.00 42.55  ? 36  GLU A N   1 
ATOM   267   C CA  . GLU A 1 40  ? 1.451   -0.478  68.002  1.00 52.22  ? 36  GLU A CA  1 
ATOM   268   C C   . GLU A 1 40  ? 0.384   -1.515  68.334  1.00 46.01  ? 36  GLU A C   1 
ATOM   269   O O   . GLU A 1 40  ? -0.712  -1.173  68.776  1.00 50.90  ? 36  GLU A O   1 
ATOM   270   C CB  . GLU A 1 40  ? 1.955   0.188   69.284  1.00 57.54  ? 36  GLU A CB  1 
ATOM   271   C CG  . GLU A 1 40  ? 2.934   1.326   69.036  1.00 75.00  ? 36  GLU A CG  1 
ATOM   272   C CD  . GLU A 1 40  ? 4.010   1.423   70.100  1.00 88.53  ? 36  GLU A CD  1 
ATOM   273   O OE1 . GLU A 1 40  ? 4.336   2.555   70.515  1.00 94.79  ? 36  GLU A OE1 1 
ATOM   274   O OE2 . GLU A 1 40  ? 4.537   0.369   70.515  1.00 92.08  ? 36  GLU A OE2 1 
ATOM   275   N N   . PHE A 1 41  ? 0.717   -2.784  68.120  1.00 30.33  ? 37  PHE A N   1 
ATOM   276   C CA  . PHE A 1 41  ? -0.218  -3.875  68.357  1.00 37.76  ? 37  PHE A CA  1 
ATOM   277   C C   . PHE A 1 41  ? 0.513   -5.068  68.975  1.00 51.62  ? 37  PHE A C   1 
ATOM   278   O O   . PHE A 1 41  ? 1.721   -5.011  69.202  1.00 58.37  ? 37  PHE A O   1 
ATOM   279   C CB  . PHE A 1 41  ? -0.894  -4.274  67.044  1.00 41.31  ? 37  PHE A CB  1 
ATOM   280   C CG  . PHE A 1 41  ? -2.221  -4.952  67.223  1.00 53.31  ? 37  PHE A CG  1 
ATOM   281   C CD1 . PHE A 1 41  ? -3.266  -4.301  67.860  1.00 50.17  ? 37  PHE A CD1 1 
ATOM   282   C CD2 . PHE A 1 41  ? -2.423  -6.241  66.759  1.00 60.67  ? 37  PHE A CD2 1 
ATOM   283   C CE1 . PHE A 1 41  ? -4.488  -4.923  68.028  1.00 51.21  ? 37  PHE A CE1 1 
ATOM   284   C CE2 . PHE A 1 41  ? -3.643  -6.868  66.923  1.00 65.75  ? 37  PHE A CE2 1 
ATOM   285   C CZ  . PHE A 1 41  ? -4.677  -6.208  67.559  1.00 63.07  ? 37  PHE A CZ  1 
ATOM   286   N N   . VAL A 1 42  ? -0.221  -6.145  69.245  1.00 56.11  ? 38  VAL A N   1 
ATOM   287   C CA  . VAL A 1 42  ? 0.355   -7.328  69.877  1.00 53.90  ? 38  VAL A CA  1 
ATOM   288   C C   . VAL A 1 42  ? 0.998   -8.238  68.837  1.00 71.66  ? 38  VAL A C   1 
ATOM   289   O O   . VAL A 1 42  ? 0.534   -8.319  67.699  1.00 68.54  ? 38  VAL A O   1 
ATOM   290   C CB  . VAL A 1 42  ? -0.707  -8.164  70.620  1.00 47.48  ? 38  VAL A CB  1 
ATOM   291   C CG1 . VAL A 1 42  ? -0.038  -9.081  71.630  1.00 38.20  ? 38  VAL A CG1 1 
ATOM   292   C CG2 . VAL A 1 42  ? -1.711  -7.270  71.322  1.00 46.61  ? 38  VAL A CG2 1 
ATOM   293   N N   . ASP A 1 43  ? 2.061   -8.926  69.238  1.00 90.88  ? 39  ASP A N   1 
ATOM   294   C CA  . ASP A 1 43  ? 2.708   -9.908  68.377  1.00 104.63 ? 39  ASP A CA  1 
ATOM   295   C C   . ASP A 1 43  ? 2.279   -11.313 68.785  1.00 98.38  ? 39  ASP A C   1 
ATOM   296   O O   . ASP A 1 43  ? 2.570   -11.761 69.894  1.00 83.86  ? 39  ASP A O   1 
ATOM   297   C CB  . ASP A 1 43  ? 4.228   -9.777  68.467  1.00 117.11 ? 39  ASP A CB  1 
ATOM   298   C CG  . ASP A 1 43  ? 4.948   -10.583 67.401  1.00 123.34 ? 39  ASP A CG  1 
ATOM   299   O OD1 . ASP A 1 43  ? 4.371   -10.781 66.310  1.00 127.73 ? 39  ASP A OD1 1 
ATOM   300   O OD2 . ASP A 1 43  ? 6.093   -11.015 67.652  1.00 119.20 ? 39  ASP A OD2 1 
ATOM   301   N N   . GLN A 1 44  ? 1.584   -12.003 67.885  1.00 104.61 ? 40  GLN A N   1 
ATOM   302   C CA  . GLN A 1 44  ? 1.087   -13.348 68.163  1.00 99.34  ? 40  GLN A CA  1 
ATOM   303   C C   . GLN A 1 44  ? 2.213   -14.305 68.543  1.00 95.22  ? 40  GLN A C   1 
ATOM   304   O O   . GLN A 1 44  ? 1.979   -15.323 69.193  1.00 95.38  ? 40  GLN A O   1 
ATOM   305   C CB  . GLN A 1 44  ? 0.331   -13.897 66.951  1.00 96.31  ? 40  GLN A CB  1 
ATOM   306   C CG  . GLN A 1 44  ? -1.077  -13.348 66.794  1.00 100.79 ? 40  GLN A CG  1 
ATOM   307   C CD  . GLN A 1 44  ? -1.798  -13.926 65.590  1.00 104.86 ? 40  GLN A CD  1 
ATOM   308   O OE1 . GLN A 1 44  ? -1.168  -14.402 64.645  1.00 110.71 ? 40  GLN A OE1 1 
ATOM   309   N NE2 . GLN A 1 44  ? -3.125  -13.890 65.622  1.00 91.33  ? 40  GLN A NE2 1 
ATOM   310   N N   . GLU A 1 45  ? 3.433   -13.975 68.134  1.00 97.71  ? 41  GLU A N   1 
ATOM   311   C CA  . GLU A 1 45  ? 4.585   -14.829 68.396  1.00 101.79 ? 41  GLU A CA  1 
ATOM   312   C C   . GLU A 1 45  ? 5.118   -14.639 69.814  1.00 86.66  ? 41  GLU A C   1 
ATOM   313   O O   . GLU A 1 45  ? 5.406   -15.613 70.511  1.00 78.36  ? 41  GLU A O   1 
ATOM   314   C CB  . GLU A 1 45  ? 5.691   -14.545 67.377  1.00 119.79 ? 41  GLU A CB  1 
ATOM   315   C CG  . GLU A 1 45  ? 5.257   -14.735 65.931  1.00 127.38 ? 41  GLU A CG  1 
ATOM   316   C CD  . GLU A 1 45  ? 4.855   -16.165 65.625  1.00 132.43 ? 41  GLU A CD  1 
ATOM   317   O OE1 . GLU A 1 45  ? 5.223   -17.068 66.405  1.00 132.81 ? 41  GLU A OE1 1 
ATOM   318   O OE2 . GLU A 1 45  ? 4.170   -16.386 64.603  1.00 132.91 ? 41  GLU A OE2 1 
ATOM   319   N N   . GLN A 1 46  ? 5.250   -13.385 70.236  1.00 86.35  ? 42  GLN A N   1 
ATOM   320   C CA  . GLN A 1 46  ? 5.739   -13.076 71.576  1.00 91.63  ? 42  GLN A CA  1 
ATOM   321   C C   . GLN A 1 46  ? 4.738   -13.515 72.641  1.00 87.15  ? 42  GLN A C   1 
ATOM   322   O O   . GLN A 1 46  ? 5.123   -13.976 73.716  1.00 83.89  ? 42  GLN A O   1 
ATOM   323   C CB  . GLN A 1 46  ? 6.017   -11.577 71.712  1.00 99.92  ? 42  GLN A CB  1 
ATOM   324   C CG  . GLN A 1 46  ? 7.164   -11.079 70.848  1.00 102.77 ? 42  GLN A CG  1 
ATOM   325   C CD  . GLN A 1 46  ? 8.488   -11.723 71.210  1.00 110.32 ? 42  GLN A CD  1 
ATOM   326   O OE1 . GLN A 1 46  ? 8.671   -12.204 72.327  1.00 115.09 ? 42  GLN A OE1 1 
ATOM   327   N NE2 . GLN A 1 46  ? 9.417   -11.740 70.261  1.00 110.87 ? 42  GLN A NE2 1 
ATOM   328   N N   . LEU A 1 47  ? 3.453   -13.369 72.332  1.00 88.81  ? 43  LEU A N   1 
ATOM   329   C CA  . LEU A 1 47  ? 2.390   -13.734 73.261  1.00 89.33  ? 43  LEU A CA  1 
ATOM   330   C C   . LEU A 1 47  ? 1.559   -14.877 72.684  1.00 98.58  ? 43  LEU A C   1 
ATOM   331   O O   . LEU A 1 47  ? 0.625   -14.655 71.911  1.00 98.11  ? 43  LEU A O   1 
ATOM   332   C CB  . LEU A 1 47  ? 1.510   -12.516 73.546  1.00 84.98  ? 43  LEU A CB  1 
ATOM   333   C CG  . LEU A 1 47  ? 0.547   -12.601 74.730  1.00 76.77  ? 43  LEU A CG  1 
ATOM   334   C CD1 . LEU A 1 47  ? 1.248   -13.096 75.982  1.00 68.56  ? 43  LEU A CD1 1 
ATOM   335   C CD2 . LEU A 1 47  ? -0.073  -11.235 74.979  1.00 80.53  ? 43  LEU A CD2 1 
ATOM   336   N N   . LYS A 1 48  ? 1.906   -16.102 73.070  1.00 98.19  ? 44  LYS A N   1 
ATOM   337   C CA  . LYS A 1 48  ? 1.306   -17.299 72.489  1.00 85.47  ? 44  LYS A CA  1 
ATOM   338   C C   . LYS A 1 48  ? -0.070  -17.600 73.077  1.00 68.95  ? 44  LYS A C   1 
ATOM   339   O O   . LYS A 1 48  ? -0.931  -18.164 72.400  1.00 59.98  ? 44  LYS A O   1 
ATOM   340   C CB  . LYS A 1 48  ? 2.229   -18.501 72.701  1.00 81.32  ? 44  LYS A CB  1 
ATOM   341   C CG  . LYS A 1 48  ? 3.617   -18.329 72.100  1.00 83.38  ? 44  LYS A CG  1 
ATOM   342   C CD  . LYS A 1 48  ? 4.512   -19.523 72.402  1.00 87.89  ? 44  LYS A CD  1 
ATOM   343   C CE  . LYS A 1 48  ? 5.896   -19.351 71.792  1.00 88.65  ? 44  LYS A CE  1 
ATOM   344   N NZ  . LYS A 1 48  ? 6.779   -20.519 72.064  1.00 87.69  ? 44  LYS A NZ  1 
ATOM   345   N N   . ASP A 1 49  ? -0.271  -17.227 74.338  1.00 45.04  ? 45  ASP A N   1 
ATOM   346   C CA  . ASP A 1 49  ? -1.524  -17.516 75.032  1.00 30.37  ? 45  ASP A CA  1 
ATOM   347   C C   . ASP A 1 49  ? -2.696  -16.757 74.407  1.00 49.90  ? 45  ASP A C   1 
ATOM   348   O O   . ASP A 1 49  ? -2.734  -15.528 74.452  1.00 59.59  ? 45  ASP A O   1 
ATOM   349   C CB  . ASP A 1 49  ? -1.407  -17.154 76.512  1.00 39.98  ? 45  ASP A CB  1 
ATOM   350   C CG  . ASP A 1 49  ? -2.560  -17.696 77.334  1.00 60.49  ? 45  ASP A CG  1 
ATOM   351   O OD1 . ASP A 1 49  ? -2.909  -18.882 77.156  1.00 56.25  ? 45  ASP A OD1 1 
ATOM   352   O OD2 . ASP A 1 49  ? -3.115  -16.941 78.160  1.00 77.21  ? 45  ASP A OD2 1 
ATOM   353   N N   . PRO A 1 50  ? -3.661  -17.491 73.825  1.00 60.43  ? 46  PRO A N   1 
ATOM   354   C CA  . PRO A 1 50  ? -4.804  -16.877 73.135  1.00 63.53  ? 46  PRO A CA  1 
ATOM   355   C C   . PRO A 1 50  ? -5.588  -15.886 73.996  1.00 68.96  ? 46  PRO A C   1 
ATOM   356   O O   . PRO A 1 50  ? -5.984  -14.830 73.501  1.00 62.51  ? 46  PRO A O   1 
ATOM   357   C CB  . PRO A 1 50  ? -5.686  -18.079 72.785  1.00 65.97  ? 46  PRO A CB  1 
ATOM   358   C CG  . PRO A 1 50  ? -4.751  -19.226 72.713  1.00 58.54  ? 46  PRO A CG  1 
ATOM   359   C CD  . PRO A 1 50  ? -3.704  -18.962 73.752  1.00 63.52  ? 46  PRO A CD  1 
ATOM   360   N N   . VAL A 1 51  ? -5.821  -16.227 75.260  1.00 69.11  ? 47  VAL A N   1 
ATOM   361   C CA  . VAL A 1 51  ? -6.577  -15.354 76.154  1.00 55.86  ? 47  VAL A CA  1 
ATOM   362   C C   . VAL A 1 51  ? -5.799  -14.082 76.471  1.00 40.53  ? 47  VAL A C   1 
ATOM   363   O O   . VAL A 1 51  ? -6.303  -12.975 76.286  1.00 61.57  ? 47  VAL A O   1 
ATOM   364   C CB  . VAL A 1 51  ? -6.938  -16.066 77.472  1.00 49.84  ? 47  VAL A CB  1 
ATOM   365   C CG1 . VAL A 1 51  ? -7.397  -15.057 78.516  1.00 25.09  ? 47  VAL A CG1 1 
ATOM   366   C CG2 . VAL A 1 51  ? -8.015  -17.116 77.231  1.00 53.92  ? 47  VAL A CG2 1 
ATOM   367   N N   . CYS A 1 52  ? -4.572  -14.242 76.952  1.00 37.91  ? 48  CYS A N   1 
ATOM   368   C CA  . CYS A 1 52  ? -3.743  -13.095 77.298  1.00 55.30  ? 48  CYS A CA  1 
ATOM   369   C C   . CYS A 1 52  ? -3.469  -12.235 76.065  1.00 53.59  ? 48  CYS A C   1 
ATOM   370   O O   . CYS A 1 52  ? -3.275  -11.023 76.174  1.00 59.32  ? 48  CYS A O   1 
ATOM   371   C CB  . CYS A 1 52  ? -2.430  -13.553 77.938  1.00 68.64  ? 48  CYS A CB  1 
ATOM   372   S SG  . CYS A 1 52  ? -2.624  -14.350 79.557  1.00 69.17  ? 48  CYS A SG  1 
ATOM   373   N N   . TYR A 1 53  ? -3.465  -12.863 74.893  1.00 46.31  ? 49  TYR A N   1 
ATOM   374   C CA  . TYR A 1 53  ? -3.299  -12.130 73.643  1.00 38.06  ? 49  TYR A CA  1 
ATOM   375   C C   . TYR A 1 53  ? -4.455  -11.159 73.437  1.00 35.05  ? 49  TYR A C   1 
ATOM   376   O O   . TYR A 1 53  ? -4.243  -9.998  73.088  1.00 41.28  ? 49  TYR A O   1 
ATOM   377   C CB  . TYR A 1 53  ? -3.214  -13.086 72.452  1.00 37.44  ? 49  TYR A CB  1 
ATOM   378   C CG  . TYR A 1 53  ? -3.306  -12.381 71.116  1.00 52.12  ? 49  TYR A CG  1 
ATOM   379   C CD1 . TYR A 1 53  ? -4.538  -12.064 70.559  1.00 39.18  ? 49  TYR A CD1 1 
ATOM   380   C CD2 . TYR A 1 53  ? -2.161  -12.027 70.413  1.00 61.61  ? 49  TYR A CD2 1 
ATOM   381   C CE1 . TYR A 1 53  ? -4.628  -11.417 69.343  1.00 23.94  ? 49  TYR A CE1 1 
ATOM   382   C CE2 . TYR A 1 53  ? -2.242  -11.380 69.193  1.00 43.97  ? 49  TYR A CE2 1 
ATOM   383   C CZ  . TYR A 1 53  ? -3.479  -11.078 68.664  1.00 45.86  ? 49  TYR A CZ  1 
ATOM   384   O OH  . TYR A 1 53  ? -3.569  -10.434 67.452  1.00 80.12  ? 49  TYR A OH  1 
ATOM   385   N N   . LEU A 1 54  ? -5.676  -11.640 73.655  1.00 28.07  ? 50  LEU A N   1 
ATOM   386   C CA  . LEU A 1 54  ? -6.865  -10.811 73.482  1.00 35.28  ? 50  LEU A CA  1 
ATOM   387   C C   . LEU A 1 54  ? -6.947  -9.732  74.555  1.00 47.17  ? 50  LEU A C   1 
ATOM   388   O O   . LEU A 1 54  ? -7.444  -8.634  74.304  1.00 65.50  ? 50  LEU A O   1 
ATOM   389   C CB  . LEU A 1 54  ? -8.133  -11.668 73.504  1.00 41.16  ? 50  LEU A CB  1 
ATOM   390   C CG  . LEU A 1 54  ? -8.357  -12.575 72.290  1.00 51.54  ? 50  LEU A CG  1 
ATOM   391   C CD1 . LEU A 1 54  ? -9.557  -13.484 72.514  1.00 54.57  ? 50  LEU A CD1 1 
ATOM   392   C CD2 . LEU A 1 54  ? -8.539  -11.757 71.018  1.00 41.20  ? 50  LEU A CD2 1 
ATOM   393   N N   . LYS A 1 55  ? -6.456  -10.041 75.750  1.00 46.79  ? 51  LYS A N   1 
ATOM   394   C CA  . LYS A 1 55  ? -6.465  -9.072  76.837  1.00 53.24  ? 51  LYS A CA  1 
ATOM   395   C C   . LYS A 1 55  ? -5.650  -7.838  76.470  1.00 30.93  ? 51  LYS A C   1 
ATOM   396   O O   . LYS A 1 55  ? -6.122  -6.709  76.606  1.00 32.15  ? 51  LYS A O   1 
ATOM   397   C CB  . LYS A 1 55  ? -5.921  -9.693  78.125  1.00 61.70  ? 51  LYS A CB  1 
ATOM   398   C CG  . LYS A 1 55  ? -6.889  -10.642 78.814  1.00 65.47  ? 51  LYS A CG  1 
ATOM   399   C CD  . LYS A 1 55  ? -6.494  -10.886 80.263  1.00 68.49  ? 51  LYS A CD  1 
ATOM   400   C CE  . LYS A 1 55  ? -6.808  -9.686  81.143  1.00 69.47  ? 51  LYS A CE  1 
ATOM   401   N NZ  . LYS A 1 55  ? -6.332  -9.880  82.540  1.00 75.64  ? 51  LYS A NZ  1 
ATOM   402   N N   . LYS A 1 56  ? -4.426  -8.056  76.001  1.00 42.51  ? 52  LYS A N   1 
ATOM   403   C CA  . LYS A 1 56  ? -3.531  -6.950  75.681  1.00 47.03  ? 52  LYS A CA  1 
ATOM   404   C C   . LYS A 1 56  ? -3.966  -6.231  74.410  1.00 46.26  ? 52  LYS A C   1 
ATOM   405   O O   . LYS A 1 56  ? -3.926  -5.004  74.339  1.00 59.72  ? 52  LYS A O   1 
ATOM   406   C CB  . LYS A 1 56  ? -2.092  -7.445  75.538  1.00 36.28  ? 52  LYS A CB  1 
ATOM   407   C CG  . LYS A 1 56  ? -1.104  -6.351  75.177  1.00 34.98  ? 52  LYS A CG  1 
ATOM   408   C CD  . LYS A 1 56  ? 0.317   -6.755  75.526  1.00 45.26  ? 52  LYS A CD  1 
ATOM   409   C CE  . LYS A 1 56  ? 0.613   -6.524  77.001  1.00 53.12  ? 52  LYS A CE  1 
ATOM   410   N NZ  . LYS A 1 56  ? 0.889   -5.090  77.296  1.00 54.53  ? 52  LYS A NZ  1 
ATOM   411   N N   . ALA A 1 57  ? -4.381  -7.001  73.408  1.00 47.19  ? 53  ALA A N   1 
ATOM   412   C CA  . ALA A 1 57  ? -4.871  -6.430  72.160  1.00 32.19  ? 53  ALA A CA  1 
ATOM   413   C C   . ALA A 1 57  ? -6.035  -5.485  72.437  1.00 39.48  ? 53  ALA A C   1 
ATOM   414   O O   . ALA A 1 57  ? -6.167  -4.445  71.794  1.00 44.03  ? 53  ALA A O   1 
ATOM   415   C CB  . ALA A 1 57  ? -5.300  -7.535  71.203  1.00 30.42  ? 53  ALA A CB  1 
ATOM   416   N N   . PHE A 1 58  ? -6.875  -5.850  73.401  1.00 54.40  ? 54  PHE A N   1 
ATOM   417   C CA  . PHE A 1 58  ? -8.023  -5.027  73.767  1.00 46.35  ? 54  PHE A CA  1 
ATOM   418   C C   . PHE A 1 58  ? -7.574  -3.667  74.283  1.00 41.63  ? 54  PHE A C   1 
ATOM   419   O O   . PHE A 1 58  ? -8.162  -2.642  73.942  1.00 55.47  ? 54  PHE A O   1 
ATOM   420   C CB  . PHE A 1 58  ? -8.875  -5.723  74.829  1.00 57.89  ? 54  PHE A CB  1 
ATOM   421   C CG  . PHE A 1 58  ? -9.993  -4.870  75.358  1.00 67.48  ? 54  PHE A CG  1 
ATOM   422   C CD1 . PHE A 1 58  ? -11.150 -4.686  74.620  1.00 59.86  ? 54  PHE A CD1 1 
ATOM   423   C CD2 . PHE A 1 58  ? -9.884  -4.243  76.589  1.00 73.78  ? 54  PHE A CD2 1 
ATOM   424   C CE1 . PHE A 1 58  ? -12.179 -3.899  75.101  1.00 59.93  ? 54  PHE A CE1 1 
ATOM   425   C CE2 . PHE A 1 58  ? -10.911 -3.455  77.076  1.00 71.05  ? 54  PHE A CE2 1 
ATOM   426   C CZ  . PHE A 1 58  ? -12.059 -3.283  76.330  1.00 65.85  ? 54  PHE A CZ  1 
ATOM   427   N N   . LEU A 1 59  ? -6.535  -3.662  75.111  1.00 36.31  ? 55  LEU A N   1 
ATOM   428   C CA  . LEU A 1 59  ? -5.985  -2.417  75.633  1.00 45.63  ? 55  LEU A CA  1 
ATOM   429   C C   . LEU A 1 59  ? -5.427  -1.559  74.507  1.00 50.77  ? 55  LEU A C   1 
ATOM   430   O O   . LEU A 1 59  ? -5.731  -0.370  74.407  1.00 45.79  ? 55  LEU A O   1 
ATOM   431   C CB  . LEU A 1 59  ? -4.875  -2.706  76.642  1.00 49.09  ? 55  LEU A CB  1 
ATOM   432   C CG  . LEU A 1 59  ? -5.297  -3.396  77.936  1.00 41.90  ? 55  LEU A CG  1 
ATOM   433   C CD1 . LEU A 1 59  ? -4.088  -3.554  78.843  1.00 41.62  ? 55  LEU A CD1 1 
ATOM   434   C CD2 . LEU A 1 59  ? -6.406  -2.615  78.632  1.00 24.36  ? 55  LEU A CD2 1 
ATOM   435   N N   . LEU A 1 60  ? -4.604  -2.173  73.665  1.00 50.43  ? 56  LEU A N   1 
ATOM   436   C CA  . LEU A 1 60  ? -3.958  -1.466  72.568  1.00 53.89  ? 56  LEU A CA  1 
ATOM   437   C C   . LEU A 1 60  ? -4.986  -0.915  71.586  1.00 62.59  ? 56  LEU A C   1 
ATOM   438   O O   . LEU A 1 60  ? -4.789  0.151   71.004  1.00 72.25  ? 56  LEU A O   1 
ATOM   439   C CB  . LEU A 1 60  ? -2.985  -2.399  71.850  1.00 37.95  ? 56  LEU A CB  1 
ATOM   440   C CG  . LEU A 1 60  ? -1.822  -2.877  72.721  1.00 36.69  ? 56  LEU A CG  1 
ATOM   441   C CD1 . LEU A 1 60  ? -1.152  -4.073  72.084  1.00 20.12  ? 56  LEU A CD1 1 
ATOM   442   C CD2 . LEU A 1 60  ? -0.820  -1.757  72.948  1.00 41.26  ? 56  LEU A CD2 1 
ATOM   443   N N   . VAL A 1 61  ? -6.084  -1.643  71.408  1.00 49.96  ? 57  VAL A N   1 
ATOM   444   C CA  . VAL A 1 61  ? -7.167  -1.190  70.542  1.00 46.47  ? 57  VAL A CA  1 
ATOM   445   C C   . VAL A 1 61  ? -7.741  0.131   71.044  1.00 30.49  ? 57  VAL A C   1 
ATOM   446   O O   . VAL A 1 61  ? -8.265  0.925   70.265  1.00 42.19  ? 57  VAL A O   1 
ATOM   447   C CB  . VAL A 1 61  ? -8.295  -2.240  70.451  1.00 47.13  ? 57  VAL A CB  1 
ATOM   448   C CG1 . VAL A 1 61  ? -9.616  -1.588  70.064  1.00 39.42  ? 57  VAL A CG1 1 
ATOM   449   C CG2 . VAL A 1 61  ? -7.925  -3.331  69.455  1.00 49.70  ? 57  VAL A CG2 1 
ATOM   450   N N   . GLN A 1 62  ? -7.635  0.366   72.348  1.00 18.92  ? 58  GLN A N   1 
ATOM   451   C CA  . GLN A 1 62  ? -8.118  1.611   72.938  1.00 39.81  ? 58  GLN A CA  1 
ATOM   452   C C   . GLN A 1 62  ? -7.242  2.780   72.505  1.00 51.58  ? 58  GLN A C   1 
ATOM   453   O O   . GLN A 1 62  ? -7.743  3.864   72.208  1.00 57.85  ? 58  GLN A O   1 
ATOM   454   C CB  . GLN A 1 62  ? -8.152  1.507   74.464  1.00 36.90  ? 58  GLN A CB  1 
ATOM   455   C CG  . GLN A 1 62  ? -8.972  0.334   74.970  1.00 41.22  ? 58  GLN A CG  1 
ATOM   456   C CD  . GLN A 1 62  ? -10.339 0.263   74.313  1.00 58.70  ? 58  GLN A CD  1 
ATOM   457   O OE1 . GLN A 1 62  ? -11.062 1.258   74.254  1.00 61.06  ? 58  GLN A OE1 1 
ATOM   458   N NE2 . GLN A 1 62  ? -10.695 -0.914  73.802  1.00 45.29  ? 58  GLN A NE2 1 
ATOM   459   N N   . ASP A 1 63  ? -5.932  2.552   72.467  1.00 58.84  ? 59  ASP A N   1 
ATOM   460   C CA  . ASP A 1 63  ? -4.995  3.553   71.970  1.00 52.64  ? 59  ASP A CA  1 
ATOM   461   C C   . ASP A 1 63  ? -5.228  3.787   70.481  1.00 52.02  ? 59  ASP A C   1 
ATOM   462   O O   . ASP A 1 63  ? -5.138  4.914   69.994  1.00 66.77  ? 59  ASP A O   1 
ATOM   463   C CB  . ASP A 1 63  ? -3.550  3.100   72.201  1.00 55.52  ? 59  ASP A CB  1 
ATOM   464   C CG  . ASP A 1 63  ? -3.154  3.126   73.665  1.00 59.41  ? 59  ASP A CG  1 
ATOM   465   O OD1 . ASP A 1 63  ? -2.663  4.177   74.127  1.00 54.93  ? 59  ASP A OD1 1 
ATOM   466   O OD2 . ASP A 1 63  ? -3.324  2.095   74.351  1.00 62.48  ? 59  ASP A OD2 1 
ATOM   467   N N   . ILE A 1 64  ? -5.536  2.710   69.766  1.00 29.49  ? 60  ILE A N   1 
ATOM   468   C CA  . ILE A 1 64  ? -5.720  2.763   68.321  1.00 24.70  ? 60  ILE A CA  1 
ATOM   469   C C   . ILE A 1 64  ? -6.992  3.509   67.926  1.00 29.82  ? 60  ILE A C   1 
ATOM   470   O O   . ILE A 1 64  ? -6.990  4.278   66.967  1.00 34.19  ? 60  ILE A O   1 
ATOM   471   C CB  . ILE A 1 64  ? -5.757  1.345   67.723  1.00 27.51  ? 60  ILE A CB  1 
ATOM   472   C CG1 . ILE A 1 64  ? -4.369  0.705   67.813  1.00 38.73  ? 60  ILE A CG1 1 
ATOM   473   C CG2 . ILE A 1 64  ? -6.223  1.387   66.278  1.00 26.72  ? 60  ILE A CG2 1 
ATOM   474   C CD1 . ILE A 1 64  ? -4.340  -0.764  67.445  1.00 50.75  ? 60  ILE A CD1 1 
ATOM   475   N N   . MET A 1 65  ? -8.076  3.281   68.659  1.00 33.09  ? 61  MET A N   1 
ATOM   476   C CA  . MET A 1 65  ? -9.338  3.950   68.366  1.00 36.42  ? 61  MET A CA  1 
ATOM   477   C C   . MET A 1 65  ? -9.201  5.456   68.544  1.00 51.17  ? 61  MET A C   1 
ATOM   478   O O   . MET A 1 65  ? -9.615  6.234   67.684  1.00 45.63  ? 61  MET A O   1 
ATOM   479   C CB  . MET A 1 65  ? -10.453 3.429   69.275  1.00 31.59  ? 61  MET A CB  1 
ATOM   480   C CG  . MET A 1 65  ? -10.988 2.060   68.887  1.00 27.58  ? 61  MET A CG  1 
ATOM   481   S SD  . MET A 1 65  ? -12.556 1.681   69.691  1.00 56.62  ? 61  MET A SD  1 
ATOM   482   C CE  . MET A 1 65  ? -12.048 1.529   71.400  1.00 35.09  ? 61  MET A CE  1 
ATOM   483   N N   . GLU A 1 66  ? -8.613  5.857   69.665  1.00 60.22  ? 62  GLU A N   1 
ATOM   484   C CA  . GLU A 1 66  ? -8.495  7.268   70.014  1.00 55.20  ? 62  GLU A CA  1 
ATOM   485   C C   . GLU A 1 66  ? -7.468  7.993   69.149  1.00 51.14  ? 62  GLU A C   1 
ATOM   486   O O   . GLU A 1 66  ? -7.732  9.083   68.642  1.00 52.80  ? 62  GLU A O   1 
ATOM   487   C CB  . GLU A 1 66  ? -8.115  7.409   71.492  1.00 63.09  ? 62  GLU A CB  1 
ATOM   488   C CG  . GLU A 1 66  ? -7.805  8.833   71.937  1.00 72.02  ? 62  GLU A CG  1 
ATOM   489   C CD  . GLU A 1 66  ? -9.013  9.747   71.876  1.00 86.02  ? 62  GLU A CD  1 
ATOM   490   O OE1 . GLU A 1 66  ? -10.131 9.245   71.637  1.00 94.96  ? 62  GLU A OE1 1 
ATOM   491   O OE2 . GLU A 1 66  ? -8.844  10.971  72.070  1.00 85.45  ? 62  GLU A OE2 1 
ATOM   492   N N   . ASP A 1 67  ? -6.302  7.380   68.974  1.00 54.62  ? 63  ASP A N   1 
ATOM   493   C CA  . ASP A 1 67  ? -5.169  8.059   68.352  1.00 53.27  ? 63  ASP A CA  1 
ATOM   494   C C   . ASP A 1 67  ? -5.114  7.903   66.831  1.00 53.72  ? 63  ASP A C   1 
ATOM   495   O O   . ASP A 1 67  ? -4.824  8.864   66.119  1.00 57.33  ? 63  ASP A O   1 
ATOM   496   C CB  . ASP A 1 67  ? -3.855  7.564   68.966  1.00 53.94  ? 63  ASP A CB  1 
ATOM   497   C CG  . ASP A 1 67  ? -3.717  7.937   70.433  1.00 54.67  ? 63  ASP A CG  1 
ATOM   498   O OD1 . ASP A 1 67  ? -4.751  8.173   71.091  1.00 53.83  ? 63  ASP A OD1 1 
ATOM   499   O OD2 . ASP A 1 67  ? -2.572  7.994   70.928  1.00 65.02  ? 63  ASP A OD2 1 
ATOM   500   N N   . THR A 1 68  ? -5.392  6.700   66.334  1.00 53.70  ? 64  THR A N   1 
ATOM   501   C CA  . THR A 1 68  ? -5.197  6.399   64.913  1.00 47.39  ? 64  THR A CA  1 
ATOM   502   C C   . THR A 1 68  ? -6.489  6.459   64.094  1.00 52.96  ? 64  THR A C   1 
ATOM   503   O O   . THR A 1 68  ? -6.522  7.072   63.027  1.00 63.14  ? 64  THR A O   1 
ATOM   504   C CB  . THR A 1 68  ? -4.554  5.011   64.721  1.00 35.69  ? 64  THR A CB  1 
ATOM   505   O OG1 . THR A 1 68  ? -3.325  4.945   65.454  1.00 46.94  ? 64  THR A OG1 1 
ATOM   506   C CG2 . THR A 1 68  ? -4.275  4.747   63.249  1.00 30.44  ? 64  THR A CG2 1 
ATOM   507   N N   . MET A 1 69  ? -7.542  5.816   64.588  1.00 47.05  ? 65  MET A N   1 
ATOM   508   C CA  . MET A 1 69  ? -8.815  5.763   63.874  1.00 37.05  ? 65  MET A CA  1 
ATOM   509   C C   . MET A 1 69  ? -9.641  7.018   64.141  1.00 45.99  ? 65  MET A C   1 
ATOM   510   O O   . MET A 1 69  ? -10.575 6.996   64.944  1.00 49.62  ? 65  MET A O   1 
ATOM   511   C CB  . MET A 1 69  ? -9.607  4.526   64.304  1.00 45.54  ? 65  MET A CB  1 
ATOM   512   C CG  . MET A 1 69  ? -8.870  3.211   64.093  1.00 59.79  ? 65  MET A CG  1 
ATOM   513   S SD  . MET A 1 69  ? -9.645  1.825   64.951  1.00 64.09  ? 65  MET A SD  1 
ATOM   514   C CE  . MET A 1 69  ? -11.299 1.902   64.278  1.00 11.66  ? 65  MET A CE  1 
ATOM   515   N N   . ARG A 1 70  ? -9.297  8.107   63.459  1.00 49.11  ? 66  ARG A N   1 
ATOM   516   C CA  . ARG A 1 70  ? -9.978  9.384   63.650  1.00 46.01  ? 66  ARG A CA  1 
ATOM   517   C C   . ARG A 1 70  ? -10.777 9.776   62.417  1.00 46.99  ? 66  ARG A C   1 
ATOM   518   O O   . ARG A 1 70  ? -10.271 9.726   61.296  1.00 38.67  ? 66  ARG A O   1 
ATOM   519   C CB  . ARG A 1 70  ? -8.970  10.491  63.968  1.00 60.28  ? 66  ARG A CB  1 
ATOM   520   C CG  . ARG A 1 70  ? -8.247  10.324  65.295  1.00 62.43  ? 66  ARG A CG  1 
ATOM   521   C CD  . ARG A 1 70  ? -7.359  11.523  65.599  1.00 62.89  ? 66  ARG A CD  1 
ATOM   522   N NE  . ARG A 1 70  ? -6.398  11.781  64.527  1.00 65.68  ? 66  ARG A NE  1 
ATOM   523   C CZ  . ARG A 1 70  ? -6.586  12.634  63.521  1.00 70.99  ? 66  ARG A CZ  1 
ATOM   524   N NH1 . ARG A 1 70  ? -7.705  13.342  63.423  1.00 67.30  ? 66  ARG A NH1 1 
ATOM   525   N NH2 . ARG A 1 70  ? -5.642  12.785  62.603  1.00 70.35  ? 66  ARG A NH2 1 
ATOM   526   N N   . PHE A 1 71  ? -12.026 10.178  62.636  1.00 58.30  ? 67  PHE A N   1 
ATOM   527   C CA  . PHE A 1 71  ? -12.902 10.608  61.552  1.00 46.82  ? 67  PHE A CA  1 
ATOM   528   C C   . PHE A 1 71  ? -13.416 12.016  61.808  1.00 46.36  ? 67  PHE A C   1 
ATOM   529   O O   . PHE A 1 71  ? -13.430 12.484  62.947  1.00 39.28  ? 67  PHE A O   1 
ATOM   530   C CB  . PHE A 1 71  ? -14.075 9.641   61.404  1.00 39.07  ? 67  PHE A CB  1 
ATOM   531   C CG  . PHE A 1 71  ? -13.660 8.246   61.044  1.00 31.87  ? 67  PHE A CG  1 
ATOM   532   C CD1 . PHE A 1 71  ? -13.330 7.331   62.030  1.00 30.86  ? 67  PHE A CD1 1 
ATOM   533   C CD2 . PHE A 1 71  ? -13.587 7.852   59.719  1.00 14.09  ? 67  PHE A CD2 1 
ATOM   534   C CE1 . PHE A 1 71  ? -12.941 6.048   61.701  1.00 30.30  ? 67  PHE A CE1 1 
ATOM   535   C CE2 . PHE A 1 71  ? -13.199 6.571   59.385  1.00 16.42  ? 67  PHE A CE2 1 
ATOM   536   C CZ  . PHE A 1 71  ? -12.874 5.668   60.376  1.00 20.75  ? 67  PHE A CZ  1 
ATOM   537   N N   . ARG A 1 72  ? -13.831 12.691  60.741  1.00 64.87  ? 68  ARG A N   1 
ATOM   538   C CA  . ARG A 1 72  ? -14.369 14.039  60.853  1.00 61.26  ? 68  ARG A CA  1 
ATOM   539   C C   . ARG A 1 72  ? -15.554 14.033  61.810  1.00 59.11  ? 68  ARG A C   1 
ATOM   540   O O   . ARG A 1 72  ? -16.376 13.117  61.788  1.00 65.75  ? 68  ARG A O   1 
ATOM   541   C CB  . ARG A 1 72  ? -14.802 14.558  59.481  1.00 50.60  ? 68  ARG A CB  1 
ATOM   542   C CG  . ARG A 1 72  ? -15.173 16.030  59.470  1.00 52.97  ? 68  ARG A CG  1 
ATOM   543   C CD  . ARG A 1 72  ? -15.716 16.462  58.120  1.00 61.59  ? 68  ARG A CD  1 
ATOM   544   N NE  . ARG A 1 72  ? -16.131 17.862  58.127  1.00 67.94  ? 68  ARG A NE  1 
ATOM   545   C CZ  . ARG A 1 72  ? -17.270 18.306  58.652  1.00 70.66  ? 68  ARG A CZ  1 
ATOM   546   N NH1 . ARG A 1 72  ? -18.122 17.464  59.226  1.00 58.21  ? 68  ARG A NH1 1 
ATOM   547   N NH2 . ARG A 1 72  ? -17.559 19.600  58.610  1.00 75.49  ? 68  ARG A NH2 1 
ATOM   548   N N   . ASP A 1 73  ? -15.635 15.054  62.655  1.00 42.91  ? 69  ASP A N   1 
ATOM   549   C CA  . ASP A 1 73  ? -16.701 15.137  63.643  1.00 52.31  ? 69  ASP A CA  1 
ATOM   550   C C   . ASP A 1 73  ? -18.075 15.082  62.982  1.00 56.01  ? 69  ASP A C   1 
ATOM   551   O O   . ASP A 1 73  ? -18.283 15.649  61.909  1.00 57.57  ? 69  ASP A O   1 
ATOM   552   C CB  . ASP A 1 73  ? -16.570 16.421  64.464  1.00 68.16  ? 69  ASP A CB  1 
ATOM   553   C CG  . ASP A 1 73  ? -15.324 16.435  65.328  1.00 94.01  ? 69  ASP A CG  1 
ATOM   554   O OD1 . ASP A 1 73  ? -14.825 15.343  65.673  1.00 100.35 ? 69  ASP A OD1 1 
ATOM   555   O OD2 . ASP A 1 73  ? -14.846 17.540  65.664  1.00 97.66  ? 69  ASP A OD2 1 
ATOM   556   N N   . ASN A 1 74  ? -19.002 14.384  63.633  1.00 51.08  ? 70  ASN A N   1 
ATOM   557   C CA  . ASN A 1 74  ? -20.394 14.313  63.193  1.00 42.46  ? 70  ASN A CA  1 
ATOM   558   C C   . ASN A 1 74  ? -20.594 13.510  61.909  1.00 54.35  ? 70  ASN A C   1 
ATOM   559   O O   . ASN A 1 74  ? -21.479 13.816  61.109  1.00 63.23  ? 70  ASN A O   1 
ATOM   560   C CB  . ASN A 1 74  ? -20.974 15.720  63.026  1.00 33.67  ? 70  ASN A CB  1 
ATOM   561   C CG  . ASN A 1 74  ? -20.922 16.527  64.309  1.00 65.36  ? 70  ASN A CG  1 
ATOM   562   O OD1 . ASN A 1 74  ? -20.344 17.614  64.351  1.00 77.66  ? 70  ASN A OD1 1 
ATOM   563   N ND2 . ASN A 1 74  ? -21.530 15.997  65.365  1.00 71.72  ? 70  ASN A ND2 1 
ATOM   564   N N   . THR A 1 75  ? -19.773 12.481  61.721  1.00 45.74  ? 71  THR A N   1 
ATOM   565   C CA  . THR A 1 75  ? -19.942 11.562  60.602  1.00 44.47  ? 71  THR A CA  1 
ATOM   566   C C   . THR A 1 75  ? -20.323 10.186  61.137  1.00 50.48  ? 71  THR A C   1 
ATOM   567   O O   . THR A 1 75  ? -19.970 9.838   62.265  1.00 55.46  ? 71  THR A O   1 
ATOM   568   C CB  . THR A 1 75  ? -18.658 11.438  59.759  1.00 47.06  ? 71  THR A CB  1 
ATOM   569   O OG1 . THR A 1 75  ? -17.601 10.893  60.560  1.00 48.30  ? 71  THR A OG1 1 
ATOM   570   C CG2 . THR A 1 75  ? -18.239 12.800  59.210  1.00 25.15  ? 71  THR A CG2 1 
ATOM   571   N N   . PRO A 1 76  ? -21.050 9.398   60.331  1.00 50.50  ? 72  PRO A N   1 
ATOM   572   C CA  . PRO A 1 76  ? -21.489 8.069   60.773  1.00 32.43  ? 72  PRO A CA  1 
ATOM   573   C C   . PRO A 1 76  ? -20.341 7.243   61.344  1.00 51.95  ? 72  PRO A C   1 
ATOM   574   O O   . PRO A 1 76  ? -20.550 6.464   62.274  1.00 63.84  ? 72  PRO A O   1 
ATOM   575   C CB  . PRO A 1 76  ? -22.017 7.428   59.485  1.00 20.54  ? 72  PRO A CB  1 
ATOM   576   C CG  . PRO A 1 76  ? -22.432 8.580   58.633  1.00 31.59  ? 72  PRO A CG  1 
ATOM   577   C CD  . PRO A 1 76  ? -21.479 9.695   58.952  1.00 40.76  ? 72  PRO A CD  1 
ATOM   578   N N   . ASN A 1 77  ? -19.144 7.421   60.791  1.00 58.86  ? 73  ASN A N   1 
ATOM   579   C CA  . ASN A 1 77  ? -17.973 6.668   61.230  1.00 46.31  ? 73  ASN A CA  1 
ATOM   580   C C   . ASN A 1 77  ? -17.406 7.182   62.549  1.00 38.79  ? 73  ASN A C   1 
ATOM   581   O O   . ASN A 1 77  ? -16.934 6.401   63.373  1.00 40.22  ? 73  ASN A O   1 
ATOM   582   C CB  . ASN A 1 77  ? -16.888 6.695   60.154  1.00 43.41  ? 73  ASN A CB  1 
ATOM   583   C CG  . ASN A 1 77  ? -17.249 5.857   58.944  1.00 32.99  ? 73  ASN A CG  1 
ATOM   584   O OD1 . ASN A 1 77  ? -17.980 4.871   59.055  1.00 35.01  ? 73  ASN A OD1 1 
ATOM   585   N ND2 . ASN A 1 77  ? -16.738 6.244   57.779  1.00 15.57  ? 73  ASN A ND2 1 
ATOM   586   N N   . ALA A 1 78  ? -17.452 8.494   62.747  1.00 34.05  ? 74  ALA A N   1 
ATOM   587   C CA  . ALA A 1 78  ? -16.985 9.088   63.993  1.00 30.93  ? 74  ALA A CA  1 
ATOM   588   C C   . ALA A 1 78  ? -17.856 8.625   65.155  1.00 34.49  ? 74  ALA A C   1 
ATOM   589   O O   . ALA A 1 78  ? -17.355 8.329   66.239  1.00 34.99  ? 74  ALA A O   1 
ATOM   590   C CB  . ALA A 1 78  ? -16.997 10.601  63.896  1.00 39.27  ? 74  ALA A CB  1 
ATOM   591   N N   . ILE A 1 79  ? -19.163 8.564   64.922  1.00 31.17  ? 75  ILE A N   1 
ATOM   592   C CA  . ILE A 1 79  ? -20.102 8.131   65.950  1.00 17.70  ? 75  ILE A CA  1 
ATOM   593   C C   . ILE A 1 79  ? -20.004 6.627   66.156  1.00 29.88  ? 75  ILE A C   1 
ATOM   594   O O   . ILE A 1 79  ? -20.203 6.131   67.265  1.00 53.25  ? 75  ILE A O   1 
ATOM   595   C CB  . ILE A 1 79  ? -21.546 8.516   65.586  1.00 20.99  ? 75  ILE A CB  1 
ATOM   596   C CG1 . ILE A 1 79  ? -21.725 10.031  65.704  1.00 34.11  ? 75  ILE A CG1 1 
ATOM   597   C CG2 . ILE A 1 79  ? -22.539 7.805   66.494  1.00 21.44  ? 75  ILE A CG2 1 
ATOM   598   C CD1 . ILE A 1 79  ? -22.997 10.546  65.075  1.00 39.12  ? 75  ILE A CD1 1 
ATOM   599   N N   . ALA A 1 80  ? -19.696 5.903   65.086  1.00 19.98  ? 76  ALA A N   1 
ATOM   600   C CA  . ALA A 1 80  ? -19.475 4.467   65.185  1.00 27.68  ? 76  ALA A CA  1 
ATOM   601   C C   . ALA A 1 80  ? -18.291 4.206   66.107  1.00 44.53  ? 76  ALA A C   1 
ATOM   602   O O   . ALA A 1 80  ? -18.292 3.250   66.881  1.00 62.39  ? 76  ALA A O   1 
ATOM   603   C CB  . ALA A 1 80  ? -19.220 3.871   63.811  1.00 29.15  ? 76  ALA A CB  1 
ATOM   604   N N   . ILE A 1 81  ? -17.283 5.069   66.023  1.00 41.74  ? 77  ILE A N   1 
ATOM   605   C CA  . ILE A 1 81  ? -16.100 4.955   66.868  1.00 32.96  ? 77  ILE A CA  1 
ATOM   606   C C   . ILE A 1 81  ? -16.425 5.366   68.303  1.00 33.72  ? 77  ILE A C   1 
ATOM   607   O O   . ILE A 1 81  ? -15.952 4.746   69.255  1.00 28.97  ? 77  ILE A O   1 
ATOM   608   C CB  . ILE A 1 81  ? -14.937 5.819   66.333  1.00 28.40  ? 77  ILE A CB  1 
ATOM   609   C CG1 . ILE A 1 81  ? -14.499 5.329   64.948  1.00 27.17  ? 77  ILE A CG1 1 
ATOM   610   C CG2 . ILE A 1 81  ? -13.761 5.798   67.301  1.00 21.35  ? 77  ILE A CG2 1 
ATOM   611   C CD1 . ILE A 1 81  ? -13.903 3.940   64.942  1.00 10.29  ? 77  ILE A CD1 1 
ATOM   612   N N   . VAL A 1 82  ? -17.234 6.411   68.455  1.00 43.76  ? 78  VAL A N   1 
ATOM   613   C CA  . VAL A 1 82  ? -17.675 6.844   69.778  1.00 45.07  ? 78  VAL A CA  1 
ATOM   614   C C   . VAL A 1 82  ? -18.395 5.707   70.487  1.00 52.81  ? 78  VAL A C   1 
ATOM   615   O O   . VAL A 1 82  ? -18.168 5.456   71.668  1.00 55.36  ? 78  VAL A O   1 
ATOM   616   C CB  . VAL A 1 82  ? -18.628 8.050   69.696  1.00 40.51  ? 78  VAL A CB  1 
ATOM   617   C CG1 . VAL A 1 82  ? -19.355 8.247   71.018  1.00 44.29  ? 78  VAL A CG1 1 
ATOM   618   C CG2 . VAL A 1 82  ? -17.865 9.308   69.316  1.00 48.41  ? 78  VAL A CG2 1 
ATOM   619   N N   . GLN A 1 83  ? -19.265 5.023   69.751  1.00 49.05  ? 79  GLN A N   1 
ATOM   620   C CA  . GLN A 1 83  ? -20.031 3.910   70.296  1.00 43.77  ? 79  GLN A CA  1 
ATOM   621   C C   . GLN A 1 83  ? -19.121 2.753   70.693  1.00 52.30  ? 79  GLN A C   1 
ATOM   622   O O   . GLN A 1 83  ? -19.327 2.121   71.731  1.00 49.66  ? 79  GLN A O   1 
ATOM   623   C CB  . GLN A 1 83  ? -21.071 3.437   69.279  1.00 42.27  ? 79  GLN A CB  1 
ATOM   624   C CG  . GLN A 1 83  ? -22.242 4.393   69.111  1.00 41.32  ? 79  GLN A CG  1 
ATOM   625   C CD  . GLN A 1 83  ? -23.129 4.043   67.933  1.00 49.34  ? 79  GLN A CD  1 
ATOM   626   O OE1 . GLN A 1 83  ? -22.724 3.315   67.028  1.00 59.94  ? 79  GLN A OE1 1 
ATOM   627   N NE2 . GLN A 1 83  ? -24.352 4.560   67.943  1.00 51.60  ? 79  GLN A NE2 1 
ATOM   628   N N   . LEU A 1 84  ? -18.116 2.479   69.867  1.00 45.32  ? 80  LEU A N   1 
ATOM   629   C CA  . LEU A 1 84  ? -17.168 1.406   70.148  1.00 35.33  ? 80  LEU A CA  1 
ATOM   630   C C   . LEU A 1 84  ? -16.315 1.741   71.367  1.00 47.91  ? 80  LEU A C   1 
ATOM   631   O O   . LEU A 1 84  ? -15.767 0.850   72.016  1.00 49.75  ? 80  LEU A O   1 
ATOM   632   C CB  . LEU A 1 84  ? -16.272 1.151   68.936  1.00 32.34  ? 80  LEU A CB  1 
ATOM   633   C CG  . LEU A 1 84  ? -16.952 0.518   67.718  1.00 34.15  ? 80  LEU A CG  1 
ATOM   634   C CD1 . LEU A 1 84  ? -16.020 0.558   66.515  1.00 23.09  ? 80  LEU A CD1 1 
ATOM   635   C CD2 . LEU A 1 84  ? -17.397 -0.913  68.007  1.00 20.13  ? 80  LEU A CD2 1 
ATOM   636   N N   . GLN A 1 85  ? -16.205 3.030   71.672  1.00 47.10  ? 81  GLN A N   1 
ATOM   637   C CA  . GLN A 1 85  ? -15.468 3.477   72.849  1.00 43.46  ? 81  GLN A CA  1 
ATOM   638   C C   . GLN A 1 85  ? -16.355 3.455   74.091  1.00 43.06  ? 81  GLN A C   1 
ATOM   639   O O   . GLN A 1 85  ? -15.873 3.242   75.204  1.00 45.88  ? 81  GLN A O   1 
ATOM   640   C CB  . GLN A 1 85  ? -14.899 4.877   72.620  1.00 45.67  ? 81  GLN A CB  1 
ATOM   641   C CG  . GLN A 1 85  ? -13.755 4.908   71.617  1.00 56.72  ? 81  GLN A CG  1 
ATOM   642   C CD  . GLN A 1 85  ? -13.243 6.309   71.354  1.00 49.84  ? 81  GLN A CD  1 
ATOM   643   O OE1 . GLN A 1 85  ? -13.967 7.160   70.838  1.00 52.88  ? 81  GLN A OE1 1 
ATOM   644   N NE2 . GLN A 1 85  ? -11.989 6.558   71.714  1.00 55.10  ? 81  GLN A NE2 1 
ATOM   645   N N   . GLU A 1 86  ? -17.652 3.678   73.897  1.00 51.89  ? 82  GLU A N   1 
ATOM   646   C CA  . GLU A 1 86  ? -18.620 3.545   74.979  1.00 43.54  ? 82  GLU A CA  1 
ATOM   647   C C   . GLU A 1 86  ? -18.727 2.077   75.366  1.00 38.64  ? 82  GLU A C   1 
ATOM   648   O O   . GLU A 1 86  ? -18.926 1.739   76.532  1.00 47.69  ? 82  GLU A O   1 
ATOM   649   C CB  . GLU A 1 86  ? -19.990 4.068   74.544  1.00 44.02  ? 82  GLU A CB  1 
ATOM   650   C CG  . GLU A 1 86  ? -20.060 5.578   74.369  1.00 42.35  ? 82  GLU A CG  1 
ATOM   651   C CD  . GLU A 1 86  ? -21.399 6.043   73.825  1.00 46.98  ? 82  GLU A CD  1 
ATOM   652   O OE1 . GLU A 1 86  ? -21.597 7.269   73.699  1.00 52.89  ? 82  GLU A OE1 1 
ATOM   653   O OE2 . GLU A 1 86  ? -22.253 5.183   73.525  1.00 60.97  ? 82  GLU A OE2 1 
ATOM   654   N N   . LEU A 1 87  ? -18.593 1.211   74.366  1.00 33.63  ? 83  LEU A N   1 
ATOM   655   C CA  . LEU A 1 87  ? -18.611 -0.230  74.574  1.00 16.98  ? 83  LEU A CA  1 
ATOM   656   C C   . LEU A 1 87  ? -17.394 -0.677  75.373  1.00 31.09  ? 83  LEU A C   1 
ATOM   657   O O   . LEU A 1 87  ? -17.510 -1.457  76.317  1.00 37.54  ? 83  LEU A O   1 
ATOM   658   C CB  . LEU A 1 87  ? -18.630 -0.948  73.224  1.00 32.02  ? 83  LEU A CB  1 
ATOM   659   C CG  . LEU A 1 87  ? -18.260 -2.432  73.236  1.00 37.18  ? 83  LEU A CG  1 
ATOM   660   C CD1 . LEU A 1 87  ? -19.282 -3.238  74.024  1.00 55.08  ? 83  LEU A CD1 1 
ATOM   661   C CD2 . LEU A 1 87  ? -18.130 -2.953  71.814  1.00 16.15  ? 83  LEU A CD2 1 
ATOM   662   N N   . SER A 1 88  ? -16.224 -0.180  74.984  1.00 44.73  ? 84  SER A N   1 
ATOM   663   C CA  . SER A 1 88  ? -14.978 -0.567  75.632  1.00 42.12  ? 84  SER A CA  1 
ATOM   664   C C   . SER A 1 88  ? -14.969 -0.151  77.098  1.00 50.55  ? 84  SER A C   1 
ATOM   665   O O   . SER A 1 88  ? -14.467 -0.880  77.953  1.00 62.88  ? 84  SER A O   1 
ATOM   666   C CB  . SER A 1 88  ? -13.784 0.047   74.901  1.00 24.72  ? 84  SER A CB  1 
ATOM   667   O OG  . SER A 1 88  ? -13.631 -0.526  73.615  1.00 30.19  ? 84  SER A OG  1 
ATOM   668   N N   . LEU A 1 89  ? -15.529 1.019   77.383  1.00 45.97  ? 85  LEU A N   1 
ATOM   669   C CA  . LEU A 1 89  ? -15.612 1.507   78.752  1.00 57.83  ? 85  LEU A CA  1 
ATOM   670   C C   . LEU A 1 89  ? -16.299 0.453   79.609  1.00 72.30  ? 85  LEU A C   1 
ATOM   671   O O   . LEU A 1 89  ? -15.851 0.142   80.713  1.00 79.16  ? 85  LEU A O   1 
ATOM   672   C CB  . LEU A 1 89  ? -16.395 2.820   78.804  1.00 52.87  ? 85  LEU A CB  1 
ATOM   673   C CG  . LEU A 1 89  ? -16.100 3.758   79.979  1.00 61.46  ? 85  LEU A CG  1 
ATOM   674   C CD1 . LEU A 1 89  ? -16.885 5.051   79.824  1.00 72.25  ? 85  LEU A CD1 1 
ATOM   675   C CD2 . LEU A 1 89  ? -16.411 3.108   81.317  1.00 67.68  ? 85  LEU A CD2 1 
ATOM   676   N N   . ARG A 1 90  ? -17.384 -0.104  79.082  1.00 66.89  ? 86  ARG A N   1 
ATOM   677   C CA  . ARG A 1 90  ? -18.156 -1.107  79.801  1.00 56.17  ? 86  ARG A CA  1 
ATOM   678   C C   . ARG A 1 90  ? -17.415 -2.438  79.856  1.00 45.55  ? 86  ARG A C   1 
ATOM   679   O O   . ARG A 1 90  ? -17.524 -3.179  80.833  1.00 53.75  ? 86  ARG A O   1 
ATOM   680   C CB  . ARG A 1 90  ? -19.519 -1.301  79.138  1.00 56.67  ? 86  ARG A CB  1 
ATOM   681   C CG  . ARG A 1 90  ? -20.333 -0.021  79.031  1.00 49.35  ? 86  ARG A CG  1 
ATOM   682   C CD  . ARG A 1 90  ? -21.687 -0.258  78.389  1.00 53.63  ? 86  ARG A CD  1 
ATOM   683   N NE  . ARG A 1 90  ? -21.941 0.688   77.301  1.00 60.67  ? 86  ARG A NE  1 
ATOM   684   C CZ  . ARG A 1 90  ? -22.028 0.371   76.009  1.00 53.97  ? 86  ARG A CZ  1 
ATOM   685   N NH1 . ARG A 1 90  ? -21.906 -0.885  75.592  1.00 33.76  ? 86  ARG A NH1 1 
ATOM   686   N NH2 . ARG A 1 90  ? -22.255 1.326   75.118  1.00 68.82  ? 86  ARG A NH2 1 
ATOM   687   N N   . LEU A 1 91  ? -16.661 -2.737  78.803  1.00 46.05  ? 87  LEU A N   1 
ATOM   688   C CA  . LEU A 1 91  ? -15.910 -3.986  78.731  1.00 41.39  ? 87  LEU A CA  1 
ATOM   689   C C   . LEU A 1 91  ? -14.783 -4.045  79.759  1.00 43.15  ? 87  LEU A C   1 
ATOM   690   O O   . LEU A 1 91  ? -14.336 -5.128  80.127  1.00 48.55  ? 87  LEU A O   1 
ATOM   691   C CB  . LEU A 1 91  ? -15.336 -4.186  77.327  1.00 32.89  ? 87  LEU A CB  1 
ATOM   692   C CG  . LEU A 1 91  ? -16.268 -4.826  76.296  1.00 29.97  ? 87  LEU A CG  1 
ATOM   693   C CD1 . LEU A 1 91  ? -15.620 -4.827  74.923  1.00 19.57  ? 87  LEU A CD1 1 
ATOM   694   C CD2 . LEU A 1 91  ? -16.637 -6.245  76.705  1.00 41.94  ? 87  LEU A CD2 1 
ATOM   695   N N   . LYS A 1 92  ? -14.329 -2.886  80.226  1.00 45.95  ? 88  LYS A N   1 
ATOM   696   C CA  . LYS A 1 92  ? -13.229 -2.834  81.186  1.00 55.03  ? 88  LYS A CA  1 
ATOM   697   C C   . LYS A 1 92  ? -13.553 -3.565  82.488  1.00 67.15  ? 88  LYS A C   1 
ATOM   698   O O   . LYS A 1 92  ? -12.653 -4.060  83.168  1.00 75.18  ? 88  LYS A O   1 
ATOM   699   C CB  . LYS A 1 92  ? -12.844 -1.385  81.486  1.00 45.50  ? 88  LYS A CB  1 
ATOM   700   C CG  . LYS A 1 92  ? -12.212 -0.666  80.310  1.00 55.16  ? 88  LYS A CG  1 
ATOM   701   C CD  . LYS A 1 92  ? -11.441 0.562   80.755  1.00 71.87  ? 88  LYS A CD  1 
ATOM   702   C CE  . LYS A 1 92  ? -10.889 1.338   79.568  1.00 80.87  ? 88  LYS A CE  1 
ATOM   703   N NZ  . LYS A 1 92  ? -10.047 0.496   78.672  1.00 80.93  ? 88  LYS A NZ  1 
ATOM   704   N N   . SER A 1 93  ? -14.835 -3.633  82.833  1.00 60.04  ? 89  SER A N   1 
ATOM   705   C CA  . SER A 1 93  ? -15.262 -4.343  84.035  1.00 60.90  ? 89  SER A CA  1 
ATOM   706   C C   . SER A 1 93  ? -15.115 -5.855  83.862  1.00 67.45  ? 89  SER A C   1 
ATOM   707   O O   . SER A 1 93  ? -15.244 -6.613  84.822  1.00 74.87  ? 89  SER A O   1 
ATOM   708   C CB  . SER A 1 93  ? -16.713 -3.996  84.376  1.00 63.02  ? 89  SER A CB  1 
ATOM   709   O OG  . SER A 1 93  ? -17.603 -4.430  83.361  1.00 60.61  ? 89  SER A OG  1 
ATOM   710   N N   . CYS A 1 94  ? -14.844 -6.283  82.632  1.00 63.92  ? 90  CYS A N   1 
ATOM   711   C CA  . CYS A 1 94  ? -14.687 -7.699  82.321  1.00 52.42  ? 90  CYS A CA  1 
ATOM   712   C C   . CYS A 1 94  ? -13.214 -8.100  82.275  1.00 54.31  ? 90  CYS A C   1 
ATOM   713   O O   . CYS A 1 94  ? -12.884 -9.279  82.397  1.00 61.53  ? 90  CYS A O   1 
ATOM   714   C CB  . CYS A 1 94  ? -15.347 -8.012  80.979  1.00 49.95  ? 90  CYS A CB  1 
ATOM   715   S SG  . CYS A 1 94  ? -16.953 -7.220  80.746  1.00 56.86  ? 90  CYS A SG  1 
ATOM   716   N N   . PHE A 1 95  ? -12.336 -7.117  82.089  1.00 65.74  ? 91  PHE A N   1 
ATOM   717   C CA  . PHE A 1 95  ? -10.896 -7.360  82.067  1.00 64.06  ? 91  PHE A CA  1 
ATOM   718   C C   . PHE A 1 95  ? -10.265 -6.930  83.386  1.00 67.28  ? 91  PHE A C   1 
ATOM   719   O O   . PHE A 1 95  ? -10.370 -5.768  83.781  1.00 75.64  ? 91  PHE A O   1 
ATOM   720   C CB  . PHE A 1 95  ? -10.237 -6.595  80.915  1.00 46.17  ? 91  PHE A CB  1 
ATOM   721   C CG  . PHE A 1 95  ? -10.651 -7.070  79.549  1.00 42.73  ? 91  PHE A CG  1 
ATOM   722   C CD1 . PHE A 1 95  ? -11.870 -6.696  79.014  1.00 32.04  ? 91  PHE A CD1 1 
ATOM   723   C CD2 . PHE A 1 95  ? -9.817  -7.882  78.797  1.00 59.31  ? 91  PHE A CD2 1 
ATOM   724   C CE1 . PHE A 1 95  ? -12.257 -7.125  77.759  1.00 31.49  ? 91  PHE A CE1 1 
ATOM   725   C CE2 . PHE A 1 95  ? -10.200 -8.315  77.538  1.00 56.57  ? 91  PHE A CE2 1 
ATOM   726   C CZ  . PHE A 1 95  ? -11.421 -7.935  77.020  1.00 44.09  ? 91  PHE A CZ  1 
ATOM   727   N N   . THR A 1 96  ? -9.611  -7.867  84.066  1.00 53.48  ? 92  THR A N   1 
ATOM   728   C CA  . THR A 1 96  ? -8.922  -7.559  85.313  1.00 59.74  ? 92  THR A CA  1 
ATOM   729   C C   . THR A 1 96  ? -7.561  -6.932  85.028  1.00 69.65  ? 92  THR A C   1 
ATOM   730   O O   . THR A 1 96  ? -6.842  -7.369  84.129  1.00 79.25  ? 92  THR A O   1 
ATOM   731   C CB  . THR A 1 96  ? -8.726  -8.818  86.179  1.00 57.43  ? 92  THR A CB  1 
ATOM   732   O OG1 . THR A 1 96  ? -8.075  -9.837  85.409  1.00 58.06  ? 92  THR A OG1 1 
ATOM   733   C CG2 . THR A 1 96  ? -10.067 -9.339  86.676  1.00 57.54  ? 92  THR A CG2 1 
ATOM   734   N N   . LYS A 1 97  ? -7.216  -5.903  85.795  1.00 63.94  ? 93  LYS A N   1 
ATOM   735   C CA  . LYS A 1 97  ? -5.940  -5.217  85.632  1.00 62.07  ? 93  LYS A CA  1 
ATOM   736   C C   . LYS A 1 97  ? -4.770  -6.158  85.902  1.00 59.29  ? 93  LYS A C   1 
ATOM   737   O O   . LYS A 1 97  ? -4.867  -7.064  86.730  1.00 69.15  ? 93  LYS A O   1 
ATOM   738   C CB  . LYS A 1 97  ? -5.862  -4.017  86.577  1.00 78.60  ? 93  LYS A CB  1 
ATOM   739   C CG  . LYS A 1 97  ? -6.679  -2.816  86.130  1.00 90.39  ? 93  LYS A CG  1 
ATOM   740   C CD  . LYS A 1 97  ? -6.053  -2.144  84.919  1.00 99.37  ? 93  LYS A CD  1 
ATOM   741   C CE  . LYS A 1 97  ? -5.979  -0.637  85.099  1.00 101.37 ? 93  LYS A CE  1 
ATOM   742   N NZ  . LYS A 1 97  ? -5.203  0.018   84.010  1.00 101.97 ? 93  LYS A NZ  1 
ATOM   743   N N   . ASP A 1 98  ? -3.664  -5.937  85.196  1.00 54.27  ? 94  ASP A N   1 
ATOM   744   C CA  . ASP A 1 98  ? -2.454  -6.731  85.385  1.00 63.69  ? 94  ASP A CA  1 
ATOM   745   C C   . ASP A 1 98  ? -1.272  -5.842  85.760  1.00 60.29  ? 94  ASP A C   1 
ATOM   746   O O   . ASP A 1 98  ? -1.439  -4.657  86.051  1.00 49.12  ? 94  ASP A O   1 
ATOM   747   C CB  . ASP A 1 98  ? -2.127  -7.520  84.115  1.00 67.66  ? 94  ASP A CB  1 
ATOM   748   C CG  . ASP A 1 98  ? -3.075  -8.682  83.888  1.00 63.60  ? 94  ASP A CG  1 
ATOM   749   O OD1 . ASP A 1 98  ? -4.269  -8.556  84.230  1.00 68.65  ? 94  ASP A OD1 1 
ATOM   750   O OD2 . ASP A 1 98  ? -2.625  -9.725  83.368  1.00 56.34  ? 94  ASP A OD2 1 
ATOM   751   N N   . LYS A 1 104 ? 4.854   -1.708  78.098  1.00 73.74  ? 100 LYS A N   1 
ATOM   752   C CA  . LYS A 1 104 ? 4.865   -2.044  76.679  1.00 84.52  ? 100 LYS A CA  1 
ATOM   753   C C   . LYS A 1 104 ? 5.516   -3.405  76.438  1.00 81.49  ? 100 LYS A C   1 
ATOM   754   O O   . LYS A 1 104 ? 6.491   -3.521  75.695  1.00 69.82  ? 100 LYS A O   1 
ATOM   755   C CB  . LYS A 1 104 ? 5.584   -0.953  75.878  1.00 84.97  ? 100 LYS A CB  1 
ATOM   756   C CG  . LYS A 1 104 ? 4.646   0.084   75.280  1.00 80.48  ? 100 LYS A CG  1 
ATOM   757   C CD  . LYS A 1 104 ? 5.404   1.254   74.673  1.00 75.32  ? 100 LYS A CD  1 
ATOM   758   C CE  . LYS A 1 104 ? 4.503   2.088   73.772  1.00 71.97  ? 100 LYS A CE  1 
ATOM   759   N NZ  . LYS A 1 104 ? 5.161   3.345   73.313  1.00 59.80  ? 100 LYS A NZ  1 
ATOM   760   N N   . ALA A 1 105 ? 4.964   -4.435  77.072  1.00 90.55  ? 101 ALA A N   1 
ATOM   761   C CA  . ALA A 1 105 ? 5.459   -5.796  76.902  1.00 91.93  ? 101 ALA A CA  1 
ATOM   762   C C   . ALA A 1 105 ? 4.630   -6.540  75.862  1.00 76.34  ? 101 ALA A C   1 
ATOM   763   O O   . ALA A 1 105 ? 3.409   -6.396  75.813  1.00 74.82  ? 101 ALA A O   1 
ATOM   764   C CB  . ALA A 1 105 ? 5.423   -6.534  78.227  1.00 99.42  ? 101 ALA A CB  1 
ATOM   765   N N   . CYS A 1 106 ? 5.301   -7.336  75.034  1.00 74.20  ? 102 CYS A N   1 
ATOM   766   C CA  . CYS A 1 106 ? 4.638   -8.094  73.976  1.00 83.20  ? 102 CYS A CA  1 
ATOM   767   C C   . CYS A 1 106 ? 4.103   -7.158  72.895  1.00 76.62  ? 102 CYS A C   1 
ATOM   768   O O   . CYS A 1 106 ? 3.210   -7.528  72.132  1.00 75.65  ? 102 CYS A O   1 
ATOM   769   C CB  . CYS A 1 106 ? 3.485   -8.932  74.542  1.00 89.47  ? 102 CYS A CB  1 
ATOM   770   S SG  . CYS A 1 106 ? 3.895   -9.926  75.998  1.00 58.23  ? 102 CYS A SG  1 
ATOM   771   N N   . VAL A 1 107 ? 4.653   -5.947  72.831  1.00 73.80  ? 103 VAL A N   1 
ATOM   772   C CA  . VAL A 1 107 ? 4.182   -4.936  71.887  1.00 70.48  ? 103 VAL A CA  1 
ATOM   773   C C   . VAL A 1 107 ? 5.175   -4.731  70.743  1.00 62.03  ? 103 VAL A C   1 
ATOM   774   O O   . VAL A 1 107 ? 6.387   -4.711  70.956  1.00 69.05  ? 103 VAL A O   1 
ATOM   775   C CB  . VAL A 1 107 ? 3.954   -3.580  72.591  1.00 68.43  ? 103 VAL A CB  1 
ATOM   776   C CG1 . VAL A 1 107 ? 3.339   -2.570  71.628  1.00 76.20  ? 103 VAL A CG1 1 
ATOM   777   C CG2 . VAL A 1 107 ? 3.071   -3.759  73.816  1.00 63.15  ? 103 VAL A CG2 1 
ATOM   778   N N   . ARG A 1 108 ? 4.652   -4.579  69.530  1.00 51.65  ? 104 ARG A N   1 
ATOM   779   C CA  . ARG A 1 108 ? 5.482   -4.312  68.361  1.00 53.28  ? 104 ARG A CA  1 
ATOM   780   C C   . ARG A 1 108 ? 4.814   -3.260  67.481  1.00 50.36  ? 104 ARG A C   1 
ATOM   781   O O   . ARG A 1 108 ? 3.594   -3.100  67.511  1.00 59.71  ? 104 ARG A O   1 
ATOM   782   C CB  . ARG A 1 108 ? 5.706   -5.597  67.559  1.00 54.87  ? 104 ARG A CB  1 
ATOM   783   C CG  . ARG A 1 108 ? 6.354   -6.726  68.350  1.00 68.16  ? 104 ARG A CG  1 
ATOM   784   C CD  . ARG A 1 108 ? 7.866   -6.583  68.427  1.00 75.82  ? 104 ARG A CD  1 
ATOM   785   N NE  . ARG A 1 108 ? 8.452   -7.528  69.380  1.00 89.51  ? 104 ARG A NE  1 
ATOM   786   C CZ  . ARG A 1 108 ? 9.645   -8.106  69.248  1.00 102.49 ? 104 ARG A CZ  1 
ATOM   787   N NH1 . ARG A 1 108 ? 10.413  -7.856  68.195  1.00 105.79 ? 104 ARG A NH1 1 
ATOM   788   N NH2 . ARG A 1 108 ? 10.072  -8.949  70.177  1.00 102.79 ? 104 ARG A NH2 1 
ATOM   789   N N   . THR A 1 109 ? 5.617   -2.539  66.706  1.00 42.95  ? 105 THR A N   1 
ATOM   790   C CA  . THR A 1 109 ? 5.089   -1.559  65.763  1.00 42.88  ? 105 THR A CA  1 
ATOM   791   C C   . THR A 1 109 ? 4.806   -2.208  64.408  1.00 49.63  ? 105 THR A C   1 
ATOM   792   O O   . THR A 1 109 ? 5.705   -2.751  63.766  1.00 56.37  ? 105 THR A O   1 
ATOM   793   C CB  . THR A 1 109 ? 6.063   -0.385  65.560  1.00 32.88  ? 105 THR A CB  1 
ATOM   794   O OG1 . THR A 1 109 ? 6.128   0.401   66.756  1.00 35.16  ? 105 THR A OG1 1 
ATOM   795   C CG2 . THR A 1 109 ? 5.600   0.497   64.417  1.00 29.55  ? 105 THR A CG2 1 
ATOM   796   N N   . PHE A 1 110 ? 3.549   -2.144  63.981  1.00 41.62  ? 106 PHE A N   1 
ATOM   797   C CA  . PHE A 1 110 ? 3.136   -2.719  62.708  1.00 51.95  ? 106 PHE A CA  1 
ATOM   798   C C   . PHE A 1 110 ? 3.134   -1.659  61.613  1.00 56.98  ? 106 PHE A C   1 
ATOM   799   O O   . PHE A 1 110 ? 2.739   -0.516  61.844  1.00 61.46  ? 106 PHE A O   1 
ATOM   800   C CB  . PHE A 1 110 ? 1.737   -3.328  62.834  1.00 59.32  ? 106 PHE A CB  1 
ATOM   801   C CG  . PHE A 1 110 ? 1.699   -4.616  63.609  1.00 50.38  ? 106 PHE A CG  1 
ATOM   802   C CD1 . PHE A 1 110 ? 2.030   -4.643  64.952  1.00 47.02  ? 106 PHE A CD1 1 
ATOM   803   C CD2 . PHE A 1 110 ? 1.319   -5.798  62.994  1.00 52.66  ? 106 PHE A CD2 1 
ATOM   804   C CE1 . PHE A 1 110 ? 1.992   -5.826  65.666  1.00 40.31  ? 106 PHE A CE1 1 
ATOM   805   C CE2 . PHE A 1 110 ? 1.276   -6.982  63.703  1.00 44.41  ? 106 PHE A CE2 1 
ATOM   806   C CZ  . PHE A 1 110 ? 1.615   -6.996  65.041  1.00 42.97  ? 106 PHE A CZ  1 
ATOM   807   N N   . TYR A 1 111 ? 3.579   -2.046  60.421  1.00 63.62  ? 107 TYR A N   1 
ATOM   808   C CA  . TYR A 1 111 ? 3.546   -1.159  59.263  1.00 65.62  ? 107 TYR A CA  1 
ATOM   809   C C   . TYR A 1 111 ? 2.687   -1.787  58.171  1.00 59.27  ? 107 TYR A C   1 
ATOM   810   O O   . TYR A 1 111 ? 3.196   -2.439  57.257  1.00 54.47  ? 107 TYR A O   1 
ATOM   811   C CB  . TYR A 1 111 ? 4.960   -0.889  58.748  1.00 62.56  ? 107 TYR A CB  1 
ATOM   812   C CG  . TYR A 1 111 ? 5.060   0.326   57.851  1.00 59.28  ? 107 TYR A CG  1 
ATOM   813   C CD1 . TYR A 1 111 ? 4.705   1.586   58.315  1.00 56.53  ? 107 TYR A CD1 1 
ATOM   814   C CD2 . TYR A 1 111 ? 5.503   0.214   56.540  1.00 61.77  ? 107 TYR A CD2 1 
ATOM   815   C CE1 . TYR A 1 111 ? 4.793   2.699   57.502  1.00 48.54  ? 107 TYR A CE1 1 
ATOM   816   C CE2 . TYR A 1 111 ? 5.596   1.322   55.720  1.00 57.88  ? 107 TYR A CE2 1 
ATOM   817   C CZ  . TYR A 1 111 ? 5.239   2.561   56.206  1.00 52.35  ? 107 TYR A CZ  1 
ATOM   818   O OH  . TYR A 1 111 ? 5.328   3.667   55.392  1.00 60.82  ? 107 TYR A OH  1 
ATOM   819   N N   . GLU A 1 112 ? 1.379   -1.583  58.279  1.00 46.31  ? 108 GLU A N   1 
ATOM   820   C CA  . GLU A 1 112 ? 0.421   -2.213  57.381  1.00 53.24  ? 108 GLU A CA  1 
ATOM   821   C C   . GLU A 1 112 ? -0.618  -1.203  56.906  1.00 59.77  ? 108 GLU A C   1 
ATOM   822   O O   . GLU A 1 112 ? -0.754  -0.126  57.484  1.00 69.48  ? 108 GLU A O   1 
ATOM   823   C CB  . GLU A 1 112 ? -0.265  -3.378  58.097  1.00 66.17  ? 108 GLU A CB  1 
ATOM   824   C CG  . GLU A 1 112 ? 0.702   -4.442  58.602  1.00 67.18  ? 108 GLU A CG  1 
ATOM   825   C CD  . GLU A 1 112 ? 0.035   -5.473  59.495  1.00 51.97  ? 108 GLU A CD  1 
ATOM   826   O OE1 . GLU A 1 112 ? -0.997  -5.146  60.117  1.00 52.50  ? 108 GLU A OE1 1 
ATOM   827   O OE2 . GLU A 1 112 ? 0.543   -6.612  59.574  1.00 54.76  ? 108 GLU A OE2 1 
ATOM   828   N N   . THR A 1 113 ? -1.351  -1.559  55.855  1.00 49.49  ? 109 THR A N   1 
ATOM   829   C CA  . THR A 1 113 ? -2.350  -0.665  55.280  1.00 39.49  ? 109 THR A CA  1 
ATOM   830   C C   . THR A 1 113 ? -3.457  -0.393  56.295  1.00 45.40  ? 109 THR A C   1 
ATOM   831   O O   . THR A 1 113 ? -3.674  -1.192  57.207  1.00 56.53  ? 109 THR A O   1 
ATOM   832   C CB  . THR A 1 113 ? -2.984  -1.262  54.005  1.00 30.30  ? 109 THR A CB  1 
ATOM   833   O OG1 . THR A 1 113 ? -3.732  -2.436  54.342  1.00 41.42  ? 109 THR A OG1 1 
ATOM   834   C CG2 . THR A 1 113 ? -1.918  -1.628  52.980  1.00 30.54  ? 109 THR A CG2 1 
ATOM   835   N N   . PRO A 1 114 ? -4.161  0.741   56.142  1.00 42.24  ? 110 PRO A N   1 
ATOM   836   C CA  . PRO A 1 114 ? -5.256  1.106   57.051  1.00 44.90  ? 110 PRO A CA  1 
ATOM   837   C C   . PRO A 1 114 ? -6.333  0.026   57.159  1.00 40.22  ? 110 PRO A C   1 
ATOM   838   O O   . PRO A 1 114 ? -6.828  -0.237  58.256  1.00 29.33  ? 110 PRO A O   1 
ATOM   839   C CB  . PRO A 1 114 ? -5.835  2.369   56.407  1.00 46.75  ? 110 PRO A CB  1 
ATOM   840   C CG  . PRO A 1 114 ? -4.702  2.953   55.641  1.00 43.36  ? 110 PRO A CG  1 
ATOM   841   C CD  . PRO A 1 114 ? -3.907  1.787   55.137  1.00 38.06  ? 110 PRO A CD  1 
ATOM   842   N N   . LEU A 1 115 ? -6.690  -0.589  56.036  1.00 40.63  ? 111 LEU A N   1 
ATOM   843   C CA  . LEU A 1 115 ? -7.714  -1.630  56.031  1.00 41.40  ? 111 LEU A CA  1 
ATOM   844   C C   . LEU A 1 115 ? -7.251  -2.861  56.807  1.00 49.16  ? 111 LEU A C   1 
ATOM   845   O O   . LEU A 1 115 ? -8.037  -3.486  57.519  1.00 50.53  ? 111 LEU A O   1 
ATOM   846   C CB  . LEU A 1 115 ? -8.091  -2.005  54.597  1.00 27.61  ? 111 LEU A CB  1 
ATOM   847   C CG  . LEU A 1 115 ? -8.932  -0.952  53.866  1.00 45.19  ? 111 LEU A CG  1 
ATOM   848   C CD1 . LEU A 1 115 ? -8.836  -1.116  52.356  1.00 54.05  ? 111 LEU A CD1 1 
ATOM   849   C CD2 . LEU A 1 115 ? -10.383 -1.029  54.314  1.00 40.37  ? 111 LEU A CD2 1 
ATOM   850   N N   . GLN A 1 116 ? -5.972  -3.200  56.674  1.00 46.26  ? 112 GLN A N   1 
ATOM   851   C CA  . GLN A 1 116 ? -5.397  -4.310  57.424  1.00 39.66  ? 112 GLN A CA  1 
ATOM   852   C C   . GLN A 1 116 ? -5.491  -4.045  58.922  1.00 38.15  ? 112 GLN A C   1 
ATOM   853   O O   . GLN A 1 116 ? -5.685  -4.968  59.713  1.00 35.24  ? 112 GLN A O   1 
ATOM   854   C CB  . GLN A 1 116 ? -3.937  -4.533  57.027  1.00 42.24  ? 112 GLN A CB  1 
ATOM   855   C CG  . GLN A 1 116 ? -3.754  -5.213  55.680  1.00 36.37  ? 112 GLN A CG  1 
ATOM   856   C CD  . GLN A 1 116 ? -2.293  -5.385  55.314  1.00 43.27  ? 112 GLN A CD  1 
ATOM   857   O OE1 . GLN A 1 116 ? -1.550  -4.410  55.200  1.00 59.63  ? 112 GLN A OE1 1 
ATOM   858   N NE2 . GLN A 1 116 ? -1.871  -6.630  55.135  1.00 48.60  ? 112 GLN A NE2 1 
ATOM   859   N N   . LEU A 1 117 ? -5.350  -2.780  59.304  1.00 43.27  ? 113 LEU A N   1 
ATOM   860   C CA  . LEU A 1 117 ? -5.477  -2.382  60.701  1.00 49.72  ? 113 LEU A CA  1 
ATOM   861   C C   . LEU A 1 117 ? -6.916  -2.541  61.182  1.00 58.41  ? 113 LEU A C   1 
ATOM   862   O O   . LEU A 1 117 ? -7.169  -3.142  62.226  1.00 60.82  ? 113 LEU A O   1 
ATOM   863   C CB  . LEU A 1 117 ? -5.029  -0.930  60.888  1.00 52.16  ? 113 LEU A CB  1 
ATOM   864   C CG  . LEU A 1 117 ? -5.382  -0.299  62.238  1.00 59.41  ? 113 LEU A CG  1 
ATOM   865   C CD1 . LEU A 1 117 ? -4.749  -1.077  63.382  1.00 56.45  ? 113 LEU A CD1 1 
ATOM   866   C CD2 . LEU A 1 117 ? -4.956  1.159   62.280  1.00 55.91  ? 113 LEU A CD2 1 
ATOM   867   N N   . LEU A 1 118 ? -7.856  -1.995  60.417  1.00 58.58  ? 114 LEU A N   1 
ATOM   868   C CA  . LEU A 1 118 ? -9.267  -2.074  60.771  1.00 51.29  ? 114 LEU A CA  1 
ATOM   869   C C   . LEU A 1 118 ? -9.729  -3.524  60.842  1.00 48.00  ? 114 LEU A C   1 
ATOM   870   O O   . LEU A 1 118 ? -10.634 -3.857  61.606  1.00 50.34  ? 114 LEU A O   1 
ATOM   871   C CB  . LEU A 1 118 ? -10.118 -1.306  59.759  1.00 44.58  ? 114 LEU A CB  1 
ATOM   872   C CG  . LEU A 1 118 ? -9.934  0.213   59.751  1.00 36.22  ? 114 LEU A CG  1 
ATOM   873   C CD1 . LEU A 1 118 ? -10.668 0.831   58.573  1.00 35.66  ? 114 LEU A CD1 1 
ATOM   874   C CD2 . LEU A 1 118 ? -10.416 0.818   61.062  1.00 21.01  ? 114 LEU A CD2 1 
ATOM   875   N N   . GLU A 1 119 ? -9.108  -4.385  60.042  1.00 43.74  ? 115 GLU A N   1 
ATOM   876   C CA  . GLU A 1 119 ? -9.450  -5.801  60.046  1.00 38.21  ? 115 GLU A CA  1 
ATOM   877   C C   . GLU A 1 119 ? -8.985  -6.441  61.350  1.00 39.25  ? 115 GLU A C   1 
ATOM   878   O O   . GLU A 1 119 ? -9.648  -7.329  61.886  1.00 46.53  ? 115 GLU A O   1 
ATOM   879   C CB  . GLU A 1 119 ? -8.811  -6.515  58.856  1.00 48.75  ? 115 GLU A CB  1 
ATOM   880   C CG  . GLU A 1 119 ? -9.661  -7.637  58.284  1.00 59.75  ? 115 GLU A CG  1 
ATOM   881   C CD  . GLU A 1 119 ? -10.832 -7.120  57.470  1.00 60.98  ? 115 GLU A CD  1 
ATOM   882   O OE1 . GLU A 1 119 ? -10.615 -6.234  56.615  1.00 54.09  ? 115 GLU A OE1 1 
ATOM   883   O OE2 . GLU A 1 119 ? -11.968 -7.595  57.685  1.00 59.08  ? 115 GLU A OE2 1 
ATOM   884   N N   . LYS A 1 120 ? -7.841  -5.983  61.852  1.00 42.29  ? 116 LYS A N   1 
ATOM   885   C CA  . LYS A 1 120 ? -7.313  -6.455  63.130  1.00 37.07  ? 116 LYS A CA  1 
ATOM   886   C C   . LYS A 1 120 ? -8.225  -6.044  64.277  1.00 37.08  ? 116 LYS A C   1 
ATOM   887   O O   . LYS A 1 120 ? -8.509  -6.839  65.175  1.00 46.64  ? 116 LYS A O   1 
ATOM   888   C CB  . LYS A 1 120 ? -5.908  -5.902  63.374  1.00 38.00  ? 116 LYS A CB  1 
ATOM   889   C CG  . LYS A 1 120 ? -4.789  -6.765  62.819  1.00 52.15  ? 116 LYS A CG  1 
ATOM   890   C CD  . LYS A 1 120 ? -3.425  -6.216  63.210  1.00 55.43  ? 116 LYS A CD  1 
ATOM   891   C CE  . LYS A 1 120 ? -2.330  -7.255  63.029  1.00 69.66  ? 116 LYS A CE  1 
ATOM   892   N NZ  . LYS A 1 120 ? -2.190  -7.693  61.612  1.00 84.09  ? 116 LYS A NZ  1 
ATOM   893   N N   . VAL A 1 121 ? -8.675  -4.795  64.247  1.00 32.00  ? 117 VAL A N   1 
ATOM   894   C CA  . VAL A 1 121 ? -9.568  -4.288  65.279  1.00 40.70  ? 117 VAL A CA  1 
ATOM   895   C C   . VAL A 1 121 ? -10.856 -5.102  65.292  1.00 38.84  ? 117 VAL A C   1 
ATOM   896   O O   . VAL A 1 121 ? -11.339 -5.496  66.353  1.00 35.90  ? 117 VAL A O   1 
ATOM   897   C CB  . VAL A 1 121 ? -9.899  -2.800  65.058  1.00 44.93  ? 117 VAL A CB  1 
ATOM   898   C CG1 . VAL A 1 121 ? -10.963 -2.336  66.044  1.00 52.11  ? 117 VAL A CG1 1 
ATOM   899   C CG2 . VAL A 1 121 ? -8.638  -1.951  65.190  1.00 40.53  ? 117 VAL A CG2 1 
ATOM   900   N N   . LYS A 1 122 ? -11.405 -5.358  64.109  1.00 50.20  ? 118 LYS A N   1 
ATOM   901   C CA  . LYS A 1 122 ? -12.637 -6.128  63.991  1.00 42.92  ? 118 LYS A CA  1 
ATOM   902   C C   . LYS A 1 122 ? -12.469 -7.519  64.591  1.00 41.83  ? 118 LYS A C   1 
ATOM   903   O O   . LYS A 1 122 ? -13.361 -8.017  65.277  1.00 43.67  ? 118 LYS A O   1 
ATOM   904   C CB  . LYS A 1 122 ? -13.065 -6.243  62.527  1.00 31.75  ? 118 LYS A CB  1 
ATOM   905   C CG  . LYS A 1 122 ? -14.327 -7.067  62.321  1.00 34.04  ? 118 LYS A CG  1 
ATOM   906   C CD  . LYS A 1 122 ? -14.666 -7.216  60.848  1.00 44.58  ? 118 LYS A CD  1 
ATOM   907   C CE  . LYS A 1 122 ? -15.796 -8.212  60.637  1.00 57.19  ? 118 LYS A CE  1 
ATOM   908   N NZ  . LYS A 1 122 ? -17.070 -7.774  61.272  1.00 44.95  ? 118 LYS A NZ  1 
ATOM   909   N N   . ASN A 1 123 ? -11.322 -8.141  64.330  1.00 34.96  ? 119 ASN A N   1 
ATOM   910   C CA  . ASN A 1 123 ? -11.047 -9.485  64.831  1.00 34.76  ? 119 ASN A CA  1 
ATOM   911   C C   . ASN A 1 123 ? -10.906 -9.545  66.353  1.00 43.37  ? 119 ASN A C   1 
ATOM   912   O O   . ASN A 1 123 ? -11.156 -10.586 66.961  1.00 56.09  ? 119 ASN A O   1 
ATOM   913   C CB  . ASN A 1 123 ? -9.787  -10.051 64.175  1.00 33.69  ? 119 ASN A CB  1 
ATOM   914   C CG  . ASN A 1 123 ? -10.013 -10.461 62.732  1.00 61.09  ? 119 ASN A CG  1 
ATOM   915   O OD1 . ASN A 1 123 ? -11.110 -10.304 62.193  1.00 75.91  ? 119 ASN A OD1 1 
ATOM   916   N ND2 . ASN A 1 123 ? -8.971  -10.986 62.095  1.00 55.20  ? 119 ASN A ND2 1 
ATOM   917   N N   . VAL A 1 124 ? -10.501 -8.439  66.970  1.00 30.94  ? 120 VAL A N   1 
ATOM   918   C CA  . VAL A 1 124 ? -10.361 -8.400  68.423  1.00 27.67  ? 120 VAL A CA  1 
ATOM   919   C C   . VAL A 1 124 ? -11.728 -8.330  69.092  1.00 29.46  ? 120 VAL A C   1 
ATOM   920   O O   . VAL A 1 124 ? -11.949 -8.952  70.129  1.00 53.00  ? 120 VAL A O   1 
ATOM   921   C CB  . VAL A 1 124 ? -9.505  -7.207  68.887  1.00 35.97  ? 120 VAL A CB  1 
ATOM   922   C CG1 . VAL A 1 124 ? -9.625  -7.020  70.393  1.00 43.53  ? 120 VAL A CG1 1 
ATOM   923   C CG2 . VAL A 1 124 ? -8.050  -7.409  68.489  1.00 32.98  ? 120 VAL A CG2 1 
ATOM   924   N N   . PHE A 1 125 ? -12.641 -7.569  68.499  1.00 28.08  ? 121 PHE A N   1 
ATOM   925   C CA  . PHE A 1 125 ? -14.013 -7.508  68.989  1.00 29.05  ? 121 PHE A CA  1 
ATOM   926   C C   . PHE A 1 125 ? -14.781 -8.767  68.585  1.00 31.86  ? 121 PHE A C   1 
ATOM   927   O O   . PHE A 1 125 ? -15.671 -9.223  69.305  1.00 23.50  ? 121 PHE A O   1 
ATOM   928   C CB  . PHE A 1 125 ? -14.727 -6.269  68.443  1.00 35.15  ? 121 PHE A CB  1 
ATOM   929   C CG  . PHE A 1 125 ? -14.336 -4.990  69.128  1.00 44.18  ? 121 PHE A CG  1 
ATOM   930   C CD1 . PHE A 1 125 ? -14.864 -4.666  70.368  1.00 50.06  ? 121 PHE A CD1 1 
ATOM   931   C CD2 . PHE A 1 125 ? -13.454 -4.106  68.528  1.00 36.37  ? 121 PHE A CD2 1 
ATOM   932   C CE1 . PHE A 1 125 ? -14.513 -3.487  71.001  1.00 38.55  ? 121 PHE A CE1 1 
ATOM   933   C CE2 . PHE A 1 125 ? -13.100 -2.926  69.156  1.00 36.75  ? 121 PHE A CE2 1 
ATOM   934   C CZ  . PHE A 1 125 ? -13.630 -2.616  70.394  1.00 27.73  ? 121 PHE A CZ  1 
ATOM   935   N N   . ASN A 1 126 ? -14.429 -9.327  67.432  1.00 34.04  ? 122 ASN A N   1 
ATOM   936   C CA  . ASN A 1 126 ? -15.102 -10.516 66.924  1.00 38.15  ? 122 ASN A CA  1 
ATOM   937   C C   . ASN A 1 126 ? -14.732 -11.749 67.742  1.00 39.16  ? 122 ASN A C   1 
ATOM   938   O O   . ASN A 1 126 ? -15.605 -12.508 68.166  1.00 44.75  ? 122 ASN A O   1 
ATOM   939   C CB  . ASN A 1 126 ? -14.749 -10.742 65.453  1.00 47.28  ? 122 ASN A CB  1 
ATOM   940   C CG  . ASN A 1 126 ? -15.628 -11.789 64.795  1.00 59.07  ? 122 ASN A CG  1 
ATOM   941   O OD1 . ASN A 1 126 ? -15.495 -12.984 65.059  1.00 47.18  ? 122 ASN A OD1 1 
ATOM   942   N ND2 . ASN A 1 126 ? -16.527 -11.344 63.924  1.00 74.41  ? 122 ASN A ND2 1 
ATOM   943   N N   . GLU A 1 127 ? -13.436 -11.943 67.964  1.00 23.96  ? 123 GLU A N   1 
ATOM   944   C CA  . GLU A 1 127 ? -12.958 -13.086 68.734  1.00 26.64  ? 123 GLU A CA  1 
ATOM   945   C C   . GLU A 1 127 ? -13.228 -12.894 70.227  1.00 42.29  ? 123 GLU A C   1 
ATOM   946   O O   . GLU A 1 127 ? -13.395 -13.865 70.967  1.00 30.22  ? 123 GLU A O   1 
ATOM   947   C CB  . GLU A 1 127 ? -11.465 -13.311 68.488  1.00 26.30  ? 123 GLU A CB  1 
ATOM   948   C CG  . GLU A 1 127 ? -10.888 -14.521 69.213  1.00 65.22  ? 123 GLU A CG  1 
ATOM   949   C CD  . GLU A 1 127 ? -11.433 -15.841 68.695  1.00 90.35  ? 123 GLU A CD  1 
ATOM   950   O OE1 . GLU A 1 127 ? -12.327 -15.822 67.823  1.00 107.58 ? 123 GLU A OE1 1 
ATOM   951   O OE2 . GLU A 1 127 ? -10.964 -16.901 69.163  1.00 87.28  ? 123 GLU A OE2 1 
ATOM   952   N N   . THR A 1 128 ? -13.271 -11.640 70.666  1.00 41.27  ? 124 THR A N   1 
ATOM   953   C CA  . THR A 1 128 ? -13.605 -11.330 72.049  1.00 35.17  ? 124 THR A CA  1 
ATOM   954   C C   . THR A 1 128 ? -15.076 -11.627 72.309  1.00 47.18  ? 124 THR A C   1 
ATOM   955   O O   . THR A 1 128 ? -15.440 -12.149 73.362  1.00 64.29  ? 124 THR A O   1 
ATOM   956   C CB  . THR A 1 128 ? -13.331 -9.852  72.380  1.00 42.43  ? 124 THR A CB  1 
ATOM   957   O OG1 . THR A 1 128 ? -11.921 -9.599  72.332  1.00 33.08  ? 124 THR A OG1 1 
ATOM   958   C CG2 . THR A 1 128 ? -13.856 -9.502  73.768  1.00 44.79  ? 124 THR A CG2 1 
ATOM   959   N N   . LYS A 1 129 ? -15.922 -11.288 71.342  1.00 37.53  ? 125 LYS A N   1 
ATOM   960   C CA  . LYS A 1 129 ? -17.355 -11.511 71.474  1.00 39.02  ? 125 LYS A CA  1 
ATOM   961   C C   . LYS A 1 129 ? -17.668 -12.997 71.617  1.00 41.95  ? 125 LYS A C   1 
ATOM   962   O O   . LYS A 1 129 ? -18.464 -13.391 72.467  1.00 47.74  ? 125 LYS A O   1 
ATOM   963   C CB  . LYS A 1 129 ? -18.101 -10.942 70.266  1.00 43.61  ? 125 LYS A CB  1 
ATOM   964   C CG  . LYS A 1 129 ? -19.577 -11.312 70.228  1.00 53.24  ? 125 LYS A CG  1 
ATOM   965   C CD  . LYS A 1 129 ? -20.265 -10.764 68.989  1.00 59.17  ? 125 LYS A CD  1 
ATOM   966   C CE  . LYS A 1 129 ? -21.739 -11.143 68.956  1.00 72.29  ? 125 LYS A CE  1 
ATOM   967   N NZ  . LYS A 1 129 ? -21.947 -12.612 68.815  1.00 83.55  ? 125 LYS A NZ  1 
ATOM   968   N N   . ASN A 1 130 ? -17.038 -13.816 70.782  1.00 43.63  ? 126 ASN A N   1 
ATOM   969   C CA  . ASN A 1 130 ? -17.323 -15.246 70.751  1.00 36.78  ? 126 ASN A CA  1 
ATOM   970   C C   . ASN A 1 130 ? -17.028 -15.940 72.074  1.00 31.26  ? 126 ASN A C   1 
ATOM   971   O O   . ASN A 1 130 ? -17.775 -16.817 72.505  1.00 53.93  ? 126 ASN A O   1 
ATOM   972   C CB  . ASN A 1 130 ? -16.527 -15.921 69.634  1.00 38.50  ? 126 ASN A CB  1 
ATOM   973   C CG  . ASN A 1 130 ? -16.915 -15.418 68.260  1.00 55.62  ? 126 ASN A CG  1 
ATOM   974   O OD1 . ASN A 1 130 ? -17.927 -14.734 68.099  1.00 59.14  ? 126 ASN A OD1 1 
ATOM   975   N ND2 . ASN A 1 130 ? -16.117 -15.764 67.257  1.00 70.51  ? 126 ASN A ND2 1 
ATOM   976   N N   . LEU A 1 131 ? -15.937 -15.545 72.717  1.00 30.63  ? 127 LEU A N   1 
ATOM   977   C CA  . LEU A 1 131 ? -15.505 -16.191 73.948  1.00 34.18  ? 127 LEU A CA  1 
ATOM   978   C C   . LEU A 1 131 ? -16.331 -15.740 75.152  1.00 43.79  ? 127 LEU A C   1 
ATOM   979   O O   . LEU A 1 131 ? -16.586 -16.528 76.062  1.00 58.52  ? 127 LEU A O   1 
ATOM   980   C CB  . LEU A 1 131 ? -14.018 -15.924 74.193  1.00 38.10  ? 127 LEU A CB  1 
ATOM   981   C CG  . LEU A 1 131 ? -13.077 -16.366 73.066  1.00 55.15  ? 127 LEU A CG  1 
ATOM   982   C CD1 . LEU A 1 131 ? -11.627 -16.099 73.443  1.00 68.74  ? 127 LEU A CD1 1 
ATOM   983   C CD2 . LEU A 1 131 ? -13.277 -17.835 72.720  1.00 46.98  ? 127 LEU A CD2 1 
ATOM   984   N N   . LEU A 1 132 ? -16.750 -14.478 75.159  1.00 38.90  ? 128 LEU A N   1 
ATOM   985   C CA  . LEU A 1 132 ? -17.536 -13.947 76.271  1.00 47.10  ? 128 LEU A CA  1 
ATOM   986   C C   . LEU A 1 132 ? -18.932 -14.567 76.322  1.00 49.58  ? 128 LEU A C   1 
ATOM   987   O O   . LEU A 1 132 ? -19.481 -14.790 77.402  1.00 66.34  ? 128 LEU A O   1 
ATOM   988   C CB  . LEU A 1 132 ? -17.638 -12.420 76.187  1.00 41.39  ? 128 LEU A CB  1 
ATOM   989   C CG  . LEU A 1 132 ? -16.428 -11.635 76.706  1.00 36.01  ? 128 LEU A CG  1 
ATOM   990   C CD1 . LEU A 1 132 ? -16.616 -10.141 76.486  1.00 44.92  ? 128 LEU A CD1 1 
ATOM   991   C CD2 . LEU A 1 132 ? -16.184 -11.924 78.180  1.00 29.27  ? 128 LEU A CD2 1 
ATOM   992   N N   . ASP A 1 133 ? -19.502 -14.846 75.153  1.00 30.82  ? 129 ASP A N   1 
ATOM   993   C CA  . ASP A 1 133 ? -20.811 -15.484 75.079  1.00 44.90  ? 129 ASP A CA  1 
ATOM   994   C C   . ASP A 1 133 ? -20.768 -16.864 75.729  1.00 47.70  ? 129 ASP A C   1 
ATOM   995   O O   . ASP A 1 133 ? -21.756 -17.325 76.301  1.00 57.22  ? 129 ASP A O   1 
ATOM   996   C CB  . ASP A 1 133 ? -21.263 -15.619 73.623  1.00 44.14  ? 129 ASP A CB  1 
ATOM   997   C CG  . ASP A 1 133 ? -21.412 -14.280 72.929  1.00 51.70  ? 129 ASP A CG  1 
ATOM   998   O OD1 . ASP A 1 133 ? -21.601 -13.262 73.629  1.00 45.13  ? 129 ASP A OD1 1 
ATOM   999   O OD2 . ASP A 1 133 ? -21.345 -14.250 71.681  1.00 55.47  ? 129 ASP A OD2 1 
ATOM   1000  N N   . LYS A 1 134 ? -19.616 -17.517 75.630  1.00 43.46  ? 130 LYS A N   1 
ATOM   1001  C CA  . LYS A 1 134 ? -19.435 -18.855 76.177  1.00 43.57  ? 130 LYS A CA  1 
ATOM   1002  C C   . LYS A 1 134 ? -18.936 -18.814 77.621  1.00 40.36  ? 130 LYS A C   1 
ATOM   1003  O O   . LYS A 1 134 ? -19.355 -19.615 78.454  1.00 37.16  ? 130 LYS A O   1 
ATOM   1004  C CB  . LYS A 1 134 ? -18.449 -19.639 75.307  1.00 35.49  ? 130 LYS A CB  1 
ATOM   1005  C CG  . LYS A 1 134 ? -18.959 -19.915 73.901  1.00 34.65  ? 130 LYS A CG  1 
ATOM   1006  C CD  . LYS A 1 134 ? -17.824 -20.270 72.954  1.00 47.71  ? 130 LYS A CD  1 
ATOM   1007  C CE  . LYS A 1 134 ? -18.338 -20.602 71.561  1.00 50.69  ? 130 LYS A CE  1 
ATOM   1008  N NZ  . LYS A 1 134 ? -17.227 -20.812 70.589  1.00 48.15  ? 130 LYS A NZ  1 
ATOM   1009  N N   . ASP A 1 135 ? -18.044 -17.875 77.911  1.00 41.93  ? 131 ASP A N   1 
ATOM   1010  C CA  . ASP A 1 135 ? -17.436 -17.780 79.231  1.00 36.91  ? 131 ASP A CA  1 
ATOM   1011  C C   . ASP A 1 135 ? -17.188 -16.321 79.596  1.00 46.55  ? 131 ASP A C   1 
ATOM   1012  O O   . ASP A 1 135 ? -16.079 -15.812 79.444  1.00 49.14  ? 131 ASP A O   1 
ATOM   1013  C CB  . ASP A 1 135 ? -16.122 -18.558 79.250  1.00 28.91  ? 131 ASP A CB  1 
ATOM   1014  C CG  . ASP A 1 135 ? -15.540 -18.688 80.641  1.00 57.74  ? 131 ASP A CG  1 
ATOM   1015  O OD1 . ASP A 1 135 ? -15.947 -17.920 81.540  1.00 70.57  ? 131 ASP A OD1 1 
ATOM   1016  O OD2 . ASP A 1 135 ? -14.670 -19.562 80.833  1.00 55.40  ? 131 ASP A OD2 1 
ATOM   1017  N N   . TRP A 1 136 ? -18.230 -15.655 80.083  1.00 37.36  ? 132 TRP A N   1 
ATOM   1018  C CA  . TRP A 1 136 ? -18.151 -14.231 80.407  1.00 37.50  ? 132 TRP A CA  1 
ATOM   1019  C C   . TRP A 1 136 ? -17.113 -13.897 81.484  1.00 42.57  ? 132 TRP A C   1 
ATOM   1020  O O   . TRP A 1 136 ? -16.726 -12.737 81.634  1.00 48.31  ? 132 TRP A O   1 
ATOM   1021  C CB  . TRP A 1 136 ? -19.526 -13.692 80.819  1.00 53.20  ? 132 TRP A CB  1 
ATOM   1022  C CG  . TRP A 1 136 ? -20.303 -14.599 81.722  1.00 56.13  ? 132 TRP A CG  1 
ATOM   1023  C CD1 . TRP A 1 136 ? -21.287 -15.471 81.355  1.00 54.92  ? 132 TRP A CD1 1 
ATOM   1024  C CD2 . TRP A 1 136 ? -20.168 -14.721 83.143  1.00 65.95  ? 132 TRP A CD2 1 
ATOM   1025  N NE1 . TRP A 1 136 ? -21.770 -16.131 82.459  1.00 64.58  ? 132 TRP A NE1 1 
ATOM   1026  C CE2 . TRP A 1 136 ? -21.100 -15.689 83.569  1.00 66.61  ? 132 TRP A CE2 1 
ATOM   1027  C CE3 . TRP A 1 136 ? -19.349 -14.108 84.097  1.00 68.48  ? 132 TRP A CE3 1 
ATOM   1028  C CZ2 . TRP A 1 136 ? -21.236 -16.057 84.906  1.00 73.16  ? 132 TRP A CZ2 1 
ATOM   1029  C CZ3 . TRP A 1 136 ? -19.484 -14.475 85.423  1.00 68.32  ? 132 TRP A CZ3 1 
ATOM   1030  C CH2 . TRP A 1 136 ? -20.421 -15.441 85.815  1.00 81.02  ? 132 TRP A CH2 1 
ATOM   1031  N N   . ASN A 1 137 ? -16.661 -14.904 82.227  1.00 20.78  ? 133 ASN A N   1 
ATOM   1032  C CA  . ASN A 1 137 ? -15.654 -14.690 83.261  1.00 36.53  ? 133 ASN A CA  1 
ATOM   1033  C C   . ASN A 1 137 ? -14.260 -15.083 82.779  1.00 57.15  ? 133 ASN A C   1 
ATOM   1034  O O   . ASN A 1 137 ? -13.352 -15.303 83.581  1.00 57.68  ? 133 ASN A O   1 
ATOM   1035  C CB  . ASN A 1 137 ? -16.011 -15.488 84.515  1.00 50.10  ? 133 ASN A CB  1 
ATOM   1036  C CG  . ASN A 1 137 ? -15.090 -15.185 85.680  1.00 60.34  ? 133 ASN A CG  1 
ATOM   1037  O OD1 . ASN A 1 137 ? -15.375 -14.316 86.504  1.00 69.63  ? 133 ASN A OD1 1 
ATOM   1038  N ND2 . ASN A 1 137 ? -13.976 -15.903 85.755  1.00 66.49  ? 133 ASN A ND2 1 
ATOM   1039  N N   . ILE A 1 138 ? -14.093 -15.158 81.463  1.00 55.74  ? 134 ILE A N   1 
ATOM   1040  C CA  . ILE A 1 138 ? -12.859 -15.663 80.873  1.00 53.40  ? 134 ILE A CA  1 
ATOM   1041  C C   . ILE A 1 138 ? -11.674 -14.709 81.030  1.00 69.30  ? 134 ILE A C   1 
ATOM   1042  O O   . ILE A 1 138 ? -10.531 -15.154 81.142  1.00 75.64  ? 134 ILE A O   1 
ATOM   1043  C CB  . ILE A 1 138 ? -13.051 -15.974 79.375  1.00 55.41  ? 134 ILE A CB  1 
ATOM   1044  C CG1 . ILE A 1 138 ? -11.814 -16.676 78.818  1.00 46.96  ? 134 ILE A CG1 1 
ATOM   1045  C CG2 . ILE A 1 138 ? -13.340 -14.698 78.591  1.00 60.29  ? 134 ILE A CG2 1 
ATOM   1046  C CD1 . ILE A 1 138 ? -11.998 -17.199 77.415  1.00 33.91  ? 134 ILE A CD1 1 
ATOM   1047  N N   . PHE A 1 139 ? -11.942 -13.405 81.041  1.00 66.43  ? 135 PHE A N   1 
ATOM   1048  C CA  . PHE A 1 139 ? -10.869 -12.411 81.073  1.00 52.98  ? 135 PHE A CA  1 
ATOM   1049  C C   . PHE A 1 139 ? -10.545 -11.899 82.475  1.00 60.62  ? 135 PHE A C   1 
ATOM   1050  O O   . PHE A 1 139 ? -10.023 -10.795 82.634  1.00 65.37  ? 135 PHE A O   1 
ATOM   1051  C CB  . PHE A 1 139 ? -11.194 -11.240 80.145  1.00 48.22  ? 135 PHE A CB  1 
ATOM   1052  C CG  . PHE A 1 139 ? -11.108 -11.587 78.689  1.00 43.14  ? 135 PHE A CG  1 
ATOM   1053  C CD1 . PHE A 1 139 ? -9.920  -12.050 78.147  1.00 46.37  ? 135 PHE A CD1 1 
ATOM   1054  C CD2 . PHE A 1 139 ? -12.209 -11.448 77.861  1.00 21.27  ? 135 PHE A CD2 1 
ATOM   1055  C CE1 . PHE A 1 139 ? -9.831  -12.375 76.807  1.00 41.10  ? 135 PHE A CE1 1 
ATOM   1056  C CE2 . PHE A 1 139 ? -12.127 -11.770 76.519  1.00 34.07  ? 135 PHE A CE2 1 
ATOM   1057  C CZ  . PHE A 1 139 ? -10.935 -12.234 75.992  1.00 42.48  ? 135 PHE A CZ  1 
ATOM   1058  N N   . SER A 1 140 ? -10.850 -12.706 83.485  1.00 67.15  ? 136 SER A N   1 
ATOM   1059  C CA  . SER A 1 140 ? -10.370 -12.451 84.837  1.00 62.39  ? 136 SER A CA  1 
ATOM   1060  C C   . SER A 1 140 ? -9.062  -13.211 85.046  1.00 61.11  ? 136 SER A C   1 
ATOM   1061  O O   . SER A 1 140 ? -8.588  -13.366 86.173  1.00 57.15  ? 136 SER A O   1 
ATOM   1062  C CB  . SER A 1 140 ? -11.410 -12.883 85.873  1.00 59.33  ? 136 SER A CB  1 
ATOM   1063  O OG  . SER A 1 140 ? -11.676 -14.273 85.794  1.00 62.64  ? 136 SER A OG  1 
ATOM   1064  N N   . LYS A 1 141 ? -8.484  -13.679 83.943  1.00 64.23  ? 137 LYS A N   1 
ATOM   1065  C CA  . LYS A 1 141 ? -7.253  -14.457 83.972  1.00 59.08  ? 137 LYS A CA  1 
ATOM   1066  C C   . LYS A 1 141 ? -6.043  -13.606 84.334  1.00 58.22  ? 137 LYS A C   1 
ATOM   1067  O O   . LYS A 1 141 ? -5.918  -12.462 83.894  1.00 56.98  ? 137 LYS A O   1 
ATOM   1068  C CB  . LYS A 1 141 ? -7.022  -15.106 82.608  1.00 36.20  ? 137 LYS A CB  1 
ATOM   1069  C CG  . LYS A 1 141 ? -5.701  -15.838 82.489  1.00 24.65  ? 137 LYS A CG  1 
ATOM   1070  C CD  . LYS A 1 141 ? -5.615  -16.612 81.185  1.00 34.01  ? 137 LYS A CD  1 
ATOM   1071  C CE  . LYS A 1 141 ? -4.337  -17.434 81.107  1.00 41.29  ? 137 LYS A CE  1 
ATOM   1072  N NZ  . LYS A 1 141 ? -4.398  -18.448 80.016  1.00 45.11  ? 137 LYS A NZ  1 
ATOM   1073  N N   . ASN A 1 142 ? -5.148  -14.180 85.132  1.00 58.34  ? 138 ASN A N   1 
ATOM   1074  C CA  . ASN A 1 142 ? -3.906  -13.513 85.497  1.00 67.96  ? 138 ASN A CA  1 
ATOM   1075  C C   . ASN A 1 142 ? -2.870  -13.706 84.398  1.00 70.89  ? 138 ASN A C   1 
ATOM   1076  O O   . ASN A 1 142 ? -2.307  -14.791 84.251  1.00 64.86  ? 138 ASN A O   1 
ATOM   1077  C CB  . ASN A 1 142 ? -3.377  -14.064 86.822  1.00 76.07  ? 138 ASN A CB  1 
ATOM   1078  C CG  . ASN A 1 142 ? -2.215  -13.257 87.368  1.00 82.72  ? 138 ASN A CG  1 
ATOM   1079  O OD1 . ASN A 1 142 ? -1.060  -13.478 87.001  1.00 79.84  ? 138 ASN A OD1 1 
ATOM   1080  N ND2 . ASN A 1 142 ? -2.516  -12.315 88.256  1.00 83.28  ? 138 ASN A ND2 1 
ATOM   1081  N N   . CYS A 1 143 ? -2.625  -12.652 83.624  1.00 69.02  ? 139 CYS A N   1 
ATOM   1082  C CA  . CYS A 1 143 ? -1.720  -12.734 82.482  1.00 50.78  ? 139 CYS A CA  1 
ATOM   1083  C C   . CYS A 1 143 ? -0.371  -12.074 82.761  1.00 57.36  ? 139 CYS A C   1 
ATOM   1084  O O   . CYS A 1 143 ? 0.299   -11.610 81.838  1.00 67.23  ? 139 CYS A O   1 
ATOM   1085  C CB  . CYS A 1 143 ? -2.366  -12.094 81.250  1.00 52.07  ? 139 CYS A CB  1 
ATOM   1086  S SG  . CYS A 1 143 ? -3.769  -13.017 80.574  1.00 41.97  ? 139 CYS A SG  1 
ATOM   1087  N N   . ASN A 1 144 ? 0.026   -12.034 84.029  1.00 55.46  ? 140 ASN A N   1 
ATOM   1088  C CA  . ASN A 1 144 ? 1.325   -11.483 84.404  1.00 46.99  ? 140 ASN A CA  1 
ATOM   1089  C C   . ASN A 1 144 ? 2.469   -12.395 83.969  1.00 43.45  ? 140 ASN A C   1 
ATOM   1090  O O   . ASN A 1 144 ? 3.502   -11.925 83.488  1.00 38.32  ? 140 ASN A O   1 
ATOM   1091  C CB  . ASN A 1 144 ? 1.395   -11.255 85.915  1.00 49.19  ? 140 ASN A CB  1 
ATOM   1092  C CG  . ASN A 1 144 ? 0.469   -10.148 86.383  1.00 65.70  ? 140 ASN A CG  1 
ATOM   1093  O OD1 . ASN A 1 144 ? 0.167   -9.216  85.636  1.00 71.11  ? 140 ASN A OD1 1 
ATOM   1094  N ND2 . ASN A 1 144 ? 0.018   -10.241 87.629  1.00 65.14  ? 140 ASN A ND2 1 
ATOM   1095  N N   . ASN A 1 145 ? 2.278   -13.700 84.143  1.00 51.17  ? 141 ASN A N   1 
ATOM   1096  C CA  . ASN A 1 145 ? 3.291   -14.687 83.777  1.00 63.91  ? 141 ASN A CA  1 
ATOM   1097  C C   . ASN A 1 145 ? 3.539   -14.725 82.271  1.00 63.00  ? 141 ASN A C   1 
ATOM   1098  O O   . ASN A 1 145 ? 4.671   -14.917 81.826  1.00 67.87  ? 141 ASN A O   1 
ATOM   1099  C CB  . ASN A 1 145 ? 2.882   -16.082 84.263  1.00 75.16  ? 141 ASN A CB  1 
ATOM   1100  C CG  . ASN A 1 145 ? 2.903   -16.210 85.777  1.00 73.81  ? 141 ASN A CG  1 
ATOM   1101  O OD1 . ASN A 1 145 ? 2.921   -15.213 86.499  1.00 77.17  ? 141 ASN A OD1 1 
ATOM   1102  N ND2 . ASN A 1 145 ? 2.897   -17.447 86.265  1.00 70.02  ? 141 ASN A ND2 1 
ATOM   1103  N N   . SER A 1 146 ? 2.478   -14.545 81.490  1.00 65.02  ? 142 SER A N   1 
ATOM   1104  C CA  . SER A 1 146 ? 2.585   -14.583 80.033  1.00 57.48  ? 142 SER A CA  1 
ATOM   1105  C C   . SER A 1 146 ? 3.192   -13.296 79.473  1.00 51.32  ? 142 SER A C   1 
ATOM   1106  O O   . SER A 1 146 ? 3.920   -13.329 78.481  1.00 49.43  ? 142 SER A O   1 
ATOM   1107  C CB  . SER A 1 146 ? 1.214   -14.842 79.399  1.00 59.41  ? 142 SER A CB  1 
ATOM   1108  O OG  . SER A 1 146 ? 1.043   -16.216 79.096  1.00 49.36  ? 142 SER A OG  1 
ATOM   1109  N N   . PHE A 1 147 ? 2.895   -12.167 80.112  1.00 56.83  ? 143 PHE A N   1 
ATOM   1110  C CA  . PHE A 1 147 ? 3.451   -10.881 79.693  1.00 68.52  ? 143 PHE A CA  1 
ATOM   1111  C C   . PHE A 1 147 ? 4.943   -10.794 80.015  1.00 81.79  ? 143 PHE A C   1 
ATOM   1112  O O   . PHE A 1 147 ? 5.684   -10.051 79.368  1.00 70.69  ? 143 PHE A O   1 
ATOM   1113  C CB  . PHE A 1 147 ? 2.717   -9.722  80.380  1.00 59.48  ? 143 PHE A CB  1 
ATOM   1114  C CG  . PHE A 1 147 ? 1.270   -9.583  79.976  1.00 63.72  ? 143 PHE A CG  1 
ATOM   1115  C CD1 . PHE A 1 147 ? 0.739   -10.340 78.942  1.00 58.59  ? 143 PHE A CD1 1 
ATOM   1116  C CD2 . PHE A 1 147 ? 0.442   -8.683  80.631  1.00 63.35  ? 143 PHE A CD2 1 
ATOM   1117  C CE1 . PHE A 1 147 ? -0.587  -10.206 78.576  1.00 43.35  ? 143 PHE A CE1 1 
ATOM   1118  C CE2 . PHE A 1 147 ? -0.886  -8.546  80.266  1.00 61.83  ? 143 PHE A CE2 1 
ATOM   1119  C CZ  . PHE A 1 147 ? -1.399  -9.308  79.237  1.00 59.61  ? 143 PHE A CZ  1 
ATOM   1120  N N   . ALA A 1 148 ? 5.375   -11.557 81.015  1.00 88.39  ? 144 ALA A N   1 
ATOM   1121  C CA  . ALA A 1 148 ? 6.757   -11.509 81.480  1.00 81.65  ? 144 ALA A CA  1 
ATOM   1122  C C   . ALA A 1 148 ? 7.690   -12.319 80.582  1.00 86.62  ? 144 ALA A C   1 
ATOM   1123  O O   . ALA A 1 148 ? 8.888   -12.048 80.520  1.00 88.94  ? 144 ALA A O   1 
ATOM   1124  C CB  . ALA A 1 148 ? 6.845   -12.009 82.916  1.00 67.18  ? 144 ALA A CB  1 
ATOM   1125  N N   . GLU A 1 149 ? 7.136   -13.305 79.883  1.00 78.57  ? 145 GLU A N   1 
ATOM   1126  C CA  . GLU A 1 149 ? 7.941   -14.187 79.041  1.00 81.34  ? 145 GLU A CA  1 
ATOM   1127  C C   . GLU A 1 149 ? 8.025   -13.686 77.598  1.00 85.43  ? 145 GLU A C   1 
ATOM   1128  O O   . GLU A 1 149 ? 8.368   -14.445 76.689  1.00 79.59  ? 145 GLU A O   1 
ATOM   1129  C CB  . GLU A 1 149 ? 7.397   -15.621 79.074  1.00 83.02  ? 145 GLU A CB  1 
ATOM   1130  C CG  . GLU A 1 149 ? 5.909   -15.744 78.784  1.00 96.88  ? 145 GLU A CG  1 
ATOM   1131  C CD  . GLU A 1 149 ? 5.436   -17.185 78.772  1.00 106.55 ? 145 GLU A CD  1 
ATOM   1132  O OE1 . GLU A 1 149 ? 4.414   -17.473 78.114  1.00 102.20 ? 145 GLU A OE1 1 
ATOM   1133  O OE2 . GLU A 1 149 ? 6.082   -18.030 79.430  1.00 112.47 ? 145 GLU A OE2 1 
ATOM   1134  N N   . CYS A 1 150 ? 7.717   -12.408 77.393  1.00 82.41  ? 146 CYS A N   1 
ATOM   1135  C CA  . CYS A 1 150 ? 7.852   -11.789 76.080  1.00 88.51  ? 146 CYS A CA  1 
ATOM   1136  C C   . CYS A 1 150 ? 9.200   -11.085 75.952  1.00 86.88  ? 146 CYS A C   1 
ATOM   1137  O O   . CYS A 1 150 ? 9.648   -10.410 76.879  1.00 75.33  ? 146 CYS A O   1 
ATOM   1138  C CB  . CYS A 1 150 ? 6.719   -10.790 75.842  1.00 92.96  ? 146 CYS A CB  1 
ATOM   1139  S SG  . CYS A 1 150 ? 5.085   -11.544 75.696  1.00 115.01 ? 146 CYS A SG  1 
ATOM   1140  N N   . SER A 1 151 ? 9.842   -11.252 74.798  1.00 88.39  ? 147 SER A N   1 
ATOM   1141  C CA  . SER A 1 151 ? 11.132  -10.622 74.534  1.00 85.77  ? 147 SER A CA  1 
ATOM   1142  C C   . SER A 1 151 ? 10.962  -9.410  73.624  1.00 84.80  ? 147 SER A C   1 
ATOM   1143  O O   . SER A 1 151 ? 11.816  -8.524  73.583  1.00 77.36  ? 147 SER A O   1 
ATOM   1144  C CB  . SER A 1 151 ? 12.092  -11.628 73.893  1.00 77.98  ? 147 SER A CB  1 
ATOM   1145  O OG  . SER A 1 151 ? 13.348  -11.034 73.604  1.00 69.75  ? 147 SER A OG  1 
ATOM   1146  N N   . TYR B 1 10  ? -26.474 23.594  27.727  1.00 79.60  ? 6   TYR B N   1 
ATOM   1147  C CA  . TYR B 1 10  ? -26.642 22.272  28.317  1.00 84.12  ? 6   TYR B CA  1 
ATOM   1148  C C   . TYR B 1 10  ? -25.502 21.963  29.284  1.00 89.89  ? 6   TYR B C   1 
ATOM   1149  O O   . TYR B 1 10  ? -25.714 21.347  30.329  1.00 112.40 ? 6   TYR B O   1 
ATOM   1150  C CB  . TYR B 1 10  ? -26.705 21.207  27.223  1.00 73.28  ? 6   TYR B CB  1 
ATOM   1151  C CG  . TYR B 1 10  ? -25.395 20.994  26.503  1.00 66.66  ? 6   TYR B CG  1 
ATOM   1152  C CD1 . TYR B 1 10  ? -24.470 20.068  26.964  1.00 56.42  ? 6   TYR B CD1 1 
ATOM   1153  C CD2 . TYR B 1 10  ? -25.082 21.718  25.362  1.00 63.58  ? 6   TYR B CD2 1 
ATOM   1154  C CE1 . TYR B 1 10  ? -23.271 19.868  26.309  1.00 41.30  ? 6   TYR B CE1 1 
ATOM   1155  C CE2 . TYR B 1 10  ? -23.886 21.526  24.700  1.00 49.56  ? 6   TYR B CE2 1 
ATOM   1156  C CZ  . TYR B 1 10  ? -22.984 20.600  25.178  1.00 38.66  ? 6   TYR B CZ  1 
ATOM   1157  O OH  . TYR B 1 10  ? -21.790 20.405  24.522  1.00 52.72  ? 6   TYR B OH  1 
ATOM   1158  N N   . CYS B 1 11  ? -24.294 22.395  28.931  1.00 55.24  ? 7   CYS B N   1 
ATOM   1159  C CA  . CYS B 1 11  ? -23.135 22.212  29.797  1.00 47.61  ? 7   CYS B CA  1 
ATOM   1160  C C   . CYS B 1 11  ? -23.365 22.898  31.136  1.00 39.86  ? 7   CYS B C   1 
ATOM   1161  O O   . CYS B 1 11  ? -22.908 22.421  32.176  1.00 44.43  ? 7   CYS B O   1 
ATOM   1162  C CB  . CYS B 1 11  ? -21.875 22.784  29.143  1.00 44.05  ? 7   CYS B CB  1 
ATOM   1163  S SG  . CYS B 1 11  ? -21.171 21.760  27.834  1.00 64.59  ? 7   CYS B SG  1 
ATOM   1164  N N   . SER B 1 12  ? -24.081 24.018  31.100  1.00 47.09  ? 8   SER B N   1 
ATOM   1165  C CA  . SER B 1 12  ? -24.289 24.848  32.283  1.00 55.42  ? 8   SER B CA  1 
ATOM   1166  C C   . SER B 1 12  ? -24.587 24.030  33.540  1.00 61.48  ? 8   SER B C   1 
ATOM   1167  O O   . SER B 1 12  ? -23.779 23.998  34.469  1.00 78.73  ? 8   SER B O   1 
ATOM   1168  C CB  . SER B 1 12  ? -25.409 25.863  32.033  1.00 48.52  ? 8   SER B CB  1 
ATOM   1169  O OG  . SER B 1 12  ? -26.586 25.230  31.565  1.00 59.26  ? 8   SER B OG  1 
ATOM   1170  N N   . HIS B 1 13  ? -25.736 23.365  33.566  1.00 47.07  ? 9   HIS B N   1 
ATOM   1171  C CA  . HIS B 1 13  ? -26.153 22.622  34.749  1.00 67.26  ? 9   HIS B CA  1 
ATOM   1172  C C   . HIS B 1 13  ? -26.051 21.114  34.542  1.00 77.89  ? 9   HIS B C   1 
ATOM   1173  O O   . HIS B 1 13  ? -27.030 20.387  34.711  1.00 85.59  ? 9   HIS B O   1 
ATOM   1174  C CB  . HIS B 1 13  ? -27.583 23.002  35.134  1.00 83.46  ? 9   HIS B CB  1 
ATOM   1175  C CG  . HIS B 1 13  ? -27.709 24.385  35.691  1.00 82.25  ? 9   HIS B CG  1 
ATOM   1176  N ND1 . HIS B 1 13  ? -27.464 25.516  34.942  1.00 75.83  ? 9   HIS B ND1 1 
ATOM   1177  C CD2 . HIS B 1 13  ? -28.052 24.820  36.927  1.00 73.85  ? 9   HIS B CD2 1 
ATOM   1178  C CE1 . HIS B 1 13  ? -27.652 26.588  35.691  1.00 67.60  ? 9   HIS B CE1 1 
ATOM   1179  N NE2 . HIS B 1 13  ? -28.009 26.193  36.900  1.00 62.86  ? 9   HIS B NE2 1 
ATOM   1180  N N   . MET B 1 14  ? -24.860 20.650  34.179  1.00 72.51  ? 10  MET B N   1 
ATOM   1181  C CA  . MET B 1 14  ? -24.613 19.223  34.027  1.00 56.81  ? 10  MET B CA  1 
ATOM   1182  C C   . MET B 1 14  ? -24.128 18.642  35.351  1.00 43.51  ? 10  MET B C   1 
ATOM   1183  O O   . MET B 1 14  ? -24.520 17.540  35.738  1.00 36.56  ? 10  MET B O   1 
ATOM   1184  C CB  . MET B 1 14  ? -23.581 18.972  32.928  1.00 47.21  ? 10  MET B CB  1 
ATOM   1185  C CG  . MET B 1 14  ? -23.460 17.514  32.523  1.00 29.32  ? 10  MET B CG  1 
ATOM   1186  S SD  . MET B 1 14  ? -22.681 17.296  30.918  1.00 55.64  ? 10  MET B SD  1 
ATOM   1187  C CE  . MET B 1 14  ? -23.911 18.022  29.838  1.00 111.77 ? 10  MET B CE  1 
ATOM   1188  N N   . ILE B 1 15  ? -23.273 19.392  36.041  1.00 40.98  ? 11  ILE B N   1 
ATOM   1189  C CA  . ILE B 1 15  ? -22.826 19.010  37.375  1.00 37.92  ? 11  ILE B CA  1 
ATOM   1190  C C   . ILE B 1 15  ? -23.801 19.565  38.404  1.00 42.63  ? 11  ILE B C   1 
ATOM   1191  O O   . ILE B 1 15  ? -23.907 20.779  38.578  1.00 51.75  ? 11  ILE B O   1 
ATOM   1192  C CB  . ILE B 1 15  ? -21.422 19.555  37.695  1.00 36.56  ? 11  ILE B CB  1 
ATOM   1193  C CG1 . ILE B 1 15  ? -20.441 19.208  36.571  1.00 38.05  ? 11  ILE B CG1 1 
ATOM   1194  C CG2 . ILE B 1 15  ? -20.937 19.004  39.035  1.00 23.84  ? 11  ILE B CG2 1 
ATOM   1195  C CD1 . ILE B 1 15  ? -19.064 19.803  36.762  1.00 44.31  ? 11  ILE B CD1 1 
ATOM   1196  N N   . GLY B 1 16  ? -24.514 18.671  39.080  1.00 29.75  ? 12  GLY B N   1 
ATOM   1197  C CA  . GLY B 1 16  ? -25.492 19.068  40.073  1.00 28.90  ? 12  GLY B CA  1 
ATOM   1198  C C   . GLY B 1 16  ? -24.930 19.032  41.478  1.00 46.38  ? 12  GLY B C   1 
ATOM   1199  O O   . GLY B 1 16  ? -23.874 18.448  41.719  1.00 46.72  ? 12  GLY B O   1 
ATOM   1200  N N   . SER B 1 17  ? -25.643 19.660  42.408  1.00 54.18  ? 13  SER B N   1 
ATOM   1201  C CA  . SER B 1 17  ? -25.232 19.684  43.805  1.00 48.06  ? 13  SER B CA  1 
ATOM   1202  C C   . SER B 1 17  ? -25.101 18.267  44.350  1.00 44.38  ? 13  SER B C   1 
ATOM   1203  O O   . SER B 1 17  ? -24.304 18.013  45.252  1.00 56.16  ? 13  SER B O   1 
ATOM   1204  C CB  . SER B 1 17  ? -26.241 20.473  44.643  1.00 58.67  ? 13  SER B CB  1 
ATOM   1205  O OG  . SER B 1 17  ? -26.339 21.815  44.197  1.00 59.50  ? 13  SER B OG  1 
ATOM   1206  N N   . GLY B 1 18  ? -25.887 17.349  43.794  1.00 41.50  ? 14  GLY B N   1 
ATOM   1207  C CA  . GLY B 1 18  ? -25.862 15.959  44.215  1.00 30.43  ? 14  GLY B CA  1 
ATOM   1208  C C   . GLY B 1 18  ? -24.484 15.335  44.095  1.00 43.03  ? 14  GLY B C   1 
ATOM   1209  O O   . GLY B 1 18  ? -24.043 14.610  44.988  1.00 42.65  ? 14  GLY B O   1 
ATOM   1210  N N   . HIS B 1 19  ? -23.804 15.612  42.987  1.00 44.59  ? 15  HIS B N   1 
ATOM   1211  C CA  . HIS B 1 19  ? -22.458 15.098  42.771  1.00 30.13  ? 15  HIS B CA  1 
ATOM   1212  C C   . HIS B 1 19  ? -21.503 15.661  43.820  1.00 37.93  ? 15  HIS B C   1 
ATOM   1213  O O   . HIS B 1 19  ? -20.630 14.952  44.322  1.00 40.67  ? 15  HIS B O   1 
ATOM   1214  C CB  . HIS B 1 19  ? -21.962 15.458  41.370  1.00 39.87  ? 15  HIS B CB  1 
ATOM   1215  C CG  . HIS B 1 19  ? -22.773 14.853  40.263  1.00 47.05  ? 15  HIS B CG  1 
ATOM   1216  N ND1 . HIS B 1 19  ? -23.793 15.529  39.633  1.00 46.23  ? 15  HIS B ND1 1 
ATOM   1217  C CD2 . HIS B 1 19  ? -22.704 13.636  39.671  1.00 50.80  ? 15  HIS B CD2 1 
ATOM   1218  C CE1 . HIS B 1 19  ? -24.321 14.755  38.699  1.00 37.72  ? 15  HIS B CE1 1 
ATOM   1219  N NE2 . HIS B 1 19  ? -23.679 13.603  38.703  1.00 35.02  ? 15  HIS B NE2 1 
ATOM   1220  N N   . LEU B 1 20  ? -21.674 16.936  44.153  1.00 46.85  ? 16  LEU B N   1 
ATOM   1221  C CA  . LEU B 1 20  ? -20.821 17.586  45.143  1.00 46.55  ? 16  LEU B CA  1 
ATOM   1222  C C   . LEU B 1 20  ? -21.030 16.989  46.527  1.00 40.31  ? 16  LEU B C   1 
ATOM   1223  O O   . LEU B 1 20  ? -20.095 16.905  47.326  1.00 29.44  ? 16  LEU B O   1 
ATOM   1224  C CB  . LEU B 1 20  ? -21.114 19.084  45.201  1.00 41.46  ? 16  LEU B CB  1 
ATOM   1225  C CG  . LEU B 1 20  ? -20.914 19.876  43.912  1.00 38.44  ? 16  LEU B CG  1 
ATOM   1226  C CD1 . LEU B 1 20  ? -21.072 21.358  44.203  1.00 33.59  ? 16  LEU B CD1 1 
ATOM   1227  C CD2 . LEU B 1 20  ? -19.555 19.581  43.294  1.00 37.72  ? 16  LEU B CD2 1 
ATOM   1228  N N   . GLN B 1 21  ? -22.263 16.584  46.808  1.00 42.03  ? 17  GLN B N   1 
ATOM   1229  C CA  . GLN B 1 21  ? -22.612 16.067  48.124  1.00 46.19  ? 17  GLN B CA  1 
ATOM   1230  C C   . GLN B 1 21  ? -22.199 14.607  48.282  1.00 32.72  ? 17  GLN B C   1 
ATOM   1231  O O   . GLN B 1 21  ? -21.877 14.170  49.385  1.00 35.68  ? 17  GLN B O   1 
ATOM   1232  C CB  . GLN B 1 21  ? -24.109 16.246  48.379  1.00 60.96  ? 17  GLN B CB  1 
ATOM   1233  C CG  . GLN B 1 21  ? -24.513 17.707  48.541  1.00 71.00  ? 17  GLN B CG  1 
ATOM   1234  C CD  . GLN B 1 21  ? -25.985 17.950  48.276  1.00 72.36  ? 17  GLN B CD  1 
ATOM   1235  O OE1 . GLN B 1 21  ? -26.761 17.010  48.101  1.00 70.98  ? 17  GLN B OE1 1 
ATOM   1236  N NE2 . GLN B 1 21  ? -26.377 19.220  48.239  1.00 66.40  ? 17  GLN B NE2 1 
ATOM   1237  N N   . SER B 1 22  ? -22.196 13.854  47.185  1.00 37.07  ? 18  SER B N   1 
ATOM   1238  C CA  . SER B 1 22  ? -21.710 12.478  47.226  1.00 46.71  ? 18  SER B CA  1 
ATOM   1239  C C   . SER B 1 22  ? -20.184 12.462  47.333  1.00 34.52  ? 18  SER B C   1 
ATOM   1240  O O   . SER B 1 22  ? -19.603 11.530  47.889  1.00 44.54  ? 18  SER B O   1 
ATOM   1241  C CB  . SER B 1 22  ? -22.183 11.683  46.003  1.00 54.47  ? 18  SER B CB  1 
ATOM   1242  O OG  . SER B 1 22  ? -21.662 12.203  44.793  1.00 75.68  ? 18  SER B OG  1 
ATOM   1243  N N   . LEU B 1 23  ? -19.541 13.503  46.812  1.00 31.43  ? 19  LEU B N   1 
ATOM   1244  C CA  . LEU B 1 23  ? -18.101 13.673  46.977  1.00 38.20  ? 19  LEU B CA  1 
ATOM   1245  C C   . LEU B 1 23  ? -17.780 14.013  48.426  1.00 42.63  ? 19  LEU B C   1 
ATOM   1246  O O   . LEU B 1 23  ? -16.920 13.389  49.046  1.00 49.44  ? 19  LEU B O   1 
ATOM   1247  C CB  . LEU B 1 23  ? -17.577 14.786  46.067  1.00 49.55  ? 19  LEU B CB  1 
ATOM   1248  C CG  . LEU B 1 23  ? -17.071 14.362  44.687  1.00 50.93  ? 19  LEU B CG  1 
ATOM   1249  C CD1 . LEU B 1 23  ? -16.827 15.577  43.807  1.00 24.76  ? 19  LEU B CD1 1 
ATOM   1250  C CD2 . LEU B 1 23  ? -15.799 13.535  44.815  1.00 62.79  ? 19  LEU B CD2 1 
ATOM   1251  N N   . GLN B 1 24  ? -18.479 15.007  48.963  1.00 43.66  ? 20  GLN B N   1 
ATOM   1252  C CA  . GLN B 1 24  ? -18.251 15.437  50.336  1.00 45.62  ? 20  GLN B CA  1 
ATOM   1253  C C   . GLN B 1 24  ? -18.471 14.280  51.310  1.00 40.67  ? 20  GLN B C   1 
ATOM   1254  O O   . GLN B 1 24  ? -17.635 14.027  52.175  1.00 50.79  ? 20  GLN B O   1 
ATOM   1255  C CB  . GLN B 1 24  ? -19.158 16.615  50.694  1.00 34.30  ? 20  GLN B CB  1 
ATOM   1256  C CG  . GLN B 1 24  ? -18.701 17.377  51.927  1.00 43.13  ? 20  GLN B CG  1 
ATOM   1257  C CD  . GLN B 1 24  ? -17.278 17.894  51.799  1.00 42.53  ? 20  GLN B CD  1 
ATOM   1258  O OE1 . GLN B 1 24  ? -16.983 18.727  50.940  1.00 37.62  ? 20  GLN B OE1 1 
ATOM   1259  N NE2 . GLN B 1 24  ? -16.386 17.395  52.651  1.00 33.33  ? 20  GLN B NE2 1 
ATOM   1260  N N   . ARG B 1 25  ? -19.594 13.581  51.171  1.00 39.95  ? 21  ARG B N   1 
ATOM   1261  C CA  A ARG B 1 25  ? -19.869 12.422  52.012  0.57 44.24  ? 21  ARG B CA  1 
ATOM   1262  C CA  B ARG B 1 25  ? -19.876 12.410  51.993  0.43 43.94  ? 21  ARG B CA  1 
ATOM   1263  C C   . ARG B 1 25  ? -18.712 11.433  51.932  1.00 47.11  ? 21  ARG B C   1 
ATOM   1264  O O   . ARG B 1 25  ? -18.276 10.894  52.951  1.00 62.12  ? 21  ARG B O   1 
ATOM   1265  C CB  A ARG B 1 25  ? -21.174 11.738  51.598  0.57 41.57  ? 21  ARG B CB  1 
ATOM   1266  C CB  B ARG B 1 25  ? -21.142 11.713  51.504  0.43 41.10  ? 21  ARG B CB  1 
ATOM   1267  C CG  A ARG B 1 25  ? -22.431 12.503  51.990  0.57 45.96  ? 21  ARG B CG  1 
ATOM   1268  C CG  B ARG B 1 25  ? -22.436 12.311  52.025  0.43 46.20  ? 21  ARG B CG  1 
ATOM   1269  C CD  A ARG B 1 25  ? -23.674 11.643  51.830  0.57 49.54  ? 21  ARG B CD  1 
ATOM   1270  C CD  B ARG B 1 25  ? -23.589 12.018  51.079  0.43 48.62  ? 21  ARG B CD  1 
ATOM   1271  N NE  A ARG B 1 25  ? -23.870 10.752  52.975  0.57 58.07  ? 21  ARG B NE  1 
ATOM   1272  N NE  B ARG B 1 25  ? -23.421 10.742  50.386  0.43 47.65  ? 21  ARG B NE  1 
ATOM   1273  C CZ  A ARG B 1 25  ? -24.143 9.450   52.899  0.57 59.20  ? 21  ARG B CZ  1 
ATOM   1274  C CZ  B ARG B 1 25  ? -24.095 10.384  49.296  0.43 34.03  ? 21  ARG B CZ  1 
ATOM   1275  N NH1 A ARG B 1 25  ? -24.295 8.749   54.014  0.57 55.38  ? 21  ARG B NH1 1 
ATOM   1276  N NH1 B ARG B 1 25  ? -24.990 11.205  48.759  0.43 33.71  ? 21  ARG B NH1 1 
ATOM   1277  N NH2 A ARG B 1 25  ? -24.263 8.836   51.728  0.57 58.99  ? 21  ARG B NH2 1 
ATOM   1278  N NH2 B ARG B 1 25  ? -23.869 9.203   48.737  0.43 4.71   ? 21  ARG B NH2 1 
ATOM   1279  N N   . LEU B 1 26  ? -18.216 11.203  50.722  1.00 34.71  ? 22  LEU B N   1 
ATOM   1280  C CA  . LEU B 1 26  ? -17.101 10.293  50.514  1.00 47.37  ? 22  LEU B CA  1 
ATOM   1281  C C   . LEU B 1 26  ? -15.870 10.816  51.244  1.00 41.72  ? 22  LEU B C   1 
ATOM   1282  O O   . LEU B 1 26  ? -15.162 10.063  51.909  1.00 30.88  ? 22  LEU B O   1 
ATOM   1283  C CB  . LEU B 1 26  ? -16.822 10.140  49.018  1.00 49.20  ? 22  LEU B CB  1 
ATOM   1284  C CG  . LEU B 1 26  ? -15.803 9.076   48.616  1.00 38.77  ? 22  LEU B CG  1 
ATOM   1285  C CD1 . LEU B 1 26  ? -16.160 8.505   47.254  1.00 24.88  ? 22  LEU B CD1 1 
ATOM   1286  C CD2 . LEU B 1 26  ? -14.400 9.660   48.598  1.00 49.96  ? 22  LEU B CD2 1 
ATOM   1287  N N   . ILE B 1 27  ? -15.632 12.117  51.128  1.00 40.86  ? 23  ILE B N   1 
ATOM   1288  C CA  . ILE B 1 27  ? -14.509 12.758  51.802  1.00 35.37  ? 23  ILE B CA  1 
ATOM   1289  C C   . ILE B 1 27  ? -14.667 12.687  53.322  1.00 41.78  ? 23  ILE B C   1 
ATOM   1290  O O   . ILE B 1 27  ? -13.686 12.533  54.050  1.00 45.80  ? 23  ILE B O   1 
ATOM   1291  C CB  . ILE B 1 27  ? -14.381 14.229  51.366  1.00 25.54  ? 23  ILE B CB  1 
ATOM   1292  C CG1 . ILE B 1 27  ? -14.028 14.306  49.880  1.00 29.64  ? 23  ILE B CG1 1 
ATOM   1293  C CG2 . ILE B 1 27  ? -13.322 14.951  52.189  1.00 6.66   ? 23  ILE B CG2 1 
ATOM   1294  C CD1 . ILE B 1 27  ? -14.181 15.687  49.290  1.00 43.65  ? 23  ILE B CD1 1 
ATOM   1295  N N   . ASP B 1 28  ? -15.905 12.789  53.795  1.00 42.57  ? 24  ASP B N   1 
ATOM   1296  C CA  . ASP B 1 28  ? -16.185 12.781  55.229  1.00 36.75  ? 24  ASP B CA  1 
ATOM   1297  C C   . ASP B 1 28  ? -16.127 11.369  55.806  1.00 34.27  ? 24  ASP B C   1 
ATOM   1298  O O   . ASP B 1 28  ? -16.056 11.192  57.023  1.00 21.12  ? 24  ASP B O   1 
ATOM   1299  C CB  . ASP B 1 28  ? -17.566 13.382  55.511  1.00 40.31  ? 24  ASP B CB  1 
ATOM   1300  C CG  . ASP B 1 28  ? -17.684 14.827  55.062  1.00 55.22  ? 24  ASP B CG  1 
ATOM   1301  O OD1 . ASP B 1 28  ? -16.645 15.516  54.968  1.00 52.80  ? 24  ASP B OD1 1 
ATOM   1302  O OD2 . ASP B 1 28  ? -18.822 15.273  54.803  1.00 61.47  ? 24  ASP B OD2 1 
ATOM   1303  N N   . SER B 1 29  ? -16.167 10.368  54.931  1.00 37.41  ? 25  SER B N   1 
ATOM   1304  C CA  . SER B 1 29  ? -16.183 8.973   55.362  1.00 28.66  ? 25  SER B CA  1 
ATOM   1305  C C   . SER B 1 29  ? -14.781 8.385   55.499  1.00 39.57  ? 25  SER B C   1 
ATOM   1306  O O   . SER B 1 29  ? -14.588 7.389   56.195  1.00 54.57  ? 25  SER B O   1 
ATOM   1307  C CB  . SER B 1 29  ? -16.997 8.127   54.381  1.00 32.42  ? 25  SER B CB  1 
ATOM   1308  O OG  . SER B 1 29  ? -16.428 8.153   53.085  1.00 24.76  ? 25  SER B OG  1 
ATOM   1309  N N   . GLN B 1 30  ? -13.805 9.001   54.839  1.00 51.20  ? 26  GLN B N   1 
ATOM   1310  C CA  . GLN B 1 30  ? -12.439 8.485   54.845  1.00 55.66  ? 26  GLN B CA  1 
ATOM   1311  C C   . GLN B 1 30  ? -11.733 8.746   56.175  1.00 55.73  ? 26  GLN B C   1 
ATOM   1312  O O   . GLN B 1 30  ? -11.915 9.794   56.797  1.00 34.69  ? 26  GLN B O   1 
ATOM   1313  C CB  . GLN B 1 30  ? -11.635 9.089   53.692  1.00 63.06  ? 26  GLN B CB  1 
ATOM   1314  C CG  . GLN B 1 30  ? -12.215 8.786   52.320  1.00 58.27  ? 26  GLN B CG  1 
ATOM   1315  C CD  . GLN B 1 30  ? -12.437 7.301   52.095  1.00 42.82  ? 26  GLN B CD  1 
ATOM   1316  O OE1 . GLN B 1 30  ? -11.494 6.513   52.117  1.00 44.39  ? 26  GLN B OE1 1 
ATOM   1317  N NE2 . GLN B 1 30  ? -13.690 6.912   51.886  1.00 32.12  ? 26  GLN B NE2 1 
ATOM   1318  N N   . MET B 1 31  ? -10.920 7.780   56.594  1.00 53.11  ? 27  MET B N   1 
ATOM   1319  C CA  . MET B 1 31  ? -10.229 7.842   57.877  1.00 34.15  ? 27  MET B CA  1 
ATOM   1320  C C   . MET B 1 31  ? -9.056  8.815   57.826  1.00 47.69  ? 27  MET B C   1 
ATOM   1321  O O   . MET B 1 31  ? -8.341  8.892   56.826  1.00 41.77  ? 27  MET B O   1 
ATOM   1322  C CB  . MET B 1 31  ? -9.735  6.447   58.265  1.00 24.87  ? 27  MET B CB  1 
ATOM   1323  C CG  . MET B 1 31  ? -9.215  6.341   59.689  1.00 31.70  ? 27  MET B CG  1 
ATOM   1324  S SD  . MET B 1 31  ? -9.144  4.634   60.268  1.00 33.70  ? 27  MET B SD  1 
ATOM   1325  C CE  . MET B 1 31  ? -7.790  3.990   59.292  1.00 47.83  ? 27  MET B CE  1 
ATOM   1326  N N   . GLU B 1 32  ? -8.863  9.557   58.913  1.00 50.06  ? 28  GLU B N   1 
ATOM   1327  C CA  . GLU B 1 32  ? -7.783  10.534  58.992  1.00 40.32  ? 28  GLU B CA  1 
ATOM   1328  C C   . GLU B 1 32  ? -6.503  9.883   59.505  1.00 46.64  ? 28  GLU B C   1 
ATOM   1329  O O   . GLU B 1 32  ? -6.337  9.679   60.708  1.00 56.01  ? 28  GLU B O   1 
ATOM   1330  C CB  . GLU B 1 32  ? -8.180  11.695  59.906  1.00 41.93  ? 28  GLU B CB  1 
ATOM   1331  C CG  . GLU B 1 32  ? -9.424  12.445  59.459  1.00 40.55  ? 28  GLU B CG  1 
ATOM   1332  C CD  . GLU B 1 32  ? -9.719  13.649  60.335  1.00 54.45  ? 28  GLU B CD  1 
ATOM   1333  O OE1 . GLU B 1 32  ? -10.516 14.513  59.913  1.00 65.43  ? 28  GLU B OE1 1 
ATOM   1334  O OE2 . GLU B 1 32  ? -9.155  13.733  61.446  1.00 52.01  ? 28  GLU B OE2 1 
ATOM   1335  N N   . THR B 1 33  ? -5.600  9.564   58.584  1.00 37.40  ? 29  THR B N   1 
ATOM   1336  C CA  . THR B 1 33  ? -4.351  8.899   58.937  1.00 51.42  ? 29  THR B CA  1 
ATOM   1337  C C   . THR B 1 33  ? -3.153  9.636   58.347  1.00 56.54  ? 29  THR B C   1 
ATOM   1338  O O   . THR B 1 33  ? -3.301  10.688  57.723  1.00 48.79  ? 29  THR B O   1 
ATOM   1339  C CB  . THR B 1 33  ? -4.326  7.438   58.431  1.00 47.64  ? 29  THR B CB  1 
ATOM   1340  O OG1 . THR B 1 33  ? -4.304  7.421   56.999  1.00 76.23  ? 29  THR B OG1 1 
ATOM   1341  C CG2 . THR B 1 33  ? -5.541  6.671   58.919  1.00 30.25  ? 29  THR B CG2 1 
ATOM   1342  N N   . SER B 1 34  ? -1.966  9.076   58.559  1.00 54.25  ? 30  SER B N   1 
ATOM   1343  C CA  . SER B 1 34  ? -0.742  9.614   57.982  1.00 52.03  ? 30  SER B CA  1 
ATOM   1344  C C   . SER B 1 34  ? -0.571  9.108   56.552  1.00 48.56  ? 30  SER B C   1 
ATOM   1345  O O   . SER B 1 34  ? 0.134   9.720   55.749  1.00 42.50  ? 30  SER B O   1 
ATOM   1346  C CB  . SER B 1 34  ? 0.466   9.209   58.829  1.00 55.64  ? 30  SER B CB  1 
ATOM   1347  O OG  . SER B 1 34  ? 0.634   7.801   58.844  1.00 54.83  ? 30  SER B OG  1 
ATOM   1348  N N   . CYS B 1 35  ? -1.228  7.991   56.249  1.00 52.66  ? 31  CYS B N   1 
ATOM   1349  C CA  . CYS B 1 35  ? -1.167  7.369   54.929  1.00 42.65  ? 31  CYS B CA  1 
ATOM   1350  C C   . CYS B 1 35  ? -0.942  8.374   53.808  1.00 43.26  ? 31  CYS B C   1 
ATOM   1351  O O   . CYS B 1 35  ? -1.634  9.387   53.716  1.00 47.98  ? 31  CYS B O   1 
ATOM   1352  C CB  . CYS B 1 35  ? -2.459  6.595   54.662  1.00 33.85  ? 31  CYS B CB  1 
ATOM   1353  S SG  . CYS B 1 35  ? -2.729  6.146   52.933  1.00 40.30  ? 31  CYS B SG  1 
ATOM   1354  N N   . GLN B 1 36  ? 0.038   8.081   52.960  1.00 43.45  ? 32  GLN B N   1 
ATOM   1355  C CA  . GLN B 1 36  ? 0.309   8.892   51.781  1.00 31.46  ? 32  GLN B CA  1 
ATOM   1356  C C   . GLN B 1 36  ? 0.342   8.001   50.545  1.00 29.76  ? 32  GLN B C   1 
ATOM   1357  O O   . GLN B 1 36  ? 0.902   6.905   50.575  1.00 37.49  ? 32  GLN B O   1 
ATOM   1358  C CB  . GLN B 1 36  ? 1.637   9.631   51.936  1.00 20.68  ? 32  GLN B CB  1 
ATOM   1359  C CG  . GLN B 1 36  ? 1.596   10.782  52.929  1.00 19.55  ? 32  GLN B CG  1 
ATOM   1360  C CD  . GLN B 1 36  ? 2.981   11.291  53.281  1.00 44.53  ? 32  GLN B CD  1 
ATOM   1361  O OE1 . GLN B 1 36  ? 3.920   10.509  53.437  1.00 35.34  ? 32  GLN B OE1 1 
ATOM   1362  N NE2 . GLN B 1 36  ? 3.117   12.607  53.399  1.00 49.30  ? 32  GLN B NE2 1 
ATOM   1363  N N   . ILE B 1 37  ? -0.266  8.474   49.463  1.00 34.36  ? 33  ILE B N   1 
ATOM   1364  C CA  . ILE B 1 37  ? -0.334  7.710   48.223  1.00 34.82  ? 33  ILE B CA  1 
ATOM   1365  C C   . ILE B 1 37  ? 0.276   8.489   47.065  1.00 40.89  ? 33  ILE B C   1 
ATOM   1366  O O   . ILE B 1 37  ? 0.569   9.680   47.188  1.00 38.84  ? 33  ILE B O   1 
ATOM   1367  C CB  . ILE B 1 37  ? -1.786  7.341   47.866  1.00 32.66  ? 33  ILE B CB  1 
ATOM   1368  C CG1 . ILE B 1 37  ? -2.663  8.596   47.817  1.00 29.74  ? 33  ILE B CG1 1 
ATOM   1369  C CG2 . ILE B 1 37  ? -2.339  6.352   48.876  1.00 39.31  ? 33  ILE B CG2 1 
ATOM   1370  C CD1 . ILE B 1 37  ? -4.062  8.346   47.286  1.00 28.92  ? 33  ILE B CD1 1 
ATOM   1371  N N   . THR B 1 38  ? 0.464   7.806   45.941  1.00 46.59  ? 34  THR B N   1 
ATOM   1372  C CA  . THR B 1 38  ? 1.042   8.424   44.755  1.00 56.81  ? 34  THR B CA  1 
ATOM   1373  C C   . THR B 1 38  ? -0.022  8.662   43.690  1.00 58.55  ? 34  THR B C   1 
ATOM   1374  O O   . THR B 1 38  ? -0.930  7.850   43.511  1.00 59.04  ? 34  THR B O   1 
ATOM   1375  C CB  . THR B 1 38  ? 2.154   7.547   44.158  1.00 48.40  ? 34  THR B CB  1 
ATOM   1376  O OG1 . THR B 1 38  ? 3.163   7.313   45.148  1.00 63.27  ? 34  THR B OG1 1 
ATOM   1377  C CG2 . THR B 1 38  ? 2.780   8.225   42.948  1.00 34.81  ? 34  THR B CG2 1 
ATOM   1378  N N   . PHE B 1 39  ? 0.097   9.781   42.983  1.00 48.24  ? 35  PHE B N   1 
ATOM   1379  C CA  . PHE B 1 39  ? -0.850  10.120  41.929  1.00 30.44  ? 35  PHE B CA  1 
ATOM   1380  C C   . PHE B 1 39  ? -0.333  11.277  41.081  1.00 28.69  ? 35  PHE B C   1 
ATOM   1381  O O   . PHE B 1 39  ? 0.347   12.173  41.581  1.00 28.73  ? 35  PHE B O   1 
ATOM   1382  C CB  . PHE B 1 39  ? -2.214  10.477  42.530  1.00 18.45  ? 35  PHE B CB  1 
ATOM   1383  C CG  . PHE B 1 39  ? -2.182  11.655  43.466  1.00 11.84  ? 35  PHE B CG  1 
ATOM   1384  C CD1 . PHE B 1 39  ? -2.202  12.949  42.972  1.00 19.58  ? 35  PHE B CD1 1 
ATOM   1385  C CD2 . PHE B 1 39  ? -2.133  11.468  44.838  1.00 19.57  ? 35  PHE B CD2 1 
ATOM   1386  C CE1 . PHE B 1 39  ? -2.171  14.036  43.828  1.00 13.87  ? 35  PHE B CE1 1 
ATOM   1387  C CE2 . PHE B 1 39  ? -2.102  12.548  45.698  1.00 20.56  ? 35  PHE B CE2 1 
ATOM   1388  C CZ  . PHE B 1 39  ? -2.121  13.835  45.192  1.00 20.29  ? 35  PHE B CZ  1 
ATOM   1389  N N   . GLU B 1 40  ? -0.656  11.245  39.792  1.00 35.85  ? 36  GLU B N   1 
ATOM   1390  C CA  . GLU B 1 40  ? -0.304  12.331  38.886  1.00 36.06  ? 36  GLU B CA  1 
ATOM   1391  C C   . GLU B 1 40  ? -1.390  13.395  38.935  1.00 41.46  ? 36  GLU B C   1 
ATOM   1392  O O   . GLU B 1 40  ? -2.579  13.078  38.905  1.00 47.17  ? 36  GLU B O   1 
ATOM   1393  C CB  . GLU B 1 40  ? -0.163  11.811  37.453  1.00 46.26  ? 36  GLU B CB  1 
ATOM   1394  C CG  . GLU B 1 40  ? 0.935   10.781  37.260  1.00 59.91  ? 36  GLU B CG  1 
ATOM   1395  C CD  . GLU B 1 40  ? 2.322   11.380  37.370  1.00 74.01  ? 36  GLU B CD  1 
ATOM   1396  O OE1 . GLU B 1 40  ? 2.935   11.663  36.318  1.00 63.33  ? 36  GLU B OE1 1 
ATOM   1397  O OE2 . GLU B 1 40  ? 2.798   11.567  38.509  1.00 79.36  ? 36  GLU B OE2 1 
ATOM   1398  N N   . PHE B 1 41  ? -0.983  14.657  39.016  1.00 44.84  ? 37  PHE B N   1 
ATOM   1399  C CA  . PHE B 1 41  ? -1.934  15.760  38.991  1.00 39.87  ? 37  PHE B CA  1 
ATOM   1400  C C   . PHE B 1 41  ? -1.248  17.028  38.494  1.00 25.67  ? 37  PHE B C   1 
ATOM   1401  O O   . PHE B 1 41  ? -0.026  17.067  38.363  1.00 42.77  ? 37  PHE B O   1 
ATOM   1402  C CB  . PHE B 1 41  ? -2.541  15.981  40.378  1.00 46.20  ? 37  PHE B CB  1 
ATOM   1403  C CG  . PHE B 1 41  ? -3.873  16.676  40.352  1.00 57.70  ? 37  PHE B CG  1 
ATOM   1404  C CD1 . PHE B 1 41  ? -4.982  16.055  39.801  1.00 52.98  ? 37  PHE B CD1 1 
ATOM   1405  C CD2 . PHE B 1 41  ? -4.017  17.952  40.873  1.00 70.10  ? 37  PHE B CD2 1 
ATOM   1406  C CE1 . PHE B 1 41  ? -6.209  16.691  39.774  1.00 54.20  ? 37  PHE B CE1 1 
ATOM   1407  C CE2 . PHE B 1 41  ? -5.244  18.591  40.849  1.00 62.10  ? 37  PHE B CE2 1 
ATOM   1408  C CZ  . PHE B 1 41  ? -6.340  17.959  40.299  1.00 56.37  ? 37  PHE B CZ  1 
ATOM   1409  N N   . VAL B 1 42  ? -2.039  18.060  38.215  1.00 35.01  ? 38  VAL B N   1 
ATOM   1410  C CA  . VAL B 1 42  ? -1.516  19.303  37.654  1.00 37.42  ? 38  VAL B CA  1 
ATOM   1411  C C   . VAL B 1 42  ? -0.569  20.007  38.622  1.00 48.85  ? 38  VAL B C   1 
ATOM   1412  O O   . VAL B 1 42  ? -0.760  19.967  39.838  1.00 48.36  ? 38  VAL B O   1 
ATOM   1413  C CB  . VAL B 1 42  ? -2.654  20.283  37.288  1.00 38.80  ? 38  VAL B CB  1 
ATOM   1414  C CG1 . VAL B 1 42  ? -2.086  21.573  36.703  1.00 43.48  ? 38  VAL B CG1 1 
ATOM   1415  C CG2 . VAL B 1 42  ? -3.622  19.638  36.311  1.00 50.49  ? 38  VAL B CG2 1 
ATOM   1416  N N   . ASP B 1 43  ? 0.455   20.649  38.067  1.00 47.85  ? 39  ASP B N   1 
ATOM   1417  C CA  . ASP B 1 43  ? 1.378   21.454  38.855  1.00 53.89  ? 39  ASP B CA  1 
ATOM   1418  C C   . ASP B 1 43  ? 0.947   22.913  38.791  1.00 57.24  ? 39  ASP B C   1 
ATOM   1419  O O   . ASP B 1 43  ? 1.025   23.544  37.736  1.00 37.04  ? 39  ASP B O   1 
ATOM   1420  C CB  . ASP B 1 43  ? 2.803   21.312  38.321  1.00 58.75  ? 39  ASP B CB  1 
ATOM   1421  C CG  . ASP B 1 43  ? 3.831   21.979  39.217  1.00 71.08  ? 39  ASP B CG  1 
ATOM   1422  O OD1 . ASP B 1 43  ? 3.443   22.840  40.037  1.00 61.68  ? 39  ASP B OD1 1 
ATOM   1423  O OD2 . ASP B 1 43  ? 5.029   21.645  39.098  1.00 77.63  ? 39  ASP B OD2 1 
ATOM   1424  N N   . GLN B 1 44  ? 0.493   23.447  39.920  1.00 80.47  ? 40  GLN B N   1 
ATOM   1425  C CA  . GLN B 1 44  ? 0.006   24.822  39.970  1.00 96.87  ? 40  GLN B CA  1 
ATOM   1426  C C   . GLN B 1 44  ? 1.113   25.824  39.654  1.00 97.48  ? 40  GLN B C   1 
ATOM   1427  O O   . GLN B 1 44  ? 0.850   26.896  39.108  1.00 100.58 ? 40  GLN B O   1 
ATOM   1428  C CB  . GLN B 1 44  ? -0.590  25.133  41.346  1.00 100.76 ? 40  GLN B CB  1 
ATOM   1429  C CG  . GLN B 1 44  ? -1.164  26.539  41.461  1.00 105.14 ? 40  GLN B CG  1 
ATOM   1430  C CD  . GLN B 1 44  ? -2.302  26.786  40.486  1.00 99.90  ? 40  GLN B CD  1 
ATOM   1431  O OE1 . GLN B 1 44  ? -3.280  26.040  40.457  1.00 114.18 ? 40  GLN B OE1 1 
ATOM   1432  N NE2 . GLN B 1 44  ? -2.176  27.833  39.678  1.00 78.27  ? 40  GLN B NE2 1 
ATOM   1433  N N   . GLU B 1 45  ? 2.348   25.475  39.998  1.00 89.80  ? 41  GLU B N   1 
ATOM   1434  C CA  . GLU B 1 45  ? 3.473   26.381  39.802  1.00 80.31  ? 41  GLU B CA  1 
ATOM   1435  C C   . GLU B 1 45  ? 3.840   26.504  38.323  1.00 61.40  ? 41  GLU B C   1 
ATOM   1436  O O   . GLU B 1 45  ? 4.370   27.529  37.894  1.00 61.70  ? 41  GLU B O   1 
ATOM   1437  C CB  . GLU B 1 45  ? 4.687   25.910  40.604  1.00 95.00  ? 41  GLU B CB  1 
ATOM   1438  C CG  . GLU B 1 45  ? 5.566   27.046  41.097  1.00 105.19 ? 41  GLU B CG  1 
ATOM   1439  C CD  . GLU B 1 45  ? 6.798   26.554  41.829  1.00 111.57 ? 41  GLU B CD  1 
ATOM   1440  O OE1 . GLU B 1 45  ? 6.948   25.323  41.984  1.00 117.44 ? 41  GLU B OE1 1 
ATOM   1441  O OE2 . GLU B 1 45  ? 7.617   27.398  42.252  1.00 108.27 ? 41  GLU B OE2 1 
ATOM   1442  N N   . GLN B 1 46  ? 3.562   25.456  37.552  1.00 48.84  ? 42  GLN B N   1 
ATOM   1443  C CA  . GLN B 1 46  ? 3.831   25.463  36.116  1.00 49.08  ? 42  GLN B CA  1 
ATOM   1444  C C   . GLN B 1 46  ? 2.637   26.004  35.334  1.00 54.83  ? 42  GLN B C   1 
ATOM   1445  O O   . GLN B 1 46  ? 2.803   26.645  34.295  1.00 61.91  ? 42  GLN B O   1 
ATOM   1446  C CB  . GLN B 1 46  ? 4.164   24.051  35.627  1.00 49.66  ? 42  GLN B CB  1 
ATOM   1447  C CG  . GLN B 1 46  ? 5.428   23.462  36.229  1.00 58.29  ? 42  GLN B CG  1 
ATOM   1448  C CD  . GLN B 1 46  ? 5.680   22.036  35.778  1.00 75.86  ? 42  GLN B CD  1 
ATOM   1449  O OE1 . GLN B 1 46  ? 5.516   21.705  34.603  1.00 82.37  ? 42  GLN B OE1 1 
ATOM   1450  N NE2 . GLN B 1 46  ? 6.078   21.181  36.715  1.00 77.99  ? 42  GLN B NE2 1 
ATOM   1451  N N   . LEU B 1 47  ? 1.436   25.741  35.840  1.00 45.61  ? 43  LEU B N   1 
ATOM   1452  C CA  . LEU B 1 47  ? 0.209   26.157  35.169  1.00 48.78  ? 43  LEU B CA  1 
ATOM   1453  C C   . LEU B 1 47  ? -0.575  27.142  36.039  1.00 58.93  ? 43  LEU B C   1 
ATOM   1454  O O   . LEU B 1 47  ? -1.318  26.744  36.937  1.00 48.34  ? 43  LEU B O   1 
ATOM   1455  C CB  . LEU B 1 47  ? -0.641  24.928  34.836  1.00 38.79  ? 43  LEU B CB  1 
ATOM   1456  C CG  . LEU B 1 47  ? -1.898  25.139  33.990  1.00 31.18  ? 43  LEU B CG  1 
ATOM   1457  C CD1 . LEU B 1 47  ? -1.636  26.062  32.809  1.00 26.92  ? 43  LEU B CD1 1 
ATOM   1458  C CD2 . LEU B 1 47  ? -2.420  23.794  33.508  1.00 27.39  ? 43  LEU B CD2 1 
ATOM   1459  N N   . LYS B 1 48  ? -0.398  28.431  35.763  1.00 75.45  ? 44  LYS B N   1 
ATOM   1460  C CA  . LYS B 1 48  ? -1.005  29.489  36.565  1.00 81.91  ? 44  LYS B CA  1 
ATOM   1461  C C   . LYS B 1 48  ? -2.435  29.795  36.130  1.00 69.73  ? 44  LYS B C   1 
ATOM   1462  O O   . LYS B 1 48  ? -3.315  29.998  36.966  1.00 66.95  ? 44  LYS B O   1 
ATOM   1463  C CB  . LYS B 1 48  ? -0.157  30.760  36.480  1.00 95.32  ? 44  LYS B CB  1 
ATOM   1464  C CG  . LYS B 1 48  ? 1.173   30.666  37.212  1.00 100.34 ? 44  LYS B CG  1 
ATOM   1465  C CD  . LYS B 1 48  ? 0.991   30.831  38.714  1.00 102.53 ? 44  LYS B CD  1 
ATOM   1466  C CE  . LYS B 1 48  ? 2.257   30.477  39.479  1.00 96.62  ? 44  LYS B CE  1 
ATOM   1467  N NZ  . LYS B 1 48  ? 2.055   30.554  40.953  1.00 89.50  ? 44  LYS B NZ  1 
ATOM   1468  N N   . ASP B 1 49  ? -2.661  29.833  34.821  1.00 59.96  ? 45  ASP B N   1 
ATOM   1469  C CA  . ASP B 1 49  ? -3.975  30.173  34.285  1.00 57.16  ? 45  ASP B CA  1 
ATOM   1470  C C   . ASP B 1 49  ? -5.071  29.298  34.898  1.00 59.92  ? 45  ASP B C   1 
ATOM   1471  O O   . ASP B 1 49  ? -5.045  28.076  34.753  1.00 64.08  ? 45  ASP B O   1 
ATOM   1472  C CB  . ASP B 1 49  ? -3.988  30.024  32.764  1.00 56.84  ? 45  ASP B CB  1 
ATOM   1473  C CG  . ASP B 1 49  ? -5.345  30.331  32.165  1.00 64.36  ? 45  ASP B CG  1 
ATOM   1474  O OD1 . ASP B 1 49  ? -6.056  31.194  32.720  1.00 57.64  ? 45  ASP B OD1 1 
ATOM   1475  O OD2 . ASP B 1 49  ? -5.705  29.709  31.145  1.00 79.26  ? 45  ASP B OD2 1 
ATOM   1476  N N   . PRO B 1 50  ? -6.040  29.925  35.585  1.00 55.88  ? 46  PRO B N   1 
ATOM   1477  C CA  . PRO B 1 50  ? -7.143  29.208  36.239  1.00 51.87  ? 46  PRO B CA  1 
ATOM   1478  C C   . PRO B 1 50  ? -7.954  28.309  35.304  1.00 46.44  ? 46  PRO B C   1 
ATOM   1479  O O   . PRO B 1 50  ? -8.202  27.151  35.642  1.00 59.15  ? 46  PRO B O   1 
ATOM   1480  C CB  . PRO B 1 50  ? -8.026  30.339  36.771  1.00 70.56  ? 46  PRO B CB  1 
ATOM   1481  C CG  . PRO B 1 50  ? -7.096  31.475  36.971  1.00 73.38  ? 46  PRO B CG  1 
ATOM   1482  C CD  . PRO B 1 50  ? -6.083  31.370  35.872  1.00 60.99  ? 46  PRO B CD  1 
ATOM   1483  N N   . VAL B 1 51  ? -8.368  28.832  34.154  1.00 48.53  ? 47  VAL B N   1 
ATOM   1484  C CA  . VAL B 1 51  ? -9.198  28.065  33.225  1.00 47.76  ? 47  VAL B CA  1 
ATOM   1485  C C   . VAL B 1 51  ? -8.458  26.845  32.685  1.00 44.87  ? 47  VAL B C   1 
ATOM   1486  O O   . VAL B 1 51  ? -8.990  25.735  32.699  1.00 49.87  ? 47  VAL B O   1 
ATOM   1487  C CB  . VAL B 1 51  ? -9.681  28.930  32.044  1.00 48.42  ? 47  VAL B CB  1 
ATOM   1488  C CG1 . VAL B 1 51  ? -10.224 28.051  30.920  1.00 40.40  ? 47  VAL B CG1 1 
ATOM   1489  C CG2 . VAL B 1 51  ? -10.738 29.921  32.512  1.00 45.00  ? 47  VAL B CG2 1 
ATOM   1490  N N   . CYS B 1 52  ? -7.233  27.052  32.213  1.00 42.46  ? 48  CYS B N   1 
ATOM   1491  C CA  . CYS B 1 52  ? -6.425  25.958  31.684  1.00 40.33  ? 48  CYS B CA  1 
ATOM   1492  C C   . CYS B 1 52  ? -6.146  24.909  32.758  1.00 35.70  ? 48  CYS B C   1 
ATOM   1493  O O   . CYS B 1 52  ? -6.056  23.716  32.465  1.00 39.97  ? 48  CYS B O   1 
ATOM   1494  C CB  . CYS B 1 52  ? -5.105  26.492  31.119  1.00 35.93  ? 48  CYS B CB  1 
ATOM   1495  S SG  . CYS B 1 52  ? -5.260  27.343  29.530  1.00 76.72  ? 48  CYS B SG  1 
ATOM   1496  N N   . TYR B 1 53  ? -6.009  25.357  34.002  1.00 22.91  ? 49  TYR B N   1 
ATOM   1497  C CA  . TYR B 1 53  ? -5.769  24.447  35.114  1.00 18.26  ? 49  TYR B CA  1 
ATOM   1498  C C   . TYR B 1 53  ? -6.901  23.430  35.212  1.00 32.05  ? 49  TYR B C   1 
ATOM   1499  O O   . TYR B 1 53  ? -6.664  22.228  35.342  1.00 27.26  ? 49  TYR B O   1 
ATOM   1500  C CB  . TYR B 1 53  ? -5.647  25.221  36.429  1.00 20.49  ? 49  TYR B CB  1 
ATOM   1501  C CG  . TYR B 1 53  ? -5.477  24.337  37.647  1.00 33.81  ? 49  TYR B CG  1 
ATOM   1502  C CD1 . TYR B 1 53  ? -6.581  23.795  38.298  1.00 23.85  ? 49  TYR B CD1 1 
ATOM   1503  C CD2 . TYR B 1 53  ? -4.214  24.044  38.146  1.00 34.22  ? 49  TYR B CD2 1 
ATOM   1504  C CE1 . TYR B 1 53  ? -6.430  22.986  39.411  1.00 27.19  ? 49  TYR B CE1 1 
ATOM   1505  C CE2 . TYR B 1 53  ? -4.053  23.236  39.258  1.00 41.77  ? 49  TYR B CE2 1 
ATOM   1506  C CZ  . TYR B 1 53  ? -5.164  22.710  39.887  1.00 47.57  ? 49  TYR B CZ  1 
ATOM   1507  O OH  . TYR B 1 53  ? -5.008  21.906  40.995  1.00 50.87  ? 49  TYR B OH  1 
ATOM   1508  N N   . LEU B 1 54  ? -8.133  23.920  35.150  1.00 39.86  ? 50  LEU B N   1 
ATOM   1509  C CA  . LEU B 1 54  ? -9.301  23.056  35.255  1.00 29.32  ? 50  LEU B CA  1 
ATOM   1510  C C   . LEU B 1 54  ? -9.402  22.122  34.055  1.00 37.30  ? 50  LEU B C   1 
ATOM   1511  O O   . LEU B 1 54  ? -9.797  20.965  34.196  1.00 51.52  ? 50  LEU B O   1 
ATOM   1512  C CB  . LEU B 1 54  ? -10.573 23.894  35.383  1.00 32.73  ? 50  LEU B CB  1 
ATOM   1513  C CG  . LEU B 1 54  ? -10.705 24.704  36.677  1.00 31.51  ? 50  LEU B CG  1 
ATOM   1514  C CD1 . LEU B 1 54  ? -11.914 25.626  36.616  1.00 29.42  ? 50  LEU B CD1 1 
ATOM   1515  C CD2 . LEU B 1 54  ? -10.798 23.786  37.889  1.00 15.23  ? 50  LEU B CD2 1 
ATOM   1516  N N   . LYS B 1 55  ? -9.040  22.620  32.878  1.00 47.83  ? 51  LYS B N   1 
ATOM   1517  C CA  . LYS B 1 55  ? -9.111  21.814  31.665  1.00 43.18  ? 51  LYS B CA  1 
ATOM   1518  C C   . LYS B 1 55  ? -8.254  20.562  31.796  1.00 43.92  ? 51  LYS B C   1 
ATOM   1519  O O   . LYS B 1 55  ? -8.686  19.465  31.440  1.00 51.31  ? 51  LYS B O   1 
ATOM   1520  C CB  . LYS B 1 55  ? -8.661  22.622  30.447  1.00 27.91  ? 51  LYS B CB  1 
ATOM   1521  C CG  . LYS B 1 55  ? -9.602  23.752  30.068  1.00 36.01  ? 51  LYS B CG  1 
ATOM   1522  C CD  . LYS B 1 55  ? -9.418  24.161  28.614  1.00 49.70  ? 51  LYS B CD  1 
ATOM   1523  C CE  . LYS B 1 55  ? -10.152 23.214  27.674  1.00 45.75  ? 51  LYS B CE  1 
ATOM   1524  N NZ  . LYS B 1 55  ? -9.954  23.572  26.246  1.00 42.88  ? 51  LYS B NZ  1 
ATOM   1525  N N   . LYS B 1 56  ? -7.041  20.729  32.313  1.00 43.38  ? 52  LYS B N   1 
ATOM   1526  C CA  . LYS B 1 56  ? -6.115  19.611  32.450  1.00 46.47  ? 52  LYS B CA  1 
ATOM   1527  C C   . LYS B 1 56  ? -6.449  18.771  33.678  1.00 51.98  ? 52  LYS B C   1 
ATOM   1528  O O   . LYS B 1 56  ? -6.517  17.545  33.599  1.00 54.24  ? 52  LYS B O   1 
ATOM   1529  C CB  . LYS B 1 56  ? -4.671  20.110  32.530  1.00 48.23  ? 52  LYS B CB  1 
ATOM   1530  C CG  . LYS B 1 56  ? -3.752  19.424  31.537  1.00 61.90  ? 52  LYS B CG  1 
ATOM   1531  C CD  . LYS B 1 56  ? -2.364  20.029  31.535  1.00 69.18  ? 52  LYS B CD  1 
ATOM   1532  C CE  . LYS B 1 56  ? -1.587  19.591  30.305  1.00 75.75  ? 52  LYS B CE  1 
ATOM   1533  N NZ  . LYS B 1 56  ? -1.510  18.106  30.188  1.00 64.51  ? 52  LYS B NZ  1 
ATOM   1534  N N   . ALA B 1 57  ? -6.658  19.438  34.808  1.00 48.13  ? 53  ALA B N   1 
ATOM   1535  C CA  . ALA B 1 57  ? -7.023  18.758  36.043  1.00 31.11  ? 53  ALA B CA  1 
ATOM   1536  C C   . ALA B 1 57  ? -8.179  17.798  35.793  1.00 37.90  ? 53  ALA B C   1 
ATOM   1537  O O   . ALA B 1 57  ? -8.143  16.643  36.212  1.00 51.42  ? 53  ALA B O   1 
ATOM   1538  C CB  . ALA B 1 57  ? -7.405  19.772  37.103  1.00 22.24  ? 53  ALA B CB  1 
ATOM   1539  N N   . PHE B 1 58  ? -9.202  18.290  35.103  1.00 36.34  ? 54  PHE B N   1 
ATOM   1540  C CA  . PHE B 1 58  ? -10.391 17.498  34.809  1.00 37.84  ? 54  PHE B CA  1 
ATOM   1541  C C   . PHE B 1 58  ? -10.025 16.161  34.164  1.00 39.58  ? 54  PHE B C   1 
ATOM   1542  O O   . PHE B 1 58  ? -10.590 15.124  34.512  1.00 43.98  ? 54  PHE B O   1 
ATOM   1543  C CB  . PHE B 1 58  ? -11.335 18.291  33.898  1.00 41.21  ? 54  PHE B CB  1 
ATOM   1544  C CG  . PHE B 1 58  ? -12.577 17.543  33.508  1.00 44.71  ? 54  PHE B CG  1 
ATOM   1545  C CD1 . PHE B 1 58  ? -13.596 17.337  34.424  1.00 52.85  ? 54  PHE B CD1 1 
ATOM   1546  C CD2 . PHE B 1 58  ? -12.727 17.043  32.224  1.00 48.53  ? 54  PHE B CD2 1 
ATOM   1547  C CE1 . PHE B 1 58  ? -14.741 16.648  34.066  1.00 58.31  ? 54  PHE B CE1 1 
ATOM   1548  C CE2 . PHE B 1 58  ? -13.869 16.354  31.860  1.00 45.46  ? 54  PHE B CE2 1 
ATOM   1549  C CZ  . PHE B 1 58  ? -14.877 16.156  32.782  1.00 52.70  ? 54  PHE B CZ  1 
ATOM   1550  N N   . LEU B 1 59  ? -9.075  16.187  33.234  1.00 35.33  ? 55  LEU B N   1 
ATOM   1551  C CA  . LEU B 1 59  ? -8.650  14.976  32.535  1.00 33.91  ? 55  LEU B CA  1 
ATOM   1552  C C   . LEU B 1 59  ? -7.884  14.030  33.452  1.00 42.74  ? 55  LEU B C   1 
ATOM   1553  O O   . LEU B 1 59  ? -8.093  12.817  33.423  1.00 47.68  ? 55  LEU B O   1 
ATOM   1554  C CB  . LEU B 1 59  ? -7.776  15.337  31.336  1.00 24.23  ? 55  LEU B CB  1 
ATOM   1555  C CG  . LEU B 1 59  ? -8.479  16.110  30.221  1.00 50.36  ? 55  LEU B CG  1 
ATOM   1556  C CD1 . LEU B 1 59  ? -7.485  16.461  29.139  1.00 51.21  ? 55  LEU B CD1 1 
ATOM   1557  C CD2 . LEU B 1 59  ? -9.638  15.310  29.642  1.00 44.84  ? 55  LEU B CD2 1 
ATOM   1558  N N   . LEU B 1 60  ? -6.987  14.590  34.256  1.00 42.18  ? 56  LEU B N   1 
ATOM   1559  C CA  . LEU B 1 60  ? -6.205  13.800  35.195  1.00 41.62  ? 56  LEU B CA  1 
ATOM   1560  C C   . LEU B 1 60  ? -7.108  13.207  36.268  1.00 49.08  ? 56  LEU B C   1 
ATOM   1561  O O   . LEU B 1 60  ? -6.829  12.138  36.808  1.00 58.55  ? 56  LEU B O   1 
ATOM   1562  C CB  . LEU B 1 60  ? -5.116  14.665  35.829  1.00 40.85  ? 56  LEU B CB  1 
ATOM   1563  C CG  . LEU B 1 60  ? -4.062  15.164  34.838  1.00 38.94  ? 56  LEU B CG  1 
ATOM   1564  C CD1 . LEU B 1 60  ? -3.224  16.270  35.451  1.00 29.27  ? 56  LEU B CD1 1 
ATOM   1565  C CD2 . LEU B 1 60  ? -3.180  14.012  34.380  1.00 33.57  ? 56  LEU B CD2 1 
ATOM   1566  N N   . VAL B 1 61  ? -8.196  13.907  36.569  1.00 53.31  ? 57  VAL B N   1 
ATOM   1567  C CA  . VAL B 1 61  ? -9.181  13.421  37.525  1.00 36.78  ? 57  VAL B CA  1 
ATOM   1568  C C   . VAL B 1 61  ? -9.824  12.132  37.027  1.00 44.74  ? 57  VAL B C   1 
ATOM   1569  O O   . VAL B 1 61  ? -10.070 11.209  37.804  1.00 45.18  ? 57  VAL B O   1 
ATOM   1570  C CB  . VAL B 1 61  ? -10.278 14.473  37.767  1.00 21.98  ? 57  VAL B CB  1 
ATOM   1571  C CG1 . VAL B 1 61  ? -11.567 13.810  38.232  1.00 27.08  ? 57  VAL B CG1 1 
ATOM   1572  C CG2 . VAL B 1 61  ? -9.803  15.508  38.774  1.00 23.78  ? 57  VAL B CG2 1 
ATOM   1573  N N   . GLN B 1 62  ? -10.093 12.074  35.726  1.00 42.45  ? 58  GLN B N   1 
ATOM   1574  C CA  . GLN B 1 62  ? -10.707 10.897  35.126  1.00 42.01  ? 58  GLN B CA  1 
ATOM   1575  C C   . GLN B 1 62  ? -9.875  9.654   35.410  1.00 40.58  ? 58  GLN B C   1 
ATOM   1576  O O   . GLN B 1 62  ? -10.412 8.611   35.782  1.00 49.13  ? 58  GLN B O   1 
ATOM   1577  C CB  . GLN B 1 62  ? -10.873 11.083  33.617  1.00 47.07  ? 58  GLN B CB  1 
ATOM   1578  C CG  . GLN B 1 62  ? -11.782 12.239  33.238  1.00 51.41  ? 58  GLN B CG  1 
ATOM   1579  C CD  . GLN B 1 62  ? -13.089 12.217  34.003  1.00 70.18  ? 58  GLN B CD  1 
ATOM   1580  O OE1 . GLN B 1 62  ? -13.773 11.193  34.055  1.00 66.03  ? 58  GLN B OE1 1 
ATOM   1581  N NE2 . GLN B 1 62  ? -13.438 13.345  34.614  1.00 81.73  ? 58  GLN B NE2 1 
ATOM   1582  N N   . ASP B 1 63  ? -8.562  9.769   35.232  1.00 32.20  ? 59  ASP B N   1 
ATOM   1583  C CA  . ASP B 1 63  ? -7.658  8.667   35.537  1.00 36.20  ? 59  ASP B CA  1 
ATOM   1584  C C   . ASP B 1 63  ? -7.689  8.347   37.030  1.00 46.78  ? 59  ASP B C   1 
ATOM   1585  O O   . ASP B 1 63  ? -7.731  7.181   37.423  1.00 42.73  ? 59  ASP B O   1 
ATOM   1586  C CB  . ASP B 1 63  ? -6.231  9.006   35.105  1.00 37.01  ? 59  ASP B CB  1 
ATOM   1587  C CG  . ASP B 1 63  ? -6.085  9.098   33.600  1.00 54.39  ? 59  ASP B CG  1 
ATOM   1588  O OD1 . ASP B 1 63  ? -6.048  8.036   32.942  1.00 56.46  ? 59  ASP B OD1 1 
ATOM   1589  O OD2 . ASP B 1 63  ? -6.010  10.229  33.076  1.00 66.55  ? 59  ASP B OD2 1 
ATOM   1590  N N   . ILE B 1 64  ? -7.679  9.389   37.856  1.00 41.97  ? 60  ILE B N   1 
ATOM   1591  C CA  . ILE B 1 64  ? -7.668  9.224   39.306  1.00 34.51  ? 60  ILE B CA  1 
ATOM   1592  C C   . ILE B 1 64  ? -8.912  8.496   39.808  1.00 37.94  ? 60  ILE B C   1 
ATOM   1593  O O   . ILE B 1 64  ? -8.837  7.707   40.749  1.00 48.59  ? 60  ILE B O   1 
ATOM   1594  C CB  . ILE B 1 64  ? -7.551  10.585  40.018  1.00 38.27  ? 60  ILE B CB  1 
ATOM   1595  C CG1 . ILE B 1 64  ? -6.165  11.186  39.771  1.00 34.02  ? 60  ILE B CG1 1 
ATOM   1596  C CG2 . ILE B 1 64  ? -7.798  10.431  41.517  1.00 28.50  ? 60  ILE B CG2 1 
ATOM   1597  C CD1 . ILE B 1 64  ? -6.042  12.633  40.180  1.00 34.06  ? 60  ILE B CD1 1 
ATOM   1598  N N   . MET B 1 65  ? -10.055 8.761   39.183  1.00 28.39  ? 61  MET B N   1 
ATOM   1599  C CA  . MET B 1 65  ? -11.299 8.104   39.570  1.00 20.06  ? 61  MET B CA  1 
ATOM   1600  C C   . MET B 1 65  ? -11.314 6.646   39.128  1.00 25.36  ? 61  MET B C   1 
ATOM   1601  O O   . MET B 1 65  ? -11.992 5.815   39.730  1.00 29.85  ? 61  MET B O   1 
ATOM   1602  C CB  . MET B 1 65  ? -12.501 8.828   38.965  1.00 29.82  ? 61  MET B CB  1 
ATOM   1603  C CG  . MET B 1 65  ? -12.826 10.149  39.631  1.00 26.34  ? 61  MET B CG  1 
ATOM   1604  S SD  . MET B 1 65  ? -14.445 10.771  39.144  1.00 35.68  ? 61  MET B SD  1 
ATOM   1605  C CE  . MET B 1 65  ? -14.187 11.069  37.397  1.00 16.68  ? 61  MET B CE  1 
ATOM   1606  N N   . GLU B 1 66  ? -10.567 6.344   38.071  1.00 34.58  ? 62  GLU B N   1 
ATOM   1607  C CA  . GLU B 1 66  ? -10.509 4.991   37.531  1.00 32.01  ? 62  GLU B CA  1 
ATOM   1608  C C   . GLU B 1 66  ? -9.437  4.156   38.221  1.00 26.96  ? 62  GLU B C   1 
ATOM   1609  O O   . GLU B 1 66  ? -9.677  3.008   38.591  1.00 39.84  ? 62  GLU B O   1 
ATOM   1610  C CB  . GLU B 1 66  ? -10.228 5.040   36.025  1.00 36.92  ? 62  GLU B CB  1 
ATOM   1611  C CG  . GLU B 1 66  ? -9.809  3.707   35.412  1.00 25.02  ? 62  GLU B CG  1 
ATOM   1612  C CD  . GLU B 1 66  ? -10.922 2.677   35.418  1.00 43.58  ? 62  GLU B CD  1 
ATOM   1613  O OE1 . GLU B 1 66  ? -12.054 3.022   35.822  1.00 51.26  ? 62  GLU B OE1 1 
ATOM   1614  O OE2 . GLU B 1 66  ? -10.666 1.522   35.012  1.00 43.77  ? 62  GLU B OE2 1 
ATOM   1615  N N   . ASP B 1 67  ? -8.258  4.745   38.400  1.00 31.37  ? 63  ASP B N   1 
ATOM   1616  C CA  . ASP B 1 67  ? -7.082  4.000   38.833  1.00 33.80  ? 63  ASP B CA  1 
ATOM   1617  C C   . ASP B 1 67  ? -6.915  3.988   40.347  1.00 42.98  ? 63  ASP B C   1 
ATOM   1618  O O   . ASP B 1 67  ? -6.678  2.937   40.942  1.00 64.76  ? 63  ASP B O   1 
ATOM   1619  C CB  . ASP B 1 67  ? -5.818  4.588   38.196  1.00 41.33  ? 63  ASP B CB  1 
ATOM   1620  C CG  . ASP B 1 67  ? -5.797  4.442   36.685  1.00 55.85  ? 63  ASP B CG  1 
ATOM   1621  O OD1 . ASP B 1 67  ? -6.403  3.481   36.165  1.00 63.30  ? 63  ASP B OD1 1 
ATOM   1622  O OD2 . ASP B 1 67  ? -5.165  5.288   36.017  1.00 54.59  ? 63  ASP B OD2 1 
ATOM   1623  N N   . THR B 1 68  ? -7.034  5.158   40.967  1.00 34.86  ? 64  THR B N   1 
ATOM   1624  C CA  . THR B 1 68  ? -6.692  5.311   42.378  1.00 39.27  ? 64  THR B CA  1 
ATOM   1625  C C   . THR B 1 68  ? -7.900  5.211   43.311  1.00 53.69  ? 64  THR B C   1 
ATOM   1626  O O   . THR B 1 68  ? -7.847  4.517   44.326  1.00 79.66  ? 64  THR B O   1 
ATOM   1627  C CB  . THR B 1 68  ? -5.982  6.656   42.626  1.00 41.57  ? 64  THR B CB  1 
ATOM   1628  O OG1 . THR B 1 68  ? -4.820  6.740   41.792  1.00 48.58  ? 64  THR B OG1 1 
ATOM   1629  C CG2 . THR B 1 68  ? -5.569  6.792   44.088  1.00 40.26  ? 64  THR B CG2 1 
ATOM   1630  N N   . MET B 1 69  ? -8.981  5.906   42.972  1.00 38.69  ? 65  MET B N   1 
ATOM   1631  C CA  . MET B 1 69  ? -10.154 5.958   43.838  1.00 52.33  ? 65  MET B CA  1 
ATOM   1632  C C   . MET B 1 69  ? -11.034 4.728   43.647  1.00 54.15  ? 65  MET B C   1 
ATOM   1633  O O   . MET B 1 69  ? -12.017 4.763   42.905  1.00 46.81  ? 65  MET B O   1 
ATOM   1634  C CB  . MET B 1 69  ? -10.954 7.234   43.567  1.00 43.72  ? 65  MET B CB  1 
ATOM   1635  C CG  . MET B 1 69  ? -10.184 8.510   43.886  1.00 44.54  ? 65  MET B CG  1 
ATOM   1636  S SD  . MET B 1 69  ? -10.999 10.020  43.335  1.00 46.25  ? 65  MET B SD  1 
ATOM   1637  C CE  . MET B 1 69  ? -12.558 9.889   44.199  1.00 56.04  ? 65  MET B CE  1 
ATOM   1638  N N   . ARG B 1 70  ? -10.676 3.643   44.329  1.00 54.41  ? 66  ARG B N   1 
ATOM   1639  C CA  . ARG B 1 70  ? -11.397 2.381   44.211  1.00 42.38  ? 66  ARG B CA  1 
ATOM   1640  C C   . ARG B 1 70  ? -11.991 1.979   45.556  1.00 34.28  ? 66  ARG B C   1 
ATOM   1641  O O   . ARG B 1 70  ? -11.307 2.002   46.578  1.00 37.41  ? 66  ARG B O   1 
ATOM   1642  C CB  . ARG B 1 70  ? -10.461 1.286   43.697  1.00 41.81  ? 66  ARG B CB  1 
ATOM   1643  C CG  . ARG B 1 70  ? -9.546  1.757   42.574  1.00 58.77  ? 66  ARG B CG  1 
ATOM   1644  C CD  . ARG B 1 70  ? -8.871  0.607   41.844  1.00 75.72  ? 66  ARG B CD  1 
ATOM   1645  N NE  . ARG B 1 70  ? -7.748  0.039   42.594  1.00 89.95  ? 66  ARG B NE  1 
ATOM   1646  C CZ  . ARG B 1 70  ? -7.695  -1.200  43.084  1.00 96.94  ? 66  ARG B CZ  1 
ATOM   1647  N NH1 . ARG B 1 70  ? -8.702  -2.053  42.921  1.00 88.51  ? 66  ARG B NH1 1 
ATOM   1648  N NH2 . ARG B 1 70  ? -6.616  -1.595  43.746  1.00 103.43 ? 66  ARG B NH2 1 
ATOM   1649  N N   . PHE B 1 71  ? -13.270 1.617   45.548  1.00 36.72  ? 67  PHE B N   1 
ATOM   1650  C CA  . PHE B 1 71  ? -13.969 1.227   46.768  1.00 35.54  ? 67  PHE B CA  1 
ATOM   1651  C C   . PHE B 1 71  ? -14.682 -0.104  46.567  1.00 38.49  ? 67  PHE B C   1 
ATOM   1652  O O   . PHE B 1 71  ? -15.073 -0.439  45.449  1.00 44.29  ? 67  PHE B O   1 
ATOM   1653  C CB  . PHE B 1 71  ? -14.978 2.305   47.164  1.00 40.37  ? 67  PHE B CB  1 
ATOM   1654  C CG  . PHE B 1 71  ? -14.362 3.654   47.386  1.00 26.11  ? 67  PHE B CG  1 
ATOM   1655  C CD1 . PHE B 1 71  ? -14.140 4.513   46.324  1.00 40.68  ? 67  PHE B CD1 1 
ATOM   1656  C CD2 . PHE B 1 71  ? -13.996 4.060   48.656  1.00 30.12  ? 67  PHE B CD2 1 
ATOM   1657  C CE1 . PHE B 1 71  ? -13.567 5.753   46.525  1.00 42.54  ? 67  PHE B CE1 1 
ATOM   1658  C CE2 . PHE B 1 71  ? -13.424 5.298   48.863  1.00 36.03  ? 67  PHE B CE2 1 
ATOM   1659  C CZ  . PHE B 1 71  ? -13.209 6.145   47.797  1.00 38.71  ? 67  PHE B CZ  1 
ATOM   1660  N N   . ARG B 1 72  ? -14.851 -0.859  47.650  1.00 52.36  ? 68  ARG B N   1 
ATOM   1661  C CA  . ARG B 1 72  ? -15.514 -2.157  47.576  1.00 53.45  ? 68  ARG B CA  1 
ATOM   1662  C C   . ARG B 1 72  ? -16.821 -2.028  46.805  1.00 52.19  ? 68  ARG B C   1 
ATOM   1663  O O   . ARG B 1 72  ? -17.590 -1.093  47.026  1.00 38.08  ? 68  ARG B O   1 
ATOM   1664  C CB  . ARG B 1 72  ? -15.786 -2.712  48.976  1.00 54.91  ? 68  ARG B CB  1 
ATOM   1665  C CG  . ARG B 1 72  ? -16.259 -4.159  48.975  1.00 54.91  ? 68  ARG B CG  1 
ATOM   1666  C CD  . ARG B 1 72  ? -16.635 -4.628  50.368  1.00 64.27  ? 68  ARG B CD  1 
ATOM   1667  N NE  . ARG B 1 72  ? -15.541 -4.455  51.320  1.00 86.55  ? 68  ARG B NE  1 
ATOM   1668  C CZ  . ARG B 1 72  ? -14.524 -5.299  51.465  1.00 103.17 ? 68  ARG B CZ  1 
ATOM   1669  N NH1 . ARG B 1 72  ? -14.439 -6.391  50.714  1.00 109.34 ? 68  ARG B NH1 1 
ATOM   1670  N NH2 . ARG B 1 72  ? -13.582 -5.049  52.363  1.00 101.77 ? 68  ARG B NH2 1 
ATOM   1671  N N   . ASP B 1 73  ? -17.065 -2.973  45.901  1.00 59.52  ? 69  ASP B N   1 
ATOM   1672  C CA  . ASP B 1 73  ? -18.228 -2.923  45.017  1.00 62.72  ? 69  ASP B CA  1 
ATOM   1673  C C   . ASP B 1 73  ? -19.539 -2.784  45.790  1.00 56.08  ? 69  ASP B C   1 
ATOM   1674  O O   . ASP B 1 73  ? -19.660 -3.254  46.922  1.00 66.58  ? 69  ASP B O   1 
ATOM   1675  C CB  . ASP B 1 73  ? -18.278 -4.174  44.133  1.00 68.25  ? 69  ASP B CB  1 
ATOM   1676  C CG  . ASP B 1 73  ? -17.096 -4.269  43.182  1.00 78.59  ? 69  ASP B CG  1 
ATOM   1677  O OD1 . ASP B 1 73  ? -16.502 -3.219  42.858  1.00 75.46  ? 69  ASP B OD1 1 
ATOM   1678  O OD2 . ASP B 1 73  ? -16.764 -5.395  42.754  1.00 84.41  ? 69  ASP B OD2 1 
ATOM   1679  N N   . ASN B 1 74  ? -20.514 -2.127  45.167  1.00 48.91  ? 70  ASN B N   1 
ATOM   1680  C CA  . ASN B 1 74  ? -21.852 -1.969  45.739  1.00 55.86  ? 70  ASN B CA  1 
ATOM   1681  C C   . ASN B 1 74  ? -21.874 -1.247  47.087  1.00 55.52  ? 70  ASN B C   1 
ATOM   1682  O O   . ASN B 1 74  ? -22.743 -1.504  47.921  1.00 61.05  ? 70  ASN B O   1 
ATOM   1683  C CB  . ASN B 1 74  ? -22.545 -3.329  45.867  1.00 50.09  ? 70  ASN B CB  1 
ATOM   1684  C CG  . ASN B 1 74  ? -22.870 -3.949  44.520  1.00 57.94  ? 70  ASN B CG  1 
ATOM   1685  O OD1 . ASN B 1 74  ? -22.983 -3.251  43.511  1.00 57.80  ? 70  ASN B OD1 1 
ATOM   1686  N ND2 . ASN B 1 74  ? -23.031 -5.267  44.500  1.00 60.66  ? 70  ASN B ND2 1 
ATOM   1687  N N   . THR B 1 75  ? -20.919 -0.344  47.292  1.00 29.67  ? 71  THR B N   1 
ATOM   1688  C CA  . THR B 1 75  ? -20.927 0.519   48.468  1.00 30.28  ? 71  THR B CA  1 
ATOM   1689  C C   . THR B 1 75  ? -21.233 1.948   48.032  1.00 42.50  ? 71  THR B C   1 
ATOM   1690  O O   . THR B 1 75  ? -20.948 2.326   46.895  1.00 60.68  ? 71  THR B O   1 
ATOM   1691  C CB  . THR B 1 75  ? -19.583 0.487   49.219  1.00 36.74  ? 71  THR B CB  1 
ATOM   1692  O OG1 . THR B 1 75  ? -18.546 1.034   48.394  1.00 34.91  ? 71  THR B OG1 1 
ATOM   1693  C CG2 . THR B 1 75  ? -19.227 -0.937  49.615  1.00 46.98  ? 71  THR B CG2 1 
ATOM   1694  N N   . PRO B 1 76  ? -21.825 2.748   48.931  1.00 35.51  ? 72  PRO B N   1 
ATOM   1695  C CA  . PRO B 1 76  ? -22.215 4.117   48.582  1.00 38.58  ? 72  PRO B CA  1 
ATOM   1696  C C   . PRO B 1 76  ? -21.111 4.870   47.844  1.00 43.59  ? 72  PRO B C   1 
ATOM   1697  O O   . PRO B 1 76  ? -21.374 5.496   46.815  1.00 35.67  ? 72  PRO B O   1 
ATOM   1698  C CB  . PRO B 1 76  ? -22.485 4.756   49.946  1.00 39.80  ? 72  PRO B CB  1 
ATOM   1699  C CG  . PRO B 1 76  ? -22.923 3.623   50.802  1.00 34.74  ? 72  PRO B CG  1 
ATOM   1700  C CD  . PRO B 1 76  ? -22.143 2.424   50.333  1.00 40.74  ? 72  PRO B CD  1 
ATOM   1701  N N   . ASN B 1 77  ? -19.889 4.800   48.361  1.00 41.52  ? 73  ASN B N   1 
ATOM   1702  C CA  . ASN B 1 77  ? -18.764 5.501   47.754  1.00 24.24  ? 73  ASN B CA  1 
ATOM   1703  C C   . ASN B 1 77  ? -18.421 4.951   46.370  1.00 31.40  ? 73  ASN B C   1 
ATOM   1704  O O   . ASN B 1 77  ? -18.136 5.718   45.452  1.00 40.11  ? 73  ASN B O   1 
ATOM   1705  C CB  . ASN B 1 77  ? -17.537 5.446   48.671  1.00 24.56  ? 73  ASN B CB  1 
ATOM   1706  C CG  . ASN B 1 77  ? -17.691 6.317   49.911  1.00 35.97  ? 73  ASN B CG  1 
ATOM   1707  O OD1 . ASN B 1 77  ? -18.500 7.245   49.937  1.00 47.89  ? 73  ASN B OD1 1 
ATOM   1708  N ND2 . ASN B 1 77  ? -16.904 6.025   50.943  1.00 18.57  ? 73  ASN B ND2 1 
ATOM   1709  N N   . ALA B 1 78  ? -18.452 3.629   46.218  1.00 22.51  ? 74  ALA B N   1 
ATOM   1710  C CA  . ALA B 1 78  ? -18.169 3.006   44.925  1.00 22.39  ? 74  ALA B CA  1 
ATOM   1711  C C   . ALA B 1 78  ? -19.164 3.481   43.870  1.00 23.41  ? 74  ALA B C   1 
ATOM   1712  O O   . ALA B 1 78  ? -18.775 3.916   42.786  1.00 36.80  ? 74  ALA B O   1 
ATOM   1713  C CB  . ALA B 1 78  ? -18.205 1.486   45.038  1.00 13.04  ? 74  ALA B CB  1 
ATOM   1714  N N   . ILE B 1 79  ? -20.449 3.397   44.197  1.00 31.22  ? 75  ILE B N   1 
ATOM   1715  C CA  . ILE B 1 79  ? -21.503 3.853   43.297  1.00 32.09  ? 75  ILE B CA  1 
ATOM   1716  C C   . ILE B 1 79  ? -21.364 5.353   43.044  1.00 34.31  ? 75  ILE B C   1 
ATOM   1717  O O   . ILE B 1 79  ? -21.648 5.835   41.949  1.00 41.21  ? 75  ILE B O   1 
ATOM   1718  C CB  . ILE B 1 79  ? -22.900 3.556   43.878  1.00 26.22  ? 75  ILE B CB  1 
ATOM   1719  C CG1 . ILE B 1 79  ? -23.094 2.047   44.049  1.00 19.88  ? 75  ILE B CG1 1 
ATOM   1720  C CG2 . ILE B 1 79  ? -23.988 4.117   42.973  1.00 11.15  ? 75  ILE B CG2 1 
ATOM   1721  C CD1 . ILE B 1 79  ? -24.237 1.679   44.966  1.00 40.81  ? 75  ILE B CD1 1 
ATOM   1722  N N   . ALA B 1 80  ? -20.919 6.085   44.061  1.00 47.45  ? 76  ALA B N   1 
ATOM   1723  C CA  . ALA B 1 80  ? -20.713 7.523   43.935  1.00 34.88  ? 76  ALA B CA  1 
ATOM   1724  C C   . ALA B 1 80  ? -19.672 7.812   42.864  1.00 35.65  ? 76  ALA B C   1 
ATOM   1725  O O   . ALA B 1 80  ? -19.811 8.758   42.090  1.00 48.20  ? 76  ALA B O   1 
ATOM   1726  C CB  . ALA B 1 80  ? -20.282 8.121   45.270  1.00 25.72  ? 76  ALA B CB  1 
ATOM   1727  N N   . ILE B 1 81  ? -18.627 6.992   42.820  1.00 41.93  ? 77  ILE B N   1 
ATOM   1728  C CA  . ILE B 1 81  ? -17.565 7.169   41.836  1.00 32.35  ? 77  ILE B CA  1 
ATOM   1729  C C   . ILE B 1 81  ? -18.083 6.854   40.440  1.00 27.07  ? 77  ILE B C   1 
ATOM   1730  O O   . ILE B 1 81  ? -17.781 7.570   39.485  1.00 40.34  ? 77  ILE B O   1 
ATOM   1731  C CB  . ILE B 1 81  ? -16.341 6.285   42.147  1.00 25.60  ? 77  ILE B CB  1 
ATOM   1732  C CG1 . ILE B 1 81  ? -15.728 6.680   43.493  1.00 41.27  ? 77  ILE B CG1 1 
ATOM   1733  C CG2 . ILE B 1 81  ? -15.299 6.411   41.057  1.00 14.60  ? 77  ILE B CG2 1 
ATOM   1734  C CD1 . ILE B 1 81  ? -15.334 8.141   43.589  1.00 29.68  ? 77  ILE B CD1 1 
ATOM   1735  N N   . VAL B 1 82  ? -18.872 5.789   40.328  1.00 32.44  ? 78  VAL B N   1 
ATOM   1736  C CA  . VAL B 1 82  ? -19.468 5.414   39.049  1.00 25.95  ? 78  VAL B CA  1 
ATOM   1737  C C   . VAL B 1 82  ? -20.247 6.584   38.463  1.00 28.80  ? 78  VAL B C   1 
ATOM   1738  O O   . VAL B 1 82  ? -20.085 6.927   37.291  1.00 25.94  ? 78  VAL B O   1 
ATOM   1739  C CB  . VAL B 1 82  ? -20.419 4.214   39.197  1.00 23.59  ? 78  VAL B CB  1 
ATOM   1740  C CG1 . VAL B 1 82  ? -21.244 4.027   37.931  1.00 28.20  ? 78  VAL B CG1 1 
ATOM   1741  C CG2 . VAL B 1 82  ? -19.637 2.946   39.523  1.00 11.57  ? 78  VAL B CG2 1 
ATOM   1742  N N   . GLN B 1 83  ? -21.094 7.192   39.289  1.00 32.61  ? 79  GLN B N   1 
ATOM   1743  C CA  . GLN B 1 83  ? -21.880 8.345   38.869  1.00 37.79  ? 79  GLN B CA  1 
ATOM   1744  C C   . GLN B 1 83  ? -20.981 9.423   38.280  1.00 35.27  ? 79  GLN B C   1 
ATOM   1745  O O   . GLN B 1 83  ? -21.211 9.891   37.165  1.00 46.19  ? 79  GLN B O   1 
ATOM   1746  C CB  . GLN B 1 83  ? -22.659 8.923   40.052  1.00 47.80  ? 79  GLN B CB  1 
ATOM   1747  C CG  . GLN B 1 83  ? -23.771 8.030   40.570  1.00 46.77  ? 79  GLN B CG  1 
ATOM   1748  C CD  . GLN B 1 83  ? -24.442 8.600   41.803  1.00 52.39  ? 79  GLN B CD  1 
ATOM   1749  O OE1 . GLN B 1 83  ? -23.924 9.520   42.437  1.00 57.05  ? 79  GLN B OE1 1 
ATOM   1750  N NE2 . GLN B 1 83  ? -25.606 8.060   42.146  1.00 44.25  ? 79  GLN B NE2 1 
ATOM   1751  N N   . LEU B 1 84  ? -19.958 9.814   39.036  1.00 30.47  ? 80  LEU B N   1 
ATOM   1752  C CA  . LEU B 1 84  ? -19.039 10.865  38.606  1.00 38.45  ? 80  LEU B CA  1 
ATOM   1753  C C   . LEU B 1 84  ? -18.409 10.541  37.257  1.00 43.60  ? 80  LEU B C   1 
ATOM   1754  O O   . LEU B 1 84  ? -18.332 11.401  36.379  1.00 46.06  ? 80  LEU B O   1 
ATOM   1755  C CB  . LEU B 1 84  ? -17.944 11.077  39.651  1.00 31.24  ? 80  LEU B CB  1 
ATOM   1756  C CG  . LEU B 1 84  ? -18.375 11.796  40.930  1.00 30.54  ? 80  LEU B CG  1 
ATOM   1757  C CD1 . LEU B 1 84  ? -17.272 11.742  41.976  1.00 25.85  ? 80  LEU B CD1 1 
ATOM   1758  C CD2 . LEU B 1 84  ? -18.757 13.239  40.631  1.00 36.60  ? 80  LEU B CD2 1 
ATOM   1759  N N   . GLN B 1 85  ? -17.959 9.301   37.096  1.00 31.50  ? 81  GLN B N   1 
ATOM   1760  C CA  . GLN B 1 85  ? -17.358 8.872   35.841  1.00 32.16  ? 81  GLN B CA  1 
ATOM   1761  C C   . GLN B 1 85  ? -18.345 9.001   34.688  1.00 29.98  ? 81  GLN B C   1 
ATOM   1762  O O   . GLN B 1 85  ? -18.001 9.512   33.624  1.00 47.42  ? 81  GLN B O   1 
ATOM   1763  C CB  . GLN B 1 85  ? -16.874 7.430   35.947  1.00 49.28  ? 81  GLN B CB  1 
ATOM   1764  C CG  . GLN B 1 85  ? -15.712 7.240   36.895  1.00 48.10  ? 81  GLN B CG  1 
ATOM   1765  C CD  . GLN B 1 85  ? -15.227 5.811   36.919  1.00 40.89  ? 81  GLN B CD  1 
ATOM   1766  O OE1 . GLN B 1 85  ? -15.786 4.967   37.617  1.00 38.85  ? 81  GLN B OE1 1 
ATOM   1767  N NE2 . GLN B 1 85  ? -14.187 5.527   36.145  1.00 42.39  ? 81  GLN B NE2 1 
ATOM   1768  N N   . GLU B 1 86  ? -19.571 8.533   34.901  1.00 34.13  ? 82  GLU B N   1 
ATOM   1769  C CA  . GLU B 1 86  ? -20.610 8.635   33.881  1.00 44.82  ? 82  GLU B CA  1 
ATOM   1770  C C   . GLU B 1 86  ? -20.871 10.093  33.518  1.00 33.96  ? 82  GLU B C   1 
ATOM   1771  O O   . GLU B 1 86  ? -20.970 10.444  32.344  1.00 42.83  ? 82  GLU B O   1 
ATOM   1772  C CB  . GLU B 1 86  ? -21.903 7.979   34.362  1.00 40.07  ? 82  GLU B CB  1 
ATOM   1773  C CG  . GLU B 1 86  ? -21.861 6.466   34.358  1.00 43.39  ? 82  GLU B CG  1 
ATOM   1774  C CD  . GLU B 1 86  ? -23.189 5.853   34.746  1.00 49.47  ? 82  GLU B CD  1 
ATOM   1775  O OE1 . GLU B 1 86  ? -23.473 4.716   34.309  1.00 46.87  ? 82  GLU B OE1 1 
ATOM   1776  O OE2 . GLU B 1 86  ? -23.950 6.508   35.489  1.00 48.69  ? 82  GLU B OE2 1 
ATOM   1777  N N   . LEU B 1 87  ? -20.987 10.936  34.537  1.00 38.13  ? 83  LEU B N   1 
ATOM   1778  C CA  . LEU B 1 87  ? -21.149 12.369  34.339  1.00 43.71  ? 83  LEU B CA  1 
ATOM   1779  C C   . LEU B 1 87  ? -20.008 12.925  33.498  1.00 52.19  ? 83  LEU B C   1 
ATOM   1780  O O   . LEU B 1 87  ? -20.229 13.693  32.560  1.00 60.75  ? 83  LEU B O   1 
ATOM   1781  C CB  . LEU B 1 87  ? -21.178 13.079  35.692  1.00 42.72  ? 83  LEU B CB  1 
ATOM   1782  C CG  . LEU B 1 87  ? -20.995 14.596  35.658  1.00 34.67  ? 83  LEU B CG  1 
ATOM   1783  C CD1 . LEU B 1 87  ? -22.181 15.265  34.987  1.00 29.07  ? 83  LEU B CD1 1 
ATOM   1784  C CD2 . LEU B 1 87  ? -20.788 15.133  37.065  1.00 42.61  ? 83  LEU B CD2 1 
ATOM   1785  N N   . SER B 1 88  ? -18.787 12.530  33.842  1.00 42.77  ? 84  SER B N   1 
ATOM   1786  C CA  . SER B 1 88  ? -17.595 13.054  33.188  1.00 32.82  ? 84  SER B CA  1 
ATOM   1787  C C   . SER B 1 88  ? -17.576 12.742  31.697  1.00 38.87  ? 84  SER B C   1 
ATOM   1788  O O   . SER B 1 88  ? -17.150 13.570  30.890  1.00 49.80  ? 84  SER B O   1 
ATOM   1789  C CB  . SER B 1 88  ? -16.340 12.495  33.852  1.00 38.72  ? 84  SER B CB  1 
ATOM   1790  O OG  . SER B 1 88  ? -16.240 12.934  35.197  1.00 49.27  ? 84  SER B OG  1 
ATOM   1791  N N   . LEU B 1 89  ? -18.033 11.549  31.331  1.00 37.32  ? 85  LEU B N   1 
ATOM   1792  C CA  . LEU B 1 89  ? -18.069 11.147  29.928  1.00 44.73  ? 85  LEU B CA  1 
ATOM   1793  C C   . LEU B 1 89  ? -18.870 12.147  29.098  1.00 52.13  ? 85  LEU B C   1 
ATOM   1794  O O   . LEU B 1 89  ? -18.598 12.344  27.913  1.00 51.07  ? 85  LEU B O   1 
ATOM   1795  C CB  . LEU B 1 89  ? -18.668 9.746   29.781  1.00 37.46  ? 85  LEU B CB  1 
ATOM   1796  C CG  . LEU B 1 89  ? -17.862 8.596   30.392  1.00 39.36  ? 85  LEU B CG  1 
ATOM   1797  C CD1 . LEU B 1 89  ? -18.626 7.283   30.275  1.00 33.88  ? 85  LEU B CD1 1 
ATOM   1798  C CD2 . LEU B 1 89  ? -16.491 8.479   29.738  1.00 23.60  ? 85  LEU B CD2 1 
ATOM   1799  N N   . ARG B 1 90  ? -19.857 12.779  29.726  1.00 42.58  ? 86  ARG B N   1 
ATOM   1800  C CA  . ARG B 1 90  ? -20.693 13.761  29.043  1.00 36.98  ? 86  ARG B CA  1 
ATOM   1801  C C   . ARG B 1 90  ? -20.103 15.162  29.168  1.00 43.04  ? 86  ARG B C   1 
ATOM   1802  O O   . ARG B 1 90  ? -20.258 15.988  28.270  1.00 45.58  ? 86  ARG B O   1 
ATOM   1803  C CB  . ARG B 1 90  ? -22.112 13.737  29.611  1.00 37.54  ? 86  ARG B CB  1 
ATOM   1804  C CG  . ARG B 1 90  ? -22.986 12.598  29.098  1.00 50.00  ? 86  ARG B CG  1 
ATOM   1805  C CD  . ARG B 1 90  ? -22.177 11.411  28.593  1.00 52.07  ? 86  ARG B CD  1 
ATOM   1806  N NE  . ARG B 1 90  ? -22.954 10.175  28.609  1.00 51.92  ? 86  ARG B NE  1 
ATOM   1807  C CZ  . ARG B 1 90  ? -22.981 9.317   29.626  1.00 55.87  ? 86  ARG B CZ  1 
ATOM   1808  N NH1 . ARG B 1 90  ? -22.275 9.546   30.725  1.00 63.67  ? 86  ARG B NH1 1 
ATOM   1809  N NH2 . ARG B 1 90  ? -23.719 8.220   29.545  1.00 54.58  ? 86  ARG B NH2 1 
ATOM   1810  N N   . LEU B 1 91  ? -19.432 15.426  30.285  1.00 45.42  ? 87  LEU B N   1 
ATOM   1811  C CA  . LEU B 1 91  ? -18.766 16.708  30.488  1.00 43.65  ? 87  LEU B CA  1 
ATOM   1812  C C   . LEU B 1 91  ? -17.690 16.944  29.438  1.00 51.12  ? 87  LEU B C   1 
ATOM   1813  O O   . LEU B 1 91  ? -17.457 18.079  29.027  1.00 63.49  ? 87  LEU B O   1 
ATOM   1814  C CB  . LEU B 1 91  ? -18.126 16.771  31.876  1.00 40.00  ? 87  LEU B CB  1 
ATOM   1815  C CG  . LEU B 1 91  ? -18.963 17.330  33.025  1.00 37.99  ? 87  LEU B CG  1 
ATOM   1816  C CD1 . LEU B 1 91  ? -18.163 17.271  34.315  1.00 42.39  ? 87  LEU B CD1 1 
ATOM   1817  C CD2 . LEU B 1 91  ? -19.407 18.758  32.739  1.00 38.27  ? 87  LEU B CD2 1 
ATOM   1818  N N   . LYS B 1 92  ? -17.029 15.870  29.016  1.00 51.70  ? 88  LYS B N   1 
ATOM   1819  C CA  . LYS B 1 92  ? -15.934 15.966  28.056  1.00 56.61  ? 88  LYS B CA  1 
ATOM   1820  C C   . LYS B 1 92  ? -16.294 16.867  26.877  1.00 49.23  ? 88  LYS B C   1 
ATOM   1821  O O   . LYS B 1 92  ? -15.452 17.612  26.375  1.00 49.61  ? 88  LYS B O   1 
ATOM   1822  C CB  . LYS B 1 92  ? -15.553 14.575  27.545  1.00 56.75  ? 88  LYS B CB  1 
ATOM   1823  N N   . SER B 1 93  ? -17.549 16.799  26.444  1.00 46.98  ? 89  SER B N   1 
ATOM   1824  C CA  . SER B 1 93  ? -18.014 17.576  25.299  1.00 61.28  ? 89  SER B CA  1 
ATOM   1825  C C   . SER B 1 93  ? -18.009 19.077  25.589  1.00 64.85  ? 89  SER B C   1 
ATOM   1826  O O   . SER B 1 93  ? -17.972 19.895  24.670  1.00 66.41  ? 89  SER B O   1 
ATOM   1827  C CB  . SER B 1 93  ? -19.418 17.126  24.891  1.00 63.23  ? 89  SER B CB  1 
ATOM   1828  O OG  . SER B 1 93  ? -19.421 15.763  24.500  1.00 66.55  ? 89  SER B OG  1 
ATOM   1829  N N   . CYS B 1 94  ? -18.056 19.429  26.870  1.00 58.38  ? 90  CYS B N   1 
ATOM   1830  C CA  . CYS B 1 94  ? -17.971 20.823  27.296  1.00 42.14  ? 90  CYS B CA  1 
ATOM   1831  C C   . CYS B 1 94  ? -16.532 21.339  27.225  1.00 46.81  ? 90  CYS B C   1 
ATOM   1832  O O   . CYS B 1 94  ? -16.298 22.547  27.222  1.00 57.24  ? 90  CYS B O   1 
ATOM   1833  C CB  . CYS B 1 94  ? -18.504 20.974  28.722  1.00 42.31  ? 90  CYS B CB  1 
ATOM   1834  S SG  . CYS B 1 94  ? -20.196 20.373  28.956  1.00 51.05  ? 90  CYS B SG  1 
ATOM   1835  N N   . PHE B 1 95  ? -15.576 20.416  27.177  1.00 39.16  ? 91  PHE B N   1 
ATOM   1836  C CA  . PHE B 1 95  ? -14.164 20.769  27.069  1.00 46.62  ? 91  PHE B CA  1 
ATOM   1837  C C   . PHE B 1 95  ? -13.633 20.504  25.661  1.00 48.35  ? 91  PHE B C   1 
ATOM   1838  O O   . PHE B 1 95  ? -13.552 19.352  25.228  1.00 42.32  ? 91  PHE B O   1 
ATOM   1839  C CB  . PHE B 1 95  ? -13.338 19.960  28.070  1.00 52.65  ? 91  PHE B CB  1 
ATOM   1840  C CG  . PHE B 1 95  ? -13.665 20.248  29.508  1.00 44.82  ? 91  PHE B CG  1 
ATOM   1841  C CD1 . PHE B 1 95  ? -14.838 19.779  30.073  1.00 48.22  ? 91  PHE B CD1 1 
ATOM   1842  C CD2 . PHE B 1 95  ? -12.790 20.973  30.299  1.00 51.83  ? 91  PHE B CD2 1 
ATOM   1843  C CE1 . PHE B 1 95  ? -15.139 20.038  31.396  1.00 49.24  ? 91  PHE B CE1 1 
ATOM   1844  C CE2 . PHE B 1 95  ? -13.085 21.235  31.623  1.00 57.36  ? 91  PHE B CE2 1 
ATOM   1845  C CZ  . PHE B 1 95  ? -14.260 20.766  32.172  1.00 56.42  ? 91  PHE B CZ  1 
ATOM   1846  N N   . THR B 1 96  ? -13.271 21.568  24.949  1.00 43.47  ? 92  THR B N   1 
ATOM   1847  C CA  . THR B 1 96  ? -12.623 21.424  23.651  1.00 54.51  ? 92  THR B CA  1 
ATOM   1848  C C   . THR B 1 96  ? -11.195 20.926  23.857  1.00 66.86  ? 92  THR B C   1 
ATOM   1849  O O   . THR B 1 96  ? -10.473 21.430  24.717  1.00 78.07  ? 92  THR B O   1 
ATOM   1850  C CB  . THR B 1 96  ? -12.584 22.755  22.877  1.00 56.75  ? 92  THR B CB  1 
ATOM   1851  O OG1 . THR B 1 96  ? -11.844 23.726  23.627  1.00 66.05  ? 92  THR B OG1 1 
ATOM   1852  C CG2 . THR B 1 96  ? -13.994 23.272  22.618  1.00 47.57  ? 92  THR B CG2 1 
ATOM   1853  N N   . LYS B 1 97  ? -10.789 19.942  23.062  1.00 60.28  ? 93  LYS B N   1 
ATOM   1854  C CA  . LYS B 1 97  ? -9.484  19.315  23.237  1.00 70.50  ? 93  LYS B CA  1 
ATOM   1855  C C   . LYS B 1 97  ? -8.354  20.223  22.759  1.00 74.91  ? 93  LYS B C   1 
ATOM   1856  O O   . LYS B 1 97  ? -8.498  20.950  21.777  1.00 76.67  ? 93  LYS B O   1 
ATOM   1857  C CB  . LYS B 1 97  ? -9.448  17.967  22.515  1.00 80.76  ? 93  LYS B CB  1 
ATOM   1858  C CG  . LYS B 1 97  ? -10.487 16.998  23.050  1.00 86.79  ? 93  LYS B CG  1 
ATOM   1859  C CD  . LYS B 1 97  ? -10.317 15.595  22.516  1.00 88.48  ? 93  LYS B CD  1 
ATOM   1860  C CE  . LYS B 1 97  ? -10.888 14.595  23.506  1.00 88.80  ? 93  LYS B CE  1 
ATOM   1861  N NZ  . LYS B 1 97  ? -11.308 13.329  22.861  1.00 85.31  ? 93  LYS B NZ  1 
ATOM   1862  N N   . ASP B 1 98  ? -7.232  20.173  23.472  1.00 74.20  ? 94  ASP B N   1 
ATOM   1863  C CA  . ASP B 1 98  ? -6.102  21.057  23.208  1.00 70.21  ? 94  ASP B CA  1 
ATOM   1864  C C   . ASP B 1 98  ? -4.900  20.274  22.690  1.00 69.83  ? 94  ASP B C   1 
ATOM   1865  O O   . ASP B 1 98  ? -4.901  19.045  22.686  1.00 64.35  ? 94  ASP B O   1 
ATOM   1866  C CB  . ASP B 1 98  ? -5.719  21.810  24.485  1.00 54.64  ? 94  ASP B CB  1 
ATOM   1867  C CG  . ASP B 1 98  ? -6.812  22.748  24.961  1.00 54.57  ? 94  ASP B CG  1 
ATOM   1868  O OD1 . ASP B 1 98  ? -7.410  23.448  24.117  1.00 52.89  ? 94  ASP B OD1 1 
ATOM   1869  O OD2 . ASP B 1 98  ? -7.078  22.783  26.182  1.00 50.23  ? 94  ASP B OD2 1 
ATOM   1870  N N   . GLU B 1 101 ? -3.645  16.807  25.030  1.00 85.78  ? 97  GLU B N   1 
ATOM   1871  C CA  . GLU B 1 101 ? -3.953  16.418  26.400  1.00 93.70  ? 97  GLU B CA  1 
ATOM   1872  C C   . GLU B 1 101 ? -3.674  14.934  26.627  1.00 109.78 ? 97  GLU B C   1 
ATOM   1873  O O   . GLU B 1 101 ? -3.473  14.178  25.675  1.00 116.26 ? 97  GLU B O   1 
ATOM   1874  C CB  . GLU B 1 101 ? -5.407  16.739  26.732  1.00 89.56  ? 97  GLU B CB  1 
ATOM   1875  C CG  . GLU B 1 101 ? -5.681  18.226  26.907  1.00 92.55  ? 97  GLU B CG  1 
ATOM   1876  C CD  . GLU B 1 101 ? -7.142  18.589  26.716  1.00 91.88  ? 97  GLU B CD  1 
ATOM   1877  O OE1 . GLU B 1 101 ? -7.855  17.855  25.999  1.00 83.87  ? 97  GLU B OE1 1 
ATOM   1878  O OE2 . GLU B 1 101 ? -7.576  19.611  27.289  1.00 88.59  ? 97  GLU B OE2 1 
ATOM   1879  N N   . HIS B 1 102 ? -3.670  14.527  27.893  1.00 114.80 ? 98  HIS B N   1 
ATOM   1880  C CA  . HIS B 1 102 ? -3.175  13.211  28.285  1.00 118.35 ? 98  HIS B CA  1 
ATOM   1881  C C   . HIS B 1 102 ? -1.681  13.153  27.980  1.00 124.51 ? 98  HIS B C   1 
ATOM   1882  O O   . HIS B 1 102 ? -1.081  12.079  27.898  1.00 129.89 ? 98  HIS B O   1 
ATOM   1883  C CB  . HIS B 1 102 ? -3.937  12.092  27.574  1.00 111.25 ? 98  HIS B CB  1 
ATOM   1884  C CG  . HIS B 1 102 ? -5.414  12.133  27.810  1.00 103.50 ? 98  HIS B CG  1 
ATOM   1885  N ND1 . HIS B 1 102 ? -5.975  11.841  29.033  1.00 102.21 ? 98  HIS B ND1 1 
ATOM   1886  C CD2 . HIS B 1 102 ? -6.443  12.440  26.985  1.00 93.30  ? 98  HIS B CD2 1 
ATOM   1887  C CE1 . HIS B 1 102 ? -7.289  11.961  28.952  1.00 95.72  ? 98  HIS B CE1 1 
ATOM   1888  N NE2 . HIS B 1 102 ? -7.598  12.323  27.721  1.00 92.20  ? 98  HIS B NE2 1 
ATOM   1889  N N   . ASP B 1 103 ? -1.099  14.336  27.814  1.00 123.02 ? 99  ASP B N   1 
ATOM   1890  C CA  . ASP B 1 103 ? 0.335   14.499  27.677  1.00 113.11 ? 99  ASP B CA  1 
ATOM   1891  C C   . ASP B 1 103 ? 0.801   15.165  28.962  1.00 107.49 ? 99  ASP B C   1 
ATOM   1892  O O   . ASP B 1 103 ? 0.194   16.137  29.412  1.00 102.54 ? 99  ASP B O   1 
ATOM   1893  C CB  . ASP B 1 103 ? 0.647   15.375  26.469  1.00 99.80  ? 99  ASP B CB  1 
ATOM   1894  C CG  . ASP B 1 103 ? 2.098   15.795  26.413  1.00 90.75  ? 99  ASP B CG  1 
ATOM   1895  O OD1 . ASP B 1 103 ? 2.976   14.958  26.712  1.00 93.15  ? 99  ASP B OD1 1 
ATOM   1896  O OD2 . ASP B 1 103 ? 2.358   16.970  26.076  1.00 75.33  ? 99  ASP B OD2 1 
ATOM   1897  N N   . LYS B 1 104 ? 1.874   14.653  29.553  1.00 99.64  ? 100 LYS B N   1 
ATOM   1898  C CA  . LYS B 1 104 ? 2.242   15.039  30.913  1.00 88.11  ? 100 LYS B CA  1 
ATOM   1899  C C   . LYS B 1 104 ? 2.901   16.418  31.014  1.00 73.02  ? 100 LYS B C   1 
ATOM   1900  O O   . LYS B 1 104 ? 3.822   16.613  31.808  1.00 67.43  ? 100 LYS B O   1 
ATOM   1901  C CB  . LYS B 1 104 ? 3.156   13.980  31.529  1.00 86.19  ? 100 LYS B CB  1 
ATOM   1902  C CG  . LYS B 1 104 ? 2.637   12.560  31.372  1.00 81.95  ? 100 LYS B CG  1 
ATOM   1903  C CD  . LYS B 1 104 ? 3.478   11.569  32.159  1.00 88.51  ? 100 LYS B CD  1 
ATOM   1904  C CE  . LYS B 1 104 ? 3.409   10.175  31.552  1.00 93.96  ? 100 LYS B CE  1 
ATOM   1905  N NZ  . LYS B 1 104 ? 4.231   9.187   32.305  1.00 96.73  ? 100 LYS B NZ  1 
ATOM   1906  N N   . ALA B 1 105 ? 2.422   17.371  30.221  1.00 62.74  ? 101 ALA B N   1 
ATOM   1907  C CA  . ALA B 1 105 ? 2.868   18.753  30.332  1.00 61.04  ? 101 ALA B CA  1 
ATOM   1908  C C   . ALA B 1 105 ? 2.191   19.412  31.527  1.00 67.26  ? 101 ALA B C   1 
ATOM   1909  O O   . ALA B 1 105 ? 1.013   19.176  31.785  1.00 69.49  ? 101 ALA B O   1 
ATOM   1910  C CB  . ALA B 1 105 ? 2.538   19.507  29.066  1.00 49.65  ? 101 ALA B CB  1 
ATOM   1911  N N   . CYS B 1 106 ? 2.938   20.239  32.251  1.00 63.30  ? 102 CYS B N   1 
ATOM   1912  C CA  . CYS B 1 106 ? 2.399   20.929  33.417  1.00 55.75  ? 102 CYS B CA  1 
ATOM   1913  C C   . CYS B 1 106 ? 1.975   19.934  34.493  1.00 60.45  ? 102 CYS B C   1 
ATOM   1914  O O   . CYS B 1 106 ? 1.162   20.253  35.357  1.00 71.16  ? 102 CYS B O   1 
ATOM   1915  C CB  . CYS B 1 106 ? 1.202   21.791  33.014  1.00 39.11  ? 102 CYS B CB  1 
ATOM   1916  S SG  . CYS B 1 106 ? 1.499   22.841  31.574  1.00 61.98  ? 102 CYS B SG  1 
ATOM   1917  N N   . VAL B 1 107 ? 2.538   18.731  34.440  1.00 56.73  ? 103 VAL B N   1 
ATOM   1918  C CA  . VAL B 1 107 ? 2.168   17.669  35.367  1.00 42.27  ? 103 VAL B CA  1 
ATOM   1919  C C   . VAL B 1 107 ? 3.358   17.245  36.220  1.00 43.56  ? 103 VAL B C   1 
ATOM   1920  O O   . VAL B 1 107 ? 4.502   17.266  35.766  1.00 61.90  ? 103 VAL B O   1 
ATOM   1921  C CB  . VAL B 1 107 ? 1.628   16.435  34.615  1.00 42.60  ? 103 VAL B CB  1 
ATOM   1922  C CG1 . VAL B 1 107 ? 1.518   15.237  35.552  1.00 28.72  ? 103 VAL B CG1 1 
ATOM   1923  C CG2 . VAL B 1 107 ? 0.279   16.748  33.972  1.00 32.38  ? 103 VAL B CG2 1 
ATOM   1924  N N   . ARG B 1 108 ? 3.075   16.867  37.461  1.00 35.24  ? 104 ARG B N   1 
ATOM   1925  C CA  . ARG B 1 108 ? 4.096   16.359  38.368  1.00 31.39  ? 104 ARG B CA  1 
ATOM   1926  C C   . ARG B 1 108 ? 3.535   15.189  39.161  1.00 54.37  ? 104 ARG B C   1 
ATOM   1927  O O   . ARG B 1 108 ? 2.321   14.978  39.203  1.00 65.69  ? 104 ARG B O   1 
ATOM   1928  C CB  . ARG B 1 108 ? 4.556   17.454  39.333  1.00 22.76  ? 104 ARG B CB  1 
ATOM   1929  C CG  . ARG B 1 108 ? 3.424   18.068  40.140  1.00 29.87  ? 104 ARG B CG  1 
ATOM   1930  C CD  . ARG B 1 108 ? 3.929   18.943  41.277  1.00 30.17  ? 104 ARG B CD  1 
ATOM   1931  N NE  . ARG B 1 108 ? 4.227   18.162  42.475  1.00 52.69  ? 104 ARG B NE  1 
ATOM   1932  C CZ  . ARG B 1 108 ? 4.271   18.658  43.709  1.00 75.40  ? 104 ARG B CZ  1 
ATOM   1933  N NH1 . ARG B 1 108 ? 4.034   19.945  43.929  1.00 81.51  ? 104 ARG B NH1 1 
ATOM   1934  N NH2 . ARG B 1 108 ? 4.547   17.863  44.733  1.00 84.68  ? 104 ARG B NH2 1 
ATOM   1935  N N   . THR B 1 109 ? 4.422   14.427  39.790  1.00 53.55  ? 105 THR B N   1 
ATOM   1936  C CA  . THR B 1 109 ? 3.999   13.339  40.658  1.00 52.93  ? 105 THR B CA  1 
ATOM   1937  C C   . THR B 1 109 ? 3.776   13.878  42.066  1.00 47.27  ? 105 THR B C   1 
ATOM   1938  O O   . THR B 1 109 ? 4.563   14.684  42.563  1.00 52.57  ? 105 THR B O   1 
ATOM   1939  C CB  . THR B 1 109 ? 5.044   12.209  40.693  1.00 54.40  ? 105 THR B CB  1 
ATOM   1940  O OG1 . THR B 1 109 ? 5.351   11.796  39.355  1.00 52.53  ? 105 THR B OG1 1 
ATOM   1941  C CG2 . THR B 1 109 ? 4.520   11.018  41.481  1.00 53.59  ? 105 THR B CG2 1 
ATOM   1942  N N   . PHE B 1 110 ? 2.693   13.438  42.699  1.00 41.48  ? 106 PHE B N   1 
ATOM   1943  C CA  . PHE B 1 110 ? 2.362   13.881  44.049  1.00 34.74  ? 106 PHE B CA  1 
ATOM   1944  C C   . PHE B 1 110 ? 2.467   12.741  45.055  1.00 35.05  ? 106 PHE B C   1 
ATOM   1945  O O   . PHE B 1 110 ? 2.230   11.579  44.724  1.00 43.45  ? 106 PHE B O   1 
ATOM   1946  C CB  . PHE B 1 110 ? 0.948   14.463  44.088  1.00 22.89  ? 106 PHE B CB  1 
ATOM   1947  C CG  . PHE B 1 110 ? 0.852   15.862  43.550  1.00 20.29  ? 106 PHE B CG  1 
ATOM   1948  C CD1 . PHE B 1 110 ? 1.116   16.951  44.365  1.00 27.41  ? 106 PHE B CD1 1 
ATOM   1949  C CD2 . PHE B 1 110 ? 0.494   16.090  42.232  1.00 23.63  ? 106 PHE B CD2 1 
ATOM   1950  C CE1 . PHE B 1 110 ? 1.025   18.242  43.874  1.00 18.13  ? 106 PHE B CE1 1 
ATOM   1951  C CE2 . PHE B 1 110 ? 0.404   17.378  41.737  1.00 26.57  ? 106 PHE B CE2 1 
ATOM   1952  C CZ  . PHE B 1 110 ? 0.668   18.454  42.561  1.00 23.11  ? 106 PHE B CZ  1 
ATOM   1953  N N   . TYR B 1 111 ? 2.827   13.088  46.286  1.00 30.48  ? 107 TYR B N   1 
ATOM   1954  C CA  . TYR B 1 111 ? 2.861   12.127  47.378  1.00 40.04  ? 107 TYR B CA  1 
ATOM   1955  C C   . TYR B 1 111 ? 2.181   12.744  48.595  1.00 48.19  ? 107 TYR B C   1 
ATOM   1956  O O   . TYR B 1 111 ? 2.826   13.379  49.430  1.00 57.76  ? 107 TYR B O   1 
ATOM   1957  C CB  . TYR B 1 111 ? 4.302   11.735  47.698  1.00 33.27  ? 107 TYR B CB  1 
ATOM   1958  C CG  . TYR B 1 111 ? 4.433   10.527  48.597  1.00 24.89  ? 107 TYR B CG  1 
ATOM   1959  C CD1 . TYR B 1 111 ? 4.032   9.270   48.166  1.00 31.40  ? 107 TYR B CD1 1 
ATOM   1960  C CD2 . TYR B 1 111 ? 4.961   10.643  49.875  1.00 39.01  ? 107 TYR B CD2 1 
ATOM   1961  C CE1 . TYR B 1 111 ? 4.152   8.161   48.985  1.00 39.49  ? 107 TYR B CE1 1 
ATOM   1962  C CE2 . TYR B 1 111 ? 5.088   9.541   50.699  1.00 41.50  ? 107 TYR B CE2 1 
ATOM   1963  C CZ  . TYR B 1 111 ? 4.681   8.303   50.251  1.00 37.22  ? 107 TYR B CZ  1 
ATOM   1964  O OH  . TYR B 1 111 ? 4.807   7.206   51.072  1.00 32.34  ? 107 TYR B OH  1 
ATOM   1965  N N   . GLU B 1 112 ? 0.869   12.557  48.678  1.00 37.16  ? 108 GLU B N   1 
ATOM   1966  C CA  . GLU B 1 112 ? 0.063   13.168  49.726  1.00 33.91  ? 108 GLU B CA  1 
ATOM   1967  C C   . GLU B 1 112 ? -0.980  12.186  50.244  1.00 46.16  ? 108 GLU B C   1 
ATOM   1968  O O   . GLU B 1 112 ? -1.082  11.063  49.755  1.00 37.16  ? 108 GLU B O   1 
ATOM   1969  C CB  . GLU B 1 112 ? -0.629  14.416  49.181  1.00 25.94  ? 108 GLU B CB  1 
ATOM   1970  C CG  . GLU B 1 112 ? 0.328   15.509  48.740  1.00 48.21  ? 108 GLU B CG  1 
ATOM   1971  C CD  . GLU B 1 112 ? -0.393  16.719  48.176  1.00 55.07  ? 108 GLU B CD  1 
ATOM   1972  O OE1 . GLU B 1 112 ? 0.254   17.776  48.017  1.00 62.29  ? 108 GLU B OE1 1 
ATOM   1973  O OE2 . GLU B 1 112 ? -1.605  16.610  47.890  1.00 46.48  ? 108 GLU B OE2 1 
ATOM   1974  N N   . THR B 1 113 ? -1.758  12.613  51.234  1.00 57.73  ? 109 THR B N   1 
ATOM   1975  C CA  . THR B 1 113 ? -2.784  11.754  51.810  1.00 56.72  ? 109 THR B CA  1 
ATOM   1976  C C   . THR B 1 113 ? -3.961  11.615  50.852  1.00 50.11  ? 109 THR B C   1 
ATOM   1977  O O   . THR B 1 113 ? -4.180  12.479  50.001  1.00 47.57  ? 109 THR B O   1 
ATOM   1978  C CB  . THR B 1 113 ? -3.314  12.308  53.151  1.00 46.93  ? 109 THR B CB  1 
ATOM   1979  O OG1 . THR B 1 113 ? -4.036  13.524  52.919  1.00 47.97  ? 109 THR B OG1 1 
ATOM   1980  C CG2 . THR B 1 113 ? -2.170  12.568  54.128  1.00 33.63  ? 109 THR B CG2 1 
ATOM   1981  N N   . PRO B 1 114 ? -4.718  10.517  50.979  1.00 43.69  ? 110 PRO B N   1 
ATOM   1982  C CA  . PRO B 1 114 ? -5.956  10.358  50.213  1.00 45.06  ? 110 PRO B CA  1 
ATOM   1983  C C   . PRO B 1 114 ? -6.901  11.544  50.405  1.00 50.51  ? 110 PRO B C   1 
ATOM   1984  O O   . PRO B 1 114 ? -7.674  11.864  49.503  1.00 56.60  ? 110 PRO B O   1 
ATOM   1985  C CB  . PRO B 1 114 ? -6.561  9.080   50.798  1.00 41.45  ? 110 PRO B CB  1 
ATOM   1986  C CG  . PRO B 1 114 ? -5.384  8.291   51.257  1.00 21.49  ? 110 PRO B CG  1 
ATOM   1987  C CD  . PRO B 1 114 ? -4.392  9.308   51.757  1.00 36.42  ? 110 PRO B CD  1 
ATOM   1988  N N   . LEU B 1 115 ? -6.833  12.191  51.565  1.00 50.00  ? 111 LEU B N   1 
ATOM   1989  C CA  . LEU B 1 115 ? -7.680  13.348  51.840  1.00 48.25  ? 111 LEU B CA  1 
ATOM   1990  C C   . LEU B 1 115 ? -7.221  14.573  51.054  1.00 34.15  ? 111 LEU B C   1 
ATOM   1991  O O   . LEU B 1 115 ? -8.041  15.304  50.496  1.00 20.19  ? 111 LEU B O   1 
ATOM   1992  C CB  . LEU B 1 115 ? -7.702  13.656  53.338  1.00 62.67  ? 111 LEU B CB  1 
ATOM   1993  C CG  . LEU B 1 115 ? -8.586  12.731  54.178  1.00 63.56  ? 111 LEU B CG  1 
ATOM   1994  C CD1 . LEU B 1 115 ? -8.418  13.029  55.657  1.00 67.71  ? 111 LEU B CD1 1 
ATOM   1995  C CD2 . LEU B 1 115 ? -10.048 12.865  53.774  1.00 60.60  ? 111 LEU B CD2 1 
ATOM   1996  N N   . GLN B 1 116 ? -5.911  14.792  51.011  1.00 53.35  ? 112 GLN B N   1 
ATOM   1997  C CA  . GLN B 1 116 ? -5.345  15.878  50.218  1.00 34.53  ? 112 GLN B CA  1 
ATOM   1998  C C   . GLN B 1 116 ? -5.682  15.684  48.745  1.00 40.86  ? 112 GLN B C   1 
ATOM   1999  O O   . GLN B 1 116 ? -5.945  16.649  48.026  1.00 47.55  ? 112 GLN B O   1 
ATOM   2000  C CB  . GLN B 1 116 ? -3.829  15.951  50.401  1.00 40.03  ? 112 GLN B CB  1 
ATOM   2001  C CG  . GLN B 1 116 ? -3.395  16.495  51.754  1.00 58.16  ? 112 GLN B CG  1 
ATOM   2002  C CD  . GLN B 1 116 ? -1.887  16.569  51.902  1.00 59.02  ? 112 GLN B CD  1 
ATOM   2003  O OE1 . GLN B 1 116 ? -1.223  15.554  52.117  1.00 52.01  ? 112 GLN B OE1 1 
ATOM   2004  N NE2 . GLN B 1 116 ? -1.339  17.774  51.791  1.00 62.08  ? 112 GLN B NE2 1 
ATOM   2005  N N   . LEU B 1 117 ? -5.672  14.432  48.301  1.00 35.61  ? 113 LEU B N   1 
ATOM   2006  C CA  . LEU B 1 117 ? -6.050  14.108  46.932  1.00 20.55  ? 113 LEU B CA  1 
ATOM   2007  C C   . LEU B 1 117 ? -7.515  14.453  46.686  1.00 31.19  ? 113 LEU B C   1 
ATOM   2008  O O   . LEU B 1 117 ? -7.829  15.301  45.854  1.00 39.06  ? 113 LEU B O   1 
ATOM   2009  C CB  . LEU B 1 117 ? -5.813  12.624  46.651  1.00 18.75  ? 113 LEU B CB  1 
ATOM   2010  C CG  . LEU B 1 117 ? -6.375  12.112  45.323  1.00 24.56  ? 113 LEU B CG  1 
ATOM   2011  C CD1 . LEU B 1 117 ? -5.751  12.858  44.155  1.00 43.62  ? 113 LEU B CD1 1 
ATOM   2012  C CD2 . LEU B 1 117 ? -6.158  10.614  45.180  1.00 10.34  ? 113 LEU B CD2 1 
ATOM   2013  N N   . LEU B 1 118 ? -8.408  13.795  47.419  1.00 41.88  ? 114 LEU B N   1 
ATOM   2014  C CA  . LEU B 1 118 ? -9.845  13.967  47.218  1.00 42.28  ? 114 LEU B CA  1 
ATOM   2015  C C   . LEU B 1 118 ? -10.248 15.438  47.218  1.00 58.29  ? 114 LEU B C   1 
ATOM   2016  O O   . LEU B 1 118 ? -11.195 15.829  46.535  1.00 53.65  ? 114 LEU B O   1 
ATOM   2017  C CB  . LEU B 1 118 ? -10.627 13.211  48.292  1.00 32.17  ? 114 LEU B CB  1 
ATOM   2018  C CG  . LEU B 1 118 ? -10.536 11.684  48.212  1.00 35.66  ? 114 LEU B CG  1 
ATOM   2019  C CD1 . LEU B 1 118 ? -11.162 11.034  49.440  1.00 32.13  ? 114 LEU B CD1 1 
ATOM   2020  C CD2 . LEU B 1 118 ? -11.200 11.178  46.947  1.00 32.13  ? 114 LEU B CD2 1 
ATOM   2021  N N   . GLU B 1 119 ? -9.530  16.253  47.984  1.00 67.03  ? 115 GLU B N   1 
ATOM   2022  C CA  . GLU B 1 119 ? -9.794  17.685  48.016  1.00 60.79  ? 115 GLU B CA  1 
ATOM   2023  C C   . GLU B 1 119 ? -9.504  18.291  46.645  1.00 45.30  ? 115 GLU B C   1 
ATOM   2024  O O   . GLU B 1 119 ? -10.275 19.107  46.141  1.00 46.76  ? 115 GLU B O   1 
ATOM   2025  C CB  . GLU B 1 119 ? -8.944  18.371  49.087  1.00 73.99  ? 115 GLU B CB  1 
ATOM   2026  C CG  . GLU B 1 119 ? -9.710  19.384  49.917  1.00 94.93  ? 115 GLU B CG  1 
ATOM   2027  C CD  . GLU B 1 119 ? -10.718 18.732  50.842  1.00 102.59 ? 115 GLU B CD  1 
ATOM   2028  O OE1 . GLU B 1 119 ? -10.301 17.920  51.696  1.00 99.23  ? 115 GLU B OE1 1 
ATOM   2029  O OE2 . GLU B 1 119 ? -11.925 19.025  50.712  1.00 107.86 ? 115 GLU B OE2 1 
ATOM   2030  N N   . LYS B 1 120 ? -8.386  17.887  46.049  1.00 37.85  ? 116 LYS B N   1 
ATOM   2031  C CA  . LYS B 1 120 ? -8.030  18.330  44.706  1.00 36.86  ? 116 LYS B CA  1 
ATOM   2032  C C   . LYS B 1 120 ? -9.128  17.971  43.711  1.00 52.44  ? 116 LYS B C   1 
ATOM   2033  O O   . LYS B 1 120 ? -9.485  18.773  42.849  1.00 55.04  ? 116 LYS B O   1 
ATOM   2034  C CB  . LYS B 1 120 ? -6.708  17.698  44.260  1.00 36.93  ? 116 LYS B CB  1 
ATOM   2035  C CG  . LYS B 1 120 ? -5.471  18.301  44.903  1.00 42.65  ? 116 LYS B CG  1 
ATOM   2036  C CD  . LYS B 1 120 ? -4.215  17.574  44.453  1.00 39.47  ? 116 LYS B CD  1 
ATOM   2037  C CE  . LYS B 1 120 ? -2.985  18.456  44.571  1.00 45.23  ? 116 LYS B CE  1 
ATOM   2038  N NZ  . LYS B 1 120 ? -2.707  18.862  45.973  1.00 50.82  ? 116 LYS B NZ  1 
ATOM   2039  N N   . VAL B 1 121 ? -9.659  16.759  43.835  1.00 53.79  ? 117 VAL B N   1 
ATOM   2040  C CA  . VAL B 1 121 ? -10.705 16.286  42.937  1.00 47.87  ? 117 VAL B CA  1 
ATOM   2041  C C   . VAL B 1 121 ? -11.998 17.064  43.155  1.00 46.37  ? 117 VAL B C   1 
ATOM   2042  O O   . VAL B 1 121 ? -12.669 17.446  42.198  1.00 46.20  ? 117 VAL B O   1 
ATOM   2043  C CB  . VAL B 1 121 ? -10.980 14.783  43.136  1.00 58.77  ? 117 VAL B CB  1 
ATOM   2044  C CG1 . VAL B 1 121 ? -12.140 14.333  42.261  1.00 58.42  ? 117 VAL B CG1 1 
ATOM   2045  C CG2 . VAL B 1 121 ? -9.731  13.968  42.828  1.00 56.11  ? 117 VAL B CG2 1 
ATOM   2046  N N   . LYS B 1 122 ? -12.342 17.301  44.418  1.00 56.23  ? 118 LYS B N   1 
ATOM   2047  C CA  . LYS B 1 122 ? -13.565 18.026  44.750  1.00 49.93  ? 118 LYS B CA  1 
ATOM   2048  C C   . LYS B 1 122 ? -13.530 19.448  44.199  1.00 40.56  ? 118 LYS B C   1 
ATOM   2049  O O   . LYS B 1 122 ? -14.526 19.942  43.675  1.00 51.66  ? 118 LYS B O   1 
ATOM   2050  C CB  . LYS B 1 122 ? -13.778 18.071  46.264  1.00 50.28  ? 118 LYS B CB  1 
ATOM   2051  C CG  . LYS B 1 122 ? -15.127 18.657  46.670  1.00 58.15  ? 118 LYS B CG  1 
ATOM   2052  C CD  . LYS B 1 122 ? -15.228 18.904  48.169  1.00 63.54  ? 118 LYS B CD  1 
ATOM   2053  C CE  . LYS B 1 122 ? -14.329 20.048  48.613  1.00 66.18  ? 118 LYS B CE  1 
ATOM   2054  N NZ  . LYS B 1 122 ? -14.591 20.448  50.023  1.00 51.27  ? 118 LYS B NZ  1 
ATOM   2055  N N   . ASN B 1 123 ? -12.381 20.104  44.319  1.00 31.60  ? 119 ASN B N   1 
ATOM   2056  C CA  . ASN B 1 123 ? -12.248 21.485  43.873  1.00 28.28  ? 119 ASN B CA  1 
ATOM   2057  C C   . ASN B 1 123 ? -12.364 21.612  42.360  1.00 37.47  ? 119 ASN B C   1 
ATOM   2058  O O   . ASN B 1 123 ? -12.829 22.630  41.847  1.00 37.75  ? 119 ASN B O   1 
ATOM   2059  C CB  . ASN B 1 123 ? -10.924 22.078  44.360  1.00 33.87  ? 119 ASN B CB  1 
ATOM   2060  C CG  . ASN B 1 123 ? -10.923 22.345  45.857  1.00 69.62  ? 119 ASN B CG  1 
ATOM   2061  O OD1 . ASN B 1 123 ? -11.972 22.589  46.455  1.00 81.22  ? 119 ASN B OD1 1 
ATOM   2062  N ND2 . ASN B 1 123 ? -9.746  22.299  46.468  1.00 70.24  ? 119 ASN B ND2 1 
ATOM   2063  N N   . VAL B 1 124 ? -11.946 20.573  41.646  1.00 48.17  ? 120 VAL B N   1 
ATOM   2064  C CA  . VAL B 1 124 ? -12.059 20.563  40.196  1.00 39.95  ? 120 VAL B CA  1 
ATOM   2065  C C   . VAL B 1 124 ? -13.530 20.574  39.800  1.00 33.94  ? 120 VAL B C   1 
ATOM   2066  O O   . VAL B 1 124 ? -13.948 21.372  38.963  1.00 27.62  ? 120 VAL B O   1 
ATOM   2067  C CB  . VAL B 1 124 ? -11.361 19.330  39.585  1.00 37.76  ? 120 VAL B CB  1 
ATOM   2068  C CG1 . VAL B 1 124 ? -11.795 19.120  38.143  1.00 32.05  ? 120 VAL B CG1 1 
ATOM   2069  C CG2 . VAL B 1 124 ? -9.850  19.480  39.673  1.00 44.68  ? 120 VAL B CG2 1 
ATOM   2070  N N   . PHE B 1 125 ? -14.313 19.691  40.413  1.00 31.16  ? 121 PHE B N   1 
ATOM   2071  C CA  . PHE B 1 125 ? -15.737 19.603  40.116  1.00 29.38  ? 121 PHE B CA  1 
ATOM   2072  C C   . PHE B 1 125 ? -16.480 20.846  40.589  1.00 40.53  ? 121 PHE B C   1 
ATOM   2073  O O   . PHE B 1 125 ? -17.389 21.328  39.915  1.00 52.43  ? 121 PHE B O   1 
ATOM   2074  C CB  . PHE B 1 125 ? -16.342 18.354  40.757  1.00 30.64  ? 121 PHE B CB  1 
ATOM   2075  C CG  . PHE B 1 125 ? -15.981 17.082  40.051  1.00 33.26  ? 121 PHE B CG  1 
ATOM   2076  C CD1 . PHE B 1 125 ? -16.573 16.757  38.842  1.00 38.42  ? 121 PHE B CD1 1 
ATOM   2077  C CD2 . PHE B 1 125 ? -15.051 16.211  40.592  1.00 29.81  ? 121 PHE B CD2 1 
ATOM   2078  C CE1 . PHE B 1 125 ? -16.244 15.588  38.184  1.00 43.10  ? 121 PHE B CE1 1 
ATOM   2079  C CE2 . PHE B 1 125 ? -14.718 15.040  39.941  1.00 47.59  ? 121 PHE B CE2 1 
ATOM   2080  C CZ  . PHE B 1 125 ? -15.316 14.728  38.735  1.00 55.28  ? 121 PHE B CZ  1 
ATOM   2081  N N   . ASN B 1 126 ? -16.089 21.359  41.751  1.00 46.53  ? 122 ASN B N   1 
ATOM   2082  C CA  . ASN B 1 126 ? -16.706 22.561  42.300  1.00 51.86  ? 122 ASN B CA  1 
ATOM   2083  C C   . ASN B 1 126 ? -16.520 23.755  41.377  1.00 50.40  ? 122 ASN B C   1 
ATOM   2084  O O   . ASN B 1 126 ? -17.492 24.321  40.880  1.00 61.78  ? 122 ASN B O   1 
ATOM   2085  C CB  . ASN B 1 126 ? -16.126 22.883  43.680  1.00 60.33  ? 122 ASN B CB  1 
ATOM   2086  C CG  . ASN B 1 126 ? -17.089 22.563  44.807  1.00 80.35  ? 122 ASN B CG  1 
ATOM   2087  O OD1 . ASN B 1 126 ? -18.280 22.867  44.726  1.00 78.63  ? 122 ASN B OD1 1 
ATOM   2088  N ND2 . ASN B 1 126 ? -16.577 21.945  45.866  1.00 96.58  ? 122 ASN B ND2 1 
ATOM   2089  N N   . GLU B 1 127 ? -15.267 24.134  41.149  1.00 53.08  ? 123 GLU B N   1 
ATOM   2090  C CA  . GLU B 1 127 ? -14.963 25.280  40.303  1.00 54.91  ? 123 GLU B CA  1 
ATOM   2091  C C   . GLU B 1 127 ? -15.516 25.078  38.897  1.00 50.03  ? 123 GLU B C   1 
ATOM   2092  O O   . GLU B 1 127 ? -15.986 26.022  38.268  1.00 70.72  ? 123 GLU B O   1 
ATOM   2093  C CB  . GLU B 1 127 ? -13.454 25.526  40.252  1.00 48.54  ? 123 GLU B CB  1 
ATOM   2094  C CG  . GLU B 1 127 ? -12.848 25.914  41.594  1.00 55.81  ? 123 GLU B CG  1 
ATOM   2095  C CD  . GLU B 1 127 ? -13.432 27.200  42.150  1.00 76.48  ? 123 GLU B CD  1 
ATOM   2096  O OE1 . GLU B 1 127 ? -14.091 27.937  41.386  1.00 86.21  ? 123 GLU B OE1 1 
ATOM   2097  O OE2 . GLU B 1 127 ? -13.235 27.474  43.353  1.00 74.50  ? 123 GLU B OE2 1 
ATOM   2098  N N   . THR B 1 128 ? -15.466 23.843  38.412  1.00 46.93  ? 124 THR B N   1 
ATOM   2099  C CA  . THR B 1 128 ? -15.994 23.528  37.090  1.00 44.18  ? 124 THR B CA  1 
ATOM   2100  C C   . THR B 1 128 ? -17.497 23.783  37.041  1.00 32.64  ? 124 THR B C   1 
ATOM   2101  O O   . THR B 1 128 ? -18.017 24.287  36.046  1.00 25.46  ? 124 THR B O   1 
ATOM   2102  C CB  . THR B 1 128 ? -15.713 22.061  36.699  1.00 38.89  ? 124 THR B CB  1 
ATOM   2103  O OG1 . THR B 1 128 ? -14.303 21.869  36.517  1.00 29.19  ? 124 THR B OG1 1 
ATOM   2104  C CG2 . THR B 1 128 ? -16.436 21.698  35.407  1.00 26.88  ? 124 THR B CG2 1 
ATOM   2105  N N   . LYS B 1 129 ? -18.191 23.435  38.119  1.00 41.73  ? 125 LYS B N   1 
ATOM   2106  C CA  . LYS B 1 129 ? -19.636 23.623  38.187  1.00 40.00  ? 125 LYS B CA  1 
ATOM   2107  C C   . LYS B 1 129 ? -19.995 25.104  38.248  1.00 53.18  ? 125 LYS B C   1 
ATOM   2108  O O   . LYS B 1 129 ? -20.881 25.565  37.527  1.00 58.43  ? 125 LYS B O   1 
ATOM   2109  C CB  . LYS B 1 129 ? -20.215 22.903  39.405  1.00 49.04  ? 125 LYS B CB  1 
ATOM   2110  C CG  . LYS B 1 129 ? -21.686 23.204  39.645  1.00 45.16  ? 125 LYS B CG  1 
ATOM   2111  C CD  . LYS B 1 129 ? -22.203 22.504  40.884  1.00 25.94  ? 125 LYS B CD  1 
ATOM   2112  C CE  . LYS B 1 129 ? -23.645 22.882  41.178  1.00 39.65  ? 125 LYS B CE  1 
ATOM   2113  N NZ  . LYS B 1 129 ? -23.784 24.312  41.575  1.00 35.63  ? 125 LYS B NZ  1 
ATOM   2114  N N   . ASN B 1 130 ? -19.306 25.843  39.114  1.00 53.89  ? 126 ASN B N   1 
ATOM   2115  C CA  . ASN B 1 130 ? -19.561 27.269  39.284  1.00 51.76  ? 126 ASN B CA  1 
ATOM   2116  C C   . ASN B 1 130 ? -19.361 28.053  37.990  1.00 53.85  ? 126 ASN B C   1 
ATOM   2117  O O   . ASN B 1 130 ? -20.084 29.011  37.719  1.00 59.03  ? 126 ASN B O   1 
ATOM   2118  C CB  . ASN B 1 130 ? -18.650 27.848  40.371  1.00 60.69  ? 126 ASN B CB  1 
ATOM   2119  C CG  . ASN B 1 130 ? -18.959 27.295  41.750  1.00 72.96  ? 126 ASN B CG  1 
ATOM   2120  O OD1 . ASN B 1 130 ? -20.082 26.874  42.027  1.00 72.00  ? 126 ASN B OD1 1 
ATOM   2121  N ND2 . ASN B 1 130 ? -17.960 27.302  42.628  1.00 70.94  ? 126 ASN B ND2 1 
ATOM   2122  N N   . LEU B 1 131 ? -18.379 27.641  37.193  1.00 42.17  ? 127 LEU B N   1 
ATOM   2123  C CA  . LEU B 1 131 ? -18.022 28.369  35.980  1.00 53.78  ? 127 LEU B CA  1 
ATOM   2124  C C   . LEU B 1 131 ? -18.889 27.984  34.783  1.00 58.89  ? 127 LEU B C   1 
ATOM   2125  O O   . LEU B 1 131 ? -19.074 28.786  33.869  1.00 69.11  ? 127 LEU B O   1 
ATOM   2126  C CB  . LEU B 1 131 ? -16.542 28.157  35.645  1.00 59.24  ? 127 LEU B CB  1 
ATOM   2127  C CG  . LEU B 1 131 ? -15.538 28.714  36.659  1.00 49.09  ? 127 LEU B CG  1 
ATOM   2128  C CD1 . LEU B 1 131 ? -14.112 28.532  36.159  1.00 36.17  ? 127 LEU B CD1 1 
ATOM   2129  C CD2 . LEU B 1 131 ? -15.817 30.179  36.959  1.00 59.71  ? 127 LEU B CD2 1 
ATOM   2130  N N   . LEU B 1 132 ? -19.414 26.764  34.778  1.00 53.26  ? 128 LEU B N   1 
ATOM   2131  C CA  . LEU B 1 132 ? -20.315 26.345  33.709  1.00 53.05  ? 128 LEU B CA  1 
ATOM   2132  C C   . LEU B 1 132 ? -21.698 26.953  33.910  1.00 61.11  ? 128 LEU B C   1 
ATOM   2133  O O   . LEU B 1 132 ? -22.349 27.364  32.950  1.00 68.07  ? 128 LEU B O   1 
ATOM   2134  C CB  . LEU B 1 132 ? -20.409 24.820  33.633  1.00 58.78  ? 128 LEU B CB  1 
ATOM   2135  C CG  . LEU B 1 132 ? -19.198 24.109  33.023  1.00 69.09  ? 128 LEU B CG  1 
ATOM   2136  C CD1 . LEU B 1 132 ? -19.445 22.612  32.934  1.00 66.42  ? 128 LEU B CD1 1 
ATOM   2137  C CD2 . LEU B 1 132 ? -18.865 24.674  31.648  1.00 74.87  ? 128 LEU B CD2 1 
ATOM   2138  N N   . ASP B 1 133 ? -22.139 27.017  35.162  1.00 64.20  ? 129 ASP B N   1 
ATOM   2139  C CA  . ASP B 1 133 ? -23.411 27.648  35.486  1.00 58.90  ? 129 ASP B CA  1 
ATOM   2140  C C   . ASP B 1 133 ? -23.406 29.101  35.021  1.00 53.27  ? 129 ASP B C   1 
ATOM   2141  O O   . ASP B 1 133 ? -24.432 29.629  34.587  1.00 32.80  ? 129 ASP B O   1 
ATOM   2142  C CB  . ASP B 1 133 ? -23.670 27.590  36.993  1.00 57.43  ? 129 ASP B CB  1 
ATOM   2143  C CG  . ASP B 1 133 ? -23.688 26.171  37.529  1.00 71.28  ? 129 ASP B CG  1 
ATOM   2144  O OD1 . ASP B 1 133 ? -23.740 25.225  36.716  1.00 77.07  ? 129 ASP B OD1 1 
ATOM   2145  O OD2 . ASP B 1 133 ? -23.656 25.999  38.767  1.00 71.98  ? 129 ASP B OD2 1 
ATOM   2146  N N   . LYS B 1 134 ? -22.240 29.734  35.107  1.00 43.86  ? 130 LYS B N   1 
ATOM   2147  C CA  . LYS B 1 134 ? -22.099 31.148  34.781  1.00 25.39  ? 130 LYS B CA  1 
ATOM   2148  C C   . LYS B 1 134 ? -21.736 31.365  33.313  1.00 34.83  ? 130 LYS B C   1 
ATOM   2149  O O   . LYS B 1 134 ? -22.364 32.174  32.632  1.00 56.00  ? 130 LYS B O   1 
ATOM   2150  C CB  . LYS B 1 134 ? -21.048 31.788  35.692  1.00 32.81  ? 130 LYS B CB  1 
ATOM   2151  C CG  . LYS B 1 134 ? -21.497 31.919  37.142  1.00 27.27  ? 130 LYS B CG  1 
ATOM   2152  C CD  . LYS B 1 134 ? -20.342 32.265  38.066  1.00 45.47  ? 130 LYS B CD  1 
ATOM   2153  C CE  . LYS B 1 134 ? -20.815 32.495  39.497  1.00 47.90  ? 130 LYS B CE  1 
ATOM   2154  N NZ  . LYS B 1 134 ? -21.255 31.238  40.168  1.00 42.09  ? 130 LYS B NZ  1 
ATOM   2155  N N   . ASP B 1 135 ? -20.725 30.644  32.832  1.00 45.84  ? 131 ASP B N   1 
ATOM   2156  C CA  . ASP B 1 135 ? -20.303 30.748  31.434  1.00 49.19  ? 131 ASP B CA  1 
ATOM   2157  C C   . ASP B 1 135 ? -20.138 29.372  30.793  1.00 57.23  ? 131 ASP B C   1 
ATOM   2158  O O   . ASP B 1 135 ? -19.045 28.815  30.754  1.00 66.01  ? 131 ASP B O   1 
ATOM   2159  C CB  . ASP B 1 135 ? -18.996 31.534  31.314  1.00 50.98  ? 131 ASP B CB  1 
ATOM   2160  C CG  . ASP B 1 135 ? -18.597 31.779  29.871  1.00 69.66  ? 131 ASP B CG  1 
ATOM   2161  O OD1 . ASP B 1 135 ? -19.486 32.095  29.054  1.00 80.18  ? 131 ASP B OD1 1 
ATOM   2162  O OD2 . ASP B 1 135 ? -17.400 31.642  29.547  1.00 74.29  ? 131 ASP B OD2 1 
ATOM   2163  N N   . TRP B 1 136 ? -21.247 28.842  30.292  1.00 64.98  ? 132 TRP B N   1 
ATOM   2164  C CA  . TRP B 1 136 ? -21.283 27.542  29.617  1.00 68.53  ? 132 TRP B CA  1 
ATOM   2165  C C   . TRP B 1 136 ? -20.220 27.362  28.527  1.00 67.77  ? 132 TRP B C   1 
ATOM   2166  O O   . TRP B 1 136 ? -19.879 26.232  28.179  1.00 65.45  ? 132 TRP B O   1 
ATOM   2167  C CB  . TRP B 1 136 ? -22.676 27.310  29.015  1.00 87.41  ? 132 TRP B CB  1 
ATOM   2168  C CG  . TRP B 1 136 ? -23.334 28.574  28.540  1.00 101.21 ? 132 TRP B CG  1 
ATOM   2169  C CD1 . TRP B 1 136 ? -24.239 29.334  29.225  1.00 103.89 ? 132 TRP B CD1 1 
ATOM   2170  C CD2 . TRP B 1 136 ? -23.128 29.232  27.284  1.00 101.63 ? 132 TRP B CD2 1 
ATOM   2171  N NE1 . TRP B 1 136 ? -24.609 30.423  28.473  1.00 109.35 ? 132 TRP B NE1 1 
ATOM   2172  C CE2 . TRP B 1 136 ? -23.942 30.383  27.276  1.00 110.04 ? 132 TRP B CE2 1 
ATOM   2173  C CE3 . TRP B 1 136 ? -22.337 28.959  26.164  1.00 90.02  ? 132 TRP B CE3 1 
ATOM   2174  C CZ2 . TRP B 1 136 ? -23.987 31.259  26.194  1.00 105.57 ? 132 TRP B CZ2 1 
ATOM   2175  C CZ3 . TRP B 1 136 ? -22.384 29.830  25.089  1.00 83.98  ? 132 TRP B CZ3 1 
ATOM   2176  C CH2 . TRP B 1 136 ? -23.200 30.967  25.114  1.00 90.86  ? 132 TRP B CH2 1 
ATOM   2177  N N   . ASN B 1 137 ? -19.706 28.463  27.983  1.00 70.64  ? 133 ASN B N   1 
ATOM   2178  C CA  . ASN B 1 137 ? -18.737 28.392  26.886  1.00 66.55  ? 133 ASN B CA  1 
ATOM   2179  C C   . ASN B 1 137 ? -17.294 28.589  27.344  1.00 56.23  ? 133 ASN B C   1 
ATOM   2180  O O   . ASN B 1 137 ? -16.381 28.676  26.522  1.00 50.77  ? 133 ASN B O   1 
ATOM   2181  C CB  . ASN B 1 137 ? -19.072 29.443  25.826  1.00 68.16  ? 133 ASN B CB  1 
ATOM   2182  C CG  . ASN B 1 137 ? -18.275 29.263  24.551  1.00 76.29  ? 133 ASN B CG  1 
ATOM   2183  O OD1 . ASN B 1 137 ? -17.760 28.179  24.272  1.00 84.87  ? 133 ASN B OD1 1 
ATOM   2184  N ND2 . ASN B 1 137 ? -18.170 30.329  23.765  1.00 73.87  ? 133 ASN B ND2 1 
ATOM   2185  N N   . ILE B 1 138 ? -17.089 28.651  28.654  1.00 56.12  ? 134 ILE B N   1 
ATOM   2186  C CA  . ILE B 1 138 ? -15.788 29.018  29.206  1.00 57.94  ? 134 ILE B CA  1 
ATOM   2187  C C   . ILE B 1 138 ? -14.655 28.078  28.790  1.00 61.36  ? 134 ILE B C   1 
ATOM   2188  O O   . ILE B 1 138 ? -13.548 28.531  28.503  1.00 68.55  ? 134 ILE B O   1 
ATOM   2189  C CB  . ILE B 1 138 ? -15.837 29.087  30.745  1.00 50.84  ? 134 ILE B CB  1 
ATOM   2190  C CG1 . ILE B 1 138 ? -14.532 29.671  31.289  1.00 45.02  ? 134 ILE B CG1 1 
ATOM   2191  C CG2 . ILE B 1 138 ? -16.100 27.709  31.336  1.00 44.92  ? 134 ILE B CG2 1 
ATOM   2192  C CD1 . ILE B 1 138 ? -14.589 30.018  32.760  1.00 35.42  ? 134 ILE B CD1 1 
ATOM   2193  N N   . PHE B 1 139 ? -14.930 26.777  28.748  1.00 57.17  ? 135 PHE B N   1 
ATOM   2194  C CA  . PHE B 1 139 ? -13.875 25.791  28.516  1.00 50.49  ? 135 PHE B CA  1 
ATOM   2195  C C   . PHE B 1 139 ? -13.629 25.487  27.039  1.00 56.08  ? 135 PHE B C   1 
ATOM   2196  O O   . PHE B 1 139 ? -13.027 24.467  26.703  1.00 55.01  ? 135 PHE B O   1 
ATOM   2197  C CB  . PHE B 1 139 ? -14.173 24.496  29.279  1.00 39.11  ? 135 PHE B CB  1 
ATOM   2198  C CG  . PHE B 1 139 ? -14.078 24.642  30.772  1.00 40.52  ? 135 PHE B CG  1 
ATOM   2199  C CD1 . PHE B 1 139 ? -12.897 25.057  31.365  1.00 36.18  ? 135 PHE B CD1 1 
ATOM   2200  C CD2 . PHE B 1 139 ? -15.165 24.361  31.583  1.00 34.90  ? 135 PHE B CD2 1 
ATOM   2201  C CE1 . PHE B 1 139 ? -12.803 25.196  32.739  1.00 38.73  ? 135 PHE B CE1 1 
ATOM   2202  C CE2 . PHE B 1 139 ? -15.078 24.495  32.958  1.00 35.55  ? 135 PHE B CE2 1 
ATOM   2203  C CZ  . PHE B 1 139 ? -13.894 24.914  33.536  1.00 30.22  ? 135 PHE B CZ  1 
ATOM   2204  N N   . SER B 1 140 ? -14.086 26.373  26.160  1.00 51.32  ? 136 SER B N   1 
ATOM   2205  C CA  . SER B 1 140 ? -13.756 26.273  24.744  1.00 46.85  ? 136 SER B CA  1 
ATOM   2206  C C   . SER B 1 140 ? -12.463 27.040  24.472  1.00 51.17  ? 136 SER B C   1 
ATOM   2207  O O   . SER B 1 140 ? -11.986 27.098  23.338  1.00 47.42  ? 136 SER B O   1 
ATOM   2208  C CB  . SER B 1 140 ? -14.895 26.824  23.884  1.00 48.22  ? 136 SER B CB  1 
ATOM   2209  O OG  . SER B 1 140 ? -15.141 28.187  24.180  1.00 70.70  ? 136 SER B OG  1 
ATOM   2210  N N   . LYS B 1 141 ? -11.901 27.624  25.527  1.00 53.70  ? 137 LYS B N   1 
ATOM   2211  C CA  . LYS B 1 141 ? -10.667 28.392  25.429  1.00 49.85  ? 137 LYS B CA  1 
ATOM   2212  C C   . LYS B 1 141 ? -9.506  27.513  24.979  1.00 65.47  ? 137 LYS B C   1 
ATOM   2213  O O   . LYS B 1 141 ? -9.426  26.341  25.345  1.00 75.70  ? 137 LYS B O   1 
ATOM   2214  C CB  . LYS B 1 141 ? -10.349 29.032  26.782  1.00 47.45  ? 137 LYS B CB  1 
ATOM   2215  C CG  . LYS B 1 141 ? -8.917  29.519  26.935  1.00 37.26  ? 137 LYS B CG  1 
ATOM   2216  C CD  . LYS B 1 141 ? -8.779  30.434  28.143  1.00 20.51  ? 137 LYS B CD  1 
ATOM   2217  C CE  . LYS B 1 141 ? -7.325  30.680  28.501  1.00 32.04  ? 137 LYS B CE  1 
ATOM   2218  N NZ  . LYS B 1 141 ? -7.183  31.749  29.528  1.00 45.52  ? 137 LYS B NZ  1 
ATOM   2219  N N   . ASN B 1 142 ? -8.610  28.087  24.182  1.00 70.94  ? 138 ASN B N   1 
ATOM   2220  C CA  . ASN B 1 142 ? -7.447  27.360  23.688  1.00 68.37  ? 138 ASN B CA  1 
ATOM   2221  C C   . ASN B 1 142 ? -6.297  27.438  24.686  1.00 72.92  ? 138 ASN B C   1 
ATOM   2222  O O   . ASN B 1 142 ? -5.720  28.506  24.895  1.00 89.54  ? 138 ASN B O   1 
ATOM   2223  C CB  . ASN B 1 142 ? -7.003  27.926  22.339  1.00 63.37  ? 138 ASN B CB  1 
ATOM   2224  C CG  . ASN B 1 142 ? -5.985  27.043  21.641  1.00 79.05  ? 138 ASN B CG  1 
ATOM   2225  O OD1 . ASN B 1 142 ? -4.807  27.026  22.002  1.00 65.90  ? 138 ASN B OD1 1 
ATOM   2226  N ND2 . ASN B 1 142 ? -6.435  26.309  20.629  1.00 90.48  ? 138 ASN B ND2 1 
ATOM   2227  N N   . CYS B 1 143 ? -5.966  26.306  25.300  1.00 49.79  ? 139 CYS B N   1 
ATOM   2228  C CA  . CYS B 1 143 ? -4.918  26.270  26.314  1.00 58.11  ? 139 CYS B CA  1 
ATOM   2229  C C   . CYS B 1 143 ? -3.640  25.608  25.807  1.00 56.56  ? 139 CYS B C   1 
ATOM   2230  O O   . CYS B 1 143 ? -2.884  25.029  26.588  1.00 54.73  ? 139 CYS B O   1 
ATOM   2231  C CB  . CYS B 1 143 ? -5.420  25.553  27.568  1.00 72.08  ? 139 CYS B CB  1 
ATOM   2232  S SG  . CYS B 1 143 ? -6.725  26.445  28.447  1.00 53.22  ? 139 CYS B SG  1 
ATOM   2233  N N   . ASN B 1 144 ? -3.394  25.701  24.504  1.00 60.30  ? 140 ASN B N   1 
ATOM   2234  C CA  . ASN B 1 144 ? -2.149  25.202  23.931  1.00 54.96  ? 140 ASN B CA  1 
ATOM   2235  C C   . ASN B 1 144 ? -0.983  26.103  24.317  1.00 54.37  ? 140 ASN B C   1 
ATOM   2236  O O   . ASN B 1 144 ? 0.159   25.655  24.398  1.00 57.69  ? 140 ASN B O   1 
ATOM   2237  C CB  . ASN B 1 144 ? -2.250  25.109  22.409  1.00 62.15  ? 140 ASN B CB  1 
ATOM   2238  C CG  . ASN B 1 144 ? -3.236  24.053  21.952  1.00 80.98  ? 140 ASN B CG  1 
ATOM   2239  O OD1 . ASN B 1 144 ? -3.394  23.014  22.593  1.00 83.55  ? 140 ASN B OD1 1 
ATOM   2240  N ND2 . ASN B 1 144 ? -3.904  24.313  20.835  1.00 93.15  ? 140 ASN B ND2 1 
ATOM   2241  N N   . ASN B 1 145 ? -1.280  27.377  24.554  1.00 64.94  ? 141 ASN B N   1 
ATOM   2242  C CA  . ASN B 1 145 ? -0.268  28.336  24.976  1.00 69.73  ? 141 ASN B CA  1 
ATOM   2243  C C   . ASN B 1 145 ? 0.208   28.048  26.395  1.00 60.92  ? 141 ASN B C   1 
ATOM   2244  O O   . ASN B 1 145 ? 1.405   27.907  26.644  1.00 61.34  ? 141 ASN B O   1 
ATOM   2245  C CB  . ASN B 1 145 ? -0.818  29.761  24.900  1.00 82.31  ? 141 ASN B CB  1 
ATOM   2246  C CG  . ASN B 1 145 ? -1.135  30.191  23.480  1.00 93.22  ? 141 ASN B CG  1 
ATOM   2247  O OD1 . ASN B 1 145 ? -0.262  30.665  22.755  1.00 103.59 ? 141 ASN B OD1 1 
ATOM   2248  N ND2 . ASN B 1 145 ? -2.392  30.036  23.080  1.00 89.62  ? 141 ASN B ND2 1 
ATOM   2249  N N   . SER B 1 146 ? -0.739  27.962  27.324  1.00 60.25  ? 142 SER B N   1 
ATOM   2250  C CA  . SER B 1 146 ? -0.419  27.681  28.718  1.00 55.00  ? 142 SER B CA  1 
ATOM   2251  C C   . SER B 1 146 ? 0.262   26.322  28.849  1.00 34.65  ? 142 SER B C   1 
ATOM   2252  O O   . SER B 1 146 ? 1.228   26.173  29.596  1.00 44.62  ? 142 SER B O   1 
ATOM   2253  C CB  . SER B 1 146 ? -1.685  27.726  29.579  1.00 59.74  ? 142 SER B CB  1 
ATOM   2254  O OG  . SER B 1 146 ? -2.233  29.033  29.618  1.00 53.37  ? 142 SER B OG  1 
ATOM   2255  N N   . PHE B 1 147 ? -0.244  25.335  28.115  1.00 43.26  ? 143 PHE B N   1 
ATOM   2256  C CA  . PHE B 1 147 ? 0.313   23.984  28.151  1.00 54.95  ? 143 PHE B CA  1 
ATOM   2257  C C   . PHE B 1 147 ? 1.728   23.949  27.584  1.00 65.92  ? 143 PHE B C   1 
ATOM   2258  O O   . PHE B 1 147 ? 2.523   23.077  27.934  1.00 84.13  ? 143 PHE B O   1 
ATOM   2259  C CB  . PHE B 1 147 ? -0.574  23.013  27.364  1.00 56.82  ? 143 PHE B CB  1 
ATOM   2260  C CG  . PHE B 1 147 ? -1.939  22.802  27.967  1.00 43.78  ? 143 PHE B CG  1 
ATOM   2261  C CD1 . PHE B 1 147 ? -2.286  23.389  29.173  1.00 41.97  ? 143 PHE B CD1 1 
ATOM   2262  C CD2 . PHE B 1 147 ? -2.875  22.006  27.324  1.00 33.07  ? 143 PHE B CD2 1 
ATOM   2263  C CE1 . PHE B 1 147 ? -3.538  23.191  29.722  1.00 46.16  ? 143 PHE B CE1 1 
ATOM   2264  C CE2 . PHE B 1 147 ? -4.129  21.804  27.872  1.00 26.77  ? 143 PHE B CE2 1 
ATOM   2265  C CZ  . PHE B 1 147 ? -4.459  22.397  29.071  1.00 41.66  ? 143 PHE B CZ  1 
ATOM   2266  N N   . ALA B 1 148 ? 2.035   24.897  26.705  1.00 66.95  ? 144 ALA B N   1 
ATOM   2267  C CA  . ALA B 1 148 ? 3.343   24.950  26.061  1.00 64.67  ? 144 ALA B CA  1 
ATOM   2268  C C   . ALA B 1 148 ? 4.388   25.574  26.979  1.00 70.38  ? 144 ALA B C   1 
ATOM   2269  O O   . ALA B 1 148 ? 5.563   25.208  26.932  1.00 65.94  ? 144 ALA B O   1 
ATOM   2270  C CB  . ALA B 1 148 ? 3.254   25.730  24.758  1.00 60.29  ? 144 ALA B CB  1 
ATOM   2271  N N   . GLU B 1 149 ? 3.956   26.511  27.817  1.00 82.01  ? 145 GLU B N   1 
ATOM   2272  C CA  . GLU B 1 149 ? 4.871   27.225  28.702  1.00 91.51  ? 145 GLU B CA  1 
ATOM   2273  C C   . GLU B 1 149 ? 5.059   26.501  30.036  1.00 96.72  ? 145 GLU B C   1 
ATOM   2274  O O   . GLU B 1 149 ? 5.343   27.132  31.054  1.00 108.28 ? 145 GLU B O   1 
ATOM   2275  C CB  . GLU B 1 149 ? 4.375   28.655  28.947  1.00 98.83  ? 145 GLU B CB  1 
ATOM   2276  C CG  . GLU B 1 149 ? 3.054   28.739  29.699  1.00 110.86 ? 145 GLU B CG  1 
ATOM   2277  C CD  . GLU B 1 149 ? 2.595   30.168  29.930  1.00 118.27 ? 145 GLU B CD  1 
ATOM   2278  O OE1 . GLU B 1 149 ? 1.995   30.435  30.994  1.00 131.28 ? 145 GLU B OE1 1 
ATOM   2279  O OE2 . GLU B 1 149 ? 2.821   31.021  29.045  1.00 103.18 ? 145 GLU B OE2 1 
ATOM   2280  N N   . CYS B 1 150 ? 4.902   25.179  30.026  1.00 82.43  ? 146 CYS B N   1 
ATOM   2281  C CA  . CYS B 1 150 ? 5.140   24.366  31.216  1.00 73.41  ? 146 CYS B CA  1 
ATOM   2282  C C   . CYS B 1 150 ? 6.357   23.473  31.007  1.00 55.56  ? 146 CYS B C   1 
ATOM   2283  O O   . CYS B 1 150 ? 6.502   22.846  29.958  1.00 35.29  ? 146 CYS B O   1 
ATOM   2284  C CB  . CYS B 1 150 ? 3.915   23.507  31.543  1.00 83.45  ? 146 CYS B CB  1 
ATOM   2285  S SG  . CYS B 1 150 ? 2.556   24.393  32.349  1.00 56.08  ? 146 CYS B SG  1 
ATOM   2286  N N   . GLU C 1 9   ? 5.524   -11.853 62.700  1.00 51.00  ? 5   GLU C N   1 
ATOM   2287  C CA  . GLU C 1 9   ? 4.426   -11.916 61.741  1.00 62.81  ? 5   GLU C CA  1 
ATOM   2288  C C   . GLU C 1 9   ? 4.192   -10.553 61.097  1.00 55.24  ? 5   GLU C C   1 
ATOM   2289  O O   . GLU C 1 9   ? 3.796   -10.466 59.936  1.00 50.73  ? 5   GLU C O   1 
ATOM   2290  C CB  . GLU C 1 9   ? 3.146   -12.410 62.422  1.00 76.94  ? 5   GLU C CB  1 
ATOM   2291  C CG  . GLU C 1 9   ? 1.944   -12.523 61.489  1.00 86.28  ? 5   GLU C CG  1 
ATOM   2292  C CD  . GLU C 1 9   ? 1.095   -11.263 61.458  1.00 95.87  ? 5   GLU C CD  1 
ATOM   2293  O OE1 . GLU C 1 9   ? 1.109   -10.506 62.451  1.00 99.58  ? 5   GLU C OE1 1 
ATOM   2294  O OE2 . GLU C 1 9   ? 0.411   -11.032 60.438  1.00 93.49  ? 5   GLU C OE2 1 
ATOM   2295  N N   . TYR C 1 10  ? 4.442   -9.491  61.855  1.00 54.54  ? 6   TYR C N   1 
ATOM   2296  C CA  . TYR C 1 10  ? 4.302   -8.138  61.335  1.00 55.68  ? 6   TYR C CA  1 
ATOM   2297  C C   . TYR C 1 10  ? 5.440   -7.817  60.366  1.00 60.19  ? 6   TYR C C   1 
ATOM   2298  O O   . TYR C 1 10  ? 5.370   -6.845  59.614  1.00 56.93  ? 6   TYR C O   1 
ATOM   2299  C CB  . TYR C 1 10  ? 4.275   -7.124  62.483  1.00 53.60  ? 6   TYR C CB  1 
ATOM   2300  C CG  . TYR C 1 10  ? 5.598   -6.956  63.193  1.00 59.63  ? 6   TYR C CG  1 
ATOM   2301  C CD1 . TYR C 1 10  ? 6.541   -6.046  62.737  1.00 69.06  ? 6   TYR C CD1 1 
ATOM   2302  C CD2 . TYR C 1 10  ? 5.901   -7.703  64.324  1.00 48.76  ? 6   TYR C CD2 1 
ATOM   2303  C CE1 . TYR C 1 10  ? 7.753   -5.886  63.384  1.00 69.45  ? 6   TYR C CE1 1 
ATOM   2304  C CE2 . TYR C 1 10  ? 7.109   -7.552  64.977  1.00 46.04  ? 6   TYR C CE2 1 
ATOM   2305  C CZ  . TYR C 1 10  ? 8.031   -6.643  64.504  1.00 59.93  ? 6   TYR C CZ  1 
ATOM   2306  O OH  . TYR C 1 10  ? 9.237   -6.488  65.152  1.00 49.93  ? 6   TYR C OH  1 
ATOM   2307  N N   . CYS C 1 11  ? 6.481   -8.647  60.382  1.00 53.33  ? 7   CYS C N   1 
ATOM   2308  C CA  . CYS C 1 11  ? 7.633   -8.464  59.506  1.00 21.03  ? 7   CYS C CA  1 
ATOM   2309  C C   . CYS C 1 11  ? 7.378   -9.065  58.130  1.00 32.01  ? 7   CYS C C   1 
ATOM   2310  O O   . CYS C 1 11  ? 8.105   -8.780  57.178  1.00 55.08  ? 7   CYS C O   1 
ATOM   2311  C CB  . CYS C 1 11  ? 8.875   -9.112  60.123  1.00 24.97  ? 7   CYS C CB  1 
ATOM   2312  S SG  . CYS C 1 11  ? 9.277   -8.520  61.787  1.00 81.78  ? 7   CYS C SG  1 
ATOM   2313  N N   . SER C 1 12  ? 6.347   -9.900  58.029  1.00 47.91  ? 8   SER C N   1 
ATOM   2314  C CA  . SER C 1 12  ? 6.032   -10.583 56.776  1.00 58.52  ? 8   SER C CA  1 
ATOM   2315  C C   . SER C 1 12  ? 5.256   -9.692  55.802  1.00 56.11  ? 8   SER C C   1 
ATOM   2316  O O   . SER C 1 12  ? 5.313   -9.896  54.590  1.00 47.59  ? 8   SER C O   1 
ATOM   2317  C CB  . SER C 1 12  ? 5.252   -11.875 57.051  1.00 63.40  ? 8   SER C CB  1 
ATOM   2318  O OG  . SER C 1 12  ? 4.051   -11.624 57.762  1.00 72.62  ? 8   SER C OG  1 
ATOM   2319  N N   . HIS C 1 13  ? 4.542   -8.703  56.333  1.00 67.64  ? 9   HIS C N   1 
ATOM   2320  C CA  . HIS C 1 13  ? 3.738   -7.805  55.506  1.00 76.15  ? 9   HIS C CA  1 
ATOM   2321  C C   . HIS C 1 13  ? 4.377   -6.423  55.403  1.00 71.66  ? 9   HIS C C   1 
ATOM   2322  O O   . HIS C 1 13  ? 3.681   -5.416  55.267  1.00 64.41  ? 9   HIS C O   1 
ATOM   2323  C CB  . HIS C 1 13  ? 2.321   -7.681  56.074  1.00 76.06  ? 9   HIS C CB  1 
ATOM   2324  C CG  . HIS C 1 13  ? 1.557   -8.968  56.080  1.00 80.15  ? 9   HIS C CG  1 
ATOM   2325  N ND1 . HIS C 1 13  ? 1.053   -9.539  54.931  1.00 82.71  ? 9   HIS C ND1 1 
ATOM   2326  C CD2 . HIS C 1 13  ? 1.207   -9.793  57.094  1.00 77.52  ? 9   HIS C CD2 1 
ATOM   2327  C CE1 . HIS C 1 13  ? 0.428   -10.662 55.238  1.00 80.30  ? 9   HIS C CE1 1 
ATOM   2328  N NE2 . HIS C 1 13  ? 0.507   -10.839 56.544  1.00 75.57  ? 9   HIS C NE2 1 
ATOM   2329  N N   . MET C 1 14  ? 5.704   -6.383  55.467  1.00 63.10  ? 10  MET C N   1 
ATOM   2330  C CA  . MET C 1 14  ? 6.438   -5.128  55.383  1.00 63.96  ? 10  MET C CA  1 
ATOM   2331  C C   . MET C 1 14  ? 6.671   -4.742  53.928  1.00 53.12  ? 10  MET C C   1 
ATOM   2332  O O   . MET C 1 14  ? 6.189   -3.709  53.461  1.00 50.43  ? 10  MET C O   1 
ATOM   2333  C CB  . MET C 1 14  ? 7.782   -5.255  56.101  1.00 66.42  ? 10  MET C CB  1 
ATOM   2334  C CG  . MET C 1 14  ? 7.661   -5.610  57.569  1.00 67.92  ? 10  MET C CG  1 
ATOM   2335  S SD  . MET C 1 14  ? 6.764   -4.370  58.509  1.00 104.97 ? 10  MET C SD  1 
ATOM   2336  C CE  . MET C 1 14  ? 7.825   -2.954  58.282  1.00 4.74   ? 10  MET C CE  1 
ATOM   2337  N N   . ILE C 1 15  ? 7.410   -5.584  53.214  1.00 29.67  ? 11  ILE C N   1 
ATOM   2338  C CA  . ILE C 1 15  ? 7.792   -5.285  51.844  1.00 39.52  ? 11  ILE C CA  1 
ATOM   2339  C C   . ILE C 1 15  ? 6.746   -5.832  50.881  1.00 44.00  ? 11  ILE C C   1 
ATOM   2340  O O   . ILE C 1 15  ? 6.573   -7.044  50.758  1.00 52.65  ? 11  ILE C O   1 
ATOM   2341  C CB  . ILE C 1 15  ? 9.164   -5.892  51.495  1.00 38.70  ? 11  ILE C CB  1 
ATOM   2342  C CG1 . ILE C 1 15  ? 10.166  -5.641  52.626  1.00 42.32  ? 11  ILE C CG1 1 
ATOM   2343  C CG2 . ILE C 1 15  ? 9.676   -5.312  50.182  1.00 36.68  ? 11  ILE C CG2 1 
ATOM   2344  C CD1 . ILE C 1 15  ? 11.512  -6.299  52.412  1.00 49.39  ? 11  ILE C CD1 1 
ATOM   2345  N N   . GLY C 1 16  ? 6.046   -4.928  50.206  1.00 46.99  ? 12  GLY C N   1 
ATOM   2346  C CA  . GLY C 1 16  ? 5.028   -5.312  49.248  1.00 61.32  ? 12  GLY C CA  1 
ATOM   2347  C C   . GLY C 1 16  ? 5.572   -5.390  47.837  1.00 61.92  ? 12  GLY C C   1 
ATOM   2348  O O   . GLY C 1 16  ? 6.645   -4.862  47.543  1.00 69.15  ? 12  GLY C O   1 
ATOM   2349  N N   . SER C 1 17  ? 4.828   -6.055  46.961  1.00 49.54  ? 13  SER C N   1 
ATOM   2350  C CA  . SER C 1 17  ? 5.212   -6.170  45.562  1.00 68.68  ? 13  SER C CA  1 
ATOM   2351  C C   . SER C 1 17  ? 5.358   -4.789  44.932  1.00 74.85  ? 13  SER C C   1 
ATOM   2352  O O   . SER C 1 17  ? 6.105   -4.612  43.969  1.00 90.50  ? 13  SER C O   1 
ATOM   2353  C CB  . SER C 1 17  ? 4.172   -6.985  44.792  1.00 90.24  ? 13  SER C CB  1 
ATOM   2354  O OG  . SER C 1 17  ? 4.041   -8.288  45.335  1.00 103.87 ? 13  SER C OG  1 
ATOM   2355  N N   . GLY C 1 18  ? 4.642   -3.813  45.481  1.00 66.76  ? 14  GLY C N   1 
ATOM   2356  C CA  . GLY C 1 18  ? 4.686   -2.453  44.973  1.00 58.15  ? 14  GLY C CA  1 
ATOM   2357  C C   . GLY C 1 18  ? 6.057   -1.818  45.107  1.00 44.28  ? 14  GLY C C   1 
ATOM   2358  O O   . GLY C 1 18  ? 6.478   -1.044  44.246  1.00 37.00  ? 14  GLY C O   1 
ATOM   2359  N N   . HIS C 1 19  ? 6.756   -2.141  46.191  1.00 27.40  ? 15  HIS C N   1 
ATOM   2360  C CA  . HIS C 1 19  ? 8.078   -1.585  46.440  1.00 35.02  ? 15  HIS C CA  1 
ATOM   2361  C C   . HIS C 1 19  ? 9.089   -2.104  45.427  1.00 48.65  ? 15  HIS C C   1 
ATOM   2362  O O   . HIS C 1 19  ? 9.989   -1.377  45.005  1.00 54.14  ? 15  HIS C O   1 
ATOM   2363  C CB  . HIS C 1 19  ? 8.542   -1.928  47.855  1.00 46.16  ? 15  HIS C CB  1 
ATOM   2364  C CG  . HIS C 1 19  ? 7.767   -1.233  48.931  1.00 52.94  ? 15  HIS C CG  1 
ATOM   2365  N ND1 . HIS C 1 19  ? 6.708   -1.824  49.585  1.00 41.92  ? 15  HIS C ND1 1 
ATOM   2366  C CD2 . HIS C 1 19  ? 7.895   0.005   49.466  1.00 65.34  ? 15  HIS C CD2 1 
ATOM   2367  C CE1 . HIS C 1 19  ? 6.219   -0.983  50.478  1.00 52.96  ? 15  HIS C CE1 1 
ATOM   2368  N NE2 . HIS C 1 19  ? 6.921   0.135   50.426  1.00 59.68  ? 15  HIS C NE2 1 
ATOM   2369  N N   . LEU C 1 20  ? 8.932   -3.364  45.037  1.00 55.39  ? 16  LEU C N   1 
ATOM   2370  C CA  . LEU C 1 20  ? 9.865   -4.002  44.118  1.00 40.37  ? 16  LEU C CA  1 
ATOM   2371  C C   . LEU C 1 20  ? 9.591   -3.594  42.674  1.00 44.11  ? 16  LEU C C   1 
ATOM   2372  O O   . LEU C 1 20  ? 10.513  -3.485  41.867  1.00 60.62  ? 16  LEU C O   1 
ATOM   2373  C CB  . LEU C 1 20  ? 9.789   -5.522  44.262  1.00 20.29  ? 16  LEU C CB  1 
ATOM   2374  C CG  . LEU C 1 20  ? 9.935   -6.041  45.694  1.00 26.08  ? 16  LEU C CG  1 
ATOM   2375  C CD1 . LEU C 1 20  ? 9.985   -7.560  45.716  1.00 36.77  ? 16  LEU C CD1 1 
ATOM   2376  C CD2 . LEU C 1 20  ? 11.169  -5.454  46.363  1.00 35.96  ? 16  LEU C CD2 1 
ATOM   2377  N N   . GLN C 1 21  ? 8.322   -3.366  42.352  1.00 41.28  ? 17  GLN C N   1 
ATOM   2378  C CA  . GLN C 1 21  ? 7.943   -2.949  41.006  1.00 54.94  ? 17  GLN C CA  1 
ATOM   2379  C C   . GLN C 1 21  ? 8.484   -1.559  40.685  1.00 42.46  ? 17  GLN C C   1 
ATOM   2380  O O   . GLN C 1 21  ? 8.885   -1.290  39.552  1.00 47.95  ? 17  GLN C O   1 
ATOM   2381  C CB  . GLN C 1 21  ? 6.423   -2.974  40.849  1.00 66.49  ? 17  GLN C CB  1 
ATOM   2382  C CG  . GLN C 1 21  ? 5.838   -4.376  40.840  1.00 82.64  ? 17  GLN C CG  1 
ATOM   2383  C CD  . GLN C 1 21  ? 4.335   -4.385  41.027  1.00 96.58  ? 17  GLN C CD  1 
ATOM   2384  O OE1 . GLN C 1 21  ? 3.665   -3.371  40.826  1.00 100.14 ? 17  GLN C OE1 1 
ATOM   2385  N NE2 . GLN C 1 21  ? 3.796   -5.535  41.420  1.00 95.41  ? 17  GLN C NE2 1 
ATOM   2386  N N   . SER C 1 22  ? 8.494   -0.680  41.682  1.00 47.36  ? 18  SER C N   1 
ATOM   2387  C CA  . SER C 1 22  ? 9.030   0.665   41.501  1.00 61.98  ? 18  SER C CA  1 
ATOM   2388  C C   . SER C 1 22  ? 10.558  0.646   41.471  1.00 56.94  ? 18  SER C C   1 
ATOM   2389  O O   . SER C 1 22  ? 11.181  1.478   40.815  1.00 54.29  ? 18  SER C O   1 
ATOM   2390  C CB  . SER C 1 22  ? 8.523   1.608   42.597  1.00 58.11  ? 18  SER C CB  1 
ATOM   2391  O OG  . SER C 1 22  ? 8.913   1.175   43.889  1.00 62.11  ? 18  SER C OG  1 
ATOM   2392  N N   . LEU C 1 23  ? 11.155  -0.308  42.180  1.00 56.08  ? 19  LEU C N   1 
ATOM   2393  C CA  . LEU C 1 23  ? 12.603  -0.489  42.154  1.00 45.83  ? 19  LEU C CA  1 
ATOM   2394  C C   . LEU C 1 23  ? 13.040  -0.886  40.753  1.00 52.08  ? 19  LEU C C   1 
ATOM   2395  O O   . LEU C 1 23  ? 14.117  -0.509  40.294  1.00 51.15  ? 19  LEU C O   1 
ATOM   2396  C CB  . LEU C 1 23  ? 13.033  -1.570  43.149  1.00 49.77  ? 19  LEU C CB  1 
ATOM   2397  C CG  . LEU C 1 23  ? 13.531  -1.094  44.515  1.00 39.78  ? 19  LEU C CG  1 
ATOM   2398  C CD1 . LEU C 1 23  ? 13.517  -2.240  45.516  1.00 34.48  ? 19  LEU C CD1 1 
ATOM   2399  C CD2 . LEU C 1 23  ? 14.930  -0.499  44.403  1.00 18.78  ? 19  LEU C CD2 1 
ATOM   2400  N N   . GLN C 1 24  ? 12.195  -1.657  40.077  1.00 56.67  ? 20  GLN C N   1 
ATOM   2401  C CA  . GLN C 1 24  ? 12.485  -2.099  38.721  1.00 41.87  ? 20  GLN C CA  1 
ATOM   2402  C C   . GLN C 1 24  ? 12.319  -0.942  37.746  1.00 45.17  ? 20  GLN C C   1 
ATOM   2403  O O   . GLN C 1 24  ? 13.178  -0.710  36.897  1.00 37.83  ? 20  GLN C O   1 
ATOM   2404  C CB  . GLN C 1 24  ? 11.564  -3.253  38.323  1.00 40.05  ? 20  GLN C CB  1 
ATOM   2405  C CG  . GLN C 1 24  ? 11.975  -3.943  37.032  1.00 37.47  ? 20  GLN C CG  1 
ATOM   2406  C CD  . GLN C 1 24  ? 13.353  -4.567  37.124  1.00 57.29  ? 20  GLN C CD  1 
ATOM   2407  O OE1 . GLN C 1 24  ? 13.625  -5.367  38.021  1.00 71.38  ? 20  GLN C OE1 1 
ATOM   2408  N NE2 . GLN C 1 24  ? 14.235  -4.196  36.202  1.00 53.32  ? 20  GLN C NE2 1 
ATOM   2409  N N   . ARG C 1 25  ? 11.209  -0.221  37.871  1.00 56.35  ? 21  ARG C N   1 
ATOM   2410  C CA  . ARG C 1 25  ? 10.949  0.935   37.021  1.00 60.29  ? 21  ARG C CA  1 
ATOM   2411  C C   . ARG C 1 25  ? 12.042  1.974   37.241  1.00 48.65  ? 21  ARG C C   1 
ATOM   2412  O O   . ARG C 1 25  ? 12.393  2.736   36.340  1.00 42.19  ? 21  ARG C O   1 
ATOM   2413  C CB  . ARG C 1 25  ? 9.578   1.529   37.339  1.00 78.96  ? 21  ARG C CB  1 
ATOM   2414  C CG  . ARG C 1 25  ? 8.969   2.328   36.196  1.00 99.60  ? 21  ARG C CG  1 
ATOM   2415  C CD  . ARG C 1 25  ? 7.520   2.698   36.479  1.00 110.00 ? 21  ARG C CD  1 
ATOM   2416  N NE  . ARG C 1 25  ? 6.767   1.569   37.028  1.00 109.04 ? 21  ARG C NE  1 
ATOM   2417  C CZ  . ARG C 1 25  ? 6.346   1.466   38.289  1.00 104.93 ? 21  ARG C CZ  1 
ATOM   2418  N NH1 . ARG C 1 25  ? 6.572   2.431   39.175  1.00 110.72 ? 21  ARG C NH1 1 
ATOM   2419  N NH2 . ARG C 1 25  ? 5.680   0.386   38.668  1.00 92.46  ? 21  ARG C NH2 1 
ATOM   2420  N N   . LEU C 1 26  ? 12.579  1.993   38.455  1.00 45.22  ? 22  LEU C N   1 
ATOM   2421  C CA  . LEU C 1 26  ? 13.711  2.842   38.780  1.00 34.51  ? 22  LEU C CA  1 
ATOM   2422  C C   . LEU C 1 26  ? 14.909  2.387   37.957  1.00 54.94  ? 22  LEU C C   1 
ATOM   2423  O O   . LEU C 1 26  ? 15.624  3.203   37.378  1.00 67.38  ? 22  LEU C O   1 
ATOM   2424  C CB  . LEU C 1 26  ? 14.024  2.734   40.271  1.00 28.05  ? 22  LEU C CB  1 
ATOM   2425  C CG  . LEU C 1 26  ? 14.985  3.759   40.863  1.00 30.36  ? 22  LEU C CG  1 
ATOM   2426  C CD1 . LEU C 1 26  ? 14.221  4.782   41.686  1.00 22.06  ? 22  LEU C CD1 1 
ATOM   2427  C CD2 . LEU C 1 26  ? 16.030  3.056   41.707  1.00 30.53  ? 22  LEU C CD2 1 
ATOM   2428  N N   . ILE C 1 27  ? 15.113  1.073   37.905  1.00 54.42  ? 23  ILE C N   1 
ATOM   2429  C CA  . ILE C 1 27  ? 16.214  0.482   37.148  1.00 49.35  ? 23  ILE C CA  1 
ATOM   2430  C C   . ILE C 1 27  ? 16.012  0.607   35.637  1.00 37.86  ? 23  ILE C C   1 
ATOM   2431  O O   . ILE C 1 27  ? 16.964  0.843   34.894  1.00 47.60  ? 23  ILE C O   1 
ATOM   2432  C CB  . ILE C 1 27  ? 16.386  -1.012  37.501  1.00 36.67  ? 23  ILE C CB  1 
ATOM   2433  C CG1 . ILE C 1 27  ? 16.842  -1.168  38.951  1.00 20.58  ? 23  ILE C CG1 1 
ATOM   2434  C CG2 . ILE C 1 27  ? 17.393  -1.676  36.569  1.00 35.95  ? 23  ILE C CG2 1 
ATOM   2435  C CD1 . ILE C 1 27  ? 16.739  -2.587  39.470  1.00 27.93  ? 23  ILE C CD1 1 
ATOM   2436  N N   . ASP C 1 28  ? 14.772  0.445   35.187  1.00 31.04  ? 24  ASP C N   1 
ATOM   2437  C CA  . ASP C 1 28  ? 14.461  0.449   33.761  1.00 31.47  ? 24  ASP C CA  1 
ATOM   2438  C C   . ASP C 1 28  ? 14.646  1.831   33.148  1.00 33.47  ? 24  ASP C C   1 
ATOM   2439  O O   . ASP C 1 28  ? 14.939  1.958   31.958  1.00 42.65  ? 24  ASP C O   1 
ATOM   2440  C CB  . ASP C 1 28  ? 13.019  -0.011  33.532  1.00 38.96  ? 24  ASP C CB  1 
ATOM   2441  C CG  . ASP C 1 28  ? 12.795  -1.454  33.936  1.00 46.46  ? 24  ASP C CG  1 
ATOM   2442  O OD1 . ASP C 1 28  ? 13.727  -2.272  33.777  1.00 36.64  ? 24  ASP C OD1 1 
ATOM   2443  O OD2 . ASP C 1 28  ? 11.681  -1.770  34.410  1.00 45.26  ? 24  ASP C OD2 1 
ATOM   2444  N N   . SER C 1 29  ? 14.466  2.862   33.965  1.00 42.70  ? 25  SER C N   1 
ATOM   2445  C CA  . SER C 1 29  ? 14.512  4.241   33.490  1.00 39.09  ? 25  SER C CA  1 
ATOM   2446  C C   . SER C 1 29  ? 15.924  4.825   33.466  1.00 30.84  ? 25  SER C C   1 
ATOM   2447  O O   . SER C 1 29  ? 16.118  5.954   33.016  1.00 31.23  ? 25  SER C O   1 
ATOM   2448  C CB  . SER C 1 29  ? 13.602  5.124   34.350  1.00 42.11  ? 25  SER C CB  1 
ATOM   2449  O OG  . SER C 1 29  ? 13.929  5.031   35.729  1.00 35.10  ? 25  SER C OG  1 
ATOM   2450  N N   . GLN C 1 30  ? 16.906  4.062   33.940  1.00 30.73  ? 26  GLN C N   1 
ATOM   2451  C CA  . GLN C 1 30  ? 18.285  4.543   33.986  1.00 22.39  ? 26  GLN C CA  1 
ATOM   2452  C C   . GLN C 1 30  ? 18.989  4.386   32.644  1.00 37.22  ? 26  GLN C C   1 
ATOM   2453  O O   . GLN C 1 30  ? 18.852  3.363   31.973  1.00 32.08  ? 26  GLN C O   1 
ATOM   2454  C CB  . GLN C 1 30  ? 19.077  3.814   35.071  1.00 19.71  ? 26  GLN C CB  1 
ATOM   2455  C CG  . GLN C 1 30  ? 18.620  4.138   36.479  1.00 34.17  ? 26  GLN C CG  1 
ATOM   2456  C CD  . GLN C 1 30  ? 18.465  5.627   36.704  1.00 46.49  ? 26  GLN C CD  1 
ATOM   2457  O OE1 . GLN C 1 30  ? 19.427  6.386   36.593  1.00 53.43  ? 26  GLN C OE1 1 
ATOM   2458  N NE2 . GLN C 1 30  ? 17.245  6.057   37.004  1.00 59.18  ? 26  GLN C NE2 1 
ATOM   2459  N N   . MET C 1 31  ? 19.748  5.411   32.268  1.00 39.21  ? 27  MET C N   1 
ATOM   2460  C CA  . MET C 1 31  ? 20.464  5.418   31.000  1.00 44.94  ? 27  MET C CA  1 
ATOM   2461  C C   . MET C 1 31  ? 21.691  4.516   31.074  1.00 45.43  ? 27  MET C C   1 
ATOM   2462  O O   . MET C 1 31  ? 22.380  4.467   32.095  1.00 55.43  ? 27  MET C O   1 
ATOM   2463  C CB  . MET C 1 31  ? 20.873  6.848   30.637  1.00 45.04  ? 27  MET C CB  1 
ATOM   2464  C CG  . MET C 1 31  ? 21.223  7.044   29.173  1.00 38.33  ? 27  MET C CG  1 
ATOM   2465  S SD  . MET C 1 31  ? 21.249  8.784   28.700  1.00 46.96  ? 27  MET C SD  1 
ATOM   2466  C CE  . MET C 1 31  ? 22.691  9.366   29.585  1.00 37.36  ? 27  MET C CE  1 
ATOM   2467  N N   . GLU C 1 32  ? 21.954  3.802   29.983  1.00 26.57  ? 28  GLU C N   1 
ATOM   2468  C CA  . GLU C 1 32  ? 23.048  2.838   29.926  1.00 23.39  ? 28  GLU C CA  1 
ATOM   2469  C C   . GLU C 1 32  ? 24.303  3.479   29.343  1.00 55.13  ? 28  GLU C C   1 
ATOM   2470  O O   . GLU C 1 32  ? 24.431  3.628   28.125  1.00 55.57  ? 28  GLU C O   1 
ATOM   2471  C CB  . GLU C 1 32  ? 22.637  1.634   29.077  1.00 31.00  ? 28  GLU C CB  1 
ATOM   2472  C CG  . GLU C 1 32  ? 21.305  1.018   29.482  1.00 54.12  ? 28  GLU C CG  1 
ATOM   2473  C CD  . GLU C 1 32  ? 20.799  0.012   28.466  1.00 67.33  ? 28  GLU C CD  1 
ATOM   2474  O OE1 . GLU C 1 32  ? 19.689  -0.526  28.660  1.00 68.16  ? 28  GLU C OE1 1 
ATOM   2475  O OE2 . GLU C 1 32  ? 21.512  -0.239  27.471  1.00 77.07  ? 28  GLU C OE2 1 
ATOM   2476  N N   . THR C 1 33  ? 25.229  3.855   30.220  1.00 59.11  ? 29  THR C N   1 
ATOM   2477  C CA  . THR C 1 33  ? 26.446  4.542   29.804  1.00 58.93  ? 29  THR C CA  1 
ATOM   2478  C C   . THR C 1 33  ? 27.678  3.920   30.457  1.00 59.69  ? 29  THR C C   1 
ATOM   2479  O O   . THR C 1 33  ? 27.590  2.872   31.097  1.00 64.74  ? 29  THR C O   1 
ATOM   2480  C CB  . THR C 1 33  ? 26.388  6.042   30.170  1.00 58.76  ? 29  THR C CB  1 
ATOM   2481  O OG1 . THR C 1 33  ? 26.436  6.195   31.594  1.00 55.75  ? 29  THR C OG1 1 
ATOM   2482  C CG2 . THR C 1 33  ? 25.115  6.680   29.639  1.00 63.26  ? 29  THR C CG2 1 
ATOM   2483  N N   . SER C 1 34  ? 28.824  4.573   30.286  1.00 54.62  ? 30  SER C N   1 
ATOM   2484  C CA  . SER C 1 34  ? 30.072  4.127   30.895  1.00 56.99  ? 30  SER C CA  1 
ATOM   2485  C C   . SER C 1 34  ? 30.192  4.632   32.332  1.00 68.79  ? 30  SER C C   1 
ATOM   2486  O O   . SER C 1 34  ? 31.100  4.237   33.065  1.00 76.07  ? 30  SER C O   1 
ATOM   2487  C CB  . SER C 1 34  ? 31.261  4.627   30.073  1.00 50.63  ? 30  SER C CB  1 
ATOM   2488  O OG  . SER C 1 34  ? 31.287  6.044   30.033  1.00 48.19  ? 30  SER C OG  1 
ATOM   2489  N N   . CYS C 1 35  ? 29.270  5.506   32.724  1.00 65.97  ? 31  CYS C N   1 
ATOM   2490  C CA  . CYS C 1 35  ? 29.285  6.114   34.051  1.00 55.99  ? 31  CYS C CA  1 
ATOM   2491  C C   . CYS C 1 35  ? 29.489  5.101   35.175  1.00 64.76  ? 31  CYS C C   1 
ATOM   2492  O O   . CYS C 1 35  ? 28.711  4.159   35.327  1.00 79.97  ? 31  CYS C O   1 
ATOM   2493  C CB  . CYS C 1 35  ? 27.979  6.874   34.294  1.00 35.11  ? 31  CYS C CB  1 
ATOM   2494  S SG  . CYS C 1 35  ? 27.636  7.212   36.037  1.00 51.36  ? 31  CYS C SG  1 
ATOM   2495  N N   . GLN C 1 36  ? 30.539  5.313   35.964  1.00 49.35  ? 32  GLN C N   1 
ATOM   2496  C CA  . GLN C 1 36  ? 30.771  4.528   37.172  1.00 37.24  ? 32  GLN C CA  1 
ATOM   2497  C C   . GLN C 1 36  ? 30.783  5.444   38.391  1.00 36.36  ? 32  GLN C C   1 
ATOM   2498  O O   . GLN C 1 36  ? 31.261  6.577   38.324  1.00 38.33  ? 32  GLN C O   1 
ATOM   2499  C CB  . GLN C 1 36  ? 32.097  3.775   37.087  1.00 32.77  ? 32  GLN C CB  1 
ATOM   2500  C CG  . GLN C 1 36  ? 32.069  2.546   36.204  1.00 36.61  ? 32  GLN C CG  1 
ATOM   2501  C CD  . GLN C 1 36  ? 33.359  1.755   36.287  1.00 52.09  ? 32  GLN C CD  1 
ATOM   2502  O OE1 . GLN C 1 36  ? 34.435  2.270   35.982  1.00 70.53  ? 32  GLN C OE1 1 
ATOM   2503  N NE2 . GLN C 1 36  ? 33.261  0.501   36.715  1.00 54.09  ? 32  GLN C NE2 1 
ATOM   2504  N N   . ILE C 1 37  ? 30.260  4.941   39.505  1.00 31.42  ? 33  ILE C N   1 
ATOM   2505  C CA  . ILE C 1 37  ? 30.200  5.708   40.742  1.00 30.58  ? 33  ILE C CA  1 
ATOM   2506  C C   . ILE C 1 37  ? 30.823  4.924   41.888  1.00 32.79  ? 33  ILE C C   1 
ATOM   2507  O O   . ILE C 1 37  ? 31.181  3.757   41.730  1.00 37.09  ? 33  ILE C O   1 
ATOM   2508  C CB  . ILE C 1 37  ? 28.748  6.057   41.118  1.00 36.85  ? 33  ILE C CB  1 
ATOM   2509  C CG1 . ILE C 1 37  ? 27.896  4.787   41.181  1.00 40.27  ? 33  ILE C CG1 1 
ATOM   2510  C CG2 . ILE C 1 37  ? 28.165  7.040   40.113  1.00 26.15  ? 33  ILE C CG2 1 
ATOM   2511  C CD1 . ILE C 1 37  ? 26.544  4.987   41.828  1.00 48.80  ? 33  ILE C CD1 1 
ATOM   2512  N N   . THR C 1 38  ? 30.943  5.576   43.040  1.00 50.00  ? 34  THR C N   1 
ATOM   2513  C CA  . THR C 1 38  ? 31.508  4.953   44.230  1.00 40.95  ? 34  THR C CA  1 
ATOM   2514  C C   . THR C 1 38  ? 30.425  4.742   45.280  1.00 49.30  ? 34  THR C C   1 
ATOM   2515  O O   . THR C 1 38  ? 29.488  5.534   45.379  1.00 40.12  ? 34  THR C O   1 
ATOM   2516  C CB  . THR C 1 38  ? 32.610  5.832   44.843  1.00 45.67  ? 34  THR C CB  1 
ATOM   2517  O OG1 . THR C 1 38  ? 33.548  6.210   43.828  1.00 39.66  ? 34  THR C OG1 1 
ATOM   2518  C CG2 . THR C 1 38  ? 33.336  5.087   45.953  1.00 57.47  ? 34  THR C CG2 1 
ATOM   2519  N N   . PHE C 1 39  ? 30.554  3.673   46.061  1.00 67.91  ? 35  PHE C N   1 
ATOM   2520  C CA  . PHE C 1 39  ? 29.613  3.400   47.145  1.00 56.77  ? 35  PHE C CA  1 
ATOM   2521  C C   . PHE C 1 39  ? 30.123  2.298   48.075  1.00 44.87  ? 35  PHE C C   1 
ATOM   2522  O O   . PHE C 1 39  ? 30.945  1.470   47.683  1.00 40.76  ? 35  PHE C O   1 
ATOM   2523  C CB  . PHE C 1 39  ? 28.237  3.027   46.581  1.00 56.71  ? 35  PHE C CB  1 
ATOM   2524  C CG  . PHE C 1 39  ? 28.239  1.790   45.726  1.00 43.43  ? 35  PHE C CG  1 
ATOM   2525  C CD1 . PHE C 1 39  ? 28.536  1.864   44.375  1.00 27.78  ? 35  PHE C CD1 1 
ATOM   2526  C CD2 . PHE C 1 39  ? 27.933  0.553   46.272  1.00 43.52  ? 35  PHE C CD2 1 
ATOM   2527  C CE1 . PHE C 1 39  ? 28.533  0.728   43.585  1.00 29.22  ? 35  PHE C CE1 1 
ATOM   2528  C CE2 . PHE C 1 39  ? 27.930  -0.588  45.488  1.00 30.65  ? 35  PHE C CE2 1 
ATOM   2529  C CZ  . PHE C 1 39  ? 28.229  -0.500  44.143  1.00 28.58  ? 35  PHE C CZ  1 
ATOM   2530  N N   . GLU C 1 40  ? 29.633  2.303   49.311  1.00 50.81  ? 36  GLU C N   1 
ATOM   2531  C CA  . GLU C 1 40  ? 30.027  1.311   50.307  1.00 52.71  ? 36  GLU C CA  1 
ATOM   2532  C C   . GLU C 1 40  ? 29.021  0.169   50.339  1.00 60.58  ? 36  GLU C C   1 
ATOM   2533  O O   . GLU C 1 40  ? 27.837  0.387   50.592  1.00 65.95  ? 36  GLU C O   1 
ATOM   2534  C CB  . GLU C 1 40  ? 30.099  1.954   51.694  1.00 62.20  ? 36  GLU C CB  1 
ATOM   2535  C CG  . GLU C 1 40  ? 31.057  3.132   51.799  1.00 71.40  ? 36  GLU C CG  1 
ATOM   2536  C CD  . GLU C 1 40  ? 32.506  2.704   51.918  1.00 82.57  ? 36  GLU C CD  1 
ATOM   2537  O OE1 . GLU C 1 40  ? 32.757  1.553   52.334  1.00 87.84  ? 36  GLU C OE1 1 
ATOM   2538  O OE2 . GLU C 1 40  ? 33.395  3.520   51.597  1.00 89.47  ? 36  GLU C OE2 1 
ATOM   2539  N N   . PHE C 1 41  ? 29.492  -1.049  50.090  1.00 68.35  ? 37  PHE C N   1 
ATOM   2540  C CA  . PHE C 1 41  ? 28.620  -2.217  50.142  1.00 51.57  ? 37  PHE C CA  1 
ATOM   2541  C C   . PHE C 1 41  ? 29.354  -3.421  50.726  1.00 50.45  ? 37  PHE C C   1 
ATOM   2542  O O   . PHE C 1 41  ? 30.560  -3.369  50.963  1.00 62.29  ? 37  PHE C O   1 
ATOM   2543  C CB  . PHE C 1 41  ? 28.069  -2.542  48.751  1.00 36.63  ? 37  PHE C CB  1 
ATOM   2544  C CG  . PHE C 1 41  ? 26.793  -3.335  48.779  1.00 46.55  ? 37  PHE C CG  1 
ATOM   2545  C CD1 . PHE C 1 41  ? 25.609  -2.751  49.199  1.00 49.54  ? 37  PHE C CD1 1 
ATOM   2546  C CD2 . PHE C 1 41  ? 26.779  -4.667  48.402  1.00 44.29  ? 37  PHE C CD2 1 
ATOM   2547  C CE1 . PHE C 1 41  ? 24.434  -3.478  49.233  1.00 42.36  ? 37  PHE C CE1 1 
ATOM   2548  C CE2 . PHE C 1 41  ? 25.607  -5.398  48.434  1.00 34.16  ? 37  PHE C CE2 1 
ATOM   2549  C CZ  . PHE C 1 41  ? 24.434  -4.802  48.849  1.00 32.11  ? 37  PHE C CZ  1 
ATOM   2550  N N   . VAL C 1 42  ? 28.615  -4.502  50.959  1.00 48.15  ? 38  VAL C N   1 
ATOM   2551  C CA  . VAL C 1 42  ? 29.156  -5.684  51.622  1.00 45.81  ? 38  VAL C CA  1 
ATOM   2552  C C   . VAL C 1 42  ? 30.140  -6.439  50.734  1.00 46.98  ? 38  VAL C C   1 
ATOM   2553  O O   . VAL C 1 42  ? 29.873  -6.677  49.555  1.00 52.40  ? 38  VAL C O   1 
ATOM   2554  C CB  . VAL C 1 42  ? 28.038  -6.665  52.025  1.00 42.37  ? 38  VAL C CB  1 
ATOM   2555  C CG1 . VAL C 1 42  ? 28.599  -7.768  52.908  1.00 43.90  ? 38  VAL C CG1 1 
ATOM   2556  C CG2 . VAL C 1 42  ? 26.910  -5.940  52.745  1.00 51.20  ? 38  VAL C CG2 1 
ATOM   2557  N N   . ASP C 1 43  ? 31.276  -6.818  51.308  1.00 39.56  ? 39  ASP C N   1 
ATOM   2558  C CA  . ASP C 1 43  ? 32.241  -7.655  50.608  1.00 56.41  ? 39  ASP C CA  1 
ATOM   2559  C C   . ASP C 1 43  ? 31.739  -9.090  50.653  1.00 52.40  ? 39  ASP C C   1 
ATOM   2560  O O   . ASP C 1 43  ? 31.679  -9.699  51.721  1.00 50.77  ? 39  ASP C O   1 
ATOM   2561  C CB  . ASP C 1 43  ? 33.620  -7.557  51.264  1.00 62.81  ? 39  ASP C CB  1 
ATOM   2562  C CG  . ASP C 1 43  ? 34.716  -8.179  50.418  1.00 62.95  ? 39  ASP C CG  1 
ATOM   2563  O OD1 . ASP C 1 43  ? 34.426  -9.135  49.667  1.00 71.98  ? 39  ASP C OD1 1 
ATOM   2564  O OD2 . ASP C 1 43  ? 35.872  -7.711  50.505  1.00 55.42  ? 39  ASP C OD2 1 
ATOM   2565  N N   . GLN C 1 44  ? 31.372  -9.626  49.493  1.00 39.75  ? 40  GLN C N   1 
ATOM   2566  C CA  . GLN C 1 44  ? 30.756  -10.946 49.424  1.00 54.53  ? 40  GLN C CA  1 
ATOM   2567  C C   . GLN C 1 44  ? 31.751  -12.061 49.743  1.00 45.83  ? 40  GLN C C   1 
ATOM   2568  O O   . GLN C 1 44  ? 31.355  -13.200 49.990  1.00 44.84  ? 40  GLN C O   1 
ATOM   2569  C CB  . GLN C 1 44  ? 30.131  -11.167 48.046  1.00 73.82  ? 40  GLN C CB  1 
ATOM   2570  C CG  . GLN C 1 44  ? 28.943  -12.117 48.052  1.00 79.50  ? 40  GLN C CG  1 
ATOM   2571  C CD  . GLN C 1 44  ? 27.997  -11.874 46.891  1.00 71.13  ? 40  GLN C CD  1 
ATOM   2572  O OE1 . GLN C 1 44  ? 28.272  -11.058 46.011  1.00 75.23  ? 40  GLN C OE1 1 
ATOM   2573  N NE2 . GLN C 1 44  ? 26.873  -12.580 46.886  1.00 53.37  ? 40  GLN C NE2 1 
ATOM   2574  N N   . GLU C 1 45  ? 33.039  -11.732 49.739  1.00 47.72  ? 41  GLU C N   1 
ATOM   2575  C CA  . GLU C 1 45  ? 34.069  -12.702 50.092  1.00 59.48  ? 41  GLU C CA  1 
ATOM   2576  C C   . GLU C 1 45  ? 34.231  -12.828 51.607  1.00 63.31  ? 41  GLU C C   1 
ATOM   2577  O O   . GLU C 1 45  ? 34.301  -13.936 52.140  1.00 80.04  ? 41  GLU C O   1 
ATOM   2578  C CB  . GLU C 1 45  ? 35.407  -12.316 49.461  1.00 55.95  ? 41  GLU C CB  1 
ATOM   2579  C CG  . GLU C 1 45  ? 35.417  -12.376 47.941  1.00 63.57  ? 41  GLU C CG  1 
ATOM   2580  C CD  . GLU C 1 45  ? 36.636  -13.096 47.392  1.00 83.11  ? 41  GLU C CD  1 
ATOM   2581  O OE1 . GLU C 1 45  ? 37.157  -14.003 48.077  1.00 78.69  ? 41  GLU C OE1 1 
ATOM   2582  O OE2 . GLU C 1 45  ? 37.076  -12.752 46.274  1.00 95.93  ? 41  GLU C OE2 1 
ATOM   2583  N N   . GLN C 1 46  ? 34.292  -11.691 52.295  1.00 50.35  ? 42  GLN C N   1 
ATOM   2584  C CA  . GLN C 1 46  ? 34.480  -11.678 53.745  1.00 57.03  ? 42  GLN C CA  1 
ATOM   2585  C C   . GLN C 1 46  ? 33.287  -12.293 54.475  1.00 55.01  ? 42  GLN C C   1 
ATOM   2586  O O   . GLN C 1 46  ? 33.452  -12.996 55.474  1.00 53.83  ? 42  GLN C O   1 
ATOM   2587  C CB  . GLN C 1 46  ? 34.690  -10.245 54.246  1.00 55.54  ? 42  GLN C CB  1 
ATOM   2588  C CG  . GLN C 1 46  ? 35.880  -9.522  53.636  1.00 48.05  ? 42  GLN C CG  1 
ATOM   2589  C CD  . GLN C 1 46  ? 36.127  -8.170  54.283  1.00 67.29  ? 42  GLN C CD  1 
ATOM   2590  O OE1 . GLN C 1 46  ? 36.290  -8.072  55.498  1.00 79.93  ? 42  GLN C OE1 1 
ATOM   2591  N NE2 . GLN C 1 46  ? 36.147  -7.118  53.472  1.00 70.21  ? 42  GLN C NE2 1 
ATOM   2592  N N   . LEU C 1 47  ? 32.087  -12.019 53.972  1.00 40.90  ? 43  LEU C N   1 
ATOM   2593  C CA  . LEU C 1 47  ? 30.859  -12.444 54.632  1.00 35.31  ? 43  LEU C CA  1 
ATOM   2594  C C   . LEU C 1 47  ? 30.104  -13.464 53.780  1.00 47.72  ? 43  LEU C C   1 
ATOM   2595  O O   . LEU C 1 47  ? 29.462  -13.107 52.791  1.00 51.18  ? 43  LEU C O   1 
ATOM   2596  C CB  . LEU C 1 47  ? 29.983  -11.222 54.909  1.00 36.11  ? 43  LEU C CB  1 
ATOM   2597  C CG  . LEU C 1 47  ? 28.766  -11.394 55.821  1.00 47.70  ? 43  LEU C CG  1 
ATOM   2598  C CD1 . LEU C 1 47  ? 29.121  -12.105 57.122  1.00 31.21  ? 43  LEU C CD1 1 
ATOM   2599  C CD2 . LEU C 1 47  ? 28.165  -10.027 56.108  1.00 46.44  ? 43  LEU C CD2 1 
ATOM   2600  N N   . LYS C 1 48  ? 30.190  -14.733 54.171  1.00 49.56  ? 44  LYS C N   1 
ATOM   2601  C CA  . LYS C 1 48  ? 29.576  -15.821 53.413  1.00 62.67  ? 44  LYS C CA  1 
ATOM   2602  C C   . LYS C 1 48  ? 28.190  -16.169 53.946  1.00 58.70  ? 44  LYS C C   1 
ATOM   2603  O O   . LYS C 1 48  ? 27.286  -16.503 53.180  1.00 71.88  ? 44  LYS C O   1 
ATOM   2604  C CB  . LYS C 1 48  ? 30.469  -17.064 53.455  1.00 74.35  ? 44  LYS C CB  1 
ATOM   2605  C CG  . LYS C 1 48  ? 31.844  -16.866 52.833  1.00 86.78  ? 44  LYS C CG  1 
ATOM   2606  C CD  . LYS C 1 48  ? 31.757  -16.537 51.349  1.00 95.99  ? 44  LYS C CD  1 
ATOM   2607  C CE  . LYS C 1 48  ? 31.163  -17.687 50.548  1.00 97.43  ? 44  LYS C CE  1 
ATOM   2608  N NZ  . LYS C 1 48  ? 31.114  -17.386 49.092  1.00 92.84  ? 44  LYS C NZ  1 
ATOM   2609  N N   . ASP C 1 49  ? 28.027  -16.096 55.262  1.00 35.22  ? 45  ASP C N   1 
ATOM   2610  C CA  . ASP C 1 49  ? 26.748  -16.406 55.888  1.00 44.67  ? 45  ASP C CA  1 
ATOM   2611  C C   . ASP C 1 49  ? 25.630  -15.617 55.202  1.00 58.49  ? 45  ASP C C   1 
ATOM   2612  O O   . ASP C 1 49  ? 25.656  -14.386 55.194  1.00 66.70  ? 45  ASP C O   1 
ATOM   2613  C CB  . ASP C 1 49  ? 26.795  -16.078 57.381  1.00 39.17  ? 45  ASP C CB  1 
ATOM   2614  C CG  . ASP C 1 49  ? 25.558  -16.545 58.118  1.00 45.25  ? 45  ASP C CG  1 
ATOM   2615  O OD1 . ASP C 1 49  ? 25.525  -17.723 58.537  1.00 37.98  ? 45  ASP C OD1 1 
ATOM   2616  O OD2 . ASP C 1 49  ? 24.622  -15.734 58.284  1.00 50.04  ? 45  ASP C OD2 1 
ATOM   2617  N N   . PRO C 1 50  ? 24.646  -16.325 54.620  1.00 56.36  ? 46  PRO C N   1 
ATOM   2618  C CA  . PRO C 1 50  ? 23.564  -15.693 53.851  1.00 36.73  ? 46  PRO C CA  1 
ATOM   2619  C C   . PRO C 1 50  ? 22.744  -14.689 54.662  1.00 35.70  ? 46  PRO C C   1 
ATOM   2620  O O   . PRO C 1 50  ? 22.564  -13.548 54.233  1.00 43.48  ? 46  PRO C O   1 
ATOM   2621  C CB  . PRO C 1 50  ? 22.676  -16.876 53.451  1.00 32.25  ? 46  PRO C CB  1 
ATOM   2622  C CG  . PRO C 1 50  ? 23.534  -18.077 53.579  1.00 29.96  ? 46  PRO C CG  1 
ATOM   2623  C CD  . PRO C 1 50  ? 24.505  -17.791 54.667  1.00 41.33  ? 46  PRO C CD  1 
ATOM   2624  N N   . VAL C 1 51  ? 22.241  -15.119 55.814  1.00 33.35  ? 47  VAL C N   1 
ATOM   2625  C CA  . VAL C 1 51  ? 21.435  -14.254 56.670  1.00 38.36  ? 47  VAL C CA  1 
ATOM   2626  C C   . VAL C 1 51  ? 22.211  -13.011 57.096  1.00 42.88  ? 47  VAL C C   1 
ATOM   2627  O O   . VAL C 1 51  ? 21.740  -11.887 56.923  1.00 48.95  ? 47  VAL C O   1 
ATOM   2628  C CB  . VAL C 1 51  ? 20.945  -15.007 57.925  1.00 27.89  ? 47  VAL C CB  1 
ATOM   2629  C CG1 . VAL C 1 51  ? 20.431  -14.034 58.980  1.00 7.11   ? 47  VAL C CG1 1 
ATOM   2630  C CG2 . VAL C 1 51  ? 19.869  -16.007 57.549  1.00 28.54  ? 47  VAL C CG2 1 
ATOM   2631  N N   . CYS C 1 52  ? 23.401  -13.216 57.651  1.00 33.99  ? 48  CYS C N   1 
ATOM   2632  C CA  . CYS C 1 52  ? 24.213  -12.108 58.142  1.00 32.81  ? 48  CYS C CA  1 
ATOM   2633  C C   . CYS C 1 52  ? 24.662  -11.202 56.999  1.00 37.21  ? 48  CYS C C   1 
ATOM   2634  O O   . CYS C 1 52  ? 24.923  -10.016 57.204  1.00 38.18  ? 48  CYS C O   1 
ATOM   2635  C CB  . CYS C 1 52  ? 25.422  -12.634 58.916  1.00 16.54  ? 48  CYS C CB  1 
ATOM   2636  S SG  . CYS C 1 52  ? 24.983  -13.607 60.376  1.00 40.59  ? 48  CYS C SG  1 
ATOM   2637  N N   . TYR C 1 53  ? 24.746  -11.757 55.795  1.00 29.59  ? 49  TYR C N   1 
ATOM   2638  C CA  . TYR C 1 53  ? 25.061  -10.951 54.623  1.00 46.14  ? 49  TYR C CA  1 
ATOM   2639  C C   . TYR C 1 53  ? 23.944  -9.948  54.359  1.00 43.50  ? 49  TYR C C   1 
ATOM   2640  O O   . TYR C 1 53  ? 24.203  -8.783  54.058  1.00 37.41  ? 49  TYR C O   1 
ATOM   2641  C CB  . TYR C 1 53  ? 25.270  -11.828 53.386  1.00 49.40  ? 49  TYR C CB  1 
ATOM   2642  C CG  . TYR C 1 53  ? 25.531  -11.026 52.129  1.00 43.55  ? 49  TYR C CG  1 
ATOM   2643  C CD1 . TYR C 1 53  ? 24.481  -10.493 51.391  1.00 40.83  ? 49  TYR C CD1 1 
ATOM   2644  C CD2 . TYR C 1 53  ? 26.825  -10.790 51.688  1.00 46.94  ? 49  TYR C CD2 1 
ATOM   2645  C CE1 . TYR C 1 53  ? 24.713  -9.754  50.246  1.00 29.13  ? 49  TYR C CE1 1 
ATOM   2646  C CE2 . TYR C 1 53  ? 27.068  -10.052 50.542  1.00 52.22  ? 49  TYR C CE2 1 
ATOM   2647  C CZ  . TYR C 1 53  ? 26.009  -9.537  49.826  1.00 38.40  ? 49  TYR C CZ  1 
ATOM   2648  O OH  . TYR C 1 53  ? 26.248  -8.802  48.686  1.00 33.10  ? 49  TYR C OH  1 
ATOM   2649  N N   . LEU C 1 54  ? 22.700  -10.405 54.471  1.00 42.49  ? 50  LEU C N   1 
ATOM   2650  C CA  . LEU C 1 54  ? 21.551  -9.544  54.219  1.00 36.32  ? 50  LEU C CA  1 
ATOM   2651  C C   . LEU C 1 54  ? 21.398  -8.497  55.315  1.00 35.67  ? 50  LEU C C   1 
ATOM   2652  O O   . LEU C 1 54  ? 21.039  -7.353  55.039  1.00 45.69  ? 50  LEU C O   1 
ATOM   2653  C CB  . LEU C 1 54  ? 20.269  -10.372 54.094  1.00 37.76  ? 50  LEU C CB  1 
ATOM   2654  C CG  . LEU C 1 54  ? 20.154  -11.248 52.841  1.00 42.01  ? 50  LEU C CG  1 
ATOM   2655  C CD1 . LEU C 1 54  ? 18.841  -12.019 52.853  1.00 43.51  ? 50  LEU C CD1 1 
ATOM   2656  C CD2 . LEU C 1 54  ? 20.280  -10.419 51.563  1.00 20.37  ? 50  LEU C CD2 1 
ATOM   2657  N N   . LYS C 1 55  ? 21.677  -8.886  56.555  1.00 34.57  ? 51  LYS C N   1 
ATOM   2658  C CA  . LYS C 1 55  ? 21.588  -7.954  57.674  1.00 46.33  ? 51  LYS C CA  1 
ATOM   2659  C C   . LYS C 1 55  ? 22.467  -6.731  57.427  1.00 42.56  ? 51  LYS C C   1 
ATOM   2660  O O   . LYS C 1 55  ? 21.988  -5.597  57.448  1.00 50.51  ? 51  LYS C O   1 
ATOM   2661  C CB  . LYS C 1 55  ? 21.993  -8.633  58.986  1.00 47.97  ? 51  LYS C CB  1 
ATOM   2662  C CG  . LYS C 1 55  ? 20.997  -9.673  59.487  1.00 56.81  ? 51  LYS C CG  1 
ATOM   2663  C CD  . LYS C 1 55  ? 21.223  -10.007 60.957  1.00 58.60  ? 51  LYS C CD  1 
ATOM   2664  C CE  . LYS C 1 55  ? 20.663  -8.923  61.868  1.00 47.67  ? 51  LYS C CE  1 
ATOM   2665  N NZ  . LYS C 1 55  ? 20.990  -9.168  63.297  1.00 35.97  ? 51  LYS C NZ  1 
ATOM   2666  N N   . LYS C 1 56  ? 23.754  -6.964  57.186  1.00 33.21  ? 52  LYS C N   1 
ATOM   2667  C CA  . LYS C 1 56  ? 24.697  -5.873  56.968  1.00 27.14  ? 52  LYS C CA  1 
ATOM   2668  C C   . LYS C 1 56  ? 24.386  -5.145  55.666  1.00 45.49  ? 52  LYS C C   1 
ATOM   2669  O O   . LYS C 1 56  ? 24.542  -3.926  55.572  1.00 44.06  ? 52  LYS C O   1 
ATOM   2670  C CB  . LYS C 1 56  ? 26.135  -6.399  56.951  1.00 22.53  ? 52  LYS C CB  1 
ATOM   2671  C CG  . LYS C 1 56  ? 27.191  -5.306  56.820  1.00 28.91  ? 52  LYS C CG  1 
ATOM   2672  C CD  . LYS C 1 56  ? 28.440  -5.631  57.626  1.00 36.35  ? 52  LYS C CD  1 
ATOM   2673  C CE  . LYS C 1 56  ? 28.216  -5.421  59.121  1.00 58.50  ? 52  LYS C CE  1 
ATOM   2674  N NZ  . LYS C 1 56  ? 28.162  -3.978  59.498  1.00 54.46  ? 52  LYS C NZ  1 
ATOM   2675  N N   . ALA C 1 57  ? 23.942  -5.897  54.666  1.00 46.25  ? 53  ALA C N   1 
ATOM   2676  C CA  . ALA C 1 57  ? 23.584  -5.321  53.376  1.00 41.05  ? 53  ALA C CA  1 
ATOM   2677  C C   . ALA C 1 57  ? 22.415  -4.351  53.516  1.00 28.59  ? 53  ALA C C   1 
ATOM   2678  O O   . ALA C 1 57  ? 22.358  -3.335  52.828  1.00 40.03  ? 53  ALA C O   1 
ATOM   2679  C CB  . ALA C 1 57  ? 23.238  -6.420  52.388  1.00 51.18  ? 53  ALA C CB  1 
ATOM   2680  N N   . PHE C 1 58  ? 21.484  -4.667  54.409  1.00 39.24  ? 54  PHE C N   1 
ATOM   2681  C CA  . PHE C 1 58  ? 20.299  -3.836  54.598  1.00 44.64  ? 54  PHE C CA  1 
ATOM   2682  C C   . PHE C 1 58  ? 20.642  -2.523  55.297  1.00 42.51  ? 54  PHE C C   1 
ATOM   2683  O O   . PHE C 1 58  ? 20.073  -1.477  54.977  1.00 28.86  ? 54  PHE C O   1 
ATOM   2684  C CB  . PHE C 1 58  ? 19.234  -4.592  55.393  1.00 36.69  ? 54  PHE C CB  1 
ATOM   2685  C CG  . PHE C 1 58  ? 17.975  -3.806  55.617  1.00 25.81  ? 54  PHE C CG  1 
ATOM   2686  C CD1 . PHE C 1 58  ? 17.070  -3.615  54.588  1.00 40.53  ? 54  PHE C CD1 1 
ATOM   2687  C CD2 . PHE C 1 58  ? 17.699  -3.254  56.856  1.00 44.90  ? 54  PHE C CD2 1 
ATOM   2688  C CE1 . PHE C 1 58  ? 15.911  -2.890  54.790  1.00 41.65  ? 54  PHE C CE1 1 
ATOM   2689  C CE2 . PHE C 1 58  ? 16.540  -2.530  57.065  1.00 42.17  ? 54  PHE C CE2 1 
ATOM   2690  C CZ  . PHE C 1 58  ? 15.646  -2.348  56.030  1.00 37.37  ? 54  PHE C CZ  1 
ATOM   2691  N N   . LEU C 1 59  ? 21.568  -2.580  56.251  1.00 31.07  ? 55  LEU C N   1 
ATOM   2692  C CA  . LEU C 1 59  ? 22.031  -1.376  56.936  1.00 27.43  ? 55  LEU C CA  1 
ATOM   2693  C C   . LEU C 1 59  ? 22.711  -0.432  55.954  1.00 46.16  ? 55  LEU C C   1 
ATOM   2694  O O   . LEU C 1 59  ? 22.573  0.788   56.049  1.00 57.76  ? 55  LEU C O   1 
ATOM   2695  C CB  . LEU C 1 59  ? 23.018  -1.733  58.049  1.00 22.26  ? 55  LEU C CB  1 
ATOM   2696  C CG  . LEU C 1 59  ? 22.477  -2.515  59.246  1.00 38.09  ? 55  LEU C CG  1 
ATOM   2697  C CD1 . LEU C 1 59  ? 23.593  -2.761  60.249  1.00 34.01  ? 55  LEU C CD1 1 
ATOM   2698  C CD2 . LEU C 1 59  ? 21.314  -1.782  59.900  1.00 36.06  ? 55  LEU C CD2 1 
ATOM   2699  N N   . LEU C 1 60  ? 23.450  -1.010  55.012  1.00 44.64  ? 56  LEU C N   1 
ATOM   2700  C CA  . LEU C 1 60  ? 24.218  -0.235  54.046  1.00 30.98  ? 56  LEU C CA  1 
ATOM   2701  C C   . LEU C 1 60  ? 23.330  0.317   52.937  1.00 23.69  ? 56  LEU C C   1 
ATOM   2702  O O   . LEU C 1 60  ? 23.570  1.412   52.428  1.00 31.07  ? 56  LEU C O   1 
ATOM   2703  C CB  . LEU C 1 60  ? 25.324  -1.105  53.448  1.00 36.71  ? 56  LEU C CB  1 
ATOM   2704  C CG  . LEU C 1 60  ? 26.356  -1.606  54.459  1.00 35.43  ? 56  LEU C CG  1 
ATOM   2705  C CD1 . LEU C 1 60  ? 27.063  -2.842  53.933  1.00 17.44  ? 56  LEU C CD1 1 
ATOM   2706  C CD2 . LEU C 1 60  ? 27.359  -0.509  54.780  1.00 38.99  ? 56  LEU C CD2 1 
ATOM   2707  N N   . VAL C 1 61  ? 22.307  -0.443  52.560  1.00 21.99  ? 57  VAL C N   1 
ATOM   2708  C CA  . VAL C 1 61  ? 21.373  -0.004  51.530  1.00 23.03  ? 57  VAL C CA  1 
ATOM   2709  C C   . VAL C 1 61  ? 20.679  1.285   51.953  1.00 37.39  ? 57  VAL C C   1 
ATOM   2710  O O   . VAL C 1 61  ? 20.332  2.116   51.114  1.00 39.66  ? 57  VAL C O   1 
ATOM   2711  C CB  . VAL C 1 61  ? 20.312  -1.080  51.238  1.00 26.31  ? 57  VAL C CB  1 
ATOM   2712  C CG1 . VAL C 1 61  ? 19.070  -0.459  50.610  1.00 29.07  ? 57  VAL C CG1 1 
ATOM   2713  C CG2 . VAL C 1 61  ? 20.889  -2.158  50.333  1.00 20.35  ? 57  VAL C CG2 1 
ATOM   2714  N N   . GLN C 1 62  ? 20.483  1.446   53.258  1.00 46.81  ? 58  GLN C N   1 
ATOM   2715  C CA  . GLN C 1 62  ? 19.852  2.645   53.798  1.00 45.49  ? 58  GLN C CA  1 
ATOM   2716  C C   . GLN C 1 62  ? 20.754  3.857   53.633  1.00 46.68  ? 58  GLN C C   1 
ATOM   2717  O O   . GLN C 1 62  ? 20.294  4.937   53.266  1.00 69.55  ? 58  GLN C O   1 
ATOM   2718  C CB  . GLN C 1 62  ? 19.515  2.445   55.272  1.00 42.56  ? 58  GLN C CB  1 
ATOM   2719  C CG  . GLN C 1 62  ? 18.429  1.412   55.514  1.00 38.97  ? 58  GLN C CG  1 
ATOM   2720  C CD  . GLN C 1 62  ? 18.411  0.924   56.945  1.00 46.74  ? 58  GLN C CD  1 
ATOM   2721  O OE1 . GLN C 1 62  ? 19.404  1.033   57.662  1.00 67.89  ? 58  GLN C OE1 1 
ATOM   2722  N NE2 . GLN C 1 62  ? 17.282  0.374   57.369  1.00 38.19  ? 58  GLN C NE2 1 
ATOM   2723  N N   . ASP C 1 63  ? 22.040  3.676   53.911  1.00 33.91  ? 59  ASP C N   1 
ATOM   2724  C CA  . ASP C 1 63  ? 23.017  4.734   53.692  1.00 29.66  ? 59  ASP C CA  1 
ATOM   2725  C C   . ASP C 1 63  ? 23.098  5.082   52.208  1.00 31.64  ? 59  ASP C C   1 
ATOM   2726  O O   . ASP C 1 63  ? 23.302  6.240   51.840  1.00 29.53  ? 59  ASP C O   1 
ATOM   2727  C CB  . ASP C 1 63  ? 24.394  4.301   54.198  1.00 40.56  ? 59  ASP C CB  1 
ATOM   2728  C CG  . ASP C 1 63  ? 24.424  4.094   55.699  1.00 55.76  ? 59  ASP C CG  1 
ATOM   2729  O OD1 . ASP C 1 63  ? 23.647  4.770   56.410  1.00 45.65  ? 59  ASP C OD1 1 
ATOM   2730  O OD2 . ASP C 1 63  ? 25.224  3.254   56.166  1.00 53.99  ? 59  ASP C OD2 1 
ATOM   2731  N N   . ILE C 1 64  ? 22.932  4.071   51.360  1.00 21.33  ? 60  ILE C N   1 
ATOM   2732  C CA  . ILE C 1 64  ? 23.045  4.249   49.917  1.00 23.10  ? 60  ILE C CA  1 
ATOM   2733  C C   . ILE C 1 64  ? 21.866  5.038   49.355  1.00 24.92  ? 60  ILE C C   1 
ATOM   2734  O O   . ILE C 1 64  ? 22.046  5.915   48.512  1.00 29.63  ? 60  ILE C O   1 
ATOM   2735  C CB  . ILE C 1 64  ? 23.151  2.889   49.195  1.00 30.87  ? 60  ILE C CB  1 
ATOM   2736  C CG1 . ILE C 1 64  ? 24.526  2.264   49.453  1.00 25.06  ? 60  ILE C CG1 1 
ATOM   2737  C CG2 . ILE C 1 64  ? 22.929  3.057   47.699  1.00 33.68  ? 60  ILE C CG2 1 
ATOM   2738  C CD1 . ILE C 1 64  ? 24.654  0.825   48.997  1.00 15.36  ? 60  ILE C CD1 1 
ATOM   2739  N N   . MET C 1 65  ? 20.663  4.728   49.825  1.00 28.45  ? 61  MET C N   1 
ATOM   2740  C CA  . MET C 1 65  ? 19.466  5.416   49.357  1.00 37.47  ? 61  MET C CA  1 
ATOM   2741  C C   . MET C 1 65  ? 19.467  6.877   49.793  1.00 30.75  ? 61  MET C C   1 
ATOM   2742  O O   . MET C 1 65  ? 19.017  7.755   49.056  1.00 27.88  ? 61  MET C O   1 
ATOM   2743  C CB  . MET C 1 65  ? 18.206  4.719   49.877  1.00 54.37  ? 61  MET C CB  1 
ATOM   2744  C CG  . MET C 1 65  ? 17.935  3.366   49.233  1.00 52.91  ? 61  MET C CG  1 
ATOM   2745  S SD  . MET C 1 65  ? 16.278  2.748   49.585  1.00 42.00  ? 61  MET C SD  1 
ATOM   2746  C CE  . MET C 1 65  ? 16.284  2.770   51.375  1.00 13.37  ? 61  MET C CE  1 
ATOM   2747  N N   . GLU C 1 66  ? 19.980  7.131   50.992  1.00 40.00  ? 62  GLU C N   1 
ATOM   2748  C CA  . GLU C 1 66  ? 20.006  8.478   51.550  1.00 50.96  ? 62  GLU C CA  1 
ATOM   2749  C C   . GLU C 1 66  ? 21.111  9.336   50.935  1.00 56.73  ? 62  GLU C C   1 
ATOM   2750  O O   . GLU C 1 66  ? 20.900  10.515  50.648  1.00 61.13  ? 62  GLU C O   1 
ATOM   2751  C CB  . GLU C 1 66  ? 20.192  8.413   53.071  1.00 58.38  ? 62  GLU C CB  1 
ATOM   2752  C CG  . GLU C 1 66  ? 20.409  9.765   53.742  1.00 61.21  ? 62  GLU C CG  1 
ATOM   2753  C CD  . GLU C 1 66  ? 19.187  10.663  53.671  1.00 65.10  ? 62  GLU C CD  1 
ATOM   2754  O OE1 . GLU C 1 66  ? 18.106  10.171  53.282  1.00 67.45  ? 62  GLU C OE1 1 
ATOM   2755  O OE2 . GLU C 1 66  ? 19.306  11.861  54.006  1.00 57.89  ? 62  GLU C OE2 1 
ATOM   2756  N N   . ASP C 1 67  ? 22.282  8.741   50.728  1.00 51.16  ? 63  ASP C N   1 
ATOM   2757  C CA  . ASP C 1 67  ? 23.466  9.494   50.317  1.00 41.63  ? 63  ASP C CA  1 
ATOM   2758  C C   . ASP C 1 67  ? 23.721  9.460   48.811  1.00 29.85  ? 63  ASP C C   1 
ATOM   2759  O O   . ASP C 1 67  ? 24.181  10.444  48.237  1.00 36.90  ? 63  ASP C O   1 
ATOM   2760  C CB  . ASP C 1 67  ? 24.712  8.961   51.036  1.00 37.42  ? 63  ASP C CB  1 
ATOM   2761  C CG  . ASP C 1 67  ? 24.640  9.125   52.541  1.00 42.06  ? 63  ASP C CG  1 
ATOM   2762  O OD1 . ASP C 1 67  ? 24.003  10.092  53.010  1.00 59.41  ? 63  ASP C OD1 1 
ATOM   2763  O OD2 . ASP C 1 67  ? 25.227  8.284   53.257  1.00 37.91  ? 63  ASP C OD2 1 
ATOM   2764  N N   . THR C 1 68  ? 23.435  8.325   48.179  1.00 13.16  ? 64  THR C N   1 
ATOM   2765  C CA  . THR C 1 68  ? 23.858  8.097   46.799  1.00 25.84  ? 64  THR C CA  1 
ATOM   2766  C C   . THR C 1 68  ? 22.713  8.153   45.790  1.00 43.81  ? 64  THR C C   1 
ATOM   2767  O O   . THR C 1 68  ? 22.838  8.783   44.739  1.00 53.93  ? 64  THR C O   1 
ATOM   2768  C CB  . THR C 1 68  ? 24.570  6.735   46.661  1.00 31.76  ? 64  THR C CB  1 
ATOM   2769  O OG1 . THR C 1 68  ? 25.670  6.674   47.578  1.00 36.70  ? 64  THR C OG1 1 
ATOM   2770  C CG2 . THR C 1 68  ? 25.084  6.536   45.241  1.00 32.22  ? 64  THR C CG2 1 
ATOM   2771  N N   . MET C 1 69  ? 21.606  7.487   46.102  1.00 51.08  ? 65  MET C N   1 
ATOM   2772  C CA  . MET C 1 69  ? 20.476  7.412   45.181  1.00 53.81  ? 65  MET C CA  1 
ATOM   2773  C C   . MET C 1 69  ? 19.591  8.649   45.307  1.00 51.31  ? 65  MET C C   1 
ATOM   2774  O O   . MET C 1 69  ? 18.607  8.652   46.047  1.00 55.29  ? 65  MET C O   1 
ATOM   2775  C CB  . MET C 1 69  ? 19.664  6.142   45.444  1.00 47.25  ? 65  MET C CB  1 
ATOM   2776  C CG  . MET C 1 69  ? 20.466  4.861   45.242  1.00 51.38  ? 65  MET C CG  1 
ATOM   2777  S SD  . MET C 1 69  ? 19.662  3.378   45.881  1.00 73.98  ? 65  MET C SD  1 
ATOM   2778  C CE  . MET C 1 69  ? 18.125  3.405   44.968  1.00 98.03  ? 65  MET C CE  1 
ATOM   2779  N N   . ARG C 1 70  ? 19.952  9.695   44.569  1.00 48.96  ? 66  ARG C N   1 
ATOM   2780  C CA  . ARG C 1 70  ? 19.251  10.973  44.627  1.00 54.73  ? 66  ARG C CA  1 
ATOM   2781  C C   . ARG C 1 70  ? 18.604  11.306  43.288  1.00 44.99  ? 66  ARG C C   1 
ATOM   2782  O O   . ARG C 1 70  ? 19.226  11.170  42.235  1.00 37.34  ? 66  ARG C O   1 
ATOM   2783  C CB  . ARG C 1 70  ? 20.225  12.086  45.013  1.00 68.78  ? 66  ARG C CB  1 
ATOM   2784  C CG  . ARG C 1 70  ? 20.770  11.975  46.428  1.00 82.54  ? 66  ARG C CG  1 
ATOM   2785  C CD  . ARG C 1 70  ? 22.291  12.040  46.452  1.00 90.84  ? 66  ARG C CD  1 
ATOM   2786  N NE  . ARG C 1 70  ? 22.821  13.143  45.653  1.00 87.01  ? 66  ARG C NE  1 
ATOM   2787  C CZ  . ARG C 1 70  ? 24.115  13.415  45.514  1.00 87.98  ? 66  ARG C CZ  1 
ATOM   2788  N NH1 . ARG C 1 70  ? 25.027  12.669  46.124  1.00 92.51  ? 66  ARG C NH1 1 
ATOM   2789  N NH2 . ARG C 1 70  ? 24.499  14.437  44.765  1.00 86.82  ? 66  ARG C NH2 1 
ATOM   2790  N N   . PHE C 1 71  ? 17.351  11.749  43.337  1.00 38.18  ? 67  PHE C N   1 
ATOM   2791  C CA  . PHE C 1 71  ? 16.612  12.106  42.132  1.00 36.70  ? 67  PHE C CA  1 
ATOM   2792  C C   . PHE C 1 71  ? 15.981  13.486  42.272  1.00 54.13  ? 67  PHE C C   1 
ATOM   2793  O O   . PHE C 1 71  ? 15.816  13.991  43.383  1.00 68.82  ? 67  PHE C O   1 
ATOM   2794  C CB  . PHE C 1 71  ? 15.520  11.071  41.863  1.00 36.54  ? 67  PHE C CB  1 
ATOM   2795  C CG  . PHE C 1 71  ? 16.043  9.685   41.622  1.00 20.73  ? 67  PHE C CG  1 
ATOM   2796  C CD1 . PHE C 1 71  ? 16.267  8.820   42.681  1.00 28.73  ? 67  PHE C CD1 1 
ATOM   2797  C CD2 . PHE C 1 71  ? 16.305  9.244   40.336  1.00 17.16  ? 67  PHE C CD2 1 
ATOM   2798  C CE1 . PHE C 1 71  ? 16.746  7.541   42.461  1.00 34.12  ? 67  PHE C CE1 1 
ATOM   2799  C CE2 . PHE C 1 71  ? 16.782  7.968   40.109  1.00 29.96  ? 67  PHE C CE2 1 
ATOM   2800  C CZ  . PHE C 1 71  ? 17.004  7.114   41.172  1.00 23.93  ? 67  PHE C CZ  1 
ATOM   2801  N N   . ARG C 1 72  ? 15.625  14.092  41.142  1.00 52.19  ? 68  ARG C N   1 
ATOM   2802  C CA  . ARG C 1 72  ? 14.952  15.386  41.152  1.00 42.50  ? 68  ARG C CA  1 
ATOM   2803  C C   . ARG C 1 72  ? 13.674  15.285  41.981  1.00 44.18  ? 68  ARG C C   1 
ATOM   2804  O O   . ARG C 1 72  ? 12.920  14.320  41.856  1.00 36.46  ? 68  ARG C O   1 
ATOM   2805  C CB  . ARG C 1 72  ? 14.623  15.834  39.726  1.00 38.29  ? 68  ARG C CB  1 
ATOM   2806  C CG  . ARG C 1 72  ? 14.146  17.276  39.626  1.00 51.99  ? 68  ARG C CG  1 
ATOM   2807  C CD  . ARG C 1 72  ? 13.776  17.650  38.198  1.00 78.94  ? 68  ARG C CD  1 
ATOM   2808  N NE  . ARG C 1 72  ? 14.893  17.481  37.269  1.00 98.14  ? 68  ARG C NE  1 
ATOM   2809  C CZ  . ARG C 1 72  ? 15.840  18.389  37.048  1.00 100.87 ? 68  ARG C CZ  1 
ATOM   2810  N NH1 . ARG C 1 72  ? 15.831  19.550  37.691  1.00 110.50 ? 68  ARG C NH1 1 
ATOM   2811  N NH2 . ARG C 1 72  ? 16.809  18.134  36.179  1.00 86.45  ? 68  ARG C NH2 1 
ATOM   2812  N N   . ASP C 1 73  ? 13.438  16.283  42.828  1.00 46.12  ? 69  ASP C N   1 
ATOM   2813  C CA  . ASP C 1 73  ? 12.302  16.260  43.748  1.00 47.71  ? 69  ASP C CA  1 
ATOM   2814  C C   . ASP C 1 73  ? 10.964  16.129  43.020  1.00 45.64  ? 69  ASP C C   1 
ATOM   2815  O O   . ASP C 1 73  ? 10.791  16.635  41.910  1.00 45.41  ? 69  ASP C O   1 
ATOM   2816  C CB  . ASP C 1 73  ? 12.301  17.521  44.619  1.00 52.47  ? 69  ASP C CB  1 
ATOM   2817  C CG  . ASP C 1 73  ? 13.477  17.570  45.579  1.00 57.35  ? 69  ASP C CG  1 
ATOM   2818  O OD1 . ASP C 1 73  ? 13.738  16.553  46.258  1.00 38.18  ? 69  ASP C OD1 1 
ATOM   2819  O OD2 . ASP C 1 73  ? 14.144  18.625  45.651  1.00 67.01  ? 69  ASP C OD2 1 
ATOM   2820  N N   . ASN C 1 74  ? 10.026  15.434  43.658  1.00 49.08  ? 70  ASN C N   1 
ATOM   2821  C CA  . ASN C 1 74  ? 8.670   15.269  43.136  1.00 53.20  ? 70  ASN C CA  1 
ATOM   2822  C C   . ASN C 1 74  ? 8.605   14.516  41.808  1.00 51.54  ? 70  ASN C C   1 
ATOM   2823  O O   . ASN C 1 74  ? 7.703   14.749  41.001  1.00 54.64  ? 70  ASN C O   1 
ATOM   2824  C CB  . ASN C 1 74  ? 7.978   16.629  42.997  1.00 62.16  ? 70  ASN C CB  1 
ATOM   2825  C CG  . ASN C 1 74  ? 7.801   17.333  44.330  1.00 68.29  ? 70  ASN C CG  1 
ATOM   2826  O OD1 . ASN C 1 74  ? 8.225   18.476  44.501  1.00 74.64  ? 70  ASN C OD1 1 
ATOM   2827  N ND2 . ASN C 1 74  ? 7.174   16.652  45.283  1.00 65.46  ? 70  ASN C ND2 1 
ATOM   2828  N N   . THR C 1 75  ? 9.556   13.613  41.589  1.00 45.35  ? 71  THR C N   1 
ATOM   2829  C CA  . THR C 1 75  ? 9.508   12.722  40.435  1.00 42.48  ? 71  THR C CA  1 
ATOM   2830  C C   . THR C 1 75  ? 9.226   11.306  40.919  1.00 44.60  ? 71  THR C C   1 
ATOM   2831  O O   . THR C 1 75  ? 9.534   10.968  42.063  1.00 50.88  ? 71  THR C O   1 
ATOM   2832  C CB  . THR C 1 75  ? 10.825  12.732  39.629  1.00 34.58  ? 71  THR C CB  1 
ATOM   2833  O OG1 . THR C 1 75  ? 11.890  12.193  40.425  1.00 55.84  ? 71  THR C OG1 1 
ATOM   2834  C CG2 . THR C 1 75  ? 11.175  14.147  39.186  1.00 17.63  ? 71  THR C CG2 1 
ATOM   2835  N N   . PRO C 1 76  ? 8.631   10.472  40.051  1.00 32.01  ? 72  PRO C N   1 
ATOM   2836  C CA  . PRO C 1 76  ? 8.294   9.090   40.410  1.00 22.99  ? 72  PRO C CA  1 
ATOM   2837  C C   . PRO C 1 76  ? 9.450   8.344   41.076  1.00 36.09  ? 72  PRO C C   1 
ATOM   2838  O O   . PRO C 1 76  ? 9.231   7.646   42.067  1.00 46.02  ? 72  PRO C O   1 
ATOM   2839  C CB  . PRO C 1 76  ? 7.946   8.460   39.061  1.00 25.47  ? 72  PRO C CB  1 
ATOM   2840  C CG  . PRO C 1 76  ? 7.427   9.594   38.249  1.00 29.38  ? 72  PRO C CG  1 
ATOM   2841  C CD  . PRO C 1 76  ? 8.222   10.798  38.673  1.00 27.95  ? 72  PRO C CD  1 
ATOM   2842  N N   . ASN C 1 77  ? 10.660  8.498   40.545  1.00 50.29  ? 73  ASN C N   1 
ATOM   2843  C CA  . ASN C 1 77  ? 11.834  7.823   41.097  1.00 40.06  ? 73  ASN C CA  1 
ATOM   2844  C C   . ASN C 1 77  ? 12.238  8.366   42.468  1.00 46.01  ? 73  ASN C C   1 
ATOM   2845  O O   . ASN C 1 77  ? 12.765  7.628   43.298  1.00 49.66  ? 73  ASN C O   1 
ATOM   2846  C CB  . ASN C 1 77  ? 13.022  7.922   40.132  1.00 35.84  ? 73  ASN C CB  1 
ATOM   2847  C CG  . ASN C 1 77  ? 12.877  7.010   38.926  1.00 43.30  ? 73  ASN C CG  1 
ATOM   2848  O OD1 . ASN C 1 77  ? 12.033  6.114   38.908  1.00 48.07  ? 73  ASN C OD1 1 
ATOM   2849  N ND2 . ASN C 1 77  ? 13.713  7.224   37.917  1.00 46.41  ? 73  ASN C ND2 1 
ATOM   2850  N N   . ALA C 1 78  ? 11.996  9.653   42.701  1.00 51.96  ? 74  ALA C N   1 
ATOM   2851  C CA  . ALA C 1 78  ? 12.337  10.272  43.980  1.00 44.03  ? 74  ALA C CA  1 
ATOM   2852  C C   . ALA C 1 78  ? 11.387  9.796   45.074  1.00 36.77  ? 74  ALA C C   1 
ATOM   2853  O O   . ALA C 1 78  ? 11.815  9.459   46.179  1.00 38.13  ? 74  ALA C O   1 
ATOM   2854  C CB  . ALA C 1 78  ? 12.295  11.791  43.867  1.00 22.24  ? 74  ALA C CB  1 
ATOM   2855  N N   . ILE C 1 79  ? 10.097  9.768   44.759  1.00 35.51  ? 75  ILE C N   1 
ATOM   2856  C CA  . ILE C 1 79  ? 9.084   9.321   45.710  1.00 43.27  ? 75  ILE C CA  1 
ATOM   2857  C C   . ILE C 1 79  ? 9.210   7.819   45.954  1.00 44.67  ? 75  ILE C C   1 
ATOM   2858  O O   . ILE C 1 79  ? 8.861   7.322   47.025  1.00 56.48  ? 75  ILE C O   1 
ATOM   2859  C CB  . ILE C 1 79  ? 7.662   9.641   45.207  1.00 39.70  ? 75  ILE C CB  1 
ATOM   2860  C CG1 . ILE C 1 79  ? 7.481   11.152  45.056  1.00 31.17  ? 75  ILE C CG1 1 
ATOM   2861  C CG2 . ILE C 1 79  ? 6.616   9.090   46.165  1.00 43.32  ? 75  ILE C CG2 1 
ATOM   2862  C CD1 . ILE C 1 79  ? 6.295   11.541  44.207  1.00 39.74  ? 75  ILE C CD1 1 
ATOM   2863  N N   . ALA C 1 80  ? 9.714   7.101   44.955  1.00 39.14  ? 76  ALA C N   1 
ATOM   2864  C CA  . ALA C 1 80  ? 9.955   5.671   45.088  1.00 32.36  ? 76  ALA C CA  1 
ATOM   2865  C C   . ALA C 1 80  ? 10.959  5.409   46.205  1.00 38.20  ? 76  ALA C C   1 
ATOM   2866  O O   . ALA C 1 80  ? 10.814  4.455   46.969  1.00 44.18  ? 76  ALA C O   1 
ATOM   2867  C CB  . ALA C 1 80  ? 10.462  5.099   43.775  1.00 33.83  ? 76  ALA C CB  1 
ATOM   2868  N N   . ILE C 1 81  ? 11.972  6.265   46.296  1.00 39.59  ? 77  ILE C N   1 
ATOM   2869  C CA  . ILE C 1 81  ? 12.999  6.138   47.326  1.00 28.11  ? 77  ILE C CA  1 
ATOM   2870  C C   . ILE C 1 81  ? 12.446  6.548   48.691  1.00 27.99  ? 77  ILE C C   1 
ATOM   2871  O O   . ILE C 1 81  ? 12.696  5.881   49.697  1.00 23.67  ? 77  ILE C O   1 
ATOM   2872  C CB  . ILE C 1 81  ? 14.235  7.004   47.001  1.00 24.84  ? 77  ILE C CB  1 
ATOM   2873  C CG1 . ILE C 1 81  ? 14.799  6.639   45.625  1.00 24.12  ? 77  ILE C CG1 1 
ATOM   2874  C CG2 . ILE C 1 81  ? 15.304  6.836   48.071  1.00 19.38  ? 77  ILE C CG2 1 
ATOM   2875  C CD1 . ILE C 1 81  ? 15.261  5.206   45.506  1.00 16.08  ? 77  ILE C CD1 1 
ATOM   2876  N N   . VAL C 1 82  ? 11.694  7.644   48.725  1.00 24.09  ? 78  VAL C N   1 
ATOM   2877  C CA  . VAL C 1 82  ? 11.084  8.110   49.968  1.00 26.17  ? 78  VAL C CA  1 
ATOM   2878  C C   . VAL C 1 82  ? 10.239  7.008   50.601  1.00 32.65  ? 78  VAL C C   1 
ATOM   2879  O O   . VAL C 1 82  ? 10.339  6.749   51.801  1.00 32.51  ? 78  VAL C O   1 
ATOM   2880  C CB  . VAL C 1 82  ? 10.203  9.349   49.736  1.00 27.79  ? 78  VAL C CB  1 
ATOM   2881  C CG1 . VAL C 1 82  ? 9.329   9.619   50.953  1.00 40.58  ? 78  VAL C CG1 1 
ATOM   2882  C CG2 . VAL C 1 82  ? 11.065  10.563  49.413  1.00 17.59  ? 78  VAL C CG2 1 
ATOM   2883  N N   . GLN C 1 83  ? 9.408   6.363   49.788  1.00 30.31  ? 79  GLN C N   1 
ATOM   2884  C CA  . GLN C 1 83  ? 8.594   5.248   50.257  1.00 31.51  ? 79  GLN C CA  1 
ATOM   2885  C C   . GLN C 1 83  ? 9.474   4.112   50.769  1.00 42.56  ? 79  GLN C C   1 
ATOM   2886  O O   . GLN C 1 83  ? 9.163   3.483   51.783  1.00 40.36  ? 79  GLN C O   1 
ATOM   2887  C CB  . GLN C 1 83  ? 7.696   4.729   49.132  1.00 25.19  ? 79  GLN C CB  1 
ATOM   2888  C CG  . GLN C 1 83  ? 6.587   5.680   48.726  1.00 23.06  ? 79  GLN C CG  1 
ATOM   2889  C CD  . GLN C 1 83  ? 5.757   5.147   47.571  1.00 53.20  ? 79  GLN C CD  1 
ATOM   2890  O OE1 . GLN C 1 83  ? 6.225   5.080   46.433  1.00 49.82  ? 79  GLN C OE1 1 
ATOM   2891  N NE2 . GLN C 1 83  ? 4.518   4.761   47.860  1.00 65.30  ? 79  GLN C NE2 1 
ATOM   2892  N N   . LEU C 1 84  ? 10.571  3.853   50.063  1.00 42.83  ? 80  LEU C N   1 
ATOM   2893  C CA  . LEU C 1 84  ? 11.469  2.755   50.412  1.00 32.98  ? 80  LEU C CA  1 
ATOM   2894  C C   . LEU C 1 84  ? 12.249  3.041   51.692  1.00 34.82  ? 80  LEU C C   1 
ATOM   2895  O O   . LEU C 1 84  ? 12.564  2.124   52.453  1.00 32.26  ? 80  LEU C O   1 
ATOM   2896  C CB  . LEU C 1 84  ? 12.430  2.471   49.258  1.00 17.93  ? 80  LEU C CB  1 
ATOM   2897  C CG  . LEU C 1 84  ? 11.809  1.732   48.070  1.00 31.94  ? 80  LEU C CG  1 
ATOM   2898  C CD1 . LEU C 1 84  ? 12.724  1.784   46.855  1.00 34.35  ? 80  LEU C CD1 1 
ATOM   2899  C CD2 . LEU C 1 84  ? 11.498  0.291   48.440  1.00 33.50  ? 80  LEU C CD2 1 
ATOM   2900  N N   . GLN C 1 85  ? 12.559  4.310   51.929  1.00 32.69  ? 81  GLN C N   1 
ATOM   2901  C CA  . GLN C 1 85  ? 13.219  4.708   53.166  1.00 35.86  ? 81  GLN C CA  1 
ATOM   2902  C C   . GLN C 1 85  ? 12.236  4.627   54.333  1.00 43.43  ? 81  GLN C C   1 
ATOM   2903  O O   . GLN C 1 85  ? 12.591  4.181   55.425  1.00 43.48  ? 81  GLN C O   1 
ATOM   2904  C CB  . GLN C 1 85  ? 13.797  6.121   53.039  1.00 10.44  ? 81  GLN C CB  1 
ATOM   2905  C CG  . GLN C 1 85  ? 14.917  6.219   52.015  1.00 26.47  ? 81  GLN C CG  1 
ATOM   2906  C CD  . GLN C 1 85  ? 15.497  7.613   51.897  1.00 41.87  ? 81  GLN C CD  1 
ATOM   2907  O OE1 . GLN C 1 85  ? 14.958  8.466   51.192  1.00 55.63  ? 81  GLN C OE1 1 
ATOM   2908  N NE2 . GLN C 1 85  ? 16.611  7.849   52.582  1.00 46.93  ? 81  GLN C NE2 1 
ATOM   2909  N N   . GLU C 1 86  ? 10.997  5.047   54.094  1.00 36.44  ? 82  GLU C N   1 
ATOM   2910  C CA  . GLU C 1 86  ? 9.951   4.956   55.107  1.00 35.72  ? 82  GLU C CA  1 
ATOM   2911  C C   . GLU C 1 86  ? 9.679   3.500   55.457  1.00 20.51  ? 82  GLU C C   1 
ATOM   2912  O O   . GLU C 1 86  ? 9.551   3.147   56.628  1.00 37.90  ? 82  GLU C O   1 
ATOM   2913  C CB  . GLU C 1 86  ? 8.666   5.623   54.614  1.00 54.00  ? 82  GLU C CB  1 
ATOM   2914  C CG  . GLU C 1 86  ? 8.719   7.140   54.611  1.00 44.15  ? 82  GLU C CG  1 
ATOM   2915  C CD  . GLU C 1 86  ? 7.470   7.761   54.025  1.00 46.69  ? 82  GLU C CD  1 
ATOM   2916  O OE1 . GLU C 1 86  ? 7.304   8.993   54.149  1.00 48.25  ? 82  GLU C OE1 1 
ATOM   2917  O OE2 . GLU C 1 86  ? 6.658   7.015   53.436  1.00 43.21  ? 82  GLU C OE2 1 
ATOM   2918  N N   . LEU C 1 87  ? 9.584   2.661   54.430  1.00 27.36  ? 83  LEU C N   1 
ATOM   2919  C CA  . LEU C 1 87  ? 9.441   1.224   54.623  1.00 25.87  ? 83  LEU C CA  1 
ATOM   2920  C C   . LEU C 1 87  ? 10.589  0.700   55.473  1.00 38.27  ? 83  LEU C C   1 
ATOM   2921  O O   . LEU C 1 87  ? 10.390  -0.084  56.401  1.00 35.85  ? 83  LEU C O   1 
ATOM   2922  C CB  . LEU C 1 87  ? 9.446   0.511   53.271  1.00 25.15  ? 83  LEU C CB  1 
ATOM   2923  C CG  . LEU C 1 87  ? 9.678   -1.002  53.311  1.00 37.09  ? 83  LEU C CG  1 
ATOM   2924  C CD1 . LEU C 1 87  ? 8.518   -1.710  54.000  1.00 56.75  ? 83  LEU C CD1 1 
ATOM   2925  C CD2 . LEU C 1 87  ? 9.896   -1.545  51.905  1.00 24.80  ? 83  LEU C CD2 1 
ATOM   2926  N N   . SER C 1 88  ? 11.794  1.151   55.144  1.00 55.12  ? 84  SER C N   1 
ATOM   2927  C CA  . SER C 1 88  ? 13.004  0.684   55.802  1.00 51.43  ? 84  SER C CA  1 
ATOM   2928  C C   . SER C 1 88  ? 13.045  1.079   57.279  1.00 48.01  ? 84  SER C C   1 
ATOM   2929  O O   . SER C 1 88  ? 13.473  0.290   58.123  1.00 50.71  ? 84  SER C O   1 
ATOM   2930  C CB  . SER C 1 88  ? 14.230  1.229   55.069  1.00 57.52  ? 84  SER C CB  1 
ATOM   2931  O OG  . SER C 1 88  ? 14.222  0.831   53.708  1.00 55.17  ? 84  SER C OG  1 
ATOM   2932  N N   . LEU C 1 89  ? 12.599  2.293   57.590  1.00 46.27  ? 85  LEU C N   1 
ATOM   2933  C CA  . LEU C 1 89  ? 12.586  2.770   58.972  1.00 54.90  ? 85  LEU C CA  1 
ATOM   2934  C C   . LEU C 1 89  ? 11.867  1.787   59.887  1.00 52.54  ? 85  LEU C C   1 
ATOM   2935  O O   . LEU C 1 89  ? 12.330  1.493   60.991  1.00 37.86  ? 85  LEU C O   1 
ATOM   2936  C CB  . LEU C 1 89  ? 11.903  4.138   59.073  1.00 52.66  ? 85  LEU C CB  1 
ATOM   2937  C CG  . LEU C 1 89  ? 12.699  5.367   58.630  1.00 44.68  ? 85  LEU C CG  1 
ATOM   2938  C CD1 . LEU C 1 89  ? 11.871  6.626   58.840  1.00 45.56  ? 85  LEU C CD1 1 
ATOM   2939  C CD2 . LEU C 1 89  ? 14.022  5.468   59.373  1.00 35.61  ? 85  LEU C CD2 1 
ATOM   2940  N N   . ARG C 1 90  ? 10.728  1.286   59.421  1.00 44.21  ? 86  ARG C N   1 
ATOM   2941  C CA  . ARG C 1 90  ? 9.895   0.402   60.226  1.00 45.69  ? 86  ARG C CA  1 
ATOM   2942  C C   . ARG C 1 90  ? 10.387  -1.042  60.172  1.00 45.04  ? 86  ARG C C   1 
ATOM   2943  O O   . ARG C 1 90  ? 10.164  -1.817  61.102  1.00 44.54  ? 86  ARG C O   1 
ATOM   2944  C CB  . ARG C 1 90  ? 8.443   0.472   59.751  1.00 50.40  ? 86  ARG C CB  1 
ATOM   2945  C CG  . ARG C 1 90  ? 7.464   0.966   60.802  1.00 56.41  ? 86  ARG C CG  1 
ATOM   2946  C CD  . ARG C 1 90  ? 7.763   2.389   61.244  1.00 57.92  ? 86  ARG C CD  1 
ATOM   2947  N NE  . ARG C 1 90  ? 7.671   3.343   60.142  1.00 53.06  ? 86  ARG C NE  1 
ATOM   2948  C CZ  . ARG C 1 90  ? 7.586   4.661   60.296  1.00 48.81  ? 86  ARG C CZ  1 
ATOM   2949  N NH1 . ARG C 1 90  ? 7.575   5.197   61.511  1.00 42.55  ? 86  ARG C NH1 1 
ATOM   2950  N NH2 . ARG C 1 90  ? 7.505   5.448   59.231  1.00 40.49  ? 86  ARG C NH2 1 
ATOM   2951  N N   . LEU C 1 91  ? 11.059  -1.399  59.083  1.00 36.73  ? 87  LEU C N   1 
ATOM   2952  C CA  . LEU C 1 91  ? 11.531  -2.764  58.887  1.00 30.73  ? 87  LEU C CA  1 
ATOM   2953  C C   . LEU C 1 91  ? 12.693  -3.107  59.819  1.00 53.32  ? 87  LEU C C   1 
ATOM   2954  O O   . LEU C 1 91  ? 12.938  -4.279  60.109  1.00 56.19  ? 87  LEU C O   1 
ATOM   2955  C CB  . LEU C 1 91  ? 11.944  -2.971  57.428  1.00 31.90  ? 87  LEU C CB  1 
ATOM   2956  C CG  . LEU C 1 91  ? 12.399  -4.379  57.045  1.00 31.74  ? 87  LEU C CG  1 
ATOM   2957  C CD1 . LEU C 1 91  ? 11.338  -5.408  57.391  1.00 33.61  ? 87  LEU C CD1 1 
ATOM   2958  C CD2 . LEU C 1 91  ? 12.737  -4.439  55.563  1.00 35.83  ? 87  LEU C CD2 1 
ATOM   2959  N N   . LYS C 1 92  ? 13.402  -2.086  60.290  1.00 60.77  ? 88  LYS C N   1 
ATOM   2960  C CA  . LYS C 1 92  ? 14.543  -2.292  61.179  1.00 55.92  ? 88  LYS C CA  1 
ATOM   2961  C C   . LYS C 1 92  ? 14.149  -2.973  62.485  1.00 59.42  ? 88  LYS C C   1 
ATOM   2962  O O   . LYS C 1 92  ? 14.978  -3.618  63.126  1.00 65.51  ? 88  LYS C O   1 
ATOM   2963  C CB  . LYS C 1 92  ? 15.229  -0.962  61.490  1.00 49.53  ? 88  LYS C CB  1 
ATOM   2964  C CG  . LYS C 1 92  ? 16.179  -0.496  60.408  1.00 57.97  ? 88  LYS C CG  1 
ATOM   2965  C CD  . LYS C 1 92  ? 16.747  0.876   60.730  1.00 67.96  ? 88  LYS C CD  1 
ATOM   2966  C CE  . LYS C 1 92  ? 15.729  1.968   60.463  1.00 71.72  ? 88  LYS C CE  1 
ATOM   2967  N NZ  . LYS C 1 92  ? 15.961  3.166   61.311  1.00 81.89  ? 88  LYS C NZ  1 
ATOM   2968  N N   . SER C 1 93  ? 12.890  -2.825  62.883  1.00 68.30  ? 89  SER C N   1 
ATOM   2969  C CA  . SER C 1 93  ? 12.403  -3.462  64.102  1.00 71.83  ? 89  SER C CA  1 
ATOM   2970  C C   . SER C 1 93  ? 12.415  -4.984  63.961  1.00 57.58  ? 89  SER C C   1 
ATOM   2971  O O   . SER C 1 93  ? 12.372  -5.708  64.956  1.00 51.24  ? 89  SER C O   1 
ATOM   2972  C CB  . SER C 1 93  ? 10.997  -2.965  64.448  1.00 80.41  ? 89  SER C CB  1 
ATOM   2973  O OG  . SER C 1 93  ? 10.082  -3.220  63.396  1.00 93.93  ? 89  SER C OG  1 
ATOM   2974  N N   . CYS C 1 94  ? 12.477  -5.460  62.720  1.00 47.49  ? 90  CYS C N   1 
ATOM   2975  C CA  . CYS C 1 94  ? 12.572  -6.889  62.441  1.00 51.30  ? 90  CYS C CA  1 
ATOM   2976  C C   . CYS C 1 94  ? 14.029  -7.351  62.426  1.00 61.38  ? 90  CYS C C   1 
ATOM   2977  O O   . CYS C 1 94  ? 14.311  -8.537  62.254  1.00 75.99  ? 90  CYS C O   1 
ATOM   2978  C CB  . CYS C 1 94  ? 11.914  -7.212  61.100  1.00 51.27  ? 90  CYS C CB  1 
ATOM   2979  S SG  . CYS C 1 94  ? 10.152  -6.846  61.039  1.00 61.89  ? 90  CYS C SG  1 
ATOM   2980  N N   . PHE C 1 95  ? 14.949  -6.405  62.593  1.00 47.18  ? 91  PHE C N   1 
ATOM   2981  C CA  . PHE C 1 95  ? 16.370  -6.714  62.706  1.00 46.00  ? 91  PHE C CA  1 
ATOM   2982  C C   . PHE C 1 95  ? 16.860  -6.422  64.122  1.00 65.16  ? 91  PHE C C   1 
ATOM   2983  O O   . PHE C 1 95  ? 16.877  -5.268  64.553  1.00 73.69  ? 91  PHE C O   1 
ATOM   2984  C CB  . PHE C 1 95  ? 17.183  -5.884  61.708  1.00 30.89  ? 91  PHE C CB  1 
ATOM   2985  C CG  . PHE C 1 95  ? 16.989  -6.287  60.270  1.00 36.32  ? 91  PHE C CG  1 
ATOM   2986  C CD1 . PHE C 1 95  ? 15.919  -5.805  59.537  1.00 49.56  ? 91  PHE C CD1 1 
ATOM   2987  C CD2 . PHE C 1 95  ? 17.889  -7.134  59.647  1.00 41.51  ? 91  PHE C CD2 1 
ATOM   2988  C CE1 . PHE C 1 95  ? 15.744  -6.171  58.213  1.00 49.01  ? 91  PHE C CE1 1 
ATOM   2989  C CE2 . PHE C 1 95  ? 17.720  -7.502  58.324  1.00 52.45  ? 91  PHE C CE2 1 
ATOM   2990  C CZ  . PHE C 1 95  ? 16.646  -7.019  57.607  1.00 50.65  ? 91  PHE C CZ  1 
ATOM   2991  N N   . THR C 1 96  ? 17.257  -7.463  64.847  1.00 59.81  ? 92  THR C N   1 
ATOM   2992  C CA  . THR C 1 96  ? 17.837  -7.276  66.172  1.00 59.75  ? 92  THR C CA  1 
ATOM   2993  C C   . THR C 1 96  ? 19.251  -6.716  66.026  1.00 68.71  ? 92  THR C C   1 
ATOM   2994  O O   . THR C 1 96  ? 19.990  -7.096  65.116  1.00 65.20  ? 92  THR C O   1 
ATOM   2995  C CB  . THR C 1 96  ? 17.861  -8.590  66.989  1.00 43.34  ? 92  THR C CB  1 
ATOM   2996  O OG1 . THR C 1 96  ? 18.645  -9.579  66.309  1.00 35.46  ? 92  THR C OG1 1 
ATOM   2997  C CG2 . THR C 1 96  ? 16.446  -9.116  67.193  1.00 44.37  ? 92  THR C CG2 1 
ATOM   2998  N N   . LYS C 1 97  ? 19.616  -5.799  66.916  1.00 66.29  ? 93  LYS C N   1 
ATOM   2999  C CA  . LYS C 1 97  ? 20.908  -5.128  66.835  1.00 58.25  ? 93  LYS C CA  1 
ATOM   3000  C C   . LYS C 1 97  ? 22.069  -6.097  67.041  1.00 58.59  ? 93  LYS C C   1 
ATOM   3001  O O   . LYS C 1 97  ? 21.951  -7.084  67.768  1.00 61.35  ? 93  LYS C O   1 
ATOM   3002  C CB  . LYS C 1 97  ? 20.987  -4.001  67.869  1.00 58.12  ? 93  LYS C CB  1 
ATOM   3003  C CG  . LYS C 1 97  ? 22.353  -3.335  67.943  1.00 57.84  ? 93  LYS C CG  1 
ATOM   3004  C CD  . LYS C 1 97  ? 22.397  -2.264  69.018  1.00 49.01  ? 93  LYS C CD  1 
ATOM   3005  C CE  . LYS C 1 97  ? 23.735  -1.536  69.032  1.00 35.93  ? 93  LYS C CE  1 
ATOM   3006  N NZ  . LYS C 1 97  ? 24.889  -2.441  69.296  1.00 22.72  ? 93  LYS C NZ  1 
ATOM   3007  N N   . ASP C 1 98  ? 23.189  -5.798  66.388  1.00 43.44  ? 94  ASP C N   1 
ATOM   3008  C CA  . ASP C 1 98  ? 24.424  -6.554  66.553  1.00 54.44  ? 94  ASP C CA  1 
ATOM   3009  C C   . ASP C 1 98  ? 25.498  -5.643  67.137  1.00 66.56  ? 94  ASP C C   1 
ATOM   3010  O O   . ASP C 1 98  ? 25.338  -4.423  67.168  1.00 58.67  ? 94  ASP C O   1 
ATOM   3011  C CB  . ASP C 1 98  ? 24.897  -7.111  65.210  1.00 64.76  ? 94  ASP C CB  1 
ATOM   3012  C CG  . ASP C 1 98  ? 23.979  -8.189  64.666  1.00 64.46  ? 94  ASP C CG  1 
ATOM   3013  O OD1 . ASP C 1 98  ? 23.512  -9.036  65.456  1.00 58.88  ? 94  ASP C OD1 1 
ATOM   3014  O OD2 . ASP C 1 98  ? 23.724  -8.190  63.442  1.00 71.69  ? 94  ASP C OD2 1 
ATOM   3015  N N   . TYR C 1 99  ? 26.594  -6.238  67.593  1.00 79.84  ? 95  TYR C N   1 
ATOM   3016  C CA  . TYR C 1 99  ? 27.678  -5.474  68.197  1.00 81.35  ? 95  TYR C CA  1 
ATOM   3017  C C   . TYR C 1 99  ? 28.458  -4.720  67.129  1.00 70.04  ? 95  TYR C C   1 
ATOM   3018  O O   . TYR C 1 99  ? 28.912  -5.308  66.148  1.00 71.02  ? 95  TYR C O   1 
ATOM   3019  C CB  . TYR C 1 99  ? 28.618  -6.394  68.979  1.00 95.97  ? 95  TYR C CB  1 
ATOM   3020  C CG  . TYR C 1 99  ? 29.774  -5.668  69.630  1.00 103.08 ? 95  TYR C CG  1 
ATOM   3021  C CD1 . TYR C 1 99  ? 29.555  -4.742  70.640  1.00 104.61 ? 95  TYR C CD1 1 
ATOM   3022  C CD2 . TYR C 1 99  ? 31.085  -5.913  69.238  1.00 104.71 ? 95  TYR C CD2 1 
ATOM   3023  C CE1 . TYR C 1 99  ? 30.606  -4.075  71.239  1.00 109.22 ? 95  TYR C CE1 1 
ATOM   3024  C CE2 . TYR C 1 99  ? 32.144  -5.251  69.833  1.00 105.99 ? 95  TYR C CE2 1 
ATOM   3025  C CZ  . TYR C 1 99  ? 31.899  -4.334  70.833  1.00 109.21 ? 95  TYR C CZ  1 
ATOM   3026  O OH  . TYR C 1 99  ? 32.948  -3.672  71.429  1.00 111.44 ? 95  TYR C OH  1 
ATOM   3027  N N   . GLU C 1 100 ? 28.603  -3.413  67.324  1.00 68.75  ? 96  GLU C N   1 
ATOM   3028  C CA  . GLU C 1 100 ? 29.367  -2.572  66.409  1.00 66.82  ? 96  GLU C CA  1 
ATOM   3029  C C   . GLU C 1 100 ? 28.827  -2.627  64.981  1.00 54.49  ? 96  GLU C C   1 
ATOM   3030  O O   . GLU C 1 100 ? 29.591  -2.813  64.035  1.00 45.40  ? 96  GLU C O   1 
ATOM   3031  C CB  . GLU C 1 100 ? 30.845  -2.978  66.416  1.00 79.84  ? 96  GLU C CB  1 
ATOM   3032  C CG  . GLU C 1 100 ? 31.567  -2.720  67.733  1.00 83.45  ? 96  GLU C CG  1 
ATOM   3033  C CD  . GLU C 1 100 ? 31.895  -1.255  67.951  1.00 89.72  ? 96  GLU C CD  1 
ATOM   3034  O OE1 . GLU C 1 100 ? 31.791  -0.470  66.985  1.00 94.88  ? 96  GLU C OE1 1 
ATOM   3035  O OE2 . GLU C 1 100 ? 32.259  -0.888  69.089  1.00 81.22  ? 96  GLU C OE2 1 
ATOM   3036  N N   . GLU C 1 101 ? 27.518  -2.465  64.816  1.00 49.62  ? 97  GLU C N   1 
ATOM   3037  C CA  . GLU C 1 101 ? 26.966  -2.317  63.475  1.00 63.38  ? 97  GLU C CA  1 
ATOM   3038  C C   . GLU C 1 101 ? 27.523  -1.032  62.887  1.00 77.99  ? 97  GLU C C   1 
ATOM   3039  O O   . GLU C 1 101 ? 28.117  -0.219  63.599  1.00 70.13  ? 97  GLU C O   1 
ATOM   3040  C CB  . GLU C 1 101 ? 25.440  -2.250  63.482  1.00 66.04  ? 97  GLU C CB  1 
ATOM   3041  C CG  . GLU C 1 101 ? 24.747  -3.506  63.971  1.00 66.47  ? 97  GLU C CG  1 
ATOM   3042  C CD  . GLU C 1 101 ? 23.232  -3.395  63.909  1.00 59.74  ? 97  GLU C CD  1 
ATOM   3043  O OE1 . GLU C 1 101 ? 22.558  -4.447  63.872  1.00 62.89  ? 97  GLU C OE1 1 
ATOM   3044  O OE2 . GLU C 1 101 ? 22.717  -2.258  63.902  1.00 49.17  ? 97  GLU C OE2 1 
ATOM   3045  N N   . HIS C 1 102 ? 27.340  -0.855  61.585  1.00 83.02  ? 98  HIS C N   1 
ATOM   3046  C CA  . HIS C 1 102 ? 27.838  0.327   60.894  1.00 62.01  ? 98  HIS C CA  1 
ATOM   3047  C C   . HIS C 1 102 ? 29.343  0.487   61.086  1.00 50.83  ? 98  HIS C C   1 
ATOM   3048  O O   . HIS C 1 102 ? 29.906  1.552   60.831  1.00 50.65  ? 98  HIS C O   1 
ATOM   3049  C CB  . HIS C 1 102 ? 27.094  1.575   61.364  1.00 54.83  ? 98  HIS C CB  1 
ATOM   3050  C CG  . HIS C 1 102 ? 25.637  1.561   61.026  1.00 60.54  ? 98  HIS C CG  1 
ATOM   3051  N ND1 . HIS C 1 102 ? 25.165  1.826   59.758  1.00 42.60  ? 98  HIS C ND1 1 
ATOM   3052  C CD2 . HIS C 1 102 ? 24.546  1.299   61.785  1.00 65.67  ? 98  HIS C CD2 1 
ATOM   3053  C CE1 . HIS C 1 102 ? 23.847  1.737   59.753  1.00 45.75  ? 98  HIS C CE1 1 
ATOM   3054  N NE2 . HIS C 1 102 ? 23.447  1.418   60.971  1.00 53.39  ? 98  HIS C NE2 1 
ATOM   3055  N N   . ASP C 1 103 ? 29.989  -0.579  61.548  1.00 53.37  ? 99  ASP C N   1 
ATOM   3056  C CA  . ASP C 1 103 ? 31.433  -0.669  61.475  1.00 45.05  ? 99  ASP C CA  1 
ATOM   3057  C C   . ASP C 1 103 ? 31.752  -0.853  60.010  1.00 53.02  ? 99  ASP C C   1 
ATOM   3058  O O   . ASP C 1 103 ? 30.895  -1.277  59.234  1.00 49.11  ? 99  ASP C O   1 
ATOM   3059  C CB  . ASP C 1 103 ? 31.945  -1.877  62.255  1.00 42.88  ? 99  ASP C CB  1 
ATOM   3060  C CG  . ASP C 1 103 ? 32.531  -1.501  63.596  1.00 66.13  ? 99  ASP C CG  1 
ATOM   3061  O OD1 . ASP C 1 103 ? 32.296  -0.363  64.053  1.00 83.01  ? 99  ASP C OD1 1 
ATOM   3062  O OD2 . ASP C 1 103 ? 33.224  -2.349  64.198  1.00 69.48  ? 99  ASP C OD2 1 
ATOM   3063  N N   . LYS C 1 104 ? 32.980  -0.544  59.621  1.00 53.05  ? 100 LYS C N   1 
ATOM   3064  C CA  . LYS C 1 104 ? 33.411  -0.847  58.267  1.00 51.13  ? 100 LYS C CA  1 
ATOM   3065  C C   . LYS C 1 104 ? 33.951  -2.273  58.232  1.00 46.04  ? 100 LYS C C   1 
ATOM   3066  O O   . LYS C 1 104 ? 34.947  -2.559  57.571  1.00 57.48  ? 100 LYS C O   1 
ATOM   3067  C CB  . LYS C 1 104 ? 34.452  0.162   57.781  1.00 66.84  ? 100 LYS C CB  1 
ATOM   3068  C CG  . LYS C 1 104 ? 33.863  1.502   57.356  1.00 72.65  ? 100 LYS C CG  1 
ATOM   3069  C CD  . LYS C 1 104 ? 33.516  1.503   55.870  1.00 82.69  ? 100 LYS C CD  1 
ATOM   3070  C CE  . LYS C 1 104 ? 32.879  2.815   55.433  1.00 78.73  ? 100 LYS C CE  1 
ATOM   3071  N NZ  . LYS C 1 104 ? 31.391  2.781   55.517  1.00 74.13  ? 100 LYS C NZ  1 
ATOM   3072  N N   . ALA C 1 105 ? 33.274  -3.168  58.947  1.00 42.50  ? 101 ALA C N   1 
ATOM   3073  C CA  . ALA C 1 105 ? 33.640  -4.578  58.980  1.00 45.61  ? 101 ALA C CA  1 
ATOM   3074  C C   . ALA C 1 105 ? 32.836  -5.323  57.927  1.00 35.35  ? 101 ALA C C   1 
ATOM   3075  O O   . ALA C 1 105 ? 31.634  -5.106  57.792  1.00 45.72  ? 101 ALA C O   1 
ATOM   3076  C CB  . ALA C 1 105 ? 33.366  -5.156  60.353  1.00 47.68  ? 101 ALA C CB  1 
ATOM   3077  N N   . CYS C 1 106 ? 33.504  -6.200  57.185  1.00 35.71  ? 102 CYS C N   1 
ATOM   3078  C CA  . CYS C 1 106 ? 32.864  -6.928  56.094  1.00 28.78  ? 102 CYS C CA  1 
ATOM   3079  C C   . CYS C 1 106 ? 32.466  -5.977  54.972  1.00 31.60  ? 102 CYS C C   1 
ATOM   3080  O O   . CYS C 1 106 ? 31.731  -6.356  54.063  1.00 44.30  ? 102 CYS C O   1 
ATOM   3081  C CB  . CYS C 1 106 ? 31.633  -7.689  56.597  1.00 15.25  ? 102 CYS C CB  1 
ATOM   3082  S SG  . CYS C 1 106 ? 32.007  -9.066  57.708  1.00 65.36  ? 102 CYS C SG  1 
ATOM   3083  N N   . VAL C 1 107 ? 32.970  -4.747  55.030  1.00 36.58  ? 103 VAL C N   1 
ATOM   3084  C CA  . VAL C 1 107 ? 32.592  -3.715  54.071  1.00 37.73  ? 103 VAL C CA  1 
ATOM   3085  C C   . VAL C 1 107 ? 33.771  -3.307  53.201  1.00 43.94  ? 103 VAL C C   1 
ATOM   3086  O O   . VAL C 1 107 ? 34.903  -3.205  53.675  1.00 38.48  ? 103 VAL C O   1 
ATOM   3087  C CB  . VAL C 1 107 ? 32.052  -2.458  54.780  1.00 32.28  ? 103 VAL C CB  1 
ATOM   3088  C CG1 . VAL C 1 107 ? 31.970  -1.284  53.807  1.00 22.93  ? 103 VAL C CG1 1 
ATOM   3089  C CG2 . VAL C 1 107 ? 30.692  -2.743  55.405  1.00 20.71  ? 103 VAL C CG2 1 
ATOM   3090  N N   . ARG C 1 108 ? 33.488  -3.071  51.924  1.00 45.80  ? 104 ARG C N   1 
ATOM   3091  C CA  . ARG C 1 108 ? 34.490  -2.593  50.981  1.00 28.91  ? 104 ARG C CA  1 
ATOM   3092  C C   . ARG C 1 108 ? 33.900  -1.472  50.138  1.00 38.06  ? 104 ARG C C   1 
ATOM   3093  O O   . ARG C 1 108 ? 32.686  -1.270  50.118  1.00 42.78  ? 104 ARG C O   1 
ATOM   3094  C CB  . ARG C 1 108 ? 34.963  -3.728  50.070  1.00 26.28  ? 104 ARG C CB  1 
ATOM   3095  C CG  . ARG C 1 108 ? 33.835  -4.429  49.329  1.00 37.83  ? 104 ARG C CG  1 
ATOM   3096  C CD  . ARG C 1 108 ? 34.337  -5.241  48.143  1.00 27.47  ? 104 ARG C CD  1 
ATOM   3097  N NE  . ARG C 1 108 ? 34.714  -4.384  47.019  1.00 32.28  ? 104 ARG C NE  1 
ATOM   3098  C CZ  . ARG C 1 108 ? 34.719  -4.767  45.744  1.00 42.42  ? 104 ARG C CZ  1 
ATOM   3099  N NH1 . ARG C 1 108 ? 34.363  -5.999  45.405  1.00 48.02  ? 104 ARG C NH1 1 
ATOM   3100  N NH2 . ARG C 1 108 ? 35.074  -3.909  44.797  1.00 45.48  ? 104 ARG C NH2 1 
ATOM   3101  N N   . THR C 1 109 ? 34.766  -0.745  49.440  1.00 46.43  ? 105 THR C N   1 
ATOM   3102  C CA  . THR C 1 109 ? 34.325  0.305   48.535  1.00 50.48  ? 105 THR C CA  1 
ATOM   3103  C C   . THR C 1 109 ? 34.248  -0.232  47.110  1.00 50.74  ? 105 THR C C   1 
ATOM   3104  O O   . THR C 1 109 ? 35.215  -0.794  46.597  1.00 56.42  ? 105 THR C O   1 
ATOM   3105  C CB  . THR C 1 109 ? 35.277  1.512   48.567  1.00 52.82  ? 105 THR C CB  1 
ATOM   3106  O OG1 . THR C 1 109 ? 35.252  2.107   49.870  1.00 49.60  ? 105 THR C OG1 1 
ATOM   3107  C CG2 . THR C 1 109 ? 34.863  2.551   47.535  1.00 46.98  ? 105 THR C CG2 1 
ATOM   3108  N N   . PHE C 1 110 ? 33.091  -0.061  46.480  1.00 52.83  ? 106 PHE C N   1 
ATOM   3109  C CA  . PHE C 1 110 ? 32.891  -0.500  45.104  1.00 43.14  ? 106 PHE C CA  1 
ATOM   3110  C C   . PHE C 1 110 ? 32.997  0.668   44.133  1.00 37.44  ? 106 PHE C C   1 
ATOM   3111  O O   . PHE C 1 110 ? 32.750  1.820   44.495  1.00 38.95  ? 106 PHE C O   1 
ATOM   3112  C CB  . PHE C 1 110 ? 31.520  -1.160  44.950  1.00 35.90  ? 106 PHE C CB  1 
ATOM   3113  C CG  . PHE C 1 110 ? 31.423  -2.511  45.591  1.00 37.48  ? 106 PHE C CG  1 
ATOM   3114  C CD1 . PHE C 1 110 ? 31.167  -2.633  46.947  1.00 43.19  ? 106 PHE C CD1 1 
ATOM   3115  C CD2 . PHE C 1 110 ? 31.582  -3.661  44.837  1.00 36.28  ? 106 PHE C CD2 1 
ATOM   3116  C CE1 . PHE C 1 110 ? 31.075  -3.877  47.538  1.00 47.49  ? 106 PHE C CE1 1 
ATOM   3117  C CE2 . PHE C 1 110 ? 31.490  -4.908  45.423  1.00 45.03  ? 106 PHE C CE2 1 
ATOM   3118  C CZ  . PHE C 1 110 ? 31.236  -5.016  46.776  1.00 52.77  ? 106 PHE C CZ  1 
ATOM   3119  N N   . TYR C 1 111 ? 33.367  0.358   42.896  1.00 30.79  ? 107 TYR C N   1 
ATOM   3120  C CA  . TYR C 1 111 ? 33.392  1.347   41.829  1.00 39.99  ? 107 TYR C CA  1 
ATOM   3121  C C   . TYR C 1 111 ? 32.698  0.764   40.604  1.00 48.84  ? 107 TYR C C   1 
ATOM   3122  O O   . TYR C 1 111 ? 33.346  0.240   39.698  1.00 62.94  ? 107 TYR C O   1 
ATOM   3123  C CB  . TYR C 1 111 ? 34.830  1.746   41.500  1.00 47.94  ? 107 TYR C CB  1 
ATOM   3124  C CG  . TYR C 1 111 ? 34.936  2.910   40.543  1.00 48.17  ? 107 TYR C CG  1 
ATOM   3125  C CD1 . TYR C 1 111 ? 34.319  4.122   40.824  1.00 34.10  ? 107 TYR C CD1 1 
ATOM   3126  C CD2 . TYR C 1 111 ? 35.649  2.797   39.356  1.00 40.41  ? 107 TYR C CD2 1 
ATOM   3127  C CE1 . TYR C 1 111 ? 34.411  5.190   39.952  1.00 36.18  ? 107 TYR C CE1 1 
ATOM   3128  C CE2 . TYR C 1 111 ? 35.748  3.859   38.479  1.00 37.05  ? 107 TYR C CE2 1 
ATOM   3129  C CZ  . TYR C 1 111 ? 35.127  5.054   38.781  1.00 40.22  ? 107 TYR C CZ  1 
ATOM   3130  O OH  . TYR C 1 111 ? 35.220  6.114   37.908  1.00 50.45  ? 107 TYR C OH  1 
ATOM   3131  N N   . GLU C 1 112 ? 31.371  0.852   40.594  1.00 34.44  ? 108 GLU C N   1 
ATOM   3132  C CA  . GLU C 1 112 ? 30.559  0.216   39.562  1.00 34.13  ? 108 GLU C CA  1 
ATOM   3133  C C   . GLU C 1 112 ? 29.510  1.179   39.011  1.00 37.81  ? 108 GLU C C   1 
ATOM   3134  O O   . GLU C 1 112 ? 29.334  2.279   39.534  1.00 43.83  ? 108 GLU C O   1 
ATOM   3135  C CB  . GLU C 1 112 ? 29.876  -1.027  40.136  1.00 47.80  ? 108 GLU C CB  1 
ATOM   3136  C CG  . GLU C 1 112 ? 30.845  -2.099  40.621  1.00 58.30  ? 108 GLU C CG  1 
ATOM   3137  C CD  . GLU C 1 112 ? 30.147  -3.231  41.349  1.00 52.26  ? 108 GLU C CD  1 
ATOM   3138  O OE1 . GLU C 1 112 ? 30.775  -4.295  41.545  1.00 40.28  ? 108 GLU C OE1 1 
ATOM   3139  O OE2 . GLU C 1 112 ? 28.970  -3.055  41.728  1.00 51.32  ? 108 GLU C OE2 1 
ATOM   3140  N N   . THR C 1 113 ? 28.814  0.759   37.959  1.00 47.17  ? 109 THR C N   1 
ATOM   3141  C CA  . THR C 1 113 ? 27.808  1.604   37.320  1.00 49.78  ? 109 THR C CA  1 
ATOM   3142  C C   . THR C 1 113 ? 26.541  1.678   38.173  1.00 46.29  ? 109 THR C C   1 
ATOM   3143  O O   . THR C 1 113 ? 26.239  0.749   38.925  1.00 26.10  ? 109 THR C O   1 
ATOM   3144  C CB  . THR C 1 113 ? 27.437  1.086   35.907  1.00 33.14  ? 109 THR C CB  1 
ATOM   3145  O OG1 . THR C 1 113 ? 26.776  -0.181  36.010  1.00 34.56  ? 109 THR C OG1 1 
ATOM   3146  C CG2 . THR C 1 113 ? 28.681  0.938   35.039  1.00 19.55  ? 109 THR C CG2 1 
ATOM   3147  N N   . PRO C 1 114 ? 25.799  2.792   38.065  1.00 45.68  ? 110 PRO C N   1 
ATOM   3148  C CA  . PRO C 1 114 ? 24.539  2.974   38.796  1.00 39.82  ? 110 PRO C CA  1 
ATOM   3149  C C   . PRO C 1 114 ? 23.568  1.811   38.607  1.00 32.93  ? 110 PRO C C   1 
ATOM   3150  O O   . PRO C 1 114 ? 22.805  1.495   39.520  1.00 25.77  ? 110 PRO C O   1 
ATOM   3151  C CB  . PRO C 1 114 ? 23.967  4.255   38.184  1.00 29.38  ? 110 PRO C CB  1 
ATOM   3152  C CG  . PRO C 1 114 ? 25.164  5.024   37.766  1.00 32.47  ? 110 PRO C CG  1 
ATOM   3153  C CD  . PRO C 1 114 ? 26.167  4.000   37.304  1.00 48.57  ? 110 PRO C CD  1 
ATOM   3154  N N   . LEU C 1 115 ? 23.595  1.184   37.436  1.00 38.48  ? 111 LEU C N   1 
ATOM   3155  C CA  . LEU C 1 115 ? 22.738  0.036   37.172  1.00 47.39  ? 111 LEU C CA  1 
ATOM   3156  C C   . LEU C 1 115 ? 23.093  -1.113  38.108  1.00 46.70  ? 111 LEU C C   1 
ATOM   3157  O O   . LEU C 1 115 ? 22.214  -1.744  38.693  1.00 53.27  ? 111 LEU C O   1 
ATOM   3158  C CB  . LEU C 1 115 ? 22.872  -0.415  35.715  1.00 59.73  ? 111 LEU C CB  1 
ATOM   3159  C CG  . LEU C 1 115 ? 22.398  0.583   34.654  1.00 74.16  ? 111 LEU C CG  1 
ATOM   3160  C CD1 . LEU C 1 115 ? 22.634  0.031   33.255  1.00 80.91  ? 111 LEU C CD1 1 
ATOM   3161  C CD2 . LEU C 1 115 ? 20.929  0.930   34.851  1.00 76.31  ? 111 LEU C CD2 1 
ATOM   3162  N N   . GLN C 1 116 ? 24.389  -1.371  38.251  1.00 50.07  ? 112 GLN C N   1 
ATOM   3163  C CA  . GLN C 1 116 ? 24.867  -2.443  39.116  1.00 33.37  ? 112 GLN C CA  1 
ATOM   3164  C C   . GLN C 1 116 ? 24.565  -2.152  40.583  1.00 36.31  ? 112 GLN C C   1 
ATOM   3165  O O   . GLN C 1 116 ? 24.348  -3.072  41.373  1.00 41.80  ? 112 GLN C O   1 
ATOM   3166  C CB  . GLN C 1 116 ? 26.369  -2.648  38.922  1.00 36.99  ? 112 GLN C CB  1 
ATOM   3167  C CG  . GLN C 1 116 ? 26.748  -3.140  37.533  1.00 45.95  ? 112 GLN C CG  1 
ATOM   3168  C CD  . GLN C 1 116 ? 28.249  -3.235  37.337  1.00 52.51  ? 112 GLN C CD  1 
ATOM   3169  O OE1 . GLN C 1 116 ? 28.936  -2.220  37.215  1.00 49.48  ? 112 GLN C OE1 1 
ATOM   3170  N NE2 . GLN C 1 116 ? 28.767  -4.458  37.312  1.00 65.20  ? 112 GLN C NE2 1 
ATOM   3171  N N   . LEU C 1 117 ? 24.550  -0.874  40.949  1.00 39.67  ? 113 LEU C N   1 
ATOM   3172  C CA  . LEU C 1 117 ? 24.225  -0.487  42.318  1.00 48.28  ? 113 LEU C CA  1 
ATOM   3173  C C   . LEU C 1 117 ? 22.748  -0.731  42.613  1.00 52.41  ? 113 LEU C C   1 
ATOM   3174  O O   . LEU C 1 117 ? 22.398  -1.308  43.642  1.00 44.80  ? 113 LEU C O   1 
ATOM   3175  C CB  . LEU C 1 117 ? 24.569  0.981   42.566  1.00 46.06  ? 113 LEU C CB  1 
ATOM   3176  C CG  . LEU C 1 117 ? 24.106  1.521   43.921  1.00 38.86  ? 113 LEU C CG  1 
ATOM   3177  C CD1 . LEU C 1 117 ? 24.598  0.627   45.045  1.00 45.39  ? 113 LEU C CD1 1 
ATOM   3178  C CD2 . LEU C 1 117 ? 24.585  2.948   44.132  1.00 33.80  ? 113 LEU C CD2 1 
ATOM   3179  N N   . LEU C 1 118 ? 21.885  -0.285  41.706  1.00 52.46  ? 114 LEU C N   1 
ATOM   3180  C CA  . LEU C 1 118 ? 20.450  -0.495  41.848  1.00 50.09  ? 114 LEU C CA  1 
ATOM   3181  C C   . LEU C 1 118 ? 20.133  -1.985  41.841  1.00 49.21  ? 114 LEU C C   1 
ATOM   3182  O O   . LEU C 1 118 ? 19.318  -2.462  42.631  1.00 44.19  ? 114 LEU C O   1 
ATOM   3183  C CB  . LEU C 1 118 ? 19.690  0.201   40.718  1.00 45.65  ? 114 LEU C CB  1 
ATOM   3184  C CG  . LEU C 1 118 ? 19.823  1.725   40.662  1.00 30.08  ? 114 LEU C CG  1 
ATOM   3185  C CD1 . LEU C 1 118 ? 19.075  2.287   39.461  1.00 22.16  ? 114 LEU C CD1 1 
ATOM   3186  C CD2 . LEU C 1 118 ? 19.327  2.347   41.952  1.00 28.98  ? 114 LEU C CD2 1 
ATOM   3187  N N   . GLU C 1 119 ? 20.783  -2.718  40.943  1.00 39.41  ? 115 GLU C N   1 
ATOM   3188  C CA  . GLU C 1 119 ? 20.586  -4.156  40.852  1.00 39.47  ? 115 GLU C CA  1 
ATOM   3189  C C   . GLU C 1 119 ? 20.870  -4.802  42.207  1.00 38.08  ? 115 GLU C C   1 
ATOM   3190  O O   . GLU C 1 119 ? 20.156  -5.708  42.637  1.00 40.94  ? 115 GLU C O   1 
ATOM   3191  C CB  . GLU C 1 119 ? 21.494  -4.754  39.776  1.00 30.29  ? 115 GLU C CB  1 
ATOM   3192  C CG  . GLU C 1 119 ? 21.038  -6.117  39.279  1.00 53.45  ? 115 GLU C CG  1 
ATOM   3193  C CD  . GLU C 1 119 ? 19.699  -6.058  38.565  1.00 50.99  ? 115 GLU C CD  1 
ATOM   3194  O OE1 . GLU C 1 119 ? 19.632  -5.456  37.471  1.00 49.38  ? 115 GLU C OE1 1 
ATOM   3195  O OE2 . GLU C 1 119 ? 18.712  -6.607  39.100  1.00 43.69  ? 115 GLU C OE2 1 
ATOM   3196  N N   . LYS C 1 120 ? 21.915  -4.327  42.877  1.00 44.67  ? 116 LYS C N   1 
ATOM   3197  C CA  . LYS C 1 120 ? 22.246  -4.808  44.213  1.00 41.01  ? 116 LYS C CA  1 
ATOM   3198  C C   . LYS C 1 120 ? 21.116  -4.496  45.188  1.00 40.28  ? 116 LYS C C   1 
ATOM   3199  O O   . LYS C 1 120 ? 20.618  -5.386  45.879  1.00 45.95  ? 116 LYS C O   1 
ATOM   3200  C CB  . LYS C 1 120 ? 23.551  -4.175  44.705  1.00 40.86  ? 116 LYS C CB  1 
ATOM   3201  C CG  . LYS C 1 120 ? 24.813  -4.833  44.170  1.00 36.50  ? 116 LYS C CG  1 
ATOM   3202  C CD  . LYS C 1 120 ? 26.058  -4.092  44.642  1.00 37.87  ? 116 LYS C CD  1 
ATOM   3203  C CE  . LYS C 1 120 ? 27.308  -4.953  44.527  1.00 43.91  ? 116 LYS C CE  1 
ATOM   3204  N NZ  . LYS C 1 120 ? 27.614  -5.346  43.123  1.00 50.86  ? 116 LYS C NZ  1 
ATOM   3205  N N   . VAL C 1 121 ? 20.711  -3.230  45.236  1.00 40.04  ? 117 VAL C N   1 
ATOM   3206  C CA  . VAL C 1 121 ? 19.666  -2.791  46.156  1.00 38.22  ? 117 VAL C CA  1 
ATOM   3207  C C   . VAL C 1 121 ? 18.392  -3.610  45.967  1.00 33.57  ? 117 VAL C C   1 
ATOM   3208  O O   . VAL C 1 121 ? 17.840  -4.140  46.930  1.00 28.15  ? 117 VAL C O   1 
ATOM   3209  C CB  . VAL C 1 121 ? 19.343  -1.297  45.972  1.00 41.79  ? 117 VAL C CB  1 
ATOM   3210  C CG1 . VAL C 1 121 ? 18.098  -0.917  46.761  1.00 54.21  ? 117 VAL C CG1 1 
ATOM   3211  C CG2 . VAL C 1 121 ? 20.526  -0.444  46.404  1.00 33.92  ? 117 VAL C CG2 1 
ATOM   3212  N N   . LYS C 1 122 ? 17.927  -3.706  44.727  1.00 29.83  ? 118 LYS C N   1 
ATOM   3213  C CA  . LYS C 1 122 ? 16.767  -4.532  44.418  1.00 32.39  ? 118 LYS C CA  1 
ATOM   3214  C C   . LYS C 1 122 ? 16.945  -5.921  45.007  1.00 43.62  ? 118 LYS C C   1 
ATOM   3215  O O   . LYS C 1 122 ? 16.097  -6.400  45.757  1.00 58.32  ? 118 LYS C O   1 
ATOM   3216  C CB  . LYS C 1 122 ? 16.560  -4.641  42.905  1.00 46.92  ? 118 LYS C CB  1 
ATOM   3217  C CG  . LYS C 1 122 ? 16.130  -6.029  42.444  1.00 53.61  ? 118 LYS C CG  1 
ATOM   3218  C CD  . LYS C 1 122 ? 15.860  -6.076  40.952  1.00 57.46  ? 118 LYS C CD  1 
ATOM   3219  C CE  . LYS C 1 122 ? 15.703  -7.513  40.475  1.00 48.13  ? 118 LYS C CE  1 
ATOM   3220  N NZ  . LYS C 1 122 ? 15.373  -7.591  39.029  1.00 47.33  ? 118 LYS C NZ  1 
ATOM   3221  N N   . ASN C 1 123 ? 18.058  -6.561  44.667  1.00 53.47  ? 119 ASN C N   1 
ATOM   3222  C CA  . ASN C 1 123 ? 18.307  -7.929  45.093  1.00 60.02  ? 119 ASN C CA  1 
ATOM   3223  C C   . ASN C 1 123 ? 18.206  -8.080  46.606  1.00 56.64  ? 119 ASN C C   1 
ATOM   3224  O O   . ASN C 1 123 ? 17.750  -9.108  47.104  1.00 58.23  ? 119 ASN C O   1 
ATOM   3225  C CB  . ASN C 1 123 ? 19.678  -8.397  44.611  1.00 58.92  ? 119 ASN C CB  1 
ATOM   3226  C CG  . ASN C 1 123 ? 19.928  -9.860  44.910  1.00 77.10  ? 119 ASN C CG  1 
ATOM   3227  O OD1 . ASN C 1 123 ? 20.693  -10.200 45.813  1.00 83.72  ? 119 ASN C OD1 1 
ATOM   3228  N ND2 . ASN C 1 123 ? 19.271  -10.737 44.160  1.00 79.70  ? 119 ASN C ND2 1 
ATOM   3229  N N   . VAL C 1 124 ? 18.629  -7.051  47.333  1.00 45.06  ? 120 VAL C N   1 
ATOM   3230  C CA  . VAL C 1 124 ? 18.550  -7.065  48.789  1.00 41.05  ? 120 VAL C CA  1 
ATOM   3231  C C   . VAL C 1 124 ? 17.096  -7.011  49.244  1.00 43.27  ? 120 VAL C C   1 
ATOM   3232  O O   . VAL C 1 124 ? 16.653  -7.846  50.031  1.00 51.60  ? 120 VAL C O   1 
ATOM   3233  C CB  . VAL C 1 124 ? 19.325  -5.884  49.411  1.00 55.49  ? 120 VAL C CB  1 
ATOM   3234  C CG1 . VAL C 1 124 ? 19.011  -5.756  50.899  1.00 49.46  ? 120 VAL C CG1 1 
ATOM   3235  C CG2 . VAL C 1 124 ? 20.822  -6.056  49.187  1.00 61.75  ? 120 VAL C CG2 1 
ATOM   3236  N N   . PHE C 1 125 ? 16.356  -6.026  48.744  1.00 34.87  ? 121 PHE C N   1 
ATOM   3237  C CA  . PHE C 1 125 ? 14.945  -5.883  49.084  1.00 35.98  ? 121 PHE C CA  1 
ATOM   3238  C C   . PHE C 1 125 ? 14.153  -7.106  48.637  1.00 44.72  ? 121 PHE C C   1 
ATOM   3239  O O   . PHE C 1 125 ? 13.205  -7.525  49.304  1.00 48.38  ? 121 PHE C O   1 
ATOM   3240  C CB  . PHE C 1 125 ? 14.362  -4.624  48.438  1.00 38.08  ? 121 PHE C CB  1 
ATOM   3241  C CG  . PHE C 1 125 ? 14.652  -3.361  49.199  1.00 35.79  ? 121 PHE C CG  1 
ATOM   3242  C CD1 . PHE C 1 125 ? 13.925  -3.042  50.333  1.00 23.97  ? 121 PHE C CD1 1 
ATOM   3243  C CD2 . PHE C 1 125 ? 15.643  -2.489  48.777  1.00 35.71  ? 121 PHE C CD2 1 
ATOM   3244  C CE1 . PHE C 1 125 ? 14.184  -1.881  51.036  1.00 42.34  ? 121 PHE C CE1 1 
ATOM   3245  C CE2 . PHE C 1 125 ? 15.905  -1.325  49.477  1.00 37.24  ? 121 PHE C CE2 1 
ATOM   3246  C CZ  . PHE C 1 125 ? 15.174  -1.022  50.607  1.00 46.49  ? 121 PHE C CZ  1 
ATOM   3247  N N   . ASN C 1 126 ? 14.553  -7.679  47.507  1.00 39.52  ? 122 ASN C N   1 
ATOM   3248  C CA  . ASN C 1 126 ? 13.849  -8.819  46.937  1.00 39.88  ? 122 ASN C CA  1 
ATOM   3249  C C   . ASN C 1 126 ? 14.054  -10.067 47.788  1.00 40.22  ? 122 ASN C C   1 
ATOM   3250  O O   . ASN C 1 126 ? 13.090  -10.683 48.245  1.00 46.54  ? 122 ASN C O   1 
ATOM   3251  C CB  . ASN C 1 126 ? 14.323  -9.069  45.505  1.00 23.07  ? 122 ASN C CB  1 
ATOM   3252  C CG  . ASN C 1 126 ? 13.399  -9.990  44.740  1.00 44.87  ? 122 ASN C CG  1 
ATOM   3253  O OD1 . ASN C 1 126 ? 13.476  -11.211 44.867  1.00 75.43  ? 122 ASN C OD1 1 
ATOM   3254  N ND2 . ASN C 1 126 ? 12.521  -9.407  43.932  1.00 50.94  ? 122 ASN C ND2 1 
ATOM   3255  N N   . GLU C 1 127 ? 15.314  -10.435 47.999  1.00 43.05  ? 123 GLU C N   1 
ATOM   3256  C CA  . GLU C 1 127 ? 15.646  -11.581 48.837  1.00 49.34  ? 123 GLU C CA  1 
ATOM   3257  C C   . GLU C 1 127 ? 15.065  -11.395 50.232  1.00 45.28  ? 123 GLU C C   1 
ATOM   3258  O O   . GLU C 1 127 ? 14.500  -12.323 50.808  1.00 41.60  ? 123 GLU C O   1 
ATOM   3259  C CB  . GLU C 1 127 ? 17.164  -11.769 48.917  1.00 57.60  ? 123 GLU C CB  1 
ATOM   3260  C CG  . GLU C 1 127 ? 17.754  -12.546 47.748  1.00 73.17  ? 123 GLU C CG  1 
ATOM   3261  C CD  . GLU C 1 127 ? 17.324  -14.003 47.738  1.00 91.81  ? 123 GLU C CD  1 
ATOM   3262  O OE1 . GLU C 1 127 ? 17.470  -14.675 48.781  1.00 104.68 ? 123 GLU C OE1 1 
ATOM   3263  O OE2 . GLU C 1 127 ? 16.834  -14.475 46.690  1.00 84.63  ? 123 GLU C OE2 1 
ATOM   3264  N N   . THR C 1 128 ? 15.202  -10.186 50.765  1.00 46.51  ? 124 THR C N   1 
ATOM   3265  C CA  . THR C 1 128 ? 14.692  -9.874  52.092  1.00 43.82  ? 124 THR C CA  1 
ATOM   3266  C C   . THR C 1 128 ? 13.198  -10.161 52.179  1.00 30.75  ? 124 THR C C   1 
ATOM   3267  O O   . THR C 1 128 ? 12.719  -10.686 53.184  1.00 40.38  ? 124 THR C O   1 
ATOM   3268  C CB  . THR C 1 128 ? 14.939  -8.397  52.459  1.00 50.90  ? 124 THR C CB  1 
ATOM   3269  O OG1 . THR C 1 128 ? 16.347  -8.154  52.580  1.00 55.68  ? 124 THR C OG1 1 
ATOM   3270  C CG2 . THR C 1 128 ? 14.262  -8.050  53.779  1.00 39.00  ? 124 THR C CG2 1 
ATOM   3271  N N   . LYS C 1 129 ? 12.462  -9.816  51.125  1.00 30.78  ? 125 LYS C N   1 
ATOM   3272  C CA  . LYS C 1 129 ? 11.015  -10.009 51.121  1.00 30.16  ? 125 LYS C CA  1 
ATOM   3273  C C   . LYS C 1 129 ? 10.642  -11.478 51.006  1.00 36.68  ? 125 LYS C C   1 
ATOM   3274  O O   . LYS C 1 129 ? 9.753   -11.953 51.711  1.00 41.25  ? 125 LYS C O   1 
ATOM   3275  C CB  . LYS C 1 129 ? 10.352  -9.237  49.980  1.00 24.41  ? 125 LYS C CB  1 
ATOM   3276  C CG  . LYS C 1 129 ? 8.884   -9.609  49.804  1.00 15.89  ? 125 LYS C CG  1 
ATOM   3277  C CD  . LYS C 1 129 ? 8.220   -8.848  48.673  1.00 30.40  ? 125 LYS C CD  1 
ATOM   3278  C CE  . LYS C 1 129 ? 6.778   -9.303  48.487  1.00 38.97  ? 125 LYS C CE  1 
ATOM   3279  N NZ  . LYS C 1 129 ? 6.680   -10.732 48.065  1.00 27.77  ? 125 LYS C NZ  1 
ATOM   3280  N N   . ASN C 1 130 ? 11.307  -12.191 50.104  1.00 48.95  ? 126 ASN C N   1 
ATOM   3281  C CA  . ASN C 1 130 ? 11.016  -13.602 49.895  1.00 50.06  ? 126 ASN C CA  1 
ATOM   3282  C C   . ASN C 1 130 ? 11.164  -14.386 51.192  1.00 48.64  ? 126 ASN C C   1 
ATOM   3283  O O   . ASN C 1 130 ? 10.300  -15.186 51.545  1.00 49.18  ? 126 ASN C O   1 
ATOM   3284  C CB  . ASN C 1 130 ? 11.927  -14.186 48.815  1.00 48.80  ? 126 ASN C CB  1 
ATOM   3285  C CG  . ASN C 1 130 ? 11.687  -13.563 47.453  1.00 63.73  ? 126 ASN C CG  1 
ATOM   3286  O OD1 . ASN C 1 130 ? 10.686  -12.878 47.240  1.00 60.75  ? 126 ASN C OD1 1 
ATOM   3287  N ND2 . ASN C 1 130 ? 12.602  -13.805 46.520  1.00 73.49  ? 126 ASN C ND2 1 
ATOM   3288  N N   . LEU C 1 131 ? 12.258  -14.141 51.905  1.00 46.43  ? 127 LEU C N   1 
ATOM   3289  C CA  . LEU C 1 131 ? 12.530  -14.837 53.156  1.00 41.36  ? 127 LEU C CA  1 
ATOM   3290  C C   . LEU C 1 131 ? 11.530  -14.453 54.245  1.00 47.84  ? 127 LEU C C   1 
ATOM   3291  O O   . LEU C 1 131 ? 10.956  -15.323 54.898  1.00 62.73  ? 127 LEU C O   1 
ATOM   3292  C CB  . LEU C 1 131 ? 13.958  -14.544 53.621  1.00 48.23  ? 127 LEU C CB  1 
ATOM   3293  C CG  . LEU C 1 131 ? 15.064  -15.048 52.690  1.00 72.82  ? 127 LEU C CG  1 
ATOM   3294  C CD1 . LEU C 1 131 ? 16.427  -14.557 53.154  1.00 89.95  ? 127 LEU C CD1 1 
ATOM   3295  C CD2 . LEU C 1 131 ? 15.044  -16.567 52.607  1.00 71.81  ? 127 LEU C CD2 1 
ATOM   3296  N N   . LEU C 1 132 ? 11.314  -13.153 54.433  1.00 38.11  ? 128 LEU C N   1 
ATOM   3297  C CA  . LEU C 1 132 ? 10.419  -12.672 55.486  1.00 22.87  ? 128 LEU C CA  1 
ATOM   3298  C C   . LEU C 1 132 ? 9.008   -13.246 55.357  1.00 30.45  ? 128 LEU C C   1 
ATOM   3299  O O   . LEU C 1 132 ? 8.245   -13.247 56.322  1.00 57.35  ? 128 LEU C O   1 
ATOM   3300  C CB  . LEU C 1 132 ? 10.365  -11.142 55.494  1.00 35.96  ? 128 LEU C CB  1 
ATOM   3301  C CG  . LEU C 1 132 ? 11.558  -10.428 56.139  1.00 35.40  ? 128 LEU C CG  1 
ATOM   3302  C CD1 . LEU C 1 132 ? 11.412  -8.923  56.002  1.00 15.16  ? 128 LEU C CD1 1 
ATOM   3303  C CD2 . LEU C 1 132 ? 11.702  -10.811 57.607  1.00 35.13  ? 128 LEU C CD2 1 
ATOM   3304  N N   . ASP C 1 133 ? 8.662   -13.731 54.169  1.00 38.67  ? 129 ASP C N   1 
ATOM   3305  C CA  . ASP C 1 133 ? 7.390   -14.418 53.976  1.00 50.84  ? 129 ASP C CA  1 
ATOM   3306  C C   . ASP C 1 133 ? 7.424   -15.765 54.693  1.00 58.68  ? 129 ASP C C   1 
ATOM   3307  O O   . ASP C 1 133 ? 6.455   -16.157 55.344  1.00 65.22  ? 129 ASP C O   1 
ATOM   3308  C CB  . ASP C 1 133 ? 7.097   -14.629 52.486  1.00 52.08  ? 129 ASP C CB  1 
ATOM   3309  C CG  . ASP C 1 133 ? 6.806   -13.331 51.750  1.00 54.16  ? 129 ASP C CG  1 
ATOM   3310  O OD1 . ASP C 1 133 ? 6.397   -12.345 52.400  1.00 44.77  ? 129 ASP C OD1 1 
ATOM   3311  O OD2 . ASP C 1 133 ? 6.977   -13.302 50.512  1.00 56.19  ? 129 ASP C OD2 1 
ATOM   3312  N N   . LYS C 1 134 ? 8.550   -16.465 54.572  1.00 54.15  ? 130 LYS C N   1 
ATOM   3313  C CA  . LYS C 1 134 ? 8.718   -17.772 55.199  1.00 53.22  ? 130 LYS C CA  1 
ATOM   3314  C C   . LYS C 1 134 ? 9.128   -17.651 56.667  1.00 70.03  ? 130 LYS C C   1 
ATOM   3315  O O   . LYS C 1 134 ? 8.387   -18.058 57.561  1.00 84.96  ? 130 LYS C O   1 
ATOM   3316  C CB  . LYS C 1 134 ? 9.756   -18.604 54.439  1.00 59.07  ? 130 LYS C CB  1 
ATOM   3317  C CG  . LYS C 1 134 ? 9.305   -19.061 53.056  1.00 72.71  ? 130 LYS C CG  1 
ATOM   3318  C CD  . LYS C 1 134 ? 9.762   -18.105 51.966  1.00 80.76  ? 130 LYS C CD  1 
ATOM   3319  C CE  . LYS C 1 134 ? 9.378   -18.613 50.580  1.00 74.74  ? 130 LYS C CE  1 
ATOM   3320  N NZ  . LYS C 1 134 ? 9.923   -17.759 49.483  1.00 52.65  ? 130 LYS C NZ  1 
ATOM   3321  N N   . ASP C 1 135 ? 10.312  -17.092 56.910  1.00 69.99  ? 131 ASP C N   1 
ATOM   3322  C CA  . ASP C 1 135 ? 10.845  -16.967 58.266  1.00 63.27  ? 131 ASP C CA  1 
ATOM   3323  C C   . ASP C 1 135 ? 10.941  -15.502 58.686  1.00 53.63  ? 131 ASP C C   1 
ATOM   3324  O O   . ASP C 1 135 ? 12.002  -14.890 58.617  1.00 60.28  ? 131 ASP C O   1 
ATOM   3325  C CB  . ASP C 1 135 ? 12.221  -17.627 58.359  1.00 60.15  ? 131 ASP C CB  1 
ATOM   3326  C CG  . ASP C 1 135 ? 12.672  -17.840 59.793  1.00 66.91  ? 131 ASP C CG  1 
ATOM   3327  O OD1 . ASP C 1 135 ? 11.917  -17.475 60.720  1.00 74.98  ? 131 ASP C OD1 1 
ATOM   3328  O OD2 . ASP C 1 135 ? 13.786  -18.368 59.996  1.00 54.34  ? 131 ASP C OD2 1 
ATOM   3329  N N   . TRP C 1 136 ? 9.810   -14.950 59.110  1.00 47.70  ? 132 TRP C N   1 
ATOM   3330  C CA  A TRP C 1 136 ? 9.736   -13.565 59.581  0.63 56.32  ? 132 TRP C CA  1 
ATOM   3331  C CA  B TRP C 1 136 ? 9.761   -13.557 59.553  0.37 55.57  ? 132 TRP C CA  1 
ATOM   3332  C C   . TRP C 1 136 ? 10.755  -13.261 60.678  1.00 58.34  ? 132 TRP C C   1 
ATOM   3333  O O   . TRP C 1 136 ? 11.174  -12.115 60.850  1.00 45.06  ? 132 TRP C O   1 
ATOM   3334  C CB  A TRP C 1 136 ? 8.323   -13.244 60.089  0.63 59.26  ? 132 TRP C CB  1 
ATOM   3335  C CB  B TRP C 1 136 ? 8.341   -13.160 59.982  0.37 58.44  ? 132 TRP C CB  1 
ATOM   3336  C CG  A TRP C 1 136 ? 7.601   -14.426 60.671  0.63 57.22  ? 132 TRP C CG  1 
ATOM   3337  C CG  B TRP C 1 136 ? 7.560   -14.252 60.645  0.37 57.76  ? 132 TRP C CG  1 
ATOM   3338  C CD1 A TRP C 1 136 ? 6.701   -15.228 60.032  0.63 57.66  ? 132 TRP C CD1 1 
ATOM   3339  C CD1 B TRP C 1 136 ? 7.541   -14.560 61.974  0.37 57.55  ? 132 TRP C CD1 1 
ATOM   3340  C CD2 A TRP C 1 136 ? 7.725   -14.944 62.002  0.63 58.41  ? 132 TRP C CD2 1 
ATOM   3341  C CD2 B TRP C 1 136 ? 6.674   -15.178 60.006  0.37 57.69  ? 132 TRP C CD2 1 
ATOM   3342  N NE1 A TRP C 1 136 ? 6.256   -16.212 60.881  0.63 61.66  ? 132 TRP C NE1 1 
ATOM   3343  N NE1 B TRP C 1 136 ? 6.702   -15.624 62.201  0.37 61.60  ? 132 TRP C NE1 1 
ATOM   3344  C CE2 A TRP C 1 136 ? 6.869   -16.060 62.096  0.63 62.45  ? 132 TRP C CE2 1 
ATOM   3345  C CE2 B TRP C 1 136 ? 6.158   -16.023 61.008  0.37 60.72  ? 132 TRP C CE2 1 
ATOM   3346  C CE3 A TRP C 1 136 ? 8.474   -14.572 63.122  0.63 53.35  ? 132 TRP C CE3 1 
ATOM   3347  C CE3 B TRP C 1 136 ? 6.271   -15.378 58.682  0.37 51.85  ? 132 TRP C CE3 1 
ATOM   3348  C CZ2 A TRP C 1 136 ? 6.743   -16.807 63.266  0.63 59.31  ? 132 TRP C CZ2 1 
ATOM   3349  C CZ2 B TRP C 1 136 ? 5.258   -17.049 60.728  0.37 57.46  ? 132 TRP C CZ2 1 
ATOM   3350  C CZ3 A TRP C 1 136 ? 8.345   -15.317 64.285  0.63 42.88  ? 132 TRP C CZ3 1 
ATOM   3351  C CZ3 B TRP C 1 136 ? 5.380   -16.397 58.406  0.37 48.03  ? 132 TRP C CZ3 1 
ATOM   3352  C CH2 A TRP C 1 136 ? 7.489   -16.421 64.345  0.63 47.16  ? 132 TRP C CH2 1 
ATOM   3353  C CH2 B TRP C 1 136 ? 4.883   -17.220 59.424  0.37 52.95  ? 132 TRP C CH2 1 
ATOM   3354  N N   . ASN C 1 137 ? 11.144  -14.289 61.428  1.00 62.59  ? 133 ASN C N   1 
ATOM   3355  C CA  . ASN C 1 137 ? 12.089  -14.119 62.533  1.00 57.91  ? 133 ASN C CA  1 
ATOM   3356  C C   . ASN C 1 137 ? 13.533  -14.396 62.120  1.00 61.14  ? 133 ASN C C   1 
ATOM   3357  O O   . ASN C 1 137 ? 14.380  -14.692 62.963  1.00 65.51  ? 133 ASN C O   1 
ATOM   3358  C CB  . ASN C 1 137 ? 11.711  -15.046 63.690  1.00 68.94  ? 133 ASN C CB  1 
ATOM   3359  C CG  . ASN C 1 137 ? 12.456  -14.718 64.969  1.00 90.43  ? 133 ASN C CG  1 
ATOM   3360  O OD1 . ASN C 1 137 ? 12.921  -13.593 65.162  1.00 104.25 ? 133 ASN C OD1 1 
ATOM   3361  N ND2 . ASN C 1 137 ? 12.572  -15.702 65.854  1.00 87.23  ? 133 ASN C ND2 1 
ATOM   3362  N N   . ILE C 1 138 ? 13.815  -14.292 60.825  1.00 55.81  ? 134 ILE C N   1 
ATOM   3363  C CA  . ILE C 1 138 ? 15.125  -14.665 60.291  1.00 30.92  ? 134 ILE C CA  1 
ATOM   3364  C C   . ILE C 1 138 ? 16.230  -13.676 60.650  1.00 31.43  ? 134 ILE C C   1 
ATOM   3365  O O   . ILE C 1 138 ? 17.393  -14.057 60.766  1.00 31.10  ? 134 ILE C O   1 
ATOM   3366  C CB  . ILE C 1 138 ? 15.083  -14.806 58.759  1.00 43.63  ? 134 ILE C CB  1 
ATOM   3367  C CG1 . ILE C 1 138 ? 16.405  -15.372 58.240  1.00 56.66  ? 134 ILE C CG1 1 
ATOM   3368  C CG2 . ILE C 1 138 ? 14.787  -13.459 58.104  1.00 37.26  ? 134 ILE C CG2 1 
ATOM   3369  C CD1 . ILE C 1 138 ? 16.322  -15.882 56.815  1.00 66.63  ? 134 ILE C CD1 1 
ATOM   3370  N N   . PHE C 1 139 ? 15.872  -12.410 60.826  1.00 51.92  ? 135 PHE C N   1 
ATOM   3371  C CA  . PHE C 1 139 ? 16.871  -11.381 61.092  1.00 58.59  ? 135 PHE C CA  1 
ATOM   3372  C C   . PHE C 1 139 ? 17.012  -11.072 62.580  1.00 62.22  ? 135 PHE C C   1 
ATOM   3373  O O   . PHE C 1 139 ? 17.478  -9.998  62.958  1.00 64.37  ? 135 PHE C O   1 
ATOM   3374  C CB  . PHE C 1 139 ? 16.547  -10.109 60.309  1.00 56.91  ? 135 PHE C CB  1 
ATOM   3375  C CG  . PHE C 1 139 ? 16.541  -10.308 58.822  1.00 57.97  ? 135 PHE C CG  1 
ATOM   3376  C CD1 . PHE C 1 139 ? 17.686  -10.723 58.162  1.00 57.25  ? 135 PHE C CD1 1 
ATOM   3377  C CD2 . PHE C 1 139 ? 15.393  -10.082 58.082  1.00 66.31  ? 135 PHE C CD2 1 
ATOM   3378  C CE1 . PHE C 1 139 ? 17.685  -10.911 56.793  1.00 69.99  ? 135 PHE C CE1 1 
ATOM   3379  C CE2 . PHE C 1 139 ? 15.387  -10.266 56.712  1.00 72.12  ? 135 PHE C CE2 1 
ATOM   3380  C CZ  . PHE C 1 139 ? 16.535  -10.681 56.067  1.00 72.03  ? 135 PHE C CZ  1 
ATOM   3381  N N   . SER C 1 140 ? 16.609  -12.022 63.418  1.00 57.87  ? 136 SER C N   1 
ATOM   3382  C CA  . SER C 1 140 ? 16.879  -11.942 64.846  1.00 63.57  ? 136 SER C CA  1 
ATOM   3383  C C   . SER C 1 140 ? 18.180  -12.678 65.144  1.00 58.30  ? 136 SER C C   1 
ATOM   3384  O O   . SER C 1 140 ? 18.574  -12.828 66.302  1.00 63.65  ? 136 SER C O   1 
ATOM   3385  C CB  . SER C 1 140 ? 15.730  -12.555 65.649  1.00 69.47  ? 136 SER C CB  1 
ATOM   3386  O OG  . SER C 1 140 ? 15.586  -13.939 65.374  1.00 65.38  ? 136 SER C OG  1 
ATOM   3387  N N   . LYS C 1 141 ? 18.841  -13.138 64.085  1.00 36.26  ? 137 LYS C N   1 
ATOM   3388  C CA  . LYS C 1 141 ? 20.088  -13.881 64.206  1.00 36.54  ? 137 LYS C CA  1 
ATOM   3389  C C   . LYS C 1 141 ? 21.198  -13.009 64.776  1.00 46.06  ? 137 LYS C C   1 
ATOM   3390  O O   . LYS C 1 141 ? 21.287  -11.818 64.472  1.00 43.48  ? 137 LYS C O   1 
ATOM   3391  C CB  . LYS C 1 141 ? 20.506  -14.411 62.834  1.00 48.47  ? 137 LYS C CB  1 
ATOM   3392  C CG  . LYS C 1 141 ? 21.733  -15.304 62.847  1.00 51.08  ? 137 LYS C CG  1 
ATOM   3393  C CD  . LYS C 1 141 ? 21.966  -15.910 61.473  1.00 60.62  ? 137 LYS C CD  1 
ATOM   3394  C CE  . LYS C 1 141 ? 22.900  -17.106 61.530  1.00 64.21  ? 137 LYS C CE  1 
ATOM   3395  N NZ  . LYS C 1 141 ? 22.615  -18.072 60.432  1.00 64.52  ? 137 LYS C NZ  1 
ATOM   3396  N N   . ASN C 1 142 ? 22.041  -13.611 65.609  1.00 50.76  ? 138 ASN C N   1 
ATOM   3397  C CA  . ASN C 1 142 ? 23.194  -12.919 66.164  1.00 52.17  ? 138 ASN C CA  1 
ATOM   3398  C C   . ASN C 1 142 ? 24.385  -13.091 65.234  1.00 56.52  ? 138 ASN C C   1 
ATOM   3399  O O   . ASN C 1 142 ? 24.960  -14.174 65.145  1.00 79.83  ? 138 ASN C O   1 
ATOM   3400  C CB  . ASN C 1 142 ? 23.525  -13.465 67.554  1.00 59.55  ? 138 ASN C CB  1 
ATOM   3401  C CG  . ASN C 1 142 ? 24.543  -12.614 68.288  1.00 60.71  ? 138 ASN C CG  1 
ATOM   3402  O OD1 . ASN C 1 142 ? 25.746  -12.729 68.058  1.00 61.47  ? 138 ASN C OD1 1 
ATOM   3403  N ND2 . ASN C 1 142 ? 24.064  -11.758 69.184  1.00 69.84  ? 138 ASN C ND2 1 
ATOM   3404  N N   . CYS C 1 143 ? 24.748  -12.021 64.535  1.00 55.88  ? 139 CYS C N   1 
ATOM   3405  C CA  . CYS C 1 143 ? 25.807  -12.086 63.536  1.00 50.13  ? 139 CYS C CA  1 
ATOM   3406  C C   . CYS C 1 143 ? 27.126  -11.515 64.047  1.00 55.27  ? 139 CYS C C   1 
ATOM   3407  O O   . CYS C 1 143 ? 28.009  -11.180 63.258  1.00 63.51  ? 139 CYS C O   1 
ATOM   3408  C CB  . CYS C 1 143 ? 25.378  -11.342 62.272  1.00 41.78  ? 139 CYS C CB  1 
ATOM   3409  S SG  . CYS C 1 143 ? 24.015  -12.130 61.388  1.00 37.76  ? 139 CYS C SG  1 
ATOM   3410  N N   . ASN C 1 144 ? 27.261  -11.409 65.365  1.00 51.42  ? 140 ASN C N   1 
ATOM   3411  C CA  . ASN C 1 144 ? 28.488  -10.897 65.959  1.00 42.46  ? 140 ASN C CA  1 
ATOM   3412  C C   . ASN C 1 144 ? 29.704  -11.681 65.481  1.00 44.17  ? 140 ASN C C   1 
ATOM   3413  O O   . ASN C 1 144 ? 30.702  -11.095 65.060  1.00 50.46  ? 140 ASN C O   1 
ATOM   3414  C CB  . ASN C 1 144 ? 28.406  -10.941 67.485  1.00 49.01  ? 140 ASN C CB  1 
ATOM   3415  C CG  . ASN C 1 144 ? 27.412  -9.945  68.043  1.00 61.49  ? 140 ASN C CG  1 
ATOM   3416  O OD1 . ASN C 1 144 ? 27.051  -8.975  67.378  1.00 74.05  ? 140 ASN C OD1 1 
ATOM   3417  N ND2 . ASN C 1 144 ? 26.967  -10.175 69.273  1.00 62.78  ? 140 ASN C ND2 1 
ATOM   3418  N N   . ASN C 1 145 ? 29.610  -13.006 65.538  1.00 43.52  ? 141 ASN C N   1 
ATOM   3419  C CA  . ASN C 1 145 ? 30.711  -13.874 65.132  1.00 58.15  ? 141 ASN C CA  1 
ATOM   3420  C C   . ASN C 1 145 ? 30.982  -13.796 63.632  1.00 51.30  ? 141 ASN C C   1 
ATOM   3421  O O   . ASN C 1 145 ? 32.126  -13.645 63.204  1.00 43.38  ? 141 ASN C O   1 
ATOM   3422  C CB  . ASN C 1 145 ? 30.423  -15.323 65.534  1.00 72.97  ? 141 ASN C CB  1 
ATOM   3423  C CG  . ASN C 1 145 ? 30.434  -15.527 67.040  1.00 80.92  ? 141 ASN C CG  1 
ATOM   3424  O OD1 . ASN C 1 145 ? 30.474  -14.566 67.810  1.00 75.43  ? 141 ASN C OD1 1 
ATOM   3425  N ND2 . ASN C 1 145 ? 30.393  -16.786 67.467  1.00 77.36  ? 141 ASN C ND2 1 
ATOM   3426  N N   . SER C 1 146 ? 29.925  -13.900 62.834  1.00 47.07  ? 142 SER C N   1 
ATOM   3427  C CA  . SER C 1 146 ? 30.059  -13.834 61.384  1.00 51.69  ? 142 SER C CA  1 
ATOM   3428  C C   . SER C 1 146 ? 30.821  -12.574 60.971  1.00 44.47  ? 142 SER C C   1 
ATOM   3429  O O   . SER C 1 146 ? 31.735  -12.633 60.149  1.00 38.60  ? 142 SER C O   1 
ATOM   3430  C CB  . SER C 1 146 ? 28.682  -13.869 60.716  1.00 63.67  ? 142 SER C CB  1 
ATOM   3431  O OG  . SER C 1 146 ? 27.995  -15.070 61.026  1.00 62.17  ? 142 SER C OG  1 
ATOM   3432  N N   . PHE C 1 147 ? 30.442  -11.437 61.549  1.00 45.92  ? 143 PHE C N   1 
ATOM   3433  C CA  . PHE C 1 147 ? 31.140  -10.180 61.301  1.00 42.71  ? 143 PHE C CA  1 
ATOM   3434  C C   . PHE C 1 147 ? 32.531  -10.234 61.921  1.00 45.39  ? 143 PHE C C   1 
ATOM   3435  O O   . PHE C 1 147 ? 33.491  -9.691  61.372  1.00 48.41  ? 143 PHE C O   1 
ATOM   3436  C CB  . PHE C 1 147 ? 30.363  -9.002  61.900  1.00 32.47  ? 143 PHE C CB  1 
ATOM   3437  C CG  . PHE C 1 147 ? 28.957  -8.862  61.376  1.00 48.59  ? 143 PHE C CG  1 
ATOM   3438  C CD1 . PHE C 1 147 ? 28.590  -9.417  60.160  1.00 40.60  ? 143 PHE C CD1 1 
ATOM   3439  C CD2 . PHE C 1 147 ? 27.999  -8.169  62.105  1.00 64.32  ? 143 PHE C CD2 1 
ATOM   3440  C CE1 . PHE C 1 147 ? 27.298  -9.286  59.683  1.00 40.69  ? 143 PHE C CE1 1 
ATOM   3441  C CE2 . PHE C 1 147 ? 26.705  -8.036  61.631  1.00 60.24  ? 143 PHE C CE2 1 
ATOM   3442  C CZ  . PHE C 1 147 ? 26.356  -8.595  60.418  1.00 47.17  ? 143 PHE C CZ  1 
ATOM   3443  N N   . ALA C 1 148 ? 32.627  -10.893 63.071  1.00 46.42  ? 144 ALA C N   1 
ATOM   3444  C CA  . ALA C 1 148 ? 33.878  -10.993 63.809  1.00 42.75  ? 144 ALA C CA  1 
ATOM   3445  C C   . ALA C 1 148 ? 34.991  -11.576 62.945  1.00 42.56  ? 144 ALA C C   1 
ATOM   3446  O O   . ALA C 1 148 ? 36.147  -11.166 63.047  1.00 44.46  ? 144 ALA C O   1 
ATOM   3447  C CB  . ALA C 1 148 ? 33.681  -11.846 65.069  1.00 43.50  ? 144 ALA C CB  1 
ATOM   3448  N N   . GLU C 1 149 ? 34.635  -12.525 62.086  1.00 52.34  ? 145 GLU C N   1 
ATOM   3449  C CA  . GLU C 1 149 ? 35.625  -13.235 61.281  1.00 59.78  ? 145 GLU C CA  1 
ATOM   3450  C C   . GLU C 1 149 ? 35.742  -12.643 59.877  1.00 52.38  ? 145 GLU C C   1 
ATOM   3451  O O   . GLU C 1 149 ? 35.586  -13.347 58.881  1.00 51.82  ? 145 GLU C O   1 
ATOM   3452  C CB  . GLU C 1 149 ? 35.300  -14.735 61.215  1.00 75.38  ? 145 GLU C CB  1 
ATOM   3453  C CG  . GLU C 1 149 ? 33.886  -15.076 60.753  1.00 87.27  ? 145 GLU C CG  1 
ATOM   3454  C CD  . GLU C 1 149 ? 33.558  -16.549 60.919  1.00 93.58  ? 145 GLU C CD  1 
ATOM   3455  O OE1 . GLU C 1 149 ? 34.499  -17.366 61.000  1.00 98.06  ? 145 GLU C OE1 1 
ATOM   3456  O OE2 . GLU C 1 149 ? 32.357  -16.889 60.980  1.00 88.13  ? 145 GLU C OE2 1 
ATOM   3457  N N   . CYS C 1 150 ? 36.024  -11.345 59.812  1.00 50.79  ? 146 CYS C N   1 
ATOM   3458  C CA  . CYS C 1 150 ? 36.263  -10.663 58.544  1.00 54.13  ? 146 CYS C CA  1 
ATOM   3459  C C   . CYS C 1 150 ? 37.598  -9.929  58.584  1.00 62.86  ? 146 CYS C C   1 
ATOM   3460  O O   . CYS C 1 150 ? 37.861  -9.152  59.504  1.00 65.81  ? 146 CYS C O   1 
ATOM   3461  C CB  . CYS C 1 150 ? 35.146  -9.661  58.242  1.00 50.49  ? 146 CYS C CB  1 
ATOM   3462  S SG  . CYS C 1 150 ? 33.523  -10.395 57.962  1.00 62.58  ? 146 CYS C SG  1 
ATOM   3463  N N   . SER C 1 151 ? 38.437  -10.174 57.582  1.00 71.37  ? 147 SER C N   1 
ATOM   3464  C CA  . SER C 1 151 ? 39.730  -9.505  57.485  1.00 78.43  ? 147 SER C CA  1 
ATOM   3465  C C   . SER C 1 151 ? 39.647  -8.313  56.536  1.00 94.55  ? 147 SER C C   1 
ATOM   3466  O O   . SER C 1 151 ? 40.322  -8.274  55.507  1.00 94.06  ? 147 SER C O   1 
ATOM   3467  C CB  . SER C 1 151 ? 40.809  -10.482 57.010  1.00 52.63  ? 147 SER C CB  1 
ATOM   3468  O OG  . SER C 1 151 ? 41.040  -11.496 57.972  1.00 43.69  ? 147 SER C OG  1 
ATOM   3469  N N   . TYR D 1 10  ? 5.934   23.534  6.990   1.00 65.29  ? 6   TYR D N   1 
ATOM   3470  C CA  . TYR D 1 10  ? 6.979   22.644  6.494   1.00 65.86  ? 6   TYR D CA  1 
ATOM   3471  C C   . TYR D 1 10  ? 7.899   22.205  7.631   1.00 59.94  ? 6   TYR D C   1 
ATOM   3472  O O   . TYR D 1 10  ? 7.740   21.112  8.174   1.00 61.39  ? 6   TYR D O   1 
ATOM   3473  C CB  . TYR D 1 10  ? 7.774   23.334  5.385   1.00 71.59  ? 6   TYR D CB  1 
ATOM   3474  C CG  . TYR D 1 10  ? 8.957   22.541  4.875   1.00 82.48  ? 6   TYR D CG  1 
ATOM   3475  C CD1 . TYR D 1 10  ? 8.792   21.263  4.361   1.00 83.46  ? 6   TYR D CD1 1 
ATOM   3476  C CD2 . TYR D 1 10  ? 10.237  23.081  4.889   1.00 86.31  ? 6   TYR D CD2 1 
ATOM   3477  C CE1 . TYR D 1 10  ? 9.872   20.538  3.888   1.00 82.34  ? 6   TYR D CE1 1 
ATOM   3478  C CE2 . TYR D 1 10  ? 11.321  22.364  4.416   1.00 78.57  ? 6   TYR D CE2 1 
ATOM   3479  C CZ  . TYR D 1 10  ? 11.132  21.093  3.917   1.00 73.36  ? 6   TYR D CZ  1 
ATOM   3480  O OH  . TYR D 1 10  ? 12.205  20.373  3.445   1.00 72.24  ? 6   TYR D OH  1 
ATOM   3481  N N   . CYS D 1 11  ? 8.854   23.058  7.993   1.00 52.75  ? 7   CYS D N   1 
ATOM   3482  C CA  . CYS D 1 11  ? 9.748   22.775  9.111   1.00 43.04  ? 7   CYS D CA  1 
ATOM   3483  C C   . CYS D 1 11  ? 9.238   23.421  10.392  1.00 48.24  ? 7   CYS D C   1 
ATOM   3484  O O   . CYS D 1 11  ? 9.752   23.156  11.478  1.00 64.62  ? 7   CYS D O   1 
ATOM   3485  C CB  . CYS D 1 11  ? 11.162  23.267  8.809   1.00 34.97  ? 7   CYS D CB  1 
ATOM   3486  S SG  . CYS D 1 11  ? 12.015  22.302  7.539   1.00 85.59  ? 7   CYS D SG  1 
ATOM   3487  N N   . SER D 1 12  ? 8.222   24.267  10.261  1.00 47.38  ? 8   SER D N   1 
ATOM   3488  C CA  . SER D 1 12  ? 7.618   24.907  11.419  1.00 40.25  ? 8   SER D CA  1 
ATOM   3489  C C   . SER D 1 12  ? 6.801   23.898  12.212  1.00 52.15  ? 8   SER D C   1 
ATOM   3490  O O   . SER D 1 12  ? 6.056   23.098  11.643  1.00 37.03  ? 8   SER D O   1 
ATOM   3491  C CB  . SER D 1 12  ? 6.734   26.077  10.989  1.00 45.98  ? 8   SER D CB  1 
ATOM   3492  O OG  . SER D 1 12  ? 7.515   27.130  10.454  1.00 60.57  ? 8   SER D OG  1 
ATOM   3493  N N   . HIS D 1 13  ? 6.965   23.929  13.529  1.00 63.80  ? 9   HIS D N   1 
ATOM   3494  C CA  . HIS D 1 13  ? 6.193   23.079  14.424  1.00 54.25  ? 9   HIS D CA  1 
ATOM   3495  C C   . HIS D 1 13  ? 6.388   21.600  14.112  1.00 64.33  ? 9   HIS D C   1 
ATOM   3496  O O   . HIS D 1 13  ? 5.523   20.776  14.412  1.00 73.47  ? 9   HIS D O   1 
ATOM   3497  C CB  . HIS D 1 13  ? 4.710   23.444  14.350  1.00 36.16  ? 9   HIS D CB  1 
ATOM   3498  C CG  . HIS D 1 13  ? 4.431   24.883  14.652  1.00 52.54  ? 9   HIS D CG  1 
ATOM   3499  N ND1 . HIS D 1 13  ? 4.279   25.359  15.937  1.00 51.37  ? 9   HIS D ND1 1 
ATOM   3500  C CD2 . HIS D 1 13  ? 4.282   25.953  13.835  1.00 52.70  ? 9   HIS D CD2 1 
ATOM   3501  C CE1 . HIS D 1 13  ? 4.047   26.659  15.898  1.00 61.88  ? 9   HIS D CE1 1 
ATOM   3502  N NE2 . HIS D 1 13  ? 4.043   27.044  14.635  1.00 65.06  ? 9   HIS D NE2 1 
ATOM   3503  N N   . MET D 1 14  ? 7.525   21.264  13.509  1.00 54.21  ? 10  MET D N   1 
ATOM   3504  C CA  . MET D 1 14  ? 7.891   19.868  13.332  1.00 45.06  ? 10  MET D CA  1 
ATOM   3505  C C   . MET D 1 14  ? 8.340   19.337  14.691  1.00 37.82  ? 10  MET D C   1 
ATOM   3506  O O   . MET D 1 14  ? 8.018   18.210  15.067  1.00 37.60  ? 10  MET D O   1 
ATOM   3507  C CB  . MET D 1 14  ? 9.004   19.717  12.293  1.00 46.14  ? 10  MET D CB  1 
ATOM   3508  C CG  . MET D 1 14  ? 9.289   18.269  11.910  1.00 54.01  ? 10  MET D CG  1 
ATOM   3509  S SD  . MET D 1 14  ? 10.411  18.082  10.508  1.00 47.82  ? 10  MET D SD  1 
ATOM   3510  C CE  . MET D 1 14  ? 9.428   18.769  9.181   1.00 105.41 ? 10  MET D CE  1 
ATOM   3511  N N   . ILE D 1 15  ? 9.077   20.167  15.425  1.00 38.29  ? 11  ILE D N   1 
ATOM   3512  C CA  . ILE D 1 15  ? 9.425   19.863  16.808  1.00 25.95  ? 11  ILE D CA  1 
ATOM   3513  C C   . ILE D 1 15  ? 8.305   20.357  17.710  1.00 37.32  ? 11  ILE D C   1 
ATOM   3514  O O   . ILE D 1 15  ? 8.097   21.561  17.852  1.00 56.45  ? 11  ILE D O   1 
ATOM   3515  C CB  . ILE D 1 15  ? 10.737  20.545  17.247  1.00 34.05  ? 11  ILE D CB  1 
ATOM   3516  C CG1 . ILE D 1 15  ? 11.874  20.211  16.280  1.00 42.95  ? 11  ILE D CG1 1 
ATOM   3517  C CG2 . ILE D 1 15  ? 11.103  20.118  18.666  1.00 39.73  ? 11  ILE D CG2 1 
ATOM   3518  C CD1 . ILE D 1 15  ? 13.194  20.865  16.644  1.00 44.99  ? 11  ILE D CD1 1 
ATOM   3519  N N   . GLY D 1 16  ? 7.578   19.421  18.308  1.00 41.60  ? 12  GLY D N   1 
ATOM   3520  C CA  . GLY D 1 16  ? 6.489   19.757  19.203  1.00 47.79  ? 12  GLY D CA  1 
ATOM   3521  C C   . GLY D 1 16  ? 6.919   19.719  20.655  1.00 51.58  ? 12  GLY D C   1 
ATOM   3522  O O   . GLY D 1 16  ? 8.036   19.309  20.969  1.00 49.91  ? 12  GLY D O   1 
ATOM   3523  N N   . SER D 1 17  ? 6.028   20.153  21.540  1.00 52.80  ? 13  SER D N   1 
ATOM   3524  C CA  . SER D 1 17  ? 6.301   20.140  22.969  1.00 48.35  ? 13  SER D CA  1 
ATOM   3525  C C   . SER D 1 17  ? 6.370   18.707  23.486  1.00 43.79  ? 13  SER D C   1 
ATOM   3526  O O   . SER D 1 17  ? 7.047   18.424  24.473  1.00 41.31  ? 13  SER D O   1 
ATOM   3527  C CB  . SER D 1 17  ? 5.216   20.914  23.719  1.00 64.15  ? 13  SER D CB  1 
ATOM   3528  O OG  . SER D 1 17  ? 3.937   20.344  23.494  1.00 66.33  ? 13  SER D OG  1 
ATOM   3529  N N   . GLY D 1 18  ? 5.660   17.806  22.815  1.00 43.64  ? 14  GLY D N   1 
ATOM   3530  C CA  . GLY D 1 18  ? 5.655   16.403  23.187  1.00 37.72  ? 14  GLY D CA  1 
ATOM   3531  C C   . GLY D 1 18  ? 7.043   15.792  23.140  1.00 36.84  ? 14  GLY D C   1 
ATOM   3532  O O   . GLY D 1 18  ? 7.397   14.971  23.985  1.00 40.02  ? 14  GLY D O   1 
ATOM   3533  N N   . HIS D 1 19  ? 7.830   16.188  22.145  1.00 44.18  ? 15  HIS D N   1 
ATOM   3534  C CA  . HIS D 1 19  ? 9.203   15.713  22.025  1.00 47.51  ? 15  HIS D CA  1 
ATOM   3535  C C   . HIS D 1 19  ? 10.038  16.257  23.176  1.00 54.73  ? 15  HIS D C   1 
ATOM   3536  O O   . HIS D 1 19  ? 10.865  15.547  23.749  1.00 70.40  ? 15  HIS D O   1 
ATOM   3537  C CB  . HIS D 1 19  ? 9.813   16.149  20.690  1.00 39.10  ? 15  HIS D CB  1 
ATOM   3538  C CG  . HIS D 1 19  ? 9.124   15.575  19.491  1.00 42.42  ? 15  HIS D CG  1 
ATOM   3539  N ND1 . HIS D 1 19  ? 8.161   16.263  18.785  1.00 40.49  ? 15  HIS D ND1 1 
ATOM   3540  C CD2 . HIS D 1 19  ? 9.259   14.378  18.872  1.00 38.60  ? 15  HIS D CD2 1 
ATOM   3541  C CE1 . HIS D 1 19  ? 7.734   15.517  17.782  1.00 44.89  ? 15  HIS D CE1 1 
ATOM   3542  N NE2 . HIS D 1 19  ? 8.384   14.367  17.813  1.00 37.70  ? 15  HIS D NE2 1 
ATOM   3543  N N   . LEU D 1 20  ? 9.812   17.523  23.512  1.00 43.60  ? 16  LEU D N   1 
ATOM   3544  C CA  . LEU D 1 20  ? 10.553  18.176  24.583  1.00 44.05  ? 16  LEU D CA  1 
ATOM   3545  C C   . LEU D 1 20  ? 10.150  17.622  25.946  1.00 54.56  ? 16  LEU D C   1 
ATOM   3546  O O   . LEU D 1 20  ? 10.989  17.464  26.833  1.00 68.26  ? 16  LEU D O   1 
ATOM   3547  C CB  . LEU D 1 20  ? 10.316  19.687  24.546  1.00 34.01  ? 16  LEU D CB  1 
ATOM   3548  C CG  . LEU D 1 20  ? 10.662  20.386  23.230  1.00 40.14  ? 16  LEU D CG  1 
ATOM   3549  C CD1 . LEU D 1 20  ? 10.499  21.893  23.363  1.00 41.49  ? 16  LEU D CD1 1 
ATOM   3550  C CD2 . LEU D 1 20  ? 12.071  20.033  22.783  1.00 34.38  ? 16  LEU D CD2 1 
ATOM   3551  N N   . GLN D 1 21  ? 8.864   17.327  26.108  1.00 43.13  ? 17  GLN D N   1 
ATOM   3552  C CA  . GLN D 1 21  ? 8.347   16.846  27.384  1.00 55.85  ? 17  GLN D CA  1 
ATOM   3553  C C   . GLN D 1 21  ? 8.871   15.452  27.717  1.00 60.89  ? 17  GLN D C   1 
ATOM   3554  O O   . GLN D 1 21  ? 9.214   15.173  28.865  1.00 72.40  ? 17  GLN D O   1 
ATOM   3555  C CB  . GLN D 1 21  ? 6.816   16.858  27.387  1.00 61.25  ? 17  GLN D CB  1 
ATOM   3556  C CG  . GLN D 1 21  ? 6.217   18.150  27.943  1.00 73.63  ? 17  GLN D CG  1 
ATOM   3557  C CD  . GLN D 1 21  ? 5.216   18.802  27.006  1.00 87.17  ? 17  GLN D CD  1 
ATOM   3558  O OE1 . GLN D 1 21  ? 4.662   18.155  26.118  1.00 95.01  ? 17  GLN D OE1 1 
ATOM   3559  N NE2 . GLN D 1 21  ? 4.979   20.097  27.203  1.00 86.47  ? 17  GLN D NE2 1 
ATOM   3560  N N   . SER D 1 22  ? 8.941   14.581  26.716  1.00 40.43  ? 18  SER D N   1 
ATOM   3561  C CA  . SER D 1 22  ? 9.480   13.243  26.925  1.00 36.49  ? 18  SER D CA  1 
ATOM   3562  C C   . SER D 1 22  ? 10.982  13.336  27.179  1.00 45.12  ? 18  SER D C   1 
ATOM   3563  O O   . SER D 1 22  ? 11.546  12.535  27.925  1.00 49.59  ? 18  SER D O   1 
ATOM   3564  C CB  . SER D 1 22  ? 9.194   12.348  25.717  1.00 32.96  ? 18  SER D CB  1 
ATOM   3565  O OG  . SER D 1 22  ? 9.859   12.825  24.560  1.00 52.02  ? 18  SER D OG  1 
ATOM   3566  N N   . LEU D 1 23  ? 11.621  14.325  26.562  1.00 51.43  ? 19  LEU D N   1 
ATOM   3567  C CA  . LEU D 1 23  ? 13.048  14.554  26.760  1.00 45.91  ? 19  LEU D CA  1 
ATOM   3568  C C   . LEU D 1 23  ? 13.291  15.028  28.189  1.00 44.85  ? 19  LEU D C   1 
ATOM   3569  O O   . LEU D 1 23  ? 14.251  14.615  28.839  1.00 43.93  ? 19  LEU D O   1 
ATOM   3570  C CB  . LEU D 1 23  ? 13.571  15.590  25.761  1.00 30.38  ? 19  LEU D CB  1 
ATOM   3571  C CG  . LEU D 1 23  ? 15.054  15.489  25.388  1.00 31.80  ? 19  LEU D CG  1 
ATOM   3572  C CD1 . LEU D 1 23  ? 15.356  16.388  24.201  1.00 27.20  ? 19  LEU D CD1 1 
ATOM   3573  C CD2 . LEU D 1 23  ? 15.954  15.843  26.562  1.00 49.22  ? 19  LEU D CD2 1 
ATOM   3574  N N   . GLN D 1 24  ? 12.407  15.892  28.678  1.00 44.60  ? 20  GLN D N   1 
ATOM   3575  C CA  . GLN D 1 24  ? 12.495  16.376  30.048  1.00 41.96  ? 20  GLN D CA  1 
ATOM   3576  C C   . GLN D 1 24  ? 12.254  15.233  31.032  1.00 45.30  ? 20  GLN D C   1 
ATOM   3577  O O   . GLN D 1 24  ? 12.953  15.114  32.038  1.00 48.50  ? 20  GLN D O   1 
ATOM   3578  C CB  . GLN D 1 24  ? 11.486  17.500  30.288  1.00 33.92  ? 20  GLN D CB  1 
ATOM   3579  C CG  . GLN D 1 24  ? 11.611  18.147  31.657  1.00 44.35  ? 20  GLN D CG  1 
ATOM   3580  C CD  . GLN D 1 24  ? 12.999  18.707  31.910  1.00 47.42  ? 20  GLN D CD  1 
ATOM   3581  O OE1 . GLN D 1 24  ? 13.489  19.546  31.154  1.00 65.75  ? 20  GLN D OE1 1 
ATOM   3582  N NE2 . GLN D 1 24  ? 13.643  18.237  32.972  1.00 31.83  ? 20  GLN D NE2 1 
ATOM   3583  N N   . ARG D 1 25  ? 11.261  14.397  30.741  1.00 41.09  ? 21  ARG D N   1 
ATOM   3584  C CA  A ARG D 1 25  ? 10.962  13.227  31.562  0.50 46.19  ? 21  ARG D CA  1 
ATOM   3585  C CA  B ARG D 1 25  ? 10.975  13.251  31.592  0.50 46.29  ? 21  ARG D CA  1 
ATOM   3586  C C   . ARG D 1 25  ? 12.167  12.299  31.605  1.00 50.61  ? 21  ARG D C   1 
ATOM   3587  O O   . ARG D 1 25  ? 12.471  11.689  32.634  1.00 44.22  ? 21  ARG D O   1 
ATOM   3588  C CB  A ARG D 1 25  ? 9.762   12.473  30.987  0.50 46.00  ? 21  ARG D CB  1 
ATOM   3589  C CB  B ARG D 1 25  ? 9.706   12.529  31.132  0.50 44.79  ? 21  ARG D CB  1 
ATOM   3590  C CG  A ARG D 1 25  ? 9.405   11.200  31.743  0.50 47.38  ? 21  ARG D CG  1 
ATOM   3591  C CG  B ARG D 1 25  ? 8.424   13.295  31.437  0.50 35.93  ? 21  ARG D CG  1 
ATOM   3592  C CD  A ARG D 1 25  ? 8.489   10.304  30.924  0.50 45.79  ? 21  ARG D CD  1 
ATOM   3593  C CD  B ARG D 1 25  ? 7.187   12.418  31.305  0.50 29.05  ? 21  ARG D CD  1 
ATOM   3594  N NE  A ARG D 1 25  ? 8.082   9.113   31.665  0.50 49.72  ? 21  ARG D NE  1 
ATOM   3595  N NE  B ARG D 1 25  ? 6.951   11.972  29.932  0.50 26.38  ? 21  ARG D NE  1 
ATOM   3596  C CZ  A ARG D 1 25  ? 7.298   8.156   31.177  0.50 55.31  ? 21  ARG D CZ  1 
ATOM   3597  C CZ  B ARG D 1 25  ? 6.307   12.679  29.005  0.50 26.48  ? 21  ARG D CZ  1 
ATOM   3598  N NH1 A ARG D 1 25  ? 6.828   8.241   29.940  0.50 64.88  ? 21  ARG D NH1 1 
ATOM   3599  N NH1 B ARG D 1 25  ? 5.831   13.887  29.279  0.50 25.35  ? 21  ARG D NH1 1 
ATOM   3600  N NH2 A ARG D 1 25  ? 6.981   7.111   31.928  0.50 50.58  ? 21  ARG D NH2 1 
ATOM   3601  N NH2 B ARG D 1 25  ? 6.143   12.177  27.789  0.50 29.96  ? 21  ARG D NH2 1 
ATOM   3602  N N   . LEU D 1 26  ? 12.844  12.187  30.468  1.00 46.54  ? 22  LEU D N   1 
ATOM   3603  C CA  . LEU D 1 26  ? 14.025  11.345  30.361  1.00 37.32  ? 22  LEU D CA  1 
ATOM   3604  C C   . LEU D 1 26  ? 15.094  11.834  31.335  1.00 32.45  ? 22  LEU D C   1 
ATOM   3605  O O   . LEU D 1 26  ? 15.759  11.038  31.995  1.00 35.35  ? 22  LEU D O   1 
ATOM   3606  C CB  . LEU D 1 26  ? 14.549  11.360  28.924  1.00 42.44  ? 22  LEU D CB  1 
ATOM   3607  C CG  . LEU D 1 26  ? 15.651  10.361  28.574  1.00 46.98  ? 22  LEU D CG  1 
ATOM   3608  C CD1 . LEU D 1 26  ? 15.582  10.008  27.101  1.00 33.54  ? 22  LEU D CD1 1 
ATOM   3609  C CD2 . LEU D 1 26  ? 17.017  10.930  28.914  1.00 65.25  ? 22  LEU D CD2 1 
ATOM   3610  N N   . ILE D 1 27  ? 15.241  13.150  31.433  1.00 37.45  ? 23  ILE D N   1 
ATOM   3611  C CA  . ILE D 1 27  ? 16.208  13.746  32.347  1.00 39.50  ? 23  ILE D CA  1 
ATOM   3612  C C   . ILE D 1 27  ? 15.791  13.556  33.804  1.00 41.67  ? 23  ILE D C   1 
ATOM   3613  O O   . ILE D 1 27  ? 16.616  13.227  34.657  1.00 39.98  ? 23  ILE D O   1 
ATOM   3614  C CB  . ILE D 1 27  ? 16.370  15.249  32.074  1.00 39.86  ? 23  ILE D CB  1 
ATOM   3615  C CG1 . ILE D 1 27  ? 16.934  15.470  30.669  1.00 37.84  ? 23  ILE D CG1 1 
ATOM   3616  C CG2 . ILE D 1 27  ? 17.283  15.886  33.114  1.00 28.71  ? 23  ILE D CG2 1 
ATOM   3617  C CD1 . ILE D 1 27  ? 16.856  16.904  30.193  1.00 51.93  ? 23  ILE D CD1 1 
ATOM   3618  N N   . ASP D 1 28  ? 14.506  13.765  34.080  1.00 45.87  ? 24  ASP D N   1 
ATOM   3619  C CA  . ASP D 1 28  ? 13.983  13.690  35.442  1.00 43.37  ? 24  ASP D CA  1 
ATOM   3620  C C   . ASP D 1 28  ? 14.288  12.358  36.129  1.00 44.90  ? 24  ASP D C   1 
ATOM   3621  O O   . ASP D 1 28  ? 14.670  12.332  37.300  1.00 65.96  ? 24  ASP D O   1 
ATOM   3622  C CB  . ASP D 1 28  ? 12.467  13.918  35.446  1.00 37.70  ? 24  ASP D CB  1 
ATOM   3623  C CG  . ASP D 1 28  ? 12.080  15.316  35.004  1.00 50.55  ? 24  ASP D CG  1 
ATOM   3624  O OD1 . ASP D 1 28  ? 12.935  16.225  35.076  1.00 62.33  ? 24  ASP D OD1 1 
ATOM   3625  O OD2 . ASP D 1 28  ? 10.917  15.506  34.586  1.00 45.49  ? 24  ASP D OD2 1 
ATOM   3626  N N   . SER D 1 29  ? 14.116  11.258  35.405  1.00 34.97  ? 25  SER D N   1 
ATOM   3627  C CA  . SER D 1 29  ? 14.238  9.930   35.996  1.00 44.20  ? 25  SER D CA  1 
ATOM   3628  C C   . SER D 1 29  ? 15.686  9.491   36.200  1.00 47.38  ? 25  SER D C   1 
ATOM   3629  O O   . SER D 1 29  ? 15.947  8.484   36.860  1.00 43.37  ? 25  SER D O   1 
ATOM   3630  C CB  . SER D 1 29  ? 13.500  8.898   35.140  1.00 54.47  ? 25  SER D CB  1 
ATOM   3631  O OG  . SER D 1 29  ? 13.923  8.933   33.790  1.00 44.64  ? 25  SER D OG  1 
ATOM   3632  N N   . GLN D 1 30  ? 16.628  10.243  35.642  1.00 57.39  ? 26  GLN D N   1 
ATOM   3633  C CA  . GLN D 1 30  ? 18.039  9.912   35.801  1.00 50.91  ? 26  GLN D CA  1 
ATOM   3634  C C   . GLN D 1 30  ? 18.498  10.149  37.232  1.00 46.02  ? 26  GLN D C   1 
ATOM   3635  O O   . GLN D 1 30  ? 18.139  11.147  37.856  1.00 51.63  ? 26  GLN D O   1 
ATOM   3636  C CB  . GLN D 1 30  ? 18.904  10.728  34.838  1.00 38.48  ? 26  GLN D CB  1 
ATOM   3637  C CG  . GLN D 1 30  ? 18.643  10.430  33.380  1.00 34.28  ? 26  GLN D CG  1 
ATOM   3638  C CD  . GLN D 1 30  ? 18.546  8.942   33.106  1.00 43.01  ? 26  GLN D CD  1 
ATOM   3639  O OE1 . GLN D 1 30  ? 19.549  8.229   33.120  1.00 57.90  ? 26  GLN D OE1 1 
ATOM   3640  N NE2 . GLN D 1 30  ? 17.330  8.463   32.869  1.00 33.30  ? 26  GLN D NE2 1 
ATOM   3641  N N   . MET D 1 31  ? 19.292  9.218   37.746  1.00 42.33  ? 27  MET D N   1 
ATOM   3642  C CA  . MET D 1 31  ? 19.881  9.358   39.067  1.00 42.46  ? 27  MET D CA  1 
ATOM   3643  C C   . MET D 1 31  ? 20.977  10.413  39.004  1.00 46.38  ? 27  MET D C   1 
ATOM   3644  O O   . MET D 1 31  ? 21.780  10.429  38.070  1.00 50.23  ? 27  MET D O   1 
ATOM   3645  C CB  . MET D 1 31  ? 20.457  8.018   39.528  1.00 38.25  ? 27  MET D CB  1 
ATOM   3646  C CG  . MET D 1 31  ? 20.921  7.992   40.973  1.00 32.11  ? 27  MET D CG  1 
ATOM   3647  S SD  . MET D 1 31  ? 21.253  6.311   41.542  1.00 42.76  ? 27  MET D SD  1 
ATOM   3648  C CE  . MET D 1 31  ? 23.002  6.414   41.913  1.00 90.88  ? 27  MET D CE  1 
ATOM   3649  N N   . GLU D 1 32  ? 21.003  11.299  39.994  1.00 43.55  ? 28  GLU D N   1 
ATOM   3650  C CA  . GLU D 1 32  ? 21.977  12.383  40.017  1.00 50.12  ? 28  GLU D CA  1 
ATOM   3651  C C   . GLU D 1 32  ? 23.328  11.873  40.499  1.00 56.24  ? 28  GLU D C   1 
ATOM   3652  O O   . GLU D 1 32  ? 23.545  11.678  41.696  1.00 55.19  ? 28  GLU D O   1 
ATOM   3653  C CB  . GLU D 1 32  ? 21.478  13.528  40.900  1.00 50.69  ? 28  GLU D CB  1 
ATOM   3654  C CG  . GLU D 1 32  ? 20.148  14.101  40.430  1.00 50.21  ? 28  GLU D CG  1 
ATOM   3655  C CD  . GLU D 1 32  ? 19.676  15.277  41.259  1.00 43.02  ? 28  GLU D CD  1 
ATOM   3656  O OE1 . GLU D 1 32  ? 18.970  16.142  40.701  1.00 27.61  ? 28  GLU D OE1 1 
ATOM   3657  O OE2 . GLU D 1 32  ? 20.001  15.335  42.465  1.00 56.65  ? 28  GLU D OE2 1 
ATOM   3658  N N   . THR D 1 33  ? 24.230  11.654  39.549  1.00 62.77  ? 29  THR D N   1 
ATOM   3659  C CA  . THR D 1 33  ? 25.545  11.100  39.837  1.00 56.51  ? 29  THR D CA  1 
ATOM   3660  C C   . THR D 1 33  ? 26.635  12.065  39.385  1.00 72.97  ? 29  THR D C   1 
ATOM   3661  O O   . THR D 1 33  ? 26.391  12.948  38.561  1.00 67.83  ? 29  THR D O   1 
ATOM   3662  C CB  . THR D 1 33  ? 25.735  9.753   39.124  1.00 47.49  ? 29  THR D CB  1 
ATOM   3663  O OG1 . THR D 1 33  ? 25.518  9.920   37.717  1.00 53.52  ? 29  THR D OG1 1 
ATOM   3664  C CG2 . THR D 1 33  ? 24.751  8.724   39.659  1.00 33.89  ? 29  THR D CG2 1 
ATOM   3665  N N   . SER D 1 34  ? 27.838  11.890  39.924  1.00 92.68  ? 30  SER D N   1 
ATOM   3666  C CA  . SER D 1 34  ? 28.954  12.781  39.617  1.00 97.69  ? 30  SER D CA  1 
ATOM   3667  C C   . SER D 1 34  ? 29.831  12.221  38.502  1.00 79.53  ? 30  SER D C   1 
ATOM   3668  O O   . SER D 1 34  ? 30.681  12.929  37.957  1.00 80.44  ? 30  SER D O   1 
ATOM   3669  C CB  . SER D 1 34  ? 29.805  13.011  40.865  1.00 107.67 ? 30  SER D CB  1 
ATOM   3670  O OG  . SER D 1 34  ? 30.695  14.099  40.678  1.00 110.55 ? 30  SER D OG  1 
ATOM   3671  N N   . CYS D 1 35  ? 29.628  10.949  38.177  1.00 57.13  ? 31  CYS D N   1 
ATOM   3672  C CA  . CYS D 1 35  ? 30.376  10.296  37.110  1.00 43.29  ? 31  CYS D CA  1 
ATOM   3673  C C   . CYS D 1 35  ? 30.451  11.180  35.874  1.00 45.35  ? 31  CYS D C   1 
ATOM   3674  O O   . CYS D 1 35  ? 29.529  11.942  35.587  1.00 38.56  ? 31  CYS D O   1 
ATOM   3675  C CB  . CYS D 1 35  ? 29.713  8.973   36.734  1.00 22.53  ? 31  CYS D CB  1 
ATOM   3676  S SG  . CYS D 1 35  ? 28.121  9.179   35.907  1.00 45.54  ? 31  CYS D SG  1 
ATOM   3677  N N   . GLN D 1 36  ? 31.553  11.067  35.142  1.00 44.85  ? 32  GLN D N   1 
ATOM   3678  C CA  . GLN D 1 36  ? 31.716  11.796  33.896  1.00 35.99  ? 32  GLN D CA  1 
ATOM   3679  C C   . GLN D 1 36  ? 31.793  10.822  32.731  1.00 55.46  ? 32  GLN D C   1 
ATOM   3680  O O   . GLN D 1 36  ? 32.393  9.752   32.839  1.00 54.07  ? 32  GLN D O   1 
ATOM   3681  C CB  . GLN D 1 36  ? 32.969  12.669  33.947  1.00 34.01  ? 32  GLN D CB  1 
ATOM   3682  C CG  . GLN D 1 36  ? 32.721  14.063  34.497  1.00 42.81  ? 32  GLN D CG  1 
ATOM   3683  C CD  . GLN D 1 36  ? 33.935  14.638  35.200  1.00 46.68  ? 32  GLN D CD  1 
ATOM   3684  O OE1 . GLN D 1 36  ? 34.569  13.966  36.013  1.00 54.47  ? 32  GLN D OE1 1 
ATOM   3685  N NE2 . GLN D 1 36  ? 34.268  15.884  34.886  1.00 43.88  ? 32  GLN D NE2 1 
ATOM   3686  N N   . ILE D 1 37  ? 31.167  11.197  31.621  1.00 58.39  ? 33  ILE D N   1 
ATOM   3687  C CA  . ILE D 1 37  ? 31.175  10.379  30.418  1.00 44.44  ? 33  ILE D CA  1 
ATOM   3688  C C   . ILE D 1 37  ? 31.746  11.184  29.259  1.00 49.66  ? 33  ILE D C   1 
ATOM   3689  O O   . ILE D 1 37  ? 31.867  12.407  29.338  1.00 46.11  ? 33  ILE D O   1 
ATOM   3690  C CB  . ILE D 1 37  ? 29.760  9.886   30.061  1.00 37.25  ? 33  ILE D CB  1 
ATOM   3691  C CG1 . ILE D 1 37  ? 28.817  11.071  29.838  1.00 36.55  ? 33  ILE D CG1 1 
ATOM   3692  C CG2 . ILE D 1 37  ? 29.222  8.986   31.163  1.00 32.28  ? 33  ILE D CG2 1 
ATOM   3693  C CD1 . ILE D 1 37  ? 27.475  10.682  29.264  1.00 25.09  ? 33  ILE D CD1 1 
ATOM   3694  N N   . THR D 1 38  ? 32.100  10.491  28.182  1.00 54.50  ? 34  THR D N   1 
ATOM   3695  C CA  . THR D 1 38  ? 32.711  11.138  27.030  1.00 53.84  ? 34  THR D CA  1 
ATOM   3696  C C   . THR D 1 38  ? 31.739  11.249  25.862  1.00 53.50  ? 34  THR D C   1 
ATOM   3697  O O   . THR D 1 38  ? 30.972  10.328  25.581  1.00 59.56  ? 34  THR D O   1 
ATOM   3698  C CB  . THR D 1 38  ? 33.961  10.375  26.563  1.00 50.46  ? 34  THR D CB  1 
ATOM   3699  O OG1 . THR D 1 38  ? 34.853  10.189  27.668  1.00 57.48  ? 34  THR D OG1 1 
ATOM   3700  C CG2 . THR D 1 38  ? 34.673  11.145  25.466  1.00 38.05  ? 34  THR D CG2 1 
ATOM   3701  N N   . PHE D 1 39  ? 31.785  12.389  25.184  1.00 40.55  ? 35  PHE D N   1 
ATOM   3702  C CA  . PHE D 1 39  ? 30.955  12.627  24.013  1.00 42.26  ? 35  PHE D CA  1 
ATOM   3703  C C   . PHE D 1 39  ? 31.472  13.856  23.276  1.00 50.03  ? 35  PHE D C   1 
ATOM   3704  O O   . PHE D 1 39  ? 31.952  14.805  23.896  1.00 47.08  ? 35  PHE D O   1 
ATOM   3705  C CB  . PHE D 1 39  ? 29.498  12.832  24.423  1.00 25.49  ? 35  PHE D CB  1 
ATOM   3706  C CG  . PHE D 1 39  ? 29.283  14.019  25.318  1.00 26.90  ? 35  PHE D CG  1 
ATOM   3707  C CD1 . PHE D 1 39  ? 29.075  15.278  24.780  1.00 15.39  ? 35  PHE D CD1 1 
ATOM   3708  C CD2 . PHE D 1 39  ? 29.290  13.877  26.695  1.00 34.86  ? 35  PHE D CD2 1 
ATOM   3709  C CE1 . PHE D 1 39  ? 28.876  16.372  25.598  1.00 7.47   ? 35  PHE D CE1 1 
ATOM   3710  C CE2 . PHE D 1 39  ? 29.092  14.970  27.518  1.00 32.94  ? 35  PHE D CE2 1 
ATOM   3711  C CZ  . PHE D 1 39  ? 28.885  16.218  26.967  1.00 17.78  ? 35  PHE D CZ  1 
ATOM   3712  N N   . GLU D 1 40  ? 31.376  13.837  21.953  1.00 40.52  ? 36  GLU D N   1 
ATOM   3713  C CA  . GLU D 1 40  ? 31.904  14.924  21.143  1.00 19.87  ? 36  GLU D CA  1 
ATOM   3714  C C   . GLU D 1 40  ? 30.796  15.908  20.796  1.00 20.74  ? 36  GLU D C   1 
ATOM   3715  O O   . GLU D 1 40  ? 29.768  15.526  20.238  1.00 42.68  ? 36  GLU D O   1 
ATOM   3716  C CB  . GLU D 1 40  ? 32.556  14.367  19.879  1.00 32.01  ? 36  GLU D CB  1 
ATOM   3717  C CG  . GLU D 1 40  ? 33.414  13.141  20.154  1.00 46.12  ? 36  GLU D CG  1 
ATOM   3718  C CD  . GLU D 1 40  ? 34.436  12.876  19.071  1.00 61.33  ? 36  GLU D CD  1 
ATOM   3719  O OE1 . GLU D 1 40  ? 35.113  11.829  19.145  1.00 56.74  ? 36  GLU D OE1 1 
ATOM   3720  O OE2 . GLU D 1 40  ? 34.564  13.709  18.150  1.00 83.62  ? 36  GLU D OE2 1 
ATOM   3721  N N   . PHE D 1 41  ? 31.013  17.175  21.136  1.00 32.07  ? 37  PHE D N   1 
ATOM   3722  C CA  . PHE D 1 41  ? 29.988  18.200  20.979  1.00 30.53  ? 37  PHE D CA  1 
ATOM   3723  C C   . PHE D 1 41  ? 30.593  19.490  20.429  1.00 51.43  ? 37  PHE D C   1 
ATOM   3724  O O   . PHE D 1 41  ? 31.797  19.561  20.181  1.00 56.29  ? 37  PHE D O   1 
ATOM   3725  C CB  . PHE D 1 41  ? 29.316  18.460  22.327  1.00 34.69  ? 37  PHE D CB  1 
ATOM   3726  C CG  . PHE D 1 41  ? 27.924  19.010  22.220  1.00 36.37  ? 37  PHE D CG  1 
ATOM   3727  C CD1 . PHE D 1 41  ? 26.950  18.335  21.501  1.00 37.53  ? 37  PHE D CD1 1 
ATOM   3728  C CD2 . PHE D 1 41  ? 27.588  20.202  22.839  1.00 32.77  ? 37  PHE D CD2 1 
ATOM   3729  C CE1 . PHE D 1 41  ? 25.668  18.840  21.404  1.00 42.54  ? 37  PHE D CE1 1 
ATOM   3730  C CE2 . PHE D 1 41  ? 26.309  20.709  22.748  1.00 34.01  ? 37  PHE D CE2 1 
ATOM   3731  C CZ  . PHE D 1 41  ? 25.347  20.029  22.028  1.00 42.16  ? 37  PHE D CZ  1 
ATOM   3732  N N   . VAL D 1 42  ? 29.754  20.506  20.244  1.00 77.05  ? 38  VAL D N   1 
ATOM   3733  C CA  . VAL D 1 42  ? 30.194  21.780  19.684  1.00 73.44  ? 38  VAL D CA  1 
ATOM   3734  C C   . VAL D 1 42  ? 30.743  22.691  20.774  1.00 71.26  ? 38  VAL D C   1 
ATOM   3735  O O   . VAL D 1 42  ? 30.189  22.763  21.872  1.00 66.39  ? 38  VAL D O   1 
ATOM   3736  C CB  . VAL D 1 42  ? 29.038  22.526  18.984  1.00 70.17  ? 38  VAL D CB  1 
ATOM   3737  C CG1 . VAL D 1 42  ? 29.577  23.693  18.174  1.00 71.57  ? 38  VAL D CG1 1 
ATOM   3738  C CG2 . VAL D 1 42  ? 28.242  21.585  18.093  1.00 73.36  ? 38  VAL D CG2 1 
ATOM   3739  N N   . ASP D 1 43  ? 31.827  23.393  20.462  1.00 80.25  ? 39  ASP D N   1 
ATOM   3740  C CA  . ASP D 1 43  ? 32.425  24.334  21.400  1.00 97.09  ? 39  ASP D CA  1 
ATOM   3741  C C   . ASP D 1 43  ? 31.759  25.701  21.257  1.00 93.14  ? 39  ASP D C   1 
ATOM   3742  O O   . ASP D 1 43  ? 31.897  26.363  20.229  1.00 99.79  ? 39  ASP D O   1 
ATOM   3743  C CB  . ASP D 1 43  ? 33.932  24.446  21.149  1.00 103.60 ? 39  ASP D CB  1 
ATOM   3744  C CG  . ASP D 1 43  ? 34.656  25.193  22.254  1.00 106.38 ? 39  ASP D CG  1 
ATOM   3745  O OD1 . ASP D 1 43  ? 34.023  26.032  22.928  1.00 101.97 ? 39  ASP D OD1 1 
ATOM   3746  O OD2 . ASP D 1 43  ? 35.864  24.939  22.448  1.00 113.42 ? 39  ASP D OD2 1 
ATOM   3747  N N   . GLN D 1 44  ? 31.031  26.112  22.292  1.00 72.84  ? 40  GLN D N   1 
ATOM   3748  C CA  . GLN D 1 44  ? 30.311  27.383  22.281  1.00 66.44  ? 40  GLN D CA  1 
ATOM   3749  C C   . GLN D 1 44  ? 31.208  28.556  21.902  1.00 57.19  ? 40  GLN D C   1 
ATOM   3750  O O   . GLN D 1 44  ? 30.745  29.542  21.327  1.00 46.73  ? 40  GLN D O   1 
ATOM   3751  C CB  . GLN D 1 44  ? 29.693  27.651  23.654  1.00 83.53  ? 40  GLN D CB  1 
ATOM   3752  C CG  . GLN D 1 44  ? 28.512  26.762  23.993  1.00 87.21  ? 40  GLN D CG  1 
ATOM   3753  C CD  . GLN D 1 44  ? 28.051  26.940  25.425  1.00 75.13  ? 40  GLN D CD  1 
ATOM   3754  O OE1 . GLN D 1 44  ? 28.847  27.260  26.309  1.00 60.49  ? 40  GLN D OE1 1 
ATOM   3755  N NE2 . GLN D 1 44  ? 26.760  26.740  25.662  1.00 79.85  ? 40  GLN D NE2 1 
ATOM   3756  N N   . GLU D 1 45  ? 32.491  28.446  22.233  1.00 69.00  ? 41  GLU D N   1 
ATOM   3757  C CA  . GLU D 1 45  ? 33.443  29.524  21.986  1.00 75.39  ? 41  GLU D CA  1 
ATOM   3758  C C   . GLU D 1 45  ? 33.995  29.476  20.568  1.00 68.13  ? 41  GLU D C   1 
ATOM   3759  O O   . GLU D 1 45  ? 33.992  30.481  19.855  1.00 68.11  ? 41  GLU D O   1 
ATOM   3760  C CB  . GLU D 1 45  ? 34.602  29.442  22.978  1.00 80.64  ? 41  GLU D CB  1 
ATOM   3761  C CG  . GLU D 1 45  ? 35.564  30.610  22.889  1.00 83.03  ? 41  GLU D CG  1 
ATOM   3762  C CD  . GLU D 1 45  ? 34.972  31.899  23.435  1.00 82.26  ? 41  GLU D CD  1 
ATOM   3763  O OE1 . GLU D 1 45  ? 34.049  31.824  24.273  1.00 84.10  ? 41  GLU D OE1 1 
ATOM   3764  O OE2 . GLU D 1 45  ? 35.432  32.985  23.024  1.00 69.38  ? 41  GLU D OE2 1 
ATOM   3765  N N   . GLN D 1 46  ? 34.477  28.304  20.168  1.00 72.16  ? 42  GLN D N   1 
ATOM   3766  C CA  . GLN D 1 46  ? 35.075  28.126  18.851  1.00 72.22  ? 42  GLN D CA  1 
ATOM   3767  C C   . GLN D 1 46  ? 34.069  28.453  17.749  1.00 81.52  ? 42  GLN D C   1 
ATOM   3768  O O   . GLN D 1 46  ? 34.451  28.731  16.611  1.00 89.75  ? 42  GLN D O   1 
ATOM   3769  C CB  . GLN D 1 46  ? 35.576  26.688  18.691  1.00 67.08  ? 42  GLN D CB  1 
ATOM   3770  C CG  . GLN D 1 46  ? 36.675  26.518  17.649  1.00 87.60  ? 42  GLN D CG  1 
ATOM   3771  C CD  . GLN D 1 46  ? 37.995  27.143  18.071  1.00 104.48 ? 42  GLN D CD  1 
ATOM   3772  O OE1 . GLN D 1 46  ? 38.588  27.928  17.330  1.00 107.74 ? 42  GLN D OE1 1 
ATOM   3773  N NE2 . GLN D 1 46  ? 38.469  26.786  19.261  1.00 106.84 ? 42  GLN D NE2 1 
ATOM   3774  N N   . LEU D 1 47  ? 32.785  28.421  18.094  1.00 73.23  ? 43  LEU D N   1 
ATOM   3775  C CA  . LEU D 1 47  ? 31.722  28.705  17.137  1.00 69.29  ? 43  LEU D CA  1 
ATOM   3776  C C   . LEU D 1 47  ? 30.687  29.636  17.761  1.00 58.71  ? 43  LEU D C   1 
ATOM   3777  O O   . LEU D 1 47  ? 29.745  29.184  18.414  1.00 51.50  ? 43  LEU D O   1 
ATOM   3778  C CB  . LEU D 1 47  ? 31.064  27.398  16.689  1.00 66.60  ? 43  LEU D CB  1 
ATOM   3779  C CG  . LEU D 1 47  ? 29.987  27.486  15.606  1.00 54.05  ? 43  LEU D CG  1 
ATOM   3780  C CD1 . LEU D 1 47  ? 30.491  28.250  14.392  1.00 49.74  ? 43  LEU D CD1 1 
ATOM   3781  C CD2 . LEU D 1 47  ? 29.539  26.088  15.209  1.00 47.89  ? 43  LEU D CD2 1 
ATOM   3782  N N   . LYS D 1 48  ? 30.867  30.937  17.554  1.00 55.72  ? 44  LYS D N   1 
ATOM   3783  C CA  . LYS D 1 48  ? 30.018  31.939  18.192  1.00 73.86  ? 44  LYS D CA  1 
ATOM   3784  C C   . LYS D 1 48  ? 28.632  32.032  17.554  1.00 73.85  ? 44  LYS D C   1 
ATOM   3785  O O   . LYS D 1 48  ? 27.622  32.010  18.257  1.00 82.13  ? 44  LYS D O   1 
ATOM   3786  C CB  . LYS D 1 48  ? 30.694  33.314  18.158  1.00 90.21  ? 44  LYS D CB  1 
ATOM   3787  C CG  . LYS D 1 48  ? 31.900  33.446  19.078  1.00 100.83 ? 44  LYS D CG  1 
ATOM   3788  C CD  . LYS D 1 48  ? 32.373  34.890  19.163  1.00 103.57 ? 44  LYS D CD  1 
ATOM   3789  C CE  . LYS D 1 48  ? 33.526  35.042  20.140  1.00 102.46 ? 44  LYS D CE  1 
ATOM   3790  N NZ  . LYS D 1 48  ? 33.924  36.466  20.314  1.00 100.97 ? 44  LYS D NZ  1 
ATOM   3791  N N   . ASP D 1 49  ? 28.588  32.138  16.228  1.00 58.96  ? 45  ASP D N   1 
ATOM   3792  C CA  . ASP D 1 49  ? 27.325  32.314  15.513  1.00 55.31  ? 45  ASP D CA  1 
ATOM   3793  C C   . ASP D 1 49  ? 26.277  31.311  15.999  1.00 53.61  ? 45  ASP D C   1 
ATOM   3794  O O   . ASP D 1 49  ? 26.456  30.103  15.846  1.00 49.72  ? 45  ASP D O   1 
ATOM   3795  C CB  . ASP D 1 49  ? 27.538  32.158  14.004  1.00 65.35  ? 45  ASP D CB  1 
ATOM   3796  C CG  . ASP D 1 49  ? 26.296  32.504  13.198  1.00 69.74  ? 45  ASP D CG  1 
ATOM   3797  O OD1 . ASP D 1 49  ? 25.469  33.302  13.689  1.00 70.56  ? 45  ASP D OD1 1 
ATOM   3798  O OD2 . ASP D 1 49  ? 26.148  31.982  12.073  1.00 68.16  ? 45  ASP D OD2 1 
ATOM   3799  N N   . PRO D 1 50  ? 25.182  31.812  16.597  1.00 59.58  ? 46  PRO D N   1 
ATOM   3800  C CA  . PRO D 1 50  ? 24.119  30.965  17.155  1.00 58.43  ? 46  PRO D CA  1 
ATOM   3801  C C   . PRO D 1 50  ? 23.495  29.999  16.146  1.00 53.75  ? 46  PRO D C   1 
ATOM   3802  O O   . PRO D 1 50  ? 23.280  28.833  16.476  1.00 46.11  ? 46  PRO D O   1 
ATOM   3803  C CB  . PRO D 1 50  ? 23.071  31.982  17.621  1.00 53.60  ? 46  PRO D CB  1 
ATOM   3804  C CG  . PRO D 1 50  ? 23.839  33.224  17.878  1.00 57.47  ? 46  PRO D CG  1 
ATOM   3805  C CD  . PRO D 1 50  ? 24.938  33.242  16.860  1.00 54.72  ? 46  PRO D CD  1 
ATOM   3806  N N   . VAL D 1 51  ? 23.197  30.478  14.942  1.00 54.07  ? 47  VAL D N   1 
ATOM   3807  C CA  . VAL D 1 51  ? 22.540  29.647  13.934  1.00 47.81  ? 47  VAL D CA  1 
ATOM   3808  C C   . VAL D 1 51  ? 23.448  28.513  13.466  1.00 40.72  ? 47  VAL D C   1 
ATOM   3809  O O   . VAL D 1 51  ? 23.027  27.359  13.400  1.00 49.84  ? 47  VAL D O   1 
ATOM   3810  C CB  . VAL D 1 51  ? 22.087  30.479  12.715  1.00 38.24  ? 47  VAL D CB  1 
ATOM   3811  C CG1 . VAL D 1 51  ? 21.653  29.569  11.573  1.00 44.85  ? 47  VAL D CG1 1 
ATOM   3812  C CG2 . VAL D 1 51  ? 20.956  31.418  13.108  1.00 18.72  ? 47  VAL D CG2 1 
ATOM   3813  N N   . CYS D 1 52  ? 24.695  28.844  13.145  1.00 51.61  ? 48  CYS D N   1 
ATOM   3814  C CA  . CYS D 1 52  ? 25.658  27.845  12.696  1.00 59.72  ? 48  CYS D CA  1 
ATOM   3815  C C   . CYS D 1 52  ? 26.039  26.904  13.837  1.00 64.63  ? 48  CYS D C   1 
ATOM   3816  O O   . CYS D 1 52  ? 26.541  25.803  13.604  1.00 66.45  ? 48  CYS D O   1 
ATOM   3817  C CB  . CYS D 1 52  ? 26.908  28.521  12.130  1.00 52.77  ? 48  CYS D CB  1 
ATOM   3818  S SG  . CYS D 1 52  ? 26.633  29.401  10.574  1.00 65.38  ? 48  CYS D SG  1 
ATOM   3819  N N   . TYR D 1 53  ? 25.805  27.344  15.070  1.00 62.42  ? 49  TYR D N   1 
ATOM   3820  C CA  . TYR D 1 53  ? 26.025  26.495  16.236  1.00 56.51  ? 49  TYR D CA  1 
ATOM   3821  C C   . TYR D 1 53  ? 24.966  25.398  16.286  1.00 56.94  ? 49  TYR D C   1 
ATOM   3822  O O   . TYR D 1 53  ? 25.265  24.249  16.612  1.00 58.94  ? 49  TYR D O   1 
ATOM   3823  C CB  . TYR D 1 53  ? 25.990  27.315  17.531  1.00 45.10  ? 49  TYR D CB  1 
ATOM   3824  C CG  . TYR D 1 53  ? 26.148  26.479  18.787  1.00 56.75  ? 49  TYR D CG  1 
ATOM   3825  C CD1 . TYR D 1 53  ? 25.065  25.799  19.334  1.00 62.77  ? 49  TYR D CD1 1 
ATOM   3826  C CD2 . TYR D 1 53  ? 27.377  26.370  19.425  1.00 59.65  ? 49  TYR D CD2 1 
ATOM   3827  C CE1 . TYR D 1 53  ? 25.204  25.032  20.476  1.00 58.24  ? 49  TYR D CE1 1 
ATOM   3828  C CE2 . TYR D 1 53  ? 27.523  25.605  20.571  1.00 64.49  ? 49  TYR D CE2 1 
ATOM   3829  C CZ  . TYR D 1 53  ? 26.433  24.941  21.092  1.00 63.52  ? 49  TYR D CZ  1 
ATOM   3830  O OH  . TYR D 1 53  ? 26.568  24.176  22.229  1.00 56.77  ? 49  TYR D OH  1 
ATOM   3831  N N   . LEU D 1 54  ? 23.729  25.758  15.958  1.00 55.06  ? 50  LEU D N   1 
ATOM   3832  C CA  . LEU D 1 54  ? 22.624  24.806  15.966  1.00 47.26  ? 50  LEU D CA  1 
ATOM   3833  C C   . LEU D 1 54  ? 22.680  23.883  14.755  1.00 35.90  ? 50  LEU D C   1 
ATOM   3834  O O   . LEU D 1 54  ? 22.137  22.778  14.785  1.00 53.15  ? 50  LEU D O   1 
ATOM   3835  C CB  . LEU D 1 54  ? 21.284  25.543  16.006  1.00 53.45  ? 50  LEU D CB  1 
ATOM   3836  C CG  . LEU D 1 54  ? 20.935  26.194  17.348  1.00 47.39  ? 50  LEU D CG  1 
ATOM   3837  C CD1 . LEU D 1 54  ? 19.673  27.028  17.227  1.00 49.01  ? 50  LEU D CD1 1 
ATOM   3838  C CD2 . LEU D 1 54  ? 20.773  25.138  18.426  1.00 41.18  ? 50  LEU D CD2 1 
ATOM   3839  N N   . LYS D 1 55  ? 23.329  24.335  13.688  1.00 25.61  ? 51  LYS D N   1 
ATOM   3840  C CA  . LYS D 1 55  ? 23.553  23.472  12.539  1.00 46.81  ? 51  LYS D CA  1 
ATOM   3841  C C   . LYS D 1 55  ? 24.477  22.331  12.946  1.00 54.00  ? 51  LYS D C   1 
ATOM   3842  O O   . LYS D 1 55  ? 24.126  21.160  12.814  1.00 63.25  ? 51  LYS D O   1 
ATOM   3843  C CB  . LYS D 1 55  ? 24.159  24.250  11.369  1.00 38.48  ? 51  LYS D CB  1 
ATOM   3844  C CG  . LYS D 1 55  ? 23.256  25.337  10.808  1.00 49.18  ? 51  LYS D CG  1 
ATOM   3845  C CD  . LYS D 1 55  ? 23.615  25.672  9.367   1.00 52.26  ? 51  LYS D CD  1 
ATOM   3846  C CE  . LYS D 1 55  ? 23.001  24.679  8.395   1.00 50.83  ? 51  LYS D CE  1 
ATOM   3847  N NZ  . LYS D 1 55  ? 23.546  24.828  7.019   1.00 61.56  ? 51  LYS D NZ  1 
ATOM   3848  N N   . LYS D 1 56  ? 25.653  22.683  13.455  1.00 52.72  ? 52  LYS D N   1 
ATOM   3849  C CA  . LYS D 1 56  ? 26.640  21.692  13.865  1.00 53.54  ? 52  LYS D CA  1 
ATOM   3850  C C   . LYS D 1 56  ? 26.113  20.844  15.017  1.00 47.94  ? 52  LYS D C   1 
ATOM   3851  O O   . LYS D 1 56  ? 26.219  19.619  14.997  1.00 51.87  ? 52  LYS D O   1 
ATOM   3852  C CB  . LYS D 1 56  ? 27.938  22.380  14.292  1.00 54.70  ? 52  LYS D CB  1 
ATOM   3853  C CG  . LYS D 1 56  ? 29.183  21.533  14.086  1.00 42.56  ? 52  LYS D CG  1 
ATOM   3854  C CD  . LYS D 1 56  ? 29.616  21.543  12.626  1.00 51.86  ? 52  LYS D CD  1 
ATOM   3855  C CE  . LYS D 1 56  ? 30.781  20.601  12.377  1.00 58.55  ? 52  LYS D CE  1 
ATOM   3856  N NZ  . LYS D 1 56  ? 30.374  19.170  12.407  1.00 55.83  ? 52  LYS D NZ  1 
ATOM   3857  N N   . ALA D 1 57  ? 25.545  21.510  16.018  1.00 54.41  ? 53  ALA D N   1 
ATOM   3858  C CA  . ALA D 1 57  ? 25.064  20.842  17.224  1.00 42.62  ? 53  ALA D CA  1 
ATOM   3859  C C   . ALA D 1 57  ? 24.052  19.747  16.904  1.00 43.55  ? 53  ALA D C   1 
ATOM   3860  O O   . ALA D 1 57  ? 24.055  18.689  17.532  1.00 49.88  ? 53  ALA D O   1 
ATOM   3861  C CB  . ALA D 1 57  ? 24.455  21.857  18.180  1.00 41.45  ? 53  ALA D CB  1 
ATOM   3862  N N   . PHE D 1 58  ? 23.187  20.003  15.928  1.00 39.80  ? 54  PHE D N   1 
ATOM   3863  C CA  . PHE D 1 58  ? 22.160  19.037  15.555  1.00 41.28  ? 54  PHE D CA  1 
ATOM   3864  C C   . PHE D 1 58  ? 22.752  17.817  14.854  1.00 43.48  ? 54  PHE D C   1 
ATOM   3865  O O   . PHE D 1 58  ? 22.192  16.723  14.924  1.00 41.11  ? 54  PHE D O   1 
ATOM   3866  C CB  . PHE D 1 58  ? 21.108  19.683  14.655  1.00 45.52  ? 54  PHE D CB  1 
ATOM   3867  C CG  . PHE D 1 58  ? 20.085  18.714  14.140  1.00 52.76  ? 54  PHE D CG  1 
ATOM   3868  C CD1 . PHE D 1 58  ? 19.041  18.297  14.947  1.00 54.18  ? 54  PHE D CD1 1 
ATOM   3869  C CD2 . PHE D 1 58  ? 20.179  18.204  12.856  1.00 63.43  ? 54  PHE D CD2 1 
ATOM   3870  C CE1 . PHE D 1 58  ? 18.101  17.398  14.480  1.00 61.25  ? 54  PHE D CE1 1 
ATOM   3871  C CE2 . PHE D 1 58  ? 19.241  17.305  12.381  1.00 61.15  ? 54  PHE D CE2 1 
ATOM   3872  C CZ  . PHE D 1 58  ? 18.202  16.902  13.195  1.00 68.95  ? 54  PHE D CZ  1 
ATOM   3873  N N   . LEU D 1 59  ? 23.878  18.007  14.173  1.00 44.83  ? 55  LEU D N   1 
ATOM   3874  C CA  . LEU D 1 59  ? 24.558  16.903  13.506  1.00 56.51  ? 55  LEU D CA  1 
ATOM   3875  C C   . LEU D 1 59  ? 25.144  15.952  14.541  1.00 52.09  ? 55  LEU D C   1 
ATOM   3876  O O   . LEU D 1 59  ? 25.073  14.731  14.394  1.00 48.48  ? 55  LEU D O   1 
ATOM   3877  C CB  . LEU D 1 59  ? 25.682  17.424  12.605  1.00 62.39  ? 55  LEU D CB  1 
ATOM   3878  C CG  . LEU D 1 59  ? 25.298  18.426  11.515  1.00 63.22  ? 55  LEU D CG  1 
ATOM   3879  C CD1 . LEU D 1 59  ? 26.527  18.843  10.717  1.00 48.81  ? 55  LEU D CD1 1 
ATOM   3880  C CD2 . LEU D 1 59  ? 24.229  17.846  10.605  1.00 71.30  ? 55  LEU D CD2 1 
ATOM   3881  N N   . LEU D 1 60  ? 25.721  16.526  15.591  1.00 45.18  ? 56  LEU D N   1 
ATOM   3882  C CA  . LEU D 1 60  ? 26.403  15.754  16.619  1.00 36.84  ? 56  LEU D CA  1 
ATOM   3883  C C   . LEU D 1 60  ? 25.428  15.061  17.569  1.00 44.04  ? 56  LEU D C   1 
ATOM   3884  O O   . LEU D 1 60  ? 25.704  13.965  18.057  1.00 40.81  ? 56  LEU D O   1 
ATOM   3885  C CB  . LEU D 1 60  ? 27.346  16.665  17.403  1.00 30.93  ? 56  LEU D CB  1 
ATOM   3886  C CG  . LEU D 1 60  ? 28.486  17.260  16.573  1.00 30.54  ? 56  LEU D CG  1 
ATOM   3887  C CD1 . LEU D 1 60  ? 29.133  18.414  17.310  1.00 32.65  ? 56  LEU D CD1 1 
ATOM   3888  C CD2 . LEU D 1 60  ? 29.519  16.196  16.241  1.00 26.42  ? 56  LEU D CD2 1 
ATOM   3889  N N   . VAL D 1 61  ? 24.291  15.700  17.832  1.00 44.80  ? 57  VAL D N   1 
ATOM   3890  C CA  . VAL D 1 61  ? 23.281  15.130  18.720  1.00 38.77  ? 57  VAL D CA  1 
ATOM   3891  C C   . VAL D 1 61  ? 22.839  13.754  18.237  1.00 41.50  ? 57  VAL D C   1 
ATOM   3892  O O   . VAL D 1 61  ? 22.469  12.898  19.038  1.00 56.92  ? 57  VAL D O   1 
ATOM   3893  C CB  . VAL D 1 61  ? 22.041  16.044  18.833  1.00 47.57  ? 57  VAL D CB  1 
ATOM   3894  C CG1 . VAL D 1 61  ? 20.830  15.257  19.310  1.00 45.07  ? 57  VAL D CG1 1 
ATOM   3895  C CG2 . VAL D 1 61  ? 22.319  17.208  19.771  1.00 50.04  ? 57  VAL D CG2 1 
ATOM   3896  N N   . GLN D 1 62  ? 22.881  13.548  16.925  1.00 30.45  ? 58  GLN D N   1 
ATOM   3897  C CA  . GLN D 1 62  ? 22.479  12.277  16.336  1.00 34.08  ? 58  GLN D CA  1 
ATOM   3898  C C   . GLN D 1 62  ? 23.376  11.139  16.811  1.00 37.00  ? 58  GLN D C   1 
ATOM   3899  O O   . GLN D 1 62  ? 22.892  10.066  17.172  1.00 24.90  ? 58  GLN D O   1 
ATOM   3900  C CB  . GLN D 1 62  ? 22.515  12.360  14.808  1.00 43.60  ? 58  GLN D CB  1 
ATOM   3901  C CG  . GLN D 1 62  ? 21.617  13.437  14.233  1.00 54.52  ? 58  GLN D CG  1 
ATOM   3902  C CD  . GLN D 1 62  ? 20.221  13.393  14.818  1.00 75.76  ? 58  GLN D CD  1 
ATOM   3903  O OE1 . GLN D 1 62  ? 19.673  12.318  15.066  1.00 74.83  ? 58  GLN D OE1 1 
ATOM   3904  N NE2 . GLN D 1 62  ? 19.641  14.565  15.055  1.00 85.56  ? 58  GLN D NE2 1 
ATOM   3905  N N   . ASP D 1 63  ? 24.683  11.376  16.800  1.00 40.67  ? 59  ASP D N   1 
ATOM   3906  C CA  . ASP D 1 63  ? 25.643  10.372  17.239  1.00 45.57  ? 59  ASP D CA  1 
ATOM   3907  C C   . ASP D 1 63  ? 25.516  10.138  18.739  1.00 37.30  ? 59  ASP D C   1 
ATOM   3908  O O   . ASP D 1 63  ? 25.762  9.036   19.233  1.00 37.92  ? 59  ASP D O   1 
ATOM   3909  C CB  . ASP D 1 63  ? 27.066  10.809  16.886  1.00 54.52  ? 59  ASP D CB  1 
ATOM   3910  C CG  . ASP D 1 63  ? 27.277  10.946  15.390  1.00 60.71  ? 59  ASP D CG  1 
ATOM   3911  O OD1 . ASP D 1 63  ? 27.499  9.914   14.722  1.00 53.19  ? 59  ASP D OD1 1 
ATOM   3912  O OD2 . ASP D 1 63  ? 27.212  12.085  14.880  1.00 59.71  ? 59  ASP D OD2 1 
ATOM   3913  N N   . ILE D 1 64  ? 25.121  11.180  19.458  1.00 33.88  ? 60  ILE D N   1 
ATOM   3914  C CA  . ILE D 1 64  ? 24.939  11.092  20.899  1.00 36.37  ? 60  ILE D CA  1 
ATOM   3915  C C   . ILE D 1 64  ? 23.711  10.245  21.234  1.00 39.83  ? 60  ILE D C   1 
ATOM   3916  O O   . ILE D 1 64  ? 23.736  9.447   22.171  1.00 37.45  ? 60  ILE D O   1 
ATOM   3917  C CB  . ILE D 1 64  ? 24.804  12.496  21.518  1.00 22.20  ? 60  ILE D CB  1 
ATOM   3918  C CG1 . ILE D 1 64  ? 26.139  13.242  21.417  1.00 17.24  ? 60  ILE D CG1 1 
ATOM   3919  C CG2 . ILE D 1 64  ? 24.362  12.402  22.963  1.00 31.97  ? 60  ILE D CG2 1 
ATOM   3920  C CD1 . ILE D 1 64  ? 26.065  14.710  21.810  1.00 11.76  ? 60  ILE D CD1 1 
ATOM   3921  N N   . MET D 1 65  ? 22.644  10.412  20.459  1.00 34.46  ? 61  MET D N   1 
ATOM   3922  C CA  . MET D 1 65  ? 21.415  9.657   20.680  1.00 43.29  ? 61  MET D CA  1 
ATOM   3923  C C   . MET D 1 65  ? 21.581  8.189   20.304  1.00 53.51  ? 61  MET D C   1 
ATOM   3924  O O   . MET D 1 65  ? 20.935  7.314   20.882  1.00 55.16  ? 61  MET D O   1 
ATOM   3925  C CB  . MET D 1 65  ? 20.259  10.259  19.877  1.00 42.31  ? 61  MET D CB  1 
ATOM   3926  C CG  . MET D 1 65  ? 19.715  11.559  20.447  1.00 50.32  ? 61  MET D CG  1 
ATOM   3927  S SD  . MET D 1 65  ? 18.120  12.019  19.738  1.00 46.44  ? 61  MET D SD  1 
ATOM   3928  C CE  . MET D 1 65  ? 18.560  12.262  18.019  1.00 20.90  ? 61  MET D CE  1 
ATOM   3929  N N   . GLU D 1 66  ? 22.449  7.925   19.333  1.00 65.39  ? 62  GLU D N   1 
ATOM   3930  C CA  . GLU D 1 66  ? 22.637  6.576   18.812  1.00 74.26  ? 62  GLU D CA  1 
ATOM   3931  C C   . GLU D 1 66  ? 23.608  5.759   19.662  1.00 71.67  ? 62  GLU D C   1 
ATOM   3932  O O   . GLU D 1 66  ? 23.421  4.555   19.844  1.00 72.11  ? 62  GLU D O   1 
ATOM   3933  C CB  . GLU D 1 66  ? 23.147  6.642   17.369  1.00 92.70  ? 62  GLU D CB  1 
ATOM   3934  C CG  . GLU D 1 66  ? 23.494  5.291   16.756  1.00 108.50 ? 62  GLU D CG  1 
ATOM   3935  C CD  . GLU D 1 66  ? 22.277  4.412   16.544  1.00 117.68 ? 62  GLU D CD  1 
ATOM   3936  O OE1 . GLU D 1 66  ? 21.156  4.855   16.870  1.00 123.68 ? 62  GLU D OE1 1 
ATOM   3937  O OE2 . GLU D 1 66  ? 22.441  3.277   16.048  1.00 116.71 ? 62  GLU D OE2 1 
ATOM   3938  N N   . ASP D 1 67  ? 24.639  6.416   20.182  1.00 73.21  ? 63  ASP D N   1 
ATOM   3939  C CA  . ASP D 1 67  ? 25.710  5.720   20.888  1.00 63.09  ? 63  ASP D CA  1 
ATOM   3940  C C   . ASP D 1 67  ? 25.560  5.781   22.410  1.00 65.42  ? 63  ASP D C   1 
ATOM   3941  O O   . ASP D 1 67  ? 25.702  4.764   23.089  1.00 84.05  ? 63  ASP D O   1 
ATOM   3942  C CB  . ASP D 1 67  ? 27.072  6.299   20.488  1.00 69.35  ? 63  ASP D CB  1 
ATOM   3943  C CG  . ASP D 1 67  ? 27.344  6.191   18.996  1.00 70.69  ? 63  ASP D CG  1 
ATOM   3944  O OD1 . ASP D 1 67  ? 26.832  5.247   18.357  1.00 66.35  ? 63  ASP D OD1 1 
ATOM   3945  O OD2 . ASP D 1 67  ? 28.078  7.051   18.463  1.00 63.89  ? 63  ASP D OD2 1 
ATOM   3946  N N   . THR D 1 68  ? 25.272  6.967   22.942  1.00 44.11  ? 64  THR D N   1 
ATOM   3947  C CA  . THR D 1 68  ? 25.307  7.188   24.391  1.00 42.02  ? 64  THR D CA  1 
ATOM   3948  C C   . THR D 1 68  ? 23.938  7.081   25.071  1.00 45.75  ? 64  THR D C   1 
ATOM   3949  O O   . THR D 1 68  ? 23.806  6.415   26.100  1.00 49.05  ? 64  THR D O   1 
ATOM   3950  C CB  . THR D 1 68  ? 25.923  8.567   24.733  1.00 43.57  ? 64  THR D CB  1 
ATOM   3951  O OG1 . THR D 1 68  ? 27.242  8.657   24.180  1.00 45.05  ? 64  THR D OG1 1 
ATOM   3952  C CG2 . THR D 1 68  ? 26.000  8.768   26.241  1.00 42.68  ? 64  THR D CG2 1 
ATOM   3953  N N   . MET D 1 69  ? 22.929  7.740   24.509  1.00 38.10  ? 65  MET D N   1 
ATOM   3954  C CA  . MET D 1 69  ? 21.598  7.762   25.115  1.00 26.42  ? 65  MET D CA  1 
ATOM   3955  C C   . MET D 1 69  ? 20.835  6.473   24.826  1.00 39.81  ? 65  MET D C   1 
ATOM   3956  O O   . MET D 1 69  ? 19.878  6.470   24.049  1.00 34.98  ? 65  MET D O   1 
ATOM   3957  C CB  . MET D 1 69  ? 20.795  8.958   24.595  1.00 17.07  ? 65  MET D CB  1 
ATOM   3958  C CG  . MET D 1 69  ? 21.436  10.312  24.878  1.00 17.11  ? 65  MET D CG  1 
ATOM   3959  S SD  . MET D 1 69  ? 20.586  11.680  24.066  1.00 52.54  ? 65  MET D SD  1 
ATOM   3960  C CE  . MET D 1 69  ? 18.990  11.611  24.873  1.00 49.04  ? 65  MET D CE  1 
ATOM   3961  N N   . ARG D 1 70  ? 21.258  5.382   25.458  1.00 51.75  ? 66  ARG D N   1 
ATOM   3962  C CA  . ARG D 1 70  ? 20.638  4.079   25.240  1.00 51.88  ? 66  ARG D CA  1 
ATOM   3963  C C   . ARG D 1 70  ? 19.892  3.618   26.488  1.00 38.71  ? 66  ARG D C   1 
ATOM   3964  O O   . ARG D 1 70  ? 20.343  3.846   27.609  1.00 33.41  ? 66  ARG D O   1 
ATOM   3965  C CB  . ARG D 1 70  ? 21.696  3.046   24.844  1.00 65.58  ? 66  ARG D CB  1 
ATOM   3966  C CG  . ARG D 1 70  ? 22.503  3.440   23.614  1.00 75.90  ? 66  ARG D CG  1 
ATOM   3967  C CD  . ARG D 1 70  ? 23.402  2.314   23.136  1.00 87.09  ? 66  ARG D CD  1 
ATOM   3968  N NE  . ARG D 1 70  ? 24.451  1.990   24.098  1.00 99.24  ? 66  ARG D NE  1 
ATOM   3969  C CZ  . ARG D 1 70  ? 25.414  1.099   23.883  1.00 105.48 ? 66  ARG D CZ  1 
ATOM   3970  N NH1 . ARG D 1 70  ? 25.467  0.434   22.735  1.00 105.60 ? 66  ARG D NH1 1 
ATOM   3971  N NH2 . ARG D 1 70  ? 26.327  0.870   24.815  1.00 102.61 ? 66  ARG D NH2 1 
ATOM   3972  N N   . PHE D 1 71  ? 18.748  2.972   26.285  1.00 45.05  ? 67  PHE D N   1 
ATOM   3973  C CA  . PHE D 1 71  ? 17.925  2.503   27.394  1.00 49.96  ? 67  PHE D CA  1 
ATOM   3974  C C   . PHE D 1 71  ? 17.420  1.084   27.154  1.00 58.30  ? 67  PHE D C   1 
ATOM   3975  O O   . PHE D 1 71  ? 17.431  0.589   26.027  1.00 53.13  ? 67  PHE D O   1 
ATOM   3976  C CB  . PHE D 1 71  ? 16.743  3.449   27.610  1.00 32.34  ? 67  PHE D CB  1 
ATOM   3977  C CG  . PHE D 1 71  ? 17.147  4.827   28.051  1.00 44.00  ? 67  PHE D CG  1 
ATOM   3978  C CD1 . PHE D 1 71  ? 17.319  5.115   29.394  1.00 44.47  ? 67  PHE D CD1 1 
ATOM   3979  C CD2 . PHE D 1 71  ? 17.360  5.833   27.124  1.00 45.18  ? 67  PHE D CD2 1 
ATOM   3980  C CE1 . PHE D 1 71  ? 17.694  6.379   29.804  1.00 41.39  ? 67  PHE D CE1 1 
ATOM   3981  C CE2 . PHE D 1 71  ? 17.736  7.101   27.530  1.00 44.64  ? 67  PHE D CE2 1 
ATOM   3982  C CZ  . PHE D 1 71  ? 17.903  7.373   28.871  1.00 37.87  ? 67  PHE D CZ  1 
ATOM   3983  N N   . ARG D 1 72  ? 16.984  0.430   28.226  1.00 59.79  ? 68  ARG D N   1 
ATOM   3984  C CA  . ARG D 1 72  ? 16.442  -0.917  28.131  1.00 64.02  ? 68  ARG D CA  1 
ATOM   3985  C C   . ARG D 1 72  ? 15.267  -0.923  27.160  1.00 71.44  ? 68  ARG D C   1 
ATOM   3986  O O   . ARG D 1 72  ? 14.339  -0.125  27.292  1.00 61.22  ? 68  ARG D O   1 
ATOM   3987  C CB  . ARG D 1 72  ? 15.993  -1.408  29.508  1.00 72.39  ? 68  ARG D CB  1 
ATOM   3988  C CG  . ARG D 1 72  ? 15.676  -2.893  29.567  1.00 79.60  ? 68  ARG D CG  1 
ATOM   3989  C CD  . ARG D 1 72  ? 15.275  -3.320  30.971  1.00 88.75  ? 68  ARG D CD  1 
ATOM   3990  N NE  . ARG D 1 72  ? 16.269  -2.930  31.968  1.00 97.95  ? 68  ARG D NE  1 
ATOM   3991  C CZ  . ARG D 1 72  ? 17.380  -3.612  32.238  1.00 115.89 ? 68  ARG D CZ  1 
ATOM   3992  N NH1 . ARG D 1 72  ? 17.661  -4.733  31.585  1.00 124.59 ? 68  ARG D NH1 1 
ATOM   3993  N NH2 . ARG D 1 72  ? 18.217  -3.169  33.165  1.00 120.14 ? 68  ARG D NH2 1 
ATOM   3994  N N   . ASP D 1 73  ? 15.316  -1.822  26.181  1.00 77.21  ? 69  ASP D N   1 
ATOM   3995  C CA  . ASP D 1 73  ? 14.292  -1.885  25.144  1.00 70.71  ? 69  ASP D CA  1 
ATOM   3996  C C   . ASP D 1 73  ? 12.886  -1.935  25.731  1.00 64.47  ? 69  ASP D C   1 
ATOM   3997  O O   . ASP D 1 73  ? 12.643  -2.605  26.735  1.00 73.09  ? 69  ASP D O   1 
ATOM   3998  C CB  . ASP D 1 73  ? 14.516  -3.103  24.245  1.00 70.11  ? 69  ASP D CB  1 
ATOM   3999  C CG  . ASP D 1 73  ? 15.756  -2.970  23.382  1.00 76.54  ? 69  ASP D CG  1 
ATOM   4000  O OD1 . ASP D 1 73  ? 16.152  -1.824  23.081  1.00 75.56  ? 69  ASP D OD1 1 
ATOM   4001  O OD2 . ASP D 1 73  ? 16.333  -4.010  23.002  1.00 80.63  ? 69  ASP D OD2 1 
ATOM   4002  N N   . ASN D 1 74  ? 11.969  -1.212  25.096  1.00 55.95  ? 70  ASN D N   1 
ATOM   4003  C CA  . ASN D 1 74  ? 10.558  -1.226  25.471  1.00 66.68  ? 70  ASN D CA  1 
ATOM   4004  C C   . ASN D 1 74  ? 10.279  -0.547  26.812  1.00 56.69  ? 70  ASN D C   1 
ATOM   4005  O O   . ASN D 1 74  ? 9.377   -0.950  27.548  1.00 47.80  ? 70  ASN D O   1 
ATOM   4006  C CB  . ASN D 1 74  ? 10.022  -2.661  25.476  1.00 74.59  ? 70  ASN D CB  1 
ATOM   4007  C CG  . ASN D 1 74  ? 10.226  -3.363  24.145  1.00 76.90  ? 70  ASN D CG  1 
ATOM   4008  O OD1 . ASN D 1 74  ? 10.861  -4.417  24.075  1.00 66.43  ? 70  ASN D OD1 1 
ATOM   4009  N ND2 . ASN D 1 74  ? 9.690   -2.778  23.080  1.00 72.60  ? 70  ASN D ND2 1 
ATOM   4010  N N   . THR D 1 75  ? 11.059  0.485   27.118  1.00 51.96  ? 71  THR D N   1 
ATOM   4011  C CA  . THR D 1 75  ? 10.797  1.338   28.271  1.00 44.74  ? 71  THR D CA  1 
ATOM   4012  C C   . THR D 1 75  ? 10.568  2.767   27.787  1.00 45.14  ? 71  THR D C   1 
ATOM   4013  O O   . THR D 1 75  ? 11.117  3.172   26.763  1.00 58.69  ? 71  THR D O   1 
ATOM   4014  C CB  . THR D 1 75  ? 11.967  1.327   29.268  1.00 39.36  ? 71  THR D CB  1 
ATOM   4015  O OG1 . THR D 1 75  ? 13.140  1.871   28.647  1.00 33.36  ? 71  THR D OG1 1 
ATOM   4016  C CG2 . THR D 1 75  ? 12.250  -0.090  29.747  1.00 41.43  ? 71  THR D CG2 1 
ATOM   4017  N N   . PRO D 1 76  ? 9.757   3.538   28.526  1.00 40.21  ? 72  PRO D N   1 
ATOM   4018  C CA  . PRO D 1 76  ? 9.376   4.894   28.113  1.00 47.97  ? 72  PRO D CA  1 
ATOM   4019  C C   . PRO D 1 76  ? 10.530  5.702   27.516  1.00 59.59  ? 72  PRO D C   1 
ATOM   4020  O O   . PRO D 1 76  ? 10.345  6.350   26.486  1.00 64.78  ? 72  PRO D O   1 
ATOM   4021  C CB  . PRO D 1 76  ? 8.894   5.527   29.418  1.00 41.86  ? 72  PRO D CB  1 
ATOM   4022  C CG  . PRO D 1 76  ? 8.347   4.379   30.201  1.00 21.02  ? 72  PRO D CG  1 
ATOM   4023  C CD  . PRO D 1 76  ? 9.185   3.179   29.836  1.00 16.57  ? 72  PRO D CD  1 
ATOM   4024  N N   . ASN D 1 77  ? 11.700  5.654   28.149  1.00 62.34  ? 73  ASN D N   1 
ATOM   4025  C CA  . ASN D 1 77  ? 12.861  6.409   27.679  1.00 43.33  ? 73  ASN D CA  1 
ATOM   4026  C C   . ASN D 1 77  ? 13.429  5.845   26.380  1.00 38.25  ? 73  ASN D C   1 
ATOM   4027  O O   . ASN D 1 77  ? 13.844  6.597   25.501  1.00 32.48  ? 73  ASN D O   1 
ATOM   4028  C CB  . ASN D 1 77  ? 13.961  6.437   28.745  1.00 46.95  ? 73  ASN D CB  1 
ATOM   4029  C CG  . ASN D 1 77  ? 13.655  7.396   29.883  1.00 42.95  ? 73  ASN D CG  1 
ATOM   4030  O OD1 . ASN D 1 77  ? 12.706  8.179   29.816  1.00 25.73  ? 73  ASN D OD1 1 
ATOM   4031  N ND2 . ASN D 1 77  ? 14.477  7.351   30.928  1.00 38.48  ? 73  ASN D ND2 1 
ATOM   4032  N N   . ALA D 1 78  ? 13.452  4.520   26.265  1.00 48.12  ? 74  ALA D N   1 
ATOM   4033  C CA  . ALA D 1 78  ? 13.965  3.866   25.066  1.00 52.18  ? 74  ALA D CA  1 
ATOM   4034  C C   . ALA D 1 78  ? 13.135  4.279   23.857  1.00 48.79  ? 74  ALA D C   1 
ATOM   4035  O O   . ALA D 1 78  ? 13.676  4.606   22.800  1.00 62.46  ? 74  ALA D O   1 
ATOM   4036  C CB  . ALA D 1 78  ? 13.943  2.352   25.232  1.00 56.38  ? 74  ALA D CB  1 
ATOM   4037  N N   . ILE D 1 79  ? 11.817  4.262   24.023  1.00 32.06  ? 75  ILE D N   1 
ATOM   4038  C CA  . ILE D 1 79  ? 10.905  4.667   22.962  1.00 38.40  ? 75  ILE D CA  1 
ATOM   4039  C C   . ILE D 1 79  ? 11.030  6.162   22.703  1.00 46.97  ? 75  ILE D C   1 
ATOM   4040  O O   . ILE D 1 79  ? 10.998  6.607   21.557  1.00 50.46  ? 75  ILE D O   1 
ATOM   4041  C CB  . ILE D 1 79  ? 9.446   4.341   23.323  1.00 36.98  ? 75  ILE D CB  1 
ATOM   4042  C CG1 . ILE D 1 79  ? 9.261   2.827   23.444  1.00 51.09  ? 75  ILE D CG1 1 
ATOM   4043  C CG2 . ILE D 1 79  ? 8.498   4.901   22.272  1.00 23.40  ? 75  ILE D CG2 1 
ATOM   4044  C CD1 . ILE D 1 79  ? 7.965   2.422   24.108  1.00 63.65  ? 75  ILE D CD1 1 
ATOM   4045  N N   . ALA D 1 80  ? 11.171  6.935   23.775  1.00 50.44  ? 76  ALA D N   1 
ATOM   4046  C CA  . ALA D 1 80  ? 11.321  8.378   23.653  1.00 32.78  ? 76  ALA D CA  1 
ATOM   4047  C C   . ALA D 1 80  ? 12.407  8.708   22.638  1.00 30.42  ? 76  ALA D C   1 
ATOM   4048  O O   . ALA D 1 80  ? 12.243  9.603   21.811  1.00 48.43  ? 76  ALA D O   1 
ATOM   4049  C CB  . ALA D 1 80  ? 11.653  8.992   25.001  1.00 18.71  ? 76  ALA D CB  1 
ATOM   4050  N N   . ILE D 1 81  ? 13.513  7.973   22.701  1.00 31.50  ? 77  ILE D N   1 
ATOM   4051  C CA  . ILE D 1 81  ? 14.640  8.207   21.804  1.00 38.40  ? 77  ILE D CA  1 
ATOM   4052  C C   . ILE D 1 81  ? 14.278  7.817   20.373  1.00 42.52  ? 77  ILE D C   1 
ATOM   4053  O O   . ILE D 1 81  ? 14.598  8.539   19.428  1.00 45.10  ? 77  ILE D O   1 
ATOM   4054  C CB  . ILE D 1 81  ? 15.889  7.418   22.248  1.00 34.11  ? 77  ILE D CB  1 
ATOM   4055  C CG1 . ILE D 1 81  ? 16.291  7.807   23.673  1.00 34.74  ? 77  ILE D CG1 1 
ATOM   4056  C CG2 . ILE D 1 81  ? 17.047  7.664   21.291  1.00 39.32  ? 77  ILE D CG2 1 
ATOM   4057  C CD1 . ILE D 1 81  ? 16.619  9.270   23.845  1.00 38.95  ? 77  ILE D CD1 1 
ATOM   4058  N N   . VAL D 1 82  ? 13.613  6.675   20.218  1.00 37.62  ? 78  VAL D N   1 
ATOM   4059  C CA  . VAL D 1 82  ? 13.151  6.232   18.906  1.00 19.73  ? 78  VAL D CA  1 
ATOM   4060  C C   . VAL D 1 82  ? 12.311  7.323   18.251  1.00 32.28  ? 78  VAL D C   1 
ATOM   4061  O O   . VAL D 1 82  ? 12.495  7.637   17.075  1.00 41.13  ? 78  VAL D O   1 
ATOM   4062  C CB  . VAL D 1 82  ? 12.306  4.947   19.002  1.00 23.08  ? 78  VAL D CB  1 
ATOM   4063  C CG1 . VAL D 1 82  ? 11.627  4.655   17.671  1.00 29.46  ? 78  VAL D CG1 1 
ATOM   4064  C CG2 . VAL D 1 82  ? 13.167  3.768   19.433  1.00 33.41  ? 78  VAL D CG2 1 
ATOM   4065  N N   . GLN D 1 83  ? 11.389  7.895   19.021  1.00 26.53  ? 79  GLN D N   1 
ATOM   4066  C CA  . GLN D 1 83  ? 10.538  8.974   18.533  1.00 28.33  ? 79  GLN D CA  1 
ATOM   4067  C C   . GLN D 1 83  ? 11.387  10.149  18.060  1.00 37.71  ? 79  GLN D C   1 
ATOM   4068  O O   . GLN D 1 83  ? 11.160  10.701  16.981  1.00 51.87  ? 79  GLN D O   1 
ATOM   4069  C CB  . GLN D 1 83  ? 9.576   9.436   19.633  1.00 34.05  ? 79  GLN D CB  1 
ATOM   4070  C CG  . GLN D 1 83  ? 8.510   8.413   20.010  1.00 30.25  ? 79  GLN D CG  1 
ATOM   4071  C CD  . GLN D 1 83  ? 7.642   8.869   21.173  1.00 37.30  ? 79  GLN D CD  1 
ATOM   4072  O OE1 . GLN D 1 83  ? 7.962   9.840   21.860  1.00 49.55  ? 79  GLN D OE1 1 
ATOM   4073  N NE2 . GLN D 1 83  ? 6.537   8.169   21.395  1.00 30.72  ? 79  GLN D NE2 1 
ATOM   4074  N N   . LEU D 1 84  ? 12.368  10.524  18.873  1.00 22.59  ? 80  LEU D N   1 
ATOM   4075  C CA  . LEU D 1 84  ? 13.236  11.652  18.562  1.00 42.50  ? 80  LEU D CA  1 
ATOM   4076  C C   . LEU D 1 84  ? 14.095  11.373  17.332  1.00 46.35  ? 80  LEU D C   1 
ATOM   4077  O O   . LEU D 1 84  ? 14.403  12.284  16.563  1.00 45.69  ? 80  LEU D O   1 
ATOM   4078  C CB  . LEU D 1 84  ? 14.126  11.983  19.761  1.00 43.85  ? 80  LEU D CB  1 
ATOM   4079  C CG  . LEU D 1 84  ? 13.410  12.589  20.971  1.00 26.13  ? 80  LEU D CG  1 
ATOM   4080  C CD1 . LEU D 1 84  ? 14.330  12.621  22.179  1.00 34.25  ? 80  LEU D CD1 1 
ATOM   4081  C CD2 . LEU D 1 84  ? 12.908  13.987  20.651  1.00 25.91  ? 80  LEU D CD2 1 
ATOM   4082  N N   . GLN D 1 85  ? 14.481  10.115  17.148  1.00 43.91  ? 81  GLN D N   1 
ATOM   4083  C CA  . GLN D 1 85  ? 15.276  9.733   15.986  1.00 38.43  ? 81  GLN D CA  1 
ATOM   4084  C C   . GLN D 1 85  ? 14.425  9.778   14.719  1.00 43.35  ? 81  GLN D C   1 
ATOM   4085  O O   . GLN D 1 85  ? 14.913  10.137  13.648  1.00 43.41  ? 81  GLN D O   1 
ATOM   4086  C CB  . GLN D 1 85  ? 15.885  8.343   16.178  1.00 18.97  ? 81  GLN D CB  1 
ATOM   4087  C CG  . GLN D 1 85  ? 17.015  8.308   17.199  1.00 30.33  ? 81  GLN D CG  1 
ATOM   4088  C CD  . GLN D 1 85  ? 17.665  6.942   17.310  1.00 51.83  ? 81  GLN D CD  1 
ATOM   4089  O OE1 . GLN D 1 85  ? 16.994  5.940   17.559  1.00 63.12  ? 81  GLN D OE1 1 
ATOM   4090  N NE2 . GLN D 1 85  ? 18.979  6.894   17.118  1.00 59.06  ? 81  GLN D NE2 1 
ATOM   4091  N N   . GLU D 1 86  ? 13.152  9.420   14.849  1.00 33.49  ? 82  GLU D N   1 
ATOM   4092  C CA  . GLU D 1 86  ? 12.212  9.528   13.740  1.00 36.48  ? 82  GLU D CA  1 
ATOM   4093  C C   . GLU D 1 86  ? 11.988  10.995  13.381  1.00 41.43  ? 82  GLU D C   1 
ATOM   4094  O O   . GLU D 1 86  ? 11.869  11.348  12.208  1.00 41.63  ? 82  GLU D O   1 
ATOM   4095  C CB  . GLU D 1 86  ? 10.882  8.869   14.102  1.00 54.94  ? 82  GLU D CB  1 
ATOM   4096  C CG  . GLU D 1 86  ? 10.956  7.359   14.238  1.00 63.75  ? 82  GLU D CG  1 
ATOM   4097  C CD  . GLU D 1 86  ? 9.644   6.758   14.696  1.00 77.68  ? 82  GLU D CD  1 
ATOM   4098  O OE1 . GLU D 1 86  ? 9.521   5.515   14.690  1.00 83.87  ? 82  GLU D OE1 1 
ATOM   4099  O OE2 . GLU D 1 86  ? 8.734   7.532   15.063  1.00 87.45  ? 82  GLU D OE2 1 
ATOM   4100  N N   . LEU D 1 87  ? 11.928  11.843  14.403  1.00 50.49  ? 83  LEU D N   1 
ATOM   4101  C CA  . LEU D 1 87  ? 11.798  13.283  14.205  1.00 47.09  ? 83  LEU D CA  1 
ATOM   4102  C C   . LEU D 1 87  ? 13.034  13.853  13.519  1.00 52.86  ? 83  LEU D C   1 
ATOM   4103  O O   . LEU D 1 87  ? 12.937  14.780  12.714  1.00 60.44  ? 83  LEU D O   1 
ATOM   4104  C CB  . LEU D 1 87  ? 11.596  13.984  15.550  1.00 41.03  ? 83  LEU D CB  1 
ATOM   4105  C CG  . LEU D 1 87  ? 11.874  15.491  15.568  1.00 36.20  ? 83  LEU D CG  1 
ATOM   4106  C CD1 . LEU D 1 87  ? 10.826  16.250  14.760  1.00 25.40  ? 83  LEU D CD1 1 
ATOM   4107  C CD2 . LEU D 1 87  ? 11.946  16.005  17.000  1.00 24.35  ? 83  LEU D CD2 1 
ATOM   4108  N N   . SER D 1 88  ? 14.195  13.298  13.848  1.00 57.62  ? 84  SER D N   1 
ATOM   4109  C CA  . SER D 1 88  ? 15.461  13.795  13.322  1.00 52.89  ? 84  SER D CA  1 
ATOM   4110  C C   . SER D 1 88  ? 15.587  13.561  11.818  1.00 48.78  ? 84  SER D C   1 
ATOM   4111  O O   . SER D 1 88  ? 16.149  14.391  11.108  1.00 51.79  ? 84  SER D O   1 
ATOM   4112  C CB  . SER D 1 88  ? 16.633  13.140  14.056  1.00 52.32  ? 84  SER D CB  1 
ATOM   4113  O OG  . SER D 1 88  ? 16.618  13.471  15.435  1.00 57.04  ? 84  SER D OG  1 
ATOM   4114  N N   . LEU D 1 89  ? 15.066  12.437  11.335  1.00 35.48  ? 85  LEU D N   1 
ATOM   4115  C CA  . LEU D 1 89  ? 15.130  12.121  9.909   1.00 48.61  ? 85  LEU D CA  1 
ATOM   4116  C C   . LEU D 1 89  ? 14.500  13.225  9.070   1.00 59.32  ? 85  LEU D C   1 
ATOM   4117  O O   . LEU D 1 89  ? 15.024  13.596  8.019   1.00 66.34  ? 85  LEU D O   1 
ATOM   4118  C CB  . LEU D 1 89  ? 14.429  10.794  9.615   1.00 42.63  ? 85  LEU D CB  1 
ATOM   4119  C CG  . LEU D 1 89  ? 15.240  9.526   9.881   1.00 30.73  ? 85  LEU D CG  1 
ATOM   4120  C CD1 . LEU D 1 89  ? 14.355  8.298   9.765   1.00 34.31  ? 85  LEU D CD1 1 
ATOM   4121  C CD2 . LEU D 1 89  ? 16.409  9.430   8.917   1.00 24.55  ? 85  LEU D CD2 1 
ATOM   4122  N N   . ARG D 1 90  ? 13.370  13.742  9.538   1.00 51.69  ? 86  ARG D N   1 
ATOM   4123  C CA  . ARG D 1 90  ? 12.667  14.799  8.827   1.00 51.47  ? 86  ARG D CA  1 
ATOM   4124  C C   . ARG D 1 90  ? 13.406  16.127  8.962   1.00 54.66  ? 86  ARG D C   1 
ATOM   4125  O O   . ARG D 1 90  ? 13.486  16.902  8.008   1.00 36.52  ? 86  ARG D O   1 
ATOM   4126  C CB  . ARG D 1 90  ? 11.240  14.937  9.361   1.00 58.72  ? 86  ARG D CB  1 
ATOM   4127  N N   . LEU D 1 91  ? 13.949  16.383  10.149  1.00 66.81  ? 87  LEU D N   1 
ATOM   4128  C CA  . LEU D 1 91  ? 14.642  17.639  10.424  1.00 59.57  ? 87  LEU D CA  1 
ATOM   4129  C C   . LEU D 1 91  ? 15.854  17.851  9.524   1.00 58.93  ? 87  LEU D C   1 
ATOM   4130  O O   . LEU D 1 91  ? 16.232  18.988  9.246   1.00 66.05  ? 87  LEU D O   1 
ATOM   4131  C CB  . LEU D 1 91  ? 15.083  17.704  11.888  1.00 43.41  ? 87  LEU D CB  1 
ATOM   4132  C CG  . LEU D 1 91  ? 14.091  18.327  12.871  1.00 29.91  ? 87  LEU D CG  1 
ATOM   4133  C CD1 . LEU D 1 91  ? 14.627  18.235  14.285  1.00 33.89  ? 87  LEU D CD1 1 
ATOM   4134  C CD2 . LEU D 1 91  ? 13.805  19.776  12.510  1.00 30.71  ? 87  LEU D CD2 1 
ATOM   4135  N N   . LYS D 1 92  ? 16.465  16.762  9.071   1.00 52.85  ? 88  LYS D N   1 
ATOM   4136  C CA  . LYS D 1 92  ? 17.656  16.860  8.235   1.00 61.70  ? 88  LYS D CA  1 
ATOM   4137  C C   . LYS D 1 92  ? 17.349  17.564  6.916   1.00 66.89  ? 88  LYS D C   1 
ATOM   4138  O O   . LYS D 1 92  ? 18.257  18.028  6.226   1.00 83.13  ? 88  LYS D O   1 
ATOM   4139  C CB  . LYS D 1 92  ? 18.253  15.473  7.984   1.00 67.35  ? 88  LYS D CB  1 
ATOM   4140  C CG  . LYS D 1 92  ? 18.717  14.786  9.257   1.00 85.39  ? 88  LYS D CG  1 
ATOM   4141  C CD  . LYS D 1 92  ? 19.458  13.489  8.994   1.00 96.50  ? 88  LYS D CD  1 
ATOM   4142  C CE  . LYS D 1 92  ? 19.728  12.755  10.301  1.00 100.11 ? 88  LYS D CE  1 
ATOM   4143  N NZ  . LYS D 1 92  ? 20.996  11.980  10.272  1.00 105.30 ? 88  LYS D NZ  1 
ATOM   4144  N N   . SER D 1 93  ? 16.067  17.644  6.573   1.00 53.98  ? 89  SER D N   1 
ATOM   4145  C CA  . SER D 1 93  ? 15.637  18.351  5.373   1.00 48.07  ? 89  SER D CA  1 
ATOM   4146  C C   . SER D 1 93  ? 15.563  19.855  5.617   1.00 41.71  ? 89  SER D C   1 
ATOM   4147  O O   . SER D 1 93  ? 15.420  20.637  4.678   1.00 45.02  ? 89  SER D O   1 
ATOM   4148  C CB  . SER D 1 93  ? 14.271  17.836  4.914   1.00 65.83  ? 89  SER D CB  1 
ATOM   4149  O OG  . SER D 1 93  ? 13.258  18.136  5.862   1.00 64.49  ? 89  SER D OG  1 
ATOM   4150  N N   . CYS D 1 94  ? 15.654  20.252  6.884   1.00 46.56  ? 90  CYS D N   1 
ATOM   4151  C CA  . CYS D 1 94  ? 15.601  21.661  7.262   1.00 43.39  ? 90  CYS D CA  1 
ATOM   4152  C C   . CYS D 1 94  ? 16.992  22.292  7.265   1.00 42.77  ? 90  CYS D C   1 
ATOM   4153  O O   . CYS D 1 94  ? 17.125  23.513  7.170   1.00 42.00  ? 90  CYS D O   1 
ATOM   4154  C CB  . CYS D 1 94  ? 14.959  21.817  8.643   1.00 32.93  ? 90  CYS D CB  1 
ATOM   4155  S SG  . CYS D 1 94  ? 13.249  21.231  8.742   1.00 58.38  ? 90  CYS D SG  1 
ATOM   4156  N N   . PHE D 1 95  ? 18.020  21.456  7.378   1.00 47.29  ? 91  PHE D N   1 
ATOM   4157  C CA  . PHE D 1 95  ? 19.401  21.927  7.378   1.00 40.85  ? 91  PHE D CA  1 
ATOM   4158  C C   . PHE D 1 95  ? 20.056  21.678  6.025   1.00 53.33  ? 91  PHE D C   1 
ATOM   4159  O O   . PHE D 1 95  ? 20.019  20.562  5.504   1.00 60.18  ? 91  PHE D O   1 
ATOM   4160  C CB  . PHE D 1 95  ? 20.206  21.217  8.468   1.00 42.29  ? 91  PHE D CB  1 
ATOM   4161  C CG  . PHE D 1 95  ? 19.717  21.490  9.863   1.00 52.99  ? 91  PHE D CG  1 
ATOM   4162  C CD1 . PHE D 1 95  ? 18.607  20.830  10.364  1.00 58.31  ? 91  PHE D CD1 1 
ATOM   4163  C CD2 . PHE D 1 95  ? 20.373  22.399  10.676  1.00 51.87  ? 91  PHE D CD2 1 
ATOM   4164  C CE1 . PHE D 1 95  ? 18.156  21.074  11.647  1.00 52.02  ? 91  PHE D CE1 1 
ATOM   4165  C CE2 . PHE D 1 95  ? 19.927  22.648  11.960  1.00 49.83  ? 91  PHE D CE2 1 
ATOM   4166  C CZ  . PHE D 1 95  ? 18.817  21.985  12.446  1.00 60.86  ? 91  PHE D CZ  1 
ATOM   4167  N N   . THR D 1 96  ? 20.657  22.719  5.459   1.00 64.13  ? 92  THR D N   1 
ATOM   4168  C CA  . THR D 1 96  ? 21.387  22.588  4.203   1.00 73.11  ? 92  THR D CA  1 
ATOM   4169  C C   . THR D 1 96  ? 22.829  22.176  4.480   1.00 76.69  ? 92  THR D C   1 
ATOM   4170  O O   . THR D 1 96  ? 23.447  22.654  5.432   1.00 80.45  ? 92  THR D O   1 
ATOM   4171  C CB  . THR D 1 96  ? 21.381  23.905  3.408   1.00 75.61  ? 92  THR D CB  1 
ATOM   4172  O OG1 . THR D 1 96  ? 21.900  24.963  4.225   1.00 78.46  ? 92  THR D OG1 1 
ATOM   4173  C CG2 . THR D 1 96  ? 19.967  24.253  2.962   1.00 69.71  ? 92  THR D CG2 1 
ATOM   4174  N N   . LYS D 1 97  ? 23.361  21.287  3.648   1.00 67.84  ? 93  LYS D N   1 
ATOM   4175  C CA  . LYS D 1 97  ? 24.715  20.779  3.840   1.00 64.92  ? 93  LYS D CA  1 
ATOM   4176  C C   . LYS D 1 97  ? 25.766  21.866  3.636   1.00 75.11  ? 93  LYS D C   1 
ATOM   4177  O O   . LYS D 1 97  ? 25.547  22.828  2.899   1.00 73.58  ? 93  LYS D O   1 
ATOM   4178  C CB  . LYS D 1 97  ? 24.987  19.604  2.898   1.00 63.08  ? 93  LYS D CB  1 
ATOM   4179  C CG  . LYS D 1 97  ? 24.291  18.319  3.309   1.00 74.38  ? 93  LYS D CG  1 
ATOM   4180  C CD  . LYS D 1 97  ? 24.972  17.096  2.715   1.00 82.75  ? 93  LYS D CD  1 
ATOM   4181  C CE  . LYS D 1 97  ? 24.567  15.827  3.454   1.00 89.00  ? 93  LYS D CE  1 
ATOM   4182  N NZ  . LYS D 1 97  ? 23.971  14.801  2.553   1.00 82.06  ? 93  LYS D NZ  1 
ATOM   4183  N N   . ASP D 1 98  ? 26.908  21.700  4.297   1.00 80.23  ? 94  ASP D N   1 
ATOM   4184  C CA  . ASP D 1 98  ? 28.008  22.651  4.197   1.00 83.74  ? 94  ASP D CA  1 
ATOM   4185  C C   . ASP D 1 98  ? 29.336  21.922  4.014   1.00 87.31  ? 94  ASP D C   1 
ATOM   4186  O O   . ASP D 1 98  ? 30.280  22.464  3.436   1.00 84.38  ? 94  ASP D O   1 
ATOM   4187  C CB  . ASP D 1 98  ? 28.066  23.530  5.448   1.00 83.29  ? 94  ASP D CB  1 
ATOM   4188  C CG  . ASP D 1 98  ? 26.881  24.473  5.556   1.00 87.06  ? 94  ASP D CG  1 
ATOM   4189  O OD1 . ASP D 1 98  ? 26.362  24.904  4.503   1.00 86.34  ? 94  ASP D OD1 1 
ATOM   4190  O OD2 . ASP D 1 98  ? 26.470  24.786  6.694   1.00 78.68  ? 94  ASP D OD2 1 
ATOM   4191  N N   . LYS D 1 104 ? 33.872  16.935  12.256  1.00 86.08  ? 100 LYS D N   1 
ATOM   4192  C CA  . LYS D 1 104 ? 35.041  17.533  11.621  1.00 74.52  ? 100 LYS D CA  1 
ATOM   4193  C C   . LYS D 1 104 ? 35.602  18.679  12.464  1.00 89.45  ? 100 LYS D C   1 
ATOM   4194  O O   . LYS D 1 104 ? 36.304  18.449  13.451  1.00 76.03  ? 100 LYS D O   1 
ATOM   4195  C CB  . LYS D 1 104 ? 34.685  18.035  10.221  1.00 46.06  ? 100 LYS D CB  1 
ATOM   4196  N N   . ALA D 1 105 ? 35.279  19.910  12.077  1.00 107.26 ? 101 ALA D N   1 
ATOM   4197  C CA  . ALA D 1 105 ? 35.823  21.093  12.736  1.00 111.01 ? 101 ALA D CA  1 
ATOM   4198  C C   . ALA D 1 105 ? 34.857  21.627  13.788  1.00 98.86  ? 101 ALA D C   1 
ATOM   4199  O O   . ALA D 1 105 ? 33.661  21.348  13.742  1.00 101.37 ? 101 ALA D O   1 
ATOM   4200  C CB  . ALA D 1 105 ? 36.135  22.172  11.707  1.00 112.42 ? 101 ALA D CB  1 
ATOM   4201  N N   . CYS D 1 106 ? 35.394  22.395  14.732  1.00 87.00  ? 102 CYS D N   1 
ATOM   4202  C CA  . CYS D 1 106 ? 34.603  22.994  15.805  1.00 83.74  ? 102 CYS D CA  1 
ATOM   4203  C C   . CYS D 1 106 ? 34.091  21.947  16.793  1.00 82.40  ? 102 CYS D C   1 
ATOM   4204  O O   . CYS D 1 106 ? 33.256  22.247  17.647  1.00 83.35  ? 102 CYS D O   1 
ATOM   4205  C CB  . CYS D 1 106 ? 33.431  23.794  15.230  1.00 90.49  ? 102 CYS D CB  1 
ATOM   4206  S SG  . CYS D 1 106 ? 33.916  25.037  14.010  1.00 74.86  ? 102 CYS D SG  1 
ATOM   4207  N N   . VAL D 1 107 ? 34.608  20.726  16.687  1.00 87.77  ? 103 VAL D N   1 
ATOM   4208  C CA  . VAL D 1 107 ? 34.182  19.634  17.555  1.00 78.98  ? 103 VAL D CA  1 
ATOM   4209  C C   . VAL D 1 107 ? 35.260  19.328  18.590  1.00 71.64  ? 103 VAL D C   1 
ATOM   4210  O O   . VAL D 1 107 ? 36.449  19.317  18.273  1.00 91.08  ? 103 VAL D O   1 
ATOM   4211  C CB  . VAL D 1 107 ? 33.886  18.356  16.743  1.00 63.61  ? 103 VAL D CB  1 
ATOM   4212  C CG1 . VAL D 1 107 ? 33.355  17.261  17.652  1.00 39.04  ? 103 VAL D CG1 1 
ATOM   4213  C CG2 . VAL D 1 107 ? 32.896  18.650  15.622  1.00 59.72  ? 103 VAL D CG2 1 
ATOM   4214  N N   . ARG D 1 108 ? 34.840  19.085  19.827  1.00 48.40  ? 104 ARG D N   1 
ATOM   4215  C CA  . ARG D 1 108 ? 35.770  18.748  20.898  1.00 28.74  ? 104 ARG D CA  1 
ATOM   4216  C C   . ARG D 1 108 ? 35.199  17.643  21.772  1.00 54.52  ? 104 ARG D C   1 
ATOM   4217  O O   . ARG D 1 108 ? 33.987  17.431  21.808  1.00 76.86  ? 104 ARG D O   1 
ATOM   4218  C CB  . ARG D 1 108 ? 36.067  19.977  21.755  1.00 34.37  ? 104 ARG D CB  1 
ATOM   4219  N N   . THR D 1 109 ? 36.078  16.942  22.478  1.00 67.98  ? 105 THR D N   1 
ATOM   4220  C CA  . THR D 1 109 ? 35.663  15.852  23.351  1.00 77.13  ? 105 THR D CA  1 
ATOM   4221  C C   . THR D 1 109 ? 35.340  16.366  24.752  1.00 65.67  ? 105 THR D C   1 
ATOM   4222  O O   . THR D 1 109 ? 36.204  16.911  25.439  1.00 58.85  ? 105 THR D O   1 
ATOM   4223  C CB  . THR D 1 109 ? 36.753  14.769  23.446  1.00 91.76  ? 105 THR D CB  1 
ATOM   4224  O OG1 . THR D 1 109 ? 36.970  14.191  22.153  1.00 92.91  ? 105 THR D OG1 1 
ATOM   4225  C CG2 . THR D 1 109 ? 36.338  13.678  24.418  1.00 99.02  ? 105 THR D CG2 1 
ATOM   4226  N N   . PHE D 1 110 ? 34.090  16.186  25.165  1.00 63.43  ? 106 PHE D N   1 
ATOM   4227  C CA  . PHE D 1 110 ? 33.635  16.624  26.480  1.00 52.87  ? 106 PHE D CA  1 
ATOM   4228  C C   . PHE D 1 110 ? 33.737  15.503  27.507  1.00 57.40  ? 106 PHE D C   1 
ATOM   4229  O O   . PHE D 1 110 ? 33.594  14.327  27.175  1.00 65.62  ? 106 PHE D O   1 
ATOM   4230  C CB  . PHE D 1 110 ? 32.186  17.109  26.406  1.00 34.57  ? 106 PHE D CB  1 
ATOM   4231  C CG  . PHE D 1 110 ? 32.034  18.473  25.801  1.00 36.01  ? 106 PHE D CG  1 
ATOM   4232  C CD1 . PHE D 1 110 ? 32.318  18.689  24.465  1.00 23.08  ? 106 PHE D CD1 1 
ATOM   4233  C CD2 . PHE D 1 110 ? 31.600  19.541  26.571  1.00 52.57  ? 106 PHE D CD2 1 
ATOM   4234  C CE1 . PHE D 1 110 ? 32.178  19.949  23.908  1.00 17.91  ? 106 PHE D CE1 1 
ATOM   4235  C CE2 . PHE D 1 110 ? 31.454  20.800  26.019  1.00 36.72  ? 106 PHE D CE2 1 
ATOM   4236  C CZ  . PHE D 1 110 ? 31.745  21.004  24.686  1.00 15.17  ? 106 PHE D CZ  1 
ATOM   4237  N N   . TYR D 1 111 ? 33.985  15.880  28.756  1.00 53.67  ? 107 TYR D N   1 
ATOM   4238  C CA  . TYR D 1 111 ? 34.001  14.930  29.859  1.00 38.01  ? 107 TYR D CA  1 
ATOM   4239  C C   . TYR D 1 111 ? 33.099  15.464  30.966  1.00 44.44  ? 107 TYR D C   1 
ATOM   4240  O O   . TYR D 1 111 ? 33.566  16.067  31.933  1.00 55.29  ? 107 TYR D O   1 
ATOM   4241  C CB  . TYR D 1 111 ? 35.428  14.730  30.369  1.00 30.80  ? 107 TYR D CB  1 
ATOM   4242  C CG  . TYR D 1 111 ? 35.607  13.517  31.254  1.00 34.75  ? 107 TYR D CG  1 
ATOM   4243  C CD1 . TYR D 1 111 ? 35.305  12.244  30.787  1.00 29.85  ? 107 TYR D CD1 1 
ATOM   4244  C CD2 . TYR D 1 111 ? 36.078  13.644  32.554  1.00 28.16  ? 107 TYR D CD2 1 
ATOM   4245  C CE1 . TYR D 1 111 ? 35.472  11.132  31.588  1.00 26.60  ? 107 TYR D CE1 1 
ATOM   4246  C CE2 . TYR D 1 111 ? 36.248  12.537  33.363  1.00 25.69  ? 107 TYR D CE2 1 
ATOM   4247  C CZ  . TYR D 1 111 ? 35.942  11.284  32.875  1.00 31.62  ? 107 TYR D CZ  1 
ATOM   4248  O OH  . TYR D 1 111 ? 36.107  10.175  33.675  1.00 28.91  ? 107 TYR D OH  1 
ATOM   4249  N N   . GLU D 1 112 ? 31.798  15.244  30.806  1.00 35.83  ? 108 GLU D N   1 
ATOM   4250  C CA  . GLU D 1 112 ? 30.805  15.803  31.715  1.00 37.63  ? 108 GLU D CA  1 
ATOM   4251  C C   . GLU D 1 112 ? 29.850  14.726  32.214  1.00 49.35  ? 108 GLU D C   1 
ATOM   4252  O O   . GLU D 1 112 ? 29.896  13.585  31.757  1.00 56.04  ? 108 GLU D O   1 
ATOM   4253  C CB  . GLU D 1 112 ? 30.025  16.918  31.015  1.00 31.97  ? 108 GLU D CB  1 
ATOM   4254  C CG  . GLU D 1 112 ? 30.889  18.107  30.618  1.00 39.40  ? 108 GLU D CG  1 
ATOM   4255  C CD  . GLU D 1 112 ? 30.135  19.147  29.814  1.00 43.07  ? 108 GLU D CD  1 
ATOM   4256  O OE1 . GLU D 1 112 ? 30.630  20.290  29.712  1.00 52.26  ? 108 GLU D OE1 1 
ATOM   4257  O OE2 . GLU D 1 112 ? 29.056  18.823  29.276  1.00 42.16  ? 108 GLU D OE2 1 
ATOM   4258  N N   . THR D 1 113 ? 28.986  15.094  33.155  1.00 47.78  ? 109 THR D N   1 
ATOM   4259  C CA  . THR D 1 113 ? 28.039  14.147  33.729  1.00 39.89  ? 109 THR D CA  1 
ATOM   4260  C C   . THR D 1 113 ? 26.925  13.833  32.738  1.00 43.96  ? 109 THR D C   1 
ATOM   4261  O O   . THR D 1 113 ? 26.610  14.650  31.872  1.00 51.03  ? 109 THR D O   1 
ATOM   4262  C CB  . THR D 1 113 ? 27.410  14.688  35.028  1.00 42.60  ? 109 THR D CB  1 
ATOM   4263  O OG1 . THR D 1 113 ? 26.658  15.872  34.742  1.00 54.01  ? 109 THR D OG1 1 
ATOM   4264  C CG2 . THR D 1 113 ? 28.484  15.009  36.059  1.00 36.85  ? 109 THR D CG2 1 
ATOM   4265  N N   . PRO D 1 114 ? 26.325  12.640  32.862  1.00 43.25  ? 110 PRO D N   1 
ATOM   4266  C CA  . PRO D 1 114 ? 25.221  12.231  31.986  1.00 39.10  ? 110 PRO D CA  1 
ATOM   4267  C C   . PRO D 1 114 ? 24.098  13.265  31.926  1.00 31.57  ? 110 PRO D C   1 
ATOM   4268  O O   . PRO D 1 114 ? 23.433  13.387  30.899  1.00 40.84  ? 110 PRO D O   1 
ATOM   4269  C CB  . PRO D 1 114 ? 24.723  10.939  32.638  1.00 47.75  ? 110 PRO D CB  1 
ATOM   4270  C CG  . PRO D 1 114 ? 25.917  10.387  33.334  1.00 35.10  ? 110 PRO D CG  1 
ATOM   4271  C CD  . PRO D 1 114 ? 26.708  11.573  33.804  1.00 34.99  ? 110 PRO D CD  1 
ATOM   4272  N N   . LEU D 1 115 ? 23.900  14.008  33.010  1.00 46.52  ? 111 LEU D N   1 
ATOM   4273  C CA  . LEU D 1 115 ? 22.802  14.966  33.084  1.00 44.22  ? 111 LEU D CA  1 
ATOM   4274  C C   . LEU D 1 115 ? 23.156  16.256  32.348  1.00 46.67  ? 111 LEU D C   1 
ATOM   4275  O O   . LEU D 1 115 ? 22.284  16.910  31.778  1.00 55.42  ? 111 LEU D O   1 
ATOM   4276  C CB  . LEU D 1 115 ? 22.436  15.257  34.541  1.00 36.02  ? 111 LEU D CB  1 
ATOM   4277  C CG  . LEU D 1 115 ? 21.926  14.045  35.331  1.00 42.36  ? 111 LEU D CG  1 
ATOM   4278  C CD1 . LEU D 1 115 ? 23.063  13.318  36.048  1.00 43.89  ? 111 LEU D CD1 1 
ATOM   4279  C CD2 . LEU D 1 115 ? 20.846  14.455  36.320  1.00 29.88  ? 111 LEU D CD2 1 
ATOM   4280  N N   . GLN D 1 116 ? 24.435  16.617  32.359  1.00 48.41  ? 112 GLN D N   1 
ATOM   4281  C CA  . GLN D 1 116 ? 24.911  17.756  31.581  1.00 39.24  ? 112 GLN D CA  1 
ATOM   4282  C C   . GLN D 1 116 ? 24.838  17.443  30.091  1.00 48.94  ? 112 GLN D C   1 
ATOM   4283  O O   . GLN D 1 116 ? 24.665  18.341  29.267  1.00 48.42  ? 112 GLN D O   1 
ATOM   4284  C CB  . GLN D 1 116 ? 26.346  18.115  31.966  1.00 30.79  ? 112 GLN D CB  1 
ATOM   4285  C CG  . GLN D 1 116 ? 26.483  18.710  33.358  1.00 52.00  ? 112 GLN D CG  1 
ATOM   4286  C CD  . GLN D 1 116 ? 27.920  19.038  33.713  1.00 58.10  ? 112 GLN D CD  1 
ATOM   4287  O OE1 . GLN D 1 116 ? 28.508  18.422  34.601  1.00 50.14  ? 112 GLN D OE1 1 
ATOM   4288  N NE2 . GLN D 1 116 ? 28.493  20.016  33.019  1.00 66.85  ? 112 GLN D NE2 1 
ATOM   4289  N N   . LEU D 1 117 ? 24.976  16.166  29.748  1.00 44.66  ? 113 LEU D N   1 
ATOM   4290  C CA  . LEU D 1 117 ? 24.839  15.734  28.365  1.00 45.38  ? 113 LEU D CA  1 
ATOM   4291  C C   . LEU D 1 117 ? 23.380  15.806  27.926  1.00 51.46  ? 113 LEU D C   1 
ATOM   4292  O O   . LEU D 1 117 ? 23.075  16.274  26.829  1.00 41.61  ? 113 LEU D O   1 
ATOM   4293  C CB  . LEU D 1 117 ? 25.358  14.306  28.192  1.00 40.20  ? 113 LEU D CB  1 
ATOM   4294  C CG  . LEU D 1 117 ? 25.080  13.694  26.815  1.00 28.18  ? 113 LEU D CG  1 
ATOM   4295  C CD1 . LEU D 1 117 ? 25.715  14.542  25.728  1.00 35.12  ? 113 LEU D CD1 1 
ATOM   4296  C CD2 . LEU D 1 117 ? 25.576  12.261  26.735  1.00 13.35  ? 113 LEU D CD2 1 
ATOM   4297  N N   . LEU D 1 118 ? 22.483  15.337  28.788  1.00 60.56  ? 114 LEU D N   1 
ATOM   4298  C CA  . LEU D 1 118 ? 21.058  15.324  28.475  1.00 52.19  ? 114 LEU D CA  1 
ATOM   4299  C C   . LEU D 1 118 ? 20.496  16.739  28.382  1.00 40.57  ? 114 LEU D C   1 
ATOM   4300  O O   . LEU D 1 118 ? 19.663  17.026  27.521  1.00 30.79  ? 114 LEU D O   1 
ATOM   4301  C CB  . LEU D 1 118 ? 20.282  14.517  29.518  1.00 39.88  ? 114 LEU D CB  1 
ATOM   4302  C CG  . LEU D 1 118 ? 20.549  13.009  29.521  1.00 47.00  ? 114 LEU D CG  1 
ATOM   4303  C CD1 . LEU D 1 118 ? 19.823  12.336  30.676  1.00 40.81  ? 114 LEU D CD1 1 
ATOM   4304  C CD2 . LEU D 1 118 ? 20.138  12.384  28.195  1.00 46.01  ? 114 LEU D CD2 1 
ATOM   4305  N N   . GLU D 1 119 ? 20.951  17.620  29.268  1.00 44.02  ? 115 GLU D N   1 
ATOM   4306  C CA  A GLU D 1 119 ? 20.511  19.012  29.254  0.58 47.65  ? 115 GLU D CA  1 
ATOM   4307  C CA  B GLU D 1 119 ? 20.513  19.012  29.257  0.42 47.12  ? 115 GLU D CA  1 
ATOM   4308  C C   . GLU D 1 119 ? 20.997  19.721  27.997  1.00 47.87  ? 115 GLU D C   1 
ATOM   4309  O O   . GLU D 1 119 ? 20.274  20.525  27.408  1.00 49.29  ? 115 GLU D O   1 
ATOM   4310  C CB  A GLU D 1 119 ? 21.009  19.748  30.500  0.58 43.12  ? 115 GLU D CB  1 
ATOM   4311  C CB  B GLU D 1 119 ? 21.027  19.743  30.498  0.42 43.64  ? 115 GLU D CB  1 
ATOM   4312  C CG  A GLU D 1 119 ? 20.016  19.748  31.650  0.58 46.23  ? 115 GLU D CG  1 
ATOM   4313  C CG  B GLU D 1 119 ? 20.340  19.325  31.788  0.42 42.79  ? 115 GLU D CG  1 
ATOM   4314  C CD  A GLU D 1 119 ? 18.791  20.594  31.359  0.58 59.86  ? 115 GLU D CD  1 
ATOM   4315  C CD  B GLU D 1 119 ? 20.979  19.942  33.016  0.42 43.80  ? 115 GLU D CD  1 
ATOM   4316  O OE1 A GLU D 1 119 ? 18.890  21.513  30.518  0.58 68.28  ? 115 GLU D OE1 1 
ATOM   4317  O OE1 B GLU D 1 119 ? 22.076  20.526  32.886  0.42 52.79  ? 115 GLU D OE1 1 
ATOM   4318  O OE2 A GLU D 1 119 ? 17.730  20.339  31.966  0.58 59.90  ? 115 GLU D OE2 1 
ATOM   4319  O OE2 B GLU D 1 119 ? 20.382  19.846  34.110  0.42 32.52  ? 115 GLU D OE2 1 
ATOM   4320  N N   . LYS D 1 120 ? 22.226  19.421  27.589  1.00 36.63  ? 116 LYS D N   1 
ATOM   4321  C CA  . LYS D 1 120 ? 22.784  19.999  26.375  1.00 34.61  ? 116 LYS D CA  1 
ATOM   4322  C C   . LYS D 1 120 ? 21.929  19.614  25.175  1.00 35.20  ? 116 LYS D C   1 
ATOM   4323  O O   . LYS D 1 120 ? 21.606  20.455  24.338  1.00 40.20  ? 116 LYS D O   1 
ATOM   4324  C CB  . LYS D 1 120 ? 24.225  19.529  26.162  1.00 45.03  ? 116 LYS D CB  1 
ATOM   4325  C CG  . LYS D 1 120 ? 25.262  20.345  26.918  1.00 56.57  ? 116 LYS D CG  1 
ATOM   4326  C CD  . LYS D 1 120 ? 26.673  19.838  26.655  1.00 52.05  ? 116 LYS D CD  1 
ATOM   4327  C CE  . LYS D 1 120 ? 27.722  20.799  27.192  1.00 43.33  ? 116 LYS D CE  1 
ATOM   4328  N NZ  . LYS D 1 120 ? 27.592  21.028  28.660  1.00 42.78  ? 116 LYS D NZ  1 
ATOM   4329  N N   . VAL D 1 121 ? 21.558  18.340  25.098  1.00 29.87  ? 117 VAL D N   1 
ATOM   4330  C CA  . VAL D 1 121 ? 20.739  17.856  23.993  1.00 34.27  ? 117 VAL D CA  1 
ATOM   4331  C C   . VAL D 1 121 ? 19.356  18.493  24.041  1.00 35.67  ? 117 VAL D C   1 
ATOM   4332  O O   . VAL D 1 121 ? 18.822  18.909  23.012  1.00 43.48  ? 117 VAL D O   1 
ATOM   4333  C CB  . VAL D 1 121 ? 20.593  16.322  24.021  1.00 44.55  ? 117 VAL D CB  1 
ATOM   4334  C CG1 . VAL D 1 121 ? 19.604  15.860  22.956  1.00 43.00  ? 117 VAL D CG1 1 
ATOM   4335  C CG2 . VAL D 1 121 ? 21.948  15.657  23.819  1.00 42.89  ? 117 VAL D CG2 1 
ATOM   4336  N N   . LYS D 1 122 ? 18.783  18.570  25.238  1.00 31.77  ? 118 LYS D N   1 
ATOM   4337  C CA  . LYS D 1 122 ? 17.463  19.166  25.415  1.00 35.58  ? 118 LYS D CA  1 
ATOM   4338  C C   . LYS D 1 122 ? 17.450  20.586  24.877  1.00 38.09  ? 118 LYS D C   1 
ATOM   4339  O O   . LYS D 1 122 ? 16.532  20.980  24.157  1.00 45.61  ? 118 LYS D O   1 
ATOM   4340  C CB  . LYS D 1 122 ? 17.066  19.193  26.893  1.00 41.77  ? 118 LYS D CB  1 
ATOM   4341  C CG  . LYS D 1 122 ? 15.620  19.621  27.120  1.00 47.02  ? 118 LYS D CG  1 
ATOM   4342  C CD  . LYS D 1 122 ? 15.355  20.050  28.554  1.00 50.27  ? 118 LYS D CD  1 
ATOM   4343  C CE  . LYS D 1 122 ? 15.953  21.422  28.843  1.00 60.69  ? 118 LYS D CE  1 
ATOM   4344  N NZ  . LYS D 1 122 ? 15.508  21.968  30.157  1.00 52.75  ? 118 LYS D NZ  1 
ATOM   4345  N N   . ASN D 1 123 ? 18.473  21.353  25.238  1.00 41.18  ? 119 ASN D N   1 
ATOM   4346  C CA  . ASN D 1 123 ? 18.561  22.751  24.838  1.00 45.83  ? 119 ASN D CA  1 
ATOM   4347  C C   . ASN D 1 123 ? 18.712  22.905  23.332  1.00 32.25  ? 119 ASN D C   1 
ATOM   4348  O O   . ASN D 1 123 ? 18.227  23.875  22.753  1.00 55.99  ? 119 ASN D O   1 
ATOM   4349  C CB  . ASN D 1 123 ? 19.723  23.437  25.559  1.00 61.72  ? 119 ASN D CB  1 
ATOM   4350  C CG  . ASN D 1 123 ? 19.464  23.608  27.045  1.00 74.86  ? 119 ASN D CG  1 
ATOM   4351  O OD1 . ASN D 1 123 ? 18.351  23.935  27.459  1.00 76.19  ? 119 ASN D OD1 1 
ATOM   4352  N ND2 . ASN D 1 123 ? 20.492  23.381  27.856  1.00 69.65  ? 119 ASN D ND2 1 
ATOM   4353  N N   . VAL D 1 124 ? 19.382  21.951  22.698  1.00 24.41  ? 120 VAL D N   1 
ATOM   4354  C CA  . VAL D 1 124 ? 19.529  21.976  21.250  1.00 33.08  ? 120 VAL D CA  1 
ATOM   4355  C C   . VAL D 1 124 ? 18.156  21.873  20.600  1.00 34.56  ? 120 VAL D C   1 
ATOM   4356  O O   . VAL D 1 124 ? 17.786  22.708  19.776  1.00 41.35  ? 120 VAL D O   1 
ATOM   4357  C CB  . VAL D 1 124 ? 20.426  20.830  20.741  1.00 26.27  ? 120 VAL D CB  1 
ATOM   4358  C CG1 . VAL D 1 124 ? 20.326  20.701  19.226  1.00 30.69  ? 120 VAL D CG1 1 
ATOM   4359  C CG2 . VAL D 1 124 ? 21.868  21.060  21.162  1.00 22.18  ? 120 VAL D CG2 1 
ATOM   4360  N N   . PHE D 1 125 ? 17.400  20.849  20.981  1.00 22.45  ? 121 PHE D N   1 
ATOM   4361  C CA  . PHE D 1 125 ? 16.061  20.660  20.436  1.00 33.63  ? 121 PHE D CA  1 
ATOM   4362  C C   . PHE D 1 125 ? 15.156  21.835  20.792  1.00 41.47  ? 121 PHE D C   1 
ATOM   4363  O O   . PHE D 1 125 ? 14.358  22.285  19.972  1.00 54.91  ? 121 PHE D O   1 
ATOM   4364  C CB  . PHE D 1 125 ? 15.455  19.349  20.938  1.00 31.29  ? 121 PHE D CB  1 
ATOM   4365  C CG  . PHE D 1 125 ? 15.976  18.134  20.224  1.00 46.97  ? 121 PHE D CG  1 
ATOM   4366  C CD1 . PHE D 1 125 ? 15.537  17.825  18.948  1.00 37.56  ? 121 PHE D CD1 1 
ATOM   4367  C CD2 . PHE D 1 125 ? 16.906  17.303  20.826  1.00 47.08  ? 121 PHE D CD2 1 
ATOM   4368  C CE1 . PHE D 1 125 ? 16.013  16.714  18.288  1.00 36.33  ? 121 PHE D CE1 1 
ATOM   4369  C CE2 . PHE D 1 125 ? 17.385  16.189  20.169  1.00 29.22  ? 121 PHE D CE2 1 
ATOM   4370  C CZ  . PHE D 1 125 ? 16.938  15.894  18.899  1.00 35.10  ? 121 PHE D CZ  1 
ATOM   4371  N N   . ASN D 1 126 ? 15.293  22.333  22.016  1.00 54.57  ? 122 ASN D N   1 
ATOM   4372  C CA  . ASN D 1 126 ? 14.494  23.459  22.479  1.00 55.84  ? 122 ASN D CA  1 
ATOM   4373  C C   . ASN D 1 126 ? 14.799  24.712  21.663  1.00 59.33  ? 122 ASN D C   1 
ATOM   4374  O O   . ASN D 1 126 ? 13.898  25.331  21.097  1.00 64.27  ? 122 ASN D O   1 
ATOM   4375  C CB  . ASN D 1 126 ? 14.766  23.719  23.962  1.00 68.42  ? 122 ASN D CB  1 
ATOM   4376  C CG  . ASN D 1 126 ? 13.686  24.557  24.615  1.00 91.66  ? 122 ASN D CG  1 
ATOM   4377  O OD1 . ASN D 1 126 ? 12.529  24.538  24.194  1.00 93.03  ? 122 ASN D OD1 1 
ATOM   4378  N ND2 . ASN D 1 126 ? 14.060  25.300  25.652  1.00 105.02 ? 122 ASN D ND2 1 
ATOM   4379  N N   . GLU D 1 127 ? 16.076  25.078  21.608  1.00 48.98  ? 123 GLU D N   1 
ATOM   4380  C CA  . GLU D 1 127 ? 16.517  26.237  20.840  1.00 46.77  ? 123 GLU D CA  1 
ATOM   4381  C C   . GLU D 1 127 ? 16.184  26.075  19.364  1.00 46.78  ? 123 GLU D C   1 
ATOM   4382  O O   . GLU D 1 127 ? 15.770  27.026  18.702  1.00 62.97  ? 123 GLU D O   1 
ATOM   4383  C CB  . GLU D 1 127 ? 18.023  26.443  21.007  1.00 58.07  ? 123 GLU D CB  1 
ATOM   4384  C CG  . GLU D 1 127 ? 18.408  27.234  22.244  1.00 72.37  ? 123 GLU D CG  1 
ATOM   4385  C CD  . GLU D 1 127 ? 18.310  28.732  22.026  1.00 84.58  ? 123 GLU D CD  1 
ATOM   4386  O OE1 . GLU D 1 127 ? 19.320  29.338  21.609  1.00 98.52  ? 123 GLU D OE1 1 
ATOM   4387  O OE2 . GLU D 1 127 ? 17.224  29.301  22.266  1.00 75.33  ? 123 GLU D OE2 1 
ATOM   4388  N N   . THR D 1 128 ? 16.372  24.865  18.850  1.00 44.92  ? 124 THR D N   1 
ATOM   4389  C CA  . THR D 1 128 ? 16.123  24.588  17.442  1.00 35.12  ? 124 THR D CA  1 
ATOM   4390  C C   . THR D 1 128 ? 14.650  24.801  17.111  1.00 46.95  ? 124 THR D C   1 
ATOM   4391  O O   . THR D 1 128 ? 14.312  25.283  16.030  1.00 71.44  ? 124 THR D O   1 
ATOM   4392  C CB  . THR D 1 128 ? 16.532  23.150  17.070  1.00 38.23  ? 124 THR D CB  1 
ATOM   4393  O OG1 . THR D 1 128 ? 17.951  23.001  17.214  1.00 34.59  ? 124 THR D OG1 1 
ATOM   4394  C CG2 . THR D 1 128 ? 16.144  22.832  15.630  1.00 41.05  ? 124 THR D CG2 1 
ATOM   4395  N N   . LYS D 1 129 ? 13.776  24.448  18.048  1.00 44.11  ? 125 LYS D N   1 
ATOM   4396  C CA  . LYS D 1 129 ? 12.342  24.611  17.851  1.00 33.00  ? 125 LYS D CA  1 
ATOM   4397  C C   . LYS D 1 129 ? 11.949  26.081  17.871  1.00 46.66  ? 125 LYS D C   1 
ATOM   4398  O O   . LYS D 1 129 ? 11.065  26.501  17.126  1.00 70.89  ? 125 LYS D O   1 
ATOM   4399  C CB  . LYS D 1 129 ? 11.562  23.854  18.925  1.00 41.86  ? 125 LYS D CB  1 
ATOM   4400  C CG  . LYS D 1 129 ? 10.071  24.148  18.920  1.00 40.86  ? 125 LYS D CG  1 
ATOM   4401  C CD  . LYS D 1 129 ? 9.339   23.333  19.970  1.00 50.83  ? 125 LYS D CD  1 
ATOM   4402  C CE  . LYS D 1 129 ? 7.857   23.666  19.999  1.00 71.06  ? 125 LYS D CE  1 
ATOM   4403  N NZ  . LYS D 1 129 ? 7.597   25.032  20.531  1.00 90.02  ? 125 LYS D NZ  1 
ATOM   4404  N N   . ASN D 1 130 ? 12.606  26.862  18.725  1.00 40.11  ? 126 ASN D N   1 
ATOM   4405  C CA  . ASN D 1 130 ? 12.311  28.287  18.833  1.00 51.27  ? 126 ASN D CA  1 
ATOM   4406  C C   . ASN D 1 130 ? 12.565  29.028  17.526  1.00 47.12  ? 126 ASN D C   1 
ATOM   4407  O O   . ASN D 1 130 ? 11.793  29.906  17.144  1.00 59.89  ? 126 ASN D O   1 
ATOM   4408  C CB  . ASN D 1 130 ? 13.132  28.929  19.954  1.00 63.88  ? 126 ASN D CB  1 
ATOM   4409  C CG  . ASN D 1 130 ? 12.663  28.512  21.331  1.00 79.24  ? 126 ASN D CG  1 
ATOM   4410  O OD1 . ASN D 1 130 ? 11.526  28.074  21.506  1.00 81.77  ? 126 ASN D OD1 1 
ATOM   4411  N ND2 . ASN D 1 130 ? 13.537  28.654  22.322  1.00 84.21  ? 126 ASN D ND2 1 
ATOM   4412  N N   . LEU D 1 131 ? 13.649  28.674  16.843  1.00 30.00  ? 127 LEU D N   1 
ATOM   4413  C CA  . LEU D 1 131 ? 14.007  29.340  15.598  1.00 33.35  ? 127 LEU D CA  1 
ATOM   4414  C C   . LEU D 1 131 ? 13.182  28.806  14.437  1.00 38.33  ? 127 LEU D C   1 
ATOM   4415  O O   . LEU D 1 131 ? 12.853  29.548  13.511  1.00 49.98  ? 127 LEU D O   1 
ATOM   4416  C CB  . LEU D 1 131 ? 15.498  29.164  15.302  1.00 50.85  ? 127 LEU D CB  1 
ATOM   4417  C CG  . LEU D 1 131 ? 16.464  29.716  16.353  1.00 65.15  ? 127 LEU D CG  1 
ATOM   4418  C CD1 . LEU D 1 131 ? 17.893  29.674  15.828  1.00 53.84  ? 127 LEU D CD1 1 
ATOM   4419  C CD2 . LEU D 1 131 ? 16.081  31.132  16.771  1.00 62.52  ? 127 LEU D CD2 1 
ATOM   4420  N N   . LEU D 1 132 ? 12.847  27.520  14.487  1.00 37.23  ? 128 LEU D N   1 
ATOM   4421  C CA  . LEU D 1 132 ? 12.082  26.893  13.413  1.00 58.33  ? 128 LEU D CA  1 
ATOM   4422  C C   . LEU D 1 132 ? 10.652  27.421  13.348  1.00 57.05  ? 128 LEU D C   1 
ATOM   4423  O O   . LEU D 1 132 ? 10.149  27.738  12.270  1.00 65.15  ? 128 LEU D O   1 
ATOM   4424  C CB  . LEU D 1 132 ? 12.064  25.371  13.579  1.00 58.18  ? 128 LEU D CB  1 
ATOM   4425  C CG  . LEU D 1 132 ? 13.294  24.611  13.078  1.00 59.51  ? 128 LEU D CG  1 
ATOM   4426  C CD1 . LEU D 1 132 ? 13.112  23.116  13.288  1.00 63.18  ? 128 LEU D CD1 1 
ATOM   4427  C CD2 . LEU D 1 132 ? 13.567  24.911  11.610  1.00 54.52  ? 128 LEU D CD2 1 
ATOM   4428  N N   . ASP D 1 133 ? 10.001  27.514  14.503  1.00 44.74  ? 129 ASP D N   1 
ATOM   4429  C CA  . ASP D 1 133 ? 8.618   27.969  14.560  1.00 48.89  ? 129 ASP D CA  1 
ATOM   4430  C C   . ASP D 1 133 ? 8.498   29.396  14.041  1.00 49.84  ? 129 ASP D C   1 
ATOM   4431  O O   . ASP D 1 133 ? 7.471   29.777  13.479  1.00 59.35  ? 129 ASP D O   1 
ATOM   4432  C CB  . ASP D 1 133 ? 8.089   27.885  15.992  1.00 63.66  ? 129 ASP D CB  1 
ATOM   4433  C CG  . ASP D 1 133 ? 8.138   26.475  16.549  1.00 63.04  ? 129 ASP D CG  1 
ATOM   4434  O OD1 . ASP D 1 133 ? 8.148   25.518  15.746  1.00 55.24  ? 129 ASP D OD1 1 
ATOM   4435  O OD2 . ASP D 1 133 ? 8.168   26.326  17.790  1.00 55.50  ? 129 ASP D OD2 1 
ATOM   4436  N N   . LYS D 1 134 ? 9.557   30.177  14.229  1.00 47.83  ? 130 LYS D N   1 
ATOM   4437  C CA  . LYS D 1 134 ? 9.583   31.564  13.782  1.00 48.41  ? 130 LYS D CA  1 
ATOM   4438  C C   . LYS D 1 134 ? 10.020  31.657  12.323  1.00 51.28  ? 130 LYS D C   1 
ATOM   4439  O O   . LYS D 1 134 ? 9.486   32.456  11.555  1.00 56.31  ? 130 LYS D O   1 
ATOM   4440  C CB  . LYS D 1 134 ? 10.541  32.380  14.651  1.00 40.52  ? 130 LYS D CB  1 
ATOM   4441  C CG  . LYS D 1 134 ? 10.213  32.363  16.135  1.00 43.76  ? 130 LYS D CG  1 
ATOM   4442  C CD  . LYS D 1 134 ? 11.379  32.888  16.959  1.00 59.43  ? 130 LYS D CD  1 
ATOM   4443  C CE  . LYS D 1 134 ? 11.118  32.762  18.449  1.00 59.46  ? 130 LYS D CE  1 
ATOM   4444  N NZ  . LYS D 1 134 ? 12.338  33.052  19.249  1.00 57.85  ? 130 LYS D NZ  1 
ATOM   4445  N N   . ASP D 1 135 ? 10.993  30.832  11.949  1.00 46.00  ? 131 ASP D N   1 
ATOM   4446  C CA  . ASP D 1 135 ? 11.592  30.891  10.620  1.00 44.93  ? 131 ASP D CA  1 
ATOM   4447  C C   . ASP D 1 135 ? 11.953  29.487  10.140  1.00 53.81  ? 131 ASP D C   1 
ATOM   4448  O O   . ASP D 1 135 ? 12.933  28.899  10.597  1.00 64.43  ? 131 ASP D O   1 
ATOM   4449  C CB  . ASP D 1 135 ? 12.841  31.772  10.662  1.00 36.41  ? 131 ASP D CB  1 
ATOM   4450  C CG  . ASP D 1 135 ? 13.403  32.056  9.289   1.00 46.24  ? 131 ASP D CG  1 
ATOM   4451  O OD1 . ASP D 1 135 ? 13.097  31.297  8.346   1.00 60.14  ? 131 ASP D OD1 1 
ATOM   4452  O OD2 . ASP D 1 135 ? 14.156  33.043  9.154   1.00 42.18  ? 131 ASP D OD2 1 
ATOM   4453  N N   . TRP D 1 136 ? 11.160  28.954  9.214   1.00 48.68  ? 132 TRP D N   1 
ATOM   4454  C CA  . TRP D 1 136 ? 11.346  27.577  8.748   1.00 64.96  ? 132 TRP D CA  1 
ATOM   4455  C C   . TRP D 1 136 ? 12.562  27.385  7.829   1.00 66.87  ? 132 TRP D C   1 
ATOM   4456  O O   . TRP D 1 136 ? 12.981  26.252  7.590   1.00 61.02  ? 132 TRP D O   1 
ATOM   4457  C CB  . TRP D 1 136 ? 10.073  27.038  8.060   1.00 70.05  ? 132 TRP D CB  1 
ATOM   4458  C CG  . TRP D 1 136 ? 9.212   28.083  7.387   1.00 83.15  ? 132 TRP D CG  1 
ATOM   4459  C CD1 . TRP D 1 136 ? 7.936   28.444  7.723   1.00 97.54  ? 132 TRP D CD1 1 
ATOM   4460  C CD2 . TRP D 1 136 ? 9.574   28.898  6.268   1.00 87.05  ? 132 TRP D CD2 1 
ATOM   4461  N NE1 . TRP D 1 136 ? 7.487   29.431  6.881   1.00 103.01 ? 132 TRP D NE1 1 
ATOM   4462  C CE2 . TRP D 1 136 ? 8.474   29.729  5.979   1.00 98.70  ? 132 TRP D CE2 1 
ATOM   4463  C CE3 . TRP D 1 136 ? 10.722  29.008  5.484   1.00 85.58  ? 132 TRP D CE3 1 
ATOM   4464  C CZ2 . TRP D 1 136 ? 8.491   30.654  4.938   1.00 104.53 ? 132 TRP D CZ2 1 
ATOM   4465  C CZ3 . TRP D 1 136 ? 10.738  29.925  4.452   1.00 88.20  ? 132 TRP D CZ3 1 
ATOM   4466  C CH2 . TRP D 1 136 ? 9.631   30.736  4.189   1.00 100.19 ? 132 TRP D CH2 1 
ATOM   4467  N N   . ASN D 1 137 ? 13.133  28.479  7.330   1.00 65.39  ? 133 ASN D N   1 
ATOM   4468  C CA  . ASN D 1 137 ? 14.234  28.393  6.370   1.00 68.93  ? 133 ASN D CA  1 
ATOM   4469  C C   . ASN D 1 137 ? 15.559  28.892  6.944   1.00 74.85  ? 133 ASN D C   1 
ATOM   4470  O O   . ASN D 1 137 ? 16.586  28.879  6.264   1.00 82.99  ? 133 ASN D O   1 
ATOM   4471  C CB  . ASN D 1 137 ? 13.882  29.174  5.098   1.00 69.83  ? 133 ASN D CB  1 
ATOM   4472  C CG  . ASN D 1 137 ? 14.970  29.111  4.049   1.00 86.81  ? 133 ASN D CG  1 
ATOM   4473  O OD1 . ASN D 1 137 ? 15.832  29.986  3.973   1.00 94.49  ? 133 ASN D OD1 1 
ATOM   4474  N ND2 . ASN D 1 137 ? 14.931  28.072  3.225   1.00 90.58  ? 133 ASN D ND2 1 
ATOM   4475  N N   . ILE D 1 138 ? 15.541  29.313  8.204   1.00 60.14  ? 134 ILE D N   1 
ATOM   4476  C CA  . ILE D 1 138 ? 16.722  29.902  8.824   1.00 47.66  ? 134 ILE D CA  1 
ATOM   4477  C C   . ILE D 1 138 ? 17.946  28.996  8.707   1.00 47.67  ? 134 ILE D C   1 
ATOM   4478  O O   . ILE D 1 138 ? 19.069  29.478  8.555   1.00 50.83  ? 134 ILE D O   1 
ATOM   4479  C CB  . ILE D 1 138 ? 16.475  30.222  10.309  1.00 52.36  ? 134 ILE D CB  1 
ATOM   4480  C CG1 . ILE D 1 138 ? 17.668  30.984  10.887  1.00 65.54  ? 134 ILE D CG1 1 
ATOM   4481  C CG2 . ILE D 1 138 ? 16.224  28.945  11.097  1.00 55.21  ? 134 ILE D CG2 1 
ATOM   4482  C CD1 . ILE D 1 138 ? 17.411  31.564  12.256  1.00 79.23  ? 134 ILE D CD1 1 
ATOM   4483  N N   . PHE D 1 139 ? 17.730  27.686  8.758   1.00 59.63  ? 135 PHE D N   1 
ATOM   4484  C CA  . PHE D 1 139 ? 18.839  26.736  8.744   1.00 56.67  ? 135 PHE D CA  1 
ATOM   4485  C C   . PHE D 1 139 ? 19.263  26.356  7.329   1.00 58.85  ? 135 PHE D C   1 
ATOM   4486  O O   . PHE D 1 139 ? 19.795  25.270  7.100   1.00 59.34  ? 135 PHE D O   1 
ATOM   4487  C CB  . PHE D 1 139 ? 18.489  25.485  9.553   1.00 54.93  ? 135 PHE D CB  1 
ATOM   4488  C CG  . PHE D 1 139 ? 18.396  25.731  11.034  1.00 53.11  ? 135 PHE D CG  1 
ATOM   4489  C CD1 . PHE D 1 139 ? 19.473  26.256  11.731  1.00 39.49  ? 135 PHE D CD1 1 
ATOM   4490  C CD2 . PHE D 1 139 ? 17.237  25.431  11.730  1.00 49.78  ? 135 PHE D CD2 1 
ATOM   4491  C CE1 . PHE D 1 139 ? 19.393  26.483  13.092  1.00 34.87  ? 135 PHE D CE1 1 
ATOM   4492  C CE2 . PHE D 1 139 ? 17.151  25.655  13.093  1.00 38.04  ? 135 PHE D CE2 1 
ATOM   4493  C CZ  . PHE D 1 139 ? 18.231  26.182  13.774  1.00 37.91  ? 135 PHE D CZ  1 
ATOM   4494  N N   . SER D 1 140 ? 19.022  27.257  6.384   1.00 62.70  ? 136 SER D N   1 
ATOM   4495  C CA  . SER D 1 140 ? 19.540  27.110  5.033   1.00 57.56  ? 136 SER D CA  1 
ATOM   4496  C C   . SER D 1 140 ? 20.778  27.985  4.878   1.00 58.17  ? 136 SER D C   1 
ATOM   4497  O O   . SER D 1 140 ? 21.515  27.871  3.899   1.00 54.85  ? 136 SER D O   1 
ATOM   4498  C CB  . SER D 1 140 ? 18.483  27.519  4.010   1.00 60.39  ? 136 SER D CB  1 
ATOM   4499  O OG  . SER D 1 140 ? 18.116  28.875  4.185   1.00 69.49  ? 136 SER D OG  1 
ATOM   4500  N N   . LYS D 1 141 ? 21.000  28.860  5.855   1.00 72.88  ? 137 LYS D N   1 
ATOM   4501  C CA  . LYS D 1 141 ? 22.144  29.763  5.839   1.00 81.03  ? 137 LYS D CA  1 
ATOM   4502  C C   . LYS D 1 141 ? 23.449  29.015  5.585   1.00 81.16  ? 137 LYS D C   1 
ATOM   4503  O O   . LYS D 1 141 ? 23.658  27.918  6.102   1.00 82.31  ? 137 LYS D O   1 
ATOM   4504  C CB  . LYS D 1 141 ? 22.238  30.521  7.164   1.00 72.21  ? 137 LYS D CB  1 
ATOM   4505  C CG  . LYS D 1 141 ? 23.623  31.080  7.446   1.00 67.52  ? 137 LYS D CG  1 
ATOM   4506  C CD  . LYS D 1 141 ? 23.627  31.999  8.655   1.00 57.72  ? 137 LYS D CD  1 
ATOM   4507  C CE  . LYS D 1 141 ? 25.046  32.364  9.063   1.00 40.73  ? 137 LYS D CE  1 
ATOM   4508  N NZ  . LYS D 1 141 ? 25.074  33.332  10.191  1.00 40.81  ? 137 LYS D NZ  1 
ATOM   4509  N N   . ASN D 1 142 ? 24.324  29.621  4.788   1.00 78.92  ? 138 ASN D N   1 
ATOM   4510  C CA  . ASN D 1 142 ? 25.632  29.044  4.508   1.00 81.68  ? 138 ASN D CA  1 
ATOM   4511  C C   . ASN D 1 142 ? 26.604  29.348  5.641   1.00 77.53  ? 138 ASN D C   1 
ATOM   4512  O O   . ASN D 1 142 ? 26.978  30.501  5.858   1.00 79.24  ? 138 ASN D O   1 
ATOM   4513  C CB  . ASN D 1 142 ? 26.182  29.588  3.189   1.00 82.56  ? 138 ASN D CB  1 
ATOM   4514  C CG  . ASN D 1 142 ? 27.476  28.915  2.774   1.00 81.43  ? 138 ASN D CG  1 
ATOM   4515  O OD1 . ASN D 1 142 ? 28.562  29.336  3.171   1.00 89.00  ? 138 ASN D OD1 1 
ATOM   4516  N ND2 . ASN D 1 142 ? 27.365  27.866  1.967   1.00 76.23  ? 138 ASN D ND2 1 
ATOM   4517  N N   . CYS D 1 143 ? 27.011  28.309  6.363   1.00 72.83  ? 139 CYS D N   1 
ATOM   4518  C CA  . CYS D 1 143 ? 27.873  28.480  7.525   1.00 76.22  ? 139 CYS D CA  1 
ATOM   4519  C C   . CYS D 1 143 ? 29.321  28.101  7.230   1.00 69.81  ? 139 CYS D C   1 
ATOM   4520  O O   . CYS D 1 143 ? 30.090  27.815  8.147   1.00 65.46  ? 139 CYS D O   1 
ATOM   4521  C CB  . CYS D 1 143 ? 27.342  27.653  8.698   1.00 83.23  ? 139 CYS D CB  1 
ATOM   4522  S SG  . CYS D 1 143 ? 25.701  28.158  9.268   1.00 65.45  ? 139 CYS D SG  1 
ATOM   4523  N N   . ASN D 1 144 ? 29.696  28.107  5.955   1.00 73.24  ? 140 ASN D N   1 
ATOM   4524  C CA  . ASN D 1 144 ? 31.072  27.810  5.578   1.00 72.14  ? 140 ASN D CA  1 
ATOM   4525  C C   . ASN D 1 144 ? 32.034  28.820  6.195   1.00 55.72  ? 140 ASN D C   1 
ATOM   4526  O O   . ASN D 1 144 ? 33.115  28.459  6.655   1.00 54.49  ? 140 ASN D O   1 
ATOM   4527  C CB  . ASN D 1 144 ? 31.231  27.795  4.055   1.00 75.51  ? 140 ASN D CB  1 
ATOM   4528  C CG  . ASN D 1 144 ? 30.518  26.624  3.403   1.00 71.14  ? 140 ASN D CG  1 
ATOM   4529  O OD1 . ASN D 1 144 ? 29.686  26.806  2.515   1.00 71.67  ? 140 ASN D OD1 1 
ATOM   4530  N ND2 . ASN D 1 144 ? 30.847  25.412  3.838   1.00 60.32  ? 140 ASN D ND2 1 
ATOM   4531  N N   . ASN D 1 145 ? 31.628  30.085  6.208   1.00 59.61  ? 141 ASN D N   1 
ATOM   4532  C CA  . ASN D 1 145 ? 32.446  31.147  6.782   1.00 81.33  ? 141 ASN D CA  1 
ATOM   4533  C C   . ASN D 1 145 ? 32.566  31.002  8.295   1.00 84.52  ? 141 ASN D C   1 
ATOM   4534  O O   . ASN D 1 145 ? 33.635  31.216  8.867   1.00 83.96  ? 141 ASN D O   1 
ATOM   4535  C CB  . ASN D 1 145 ? 31.853  32.516  6.441   1.00 93.61  ? 141 ASN D CB  1 
ATOM   4536  C CG  . ASN D 1 145 ? 31.815  32.780  4.948   1.00 114.29 ? 141 ASN D CG  1 
ATOM   4537  O OD1 . ASN D 1 145 ? 32.042  31.880  4.140   1.00 123.41 ? 141 ASN D OD1 1 
ATOM   4538  N ND2 . ASN D 1 145 ? 31.522  34.021  4.574   1.00 121.47 ? 141 ASN D ND2 1 
ATOM   4539  N N   . SER D 1 146 ? 31.462  30.631  8.936   1.00 80.57  ? 142 SER D N   1 
ATOM   4540  C CA  . SER D 1 146 ? 31.421  30.492  10.388  1.00 65.97  ? 142 SER D CA  1 
ATOM   4541  C C   . SER D 1 146 ? 32.220  29.272  10.848  1.00 60.00  ? 142 SER D C   1 
ATOM   4542  O O   . SER D 1 146 ? 32.883  29.312  11.884  1.00 60.65  ? 142 SER D O   1 
ATOM   4543  C CB  . SER D 1 146 ? 29.972  30.382  10.867  1.00 67.78  ? 142 SER D CB  1 
ATOM   4544  O OG  . SER D 1 146 ? 29.180  31.432  10.340  1.00 67.23  ? 142 SER D OG  1 
ATOM   4545  N N   . PHE D 1 147 ? 32.151  28.190  10.077  1.00 54.84  ? 143 PHE D N   1 
ATOM   4546  C CA  . PHE D 1 147 ? 32.929  26.989  10.369  1.00 68.14  ? 143 PHE D CA  1 
ATOM   4547  C C   . PHE D 1 147 ? 34.404  27.231  10.075  1.00 75.00  ? 143 PHE D C   1 
ATOM   4548  O O   . PHE D 1 147 ? 35.277  26.817  10.837  1.00 73.89  ? 143 PHE D O   1 
ATOM   4549  C CB  . PHE D 1 147 ? 32.436  25.799  9.537   1.00 74.50  ? 143 PHE D CB  1 
ATOM   4550  C CG  . PHE D 1 147 ? 31.051  25.326  9.894   1.00 78.12  ? 143 PHE D CG  1 
ATOM   4551  C CD1 . PHE D 1 147 ? 30.426  25.748  11.057  1.00 77.42  ? 143 PHE D CD1 1 
ATOM   4552  C CD2 . PHE D 1 147 ? 30.375  24.447  9.061   1.00 79.99  ? 143 PHE D CD2 1 
ATOM   4553  C CE1 . PHE D 1 147 ? 29.155  25.307  11.376  1.00 78.28  ? 143 PHE D CE1 1 
ATOM   4554  C CE2 . PHE D 1 147 ? 29.104  24.003  9.379   1.00 73.63  ? 143 PHE D CE2 1 
ATOM   4555  C CZ  . PHE D 1 147 ? 28.495  24.434  10.537  1.00 72.11  ? 143 PHE D CZ  1 
ATOM   4556  N N   . ALA D 1 148 ? 34.673  27.904  8.961   1.00 87.87  ? 144 ALA D N   1 
ATOM   4557  C CA  . ALA D 1 148 ? 36.042  28.171  8.532   1.00 89.25  ? 144 ALA D CA  1 
ATOM   4558  C C   . ALA D 1 148 ? 36.814  28.974  9.575   1.00 89.00  ? 144 ALA D C   1 
ATOM   4559  O O   . ALA D 1 148 ? 38.045  28.988  9.571   1.00 95.35  ? 144 ALA D O   1 
ATOM   4560  C CB  . ALA D 1 148 ? 36.040  28.906  7.200   1.00 89.73  ? 144 ALA D CB  1 
ATOM   4561  N N   . GLU D 1 149 ? 36.088  29.642  10.465  1.00 76.61  ? 145 GLU D N   1 
ATOM   4562  C CA  . GLU D 1 149 ? 36.712  30.458  11.499  1.00 62.51  ? 145 GLU D CA  1 
ATOM   4563  C C   . GLU D 1 149 ? 36.881  29.682  12.803  1.00 72.13  ? 145 GLU D C   1 
ATOM   4564  O O   . GLU D 1 149 ? 36.815  30.258  13.888  1.00 83.99  ? 145 GLU D O   1 
ATOM   4565  C CB  . GLU D 1 149 ? 35.885  31.722  11.735  1.00 60.83  ? 145 GLU D CB  1 
ATOM   4566  C CG  . GLU D 1 149 ? 35.858  32.662  10.539  1.00 76.08  ? 145 GLU D CG  1 
ATOM   4567  C CD  . GLU D 1 149 ? 34.820  33.757  10.675  1.00 81.08  ? 145 GLU D CD  1 
ATOM   4568  O OE1 . GLU D 1 149 ? 35.199  34.895  11.022  1.00 90.29  ? 145 GLU D OE1 1 
ATOM   4569  O OE2 . GLU D 1 149 ? 33.627  33.482  10.427  1.00 74.92  ? 145 GLU D OE2 1 
ATOM   4570  N N   . CYS D 1 150 ? 37.095  28.373  12.690  1.00 74.59  ? 146 CYS D N   1 
ATOM   4571  C CA  . CYS D 1 150 ? 37.361  27.532  13.853  1.00 81.65  ? 146 CYS D CA  1 
ATOM   4572  C C   . CYS D 1 150 ? 38.781  26.977  13.809  1.00 81.83  ? 146 CYS D C   1 
ATOM   4573  O O   . CYS D 1 150 ? 39.293  26.475  14.811  1.00 82.13  ? 146 CYS D O   1 
ATOM   4574  C CB  . CYS D 1 150 ? 36.355  26.381  13.924  1.00 80.88  ? 146 CYS D CB  1 
ATOM   4575  S SG  . CYS D 1 150 ? 34.680  26.881  14.390  1.00 96.71  ? 146 CYS D SG  1 
ATOM   4576  N N   . VAL E 1 7   ? -12.595 23.745  -21.730 1.00 130.16 ? 3   VAL E N   1 
ATOM   4577  C CA  . VAL E 1 7   ? -13.196 23.907  -20.411 1.00 132.68 ? 3   VAL E CA  1 
ATOM   4578  C C   . VAL E 1 7   ? -14.623 24.438  -20.534 1.00 133.63 ? 3   VAL E C   1 
ATOM   4579  O O   . VAL E 1 7   ? -14.834 25.640  -20.697 1.00 133.60 ? 3   VAL E O   1 
ATOM   4580  C CB  . VAL E 1 7   ? -12.375 24.875  -19.534 1.00 127.05 ? 3   VAL E CB  1 
ATOM   4581  C CG1 . VAL E 1 7   ? -12.990 24.990  -18.145 1.00 125.58 ? 3   VAL E CG1 1 
ATOM   4582  C CG2 . VAL E 1 7   ? -10.923 24.420  -19.445 1.00 122.14 ? 3   VAL E CG2 1 
ATOM   4583  N N   . SER E 1 8   ? -15.599 23.538  -20.457 1.00 132.88 ? 4   SER E N   1 
ATOM   4584  C CA  . SER E 1 8   ? -17.004 23.922  -20.544 1.00 129.27 ? 4   SER E CA  1 
ATOM   4585  C C   . SER E 1 8   ? -17.477 24.559  -19.238 1.00 124.38 ? 4   SER E C   1 
ATOM   4586  O O   . SER E 1 8   ? -16.666 24.997  -18.425 1.00 127.59 ? 4   SER E O   1 
ATOM   4587  C CB  . SER E 1 8   ? -17.868 22.708  -20.885 1.00 124.43 ? 4   SER E CB  1 
ATOM   4588  O OG  . SER E 1 8   ? -19.183 23.114  -21.231 1.00 120.09 ? 4   SER E OG  1 
ATOM   4589  N N   . GLU E 1 9   ? -18.791 24.592  -19.036 1.00 114.99 ? 5   GLU E N   1 
ATOM   4590  C CA  . GLU E 1 9   ? -19.375 25.299  -17.901 1.00 109.07 ? 5   GLU E CA  1 
ATOM   4591  C C   . GLU E 1 9   ? -19.862 24.311  -16.850 1.00 115.44 ? 5   GLU E C   1 
ATOM   4592  O O   . GLU E 1 9   ? -20.091 24.675  -15.695 1.00 121.24 ? 5   GLU E O   1 
ATOM   4593  C CB  . GLU E 1 9   ? -20.539 26.168  -18.369 1.00 102.44 ? 5   GLU E CB  1 
ATOM   4594  C CG  . GLU E 1 9   ? -20.217 27.033  -19.576 1.00 104.49 ? 5   GLU E CG  1 
ATOM   4595  C CD  . GLU E 1 9   ? -21.393 27.159  -20.525 1.00 108.99 ? 5   GLU E CD  1 
ATOM   4596  O OE1 . GLU E 1 9   ? -22.546 27.000  -20.069 1.00 108.94 ? 5   GLU E OE1 1 
ATOM   4597  O OE2 . GLU E 1 9   ? -21.164 27.409  -21.728 1.00 110.09 ? 5   GLU E OE2 1 
ATOM   4598  N N   . TYR E 1 10  ? -20.012 23.055  -17.258 1.00 111.41 ? 6   TYR E N   1 
ATOM   4599  C CA  . TYR E 1 10  ? -20.485 22.005  -16.366 1.00 104.92 ? 6   TYR E CA  1 
ATOM   4600  C C   . TYR E 1 10  ? -19.591 21.869  -15.136 1.00 90.03  ? 6   TYR E C   1 
ATOM   4601  O O   . TYR E 1 10  ? -19.975 21.246  -14.146 1.00 89.19  ? 6   TYR E O   1 
ATOM   4602  C CB  . TYR E 1 10  ? -20.551 20.671  -17.113 1.00 103.45 ? 6   TYR E CB  1 
ATOM   4603  N N   . CYS E 1 11  ? -18.400 22.455  -15.201 1.00 72.50  ? 7   CYS E N   1 
ATOM   4604  C CA  . CYS E 1 11  ? -17.453 22.399  -14.094 1.00 78.97  ? 7   CYS E CA  1 
ATOM   4605  C C   . CYS E 1 11  ? -18.001 23.039  -12.817 1.00 87.72  ? 7   CYS E C   1 
ATOM   4606  O O   . CYS E 1 11  ? -17.456 22.833  -11.731 1.00 76.51  ? 7   CYS E O   1 
ATOM   4607  C CB  . CYS E 1 11  ? -16.145 23.079  -14.501 1.00 79.66  ? 7   CYS E CB  1 
ATOM   4608  S SG  . CYS E 1 11  ? -15.397 22.384  -15.995 1.00 91.10  ? 7   CYS E SG  1 
ATOM   4609  N N   . SER E 1 12  ? -19.076 23.812  -12.947 1.00 94.61  ? 8   SER E N   1 
ATOM   4610  C CA  . SER E 1 12  ? -19.665 24.505  -11.805 1.00 90.75  ? 8   SER E CA  1 
ATOM   4611  C C   . SER E 1 12  ? -20.363 23.554  -10.840 1.00 95.89  ? 8   SER E C   1 
ATOM   4612  O O   . SER E 1 12  ? -20.357 23.770  -9.627  1.00 98.55  ? 8   SER E O   1 
ATOM   4613  C CB  . SER E 1 12  ? -20.654 25.566  -12.287 1.00 84.27  ? 8   SER E CB  1 
ATOM   4614  O OG  . SER E 1 12  ? -19.959 26.643  -12.887 1.00 85.63  ? 8   SER E OG  1 
ATOM   4615  N N   . HIS E 1 13  ? -20.954 22.497  -11.383 1.00 94.31  ? 9   HIS E N   1 
ATOM   4616  C CA  . HIS E 1 13  ? -21.775 21.591  -10.591 1.00 90.28  ? 9   HIS E CA  1 
ATOM   4617  C C   . HIS E 1 13  ? -21.076 20.252  -10.367 1.00 78.63  ? 9   HIS E C   1 
ATOM   4618  O O   . HIS E 1 13  ? -21.729 19.242  -10.105 1.00 78.76  ? 9   HIS E O   1 
ATOM   4619  C CB  . HIS E 1 13  ? -23.120 21.368  -11.287 1.00 101.08 ? 9   HIS E CB  1 
ATOM   4620  C CG  . HIS E 1 13  ? -23.671 22.596  -11.940 1.00 114.03 ? 9   HIS E CG  1 
ATOM   4621  N ND1 . HIS E 1 13  ? -24.622 23.399  -11.340 1.00 113.44 ? 9   HIS E ND1 1 
ATOM   4622  C CD2 . HIS E 1 13  ? -23.407 23.167  -13.139 1.00 119.52 ? 9   HIS E CD2 1 
ATOM   4623  C CE1 . HIS E 1 13  ? -24.917 24.403  -12.141 1.00 112.39 ? 9   HIS E CE1 1 
ATOM   4624  N NE2 . HIS E 1 13  ? -24.192 24.288  -13.243 1.00 116.73 ? 9   HIS E NE2 1 
ATOM   4625  N N   . MET E 1 14  ? -19.750 20.249  -10.468 1.00 70.08  ? 10  MET E N   1 
ATOM   4626  C CA  . MET E 1 14  ? -18.969 19.033  -10.262 1.00 62.24  ? 10  MET E CA  1 
ATOM   4627  C C   . MET E 1 14  ? -18.935 18.653  -8.787  1.00 58.52  ? 10  MET E C   1 
ATOM   4628  O O   . MET E 1 14  ? -19.401 17.581  -8.401  1.00 52.01  ? 10  MET E O   1 
ATOM   4629  C CB  . MET E 1 14  ? -17.540 19.222  -10.776 1.00 59.30  ? 10  MET E CB  1 
ATOM   4630  C CG  . MET E 1 14  ? -17.429 19.235  -12.286 1.00 54.35  ? 10  MET E CG  1 
ATOM   4631  S SD  . MET E 1 14  ? -17.742 17.617  -13.019 1.00 87.74  ? 10  MET E SD  1 
ATOM   4632  C CE  . MET E 1 14  ? -17.815 18.050  -14.757 1.00 85.25  ? 10  MET E CE  1 
ATOM   4633  N N   . ILE E 1 15  ? -18.383 19.541  -7.968  1.00 66.69  ? 11  ILE E N   1 
ATOM   4634  C CA  . ILE E 1 15  ? -18.221 19.275  -6.545  1.00 61.56  ? 11  ILE E CA  1 
ATOM   4635  C C   . ILE E 1 15  ? -19.472 19.676  -5.772  1.00 55.18  ? 11  ILE E C   1 
ATOM   4636  O O   . ILE E 1 15  ? -19.665 20.848  -5.452  1.00 60.07  ? 11  ILE E O   1 
ATOM   4637  C CB  . ILE E 1 15  ? -17.019 20.041  -5.965  1.00 50.57  ? 11  ILE E CB  1 
ATOM   4638  C CG1 . ILE E 1 15  ? -15.771 19.800  -6.820  1.00 50.67  ? 11  ILE E CG1 1 
ATOM   4639  C CG2 . ILE E 1 15  ? -16.776 19.619  -4.523  1.00 53.41  ? 11  ILE E CG2 1 
ATOM   4640  C CD1 . ILE E 1 15  ? -14.561 20.606  -6.388  1.00 44.10  ? 11  ILE E CD1 1 
ATOM   4641  N N   . GLY E 1 16  ? -20.321 18.697  -5.479  1.00 42.12  ? 12  GLY E N   1 
ATOM   4642  C CA  . GLY E 1 16  ? -21.528 18.939  -4.712  1.00 56.97  ? 12  GLY E CA  1 
ATOM   4643  C C   . GLY E 1 16  ? -21.265 18.851  -3.221  1.00 65.35  ? 12  GLY E C   1 
ATOM   4644  O O   . GLY E 1 16  ? -20.167 18.489  -2.797  1.00 62.95  ? 12  GLY E O   1 
ATOM   4645  N N   . SER E 1 17  ? -22.275 19.184  -2.424  1.00 62.65  ? 13  SER E N   1 
ATOM   4646  C CA  . SER E 1 17  ? -22.158 19.120  -0.972  1.00 61.64  ? 13  SER E CA  1 
ATOM   4647  C C   . SER E 1 17  ? -21.905 17.689  -0.509  1.00 52.37  ? 13  SER E C   1 
ATOM   4648  O O   . SER E 1 17  ? -21.200 17.461  0.474   1.00 34.31  ? 13  SER E O   1 
ATOM   4649  C CB  . SER E 1 17  ? -23.429 19.658  -0.314  1.00 75.48  ? 13  SER E CB  1 
ATOM   4650  O OG  . SER E 1 17  ? -23.655 21.011  -0.667  1.00 88.85  ? 13  SER E OG  1 
ATOM   4651  N N   . GLY E 1 18  ? -22.485 16.729  -1.222  1.00 44.02  ? 14  GLY E N   1 
ATOM   4652  C CA  . GLY E 1 18  ? -22.334 15.326  -0.882  1.00 42.20  ? 14  GLY E CA  1 
ATOM   4653  C C   . GLY E 1 18  ? -20.882 14.905  -0.740  1.00 54.02  ? 14  GLY E C   1 
ATOM   4654  O O   . GLY E 1 18  ? -20.519 14.202  0.206   1.00 48.74  ? 14  GLY E O   1 
ATOM   4655  N N   . HIS E 1 19  ? -20.048 15.335  -1.681  1.00 46.31  ? 15  HIS E N   1 
ATOM   4656  C CA  . HIS E 1 19  ? -18.640 14.950  -1.688  1.00 54.15  ? 15  HIS E CA  1 
ATOM   4657  C C   . HIS E 1 19  ? -17.896 15.499  -0.472  1.00 53.83  ? 15  HIS E C   1 
ATOM   4658  O O   . HIS E 1 19  ? -17.054 14.814  0.109   1.00 46.73  ? 15  HIS E O   1 
ATOM   4659  C CB  . HIS E 1 19  ? -17.963 15.430  -2.975  1.00 63.16  ? 15  HIS E CB  1 
ATOM   4660  C CG  . HIS E 1 19  ? -18.537 14.830  -4.221  1.00 58.92  ? 15  HIS E CG  1 
ATOM   4661  N ND1 . HIS E 1 19  ? -19.323 15.546  -5.099  1.00 61.82  ? 15  HIS E ND1 1 
ATOM   4662  C CD2 . HIS E 1 19  ? -18.442 13.581  -4.735  1.00 58.24  ? 15  HIS E CD2 1 
ATOM   4663  C CE1 . HIS E 1 19  ? -19.685 14.764  -6.101  1.00 62.28  ? 15  HIS E CE1 1 
ATOM   4664  N NE2 . HIS E 1 19  ? -19.163 13.567  -5.904  1.00 60.72  ? 15  HIS E NE2 1 
ATOM   4665  N N   . LEU E 1 20  ? -18.209 16.734  -0.091  1.00 58.43  ? 16  LEU E N   1 
ATOM   4666  C CA  . LEU E 1 20  ? -17.551 17.372  1.045   1.00 54.54  ? 16  LEU E CA  1 
ATOM   4667  C C   . LEU E 1 20  ? -17.989 16.735  2.359   1.00 67.68  ? 16  LEU E C   1 
ATOM   4668  O O   . LEU E 1 20  ? -17.172 16.504  3.250   1.00 70.57  ? 16  LEU E O   1 
ATOM   4669  C CB  . LEU E 1 20  ? -17.862 18.869  1.070   1.00 39.19  ? 16  LEU E CB  1 
ATOM   4670  C CG  . LEU E 1 20  ? -17.522 19.637  -0.209  1.00 35.81  ? 16  LEU E CG  1 
ATOM   4671  C CD1 . LEU E 1 20  ? -17.806 21.120  -0.031  1.00 35.24  ? 16  LEU E CD1 1 
ATOM   4672  C CD2 . LEU E 1 20  ? -16.072 19.407  -0.606  1.00 43.64  ? 16  LEU E CD2 1 
ATOM   4673  N N   . GLN E 1 21  ? -19.283 16.455  2.473   1.00 76.13  ? 17  GLN E N   1 
ATOM   4674  C CA  . GLN E 1 21  ? -19.829 15.842  3.677   1.00 76.80  ? 17  GLN E CA  1 
ATOM   4675  C C   . GLN E 1 21  ? -19.145 14.512  3.970   1.00 75.06  ? 17  GLN E C   1 
ATOM   4676  O O   . GLN E 1 21  ? -18.705 14.268  5.093   1.00 89.87  ? 17  GLN E O   1 
ATOM   4677  C CB  . GLN E 1 21  ? -21.336 15.632  3.530   1.00 80.80  ? 17  GLN E CB  1 
ATOM   4678  C CG  . GLN E 1 21  ? -22.135 16.922  3.483   1.00 77.73  ? 17  GLN E CG  1 
ATOM   4679  C CD  . GLN E 1 21  ? -23.584 16.693  3.108   1.00 67.32  ? 17  GLN E CD  1 
ATOM   4680  O OE1 . GLN E 1 21  ? -24.075 15.564  3.140   1.00 46.49  ? 17  GLN E OE1 1 
ATOM   4681  N NE2 . GLN E 1 21  ? -24.278 17.767  2.746   1.00 68.98  ? 17  GLN E NE2 1 
ATOM   4682  N N   . SER E 1 22  ? -19.059 13.656  2.958   1.00 65.47  ? 18  SER E N   1 
ATOM   4683  C CA  . SER E 1 22  ? -18.421 12.355  3.117   1.00 61.94  ? 18  SER E CA  1 
ATOM   4684  C C   . SER E 1 22  ? -16.952 12.515  3.489   1.00 64.98  ? 18  SER E C   1 
ATOM   4685  O O   . SER E 1 22  ? -16.351 11.620  4.086   1.00 75.12  ? 18  SER E O   1 
ATOM   4686  C CB  . SER E 1 22  ? -18.554 11.527  1.837   1.00 56.62  ? 18  SER E CB  1 
ATOM   4687  O OG  . SER E 1 22  ? -17.931 12.168  0.736   1.00 64.37  ? 18  SER E OG  1 
ATOM   4688  N N   . LEU E 1 23  ? -16.376 13.659  3.135   1.00 54.68  ? 19  LEU E N   1 
ATOM   4689  C CA  . LEU E 1 23  ? -14.986 13.942  3.459   1.00 53.17  ? 19  LEU E CA  1 
ATOM   4690  C C   . LEU E 1 23  ? -14.866 14.348  4.922   1.00 52.63  ? 19  LEU E C   1 
ATOM   4691  O O   . LEU E 1 23  ? -13.963 13.903  5.629   1.00 49.18  ? 19  LEU E O   1 
ATOM   4692  C CB  . LEU E 1 23  ? -14.443 15.045  2.550   1.00 53.64  ? 19  LEU E CB  1 
ATOM   4693  C CG  . LEU E 1 23  ? -12.941 15.329  2.618   1.00 51.75  ? 19  LEU E CG  1 
ATOM   4694  C CD1 . LEU E 1 23  ? -12.132 14.042  2.587   1.00 40.77  ? 19  LEU E CD1 1 
ATOM   4695  C CD2 . LEU E 1 23  ? -12.533 16.237  1.467   1.00 58.07  ? 19  LEU E CD2 1 
ATOM   4696  N N   . GLN E 1 24  ? -15.786 15.193  5.376   1.00 53.78  ? 20  GLN E N   1 
ATOM   4697  C CA  . GLN E 1 24  ? -15.811 15.604  6.772   1.00 59.58  ? 20  GLN E CA  1 
ATOM   4698  C C   . GLN E 1 24  ? -16.116 14.397  7.650   1.00 68.29  ? 20  GLN E C   1 
ATOM   4699  O O   . GLN E 1 24  ? -15.561 14.248  8.738   1.00 67.65  ? 20  GLN E O   1 
ATOM   4700  C CB  . GLN E 1 24  ? -16.864 16.691  6.993   1.00 57.07  ? 20  GLN E CB  1 
ATOM   4701  C CG  . GLN E 1 24  ? -16.832 17.303  8.384   1.00 50.11  ? 20  GLN E CG  1 
ATOM   4702  C CD  . GLN E 1 24  ? -15.529 18.024  8.671   1.00 49.69  ? 20  GLN E CD  1 
ATOM   4703  O OE1 . GLN E 1 24  ? -15.209 19.028  8.035   1.00 51.48  ? 20  GLN E OE1 1 
ATOM   4704  N NE2 . GLN E 1 24  ? -14.766 17.511  9.630   1.00 44.92  ? 20  GLN E NE2 1 
ATOM   4705  N N   . ARG E 1 25  ? -17.003 13.536  7.163   1.00 67.05  ? 21  ARG E N   1 
ATOM   4706  C CA  . ARG E 1 25  ? -17.377 12.326  7.880   1.00 46.67  ? 21  ARG E CA  1 
ATOM   4707  C C   . ARG E 1 25  ? -16.165 11.407  7.980   1.00 55.54  ? 21  ARG E C   1 
ATOM   4708  O O   . ARG E 1 25  ? -16.012 10.659  8.946   1.00 50.41  ? 21  ARG E O   1 
ATOM   4709  C CB  . ARG E 1 25  ? -18.523 11.620  7.152   1.00 42.13  ? 21  ARG E CB  1 
ATOM   4710  C CG  . ARG E 1 25  ? -19.433 10.815  8.064   1.00 72.54  ? 21  ARG E CG  1 
ATOM   4711  C CD  . ARG E 1 25  ? -20.571 10.164  7.295   1.00 87.07  ? 21  ARG E CD  1 
ATOM   4712  N NE  . ARG E 1 25  ? -21.332 11.131  6.500   1.00 94.64  ? 21  ARG E NE  1 
ATOM   4713  C CZ  . ARG E 1 25  ? -21.384 11.163  5.168   1.00 105.44 ? 21  ARG E CZ  1 
ATOM   4714  N NH1 . ARG E 1 25  ? -20.728 10.275  4.429   1.00 112.49 ? 21  ARG E NH1 1 
ATOM   4715  N NH2 . ARG E 1 25  ? -22.109 12.092  4.563   1.00 103.10 ? 21  ARG E NH2 1 
ATOM   4716  N N   . LEU E 1 26  ? -15.304 11.476  6.971   1.00 73.05  ? 22  LEU E N   1 
ATOM   4717  C CA  . LEU E 1 26  ? -14.082 10.683  6.933   1.00 66.99  ? 22  LEU E CA  1 
ATOM   4718  C C   . LEU E 1 26  ? -13.063 11.212  7.937   1.00 57.54  ? 22  LEU E C   1 
ATOM   4719  O O   . LEU E 1 26  ? -12.397 10.441  8.628   1.00 67.56  ? 22  LEU E O   1 
ATOM   4720  C CB  . LEU E 1 26  ? -13.498 10.704  5.520   1.00 68.28  ? 22  LEU E CB  1 
ATOM   4721  C CG  . LEU E 1 26  ? -12.233 9.885   5.269   1.00 68.67  ? 22  LEU E CG  1 
ATOM   4722  C CD1 . LEU E 1 26  ? -12.194 9.437   3.819   1.00 53.50  ? 22  LEU E CD1 1 
ATOM   4723  C CD2 . LEU E 1 26  ? -10.983 10.685  5.612   1.00 67.39  ? 22  LEU E CD2 1 
ATOM   4724  N N   . ILE E 1 27  ? -12.946 12.533  8.013   1.00 49.06  ? 23  ILE E N   1 
ATOM   4725  C CA  . ILE E 1 27  ? -12.048 13.176  8.964   1.00 41.17  ? 23  ILE E CA  1 
ATOM   4726  C C   . ILE E 1 27  ? -12.501 12.915  10.396  1.00 48.83  ? 23  ILE E C   1 
ATOM   4727  O O   . ILE E 1 27  ? -11.697 12.576  11.263  1.00 51.99  ? 23  ILE E O   1 
ATOM   4728  C CB  . ILE E 1 27  ? -12.012 14.697  8.748   1.00 34.21  ? 23  ILE E CB  1 
ATOM   4729  C CG1 . ILE E 1 27  ? -11.468 15.028  7.358   1.00 26.91  ? 23  ILE E CG1 1 
ATOM   4730  C CG2 . ILE E 1 27  ? -11.159 15.369  9.816   1.00 46.17  ? 23  ILE E CG2 1 
ATOM   4731  C CD1 . ILE E 1 27  ? -11.777 16.438  6.905   1.00 26.47  ? 23  ILE E CD1 1 
ATOM   4732  N N   . ASP E 1 28  ? -13.798 13.079  10.633  1.00 57.39  ? 24  ASP E N   1 
ATOM   4733  C CA  . ASP E 1 28  ? -14.362 12.961  11.972  1.00 53.47  ? 24  ASP E CA  1 
ATOM   4734  C C   . ASP E 1 28  ? -14.150 11.573  12.574  1.00 49.02  ? 24  ASP E C   1 
ATOM   4735  O O   . ASP E 1 28  ? -14.076 11.424  13.794  1.00 61.98  ? 24  ASP E O   1 
ATOM   4736  C CB  . ASP E 1 28  ? -15.859 13.282  11.938  1.00 62.37  ? 24  ASP E CB  1 
ATOM   4737  C CG  . ASP E 1 28  ? -16.142 14.720  11.544  1.00 47.57  ? 24  ASP E CG  1 
ATOM   4738  O OD1 . ASP E 1 28  ? -15.246 15.575  11.711  1.00 37.30  ? 24  ASP E OD1 1 
ATOM   4739  O OD2 . ASP E 1 28  ? -17.262 14.994  11.065  1.00 42.54  ? 24  ASP E OD2 1 
ATOM   4740  N N   . SER E 1 29  ? -14.055 10.562  11.719  1.00 39.34  ? 25  SER E N   1 
ATOM   4741  C CA  . SER E 1 29  ? -13.922 9.184   12.179  1.00 40.44  ? 25  SER E CA  1 
ATOM   4742  C C   . SER E 1 29  ? -12.499 8.859   12.625  1.00 37.26  ? 25  SER E C   1 
ATOM   4743  O O   . SER E 1 29  ? -12.261 7.836   13.269  1.00 30.55  ? 25  SER E O   1 
ATOM   4744  C CB  . SER E 1 29  ? -14.334 8.218   11.071  1.00 45.00  ? 25  SER E CB  1 
ATOM   4745  O OG  . SER E 1 29  ? -13.475 8.341   9.951   1.00 53.08  ? 25  SER E OG  1 
ATOM   4746  N N   . GLN E 1 30  ? -11.556 9.728   12.280  1.00 41.86  ? 26  GLN E N   1 
ATOM   4747  C CA  . GLN E 1 30  ? -10.152 9.475   12.575  1.00 31.11  ? 26  GLN E CA  1 
ATOM   4748  C C   . GLN E 1 30  ? -9.840  9.688   14.047  1.00 33.56  ? 26  GLN E C   1 
ATOM   4749  O O   . GLN E 1 30  ? -10.266 10.674  14.649  1.00 41.05  ? 26  GLN E O   1 
ATOM   4750  C CB  . GLN E 1 30  ? -9.257  10.371  11.718  1.00 35.03  ? 26  GLN E CB  1 
ATOM   4751  C CG  . GLN E 1 30  ? -9.354  10.088  10.231  1.00 31.45  ? 26  GLN E CG  1 
ATOM   4752  C CD  . GLN E 1 30  ? -9.115  8.625   9.905   1.00 43.69  ? 26  GLN E CD  1 
ATOM   4753  O OE1 . GLN E 1 30  ? -8.015  8.104   10.098  1.00 37.40  ? 26  GLN E OE1 1 
ATOM   4754  N NE2 . GLN E 1 30  ? -10.152 7.951   9.418   1.00 49.20  ? 26  GLN E NE2 1 
ATOM   4755  N N   . MET E 1 31  ? -9.097  8.749   14.620  1.00 38.78  ? 27  MET E N   1 
ATOM   4756  C CA  . MET E 1 31  ? -8.661  8.855   16.003  1.00 42.46  ? 27  MET E CA  1 
ATOM   4757  C C   . MET E 1 31  ? -7.647  9.987   16.107  1.00 53.83  ? 27  MET E C   1 
ATOM   4758  O O   . MET E 1 31  ? -6.787  10.142  15.237  1.00 46.97  ? 27  MET E O   1 
ATOM   4759  C CB  . MET E 1 31  ? -8.037  7.536   16.461  1.00 44.55  ? 27  MET E CB  1 
ATOM   4760  C CG  . MET E 1 31  ? -7.945  7.376   17.970  1.00 42.20  ? 27  MET E CG  1 
ATOM   4761  S SD  . MET E 1 31  ? -7.357  5.739   18.455  1.00 42.10  ? 27  MET E SD  1 
ATOM   4762  C CE  . MET E 1 31  ? -5.618  5.879   18.063  1.00 31.18  ? 27  MET E CE  1 
ATOM   4763  N N   . GLU E 1 32  ? -7.756  10.783  17.166  1.00 55.42  ? 28  GLU E N   1 
ATOM   4764  C CA  . GLU E 1 32  ? -6.871  11.924  17.357  1.00 49.60  ? 28  GLU E CA  1 
ATOM   4765  C C   . GLU E 1 32  ? -5.562  11.492  18.011  1.00 68.52  ? 28  GLU E C   1 
ATOM   4766  O O   . GLU E 1 32  ? -5.500  11.272  19.220  1.00 74.13  ? 28  GLU E O   1 
ATOM   4767  C CB  . GLU E 1 32  ? -7.567  12.994  18.199  1.00 46.39  ? 28  GLU E CB  1 
ATOM   4768  C CG  . GLU E 1 32  ? -8.876  13.485  17.593  1.00 49.92  ? 28  GLU E CG  1 
ATOM   4769  C CD  . GLU E 1 32  ? -9.543  14.564  18.426  1.00 60.21  ? 28  GLU E CD  1 
ATOM   4770  O OE1 . GLU E 1 32  ? -10.404 15.290  17.883  1.00 50.70  ? 28  GLU E OE1 1 
ATOM   4771  O OE2 . GLU E 1 32  ? -9.211  14.684  19.623  1.00 73.54  ? 28  GLU E OE2 1 
ATOM   4772  N N   . THR E 1 33  ? -4.519  11.373  17.194  1.00 84.46  ? 29  THR E N   1 
ATOM   4773  C CA  . THR E 1 33  ? -3.211  10.930  17.661  1.00 90.57  ? 29  THR E CA  1 
ATOM   4774  C C   . THR E 1 33  ? -2.153  11.986  17.355  1.00 104.10 ? 29  THR E C   1 
ATOM   4775  O O   . THR E 1 33  ? -2.277  12.739  16.388  1.00 108.53 ? 29  THR E O   1 
ATOM   4776  C CB  . THR E 1 33  ? -2.802  9.601   16.994  1.00 89.81  ? 29  THR E CB  1 
ATOM   4777  O OG1 . THR E 1 33  ? -2.620  9.798   15.586  1.00 94.14  ? 29  THR E OG1 1 
ATOM   4778  C CG2 . THR E 1 33  ? -3.870  8.541   17.216  1.00 91.32  ? 29  THR E CG2 1 
ATOM   4779  N N   . SER E 1 34  ? -1.115  12.036  18.183  1.00 104.89 ? 30  SER E N   1 
ATOM   4780  C CA  . SER E 1 34  ? -0.038  13.004  18.010  1.00 100.85 ? 30  SER E CA  1 
ATOM   4781  C C   . SER E 1 34  ? 1.029   12.504  17.032  1.00 85.17  ? 30  SER E C   1 
ATOM   4782  O O   . SER E 1 34  ? 1.976   13.224  16.716  1.00 87.17  ? 30  SER E O   1 
ATOM   4783  C CB  . SER E 1 34  ? 0.606   13.320  19.363  1.00 103.17 ? 30  SER E CB  1 
ATOM   4784  O OG  . SER E 1 34  ? 1.119   12.147  19.969  1.00 97.12  ? 30  SER E OG  1 
ATOM   4785  N N   . CYS E 1 35  ? 0.870   11.271  16.558  1.00 74.60  ? 31  CYS E N   1 
ATOM   4786  C CA  . CYS E 1 35  ? 1.818   10.673  15.620  1.00 65.02  ? 31  CYS E CA  1 
ATOM   4787  C C   . CYS E 1 35  ? 2.018   11.553  14.393  1.00 56.60  ? 31  CYS E C   1 
ATOM   4788  O O   . CYS E 1 35  ? 1.181   12.396  14.081  1.00 60.12  ? 31  CYS E O   1 
ATOM   4789  C CB  . CYS E 1 35  ? 1.319   9.304   15.164  1.00 57.15  ? 31  CYS E CB  1 
ATOM   4790  S SG  . CYS E 1 35  ? -0.021  9.396   13.953  1.00 81.71  ? 31  CYS E SG  1 
ATOM   4791  N N   . GLN E 1 36  ? 3.124   11.337  13.689  1.00 56.61  ? 32  GLN E N   1 
ATOM   4792  C CA  . GLN E 1 36  ? 3.424   12.099  12.482  1.00 55.35  ? 32  GLN E CA  1 
ATOM   4793  C C   . GLN E 1 36  ? 3.721   11.170  11.312  1.00 54.56  ? 32  GLN E C   1 
ATOM   4794  O O   . GLN E 1 36  ? 4.217   10.057  11.495  1.00 53.07  ? 32  GLN E O   1 
ATOM   4795  C CB  . GLN E 1 36  ? 4.613   13.033  12.724  1.00 45.49  ? 32  GLN E CB  1 
ATOM   4796  C CG  . GLN E 1 36  ? 4.262   14.292  13.505  1.00 45.34  ? 32  GLN E CG  1 
ATOM   4797  C CD  . GLN E 1 36  ? 5.401   14.773  14.384  1.00 45.07  ? 32  GLN E CD  1 
ATOM   4798  O OE1 . GLN E 1 36  ? 5.939   14.014  15.192  1.00 38.76  ? 32  GLN E OE1 1 
ATOM   4799  N NE2 . GLN E 1 36  ? 5.776   16.038  14.230  1.00 48.89  ? 32  GLN E NE2 1 
ATOM   4800  N N   . ILE E 1 37  ? 3.407   11.635  10.108  1.00 62.59  ? 33  ILE E N   1 
ATOM   4801  C CA  . ILE E 1 37  ? 3.695   10.882  8.895   1.00 61.81  ? 33  ILE E CA  1 
ATOM   4802  C C   . ILE E 1 37  ? 4.305   11.799  7.839   1.00 65.27  ? 33  ILE E C   1 
ATOM   4803  O O   . ILE E 1 37  ? 4.374   13.016  8.022   1.00 56.16  ? 33  ILE E O   1 
ATOM   4804  C CB  . ILE E 1 37  ? 2.427   10.215  8.330   1.00 46.68  ? 33  ILE E CB  1 
ATOM   4805  C CG1 . ILE E 1 37  ? 1.317   11.252  8.144   1.00 60.70  ? 33  ILE E CG1 1 
ATOM   4806  C CG2 . ILE E 1 37  ? 1.960   9.105   9.257   1.00 51.67  ? 33  ILE E CG2 1 
ATOM   4807  C CD1 . ILE E 1 37  ? 0.090   10.720  7.433   1.00 57.09  ? 33  ILE E CD1 1 
ATOM   4808  N N   . THR E 1 38  ? 4.751   11.207  6.738   1.00 61.13  ? 34  THR E N   1 
ATOM   4809  C CA  . THR E 1 38  ? 5.390   11.958  5.667   1.00 52.42  ? 34  THR E CA  1 
ATOM   4810  C C   . THR E 1 38  ? 4.523   11.957  4.413   1.00 59.81  ? 34  THR E C   1 
ATOM   4811  O O   . THR E 1 38  ? 3.929   10.940  4.059   1.00 64.75  ? 34  THR E O   1 
ATOM   4812  C CB  . THR E 1 38  ? 6.762   11.361  5.326   1.00 54.20  ? 34  THR E CB  1 
ATOM   4813  O OG1 . THR E 1 38  ? 7.592   11.369  6.494   1.00 66.23  ? 34  THR E OG1 1 
ATOM   4814  C CG2 . THR E 1 38  ? 7.433   12.160  4.226   1.00 49.71  ? 34  THR E CG2 1 
ATOM   4815  N N   . PHE E 1 39  ? 4.454   13.103  3.744   1.00 64.70  ? 35  PHE E N   1 
ATOM   4816  C CA  . PHE E 1 39  ? 3.683   13.221  2.513   1.00 56.75  ? 35  PHE E CA  1 
ATOM   4817  C C   . PHE E 1 39  ? 4.050   14.493  1.761   1.00 45.85  ? 35  PHE E C   1 
ATOM   4818  O O   . PHE E 1 39  ? 4.384   15.509  2.366   1.00 39.23  ? 35  PHE E O   1 
ATOM   4819  C CB  . PHE E 1 39  ? 2.183   13.213  2.817   1.00 57.65  ? 35  PHE E CB  1 
ATOM   4820  C CG  . PHE E 1 39  ? 1.741   14.328  3.721   1.00 66.72  ? 35  PHE E CG  1 
ATOM   4821  C CD1 . PHE E 1 39  ? 1.419   15.572  3.203   1.00 58.31  ? 35  PHE E CD1 1 
ATOM   4822  C CD2 . PHE E 1 39  ? 1.644   14.131  5.089   1.00 65.48  ? 35  PHE E CD2 1 
ATOM   4823  C CE1 . PHE E 1 39  ? 1.010   16.598  4.031   1.00 40.35  ? 35  PHE E CE1 1 
ATOM   4824  C CE2 . PHE E 1 39  ? 1.236   15.155  5.923   1.00 55.49  ? 35  PHE E CE2 1 
ATOM   4825  C CZ  . PHE E 1 39  ? 0.919   16.389  5.394   1.00 46.00  ? 35  PHE E CZ  1 
ATOM   4826  N N   . GLU E 1 40  ? 3.988   14.425  0.435   1.00 65.02  ? 36  GLU E N   1 
ATOM   4827  C CA  . GLU E 1 40  ? 4.288   15.572  -0.411  1.00 82.56  ? 36  GLU E CA  1 
ATOM   4828  C C   . GLU E 1 40  ? 3.064   16.469  -0.541  1.00 92.54  ? 36  GLU E C   1 
ATOM   4829  O O   . GLU E 1 40  ? 1.935   15.984  -0.617  1.00 100.65 ? 36  GLU E O   1 
ATOM   4830  C CB  . GLU E 1 40  ? 4.728   15.106  -1.800  1.00 86.30  ? 36  GLU E CB  1 
ATOM   4831  C CG  . GLU E 1 40  ? 6.030   14.325  -1.817  1.00 90.99  ? 36  GLU E CG  1 
ATOM   4832  C CD  . GLU E 1 40  ? 7.242   15.209  -1.597  1.00 94.03  ? 36  GLU E CD  1 
ATOM   4833  O OE1 . GLU E 1 40  ? 8.021   15.398  -2.555  1.00 86.55  ? 36  GLU E OE1 1 
ATOM   4834  O OE2 . GLU E 1 40  ? 7.418   15.711  -0.467  1.00 97.38  ? 36  GLU E OE2 1 
ATOM   4835  N N   . PHE E 1 41  ? 3.292   17.778  -0.568  1.00 85.45  ? 37  PHE E N   1 
ATOM   4836  C CA  . PHE E 1 41  ? 2.206   18.735  -0.738  1.00 79.16  ? 37  PHE E CA  1 
ATOM   4837  C C   . PHE E 1 41  ? 2.749   20.094  -1.166  1.00 73.49  ? 37  PHE E C   1 
ATOM   4838  O O   . PHE E 1 41  ? 3.962   20.300  -1.212  1.00 74.81  ? 37  PHE E O   1 
ATOM   4839  C CB  . PHE E 1 41  ? 1.400   18.863  0.556   1.00 72.50  ? 37  PHE E CB  1 
ATOM   4840  C CG  . PHE E 1 41  ? 0.010   19.393  0.353   1.00 69.05  ? 37  PHE E CG  1 
ATOM   4841  C CD1 . PHE E 1 41  ? -0.886  18.726  -0.466  1.00 61.09  ? 37  PHE E CD1 1 
ATOM   4842  C CD2 . PHE E 1 41  ? -0.398  20.563  0.969   1.00 69.76  ? 37  PHE E CD2 1 
ATOM   4843  C CE1 . PHE E 1 41  ? -2.165  19.211  -0.659  1.00 55.86  ? 37  PHE E CE1 1 
ATOM   4844  C CE2 . PHE E 1 41  ? -1.676  21.051  0.781   1.00 62.26  ? 37  PHE E CE2 1 
ATOM   4845  C CZ  . PHE E 1 41  ? -2.560  20.375  -0.035  1.00 53.72  ? 37  PHE E CZ  1 
ATOM   4846  N N   . VAL E 1 42  ? 1.846   21.018  -1.479  1.00 70.11  ? 38  VAL E N   1 
ATOM   4847  C CA  . VAL E 1 42  ? 2.233   22.338  -1.966  1.00 66.77  ? 38  VAL E CA  1 
ATOM   4848  C C   . VAL E 1 42  ? 2.600   23.256  -0.804  1.00 69.74  ? 38  VAL E C   1 
ATOM   4849  O O   . VAL E 1 42  ? 1.925   23.266  0.226   1.00 62.17  ? 38  VAL E O   1 
ATOM   4850  C CB  . VAL E 1 42  ? 1.094   22.999  -2.771  1.00 58.78  ? 38  VAL E CB  1 
ATOM   4851  C CG1 . VAL E 1 42  ? 1.596   24.255  -3.467  1.00 59.81  ? 38  VAL E CG1 1 
ATOM   4852  C CG2 . VAL E 1 42  ? 0.510   22.023  -3.788  1.00 54.84  ? 38  VAL E CG2 1 
ATOM   4853  N N   . ASP E 1 43  ? 3.670   24.026  -0.974  1.00 85.09  ? 39  ASP E N   1 
ATOM   4854  C CA  . ASP E 1 43  ? 4.091   24.980  0.045   1.00 93.12  ? 39  ASP E CA  1 
ATOM   4855  C C   . ASP E 1 43  ? 3.383   26.312  -0.183  1.00 96.34  ? 39  ASP E C   1 
ATOM   4856  O O   . ASP E 1 43  ? 3.653   27.014  -1.159  1.00 103.77 ? 39  ASP E O   1 
ATOM   4857  C CB  . ASP E 1 43  ? 5.611   25.162  0.019   1.00 89.80  ? 39  ASP E CB  1 
ATOM   4858  C CG  . ASP E 1 43  ? 6.137   25.862  1.258   1.00 92.77  ? 39  ASP E CG  1 
ATOM   4859  O OD1 . ASP E 1 43  ? 5.371   26.005  2.234   1.00 88.76  ? 39  ASP E OD1 1 
ATOM   4860  O OD2 . ASP E 1 43  ? 7.322   26.258  1.261   1.00 90.61  ? 39  ASP E OD2 1 
ATOM   4861  N N   . GLN E 1 44  ? 2.475   26.651  0.726   1.00 82.58  ? 40  GLN E N   1 
ATOM   4862  C CA  . GLN E 1 44  ? 1.617   27.821  0.571   1.00 70.64  ? 40  GLN E CA  1 
ATOM   4863  C C   . GLN E 1 44  ? 2.398   29.134  0.630   1.00 65.35  ? 40  GLN E C   1 
ATOM   4864  O O   . GLN E 1 44  ? 1.853   30.198  0.335   1.00 60.77  ? 40  GLN E O   1 
ATOM   4865  C CB  . GLN E 1 44  ? 0.534   27.813  1.651   1.00 74.76  ? 40  GLN E CB  1 
ATOM   4866  C CG  . GLN E 1 44  ? -0.722  28.583  1.282   1.00 82.53  ? 40  GLN E CG  1 
ATOM   4867  C CD  . GLN E 1 44  ? -1.850  28.356  2.272   1.00 81.46  ? 40  GLN E CD  1 
ATOM   4868  O OE1 . GLN E 1 44  ? -1.644  28.393  3.487   1.00 77.62  ? 40  GLN E OE1 1 
ATOM   4869  N NE2 . GLN E 1 44  ? -3.049  28.106  1.757   1.00 74.15  ? 40  GLN E NE2 1 
ATOM   4870  N N   . GLU E 1 45  ? 3.669   29.056  1.014   1.00 73.53  ? 41  GLU E N   1 
ATOM   4871  C CA  . GLU E 1 45  ? 4.521   30.239  1.092   1.00 88.13  ? 41  GLU E CA  1 
ATOM   4872  C C   . GLU E 1 45  ? 5.292   30.456  -0.208  1.00 79.12  ? 41  GLU E C   1 
ATOM   4873  O O   . GLU E 1 45  ? 5.558   31.595  -0.596  1.00 74.58  ? 41  GLU E O   1 
ATOM   4874  C CB  . GLU E 1 45  ? 5.498   30.114  2.264   1.00 105.16 ? 41  GLU E CB  1 
ATOM   4875  C CG  . GLU E 1 45  ? 4.824   30.021  3.630   1.00 115.16 ? 41  GLU E CG  1 
ATOM   4876  C CD  . GLU E 1 45  ? 5.138   31.204  4.533   1.00 120.73 ? 41  GLU E CD  1 
ATOM   4877  O OE1 . GLU E 1 45  ? 5.467   32.291  4.011   1.00 122.60 ? 41  GLU E OE1 1 
ATOM   4878  O OE2 . GLU E 1 45  ? 5.054   31.046  5.770   1.00 118.28 ? 41  GLU E OE2 1 
ATOM   4879  N N   . GLN E 1 46  ? 5.651   29.363  -0.874  1.00 74.41  ? 42  GLN E N   1 
ATOM   4880  C CA  . GLN E 1 46  ? 6.362   29.441  -2.147  1.00 76.05  ? 42  GLN E CA  1 
ATOM   4881  C C   . GLN E 1 46  ? 5.407   29.766  -3.285  1.00 85.38  ? 42  GLN E C   1 
ATOM   4882  O O   . GLN E 1 46  ? 5.774   30.458  -4.236  1.00 95.24  ? 42  GLN E O   1 
ATOM   4883  C CB  . GLN E 1 46  ? 7.079   28.125  -2.448  1.00 79.35  ? 42  GLN E CB  1 
ATOM   4884  C CG  . GLN E 1 46  ? 8.241   27.831  -1.523  1.00 87.68  ? 42  GLN E CG  1 
ATOM   4885  C CD  . GLN E 1 46  ? 9.344   27.054  -2.208  1.00 84.05  ? 42  GLN E CD  1 
ATOM   4886  O OE1 . GLN E 1 46  ? 9.122   25.955  -2.719  1.00 72.19  ? 42  GLN E OE1 1 
ATOM   4887  N NE2 . GLN E 1 46  ? 10.542  27.628  -2.234  1.00 91.52  ? 42  GLN E NE2 1 
ATOM   4888  N N   . LEU E 1 47  ? 4.182   29.261  -3.187  1.00 79.99  ? 43  LEU E N   1 
ATOM   4889  C CA  . LEU E 1 47  ? 3.177   29.494  -4.214  1.00 79.46  ? 43  LEU E CA  1 
ATOM   4890  C C   . LEU E 1 47  ? 2.133   30.485  -3.702  1.00 94.27  ? 43  LEU E C   1 
ATOM   4891  O O   . LEU E 1 47  ? 1.163   30.106  -3.043  1.00 93.89  ? 43  LEU E O   1 
ATOM   4892  C CB  . LEU E 1 47  ? 2.530   28.169  -4.622  1.00 63.28  ? 43  LEU E CB  1 
ATOM   4893  C CG  . LEU E 1 47  ? 1.761   28.130  -5.945  1.00 49.24  ? 43  LEU E CG  1 
ATOM   4894  C CD1 . LEU E 1 47  ? 2.415   29.002  -7.005  1.00 46.19  ? 43  LEU E CD1 1 
ATOM   4895  C CD2 . LEU E 1 47  ? 1.669   26.693  -6.432  1.00 51.53  ? 43  LEU E CD2 1 
ATOM   4896  N N   . LYS E 1 48  ? 2.351   31.759  -4.013  1.00 98.42  ? 44  LYS E N   1 
ATOM   4897  C CA  . LYS E 1 48  ? 1.530   32.846  -3.488  1.00 94.12  ? 44  LYS E CA  1 
ATOM   4898  C C   . LYS E 1 48  ? 0.130   32.880  -4.096  1.00 77.82  ? 44  LYS E C   1 
ATOM   4899  O O   . LYS E 1 48  ? -0.862  32.985  -3.375  1.00 75.91  ? 44  LYS E O   1 
ATOM   4900  C CB  . LYS E 1 48  ? 2.226   34.190  -3.734  1.00 103.48 ? 44  LYS E CB  1 
ATOM   4901  C CG  . LYS E 1 48  ? 2.373   34.558  -5.206  1.00 108.72 ? 44  LYS E CG  1 
ATOM   4902  C CD  . LYS E 1 48  ? 3.252   35.782  -5.399  1.00 110.10 ? 44  LYS E CD  1 
ATOM   4903  C CE  . LYS E 1 48  ? 3.424   36.107  -6.876  1.00 108.90 ? 44  LYS E CE  1 
ATOM   4904  N NZ  . LYS E 1 48  ? 4.350   37.251  -7.102  1.00 106.73 ? 44  LYS E NZ  1 
ATOM   4905  N N   . ASP E 1 49  ? 0.054   32.793  -5.420  1.00 70.93  ? 45  ASP E N   1 
ATOM   4906  C CA  . ASP E 1 49  ? -1.213  32.962  -6.125  1.00 66.73  ? 45  ASP E CA  1 
ATOM   4907  C C   . ASP E 1 49  ? -2.229  31.887  -5.733  1.00 64.44  ? 45  ASP E C   1 
ATOM   4908  O O   . ASP E 1 49  ? -2.007  30.700  -5.982  1.00 53.42  ? 45  ASP E O   1 
ATOM   4909  C CB  . ASP E 1 49  ? -0.990  32.935  -7.636  1.00 74.17  ? 45  ASP E CB  1 
ATOM   4910  C CG  . ASP E 1 49  ? -2.169  33.495  -8.404  1.00 74.47  ? 45  ASP E CG  1 
ATOM   4911  O OD1 . ASP E 1 49  ? -3.132  32.740  -8.658  1.00 67.78  ? 45  ASP E OD1 1 
ATOM   4912  O OD2 . ASP E 1 49  ? -2.136  34.697  -8.744  1.00 73.04  ? 45  ASP E OD2 1 
ATOM   4913  N N   . PRO E 1 50  ? -3.354  32.304  -5.124  1.00 60.22  ? 46  PRO E N   1 
ATOM   4914  C CA  . PRO E 1 50  ? -4.399  31.386  -4.651  1.00 56.52  ? 46  PRO E CA  1 
ATOM   4915  C C   . PRO E 1 50  ? -4.883  30.399  -5.711  1.00 59.79  ? 46  PRO E C   1 
ATOM   4916  O O   . PRO E 1 50  ? -5.112  29.231  -5.397  1.00 61.86  ? 46  PRO E O   1 
ATOM   4917  C CB  . PRO E 1 50  ? -5.539  32.331  -4.260  1.00 56.86  ? 46  PRO E CB  1 
ATOM   4918  C CG  . PRO E 1 50  ? -4.866  33.596  -3.898  1.00 55.13  ? 46  PRO E CG  1 
ATOM   4919  C CD  . PRO E 1 50  ? -3.681  33.707  -4.812  1.00 62.50  ? 46  PRO E CD  1 
ATOM   4920  N N   . VAL E 1 51  ? -5.047  30.865  -6.945  1.00 67.83  ? 47  VAL E N   1 
ATOM   4921  C CA  . VAL E 1 51  ? -5.539  30.011  -8.023  1.00 55.93  ? 47  VAL E CA  1 
ATOM   4922  C C   . VAL E 1 51  ? -4.518  28.944  -8.409  1.00 53.49  ? 47  VAL E C   1 
ATOM   4923  O O   . VAL E 1 51  ? -4.849  27.759  -8.475  1.00 59.16  ? 47  VAL E O   1 
ATOM   4924  C CB  . VAL E 1 51  ? -5.906  30.837  -9.272  1.00 36.99  ? 47  VAL E CB  1 
ATOM   4925  C CG1 . VAL E 1 51  ? -6.070  29.933  -10.487 1.00 60.23  ? 47  VAL E CG1 1 
ATOM   4926  C CG2 . VAL E 1 51  ? -7.176  31.634  -9.021  1.00 23.13  ? 47  VAL E CG2 1 
ATOM   4927  N N   . CYS E 1 52  ? -3.280  29.364  -8.657  1.00 45.66  ? 48  CYS E N   1 
ATOM   4928  C CA  . CYS E 1 52  ? -2.227  28.440  -9.075  1.00 56.16  ? 48  CYS E CA  1 
ATOM   4929  C C   . CYS E 1 52  ? -1.907  27.433  -7.974  1.00 59.38  ? 48  CYS E C   1 
ATOM   4930  O O   . CYS E 1 52  ? -1.464  26.319  -8.251  1.00 72.31  ? 48  CYS E O   1 
ATOM   4931  C CB  . CYS E 1 52  ? -0.956  29.203  -9.458  1.00 50.36  ? 48  CYS E CB  1 
ATOM   4932  S SG  . CYS E 1 52  ? -1.088  30.193  -10.962 1.00 81.01  ? 48  CYS E SG  1 
ATOM   4933  N N   . TYR E 1 53  ? -2.120  27.837  -6.726  1.00 57.62  ? 49  TYR E N   1 
ATOM   4934  C CA  . TYR E 1 53  ? -1.922  26.945  -5.589  1.00 58.45  ? 49  TYR E CA  1 
ATOM   4935  C C   . TYR E 1 53  ? -2.894  25.770  -5.664  1.00 54.34  ? 49  TYR E C   1 
ATOM   4936  O O   . TYR E 1 53  ? -2.532  24.630  -5.371  1.00 63.31  ? 49  TYR E O   1 
ATOM   4937  C CB  . TYR E 1 53  ? -2.109  27.697  -4.265  1.00 68.18  ? 49  TYR E CB  1 
ATOM   4938  C CG  . TYR E 1 53  ? -2.092  26.796  -3.045  1.00 76.06  ? 49  TYR E CG  1 
ATOM   4939  C CD1 . TYR E 1 53  ? -3.263  26.225  -2.563  1.00 71.38  ? 49  TYR E CD1 1 
ATOM   4940  C CD2 . TYR E 1 53  ? -0.905  26.512  -2.380  1.00 85.93  ? 49  TYR E CD2 1 
ATOM   4941  C CE1 . TYR E 1 53  ? -3.253  25.399  -1.456  1.00 70.49  ? 49  TYR E CE1 1 
ATOM   4942  C CE2 . TYR E 1 53  ? -0.888  25.687  -1.269  1.00 87.98  ? 49  TYR E CE2 1 
ATOM   4943  C CZ  . TYR E 1 53  ? -2.066  25.136  -0.812  1.00 81.20  ? 49  TYR E CZ  1 
ATOM   4944  O OH  . TYR E 1 53  ? -2.067  24.311  0.288   1.00 76.47  ? 49  TYR E OH  1 
ATOM   4945  N N   . LEU E 1 54  ? -4.127  26.057  -6.067  1.00 60.72  ? 50  LEU E N   1 
ATOM   4946  C CA  . LEU E 1 54  ? -5.170  25.042  -6.153  1.00 59.37  ? 50  LEU E CA  1 
ATOM   4947  C C   . LEU E 1 54  ? -4.971  24.118  -7.350  1.00 61.98  ? 50  LEU E C   1 
ATOM   4948  O O   . LEU E 1 54  ? -5.255  22.922  -7.272  1.00 67.57  ? 50  LEU E O   1 
ATOM   4949  C CB  . LEU E 1 54  ? -6.540  25.712  -6.239  1.00 54.22  ? 50  LEU E CB  1 
ATOM   4950  C CG  . LEU E 1 54  ? -7.051  26.338  -4.941  1.00 44.59  ? 50  LEU E CG  1 
ATOM   4951  C CD1 . LEU E 1 54  ? -8.303  27.161  -5.202  1.00 50.47  ? 50  LEU E CD1 1 
ATOM   4952  C CD2 . LEU E 1 54  ? -7.327  25.262  -3.902  1.00 49.87  ? 50  LEU E CD2 1 
ATOM   4953  N N   . LYS E 1 55  ? -4.485  24.674  -8.456  1.00 47.44  ? 51  LYS E N   1 
ATOM   4954  C CA  . LYS E 1 55  ? -4.247  23.887  -9.660  1.00 30.93  ? 51  LYS E CA  1 
ATOM   4955  C C   . LYS E 1 55  ? -3.261  22.760  -9.387  1.00 45.38  ? 51  LYS E C   1 
ATOM   4956  O O   . LYS E 1 55  ? -3.495  21.615  -9.774  1.00 63.75  ? 51  LYS E O   1 
ATOM   4957  C CB  . LYS E 1 55  ? -3.717  24.769  -10.791 1.00 25.58  ? 51  LYS E CB  1 
ATOM   4958  C CG  . LYS E 1 55  ? -4.754  25.696  -11.407 1.00 43.69  ? 51  LYS E CG  1 
ATOM   4959  C CD  . LYS E 1 55  ? -4.302  26.209  -12.767 1.00 56.51  ? 51  LYS E CD  1 
ATOM   4960  C CE  . LYS E 1 55  ? -4.399  25.127  -13.834 1.00 49.13  ? 51  LYS E CE  1 
ATOM   4961  N NZ  . LYS E 1 55  ? -3.697  25.518  -15.083 1.00 41.55  ? 51  LYS E NZ  1 
ATOM   4962  N N   . LYS E 1 56  ? -2.160  23.087  -8.717  1.00 38.37  ? 52  LYS E N   1 
ATOM   4963  C CA  . LYS E 1 56  ? -1.128  22.099  -8.421  1.00 52.14  ? 52  LYS E CA  1 
ATOM   4964  C C   . LYS E 1 56  ? -1.569  21.186  -7.284  1.00 55.03  ? 52  LYS E C   1 
ATOM   4965  O O   . LYS E 1 56  ? -1.459  19.964  -7.380  1.00 62.05  ? 52  LYS E O   1 
ATOM   4966  C CB  . LYS E 1 56  ? 0.189   22.784  -8.059  1.00 73.63  ? 52  LYS E CB  1 
ATOM   4967  C CG  . LYS E 1 56  ? 1.384   21.844  -8.042  1.00 84.09  ? 52  LYS E CG  1 
ATOM   4968  C CD  . LYS E 1 56  ? 2.683   22.602  -7.840  1.00 89.21  ? 52  LYS E CD  1 
ATOM   4969  C CE  . LYS E 1 56  ? 3.728   22.189  -8.866  1.00 95.14  ? 52  LYS E CE  1 
ATOM   4970  N NZ  . LYS E 1 56  ? 4.163   20.773  -8.700  1.00 89.53  ? 52  LYS E NZ  1 
ATOM   4971  N N   . ALA E 1 57  ? -2.068  21.786  -6.208  1.00 64.19  ? 53  ALA E N   1 
ATOM   4972  C CA  . ALA E 1 57  ? -2.558  21.022  -5.067  1.00 76.68  ? 53  ALA E CA  1 
ATOM   4973  C C   . ALA E 1 57  ? -3.506  19.925  -5.536  1.00 68.84  ? 53  ALA E C   1 
ATOM   4974  O O   . ALA E 1 57  ? -3.453  18.795  -5.052  1.00 56.26  ? 53  ALA E O   1 
ATOM   4975  C CB  . ALA E 1 57  ? -3.258  21.940  -4.078  1.00 86.11  ? 53  ALA E CB  1 
ATOM   4976  N N   . PHE E 1 58  ? -4.369  20.268  -6.487  1.00 60.13  ? 54  PHE E N   1 
ATOM   4977  C CA  . PHE E 1 58  ? -5.323  19.317  -7.039  1.00 49.93  ? 54  PHE E CA  1 
ATOM   4978  C C   . PHE E 1 58  ? -4.614  18.095  -7.609  1.00 53.32  ? 54  PHE E C   1 
ATOM   4979  O O   . PHE E 1 58  ? -5.075  16.967  -7.438  1.00 73.51  ? 54  PHE E O   1 
ATOM   4980  C CB  . PHE E 1 58  ? -6.161  19.983  -8.130  1.00 58.73  ? 54  PHE E CB  1 
ATOM   4981  C CG  . PHE E 1 58  ? -7.089  19.040  -8.841  1.00 59.03  ? 54  PHE E CG  1 
ATOM   4982  C CD1 . PHE E 1 58  ? -8.282  18.651  -8.257  1.00 57.87  ? 54  PHE E CD1 1 
ATOM   4983  C CD2 . PHE E 1 58  ? -6.765  18.540  -10.091 1.00 66.34  ? 54  PHE E CD2 1 
ATOM   4984  C CE1 . PHE E 1 58  ? -9.138  17.782  -8.907  1.00 67.45  ? 54  PHE E CE1 1 
ATOM   4985  C CE2 . PHE E 1 58  ? -7.617  17.671  -10.748 1.00 70.41  ? 54  PHE E CE2 1 
ATOM   4986  C CZ  . PHE E 1 58  ? -8.805  17.292  -10.154 1.00 70.72  ? 54  PHE E CZ  1 
ATOM   4987  N N   . LEU E 1 59  ? -3.493  18.325  -8.285  1.00 42.84  ? 55  LEU E N   1 
ATOM   4988  C CA  . LEU E 1 59  ? -2.737  17.240  -8.901  1.00 31.70  ? 55  LEU E CA  1 
ATOM   4989  C C   . LEU E 1 59  ? -2.052  16.367  -7.854  1.00 37.31  ? 55  LEU E C   1 
ATOM   4990  O O   . LEU E 1 59  ? -1.962  15.150  -8.018  1.00 52.76  ? 55  LEU E O   1 
ATOM   4991  C CB  . LEU E 1 59  ? -1.699  17.797  -9.879  1.00 54.22  ? 55  LEU E CB  1 
ATOM   4992  C CG  . LEU E 1 59  ? -2.254  18.583  -11.072 1.00 58.91  ? 55  LEU E CG  1 
ATOM   4993  C CD1 . LEU E 1 59  ? -1.129  19.008  -12.009 1.00 55.53  ? 55  LEU E CD1 1 
ATOM   4994  C CD2 . LEU E 1 59  ? -3.301  17.773  -11.821 1.00 41.96  ? 55  LEU E CD2 1 
ATOM   4995  N N   . LEU E 1 60  ? -1.570  16.986  -6.781  1.00 46.09  ? 56  LEU E N   1 
ATOM   4996  C CA  . LEU E 1 60  ? -0.901  16.242  -5.717  1.00 51.22  ? 56  LEU E CA  1 
ATOM   4997  C C   . LEU E 1 60  ? -1.892  15.446  -4.878  1.00 53.64  ? 56  LEU E C   1 
ATOM   4998  O O   . LEU E 1 60  ? -1.577  14.354  -4.406  1.00 51.47  ? 56  LEU E O   1 
ATOM   4999  C CB  . LEU E 1 60  ? -0.103  17.186  -4.818  1.00 59.23  ? 56  LEU E CB  1 
ATOM   5000  C CG  . LEU E 1 60  ? 1.217   17.689  -5.404  1.00 79.22  ? 56  LEU E CG  1 
ATOM   5001  C CD1 . LEU E 1 60  ? 1.849   18.706  -4.477  1.00 86.15  ? 56  LEU E CD1 1 
ATOM   5002  C CD2 . LEU E 1 60  ? 2.180   16.536  -5.660  1.00 83.27  ? 56  LEU E CD2 1 
ATOM   5003  N N   . VAL E 1 61  ? -3.087  15.996  -4.690  1.00 62.61  ? 57  VAL E N   1 
ATOM   5004  C CA  . VAL E 1 61  ? -4.124  15.318  -3.921  1.00 64.64  ? 57  VAL E CA  1 
ATOM   5005  C C   . VAL E 1 61  ? -4.446  13.962  -4.542  1.00 71.52  ? 57  VAL E C   1 
ATOM   5006  O O   . VAL E 1 61  ? -4.844  13.027  -3.844  1.00 75.20  ? 57  VAL E O   1 
ATOM   5007  C CB  . VAL E 1 61  ? -5.406  16.173  -3.830  1.00 44.48  ? 57  VAL E CB  1 
ATOM   5008  C CG1 . VAL E 1 61  ? -6.614  15.311  -3.496  1.00 37.62  ? 57  VAL E CG1 1 
ATOM   5009  C CG2 . VAL E 1 61  ? -5.235  17.273  -2.792  1.00 35.54  ? 57  VAL E CG2 1 
ATOM   5010  N N   . GLN E 1 62  ? -4.264  13.856  -5.854  1.00 48.69  ? 58  GLN E N   1 
ATOM   5011  C CA  . GLN E 1 62  ? -4.480  12.595  -6.551  1.00 59.42  ? 58  GLN E CA  1 
ATOM   5012  C C   . GLN E 1 62  ? -3.452  11.556  -6.114  1.00 64.75  ? 58  GLN E C   1 
ATOM   5013  O O   . GLN E 1 62  ? -3.775  10.379  -5.955  1.00 76.77  ? 58  GLN E O   1 
ATOM   5014  C CB  . GLN E 1 62  ? -4.410  12.802  -8.065  1.00 71.48  ? 58  GLN E CB  1 
ATOM   5015  C CG  . GLN E 1 62  ? -5.519  13.681  -8.612  1.00 67.41  ? 58  GLN E CG  1 
ATOM   5016  C CD  . GLN E 1 62  ? -6.892  13.165  -8.240  1.00 69.97  ? 58  GLN E CD  1 
ATOM   5017  O OE1 . GLN E 1 62  ? -7.587  13.755  -7.412  1.00 64.80  ? 58  GLN E OE1 1 
ATOM   5018  N NE2 . GLN E 1 62  ? -7.288  12.050  -8.844  1.00 69.82  ? 58  GLN E NE2 1 
ATOM   5019  N N   . ASP E 1 63  ? -2.212  11.997  -5.922  1.00 43.08  ? 59  ASP E N   1 
ATOM   5020  C CA  . ASP E 1 63  ? -1.150  11.109  -5.468  1.00 44.98  ? 59  ASP E CA  1 
ATOM   5021  C C   . ASP E 1 63  ? -1.360  10.746  -4.003  1.00 47.22  ? 59  ASP E C   1 
ATOM   5022  O O   . ASP E 1 63  ? -1.006  9.651   -3.568  1.00 53.17  ? 59  ASP E O   1 
ATOM   5023  C CB  . ASP E 1 63  ? 0.220   11.772  -5.640  1.00 58.03  ? 59  ASP E CB  1 
ATOM   5024  C CG  . ASP E 1 63  ? 0.510   12.159  -7.078  1.00 60.02  ? 59  ASP E CG  1 
ATOM   5025  O OD1 . ASP E 1 63  ? -0.044  11.515  -7.994  1.00 64.65  ? 59  ASP E OD1 1 
ATOM   5026  O OD2 . ASP E 1 63  ? 1.293   13.111  -7.291  1.00 47.48  ? 59  ASP E OD2 1 
ATOM   5027  N N   . ILE E 1 64  ? -1.939  11.674  -3.248  1.00 49.04  ? 60  ILE E N   1 
ATOM   5028  C CA  . ILE E 1 64  ? -2.155  11.482  -1.817  1.00 51.67  ? 60  ILE E CA  1 
ATOM   5029  C C   . ILE E 1 64  ? -3.289  10.500  -1.533  1.00 59.05  ? 60  ILE E C   1 
ATOM   5030  O O   . ILE E 1 64  ? -3.224  9.728   -0.576  1.00 63.42  ? 60  ILE E O   1 
ATOM   5031  C CB  . ILE E 1 64  ? -2.464  12.820  -1.121  1.00 32.82  ? 60  ILE E CB  1 
ATOM   5032  C CG1 . ILE E 1 64  ? -1.211  13.699  -1.094  1.00 41.01  ? 60  ILE E CG1 1 
ATOM   5033  C CG2 . ILE E 1 64  ? -2.964  12.581  0.292   1.00 25.48  ? 60  ILE E CG2 1 
ATOM   5034  C CD1 . ILE E 1 64  ? -1.439  15.084  -0.521  1.00 43.20  ? 60  ILE E CD1 1 
ATOM   5035  N N   . MET E 1 65  ? -4.329  10.534  -2.360  1.00 46.89  ? 61  MET E N   1 
ATOM   5036  C CA  . MET E 1 65  ? -5.465  9.635   -2.192  1.00 39.61  ? 61  MET E CA  1 
ATOM   5037  C C   . MET E 1 65  ? -5.096  8.200   -2.557  1.00 49.85  ? 61  MET E C   1 
ATOM   5038  O O   . MET E 1 65  ? -5.571  7.250   -1.936  1.00 60.65  ? 61  MET E O   1 
ATOM   5039  C CB  . MET E 1 65  ? -6.646  10.095  -3.051  1.00 42.79  ? 61  MET E CB  1 
ATOM   5040  C CG  . MET E 1 65  ? -7.349  11.344  -2.538  1.00 39.91  ? 61  MET E CG  1 
ATOM   5041  S SD  . MET E 1 65  ? -8.900  11.683  -3.398  1.00 62.47  ? 61  MET E SD  1 
ATOM   5042  C CE  . MET E 1 65  ? -8.313  12.020  -5.057  1.00 59.94  ? 61  MET E CE  1 
ATOM   5043  N N   . GLU E 1 66  ? -4.244  8.050   -3.565  1.00 64.88  ? 62  GLU E N   1 
ATOM   5044  C CA  . GLU E 1 66  ? -3.904  6.734   -4.098  1.00 55.91  ? 62  GLU E CA  1 
ATOM   5045  C C   . GLU E 1 66  ? -2.770  6.060   -3.328  1.00 41.38  ? 62  GLU E C   1 
ATOM   5046  O O   . GLU E 1 66  ? -2.701  4.832   -3.263  1.00 49.83  ? 62  GLU E O   1 
ATOM   5047  C CB  . GLU E 1 66  ? -3.520  6.858   -5.576  1.00 60.41  ? 62  GLU E CB  1 
ATOM   5048  C CG  . GLU E 1 66  ? -3.077  5.556   -6.228  1.00 70.39  ? 62  GLU E CG  1 
ATOM   5049  C CD  . GLU E 1 66  ? -4.190  4.528   -6.301  1.00 86.94  ? 62  GLU E CD  1 
ATOM   5050  O OE1 . GLU E 1 66  ? -4.618  4.196   -7.426  1.00 91.73  ? 62  GLU E OE1 1 
ATOM   5051  O OE2 . GLU E 1 66  ? -4.635  4.050   -5.237  1.00 93.73  ? 62  GLU E OE2 1 
ATOM   5052  N N   . ASP E 1 67  ? -1.885  6.861   -2.743  1.00 36.35  ? 63  ASP E N   1 
ATOM   5053  C CA  . ASP E 1 67  ? -0.692  6.326   -2.093  1.00 45.98  ? 63  ASP E CA  1 
ATOM   5054  C C   . ASP E 1 67  ? -0.780  6.366   -0.567  1.00 53.50  ? 63  ASP E C   1 
ATOM   5055  O O   . ASP E 1 67  ? -0.403  5.405   0.105   1.00 56.92  ? 63  ASP E O   1 
ATOM   5056  C CB  . ASP E 1 67  ? 0.553   7.093   -2.554  1.00 47.35  ? 63  ASP E CB  1 
ATOM   5057  C CG  . ASP E 1 67  ? 0.753   7.038   -4.060  1.00 58.59  ? 63  ASP E CG  1 
ATOM   5058  O OD1 . ASP E 1 67  ? 0.257   6.087   -4.699  1.00 55.37  ? 63  ASP E OD1 1 
ATOM   5059  O OD2 . ASP E 1 67  ? 1.414   7.948   -4.604  1.00 62.63  ? 63  ASP E OD2 1 
ATOM   5060  N N   . THR E 1 68  ? -1.279  7.473   -0.025  1.00 46.86  ? 64  THR E N   1 
ATOM   5061  C CA  . THR E 1 68  ? -1.243  7.701   1.418   1.00 49.89  ? 64  THR E CA  1 
ATOM   5062  C C   . THR E 1 68  ? -2.551  7.336   2.125   1.00 55.09  ? 64  THR E C   1 
ATOM   5063  O O   . THR E 1 68  ? -2.551  6.545   3.070   1.00 61.48  ? 64  THR E O   1 
ATOM   5064  C CB  . THR E 1 68  ? -0.897  9.171   1.731   1.00 54.78  ? 64  THR E CB  1 
ATOM   5065  O OG1 . THR E 1 68  ? 0.333   9.522   1.082   1.00 60.28  ? 64  THR E OG1 1 
ATOM   5066  C CG2 . THR E 1 68  ? -0.754  9.384   3.231   1.00 49.48  ? 64  THR E CG2 1 
ATOM   5067  N N   . MET E 1 69  ? -3.658  7.916   1.674   1.00 47.51  ? 65  MET E N   1 
ATOM   5068  C CA  . MET E 1 69  ? -4.951  7.695   2.314   1.00 42.53  ? 65  MET E CA  1 
ATOM   5069  C C   . MET E 1 69  ? -5.546  6.353   1.904   1.00 55.01  ? 65  MET E C   1 
ATOM   5070  O O   . MET E 1 69  ? -6.308  6.274   0.940   1.00 66.70  ? 65  MET E O   1 
ATOM   5071  C CB  . MET E 1 69  ? -5.919  8.820   1.947   1.00 32.68  ? 65  MET E CB  1 
ATOM   5072  C CG  . MET E 1 69  ? -5.454  10.202  2.385   1.00 37.05  ? 65  MET E CG  1 
ATOM   5073  S SD  . MET E 1 69  ? -6.453  11.528  1.679   1.00 61.81  ? 65  MET E SD  1 
ATOM   5074  C CE  . MET E 1 69  ? -8.090  10.990  2.155   1.00 33.50  ? 65  MET E CE  1 
ATOM   5075  N N   . ARG E 1 70  ? -5.200  5.304   2.646   1.00 51.19  ? 66  ARG E N   1 
ATOM   5076  C CA  A ARG E 1 70  ? -5.668  3.957   2.337   0.36 51.04  ? 66  ARG E CA  1 
ATOM   5077  C CA  B ARG E 1 70  ? -5.671  3.959   2.337   0.64 50.83  ? 66  ARG E CA  1 
ATOM   5078  C C   . ARG E 1 70  ? -6.553  3.409   3.451   1.00 43.86  ? 66  ARG E C   1 
ATOM   5079  O O   . ARG E 1 70  ? -6.224  3.525   4.630   1.00 37.63  ? 66  ARG E O   1 
ATOM   5080  C CB  A ARG E 1 70  ? -4.479  3.019   2.126   0.36 55.26  ? 66  ARG E CB  1 
ATOM   5081  C CB  B ARG E 1 70  ? -4.483  3.022   2.118   0.64 55.87  ? 66  ARG E CB  1 
ATOM   5082  C CG  A ARG E 1 70  ? -3.387  3.589   1.237   0.36 57.23  ? 66  ARG E CG  1 
ATOM   5083  C CG  B ARG E 1 70  ? -3.482  3.519   1.086   0.64 56.39  ? 66  ARG E CG  1 
ATOM   5084  C CD  A ARG E 1 70  ? -2.326  2.546   0.924   0.36 55.81  ? 66  ARG E CD  1 
ATOM   5085  C CD  B ARG E 1 70  ? -4.155  3.843   -0.236  0.64 49.14  ? 66  ARG E CD  1 
ATOM   5086  N NE  A ARG E 1 70  ? -1.832  1.877   2.127   0.36 47.06  ? 66  ARG E NE  1 
ATOM   5087  N NE  B ARG E 1 70  ? -4.832  2.685   -0.811  0.64 49.98  ? 66  ARG E NE  1 
ATOM   5088  C CZ  A ARG E 1 70  ? -0.875  2.352   2.919   0.36 30.92  ? 66  ARG E CZ  1 
ATOM   5089  C CZ  B ARG E 1 70  ? -5.599  2.728   -1.896  0.64 44.22  ? 66  ARG E CZ  1 
ATOM   5090  N NH1 A ARG E 1 70  ? -0.290  3.515   2.655   0.36 8.85   ? 66  ARG E NH1 1 
ATOM   5091  N NH1 B ARG E 1 70  ? -5.798  3.876   -2.530  0.64 33.76  ? 66  ARG E NH1 1 
ATOM   5092  N NH2 A ARG E 1 70  ? -0.501  1.660   3.987   0.36 34.08  ? 66  ARG E NH2 1 
ATOM   5093  N NH2 B ARG E 1 70  ? -6.173  1.621   -2.346  0.64 36.07  ? 66  ARG E NH2 1 
ATOM   5094  N N   . PHE E 1 71  ? -7.675  2.809   3.065   1.00 43.34  ? 67  PHE E N   1 
ATOM   5095  C CA  . PHE E 1 71  ? -8.585  2.180   4.015   1.00 55.51  ? 67  PHE E CA  1 
ATOM   5096  C C   . PHE E 1 71  ? -8.895  0.762   3.553   1.00 54.45  ? 67  PHE E C   1 
ATOM   5097  O O   . PHE E 1 71  ? -8.697  0.428   2.387   1.00 57.65  ? 67  PHE E O   1 
ATOM   5098  C CB  . PHE E 1 71  ? -9.886  2.975   4.131   1.00 55.41  ? 67  PHE E CB  1 
ATOM   5099  C CG  . PHE E 1 71  ? -9.696  4.389   4.597   1.00 39.84  ? 67  PHE E CG  1 
ATOM   5100  C CD1 . PHE E 1 71  ? -9.599  4.679   5.945   1.00 33.06  ? 67  PHE E CD1 1 
ATOM   5101  C CD2 . PHE E 1 71  ? -9.622  5.430   3.686   1.00 48.89  ? 67  PHE E CD2 1 
ATOM   5102  C CE1 . PHE E 1 71  ? -9.426  5.981   6.377   1.00 38.33  ? 67  PHE E CE1 1 
ATOM   5103  C CE2 . PHE E 1 71  ? -9.449  6.735   4.114   1.00 41.40  ? 67  PHE E CE2 1 
ATOM   5104  C CZ  . PHE E 1 71  ? -9.351  7.010   5.461   1.00 22.50  ? 67  PHE E CZ  1 
ATOM   5105  N N   . ARG E 1 72  ? -9.387  -0.070  4.465   1.00 57.71  ? 68  ARG E N   1 
ATOM   5106  C CA  . ARG E 1 72  ? -9.736  -1.439  4.114   1.00 60.34  ? 68  ARG E CA  1 
ATOM   5107  C C   . ARG E 1 72  ? -10.804 -1.414  3.024   1.00 54.88  ? 68  ARG E C   1 
ATOM   5108  O O   . ARG E 1 72  ? -11.728 -0.601  3.069   1.00 42.66  ? 68  ARG E O   1 
ATOM   5109  C CB  . ARG E 1 72  ? -10.232 -2.212  5.340   1.00 64.59  ? 68  ARG E CB  1 
ATOM   5110  C CG  . ARG E 1 72  ? -9.912  -3.701  5.289   1.00 73.87  ? 68  ARG E CG  1 
ATOM   5111  C CD  . ARG E 1 72  ? -10.441 -4.445  6.505   1.00 75.20  ? 68  ARG E CD  1 
ATOM   5112  N NE  . ARG E 1 72  ? -11.872 -4.720  6.407   1.00 83.34  ? 68  ARG E NE  1 
ATOM   5113  C CZ  . ARG E 1 72  ? -12.545 -5.506  7.243   1.00 82.23  ? 68  ARG E CZ  1 
ATOM   5114  N NH1 . ARG E 1 72  ? -11.922 -6.104  8.251   1.00 80.22  ? 68  ARG E NH1 1 
ATOM   5115  N NH2 . ARG E 1 72  ? -13.846 -5.698  7.072   1.00 73.83  ? 68  ARG E NH2 1 
ATOM   5116  N N   . ASP E 1 73  ? -10.667 -2.301  2.043   1.00 48.33  ? 69  ASP E N   1 
ATOM   5117  C CA  . ASP E 1 73  ? -11.573 -2.330  0.898   1.00 48.80  ? 69  ASP E CA  1 
ATOM   5118  C C   . ASP E 1 73  ? -13.027 -2.516  1.326   1.00 45.06  ? 69  ASP E C   1 
ATOM   5119  O O   . ASP E 1 73  ? -13.317 -3.252  2.267   1.00 49.67  ? 69  ASP E O   1 
ATOM   5120  C CB  . ASP E 1 73  ? -11.183 -3.454  -0.068  1.00 65.43  ? 69  ASP E CB  1 
ATOM   5121  C CG  . ASP E 1 73  ? -9.919  -3.147  -0.850  1.00 64.82  ? 69  ASP E CG  1 
ATOM   5122  O OD1 . ASP E 1 73  ? -10.010 -2.430  -1.869  1.00 77.04  ? 69  ASP E OD1 1 
ATOM   5123  O OD2 . ASP E 1 73  ? -8.839  -3.634  -0.457  1.00 53.85  ? 69  ASP E OD2 1 
ATOM   5124  N N   . ASN E 1 74  ? -13.928 -1.836  0.622   1.00 50.90  ? 70  ASN E N   1 
ATOM   5125  C CA  . ASN E 1 74  ? -15.371 -1.967  0.830   1.00 60.21  ? 70  ASN E CA  1 
ATOM   5126  C C   . ASN E 1 74  ? -15.862 -1.454  2.185   1.00 67.40  ? 70  ASN E C   1 
ATOM   5127  O O   . ASN E 1 74  ? -16.893 -1.901  2.690   1.00 73.47  ? 70  ASN E O   1 
ATOM   5128  C CB  . ASN E 1 74  ? -15.818 -3.418  0.610   1.00 64.82  ? 70  ASN E CB  1 
ATOM   5129  C CG  . ASN E 1 74  ? -15.559 -3.900  -0.809  1.00 71.86  ? 70  ASN E CG  1 
ATOM   5130  O OD1 . ASN E 1 74  ? -14.912 -4.927  -1.020  1.00 71.66  ? 70  ASN E OD1 1 
ATOM   5131  N ND2 . ASN E 1 74  ? -16.062 -3.156  -1.790  1.00 60.61  ? 70  ASN E ND2 1 
ATOM   5132  N N   . THR E 1 75  ? -15.126 -0.508  2.760   1.00 63.40  ? 71  THR E N   1 
ATOM   5133  C CA  . THR E 1 75  ? -15.571 0.184   3.964   1.00 57.68  ? 71  THR E CA  1 
ATOM   5134  C C   . THR E 1 75  ? -15.994 1.601   3.593   1.00 56.04  ? 71  THR E C   1 
ATOM   5135  O O   . THR E 1 75  ? -15.531 2.147   2.590   1.00 35.55  ? 71  THR E O   1 
ATOM   5136  C CB  . THR E 1 75  ? -14.465 0.242   5.040   1.00 54.13  ? 71  THR E CB  1 
ATOM   5137  O OG1 . THR E 1 75  ? -13.386 1.074   4.591   1.00 53.99  ? 71  THR E OG1 1 
ATOM   5138  C CG2 . THR E 1 75  ? -13.944 -1.153  5.350   1.00 54.03  ? 71  THR E CG2 1 
ATOM   5139  N N   . PRO E 1 76  ? -16.881 2.201   4.401   1.00 54.59  ? 72  PRO E N   1 
ATOM   5140  C CA  . PRO E 1 76  ? -17.421 3.535   4.110   1.00 53.91  ? 72  PRO E CA  1 
ATOM   5141  C C   . PRO E 1 76  ? -16.349 4.542   3.697   1.00 50.87  ? 72  PRO E C   1 
ATOM   5142  O O   . PRO E 1 76  ? -16.593 5.357   2.807   1.00 57.67  ? 72  PRO E O   1 
ATOM   5143  C CB  . PRO E 1 76  ? -18.065 3.940   5.437   1.00 56.50  ? 72  PRO E CB  1 
ATOM   5144  C CG  . PRO E 1 76  ? -18.486 2.650   6.042   1.00 48.64  ? 72  PRO E CG  1 
ATOM   5145  C CD  . PRO E 1 76  ? -17.437 1.645   5.647   1.00 41.90  ? 72  PRO E CD  1 
ATOM   5146  N N   . ASN E 1 77  ? -15.181 4.487   4.330   1.00 40.95  ? 73  ASN E N   1 
ATOM   5147  C CA  . ASN E 1 77  ? -14.092 5.391   3.976   1.00 41.14  ? 73  ASN E CA  1 
ATOM   5148  C C   . ASN E 1 77  ? -13.438 5.011   2.651   1.00 39.11  ? 73  ASN E C   1 
ATOM   5149  O O   . ASN E 1 77  ? -13.216 5.869   1.798   1.00 45.67  ? 73  ASN E O   1 
ATOM   5150  C CB  . ASN E 1 77  ? -13.041 5.439   5.084   1.00 40.39  ? 73  ASN E CB  1 
ATOM   5151  C CG  . ASN E 1 77  ? -13.458 6.319   6.245   1.00 54.78  ? 73  ASN E CG  1 
ATOM   5152  O OD1 . ASN E 1 77  ? -14.352 7.156   6.116   1.00 49.65  ? 73  ASN E OD1 1 
ATOM   5153  N ND2 . ASN E 1 77  ? -12.802 6.142   7.385   1.00 67.59  ? 73  ASN E ND2 1 
ATOM   5154  N N   . ALA E 1 78  ? -13.130 3.728   2.482   1.00 38.20  ? 74  ALA E N   1 
ATOM   5155  C CA  . ALA E 1 78  ? -12.513 3.249   1.249   1.00 39.76  ? 74  ALA E CA  1 
ATOM   5156  C C   . ALA E 1 78  ? -13.363 3.634   0.045   1.00 46.65  ? 74  ALA E C   1 
ATOM   5157  O O   . ALA E 1 78  ? -12.850 4.120   -0.963  1.00 51.81  ? 74  ALA E O   1 
ATOM   5158  C CB  . ALA E 1 78  ? -12.330 1.753   1.301   1.00 38.83  ? 74  ALA E CB  1 
ATOM   5159  N N   . ILE E 1 79  ? -14.667 3.409   0.159   1.00 48.89  ? 75  ILE E N   1 
ATOM   5160  C CA  . ILE E 1 79  ? -15.603 3.784   -0.890  1.00 45.03  ? 75  ILE E CA  1 
ATOM   5161  C C   . ILE E 1 79  ? -15.556 5.293   -1.100  1.00 45.60  ? 75  ILE E C   1 
ATOM   5162  O O   . ILE E 1 79  ? -15.459 5.769   -2.230  1.00 56.88  ? 75  ILE E O   1 
ATOM   5163  C CB  . ILE E 1 79  ? -17.044 3.389   -0.525  1.00 60.28  ? 75  ILE E CB  1 
ATOM   5164  C CG1 . ILE E 1 79  ? -17.152 1.879   -0.293  1.00 65.70  ? 75  ILE E CG1 1 
ATOM   5165  C CG2 . ILE E 1 79  ? -18.003 3.814   -1.626  1.00 68.29  ? 75  ILE E CG2 1 
ATOM   5166  C CD1 . ILE E 1 79  ? -18.425 1.466   0.418   1.00 65.79  ? 75  ILE E CD1 1 
ATOM   5167  N N   . ALA E 1 80  ? -15.622 6.037   0.001   1.00 42.32  ? 76  ALA E N   1 
ATOM   5168  C CA  . ALA E 1 80  ? -15.639 7.496   -0.049  1.00 40.62  ? 76  ALA E CA  1 
ATOM   5169  C C   . ALA E 1 80  ? -14.453 8.054   -0.833  1.00 44.74  ? 76  ALA E C   1 
ATOM   5170  O O   . ALA E 1 80  ? -14.620 8.937   -1.674  1.00 62.38  ? 76  ALA E O   1 
ATOM   5171  C CB  . ALA E 1 80  ? -15.656 8.069   1.359   1.00 45.42  ? 76  ALA E CB  1 
ATOM   5172  N N   . ILE E 1 81  ? -13.256 7.544   -0.557  1.00 38.80  ? 77  ILE E N   1 
ATOM   5173  C CA  . ILE E 1 81  ? -12.055 8.028   -1.234  1.00 40.76  ? 77  ILE E CA  1 
ATOM   5174  C C   . ILE E 1 81  ? -12.100 7.698   -2.721  1.00 31.05  ? 77  ILE E C   1 
ATOM   5175  O O   . ILE E 1 81  ? -11.726 8.521   -3.555  1.00 43.39  ? 77  ILE E O   1 
ATOM   5176  C CB  . ILE E 1 81  ? -10.767 7.446   -0.614  1.00 43.90  ? 77  ILE E CB  1 
ATOM   5177  C CG1 . ILE E 1 81  ? -10.617 7.913   0.833   1.00 50.21  ? 77  ILE E CG1 1 
ATOM   5178  C CG2 . ILE E 1 81  ? -9.541  7.869   -1.420  1.00 30.70  ? 77  ILE E CG2 1 
ATOM   5179  C CD1 . ILE E 1 81  ? -10.562 9.422   0.981   1.00 61.51  ? 77  ILE E CD1 1 
ATOM   5180  N N   . VAL E 1 82  ? -12.556 6.494   -3.052  1.00 29.00  ? 78  VAL E N   1 
ATOM   5181  C CA  . VAL E 1 82  ? -12.723 6.113   -4.450  1.00 44.13  ? 78  VAL E CA  1 
ATOM   5182  C C   . VAL E 1 82  ? -13.583 7.148   -5.161  1.00 46.56  ? 78  VAL E C   1 
ATOM   5183  O O   . VAL E 1 82  ? -13.241 7.613   -6.248  1.00 54.02  ? 78  VAL E O   1 
ATOM   5184  C CB  . VAL E 1 82  ? -13.381 4.725   -4.589  1.00 46.10  ? 78  VAL E CB  1 
ATOM   5185  C CG1 . VAL E 1 82  ? -13.927 4.526   -5.995  1.00 52.47  ? 78  VAL E CG1 1 
ATOM   5186  C CG2 . VAL E 1 82  ? -12.389 3.628   -4.239  1.00 36.64  ? 78  VAL E CG2 1 
ATOM   5187  N N   . GLN E 1 83  ? -14.696 7.512   -4.534  1.00 36.19  ? 79  GLN E N   1 
ATOM   5188  C CA  . GLN E 1 83  ? -15.613 8.490   -5.105  1.00 38.45  ? 79  GLN E CA  1 
ATOM   5189  C C   . GLN E 1 83  ? -14.919 9.824   -5.378  1.00 49.16  ? 79  GLN E C   1 
ATOM   5190  O O   . GLN E 1 83  ? -15.172 10.463  -6.402  1.00 31.81  ? 79  GLN E O   1 
ATOM   5191  C CB  . GLN E 1 83  ? -16.812 8.697   -4.179  1.00 29.23  ? 79  GLN E CB  1 
ATOM   5192  C CG  . GLN E 1 83  ? -17.742 7.501   -4.108  1.00 45.61  ? 79  GLN E CG  1 
ATOM   5193  C CD  . GLN E 1 83  ? -18.962 7.765   -3.249  1.00 49.01  ? 79  GLN E CD  1 
ATOM   5194  O OE1 . GLN E 1 83  ? -19.041 8.781   -2.558  1.00 41.24  ? 79  GLN E OE1 1 
ATOM   5195  N NE2 . GLN E 1 83  ? -19.925 6.851   -3.291  1.00 49.30  ? 79  GLN E NE2 1 
ATOM   5196  N N   . LEU E 1 84  ? -14.048 10.243  -4.463  1.00 52.68  ? 80  LEU E N   1 
ATOM   5197  C CA  . LEU E 1 84  ? -13.298 11.485  -4.634  1.00 37.91  ? 80  LEU E CA  1 
ATOM   5198  C C   . LEU E 1 84  ? -12.285 11.368  -5.767  1.00 29.08  ? 80  LEU E C   1 
ATOM   5199  O O   . LEU E 1 84  ? -11.951 12.360  -6.414  1.00 52.06  ? 80  LEU E O   1 
ATOM   5200  C CB  . LEU E 1 84  ? -12.583 11.865  -3.337  1.00 19.82  ? 80  LEU E CB  1 
ATOM   5201  C CG  . LEU E 1 84  ? -13.480 12.398  -2.222  1.00 36.57  ? 80  LEU E CG  1 
ATOM   5202  C CD1 . LEU E 1 84  ? -12.681 12.590  -0.944  1.00 44.64  ? 80  LEU E CD1 1 
ATOM   5203  C CD2 . LEU E 1 84  ? -14.138 13.705  -2.638  1.00 48.05  ? 80  LEU E CD2 1 
ATOM   5204  N N   . GLN E 1 85  ? -11.794 10.154  -6.001  1.00 19.61  ? 81  GLN E N   1 
ATOM   5205  C CA  . GLN E 1 85  ? -10.870 9.905   -7.102  1.00 27.54  ? 81  GLN E CA  1 
ATOM   5206  C C   . GLN E 1 85  ? -11.619 9.941   -8.428  1.00 35.03  ? 81  GLN E C   1 
ATOM   5207  O O   . GLN E 1 85  ? -11.075 10.360  -9.451  1.00 38.35  ? 81  GLN E O   1 
ATOM   5208  C CB  . GLN E 1 85  ? -10.168 8.557   -6.924  1.00 30.19  ? 81  GLN E CB  1 
ATOM   5209  C CG  . GLN E 1 85  ? -9.198  8.513   -5.749  1.00 29.67  ? 81  GLN E CG  1 
ATOM   5210  C CD  . GLN E 1 85  ? -8.583  7.139   -5.546  1.00 31.44  ? 81  GLN E CD  1 
ATOM   5211  O OE1 . GLN E 1 85  ? -9.291  6.138   -5.437  1.00 33.92  ? 81  GLN E OE1 1 
ATOM   5212  N NE2 . GLN E 1 85  ? -7.256  7.085   -5.500  1.00 34.79  ? 81  GLN E NE2 1 
ATOM   5213  N N   . GLU E 1 86  ? -12.873 9.500   -8.400  1.00 43.85  ? 82  GLU E N   1 
ATOM   5214  C CA  . GLU E 1 86  ? -13.737 9.560   -9.571  1.00 45.19  ? 82  GLU E CA  1 
ATOM   5215  C C   . GLU E 1 86  ? -14.101 11.008  -9.878  1.00 49.83  ? 82  GLU E C   1 
ATOM   5216  O O   . GLU E 1 86  ? -14.042 11.446  -11.026 1.00 55.97  ? 82  GLU E O   1 
ATOM   5217  C CB  . GLU E 1 86  ? -15.008 8.748   -9.333  1.00 44.60  ? 82  GLU E CB  1 
ATOM   5218  C CG  . GLU E 1 86  ? -14.778 7.253   -9.196  1.00 27.24  ? 82  GLU E CG  1 
ATOM   5219  C CD  . GLU E 1 86  ? -16.040 6.511   -8.802  1.00 38.71  ? 82  GLU E CD  1 
ATOM   5220  O OE1 . GLU E 1 86  ? -16.192 5.340   -9.206  1.00 50.93  ? 82  GLU E OE1 1 
ATOM   5221  O OE2 . GLU E 1 86  ? -16.881 7.100   -8.088  1.00 41.09  ? 82  GLU E OE2 1 
ATOM   5222  N N   . LEU E 1 87  ? -14.483 11.743  -8.839  1.00 56.48  ? 83  LEU E N   1 
ATOM   5223  C CA  . LEU E 1 87  ? -14.804 13.158  -8.966  1.00 57.35  ? 83  LEU E CA  1 
ATOM   5224  C C   . LEU E 1 87  ? -13.634 13.927  -9.569  1.00 52.10  ? 83  LEU E C   1 
ATOM   5225  O O   . LEU E 1 87  ? -13.825 14.885  -10.320 1.00 56.76  ? 83  LEU E O   1 
ATOM   5226  C CB  . LEU E 1 87  ? -15.148 13.739  -7.594  1.00 54.20  ? 83  LEU E CB  1 
ATOM   5227  C CG  . LEU E 1 87  ? -15.201 15.265  -7.500  1.00 45.12  ? 83  LEU E CG  1 
ATOM   5228  C CD1 . LEU E 1 87  ? -16.381 15.811  -8.290  1.00 44.52  ? 83  LEU E CD1 1 
ATOM   5229  C CD2 . LEU E 1 87  ? -15.264 15.703  -6.046  1.00 33.42  ? 83  LEU E CD2 1 
ATOM   5230  N N   . SER E 1 88  ? -12.421 13.500  -9.232  1.00 32.98  ? 84  SER E N   1 
ATOM   5231  C CA  . SER E 1 88  ? -11.216 14.179  -9.687  1.00 29.44  ? 84  SER E CA  1 
ATOM   5232  C C   . SER E 1 88  ? -10.915 13.881  -11.154 1.00 49.28  ? 84  SER E C   1 
ATOM   5233  O O   . SER E 1 88  ? -10.294 14.691  -11.840 1.00 49.15  ? 84  SER E O   1 
ATOM   5234  C CB  . SER E 1 88  ? -10.028 13.775  -8.817  1.00 33.26  ? 84  SER E CB  1 
ATOM   5235  O OG  . SER E 1 88  ? -10.214 14.191  -7.472  1.00 29.46  ? 84  SER E OG  1 
ATOM   5236  N N   . LEU E 1 89  ? -11.348 12.716  -11.630 1.00 62.21  ? 85  LEU E N   1 
ATOM   5237  C CA  . LEU E 1 89  ? -11.182 12.359  -13.037 1.00 54.60  ? 85  LEU E CA  1 
ATOM   5238  C C   . LEU E 1 89  ? -12.029 13.270  -13.923 1.00 54.02  ? 85  LEU E C   1 
ATOM   5239  O O   . LEU E 1 89  ? -11.590 13.687  -14.995 1.00 59.64  ? 85  LEU E O   1 
ATOM   5240  C CB  . LEU E 1 89  ? -11.559 10.893  -13.276 1.00 55.29  ? 85  LEU E CB  1 
ATOM   5241  C CG  . LEU E 1 89  ? -10.509 9.836   -12.918 1.00 40.89  ? 85  LEU E CG  1 
ATOM   5242  C CD1 . LEU E 1 89  ? -11.136 8.453   -12.874 1.00 41.44  ? 85  LEU E CD1 1 
ATOM   5243  C CD2 . LEU E 1 89  ? -9.358  9.853   -13.913 1.00 14.01  ? 85  LEU E CD2 1 
ATOM   5244  N N   . ARG E 1 90  ? -13.242 13.577  -13.471 1.00 50.37  ? 86  ARG E N   1 
ATOM   5245  C CA  . ARG E 1 90  ? -14.133 14.460  -14.220 1.00 45.78  ? 86  ARG E CA  1 
ATOM   5246  C C   . ARG E 1 90  ? -13.620 15.898  -14.177 1.00 44.15  ? 86  ARG E C   1 
ATOM   5247  O O   . ARG E 1 90  ? -13.770 16.649  -15.140 1.00 59.66  ? 86  ARG E O   1 
ATOM   5248  C CB  . ARG E 1 90  ? -15.556 14.416  -13.654 1.00 41.12  ? 86  ARG E CB  1 
ATOM   5249  C CG  . ARG E 1 90  ? -16.117 13.022  -13.412 1.00 36.49  ? 86  ARG E CG  1 
ATOM   5250  C CD  . ARG E 1 90  ? -17.621 13.077  -13.174 1.00 46.41  ? 86  ARG E CD  1 
ATOM   5251  N NE  . ARG E 1 90  ? -18.073 12.092  -12.191 1.00 55.81  ? 86  ARG E NE  1 
ATOM   5252  C CZ  . ARG E 1 90  ? -18.192 12.323  -10.884 1.00 52.16  ? 86  ARG E CZ  1 
ATOM   5253  N NH1 . ARG E 1 90  ? -17.895 13.510  -10.370 1.00 42.24  ? 86  ARG E NH1 1 
ATOM   5254  N NH2 . ARG E 1 90  ? -18.613 11.357  -10.081 1.00 61.27  ? 86  ARG E NH2 1 
ATOM   5255  N N   . LEU E 1 91  ? -13.019 16.276  -13.053 1.00 28.67  ? 87  LEU E N   1 
ATOM   5256  C CA  . LEU E 1 91  ? -12.500 17.629  -12.873 1.00 28.82  ? 87  LEU E CA  1 
ATOM   5257  C C   . LEU E 1 91  ? -11.265 17.918  -13.728 1.00 50.97  ? 87  LEU E C   1 
ATOM   5258  O O   . LEU E 1 91  ? -11.030 19.063  -14.110 1.00 66.37  ? 87  LEU E O   1 
ATOM   5259  C CB  . LEU E 1 91  ? -12.163 17.870  -11.399 1.00 27.16  ? 87  LEU E CB  1 
ATOM   5260  C CG  . LEU E 1 91  ? -13.346 18.158  -10.472 1.00 29.40  ? 87  LEU E CG  1 
ATOM   5261  C CD1 . LEU E 1 91  ? -12.898 18.133  -9.017  1.00 21.08  ? 87  LEU E CD1 1 
ATOM   5262  C CD2 . LEU E 1 91  ? -13.980 19.499  -10.815 1.00 21.24  ? 87  LEU E CD2 1 
ATOM   5263  N N   . LYS E 1 92  ? -10.477 16.888  -14.024 1.00 48.45  ? 88  LYS E N   1 
ATOM   5264  C CA  . LYS E 1 92  ? -9.233  17.067  -14.771 1.00 54.19  ? 88  LYS E CA  1 
ATOM   5265  C C   . LYS E 1 92  ? -9.421  17.928  -16.018 1.00 71.50  ? 88  LYS E C   1 
ATOM   5266  O O   . LYS E 1 92  ? -8.484  18.583  -16.477 1.00 73.58  ? 88  LYS E O   1 
ATOM   5267  C CB  . LYS E 1 92  ? -8.641  15.714  -15.173 1.00 66.02  ? 88  LYS E CB  1 
ATOM   5268  C CG  . LYS E 1 92  ? -7.992  14.950  -14.031 1.00 69.10  ? 88  LYS E CG  1 
ATOM   5269  C CD  . LYS E 1 92  ? -6.933  13.988  -14.545 1.00 68.13  ? 88  LYS E CD  1 
ATOM   5270  C CE  . LYS E 1 92  ? -6.259  13.242  -13.405 1.00 74.62  ? 88  LYS E CE  1 
ATOM   5271  N NZ  . LYS E 1 92  ? -4.991  12.595  -13.838 1.00 72.76  ? 88  LYS E NZ  1 
ATOM   5272  N N   . SER E 1 93  ? -10.631 17.918  -16.567 1.00 83.89  ? 89  SER E N   1 
ATOM   5273  C CA  . SER E 1 93  ? -10.940 18.715  -17.748 1.00 84.46  ? 89  SER E CA  1 
ATOM   5274  C C   . SER E 1 93  ? -10.917 20.207  -17.428 1.00 86.19  ? 89  SER E C   1 
ATOM   5275  O O   . SER E 1 93  ? -10.467 21.018  -18.238 1.00 101.96 ? 89  SER E O   1 
ATOM   5276  C CB  . SER E 1 93  ? -12.310 18.327  -18.305 1.00 84.42  ? 89  SER E CB  1 
ATOM   5277  O OG  . SER E 1 93  ? -12.666 19.155  -19.397 1.00 96.92  ? 89  SER E OG  1 
ATOM   5278  N N   . CYS E 1 94  ? -11.403 20.560  -16.242 1.00 63.06  ? 90  CYS E N   1 
ATOM   5279  C CA  . CYS E 1 94  ? -11.508 21.957  -15.833 1.00 61.13  ? 90  CYS E CA  1 
ATOM   5280  C C   . CYS E 1 94  ? -10.144 22.599  -15.573 1.00 58.22  ? 90  CYS E C   1 
ATOM   5281  O O   . CYS E 1 94  ? -10.032 23.824  -15.517 1.00 55.58  ? 90  CYS E O   1 
ATOM   5282  C CB  . CYS E 1 94  ? -12.378 22.075  -14.579 1.00 62.01  ? 90  CYS E CB  1 
ATOM   5283  S SG  . CYS E 1 94  ? -14.063 21.447  -14.784 1.00 50.87  ? 90  CYS E SG  1 
ATOM   5284  N N   . PHE E 1 95  ? -9.116  21.772  -15.410 1.00 59.89  ? 91  PHE E N   1 
ATOM   5285  C CA  . PHE E 1 95  ? -7.760  22.265  -15.184 1.00 67.42  ? 91  PHE E CA  1 
ATOM   5286  C C   . PHE E 1 95  ? -6.903  22.086  -16.432 1.00 80.66  ? 91  PHE E C   1 
ATOM   5287  O O   . PHE E 1 95  ? -6.644  20.959  -16.859 1.00 95.76  ? 91  PHE E O   1 
ATOM   5288  C CB  . PHE E 1 95  ? -7.111  21.528  -14.009 1.00 72.41  ? 91  PHE E CB  1 
ATOM   5289  C CG  . PHE E 1 95  ? -7.752  21.816  -12.680 1.00 67.37  ? 91  PHE E CG  1 
ATOM   5290  C CD1 . PHE E 1 95  ? -8.942  21.205  -12.324 1.00 58.38  ? 91  PHE E CD1 1 
ATOM   5291  C CD2 . PHE E 1 95  ? -7.159  22.690  -11.785 1.00 63.15  ? 91  PHE E CD2 1 
ATOM   5292  C CE1 . PHE E 1 95  ? -9.534  21.466  -11.102 1.00 51.92  ? 91  PHE E CE1 1 
ATOM   5293  C CE2 . PHE E 1 95  ? -7.746  22.955  -10.560 1.00 53.97  ? 91  PHE E CE2 1 
ATOM   5294  C CZ  . PHE E 1 95  ? -8.934  22.342  -10.219 1.00 49.09  ? 91  PHE E CZ  1 
ATOM   5295  N N   . THR E 1 96  ? -6.464  23.197  -17.015 1.00 71.07  ? 92  THR E N   1 
ATOM   5296  C CA  . THR E 1 96  ? -5.597  23.147  -18.186 1.00 61.52  ? 92  THR E CA  1 
ATOM   5297  C C   . THR E 1 96  ? -4.187  22.762  -17.758 1.00 74.61  ? 92  THR E C   1 
ATOM   5298  O O   . THR E 1 96  ? -3.715  23.177  -16.700 1.00 85.36  ? 92  THR E O   1 
ATOM   5299  C CB  . THR E 1 96  ? -5.555  24.498  -18.931 1.00 42.27  ? 92  THR E CB  1 
ATOM   5300  O OG1 . THR E 1 96  ? -4.939  25.493  -18.103 1.00 52.31  ? 92  THR E OG1 1 
ATOM   5301  C CG2 . THR E 1 96  ? -6.961  24.945  -19.310 1.00 28.33  ? 92  THR E CG2 1 
ATOM   5302  N N   . LYS E 1 97  ? -3.520  21.959  -18.580 1.00 74.00  ? 93  LYS E N   1 
ATOM   5303  C CA  . LYS E 1 97  ? -2.168  21.515  -18.272 1.00 76.43  ? 93  LYS E CA  1 
ATOM   5304  C C   . LYS E 1 97  ? -1.206  22.698  -18.269 1.00 78.23  ? 93  LYS E C   1 
ATOM   5305  O O   . LYS E 1 97  ? -1.407  23.674  -18.992 1.00 77.93  ? 93  LYS E O   1 
ATOM   5306  C CB  . LYS E 1 97  ? -1.704  20.473  -19.290 1.00 78.81  ? 93  LYS E CB  1 
ATOM   5307  C CG  . LYS E 1 97  ? -0.341  19.870  -18.978 1.00 78.11  ? 93  LYS E CG  1 
ATOM   5308  C CD  . LYS E 1 97  ? 0.152   18.972  -20.102 1.00 86.04  ? 93  LYS E CD  1 
ATOM   5309  C CE  . LYS E 1 97  ? 0.475   19.760  -21.367 1.00 84.23  ? 93  LYS E CE  1 
ATOM   5310  N NZ  . LYS E 1 97  ? 1.590   20.729  -21.171 1.00 74.36  ? 93  LYS E NZ  1 
ATOM   5311  N N   . ASP E 1 98  ? -0.166  22.602  -17.447 1.00 83.78  ? 94  ASP E N   1 
ATOM   5312  C CA  . ASP E 1 98  ? 0.865   23.628  -17.377 1.00 79.76  ? 94  ASP E CA  1 
ATOM   5313  C C   . ASP E 1 98  ? 2.249   22.988  -17.459 1.00 86.20  ? 94  ASP E C   1 
ATOM   5314  O O   . ASP E 1 98  ? 2.370   21.769  -17.589 1.00 96.49  ? 94  ASP E O   1 
ATOM   5315  C CB  . ASP E 1 98  ? 0.726   24.427  -16.079 1.00 70.01  ? 94  ASP E CB  1 
ATOM   5316  C CG  . ASP E 1 98  ? -0.424  25.416  -16.122 1.00 62.69  ? 94  ASP E CG  1 
ATOM   5317  O OD1 . ASP E 1 98  ? -0.843  25.799  -17.234 1.00 66.35  ? 94  ASP E OD1 1 
ATOM   5318  O OD2 . ASP E 1 98  ? -0.905  25.816  -15.042 1.00 56.25  ? 94  ASP E OD2 1 
ATOM   5319  N N   . TYR E 1 99  ? 3.290   23.813  -17.388 1.00 81.59  ? 95  TYR E N   1 
ATOM   5320  C CA  . TYR E 1 99  ? 4.662   23.322  -17.412 1.00 79.12  ? 95  TYR E CA  1 
ATOM   5321  C C   . TYR E 1 99  ? 5.406   23.722  -16.142 1.00 67.00  ? 95  TYR E C   1 
ATOM   5322  O O   . TYR E 1 99  ? 6.364   23.061  -15.738 1.00 52.76  ? 95  TYR E O   1 
ATOM   5323  C CB  . TYR E 1 99  ? 5.401   23.856  -18.640 1.00 79.12  ? 95  TYR E CB  1 
ATOM   5324  C CG  . TYR E 1 99  ? 6.861   23.461  -18.690 1.00 89.92  ? 95  TYR E CG  1 
ATOM   5325  C CD1 . TYR E 1 99  ? 7.239   22.162  -19.006 1.00 90.91  ? 95  TYR E CD1 1 
ATOM   5326  C CD2 . TYR E 1 99  ? 7.861   24.387  -18.425 1.00 95.89  ? 95  TYR E CD2 1 
ATOM   5327  C CE1 . TYR E 1 99  ? 8.573   21.796  -19.053 1.00 83.47  ? 95  TYR E CE1 1 
ATOM   5328  C CE2 . TYR E 1 99  ? 9.197   24.031  -18.471 1.00 96.23  ? 95  TYR E CE2 1 
ATOM   5329  C CZ  . TYR E 1 99  ? 9.547   22.734  -18.785 1.00 85.13  ? 95  TYR E CZ  1 
ATOM   5330  O OH  . TYR E 1 99  ? 10.875  22.374  -18.832 1.00 74.34  ? 95  TYR E OH  1 
ATOM   5331  N N   . ASP E 1 103 ? 8.680   19.360  -12.408 1.00 109.54 ? 99  ASP E N   1 
ATOM   5332  C CA  . ASP E 1 103 ? 7.657   18.402  -12.009 1.00 106.39 ? 99  ASP E CA  1 
ATOM   5333  C C   . ASP E 1 103 ? 7.277   18.611  -10.546 1.00 94.77  ? 99  ASP E C   1 
ATOM   5334  O O   . ASP E 1 103 ? 6.108   18.817  -10.221 1.00 103.81 ? 99  ASP E O   1 
ATOM   5335  C CB  . ASP E 1 103 ? 8.160   16.971  -12.222 1.00 115.61 ? 99  ASP E CB  1 
ATOM   5336  C CG  . ASP E 1 103 ? 7.073   15.929  -12.019 1.00 124.14 ? 99  ASP E CG  1 
ATOM   5337  O OD1 . ASP E 1 103 ? 6.099   16.209  -11.289 1.00 124.98 ? 99  ASP E OD1 1 
ATOM   5338  O OD2 . ASP E 1 103 ? 7.196   14.825  -12.591 1.00 128.57 ? 99  ASP E OD2 1 
ATOM   5339  N N   . LYS E 1 104 ? 8.275   18.561  -9.669  1.00 80.42  ? 100 LYS E N   1 
ATOM   5340  C CA  . LYS E 1 104 ? 8.045   18.683  -8.234  1.00 90.56  ? 100 LYS E CA  1 
ATOM   5341  C C   . LYS E 1 104 ? 8.528   20.026  -7.692  1.00 84.02  ? 100 LYS E C   1 
ATOM   5342  O O   . LYS E 1 104 ? 9.171   20.094  -6.642  1.00 58.27  ? 100 LYS E O   1 
ATOM   5343  C CB  . LYS E 1 104 ? 8.715   17.523  -7.492  1.00 96.73  ? 100 LYS E CB  1 
ATOM   5344  C CG  . LYS E 1 104 ? 7.858   16.269  -7.438  1.00 103.62 ? 100 LYS E CG  1 
ATOM   5345  C CD  . LYS E 1 104 ? 8.673   15.041  -7.080  1.00 107.39 ? 100 LYS E CD  1 
ATOM   5346  C CE  . LYS E 1 104 ? 7.788   13.919  -6.552  1.00 111.55 ? 100 LYS E CE  1 
ATOM   5347  N NZ  . LYS E 1 104 ? 7.266   14.194  -5.185  1.00 110.55 ? 100 LYS E NZ  1 
ATOM   5348  N N   . ALA E 1 105 ? 8.206   21.092  -8.417  1.00 85.89  ? 101 ALA E N   1 
ATOM   5349  C CA  . ALA E 1 105 ? 8.469   22.445  -7.949  1.00 87.35  ? 101 ALA E CA  1 
ATOM   5350  C C   . ALA E 1 105 ? 7.301   22.890  -7.079  1.00 83.99  ? 101 ALA E C   1 
ATOM   5351  O O   . ALA E 1 105 ? 6.207   22.337  -7.176  1.00 80.76  ? 101 ALA E O   1 
ATOM   5352  C CB  . ALA E 1 105 ? 8.646   23.389  -9.127  1.00 94.13  ? 101 ALA E CB  1 
ATOM   5353  N N   . CYS E 1 106 ? 7.535   23.884  -6.227  1.00 72.78  ? 102 CYS E N   1 
ATOM   5354  C CA  . CYS E 1 106 ? 6.500   24.375  -5.322  1.00 44.97  ? 102 CYS E CA  1 
ATOM   5355  C C   . CYS E 1 106 ? 6.015   23.272  -4.384  1.00 55.72  ? 102 CYS E C   1 
ATOM   5356  O O   . CYS E 1 106 ? 4.914   23.351  -3.837  1.00 65.83  ? 102 CYS E O   1 
ATOM   5357  C CB  . CYS E 1 106 ? 5.321   24.942  -6.116  1.00 20.71  ? 102 CYS E CB  1 
ATOM   5358  S SG  . CYS E 1 106 ? 5.730   26.389  -7.118  1.00 48.81  ? 102 CYS E SG  1 
ATOM   5359  N N   . VAL E 1 107 ? 6.848   22.253  -4.189  1.00 58.44  ? 103 VAL E N   1 
ATOM   5360  C CA  . VAL E 1 107 ? 6.496   21.124  -3.334  1.00 63.93  ? 103 VAL E CA  1 
ATOM   5361  C C   . VAL E 1 107 ? 7.423   21.052  -2.126  1.00 63.93  ? 103 VAL E C   1 
ATOM   5362  O O   . VAL E 1 107 ? 8.584   21.458  -2.191  1.00 61.68  ? 103 VAL E O   1 
ATOM   5363  C CB  . VAL E 1 107 ? 6.562   19.788  -4.106  1.00 65.31  ? 103 VAL E CB  1 
ATOM   5364  C CG1 . VAL E 1 107 ? 6.350   18.606  -3.164  1.00 68.82  ? 103 VAL E CG1 1 
ATOM   5365  C CG2 . VAL E 1 107 ? 5.529   19.773  -5.216  1.00 62.13  ? 103 VAL E CG2 1 
ATOM   5366  N N   . ARG E 1 108 ? 6.896   20.535  -1.022  1.00 50.15  ? 104 ARG E N   1 
ATOM   5367  C CA  . ARG E 1 108 ? 7.676   20.382  0.196   1.00 48.61  ? 104 ARG E CA  1 
ATOM   5368  C C   . ARG E 1 108 ? 7.229   19.140  0.958   1.00 63.17  ? 104 ARG E C   1 
ATOM   5369  O O   . ARG E 1 108 ? 6.050   18.787  0.950   1.00 70.42  ? 104 ARG E O   1 
ATOM   5370  C CB  . ARG E 1 108 ? 7.529   21.621  1.079   1.00 38.48  ? 104 ARG E CB  1 
ATOM   5371  N N   . THR E 1 109 ? 8.180   18.477  1.607   1.00 68.15  ? 105 THR E N   1 
ATOM   5372  C CA  . THR E 1 109 ? 7.887   17.283  2.392   1.00 66.10  ? 105 THR E CA  1 
ATOM   5373  C C   . THR E 1 109 ? 7.460   17.648  3.811   1.00 69.17  ? 105 THR E C   1 
ATOM   5374  O O   . THR E 1 109 ? 8.254   18.169  4.595   1.00 85.95  ? 105 THR E O   1 
ATOM   5375  C CB  . THR E 1 109 ? 9.108   16.346  2.461   1.00 65.16  ? 105 THR E CB  1 
ATOM   5376  O OG1 . THR E 1 109 ? 9.327   15.747  1.178   1.00 53.15  ? 105 THR E OG1 1 
ATOM   5377  C CG2 . THR E 1 109 ? 8.886   15.247  3.489   1.00 72.23  ? 105 THR E CG2 1 
ATOM   5378  N N   . PHE E 1 110 ? 6.205   17.362  4.138   1.00 60.79  ? 106 PHE E N   1 
ATOM   5379  C CA  . PHE E 1 110 ? 5.667   17.672  5.456   1.00 46.86  ? 106 PHE E CA  1 
ATOM   5380  C C   . PHE E 1 110 ? 5.859   16.506  6.413   1.00 45.82  ? 106 PHE E C   1 
ATOM   5381  O O   . PHE E 1 110 ? 5.899   15.347  5.998   1.00 43.15  ? 106 PHE E O   1 
ATOM   5382  C CB  . PHE E 1 110 ? 4.177   18.008  5.362   1.00 45.11  ? 106 PHE E CB  1 
ATOM   5383  C CG  . PHE E 1 110 ? 3.889   19.311  4.671   1.00 40.86  ? 106 PHE E CG  1 
ATOM   5384  C CD1 . PHE E 1 110 ? 3.980   19.415  3.292   1.00 32.86  ? 106 PHE E CD1 1 
ATOM   5385  C CD2 . PHE E 1 110 ? 3.517   20.429  5.400   1.00 42.06  ? 106 PHE E CD2 1 
ATOM   5386  C CE1 . PHE E 1 110 ? 3.713   20.612  2.655   1.00 38.12  ? 106 PHE E CE1 1 
ATOM   5387  C CE2 . PHE E 1 110 ? 3.247   21.629  4.767   1.00 44.51  ? 106 PHE E CE2 1 
ATOM   5388  C CZ  . PHE E 1 110 ? 3.345   21.719  3.392   1.00 46.82  ? 106 PHE E CZ  1 
ATOM   5389  N N   . TYR E 1 111 ? 5.989   16.826  7.695   1.00 49.70  ? 107 TYR E N   1 
ATOM   5390  C CA  . TYR E 1 111 ? 5.984   15.822  8.746   1.00 47.84  ? 107 TYR E CA  1 
ATOM   5391  C C   . TYR E 1 111 ? 4.875   16.188  9.725   1.00 60.90  ? 107 TYR E C   1 
ATOM   5392  O O   . TYR E 1 111 ? 5.122   16.783  10.775  1.00 55.54  ? 107 TYR E O   1 
ATOM   5393  C CB  . TYR E 1 111 ? 7.341   15.761  9.449   1.00 39.77  ? 107 TYR E CB  1 
ATOM   5394  C CG  . TYR E 1 111 ? 7.516   14.558  10.352  1.00 38.42  ? 107 TYR E CG  1 
ATOM   5395  C CD1 . TYR E 1 111 ? 7.511   13.268  9.834   1.00 41.22  ? 107 TYR E CD1 1 
ATOM   5396  C CD2 . TYR E 1 111 ? 7.682   14.711  11.720  1.00 46.89  ? 107 TYR E CD2 1 
ATOM   5397  C CE1 . TYR E 1 111 ? 7.670   12.168  10.654  1.00 43.84  ? 107 TYR E CE1 1 
ATOM   5398  C CE2 . TYR E 1 111 ? 7.842   13.619  12.548  1.00 58.95  ? 107 TYR E CE2 1 
ATOM   5399  C CZ  . TYR E 1 111 ? 7.835   12.349  12.012  1.00 58.27  ? 107 TYR E CZ  1 
ATOM   5400  O OH  . TYR E 1 111 ? 7.994   11.260  12.839  1.00 59.57  ? 107 TYR E OH  1 
ATOM   5401  N N   . GLU E 1 112 ? 3.645   15.841  9.358   1.00 63.90  ? 108 GLU E N   1 
ATOM   5402  C CA  . GLU E 1 112 ? 2.472   16.233  10.129  1.00 65.73  ? 108 GLU E CA  1 
ATOM   5403  C C   . GLU E 1 112 ? 1.568   15.042  10.421  1.00 66.90  ? 108 GLU E C   1 
ATOM   5404  O O   . GLU E 1 112 ? 1.722   13.972  9.834   1.00 63.16  ? 108 GLU E O   1 
ATOM   5405  C CB  . GLU E 1 112 ? 1.684   17.304  9.372   1.00 57.81  ? 108 GLU E CB  1 
ATOM   5406  C CG  . GLU E 1 112 ? 2.435   18.613  9.189   1.00 54.72  ? 108 GLU E CG  1 
ATOM   5407  C CD  . GLU E 1 112 ? 1.652   19.621  8.370   1.00 55.55  ? 108 GLU E CD  1 
ATOM   5408  O OE1 . GLU E 1 112 ? 1.444   20.754  8.855   1.00 64.75  ? 108 GLU E OE1 1 
ATOM   5409  O OE2 . GLU E 1 112 ? 1.246   19.280  7.239   1.00 48.52  ? 108 GLU E OE2 1 
ATOM   5410  N N   . THR E 1 113 ? 0.617   15.244  11.329  1.00 69.49  ? 109 THR E N   1 
ATOM   5411  C CA  . THR E 1 113 ? -0.305  14.187  11.726  1.00 66.79  ? 109 THR E CA  1 
ATOM   5412  C C   . THR E 1 113 ? -1.205  13.815  10.553  1.00 59.90  ? 109 THR E C   1 
ATOM   5413  O O   . THR E 1 113 ? -1.357  14.597  9.613   1.00 43.83  ? 109 THR E O   1 
ATOM   5414  C CB  . THR E 1 113 ? -1.198  14.622  12.911  1.00 51.74  ? 109 THR E CB  1 
ATOM   5415  O OG1 . THR E 1 113 ? -2.096  15.654  12.484  1.00 67.10  ? 109 THR E OG1 1 
ATOM   5416  C CG2 . THR E 1 113 ? -0.358  15.134  14.082  1.00 38.06  ? 109 THR E CG2 1 
ATOM   5417  N N   . PRO E 1 114 ? -1.799  12.612  10.599  1.00 62.38  ? 110 PRO E N   1 
ATOM   5418  C CA  . PRO E 1 114 ? -2.764  12.199  9.574   1.00 55.82  ? 110 PRO E CA  1 
ATOM   5419  C C   . PRO E 1 114 ? -3.932  13.173  9.476   1.00 42.32  ? 110 PRO E C   1 
ATOM   5420  O O   . PRO E 1 114 ? -4.479  13.369  8.391   1.00 42.28  ? 110 PRO E O   1 
ATOM   5421  C CB  . PRO E 1 114 ? -3.243  10.834  10.076  1.00 68.92  ? 110 PRO E CB  1 
ATOM   5422  C CG  . PRO E 1 114 ? -2.116  10.323  10.901  1.00 75.68  ? 110 PRO E CG  1 
ATOM   5423  C CD  . PRO E 1 114 ? -1.518  11.530  11.558  1.00 68.37  ? 110 PRO E CD  1 
ATOM   5424  N N   . LEU E 1 115 ? -4.300  13.781  10.600  1.00 43.62  ? 111 LEU E N   1 
ATOM   5425  C CA  . LEU E 1 115 ? -5.393  14.747  10.626  1.00 53.39  ? 111 LEU E CA  1 
ATOM   5426  C C   . LEU E 1 115 ? -5.000  16.042  9.921   1.00 38.64  ? 111 LEU E C   1 
ATOM   5427  O O   . LEU E 1 115 ? -5.790  16.617  9.175   1.00 31.25  ? 111 LEU E O   1 
ATOM   5428  C CB  . LEU E 1 115 ? -5.814  15.039  12.068  1.00 70.87  ? 111 LEU E CB  1 
ATOM   5429  C CG  . LEU E 1 115 ? -6.651  13.950  12.743  1.00 76.32  ? 111 LEU E CG  1 
ATOM   5430  C CD1 . LEU E 1 115 ? -6.710  14.174  14.244  1.00 86.39  ? 111 LEU E CD1 1 
ATOM   5431  C CD2 . LEU E 1 115 ? -8.055  13.914  12.158  1.00 64.67  ? 111 LEU E CD2 1 
ATOM   5432  N N   . GLN E 1 116 ? -3.774  16.494  10.157  1.00 42.36  ? 112 GLN E N   1 
ATOM   5433  C CA  . GLN E 1 116 ? -3.265  17.692  9.500   1.00 49.28  ? 112 GLN E CA  1 
ATOM   5434  C C   . GLN E 1 116 ? -3.202  17.498  7.986   1.00 48.27  ? 112 GLN E C   1 
ATOM   5435  O O   . GLN E 1 116 ? -3.247  18.465  7.226   1.00 48.80  ? 112 GLN E O   1 
ATOM   5436  C CB  . GLN E 1 116 ? -1.884  18.057  10.050  1.00 49.62  ? 112 GLN E CB  1 
ATOM   5437  C CG  . GLN E 1 116 ? -1.913  18.622  11.468  1.00 47.64  ? 112 GLN E CG  1 
ATOM   5438  C CD  . GLN E 1 116 ? -0.525  18.887  12.028  1.00 59.15  ? 112 GLN E CD  1 
ATOM   5439  O OE1 . GLN E 1 116 ? 0.217   17.958  12.346  1.00 43.63  ? 112 GLN E OE1 1 
ATOM   5440  N NE2 . GLN E 1 116 ? -0.170  20.163  12.153  1.00 76.90  ? 112 GLN E NE2 1 
ATOM   5441  N N   . LEU E 1 117 ? -3.102  16.246  7.552   1.00 52.06  ? 113 LEU E N   1 
ATOM   5442  C CA  . LEU E 1 117 ? -3.105  15.927  6.129   1.00 41.64  ? 113 LEU E CA  1 
ATOM   5443  C C   . LEU E 1 117 ? -4.514  16.003  5.554   1.00 46.27  ? 113 LEU E C   1 
ATOM   5444  O O   . LEU E 1 117 ? -4.739  16.629  4.519   1.00 43.86  ? 113 LEU E O   1 
ATOM   5445  C CB  . LEU E 1 117 ? -2.533  14.528  5.891   1.00 33.57  ? 113 LEU E CB  1 
ATOM   5446  C CG  . LEU E 1 117 ? -2.823  13.952  4.502   1.00 49.25  ? 113 LEU E CG  1 
ATOM   5447  C CD1 . LEU E 1 117 ? -2.234  14.846  3.423   1.00 66.95  ? 113 LEU E CD1 1 
ATOM   5448  C CD2 . LEU E 1 117 ? -2.290  12.535  4.376   1.00 45.02  ? 113 LEU E CD2 1 
ATOM   5449  N N   . LEU E 1 118 ? -5.459  15.354  6.228   1.00 46.47  ? 114 LEU E N   1 
ATOM   5450  C CA  . LEU E 1 118 ? -6.838  15.297  5.755   1.00 42.79  ? 114 LEU E CA  1 
ATOM   5451  C C   . LEU E 1 118 ? -7.464  16.684  5.678   1.00 59.91  ? 114 LEU E C   1 
ATOM   5452  O O   . LEU E 1 118 ? -8.331  16.933  4.842   1.00 63.59  ? 114 LEU E O   1 
ATOM   5453  C CB  . LEU E 1 118 ? -7.678  14.402  6.667   1.00 34.77  ? 114 LEU E CB  1 
ATOM   5454  C CG  . LEU E 1 118 ? -7.328  12.914  6.629   1.00 42.52  ? 114 LEU E CG  1 
ATOM   5455  C CD1 . LEU E 1 118 ? -8.003  12.175  7.768   1.00 45.06  ? 114 LEU E CD1 1 
ATOM   5456  C CD2 . LEU E 1 118 ? -7.731  12.310  5.296   1.00 47.19  ? 114 LEU E CD2 1 
ATOM   5457  N N   . GLU E 1 119 ? -7.030  17.581  6.558   1.00 55.89  ? 115 GLU E N   1 
ATOM   5458  C CA  . GLU E 1 119 ? -7.529  18.951  6.553   1.00 45.03  ? 115 GLU E CA  1 
ATOM   5459  C C   . GLU E 1 119 ? -7.034  19.686  5.312   1.00 39.97  ? 115 GLU E C   1 
ATOM   5460  O O   . GLU E 1 119 ? -7.775  20.458  4.702   1.00 41.00  ? 115 GLU E O   1 
ATOM   5461  C CB  . GLU E 1 119 ? -7.086  19.691  7.818   1.00 59.93  ? 115 GLU E CB  1 
ATOM   5462  C CG  . GLU E 1 119 ? -7.674  19.130  9.108   1.00 66.90  ? 115 GLU E CG  1 
ATOM   5463  C CD  . GLU E 1 119 ? -9.173  19.337  9.214   1.00 62.81  ? 115 GLU E CD  1 
ATOM   5464  O OE1 . GLU E 1 119 ? -9.734  20.096  8.396   1.00 75.11  ? 115 GLU E OE1 1 
ATOM   5465  O OE2 . GLU E 1 119 ? -9.792  18.737  10.118  1.00 48.82  ? 115 GLU E OE2 1 
ATOM   5466  N N   . LYS E 1 120 ? -5.780  19.439  4.942   1.00 36.96  ? 116 LYS E N   1 
ATOM   5467  C CA  . LYS E 1 120 ? -5.198  20.036  3.744   1.00 29.38  ? 116 LYS E CA  1 
ATOM   5468  C C   . LYS E 1 120 ? -5.970  19.609  2.502   1.00 40.73  ? 116 LYS E C   1 
ATOM   5469  O O   . LYS E 1 120 ? -6.205  20.412  1.602   1.00 45.07  ? 116 LYS E O   1 
ATOM   5470  C CB  . LYS E 1 120 ? -3.730  19.629  3.599   1.00 25.39  ? 116 LYS E CB  1 
ATOM   5471  C CG  . LYS E 1 120 ? -2.772  20.405  4.489   1.00 33.85  ? 116 LYS E CG  1 
ATOM   5472  C CD  . LYS E 1 120 ? -1.344  19.892  4.349   1.00 27.76  ? 116 LYS E CD  1 
ATOM   5473  C CE  . LYS E 1 120 ? -0.331  20.900  4.869   1.00 33.43  ? 116 LYS E CE  1 
ATOM   5474  N NZ  . LYS E 1 120 ? -0.525  21.203  6.315   1.00 52.28  ? 116 LYS E NZ  1 
ATOM   5475  N N   . VAL E 1 121 ? -6.356  18.337  2.462   1.00 46.01  ? 117 VAL E N   1 
ATOM   5476  C CA  . VAL E 1 121 ? -7.127  17.798  1.346   1.00 29.48  ? 117 VAL E CA  1 
ATOM   5477  C C   . VAL E 1 121 ? -8.543  18.365  1.361   1.00 38.60  ? 117 VAL E C   1 
ATOM   5478  O O   . VAL E 1 121 ? -9.089  18.721  0.317   1.00 46.65  ? 117 VAL E O   1 
ATOM   5479  C CB  . VAL E 1 121 ? -7.201  16.260  1.407   1.00 34.97  ? 117 VAL E CB  1 
ATOM   5480  C CG1 . VAL E 1 121 ? -8.069  15.720  0.278   1.00 45.30  ? 117 VAL E CG1 1 
ATOM   5481  C CG2 . VAL E 1 121 ? -5.803  15.656  1.345   1.00 33.91  ? 117 VAL E CG2 1 
ATOM   5482  N N   . LYS E 1 122 ? -9.129  18.447  2.553   1.00 42.73  ? 118 LYS E N   1 
ATOM   5483  C CA  . LYS E 1 122 ? -10.467 19.002  2.722   1.00 43.87  ? 118 LYS E CA  1 
ATOM   5484  C C   . LYS E 1 122 ? -10.539 20.414  2.173   1.00 40.23  ? 118 LYS E C   1 
ATOM   5485  O O   . LYS E 1 122 ? -11.467 20.760  1.442   1.00 52.51  ? 118 LYS E O   1 
ATOM   5486  C CB  . LYS E 1 122 ? -10.858 19.026  4.201   1.00 54.83  ? 118 LYS E CB  1 
ATOM   5487  C CG  . LYS E 1 122 ? -12.166 19.757  4.476   1.00 40.05  ? 118 LYS E CG  1 
ATOM   5488  C CD  . LYS E 1 122 ? -12.386 19.991  5.960   1.00 28.82  ? 118 LYS E CD  1 
ATOM   5489  C CE  . LYS E 1 122 ? -13.649 20.803  6.202   1.00 38.49  ? 118 LYS E CE  1 
ATOM   5490  N NZ  . LYS E 1 122 ? -13.829 21.165  7.635   1.00 47.26  ? 118 LYS E NZ  1 
ATOM   5491  N N   . ASN E 1 123 ? -9.560  21.234  2.538   1.00 42.81  ? 119 ASN E N   1 
ATOM   5492  C CA  . ASN E 1 123 ? -9.546  22.629  2.124   1.00 50.16  ? 119 ASN E CA  1 
ATOM   5493  C C   . ASN E 1 123 ? -9.403  22.782  0.616   1.00 41.58  ? 119 ASN E C   1 
ATOM   5494  O O   . ASN E 1 123 ? -9.979  23.694  0.031   1.00 37.47  ? 119 ASN E O   1 
ATOM   5495  C CB  . ASN E 1 123 ? -8.430  23.395  2.839   1.00 69.84  ? 119 ASN E CB  1 
ATOM   5496  C CG  . ASN E 1 123 ? -8.653  23.489  4.339   1.00 84.66  ? 119 ASN E CG  1 
ATOM   5497  O OD1 . ASN E 1 123 ? -7.775  23.145  5.131   1.00 89.42  ? 119 ASN E OD1 1 
ATOM   5498  N ND2 . ASN E 1 123 ? -9.832  23.957  4.735   1.00 81.52  ? 119 ASN E ND2 1 
ATOM   5499  N N   . VAL E 1 124 ? -8.643  21.890  -0.016  1.00 48.01  ? 120 VAL E N   1 
ATOM   5500  C CA  . VAL E 1 124 ? -8.457  21.952  -1.463  1.00 43.12  ? 120 VAL E CA  1 
ATOM   5501  C C   . VAL E 1 124 ? -9.770  21.702  -2.194  1.00 45.77  ? 120 VAL E C   1 
ATOM   5502  O O   . VAL E 1 124 ? -10.118 22.427  -3.126  1.00 51.44  ? 120 VAL E O   1 
ATOM   5503  C CB  . VAL E 1 124 ? -7.410  20.939  -1.957  1.00 34.93  ? 120 VAL E CB  1 
ATOM   5504  C CG1 . VAL E 1 124 ? -7.431  20.853  -3.481  1.00 26.70  ? 120 VAL E CG1 1 
ATOM   5505  C CG2 . VAL E 1 124 ? -6.026  21.329  -1.470  1.00 28.68  ? 120 VAL E CG2 1 
ATOM   5506  N N   . PHE E 1 125 ? -10.497 20.671  -1.777  1.00 39.56  ? 121 PHE E N   1 
ATOM   5507  C CA  . PHE E 1 125 ? -11.790 20.373  -2.380  1.00 46.34  ? 121 PHE E CA  1 
ATOM   5508  C C   . PHE E 1 125 ? -12.815 21.436  -1.995  1.00 58.09  ? 121 PHE E C   1 
ATOM   5509  O O   . PHE E 1 125 ? -13.709 21.764  -2.777  1.00 62.14  ? 121 PHE E O   1 
ATOM   5510  C CB  . PHE E 1 125 ? -12.280 18.987  -1.957  1.00 41.59  ? 121 PHE E CB  1 
ATOM   5511  C CG  . PHE E 1 125 ? -11.608 17.857  -2.685  1.00 44.92  ? 121 PHE E CG  1 
ATOM   5512  C CD1 . PHE E 1 125 ? -11.957 17.556  -3.992  1.00 44.38  ? 121 PHE E CD1 1 
ATOM   5513  C CD2 . PHE E 1 125 ? -10.634 17.093  -2.064  1.00 42.39  ? 121 PHE E CD2 1 
ATOM   5514  C CE1 . PHE E 1 125 ? -11.343 16.516  -4.667  1.00 41.98  ? 121 PHE E CE1 1 
ATOM   5515  C CE2 . PHE E 1 125 ? -10.017 16.051  -2.733  1.00 34.48  ? 121 PHE E CE2 1 
ATOM   5516  C CZ  . PHE E 1 125 ? -10.372 15.763  -4.037  1.00 38.30  ? 121 PHE E CZ  1 
ATOM   5517  N N   . ASN E 1 126 ? -12.674 21.976  -0.788  1.00 54.56  ? 122 ASN E N   1 
ATOM   5518  C CA  . ASN E 1 126 ? -13.598 22.984  -0.283  1.00 65.80  ? 122 ASN E CA  1 
ATOM   5519  C C   . ASN E 1 126 ? -13.448 24.307  -1.033  1.00 59.92  ? 122 ASN E C   1 
ATOM   5520  O O   . ASN E 1 126 ? -14.425 24.862  -1.537  1.00 56.84  ? 122 ASN E O   1 
ATOM   5521  C CB  . ASN E 1 126 ? -13.368 23.198  1.215   1.00 77.11  ? 122 ASN E CB  1 
ATOM   5522  C CG  . ASN E 1 126 ? -14.520 23.915  1.889   1.00 86.83  ? 122 ASN E CG  1 
ATOM   5523  O OD1 . ASN E 1 126 ? -15.680 23.746  1.509   1.00 93.78  ? 122 ASN E OD1 1 
ATOM   5524  N ND2 . ASN E 1 126 ? -14.206 24.720  2.897   1.00 86.89  ? 122 ASN E ND2 1 
ATOM   5525  N N   . GLU E 1 127 ? -12.217 24.805  -1.106  1.00 48.29  ? 123 GLU E N   1 
ATOM   5526  C CA  . GLU E 1 127 ? -11.932 26.053  -1.807  1.00 39.27  ? 123 GLU E CA  1 
ATOM   5527  C C   . GLU E 1 127 ? -12.166 25.915  -3.307  1.00 41.38  ? 123 GLU E C   1 
ATOM   5528  O O   . GLU E 1 127 ? -12.581 26.868  -3.963  1.00 58.94  ? 123 GLU E O   1 
ATOM   5529  C CB  . GLU E 1 127 ? -10.492 26.504  -1.547  1.00 57.00  ? 123 GLU E CB  1 
ATOM   5530  C CG  . GLU E 1 127 ? -10.367 27.622  -0.524  1.00 62.69  ? 123 GLU E CG  1 
ATOM   5531  C CD  . GLU E 1 127 ? -8.924  27.943  -0.186  1.00 63.75  ? 123 GLU E CD  1 
ATOM   5532  O OE1 . GLU E 1 127 ? -8.601  29.138  -0.019  1.00 70.12  ? 123 GLU E OE1 1 
ATOM   5533  O OE2 . GLU E 1 127 ? -8.113  26.999  -0.084  1.00 61.00  ? 123 GLU E OE2 1 
ATOM   5534  N N   . THR E 1 128 ? -11.900 24.730  -3.848  1.00 42.78  ? 124 THR E N   1 
ATOM   5535  C CA  . THR E 1 128 ? -12.089 24.487  -5.275  1.00 49.22  ? 124 THR E CA  1 
ATOM   5536  C C   . THR E 1 128 ? -13.558 24.625  -5.666  1.00 53.83  ? 124 THR E C   1 
ATOM   5537  O O   . THR E 1 128 ? -13.875 25.158  -6.729  1.00 47.83  ? 124 THR E O   1 
ATOM   5538  C CB  . THR E 1 128 ? -11.584 23.089  -5.685  1.00 55.57  ? 124 THR E CB  1 
ATOM   5539  O OG1 . THR E 1 128 ? -10.156 23.046  -5.588  1.00 49.49  ? 124 THR E OG1 1 
ATOM   5540  C CG2 . THR E 1 128 ? -11.991 22.767  -7.118  1.00 53.44  ? 124 THR E CG2 1 
ATOM   5541  N N   . LYS E 1 129 ? -14.452 24.145  -4.807  1.00 58.08  ? 125 LYS E N   1 
ATOM   5542  C CA  . LYS E 1 129 ? -15.886 24.240  -5.068  1.00 48.81  ? 125 LYS E CA  1 
ATOM   5543  C C   . LYS E 1 129 ? -16.374 25.685  -4.998  1.00 47.32  ? 125 LYS E C   1 
ATOM   5544  O O   . LYS E 1 129 ? -17.191 26.111  -5.814  1.00 56.89  ? 125 LYS E O   1 
ATOM   5545  C CB  . LYS E 1 129 ? -16.676 23.384  -4.077  1.00 48.62  ? 125 LYS E CB  1 
ATOM   5546  C CG  . LYS E 1 129 ? -18.189 23.522  -4.222  1.00 48.11  ? 125 LYS E CG  1 
ATOM   5547  C CD  . LYS E 1 129 ? -18.938 22.668  -3.210  1.00 43.76  ? 125 LYS E CD  1 
ATOM   5548  C CE  . LYS E 1 129 ? -20.448 22.831  -3.344  1.00 50.12  ? 125 LYS E CE  1 
ATOM   5549  N NZ  . LYS E 1 129 ? -20.922 24.162  -2.871  1.00 48.62  ? 125 LYS E NZ  1 
ATOM   5550  N N   . ASN E 1 130 ? -15.875 26.434  -4.019  1.00 44.26  ? 126 ASN E N   1 
ATOM   5551  C CA  . ASN E 1 130 ? -16.277 27.826  -3.841  1.00 47.59  ? 126 ASN E CA  1 
ATOM   5552  C C   . ASN E 1 130 ? -15.921 28.675  -5.059  1.00 59.34  ? 126 ASN E C   1 
ATOM   5553  O O   . ASN E 1 130 ? -16.618 29.639  -5.379  1.00 56.42  ? 126 ASN E O   1 
ATOM   5554  C CB  . ASN E 1 130 ? -15.626 28.422  -2.589  1.00 45.62  ? 126 ASN E CB  1 
ATOM   5555  C CG  . ASN E 1 130 ? -16.091 27.750  -1.305  1.00 47.36  ? 126 ASN E CG  1 
ATOM   5556  O OD1 . ASN E 1 130 ? -17.186 27.190  -1.241  1.00 33.60  ? 126 ASN E OD1 1 
ATOM   5557  N ND2 . ASN E 1 130 ? -15.260 27.816  -0.270  1.00 48.26  ? 126 ASN E ND2 1 
ATOM   5558  N N   . LEU E 1 131 ? -14.834 28.314  -5.735  1.00 61.49  ? 127 LEU E N   1 
ATOM   5559  C CA  . LEU E 1 131 ? -14.382 29.058  -6.907  1.00 56.23  ? 127 LEU E CA  1 
ATOM   5560  C C   . LEU E 1 131 ? -15.109 28.609  -8.170  1.00 38.53  ? 127 LEU E C   1 
ATOM   5561  O O   . LEU E 1 131 ? -15.533 29.436  -8.974  1.00 51.72  ? 127 LEU E O   1 
ATOM   5562  C CB  . LEU E 1 131 ? -12.870 28.905  -7.089  1.00 55.32  ? 127 LEU E CB  1 
ATOM   5563  C CG  . LEU E 1 131 ? -12.003 29.402  -5.928  1.00 43.81  ? 127 LEU E CG  1 
ATOM   5564  C CD1 . LEU E 1 131 ? -10.530 29.375  -6.312  1.00 49.42  ? 127 LEU E CD1 1 
ATOM   5565  C CD2 . LEU E 1 131 ? -12.422 30.797  -5.485  1.00 38.11  ? 127 LEU E CD2 1 
ATOM   5566  N N   . LEU E 1 132 ? -15.253 27.299  -8.344  1.00 31.86  ? 128 LEU E N   1 
ATOM   5567  C CA  . LEU E 1 132 ? -15.945 26.755  -9.508  1.00 33.15  ? 128 LEU E CA  1 
ATOM   5568  C C   . LEU E 1 132 ? -17.394 27.230  -9.576  1.00 37.85  ? 128 LEU E C   1 
ATOM   5569  O O   . LEU E 1 132 ? -17.934 27.442  -10.662 1.00 61.94  ? 128 LEU E O   1 
ATOM   5570  C CB  . LEU E 1 132 ? -15.905 25.226  -9.490  1.00 42.09  ? 128 LEU E CB  1 
ATOM   5571  C CG  . LEU E 1 132 ? -14.554 24.581  -9.809  1.00 51.08  ? 128 LEU E CG  1 
ATOM   5572  C CD1 . LEU E 1 132 ? -14.647 23.065  -9.689  1.00 69.12  ? 128 LEU E CD1 1 
ATOM   5573  C CD2 . LEU E 1 132 ? -14.073 24.980  -11.196 1.00 25.83  ? 128 LEU E CD2 1 
ATOM   5574  N N   . ASP E 1 133 ? -18.021 27.396  -8.416  1.00 41.57  ? 129 ASP E N   1 
ATOM   5575  C CA  . ASP E 1 133 ? -19.402 27.866  -8.356  1.00 47.64  ? 129 ASP E CA  1 
ATOM   5576  C C   . ASP E 1 133 ? -19.516 29.319  -8.814  1.00 44.39  ? 129 ASP E C   1 
ATOM   5577  O O   . ASP E 1 133 ? -20.549 29.730  -9.341  1.00 41.71  ? 129 ASP E O   1 
ATOM   5578  C CB  . ASP E 1 133 ? -19.957 27.736  -6.934  1.00 54.20  ? 129 ASP E CB  1 
ATOM   5579  C CG  . ASP E 1 133 ? -20.198 26.294  -6.525  1.00 54.88  ? 129 ASP E CG  1 
ATOM   5580  O OD1 . ASP E 1 133 ? -20.212 25.410  -7.408  1.00 59.23  ? 129 ASP E OD1 1 
ATOM   5581  O OD2 . ASP E 1 133 ? -20.388 26.047  -5.316  1.00 51.53  ? 129 ASP E OD2 1 
ATOM   5582  N N   . LYS E 1 134 ? -18.454 30.091  -8.606  1.00 55.77  ? 130 LYS E N   1 
ATOM   5583  C CA  . LYS E 1 134 ? -18.452 31.509  -8.952  1.00 53.49  ? 130 LYS E CA  1 
ATOM   5584  C C   . LYS E 1 134 ? -17.895 31.750  -10.353 1.00 63.96  ? 130 LYS E C   1 
ATOM   5585  O O   . LYS E 1 134 ? -18.351 32.646  -11.064 1.00 62.74  ? 130 LYS E O   1 
ATOM   5586  C CB  . LYS E 1 134 ? -17.626 32.296  -7.932  1.00 46.86  ? 130 LYS E CB  1 
ATOM   5587  C CG  . LYS E 1 134 ? -18.188 32.259  -6.519  1.00 50.32  ? 130 LYS E CG  1 
ATOM   5588  C CD  . LYS E 1 134 ? -17.229 32.889  -5.524  1.00 46.39  ? 130 LYS E CD  1 
ATOM   5589  C CE  . LYS E 1 134 ? -17.778 32.839  -4.109  1.00 49.49  ? 130 LYS E CE  1 
ATOM   5590  N NZ  . LYS E 1 134 ? -16.773 33.311  -3.117  1.00 58.96  ? 130 LYS E NZ  1 
ATOM   5591  N N   . ASP E 1 135 ? -16.909 30.947  -10.740 1.00 70.32  ? 131 ASP E N   1 
ATOM   5592  C CA  . ASP E 1 135 ? -16.233 31.115  -12.021 1.00 63.32  ? 131 ASP E CA  1 
ATOM   5593  C C   . ASP E 1 135 ? -15.760 29.763  -12.546 1.00 63.35  ? 131 ASP E C   1 
ATOM   5594  O O   . ASP E 1 135 ? -14.663 29.312  -12.223 1.00 69.55  ? 131 ASP E O   1 
ATOM   5595  C CB  . ASP E 1 135 ? -15.042 32.066  -11.864 1.00 65.40  ? 131 ASP E CB  1 
ATOM   5596  C CG  . ASP E 1 135 ? -14.451 32.493  -13.196 1.00 76.48  ? 131 ASP E CG  1 
ATOM   5597  O OD1 . ASP E 1 135 ? -14.484 31.692  -14.153 1.00 77.31  ? 131 ASP E OD1 1 
ATOM   5598  O OD2 . ASP E 1 135 ? -13.955 33.636  -13.284 1.00 71.73  ? 131 ASP E OD2 1 
ATOM   5599  N N   . TRP E 1 136 ? -16.599 29.120  -13.352 1.00 66.18  ? 132 TRP E N   1 
ATOM   5600  C CA  . TRP E 1 136 ? -16.277 27.813  -13.923 1.00 80.23  ? 132 TRP E CA  1 
ATOM   5601  C C   . TRP E 1 136 ? -14.940 27.799  -14.661 1.00 73.03  ? 132 TRP E C   1 
ATOM   5602  O O   . TRP E 1 136 ? -14.287 26.758  -14.754 1.00 59.62  ? 132 TRP E O   1 
ATOM   5603  C CB  . TRP E 1 136 ? -17.392 27.338  -14.864 1.00 90.78  ? 132 TRP E CB  1 
ATOM   5604  C CG  . TRP E 1 136 ? -17.868 28.359  -15.848 1.00 97.72  ? 132 TRP E CG  1 
ATOM   5605  C CD1 . TRP E 1 136 ? -18.833 29.302  -15.647 1.00 98.46  ? 132 TRP E CD1 1 
ATOM   5606  C CD2 . TRP E 1 136 ? -17.416 28.528  -17.196 1.00 101.65 ? 132 TRP E CD2 1 
ATOM   5607  N NE1 . TRP E 1 136 ? -19.005 30.053  -16.783 1.00 100.85 ? 132 TRP E NE1 1 
ATOM   5608  C CE2 . TRP E 1 136 ? -18.147 29.598  -17.750 1.00 105.52 ? 132 TRP E CE2 1 
ATOM   5609  C CE3 . TRP E 1 136 ? -16.463 27.881  -17.989 1.00 99.20  ? 132 TRP E CE3 1 
ATOM   5610  C CZ2 . TRP E 1 136 ? -17.954 30.037  -19.058 1.00 102.70 ? 132 TRP E CZ2 1 
ATOM   5611  C CZ3 . TRP E 1 136 ? -16.272 28.318  -19.288 1.00 96.94  ? 132 TRP E CZ3 1 
ATOM   5612  C CH2 . TRP E 1 136 ? -17.014 29.385  -19.809 1.00 98.09  ? 132 TRP E CH2 1 
ATOM   5613  N N   . ASN E 1 137 ? -14.533 28.952  -15.180 1.00 72.47  ? 133 ASN E N   1 
ATOM   5614  C CA  . ASN E 1 137 ? -13.309 29.046  -15.967 1.00 69.58  ? 133 ASN E CA  1 
ATOM   5615  C C   . ASN E 1 137 ? -12.133 29.565  -15.140 1.00 58.80  ? 133 ASN E C   1 
ATOM   5616  O O   . ASN E 1 137 ? -11.183 30.134  -15.679 1.00 49.49  ? 133 ASN E O   1 
ATOM   5617  C CB  . ASN E 1 137 ? -13.546 29.954  -17.176 1.00 65.68  ? 133 ASN E CB  1 
ATOM   5618  C CG  . ASN E 1 137 ? -12.480 29.803  -18.238 1.00 76.10  ? 133 ASN E CG  1 
ATOM   5619  O OD1 . ASN E 1 137 ? -11.553 30.608  -18.322 1.00 95.91  ? 133 ASN E OD1 1 
ATOM   5620  N ND2 . ASN E 1 137 ? -12.607 28.769  -19.062 1.00 70.04  ? 133 ASN E ND2 1 
ATOM   5621  N N   . ILE E 1 138 ? -12.195 29.354  -13.829 1.00 46.26  ? 134 ILE E N   1 
ATOM   5622  C CA  . ILE E 1 138 ? -11.189 29.887  -12.917 1.00 55.87  ? 134 ILE E CA  1 
ATOM   5623  C C   . ILE E 1 138 ? -9.835  29.196  -13.082 1.00 60.47  ? 134 ILE E C   1 
ATOM   5624  O O   . ILE E 1 138 ? -8.786  29.826  -12.929 1.00 44.42  ? 134 ILE E O   1 
ATOM   5625  C CB  . ILE E 1 138 ? -11.644 29.749  -11.446 1.00 62.64  ? 134 ILE E CB  1 
ATOM   5626  C CG1 . ILE E 1 138 ? -10.729 30.549  -10.516 1.00 74.87  ? 134 ILE E CG1 1 
ATOM   5627  C CG2 . ILE E 1 138 ? -11.679 28.289  -11.029 1.00 70.16  ? 134 ILE E CG2 1 
ATOM   5628  C CD1 . ILE E 1 138 ? -11.060 32.019  -10.466 1.00 84.18  ? 134 ILE E CD1 1 
ATOM   5629  N N   . PHE E 1 139 ? -9.860  27.905  -13.400 1.00 69.39  ? 135 PHE E N   1 
ATOM   5630  C CA  . PHE E 1 139 ? -8.634  27.115  -13.468 1.00 66.18  ? 135 PHE E CA  1 
ATOM   5631  C C   . PHE E 1 139 ? -8.126  26.931  -14.895 1.00 65.10  ? 135 PHE E C   1 
ATOM   5632  O O   . PHE E 1 139 ? -7.328  26.035  -15.168 1.00 71.26  ? 135 PHE E O   1 
ATOM   5633  C CB  . PHE E 1 139 ? -8.839  25.757  -12.792 1.00 61.92  ? 135 PHE E CB  1 
ATOM   5634  C CG  . PHE E 1 139 ? -9.101  25.857  -11.318 1.00 64.54  ? 135 PHE E CG  1 
ATOM   5635  C CD1 . PHE E 1 139 ? -8.149  26.402  -10.473 1.00 77.73  ? 135 PHE E CD1 1 
ATOM   5636  C CD2 . PHE E 1 139 ? -10.294 25.412  -10.777 1.00 66.54  ? 135 PHE E CD2 1 
ATOM   5637  C CE1 . PHE E 1 139 ? -8.382  26.503  -9.115  1.00 70.09  ? 135 PHE E CE1 1 
ATOM   5638  C CE2 . PHE E 1 139 ? -10.533 25.510  -9.418  1.00 75.60  ? 135 PHE E CE2 1 
ATOM   5639  C CZ  . PHE E 1 139 ? -9.575  26.057  -8.587  1.00 71.95  ? 135 PHE E CZ  1 
ATOM   5640  N N   . SER E 1 140 ? -8.586  27.788  -15.799 1.00 52.11  ? 136 SER E N   1 
ATOM   5641  C CA  . SER E 1 140 ? -8.036  27.841  -17.144 1.00 45.86  ? 136 SER E CA  1 
ATOM   5642  C C   . SER E 1 140 ? -6.781  28.699  -17.120 1.00 30.53  ? 136 SER E C   1 
ATOM   5643  O O   . SER E 1 140 ? -5.989  28.687  -18.062 1.00 37.33  ? 136 SER E O   1 
ATOM   5644  C CB  . SER E 1 140 ? -9.047  28.446  -18.115 1.00 52.68  ? 136 SER E CB  1 
ATOM   5645  O OG  . SER E 1 140 ? -9.213  29.831  -17.862 1.00 48.05  ? 136 SER E OG  1 
ATOM   5646  N N   . LYS E 1 141 ? -6.611  29.448  -16.033 1.00 42.55  ? 137 LYS E N   1 
ATOM   5647  C CA  . LYS E 1 141 ? -5.476  30.350  -15.887 1.00 59.07  ? 137 LYS E CA  1 
ATOM   5648  C C   . LYS E 1 141 ? -4.153  29.645  -16.157 1.00 65.81  ? 137 LYS E C   1 
ATOM   5649  O O   . LYS E 1 141 ? -4.027  28.434  -15.968 1.00 57.24  ? 137 LYS E O   1 
ATOM   5650  C CB  . LYS E 1 141 ? -5.450  30.962  -14.483 1.00 58.97  ? 137 LYS E CB  1 
ATOM   5651  C CG  . LYS E 1 141 ? -4.235  31.846  -14.241 1.00 65.58  ? 137 LYS E CG  1 
ATOM   5652  C CD  . LYS E 1 141 ? -4.249  32.500  -12.872 1.00 54.30  ? 137 LYS E CD  1 
ATOM   5653  C CE  . LYS E 1 141 ? -2.909  33.170  -12.590 1.00 47.92  ? 137 LYS E CE  1 
ATOM   5654  N NZ  . LYS E 1 141 ? -2.989  34.185  -11.507 1.00 58.38  ? 137 LYS E NZ  1 
ATOM   5655  N N   . ASN E 1 142 ? -3.168  30.421  -16.599 1.00 75.70  ? 138 ASN E N   1 
ATOM   5656  C CA  . ASN E 1 142 ? -1.830  29.907  -16.847 1.00 72.43  ? 138 ASN E CA  1 
ATOM   5657  C C   . ASN E 1 142 ? -0.947  30.148  -15.629 1.00 66.80  ? 138 ASN E C   1 
ATOM   5658  O O   . ASN E 1 142 ? -0.735  31.292  -15.226 1.00 53.69  ? 138 ASN E O   1 
ATOM   5659  C CB  . ASN E 1 142 ? -1.224  30.584  -18.078 1.00 70.68  ? 138 ASN E CB  1 
ATOM   5660  C CG  . ASN E 1 142 ? 0.028   29.887  -18.572 1.00 79.60  ? 138 ASN E CG  1 
ATOM   5661  O OD1 . ASN E 1 142 ? 0.301   28.742  -18.211 1.00 82.73  ? 138 ASN E OD1 1 
ATOM   5662  N ND2 . ASN E 1 142 ? 0.793   30.574  -19.412 1.00 87.69  ? 138 ASN E ND2 1 
ATOM   5663  N N   . CYS E 1 143 ? -0.440  29.068  -15.043 1.00 81.00  ? 139 CYS E N   1 
ATOM   5664  C CA  . CYS E 1 143 ? 0.384   29.164  -13.842 1.00 77.37  ? 139 CYS E CA  1 
ATOM   5665  C C   . CYS E 1 143 ? 1.831   28.770  -14.123 1.00 67.73  ? 139 CYS E C   1 
ATOM   5666  O O   . CYS E 1 143 ? 2.588   28.468  -13.200 1.00 58.01  ? 139 CYS E O   1 
ATOM   5667  C CB  . CYS E 1 143 ? -0.191  28.282  -12.732 1.00 79.13  ? 139 CYS E CB  1 
ATOM   5668  S SG  . CYS E 1 143 ? -1.848  28.765  -12.188 1.00 85.83  ? 139 CYS E SG  1 
ATOM   5669  N N   . ASN E 1 144 ? 2.208   28.771  -15.398 1.00 66.63  ? 140 ASN E N   1 
ATOM   5670  C CA  . ASN E 1 144 ? 3.583   28.484  -15.789 1.00 59.59  ? 140 ASN E CA  1 
ATOM   5671  C C   . ASN E 1 144 ? 4.542   29.494  -15.169 1.00 50.48  ? 140 ASN E C   1 
ATOM   5672  O O   . ASN E 1 144 ? 5.628   29.136  -14.713 1.00 53.20  ? 140 ASN E O   1 
ATOM   5673  C CB  . ASN E 1 144 ? 3.723   28.499  -17.314 1.00 63.81  ? 140 ASN E CB  1 
ATOM   5674  C CG  . ASN E 1 144 ? 2.865   27.445  -17.991 1.00 70.01  ? 140 ASN E CG  1 
ATOM   5675  O OD1 . ASN E 1 144 ? 2.458   26.467  -17.367 1.00 80.46  ? 140 ASN E OD1 1 
ATOM   5676  N ND2 . ASN E 1 144 ? 2.591   27.638  -19.277 1.00 61.63  ? 140 ASN E ND2 1 
ATOM   5677  N N   . ASN E 1 145 ? 4.129   30.758  -15.151 1.00 54.16  ? 141 ASN E N   1 
ATOM   5678  C CA  . ASN E 1 145 ? 4.946   31.827  -14.589 1.00 60.37  ? 141 ASN E CA  1 
ATOM   5679  C C   . ASN E 1 145 ? 5.094   31.685  -13.077 1.00 62.95  ? 141 ASN E C   1 
ATOM   5680  O O   . ASN E 1 145 ? 6.178   31.886  -12.529 1.00 59.59  ? 141 ASN E O   1 
ATOM   5681  C CB  . ASN E 1 145 ? 4.338   33.193  -14.924 1.00 64.51  ? 141 ASN E CB  1 
ATOM   5682  C CG  . ASN E 1 145 ? 4.285   33.461  -16.418 1.00 78.85  ? 141 ASN E CG  1 
ATOM   5683  O OD1 . ASN E 1 145 ? 5.264   33.910  -17.014 1.00 88.18  ? 141 ASN E OD1 1 
ATOM   5684  N ND2 . ASN E 1 145 ? 3.134   33.197  -17.027 1.00 82.65  ? 141 ASN E ND2 1 
ATOM   5685  N N   . SER E 1 146 ? 3.997   31.338  -12.410 1.00 64.72  ? 142 SER E N   1 
ATOM   5686  C CA  . SER E 1 146 ? 3.992   31.189  -10.958 1.00 57.07  ? 142 SER E CA  1 
ATOM   5687  C C   . SER E 1 146 ? 4.823   29.987  -10.516 1.00 53.23  ? 142 SER E C   1 
ATOM   5688  O O   . SER E 1 146 ? 5.489   30.033  -9.481  1.00 59.08  ? 142 SER E O   1 
ATOM   5689  C CB  . SER E 1 146 ? 2.560   31.041  -10.439 1.00 55.02  ? 142 SER E CB  1 
ATOM   5690  O OG  . SER E 1 146 ? 1.795   32.204  -10.701 1.00 66.45  ? 142 SER E OG  1 
ATOM   5691  N N   . PHE E 1 147 ? 4.777   28.912  -11.299 1.00 48.25  ? 143 PHE E N   1 
ATOM   5692  C CA  . PHE E 1 147 ? 5.520   27.697  -10.974 1.00 58.03  ? 143 PHE E CA  1 
ATOM   5693  C C   . PHE E 1 147 ? 7.021   27.899  -11.167 1.00 81.70  ? 143 PHE E C   1 
ATOM   5694  O O   . PHE E 1 147 ? 7.832   27.286  -10.472 1.00 92.32  ? 143 PHE E O   1 
ATOM   5695  C CB  . PHE E 1 147 ? 5.040   26.519  -11.830 1.00 39.21  ? 143 PHE E CB  1 
ATOM   5696  C CG  . PHE E 1 147 ? 3.613   26.106  -11.563 1.00 56.44  ? 143 PHE E CG  1 
ATOM   5697  C CD1 . PHE E 1 147 ? 2.906   26.626  -10.489 1.00 57.06  ? 143 PHE E CD1 1 
ATOM   5698  C CD2 . PHE E 1 147 ? 2.981   25.188  -12.388 1.00 67.87  ? 143 PHE E CD2 1 
ATOM   5699  C CE1 . PHE E 1 147 ? 1.599   26.241  -10.249 1.00 55.09  ? 143 PHE E CE1 1 
ATOM   5700  C CE2 . PHE E 1 147 ? 1.673   24.802  -12.150 1.00 58.94  ? 143 PHE E CE2 1 
ATOM   5701  C CZ  . PHE E 1 147 ? 0.983   25.329  -11.080 1.00 48.72  ? 143 PHE E CZ  1 
ATOM   5702  N N   . ALA E 1 148 ? 7.387   28.755  -12.115 1.00 82.76  ? 144 ALA E N   1 
ATOM   5703  C CA  . ALA E 1 148 ? 8.791   29.060  -12.364 1.00 90.51  ? 144 ALA E CA  1 
ATOM   5704  C C   . ALA E 1 148 ? 9.307   30.057  -11.333 1.00 101.19 ? 144 ALA E C   1 
ATOM   5705  O O   . ALA E 1 148 ? 10.469  30.003  -10.930 1.00 98.99  ? 144 ALA E O   1 
ATOM   5706  C CB  . ALA E 1 148 ? 8.969   29.610  -13.768 1.00 98.20  ? 144 ALA E CB  1 
ATOM   5707  N N   . GLU E 1 149 ? 8.436   30.968  -10.911 1.00 111.17 ? 145 GLU E N   1 
ATOM   5708  C CA  . GLU E 1 149 ? 8.802   31.982  -9.928  1.00 110.24 ? 145 GLU E CA  1 
ATOM   5709  C C   . GLU E 1 149 ? 9.161   31.345  -8.590  1.00 106.99 ? 145 GLU E C   1 
ATOM   5710  O O   . GLU E 1 149 ? 10.176  31.689  -7.984  1.00 104.34 ? 145 GLU E O   1 
ATOM   5711  C CB  . GLU E 1 149 ? 7.659   32.980  -9.741  1.00 104.83 ? 145 GLU E CB  1 
ATOM   5712  C CG  . GLU E 1 149 ? 7.936   34.051  -8.700  1.00 102.15 ? 145 GLU E CG  1 
ATOM   5713  C CD  . GLU E 1 149 ? 6.840   35.093  -8.639  1.00 107.81 ? 145 GLU E CD  1 
ATOM   5714  O OE1 . GLU E 1 149 ? 5.909   35.023  -9.469  1.00 113.18 ? 145 GLU E OE1 1 
ATOM   5715  O OE2 . GLU E 1 149 ? 6.907   35.981  -7.763  1.00 105.64 ? 145 GLU E OE2 1 
ATOM   5716  N N   . CYS E 1 150 ? 8.325   30.420  -8.130  1.00 109.23 ? 146 CYS E N   1 
ATOM   5717  C CA  . CYS E 1 150 ? 8.602   29.704  -6.894  1.00 116.63 ? 146 CYS E CA  1 
ATOM   5718  C C   . CYS E 1 150 ? 9.922   28.957  -7.041  1.00 123.78 ? 146 CYS E C   1 
ATOM   5719  O O   . CYS E 1 150 ? 10.116  28.211  -8.000  1.00 134.05 ? 146 CYS E O   1 
ATOM   5720  C CB  . CYS E 1 150 ? 7.476   28.720  -6.581  1.00 110.78 ? 146 CYS E CB  1 
ATOM   5721  S SG  . CYS E 1 150 ? 7.515   27.227  -7.591  1.00 189.42 ? 146 CYS E SG  1 
ATOM   5722  N N   . SER E 1 151 ? 10.826  29.160  -6.089  1.00 113.43 ? 147 SER E N   1 
ATOM   5723  C CA  . SER E 1 151 ? 12.163  28.585  -6.177  1.00 104.34 ? 147 SER E CA  1 
ATOM   5724  C C   . SER E 1 151 ? 12.227  27.240  -5.456  1.00 100.34 ? 147 SER E C   1 
ATOM   5725  O O   . SER E 1 151 ? 12.061  27.179  -4.240  1.00 92.90  ? 147 SER E O   1 
ATOM   5726  C CB  . SER E 1 151 ? 13.196  29.550  -5.589  1.00 94.64  ? 147 SER E CB  1 
ATOM   5727  O OG  . SER E 1 151 ? 13.267  30.750  -6.341  1.00 83.02  ? 147 SER E OG  1 
ATOM   5728  N N   . SER E 1 152 ? 12.468  26.177  -6.223  1.00 102.19 ? 148 SER E N   1 
ATOM   5729  C CA  . SER E 1 152 ? 12.586  24.806  -5.711  1.00 107.18 ? 148 SER E CA  1 
ATOM   5730  C C   . SER E 1 152 ? 11.446  23.932  -6.231  1.00 101.73 ? 148 SER E C   1 
ATOM   5731  O O   . SER E 1 152 ? 10.273  24.187  -5.954  1.00 92.21  ? 148 SER E O   1 
ATOM   5732  C CB  . SER E 1 152 ? 12.622  24.761  -4.180  1.00 118.22 ? 148 SER E CB  1 
ATOM   5733  O OG  . SER E 1 152 ? 13.628  25.616  -3.665  1.00 126.97 ? 148 SER E OG  1 
ATOM   5734  N N   . SER F 1 8   ? -22.608 -13.242 39.431  1.00 99.31  ? 4   SER F N   1 
ATOM   5735  C CA  . SER F 1 8   ? -23.933 -12.848 38.969  1.00 89.49  ? 4   SER F CA  1 
ATOM   5736  C C   . SER F 1 8   ? -24.214 -13.416 37.582  1.00 89.23  ? 4   SER F C   1 
ATOM   5737  O O   . SER F 1 8   ? -23.294 -13.651 36.800  1.00 86.35  ? 4   SER F O   1 
ATOM   5738  C CB  . SER F 1 8   ? -24.060 -11.324 38.953  1.00 75.67  ? 4   SER F CB  1 
ATOM   5739  O OG  . SER F 1 8   ? -23.088 -10.728 38.111  1.00 72.19  ? 4   SER F OG  1 
ATOM   5740  N N   . GLU F 1 9   ? -25.492 -13.627 37.282  1.00 86.76  ? 5   GLU F N   1 
ATOM   5741  C CA  . GLU F 1 9   ? -25.891 -14.298 36.049  1.00 84.25  ? 5   GLU F CA  1 
ATOM   5742  C C   . GLU F 1 9   ? -26.128 -13.320 34.894  1.00 80.63  ? 5   GLU F C   1 
ATOM   5743  O O   . GLU F 1 9   ? -26.203 -13.728 33.735  1.00 72.48  ? 5   GLU F O   1 
ATOM   5744  C CB  . GLU F 1 9   ? -27.142 -15.148 36.304  1.00 89.08  ? 5   GLU F CB  1 
ATOM   5745  C CG  . GLU F 1 9   ? -27.666 -15.889 35.081  1.00 101.12 ? 5   GLU F CG  1 
ATOM   5746  C CD  . GLU F 1 9   ? -28.685 -15.085 34.294  1.00 106.80 ? 5   GLU F CD  1 
ATOM   5747  O OE1 . GLU F 1 9   ? -29.146 -14.041 34.801  1.00 107.91 ? 5   GLU F OE1 1 
ATOM   5748  O OE2 . GLU F 1 9   ? -29.027 -15.500 33.167  1.00 108.76 ? 5   GLU F OE2 1 
ATOM   5749  N N   . TYR F 1 10  ? -26.223 -12.031 35.207  1.00 86.44  ? 6   TYR F N   1 
ATOM   5750  C CA  . TYR F 1 10  ? -26.549 -11.024 34.200  1.00 88.60  ? 6   TYR F CA  1 
ATOM   5751  C C   . TYR F 1 10  ? -25.329 -10.612 33.375  1.00 84.95  ? 6   TYR F C   1 
ATOM   5752  O O   . TYR F 1 10  ? -25.464 -9.943  32.349  1.00 86.47  ? 6   TYR F O   1 
ATOM   5753  C CB  . TYR F 1 10  ? -27.165 -9.788  34.861  1.00 95.64  ? 6   TYR F CB  1 
ATOM   5754  C CG  . TYR F 1 10  ? -26.223 -9.052  35.787  1.00 98.63  ? 6   TYR F CG  1 
ATOM   5755  C CD1 . TYR F 1 10  ? -25.349 -8.090  35.298  1.00 99.42  ? 6   TYR F CD1 1 
ATOM   5756  C CD2 . TYR F 1 10  ? -26.209 -9.316  37.150  1.00 106.12 ? 6   TYR F CD2 1 
ATOM   5757  C CE1 . TYR F 1 10  ? -24.486 -7.414  36.141  1.00 108.19 ? 6   TYR F CE1 1 
ATOM   5758  C CE2 . TYR F 1 10  ? -25.350 -8.645  38.000  1.00 111.50 ? 6   TYR F CE2 1 
ATOM   5759  C CZ  . TYR F 1 10  ? -24.491 -7.696  37.491  1.00 113.02 ? 6   TYR F CZ  1 
ATOM   5760  O OH  . TYR F 1 10  ? -23.635 -7.026  38.334  1.00 113.15 ? 6   TYR F OH  1 
ATOM   5761  N N   . CYS F 1 11  ? -24.144 -11.017 33.820  1.00 74.72  ? 7   CYS F N   1 
ATOM   5762  C CA  . CYS F 1 11  ? -22.903 -10.632 33.156  1.00 47.26  ? 7   CYS F CA  1 
ATOM   5763  C C   . CYS F 1 11  ? -22.851 -11.131 31.714  1.00 52.55  ? 7   CYS F C   1 
ATOM   5764  O O   . CYS F 1 11  ? -22.236 -10.503 30.852  1.00 65.28  ? 7   CYS F O   1 
ATOM   5765  C CB  . CYS F 1 11  ? -21.700 -11.169 33.932  1.00 23.26  ? 7   CYS F CB  1 
ATOM   5766  S SG  . CYS F 1 11  ? -21.633 -10.634 35.658  1.00 63.39  ? 7   CYS F SG  1 
ATOM   5767  N N   . SER F 1 12  ? -23.498 -12.262 31.456  1.00 47.42  ? 8   SER F N   1 
ATOM   5768  C CA  . SER F 1 12  ? -23.459 -12.883 30.137  1.00 54.35  ? 8   SER F CA  1 
ATOM   5769  C C   . SER F 1 12  ? -24.080 -11.998 29.054  1.00 65.22  ? 8   SER F C   1 
ATOM   5770  O O   . SER F 1 12  ? -23.773 -12.150 27.870  1.00 68.77  ? 8   SER F O   1 
ATOM   5771  C CB  . SER F 1 12  ? -24.167 -14.242 30.171  1.00 55.27  ? 8   SER F CB  1 
ATOM   5772  O OG  . SER F 1 12  ? -25.509 -14.113 30.609  1.00 54.43  ? 8   SER F OG  1 
ATOM   5773  N N   . HIS F 1 13  ? -24.944 -11.070 29.459  1.00 72.41  ? 9   HIS F N   1 
ATOM   5774  C CA  . HIS F 1 13  ? -25.685 -10.244 28.509  1.00 80.65  ? 9   HIS F CA  1 
ATOM   5775  C C   . HIS F 1 13  ? -25.205 -8.791  28.486  1.00 74.85  ? 9   HIS F C   1 
ATOM   5776  O O   . HIS F 1 13  ? -25.876 -7.922  27.929  1.00 82.29  ? 9   HIS F O   1 
ATOM   5777  C CB  . HIS F 1 13  ? -27.182 -10.286 28.833  1.00 95.48  ? 9   HIS F CB  1 
ATOM   5778  C CG  . HIS F 1 13  ? -27.814 -11.625 28.604  1.00 111.36 ? 9   HIS F CG  1 
ATOM   5779  N ND1 . HIS F 1 13  ? -27.287 -12.793 29.109  1.00 117.81 ? 9   HIS F ND1 1 
ATOM   5780  C CD2 . HIS F 1 13  ? -28.931 -11.978 27.927  1.00 114.46 ? 9   HIS F CD2 1 
ATOM   5781  C CE1 . HIS F 1 13  ? -28.051 -13.810 28.751  1.00 116.22 ? 9   HIS F CE1 1 
ATOM   5782  N NE2 . HIS F 1 13  ? -29.056 -13.343 28.033  1.00 114.34 ? 9   HIS F NE2 1 
ATOM   5783  N N   . MET F 1 14  ? -24.043 -8.532  29.077  1.00 68.48  ? 10  MET F N   1 
ATOM   5784  C CA  . MET F 1 14  ? -23.509 -7.176  29.147  1.00 62.82  ? 10  MET F CA  1 
ATOM   5785  C C   . MET F 1 14  ? -22.937 -6.759  27.799  1.00 60.30  ? 10  MET F C   1 
ATOM   5786  O O   . MET F 1 14  ? -23.318 -5.729  27.244  1.00 53.62  ? 10  MET F O   1 
ATOM   5787  C CB  . MET F 1 14  ? -22.424 -7.088  30.222  1.00 65.19  ? 10  MET F CB  1 
ATOM   5788  C CG  . MET F 1 14  ? -22.900 -7.499  31.602  1.00 65.65  ? 10  MET F CG  1 
ATOM   5789  S SD  . MET F 1 14  ? -24.001 -6.287  32.350  1.00 74.50  ? 10  MET F SD  1 
ATOM   5790  C CE  . MET F 1 14  ? -22.880 -5.511  33.508  1.00 71.21  ? 10  MET F CE  1 
ATOM   5791  N N   . ILE F 1 15  ? -22.025 -7.572  27.275  1.00 68.20  ? 11  ILE F N   1 
ATOM   5792  C CA  . ILE F 1 15  ? -21.350 -7.260  26.020  1.00 57.45  ? 11  ILE F CA  1 
ATOM   5793  C C   . ILE F 1 15  ? -22.122 -7.824  24.835  1.00 62.58  ? 11  ILE F C   1 
ATOM   5794  O O   . ILE F 1 15  ? -22.007 -9.006  24.508  1.00 58.21  ? 11  ILE F O   1 
ATOM   5795  C CB  . ILE F 1 15  ? -19.918 -7.825  25.995  1.00 48.79  ? 11  ILE F CB  1 
ATOM   5796  C CG1 . ILE F 1 15  ? -19.185 -7.469  27.292  1.00 47.27  ? 11  ILE F CG1 1 
ATOM   5797  C CG2 . ILE F 1 15  ? -19.166 -7.298  24.775  1.00 38.23  ? 11  ILE F CG2 1 
ATOM   5798  C CD1 . ILE F 1 15  ? -17.784 -8.034  27.386  1.00 57.86  ? 11  ILE F CD1 1 
ATOM   5799  N N   . GLY F 1 16  ? -22.913 -6.971  24.196  1.00 73.48  ? 12  GLY F N   1 
ATOM   5800  C CA  . GLY F 1 16  ? -23.681 -7.371  23.032  1.00 80.89  ? 12  GLY F CA  1 
ATOM   5801  C C   . GLY F 1 16  ? -22.833 -7.355  21.778  1.00 75.45  ? 12  GLY F C   1 
ATOM   5802  O O   . GLY F 1 16  ? -21.741 -6.788  21.766  1.00 63.54  ? 12  GLY F O   1 
ATOM   5803  N N   . SER F 1 17  ? -23.335 -7.984  20.720  1.00 85.89  ? 13  SER F N   1 
ATOM   5804  C CA  . SER F 1 17  ? -22.626 -8.021  19.447  1.00 87.58  ? 13  SER F CA  1 
ATOM   5805  C C   . SER F 1 17  ? -22.522 -6.618  18.855  1.00 77.54  ? 13  SER F C   1 
ATOM   5806  O O   . SER F 1 17  ? -21.550 -6.292  18.174  1.00 79.21  ? 13  SER F O   1 
ATOM   5807  C CB  . SER F 1 17  ? -23.335 -8.957  18.466  1.00 87.40  ? 13  SER F CB  1 
ATOM   5808  O OG  . SER F 1 17  ? -23.315 -10.296 18.933  1.00 77.10  ? 13  SER F OG  1 
ATOM   5809  N N   . GLY F 1 18  ? -23.529 -5.793  19.120  1.00 63.54  ? 14  GLY F N   1 
ATOM   5810  C CA  . GLY F 1 18  ? -23.525 -4.415  18.666  1.00 58.54  ? 14  GLY F CA  1 
ATOM   5811  C C   . GLY F 1 18  ? -22.290 -3.679  19.146  1.00 56.24  ? 14  GLY F C   1 
ATOM   5812  O O   . GLY F 1 18  ? -21.716 -2.868  18.419  1.00 61.08  ? 14  GLY F O   1 
ATOM   5813  N N   . HIS F 1 19  ? -21.883 -3.961  20.380  1.00 47.73  ? 15  HIS F N   1 
ATOM   5814  C CA  . HIS F 1 19  ? -20.676 -3.369  20.940  1.00 46.51  ? 15  HIS F CA  1 
ATOM   5815  C C   . HIS F 1 19  ? -19.448 -3.846  20.170  1.00 55.42  ? 15  HIS F C   1 
ATOM   5816  O O   . HIS F 1 19  ? -18.567 -3.052  19.839  1.00 51.53  ? 15  HIS F O   1 
ATOM   5817  C CB  . HIS F 1 19  ? -20.536 -3.730  22.421  1.00 53.53  ? 15  HIS F CB  1 
ATOM   5818  C CG  . HIS F 1 19  ? -21.599 -3.137  23.296  1.00 58.51  ? 15  HIS F CG  1 
ATOM   5819  N ND1 . HIS F 1 19  ? -22.786 -3.782  23.567  1.00 55.24  ? 15  HIS F ND1 1 
ATOM   5820  C CD2 . HIS F 1 19  ? -21.649 -1.961  23.965  1.00 63.47  ? 15  HIS F CD2 1 
ATOM   5821  C CE1 . HIS F 1 19  ? -23.522 -3.028  24.365  1.00 51.87  ? 15  HIS F CE1 1 
ATOM   5822  N NE2 . HIS F 1 19  ? -22.857 -1.917  24.620  1.00 43.90  ? 15  HIS F NE2 1 
ATOM   5823  N N   . LEU F 1 20  ? -19.398 -5.145  19.880  1.00 55.18  ? 16  LEU F N   1 
ATOM   5824  C CA  . LEU F 1 20  ? -18.264 -5.734  19.173  1.00 53.32  ? 16  LEU F CA  1 
ATOM   5825  C C   . LEU F 1 20  ? -18.198 -5.255  17.729  1.00 59.10  ? 16  LEU F C   1 
ATOM   5826  O O   . LEU F 1 20  ? -17.114 -5.122  17.159  1.00 63.52  ? 16  LEU F O   1 
ATOM   5827  C CB  . LEU F 1 20  ? -18.348 -7.261  19.198  1.00 52.70  ? 16  LEU F CB  1 
ATOM   5828  C CG  . LEU F 1 20  ? -18.354 -7.918  20.579  1.00 57.53  ? 16  LEU F CG  1 
ATOM   5829  C CD1 . LEU F 1 20  ? -18.270 -9.425  20.438  1.00 55.87  ? 16  LEU F CD1 1 
ATOM   5830  C CD2 . LEU F 1 20  ? -17.215 -7.401  21.442  1.00 64.86  ? 16  LEU F CD2 1 
ATOM   5831  N N   . GLN F 1 21  ? -19.361 -5.005  17.138  1.00 60.20  ? 17  GLN F N   1 
ATOM   5832  C CA  . GLN F 1 21  ? -19.425 -4.513  15.769  1.00 64.86  ? 17  GLN F CA  1 
ATOM   5833  C C   . GLN F 1 21  ? -18.951 -3.065  15.698  1.00 49.52  ? 17  GLN F C   1 
ATOM   5834  O O   . GLN F 1 21  ? -18.178 -2.705  14.811  1.00 34.92  ? 17  GLN F O   1 
ATOM   5835  C CB  . GLN F 1 21  ? -20.846 -4.642  15.213  1.00 73.02  ? 17  GLN F CB  1 
ATOM   5836  C CG  . GLN F 1 21  ? -21.273 -6.080  14.944  1.00 77.42  ? 17  GLN F CG  1 
ATOM   5837  C CD  . GLN F 1 21  ? -22.739 -6.199  14.573  1.00 72.15  ? 17  GLN F CD  1 
ATOM   5838  O OE1 . GLN F 1 21  ? -23.393 -5.207  14.250  1.00 66.93  ? 17  GLN F OE1 1 
ATOM   5839  N NE2 . GLN F 1 21  ? -23.264 -7.419  14.620  1.00 70.27  ? 17  GLN F NE2 1 
ATOM   5840  N N   . SER F 1 22  ? -19.404 -2.240  16.638  1.00 54.15  ? 18  SER F N   1 
ATOM   5841  C CA  . SER F 1 22  ? -18.992 -0.840  16.683  1.00 54.36  ? 18  SER F CA  1 
ATOM   5842  C C   . SER F 1 22  ? -17.477 -0.737  16.841  1.00 43.77  ? 18  SER F C   1 
ATOM   5843  O O   . SER F 1 22  ? -16.861 0.223   16.381  1.00 30.88  ? 18  SER F O   1 
ATOM   5844  C CB  . SER F 1 22  ? -19.708 -0.092  17.814  1.00 62.72  ? 18  SER F CB  1 
ATOM   5845  O OG  . SER F 1 22  ? -19.398 -0.632  19.088  1.00 70.98  ? 18  SER F OG  1 
ATOM   5846  N N   . LEU F 1 23  ? -16.883 -1.737  17.485  1.00 34.07  ? 19  LEU F N   1 
ATOM   5847  C CA  . LEU F 1 23  ? -15.434 -1.820  17.594  1.00 26.66  ? 19  LEU F CA  1 
ATOM   5848  C C   . LEU F 1 23  ? -14.830 -2.083  16.222  1.00 36.67  ? 19  LEU F C   1 
ATOM   5849  O O   . LEU F 1 23  ? -13.812 -1.496  15.858  1.00 52.82  ? 19  LEU F O   1 
ATOM   5850  C CB  . LEU F 1 23  ? -15.029 -2.936  18.558  1.00 34.29  ? 19  LEU F CB  1 
ATOM   5851  C CG  . LEU F 1 23  ? -14.884 -2.535  20.026  1.00 47.71  ? 19  LEU F CG  1 
ATOM   5852  C CD1 . LEU F 1 23  ? -14.945 -3.759  20.926  1.00 60.66  ? 19  LEU F CD1 1 
ATOM   5853  C CD2 . LEU F 1 23  ? -13.581 -1.781  20.237  1.00 41.88  ? 19  LEU F CD2 1 
ATOM   5854  N N   . GLN F 1 24  ? -15.465 -2.969  15.462  1.00 33.14  ? 20  GLN F N   1 
ATOM   5855  C CA  . GLN F 1 24  ? -14.971 -3.328  14.139  1.00 41.60  ? 20  GLN F CA  1 
ATOM   5856  C C   . GLN F 1 24  ? -15.085 -2.150  13.180  1.00 46.50  ? 20  GLN F C   1 
ATOM   5857  O O   . GLN F 1 24  ? -14.131 -1.822  12.476  1.00 35.64  ? 20  GLN F O   1 
ATOM   5858  C CB  . GLN F 1 24  ? -15.739 -4.527  13.587  1.00 44.16  ? 20  GLN F CB  1 
ATOM   5859  C CG  . GLN F 1 24  ? -15.095 -5.138  12.357  1.00 45.81  ? 20  GLN F CG  1 
ATOM   5860  C CD  . GLN F 1 24  ? -13.680 -5.612  12.624  1.00 45.81  ? 20  GLN F CD  1 
ATOM   5861  O OE1 . GLN F 1 24  ? -13.428 -6.329  13.593  1.00 39.66  ? 20  GLN F OE1 1 
ATOM   5862  N NE2 . GLN F 1 24  ? -12.745 -5.206  11.769  1.00 41.57  ? 20  GLN F NE2 1 
ATOM   5863  N N   . ARG F 1 25  ? -16.258 -1.523  13.150  1.00 51.96  ? 21  ARG F N   1 
ATOM   5864  C CA  A ARG F 1 25  ? -16.482 -0.354  12.310  0.38 42.57  ? 21  ARG F CA  1 
ATOM   5865  C CA  B ARG F 1 25  ? -16.479 -0.357  12.305  0.62 42.32  ? 21  ARG F CA  1 
ATOM   5866  C C   . ARG F 1 25  ? -15.498 0.748   12.681  1.00 46.11  ? 21  ARG F C   1 
ATOM   5867  O O   . ARG F 1 25  ? -15.054 1.517   11.827  1.00 56.86  ? 21  ARG F O   1 
ATOM   5868  C CB  A ARG F 1 25  ? -17.917 0.146   12.478  0.38 38.04  ? 21  ARG F CB  1 
ATOM   5869  C CB  B ARG F 1 25  ? -17.914 0.157   12.449  0.62 37.34  ? 21  ARG F CB  1 
ATOM   5870  C CG  A ARG F 1 25  ? -18.189 1.496   11.832  0.38 33.35  ? 21  ARG F CG  1 
ATOM   5871  C CG  B ARG F 1 25  ? -18.992 -0.875  12.150  0.62 41.12  ? 21  ARG F CG  1 
ATOM   5872  C CD  A ARG F 1 25  ? -19.586 1.989   12.160  0.38 24.05  ? 21  ARG F CD  1 
ATOM   5873  C CD  B ARG F 1 25  ? -20.352 -0.215  11.973  0.62 48.74  ? 21  ARG F CD  1 
ATOM   5874  N NE  A ARG F 1 25  ? -19.780 3.382   11.767  0.38 29.69  ? 21  ARG F NE  1 
ATOM   5875  N NE  B ARG F 1 25  ? -21.433 -1.010  12.555  0.62 46.61  ? 21  ARG F NE  1 
ATOM   5876  C CZ  A ARG F 1 25  ? -20.851 4.107   12.075  0.38 40.22  ? 21  ARG F CZ  1 
ATOM   5877  C CZ  B ARG F 1 25  ? -21.912 -0.856  13.789  0.62 36.83  ? 21  ARG F CZ  1 
ATOM   5878  N NH1 A ARG F 1 25  ? -21.836 3.576   12.788  0.38 36.96  ? 21  ARG F NH1 1 
ATOM   5879  N NH1 B ARG F 1 25  ? -21.419 0.073   14.601  0.62 26.58  ? 21  ARG F NH1 1 
ATOM   5880  N NH2 A ARG F 1 25  ? -20.938 5.367   11.674  0.38 46.66  ? 21  ARG F NH2 1 
ATOM   5881  N NH2 B ARG F 1 25  ? -22.895 -1.635  14.216  0.62 36.71  ? 21  ARG F NH2 1 
ATOM   5882  N N   . LEU F 1 26  ? -15.162 0.816   13.964  1.00 45.52  ? 22  LEU F N   1 
ATOM   5883  C CA  . LEU F 1 26  ? -14.235 1.821   14.467  1.00 51.97  ? 22  LEU F CA  1 
ATOM   5884  C C   . LEU F 1 26  ? -12.808 1.499   14.030  1.00 50.15  ? 22  LEU F C   1 
ATOM   5885  O O   . LEU F 1 26  ? -11.983 2.397   13.870  1.00 60.35  ? 22  LEU F O   1 
ATOM   5886  C CB  . LEU F 1 26  ? -14.331 1.895   15.992  1.00 57.32  ? 22  LEU F CB  1 
ATOM   5887  C CG  . LEU F 1 26  ? -13.583 3.027   16.690  1.00 47.95  ? 22  LEU F CG  1 
ATOM   5888  C CD1 . LEU F 1 26  ? -14.340 3.443   17.945  1.00 25.79  ? 22  LEU F CD1 1 
ATOM   5889  C CD2 . LEU F 1 26  ? -12.165 2.597   17.038  1.00 59.76  ? 22  LEU F CD2 1 
ATOM   5890  N N   . ILE F 1 27  ? -12.525 0.214   13.839  1.00 54.66  ? 23  ILE F N   1 
ATOM   5891  C CA  . ILE F 1 27  ? -11.239 -0.225  13.304  1.00 49.53  ? 23  ILE F CA  1 
ATOM   5892  C C   . ILE F 1 27  ? -11.188 -0.038  11.791  1.00 44.28  ? 23  ILE F C   1 
ATOM   5893  O O   . ILE F 1 27  ? -10.169 0.374   11.238  1.00 37.00  ? 23  ILE F O   1 
ATOM   5894  C CB  . ILE F 1 27  ? -10.984 -1.710  13.610  1.00 38.44  ? 23  ILE F CB  1 
ATOM   5895  C CG1 . ILE F 1 27  ? -10.665 -1.901  15.090  1.00 34.96  ? 23  ILE F CG1 1 
ATOM   5896  C CG2 . ILE F 1 27  ? -9.827  -2.238  12.774  1.00 45.25  ? 23  ILE F CG2 1 
ATOM   5897  C CD1 . ILE F 1 27  ? -10.638 -3.348  15.518  1.00 24.28  ? 23  ILE F CD1 1 
ATOM   5898  N N   . ASP F 1 28  ? -12.296 -0.352  11.128  1.00 38.16  ? 24  ASP F N   1 
ATOM   5899  C CA  . ASP F 1 28  ? -12.370 -0.284  9.675   1.00 43.84  ? 24  ASP F CA  1 
ATOM   5900  C C   . ASP F 1 28  ? -12.288 1.153   9.168   1.00 43.07  ? 24  ASP F C   1 
ATOM   5901  O O   . ASP F 1 28  ? -11.925 1.390   8.014   1.00 42.10  ? 24  ASP F O   1 
ATOM   5902  C CB  . ASP F 1 28  ? -13.671 -0.923  9.181   1.00 46.70  ? 24  ASP F CB  1 
ATOM   5903  C CG  . ASP F 1 28  ? -13.746 -2.409  9.480   1.00 54.07  ? 24  ASP F CG  1 
ATOM   5904  O OD1 . ASP F 1 28  ? -12.681 -3.050  9.616   1.00 54.82  ? 24  ASP F OD1 1 
ATOM   5905  O OD2 . ASP F 1 28  ? -14.874 -2.936  9.579   1.00 49.54  ? 24  ASP F OD2 1 
ATOM   5906  N N   . SER F 1 29  ? -12.629 2.106   10.032  1.00 35.32  ? 25  SER F N   1 
ATOM   5907  C CA  . SER F 1 29  ? -12.672 3.515   9.647   1.00 38.60  ? 25  SER F CA  1 
ATOM   5908  C C   . SER F 1 29  ? -11.337 4.239   9.839   1.00 37.65  ? 25  SER F C   1 
ATOM   5909  O O   . SER F 1 29  ? -11.233 5.435   9.563   1.00 39.38  ? 25  SER F O   1 
ATOM   5910  C CB  . SER F 1 29  ? -13.774 4.246   10.425  1.00 36.91  ? 25  SER F CB  1 
ATOM   5911  O OG  . SER F 1 29  ? -13.573 4.155   11.826  1.00 39.44  ? 25  SER F OG  1 
ATOM   5912  N N   . GLN F 1 30  ? -10.318 3.521   10.299  1.00 39.14  ? 26  GLN F N   1 
ATOM   5913  C CA  . GLN F 1 30  ? -9.010  4.128   10.534  1.00 37.06  ? 26  GLN F CA  1 
ATOM   5914  C C   . GLN F 1 30  ? -8.111  4.052   9.303   1.00 39.24  ? 26  GLN F C   1 
ATOM   5915  O O   . GLN F 1 30  ? -7.982  3.001   8.674   1.00 38.89  ? 26  GLN F O   1 
ATOM   5916  C CB  . GLN F 1 30  ? -8.317  3.464   11.724  1.00 43.31  ? 26  GLN F CB  1 
ATOM   5917  C CG  . GLN F 1 30  ? -9.050  3.647   13.039  1.00 46.56  ? 26  GLN F CG  1 
ATOM   5918  C CD  . GLN F 1 30  ? -9.370  5.099   13.326  1.00 39.86  ? 26  GLN F CD  1 
ATOM   5919  O OE1 . GLN F 1 30  ? -8.470  5.932   13.448  1.00 37.05  ? 26  GLN F OE1 1 
ATOM   5920  N NE2 . GLN F 1 30  ? -10.659 5.416   13.424  1.00 25.80  ? 26  GLN F NE2 1 
ATOM   5921  N N   . MET F 1 31  ? -7.486  5.178   8.974   1.00 40.54  ? 27  MET F N   1 
ATOM   5922  C CA  . MET F 1 31  ? -6.599  5.263   7.822   1.00 42.29  ? 27  MET F CA  1 
ATOM   5923  C C   . MET F 1 31  ? -5.304  4.498   8.088   1.00 42.95  ? 27  MET F C   1 
ATOM   5924  O O   . MET F 1 31  ? -4.645  4.707   9.107   1.00 35.66  ? 27  MET F O   1 
ATOM   5925  C CB  . MET F 1 31  ? -6.293  6.729   7.514   1.00 47.17  ? 27  MET F CB  1 
ATOM   5926  C CG  . MET F 1 31  ? -5.767  6.981   6.112   1.00 51.25  ? 27  MET F CG  1 
ATOM   5927  S SD  . MET F 1 31  ? -5.722  8.741   5.713   1.00 48.03  ? 27  MET F SD  1 
ATOM   5928  C CE  . MET F 1 31  ? -4.434  9.304   6.821   1.00 70.16  ? 27  MET F CE  1 
ATOM   5929  N N   . GLU F 1 32  ? -4.949  3.608   7.167   1.00 46.23  ? 28  GLU F N   1 
ATOM   5930  C CA  . GLU F 1 32  ? -3.757  2.781   7.315   1.00 46.09  ? 28  GLU F CA  1 
ATOM   5931  C C   . GLU F 1 32  ? -2.495  3.592   7.040   1.00 54.05  ? 28  GLU F C   1 
ATOM   5932  O O   . GLU F 1 32  ? -2.140  3.835   5.886   1.00 47.37  ? 28  GLU F O   1 
ATOM   5933  C CB  . GLU F 1 32  ? -3.826  1.580   6.369   1.00 41.09  ? 28  GLU F CB  1 
ATOM   5934  C CG  . GLU F 1 32  ? -5.070  0.720   6.550   1.00 55.48  ? 28  GLU F CG  1 
ATOM   5935  C CD  . GLU F 1 32  ? -5.125  -0.443  5.576   1.00 66.75  ? 28  GLU F CD  1 
ATOM   5936  O OE1 . GLU F 1 32  ? -5.916  -1.381  5.811   1.00 61.76  ? 28  GLU F OE1 1 
ATOM   5937  O OE2 . GLU F 1 32  ? -4.379  -0.418  4.574   1.00 72.32  ? 28  GLU F OE2 1 
ATOM   5938  N N   . THR F 1 33  ? -1.820  4.005   8.110   1.00 49.68  ? 29  THR F N   1 
ATOM   5939  C CA  . THR F 1 33  ? -0.631  4.840   7.990   1.00 51.27  ? 29  THR F CA  1 
ATOM   5940  C C   . THR F 1 33  ? 0.538   4.270   8.783   1.00 52.50  ? 29  THR F C   1 
ATOM   5941  O O   . THR F 1 33  ? 0.378   3.318   9.548   1.00 47.85  ? 29  THR F O   1 
ATOM   5942  C CB  . THR F 1 33  ? -0.903  6.269   8.491   1.00 47.17  ? 29  THR F CB  1 
ATOM   5943  O OG1 . THR F 1 33  ? -1.377  6.221   9.842   1.00 58.99  ? 29  THR F OG1 1 
ATOM   5944  C CG2 . THR F 1 33  ? -1.940  6.954   7.621   1.00 39.68  ? 29  THR F CG2 1 
ATOM   5945  N N   . SER F 1 34  ? 1.713   4.863   8.591   1.00 46.31  ? 30  SER F N   1 
ATOM   5946  C CA  . SER F 1 34  ? 2.908   4.465   9.324   1.00 44.08  ? 30  SER F CA  1 
ATOM   5947  C C   . SER F 1 34  ? 2.865   4.996   10.754  1.00 41.34  ? 30  SER F C   1 
ATOM   5948  O O   . SER F 1 34  ? 3.702   4.640   11.583  1.00 33.62  ? 30  SER F O   1 
ATOM   5949  C CB  . SER F 1 34  ? 4.163   4.982   8.619   1.00 39.70  ? 30  SER F CB  1 
ATOM   5950  O OG  . SER F 1 34  ? 4.190   6.400   8.598   1.00 20.60  ? 30  SER F OG  1 
ATOM   5951  N N   . CYS F 1 35  ? 1.886   5.854   11.030  1.00 43.38  ? 31  CYS F N   1 
ATOM   5952  C CA  . CYS F 1 35  ? 1.701   6.423   12.360  1.00 32.18  ? 31  CYS F CA  1 
ATOM   5953  C C   . CYS F 1 35  ? 1.759   5.358   13.449  1.00 48.39  ? 31  CYS F C   1 
ATOM   5954  O O   . CYS F 1 35  ? 1.086   4.329   13.365  1.00 41.36  ? 31  CYS F O   1 
ATOM   5955  C CB  . CYS F 1 35  ? 0.357   7.157   12.424  1.00 10.65  ? 31  CYS F CB  1 
ATOM   5956  S SG  . CYS F 1 35  ? -0.314  7.392   14.083  1.00 87.38  ? 31  CYS F SG  1 
ATOM   5957  N N   . GLN F 1 36  ? 2.580   5.612   14.464  1.00 54.75  ? 32  GLN F N   1 
ATOM   5958  C CA  . GLN F 1 36  ? 2.613   4.782   15.663  1.00 37.82  ? 32  GLN F CA  1 
ATOM   5959  C C   . GLN F 1 36  ? 2.423   5.673   16.885  1.00 42.17  ? 32  GLN F C   1 
ATOM   5960  O O   . GLN F 1 36  ? 2.728   6.866   16.844  1.00 34.82  ? 32  GLN F O   1 
ATOM   5961  C CB  . GLN F 1 36  ? 3.933   4.011   15.765  1.00 24.14  ? 32  GLN F CB  1 
ATOM   5962  C CG  . GLN F 1 36  ? 4.112   2.935   14.701  1.00 43.78  ? 32  GLN F CG  1 
ATOM   5963  C CD  . GLN F 1 36  ? 5.222   1.955   15.042  1.00 58.50  ? 32  GLN F CD  1 
ATOM   5964  O OE1 . GLN F 1 36  ? 6.232   2.325   15.641  1.00 49.37  ? 32  GLN F OE1 1 
ATOM   5965  N NE2 . GLN F 1 36  ? 5.034   0.695   14.667  1.00 71.20  ? 32  GLN F NE2 1 
ATOM   5966  N N   . ILE F 1 37  ? 1.911   5.091   17.965  1.00 42.14  ? 33  ILE F N   1 
ATOM   5967  C CA  . ILE F 1 37  ? 1.683   5.835   19.197  1.00 33.67  ? 33  ILE F CA  1 
ATOM   5968  C C   . ILE F 1 37  ? 2.169   5.042   20.405  1.00 35.31  ? 33  ILE F C   1 
ATOM   5969  O O   . ILE F 1 37  ? 2.543   3.875   20.284  1.00 24.62  ? 33  ILE F O   1 
ATOM   5970  C CB  . ILE F 1 37  ? 0.191   6.172   19.381  1.00 27.80  ? 33  ILE F CB  1 
ATOM   5971  C CG1 . ILE F 1 37  ? -0.644  4.890   19.418  1.00 22.71  ? 33  ILE F CG1 1 
ATOM   5972  C CG2 . ILE F 1 37  ? -0.286  7.086   18.259  1.00 15.78  ? 33  ILE F CG2 1 
ATOM   5973  C CD1 . ILE F 1 37  ? -2.113  5.127   19.690  1.00 13.45  ? 33  ILE F CD1 1 
ATOM   5974  N N   . THR F 1 38  ? 2.165   5.684   21.569  1.00 45.00  ? 34  THR F N   1 
ATOM   5975  C CA  . THR F 1 38  ? 2.557   5.021   22.807  1.00 57.73  ? 34  THR F CA  1 
ATOM   5976  C C   . THR F 1 38  ? 1.341   4.758   23.688  1.00 50.18  ? 34  THR F C   1 
ATOM   5977  O O   . THR F 1 38  ? 0.382   5.531   23.696  1.00 41.45  ? 34  THR F O   1 
ATOM   5978  C CB  . THR F 1 38  ? 3.582   5.854   23.604  1.00 63.63  ? 34  THR F CB  1 
ATOM   5979  O OG1 . THR F 1 38  ? 3.063   7.169   23.838  1.00 58.46  ? 34  THR F OG1 1 
ATOM   5980  C CG2 . THR F 1 38  ? 4.894   5.954   22.844  1.00 68.35  ? 34  THR F CG2 1 
ATOM   5981  N N   . PHE F 1 39  ? 1.389   3.655   24.426  1.00 49.08  ? 35  PHE F N   1 
ATOM   5982  C CA  . PHE F 1 39  ? 0.319   3.299   25.346  1.00 46.81  ? 35  PHE F CA  1 
ATOM   5983  C C   . PHE F 1 39  ? 0.809   2.218   26.302  1.00 44.69  ? 35  PHE F C   1 
ATOM   5984  O O   . PHE F 1 39  ? 1.815   1.560   26.037  1.00 41.02  ? 35  PHE F O   1 
ATOM   5985  C CB  . PHE F 1 39  ? -0.905  2.807   24.572  1.00 35.98  ? 35  PHE F CB  1 
ATOM   5986  C CG  . PHE F 1 39  ? -0.630  1.614   23.700  1.00 40.82  ? 35  PHE F CG  1 
ATOM   5987  C CD1 . PHE F 1 39  ? -0.189  1.778   22.397  1.00 37.48  ? 35  PHE F CD1 1 
ATOM   5988  C CD2 . PHE F 1 39  ? -0.814  0.329   24.185  1.00 35.56  ? 35  PHE F CD2 1 
ATOM   5989  C CE1 . PHE F 1 39  ? 0.064   0.682   21.594  1.00 27.53  ? 35  PHE F CE1 1 
ATOM   5990  C CE2 . PHE F 1 39  ? -0.562  -0.769  23.388  1.00 18.89  ? 35  PHE F CE2 1 
ATOM   5991  C CZ  . PHE F 1 39  ? -0.123  -0.593  22.091  1.00 35.66  ? 35  PHE F CZ  1 
ATOM   5992  N N   . GLU F 1 40  ? 0.105   2.047   27.417  1.00 46.30  ? 36  GLU F N   1 
ATOM   5993  C CA  . GLU F 1 40  ? 0.432   0.994   28.372  1.00 36.37  ? 36  GLU F CA  1 
ATOM   5994  C C   . GLU F 1 40  ? -0.553  -0.156  28.234  1.00 48.79  ? 36  GLU F C   1 
ATOM   5995  O O   . GLU F 1 40  ? -1.765  0.055   28.195  1.00 62.25  ? 36  GLU F O   1 
ATOM   5996  C CB  . GLU F 1 40  ? 0.399   1.527   29.802  1.00 37.00  ? 36  GLU F CB  1 
ATOM   5997  C CG  . GLU F 1 40  ? 1.370   2.658   30.066  1.00 54.60  ? 36  GLU F CG  1 
ATOM   5998  C CD  . GLU F 1 40  ? 1.981   2.581   31.449  1.00 61.98  ? 36  GLU F CD  1 
ATOM   5999  O OE1 . GLU F 1 40  ? 1.675   3.454   32.287  1.00 56.30  ? 36  GLU F OE1 1 
ATOM   6000  O OE2 . GLU F 1 40  ? 2.768   1.643   31.698  1.00 74.72  ? 36  GLU F OE2 1 
ATOM   6001  N N   . PHE F 1 41  ? -0.030  -1.375  28.169  1.00 53.34  ? 37  PHE F N   1 
ATOM   6002  C CA  . PHE F 1 41  ? -0.875  -2.553  28.036  1.00 54.60  ? 37  PHE F CA  1 
ATOM   6003  C C   . PHE F 1 41  ? -0.230  -3.764  28.708  1.00 68.23  ? 37  PHE F C   1 
ATOM   6004  O O   . PHE F 1 41  ? 0.905   -3.693  29.176  1.00 76.70  ? 37  PHE F O   1 
ATOM   6005  C CB  . PHE F 1 41  ? -1.158  -2.838  26.559  1.00 29.13  ? 37  PHE F CB  1 
ATOM   6006  C CG  . PHE F 1 41  ? -2.324  -3.755  26.335  1.00 35.60  ? 37  PHE F CG  1 
ATOM   6007  C CD1 . PHE F 1 41  ? -3.601  -3.378  26.717  1.00 43.91  ? 37  PHE F CD1 1 
ATOM   6008  C CD2 . PHE F 1 41  ? -2.143  -5.000  25.759  1.00 32.42  ? 37  PHE F CD2 1 
ATOM   6009  C CE1 . PHE F 1 41  ? -4.676  -4.219  26.517  1.00 38.71  ? 37  PHE F CE1 1 
ATOM   6010  C CE2 . PHE F 1 41  ? -3.215  -5.846  25.557  1.00 27.32  ? 37  PHE F CE2 1 
ATOM   6011  C CZ  . PHE F 1 41  ? -4.483  -5.455  25.936  1.00 32.37  ? 37  PHE F CZ  1 
ATOM   6012  N N   . VAL F 1 42  ? -0.966  -4.870  28.759  1.00 63.61  ? 38  VAL F N   1 
ATOM   6013  C CA  . VAL F 1 42  ? -0.494  -6.084  29.416  1.00 55.65  ? 38  VAL F CA  1 
ATOM   6014  C C   . VAL F 1 42  ? 0.664   -6.715  28.647  1.00 57.80  ? 38  VAL F C   1 
ATOM   6015  O O   . VAL F 1 42  ? 0.726   -6.633  27.420  1.00 55.66  ? 38  VAL F O   1 
ATOM   6016  C CB  . VAL F 1 42  ? -1.628  -7.123  29.549  1.00 62.87  ? 38  VAL F CB  1 
ATOM   6017  C CG1 . VAL F 1 42  ? -1.168  -8.319  30.374  1.00 53.04  ? 38  VAL F CG1 1 
ATOM   6018  C CG2 . VAL F 1 42  ? -2.856  -6.492  30.181  1.00 59.69  ? 38  VAL F CG2 1 
ATOM   6019  N N   . ASP F 1 43  ? 1.572   -7.353  29.379  1.00 70.07  ? 39  ASP F N   1 
ATOM   6020  C CA  . ASP F 1 43  ? 2.727   -8.014  28.783  1.00 78.40  ? 39  ASP F CA  1 
ATOM   6021  C C   . ASP F 1 43  ? 2.415   -9.493  28.574  1.00 76.35  ? 39  ASP F C   1 
ATOM   6022  O O   . ASP F 1 43  ? 2.406   -10.273 29.525  1.00 69.33  ? 39  ASP F O   1 
ATOM   6023  C CB  . ASP F 1 43  ? 3.949   -7.850  29.690  1.00 91.62  ? 39  ASP F CB  1 
ATOM   6024  C CG  . ASP F 1 43  ? 5.228   -8.362  29.053  1.00 110.16 ? 39  ASP F CG  1 
ATOM   6025  O OD1 . ASP F 1 43  ? 5.163   -9.329  28.264  1.00 115.04 ? 39  ASP F OD1 1 
ATOM   6026  O OD2 . ASP F 1 43  ? 6.303   -7.796  29.346  1.00 117.66 ? 39  ASP F OD2 1 
ATOM   6027  N N   . GLN F 1 44  ? 2.161   -9.870  27.324  1.00 87.28  ? 40  GLN F N   1 
ATOM   6028  C CA  . GLN F 1 44  ? 1.713   -11.222 26.999  1.00 95.86  ? 40  GLN F CA  1 
ATOM   6029  C C   . GLN F 1 44  ? 2.720   -12.293 27.421  1.00 92.79  ? 40  GLN F C   1 
ATOM   6030  O O   . GLN F 1 44  ? 2.336   -13.413 27.759  1.00 93.24  ? 40  GLN F O   1 
ATOM   6031  C CB  . GLN F 1 44  ? 1.427   -11.335 25.499  1.00 106.12 ? 40  GLN F CB  1 
ATOM   6032  C CG  . GLN F 1 44  ? 0.668   -12.593 25.103  1.00 116.39 ? 40  GLN F CG  1 
ATOM   6033  C CD  . GLN F 1 44  ? 0.230   -12.579 23.650  1.00 122.50 ? 40  GLN F CD  1 
ATOM   6034  O OE1 . GLN F 1 44  ? 0.317   -11.555 22.972  1.00 119.37 ? 40  GLN F OE1 1 
ATOM   6035  N NE2 . GLN F 1 44  ? -0.245  -13.721 23.163  1.00 125.64 ? 40  GLN F NE2 1 
ATOM   6036  N N   . GLU F 1 45  ? 4.004   -11.949 27.399  1.00 93.94  ? 41  GLU F N   1 
ATOM   6037  C CA  . GLU F 1 45  ? 5.052   -12.890 27.782  1.00 87.68  ? 41  GLU F CA  1 
ATOM   6038  C C   . GLU F 1 45  ? 5.196   -12.982 29.299  1.00 70.14  ? 41  GLU F C   1 
ATOM   6039  O O   . GLU F 1 45  ? 5.464   -14.054 29.841  1.00 47.78  ? 41  GLU F O   1 
ATOM   6040  C CB  . GLU F 1 45  ? 6.389   -12.478 27.160  1.00 95.69  ? 41  GLU F CB  1 
ATOM   6041  C CG  . GLU F 1 45  ? 6.429   -12.584 25.644  1.00 103.76 ? 41  GLU F CG  1 
ATOM   6042  C CD  . GLU F 1 45  ? 6.292   -14.014 25.157  1.00 112.25 ? 41  GLU F CD  1 
ATOM   6043  O OE1 . GLU F 1 45  ? 6.584   -14.942 25.941  1.00 109.05 ? 41  GLU F OE1 1 
ATOM   6044  O OE2 . GLU F 1 45  ? 5.889   -14.210 23.991  1.00 117.76 ? 41  GLU F OE2 1 
ATOM   6045  N N   . GLN F 1 46  ? 5.013   -11.854 29.977  1.00 70.82  ? 42  GLN F N   1 
ATOM   6046  C CA  . GLN F 1 46  ? 5.198   -11.785 31.421  1.00 72.16  ? 42  GLN F CA  1 
ATOM   6047  C C   . GLN F 1 46  ? 4.001   -12.372 32.172  1.00 78.02  ? 42  GLN F C   1 
ATOM   6048  O O   . GLN F 1 46  ? 4.136   -12.847 33.302  1.00 81.52  ? 42  GLN F O   1 
ATOM   6049  C CB  . GLN F 1 46  ? 5.419   -10.333 31.844  1.00 66.97  ? 42  GLN F CB  1 
ATOM   6050  C CG  . GLN F 1 46  ? 5.964   -10.170 33.250  1.00 70.84  ? 42  GLN F CG  1 
ATOM   6051  C CD  . GLN F 1 46  ? 6.413   -8.749  33.540  1.00 83.07  ? 42  GLN F CD  1 
ATOM   6052  O OE1 . GLN F 1 46  ? 6.003   -8.147  34.532  1.00 88.26  ? 42  GLN F OE1 1 
ATOM   6053  N NE2 . GLN F 1 46  ? 7.268   -8.209  32.676  1.00 85.38  ? 42  GLN F NE2 1 
ATOM   6054  N N   . LEU F 1 47  ? 2.834   -12.331 31.536  1.00 75.88  ? 43  LEU F N   1 
ATOM   6055  C CA  . LEU F 1 47  ? 1.611   -12.883 32.111  1.00 75.16  ? 43  LEU F CA  1 
ATOM   6056  C C   . LEU F 1 47  ? 0.902   -13.747 31.069  1.00 75.32  ? 43  LEU F C   1 
ATOM   6057  O O   . LEU F 1 47  ? 0.345   -13.230 30.100  1.00 61.94  ? 43  LEU F O   1 
ATOM   6058  C CB  . LEU F 1 47  ? 0.692   -11.753 32.582  1.00 64.54  ? 43  LEU F CB  1 
ATOM   6059  C CG  . LEU F 1 47  ? -0.663  -12.166 33.160  1.00 58.21  ? 43  LEU F CG  1 
ATOM   6060  C CD1 . LEU F 1 47  ? -0.484  -13.019 34.405  1.00 63.18  ? 43  LEU F CD1 1 
ATOM   6061  C CD2 . LEU F 1 47  ? -1.506  -10.936 33.465  1.00 37.75  ? 43  LEU F CD2 1 
ATOM   6062  N N   . LYS F 1 48  ? 0.922   -15.062 31.274  1.00 81.54  ? 44  LYS F N   1 
ATOM   6063  C CA  . LYS F 1 48  ? 0.441   -16.003 30.264  1.00 75.15  ? 44  LYS F CA  1 
ATOM   6064  C C   . LYS F 1 48  ? -0.873  -16.696 30.634  1.00 54.55  ? 44  LYS F C   1 
ATOM   6065  O O   . LYS F 1 48  ? -1.516  -17.294 29.774  1.00 37.06  ? 44  LYS F O   1 
ATOM   6066  C CB  . LYS F 1 48  ? 1.519   -17.051 29.966  1.00 87.14  ? 44  LYS F CB  1 
ATOM   6067  C CG  . LYS F 1 48  ? 2.728   -16.493 29.223  1.00 87.96  ? 44  LYS F CG  1 
ATOM   6068  C CD  . LYS F 1 48  ? 3.642   -17.596 28.708  1.00 88.19  ? 44  LYS F CD  1 
ATOM   6069  C CE  . LYS F 1 48  ? 4.728   -17.034 27.802  1.00 91.42  ? 44  LYS F CE  1 
ATOM   6070  N NZ  . LYS F 1 48  ? 5.569   -18.105 27.197  1.00 85.41  ? 44  LYS F NZ  1 
ATOM   6071  N N   . ASP F 1 49  ? -1.273  -16.625 31.899  1.00 61.85  ? 45  ASP F N   1 
ATOM   6072  C CA  . ASP F 1 49  ? -2.553  -17.201 32.307  1.00 59.67  ? 45  ASP F CA  1 
ATOM   6073  C C   . ASP F 1 49  ? -3.691  -16.447 31.624  1.00 68.36  ? 45  ASP F C   1 
ATOM   6074  O O   . ASP F 1 49  ? -3.895  -15.261 31.883  1.00 72.19  ? 45  ASP F O   1 
ATOM   6075  C CB  . ASP F 1 49  ? -2.720  -17.149 33.827  1.00 63.66  ? 45  ASP F CB  1 
ATOM   6076  C CG  . ASP F 1 49  ? -4.084  -17.644 34.282  1.00 61.12  ? 45  ASP F CG  1 
ATOM   6077  O OD1 . ASP F 1 49  ? -4.757  -18.345 33.497  1.00 51.76  ? 45  ASP F OD1 1 
ATOM   6078  O OD2 . ASP F 1 49  ? -4.484  -17.328 35.422  1.00 55.00  ? 45  ASP F OD2 1 
ATOM   6079  N N   . PRO F 1 50  ? -4.436  -17.133 30.742  1.00 76.57  ? 46  PRO F N   1 
ATOM   6080  C CA  . PRO F 1 50  ? -5.502  -16.488 29.965  1.00 78.70  ? 46  PRO F CA  1 
ATOM   6081  C C   . PRO F 1 50  ? -6.489  -15.684 30.812  1.00 84.13  ? 46  PRO F C   1 
ATOM   6082  O O   . PRO F 1 50  ? -6.748  -14.522 30.498  1.00 96.27  ? 46  PRO F O   1 
ATOM   6083  C CB  . PRO F 1 50  ? -6.209  -17.672 29.298  1.00 72.35  ? 46  PRO F CB  1 
ATOM   6084  C CG  . PRO F 1 50  ? -5.156  -18.712 29.180  1.00 71.53  ? 46  PRO F CG  1 
ATOM   6085  C CD  . PRO F 1 50  ? -4.300  -18.561 30.403  1.00 73.76  ? 46  PRO F CD  1 
ATOM   6086  N N   . VAL F 1 51  ? -7.031  -16.286 31.865  1.00 65.71  ? 47  VAL F N   1 
ATOM   6087  C CA  . VAL F 1 51  ? -8.048  -15.621 32.673  1.00 49.30  ? 47  VAL F CA  1 
ATOM   6088  C C   . VAL F 1 51  ? -7.491  -14.399 33.391  1.00 52.15  ? 47  VAL F C   1 
ATOM   6089  O O   . VAL F 1 51  ? -8.091  -13.326 33.362  1.00 68.76  ? 47  VAL F O   1 
ATOM   6090  C CB  . VAL F 1 51  ? -8.653  -16.574 33.715  1.00 60.06  ? 47  VAL F CB  1 
ATOM   6091  C CG1 . VAL F 1 51  ? -9.618  -15.824 34.626  1.00 40.19  ? 47  VAL F CG1 1 
ATOM   6092  C CG2 . VAL F 1 51  ? -9.360  -17.725 33.023  1.00 63.50  ? 47  VAL F CG2 1 
ATOM   6093  N N   . CYS F 1 52  ? -6.348  -14.565 34.044  1.00 50.12  ? 48  CYS F N   1 
ATOM   6094  C CA  . CYS F 1 52  ? -5.722  -13.463 34.762  1.00 54.63  ? 48  CYS F CA  1 
ATOM   6095  C C   . CYS F 1 52  ? -5.202  -12.398 33.804  1.00 63.60  ? 48  CYS F C   1 
ATOM   6096  O O   . CYS F 1 52  ? -4.915  -11.270 34.208  1.00 79.82  ? 48  CYS F O   1 
ATOM   6097  C CB  . CYS F 1 52  ? -4.596  -13.988 35.651  1.00 55.27  ? 48  CYS F CB  1 
ATOM   6098  S SG  . CYS F 1 52  ? -5.200  -14.972 37.047  1.00 78.19  ? 48  CYS F SG  1 
ATOM   6099  N N   . TYR F 1 53  ? -5.096  -12.756 32.530  1.00 54.98  ? 49  TYR F N   1 
ATOM   6100  C CA  . TYR F 1 53  ? -4.671  -11.814 31.509  1.00 45.88  ? 49  TYR F CA  1 
ATOM   6101  C C   . TYR F 1 53  ? -5.833  -10.906 31.115  1.00 41.01  ? 49  TYR F C   1 
ATOM   6102  O O   . TYR F 1 53  ? -5.643  -9.716  30.865  1.00 37.45  ? 49  TYR F O   1 
ATOM   6103  C CB  . TYR F 1 53  ? -4.143  -12.574 30.290  1.00 49.71  ? 49  TYR F CB  1 
ATOM   6104  C CG  . TYR F 1 53  ? -3.724  -11.693 29.138  1.00 49.15  ? 49  TYR F CG  1 
ATOM   6105  C CD1 . TYR F 1 53  ? -2.428  -11.206 29.048  1.00 60.74  ? 49  TYR F CD1 1 
ATOM   6106  C CD2 . TYR F 1 53  ? -4.622  -11.356 28.137  1.00 48.71  ? 49  TYR F CD2 1 
ATOM   6107  C CE1 . TYR F 1 53  ? -2.039  -10.401 27.994  1.00 69.55  ? 49  TYR F CE1 1 
ATOM   6108  C CE2 . TYR F 1 53  ? -4.244  -10.553 27.079  1.00 67.29  ? 49  TYR F CE2 1 
ATOM   6109  C CZ  . TYR F 1 53  ? -2.951  -10.078 27.012  1.00 74.85  ? 49  TYR F CZ  1 
ATOM   6110  O OH  . TYR F 1 53  ? -2.570  -9.278  25.958  1.00 81.86  ? 49  TYR F OH  1 
ATOM   6111  N N   . LEU F 1 54  ? -7.037  -11.470 31.076  1.00 37.53  ? 50  LEU F N   1 
ATOM   6112  C CA  . LEU F 1 54  ? -8.222  -10.718 30.672  1.00 29.41  ? 50  LEU F CA  1 
ATOM   6113  C C   . LEU F 1 54  ? -8.755  -9.844  31.800  1.00 28.70  ? 50  LEU F C   1 
ATOM   6114  O O   . LEU F 1 54  ? -9.465  -8.871  31.554  1.00 45.57  ? 50  LEU F O   1 
ATOM   6115  C CB  . LEU F 1 54  ? -9.321  -11.669 30.196  1.00 57.42  ? 50  LEU F CB  1 
ATOM   6116  C CG  . LEU F 1 54  ? -9.088  -12.312 28.829  1.00 65.75  ? 50  LEU F CG  1 
ATOM   6117  C CD1 . LEU F 1 54  ? -10.051 -13.466 28.615  1.00 70.41  ? 50  LEU F CD1 1 
ATOM   6118  C CD2 . LEU F 1 54  ? -9.237  -11.283 27.721  1.00 52.65  ? 50  LEU F CD2 1 
ATOM   6119  N N   . LYS F 1 55  ? -8.421  -10.192 33.037  1.00 47.94  ? 51  LYS F N   1 
ATOM   6120  C CA  . LYS F 1 55  ? -8.836  -9.383  34.174  1.00 52.22  ? 51  LYS F CA  1 
ATOM   6121  C C   . LYS F 1 55  ? -8.026  -8.095  34.219  1.00 53.55  ? 51  LYS F C   1 
ATOM   6122  O O   . LYS F 1 55  ? -8.576  -7.015  34.427  1.00 66.97  ? 51  LYS F O   1 
ATOM   6123  C CB  . LYS F 1 55  ? -8.683  -10.159 35.482  1.00 45.74  ? 51  LYS F CB  1 
ATOM   6124  C CG  . LYS F 1 55  ? -9.684  -11.287 35.633  1.00 47.03  ? 51  LYS F CG  1 
ATOM   6125  C CD  . LYS F 1 55  ? -9.650  -11.892 37.027  1.00 67.90  ? 51  LYS F CD  1 
ATOM   6126  C CE  . LYS F 1 55  ? -10.176 -10.923 38.079  1.00 70.24  ? 51  LYS F CE  1 
ATOM   6127  N NZ  . LYS F 1 55  ? -10.628 -11.632 39.308  1.00 77.84  ? 51  LYS F NZ  1 
ATOM   6128  N N   . LYS F 1 56  ? -6.717  -8.213  34.020  1.00 43.51  ? 52  LYS F N   1 
ATOM   6129  C CA  . LYS F 1 56  ? -5.851  -7.044  33.991  1.00 45.02  ? 52  LYS F CA  1 
ATOM   6130  C C   . LYS F 1 56  ? -6.044  -6.255  32.703  1.00 43.67  ? 52  LYS F C   1 
ATOM   6131  O O   . LYS F 1 56  ? -6.277  -5.048  32.735  1.00 58.61  ? 52  LYS F O   1 
ATOM   6132  C CB  . LYS F 1 56  ? -4.386  -7.452  34.135  1.00 54.26  ? 52  LYS F CB  1 
ATOM   6133  C CG  . LYS F 1 56  ? -3.422  -6.294  33.956  1.00 56.18  ? 52  LYS F CG  1 
ATOM   6134  C CD  . LYS F 1 56  ? -2.116  -6.524  34.691  1.00 63.02  ? 52  LYS F CD  1 
ATOM   6135  C CE  . LYS F 1 56  ? -2.343  -6.656  36.191  1.00 61.98  ? 52  LYS F CE  1 
ATOM   6136  N NZ  . LYS F 1 56  ? -1.152  -6.253  36.981  1.00 73.54  ? 52  LYS F NZ  1 
ATOM   6137  N N   . ALA F 1 57  ? -5.939  -6.941  31.571  1.00 29.25  ? 53  ALA F N   1 
ATOM   6138  C CA  . ALA F 1 57  ? -6.138  -6.300  30.278  1.00 30.42  ? 53  ALA F CA  1 
ATOM   6139  C C   . ALA F 1 57  ? -7.396  -5.435  30.287  1.00 42.29  ? 53  ALA F C   1 
ATOM   6140  O O   . ALA F 1 57  ? -7.369  -4.284  29.854  1.00 57.09  ? 53  ALA F O   1 
ATOM   6141  C CB  . ALA F 1 57  ? -6.226  -7.345  29.183  1.00 18.93  ? 53  ALA F CB  1 
ATOM   6142  N N   . PHE F 1 58  ? -8.494  -5.991  30.788  1.00 17.81  ? 54  PHE F N   1 
ATOM   6143  C CA  . PHE F 1 58  ? -9.764  -5.278  30.830  1.00 25.36  ? 54  PHE F CA  1 
ATOM   6144  C C   . PHE F 1 58  ? -9.644  -3.959  31.588  1.00 45.92  ? 54  PHE F C   1 
ATOM   6145  O O   . PHE F 1 58  ? -10.308 -2.980  31.247  1.00 60.71  ? 54  PHE F O   1 
ATOM   6146  C CB  . PHE F 1 58  ? -10.837 -6.154  31.478  1.00 42.27  ? 54  PHE F CB  1 
ATOM   6147  C CG  . PHE F 1 58  ? -12.175 -5.486  31.600  1.00 44.13  ? 54  PHE F CG  1 
ATOM   6148  C CD1 . PHE F 1 58  ? -13.026 -5.410  30.511  1.00 37.47  ? 54  PHE F CD1 1 
ATOM   6149  C CD2 . PHE F 1 58  ? -12.585 -4.939  32.805  1.00 61.22  ? 54  PHE F CD2 1 
ATOM   6150  C CE1 . PHE F 1 58  ? -14.259 -4.798  30.618  1.00 48.32  ? 54  PHE F CE1 1 
ATOM   6151  C CE2 . PHE F 1 58  ? -13.818 -4.326  32.919  1.00 60.35  ? 54  PHE F CE2 1 
ATOM   6152  C CZ  . PHE F 1 58  ? -14.656 -4.256  31.824  1.00 55.22  ? 54  PHE F CZ  1 
ATOM   6153  N N   . LEU F 1 59  ? -8.803  -3.933  32.618  1.00 35.90  ? 55  LEU F N   1 
ATOM   6154  C CA  . LEU F 1 59  ? -8.609  -2.717  33.402  1.00 38.33  ? 55  LEU F CA  1 
ATOM   6155  C C   . LEU F 1 59  ? -7.760  -1.691  32.653  1.00 47.75  ? 55  LEU F C   1 
ATOM   6156  O O   . LEU F 1 59  ? -8.031  -0.491  32.712  1.00 52.99  ? 55  LEU F O   1 
ATOM   6157  C CB  . LEU F 1 59  ? -7.967  -3.037  34.752  1.00 34.46  ? 55  LEU F CB  1 
ATOM   6158  C CG  . LEU F 1 59  ? -8.813  -3.849  35.737  1.00 44.31  ? 55  LEU F CG  1 
ATOM   6159  C CD1 . LEU F 1 59  ? -8.199  -3.794  37.129  1.00 30.55  ? 55  LEU F CD1 1 
ATOM   6160  C CD2 . LEU F 1 59  ? -10.255 -3.361  35.770  1.00 50.89  ? 55  LEU F CD2 1 
ATOM   6161  N N   . LEU F 1 60  ? -6.731  -2.160  31.957  1.00 39.79  ? 56  LEU F N   1 
ATOM   6162  C CA  . LEU F 1 60  ? -5.886  -1.270  31.170  1.00 44.89  ? 56  LEU F CA  1 
ATOM   6163  C C   . LEU F 1 60  ? -6.628  -0.771  29.932  1.00 44.31  ? 56  LEU F C   1 
ATOM   6164  O O   . LEU F 1 60  ? -6.299  0.280   29.383  1.00 47.98  ? 56  LEU F O   1 
ATOM   6165  C CB  . LEU F 1 60  ? -4.588  -1.974  30.771  1.00 41.39  ? 56  LEU F CB  1 
ATOM   6166  C CG  . LEU F 1 60  ? -3.593  -2.204  31.913  1.00 36.26  ? 56  LEU F CG  1 
ATOM   6167  C CD1 . LEU F 1 60  ? -2.430  -3.054  31.445  1.00 40.06  ? 56  LEU F CD1 1 
ATOM   6168  C CD2 . LEU F 1 60  ? -3.085  -0.881  32.466  1.00 35.45  ? 56  LEU F CD2 1 
ATOM   6169  N N   . VAL F 1 61  ? -7.632  -1.526  29.497  1.00 32.02  ? 57  VAL F N   1 
ATOM   6170  C CA  . VAL F 1 61  ? -8.480  -1.094  28.391  1.00 45.84  ? 57  VAL F CA  1 
ATOM   6171  C C   . VAL F 1 61  ? -9.260  0.158   28.781  1.00 51.87  ? 57  VAL F C   1 
ATOM   6172  O O   . VAL F 1 61  ? -9.534  1.013   27.940  1.00 47.73  ? 57  VAL F O   1 
ATOM   6173  C CB  . VAL F 1 61  ? -9.465  -2.202  27.961  1.00 31.42  ? 57  VAL F CB  1 
ATOM   6174  C CG1 . VAL F 1 61  ? -10.699 -1.602  27.294  1.00 26.06  ? 57  VAL F CG1 1 
ATOM   6175  C CG2 . VAL F 1 61  ? -8.777  -3.190  27.032  1.00 28.79  ? 57  VAL F CG2 1 
ATOM   6176  N N   . GLN F 1 62  ? -9.617  0.259   30.058  1.00 49.92  ? 58  GLN F N   1 
ATOM   6177  C CA  . GLN F 1 62  ? -10.319 1.434   30.560  1.00 34.71  ? 58  GLN F CA  1 
ATOM   6178  C C   . GLN F 1 62  ? -9.445  2.670   30.402  1.00 29.69  ? 58  GLN F C   1 
ATOM   6179  O O   . GLN F 1 62  ? -9.895  3.698   29.899  1.00 34.58  ? 58  GLN F O   1 
ATOM   6180  C CB  . GLN F 1 62  ? -10.703 1.250   32.030  1.00 43.19  ? 58  GLN F CB  1 
ATOM   6181  C CG  . GLN F 1 62  ? -11.729 0.156   32.273  1.00 54.80  ? 58  GLN F CG  1 
ATOM   6182  C CD  . GLN F 1 62  ? -13.064 0.462   31.626  1.00 69.14  ? 58  GLN F CD  1 
ATOM   6183  O OE1 . GLN F 1 62  ? -13.333 0.044   30.500  1.00 75.60  ? 58  GLN F OE1 1 
ATOM   6184  N NE2 . GLN F 1 62  ? -13.909 1.201   32.336  1.00 79.85  ? 58  GLN F NE2 1 
ATOM   6185  N N   . ASP F 1 63  ? -8.192  2.563   30.830  1.00 48.34  ? 59  ASP F N   1 
ATOM   6186  C CA  . ASP F 1 63  ? -7.251  3.672   30.729  1.00 49.85  ? 59  ASP F CA  1 
ATOM   6187  C C   . ASP F 1 63  ? -6.994  4.031   29.270  1.00 43.73  ? 59  ASP F C   1 
ATOM   6188  O O   . ASP F 1 63  ? -6.898  5.206   28.916  1.00 47.76  ? 59  ASP F O   1 
ATOM   6189  C CB  . ASP F 1 63  ? -5.935  3.322   31.430  1.00 55.95  ? 59  ASP F CB  1 
ATOM   6190  C CG  . ASP F 1 63  ? -6.078  3.263   32.941  1.00 59.28  ? 59  ASP F CG  1 
ATOM   6191  O OD1 . ASP F 1 63  ? -6.760  4.143   33.507  1.00 67.89  ? 59  ASP F OD1 1 
ATOM   6192  O OD2 . ASP F 1 63  ? -5.509  2.340   33.563  1.00 37.80  ? 59  ASP F OD2 1 
ATOM   6193  N N   . ILE F 1 64  ? -6.892  3.011   28.426  1.00 42.26  ? 60  ILE F N   1 
ATOM   6194  C CA  . ILE F 1 64  ? -6.666  3.218   27.002  1.00 33.19  ? 60  ILE F CA  1 
ATOM   6195  C C   . ILE F 1 64  ? -7.812  4.000   26.362  1.00 35.62  ? 60  ILE F C   1 
ATOM   6196  O O   . ILE F 1 64  ? -7.580  4.947   25.611  1.00 34.20  ? 60  ILE F O   1 
ATOM   6197  C CB  . ILE F 1 64  ? -6.493  1.877   26.271  1.00 29.79  ? 60  ILE F CB  1 
ATOM   6198  C CG1 . ILE F 1 64  ? -5.115  1.285   26.583  1.00 33.17  ? 60  ILE F CG1 1 
ATOM   6199  C CG2 . ILE F 1 64  ? -6.652  2.064   24.770  1.00 33.58  ? 60  ILE F CG2 1 
ATOM   6200  C CD1 . ILE F 1 64  ? -4.911  -0.125  26.060  1.00 22.93  ? 60  ILE F CD1 1 
ATOM   6201  N N   . MET F 1 65  ? -9.046  3.604   26.662  1.00 31.87  ? 61  MET F N   1 
ATOM   6202  C CA  . MET F 1 65  ? -10.216 4.249   26.073  1.00 43.63  ? 61  MET F CA  1 
ATOM   6203  C C   . MET F 1 65  ? -10.341 5.706   26.510  1.00 52.65  ? 61  MET F C   1 
ATOM   6204  O O   . MET F 1 65  ? -10.783 6.558   25.739  1.00 63.76  ? 61  MET F O   1 
ATOM   6205  C CB  . MET F 1 65  ? -11.494 3.485   26.431  1.00 43.03  ? 61  MET F CB  1 
ATOM   6206  C CG  . MET F 1 65  ? -11.646 2.162   25.690  1.00 50.09  ? 61  MET F CG  1 
ATOM   6207  S SD  . MET F 1 65  ? -13.314 1.477   25.774  1.00 43.98  ? 61  MET F SD  1 
ATOM   6208  C CE  . MET F 1 65  ? -13.507 1.238   27.539  1.00 36.30  ? 61  MET F CE  1 
ATOM   6209  N N   . GLU F 1 66  ? -9.946  5.987   27.746  1.00 58.05  ? 62  GLU F N   1 
ATOM   6210  C CA  . GLU F 1 66  ? -10.045 7.335   28.294  1.00 56.35  ? 62  GLU F CA  1 
ATOM   6211  C C   . GLU F 1 66  ? -8.904  8.227   27.810  1.00 53.97  ? 62  GLU F C   1 
ATOM   6212  O O   . GLU F 1 66  ? -9.124  9.379   27.433  1.00 45.48  ? 62  GLU F O   1 
ATOM   6213  C CB  . GLU F 1 66  ? -10.046 7.277   29.826  1.00 62.15  ? 62  GLU F CB  1 
ATOM   6214  C CG  . GLU F 1 66  ? -9.807  8.616   30.512  1.00 76.52  ? 62  GLU F CG  1 
ATOM   6215  C CD  . GLU F 1 66  ? -10.875 9.645   30.195  1.00 85.03  ? 62  GLU F CD  1 
ATOM   6216  O OE1 . GLU F 1 66  ? -11.924 9.266   29.632  1.00 89.11  ? 62  GLU F OE1 1 
ATOM   6217  O OE2 . GLU F 1 66  ? -10.662 10.836  30.509  1.00 73.96  ? 62  GLU F OE2 1 
ATOM   6218  N N   . ASP F 1 67  ? -7.689  7.686   27.810  1.00 49.15  ? 63  ASP F N   1 
ATOM   6219  C CA  . ASP F 1 67  ? -6.493  8.485   27.556  1.00 44.33  ? 63  ASP F CA  1 
ATOM   6220  C C   . ASP F 1 67  ? -6.066  8.498   26.088  1.00 46.92  ? 63  ASP F C   1 
ATOM   6221  O O   . ASP F 1 67  ? -5.706  9.545   25.552  1.00 47.05  ? 63  ASP F O   1 
ATOM   6222  C CB  . ASP F 1 67  ? -5.327  7.969   28.405  1.00 46.66  ? 63  ASP F CB  1 
ATOM   6223  C CG  . ASP F 1 67  ? -5.651  7.932   29.886  1.00 40.32  ? 63  ASP F CG  1 
ATOM   6224  O OD1 . ASP F 1 67  ? -6.469  8.760   30.340  1.00 39.14  ? 63  ASP F OD1 1 
ATOM   6225  O OD2 . ASP F 1 67  ? -5.085  7.075   30.596  1.00 37.94  ? 63  ASP F OD2 1 
ATOM   6226  N N   . THR F 1 68  ? -6.100  7.335   25.446  1.00 60.21  ? 64  THR F N   1 
ATOM   6227  C CA  . THR F 1 68  ? -5.497  7.172   24.125  1.00 49.38  ? 64  THR F CA  1 
ATOM   6228  C C   . THR F 1 68  ? -6.508  7.184   22.977  1.00 44.73  ? 64  THR F C   1 
ATOM   6229  O O   . THR F 1 68  ? -6.292  7.854   21.966  1.00 40.33  ? 64  THR F O   1 
ATOM   6230  C CB  . THR F 1 68  ? -4.680  5.865   24.058  1.00 45.76  ? 64  THR F CB  1 
ATOM   6231  O OG1 . THR F 1 68  ? -3.661  5.885   25.066  1.00 30.60  ? 64  THR F OG1 1 
ATOM   6232  C CG2 . THR F 1 68  ? -4.036  5.699   22.689  1.00 52.02  ? 64  THR F CG2 1 
ATOM   6233  N N   . MET F 1 69  ? -7.597  6.435   23.122  1.00 45.42  ? 65  MET F N   1 
ATOM   6234  C CA  . MET F 1 69  ? -8.593  6.339   22.059  1.00 51.49  ? 65  MET F CA  1 
ATOM   6235  C C   . MET F 1 69  ? -9.538  7.538   22.092  1.00 57.69  ? 65  MET F C   1 
ATOM   6236  O O   . MET F 1 69  ? -10.563 7.522   22.774  1.00 71.83  ? 65  MET F O   1 
ATOM   6237  C CB  . MET F 1 69  ? -9.376  5.032   22.180  1.00 54.79  ? 65  MET F CB  1 
ATOM   6238  C CG  . MET F 1 69  ? -8.515  3.790   21.993  1.00 62.40  ? 65  MET F CG  1 
ATOM   6239  S SD  . MET F 1 69  ? -9.366  2.260   22.420  1.00 60.08  ? 65  MET F SD  1 
ATOM   6240  C CE  . MET F 1 69  ? -10.755 2.323   21.294  1.00 125.69 ? 65  MET F CE  1 
ATOM   6241  N N   . ARG F 1 70  ? -9.183  8.569   21.332  1.00 45.18  ? 66  ARG F N   1 
ATOM   6242  C CA  . ARG F 1 70  ? -9.901  9.835   21.347  1.00 43.01  ? 66  ARG F CA  1 
ATOM   6243  C C   . ARG F 1 70  ? -10.525 10.131  19.983  1.00 61.54  ? 66  ARG F C   1 
ATOM   6244  O O   . ARG F 1 70  ? -9.880  9.970   18.945  1.00 69.91  ? 66  ARG F O   1 
ATOM   6245  C CB  . ARG F 1 70  ? -8.938  10.955  21.740  1.00 45.54  ? 66  ARG F CB  1 
ATOM   6246  C CG  . ARG F 1 70  ? -8.674  11.055  23.240  1.00 64.66  ? 66  ARG F CG  1 
ATOM   6247  C CD  . ARG F 1 70  ? -7.188  11.109  23.526  1.00 82.75  ? 66  ARG F CD  1 
ATOM   6248  N NE  . ARG F 1 70  ? -6.526  12.175  22.780  1.00 94.52  ? 66  ARG F NE  1 
ATOM   6249  C CZ  . ARG F 1 70  ? -5.207  12.328  22.703  1.00 105.97 ? 66  ARG F CZ  1 
ATOM   6250  N NH1 . ARG F 1 70  ? -4.398  11.481  23.325  1.00 101.72 ? 66  ARG F NH1 1 
ATOM   6251  N NH2 . ARG F 1 70  ? -4.696  13.328  21.999  1.00 113.11 ? 66  ARG F NH2 1 
ATOM   6252  N N   . PHE F 1 71  ? -11.788 10.549  19.989  1.00 53.83  ? 67  PHE F N   1 
ATOM   6253  C CA  . PHE F 1 71  ? -12.479 10.921  18.758  1.00 43.33  ? 67  PHE F CA  1 
ATOM   6254  C C   . PHE F 1 71  ? -13.236 12.233  18.922  1.00 62.55  ? 67  PHE F C   1 
ATOM   6255  O O   . PHE F 1 71  ? -13.615 12.610  20.032  1.00 68.32  ? 67  PHE F O   1 
ATOM   6256  C CB  . PHE F 1 71  ? -13.448 9.818   18.328  1.00 50.01  ? 67  PHE F CB  1 
ATOM   6257  C CG  . PHE F 1 71  ? -12.775 8.517   18.010  1.00 48.09  ? 67  PHE F CG  1 
ATOM   6258  C CD1 . PHE F 1 71  ? -12.207 8.306   16.768  1.00 55.62  ? 67  PHE F CD1 1 
ATOM   6259  C CD2 . PHE F 1 71  ? -12.704 7.508   18.956  1.00 54.07  ? 67  PHE F CD2 1 
ATOM   6260  C CE1 . PHE F 1 71  ? -11.582 7.113   16.471  1.00 65.27  ? 67  PHE F CE1 1 
ATOM   6261  C CE2 . PHE F 1 71  ? -12.078 6.311   18.665  1.00 58.07  ? 67  PHE F CE2 1 
ATOM   6262  C CZ  . PHE F 1 71  ? -11.517 6.115   17.419  1.00 59.26  ? 67  PHE F CZ  1 
ATOM   6263  N N   . ARG F 1 72  ? -13.450 12.921  17.806  1.00 70.17  ? 68  ARG F N   1 
ATOM   6264  C CA  . ARG F 1 72  ? -14.160 14.193  17.805  1.00 60.55  ? 68  ARG F CA  1 
ATOM   6265  C C   . ARG F 1 72  ? -15.523 14.023  18.466  1.00 64.11  ? 68  ARG F C   1 
ATOM   6266  O O   . ARG F 1 72  ? -16.223 13.039  18.222  1.00 62.08  ? 68  ARG F O   1 
ATOM   6267  C CB  . ARG F 1 72  ? -14.321 14.696  16.372  1.00 48.61  ? 68  ARG F CB  1 
ATOM   6268  C CG  . ARG F 1 72  ? -14.533 16.194  16.243  1.00 55.09  ? 68  ARG F CG  1 
ATOM   6269  C CD  . ARG F 1 72  ? -14.302 16.643  14.809  1.00 67.52  ? 68  ARG F CD  1 
ATOM   6270  N NE  . ARG F 1 72  ? -13.032 16.138  14.286  1.00 91.76  ? 68  ARG F NE  1 
ATOM   6271  C CZ  . ARG F 1 72  ? -11.903 16.840  14.192  1.00 100.98 ? 68  ARG F CZ  1 
ATOM   6272  N NH1 . ARG F 1 72  ? -11.850 18.113  14.569  1.00 102.34 ? 68  ARG F NH1 1 
ATOM   6273  N NH2 . ARG F 1 72  ? -10.814 16.263  13.704  1.00 99.90  ? 68  ARG F NH2 1 
ATOM   6274  N N   . ASP F 1 73  ? -15.892 14.984  19.307  1.00 66.94  ? 69  ASP F N   1 
ATOM   6275  C CA  . ASP F 1 73  ? -17.123 14.898  20.087  1.00 55.83  ? 69  ASP F CA  1 
ATOM   6276  C C   . ASP F 1 73  ? -18.355 14.706  19.205  1.00 51.76  ? 69  ASP F C   1 
ATOM   6277  O O   . ASP F 1 73  ? -18.513 15.379  18.186  1.00 53.43  ? 69  ASP F O   1 
ATOM   6278  C CB  . ASP F 1 73  ? -17.293 16.158  20.941  1.00 57.28  ? 69  ASP F CB  1 
ATOM   6279  C CG  . ASP F 1 73  ? -16.173 16.337  21.951  1.00 70.70  ? 69  ASP F CG  1 
ATOM   6280  O OD1 . ASP F 1 73  ? -15.713 15.324  22.521  1.00 72.09  ? 69  ASP F OD1 1 
ATOM   6281  O OD2 . ASP F 1 73  ? -15.753 17.492  22.176  1.00 73.63  ? 69  ASP F OD2 1 
ATOM   6282  N N   . ASN F 1 74  ? -19.218 13.776  19.603  1.00 55.80  ? 70  ASN F N   1 
ATOM   6283  C CA  . ASN F 1 74  ? -20.517 13.586  18.962  1.00 59.41  ? 70  ASN F CA  1 
ATOM   6284  C C   . ASN F 1 74  ? -20.437 12.918  17.590  1.00 56.21  ? 70  ASN F C   1 
ATOM   6285  O O   . ASN F 1 74  ? -21.327 13.089  16.759  1.00 57.06  ? 70  ASN F O   1 
ATOM   6286  C CB  . ASN F 1 74  ? -21.244 14.927  18.836  1.00 74.25  ? 70  ASN F CB  1 
ATOM   6287  C CG  . ASN F 1 74  ? -22.744 14.765  18.666  1.00 90.72  ? 70  ASN F CG  1 
ATOM   6288  O OD1 . ASN F 1 74  ? -23.233 13.684  18.337  1.00 93.23  ? 70  ASN F OD1 1 
ATOM   6289  N ND2 . ASN F 1 74  ? -23.482 15.846  18.887  1.00 103.08 ? 70  ASN F ND2 1 
ATOM   6290  N N   . THR F 1 75  ? -19.371 12.161  17.353  1.00 57.47  ? 71  THR F N   1 
ATOM   6291  C CA  . THR F 1 75  ? -19.249 11.393  16.118  1.00 62.19  ? 71  THR F CA  1 
ATOM   6292  C C   . THR F 1 75  ? -19.551 9.921   16.385  1.00 57.77  ? 71  THR F C   1 
ATOM   6293  O O   . THR F 1 75  ? -19.407 9.453   17.516  1.00 60.77  ? 71  THR F O   1 
ATOM   6294  C CB  . THR F 1 75  ? -17.841 11.524  15.498  1.00 67.12  ? 71  THR F CB  1 
ATOM   6295  O OG1 . THR F 1 75  ? -16.871 10.905  16.354  1.00 74.53  ? 71  THR F OG1 1 
ATOM   6296  C CG2 . THR F 1 75  ? -17.481 12.988  15.290  1.00 59.05  ? 71  THR F CG2 1 
ATOM   6297  N N   . PRO F 1 76  ? -19.978 9.187   15.344  1.00 35.92  ? 72  PRO F N   1 
ATOM   6298  C CA  . PRO F 1 76  ? -20.307 7.763   15.479  1.00 28.47  ? 72  PRO F CA  1 
ATOM   6299  C C   . PRO F 1 76  ? -19.251 6.979   16.257  1.00 36.78  ? 72  PRO F C   1 
ATOM   6300  O O   . PRO F 1 76  ? -19.602 6.116   17.061  1.00 50.94  ? 72  PRO F O   1 
ATOM   6301  C CB  . PRO F 1 76  ? -20.377 7.286   14.027  1.00 31.50  ? 72  PRO F CB  1 
ATOM   6302  C CG  . PRO F 1 76  ? -20.821 8.496   13.268  1.00 20.84  ? 72  PRO F CG  1 
ATOM   6303  C CD  . PRO F 1 76  ? -20.194 9.674   13.968  1.00 17.59  ? 72  PRO F CD  1 
ATOM   6304  N N   . ASN F 1 77  ? -17.978 7.280   16.023  1.00 46.12  ? 73  ASN F N   1 
ATOM   6305  C CA  . ASN F 1 77  ? -16.896 6.622   16.747  1.00 37.52  ? 73  ASN F CA  1 
ATOM   6306  C C   . ASN F 1 77  ? -16.803 7.078   18.197  1.00 31.14  ? 73  ASN F C   1 
ATOM   6307  O O   . ASN F 1 77  ? -16.547 6.270   19.089  1.00 53.35  ? 73  ASN F O   1 
ATOM   6308  C CB  . ASN F 1 77  ? -15.556 6.863   16.053  1.00 42.79  ? 73  ASN F CB  1 
ATOM   6309  C CG  . ASN F 1 77  ? -15.318 5.914   14.900  1.00 35.77  ? 73  ASN F CG  1 
ATOM   6310  O OD1 . ASN F 1 77  ? -15.893 4.827   14.847  1.00 40.70  ? 73  ASN F OD1 1 
ATOM   6311  N ND2 . ASN F 1 77  ? -14.458 6.315   13.972  1.00 39.58  ? 73  ASN F ND2 1 
ATOM   6312  N N   . ALA F 1 78  ? -16.999 8.372   18.431  1.00 26.47  ? 74  ALA F N   1 
ATOM   6313  C CA  . ALA F 1 78  ? -16.926 8.923   19.781  1.00 45.98  ? 74  ALA F CA  1 
ATOM   6314  C C   . ALA F 1 78  ? -18.031 8.342   20.655  1.00 50.58  ? 74  ALA F C   1 
ATOM   6315  O O   . ALA F 1 78  ? -17.825 8.055   21.835  1.00 38.41  ? 74  ALA F O   1 
ATOM   6316  C CB  . ALA F 1 78  ? -17.028 10.431  19.740  1.00 47.40  ? 74  ALA F CB  1 
ATOM   6317  N N   . ILE F 1 79  ? -19.208 8.174   20.064  1.00 62.51  ? 75  ILE F N   1 
ATOM   6318  C CA  . ILE F 1 79  ? -20.337 7.575   20.756  1.00 50.09  ? 75  ILE F CA  1 
ATOM   6319  C C   . ILE F 1 79  ? -20.004 6.127   21.091  1.00 50.09  ? 75  ILE F C   1 
ATOM   6320  O O   . ILE F 1 79  ? -20.317 5.641   22.178  1.00 55.77  ? 75  ILE F O   1 
ATOM   6321  C CB  . ILE F 1 79  ? -21.605 7.610   19.884  1.00 55.31  ? 75  ILE F CB  1 
ATOM   6322  C CG1 . ILE F 1 79  ? -21.965 9.054   19.520  1.00 52.49  ? 75  ILE F CG1 1 
ATOM   6323  C CG2 . ILE F 1 79  ? -22.769 6.949   20.610  1.00 68.68  ? 75  ILE F CG2 1 
ATOM   6324  C CD1 . ILE F 1 79  ? -22.967 9.168   18.396  1.00 55.87  ? 75  ILE F CD1 1 
ATOM   6325  N N   . ALA F 1 80  ? -19.361 5.446   20.147  1.00 46.82  ? 76  ALA F N   1 
ATOM   6326  C CA  . ALA F 1 80  ? -18.996 4.044   20.309  1.00 45.47  ? 76  ALA F CA  1 
ATOM   6327  C C   . ALA F 1 80  ? -18.103 3.835   21.527  1.00 48.46  ? 76  ALA F C   1 
ATOM   6328  O O   . ALA F 1 80  ? -18.209 2.822   22.217  1.00 46.24  ? 76  ALA F O   1 
ATOM   6329  C CB  . ALA F 1 80  ? -18.301 3.535   19.055  1.00 39.28  ? 76  ALA F CB  1 
ATOM   6330  N N   . ILE F 1 81  ? -17.219 4.792   21.786  1.00 56.62  ? 77  ILE F N   1 
ATOM   6331  C CA  . ILE F 1 81  ? -16.306 4.695   22.917  1.00 56.86  ? 77  ILE F CA  1 
ATOM   6332  C C   . ILE F 1 81  ? -17.048 4.922   24.231  1.00 54.23  ? 77  ILE F C   1 
ATOM   6333  O O   . ILE F 1 81  ? -16.850 4.189   25.201  1.00 56.77  ? 77  ILE F O   1 
ATOM   6334  C CB  . ILE F 1 81  ? -15.158 5.713   22.800  1.00 48.07  ? 77  ILE F CB  1 
ATOM   6335  C CG1 . ILE F 1 81  ? -14.359 5.467   21.519  1.00 42.90  ? 77  ILE F CG1 1 
ATOM   6336  C CG2 . ILE F 1 81  ? -14.245 5.631   24.016  1.00 45.09  ? 77  ILE F CG2 1 
ATOM   6337  C CD1 . ILE F 1 81  ? -13.737 4.092   21.439  1.00 39.55  ? 77  ILE F CD1 1 
ATOM   6338  N N   . VAL F 1 82  ? -17.903 5.939   24.259  1.00 39.88  ? 78  VAL F N   1 
ATOM   6339  C CA  . VAL F 1 82  ? -18.678 6.251   25.455  1.00 49.23  ? 78  VAL F CA  1 
ATOM   6340  C C   . VAL F 1 82  ? -19.532 5.064   25.886  1.00 42.35  ? 78  VAL F C   1 
ATOM   6341  O O   . VAL F 1 82  ? -19.596 4.731   27.069  1.00 42.21  ? 78  VAL F O   1 
ATOM   6342  C CB  . VAL F 1 82  ? -19.589 7.473   25.231  1.00 49.13  ? 78  VAL F CB  1 
ATOM   6343  C CG1 . VAL F 1 82  ? -20.630 7.579   26.335  1.00 37.47  ? 78  VAL F CG1 1 
ATOM   6344  C CG2 . VAL F 1 82  ? -18.759 8.745   25.153  1.00 60.51  ? 78  VAL F CG2 1 
ATOM   6345  N N   . GLN F 1 83  ? -20.186 4.426   24.921  1.00 44.44  ? 79  GLN F N   1 
ATOM   6346  C CA  . GLN F 1 83  ? -21.048 3.284   25.204  1.00 37.83  ? 79  GLN F CA  1 
ATOM   6347  C C   . GLN F 1 83  ? -20.242 2.099   25.728  1.00 40.69  ? 79  GLN F C   1 
ATOM   6348  O O   . GLN F 1 83  ? -20.734 1.314   26.540  1.00 38.72  ? 79  GLN F O   1 
ATOM   6349  C CB  . GLN F 1 83  ? -21.820 2.876   23.949  1.00 28.66  ? 79  GLN F CB  1 
ATOM   6350  C CG  . GLN F 1 83  ? -22.864 3.890   23.505  1.00 48.14  ? 79  GLN F CG  1 
ATOM   6351  C CD  . GLN F 1 83  ? -23.468 3.551   22.154  1.00 68.91  ? 79  GLN F CD  1 
ATOM   6352  O OE1 . GLN F 1 83  ? -22.915 2.751   21.398  1.00 79.81  ? 79  GLN F OE1 1 
ATOM   6353  N NE2 . GLN F 1 83  ? -24.609 4.157   21.844  1.00 58.21  ? 79  GLN F NE2 1 
ATOM   6354  N N   . LEU F 1 84  ? -19.004 1.974   25.256  1.00 43.82  ? 80  LEU F N   1 
ATOM   6355  C CA  . LEU F 1 84  ? -18.121 0.896   25.692  1.00 39.20  ? 80  LEU F CA  1 
ATOM   6356  C C   . LEU F 1 84  ? -17.548 1.179   27.079  1.00 42.91  ? 80  LEU F C   1 
ATOM   6357  O O   . LEU F 1 84  ? -17.262 0.254   27.842  1.00 35.58  ? 80  LEU F O   1 
ATOM   6358  C CB  . LEU F 1 84  ? -16.988 0.691   24.683  1.00 45.03  ? 80  LEU F CB  1 
ATOM   6359  C CG  . LEU F 1 84  ? -17.390 0.050   23.350  1.00 35.01  ? 80  LEU F CG  1 
ATOM   6360  C CD1 . LEU F 1 84  ? -16.238 0.115   22.349  1.00 12.77  ? 80  LEU F CD1 1 
ATOM   6361  C CD2 . LEU F 1 84  ? -17.844 -1.389  23.561  1.00 14.09  ? 80  LEU F CD2 1 
ATOM   6362  N N   . GLN F 1 85  ? -17.382 2.459   27.401  1.00 42.69  ? 81  GLN F N   1 
ATOM   6363  C CA  . GLN F 1 85  ? -16.938 2.859   28.731  1.00 28.78  ? 81  GLN F CA  1 
ATOM   6364  C C   . GLN F 1 85  ? -18.077 2.675   29.726  1.00 24.91  ? 81  GLN F C   1 
ATOM   6365  O O   . GLN F 1 85  ? -17.864 2.225   30.852  1.00 27.03  ? 81  GLN F O   1 
ATOM   6366  C CB  . GLN F 1 85  ? -16.465 4.314   28.728  1.00 30.08  ? 81  GLN F CB  1 
ATOM   6367  C CG  . GLN F 1 85  ? -15.160 4.540   27.982  1.00 35.83  ? 81  GLN F CG  1 
ATOM   6368  C CD  . GLN F 1 85  ? -14.758 6.001   27.934  1.00 32.96  ? 81  GLN F CD  1 
ATOM   6369  O OE1 . GLN F 1 85  ? -15.357 6.798   27.213  1.00 41.69  ? 81  GLN F OE1 1 
ATOM   6370  N NE2 . GLN F 1 85  ? -13.735 6.359   28.702  1.00 23.26  ? 81  GLN F NE2 1 
ATOM   6371  N N   . GLU F 1 86  ? -19.289 3.024   29.304  1.00 41.38  ? 82  GLU F N   1 
ATOM   6372  C CA  . GLU F 1 86  ? -20.477 2.799   30.118  1.00 37.70  ? 82  GLU F CA  1 
ATOM   6373  C C   . GLU F 1 86  ? -20.602 1.312   30.393  1.00 33.42  ? 82  GLU F C   1 
ATOM   6374  O O   . GLU F 1 86  ? -20.688 0.883   31.543  1.00 49.41  ? 82  GLU F O   1 
ATOM   6375  C CB  . GLU F 1 86  ? -21.728 3.303   29.395  1.00 47.36  ? 82  GLU F CB  1 
ATOM   6376  C CG  . GLU F 1 86  ? -21.909 4.813   29.426  1.00 52.40  ? 82  GLU F CG  1 
ATOM   6377  C CD  . GLU F 1 86  ? -22.405 5.318   30.769  1.00 62.94  ? 82  GLU F CD  1 
ATOM   6378  O OE1 . GLU F 1 86  ? -22.815 4.486   31.607  1.00 62.27  ? 82  GLU F OE1 1 
ATOM   6379  O OE2 . GLU F 1 86  ? -22.388 6.549   30.985  1.00 59.48  ? 82  GLU F OE2 1 
ATOM   6380  N N   . LEU F 1 87  ? -20.607 0.531   29.319  1.00 36.37  ? 83  LEU F N   1 
ATOM   6381  C CA  . LEU F 1 87  ? -20.640 -0.921  29.411  1.00 35.24  ? 83  LEU F CA  1 
ATOM   6382  C C   . LEU F 1 87  ? -19.629 -1.419  30.435  1.00 40.23  ? 83  LEU F C   1 
ATOM   6383  O O   . LEU F 1 87  ? -19.948 -2.237  31.298  1.00 44.28  ? 83  LEU F O   1 
ATOM   6384  C CB  . LEU F 1 87  ? -20.325 -1.528  28.044  1.00 31.22  ? 83  LEU F CB  1 
ATOM   6385  C CG  . LEU F 1 87  ? -20.072 -3.034  28.020  1.00 36.69  ? 83  LEU F CG  1 
ATOM   6386  C CD1 . LEU F 1 87  ? -21.371 -3.804  28.196  1.00 33.89  ? 83  LEU F CD1 1 
ATOM   6387  C CD2 . LEU F 1 87  ? -19.377 -3.420  26.728  1.00 35.61  ? 83  LEU F CD2 1 
ATOM   6388  N N   . SER F 1 88  ? -18.406 -0.911  30.333  1.00 43.73  ? 84  SER F N   1 
ATOM   6389  C CA  . SER F 1 88  ? -17.318 -1.346  31.196  1.00 39.81  ? 84  SER F CA  1 
ATOM   6390  C C   . SER F 1 88  ? -17.563 -0.972  32.654  1.00 45.38  ? 84  SER F C   1 
ATOM   6391  O O   . SER F 1 88  ? -17.112 -1.671  33.561  1.00 49.00  ? 84  SER F O   1 
ATOM   6392  C CB  . SER F 1 88  ? -16.000 -0.741  30.719  1.00 37.82  ? 84  SER F CB  1 
ATOM   6393  O OG  . SER F 1 88  ? -15.730 -1.115  29.379  1.00 45.90  ? 84  SER F OG  1 
ATOM   6394  N N   . LEU F 1 89  ? -18.271 0.131   32.880  1.00 54.14  ? 85  LEU F N   1 
ATOM   6395  C CA  . LEU F 1 89  ? -18.608 0.551   34.238  1.00 50.87  ? 85  LEU F CA  1 
ATOM   6396  C C   . LEU F 1 89  ? -19.579 -0.431  34.886  1.00 51.55  ? 85  LEU F C   1 
ATOM   6397  O O   . LEU F 1 89  ? -19.539 -0.645  36.097  1.00 61.75  ? 85  LEU F O   1 
ATOM   6398  C CB  . LEU F 1 89  ? -19.211 1.958   34.238  1.00 45.33  ? 85  LEU F CB  1 
ATOM   6399  C CG  . LEU F 1 89  ? -18.227 3.122   34.110  1.00 37.89  ? 85  LEU F CG  1 
ATOM   6400  C CD1 . LEU F 1 89  ? -18.975 4.423   33.873  1.00 39.05  ? 85  LEU F CD1 1 
ATOM   6401  C CD2 . LEU F 1 89  ? -17.357 3.230   35.353  1.00 26.32  ? 85  LEU F CD2 1 
ATOM   6402  N N   . ARG F 1 90  ? -20.452 -1.024  34.076  1.00 47.05  ? 86  ARG F N   1 
ATOM   6403  C CA  . ARG F 1 90  ? -21.418 -1.994  34.576  1.00 48.79  ? 86  ARG F CA  1 
ATOM   6404  C C   . ARG F 1 90  ? -20.794 -3.382  34.705  1.00 57.50  ? 86  ARG F C   1 
ATOM   6405  O O   . ARG F 1 90  ? -21.264 -4.210  35.485  1.00 58.02  ? 86  ARG F O   1 
ATOM   6406  C CB  . ARG F 1 90  ? -22.643 -2.053  33.661  1.00 63.27  ? 86  ARG F CB  1 
ATOM   6407  C CG  . ARG F 1 90  ? -23.451 -0.767  33.628  1.00 78.83  ? 86  ARG F CG  1 
ATOM   6408  C CD  . ARG F 1 90  ? -24.758 -0.951  32.877  1.00 83.60  ? 86  ARG F CD  1 
ATOM   6409  N NE  . ARG F 1 90  ? -24.902 0.013   31.788  1.00 95.06  ? 86  ARG F NE  1 
ATOM   6410  C CZ  . ARG F 1 90  ? -24.511 -0.195  30.532  1.00 95.89  ? 86  ARG F CZ  1 
ATOM   6411  N NH1 . ARG F 1 90  ? -23.944 -1.342  30.174  1.00 97.80  ? 86  ARG F NH1 1 
ATOM   6412  N NH2 . ARG F 1 90  ? -24.690 0.752   29.623  1.00 86.29  ? 86  ARG F NH2 1 
ATOM   6413  N N   . LEU F 1 91  ? -19.734 -3.629  33.940  1.00 62.28  ? 87  LEU F N   1 
ATOM   6414  C CA  . LEU F 1 91  ? -19.043 -4.918  33.974  1.00 56.06  ? 87  LEU F CA  1 
ATOM   6415  C C   . LEU F 1 91  ? -18.215 -5.106  35.243  1.00 47.10  ? 87  LEU F C   1 
ATOM   6416  O O   . LEU F 1 91  ? -17.904 -6.234  35.621  1.00 50.20  ? 87  LEU F O   1 
ATOM   6417  C CB  . LEU F 1 91  ? -18.133 -5.070  32.753  1.00 60.47  ? 87  LEU F CB  1 
ATOM   6418  C CG  . LEU F 1 91  ? -18.742 -5.715  31.507  1.00 50.29  ? 87  LEU F CG  1 
ATOM   6419  C CD1 . LEU F 1 91  ? -17.768 -5.631  30.341  1.00 35.45  ? 87  LEU F CD1 1 
ATOM   6420  C CD2 . LEU F 1 91  ? -19.121 -7.164  31.779  1.00 37.86  ? 87  LEU F CD2 1 
ATOM   6421  N N   . LYS F 1 92  ? -17.859 -4.004  35.895  1.00 58.18  ? 88  LYS F N   1 
ATOM   6422  C CA  . LYS F 1 92  ? -16.992 -4.052  37.072  1.00 94.53  ? 88  LYS F CA  1 
ATOM   6423  C C   . LYS F 1 92  ? -17.482 -5.036  38.134  1.00 111.01 ? 88  LYS F C   1 
ATOM   6424  O O   . LYS F 1 92  ? -16.679 -5.648  38.840  1.00 121.02 ? 88  LYS F O   1 
ATOM   6425  C CB  . LYS F 1 92  ? -16.857 -2.658  37.689  1.00 108.90 ? 88  LYS F CB  1 
ATOM   6426  C CG  . LYS F 1 92  ? -16.034 -1.690  36.855  1.00 116.83 ? 88  LYS F CG  1 
ATOM   6427  C CD  . LYS F 1 92  ? -15.779 -0.392  37.603  1.00 121.25 ? 88  LYS F CD  1 
ATOM   6428  C CE  . LYS F 1 92  ? -14.815 0.504   36.843  1.00 121.38 ? 88  LYS F CE  1 
ATOM   6429  N NZ  . LYS F 1 92  ? -14.410 1.690   37.645  1.00 123.35 ? 88  LYS F NZ  1 
ATOM   6430  N N   . SER F 1 93  ? -18.797 -5.185  38.247  1.00 105.82 ? 89  SER F N   1 
ATOM   6431  C CA  . SER F 1 93  ? -19.381 -6.058  39.259  1.00 91.76  ? 89  SER F CA  1 
ATOM   6432  C C   . SER F 1 93  ? -19.082 -7.531  38.977  1.00 84.17  ? 89  SER F C   1 
ATOM   6433  O O   . SER F 1 93  ? -19.136 -8.365  39.881  1.00 84.69  ? 89  SER F O   1 
ATOM   6434  C CB  . SER F 1 93  ? -20.892 -5.836  39.342  1.00 85.43  ? 89  SER F CB  1 
ATOM   6435  O OG  . SER F 1 93  ? -21.187 -4.502  39.719  1.00 78.52  ? 89  SER F OG  1 
ATOM   6436  N N   . CYS F 1 94  ? -18.768 -7.843  37.724  1.00 68.07  ? 90  CYS F N   1 
ATOM   6437  C CA  . CYS F 1 94  ? -18.459 -9.213  37.326  1.00 49.06  ? 90  CYS F CA  1 
ATOM   6438  C C   . CYS F 1 94  ? -16.999 -9.565  37.606  1.00 44.99  ? 90  CYS F C   1 
ATOM   6439  O O   . CYS F 1 94  ? -16.601 -10.725 37.488  1.00 45.94  ? 90  CYS F O   1 
ATOM   6440  C CB  . CYS F 1 94  ? -18.750 -9.411  35.838  1.00 30.30  ? 90  CYS F CB  1 
ATOM   6441  S SG  . CYS F 1 94  ? -20.444 -9.018  35.343  1.00 58.29  ? 90  CYS F SG  1 
ATOM   6442  N N   . PHE F 1 95  ? -16.205 -8.562  37.965  1.00 37.43  ? 91  PHE F N   1 
ATOM   6443  C CA  . PHE F 1 95  ? -14.788 -8.766  38.235  1.00 44.00  ? 91  PHE F CA  1 
ATOM   6444  C C   . PHE F 1 95  ? -14.470 -8.519  39.703  1.00 56.14  ? 91  PHE F C   1 
ATOM   6445  O O   . PHE F 1 95  ? -14.842 -7.489  40.266  1.00 70.53  ? 91  PHE F O   1 
ATOM   6446  C CB  . PHE F 1 95  ? -13.945 -7.835  37.364  1.00 58.63  ? 91  PHE F CB  1 
ATOM   6447  C CG  . PHE F 1 95  ? -14.037 -8.131  35.896  1.00 62.78  ? 91  PHE F CG  1 
ATOM   6448  C CD1 . PHE F 1 95  ? -15.179 -7.812  35.183  1.00 57.18  ? 91  PHE F CD1 1 
ATOM   6449  C CD2 . PHE F 1 95  ? -12.979 -8.721  35.228  1.00 69.53  ? 91  PHE F CD2 1 
ATOM   6450  C CE1 . PHE F 1 95  ? -15.269 -8.081  33.833  1.00 57.98  ? 91  PHE F CE1 1 
ATOM   6451  C CE2 . PHE F 1 95  ? -13.060 -8.992  33.876  1.00 68.45  ? 91  PHE F CE2 1 
ATOM   6452  C CZ  . PHE F 1 95  ? -14.207 -8.671  33.177  1.00 60.24  ? 91  PHE F CZ  1 
ATOM   6453  N N   . THR F 1 96  ? -13.772 -9.468  40.317  1.00 58.95  ? 92  THR F N   1 
ATOM   6454  C CA  . THR F 1 96  ? -13.412 -9.363  41.726  1.00 67.58  ? 92  THR F CA  1 
ATOM   6455  C C   . THR F 1 96  ? -12.086 -8.620  41.894  1.00 75.03  ? 92  THR F C   1 
ATOM   6456  O O   . THR F 1 96  ? -11.125 -8.869  41.165  1.00 68.58  ? 92  THR F O   1 
ATOM   6457  C CB  . THR F 1 96  ? -13.323 -10.753 42.388  1.00 65.33  ? 92  THR F CB  1 
ATOM   6458  O OG1 . THR F 1 96  ? -12.334 -11.548 41.721  1.00 57.42  ? 92  THR F OG1 1 
ATOM   6459  C CG2 . THR F 1 96  ? -14.672 -11.460 42.326  1.00 61.17  ? 92  THR F CG2 1 
ATOM   6460  N N   . LYS F 1 97  ? -12.046 -7.711  42.863  1.00 83.46  ? 93  LYS F N   1 
ATOM   6461  C CA  . LYS F 1 97  ? -10.889 -6.844  43.068  1.00 88.40  ? 93  LYS F CA  1 
ATOM   6462  C C   . LYS F 1 97  ? -9.628  -7.622  43.434  1.00 97.24  ? 93  LYS F C   1 
ATOM   6463  O O   . LYS F 1 97  ? -9.699  -8.732  43.961  1.00 100.06 ? 93  LYS F O   1 
ATOM   6464  C CB  . LYS F 1 97  ? -11.196 -5.819  44.159  1.00 82.91  ? 93  LYS F CB  1 
ATOM   6465  C CG  . LYS F 1 97  ? -12.295 -4.842  43.786  1.00 84.67  ? 93  LYS F CG  1 
ATOM   6466  C CD  . LYS F 1 97  ? -12.709 -4.000  44.977  1.00 83.25  ? 93  LYS F CD  1 
ATOM   6467  C CE  . LYS F 1 97  ? -12.917 -2.547  44.589  1.00 77.27  ? 93  LYS F CE  1 
ATOM   6468  N NZ  . LYS F 1 97  ? -13.997 -2.371  43.577  1.00 72.90  ? 93  LYS F NZ  1 
ATOM   6469  N N   . ASP F 1 98  ? -8.474  -7.025  43.144  1.00 98.49  ? 94  ASP F N   1 
ATOM   6470  C CA  . ASP F 1 98  ? -7.183  -7.612  43.485  1.00 96.86  ? 94  ASP F CA  1 
ATOM   6471  C C   . ASP F 1 98  ? -6.313  -6.591  44.213  1.00 88.28  ? 94  ASP F C   1 
ATOM   6472  O O   . ASP F 1 98  ? -5.270  -6.931  44.774  1.00 81.46  ? 94  ASP F O   1 
ATOM   6473  C CB  . ASP F 1 98  ? -6.464  -8.099  42.224  1.00 99.75  ? 94  ASP F CB  1 
ATOM   6474  C CG  . ASP F 1 98  ? -7.124  -9.320  41.608  1.00 108.00 ? 94  ASP F CG  1 
ATOM   6475  O OD1 . ASP F 1 98  ? -7.678  -10.146 42.362  1.00 110.19 ? 94  ASP F OD1 1 
ATOM   6476  O OD2 . ASP F 1 98  ? -7.085  -9.454  40.367  1.00 111.40 ? 94  ASP F OD2 1 
ATOM   6477  N N   . LYS F 1 104 ? 0.782   -1.691  38.404  1.00 51.26  ? 100 LYS F N   1 
ATOM   6478  C CA  . LYS F 1 104 ? 1.837   -1.688  37.397  1.00 58.53  ? 100 LYS F CA  1 
ATOM   6479  C C   . LYS F 1 104 ? 2.504   -3.056  37.267  1.00 72.23  ? 100 LYS F C   1 
ATOM   6480  O O   . LYS F 1 104 ? 3.626   -3.162  36.773  1.00 79.59  ? 100 LYS F O   1 
ATOM   6481  C CB  . LYS F 1 104 ? 2.888   -0.630  37.734  1.00 71.11  ? 100 LYS F CB  1 
ATOM   6482  C CG  . LYS F 1 104 ? 2.534   0.764   37.255  1.00 93.65  ? 100 LYS F CG  1 
ATOM   6483  C CD  . LYS F 1 104 ? 2.828   0.917   35.773  1.00 93.47  ? 100 LYS F CD  1 
ATOM   6484  C CE  . LYS F 1 104 ? 2.233   2.195   35.213  1.00 84.44  ? 100 LYS F CE  1 
ATOM   6485  N NZ  . LYS F 1 104 ? 0.749   2.119   35.097  1.00 81.44  ? 100 LYS F NZ  1 
ATOM   6486  N N   . ALA F 1 105 ? 1.811   -4.101  37.709  1.00 72.28  ? 101 ALA F N   1 
ATOM   6487  C CA  . ALA F 1 105 ? 2.337   -5.460  37.621  1.00 65.78  ? 101 ALA F CA  1 
ATOM   6488  C C   . ALA F 1 105 ? 1.972   -6.110  36.295  1.00 71.02  ? 101 ALA F C   1 
ATOM   6489  O O   . ALA F 1 105 ? 0.822   -6.050  35.863  1.00 81.82  ? 101 ALA F O   1 
ATOM   6490  C CB  . ALA F 1 105 ? 1.804   -6.293  38.758  1.00 52.87  ? 101 ALA F CB  1 
ATOM   6491  N N   . CYS F 1 106 ? 2.950   -6.747  35.661  1.00 62.68  ? 102 CYS F N   1 
ATOM   6492  C CA  . CYS F 1 106 ? 2.704   -7.469  34.420  1.00 53.26  ? 102 CYS F CA  1 
ATOM   6493  C C   . CYS F 1 106 ? 2.320   -6.534  33.274  1.00 53.87  ? 102 CYS F C   1 
ATOM   6494  O O   . CYS F 1 106 ? 1.564   -6.923  32.386  1.00 55.05  ? 102 CYS F O   1 
ATOM   6495  C CB  . CYS F 1 106 ? 1.587   -8.490  34.635  1.00 38.37  ? 102 CYS F CB  1 
ATOM   6496  S SG  . CYS F 1 106 ? 1.777   -9.480  36.135  1.00 74.83  ? 102 CYS F SG  1 
ATOM   6497  N N   . VAL F 1 107 ? 2.836   -5.307  33.293  1.00 62.49  ? 103 VAL F N   1 
ATOM   6498  C CA  . VAL F 1 107 ? 2.548   -4.343  32.233  1.00 58.23  ? 103 VAL F CA  1 
ATOM   6499  C C   . VAL F 1 107 ? 3.828   -3.777  31.628  1.00 73.50  ? 103 VAL F C   1 
ATOM   6500  O O   . VAL F 1 107 ? 4.845   -3.645  32.309  1.00 80.43  ? 103 VAL F O   1 
ATOM   6501  C CB  . VAL F 1 107 ? 1.693   -3.167  32.747  1.00 40.84  ? 103 VAL F CB  1 
ATOM   6502  C CG1 . VAL F 1 107 ? 0.497   -3.684  33.523  1.00 51.74  ? 103 VAL F CG1 1 
ATOM   6503  C CG2 . VAL F 1 107 ? 2.522   -2.235  33.616  1.00 24.78  ? 103 VAL F CG2 1 
ATOM   6504  N N   . ARG F 1 108 ? 3.766   -3.438  30.344  1.00 65.07  ? 104 ARG F N   1 
ATOM   6505  C CA  . ARG F 1 108 ? 4.885   -2.810  29.657  1.00 59.86  ? 104 ARG F CA  1 
ATOM   6506  C C   . ARG F 1 108 ? 4.372   -1.657  28.805  1.00 54.57  ? 104 ARG F C   1 
ATOM   6507  O O   . ARG F 1 108 ? 3.165   -1.427  28.718  1.00 40.38  ? 104 ARG F O   1 
ATOM   6508  C CB  . ARG F 1 108 ? 5.616   -3.825  28.773  1.00 71.54  ? 104 ARG F CB  1 
ATOM   6509  C CG  . ARG F 1 108 ? 4.695   -4.588  27.841  1.00 87.79  ? 104 ARG F CG  1 
ATOM   6510  C CD  . ARG F 1 108 ? 5.439   -5.228  26.680  1.00 95.74  ? 104 ARG F CD  1 
ATOM   6511  N NE  . ARG F 1 108 ? 5.808   -4.250  25.658  1.00 103.14 ? 104 ARG F NE  1 
ATOM   6512  C CZ  . ARG F 1 108 ? 6.102   -4.553  24.396  1.00 116.47 ? 104 ARG F CZ  1 
ATOM   6513  N NH1 . ARG F 1 108 ? 6.070   -5.813  23.979  1.00 122.61 ? 104 ARG F NH1 1 
ATOM   6514  N NH2 . ARG F 1 108 ? 6.423   -3.592  23.541  1.00 119.69 ? 104 ARG F NH2 1 
ATOM   6515  N N   . THR F 1 109 ? 5.294   -0.932  28.183  1.00 55.99  ? 105 THR F N   1 
ATOM   6516  C CA  . THR F 1 109 ? 4.932   0.156   27.288  1.00 45.54  ? 105 THR F CA  1 
ATOM   6517  C C   . THR F 1 109 ? 5.060   -0.301  25.838  1.00 49.12  ? 105 THR F C   1 
ATOM   6518  O O   . THR F 1 109 ? 6.046   -0.938  25.465  1.00 58.50  ? 105 THR F O   1 
ATOM   6519  C CB  . THR F 1 109 ? 5.822   1.386   27.523  1.00 39.35  ? 105 THR F CB  1 
ATOM   6520  O OG1 . THR F 1 109 ? 5.631   1.864   28.861  1.00 44.33  ? 105 THR F OG1 1 
ATOM   6521  C CG2 . THR F 1 109 ? 5.481   2.494   26.539  1.00 28.35  ? 105 THR F CG2 1 
ATOM   6522  N N   . PHE F 1 110 ? 4.057   0.022   25.027  1.00 44.52  ? 106 PHE F N   1 
ATOM   6523  C CA  . PHE F 1 110 ? 4.039   -0.384  23.626  1.00 41.16  ? 106 PHE F CA  1 
ATOM   6524  C C   . PHE F 1 110 ? 4.184   0.815   22.701  1.00 44.77  ? 106 PHE F C   1 
ATOM   6525  O O   . PHE F 1 110 ? 3.760   1.922   23.031  1.00 55.10  ? 106 PHE F O   1 
ATOM   6526  C CB  . PHE F 1 110 ? 2.736   -1.115  23.305  1.00 40.36  ? 106 PHE F CB  1 
ATOM   6527  C CG  . PHE F 1 110 ? 2.625   -2.467  23.944  1.00 43.66  ? 106 PHE F CG  1 
ATOM   6528  C CD1 . PHE F 1 110 ? 2.167   -2.599  25.243  1.00 47.20  ? 106 PHE F CD1 1 
ATOM   6529  C CD2 . PHE F 1 110 ? 2.980   -3.609  23.244  1.00 42.85  ? 106 PHE F CD2 1 
ATOM   6530  C CE1 . PHE F 1 110 ? 2.066   -3.845  25.833  1.00 42.17  ? 106 PHE F CE1 1 
ATOM   6531  C CE2 . PHE F 1 110 ? 2.879   -4.857  23.830  1.00 36.06  ? 106 PHE F CE2 1 
ATOM   6532  C CZ  . PHE F 1 110 ? 2.422   -4.975  25.125  1.00 38.19  ? 106 PHE F CZ  1 
ATOM   6533  N N   . TYR F 1 111 ? 4.790   0.585   21.541  1.00 50.90  ? 107 TYR F N   1 
ATOM   6534  C CA  . TYR F 1 111 ? 4.900   1.611   20.513  1.00 49.56  ? 107 TYR F CA  1 
ATOM   6535  C C   . TYR F 1 111 ? 4.474   1.019   19.175  1.00 34.21  ? 107 TYR F C   1 
ATOM   6536  O O   . TYR F 1 111 ? 5.307   0.648   18.349  1.00 51.08  ? 107 TYR F O   1 
ATOM   6537  C CB  . TYR F 1 111 ? 6.330   2.149   20.437  1.00 59.83  ? 107 TYR F CB  1 
ATOM   6538  C CG  . TYR F 1 111 ? 6.505   3.280   19.449  1.00 64.04  ? 107 TYR F CG  1 
ATOM   6539  C CD1 . TYR F 1 111 ? 5.811   4.475   19.600  1.00 62.36  ? 107 TYR F CD1 1 
ATOM   6540  C CD2 . TYR F 1 111 ? 7.360   3.152   18.362  1.00 58.04  ? 107 TYR F CD2 1 
ATOM   6541  C CE1 . TYR F 1 111 ? 5.967   5.511   18.697  1.00 54.41  ? 107 TYR F CE1 1 
ATOM   6542  C CE2 . TYR F 1 111 ? 7.524   4.183   17.456  1.00 56.03  ? 107 TYR F CE2 1 
ATOM   6543  C CZ  . TYR F 1 111 ? 6.825   5.359   17.628  1.00 57.64  ? 107 TYR F CZ  1 
ATOM   6544  O OH  . TYR F 1 111 ? 6.984   6.387   16.727  1.00 65.95  ? 107 TYR F OH  1 
ATOM   6545  N N   . GLU F 1 112 ? 3.164   0.928   18.976  1.00 35.08  ? 108 GLU F N   1 
ATOM   6546  C CA  . GLU F 1 112 ? 2.608   0.283   17.795  1.00 42.25  ? 108 GLU F CA  1 
ATOM   6547  C C   . GLU F 1 112 ? 1.682   1.230   17.046  1.00 44.38  ? 108 GLU F C   1 
ATOM   6548  O O   . GLU F 1 112 ? 1.410   2.339   17.504  1.00 44.17  ? 108 GLU F O   1 
ATOM   6549  C CB  . GLU F 1 112 ? 1.836   -0.971  18.205  1.00 36.48  ? 108 GLU F CB  1 
ATOM   6550  C CG  . GLU F 1 112 ? 2.664   -1.969  19.002  1.00 28.28  ? 108 GLU F CG  1 
ATOM   6551  C CD  . GLU F 1 112 ? 1.829   -3.105  19.558  1.00 39.58  ? 108 GLU F CD  1 
ATOM   6552  O OE1 . GLU F 1 112 ? 2.412   -4.051  20.130  1.00 42.99  ? 108 GLU F OE1 1 
ATOM   6553  O OE2 . GLU F 1 112 ? 0.588   -3.050  19.426  1.00 56.28  ? 108 GLU F OE2 1 
ATOM   6554  N N   . THR F 1 113 ? 1.202   0.789   15.888  1.00 45.42  ? 109 THR F N   1 
ATOM   6555  C CA  . THR F 1 113 ? 0.252   1.580   15.119  1.00 51.08  ? 109 THR F CA  1 
ATOM   6556  C C   . THR F 1 113 ? -1.081  1.623   15.855  1.00 32.32  ? 109 THR F C   1 
ATOM   6557  O O   . THR F 1 113 ? -1.392  0.723   16.635  1.00 41.96  ? 109 THR F O   1 
ATOM   6558  C CB  . THR F 1 113 ? 0.037   1.001   13.704  1.00 53.42  ? 109 THR F CB  1 
ATOM   6559  O OG1 . THR F 1 113 ? -0.475  -0.333  13.797  1.00 49.85  ? 109 THR F OG1 1 
ATOM   6560  C CG2 . THR F 1 113 ? 1.344   0.985   12.926  1.00 55.31  ? 109 THR F CG2 1 
ATOM   6561  N N   . PRO F 1 114 ? -1.871  2.680   15.621  1.00 30.67  ? 110 PRO F N   1 
ATOM   6562  C CA  . PRO F 1 114 ? -3.202  2.767   16.229  1.00 35.75  ? 110 PRO F CA  1 
ATOM   6563  C C   . PRO F 1 114 ? -4.033  1.515   15.962  1.00 45.92  ? 110 PRO F C   1 
ATOM   6564  O O   . PRO F 1 114 ? -4.780  1.071   16.832  1.00 49.58  ? 110 PRO F O   1 
ATOM   6565  C CB  . PRO F 1 114 ? -3.823  3.977   15.529  1.00 23.81  ? 110 PRO F CB  1 
ATOM   6566  C CG  . PRO F 1 114 ? -2.660  4.824   15.142  1.00 29.63  ? 110 PRO F CG  1 
ATOM   6567  C CD  . PRO F 1 114 ? -1.552  3.868   14.810  1.00 31.60  ? 110 PRO F CD  1 
ATOM   6568  N N   . LEU F 1 115 ? -3.893  0.953   14.766  1.00 44.45  ? 111 LEU F N   1 
ATOM   6569  C CA  . LEU F 1 115 ? -4.667  -0.217  14.371  1.00 40.30  ? 111 LEU F CA  1 
ATOM   6570  C C   . LEU F 1 115 ? -4.328  -1.421  15.241  1.00 49.40  ? 111 LEU F C   1 
ATOM   6571  O O   . LEU F 1 115 ? -5.214  -2.180  15.634  1.00 62.04  ? 111 LEU F O   1 
ATOM   6572  C CB  . LEU F 1 115 ? -4.416  -0.543  12.899  1.00 41.31  ? 111 LEU F CB  1 
ATOM   6573  C CG  . LEU F 1 115 ? -4.907  0.525   11.921  1.00 53.24  ? 111 LEU F CG  1 
ATOM   6574  C CD1 . LEU F 1 115 ? -4.098  0.491   10.633  1.00 59.75  ? 111 LEU F CD1 1 
ATOM   6575  C CD2 . LEU F 1 115 ? -6.387  0.334   11.631  1.00 45.67  ? 111 LEU F CD2 1 
ATOM   6576  N N   . GLN F 1 116 ? -3.043  -1.596  15.535  1.00 48.45  ? 112 GLN F N   1 
ATOM   6577  C CA  . GLN F 1 116 ? -2.609  -2.679  16.409  1.00 43.63  ? 112 GLN F CA  1 
ATOM   6578  C C   . GLN F 1 116 ? -3.228  -2.507  17.790  1.00 36.58  ? 112 GLN F C   1 
ATOM   6579  O O   . GLN F 1 116 ? -3.666  -3.476  18.408  1.00 32.87  ? 112 GLN F O   1 
ATOM   6580  C CB  . GLN F 1 116 ? -1.083  -2.720  16.515  1.00 38.76  ? 112 GLN F CB  1 
ATOM   6581  C CG  . GLN F 1 116 ? -0.385  -3.239  15.263  1.00 40.62  ? 112 GLN F CG  1 
ATOM   6582  C CD  . GLN F 1 116 ? 1.133   -3.269  15.393  1.00 58.84  ? 112 GLN F CD  1 
ATOM   6583  O OE1 . GLN F 1 116 ? 1.852   -2.819  14.500  1.00 60.80  ? 112 GLN F OE1 1 
ATOM   6584  N NE2 . GLN F 1 116 ? 1.625   -3.813  16.501  1.00 65.03  ? 112 GLN F NE2 1 
ATOM   6585  N N   . LEU F 1 117 ? -3.265  -1.267  18.268  1.00 47.50  ? 113 LEU F N   1 
ATOM   6586  C CA  . LEU F 1 117 ? -3.883  -0.963  19.554  1.00 48.91  ? 113 LEU F CA  1 
ATOM   6587  C C   . LEU F 1 117 ? -5.360  -1.344  19.548  1.00 39.34  ? 113 LEU F C   1 
ATOM   6588  O O   . LEU F 1 117 ? -5.854  -1.960  20.490  1.00 44.04  ? 113 LEU F O   1 
ATOM   6589  C CB  . LEU F 1 117 ? -3.731  0.524   19.884  1.00 38.42  ? 113 LEU F CB  1 
ATOM   6590  C CG  . LEU F 1 117 ? -4.556  1.023   21.075  1.00 32.44  ? 113 LEU F CG  1 
ATOM   6591  C CD1 . LEU F 1 117 ? -4.171  0.286   22.347  1.00 36.00  ? 113 LEU F CD1 1 
ATOM   6592  C CD2 . LEU F 1 117 ? -4.393  2.523   21.255  1.00 24.64  ? 113 LEU F CD2 1 
ATOM   6593  N N   . LEU F 1 118 ? -6.054  -0.976  18.476  1.00 22.11  ? 114 LEU F N   1 
ATOM   6594  C CA  . LEU F 1 118 ? -7.488  -1.211  18.361  1.00 36.31  ? 114 LEU F CA  1 
ATOM   6595  C C   . LEU F 1 118 ? -7.829  -2.698  18.289  1.00 52.17  ? 114 LEU F C   1 
ATOM   6596  O O   . LEU F 1 118 ? -8.824  -3.141  18.863  1.00 58.09  ? 114 LEU F O   1 
ATOM   6597  C CB  . LEU F 1 118 ? -8.041  -0.484  17.134  1.00 36.36  ? 114 LEU F CB  1 
ATOM   6598  C CG  . LEU F 1 118 ? -8.005  1.043   17.232  1.00 26.82  ? 114 LEU F CG  1 
ATOM   6599  C CD1 . LEU F 1 118 ? -8.348  1.681   15.899  1.00 16.85  ? 114 LEU F CD1 1 
ATOM   6600  C CD2 . LEU F 1 118 ? -8.960  1.520   18.313  1.00 41.53  ? 114 LEU F CD2 1 
ATOM   6601  N N   . GLU F 1 119 ? -7.010  -3.468  17.579  1.00 42.86  ? 115 GLU F N   1 
ATOM   6602  C CA  A GLU F 1 119 ? -7.216  -4.909  17.497  0.74 38.50  ? 115 GLU F CA  1 
ATOM   6603  C CA  B GLU F 1 119 ? -7.203  -4.911  17.494  0.26 38.78  ? 115 GLU F CA  1 
ATOM   6604  C C   . GLU F 1 119 ? -6.968  -5.554  18.856  1.00 44.85  ? 115 GLU F C   1 
ATOM   6605  O O   . GLU F 1 119 ? -7.568  -6.577  19.184  1.00 54.81  ? 115 GLU F O   1 
ATOM   6606  C CB  A GLU F 1 119 ? -6.304  -5.526  16.436  0.74 33.83  ? 115 GLU F CB  1 
ATOM   6607  C CB  B GLU F 1 119 ? -6.257  -5.517  16.456  0.26 35.02  ? 115 GLU F CB  1 
ATOM   6608  C CG  A GLU F 1 119 ? -6.914  -5.561  15.041  0.74 34.57  ? 115 GLU F CG  1 
ATOM   6609  C CG  B GLU F 1 119 ? -6.590  -5.144  15.018  0.26 33.01  ? 115 GLU F CG  1 
ATOM   6610  C CD  A GLU F 1 119 ? -7.963  -6.648  14.888  0.74 41.15  ? 115 GLU F CD  1 
ATOM   6611  C CD  B GLU F 1 119 ? -5.583  -5.693  14.023  0.26 23.82  ? 115 GLU F CD  1 
ATOM   6612  O OE1 A GLU F 1 119 ? -8.200  -7.389  15.865  0.74 48.09  ? 115 GLU F OE1 1 
ATOM   6613  O OE1 B GLU F 1 119 ? -4.566  -6.272  14.461  0.26 22.37  ? 115 GLU F OE1 1 
ATOM   6614  O OE2 A GLU F 1 119 ? -8.548  -6.765  13.790  0.74 41.78  ? 115 GLU F OE2 1 
ATOM   6615  O OE2 B GLU F 1 119 ? -5.809  -5.545  12.802  0.26 0.83   ? 115 GLU F OE2 1 
ATOM   6616  N N   . LYS F 1 120 ? -6.085  -4.948  19.646  1.00 54.74  ? 116 LYS F N   1 
ATOM   6617  C CA  . LYS F 1 120 ? -5.802  -5.428  20.995  1.00 52.56  ? 116 LYS F CA  1 
ATOM   6618  C C   . LYS F 1 120 ? -6.999  -5.184  21.905  1.00 47.68  ? 116 LYS F C   1 
ATOM   6619  O O   . LYS F 1 120 ? -7.404  -6.066  22.663  1.00 51.65  ? 116 LYS F O   1 
ATOM   6620  C CB  . LYS F 1 120 ? -4.572  -4.722  21.573  1.00 53.42  ? 116 LYS F CB  1 
ATOM   6621  C CG  . LYS F 1 120 ? -3.250  -5.407  21.279  1.00 52.85  ? 116 LYS F CG  1 
ATOM   6622  C CD  . LYS F 1 120 ? -2.093  -4.617  21.872  1.00 54.76  ? 116 LYS F CD  1 
ATOM   6623  C CE  . LYS F 1 120 ? -0.868  -5.487  22.092  1.00 51.39  ? 116 LYS F CE  1 
ATOM   6624  N NZ  . LYS F 1 120 ? -0.316  -6.025  20.822  1.00 58.87  ? 116 LYS F NZ  1 
ATOM   6625  N N   . VAL F 1 121 ? -7.558  -3.980  21.830  1.00 39.24  ? 117 VAL F N   1 
ATOM   6626  C CA  . VAL F 1 121 ? -8.716  -3.622  22.638  1.00 42.14  ? 117 VAL F CA  1 
ATOM   6627  C C   . VAL F 1 121 ? -9.907  -4.495  22.266  1.00 48.01  ? 117 VAL F C   1 
ATOM   6628  O O   . VAL F 1 121 ? -10.617 -4.994  23.140  1.00 41.82  ? 117 VAL F O   1 
ATOM   6629  C CB  . VAL F 1 121 ? -9.103  -2.140  22.450  1.00 37.02  ? 117 VAL F CB  1 
ATOM   6630  C CG1 . VAL F 1 121 ? -10.416 -1.836  23.161  1.00 44.55  ? 117 VAL F CG1 1 
ATOM   6631  C CG2 . VAL F 1 121 ? -7.993  -1.223  22.961  1.00 16.18  ? 117 VAL F CG2 1 
ATOM   6632  N N   . LYS F 1 122 ? -10.117 -4.682  20.967  1.00 44.05  ? 118 LYS F N   1 
ATOM   6633  C CA  . LYS F 1 122 ? -11.246 -5.465  20.477  1.00 28.30  ? 118 LYS F CA  1 
ATOM   6634  C C   . LYS F 1 122 ? -11.179 -6.904  20.974  1.00 38.83  ? 118 LYS F C   1 
ATOM   6635  O O   . LYS F 1 122 ? -12.149 -7.424  21.527  1.00 53.67  ? 118 LYS F O   1 
ATOM   6636  C CB  . LYS F 1 122 ? -11.288 -5.452  18.947  1.00 31.88  ? 118 LYS F CB  1 
ATOM   6637  C CG  . LYS F 1 122 ? -12.502 -6.166  18.368  1.00 46.64  ? 118 LYS F CG  1 
ATOM   6638  C CD  . LYS F 1 122 ? -12.472 -6.230  16.850  1.00 43.77  ? 118 LYS F CD  1 
ATOM   6639  C CE  . LYS F 1 122 ? -11.359 -7.137  16.354  1.00 51.75  ? 118 LYS F CE  1 
ATOM   6640  N NZ  . LYS F 1 122 ? -11.440 -7.372  14.886  1.00 61.22  ? 118 LYS F NZ  1 
ATOM   6641  N N   . ASN F 1 123 ? -10.031 -7.544  20.776  1.00 34.96  ? 119 ASN F N   1 
ATOM   6642  C CA  . ASN F 1 123 ? -9.860  -8.941  21.164  1.00 46.97  ? 119 ASN F CA  1 
ATOM   6643  C C   . ASN F 1 123 ? -10.187 -9.186  22.636  1.00 54.33  ? 119 ASN F C   1 
ATOM   6644  O O   . ASN F 1 123 ? -10.699 -10.244 22.993  1.00 75.53  ? 119 ASN F O   1 
ATOM   6645  C CB  . ASN F 1 123 ? -8.438  -9.414  20.846  1.00 49.64  ? 119 ASN F CB  1 
ATOM   6646  C CG  . ASN F 1 123 ? -8.185  -9.536  19.350  1.00 63.70  ? 119 ASN F CG  1 
ATOM   6647  O OD1 . ASN F 1 123 ? -9.096  -9.837  18.577  1.00 58.50  ? 119 ASN F OD1 1 
ATOM   6648  N ND2 . ASN F 1 123 ? -6.944  -9.301  18.937  1.00 66.35  ? 119 ASN F ND2 1 
ATOM   6649  N N   . VAL F 1 124 ? -9.899  -8.206  23.485  1.00 44.65  ? 120 VAL F N   1 
ATOM   6650  C CA  . VAL F 1 124 ? -10.208 -8.320  24.906  1.00 38.11  ? 120 VAL F CA  1 
ATOM   6651  C C   . VAL F 1 124 ? -11.717 -8.322  25.133  1.00 50.74  ? 120 VAL F C   1 
ATOM   6652  O O   . VAL F 1 124 ? -12.217 -9.017  26.017  1.00 55.28  ? 120 VAL F O   1 
ATOM   6653  C CB  . VAL F 1 124 ? -9.579  -7.171  25.718  1.00 45.75  ? 120 VAL F CB  1 
ATOM   6654  C CG1 . VAL F 1 124 ? -10.142 -7.142  27.133  1.00 42.90  ? 120 VAL F CG1 1 
ATOM   6655  C CG2 . VAL F 1 124 ? -8.064  -7.308  25.749  1.00 50.73  ? 120 VAL F CG2 1 
ATOM   6656  N N   . PHE F 1 125 ? -12.439 -7.540  24.337  1.00 55.27  ? 121 PHE F N   1 
ATOM   6657  C CA  . PHE F 1 125 ? -13.894 -7.491  24.438  1.00 53.82  ? 121 PHE F CA  1 
ATOM   6658  C C   . PHE F 1 125 ? -14.521 -8.762  23.877  1.00 58.38  ? 121 PHE F C   1 
ATOM   6659  O O   . PHE F 1 125 ? -15.448 -9.316  24.469  1.00 50.33  ? 121 PHE F O   1 
ATOM   6660  C CB  . PHE F 1 125 ? -14.452 -6.258  23.721  1.00 54.20  ? 121 PHE F CB  1 
ATOM   6661  C CG  . PHE F 1 125 ? -14.356 -4.995  24.530  1.00 59.64  ? 121 PHE F CG  1 
ATOM   6662  C CD1 . PHE F 1 125 ? -15.212 -4.778  25.597  1.00 42.22  ? 121 PHE F CD1 1 
ATOM   6663  C CD2 . PHE F 1 125 ? -13.413 -4.028  24.227  1.00 56.97  ? 121 PHE F CD2 1 
ATOM   6664  C CE1 . PHE F 1 125 ? -15.127 -3.622  26.348  1.00 27.09  ? 121 PHE F CE1 1 
ATOM   6665  C CE2 . PHE F 1 125 ? -13.324 -2.869  24.973  1.00 45.56  ? 121 PHE F CE2 1 
ATOM   6666  C CZ  . PHE F 1 125 ? -14.183 -2.667  26.035  1.00 45.17  ? 121 PHE F CZ  1 
ATOM   6667  N N   . ASN F 1 126 ? -14.012 -9.225  22.739  1.00 56.16  ? 122 ASN F N   1 
ATOM   6668  C CA  . ASN F 1 126 ? -14.492 -10.465 22.141  1.00 52.65  ? 122 ASN F CA  1 
ATOM   6669  C C   . ASN F 1 126 ? -14.288 -11.651 23.073  1.00 52.02  ? 122 ASN F C   1 
ATOM   6670  O O   . ASN F 1 126 ? -15.202 -12.446 23.288  1.00 64.59  ? 122 ASN F O   1 
ATOM   6671  C CB  . ASN F 1 126 ? -13.786 -10.739 20.811  1.00 74.06  ? 122 ASN F CB  1 
ATOM   6672  C CG  . ASN F 1 126 ? -14.653 -10.413 19.611  1.00 87.54  ? 122 ASN F CG  1 
ATOM   6673  O OD1 . ASN F 1 126 ? -15.539 -11.184 19.242  1.00 88.17  ? 122 ASN F OD1 1 
ATOM   6674  N ND2 . ASN F 1 126 ? -14.395 -9.271  18.989  1.00 88.66  ? 122 ASN F ND2 1 
ATOM   6675  N N   . GLU F 1 127 ? -13.084 -11.763 23.623  1.00 62.60  ? 123 GLU F N   1 
ATOM   6676  C CA  . GLU F 1 127 ? -12.731 -12.887 24.484  1.00 65.70  ? 123 GLU F CA  1 
ATOM   6677  C C   . GLU F 1 127 ? -13.447 -12.821 25.829  1.00 51.10  ? 123 GLU F C   1 
ATOM   6678  O O   . GLU F 1 127 ? -13.784 -13.851 26.409  1.00 61.93  ? 123 GLU F O   1 
ATOM   6679  C CB  . GLU F 1 127 ? -11.217 -12.938 24.694  1.00 64.11  ? 123 GLU F CB  1 
ATOM   6680  C CG  . GLU F 1 127 ? -10.437 -13.236 23.424  1.00 77.07  ? 123 GLU F CG  1 
ATOM   6681  C CD  . GLU F 1 127 ? -8.939  -13.132 23.623  1.00 91.90  ? 123 GLU F CD  1 
ATOM   6682  O OE1 . GLU F 1 127 ? -8.473  -13.373 24.757  1.00 94.65  ? 123 GLU F OE1 1 
ATOM   6683  O OE2 . GLU F 1 127 ? -8.229  -12.807 22.647  1.00 91.59  ? 123 GLU F OE2 1 
ATOM   6684  N N   . THR F 1 128 ? -13.676 -11.610 26.324  1.00 52.23  ? 124 THR F N   1 
ATOM   6685  C CA  . THR F 1 128 ? -14.399 -11.426 27.577  1.00 50.42  ? 124 THR F CA  1 
ATOM   6686  C C   . THR F 1 128 ? -15.860 -11.840 27.424  1.00 52.90  ? 124 THR F C   1 
ATOM   6687  O O   . THR F 1 128 ? -16.456 -12.398 28.345  1.00 52.57  ? 124 THR F O   1 
ATOM   6688  C CB  . THR F 1 128 ? -14.335 -9.962  28.050  1.00 35.24  ? 124 THR F CB  1 
ATOM   6689  O OG1 . THR F 1 128 ? -13.000 -9.651  28.467  1.00 37.34  ? 124 THR F OG1 1 
ATOM   6690  C CG2 . THR F 1 128 ? -15.287 -9.727  29.212  1.00 33.97  ? 124 THR F CG2 1 
ATOM   6691  N N   . LYS F 1 129 ? -16.433 -11.562 26.257  1.00 41.37  ? 125 LYS F N   1 
ATOM   6692  C CA  . LYS F 1 129 ? -17.815 -11.931 25.975  1.00 46.46  ? 125 LYS F CA  1 
ATOM   6693  C C   . LYS F 1 129 ? -17.961 -13.447 25.862  1.00 63.54  ? 125 LYS F C   1 
ATOM   6694  O O   . LYS F 1 129 ? -18.938 -14.022 26.340  1.00 71.63  ? 125 LYS F O   1 
ATOM   6695  C CB  . LYS F 1 129 ? -18.291 -11.260 24.684  1.00 40.63  ? 125 LYS F CB  1 
ATOM   6696  C CG  . LYS F 1 129 ? -19.688 -11.677 24.243  1.00 45.12  ? 125 LYS F CG  1 
ATOM   6697  C CD  . LYS F 1 129 ? -20.088 -11.004 22.938  1.00 51.11  ? 125 LYS F CD  1 
ATOM   6698  C CE  . LYS F 1 129 ? -21.468 -11.446 22.471  1.00 58.42  ? 125 LYS F CE  1 
ATOM   6699  N NZ  . LYS F 1 129 ? -21.471 -12.854 21.982  1.00 56.94  ? 125 LYS F NZ  1 
ATOM   6700  N N   . ASN F 1 130 ? -16.982 -14.088 25.229  1.00 67.01  ? 126 ASN F N   1 
ATOM   6701  C CA  . ASN F 1 130 ? -17.019 -15.531 25.019  1.00 58.73  ? 126 ASN F CA  1 
ATOM   6702  C C   . ASN F 1 130 ? -16.910 -16.323 26.320  1.00 60.22  ? 126 ASN F C   1 
ATOM   6703  O O   . ASN F 1 130 ? -17.438 -17.429 26.425  1.00 64.80  ? 126 ASN F O   1 
ATOM   6704  C CB  . ASN F 1 130 ? -15.902 -15.956 24.063  1.00 48.19  ? 126 ASN F CB  1 
ATOM   6705  C CG  . ASN F 1 130 ? -16.055 -15.351 22.683  1.00 59.45  ? 126 ASN F CG  1 
ATOM   6706  O OD1 . ASN F 1 130 ? -17.132 -14.883 22.313  1.00 66.27  ? 126 ASN F OD1 1 
ATOM   6707  N ND2 . ASN F 1 130 ? -14.975 -15.361 21.910  1.00 68.34  ? 126 ASN F ND2 1 
ATOM   6708  N N   . LEU F 1 131 ? -16.221 -15.759 27.308  1.00 60.78  ? 127 LEU F N   1 
ATOM   6709  C CA  . LEU F 1 131 ? -16.036 -16.437 28.589  1.00 52.15  ? 127 LEU F CA  1 
ATOM   6710  C C   . LEU F 1 131 ? -17.209 -16.203 29.536  1.00 66.50  ? 127 LEU F C   1 
ATOM   6711  O O   . LEU F 1 131 ? -17.517 -17.053 30.369  1.00 90.65  ? 127 LEU F O   1 
ATOM   6712  C CB  . LEU F 1 131 ? -14.734 -15.987 29.255  1.00 39.54  ? 127 LEU F CB  1 
ATOM   6713  C CG  . LEU F 1 131 ? -13.445 -16.310 28.493  1.00 58.44  ? 127 LEU F CG  1 
ATOM   6714  C CD1 . LEU F 1 131 ? -12.229 -16.038 29.366  1.00 51.19  ? 127 LEU F CD1 1 
ATOM   6715  C CD2 . LEU F 1 131 ? -13.439 -17.749 27.990  1.00 69.23  ? 127 LEU F CD2 1 
ATOM   6716  N N   . LEU F 1 132 ? -17.858 -15.049 29.412  1.00 56.05  ? 128 LEU F N   1 
ATOM   6717  C CA  . LEU F 1 132 ? -19.026 -14.742 30.231  1.00 45.10  ? 128 LEU F CA  1 
ATOM   6718  C C   . LEU F 1 132 ? -20.236 -15.549 29.769  1.00 65.09  ? 128 LEU F C   1 
ATOM   6719  O O   . LEU F 1 132 ? -21.063 -15.964 30.582  1.00 59.01  ? 128 LEU F O   1 
ATOM   6720  C CB  . LEU F 1 132 ? -19.347 -13.248 30.166  1.00 42.58  ? 128 LEU F CB  1 
ATOM   6721  C CG  . LEU F 1 132 ? -18.351 -12.307 30.846  1.00 52.67  ? 128 LEU F CG  1 
ATOM   6722  C CD1 . LEU F 1 132 ? -18.678 -10.860 30.506  1.00 71.15  ? 128 LEU F CD1 1 
ATOM   6723  C CD2 . LEU F 1 132 ? -18.346 -12.515 32.353  1.00 41.47  ? 128 LEU F CD2 1 
ATOM   6724  N N   . ASP F 1 133 ? -20.334 -15.765 28.459  1.00 83.31  ? 129 ASP F N   1 
ATOM   6725  C CA  . ASP F 1 133 ? -21.438 -16.529 27.887  1.00 88.88  ? 129 ASP F CA  1 
ATOM   6726  C C   . ASP F 1 133 ? -21.407 -17.974 28.375  1.00 99.57  ? 129 ASP F C   1 
ATOM   6727  O O   . ASP F 1 133 ? -22.451 -18.608 28.530  1.00 110.30 ? 129 ASP F O   1 
ATOM   6728  C CB  . ASP F 1 133 ? -21.377 -16.507 26.356  1.00 81.97  ? 129 ASP F CB  1 
ATOM   6729  C CG  . ASP F 1 133 ? -21.577 -15.117 25.776  1.00 83.97  ? 129 ASP F CG  1 
ATOM   6730  O OD1 . ASP F 1 133 ? -22.153 -14.251 26.467  1.00 80.44  ? 129 ASP F OD1 1 
ATOM   6731  O OD2 . ASP F 1 133 ? -21.163 -14.896 24.618  1.00 89.31  ? 129 ASP F OD2 1 
ATOM   6732  N N   . LYS F 1 134 ? -20.204 -18.488 28.611  1.00 97.15  ? 130 LYS F N   1 
ATOM   6733  C CA  . LYS F 1 134 ? -20.025 -19.868 29.048  1.00 97.51  ? 130 LYS F CA  1 
ATOM   6734  C C   . LYS F 1 134 ? -20.036 -19.974 30.573  1.00 100.18 ? 130 LYS F C   1 
ATOM   6735  O O   . LYS F 1 134 ? -20.701 -20.841 31.140  1.00 103.12 ? 130 LYS F O   1 
ATOM   6736  C CB  . LYS F 1 134 ? -18.713 -20.423 28.491  1.00 94.40  ? 130 LYS F CB  1 
ATOM   6737  C CG  . LYS F 1 134 ? -18.642 -20.416 26.970  1.00 97.92  ? 130 LYS F CG  1 
ATOM   6738  C CD  . LYS F 1 134 ? -17.226 -20.653 26.463  1.00 101.20 ? 130 LYS F CD  1 
ATOM   6739  C CE  . LYS F 1 134 ? -17.184 -20.755 24.945  1.00 105.30 ? 130 LYS F CE  1 
ATOM   6740  N NZ  . LYS F 1 134 ? -17.652 -19.511 24.274  1.00 108.84 ? 130 LYS F NZ  1 
ATOM   6741  N N   . ASP F 1 135 ? -19.298 -19.082 31.229  1.00 89.69  ? 131 ASP F N   1 
ATOM   6742  C CA  . ASP F 1 135 ? -19.194 -19.076 32.684  1.00 65.14  ? 131 ASP F CA  1 
ATOM   6743  C C   . ASP F 1 135 ? -19.187 -17.642 33.201  1.00 61.38  ? 131 ASP F C   1 
ATOM   6744  O O   . ASP F 1 135 ? -18.163 -16.962 33.144  1.00 63.50  ? 131 ASP F O   1 
ATOM   6745  C CB  . ASP F 1 135 ? -17.914 -19.791 33.121  1.00 68.20  ? 131 ASP F CB  1 
ATOM   6746  C CG  . ASP F 1 135 ? -17.738 -19.811 34.627  1.00 83.84  ? 131 ASP F CG  1 
ATOM   6747  O OD1 . ASP F 1 135 ? -18.756 -19.746 35.349  1.00 96.82  ? 131 ASP F OD1 1 
ATOM   6748  O OD2 . ASP F 1 135 ? -16.580 -19.896 35.088  1.00 78.48  ? 131 ASP F OD2 1 
ATOM   6749  N N   . TRP F 1 136 ? -20.328 -17.190 33.713  1.00 69.00  ? 132 TRP F N   1 
ATOM   6750  C CA  . TRP F 1 136 ? -20.477 -15.797 34.135  1.00 67.98  ? 132 TRP F CA  1 
ATOM   6751  C C   . TRP F 1 136 ? -19.831 -15.499 35.492  1.00 58.19  ? 132 TRP F C   1 
ATOM   6752  O O   . TRP F 1 136 ? -19.791 -14.347 35.923  1.00 47.09  ? 132 TRP F O   1 
ATOM   6753  C CB  . TRP F 1 136 ? -21.956 -15.399 34.161  1.00 69.44  ? 132 TRP F CB  1 
ATOM   6754  C CG  . TRP F 1 136 ? -22.800 -16.229 35.077  1.00 79.70  ? 132 TRP F CG  1 
ATOM   6755  C CD1 . TRP F 1 136 ? -22.702 -16.309 36.435  1.00 81.01  ? 132 TRP F CD1 1 
ATOM   6756  C CD2 . TRP F 1 136 ? -23.884 -17.087 34.702  1.00 82.18  ? 132 TRP F CD2 1 
ATOM   6757  N NE1 . TRP F 1 136 ? -23.654 -17.167 36.930  1.00 78.77  ? 132 TRP F NE1 1 
ATOM   6758  C CE2 . TRP F 1 136 ? -24.394 -17.659 35.885  1.00 80.67  ? 132 TRP F CE2 1 
ATOM   6759  C CE3 . TRP F 1 136 ? -24.474 -17.430 33.480  1.00 77.46  ? 132 TRP F CE3 1 
ATOM   6760  C CZ2 . TRP F 1 136 ? -25.461 -18.554 35.884  1.00 85.92  ? 132 TRP F CZ2 1 
ATOM   6761  C CZ3 . TRP F 1 136 ? -25.534 -18.319 33.480  1.00 81.61  ? 132 TRP F CZ3 1 
ATOM   6762  C CH2 . TRP F 1 136 ? -26.016 -18.870 34.674  1.00 87.08  ? 132 TRP F CH2 1 
ATOM   6763  N N   . ASN F 1 137 ? -19.326 -16.532 36.159  1.00 68.81  ? 133 ASN F N   1 
ATOM   6764  C CA  . ASN F 1 137 ? -18.646 -16.358 37.439  1.00 77.64  ? 133 ASN F CA  1 
ATOM   6765  C C   . ASN F 1 137 ? -17.136 -16.552 37.320  1.00 78.97  ? 133 ASN F C   1 
ATOM   6766  O O   . ASN F 1 137 ? -16.435 -16.673 38.325  1.00 80.16  ? 133 ASN F O   1 
ATOM   6767  C CB  . ASN F 1 137 ? -19.213 -17.336 38.471  1.00 81.15  ? 133 ASN F CB  1 
ATOM   6768  C CG  . ASN F 1 137 ? -20.109 -16.658 39.490  1.00 91.56  ? 133 ASN F CG  1 
ATOM   6769  O OD1 . ASN F 1 137 ? -20.628 -15.567 39.253  1.00 93.87  ? 133 ASN F OD1 1 
ATOM   6770  N ND2 . ASN F 1 137 ? -20.294 -17.305 40.635  1.00 95.40  ? 133 ASN F ND2 1 
ATOM   6771  N N   . ILE F 1 138 ? -16.640 -16.566 36.087  1.00 76.00  ? 134 ILE F N   1 
ATOM   6772  C CA  . ILE F 1 138 ? -15.240 -16.884 35.824  1.00 74.43  ? 134 ILE F CA  1 
ATOM   6773  C C   . ILE F 1 138 ? -14.272 -15.849 36.387  1.00 69.84  ? 134 ILE F C   1 
ATOM   6774  O O   . ILE F 1 138 ? -13.225 -16.204 36.931  1.00 58.87  ? 134 ILE F O   1 
ATOM   6775  C CB  . ILE F 1 138 ? -14.971 -17.035 34.313  1.00 76.09  ? 134 ILE F CB  1 
ATOM   6776  C CG1 . ILE F 1 138 ? -13.529 -17.489 34.079  1.00 74.54  ? 134 ILE F CG1 1 
ATOM   6777  C CG2 . ILE F 1 138 ? -15.243 -15.724 33.579  1.00 73.44  ? 134 ILE F CG2 1 
ATOM   6778  C CD1 . ILE F 1 138 ? -13.250 -17.921 32.660  1.00 79.49  ? 134 ILE F CD1 1 
ATOM   6779  N N   . PHE F 1 139 ? -14.616 -14.572 36.262  1.00 77.92  ? 135 PHE F N   1 
ATOM   6780  C CA  . PHE F 1 139 ? -13.706 -13.509 36.680  1.00 67.20  ? 135 PHE F CA  1 
ATOM   6781  C C   . PHE F 1 139 ? -13.732 -13.244 38.186  1.00 67.61  ? 135 PHE F C   1 
ATOM   6782  O O   . PHE F 1 139 ? -13.325 -12.172 38.637  1.00 65.47  ? 135 PHE F O   1 
ATOM   6783  C CB  . PHE F 1 139 ? -13.991 -12.218 35.907  1.00 53.97  ? 135 PHE F CB  1 
ATOM   6784  C CG  . PHE F 1 139 ? -13.751 -12.336 34.429  1.00 65.00  ? 135 PHE F CG  1 
ATOM   6785  C CD1 . PHE F 1 139 ? -12.495 -12.662 33.940  1.00 72.81  ? 135 PHE F CD1 1 
ATOM   6786  C CD2 . PHE F 1 139 ? -14.778 -12.112 33.527  1.00 63.68  ? 135 PHE F CD2 1 
ATOM   6787  C CE1 . PHE F 1 139 ? -12.271 -12.771 32.580  1.00 74.40  ? 135 PHE F CE1 1 
ATOM   6788  C CE2 . PHE F 1 139 ? -14.560 -12.217 32.166  1.00 71.69  ? 135 PHE F CE2 1 
ATOM   6789  C CZ  . PHE F 1 139 ? -13.305 -12.547 31.692  1.00 79.82  ? 135 PHE F CZ  1 
ATOM   6790  N N   . SER F 1 140 ? -14.200 -14.220 38.958  1.00 67.49  ? 136 SER F N   1 
ATOM   6791  C CA  . SER F 1 140 ? -14.074 -14.175 40.408  1.00 82.35  ? 136 SER F CA  1 
ATOM   6792  C C   . SER F 1 140 ? -12.791 -14.898 40.811  1.00 95.29  ? 136 SER F C   1 
ATOM   6793  O O   . SER F 1 140 ? -12.518 -15.099 41.996  1.00 105.84 ? 136 SER F O   1 
ATOM   6794  C CB  . SER F 1 140 ? -15.287 -14.829 41.071  1.00 79.99  ? 136 SER F CB  1 
ATOM   6795  O OG  . SER F 1 140 ? -15.431 -16.168 40.635  1.00 79.32  ? 136 SER F OG  1 
ATOM   6796  N N   . LYS F 1 141 ? -12.012 -15.284 39.804  1.00 88.91  ? 137 LYS F N   1 
ATOM   6797  C CA  . LYS F 1 141 ? -10.745 -15.980 40.001  1.00 85.08  ? 137 LYS F CA  1 
ATOM   6798  C C   . LYS F 1 141 ? -9.692  -15.077 40.638  1.00 97.88  ? 137 LYS F C   1 
ATOM   6799  O O   . LYS F 1 141 ? -9.469  -13.954 40.186  1.00 101.70 ? 137 LYS F O   1 
ATOM   6800  C CB  . LYS F 1 141 ? -10.237 -16.497 38.653  1.00 76.79  ? 137 LYS F CB  1 
ATOM   6801  C CG  . LYS F 1 141 ? -8.840  -17.099 38.668  1.00 74.22  ? 137 LYS F CG  1 
ATOM   6802  C CD  . LYS F 1 141 ? -8.435  -17.519 37.263  1.00 57.93  ? 137 LYS F CD  1 
ATOM   6803  C CE  . LYS F 1 141 ? -7.161  -18.344 37.252  1.00 51.91  ? 137 LYS F CE  1 
ATOM   6804  N NZ  . LYS F 1 141 ? -7.175  -19.352 36.155  1.00 54.59  ? 137 LYS F NZ  1 
ATOM   6805  N N   . ASN F 1 142 ? -9.043  -15.578 41.686  1.00 105.08 ? 138 ASN F N   1 
ATOM   6806  C CA  . ASN F 1 142 ? -7.993  -14.831 42.369  1.00 107.89 ? 138 ASN F CA  1 
ATOM   6807  C C   . ASN F 1 142 ? -6.688  -14.898 41.582  1.00 104.78 ? 138 ASN F C   1 
ATOM   6808  O O   . ASN F 1 142 ? -6.111  -15.974 41.420  1.00 106.04 ? 138 ASN F O   1 
ATOM   6809  C CB  . ASN F 1 142 ? -7.781  -15.382 43.781  1.00 113.84 ? 138 ASN F CB  1 
ATOM   6810  C CG  . ASN F 1 142 ? -6.862  -14.510 44.617  1.00 114.72 ? 138 ASN F CG  1 
ATOM   6811  O OD1 . ASN F 1 142 ? -5.639  -14.562 44.477  1.00 107.88 ? 138 ASN F OD1 1 
ATOM   6812  N ND2 . ASN F 1 142 ? -7.448  -13.709 45.500  1.00 115.41 ? 138 ASN F ND2 1 
ATOM   6813  N N   . CYS F 1 143 ? -6.226  -13.748 41.099  1.00 96.52  ? 139 CYS F N   1 
ATOM   6814  C CA  . CYS F 1 143 ? -5.054  -13.699 40.228  1.00 81.24  ? 139 CYS F CA  1 
ATOM   6815  C C   . CYS F 1 143 ? -3.826  -13.088 40.900  1.00 77.06  ? 139 CYS F C   1 
ATOM   6816  O O   . CYS F 1 143 ? -2.795  -12.901 40.256  1.00 70.11  ? 139 CYS F O   1 
ATOM   6817  C CB  . CYS F 1 143 ? -5.380  -12.916 38.956  1.00 68.80  ? 139 CYS F CB  1 
ATOM   6818  S SG  . CYS F 1 143 ? -6.579  -13.729 37.880  1.00 49.07  ? 139 CYS F SG  1 
ATOM   6819  N N   . ASN F 1 144 ? -3.933  -12.776 42.187  1.00 85.18  ? 140 ASN F N   1 
ATOM   6820  C CA  . ASN F 1 144 ? -2.799  -12.231 42.926  1.00 89.03  ? 140 ASN F CA  1 
ATOM   6821  C C   . ASN F 1 144 ? -1.587  -13.155 42.835  1.00 72.57  ? 140 ASN F C   1 
ATOM   6822  O O   . ASN F 1 144 ? -0.444  -12.698 42.812  1.00 58.62  ? 140 ASN F O   1 
ATOM   6823  C CB  . ASN F 1 144 ? -3.174  -12.001 44.392  1.00 103.31 ? 140 ASN F CB  1 
ATOM   6824  C CG  . ASN F 1 144 ? -4.106  -10.818 44.578  1.00 113.47 ? 140 ASN F CG  1 
ATOM   6825  O OD1 . ASN F 1 144 ? -4.007  -9.816  43.869  1.00 120.54 ? 140 ASN F OD1 1 
ATOM   6826  N ND2 . ASN F 1 144 ? -5.018  -10.927 45.539  1.00 109.51 ? 140 ASN F ND2 1 
ATOM   6827  N N   . ASN F 1 145 ? -1.848  -14.458 42.780  1.00 71.97  ? 141 ASN F N   1 
ATOM   6828  C CA  . ASN F 1 145 ? -0.791  -15.452 42.637  1.00 81.07  ? 141 ASN F CA  1 
ATOM   6829  C C   . ASN F 1 145 ? -0.146  -15.360 41.259  1.00 72.09  ? 141 ASN F C   1 
ATOM   6830  O O   . ASN F 1 145 ? 1.068   -15.509 41.116  1.00 62.03  ? 141 ASN F O   1 
ATOM   6831  C CB  . ASN F 1 145 ? -1.352  -16.861 42.846  1.00 91.54  ? 141 ASN F CB  1 
ATOM   6832  C CG  . ASN F 1 145 ? -1.999  -17.041 44.207  1.00 101.82 ? 141 ASN F CG  1 
ATOM   6833  O OD1 . ASN F 1 145 ? -2.187  -16.078 44.951  1.00 109.14 ? 141 ASN F OD1 1 
ATOM   6834  N ND2 . ASN F 1 145 ? -2.351  -18.279 44.536  1.00 98.71  ? 141 ASN F ND2 1 
ATOM   6835  N N   . SER F 1 146 ? -0.972  -15.112 40.247  1.00 68.80  ? 142 SER F N   1 
ATOM   6836  C CA  . SER F 1 146 ? -0.504  -15.027 38.869  1.00 60.91  ? 142 SER F CA  1 
ATOM   6837  C C   . SER F 1 146 ? 0.130   -13.666 38.576  1.00 58.09  ? 142 SER F C   1 
ATOM   6838  O O   . SER F 1 146 ? 0.873   -13.519 37.605  1.00 71.24  ? 142 SER F O   1 
ATOM   6839  C CB  . SER F 1 146 ? -1.660  -15.292 37.899  1.00 65.32  ? 142 SER F CB  1 
ATOM   6840  O OG  . SER F 1 146 ? -2.242  -16.566 38.126  1.00 61.89  ? 142 SER F OG  1 
ATOM   6841  N N   . PHE F 1 147 ? -0.169  -12.674 39.411  1.00 45.50  ? 143 PHE F N   1 
ATOM   6842  C CA  . PHE F 1 147 ? 0.433   -11.349 39.278  1.00 59.40  ? 143 PHE F CA  1 
ATOM   6843  C C   . PHE F 1 147 ? 1.776   -11.301 39.996  1.00 82.74  ? 143 PHE F C   1 
ATOM   6844  O O   . PHE F 1 147 ? 2.687   -10.583 39.583  1.00 91.29  ? 143 PHE F O   1 
ATOM   6845  C CB  . PHE F 1 147 ? -0.489  -10.268 39.853  1.00 57.33  ? 143 PHE F CB  1 
ATOM   6846  C CG  . PHE F 1 147 ? -1.747  -10.044 39.055  1.00 52.57  ? 143 PHE F CG  1 
ATOM   6847  C CD1 . PHE F 1 147 ? -1.980  -10.744 37.881  1.00 41.74  ? 143 PHE F CD1 1 
ATOM   6848  C CD2 . PHE F 1 147 ? -2.694  -9.123  39.478  1.00 49.56  ? 143 PHE F CD2 1 
ATOM   6849  C CE1 . PHE F 1 147 ? -3.135  -10.535 37.152  1.00 56.44  ? 143 PHE F CE1 1 
ATOM   6850  C CE2 . PHE F 1 147 ? -3.850  -8.911  38.751  1.00 46.92  ? 143 PHE F CE2 1 
ATOM   6851  C CZ  . PHE F 1 147 ? -4.070  -9.618  37.587  1.00 57.16  ? 143 PHE F CZ  1 
ATOM   6852  N N   . ALA F 1 148 ? 1.889   -12.064 41.077  1.00 89.77  ? 144 ALA F N   1 
ATOM   6853  C CA  . ALA F 1 148 ? 3.118   -12.102 41.858  1.00 95.12  ? 144 ALA F CA  1 
ATOM   6854  C C   . ALA F 1 148 ? 4.288   -12.568 40.999  1.00 93.85  ? 144 ALA F C   1 
ATOM   6855  O O   . ALA F 1 148 ? 5.393   -12.039 41.104  1.00 89.88  ? 144 ALA F O   1 
ATOM   6856  C CB  . ALA F 1 148 ? 2.948   -13.016 43.062  1.00 102.03 ? 144 ALA F CB  1 
ATOM   6857  N N   . GLU F 1 149 ? 4.036   -13.552 40.142  1.00 100.51 ? 145 GLU F N   1 
ATOM   6858  C CA  . GLU F 1 149 ? 5.085   -14.113 39.295  1.00 108.60 ? 145 GLU F CA  1 
ATOM   6859  C C   . GLU F 1 149 ? 5.228   -13.332 37.987  1.00 118.24 ? 145 GLU F C   1 
ATOM   6860  O O   . GLU F 1 149 ? 5.116   -13.896 36.898  1.00 116.60 ? 145 GLU F O   1 
ATOM   6861  C CB  . GLU F 1 149 ? 4.822   -15.598 39.011  1.00 105.23 ? 145 GLU F CB  1 
ATOM   6862  C CG  . GLU F 1 149 ? 3.474   -15.905 38.371  1.00 104.05 ? 145 GLU F CG  1 
ATOM   6863  C CD  . GLU F 1 149 ? 3.276   -17.388 38.118  1.00 103.17 ? 145 GLU F CD  1 
ATOM   6864  O OE1 . GLU F 1 149 ? 4.264   -18.146 38.209  1.00 104.31 ? 145 GLU F OE1 1 
ATOM   6865  O OE2 . GLU F 1 149 ? 2.130   -17.797 37.835  1.00 102.61 ? 145 GLU F OE2 1 
ATOM   6866  N N   . CYS F 1 150 ? 5.480   -12.031 38.109  1.00 125.51 ? 146 CYS F N   1 
ATOM   6867  C CA  . CYS F 1 150 ? 5.706   -11.171 36.951  1.00 127.28 ? 146 CYS F CA  1 
ATOM   6868  C C   . CYS F 1 150 ? 6.987   -10.357 37.115  1.00 122.79 ? 146 CYS F C   1 
ATOM   6869  O O   . CYS F 1 150 ? 7.537   -10.257 38.212  1.00 117.55 ? 146 CYS F O   1 
ATOM   6870  C CB  . CYS F 1 150 ? 4.518   -10.229 36.742  1.00 128.69 ? 146 CYS F CB  1 
ATOM   6871  S SG  . CYS F 1 150 ? 3.151   -10.941 35.799  1.00 71.66  ? 146 CYS F SG  1 
ATOM   6872  N N   . SER G 1 8   ? 12.926  -7.375  110.581 1.00 71.70  ? 4   SER G N   1 
ATOM   6873  C CA  . SER G 1 8   ? 11.569  -7.907  110.594 1.00 68.35  ? 4   SER G CA  1 
ATOM   6874  C C   . SER G 1 8   ? 11.263  -8.604  109.271 1.00 59.49  ? 4   SER G C   1 
ATOM   6875  O O   . SER G 1 8   ? 12.148  -8.787  108.437 1.00 51.16  ? 4   SER G O   1 
ATOM   6876  C CB  . SER G 1 8   ? 10.560  -6.782  110.838 1.00 66.71  ? 4   SER G CB  1 
ATOM   6877  O OG  . SER G 1 8   ? 9.305   -7.299  111.245 1.00 64.11  ? 4   SER G OG  1 
ATOM   6878  N N   . GLU G 1 9   ? 10.003  -8.984  109.085 1.00 69.14  ? 5   GLU G N   1 
ATOM   6879  C CA  . GLU G 1 9   ? 9.563   -9.626  107.850 1.00 68.66  ? 5   GLU G CA  1 
ATOM   6880  C C   . GLU G 1 9   ? 9.024   -8.586  106.863 1.00 65.02  ? 5   GLU G C   1 
ATOM   6881  O O   . GLU G 1 9   ? 8.280   -8.912  105.940 1.00 68.31  ? 5   GLU G O   1 
ATOM   6882  C CB  . GLU G 1 9   ? 8.509   -10.697 108.165 1.00 76.20  ? 5   GLU G CB  1 
ATOM   6883  C CG  . GLU G 1 9   ? 7.832   -11.329 106.954 1.00 84.08  ? 5   GLU G CG  1 
ATOM   6884  C CD  . GLU G 1 9   ? 6.453   -10.750 106.680 1.00 89.85  ? 5   GLU G CD  1 
ATOM   6885  O OE1 . GLU G 1 9   ? 6.057   -9.785  107.367 1.00 93.09  ? 5   GLU G OE1 1 
ATOM   6886  O OE2 . GLU G 1 9   ? 5.762   -11.267 105.777 1.00 93.12  ? 5   GLU G OE2 1 
ATOM   6887  N N   . TYR G 1 10  ? 9.422   -7.331  107.056 1.00 64.86  ? 6   TYR G N   1 
ATOM   6888  C CA  . TYR G 1 10  ? 9.002   -6.244  106.180 1.00 52.92  ? 6   TYR G CA  1 
ATOM   6889  C C   . TYR G 1 10  ? 10.013  -6.023  105.060 1.00 58.17  ? 6   TYR G C   1 
ATOM   6890  O O   . TYR G 1 10  ? 9.854   -5.117  104.241 1.00 62.37  ? 6   TYR G O   1 
ATOM   6891  C CB  . TYR G 1 10  ? 8.831   -4.952  106.979 1.00 58.72  ? 6   TYR G CB  1 
ATOM   6892  N N   . CYS G 1 11  ? 11.054  -6.850  105.027 1.00 59.42  ? 7   CYS G N   1 
ATOM   6893  C CA  . CYS G 1 11  ? 12.074  -6.752  103.990 1.00 58.47  ? 7   CYS G CA  1 
ATOM   6894  C C   . CYS G 1 11  ? 11.541  -7.269  102.657 1.00 64.42  ? 7   CYS G C   1 
ATOM   6895  O O   . CYS G 1 11  ? 11.978  -6.833  101.591 1.00 76.00  ? 7   CYS G O   1 
ATOM   6896  C CB  . CYS G 1 11  ? 13.323  -7.540  104.392 1.00 57.64  ? 7   CYS G CB  1 
ATOM   6897  S SG  . CYS G 1 11  ? 14.193  -6.887  105.837 1.00 116.62 ? 7   CYS G SG  1 
ATOM   6898  N N   . SER G 1 12  ? 10.592  -8.198  102.724 1.00 55.51  ? 8   SER G N   1 
ATOM   6899  C CA  . SER G 1 12  ? 10.047  -8.833  101.528 1.00 65.42  ? 8   SER G CA  1 
ATOM   6900  C C   . SER G 1 12  ? 9.094   -7.916  100.759 1.00 84.08  ? 8   SER G C   1 
ATOM   6901  O O   . SER G 1 12  ? 8.662   -8.250  99.655  1.00 94.67  ? 8   SER G O   1 
ATOM   6902  C CB  . SER G 1 12  ? 9.335   -10.136 101.904 1.00 57.48  ? 8   SER G CB  1 
ATOM   6903  O OG  . SER G 1 12  ? 8.355   -9.916  102.903 1.00 63.52  ? 8   SER G OG  1 
ATOM   6904  N N   . HIS G 1 13  ? 8.776   -6.762  101.341 1.00 84.84  ? 9   HIS G N   1 
ATOM   6905  C CA  . HIS G 1 13  ? 7.846   -5.822  100.723 1.00 80.45  ? 9   HIS G CA  1 
ATOM   6906  C C   . HIS G 1 13  ? 8.522   -4.498  100.364 1.00 73.48  ? 9   HIS G C   1 
ATOM   6907  O O   . HIS G 1 13  ? 7.851   -3.539  99.980  1.00 76.52  ? 9   HIS G O   1 
ATOM   6908  C CB  . HIS G 1 13  ? 6.668   -5.556  101.665 1.00 75.41  ? 9   HIS G CB  1 
ATOM   6909  C CG  . HIS G 1 13  ? 5.981   -6.798  102.138 1.00 86.11  ? 9   HIS G CG  1 
ATOM   6910  N ND1 . HIS G 1 13  ? 4.908   -7.356  101.473 1.00 95.37  ? 9   HIS G ND1 1 
ATOM   6911  C CD2 . HIS G 1 13  ? 6.207   -7.592  103.211 1.00 91.94  ? 9   HIS G CD2 1 
ATOM   6912  C CE1 . HIS G 1 13  ? 4.508   -8.437  102.113 1.00 96.92  ? 9   HIS G CE1 1 
ATOM   6913  N NE2 . HIS G 1 13  ? 5.280   -8.604  103.174 1.00 96.21  ? 9   HIS G NE2 1 
ATOM   6914  N N   . MET G 1 14  ? 9.847   -4.447  100.479 1.00 59.21  ? 10  MET G N   1 
ATOM   6915  C CA  . MET G 1 14  ? 10.587  -3.212  100.240 1.00 65.62  ? 10  MET G CA  1 
ATOM   6916  C C   . MET G 1 14  ? 10.717  -2.924  98.750  1.00 66.53  ? 10  MET G C   1 
ATOM   6917  O O   . MET G 1 14  ? 10.423  -1.818  98.294  1.00 82.18  ? 10  MET G O   1 
ATOM   6918  C CB  . MET G 1 14  ? 11.975  -3.288  100.880 1.00 81.10  ? 10  MET G CB  1 
ATOM   6919  C CG  . MET G 1 14  ? 11.947  -3.475  102.388 1.00 92.42  ? 10  MET G CG  1 
ATOM   6920  S SD  . MET G 1 14  ? 10.982  -2.212  103.236 1.00 126.06 ? 10  MET G SD  1 
ATOM   6921  C CE  . MET G 1 14  ? 11.881  -0.739  102.775 1.00 34.09  ? 10  MET G CE  1 
ATOM   6922  N N   . ILE G 1 15  ? 11.157  -3.923  97.991  1.00 47.12  ? 11  ILE G N   1 
ATOM   6923  C CA  . ILE G 1 15  ? 11.348  -3.752  96.556  1.00 50.69  ? 11  ILE G CA  1 
ATOM   6924  C C   . ILE G 1 15  ? 10.021  -3.949  95.831  1.00 51.67  ? 11  ILE G C   1 
ATOM   6925  O O   . ILE G 1 15  ? 9.563   -5.076  95.644  1.00 43.77  ? 11  ILE G O   1 
ATOM   6926  C CB  . ILE G 1 15  ? 12.393  -4.736  95.981  1.00 46.31  ? 11  ILE G CB  1 
ATOM   6927  C CG1 . ILE G 1 15  ? 13.653  -4.757  96.851  1.00 27.82  ? 11  ILE G CG1 1 
ATOM   6928  C CG2 . ILE G 1 15  ? 12.748  -4.350  94.543  1.00 30.46  ? 11  ILE G CG2 1 
ATOM   6929  C CD1 . ILE G 1 15  ? 14.686  -5.775  96.411  1.00 17.40  ? 11  ILE G CD1 1 
ATOM   6930  N N   . GLY G 1 16  ? 9.406   -2.840  95.434  1.00 58.32  ? 12  GLY G N   1 
ATOM   6931  C CA  . GLY G 1 16  ? 8.152   -2.879  94.707  1.00 67.73  ? 12  GLY G CA  1 
ATOM   6932  C C   . GLY G 1 16  ? 8.372   -2.907  93.208  1.00 78.58  ? 12  GLY G C   1 
ATOM   6933  O O   . GLY G 1 16  ? 9.485   -2.685  92.731  1.00 83.59  ? 12  GLY G O   1 
ATOM   6934  N N   . SER G 1 17  ? 7.306   -3.183  92.465  1.00 83.24  ? 13  SER G N   1 
ATOM   6935  C CA  . SER G 1 17  ? 7.379   -3.235  91.010  1.00 84.50  ? 13  SER G CA  1 
ATOM   6936  C C   . SER G 1 17  ? 7.691   -1.859  90.432  1.00 72.96  ? 13  SER G C   1 
ATOM   6937  O O   . SER G 1 17  ? 8.266   -1.748  89.350  1.00 73.45  ? 13  SER G O   1 
ATOM   6938  C CB  . SER G 1 17  ? 6.063   -3.756  90.432  1.00 95.81  ? 13  SER G CB  1 
ATOM   6939  O OG  . SER G 1 17  ? 5.774   -5.058  90.912  1.00 104.39 ? 13  SER G OG  1 
ATOM   6940  N N   . GLY G 1 18  ? 7.307   -0.814  91.158  1.00 61.12  ? 14  GLY G N   1 
ATOM   6941  C CA  . GLY G 1 18  ? 7.560   0.549   90.728  1.00 52.04  ? 14  GLY G CA  1 
ATOM   6942  C C   . GLY G 1 18  ? 9.041   0.836   90.565  1.00 54.41  ? 14  GLY G C   1 
ATOM   6943  O O   . GLY G 1 18  ? 9.434   1.658   89.737  1.00 43.26  ? 14  GLY G O   1 
ATOM   6944  N N   . HIS G 1 19  ? 9.864   0.154   91.357  1.00 65.89  ? 15  HIS G N   1 
ATOM   6945  C CA  . HIS G 1 19  ? 11.310  0.338   91.304  1.00 62.91  ? 15  HIS G CA  1 
ATOM   6946  C C   . HIS G 1 19  ? 11.917  -0.395  90.113  1.00 42.75  ? 15  HIS G C   1 
ATOM   6947  O O   . HIS G 1 19  ? 12.883  0.075   89.512  1.00 51.29  ? 15  HIS G O   1 
ATOM   6948  C CB  . HIS G 1 19  ? 11.960  -0.152  92.600  1.00 64.80  ? 15  HIS G CB  1 
ATOM   6949  C CG  . HIS G 1 19  ? 11.518  0.596   93.819  1.00 58.42  ? 15  HIS G CG  1 
ATOM   6950  N ND1 . HIS G 1 19  ? 10.522  0.138   94.655  1.00 54.13  ? 15  HIS G ND1 1 
ATOM   6951  C CD2 . HIS G 1 19  ? 11.933  1.775   94.342  1.00 56.52  ? 15  HIS G CD2 1 
ATOM   6952  C CE1 . HIS G 1 19  ? 10.346  0.998   95.641  1.00 64.15  ? 15  HIS G CE1 1 
ATOM   6953  N NE2 . HIS G 1 19  ? 11.190  2.002   95.474  1.00 64.25  ? 15  HIS G NE2 1 
ATOM   6954  N N   . LEU G 1 20  ? 11.349  -1.548  89.776  1.00 23.55  ? 16  LEU G N   1 
ATOM   6955  C CA  . LEU G 1 20  ? 11.822  -2.321  88.633  1.00 31.21  ? 16  LEU G CA  1 
ATOM   6956  C C   . LEU G 1 20  ? 11.411  -1.647  87.326  1.00 52.59  ? 16  LEU G C   1 
ATOM   6957  O O   . LEU G 1 20  ? 12.147  -1.682  86.337  1.00 40.67  ? 16  LEU G O   1 
ATOM   6958  C CB  . LEU G 1 20  ? 11.275  -3.747  88.693  1.00 31.15  ? 16  LEU G CB  1 
ATOM   6959  C CG  . LEU G 1 20  ? 11.583  -4.495  89.994  1.00 59.86  ? 16  LEU G CG  1 
ATOM   6960  C CD1 . LEU G 1 20  ? 11.038  -5.914  89.947  1.00 70.55  ? 16  LEU G CD1 1 
ATOM   6961  C CD2 . LEU G 1 20  ? 13.081  -4.503  90.283  1.00 49.78  ? 16  LEU G CD2 1 
ATOM   6962  N N   . GLN G 1 21  ? 10.235  -1.026  87.329  1.00 63.74  ? 17  GLN G N   1 
ATOM   6963  C CA  . GLN G 1 21  ? 9.761   -0.290  86.165  1.00 60.05  ? 17  GLN G CA  1 
ATOM   6964  C C   . GLN G 1 21  ? 10.661  0.911   85.894  1.00 54.96  ? 17  GLN G C   1 
ATOM   6965  O O   . GLN G 1 21  ? 11.055  1.153   84.754  1.00 51.75  ? 17  GLN G O   1 
ATOM   6966  C CB  . GLN G 1 21  ? 8.315   0.168   86.369  1.00 55.08  ? 17  GLN G CB  1 
ATOM   6967  C CG  . GLN G 1 21  ? 7.301   -0.967  86.368  1.00 62.22  ? 17  GLN G CG  1 
ATOM   6968  C CD  . GLN G 1 21  ? 5.904   -0.506  86.742  1.00 63.40  ? 17  GLN G CD  1 
ATOM   6969  O OE1 . GLN G 1 21  ? 5.623   0.692   86.780  1.00 74.84  ? 17  GLN G OE1 1 
ATOM   6970  N NE2 . GLN G 1 21  ? 5.021   -1.458  87.023  1.00 44.44  ? 17  GLN G NE2 1 
ATOM   6971  N N   . SER G 1 22  ? 10.992  1.654   86.947  1.00 49.06  ? 18  SER G N   1 
ATOM   6972  C CA  . SER G 1 22  ? 11.856  2.822   86.815  1.00 31.33  ? 18  SER G CA  1 
ATOM   6973  C C   . SER G 1 22  ? 13.253  2.411   86.364  1.00 44.26  ? 18  SER G C   1 
ATOM   6974  O O   . SER G 1 22  ? 13.951  3.182   85.707  1.00 53.55  ? 18  SER G O   1 
ATOM   6975  C CB  . SER G 1 22  ? 11.933  3.598   88.132  1.00 42.98  ? 18  SER G CB  1 
ATOM   6976  O OG  . SER G 1 22  ? 12.547  2.838   89.161  1.00 52.75  ? 18  SER G OG  1 
ATOM   6977  N N   . LEU G 1 23  ? 13.652  1.194   86.717  1.00 51.62  ? 19  LEU G N   1 
ATOM   6978  C CA  . LEU G 1 23  ? 14.941  0.659   86.294  1.00 50.89  ? 19  LEU G CA  1 
ATOM   6979  C C   . LEU G 1 23  ? 14.917  0.329   84.807  1.00 43.58  ? 19  LEU G C   1 
ATOM   6980  O O   . LEU G 1 23  ? 15.858  0.636   84.081  1.00 49.77  ? 19  LEU G O   1 
ATOM   6981  C CB  . LEU G 1 23  ? 15.290  -0.594  87.099  1.00 51.07  ? 19  LEU G CB  1 
ATOM   6982  C CG  . LEU G 1 23  ? 15.996  -0.357  88.434  1.00 46.40  ? 19  LEU G CG  1 
ATOM   6983  C CD1 . LEU G 1 23  ? 15.868  -1.575  89.330  1.00 45.18  ? 19  LEU G CD1 1 
ATOM   6984  C CD2 . LEU G 1 23  ? 17.462  -0.020  88.201  1.00 45.00  ? 19  LEU G CD2 1 
ATOM   6985  N N   . GLN G 1 24  ? 13.832  -0.293  84.358  1.00 41.95  ? 20  GLN G N   1 
ATOM   6986  C CA  . GLN G 1 24  ? 13.698  -0.680  82.960  1.00 30.99  ? 20  GLN G CA  1 
ATOM   6987  C C   . GLN G 1 24  ? 13.661  0.550   82.063  1.00 43.19  ? 20  GLN G C   1 
ATOM   6988  O O   . GLN G 1 24  ? 14.377  0.619   81.064  1.00 54.21  ? 20  GLN G O   1 
ATOM   6989  C CB  . GLN G 1 24  ? 12.432  -1.512  82.753  1.00 33.76  ? 20  GLN G CB  1 
ATOM   6990  C CG  . GLN G 1 24  ? 12.299  -2.082  81.351  1.00 22.07  ? 20  GLN G CG  1 
ATOM   6991  C CD  . GLN G 1 24  ? 13.403  -3.068  81.018  1.00 39.58  ? 20  GLN G CD  1 
ATOM   6992  O OE1 . GLN G 1 24  ? 13.489  -4.143  81.612  1.00 55.04  ? 20  GLN G OE1 1 
ATOM   6993  N NE2 . GLN G 1 24  ? 14.258  -2.704  80.069  1.00 42.91  ? 20  GLN G NE2 1 
ATOM   6994  N N   . ARG G 1 25  ? 12.821  1.517   82.419  1.00 50.33  ? 21  ARG G N   1 
ATOM   6995  C CA  . ARG G 1 25  ? 12.723  2.761   81.663  1.00 48.32  ? 21  ARG G CA  1 
ATOM   6996  C C   . ARG G 1 25  ? 14.084  3.441   81.612  1.00 48.02  ? 21  ARG G C   1 
ATOM   6997  O O   . ARG G 1 25  ? 14.432  4.094   80.629  1.00 61.79  ? 21  ARG G O   1 
ATOM   6998  C CB  . ARG G 1 25  ? 11.697  3.700   82.300  1.00 46.49  ? 21  ARG G CB  1 
ATOM   6999  C CG  . ARG G 1 25  ? 10.275  3.164   82.282  1.00 64.45  ? 21  ARG G CG  1 
ATOM   7000  C CD  . ARG G 1 25  ? 9.271   4.213   82.727  1.00 79.10  ? 21  ARG G CD  1 
ATOM   7001  N NE  . ARG G 1 25  ? 8.284   3.665   83.655  1.00 100.15 ? 21  ARG G NE  1 
ATOM   7002  C CZ  . ARG G 1 25  ? 7.119   4.238   83.943  1.00 107.64 ? 21  ARG G CZ  1 
ATOM   7003  N NH1 . ARG G 1 25  ? 6.771   5.385   83.373  1.00 114.44 ? 21  ARG G NH1 1 
ATOM   7004  N NH2 . ARG G 1 25  ? 6.292   3.657   84.800  1.00 101.97 ? 21  ARG G NH2 1 
ATOM   7005  N N   . LEU G 1 26  ? 14.849  3.277   82.683  1.00 43.25  ? 22  LEU G N   1 
ATOM   7006  C CA  . LEU G 1 26  ? 16.174  3.868   82.780  1.00 34.62  ? 22  LEU G CA  1 
ATOM   7007  C C   . LEU G 1 26  ? 17.120  3.194   81.786  1.00 38.87  ? 22  LEU G C   1 
ATOM   7008  O O   . LEU G 1 26  ? 17.960  3.848   81.168  1.00 39.05  ? 22  LEU G O   1 
ATOM   7009  C CB  . LEU G 1 26  ? 16.691  3.726   84.211  1.00 28.01  ? 22  LEU G CB  1 
ATOM   7010  C CG  . LEU G 1 26  ? 17.698  4.763   84.695  1.00 49.47  ? 22  LEU G CG  1 
ATOM   7011  C CD1 . LEU G 1 26  ? 17.400  5.137   86.138  1.00 30.82  ? 22  LEU G CD1 1 
ATOM   7012  C CD2 . LEU G 1 26  ? 19.097  4.217   84.573  1.00 66.90  ? 22  LEU G CD2 1 
ATOM   7013  N N   . ILE G 1 27  ? 16.969  1.883   81.629  1.00 50.44  ? 23  ILE G N   1 
ATOM   7014  C CA  . ILE G 1 27  ? 17.765  1.122   80.672  1.00 47.31  ? 23  ILE G CA  1 
ATOM   7015  C C   . ILE G 1 27  ? 17.353  1.444   79.239  1.00 37.48  ? 23  ILE G C   1 
ATOM   7016  O O   . ILE G 1 27  ? 18.198  1.650   78.370  1.00 40.44  ? 23  ILE G O   1 
ATOM   7017  C CB  . ILE G 1 27  ? 17.602  -0.396  80.888  1.00 51.48  ? 23  ILE G CB  1 
ATOM   7018  C CG1 . ILE G 1 27  ? 18.144  -0.806  82.257  1.00 61.51  ? 23  ILE G CG1 1 
ATOM   7019  C CG2 . ILE G 1 27  ? 18.325  -1.172  79.794  1.00 49.78  ? 23  ILE G CG2 1 
ATOM   7020  C CD1 . ILE G 1 27  ? 17.754  -2.208  82.674  1.00 58.54  ? 23  ILE G CD1 1 
ATOM   7021  N N   . ASP G 1 28  ? 16.047  1.485   79.000  1.00 38.98  ? 24  ASP G N   1 
ATOM   7022  C CA  . ASP G 1 28  ? 15.515  1.684   77.657  1.00 54.05  ? 24  ASP G CA  1 
ATOM   7023  C C   . ASP G 1 28  ? 15.901  3.044   77.079  1.00 46.55  ? 24  ASP G C   1 
ATOM   7024  O O   . ASP G 1 28  ? 16.084  3.185   75.870  1.00 59.05  ? 24  ASP G O   1 
ATOM   7025  C CB  . ASP G 1 28  ? 13.989  1.547   77.670  1.00 70.87  ? 24  ASP G CB  1 
ATOM   7026  C CG  . ASP G 1 28  ? 13.531  0.140   78.010  1.00 64.59  ? 24  ASP G CG  1 
ATOM   7027  O OD1 . ASP G 1 28  ? 14.263  -0.822  77.694  1.00 68.49  ? 24  ASP G OD1 1 
ATOM   7028  O OD2 . ASP G 1 28  ? 12.437  -0.004  78.595  1.00 54.31  ? 24  ASP G OD2 1 
ATOM   7029  N N   . SER G 1 29  ? 16.022  4.041   77.947  1.00 40.40  ? 25  SER G N   1 
ATOM   7030  C CA  . SER G 1 29  ? 16.275  5.412   77.513  1.00 57.40  ? 25  SER G CA  1 
ATOM   7031  C C   . SER G 1 29  ? 17.700  5.642   77.002  1.00 64.34  ? 25  SER G C   1 
ATOM   7032  O O   . SER G 1 29  ? 17.988  6.683   76.410  1.00 65.23  ? 25  SER G O   1 
ATOM   7033  C CB  . SER G 1 29  ? 15.971  6.386   78.655  1.00 47.43  ? 25  SER G CB  1 
ATOM   7034  O OG  . SER G 1 29  ? 16.701  6.056   79.826  1.00 8.82   ? 25  SER G OG  1 
ATOM   7035  N N   . GLN G 1 30  ? 18.586  4.675   77.224  1.00 58.68  ? 26  GLN G N   1 
ATOM   7036  C CA  . GLN G 1 30  ? 19.992  4.828   76.859  1.00 37.30  ? 26  GLN G CA  1 
ATOM   7037  C C   . GLN G 1 30  ? 20.234  4.539   75.380  1.00 41.81  ? 26  GLN G C   1 
ATOM   7038  O O   . GLN G 1 30  ? 19.537  3.728   74.771  1.00 47.17  ? 26  GLN G O   1 
ATOM   7039  C CB  . GLN G 1 30  ? 20.860  3.907   77.716  1.00 33.03  ? 26  GLN G CB  1 
ATOM   7040  C CG  . GLN G 1 30  ? 20.671  4.099   79.211  1.00 34.66  ? 26  GLN G CG  1 
ATOM   7041  C CD  . GLN G 1 30  ? 20.938  5.523   79.657  1.00 42.65  ? 26  GLN G CD  1 
ATOM   7042  O OE1 . GLN G 1 30  ? 22.014  6.070   79.414  1.00 56.60  ? 26  GLN G OE1 1 
ATOM   7043  N NE2 . GLN G 1 30  ? 19.954  6.136   80.306  1.00 38.36  ? 26  GLN G NE2 1 
ATOM   7044  N N   . MET G 1 31  ? 21.234  5.208   74.814  1.00 51.66  ? 27  MET G N   1 
ATOM   7045  C CA  . MET G 1 31  ? 21.575  5.053   73.403  1.00 46.98  ? 27  MET G CA  1 
ATOM   7046  C C   . MET G 1 31  ? 22.520  3.870   73.215  1.00 46.68  ? 27  MET G C   1 
ATOM   7047  O O   . MET G 1 31  ? 23.626  3.849   73.757  1.00 43.73  ? 27  MET G O   1 
ATOM   7048  C CB  . MET G 1 31  ? 22.236  6.328   72.887  1.00 29.67  ? 27  MET G CB  1 
ATOM   7049  C CG  . MET G 1 31  ? 22.142  6.516   71.388  1.00 27.72  ? 27  MET G CG  1 
ATOM   7050  S SD  . MET G 1 31  ? 23.019  7.988   70.833  1.00 54.81  ? 27  MET G SD  1 
ATOM   7051  C CE  . MET G 1 31  ? 24.713  7.522   71.175  1.00 20.06  ? 27  MET G CE  1 
ATOM   7052  N N   . GLU G 1 32  ? 22.080  2.894   72.430  1.00 35.18  ? 28  GLU G N   1 
ATOM   7053  C CA  . GLU G 1 32  ? 22.786  1.623   72.314  1.00 45.97  ? 28  GLU G CA  1 
ATOM   7054  C C   . GLU G 1 32  ? 24.195  1.754   71.740  1.00 59.55  ? 28  GLU G C   1 
ATOM   7055  O O   . GLU G 1 32  ? 25.079  0.962   72.070  1.00 48.33  ? 28  GLU G O   1 
ATOM   7056  C CB  . GLU G 1 32  ? 21.972  0.646   71.462  1.00 43.37  ? 28  GLU G CB  1 
ATOM   7057  C CG  . GLU G 1 32  ? 20.567  0.381   71.983  1.00 45.46  ? 28  GLU G CG  1 
ATOM   7058  C CD  . GLU G 1 32  ? 19.978  -0.893  71.418  1.00 54.54  ? 28  GLU G CD  1 
ATOM   7059  O OE1 . GLU G 1 32  ? 20.285  -1.976  71.958  1.00 61.22  ? 28  GLU G OE1 1 
ATOM   7060  O OE2 . GLU G 1 32  ? 19.212  -0.812  70.434  1.00 53.11  ? 28  GLU G OE2 1 
ATOM   7061  N N   . THR G 1 33  ? 24.406  2.751   70.888  1.00 70.43  ? 29  THR G N   1 
ATOM   7062  C CA  . THR G 1 33  ? 25.687  2.925   70.216  1.00 68.43  ? 29  THR G CA  1 
ATOM   7063  C C   . THR G 1 33  ? 26.612  3.829   71.019  1.00 63.66  ? 29  THR G C   1 
ATOM   7064  O O   . THR G 1 33  ? 27.424  4.569   70.459  1.00 77.15  ? 29  THR G O   1 
ATOM   7065  C CB  . THR G 1 33  ? 25.479  3.539   68.838  1.00 81.44  ? 29  THR G CB  1 
ATOM   7066  O OG1 . THR G 1 33  ? 24.325  2.948   68.230  1.00 79.81  ? 29  THR G OG1 1 
ATOM   7067  C CG2 . THR G 1 33  ? 26.694  3.310   67.954  1.00 86.19  ? 29  THR G CG2 1 
ATOM   7068  N N   . SER G 1 34  ? 26.484  3.771   72.337  1.00 64.39  ? 30  SER G N   1 
ATOM   7069  C CA  . SER G 1 34  ? 27.341  4.547   73.212  1.00 73.13  ? 30  SER G CA  1 
ATOM   7070  C C   . SER G 1 34  ? 28.670  3.854   73.442  1.00 76.11  ? 30  SER G C   1 
ATOM   7071  O O   . SER G 1 34  ? 28.752  2.625   73.492  1.00 87.25  ? 30  SER G O   1 
ATOM   7072  C CB  . SER G 1 34  ? 26.657  4.762   74.557  1.00 79.74  ? 30  SER G CB  1 
ATOM   7073  O OG  . SER G 1 34  ? 27.500  5.467   75.453  1.00 78.68  ? 30  SER G OG  1 
ATOM   7074  N N   . CYS G 1 35  ? 29.715  4.656   73.595  1.00 69.74  ? 31  CYS G N   1 
ATOM   7075  C CA  . CYS G 1 35  ? 31.018  4.130   73.959  1.00 69.85  ? 31  CYS G CA  1 
ATOM   7076  C C   . CYS G 1 35  ? 30.886  3.365   75.267  1.00 72.68  ? 31  CYS G C   1 
ATOM   7077  O O   . CYS G 1 35  ? 29.905  3.529   75.995  1.00 78.62  ? 31  CYS G O   1 
ATOM   7078  C CB  . CYS G 1 35  ? 32.045  5.259   74.084  1.00 72.32  ? 31  CYS G CB  1 
ATOM   7079  S SG  . CYS G 1 35  ? 31.414  6.786   74.822  1.00 75.35  ? 31  CYS G SG  1 
ATOM   7080  N N   . GLN G 1 36  ? 31.867  2.520   75.558  1.00 63.24  ? 32  GLN G N   1 
ATOM   7081  C CA  . GLN G 1 36  ? 31.843  1.735   76.783  1.00 53.00  ? 32  GLN G CA  1 
ATOM   7082  C C   . GLN G 1 36  ? 32.586  2.465   77.898  1.00 57.01  ? 32  GLN G C   1 
ATOM   7083  O O   . GLN G 1 36  ? 33.477  3.274   77.637  1.00 64.71  ? 32  GLN G O   1 
ATOM   7084  C CB  . GLN G 1 36  ? 32.445  0.350   76.539  1.00 53.53  ? 32  GLN G CB  1 
ATOM   7085  C CG  . GLN G 1 36  ? 31.833  -0.374  75.347  1.00 60.51  ? 32  GLN G CG  1 
ATOM   7086  C CD  . GLN G 1 36  ? 32.004  -1.879  75.418  1.00 68.93  ? 32  GLN G CD  1 
ATOM   7087  O OE1 . GLN G 1 36  ? 31.047  -2.613  75.667  1.00 66.83  ? 32  GLN G OE1 1 
ATOM   7088  N NE2 . GLN G 1 36  ? 33.225  -2.347  75.196  1.00 78.61  ? 32  GLN G NE2 1 
ATOM   7089  N N   . ILE G 1 37  ? 32.206  2.181   79.141  1.00 45.88  ? 33  ILE G N   1 
ATOM   7090  C CA  . ILE G 1 37  ? 32.775  2.869   80.294  1.00 41.24  ? 33  ILE G CA  1 
ATOM   7091  C C   . ILE G 1 37  ? 33.400  1.887   81.280  1.00 53.55  ? 33  ILE G C   1 
ATOM   7092  O O   . ILE G 1 37  ? 33.120  0.689   81.245  1.00 60.77  ? 33  ILE G O   1 
ATOM   7093  C CB  . ILE G 1 37  ? 31.706  3.696   81.031  1.00 40.44  ? 33  ILE G CB  1 
ATOM   7094  C CG1 . ILE G 1 37  ? 30.628  2.782   81.621  1.00 27.25  ? 33  ILE G CG1 1 
ATOM   7095  C CG2 . ILE G 1 37  ? 31.082  4.708   80.083  1.00 39.81  ? 33  ILE G CG2 1 
ATOM   7096  C CD1 . ILE G 1 37  ? 29.646  3.499   82.528  1.00 26.62  ? 33  ILE G CD1 1 
ATOM   7097  N N   . THR G 1 38  ? 34.242  2.410   82.167  1.00 47.81  ? 34  THR G N   1 
ATOM   7098  C CA  . THR G 1 38  ? 34.928  1.593   83.161  1.00 36.81  ? 34  THR G CA  1 
ATOM   7099  C C   . THR G 1 38  ? 34.263  1.727   84.527  1.00 39.13  ? 34  THR G C   1 
ATOM   7100  O O   . THR G 1 38  ? 34.024  2.838   85.002  1.00 57.51  ? 34  THR G O   1 
ATOM   7101  C CB  . THR G 1 38  ? 36.410  2.003   83.289  1.00 52.26  ? 34  THR G CB  1 
ATOM   7102  O OG1 . THR G 1 38  ? 37.097  1.719   82.063  1.00 51.43  ? 34  THR G OG1 1 
ATOM   7103  C CG2 . THR G 1 38  ? 37.083  1.250   84.424  1.00 60.01  ? 34  THR G CG2 1 
ATOM   7104  N N   . PHE G 1 39  ? 33.968  0.596   85.159  1.00 30.81  ? 35  PHE G N   1 
ATOM   7105  C CA  . PHE G 1 39  ? 33.393  0.610   86.500  1.00 38.80  ? 35  PHE G CA  1 
ATOM   7106  C C   . PHE G 1 39  ? 33.741  -0.656  87.271  1.00 54.43  ? 35  PHE G C   1 
ATOM   7107  O O   . PHE G 1 39  ? 34.037  -1.696  86.683  1.00 43.82  ? 35  PHE G O   1 
ATOM   7108  C CB  . PHE G 1 39  ? 31.872  0.773   86.437  1.00 37.77  ? 35  PHE G CB  1 
ATOM   7109  C CG  . PHE G 1 39  ? 31.164  -0.370  85.766  1.00 28.42  ? 35  PHE G CG  1 
ATOM   7110  C CD1 . PHE G 1 39  ? 30.871  -1.530  86.464  1.00 38.34  ? 35  PHE G CD1 1 
ATOM   7111  C CD2 . PHE G 1 39  ? 30.784  -0.280  84.437  1.00 36.55  ? 35  PHE G CD2 1 
ATOM   7112  C CE1 . PHE G 1 39  ? 30.214  -2.582  85.848  1.00 36.62  ? 35  PHE G CE1 1 
ATOM   7113  C CE2 . PHE G 1 39  ? 30.129  -1.326  83.816  1.00 45.43  ? 35  PHE G CE2 1 
ATOM   7114  C CZ  . PHE G 1 39  ? 29.844  -2.478  84.522  1.00 47.89  ? 35  PHE G CZ  1 
ATOM   7115  N N   . GLU G 1 40  ? 33.705  -0.554  88.596  1.00 72.81  ? 36  GLU G N   1 
ATOM   7116  C CA  . GLU G 1 40  ? 33.963  -1.693  89.465  1.00 68.04  ? 36  GLU G CA  1 
ATOM   7117  C C   . GLU G 1 40  ? 32.659  -2.419  89.754  1.00 50.06  ? 36  GLU G C   1 
ATOM   7118  O O   . GLU G 1 40  ? 31.626  -1.786  89.965  1.00 50.53  ? 36  GLU G O   1 
ATOM   7119  C CB  . GLU G 1 40  ? 34.594  -1.225  90.777  1.00 79.83  ? 36  GLU G CB  1 
ATOM   7120  C CG  . GLU G 1 40  ? 35.940  -0.551  90.603  1.00 95.63  ? 36  GLU G CG  1 
ATOM   7121  C CD  . GLU G 1 40  ? 36.998  -1.501  90.080  1.00 113.73 ? 36  GLU G CD  1 
ATOM   7122  O OE1 . GLU G 1 40  ? 36.847  -2.725  90.275  1.00 118.59 ? 36  GLU G OE1 1 
ATOM   7123  O OE2 . GLU G 1 40  ? 37.978  -1.024  89.470  1.00 118.48 ? 36  GLU G OE2 1 
ATOM   7124  N N   . PHE G 1 41  ? 32.705  -3.746  89.763  1.00 48.43  ? 37  PHE G N   1 
ATOM   7125  C CA  . PHE G 1 41  ? 31.516  -4.535  90.060  1.00 60.13  ? 37  PHE G CA  1 
ATOM   7126  C C   . PHE G 1 41  ? 31.881  -5.968  90.424  1.00 74.88  ? 37  PHE G C   1 
ATOM   7127  O O   . PHE G 1 41  ? 33.030  -6.385  90.276  1.00 77.93  ? 37  PHE G O   1 
ATOM   7128  C CB  . PHE G 1 41  ? 30.561  -4.518  88.864  1.00 50.62  ? 37  PHE G CB  1 
ATOM   7129  C CG  . PHE G 1 41  ? 29.127  -4.792  89.226  1.00 45.68  ? 37  PHE G CG  1 
ATOM   7130  C CD1 . PHE G 1 41  ? 28.426  -3.916  90.040  1.00 38.73  ? 37  PHE G CD1 1 
ATOM   7131  C CD2 . PHE G 1 41  ? 28.482  -5.923  88.756  1.00 49.61  ? 37  PHE G CD2 1 
ATOM   7132  C CE1 . PHE G 1 41  ? 27.107  -4.161  90.375  1.00 44.35  ? 37  PHE G CE1 1 
ATOM   7133  C CE2 . PHE G 1 41  ? 27.161  -6.172  89.087  1.00 58.00  ? 37  PHE G CE2 1 
ATOM   7134  C CZ  . PHE G 1 41  ? 26.474  -5.291  89.898  1.00 47.56  ? 37  PHE G CZ  1 
ATOM   7135  N N   . VAL G 1 42  ? 30.893  -6.717  90.901  1.00 83.32  ? 38  VAL G N   1 
ATOM   7136  C CA  . VAL G 1 42  ? 31.109  -8.094  91.327  1.00 70.27  ? 38  VAL G CA  1 
ATOM   7137  C C   . VAL G 1 42  ? 31.305  -9.022  90.131  1.00 74.18  ? 38  VAL G C   1 
ATOM   7138  O O   . VAL G 1 42  ? 30.618  -8.899  89.116  1.00 72.59  ? 38  VAL G O   1 
ATOM   7139  C CB  . VAL G 1 42  ? 29.922  -8.611  92.168  1.00 57.85  ? 38  VAL G CB  1 
ATOM   7140  C CG1 . VAL G 1 42  ? 30.178  -10.035 92.633  1.00 54.70  ? 38  VAL G CG1 1 
ATOM   7141  C CG2 . VAL G 1 42  ? 29.677  -7.701  93.360  1.00 54.08  ? 38  VAL G CG2 1 
ATOM   7142  N N   . ASP G 1 43  ? 32.249  -9.950  90.261  1.00 75.00  ? 39  ASP G N   1 
ATOM   7143  C CA  . ASP G 1 43  ? 32.497  -10.943 89.221  1.00 68.01  ? 39  ASP G CA  1 
ATOM   7144  C C   . ASP G 1 43  ? 31.646  -12.177 89.484  1.00 73.43  ? 39  ASP G C   1 
ATOM   7145  O O   . ASP G 1 43  ? 31.802  -12.844 90.508  1.00 77.05  ? 39  ASP G O   1 
ATOM   7146  C CB  . ASP G 1 43  ? 33.979  -11.326 89.181  1.00 65.63  ? 39  ASP G CB  1 
ATOM   7147  C CG  . ASP G 1 43  ? 34.343  -12.119 87.941  1.00 75.07  ? 39  ASP G CG  1 
ATOM   7148  O OD1 . ASP G 1 43  ? 33.510  -12.191 87.013  1.00 81.79  ? 39  ASP G OD1 1 
ATOM   7149  O OD2 . ASP G 1 43  ? 35.465  -12.663 87.890  1.00 77.86  ? 39  ASP G OD2 1 
ATOM   7150  N N   . GLN G 1 44  ? 30.749  -12.480 88.552  1.00 70.54  ? 40  GLN G N   1 
ATOM   7151  C CA  . GLN G 1 44  ? 29.803  -13.577 88.722  1.00 69.05  ? 40  GLN G CA  1 
ATOM   7152  C C   . GLN G 1 44  ? 30.509  -14.931 88.754  1.00 57.68  ? 40  GLN G C   1 
ATOM   7153  O O   . GLN G 1 44  ? 29.911  -15.937 89.134  1.00 66.48  ? 40  GLN G O   1 
ATOM   7154  C CB  . GLN G 1 44  ? 28.762  -13.553 87.600  1.00 88.19  ? 40  GLN G CB  1 
ATOM   7155  C CG  . GLN G 1 44  ? 27.533  -14.408 87.870  1.00 94.67  ? 40  GLN G CG  1 
ATOM   7156  C CD  . GLN G 1 44  ? 26.464  -14.244 86.806  1.00 100.45 ? 40  GLN G CD  1 
ATOM   7157  O OE1 . GLN G 1 44  ? 26.518  -13.321 85.994  1.00 101.81 ? 40  GLN G OE1 1 
ATOM   7158  N NE2 . GLN G 1 44  ? 25.487  -15.143 86.803  1.00 107.28 ? 40  GLN G NE2 1 
ATOM   7159  N N   . GLU G 1 45  ? 31.777  -14.956 88.356  1.00 50.74  ? 41  GLU G N   1 
ATOM   7160  C CA  . GLU G 1 45  ? 32.552  -16.193 88.356  1.00 53.84  ? 41  GLU G CA  1 
ATOM   7161  C C   . GLU G 1 45  ? 33.282  -16.408 89.681  1.00 51.94  ? 41  GLU G C   1 
ATOM   7162  O O   . GLU G 1 45  ? 33.360  -17.533 90.177  1.00 32.91  ? 41  GLU G O   1 
ATOM   7163  C CB  . GLU G 1 45  ? 33.559  -16.191 87.203  1.00 60.68  ? 41  GLU G CB  1 
ATOM   7164  C CG  . GLU G 1 45  ? 32.926  -16.223 85.820  1.00 77.54  ? 41  GLU G CG  1 
ATOM   7165  C CD  . GLU G 1 45  ? 32.226  -17.535 85.522  1.00 91.07  ? 41  GLU G CD  1 
ATOM   7166  O OE1 . GLU G 1 45  ? 32.236  -18.432 86.393  1.00 90.76  ? 41  GLU G OE1 1 
ATOM   7167  O OE2 . GLU G 1 45  ? 31.668  -17.672 84.412  1.00 96.23  ? 41  GLU G OE2 1 
ATOM   7168  N N   . GLN G 1 46  ? 33.824  -15.335 90.247  1.00 61.77  ? 42  GLN G N   1 
ATOM   7169  C CA  . GLN G 1 46  ? 34.509  -15.423 91.532  1.00 54.91  ? 42  GLN G CA  1 
ATOM   7170  C C   . GLN G 1 46  ? 33.509  -15.680 92.659  1.00 53.40  ? 42  GLN G C   1 
ATOM   7171  O O   . GLN G 1 46  ? 33.807  -16.406 93.607  1.00 54.19  ? 42  GLN G O   1 
ATOM   7172  C CB  . GLN G 1 46  ? 35.321  -14.155 91.803  1.00 59.29  ? 42  GLN G CB  1 
ATOM   7173  C CG  . GLN G 1 46  ? 36.544  -14.013 90.904  1.00 79.73  ? 42  GLN G CG  1 
ATOM   7174  C CD  . GLN G 1 46  ? 37.489  -12.915 91.357  1.00 85.42  ? 42  GLN G CD  1 
ATOM   7175  O OE1 . GLN G 1 46  ? 37.129  -12.068 92.173  1.00 89.84  ? 42  GLN G OE1 1 
ATOM   7176  N NE2 . GLN G 1 46  ? 38.710  -12.931 90.833  1.00 78.02  ? 42  GLN G NE2 1 
ATOM   7177  N N   . LEU G 1 47  ? 32.323  -15.088 92.547  1.00 56.34  ? 43  LEU G N   1 
ATOM   7178  C CA  . LEU G 1 47  ? 31.240  -15.351 93.490  1.00 64.23  ? 43  LEU G CA  1 
ATOM   7179  C C   . LEU G 1 47  ? 30.090  -16.068 92.790  1.00 75.30  ? 43  LEU G C   1 
ATOM   7180  O O   . LEU G 1 47  ? 29.171  -15.430 92.276  1.00 74.83  ? 43  LEU G O   1 
ATOM   7181  C CB  . LEU G 1 47  ? 30.737  -14.048 94.120  1.00 61.20  ? 43  LEU G CB  1 
ATOM   7182  C CG  . LEU G 1 47  ? 31.377  -13.597 95.437  1.00 51.79  ? 43  LEU G CG  1 
ATOM   7183  C CD1 . LEU G 1 47  ? 30.679  -12.344 95.946  1.00 37.55  ? 43  LEU G CD1 1 
ATOM   7184  C CD2 . LEU G 1 47  ? 31.332  -14.697 96.494  1.00 46.38  ? 43  LEU G CD2 1 
ATOM   7185  N N   . LYS G 1 48  ? 30.150  -17.396 92.763  1.00 80.88  ? 44  LYS G N   1 
ATOM   7186  C CA  . LYS G 1 48  ? 29.095  -18.193 92.148  1.00 84.57  ? 44  LYS G CA  1 
ATOM   7187  C C   . LYS G 1 48  ? 27.856  -18.224 93.037  1.00 83.89  ? 44  LYS G C   1 
ATOM   7188  O O   . LYS G 1 48  ? 26.730  -18.214 92.541  1.00 87.58  ? 44  LYS G O   1 
ATOM   7189  C CB  . LYS G 1 48  ? 29.583  -19.619 91.883  1.00 80.40  ? 44  LYS G CB  1 
ATOM   7190  N N   . ASP G 1 49  ? 28.069  -18.256 94.349  1.00 79.78  ? 45  ASP G N   1 
ATOM   7191  C CA  . ASP G 1 49  ? 26.967  -18.291 95.302  1.00 81.60  ? 45  ASP G CA  1 
ATOM   7192  C C   . ASP G 1 49  ? 26.048  -17.090 95.098  1.00 90.97  ? 45  ASP G C   1 
ATOM   7193  O O   . ASP G 1 49  ? 26.414  -15.963 95.431  1.00 94.85  ? 45  ASP G O   1 
ATOM   7194  C CB  . ASP G 1 49  ? 27.501  -18.294 96.733  1.00 69.58  ? 45  ASP G CB  1 
ATOM   7195  C CG  . ASP G 1 49  ? 26.394  -18.369 97.765  1.00 67.38  ? 45  ASP G CG  1 
ATOM   7196  O OD1 . ASP G 1 49  ? 25.271  -18.783 97.404  1.00 59.81  ? 45  ASP G OD1 1 
ATOM   7197  O OD2 . ASP G 1 49  ? 26.642  -18.012 98.936  1.00 70.52  ? 45  ASP G OD2 1 
ATOM   7198  N N   . PRO G 1 50  ? 24.844  -17.330 94.556  1.00 86.44  ? 46  PRO G N   1 
ATOM   7199  C CA  . PRO G 1 50  ? 23.895  -16.258 94.233  1.00 84.63  ? 46  PRO G CA  1 
ATOM   7200  C C   . PRO G 1 50  ? 23.636  -15.302 95.398  1.00 73.43  ? 46  PRO G C   1 
ATOM   7201  O O   . PRO G 1 50  ? 23.623  -14.087 95.201  1.00 65.90  ? 46  PRO G O   1 
ATOM   7202  C CB  . PRO G 1 50  ? 22.617  -17.022 93.876  1.00 85.10  ? 46  PRO G CB  1 
ATOM   7203  C CG  . PRO G 1 50  ? 23.093  -18.345 93.404  1.00 79.45  ? 46  PRO G CG  1 
ATOM   7204  C CD  . PRO G 1 50  ? 24.296  -18.660 94.236  1.00 79.30  ? 46  PRO G CD  1 
ATOM   7205  N N   . VAL G 1 51  ? 23.426  -15.843 96.592  1.00 71.53  ? 47  VAL G N   1 
ATOM   7206  C CA  . VAL G 1 51  ? 23.161  -15.013 97.762  1.00 62.23  ? 47  VAL G CA  1 
ATOM   7207  C C   . VAL G 1 51  ? 24.348  -14.105 98.067  1.00 63.58  ? 47  VAL G C   1 
ATOM   7208  O O   . VAL G 1 51  ? 24.205  -12.884 98.131  1.00 58.53  ? 47  VAL G O   1 
ATOM   7209  C CB  . VAL G 1 51  ? 22.847  -15.869 99.003  1.00 44.47  ? 47  VAL G CB  1 
ATOM   7210  C CG1 . VAL G 1 51  ? 22.814  -15.005 100.258 1.00 25.55  ? 47  VAL G CG1 1 
ATOM   7211  C CG2 . VAL G 1 51  ? 21.528  -16.602 98.817  1.00 46.19  ? 47  VAL G CG2 1 
ATOM   7212  N N   . CYS G 1 52  ? 25.519  -14.707 98.250  1.00 63.76  ? 48  CYS G N   1 
ATOM   7213  C CA  . CYS G 1 52  ? 26.723  -13.955 98.592  1.00 65.82  ? 48  CYS G CA  1 
ATOM   7214  C C   . CYS G 1 52  ? 27.142  -13.000 97.477  1.00 38.89  ? 48  CYS G C   1 
ATOM   7215  O O   . CYS G 1 52  ? 27.834  -12.013 97.722  1.00 41.67  ? 48  CYS G O   1 
ATOM   7216  C CB  . CYS G 1 52  ? 27.866  -14.911 98.932  1.00 76.43  ? 48  CYS G CB  1 
ATOM   7217  S SG  . CYS G 1 52  ? 27.625  -15.791 100.494 1.00 65.60  ? 48  CYS G SG  1 
ATOM   7218  N N   . TYR G 1 53  ? 26.721  -13.293 96.254  1.00 36.07  ? 49  TYR G N   1 
ATOM   7219  C CA  . TYR G 1 53  ? 26.961  -12.386 95.143  1.00 49.39  ? 49  TYR G CA  1 
ATOM   7220  C C   . TYR G 1 53  ? 26.117  -11.132 95.333  1.00 49.09  ? 49  TYR G C   1 
ATOM   7221  O O   . TYR G 1 53  ? 26.619  -10.013 95.244  1.00 37.88  ? 49  TYR G O   1 
ATOM   7222  C CB  . TYR G 1 53  ? 26.624  -13.060 93.812  1.00 49.74  ? 49  TYR G CB  1 
ATOM   7223  C CG  . TYR G 1 53  ? 26.528  -12.097 92.653  1.00 44.81  ? 49  TYR G CG  1 
ATOM   7224  C CD1 . TYR G 1 53  ? 27.661  -11.705 91.957  1.00 46.56  ? 49  TYR G CD1 1 
ATOM   7225  C CD2 . TYR G 1 53  ? 25.304  -11.573 92.260  1.00 54.91  ? 49  TYR G CD2 1 
ATOM   7226  C CE1 . TYR G 1 53  ? 27.578  -10.822 90.899  1.00 63.24  ? 49  TYR G CE1 1 
ATOM   7227  C CE2 . TYR G 1 53  ? 25.211  -10.690 91.204  1.00 56.14  ? 49  TYR G CE2 1 
ATOM   7228  C CZ  . TYR G 1 53  ? 26.351  -10.317 90.528  1.00 61.29  ? 49  TYR G CZ  1 
ATOM   7229  O OH  . TYR G 1 53  ? 26.264  -9.436  89.475  1.00 66.01  ? 49  TYR G OH  1 
ATOM   7230  N N   . LEU G 1 54  ? 24.833  -11.332 95.612  1.00 52.49  ? 50  LEU G N   1 
ATOM   7231  C CA  . LEU G 1 54  ? 23.897  -10.226 95.753  1.00 39.76  ? 50  LEU G CA  1 
ATOM   7232  C C   . LEU G 1 54  ? 24.163  -9.405  97.011  1.00 38.43  ? 50  LEU G C   1 
ATOM   7233  O O   . LEU G 1 54  ? 23.888  -8.206  97.041  1.00 47.97  ? 50  LEU G O   1 
ATOM   7234  C CB  . LEU G 1 54  ? 22.462  -10.751 95.766  1.00 50.51  ? 50  LEU G CB  1 
ATOM   7235  C CG  . LEU G 1 54  ? 21.982  -11.340 94.438  1.00 59.14  ? 50  LEU G CG  1 
ATOM   7236  C CD1 . LEU G 1 54  ? 20.645  -12.037 94.615  1.00 68.67  ? 50  LEU G CD1 1 
ATOM   7237  C CD2 . LEU G 1 54  ? 21.883  -10.255 93.374  1.00 51.04  ? 50  LEU G CD2 1 
ATOM   7238  N N   . LYS G 1 55  ? 24.694  -10.047 98.047  1.00 30.97  ? 51  LYS G N   1 
ATOM   7239  C CA  . LYS G 1 55  ? 25.006  -9.343  99.286  1.00 36.85  ? 51  LYS G CA  1 
ATOM   7240  C C   . LYS G 1 55  ? 26.056  -8.271  99.039  1.00 43.20  ? 51  LYS G C   1 
ATOM   7241  O O   . LYS G 1 55  ? 25.855  -7.104  99.369  1.00 43.33  ? 51  LYS G O   1 
ATOM   7242  C CB  . LYS G 1 55  ? 25.499  -10.314 100.360 1.00 43.61  ? 51  LYS G CB  1 
ATOM   7243  C CG  . LYS G 1 55  ? 24.394  -11.130 101.020 1.00 59.59  ? 51  LYS G CG  1 
ATOM   7244  C CD  . LYS G 1 55  ? 24.874  -11.792 102.304 1.00 57.33  ? 51  LYS G CD  1 
ATOM   7245  C CE  . LYS G 1 55  ? 25.146  -10.770 103.397 1.00 41.03  ? 51  LYS G CE  1 
ATOM   7246  N NZ  . LYS G 1 55  ? 25.456  -11.414 104.703 1.00 30.63  ? 51  LYS G NZ  1 
ATOM   7247  N N   . LYS G 1 56  ? 27.176  -8.670  98.449  1.00 52.33  ? 52  LYS G N   1 
ATOM   7248  C CA  . LYS G 1 56  ? 28.247  -7.729  98.166  1.00 45.02  ? 52  LYS G CA  1 
ATOM   7249  C C   . LYS G 1 56  ? 27.857  -6.772  97.049  1.00 44.12  ? 52  LYS G C   1 
ATOM   7250  O O   . LYS G 1 56  ? 28.094  -5.569  97.143  1.00 47.68  ? 52  LYS G O   1 
ATOM   7251  C CB  . LYS G 1 56  ? 29.520  -8.463  97.775  1.00 52.86  ? 52  LYS G CB  1 
ATOM   7252  C CG  . LYS G 1 56  ? 30.627  -7.523  97.400  1.00 53.86  ? 52  LYS G CG  1 
ATOM   7253  C CD  . LYS G 1 56  ? 31.864  -8.268  97.029  1.00 48.11  ? 52  LYS G CD  1 
ATOM   7254  C CE  . LYS G 1 56  ? 33.045  -7.359  97.176  1.00 51.36  ? 52  LYS G CE  1 
ATOM   7255  N NZ  . LYS G 1 56  ? 33.689  -7.467  98.511  1.00 41.75  ? 52  LYS G NZ  1 
ATOM   7256  N N   . ALA G 1 57  ? 27.264  -7.314  95.989  1.00 45.74  ? 53  ALA G N   1 
ATOM   7257  C CA  . ALA G 1 57  ? 26.845  -6.500  94.855  1.00 38.47  ? 53  ALA G CA  1 
ATOM   7258  C C   . ALA G 1 57  ? 25.946  -5.368  95.332  1.00 43.20  ? 53  ALA G C   1 
ATOM   7259  O O   . ALA G 1 57  ? 25.967  -4.270  94.780  1.00 47.69  ? 53  ALA G O   1 
ATOM   7260  C CB  . ALA G 1 57  ? 26.120  -7.350  93.827  1.00 25.61  ? 53  ALA G CB  1 
ATOM   7261  N N   . PHE G 1 58  ? 25.161  -5.642  96.366  1.00 47.22  ? 54  PHE G N   1 
ATOM   7262  C CA  . PHE G 1 58  ? 24.250  -4.648  96.910  1.00 44.00  ? 54  PHE G CA  1 
ATOM   7263  C C   . PHE G 1 58  ? 25.011  -3.475  97.519  1.00 51.25  ? 54  PHE G C   1 
ATOM   7264  O O   . PHE G 1 58  ? 24.529  -2.343  97.515  1.00 63.87  ? 54  PHE G O   1 
ATOM   7265  C CB  . PHE G 1 58  ? 23.340  -5.277  97.962  1.00 40.92  ? 54  PHE G CB  1 
ATOM   7266  C CG  . PHE G 1 58  ? 22.397  -4.303  98.592  1.00 57.77  ? 54  PHE G CG  1 
ATOM   7267  C CD1 . PHE G 1 58  ? 21.205  -3.976  97.971  1.00 64.96  ? 54  PHE G CD1 1 
ATOM   7268  C CD2 . PHE G 1 58  ? 22.709  -3.700  99.797  1.00 65.33  ? 54  PHE G CD2 1 
ATOM   7269  C CE1 . PHE G 1 58  ? 20.338  -3.071  98.546  1.00 68.07  ? 54  PHE G CE1 1 
ATOM   7270  C CE2 . PHE G 1 58  ? 21.845  -2.797  100.378 1.00 61.93  ? 54  PHE G CE2 1 
ATOM   7271  C CZ  . PHE G 1 58  ? 20.660  -2.481  99.752  1.00 64.93  ? 54  PHE G CZ  1 
ATOM   7272  N N   . LEU G 1 59  ? 26.200  -3.749  98.046  1.00 60.84  ? 55  LEU G N   1 
ATOM   7273  C CA  . LEU G 1 59  ? 27.022  -2.708  98.652  1.00 55.88  ? 55  LEU G CA  1 
ATOM   7274  C C   . LEU G 1 59  ? 27.724  -1.859  97.593  1.00 48.77  ? 55  LEU G C   1 
ATOM   7275  O O   . LEU G 1 59  ? 28.087  -0.709  97.849  1.00 48.53  ? 55  LEU G O   1 
ATOM   7276  C CB  . LEU G 1 59  ? 28.060  -3.329  99.590  1.00 47.88  ? 55  LEU G CB  1 
ATOM   7277  C CG  . LEU G 1 59  ? 27.510  -4.111  100.786 1.00 50.12  ? 55  LEU G CG  1 
ATOM   7278  C CD1 . LEU G 1 59  ? 28.652  -4.640  101.646 1.00 50.51  ? 55  LEU G CD1 1 
ATOM   7279  C CD2 . LEU G 1 59  ? 26.567  -3.250  101.613 1.00 42.89  ? 55  LEU G CD2 1 
ATOM   7280  N N   . LEU G 1 60  ? 27.914  -2.424  96.406  1.00 37.80  ? 56  LEU G N   1 
ATOM   7281  C CA  . LEU G 1 60  ? 28.618  -1.721  95.341  1.00 53.85  ? 56  LEU G CA  1 
ATOM   7282  C C   . LEU G 1 60  ? 27.704  -0.783  94.561  1.00 71.76  ? 56  LEU G C   1 
ATOM   7283  O O   . LEU G 1 60  ? 28.093  0.338   94.236  1.00 81.42  ? 56  LEU G O   1 
ATOM   7284  C CB  . LEU G 1 60  ? 29.275  -2.720  94.386  1.00 49.52  ? 56  LEU G CB  1 
ATOM   7285  C CG  . LEU G 1 60  ? 30.513  -3.444  94.921  1.00 41.55  ? 56  LEU G CG  1 
ATOM   7286  C CD1 . LEU G 1 60  ? 31.048  -4.393  93.870  1.00 37.42  ? 56  LEU G CD1 1 
ATOM   7287  C CD2 . LEU G 1 60  ? 31.592  -2.457  95.336  1.00 55.12  ? 56  LEU G CD2 1 
ATOM   7288  N N   . VAL G 1 61  ? 26.491  -1.240  94.263  1.00 80.15  ? 57  VAL G N   1 
ATOM   7289  C CA  . VAL G 1 61  ? 25.554  -0.441  93.477  1.00 79.30  ? 57  VAL G CA  1 
ATOM   7290  C C   . VAL G 1 61  ? 25.388  0.956   94.067  1.00 86.56  ? 57  VAL G C   1 
ATOM   7291  O O   . VAL G 1 61  ? 25.176  1.924   93.338  1.00 88.36  ? 57  VAL G O   1 
ATOM   7292  C CB  . VAL G 1 61  ? 24.165  -1.107  93.378  1.00 66.81  ? 57  VAL G CB  1 
ATOM   7293  C CG1 . VAL G 1 61  ? 24.255  -2.420  92.615  1.00 70.27  ? 57  VAL G CG1 1 
ATOM   7294  C CG2 . VAL G 1 61  ? 23.569  -1.320  94.761  1.00 51.92  ? 57  VAL G CG2 1 
ATOM   7295  N N   . GLN G 1 62  ? 25.489  1.056   95.388  1.00 80.42  ? 58  GLN G N   1 
ATOM   7296  C CA  . GLN G 1 62  ? 25.346  2.336   96.066  1.00 77.81  ? 58  GLN G CA  1 
ATOM   7297  C C   . GLN G 1 62  ? 26.469  3.291   95.663  1.00 73.99  ? 58  GLN G C   1 
ATOM   7298  O O   . GLN G 1 62  ? 26.259  4.500   95.556  1.00 71.98  ? 58  GLN G O   1 
ATOM   7299  C CB  . GLN G 1 62  ? 25.337  2.133   97.582  1.00 87.11  ? 58  GLN G CB  1 
ATOM   7300  C CG  . GLN G 1 62  ? 24.838  3.336   98.362  1.00 100.08 ? 58  GLN G CG  1 
ATOM   7301  C CD  . GLN G 1 62  ? 24.474  2.990   99.792  1.00 99.92  ? 58  GLN G CD  1 
ATOM   7302  O OE1 . GLN G 1 62  ? 25.057  2.088   100.394 1.00 103.03 ? 58  GLN G OE1 1 
ATOM   7303  N NE2 . GLN G 1 62  ? 23.495  3.700   100.341 1.00 85.83  ? 58  GLN G NE2 1 
ATOM   7304  N N   . ASP G 1 63  ? 27.659  2.741   95.440  1.00 69.22  ? 59  ASP G N   1 
ATOM   7305  C CA  . ASP G 1 63  ? 28.801  3.531   94.990  1.00 66.21  ? 59  ASP G CA  1 
ATOM   7306  C C   . ASP G 1 63  ? 28.708  3.821   93.496  1.00 61.83  ? 59  ASP G C   1 
ATOM   7307  O O   . ASP G 1 63  ? 29.188  4.852   93.024  1.00 49.32  ? 59  ASP G O   1 
ATOM   7308  C CB  . ASP G 1 63  ? 30.111  2.798   95.287  1.00 73.61  ? 59  ASP G CB  1 
ATOM   7309  C CG  . ASP G 1 63  ? 30.437  2.760   96.765  1.00 77.13  ? 59  ASP G CG  1 
ATOM   7310  O OD1 . ASP G 1 63  ? 30.110  3.736   97.472  1.00 69.22  ? 59  ASP G OD1 1 
ATOM   7311  O OD2 . ASP G 1 63  ? 31.025  1.755   97.216  1.00 80.04  ? 59  ASP G OD2 1 
ATOM   7312  N N   . ILE G 1 64  ? 28.099  2.902   92.755  1.00 63.48  ? 60  ILE G N   1 
ATOM   7313  C CA  . ILE G 1 64  ? 27.931  3.069   91.317  1.00 55.11  ? 60  ILE G CA  1 
ATOM   7314  C C   . ILE G 1 64  ? 26.843  4.089   91.004  1.00 57.36  ? 60  ILE G C   1 
ATOM   7315  O O   . ILE G 1 64  ? 26.940  4.832   90.027  1.00 56.61  ? 60  ILE G O   1 
ATOM   7316  C CB  . ILE G 1 64  ? 27.577  1.735   90.639  1.00 39.63  ? 60  ILE G CB  1 
ATOM   7317  C CG1 . ILE G 1 64  ? 28.797  0.813   90.632  1.00 23.25  ? 60  ILE G CG1 1 
ATOM   7318  C CG2 . ILE G 1 64  ? 27.092  1.970   89.215  1.00 46.43  ? 60  ILE G CG2 1 
ATOM   7319  C CD1 . ILE G 1 64  ? 28.539  -0.540  90.015  1.00 36.98  ? 60  ILE G CD1 1 
ATOM   7320  N N   . MET G 1 65  ? 25.809  4.124   91.837  1.00 47.50  ? 61  MET G N   1 
ATOM   7321  C CA  . MET G 1 65  ? 24.687  5.027   91.612  1.00 43.29  ? 61  MET G CA  1 
ATOM   7322  C C   . MET G 1 65  ? 25.053  6.472   91.937  1.00 46.32  ? 61  MET G C   1 
ATOM   7323  O O   . MET G 1 65  ? 24.559  7.402   91.300  1.00 60.42  ? 61  MET G O   1 
ATOM   7324  C CB  . MET G 1 65  ? 23.471  4.586   92.433  1.00 38.86  ? 61  MET G CB  1 
ATOM   7325  C CG  . MET G 1 65  ? 22.745  3.384   91.844  1.00 28.67  ? 61  MET G CG  1 
ATOM   7326  S SD  . MET G 1 65  ? 21.172  3.028   92.646  1.00 33.32  ? 61  MET G SD  1 
ATOM   7327  C CE  . MET G 1 65  ? 21.731  2.441   94.243  1.00 78.40  ? 61  MET G CE  1 
ATOM   7328  N N   . GLU G 1 66  ? 25.929  6.657   92.919  1.00 52.32  ? 62  GLU G N   1 
ATOM   7329  C CA  . GLU G 1 66  ? 26.300  7.994   93.371  1.00 62.02  ? 62  GLU G CA  1 
ATOM   7330  C C   . GLU G 1 66  ? 27.444  8.585   92.550  1.00 57.62  ? 62  GLU G C   1 
ATOM   7331  O O   . GLU G 1 66  ? 27.452  9.782   92.260  1.00 55.31  ? 62  GLU G O   1 
ATOM   7332  C CB  . GLU G 1 66  ? 26.691  7.960   94.851  1.00 70.69  ? 62  GLU G CB  1 
ATOM   7333  C CG  . GLU G 1 66  ? 27.119  9.308   95.415  1.00 74.31  ? 62  GLU G CG  1 
ATOM   7334  C CD  . GLU G 1 66  ? 26.016  10.351  95.351  1.00 70.22  ? 62  GLU G CD  1 
ATOM   7335  O OE1 . GLU G 1 66  ? 24.840  9.970   95.166  1.00 44.70  ? 62  GLU G OE1 1 
ATOM   7336  O OE2 . GLU G 1 66  ? 26.327  11.553  95.487  1.00 76.67  ? 62  GLU G OE2 1 
ATOM   7337  N N   . ASP G 1 67  ? 28.405  7.747   92.176  1.00 53.28  ? 63  ASP G N   1 
ATOM   7338  C CA  . ASP G 1 67  ? 29.609  8.222   91.501  1.00 60.91  ? 63  ASP G CA  1 
ATOM   7339  C C   . ASP G 1 67  ? 29.523  8.110   89.981  1.00 47.95  ? 63  ASP G C   1 
ATOM   7340  O O   . ASP G 1 67  ? 29.975  9.001   89.261  1.00 37.86  ? 63  ASP G O   1 
ATOM   7341  C CB  . ASP G 1 67  ? 30.837  7.452   91.998  1.00 64.33  ? 63  ASP G CB  1 
ATOM   7342  C CG  . ASP G 1 67  ? 31.148  7.726   93.456  1.00 59.32  ? 63  ASP G CG  1 
ATOM   7343  O OD1 . ASP G 1 67  ? 30.822  8.831   93.939  1.00 64.71  ? 63  ASP G OD1 1 
ATOM   7344  O OD2 . ASP G 1 67  ? 31.722  6.837   94.119  1.00 47.88  ? 63  ASP G OD2 1 
ATOM   7345  N N   . THR G 1 68  ? 28.941  7.017   89.496  1.00 40.99  ? 64  THR G N   1 
ATOM   7346  C CA  . THR G 1 68  ? 28.970  6.711   88.070  1.00 45.65  ? 64  THR G CA  1 
ATOM   7347  C C   . THR G 1 68  ? 27.656  7.044   87.354  1.00 52.50  ? 64  THR G C   1 
ATOM   7348  O O   . THR G 1 68  ? 27.669  7.653   86.283  1.00 56.14  ? 64  THR G O   1 
ATOM   7349  C CB  . THR G 1 68  ? 29.325  5.229   87.837  1.00 51.47  ? 64  THR G CB  1 
ATOM   7350  O OG1 . THR G 1 68  ? 30.574  4.931   88.477  1.00 37.80  ? 64  THR G OG1 1 
ATOM   7351  C CG2 . THR G 1 68  ? 29.436  4.928   86.352  1.00 64.66  ? 64  THR G CG2 1 
ATOM   7352  N N   . MET G 1 69  ? 26.528  6.651   87.941  1.00 45.03  ? 65  MET G N   1 
ATOM   7353  C CA  . MET G 1 69  ? 25.224  6.897   87.325  1.00 41.27  ? 65  MET G CA  1 
ATOM   7354  C C   . MET G 1 69  ? 24.749  8.321   87.582  1.00 49.90  ? 65  MET G C   1 
ATOM   7355  O O   . MET G 1 69  ? 23.966  8.570   88.499  1.00 55.76  ? 65  MET G O   1 
ATOM   7356  C CB  . MET G 1 69  ? 24.184  5.907   87.848  1.00 31.66  ? 65  MET G CB  1 
ATOM   7357  C CG  . MET G 1 69  ? 24.446  4.475   87.426  1.00 48.71  ? 65  MET G CG  1 
ATOM   7358  S SD  . MET G 1 69  ? 23.195  3.312   87.998  1.00 78.32  ? 65  MET G SD  1 
ATOM   7359  C CE  . MET G 1 69  ? 23.732  1.826   87.155  1.00 18.47  ? 65  MET G CE  1 
ATOM   7360  N N   . ARG G 1 70  ? 25.220  9.249   86.755  1.00 51.84  ? 66  ARG G N   1 
ATOM   7361  C CA  . ARG G 1 70  ? 24.902  10.662  86.920  1.00 54.34  ? 66  ARG G CA  1 
ATOM   7362  C C   . ARG G 1 70  ? 23.953  11.156  85.834  1.00 54.38  ? 66  ARG G C   1 
ATOM   7363  O O   . ARG G 1 70  ? 24.192  10.956  84.643  1.00 47.90  ? 66  ARG G O   1 
ATOM   7364  C CB  . ARG G 1 70  ? 26.185  11.495  86.898  1.00 46.29  ? 66  ARG G CB  1 
ATOM   7365  C CG  . ARG G 1 70  ? 27.117  11.239  88.073  1.00 53.43  ? 66  ARG G CG  1 
ATOM   7366  C CD  . ARG G 1 70  ? 28.568  11.166  87.622  1.00 70.75  ? 66  ARG G CD  1 
ATOM   7367  N NE  . ARG G 1 70  ? 28.938  12.285  86.758  1.00 82.72  ? 66  ARG G NE  1 
ATOM   7368  C CZ  . ARG G 1 70  ? 30.089  12.377  86.098  1.00 83.30  ? 66  ARG G CZ  1 
ATOM   7369  N NH1 . ARG G 1 70  ? 30.997  11.415  86.192  1.00 89.89  ? 66  ARG G NH1 1 
ATOM   7370  N NH2 . ARG G 1 70  ? 30.331  13.435  85.336  1.00 72.37  ? 66  ARG G NH2 1 
ATOM   7371  N N   . PHE G 1 71  ? 22.872  11.801  86.259  1.00 50.72  ? 67  PHE G N   1 
ATOM   7372  C CA  . PHE G 1 71  ? 21.931  12.428  85.342  1.00 43.80  ? 67  PHE G CA  1 
ATOM   7373  C C   . PHE G 1 71  ? 21.723  13.876  85.757  1.00 48.84  ? 67  PHE G C   1 
ATOM   7374  O O   . PHE G 1 71  ? 21.914  14.228  86.922  1.00 60.42  ? 67  PHE G O   1 
ATOM   7375  C CB  . PHE G 1 71  ? 20.591  11.694  85.362  1.00 46.04  ? 67  PHE G CB  1 
ATOM   7376  C CG  . PHE G 1 71  ? 20.692  10.239  85.013  1.00 48.78  ? 67  PHE G CG  1 
ATOM   7377  C CD1 . PHE G 1 71  ? 20.954  9.294   85.992  1.00 60.37  ? 67  PHE G CD1 1 
ATOM   7378  C CD2 . PHE G 1 71  ? 20.520  9.814   83.709  1.00 37.13  ? 67  PHE G CD2 1 
ATOM   7379  C CE1 . PHE G 1 71  ? 21.045  7.952   85.672  1.00 54.51  ? 67  PHE G CE1 1 
ATOM   7380  C CE2 . PHE G 1 71  ? 20.610  8.476   83.384  1.00 39.31  ? 67  PHE G CE2 1 
ATOM   7381  C CZ  . PHE G 1 71  ? 20.873  7.544   84.366  1.00 44.93  ? 67  PHE G CZ  1 
ATOM   7382  N N   . ARG G 1 72  ? 21.330  14.716  84.806  1.00 37.37  ? 68  ARG G N   1 
ATOM   7383  C CA  . ARG G 1 72  ? 21.067  16.117  85.103  1.00 45.75  ? 68  ARG G CA  1 
ATOM   7384  C C   . ARG G 1 72  ? 20.014  16.205  86.205  1.00 62.78  ? 68  ARG G C   1 
ATOM   7385  O O   . ARG G 1 72  ? 19.015  15.485  86.175  1.00 73.55  ? 68  ARG G O   1 
ATOM   7386  C CB  . ARG G 1 72  ? 20.583  16.854  83.854  1.00 49.62  ? 68  ARG G CB  1 
ATOM   7387  C CG  . ARG G 1 72  ? 21.220  18.219  83.652  1.00 60.25  ? 68  ARG G CG  1 
ATOM   7388  C CD  . ARG G 1 72  ? 20.444  19.036  82.638  1.00 59.23  ? 68  ARG G CD  1 
ATOM   7389  N NE  . ARG G 1 72  ? 19.112  19.374  83.132  1.00 70.49  ? 68  ARG G NE  1 
ATOM   7390  C CZ  . ARG G 1 72  ? 18.159  19.943  82.401  1.00 81.90  ? 68  ARG G CZ  1 
ATOM   7391  N NH1 . ARG G 1 72  ? 18.378  20.242  81.126  1.00 98.18  ? 68  ARG G NH1 1 
ATOM   7392  N NH2 . ARG G 1 72  ? 16.980  20.212  82.946  1.00 55.65  ? 68  ARG G NH2 1 
ATOM   7393  N N   . ASP G 1 73  ? 20.243  17.084  87.176  1.00 52.05  ? 69  ASP G N   1 
ATOM   7394  C CA  . ASP G 1 73  ? 19.339  17.223  88.315  1.00 48.33  ? 69  ASP G CA  1 
ATOM   7395  C C   . ASP G 1 73  ? 17.880  17.366  87.884  1.00 41.20  ? 69  ASP G C   1 
ATOM   7396  O O   . ASP G 1 73  ? 17.561  18.131  86.976  1.00 22.42  ? 69  ASP G O   1 
ATOM   7397  C CB  . ASP G 1 73  ? 19.738  18.428  89.173  1.00 51.67  ? 69  ASP G CB  1 
ATOM   7398  C CG  . ASP G 1 73  ? 20.933  18.145  90.065  1.00 62.39  ? 69  ASP G CG  1 
ATOM   7399  O OD1 . ASP G 1 73  ? 21.035  17.014  90.588  1.00 64.84  ? 69  ASP G OD1 1 
ATOM   7400  O OD2 . ASP G 1 73  ? 21.768  19.056  90.248  1.00 65.50  ? 69  ASP G OD2 1 
ATOM   7401  N N   . ASN G 1 74  ? 17.007  16.606  88.541  1.00 43.43  ? 70  ASN G N   1 
ATOM   7402  C CA  . ASN G 1 74  ? 15.557  16.739  88.391  1.00 34.30  ? 70  ASN G CA  1 
ATOM   7403  C C   . ASN G 1 74  ? 14.977  16.135  87.111  1.00 45.43  ? 70  ASN G C   1 
ATOM   7404  O O   . ASN G 1 74  ? 13.776  16.247  86.861  1.00 46.70  ? 70  ASN G O   1 
ATOM   7405  C CB  . ASN G 1 74  ? 15.130  18.206  88.529  1.00 30.22  ? 70  ASN G CB  1 
ATOM   7406  C CG  . ASN G 1 74  ? 15.370  18.751  89.925  1.00 44.62  ? 70  ASN G CG  1 
ATOM   7407  O OD1 . ASN G 1 74  ? 16.087  19.736  90.109  1.00 52.92  ? 70  ASN G OD1 1 
ATOM   7408  N ND2 . ASN G 1 74  ? 14.769  18.106  90.919  1.00 45.21  ? 70  ASN G ND2 1 
ATOM   7409  N N   . THR G 1 75  ? 15.816  15.483  86.313  1.00 51.41  ? 71  THR G N   1 
ATOM   7410  C CA  . THR G 1 75  ? 15.319  14.758  85.149  1.00 54.21  ? 71  THR G CA  1 
ATOM   7411  C C   . THR G 1 75  ? 14.776  13.411  85.620  1.00 54.59  ? 71  THR G C   1 
ATOM   7412  O O   . THR G 1 75  ? 15.277  12.849  86.594  1.00 63.61  ? 71  THR G O   1 
ATOM   7413  C CB  . THR G 1 75  ? 16.414  14.544  84.083  1.00 44.48  ? 71  THR G CB  1 
ATOM   7414  O OG1 . THR G 1 75  ? 17.423  13.662  84.591  1.00 45.61  ? 71  THR G OG1 1 
ATOM   7415  C CG2 . THR G 1 75  ? 17.043  15.878  83.679  1.00 16.56  ? 71  THR G CG2 1 
ATOM   7416  N N   . PRO G 1 76  ? 13.745  12.891  84.934  1.00 35.59  ? 72  PRO G N   1 
ATOM   7417  C CA  . PRO G 1 76  ? 13.062  11.661  85.356  1.00 37.79  ? 72  PRO G CA  1 
ATOM   7418  C C   . PRO G 1 76  ? 14.020  10.564  85.818  1.00 42.89  ? 72  PRO G C   1 
ATOM   7419  O O   . PRO G 1 76  ? 13.777  9.936   86.849  1.00 50.83  ? 72  PRO G O   1 
ATOM   7420  C CB  . PRO G 1 76  ? 12.317  11.229  84.092  1.00 39.84  ? 72  PRO G CB  1 
ATOM   7421  C CG  . PRO G 1 76  ? 12.034  12.504  83.381  1.00 32.97  ? 72  PRO G CG  1 
ATOM   7422  C CD  . PRO G 1 76  ? 13.205  13.410  83.665  1.00 36.59  ? 72  PRO G CD  1 
ATOM   7423  N N   . ASN G 1 77  ? 15.096  10.346  85.069  1.00 35.79  ? 73  ASN G N   1 
ATOM   7424  C CA  . ASN G 1 77  ? 16.059  9.303   85.404  1.00 33.68  ? 73  ASN G CA  1 
ATOM   7425  C C   . ASN G 1 77  ? 16.934  9.670   86.600  1.00 41.00  ? 73  ASN G C   1 
ATOM   7426  O O   . ASN G 1 77  ? 17.441  8.792   87.295  1.00 41.82  ? 73  ASN G O   1 
ATOM   7427  C CB  . ASN G 1 77  ? 16.940  8.984   84.195  1.00 53.08  ? 73  ASN G CB  1 
ATOM   7428  C CG  . ASN G 1 77  ? 16.173  8.305   83.077  1.00 48.29  ? 73  ASN G CG  1 
ATOM   7429  O OD1 . ASN G 1 77  ? 15.081  7.776   83.286  1.00 43.97  ? 73  ASN G OD1 1 
ATOM   7430  N ND2 . ASN G 1 77  ? 16.750  8.305   81.881  1.00 44.90  ? 73  ASN G ND2 1 
ATOM   7431  N N   . ALA G 1 78  ? 17.120  10.964  86.834  1.00 43.30  ? 74  ALA G N   1 
ATOM   7432  C CA  . ALA G 1 78  ? 17.888  11.420  87.986  1.00 39.73  ? 74  ALA G CA  1 
ATOM   7433  C C   . ALA G 1 78  ? 17.139  11.082  89.267  1.00 53.07  ? 74  ALA G C   1 
ATOM   7434  O O   . ALA G 1 78  ? 17.718  10.561  90.223  1.00 52.76  ? 74  ALA G O   1 
ATOM   7435  C CB  . ALA G 1 78  ? 18.137  12.912  87.901  1.00 45.30  ? 74  ALA G CB  1 
ATOM   7436  N N   . ILE G 1 79  ? 15.845  11.384  89.276  1.00 58.89  ? 75  ILE G N   1 
ATOM   7437  C CA  . ILE G 1 79  ? 14.990  11.073  90.413  1.00 48.12  ? 75  ILE G CA  1 
ATOM   7438  C C   . ILE G 1 79  ? 14.951  9.569   90.647  1.00 35.99  ? 75  ILE G C   1 
ATOM   7439  O O   . ILE G 1 79  ? 15.049  9.108   91.783  1.00 33.34  ? 75  ILE G O   1 
ATOM   7440  C CB  . ILE G 1 79  ? 13.557  11.591  90.191  1.00 51.18  ? 75  ILE G CB  1 
ATOM   7441  C CG1 . ILE G 1 79  ? 13.542  13.122  90.200  1.00 40.34  ? 75  ILE G CG1 1 
ATOM   7442  C CG2 . ILE G 1 79  ? 12.622  11.051  91.264  1.00 59.83  ? 75  ILE G CG2 1 
ATOM   7443  C CD1 . ILE G 1 79  ? 12.230  13.727  89.749  1.00 50.22  ? 75  ILE G CD1 1 
ATOM   7444  N N   . ALA G 1 80  ? 14.810  8.809   89.565  1.00 42.80  ? 76  ALA G N   1 
ATOM   7445  C CA  . ALA G 1 80  ? 14.780  7.353   89.650  1.00 23.59  ? 76  ALA G CA  1 
ATOM   7446  C C   . ALA G 1 80  ? 15.959  6.842   90.469  1.00 32.51  ? 76  ALA G C   1 
ATOM   7447  O O   . ALA G 1 80  ? 15.808  5.938   91.289  1.00 43.73  ? 76  ALA G O   1 
ATOM   7448  C CB  . ALA G 1 80  ? 14.799  6.743   88.259  1.00 14.46  ? 76  ALA G CB  1 
ATOM   7449  N N   . ILE G 1 81  ? 17.131  7.428   90.247  1.00 40.62  ? 77  ILE G N   1 
ATOM   7450  C CA  . ILE G 1 81  ? 18.328  7.037   90.983  1.00 43.53  ? 77  ILE G CA  1 
ATOM   7451  C C   . ILE G 1 81  ? 18.217  7.436   92.451  1.00 58.54  ? 77  ILE G C   1 
ATOM   7452  O O   . ILE G 1 81  ? 18.606  6.677   93.338  1.00 64.67  ? 77  ILE G O   1 
ATOM   7453  C CB  . ILE G 1 81  ? 19.595  7.671   90.386  1.00 29.30  ? 77  ILE G CB  1 
ATOM   7454  C CG1 . ILE G 1 81  ? 19.781  7.220   88.935  1.00 18.06  ? 77  ILE G CG1 1 
ATOM   7455  C CG2 . ILE G 1 81  ? 20.816  7.302   91.218  1.00 14.57  ? 77  ILE G CG2 1 
ATOM   7456  C CD1 . ILE G 1 81  ? 19.940  5.720   88.767  1.00 8.03   ? 77  ILE G CD1 1 
ATOM   7457  N N   . VAL G 1 82  ? 17.689  8.630   92.707  1.00 55.58  ? 78  VAL G N   1 
ATOM   7458  C CA  . VAL G 1 82  ? 17.468  9.078   94.077  1.00 41.78  ? 78  VAL G CA  1 
ATOM   7459  C C   . VAL G 1 82  ? 16.573  8.084   94.810  1.00 51.40  ? 78  VAL G C   1 
ATOM   7460  O O   . VAL G 1 82  ? 16.883  7.662   95.922  1.00 69.09  ? 78  VAL G O   1 
ATOM   7461  C CB  . VAL G 1 82  ? 16.818  10.475  94.121  1.00 38.59  ? 78  VAL G CB  1 
ATOM   7462  C CG1 . VAL G 1 82  ? 16.319  10.791  95.523  1.00 43.83  ? 78  VAL G CG1 1 
ATOM   7463  C CG2 . VAL G 1 82  ? 17.801  11.536  93.650  1.00 29.67  ? 78  VAL G CG2 1 
ATOM   7464  N N   . GLN G 1 83  ? 15.468  7.709   94.173  1.00 45.34  ? 79  GLN G N   1 
ATOM   7465  C CA  . GLN G 1 83  ? 14.522  6.764   94.757  1.00 37.40  ? 79  GLN G CA  1 
ATOM   7466  C C   . GLN G 1 83  ? 15.158  5.397   94.987  1.00 31.74  ? 79  GLN G C   1 
ATOM   7467  O O   . GLN G 1 83  ? 14.799  4.691   95.930  1.00 41.68  ? 79  GLN G O   1 
ATOM   7468  C CB  . GLN G 1 83  ? 13.298  6.609   93.851  1.00 38.42  ? 79  GLN G CB  1 
ATOM   7469  C CG  . GLN G 1 83  ? 12.426  7.850   93.762  1.00 48.90  ? 79  GLN G CG  1 
ATOM   7470  C CD  . GLN G 1 83  ? 11.193  7.630   92.909  1.00 64.04  ? 79  GLN G CD  1 
ATOM   7471  O OE1 . GLN G 1 83  ? 11.077  6.618   92.217  1.00 74.22  ? 79  GLN G OE1 1 
ATOM   7472  N NE2 . GLN G 1 83  ? 10.261  8.575   92.958  1.00 59.86  ? 79  GLN G NE2 1 
ATOM   7473  N N   . LEU G 1 84  ? 16.097  5.026   94.121  1.00 27.46  ? 80  LEU G N   1 
ATOM   7474  C CA  . LEU G 1 84  ? 16.754  3.724   94.211  1.00 34.96  ? 80  LEU G CA  1 
ATOM   7475  C C   . LEU G 1 84  ? 17.814  3.702   95.309  1.00 32.20  ? 80  LEU G C   1 
ATOM   7476  O O   . LEU G 1 84  ? 17.990  2.692   95.991  1.00 30.66  ? 80  LEU G O   1 
ATOM   7477  C CB  . LEU G 1 84  ? 17.381  3.346   92.867  1.00 43.41  ? 80  LEU G CB  1 
ATOM   7478  C CG  . LEU G 1 84  ? 16.413  2.852   91.789  1.00 37.57  ? 80  LEU G CG  1 
ATOM   7479  C CD1 . LEU G 1 84  ? 17.132  2.702   90.453  1.00 42.32  ? 80  LEU G CD1 1 
ATOM   7480  C CD2 . LEU G 1 84  ? 15.769  1.535   92.203  1.00 10.77  ? 80  LEU G CD2 1 
ATOM   7481  N N   . GLN G 1 85  ? 18.520  4.814   95.480  1.00 35.83  ? 81  GLN G N   1 
ATOM   7482  C CA  . GLN G 1 85  ? 19.478  4.937   96.571  1.00 29.72  ? 81  GLN G CA  1 
ATOM   7483  C C   . GLN G 1 85  ? 18.724  4.919   97.895  1.00 45.24  ? 81  GLN G C   1 
ATOM   7484  O O   . GLN G 1 85  ? 19.165  4.297   98.862  1.00 59.87  ? 81  GLN G O   1 
ATOM   7485  C CB  . GLN G 1 85  ? 20.292  6.225   96.436  1.00 15.03  ? 81  GLN G CB  1 
ATOM   7486  C CG  . GLN G 1 85  ? 21.218  6.244   95.229  1.00 36.44  ? 81  GLN G CG  1 
ATOM   7487  C CD  . GLN G 1 85  ? 21.933  7.570   95.059  1.00 64.76  ? 81  GLN G CD  1 
ATOM   7488  O OE1 . GLN G 1 85  ? 21.329  8.570   94.670  1.00 62.45  ? 81  GLN G OE1 1 
ATOM   7489  N NE2 . GLN G 1 85  ? 23.230  7.584   95.350  1.00 75.22  ? 81  GLN G NE2 1 
ATOM   7490  N N   . GLU G 1 86  ? 17.580  5.598   97.926  1.00 44.13  ? 82  GLU G N   1 
ATOM   7491  C CA  . GLU G 1 86  ? 16.709  5.578   99.094  1.00 38.84  ? 82  GLU G CA  1 
ATOM   7492  C C   . GLU G 1 86  ? 16.295  4.146   99.398  1.00 47.31  ? 82  GLU G C   1 
ATOM   7493  O O   . GLU G 1 86  ? 16.395  3.691   100.536 1.00 55.82  ? 82  GLU G O   1 
ATOM   7494  C CB  . GLU G 1 86  ? 15.469  6.450   98.867  1.00 36.82  ? 82  GLU G CB  1 
ATOM   7495  C CG  . GLU G 1 86  ? 15.724  7.945   99.018  1.00 38.49  ? 82  GLU G CG  1 
ATOM   7496  C CD  . GLU G 1 86  ? 14.467  8.782   98.855  1.00 46.55  ? 82  GLU G CD  1 
ATOM   7497  O OE1 . GLU G 1 86  ? 14.358  9.829   99.527  1.00 59.12  ? 82  GLU G OE1 1 
ATOM   7498  O OE2 . GLU G 1 86  ? 13.592  8.400   98.050  1.00 47.13  ? 82  GLU G OE2 1 
ATOM   7499  N N   . LEU G 1 87  ? 15.839  3.439   98.369  1.00 53.96  ? 83  LEU G N   1 
ATOM   7500  C CA  . LEU G 1 87  ? 15.467  2.036   98.506  1.00 51.26  ? 83  LEU G CA  1 
ATOM   7501  C C   . LEU G 1 87  ? 16.605  1.231   99.123  1.00 45.31  ? 83  LEU G C   1 
ATOM   7502  O O   . LEU G 1 87  ? 16.375  0.333   99.932  1.00 58.98  ? 83  LEU G O   1 
ATOM   7503  C CB  . LEU G 1 87  ? 15.095  1.449   97.143  1.00 45.80  ? 83  LEU G CB  1 
ATOM   7504  C CG  . LEU G 1 87  ? 14.960  -0.075  97.080  1.00 37.23  ? 83  LEU G CG  1 
ATOM   7505  C CD1 . LEU G 1 87  ? 13.766  -0.548  97.898  1.00 32.45  ? 83  LEU G CD1 1 
ATOM   7506  C CD2 . LEU G 1 87  ? 14.859  -0.543  95.630  1.00 7.91   ? 83  LEU G CD2 1 
ATOM   7507  N N   . SER G 1 88  ? 17.834  1.558   98.741  1.00 43.76  ? 84  SER G N   1 
ATOM   7508  C CA  . SER G 1 88  ? 19.002  0.842   99.241  1.00 50.20  ? 84  SER G CA  1 
ATOM   7509  C C   . SER G 1 88  ? 19.316  1.204   100.691 1.00 53.81  ? 84  SER G C   1 
ATOM   7510  O O   . SER G 1 88  ? 19.866  0.390   101.432 1.00 48.42  ? 84  SER G O   1 
ATOM   7511  C CB  . SER G 1 88  ? 20.216  1.118   98.352  1.00 33.02  ? 84  SER G CB  1 
ATOM   7512  O OG  . SER G 1 88  ? 20.042  0.532   97.075  1.00 37.77  ? 84  SER G OG  1 
ATOM   7513  N N   . LEU G 1 89  ? 18.968  2.423   101.093 1.00 55.08  ? 85  LEU G N   1 
ATOM   7514  C CA  . LEU G 1 89  ? 19.159  2.848   102.476 1.00 50.01  ? 85  LEU G CA  1 
ATOM   7515  C C   . LEU G 1 89  ? 18.276  2.033   103.420 1.00 43.09  ? 85  LEU G C   1 
ATOM   7516  O O   . LEU G 1 89  ? 18.642  1.796   104.571 1.00 44.45  ? 85  LEU G O   1 
ATOM   7517  C CB  . LEU G 1 89  ? 18.857  4.342   102.633 1.00 39.34  ? 85  LEU G CB  1 
ATOM   7518  C CG  . LEU G 1 89  ? 19.892  5.320   102.067 1.00 35.97  ? 85  LEU G CG  1 
ATOM   7519  C CD1 . LEU G 1 89  ? 19.345  6.739   102.059 1.00 34.88  ? 85  LEU G CD1 1 
ATOM   7520  C CD2 . LEU G 1 89  ? 21.182  5.262   102.866 1.00 35.54  ? 85  LEU G CD2 1 
ATOM   7521  N N   . ARG G 1 90  ? 17.115  1.603   102.930 1.00 35.17  ? 86  ARG G N   1 
ATOM   7522  C CA  . ARG G 1 90  ? 16.187  0.823   103.746 1.00 39.38  ? 86  ARG G CA  1 
ATOM   7523  C C   . ARG G 1 90  ? 16.574  -0.651  103.757 1.00 41.62  ? 86  ARG G C   1 
ATOM   7524  O O   . ARG G 1 90  ? 16.412  -1.339  104.764 1.00 57.53  ? 86  ARG G O   1 
ATOM   7525  C CB  . ARG G 1 90  ? 14.755  0.955   103.225 1.00 30.47  ? 86  ARG G CB  1 
ATOM   7526  C CG  . ARG G 1 90  ? 14.336  2.364   102.860 1.00 26.65  ? 86  ARG G CG  1 
ATOM   7527  C CD  . ARG G 1 90  ? 12.850  2.425   102.545 1.00 26.66  ? 86  ARG G CD  1 
ATOM   7528  N NE  . ARG G 1 90  ? 12.526  3.528   101.643 1.00 48.03  ? 86  ARG G NE  1 
ATOM   7529  C CZ  . ARG G 1 90  ? 12.324  3.405   100.333 1.00 53.17  ? 86  ARG G CZ  1 
ATOM   7530  N NH1 . ARG G 1 90  ? 12.396  2.221   99.737  1.00 57.26  ? 86  ARG G NH1 1 
ATOM   7531  N NH2 . ARG G 1 90  ? 12.038  4.479   99.610  1.00 56.39  ? 86  ARG G NH2 1 
ATOM   7532  N N   . LEU G 1 91  ? 17.078  -1.131  102.627 1.00 39.38  ? 87  LEU G N   1 
ATOM   7533  C CA  . LEU G 1 91  ? 17.404  -2.541  102.470 1.00 36.49  ? 87  LEU G CA  1 
ATOM   7534  C C   . LEU G 1 91  ? 18.621  -2.958  103.289 1.00 41.61  ? 87  LEU G C   1 
ATOM   7535  O O   . LEU G 1 91  ? 18.794  -4.138  103.581 1.00 55.07  ? 87  LEU G O   1 
ATOM   7536  C CB  . LEU G 1 91  ? 17.646  -2.858  100.993 1.00 34.04  ? 87  LEU G CB  1 
ATOM   7537  C CG  . LEU G 1 91  ? 16.413  -3.049  100.109 1.00 39.52  ? 87  LEU G CG  1 
ATOM   7538  C CD1 . LEU G 1 91  ? 16.841  -3.200  98.654  1.00 33.13  ? 87  LEU G CD1 1 
ATOM   7539  C CD2 . LEU G 1 91  ? 15.590  -4.249  100.559 1.00 32.29  ? 87  LEU G CD2 1 
ATOM   7540  N N   . LYS G 1 92  ? 19.465  -2.001  103.659 1.00 41.31  ? 88  LYS G N   1 
ATOM   7541  C CA  . LYS G 1 92  ? 20.670  -2.317  104.422 1.00 54.09  ? 88  LYS G CA  1 
ATOM   7542  C C   . LYS G 1 92  ? 20.355  -3.047  105.729 1.00 50.68  ? 88  LYS G C   1 
ATOM   7543  O O   . LYS G 1 92  ? 21.168  -3.836  106.216 1.00 49.29  ? 88  LYS G O   1 
ATOM   7544  C CB  . LYS G 1 92  ? 21.480  -1.051  104.711 1.00 52.67  ? 88  LYS G CB  1 
ATOM   7545  C CG  . LYS G 1 92  ? 22.379  -0.613  103.561 1.00 61.37  ? 88  LYS G CG  1 
ATOM   7546  C CD  . LYS G 1 92  ? 23.440  0.374   104.027 1.00 67.16  ? 88  LYS G CD  1 
ATOM   7547  C CE  . LYS G 1 92  ? 22.835  1.717   104.416 1.00 71.43  ? 88  LYS G CE  1 
ATOM   7548  N NZ  . LYS G 1 92  ? 23.718  2.478   105.341 1.00 68.48  ? 88  LYS G NZ  1 
ATOM   7549  N N   . SER G 1 93  ? 19.179  -2.788  106.294 1.00 33.82  ? 89  SER G N   1 
ATOM   7550  C CA  . SER G 1 93  ? 18.773  -3.435  107.539 1.00 45.34  ? 89  SER G CA  1 
ATOM   7551  C C   . SER G 1 93  ? 18.392  -4.898  107.311 1.00 57.24  ? 89  SER G C   1 
ATOM   7552  O O   . SER G 1 93  ? 18.264  -5.669  108.263 1.00 74.96  ? 89  SER G O   1 
ATOM   7553  C CB  . SER G 1 93  ? 17.606  -2.682  108.183 1.00 46.36  ? 89  SER G CB  1 
ATOM   7554  O OG  . SER G 1 93  ? 16.475  -2.650  107.329 1.00 44.37  ? 89  SER G OG  1 
ATOM   7555  N N   . CYS G 1 94  ? 18.212  -5.270  106.048 1.00 39.79  ? 90  CYS G N   1 
ATOM   7556  C CA  . CYS G 1 94  ? 17.866  -6.641  105.686 1.00 37.07  ? 90  CYS G CA  1 
ATOM   7557  C C   . CYS G 1 94  ? 19.114  -7.488  105.440 1.00 58.10  ? 90  CYS G C   1 
ATOM   7558  O O   . CYS G 1 94  ? 19.022  -8.702  105.251 1.00 67.36  ? 90  CYS G O   1 
ATOM   7559  C CB  . CYS G 1 94  ? 16.979  -6.647  104.438 1.00 14.89  ? 90  CYS G CB  1 
ATOM   7560  S SG  . CYS G 1 94  ? 15.407  -5.775  104.644 1.00 98.80  ? 90  CYS G SG  1 
ATOM   7561  N N   . PHE G 1 95  ? 20.277  -6.843  105.438 1.00 60.87  ? 91  PHE G N   1 
ATOM   7562  C CA  . PHE G 1 95  ? 21.544  -7.537  105.241 1.00 61.11  ? 91  PHE G CA  1 
ATOM   7563  C C   . PHE G 1 95  ? 22.402  -7.438  106.496 1.00 63.57  ? 91  PHE G C   1 
ATOM   7564  O O   . PHE G 1 95  ? 22.604  -6.347  107.033 1.00 56.09  ? 91  PHE G O   1 
ATOM   7565  C CB  . PHE G 1 95  ? 22.304  -6.935  104.057 1.00 58.84  ? 91  PHE G CB  1 
ATOM   7566  C CG  . PHE G 1 95  ? 21.621  -7.122  102.731 1.00 53.85  ? 91  PHE G CG  1 
ATOM   7567  C CD1 . PHE G 1 95  ? 20.436  -6.465  102.451 1.00 36.46  ? 91  PHE G CD1 1 
ATOM   7568  C CD2 . PHE G 1 95  ? 22.174  -7.942  101.760 1.00 61.48  ? 91  PHE G CD2 1 
ATOM   7569  C CE1 . PHE G 1 95  ? 19.804  -6.628  101.231 1.00 30.47  ? 91  PHE G CE1 1 
ATOM   7570  C CE2 . PHE G 1 95  ? 21.548  -8.111  100.535 1.00 46.08  ? 91  PHE G CE2 1 
ATOM   7571  C CZ  . PHE G 1 95  ? 20.363  -7.453  100.270 1.00 42.45  ? 91  PHE G CZ  1 
ATOM   7572  N N   . THR G 1 96  ? 22.904  -8.578  106.961 1.00 60.10  ? 92  THR G N   1 
ATOM   7573  C CA  . THR G 1 96  ? 23.806  -8.601  108.107 1.00 61.37  ? 92  THR G CA  1 
ATOM   7574  C C   . THR G 1 96  ? 25.234  -8.329  107.648 1.00 62.09  ? 92  THR G C   1 
ATOM   7575  O O   . THR G 1 96  ? 25.614  -8.679  106.529 1.00 59.96  ? 92  THR G O   1 
ATOM   7576  C CB  . THR G 1 96  ? 23.757  -9.954  108.849 1.00 67.42  ? 92  THR G CB  1 
ATOM   7577  O OG1 . THR G 1 96  ? 24.097  -11.015 107.948 1.00 76.91  ? 92  THR G OG1 1 
ATOM   7578  C CG2 . THR G 1 96  ? 22.367  -10.201 109.423 1.00 57.11  ? 92  THR G CG2 1 
ATOM   7579  N N   . LYS G 1 97  ? 26.020  -7.701  108.515 1.00 68.69  ? 93  LYS G N   1 
ATOM   7580  C CA  . LYS G 1 97  ? 27.394  -7.346  108.185 1.00 69.71  ? 93  LYS G CA  1 
ATOM   7581  C C   . LYS G 1 97  ? 28.279  -8.582  108.083 1.00 68.88  ? 93  LYS G C   1 
ATOM   7582  O O   . LYS G 1 97  ? 28.177  -9.503  108.895 1.00 70.55  ? 93  LYS G O   1 
ATOM   7583  C CB  . LYS G 1 97  ? 27.966  -6.399  109.242 1.00 77.45  ? 93  LYS G CB  1 
ATOM   7584  C CG  . LYS G 1 97  ? 27.193  -5.099  109.404 1.00 88.00  ? 93  LYS G CG  1 
ATOM   7585  C CD  . LYS G 1 97  ? 27.209  -4.265  108.132 1.00 95.58  ? 93  LYS G CD  1 
ATOM   7586  C CE  . LYS G 1 97  ? 28.621  -3.849  107.748 1.00 94.28  ? 93  LYS G CE  1 
ATOM   7587  N NZ  . LYS G 1 97  ? 28.632  -2.936  106.573 1.00 90.76  ? 93  LYS G NZ  1 
ATOM   7588  N N   . ASP G 1 98  ? 29.149  -8.592  107.079 1.00 62.45  ? 94  ASP G N   1 
ATOM   7589  C CA  . ASP G 1 98  ? 30.137  -9.649  106.922 1.00 65.28  ? 94  ASP G CA  1 
ATOM   7590  C C   . ASP G 1 98  ? 31.527  -9.096  107.214 1.00 71.66  ? 94  ASP G C   1 
ATOM   7591  O O   . ASP G 1 98  ? 31.683  -7.909  107.499 1.00 71.15  ? 94  ASP G O   1 
ATOM   7592  C CB  . ASP G 1 98  ? 30.088  -10.221 105.505 1.00 61.18  ? 94  ASP G CB  1 
ATOM   7593  C CG  . ASP G 1 98  ? 28.912  -11.152 105.292 1.00 49.56  ? 94  ASP G CG  1 
ATOM   7594  O OD1 . ASP G 1 98  ? 28.611  -11.946 106.208 1.00 50.43  ? 94  ASP G OD1 1 
ATOM   7595  O OD2 . ASP G 1 98  ? 28.290  -11.091 104.210 1.00 53.75  ? 94  ASP G OD2 1 
ATOM   7596  N N   . TYR G 1 99  ? 32.534  -9.960  107.137 1.00 78.75  ? 95  TYR G N   1 
ATOM   7597  C CA  . TYR G 1 99  ? 33.910  -9.545  107.374 1.00 89.74  ? 95  TYR G CA  1 
ATOM   7598  C C   . TYR G 1 99  ? 34.685  -9.452  106.066 1.00 84.65  ? 95  TYR G C   1 
ATOM   7599  O O   . TYR G 1 99  ? 34.751  -10.412 105.297 1.00 69.49  ? 95  TYR G O   1 
ATOM   7600  C CB  . TYR G 1 99  ? 34.614  -10.510 108.329 1.00 101.49 ? 95  TYR G CB  1 
ATOM   7601  C CG  . TYR G 1 99  ? 36.116  -10.334 108.349 1.00 111.37 ? 95  TYR G CG  1 
ATOM   7602  C CD1 . TYR G 1 99  ? 36.689  -9.113  108.683 1.00 111.10 ? 95  TYR G CD1 1 
ATOM   7603  C CD2 . TYR G 1 99  ? 36.962  -11.389 108.032 1.00 116.44 ? 95  TYR G CD2 1 
ATOM   7604  C CE1 . TYR G 1 99  ? 38.062  -8.948  108.699 1.00 112.49 ? 95  TYR G CE1 1 
ATOM   7605  C CE2 . TYR G 1 99  ? 38.335  -11.234 108.047 1.00 117.28 ? 95  TYR G CE2 1 
ATOM   7606  C CZ  . TYR G 1 99  ? 38.879  -10.012 108.381 1.00 118.04 ? 95  TYR G CZ  1 
ATOM   7607  O OH  . TYR G 1 99  ? 40.246  -9.857  108.396 1.00 123.44 ? 95  TYR G OH  1 
ATOM   7608  N N   . GLU G 1 100 ? 35.271  -8.283  105.824 1.00 93.03  ? 96  GLU G N   1 
ATOM   7609  C CA  . GLU G 1 100 ? 36.070  -8.051  104.629 1.00 91.05  ? 96  GLU G CA  1 
ATOM   7610  C C   . GLU G 1 100 ? 37.518  -7.755  104.994 1.00 91.48  ? 96  GLU G C   1 
ATOM   7611  O O   . GLU G 1 100 ? 37.817  -6.710  105.574 1.00 99.25  ? 96  GLU G O   1 
ATOM   7612  C CB  . GLU G 1 100 ? 35.501  -6.877  103.828 1.00 84.37  ? 96  GLU G CB  1 
ATOM   7613  C CG  . GLU G 1 100 ? 34.261  -7.209  103.013 1.00 78.08  ? 96  GLU G CG  1 
ATOM   7614  C CD  . GLU G 1 100 ? 34.559  -8.110  101.832 1.00 74.83  ? 96  GLU G CD  1 
ATOM   7615  O OE1 . GLU G 1 100 ? 33.616  -8.432  101.080 1.00 76.16  ? 96  GLU G OE1 1 
ATOM   7616  O OE2 . GLU G 1 100 ? 35.734  -8.495  101.652 1.00 75.20  ? 96  GLU G OE2 1 
ATOM   7617  N N   . GLU G 1 101 ? 38.413  -8.679  104.661 1.00 85.81  ? 97  GLU G N   1 
ATOM   7618  C CA  . GLU G 1 101 ? 39.839  -8.435  104.823 1.00 85.29  ? 97  GLU G CA  1 
ATOM   7619  C C   . GLU G 1 101 ? 40.245  -7.360  103.824 1.00 97.72  ? 97  GLU G C   1 
ATOM   7620  O O   . GLU G 1 101 ? 40.980  -6.432  104.157 1.00 108.66 ? 97  GLU G O   1 
ATOM   7621  C CB  . GLU G 1 101 ? 40.644  -9.712  104.588 1.00 74.01  ? 97  GLU G CB  1 
ATOM   7622  C CG  . GLU G 1 101 ? 42.121  -9.566  104.925 1.00 64.07  ? 97  GLU G CG  1 
ATOM   7623  C CD  . GLU G 1 101 ? 42.910  -10.837 104.682 1.00 71.79  ? 97  GLU G CD  1 
ATOM   7624  O OE1 . GLU G 1 101 ? 42.442  -11.920 105.094 1.00 69.85  ? 97  GLU G OE1 1 
ATOM   7625  O OE2 . GLU G 1 101 ? 44.002  -10.750 104.079 1.00 74.76  ? 97  GLU G OE2 1 
ATOM   7626  N N   . HIS G 1 102 ? 39.754  -7.502  102.596 1.00 96.71  ? 98  HIS G N   1 
ATOM   7627  C CA  . HIS G 1 102 ? 39.901  -6.479  101.567 1.00 85.93  ? 98  HIS G CA  1 
ATOM   7628  C C   . HIS G 1 102 ? 38.517  -6.067  101.076 1.00 81.71  ? 98  HIS G C   1 
ATOM   7629  O O   . HIS G 1 102 ? 37.756  -6.899  100.584 1.00 75.30  ? 98  HIS G O   1 
ATOM   7630  C CB  . HIS G 1 102 ? 40.732  -7.007  100.397 1.00 73.35  ? 98  HIS G CB  1 
ATOM   7631  C CG  . HIS G 1 102 ? 42.116  -7.428  100.780 1.00 65.06  ? 98  HIS G CG  1 
ATOM   7632  N ND1 . HIS G 1 102 ? 42.402  -8.677  101.287 1.00 57.71  ? 98  HIS G ND1 1 
ATOM   7633  C CD2 . HIS G 1 102 ? 43.295  -6.763  100.731 1.00 66.04  ? 98  HIS G CD2 1 
ATOM   7634  C CE1 . HIS G 1 102 ? 43.698  -8.764  101.532 1.00 62.34  ? 98  HIS G CE1 1 
ATOM   7635  N NE2 . HIS G 1 102 ? 44.262  -7.615  101.204 1.00 63.46  ? 98  HIS G NE2 1 
ATOM   7636  N N   . ASP G 1 103 ? 38.195  -4.783  101.209 1.00 88.68  ? 99  ASP G N   1 
ATOM   7637  C CA  . ASP G 1 103 ? 36.865  -4.287  100.865 1.00 87.25  ? 99  ASP G CA  1 
ATOM   7638  C C   . ASP G 1 103 ? 36.568  -4.494  99.382  1.00 84.29  ? 99  ASP G C   1 
ATOM   7639  O O   . ASP G 1 103 ? 35.409  -4.604  98.983  1.00 87.00  ? 99  ASP G O   1 
ATOM   7640  C CB  . ASP G 1 103 ? 36.742  -2.803  101.218 1.00 85.07  ? 99  ASP G CB  1 
ATOM   7641  C CG  . ASP G 1 103 ? 35.300  -2.358  101.371 1.00 98.92  ? 99  ASP G CG  1 
ATOM   7642  O OD1 . ASP G 1 103 ? 34.647  -2.088  100.342 1.00 107.77 ? 99  ASP G OD1 1 
ATOM   7643  O OD2 . ASP G 1 103 ? 34.822  -2.272  102.523 1.00 102.33 ? 99  ASP G OD2 1 
ATOM   7644  N N   . LYS G 1 104 ? 37.620  -4.541  98.569  1.00 77.35  ? 100 LYS G N   1 
ATOM   7645  C CA  . LYS G 1 104 ? 37.473  -4.770  97.135  1.00 78.72  ? 100 LYS G CA  1 
ATOM   7646  C C   . LYS G 1 104 ? 37.718  -6.241  96.778  1.00 78.96  ? 100 LYS G C   1 
ATOM   7647  O O   . LYS G 1 104 ? 38.340  -6.544  95.762  1.00 78.13  ? 100 LYS G O   1 
ATOM   7648  C CB  . LYS G 1 104 ? 38.436  -3.870  96.352  1.00 75.97  ? 100 LYS G CB  1 
ATOM   7649  C CG  . LYS G 1 104 ? 38.227  -2.375  96.576  1.00 73.33  ? 100 LYS G CG  1 
ATOM   7650  C CD  . LYS G 1 104 ? 37.180  -1.800  95.633  1.00 76.47  ? 100 LYS G CD  1 
ATOM   7651  C CE  . LYS G 1 104 ? 36.967  -0.317  95.892  1.00 91.95  ? 100 LYS G CE  1 
ATOM   7652  N NZ  . LYS G 1 104 ? 36.169  0.339   94.821  1.00 100.96 ? 100 LYS G NZ  1 
ATOM   7653  N N   . ALA G 1 105 ? 37.220  -7.146  97.617  1.00 79.98  ? 101 ALA G N   1 
ATOM   7654  C CA  . ALA G 1 105 ? 37.424  -8.583  97.434  1.00 85.99  ? 101 ALA G CA  1 
ATOM   7655  C C   . ALA G 1 105 ? 36.309  -9.207  96.606  1.00 86.52  ? 101 ALA G C   1 
ATOM   7656  O O   . ALA G 1 105 ? 35.144  -9.139  96.987  1.00 79.52  ? 101 ALA G O   1 
ATOM   7657  C CB  . ALA G 1 105 ? 37.485  -9.268  98.782  1.00 95.34  ? 101 ALA G CB  1 
ATOM   7658  N N   . CYS G 1 106 ? 36.680  -9.860  95.508  1.00 96.16  ? 102 CYS G N   1 
ATOM   7659  C CA  . CYS G 1 106 ? 35.712  -10.437 94.576  1.00 96.95  ? 102 CYS G CA  1 
ATOM   7660  C C   . CYS G 1 106 ? 35.178  -9.379  93.611  1.00 92.88  ? 102 CYS G C   1 
ATOM   7661  O O   . CYS G 1 106 ? 34.133  -9.569  92.987  1.00 89.64  ? 102 CYS G O   1 
ATOM   7662  C CB  . CYS G 1 106 ? 34.539  -11.077 95.321  1.00 95.39  ? 102 CYS G CB  1 
ATOM   7663  S SG  . CYS G 1 106 ? 34.989  -12.018 96.796  1.00 75.62  ? 102 CYS G SG  1 
ATOM   7664  N N   . VAL G 1 107 ? 35.894  -8.264  93.491  1.00 85.97  ? 103 VAL G N   1 
ATOM   7665  C CA  . VAL G 1 107 ? 35.477  -7.178  92.613  1.00 60.64  ? 103 VAL G CA  1 
ATOM   7666  C C   . VAL G 1 107 ? 36.489  -7.006  91.496  1.00 41.78  ? 103 VAL G C   1 
ATOM   7667  O O   . VAL G 1 107 ? 37.696  -7.011  91.735  1.00 42.72  ? 103 VAL G O   1 
ATOM   7668  C CB  . VAL G 1 107 ? 35.355  -5.849  93.386  1.00 46.25  ? 103 VAL G CB  1 
ATOM   7669  C CG1 . VAL G 1 107 ? 34.865  -4.730  92.474  1.00 47.84  ? 103 VAL G CG1 1 
ATOM   7670  C CG2 . VAL G 1 107 ? 34.431  -6.025  94.569  1.00 30.40  ? 103 VAL G CG2 1 
ATOM   7671  N N   . ARG G 1 108 ? 35.991  -6.863  90.274  1.00 40.27  ? 104 ARG G N   1 
ATOM   7672  C CA  . ARG G 1 108 ? 36.850  -6.654  89.118  1.00 57.64  ? 104 ARG G CA  1 
ATOM   7673  C C   . ARG G 1 108 ? 36.398  -5.421  88.353  1.00 61.25  ? 104 ARG G C   1 
ATOM   7674  O O   . ARG G 1 108 ? 35.375  -4.817  88.677  1.00 63.21  ? 104 ARG G O   1 
ATOM   7675  C CB  . ARG G 1 108 ? 36.802  -7.868  88.192  1.00 49.52  ? 104 ARG G CB  1 
ATOM   7676  C CG  . ARG G 1 108 ? 35.395  -8.211  87.738  1.00 53.22  ? 104 ARG G CG  1 
ATOM   7677  C CD  . ARG G 1 108 ? 35.370  -9.242  86.621  1.00 52.31  ? 104 ARG G CD  1 
ATOM   7678  N NE  . ARG G 1 108 ? 35.336  -8.611  85.303  1.00 57.63  ? 104 ARG G NE  1 
ATOM   7679  C CZ  . ARG G 1 108 ? 34.912  -9.206  84.191  1.00 55.52  ? 104 ARG G CZ  1 
ATOM   7680  N NH1 . ARG G 1 108 ? 34.480  -10.460 84.218  1.00 50.05  ? 104 ARG G NH1 1 
ATOM   7681  N NH2 . ARG G 1 108 ? 34.916  -8.542  83.043  1.00 59.90  ? 104 ARG G NH2 1 
ATOM   7682  N N   . THR G 1 109 ? 37.162  -5.056  87.330  1.00 60.74  ? 105 THR G N   1 
ATOM   7683  C CA  . THR G 1 109 ? 36.796  -3.942  86.468  1.00 52.44  ? 105 THR G CA  1 
ATOM   7684  C C   . THR G 1 109 ? 35.956  -4.446  85.300  1.00 50.57  ? 105 THR G C   1 
ATOM   7685  O O   . THR G 1 109 ? 36.205  -5.526  84.764  1.00 54.87  ? 105 THR G O   1 
ATOM   7686  C CB  . THR G 1 109 ? 38.039  -3.212  85.924  1.00 45.82  ? 105 THR G CB  1 
ATOM   7687  O OG1 . THR G 1 109 ? 38.829  -2.725  87.016  1.00 52.23  ? 105 THR G OG1 1 
ATOM   7688  C CG2 . THR G 1 109 ? 37.631  -2.043  85.044  1.00 46.76  ? 105 THR G CG2 1 
ATOM   7689  N N   . PHE G 1 110 ? 34.952  -3.664  84.920  1.00 40.91  ? 106 PHE G N   1 
ATOM   7690  C CA  . PHE G 1 110 ? 34.121  -3.984  83.768  1.00 40.82  ? 106 PHE G CA  1 
ATOM   7691  C C   . PHE G 1 110 ? 34.170  -2.845  82.756  1.00 44.74  ? 106 PHE G C   1 
ATOM   7692  O O   . PHE G 1 110 ? 34.066  -1.675  83.120  1.00 56.42  ? 106 PHE G O   1 
ATOM   7693  C CB  . PHE G 1 110 ? 32.674  -4.226  84.198  1.00 54.45  ? 106 PHE G CB  1 
ATOM   7694  C CG  . PHE G 1 110 ? 32.449  -5.552  84.873  1.00 59.54  ? 106 PHE G CG  1 
ATOM   7695  C CD1 . PHE G 1 110 ? 32.663  -5.699  86.233  1.00 59.60  ? 106 PHE G CD1 1 
ATOM   7696  C CD2 . PHE G 1 110 ? 32.012  -6.649  84.146  1.00 55.81  ? 106 PHE G CD2 1 
ATOM   7697  C CE1 . PHE G 1 110 ? 32.450  -6.917  86.855  1.00 46.97  ? 106 PHE G CE1 1 
ATOM   7698  C CE2 . PHE G 1 110 ? 31.799  -7.869  84.763  1.00 39.76  ? 106 PHE G CE2 1 
ATOM   7699  C CZ  . PHE G 1 110 ? 32.018  -8.002  86.118  1.00 46.93  ? 106 PHE G CZ  1 
ATOM   7700  N N   . TYR G 1 111 ? 34.332  -3.195  81.485  1.00 52.14  ? 107 TYR G N   1 
ATOM   7701  C CA  . TYR G 1 111 ? 34.329  -2.208  80.414  1.00 51.39  ? 107 TYR G CA  1 
ATOM   7702  C C   . TYR G 1 111 ? 33.128  -2.453  79.509  1.00 54.72  ? 107 TYR G C   1 
ATOM   7703  O O   . TYR G 1 111 ? 33.236  -3.105  78.472  1.00 65.96  ? 107 TYR G O   1 
ATOM   7704  C CB  . TYR G 1 111 ? 35.636  -2.274  79.622  1.00 58.29  ? 107 TYR G CB  1 
ATOM   7705  C CG  . TYR G 1 111 ? 35.735  -1.260  78.510  1.00 57.86  ? 107 TYR G CG  1 
ATOM   7706  C CD1 . TYR G 1 111 ? 35.715  0.102   78.782  1.00 56.41  ? 107 TYR G CD1 1 
ATOM   7707  C CD2 . TYR G 1 111 ? 35.848  -1.664  77.187  1.00 61.34  ? 107 TYR G CD2 1 
ATOM   7708  C CE1 . TYR G 1 111 ? 35.807  1.034   77.766  1.00 68.88  ? 107 TYR G CE1 1 
ATOM   7709  C CE2 . TYR G 1 111 ? 35.944  -0.742  76.165  1.00 72.15  ? 107 TYR G CE2 1 
ATOM   7710  C CZ  . TYR G 1 111 ? 35.921  0.605   76.457  1.00 82.88  ? 107 TYR G CZ  1 
ATOM   7711  O OH  . TYR G 1 111 ? 36.012  1.522   75.434  1.00 94.42  ? 107 TYR G OH  1 
ATOM   7712  N N   . GLU G 1 112 ? 31.979  -1.928  79.922  1.00 63.81  ? 108 GLU G N   1 
ATOM   7713  C CA  . GLU G 1 112 ? 30.726  -2.151  79.213  1.00 59.14  ? 108 GLU G CA  1 
ATOM   7714  C C   . GLU G 1 112 ? 29.969  -0.837  79.053  1.00 55.14  ? 108 GLU G C   1 
ATOM   7715  O O   . GLU G 1 112 ? 30.239  0.133   79.759  1.00 55.15  ? 108 GLU G O   1 
ATOM   7716  C CB  . GLU G 1 112 ? 29.865  -3.160  79.980  1.00 45.09  ? 108 GLU G CB  1 
ATOM   7717  C CG  . GLU G 1 112 ? 30.539  -4.508  80.217  1.00 51.67  ? 108 GLU G CG  1 
ATOM   7718  C CD  . GLU G 1 112 ? 29.760  -5.395  81.174  1.00 59.12  ? 108 GLU G CD  1 
ATOM   7719  O OE1 . GLU G 1 112 ? 30.174  -6.555  81.386  1.00 49.49  ? 108 GLU G OE1 1 
ATOM   7720  O OE2 . GLU G 1 112 ? 28.736  -4.930  81.718  1.00 64.08  ? 108 GLU G OE2 1 
ATOM   7721  N N   . THR G 1 113 ? 29.024  -0.809  78.118  1.00 50.34  ? 109 THR G N   1 
ATOM   7722  C CA  . THR G 1 113 ? 28.204  0.376   77.904  1.00 53.46  ? 109 THR G CA  1 
ATOM   7723  C C   . THR G 1 113 ? 27.382  0.676   79.147  1.00 60.40  ? 109 THR G C   1 
ATOM   7724  O O   . THR G 1 113 ? 27.141  -0.211  79.966  1.00 71.08  ? 109 THR G O   1 
ATOM   7725  C CB  . THR G 1 113 ? 27.240  0.194   76.716  1.00 65.36  ? 109 THR G CB  1 
ATOM   7726  O OG1 . THR G 1 113 ? 26.561  -1.062  76.833  1.00 63.77  ? 109 THR G OG1 1 
ATOM   7727  C CG2 . THR G 1 113 ? 27.994  0.239   75.397  1.00 66.74  ? 109 THR G CG2 1 
ATOM   7728  N N   . PRO G 1 114 ? 26.950  1.935   79.297  1.00 65.28  ? 110 PRO G N   1 
ATOM   7729  C CA  . PRO G 1 114 ? 26.066  2.299   80.408  1.00 60.46  ? 110 PRO G CA  1 
ATOM   7730  C C   . PRO G 1 114 ? 24.822  1.416   80.440  1.00 64.12  ? 110 PRO G C   1 
ATOM   7731  O O   . PRO G 1 114 ? 24.277  1.152   81.510  1.00 68.54  ? 110 PRO G O   1 
ATOM   7732  C CB  . PRO G 1 114 ? 25.689  3.749   80.093  1.00 39.61  ? 110 PRO G CB  1 
ATOM   7733  C CG  . PRO G 1 114 ? 26.822  4.263   79.276  1.00 47.12  ? 110 PRO G CG  1 
ATOM   7734  C CD  . PRO G 1 114 ? 27.302  3.098   78.463  1.00 53.72  ? 110 PRO G CD  1 
ATOM   7735  N N   . LEU G 1 115 ? 24.391  0.959   79.270  1.00 73.84  ? 111 LEU G N   1 
ATOM   7736  C CA  . LEU G 1 115 ? 23.193  0.137   79.158  1.00 67.44  ? 111 LEU G CA  1 
ATOM   7737  C C   . LEU G 1 115 ? 23.402  -1.213  79.841  1.00 55.94  ? 111 LEU G C   1 
ATOM   7738  O O   . LEU G 1 115 ? 22.566  -1.654  80.628  1.00 59.48  ? 111 LEU G O   1 
ATOM   7739  C CB  . LEU G 1 115 ? 22.825  -0.057  77.685  1.00 50.58  ? 111 LEU G CB  1 
ATOM   7740  C CG  . LEU G 1 115 ? 21.350  -0.329  77.391  1.00 46.74  ? 111 LEU G CG  1 
ATOM   7741  C CD1 . LEU G 1 115 ? 21.013  0.094   75.969  1.00 48.32  ? 111 LEU G CD1 1 
ATOM   7742  C CD2 . LEU G 1 115 ? 21.009  -1.796  77.609  1.00 39.52  ? 111 LEU G CD2 1 
ATOM   7743  N N   . GLN G 1 116 ? 24.523  -1.861  79.539  1.00 33.77  ? 112 GLN G N   1 
ATOM   7744  C CA  . GLN G 1 116 ? 24.864  -3.133  80.166  1.00 48.83  ? 112 GLN G CA  1 
ATOM   7745  C C   . GLN G 1 116 ? 25.013  -2.965  81.676  1.00 46.67  ? 112 GLN G C   1 
ATOM   7746  O O   . GLN G 1 116 ? 24.474  -3.751  82.455  1.00 55.36  ? 112 GLN G O   1 
ATOM   7747  C CB  . GLN G 1 116 ? 26.160  -3.688  79.575  1.00 55.69  ? 112 GLN G CB  1 
ATOM   7748  C CG  . GLN G 1 116 ? 26.049  -4.118  78.125  1.00 56.77  ? 112 GLN G CG  1 
ATOM   7749  C CD  . GLN G 1 116 ? 27.361  -4.642  77.577  1.00 73.17  ? 112 GLN G CD  1 
ATOM   7750  O OE1 . GLN G 1 116 ? 28.240  -3.868  77.194  1.00 76.77  ? 112 GLN G OE1 1 
ATOM   7751  N NE2 . GLN G 1 116 ? 27.504  -5.962  77.544  1.00 79.85  ? 112 GLN G NE2 1 
ATOM   7752  N N   . LEU G 1 117 ? 25.754  -1.939  82.077  1.00 38.78  ? 113 LEU G N   1 
ATOM   7753  C CA  . LEU G 1 117 ? 25.915  -1.603  83.486  1.00 38.43  ? 113 LEU G CA  1 
ATOM   7754  C C   . LEU G 1 117 ? 24.559  -1.483  84.173  1.00 41.72  ? 113 LEU G C   1 
ATOM   7755  O O   . LEU G 1 117 ? 24.397  -1.870  85.330  1.00 52.89  ? 113 LEU G O   1 
ATOM   7756  C CB  . LEU G 1 117 ? 26.681  -0.287  83.621  1.00 36.84  ? 113 LEU G CB  1 
ATOM   7757  C CG  . LEU G 1 117 ? 26.719  0.338   85.016  1.00 42.96  ? 113 LEU G CG  1 
ATOM   7758  C CD1 . LEU G 1 117 ? 27.294  -0.634  86.033  1.00 43.91  ? 113 LEU G CD1 1 
ATOM   7759  C CD2 . LEU G 1 117 ? 27.526  1.624   84.988  1.00 41.53  ? 113 LEU G CD2 1 
ATOM   7760  N N   . LEU G 1 118 ? 23.587  -0.942  83.450  1.00 50.01  ? 114 LEU G N   1 
ATOM   7761  C CA  . LEU G 1 118 ? 22.242  -0.757  83.980  1.00 45.79  ? 114 LEU G CA  1 
ATOM   7762  C C   . LEU G 1 118 ? 21.460  -2.067  84.006  1.00 40.28  ? 114 LEU G C   1 
ATOM   7763  O O   . LEU G 1 118 ? 20.524  -2.227  84.789  1.00 31.37  ? 114 LEU G O   1 
ATOM   7764  C CB  . LEU G 1 118 ? 21.500  0.283   83.144  1.00 40.11  ? 114 LEU G CB  1 
ATOM   7765  C CG  . LEU G 1 118 ? 22.024  1.704   83.327  1.00 32.21  ? 114 LEU G CG  1 
ATOM   7766  C CD1 . LEU G 1 118 ? 21.586  2.596   82.186  1.00 54.54  ? 114 LEU G CD1 1 
ATOM   7767  C CD2 . LEU G 1 118 ? 21.524  2.236   84.642  1.00 29.64  ? 114 LEU G CD2 1 
ATOM   7768  N N   . GLU G 1 119 ? 21.842  -3.000  83.141  1.00 37.22  ? 115 GLU G N   1 
ATOM   7769  C CA  . GLU G 1 119 ? 21.241  -4.324  83.138  1.00 43.42  ? 115 GLU G CA  1 
ATOM   7770  C C   . GLU G 1 119 ? 21.712  -5.086  84.374  1.00 45.58  ? 115 GLU G C   1 
ATOM   7771  O O   . GLU G 1 119 ? 20.947  -5.836  84.984  1.00 47.21  ? 115 GLU G O   1 
ATOM   7772  C CB  . GLU G 1 119 ? 21.632  -5.083  81.869  1.00 62.54  ? 115 GLU G CB  1 
ATOM   7773  C CG  . GLU G 1 119 ? 20.703  -6.237  81.518  1.00 79.91  ? 115 GLU G CG  1 
ATOM   7774  C CD  . GLU G 1 119 ? 19.423  -5.776  80.840  1.00 79.70  ? 115 GLU G CD  1 
ATOM   7775  O OE1 . GLU G 1 119 ? 19.482  -4.825  80.031  1.00 62.75  ? 115 GLU G OE1 1 
ATOM   7776  O OE2 . GLU G 1 119 ? 18.358  -6.370  81.115  1.00 80.42  ? 115 GLU G OE2 1 
ATOM   7777  N N   . LYS G 1 120 ? 22.976  -4.885  84.739  1.00 29.99  ? 116 LYS G N   1 
ATOM   7778  C CA  . LYS G 1 120 ? 23.552  -5.536  85.911  1.00 42.13  ? 116 LYS G CA  1 
ATOM   7779  C C   . LYS G 1 120 ? 22.827  -5.130  87.190  1.00 51.27  ? 116 LYS G C   1 
ATOM   7780  O O   . LYS G 1 120 ? 22.450  -5.979  87.999  1.00 45.42  ? 116 LYS G O   1 
ATOM   7781  C CB  . LYS G 1 120 ? 25.039  -5.198  86.037  1.00 29.87  ? 116 LYS G CB  1 
ATOM   7782  C CG  . LYS G 1 120 ? 25.951  -6.109  85.237  1.00 37.73  ? 116 LYS G CG  1 
ATOM   7783  C CD  . LYS G 1 120 ? 27.414  -5.762  85.454  1.00 42.07  ? 116 LYS G CD  1 
ATOM   7784  C CE  . LYS G 1 120 ? 28.319  -6.956  85.179  1.00 53.22  ? 116 LYS G CE  1 
ATOM   7785  N NZ  . LYS G 1 120 ? 28.205  -7.450  83.777  1.00 62.82  ? 116 LYS G NZ  1 
ATOM   7786  N N   . VAL G 1 121 ? 22.641  -3.826  87.372  1.00 38.06  ? 117 VAL G N   1 
ATOM   7787  C CA  . VAL G 1 121 ? 21.962  -3.314  88.554  1.00 31.41  ? 117 VAL G CA  1 
ATOM   7788  C C   . VAL G 1 121 ? 20.520  -3.807  88.595  1.00 33.07  ? 117 VAL G C   1 
ATOM   7789  O O   . VAL G 1 121 ? 20.018  -4.195  89.648  1.00 37.66  ? 117 VAL G O   1 
ATOM   7790  C CB  . VAL G 1 121 ? 21.988  -1.775  88.595  1.00 37.16  ? 117 VAL G CB  1 
ATOM   7791  C CG1 . VAL G 1 121 ? 21.086  -1.254  89.704  1.00 24.94  ? 117 VAL G CG1 1 
ATOM   7792  C CG2 . VAL G 1 121 ? 23.414  -1.279  88.789  1.00 37.91  ? 117 VAL G CG2 1 
ATOM   7793  N N   . LYS G 1 122 ? 19.857  -3.786  87.444  1.00 41.15  ? 118 LYS G N   1 
ATOM   7794  C CA  . LYS G 1 122 ? 18.503  -4.310  87.342  1.00 50.74  ? 118 LYS G CA  1 
ATOM   7795  C C   . LYS G 1 122 ? 18.475  -5.724  87.900  1.00 57.12  ? 118 LYS G C   1 
ATOM   7796  O O   . LYS G 1 122 ? 17.651  -6.052  88.753  1.00 60.38  ? 118 LYS G O   1 
ATOM   7797  C CB  . LYS G 1 122 ? 18.046  -4.319  85.882  1.00 69.39  ? 118 LYS G CB  1 
ATOM   7798  C CG  . LYS G 1 122 ? 16.651  -4.886  85.658  1.00 76.20  ? 118 LYS G CG  1 
ATOM   7799  C CD  . LYS G 1 122 ? 15.585  -3.806  85.730  1.00 76.43  ? 118 LYS G CD  1 
ATOM   7800  C CE  . LYS G 1 122 ? 14.213  -4.356  85.373  1.00 83.63  ? 118 LYS G CE  1 
ATOM   7801  N NZ  . LYS G 1 122 ? 13.724  -5.352  86.366  1.00 92.31  ? 118 LYS G NZ  1 
ATOM   7802  N N   . ASN G 1 123 ? 19.392  -6.555  87.417  1.00 58.46  ? 119 ASN G N   1 
ATOM   7803  C CA  . ASN G 1 123 ? 19.482  -7.941  87.853  1.00 56.46  ? 119 ASN G CA  1 
ATOM   7804  C C   . ASN G 1 123 ? 19.600  -8.047  89.371  1.00 65.15  ? 119 ASN G C   1 
ATOM   7805  O O   . ASN G 1 123 ? 18.910  -8.849  89.999  1.00 66.75  ? 119 ASN G O   1 
ATOM   7806  C CB  . ASN G 1 123 ? 20.679  -8.622  87.187  1.00 54.99  ? 119 ASN G CB  1 
ATOM   7807  C CG  . ASN G 1 123 ? 20.625  -10.133 87.292  1.00 67.67  ? 119 ASN G CG  1 
ATOM   7808  O OD1 . ASN G 1 123 ? 19.554  -10.719 87.451  1.00 72.81  ? 119 ASN G OD1 1 
ATOM   7809  N ND2 . ASN G 1 123 ? 21.785  -10.773 87.197  1.00 70.85  ? 119 ASN G ND2 1 
ATOM   7810  N N   . VAL G 1 124 ? 20.472  -7.233  89.958  1.00 66.56  ? 120 VAL G N   1 
ATOM   7811  C CA  . VAL G 1 124 ? 20.690  -7.257  91.403  1.00 64.75  ? 120 VAL G CA  1 
ATOM   7812  C C   . VAL G 1 124 ? 19.399  -6.973  92.167  1.00 65.44  ? 120 VAL G C   1 
ATOM   7813  O O   . VAL G 1 124 ? 18.954  -7.793  92.970  1.00 68.80  ? 120 VAL G O   1 
ATOM   7814  C CB  . VAL G 1 124 ? 21.769  -6.241  91.828  1.00 60.29  ? 120 VAL G CB  1 
ATOM   7815  C CG1 . VAL G 1 124 ? 21.775  -6.059  93.342  1.00 49.68  ? 120 VAL G CG1 1 
ATOM   7816  C CG2 . VAL G 1 124 ? 23.137  -6.688  91.337  1.00 64.54  ? 120 VAL G CG2 1 
ATOM   7817  N N   . PHE G 1 125 ? 18.804  -5.810  91.921  1.00 50.76  ? 121 PHE G N   1 
ATOM   7818  C CA  . PHE G 1 125 ? 17.548  -5.450  92.570  1.00 50.24  ? 121 PHE G CA  1 
ATOM   7819  C C   . PHE G 1 125 ? 16.467  -6.485  92.274  1.00 60.90  ? 121 PHE G C   1 
ATOM   7820  O O   . PHE G 1 125 ? 15.636  -6.786  93.130  1.00 64.04  ? 121 PHE G O   1 
ATOM   7821  C CB  . PHE G 1 125 ? 17.078  -4.067  92.111  1.00 48.77  ? 121 PHE G CB  1 
ATOM   7822  C CG  . PHE G 1 125 ? 17.831  -2.930  92.742  1.00 40.07  ? 121 PHE G CG  1 
ATOM   7823  C CD1 . PHE G 1 125 ? 17.535  -2.521  94.030  1.00 33.60  ? 121 PHE G CD1 1 
ATOM   7824  C CD2 . PHE G 1 125 ? 18.828  -2.266  92.047  1.00 37.92  ? 121 PHE G CD2 1 
ATOM   7825  C CE1 . PHE G 1 125 ? 18.222  -1.476  94.616  1.00 39.65  ? 121 PHE G CE1 1 
ATOM   7826  C CE2 . PHE G 1 125 ? 19.518  -1.218  92.629  1.00 37.69  ? 121 PHE G CE2 1 
ATOM   7827  C CZ  . PHE G 1 125 ? 19.214  -0.823  93.914  1.00 38.16  ? 121 PHE G CZ  1 
ATOM   7828  N N   . ASN G 1 126 ? 16.489  -7.029  91.061  1.00 65.40  ? 122 ASN G N   1 
ATOM   7829  C CA  . ASN G 1 126 ? 15.484  -7.994  90.632  1.00 60.72  ? 122 ASN G CA  1 
ATOM   7830  C C   . ASN G 1 126 ? 15.603  -9.317  91.385  1.00 61.76  ? 122 ASN G C   1 
ATOM   7831  O O   . ASN G 1 126 ? 14.629  -9.801  91.961  1.00 69.15  ? 122 ASN G O   1 
ATOM   7832  C CB  . ASN G 1 126 ? 15.598  -8.242  89.126  1.00 79.38  ? 122 ASN G CB  1 
ATOM   7833  C CG  . ASN G 1 126 ? 14.459  -9.086  88.587  1.00 91.87  ? 122 ASN G CG  1 
ATOM   7834  O OD1 . ASN G 1 126 ? 13.342  -9.044  89.105  1.00 97.34  ? 122 ASN G OD1 1 
ATOM   7835  N ND2 . ASN G 1 126 ? 14.736  -9.860  87.544  1.00 87.46  ? 122 ASN G ND2 1 
ATOM   7836  N N   . GLU G 1 127 ? 16.799  -9.897  91.375  1.00 68.38  ? 123 GLU G N   1 
ATOM   7837  C CA  . GLU G 1 127 ? 17.048  -11.158 92.065  1.00 65.95  ? 123 GLU G CA  1 
ATOM   7838  C C   . GLU G 1 127 ? 16.813  -11.015 93.566  1.00 54.22  ? 123 GLU G C   1 
ATOM   7839  O O   . GLU G 1 127 ? 16.348  -11.947 94.218  1.00 53.82  ? 123 GLU G O   1 
ATOM   7840  C CB  . GLU G 1 127 ? 18.479  -11.643 91.810  1.00 72.79  ? 123 GLU G CB  1 
ATOM   7841  C CG  . GLU G 1 127 ? 18.760  -12.057 90.370  1.00 80.45  ? 123 GLU G CG  1 
ATOM   7842  C CD  . GLU G 1 127 ? 20.169  -12.595 90.173  1.00 86.15  ? 123 GLU G CD  1 
ATOM   7843  O OE1 . GLU G 1 127 ? 20.842  -12.895 91.182  1.00 80.00  ? 123 GLU G OE1 1 
ATOM   7844  O OE2 . GLU G 1 127 ? 20.603  -12.718 89.008  1.00 87.88  ? 123 GLU G OE2 1 
ATOM   7845  N N   . THR G 1 128 ? 17.134  -9.844  94.108  1.00 42.32  ? 124 THR G N   1 
ATOM   7846  C CA  . THR G 1 128 ? 16.969  -9.594  95.536  1.00 44.41  ? 124 THR G CA  1 
ATOM   7847  C C   . THR G 1 128 ? 15.497  -9.658  95.925  1.00 44.03  ? 124 THR G C   1 
ATOM   7848  O O   . THR G 1 128 ? 15.139  -10.246 96.945  1.00 42.16  ? 124 THR G O   1 
ATOM   7849  C CB  . THR G 1 128 ? 17.530  -8.214  95.942  1.00 49.66  ? 124 THR G CB  1 
ATOM   7850  O OG1 . THR G 1 128 ? 18.945  -8.177  95.716  1.00 34.36  ? 124 THR G OG1 1 
ATOM   7851  C CG2 . THR G 1 128 ? 17.254  -7.936  97.413  1.00 52.00  ? 124 THR G CG2 1 
ATOM   7852  N N   . LYS G 1 129 ? 14.645  -9.048  95.108  1.00 48.49  ? 125 LYS G N   1 
ATOM   7853  C CA  . LYS G 1 129 ? 13.214  -9.038  95.376  1.00 54.61  ? 125 LYS G CA  1 
ATOM   7854  C C   . LYS G 1 129 ? 12.649  -10.452 95.345  1.00 54.16  ? 125 LYS G C   1 
ATOM   7855  O O   . LYS G 1 129 ? 11.825  -10.818 96.183  1.00 63.74  ? 125 LYS G O   1 
ATOM   7856  C CB  . LYS G 1 129 ? 12.481  -8.165  94.356  1.00 48.50  ? 125 LYS G CB  1 
ATOM   7857  C CG  . LYS G 1 129 ? 10.966  -8.211  94.495  1.00 48.11  ? 125 LYS G CG  1 
ATOM   7858  C CD  . LYS G 1 129 ? 10.281  -7.264  93.527  1.00 52.20  ? 125 LYS G CD  1 
ATOM   7859  C CE  . LYS G 1 129 ? 8.767   -7.342  93.646  1.00 51.05  ? 125 LYS G CE  1 
ATOM   7860  N NZ  . LYS G 1 129 ? 8.234   -8.667  93.220  1.00 53.74  ? 125 LYS G NZ  1 
ATOM   7861  N N   . ASN G 1 130 ? 13.098  -11.245 94.377  1.00 45.32  ? 126 ASN G N   1 
ATOM   7862  C CA  . ASN G 1 130 ? 12.589  -12.600 94.201  1.00 48.53  ? 126 ASN G CA  1 
ATOM   7863  C C   . ASN G 1 130 ? 12.921  -13.521 95.373  1.00 42.09  ? 126 ASN G C   1 
ATOM   7864  O O   . ASN G 1 130 ? 12.146  -14.417 95.703  1.00 48.74  ? 126 ASN G O   1 
ATOM   7865  C CB  . ASN G 1 130 ? 13.124  -13.202 92.900  1.00 53.48  ? 126 ASN G CB  1 
ATOM   7866  C CG  . ASN G 1 130 ? 12.627  -12.467 91.670  1.00 51.44  ? 126 ASN G CG  1 
ATOM   7867  O OD1 . ASN G 1 130 ? 11.654  -11.715 91.734  1.00 56.46  ? 126 ASN G OD1 1 
ATOM   7868  N ND2 . ASN G 1 130 ? 13.289  -12.688 90.540  1.00 44.08  ? 126 ASN G ND2 1 
ATOM   7869  N N   . LEU G 1 131 ? 14.071  -13.300 96.001  1.00 46.98  ? 127 LEU G N   1 
ATOM   7870  C CA  . LEU G 1 131 ? 14.519  -14.161 97.092  1.00 39.61  ? 127 LEU G CA  1 
ATOM   7871  C C   . LEU G 1 131 ? 13.957  -13.720 98.443  1.00 46.60  ? 127 LEU G C   1 
ATOM   7872  O O   . LEU G 1 131 ? 13.695  -14.551 99.313  1.00 43.46  ? 127 LEU G O   1 
ATOM   7873  C CB  . LEU G 1 131 ? 16.047  -14.197 97.150  1.00 16.60  ? 127 LEU G CB  1 
ATOM   7874  C CG  . LEU G 1 131 ? 16.743  -14.689 95.879  1.00 33.00  ? 127 LEU G CG  1 
ATOM   7875  C CD1 . LEU G 1 131 ? 18.247  -14.764 96.093  1.00 46.55  ? 127 LEU G CD1 1 
ATOM   7876  C CD2 . LEU G 1 131 ? 16.190  -16.037 95.442  1.00 48.93  ? 127 LEU G CD2 1 
ATOM   7877  N N   . LEU G 1 132 ? 13.776  -12.414 98.619  1.00 48.27  ? 128 LEU G N   1 
ATOM   7878  C CA  . LEU G 1 132 ? 13.209  -11.887 99.857  1.00 39.99  ? 128 LEU G CA  1 
ATOM   7879  C C   . LEU G 1 132 ? 11.746  -12.296 99.999  1.00 46.24  ? 128 LEU G C   1 
ATOM   7880  O O   . LEU G 1 132 ? 11.252  -12.497 101.110 1.00 36.18  ? 128 LEU G O   1 
ATOM   7881  C CB  . LEU G 1 132 ? 13.340  -10.364 99.907  1.00 33.11  ? 128 LEU G CB  1 
ATOM   7882  C CG  . LEU G 1 132 ? 14.710  -9.832  100.329 1.00 41.10  ? 128 LEU G CG  1 
ATOM   7883  C CD1 . LEU G 1 132 ? 14.816  -8.337  100.070 1.00 26.98  ? 128 LEU G CD1 1 
ATOM   7884  C CD2 . LEU G 1 132 ? 14.966  -10.136 101.799 1.00 56.74  ? 128 LEU G CD2 1 
ATOM   7885  N N   . ASP G 1 133 ? 11.057  -12.423 98.869  1.00 50.42  ? 129 ASP G N   1 
ATOM   7886  C CA  . ASP G 1 133 ? 9.677   -12.893 98.864  1.00 51.97  ? 129 ASP G CA  1 
ATOM   7887  C C   . ASP G 1 133 ? 9.608   -14.334 99.361  1.00 43.91  ? 129 ASP G C   1 
ATOM   7888  O O   . ASP G 1 133 ? 8.650   -14.728 100.025 1.00 53.39  ? 129 ASP G O   1 
ATOM   7889  C CB  . ASP G 1 133 ? 9.081   -12.801 97.456  1.00 45.23  ? 129 ASP G CB  1 
ATOM   7890  C CG  . ASP G 1 133 ? 8.862   -11.369 97.004  1.00 60.51  ? 129 ASP G CG  1 
ATOM   7891  O OD1 . ASP G 1 133 ? 8.546   -10.514 97.859  1.00 70.17  ? 129 ASP G OD1 1 
ATOM   7892  O OD2 . ASP G 1 133 ? 9.003   -11.099 95.792  1.00 55.92  ? 129 ASP G OD2 1 
ATOM   7893  N N   . LYS G 1 134 ? 10.636  -15.112 99.040  1.00 42.59  ? 130 LYS G N   1 
ATOM   7894  C CA  . LYS G 1 134 ? 10.674  -16.525 99.400  1.00 55.23  ? 130 LYS G CA  1 
ATOM   7895  C C   . LYS G 1 134 ? 11.165  -16.728 100.832 1.00 70.59  ? 130 LYS G C   1 
ATOM   7896  O O   . LYS G 1 134 ? 10.597  -17.523 101.581 1.00 78.44  ? 130 LYS G O   1 
ATOM   7897  C CB  . LYS G 1 134 ? 11.562  -17.288 98.418  1.00 49.83  ? 130 LYS G CB  1 
ATOM   7898  C CG  . LYS G 1 134 ? 11.045  -17.263 96.990  1.00 27.51  ? 130 LYS G CG  1 
ATOM   7899  C CD  . LYS G 1 134 ? 12.024  -17.911 96.022  1.00 48.16  ? 130 LYS G CD  1 
ATOM   7900  C CE  . LYS G 1 134 ? 11.443  -18.007 94.616  1.00 53.77  ? 130 LYS G CE  1 
ATOM   7901  N NZ  . LYS G 1 134 ? 11.096  -16.674 94.045  1.00 60.45  ? 130 LYS G NZ  1 
ATOM   7902  N N   . ASP G 1 135 ? 12.221  -16.012 101.205 1.00 67.00  ? 131 ASP G N   1 
ATOM   7903  C CA  . ASP G 1 135 ? 12.721  -16.044 102.577 1.00 67.31  ? 131 ASP G CA  1 
ATOM   7904  C C   . ASP G 1 135 ? 13.252  -14.672 102.983 1.00 58.94  ? 131 ASP G C   1 
ATOM   7905  O O   . ASP G 1 135 ? 14.324  -14.253 102.545 1.00 57.86  ? 131 ASP G O   1 
ATOM   7906  C CB  . ASP G 1 135 ? 13.813  -17.106 102.735 1.00 68.38  ? 131 ASP G CB  1 
ATOM   7907  C CG  . ASP G 1 135 ? 14.206  -17.326 104.185 1.00 80.54  ? 131 ASP G CG  1 
ATOM   7908  O OD1 . ASP G 1 135 ? 14.168  -16.357 104.971 1.00 91.15  ? 131 ASP G OD1 1 
ATOM   7909  O OD2 . ASP G 1 135 ? 14.546  -18.473 104.543 1.00 82.46  ? 131 ASP G OD2 1 
ATOM   7910  N N   . TRP G 1 136 ? 12.489  -13.981 103.824 1.00 53.19  ? 132 TRP G N   1 
ATOM   7911  C CA  . TRP G 1 136 ? 12.831  -12.633 104.268 1.00 49.61  ? 132 TRP G CA  1 
ATOM   7912  C C   . TRP G 1 136 ? 14.217  -12.567 104.908 1.00 52.52  ? 132 TRP G C   1 
ATOM   7913  O O   . TRP G 1 136 ? 14.937  -11.580 104.744 1.00 43.42  ? 132 TRP G O   1 
ATOM   7914  C CB  . TRP G 1 136 ? 11.783  -12.127 105.265 1.00 47.97  ? 132 TRP G CB  1 
ATOM   7915  C CG  . TRP G 1 136 ? 11.679  -12.972 106.499 1.00 66.99  ? 132 TRP G CG  1 
ATOM   7916  C CD1 . TRP G 1 136 ? 10.897  -14.078 106.672 1.00 67.75  ? 132 TRP G CD1 1 
ATOM   7917  C CD2 . TRP G 1 136 ? 12.384  -12.782 107.733 1.00 70.00  ? 132 TRP G CD2 1 
ATOM   7918  N NE1 . TRP G 1 136 ? 11.072  -14.588 107.936 1.00 66.64  ? 132 TRP G NE1 1 
ATOM   7919  C CE2 . TRP G 1 136 ? 11.979  -13.811 108.607 1.00 64.50  ? 132 TRP G CE2 1 
ATOM   7920  C CE3 . TRP G 1 136 ? 13.318  -11.842 108.183 1.00 70.48  ? 132 TRP G CE3 1 
ATOM   7921  C CZ2 . TRP G 1 136 ? 12.476  -13.927 109.904 1.00 63.97  ? 132 TRP G CZ2 1 
ATOM   7922  C CZ3 . TRP G 1 136 ? 13.809  -11.959 109.473 1.00 66.39  ? 132 TRP G CZ3 1 
ATOM   7923  C CH2 . TRP G 1 136 ? 13.388  -12.994 110.317 1.00 61.05  ? 132 TRP G CH2 1 
ATOM   7924  N N   . ASN G 1 137 ? 14.585  -13.622 105.629 1.00 56.44  ? 133 ASN G N   1 
ATOM   7925  C CA  . ASN G 1 137 ? 15.829  -13.642 106.395 1.00 52.25  ? 133 ASN G CA  1 
ATOM   7926  C C   . ASN G 1 137 ? 16.969  -14.326 105.648 1.00 48.69  ? 133 ASN G C   1 
ATOM   7927  O O   . ASN G 1 137 ? 17.938  -14.775 106.260 1.00 42.63  ? 133 ASN G O   1 
ATOM   7928  C CB  . ASN G 1 137 ? 15.603  -14.354 107.731 1.00 64.37  ? 133 ASN G CB  1 
ATOM   7929  C CG  . ASN G 1 137 ? 16.709  -14.086 108.733 1.00 67.76  ? 133 ASN G CG  1 
ATOM   7930  O OD1 . ASN G 1 137 ? 17.431  -13.094 108.630 1.00 71.28  ? 133 ASN G OD1 1 
ATOM   7931  N ND2 . ASN G 1 137 ? 16.844  -14.972 109.713 1.00 65.64  ? 133 ASN G ND2 1 
ATOM   7932  N N   . ILE G 1 138 ? 16.857  -14.405 104.327 1.00 61.71  ? 134 ILE G N   1 
ATOM   7933  C CA  . ILE G 1 138 ? 17.845  -15.119 103.525 1.00 53.33  ? 134 ILE G CA  1 
ATOM   7934  C C   . ILE G 1 138 ? 19.215  -14.449 103.554 1.00 50.21  ? 134 ILE G C   1 
ATOM   7935  O O   . ILE G 1 138 ? 20.242  -15.129 103.535 1.00 56.20  ? 134 ILE G O   1 
ATOM   7936  C CB  . ILE G 1 138 ? 17.398  -15.262 102.058 1.00 45.77  ? 134 ILE G CB  1 
ATOM   7937  C CG1 . ILE G 1 138 ? 18.403  -16.126 101.292 1.00 37.24  ? 134 ILE G CG1 1 
ATOM   7938  C CG2 . ILE G 1 138 ? 17.254  -13.893 101.398 1.00 35.50  ? 134 ILE G CG2 1 
ATOM   7939  C CD1 . ILE G 1 138 ? 17.949  -16.508 99.908  1.00 16.16  ? 134 ILE G CD1 1 
ATOM   7940  N N   . PHE G 1 139 ? 19.230  -13.121 103.604 1.00 51.66  ? 135 PHE G N   1 
ATOM   7941  C CA  . PHE G 1 139 ? 20.483  -12.375 103.534 1.00 59.43  ? 135 PHE G CA  1 
ATOM   7942  C C   . PHE G 1 139 ? 21.105  -12.137 104.908 1.00 69.31  ? 135 PHE G C   1 
ATOM   7943  O O   . PHE G 1 139 ? 21.873  -11.191 105.094 1.00 73.22  ? 135 PHE G O   1 
ATOM   7944  C CB  . PHE G 1 139 ? 20.277  -11.050 102.797 1.00 48.02  ? 135 PHE G CB  1 
ATOM   7945  C CG  . PHE G 1 139 ? 19.943  -11.218 101.341 1.00 45.55  ? 135 PHE G CG  1 
ATOM   7946  C CD1 . PHE G 1 139 ? 20.862  -11.779 100.468 1.00 31.82  ? 135 PHE G CD1 1 
ATOM   7947  C CD2 . PHE G 1 139 ? 18.714  -10.819 100.845 1.00 34.26  ? 135 PHE G CD2 1 
ATOM   7948  C CE1 . PHE G 1 139 ? 20.559  -11.940 99.129  1.00 31.56  ? 135 PHE G CE1 1 
ATOM   7949  C CE2 . PHE G 1 139 ? 18.407  -10.975 99.507  1.00 32.03  ? 135 PHE G CE2 1 
ATOM   7950  C CZ  . PHE G 1 139 ? 19.331  -11.537 98.648  1.00 42.21  ? 135 PHE G CZ  1 
ATOM   7951  N N   . SER G 1 140 ? 20.772  -12.998 105.865 1.00 62.43  ? 136 SER G N   1 
ATOM   7952  C CA  . SER G 1 140 ? 21.466  -13.022 107.146 1.00 65.60  ? 136 SER G CA  1 
ATOM   7953  C C   . SER G 1 140 ? 22.594  -14.049 107.079 1.00 61.63  ? 136 SER G C   1 
ATOM   7954  O O   . SER G 1 140 ? 23.290  -14.296 108.067 1.00 49.00  ? 136 SER G O   1 
ATOM   7955  C CB  . SER G 1 140 ? 20.500  -13.362 108.284 1.00 58.03  ? 136 SER G CB  1 
ATOM   7956  O OG  . SER G 1 140 ? 19.958  -14.664 108.136 1.00 54.88  ? 136 SER G OG  1 
ATOM   7957  N N   . LYS G 1 141 ? 22.764  -14.644 105.901 1.00 48.33  ? 137 LYS G N   1 
ATOM   7958  C CA  . LYS G 1 141 ? 23.818  -15.621 105.668 1.00 50.03  ? 137 LYS G CA  1 
ATOM   7959  C C   . LYS G 1 141 ? 25.192  -15.037 105.976 1.00 66.18  ? 137 LYS G C   1 
ATOM   7960  O O   . LYS G 1 141 ? 25.425  -13.840 105.801 1.00 67.01  ? 137 LYS G O   1 
ATOM   7961  C CB  . LYS G 1 141 ? 23.776  -16.089 104.213 1.00 47.41  ? 137 LYS G CB  1 
ATOM   7962  C CG  . LYS G 1 141 ? 24.886  -17.053 103.838 1.00 55.28  ? 137 LYS G CG  1 
ATOM   7963  C CD  . LYS G 1 141 ? 24.740  -17.518 102.401 1.00 51.65  ? 137 LYS G CD  1 
ATOM   7964  C CE  . LYS G 1 141 ? 25.734  -18.617 102.062 1.00 23.50  ? 137 LYS G CE  1 
ATOM   7965  N NZ  . LYS G 1 141 ? 25.277  -19.401 100.882 1.00 31.21  ? 137 LYS G NZ  1 
ATOM   7966  N N   . ASN G 1 142 ? 26.100  -15.893 106.436 1.00 70.84  ? 138 ASN G N   1 
ATOM   7967  C CA  . ASN G 1 142 ? 27.473  -15.485 106.704 1.00 75.72  ? 138 ASN G CA  1 
ATOM   7968  C C   . ASN G 1 142 ? 28.354  -15.796 105.501 1.00 71.20  ? 138 ASN G C   1 
ATOM   7969  O O   . ASN G 1 142 ? 28.704  -16.951 105.258 1.00 71.37  ? 138 ASN G O   1 
ATOM   7970  C CB  . ASN G 1 142 ? 28.007  -16.199 107.947 1.00 88.13  ? 138 ASN G CB  1 
ATOM   7971  C CG  . ASN G 1 142 ? 29.302  -15.596 108.454 1.00 84.92  ? 138 ASN G CG  1 
ATOM   7972  O OD1 . ASN G 1 142 ? 30.382  -15.887 107.938 1.00 70.17  ? 138 ASN G OD1 1 
ATOM   7973  N ND2 . ASN G 1 142 ? 29.202  -14.754 109.478 1.00 91.76  ? 138 ASN G ND2 1 
ATOM   7974  N N   . CYS G 1 143 ? 28.703  -14.759 104.748 1.00 77.58  ? 139 CYS G N   1 
ATOM   7975  C CA  . CYS G 1 143 ? 29.471  -14.925 103.520 1.00 81.16  ? 139 CYS G CA  1 
ATOM   7976  C C   . CYS G 1 143 ? 30.960  -14.660 103.731 1.00 74.99  ? 139 CYS G C   1 
ATOM   7977  O O   . CYS G 1 143 ? 31.710  -14.515 102.765 1.00 64.06  ? 139 CYS G O   1 
ATOM   7978  C CB  . CYS G 1 143 ? 28.931  -13.993 102.433 1.00 83.91  ? 139 CYS G CB  1 
ATOM   7979  S SG  . CYS G 1 143 ? 27.244  -14.369 101.894 1.00 49.55  ? 139 CYS G SG  1 
ATOM   7980  N N   . ASN G 1 144 ? 31.385  -14.599 104.990 1.00 69.40  ? 140 ASN G N   1 
ATOM   7981  C CA  . ASN G 1 144 ? 32.787  -14.353 105.307 1.00 61.93  ? 140 ASN G CA  1 
ATOM   7982  C C   . ASN G 1 144 ? 33.699  -15.351 104.600 1.00 67.46  ? 140 ASN G C   1 
ATOM   7983  O O   . ASN G 1 144 ? 34.731  -14.976 104.042 1.00 68.89  ? 140 ASN G O   1 
ATOM   7984  C CB  . ASN G 1 144 ? 33.019  -14.421 106.817 1.00 58.19  ? 140 ASN G CB  1 
ATOM   7985  C CG  . ASN G 1 144 ? 32.181  -13.415 107.582 1.00 58.65  ? 140 ASN G CG  1 
ATOM   7986  O OD1 . ASN G 1 144 ? 31.552  -12.538 106.991 1.00 75.32  ? 140 ASN G OD1 1 
ATOM   7987  N ND2 . ASN G 1 144 ? 32.177  -13.531 108.904 1.00 53.29  ? 140 ASN G ND2 1 
ATOM   7988  N N   . ASN G 1 145 ? 33.307  -16.621 104.624 1.00 69.12  ? 141 ASN G N   1 
ATOM   7989  C CA  . ASN G 1 145 ? 34.087  -17.681 103.996 1.00 70.25  ? 141 ASN G CA  1 
ATOM   7990  C C   . ASN G 1 145 ? 34.122  -17.542 102.476 1.00 68.30  ? 141 ASN G C   1 
ATOM   7991  O O   . ASN G 1 145 ? 35.168  -17.723 101.851 1.00 56.14  ? 141 ASN G O   1 
ATOM   7992  C CB  . ASN G 1 145 ? 33.517  -19.049 104.374 1.00 74.75  ? 141 ASN G CB  1 
ATOM   7993  C CG  . ASN G 1 145 ? 33.540  -19.298 105.870 1.00 75.44  ? 141 ASN G CG  1 
ATOM   7994  O OD1 . ASN G 1 145 ? 32.605  -18.937 106.587 1.00 78.76  ? 141 ASN G OD1 1 
ATOM   7995  N ND2 . ASN G 1 145 ? 34.611  -19.925 106.350 1.00 52.21  ? 141 ASN G ND2 1 
ATOM   7996  N N   . SER G 1 146 ? 32.975  -17.221 101.887 1.00 73.81  ? 142 SER G N   1 
ATOM   7997  C CA  . SER G 1 146 ? 32.867  -17.092 100.437 1.00 72.51  ? 142 SER G CA  1 
ATOM   7998  C C   . SER G 1 146 ? 33.717  -15.935 99.909  1.00 69.16  ? 142 SER G C   1 
ATOM   7999  O O   . SER G 1 146 ? 34.298  -16.029 98.828  1.00 61.81  ? 142 SER G O   1 
ATOM   8000  C CB  . SER G 1 146 ? 31.405  -16.897 100.027 1.00 71.53  ? 142 SER G CB  1 
ATOM   8001  O OG  . SER G 1 146 ? 30.636  -18.053 100.311 1.00 78.03  ? 142 SER G OG  1 
ATOM   8002  N N   . PHE G 1 147 ? 33.787  -14.850 100.675 1.00 69.45  ? 143 PHE G N   1 
ATOM   8003  C CA  . PHE G 1 147 ? 34.577  -13.683 100.287 1.00 69.09  ? 143 PHE G CA  1 
ATOM   8004  C C   . PHE G 1 147 ? 36.073  -13.976 100.378 1.00 81.91  ? 143 PHE G C   1 
ATOM   8005  O O   . PHE G 1 147 ? 36.876  -13.384 99.656  1.00 92.28  ? 143 PHE G O   1 
ATOM   8006  C CB  . PHE G 1 147 ? 34.233  -12.475 101.169 1.00 61.75  ? 143 PHE G CB  1 
ATOM   8007  C CG  . PHE G 1 147 ? 32.829  -11.952 100.978 1.00 67.44  ? 143 PHE G CG  1 
ATOM   8008  C CD1 . PHE G 1 147 ? 32.056  -12.363 99.903  1.00 68.94  ? 143 PHE G CD1 1 
ATOM   8009  C CD2 . PHE G 1 147 ? 32.287  -11.041 101.874 1.00 68.55  ? 143 PHE G CD2 1 
ATOM   8010  C CE1 . PHE G 1 147 ? 30.772  -11.880 99.729  1.00 61.35  ? 143 PHE G CE1 1 
ATOM   8011  C CE2 . PHE G 1 147 ? 31.001  -10.556 101.702 1.00 60.78  ? 143 PHE G CE2 1 
ATOM   8012  C CZ  . PHE G 1 147 ? 30.245  -10.977 100.628 1.00 56.00  ? 143 PHE G CZ  1 
ATOM   8013  N N   . ALA G 1 148 ? 36.442  -14.889 101.270 1.00 83.94  ? 144 ALA G N   1 
ATOM   8014  C CA  . ALA G 1 148 ? 37.840  -15.261 101.452 1.00 76.80  ? 144 ALA G CA  1 
ATOM   8015  C C   . ALA G 1 148 ? 38.352  -16.076 100.265 1.00 74.51  ? 144 ALA G C   1 
ATOM   8016  O O   . ALA G 1 148 ? 39.541  -16.048 99.947  1.00 64.19  ? 144 ALA G O   1 
ATOM   8017  C CB  . ALA G 1 148 ? 38.013  -16.046 102.748 1.00 73.01  ? 144 ALA G CB  1 
ATOM   8018  N N   . GLU G 1 149 ? 37.444  -16.793 99.609  1.00 79.55  ? 145 GLU G N   1 
ATOM   8019  C CA  . GLU G 1 149 ? 37.810  -17.682 98.512  1.00 78.70  ? 145 GLU G CA  1 
ATOM   8020  C C   . GLU G 1 149 ? 37.852  -16.959 97.165  1.00 83.89  ? 145 GLU G C   1 
ATOM   8021  O O   . GLU G 1 149 ? 37.931  -17.599 96.115  1.00 91.68  ? 145 GLU G O   1 
ATOM   8022  C CB  . GLU G 1 149 ? 36.827  -18.855 98.445  1.00 84.75  ? 145 GLU G CB  1 
ATOM   8023  C CG  . GLU G 1 149 ? 36.840  -19.745 99.684  1.00 90.16  ? 145 GLU G CG  1 
ATOM   8024  C CD  . GLU G 1 149 ? 35.718  -20.768 99.690  1.00 97.86  ? 145 GLU G CD  1 
ATOM   8025  O OE1 . GLU G 1 149 ? 34.807  -20.664 98.841  1.00 99.77  ? 145 GLU G OE1 1 
ATOM   8026  O OE2 . GLU G 1 149 ? 35.748  -21.678 100.544 1.00 100.45 ? 145 GLU G OE2 1 
ATOM   8027  N N   . CYS G 1 150 ? 37.799  -15.631 97.195  1.00 83.28  ? 146 CYS G N   1 
ATOM   8028  C CA  . CYS G 1 150 ? 37.849  -14.836 95.973  1.00 82.01  ? 146 CYS G CA  1 
ATOM   8029  C C   . CYS G 1 150 ? 39.284  -14.485 95.596  1.00 88.83  ? 146 CYS G C   1 
ATOM   8030  O O   . CYS G 1 150 ? 40.078  -14.075 96.444  1.00 95.71  ? 146 CYS G O   1 
ATOM   8031  C CB  . CYS G 1 150 ? 37.026  -13.558 96.137  1.00 81.13  ? 146 CYS G CB  1 
ATOM   8032  S SG  . CYS G 1 150 ? 35.258  -13.767 95.810  1.00 68.01  ? 146 CYS G SG  1 
ATOM   8033  N N   . SER G 1 151 ? 39.611  -14.653 94.318  1.00 77.03  ? 147 SER G N   1 
ATOM   8034  C CA  . SER G 1 151 ? 40.940  -14.328 93.821  1.00 68.36  ? 147 SER G CA  1 
ATOM   8035  C C   . SER G 1 151 ? 40.974  -12.890 93.316  1.00 74.12  ? 147 SER G C   1 
ATOM   8036  O O   . SER G 1 151 ? 42.039  -12.352 93.015  1.00 87.82  ? 147 SER G O   1 
ATOM   8037  C CB  . SER G 1 151 ? 41.342  -15.286 92.698  1.00 62.98  ? 147 SER G CB  1 
ATOM   8038  O OG  . SER G 1 151 ? 40.512  -15.119 91.563  1.00 54.85  ? 147 SER G OG  1 
ATOM   8039  N N   . GLU H 1 9   ? 5.040   26.085  51.051  1.00 109.79 ? 5   GLU H N   1 
ATOM   8040  C CA  . GLU H 1 9   ? 5.143   26.901  52.254  1.00 106.21 ? 5   GLU H CA  1 
ATOM   8041  C C   . GLU H 1 9   ? 4.906   26.072  53.514  1.00 106.66 ? 5   GLU H C   1 
ATOM   8042  O O   . GLU H 1 9   ? 4.986   26.589  54.628  1.00 108.24 ? 5   GLU H O   1 
ATOM   8043  C CB  . GLU H 1 9   ? 4.143   28.058  52.204  1.00 105.25 ? 5   GLU H CB  1 
ATOM   8044  C CG  . GLU H 1 9   ? 2.688   27.624  52.078  1.00 115.49 ? 5   GLU H CG  1 
ATOM   8045  C CD  . GLU H 1 9   ? 2.341   27.128  50.687  1.00 125.22 ? 5   GLU H CD  1 
ATOM   8046  O OE1 . GLU H 1 9   ? 3.270   26.910  49.881  1.00 126.57 ? 5   GLU H OE1 1 
ATOM   8047  O OE2 . GLU H 1 9   ? 1.137   26.958  50.399  1.00 126.09 ? 5   GLU H OE2 1 
ATOM   8048  N N   . TYR H 1 10  ? 4.612   24.787  53.335  1.00 107.73 ? 6   TYR H N   1 
ATOM   8049  C CA  . TYR H 1 10  ? 4.347   23.904  54.465  1.00 107.61 ? 6   TYR H CA  1 
ATOM   8050  C C   . TYR H 1 10  ? 5.641   23.512  55.176  1.00 95.08  ? 6   TYR H C   1 
ATOM   8051  O O   . TYR H 1 10  ? 5.610   22.930  56.261  1.00 84.64  ? 6   TYR H O   1 
ATOM   8052  C CB  . TYR H 1 10  ? 3.601   22.652  54.003  1.00 114.91 ? 6   TYR H CB  1 
ATOM   8053  C CG  . TYR H 1 10  ? 4.464   21.666  53.252  1.00 125.44 ? 6   TYR H CG  1 
ATOM   8054  C CD1 . TYR H 1 10  ? 5.174   20.684  53.927  1.00 134.65 ? 6   TYR H CD1 1 
ATOM   8055  C CD2 . TYR H 1 10  ? 4.569   21.716  51.868  1.00 135.42 ? 6   TYR H CD2 1 
ATOM   8056  C CE1 . TYR H 1 10  ? 5.965   19.779  53.248  1.00 142.67 ? 6   TYR H CE1 1 
ATOM   8057  C CE2 . TYR H 1 10  ? 5.357   20.815  51.180  1.00 144.60 ? 6   TYR H CE2 1 
ATOM   8058  C CZ  . TYR H 1 10  ? 6.052   19.849  51.875  1.00 146.43 ? 6   TYR H CZ  1 
ATOM   8059  O OH  . TYR H 1 10  ? 6.838   18.950  51.192  1.00 149.00 ? 6   TYR H OH  1 
ATOM   8060  N N   . CYS H 1 11  ? 6.775   23.828  54.558  1.00 89.02  ? 7   CYS H N   1 
ATOM   8061  C CA  . CYS H 1 11  ? 8.076   23.587  55.170  1.00 69.91  ? 7   CYS H CA  1 
ATOM   8062  C C   . CYS H 1 11  ? 8.145   24.263  56.534  1.00 58.70  ? 7   CYS H C   1 
ATOM   8063  O O   . CYS H 1 11  ? 8.845   23.800  57.437  1.00 46.58  ? 7   CYS H O   1 
ATOM   8064  C CB  . CYS H 1 11  ? 9.191   24.125  54.273  1.00 62.79  ? 7   CYS H CB  1 
ATOM   8065  S SG  . CYS H 1 11  ? 9.049   23.623  52.547  1.00 48.74  ? 7   CYS H SG  1 
ATOM   8066  N N   . SER H 1 12  ? 7.412   25.363  56.673  1.00 55.39  ? 8   SER H N   1 
ATOM   8067  C CA  . SER H 1 12  ? 7.377   26.117  57.918  1.00 64.15  ? 8   SER H CA  1 
ATOM   8068  C C   . SER H 1 12  ? 6.817   25.275  59.059  1.00 70.40  ? 8   SER H C   1 
ATOM   8069  O O   . SER H 1 12  ? 7.215   25.435  60.214  1.00 62.73  ? 8   SER H O   1 
ATOM   8070  C CB  . SER H 1 12  ? 6.519   27.372  57.746  1.00 72.82  ? 8   SER H CB  1 
ATOM   8071  O OG  . SER H 1 12  ? 7.005   28.186  56.695  1.00 77.00  ? 8   SER H OG  1 
ATOM   8072  N N   . HIS H 1 13  ? 5.896   24.375  58.727  1.00 73.17  ? 9   HIS H N   1 
ATOM   8073  C CA  . HIS H 1 13  ? 5.175   23.613  59.740  1.00 81.29  ? 9   HIS H CA  1 
ATOM   8074  C C   . HIS H 1 13  ? 5.583   22.142  59.767  1.00 62.99  ? 9   HIS H C   1 
ATOM   8075  O O   . HIS H 1 13  ? 4.781   21.278  60.120  1.00 50.37  ? 9   HIS H O   1 
ATOM   8076  C CB  . HIS H 1 13  ? 3.669   23.726  59.499  1.00 100.89 ? 9   HIS H CB  1 
ATOM   8077  C CG  . HIS H 1 13  ? 3.185   25.136  59.360  1.00 112.78 ? 9   HIS H CG  1 
ATOM   8078  N ND1 . HIS H 1 13  ? 2.906   25.938  60.446  1.00 115.26 ? 9   HIS H ND1 1 
ATOM   8079  C CD2 . HIS H 1 13  ? 2.936   25.890  58.263  1.00 112.46 ? 9   HIS H CD2 1 
ATOM   8080  C CE1 . HIS H 1 13  ? 2.504   27.123  60.024  1.00 111.69 ? 9   HIS H CE1 1 
ATOM   8081  N NE2 . HIS H 1 13  ? 2.513   27.120  58.703  1.00 115.25 ? 9   HIS H NE2 1 
ATOM   8082  N N   . MET H 1 14  ? 6.827   21.859  59.396  1.00 59.58  ? 10  MET H N   1 
ATOM   8083  C CA  . MET H 1 14  ? 7.334   20.494  59.444  1.00 58.53  ? 10  MET H CA  1 
ATOM   8084  C C   . MET H 1 14  ? 7.850   20.183  60.843  1.00 62.78  ? 10  MET H C   1 
ATOM   8085  O O   . MET H 1 14  ? 7.336   19.297  61.527  1.00 53.60  ? 10  MET H O   1 
ATOM   8086  C CB  . MET H 1 14  ? 8.450   20.301  58.418  1.00 47.69  ? 10  MET H CB  1 
ATOM   8087  C CG  . MET H 1 14  ? 7.986   20.423  56.981  1.00 56.03  ? 10  MET H CG  1 
ATOM   8088  S SD  . MET H 1 14  ? 6.698   19.233  56.565  1.00 73.26  ? 10  MET H SD  1 
ATOM   8089  C CE  . MET H 1 14  ? 7.549   17.692  56.870  1.00 47.26  ? 10  MET H CE  1 
ATOM   8090  N N   . ILE H 1 15  ? 8.864   20.928  61.265  1.00 59.63  ? 11  ILE H N   1 
ATOM   8091  C CA  . ILE H 1 15  ? 9.462   20.728  62.575  1.00 47.78  ? 11  ILE H CA  1 
ATOM   8092  C C   . ILE H 1 15  ? 8.584   21.383  63.635  1.00 37.62  ? 11  ILE H C   1 
ATOM   8093  O O   . ILE H 1 15  ? 8.431   22.607  63.662  1.00 34.32  ? 11  ILE H O   1 
ATOM   8094  C CB  . ILE H 1 15  ? 10.883  21.323  62.650  1.00 44.24  ? 11  ILE H CB  1 
ATOM   8095  C CG1 . ILE H 1 15  ? 11.718  20.865  61.450  1.00 38.89  ? 11  ILE H CG1 1 
ATOM   8096  C CG2 . ILE H 1 15  ? 11.553  20.921  63.957  1.00 50.49  ? 11  ILE H CG2 1 
ATOM   8097  C CD1 . ILE H 1 15  ? 13.104  21.470  61.389  1.00 33.44  ? 11  ILE H CD1 1 
ATOM   8098  N N   . GLY H 1 16  ? 8.002   20.561  64.501  1.00 39.42  ? 12  GLY H N   1 
ATOM   8099  C CA  . GLY H 1 16  ? 7.150   21.052  65.567  1.00 44.10  ? 12  GLY H CA  1 
ATOM   8100  C C   . GLY H 1 16  ? 7.877   21.076  66.896  1.00 47.77  ? 12  GLY H C   1 
ATOM   8101  O O   . GLY H 1 16  ? 8.875   20.379  67.079  1.00 48.76  ? 12  GLY H O   1 
ATOM   8102  N N   . SER H 1 17  ? 7.373   21.880  67.826  1.00 57.35  ? 13  SER H N   1 
ATOM   8103  C CA  . SER H 1 17  ? 7.973   21.990  69.150  1.00 51.01  ? 13  SER H CA  1 
ATOM   8104  C C   . SER H 1 17  ? 8.021   20.633  69.840  1.00 59.75  ? 13  SER H C   1 
ATOM   8105  O O   . SER H 1 17  ? 8.969   20.330  70.563  1.00 72.96  ? 13  SER H O   1 
ATOM   8106  C CB  . SER H 1 17  ? 7.186   22.981  70.008  1.00 34.04  ? 13  SER H CB  1 
ATOM   8107  O OG  . SER H 1 17  ? 7.208   24.272  69.430  1.00 41.81  ? 13  SER H OG  1 
ATOM   8108  N N   . GLY H 1 18  ? 6.993   19.821  69.612  1.00 55.42  ? 14  GLY H N   1 
ATOM   8109  C CA  . GLY H 1 18  ? 6.926   18.491  70.191  1.00 58.49  ? 14  GLY H CA  1 
ATOM   8110  C C   . GLY H 1 18  ? 8.165   17.667  69.894  1.00 65.47  ? 14  GLY H C   1 
ATOM   8111  O O   . GLY H 1 18  ? 8.656   16.935  70.754  1.00 54.38  ? 14  GLY H O   1 
ATOM   8112  N N   . HIS H 1 19  ? 8.671   17.787  68.670  1.00 79.14  ? 15  HIS H N   1 
ATOM   8113  C CA  . HIS H 1 19  ? 9.867   17.062  68.260  1.00 76.48  ? 15  HIS H CA  1 
ATOM   8114  C C   . HIS H 1 19  ? 11.103  17.569  68.999  1.00 58.78  ? 15  HIS H C   1 
ATOM   8115  O O   . HIS H 1 19  ? 11.920  16.780  69.472  1.00 62.47  ? 15  HIS H O   1 
ATOM   8116  C CB  . HIS H 1 19  ? 10.080  17.196  66.750  1.00 79.99  ? 15  HIS H CB  1 
ATOM   8117  C CG  . HIS H 1 19  ? 9.005   16.557  65.927  1.00 90.82  ? 15  HIS H CG  1 
ATOM   8118  N ND1 . HIS H 1 19  ? 7.887   17.241  65.499  1.00 91.33  ? 15  HIS H ND1 1 
ATOM   8119  C CD2 . HIS H 1 19  ? 8.876   15.295  65.454  1.00 91.03  ? 15  HIS H CD2 1 
ATOM   8120  C CE1 . HIS H 1 19  ? 7.118   16.429  64.796  1.00 90.50  ? 15  HIS H CE1 1 
ATOM   8121  N NE2 . HIS H 1 19  ? 7.695   15.241  64.754  1.00 84.02  ? 15  HIS H NE2 1 
ATOM   8122  N N   . LEU H 1 20  ? 11.231  18.888  69.098  1.00 42.21  ? 16  LEU H N   1 
ATOM   8123  C CA  . LEU H 1 20  ? 12.407  19.503  69.705  1.00 45.33  ? 16  LEU H CA  1 
ATOM   8124  C C   . LEU H 1 20  ? 12.409  19.325  71.220  1.00 58.40  ? 16  LEU H C   1 
ATOM   8125  O O   . LEU H 1 20  ? 13.446  19.468  71.871  1.00 64.81  ? 16  LEU H O   1 
ATOM   8126  C CB  . LEU H 1 20  ? 12.464  20.992  69.361  1.00 40.77  ? 16  LEU H CB  1 
ATOM   8127  C CG  . LEU H 1 20  ? 12.358  21.338  67.875  1.00 32.65  ? 16  LEU H CG  1 
ATOM   8128  C CD1 . LEU H 1 20  ? 12.611  22.819  67.658  1.00 39.54  ? 16  LEU H CD1 1 
ATOM   8129  C CD2 . LEU H 1 20  ? 13.321  20.499  67.050  1.00 43.54  ? 16  LEU H CD2 1 
ATOM   8130  N N   . GLN H 1 21  ? 11.242  19.020  71.776  1.00 55.46  ? 17  GLN H N   1 
ATOM   8131  C CA  . GLN H 1 21  ? 11.117  18.778  73.206  1.00 38.85  ? 17  GLN H CA  1 
ATOM   8132  C C   . GLN H 1 21  ? 11.466  17.331  73.533  1.00 45.05  ? 17  GLN H C   1 
ATOM   8133  O O   . GLN H 1 21  ? 12.119  17.059  74.540  1.00 62.83  ? 17  GLN H O   1 
ATOM   8134  C CB  . GLN H 1 21  ? 9.700   19.112  73.680  1.00 51.75  ? 17  GLN H CB  1 
ATOM   8135  C CG  . GLN H 1 21  ? 9.391   20.606  73.679  1.00 66.41  ? 17  GLN H CG  1 
ATOM   8136  C CD  . GLN H 1 21  ? 7.936   20.911  73.982  1.00 69.51  ? 17  GLN H CD  1 
ATOM   8137  O OE1 . GLN H 1 21  ? 7.151   20.012  74.283  1.00 74.31  ? 17  GLN H OE1 1 
ATOM   8138  N NE2 . GLN H 1 21  ? 7.568   22.187  73.903  1.00 63.40  ? 17  GLN H NE2 1 
ATOM   8139  N N   . SER H 1 22  ? 11.036  16.407  72.678  1.00 53.19  ? 18  SER H N   1 
ATOM   8140  C CA  . SER H 1 22  ? 11.352  14.996  72.863  1.00 47.32  ? 18  SER H CA  1 
ATOM   8141  C C   . SER H 1 22  ? 12.832  14.757  72.601  1.00 44.86  ? 18  SER H C   1 
ATOM   8142  O O   . SER H 1 22  ? 13.440  13.851  73.171  1.00 49.59  ? 18  SER H O   1 
ATOM   8143  C CB  . SER H 1 22  ? 10.497  14.119  71.943  1.00 39.42  ? 18  SER H CB  1 
ATOM   8144  O OG  . SER H 1 22  ? 10.826  14.296  70.576  1.00 32.79  ? 18  SER H OG  1 
ATOM   8145  N N   . LEU H 1 23  ? 13.408  15.588  71.740  1.00 31.45  ? 19  LEU H N   1 
ATOM   8146  C CA  . LEU H 1 23  ? 14.828  15.516  71.442  1.00 24.57  ? 19  LEU H CA  1 
ATOM   8147  C C   . LEU H 1 23  ? 15.611  16.012  72.649  1.00 37.50  ? 19  LEU H C   1 
ATOM   8148  O O   . LEU H 1 23  ? 16.769  15.650  72.844  1.00 44.02  ? 19  LEU H O   1 
ATOM   8149  C CB  . LEU H 1 23  ? 15.151  16.364  70.213  1.00 28.26  ? 19  LEU H CB  1 
ATOM   8150  C CG  . LEU H 1 23  ? 16.585  16.312  69.684  1.00 33.41  ? 19  LEU H CG  1 
ATOM   8151  C CD1 . LEU H 1 23  ? 17.079  14.879  69.583  1.00 35.83  ? 19  LEU H CD1 1 
ATOM   8152  C CD2 . LEU H 1 23  ? 16.658  16.994  68.327  1.00 47.01  ? 19  LEU H CD2 1 
ATOM   8153  N N   . GLN H 1 24  ? 14.964  16.844  73.458  1.00 43.57  ? 20  GLN H N   1 
ATOM   8154  C CA  . GLN H 1 24  ? 15.561  17.338  74.690  1.00 48.96  ? 20  GLN H CA  1 
ATOM   8155  C C   . GLN H 1 24  ? 15.433  16.287  75.789  1.00 49.18  ? 20  GLN H C   1 
ATOM   8156  O O   . GLN H 1 24  ? 16.373  16.057  76.550  1.00 46.73  ? 20  GLN H O   1 
ATOM   8157  C CB  . GLN H 1 24  ? 14.889  18.641  75.125  1.00 55.86  ? 20  GLN H CB  1 
ATOM   8158  C CG  . GLN H 1 24  ? 15.570  19.325  76.294  1.00 55.09  ? 20  GLN H CG  1 
ATOM   8159  C CD  . GLN H 1 24  ? 16.994  19.730  75.977  1.00 56.35  ? 20  GLN H CD  1 
ATOM   8160  O OE1 . GLN H 1 24  ? 17.236  20.519  75.064  1.00 63.23  ? 20  GLN H OE1 1 
ATOM   8161  N NE2 . GLN H 1 24  ? 17.948  19.185  76.726  1.00 44.59  ? 20  GLN H NE2 1 
ATOM   8162  N N   . ARG H 1 25  ? 14.266  15.654  75.870  1.00 48.75  ? 21  ARG H N   1 
ATOM   8163  C CA  . ARG H 1 25  ? 14.052  14.571  76.824  1.00 52.36  ? 21  ARG H CA  1 
ATOM   8164  C C   . ARG H 1 25  ? 14.997  13.425  76.500  1.00 51.96  ? 21  ARG H C   1 
ATOM   8165  O O   . ARG H 1 25  ? 15.439  12.692  77.385  1.00 50.92  ? 21  ARG H O   1 
ATOM   8166  C CB  . ARG H 1 25  ? 12.606  14.077  76.774  1.00 57.70  ? 21  ARG H CB  1 
ATOM   8167  C CG  . ARG H 1 25  ? 11.583  15.101  77.233  1.00 64.49  ? 21  ARG H CG  1 
ATOM   8168  C CD  . ARG H 1 25  ? 10.221  14.468  77.456  1.00 69.26  ? 21  ARG H CD  1 
ATOM   8169  N NE  . ARG H 1 25  ? 9.158   15.188  76.757  1.00 72.96  ? 21  ARG H NE  1 
ATOM   8170  C CZ  . ARG H 1 25  ? 8.635   14.830  75.586  1.00 80.96  ? 21  ARG H CZ  1 
ATOM   8171  N NH1 . ARG H 1 25  ? 9.057   13.743  74.950  1.00 96.76  ? 21  ARG H NH1 1 
ATOM   8172  N NH2 . ARG H 1 25  ? 7.673   15.564  75.045  1.00 75.92  ? 21  ARG H NH2 1 
ATOM   8173  N N   . LEU H 1 26  ? 15.299  13.276  75.216  1.00 49.78  ? 22  LEU H N   1 
ATOM   8174  C CA  . LEU H 1 26  ? 16.240  12.265  74.768  1.00 42.89  ? 22  LEU H CA  1 
ATOM   8175  C C   . LEU H 1 26  ? 17.609  12.546  75.375  1.00 31.51  ? 22  LEU H C   1 
ATOM   8176  O O   . LEU H 1 26  ? 18.260  11.643  75.899  1.00 38.82  ? 22  LEU H O   1 
ATOM   8177  C CB  . LEU H 1 26  ? 16.318  12.264  73.241  1.00 47.20  ? 22  LEU H CB  1 
ATOM   8178  C CG  . LEU H 1 26  ? 17.177  11.173  72.605  1.00 39.70  ? 22  LEU H CG  1 
ATOM   8179  C CD1 . LEU H 1 26  ? 16.583  10.752  71.271  1.00 40.23  ? 22  LEU H CD1 1 
ATOM   8180  C CD2 . LEU H 1 26  ? 18.607  11.657  72.424  1.00 40.12  ? 22  LEU H CD2 1 
ATOM   8181  N N   . ILE H 1 27  ? 18.032  13.806  75.314  1.00 18.05  ? 23  ILE H N   1 
ATOM   8182  C CA  . ILE H 1 27  ? 19.312  14.215  75.885  1.00 28.68  ? 23  ILE H CA  1 
ATOM   8183  C C   . ILE H 1 27  ? 19.310  14.079  77.407  1.00 37.03  ? 23  ILE H C   1 
ATOM   8184  O O   . ILE H 1 27  ? 20.218  13.483  77.985  1.00 27.01  ? 23  ILE H O   1 
ATOM   8185  C CB  . ILE H 1 27  ? 19.650  15.675  75.527  1.00 27.97  ? 23  ILE H CB  1 
ATOM   8186  C CG1 . ILE H 1 27  ? 19.862  15.820  74.021  1.00 19.34  ? 23  ILE H CG1 1 
ATOM   8187  C CG2 . ILE H 1 27  ? 20.899  16.133  76.273  1.00 39.34  ? 23  ILE H CG2 1 
ATOM   8188  C CD1 . ILE H 1 27  ? 20.055  17.247  73.567  1.00 27.61  ? 23  ILE H CD1 1 
ATOM   8189  N N   . ASP H 1 28  ? 18.286  14.637  78.045  1.00 46.53  ? 24  ASP H N   1 
ATOM   8190  C CA  . ASP H 1 28  ? 18.189  14.642  79.502  1.00 46.08  ? 24  ASP H CA  1 
ATOM   8191  C C   . ASP H 1 28  ? 18.307  13.241  80.095  1.00 41.60  ? 24  ASP H C   1 
ATOM   8192  O O   . ASP H 1 28  ? 18.811  13.071  81.208  1.00 37.56  ? 24  ASP H O   1 
ATOM   8193  C CB  . ASP H 1 28  ? 16.861  15.262  79.947  1.00 45.33  ? 24  ASP H CB  1 
ATOM   8194  C CG  . ASP H 1 28  ? 16.771  16.745  79.637  1.00 48.93  ? 24  ASP H CG  1 
ATOM   8195  O OD1 . ASP H 1 28  ? 17.826  17.373  79.407  1.00 43.08  ? 24  ASP H OD1 1 
ATOM   8196  O OD2 . ASP H 1 28  ? 15.641  17.280  79.623  1.00 40.73  ? 24  ASP H OD2 1 
ATOM   8197  N N   . SER H 1 29  ? 17.837  12.244  79.352  1.00 19.32  ? 25  SER H N   1 
ATOM   8198  C CA  . SER H 1 29  ? 17.808  10.870  79.845  1.00 20.71  ? 25  SER H CA  1 
ATOM   8199  C C   . SER H 1 29  ? 19.165  10.169  79.748  1.00 30.90  ? 25  SER H C   1 
ATOM   8200  O O   . SER H 1 29  ? 19.405  9.180   80.441  1.00 44.26  ? 25  SER H O   1 
ATOM   8201  C CB  . SER H 1 29  ? 16.749  10.058  79.091  1.00 25.69  ? 25  SER H CB  1 
ATOM   8202  O OG  . SER H 1 29  ? 17.033  9.999   77.703  1.00 41.97  ? 25  SER H OG  1 
ATOM   8203  N N   . GLN H 1 30  ? 20.049  10.676  78.893  1.00 42.42  ? 26  GLN H N   1 
ATOM   8204  C CA  . GLN H 1 30  ? 21.348  10.044  78.686  1.00 38.51  ? 26  GLN H CA  1 
ATOM   8205  C C   . GLN H 1 30  ? 22.207  10.103  79.943  1.00 44.35  ? 26  GLN H C   1 
ATOM   8206  O O   . GLN H 1 30  ? 22.314  11.146  80.587  1.00 48.37  ? 26  GLN H O   1 
ATOM   8207  C CB  . GLN H 1 30  ? 22.088  10.708  77.521  1.00 33.29  ? 26  GLN H CB  1 
ATOM   8208  C CG  . GLN H 1 30  ? 21.417  10.522  76.175  1.00 21.00  ? 26  GLN H CG  1 
ATOM   8209  C CD  . GLN H 1 30  ? 20.960  9.096   75.945  1.00 24.53  ? 26  GLN H CD  1 
ATOM   8210  O OE1 . GLN H 1 30  ? 21.775  8.188   75.774  1.00 34.43  ? 26  GLN H OE1 1 
ATOM   8211  N NE2 . GLN H 1 30  ? 19.649  8.889   75.948  1.00 20.09  ? 26  GLN H NE2 1 
ATOM   8212  N N   . MET H 1 31  ? 22.820  8.973   80.284  1.00 44.53  ? 27  MET H N   1 
ATOM   8213  C CA  . MET H 1 31  ? 23.684  8.886   81.455  1.00 39.67  ? 27  MET H CA  1 
ATOM   8214  C C   . MET H 1 31  ? 25.004  9.595   81.174  1.00 43.53  ? 27  MET H C   1 
ATOM   8215  O O   . MET H 1 31  ? 25.646  9.346   80.155  1.00 52.33  ? 27  MET H O   1 
ATOM   8216  C CB  . MET H 1 31  ? 23.933  7.421   81.812  1.00 41.13  ? 27  MET H CB  1 
ATOM   8217  C CG  . MET H 1 31  ? 24.716  7.205   83.093  1.00 39.26  ? 27  MET H CG  1 
ATOM   8218  S SD  . MET H 1 31  ? 24.800  5.455   83.528  1.00 45.20  ? 27  MET H SD  1 
ATOM   8219  C CE  . MET H 1 31  ? 26.526  5.312   83.975  1.00 106.42 ? 27  MET H CE  1 
ATOM   8220  N N   . GLU H 1 32  ? 25.405  10.475  82.086  1.00 48.52  ? 28  GLU H N   1 
ATOM   8221  C CA  . GLU H 1 32  ? 26.561  11.340  81.864  1.00 54.02  ? 28  GLU H CA  1 
ATOM   8222  C C   . GLU H 1 32  ? 27.886  10.577  81.898  1.00 62.64  ? 28  GLU H C   1 
ATOM   8223  O O   . GLU H 1 32  ? 28.354  10.166  82.961  1.00 62.44  ? 28  GLU H O   1 
ATOM   8224  C CB  . GLU H 1 32  ? 26.575  12.474  82.894  1.00 32.97  ? 28  GLU H CB  1 
ATOM   8225  C CG  . GLU H 1 32  ? 25.337  13.365  82.839  1.00 26.28  ? 28  GLU H CG  1 
ATOM   8226  C CD  . GLU H 1 32  ? 25.343  14.445  83.901  1.00 37.72  ? 28  GLU H CD  1 
ATOM   8227  O OE1 . GLU H 1 32  ? 24.498  15.363  83.823  1.00 27.25  ? 28  GLU H OE1 1 
ATOM   8228  O OE2 . GLU H 1 32  ? 26.190  14.375  84.816  1.00 59.86  ? 28  GLU H OE2 1 
ATOM   8229  N N   . THR H 1 33  ? 28.482  10.399  80.721  1.00 59.83  ? 29  THR H N   1 
ATOM   8230  C CA  . THR H 1 33  ? 29.776  9.738   80.592  1.00 58.66  ? 29  THR H CA  1 
ATOM   8231  C C   . THR H 1 33  ? 30.770  10.656  79.880  1.00 72.53  ? 29  THR H C   1 
ATOM   8232  O O   . THR H 1 33  ? 30.373  11.597  79.191  1.00 78.35  ? 29  THR H O   1 
ATOM   8233  C CB  . THR H 1 33  ? 29.659  8.427   79.792  1.00 40.69  ? 29  THR H CB  1 
ATOM   8234  O OG1 . THR H 1 33  ? 29.217  8.715   78.460  1.00 29.54  ? 29  THR H OG1 1 
ATOM   8235  C CG2 . THR H 1 33  ? 28.676  7.475   80.454  1.00 35.38  ? 29  THR H CG2 1 
ATOM   8236  N N   . SER H 1 34  ? 32.059  10.375  80.047  1.00 66.88  ? 30  SER H N   1 
ATOM   8237  C CA  . SER H 1 34  ? 33.108  11.164  79.409  1.00 50.73  ? 30  SER H CA  1 
ATOM   8238  C C   . SER H 1 34  ? 33.672  10.438  78.191  1.00 51.19  ? 30  SER H C   1 
ATOM   8239  O O   . SER H 1 34  ? 34.483  10.992  77.448  1.00 55.10  ? 30  SER H O   1 
ATOM   8240  C CB  . SER H 1 34  ? 34.231  11.466  80.405  1.00 59.88  ? 30  SER H CB  1 
ATOM   8241  O OG  . SER H 1 34  ? 33.783  12.336  81.431  1.00 62.22  ? 30  SER H OG  1 
ATOM   8242  N N   . CYS H 1 35  ? 33.238  9.196   77.990  1.00 42.24  ? 31  CYS H N   1 
ATOM   8243  C CA  . CYS H 1 35  ? 33.674  8.410   76.842  1.00 38.32  ? 31  CYS H CA  1 
ATOM   8244  C C   . CYS H 1 35  ? 33.242  9.074   75.539  1.00 43.51  ? 31  CYS H C   1 
ATOM   8245  O O   . CYS H 1 35  ? 32.275  9.834   75.511  1.00 39.38  ? 31  CYS H O   1 
ATOM   8246  C CB  . CYS H 1 35  ? 33.106  6.991   76.915  1.00 19.83  ? 31  CYS H CB  1 
ATOM   8247  S SG  . CYS H 1 35  ? 31.301  6.903   76.846  1.00 59.88  ? 31  CYS H SG  1 
ATOM   8248  N N   . GLN H 1 36  ? 33.957  8.768   74.460  1.00 38.89  ? 32  GLN H N   1 
ATOM   8249  C CA  . GLN H 1 36  ? 33.705  9.391   73.167  1.00 24.63  ? 32  GLN H CA  1 
ATOM   8250  C C   . GLN H 1 36  ? 33.379  8.351   72.097  1.00 37.24  ? 32  GLN H C   1 
ATOM   8251  O O   . GLN H 1 36  ? 33.809  7.201   72.182  1.00 36.44  ? 32  GLN H O   1 
ATOM   8252  C CB  . GLN H 1 36  ? 34.927  10.200  72.735  1.00 23.33  ? 32  GLN H CB  1 
ATOM   8253  C CG  . GLN H 1 36  ? 35.336  11.284  73.715  1.00 19.02  ? 32  GLN H CG  1 
ATOM   8254  C CD  . GLN H 1 36  ? 36.793  11.680  73.561  1.00 27.98  ? 32  GLN H CD  1 
ATOM   8255  O OE1 . GLN H 1 36  ? 37.672  10.823  73.442  1.00 27.37  ? 32  GLN H OE1 1 
ATOM   8256  N NE2 . GLN H 1 36  ? 37.057  12.981  73.559  1.00 13.50  ? 32  GLN H NE2 1 
ATOM   8257  N N   . ILE H 1 37  ? 32.617  8.771   71.091  1.00 34.29  ? 33  ILE H N   1 
ATOM   8258  C CA  . ILE H 1 37  ? 32.303  7.926   69.946  1.00 27.97  ? 33  ILE H CA  1 
ATOM   8259  C C   . ILE H 1 37  ? 32.648  8.658   68.659  1.00 36.13  ? 33  ILE H C   1 
ATOM   8260  O O   . ILE H 1 37  ? 32.944  9.853   68.678  1.00 41.00  ? 33  ILE H O   1 
ATOM   8261  C CB  . ILE H 1 37  ? 30.816  7.532   69.917  1.00 31.40  ? 33  ILE H CB  1 
ATOM   8262  C CG1 . ILE H 1 37  ? 29.930  8.769   70.091  1.00 39.10  ? 33  ILE H CG1 1 
ATOM   8263  C CG2 . ILE H 1 37  ? 30.526  6.525   71.008  1.00 13.80  ? 33  ILE H CG2 1 
ATOM   8264  C CD1 . ILE H 1 37  ? 28.449  8.504   69.871  1.00 21.57  ? 33  ILE H CD1 1 
ATOM   8265  N N   . THR H 1 38  ? 32.603  7.938   67.543  1.00 36.86  ? 34  THR H N   1 
ATOM   8266  C CA  . THR H 1 38  ? 32.999  8.494   66.255  1.00 37.68  ? 34  THR H CA  1 
ATOM   8267  C C   . THR H 1 38  ? 31.792  8.815   65.381  1.00 41.58  ? 34  THR H C   1 
ATOM   8268  O O   . THR H 1 38  ? 30.757  8.154   65.464  1.00 42.92  ? 34  THR H O   1 
ATOM   8269  C CB  . THR H 1 38  ? 33.903  7.514   65.486  1.00 43.83  ? 34  THR H CB  1 
ATOM   8270  O OG1 . THR H 1 38  ? 34.944  7.038   66.348  1.00 60.52  ? 34  THR H OG1 1 
ATOM   8271  C CG2 . THR H 1 38  ? 34.519  8.194   64.272  1.00 41.05  ? 34  THR H CG2 1 
ATOM   8272  N N   . PHE H 1 39  ? 31.934  9.835   64.542  1.00 47.52  ? 35  PHE H N   1 
ATOM   8273  C CA  . PHE H 1 39  ? 30.902  10.182  63.571  1.00 36.34  ? 35  PHE H CA  1 
ATOM   8274  C C   . PHE H 1 39  ? 31.394  11.278  62.631  1.00 32.36  ? 35  PHE H C   1 
ATOM   8275  O O   . PHE H 1 39  ? 32.319  12.020  62.958  1.00 30.28  ? 35  PHE H O   1 
ATOM   8276  C CB  . PHE H 1 39  ? 29.611  10.621  64.272  1.00 28.25  ? 35  PHE H CB  1 
ATOM   8277  C CG  . PHE H 1 39  ? 29.771  11.831  65.153  1.00 26.67  ? 35  PHE H CG  1 
ATOM   8278  C CD1 . PHE H 1 39  ? 29.600  13.105  64.639  1.00 34.16  ? 35  PHE H CD1 1 
ATOM   8279  C CD2 . PHE H 1 39  ? 30.078  11.692  66.497  1.00 24.77  ? 35  PHE H CD2 1 
ATOM   8280  C CE1 . PHE H 1 39  ? 29.740  14.220  65.448  1.00 29.71  ? 35  PHE H CE1 1 
ATOM   8281  C CE2 . PHE H 1 39  ? 30.219  12.804  67.309  1.00 20.66  ? 35  PHE H CE2 1 
ATOM   8282  C CZ  . PHE H 1 39  ? 30.050  14.069  66.783  1.00 19.92  ? 35  PHE H CZ  1 
ATOM   8283  N N   . GLU H 1 40  ? 30.777  11.361  61.456  1.00 39.59  ? 36  GLU H N   1 
ATOM   8284  C CA  . GLU H 1 40  ? 31.084  12.406  60.488  1.00 36.36  ? 36  GLU H CA  1 
ATOM   8285  C C   . GLU H 1 40  ? 30.195  13.616  60.756  1.00 46.13  ? 36  GLU H C   1 
ATOM   8286  O O   . GLU H 1 40  ? 29.033  13.466  61.131  1.00 49.62  ? 36  GLU H O   1 
ATOM   8287  C CB  . GLU H 1 40  ? 30.835  11.899  59.065  1.00 38.50  ? 36  GLU H CB  1 
ATOM   8288  C CG  . GLU H 1 40  ? 31.544  10.596  58.727  1.00 54.41  ? 36  GLU H CG  1 
ATOM   8289  C CD  . GLU H 1 40  ? 33.009  10.793  58.388  1.00 74.90  ? 36  GLU H CD  1 
ATOM   8290  O OE1 . GLU H 1 40  ? 33.320  11.708  57.597  1.00 78.58  ? 36  GLU H OE1 1 
ATOM   8291  O OE2 . GLU H 1 40  ? 33.848  10.032  58.914  1.00 85.07  ? 36  GLU H OE2 1 
ATOM   8292  N N   . PHE H 1 41  ? 30.735  14.816  60.566  1.00 42.11  ? 37  PHE H N   1 
ATOM   8293  C CA  . PHE H 1 41  ? 29.939  16.027  60.723  1.00 40.15  ? 37  PHE H CA  1 
ATOM   8294  C C   . PHE H 1 41  ? 30.638  17.228  60.097  1.00 30.75  ? 37  PHE H C   1 
ATOM   8295  O O   . PHE H 1 41  ? 31.809  17.152  59.733  1.00 42.86  ? 37  PHE H O   1 
ATOM   8296  C CB  . PHE H 1 41  ? 29.645  16.285  62.201  1.00 51.48  ? 37  PHE H CB  1 
ATOM   8297  C CG  . PHE H 1 41  ? 28.406  17.098  62.437  1.00 36.40  ? 37  PHE H CG  1 
ATOM   8298  C CD1 . PHE H 1 41  ? 27.157  16.582  62.135  1.00 34.83  ? 37  PHE H CD1 1 
ATOM   8299  C CD2 . PHE H 1 41  ? 28.489  18.379  62.952  1.00 38.30  ? 37  PHE H CD2 1 
ATOM   8300  C CE1 . PHE H 1 41  ? 26.015  17.329  62.348  1.00 59.44  ? 37  PHE H CE1 1 
ATOM   8301  C CE2 . PHE H 1 41  ? 27.349  19.128  63.169  1.00 45.09  ? 37  PHE H CE2 1 
ATOM   8302  C CZ  . PHE H 1 41  ? 26.112  18.604  62.866  1.00 56.05  ? 37  PHE H CZ  1 
ATOM   8303  N N   . VAL H 1 42  ? 29.908  18.334  59.975  1.00 43.62  ? 38  VAL H N   1 
ATOM   8304  C CA  . VAL H 1 42  ? 30.407  19.528  59.294  1.00 42.41  ? 38  VAL H CA  1 
ATOM   8305  C C   . VAL H 1 42  ? 31.529  20.204  60.075  1.00 38.35  ? 38  VAL H C   1 
ATOM   8306  O O   . VAL H 1 42  ? 31.446  20.357  61.294  1.00 43.81  ? 38  VAL H O   1 
ATOM   8307  C CB  . VAL H 1 42  ? 29.284  20.570  59.088  1.00 40.72  ? 38  VAL H CB  1 
ATOM   8308  C CG1 . VAL H 1 42  ? 29.798  21.755  58.291  1.00 39.74  ? 38  VAL H CG1 1 
ATOM   8309  C CG2 . VAL H 1 42  ? 28.093  19.947  58.386  1.00 35.52  ? 38  VAL H CG2 1 
ATOM   8310  N N   . ASP H 1 43  ? 32.571  20.618  59.363  1.00 50.23  ? 39  ASP H N   1 
ATOM   8311  C CA  . ASP H 1 43  ? 33.679  21.339  59.976  1.00 59.35  ? 39  ASP H CA  1 
ATOM   8312  C C   . ASP H 1 43  ? 33.395  22.835  59.945  1.00 65.45  ? 39  ASP H C   1 
ATOM   8313  O O   . ASP H 1 43  ? 33.411  23.456  58.884  1.00 75.12  ? 39  ASP H O   1 
ATOM   8314  C CB  . ASP H 1 43  ? 34.987  21.037  59.241  1.00 48.58  ? 39  ASP H CB  1 
ATOM   8315  C CG  . ASP H 1 43  ? 36.202  21.608  59.950  1.00 67.93  ? 39  ASP H CG  1 
ATOM   8316  O OD1 . ASP H 1 43  ? 36.104  21.910  61.158  1.00 71.34  ? 39  ASP H OD1 1 
ATOM   8317  O OD2 . ASP H 1 43  ? 37.261  21.746  59.300  1.00 80.26  ? 39  ASP H OD2 1 
ATOM   8318  N N   . GLN H 1 44  ? 33.133  23.408  61.115  1.00 77.84  ? 40  GLN H N   1 
ATOM   8319  C CA  . GLN H 1 44  ? 32.787  24.822  61.223  1.00 86.75  ? 40  GLN H CA  1 
ATOM   8320  C C   . GLN H 1 44  ? 33.863  25.731  60.630  1.00 88.26  ? 40  GLN H C   1 
ATOM   8321  O O   . GLN H 1 44  ? 33.580  26.864  60.243  1.00 92.57  ? 40  GLN H O   1 
ATOM   8322  C CB  . GLN H 1 44  ? 32.542  25.192  62.688  1.00 83.79  ? 40  GLN H CB  1 
ATOM   8323  C CG  . GLN H 1 44  ? 31.273  24.589  63.272  1.00 85.19  ? 40  GLN H CG  1 
ATOM   8324  C CD  . GLN H 1 44  ? 31.182  24.758  64.777  1.00 80.81  ? 40  GLN H CD  1 
ATOM   8325  O OE1 . GLN H 1 44  ? 32.199  24.793  65.471  1.00 68.65  ? 40  GLN H OE1 1 
ATOM   8326  N NE2 . GLN H 1 44  ? 29.961  24.868  65.288  1.00 80.49  ? 40  GLN H NE2 1 
ATOM   8327  N N   . GLU H 1 45  ? 35.094  25.233  60.558  1.00 78.00  ? 41  GLU H N   1 
ATOM   8328  C CA  . GLU H 1 45  ? 36.205  26.018  60.029  1.00 76.23  ? 41  GLU H CA  1 
ATOM   8329  C C   . GLU H 1 45  ? 36.289  25.929  58.507  1.00 67.49  ? 41  GLU H C   1 
ATOM   8330  O O   . GLU H 1 45  ? 36.752  26.858  57.846  1.00 66.72  ? 41  GLU H O   1 
ATOM   8331  C CB  . GLU H 1 45  ? 37.524  25.550  60.645  1.00 86.18  ? 41  GLU H CB  1 
ATOM   8332  C CG  . GLU H 1 45  ? 37.602  25.734  62.152  1.00 96.77  ? 41  GLU H CG  1 
ATOM   8333  C CD  . GLU H 1 45  ? 37.563  27.193  62.565  1.00 102.97 ? 41  GLU H CD  1 
ATOM   8334  O OE1 . GLU H 1 45  ? 37.897  28.060  61.728  1.00 106.25 ? 41  GLU H OE1 1 
ATOM   8335  O OE2 . GLU H 1 45  ? 37.197  27.475  63.726  1.00 99.64  ? 41  GLU H OE2 1 
ATOM   8336  N N   . GLN H 1 46  ? 35.839  24.805  57.959  1.00 66.30  ? 42  GLN H N   1 
ATOM   8337  C CA  . GLN H 1 46  ? 35.907  24.561  56.522  1.00 65.56  ? 42  GLN H CA  1 
ATOM   8338  C C   . GLN H 1 46  ? 34.691  25.149  55.803  1.00 76.85  ? 42  GLN H C   1 
ATOM   8339  O O   . GLN H 1 46  ? 34.758  25.477  54.618  1.00 77.38  ? 42  GLN H O   1 
ATOM   8340  C CB  . GLN H 1 46  ? 36.003  23.056  56.259  1.00 60.67  ? 42  GLN H CB  1 
ATOM   8341  C CG  . GLN H 1 46  ? 37.055  22.658  55.232  1.00 61.62  ? 42  GLN H CG  1 
ATOM   8342  C CD  . GLN H 1 46  ? 37.369  21.170  55.260  1.00 69.70  ? 42  GLN H CD  1 
ATOM   8343  O OE1 . GLN H 1 46  ? 37.675  20.610  56.312  1.00 79.26  ? 42  GLN H OE1 1 
ATOM   8344  N NE2 . GLN H 1 46  ? 37.296  20.524  54.100  1.00 61.70  ? 42  GLN H NE2 1 
ATOM   8345  N N   . LEU H 1 47  ? 33.585  25.283  56.531  1.00 76.54  ? 43  LEU H N   1 
ATOM   8346  C CA  . LEU H 1 47  ? 32.345  25.812  55.970  1.00 79.44  ? 43  LEU H CA  1 
ATOM   8347  C C   . LEU H 1 47  ? 31.799  26.930  56.859  1.00 88.50  ? 43  LEU H C   1 
ATOM   8348  O O   . LEU H 1 47  ? 31.288  26.671  57.950  1.00 83.81  ? 43  LEU H O   1 
ATOM   8349  C CB  . LEU H 1 47  ? 31.318  24.686  55.834  1.00 68.57  ? 43  LEU H CB  1 
ATOM   8350  C CG  . LEU H 1 47  ? 29.983  25.034  55.176  1.00 60.84  ? 43  LEU H CG  1 
ATOM   8351  C CD1 . LEU H 1 47  ? 30.186  25.557  53.763  1.00 57.03  ? 43  LEU H CD1 1 
ATOM   8352  C CD2 . LEU H 1 47  ? 29.078  23.816  55.168  1.00 66.03  ? 43  LEU H CD2 1 
ATOM   8353  N N   . LYS H 1 48  ? 31.906  28.170  56.385  1.00 94.38  ? 44  LYS H N   1 
ATOM   8354  C CA  . LYS H 1 48  ? 31.560  29.340  57.192  1.00 84.95  ? 44  LYS H CA  1 
ATOM   8355  C C   . LYS H 1 48  ? 30.095  29.760  57.045  1.00 84.10  ? 44  LYS H C   1 
ATOM   8356  O O   . LYS H 1 48  ? 29.428  30.052  58.037  1.00 83.60  ? 44  LYS H O   1 
ATOM   8357  C CB  . LYS H 1 48  ? 32.469  30.520  56.830  1.00 72.14  ? 44  LYS H CB  1 
ATOM   8358  C CG  . LYS H 1 48  ? 33.954  30.273  57.072  1.00 67.41  ? 44  LYS H CG  1 
ATOM   8359  C CD  . LYS H 1 48  ? 34.226  29.819  58.501  1.00 59.48  ? 44  LYS H CD  1 
ATOM   8360  C CE  . LYS H 1 48  ? 35.719  29.751  58.802  1.00 45.72  ? 44  LYS H CE  1 
ATOM   8361  N NZ  . LYS H 1 48  ? 36.298  31.078  59.166  1.00 27.44  ? 44  LYS H NZ  1 
ATOM   8362  N N   . ASP H 1 49  ? 29.603  29.797  55.809  1.00 77.70  ? 45  ASP H N   1 
ATOM   8363  C CA  . ASP H 1 49  ? 28.244  30.270  55.535  1.00 68.84  ? 45  ASP H CA  1 
ATOM   8364  C C   . ASP H 1 49  ? 27.196  29.587  56.419  1.00 69.28  ? 45  ASP H C   1 
ATOM   8365  O O   . ASP H 1 49  ? 27.035  28.367  56.363  1.00 73.80  ? 45  ASP H O   1 
ATOM   8366  C CB  . ASP H 1 49  ? 27.886  30.052  54.064  1.00 71.43  ? 45  ASP H CB  1 
ATOM   8367  C CG  . ASP H 1 49  ? 26.467  30.481  53.745  1.00 73.68  ? 45  ASP H CG  1 
ATOM   8368  O OD1 . ASP H 1 49  ? 25.906  31.293  54.509  1.00 69.13  ? 45  ASP H OD1 1 
ATOM   8369  O OD2 . ASP H 1 49  ? 25.910  30.006  52.734  1.00 78.73  ? 45  ASP H OD2 1 
ATOM   8370  N N   . PRO H 1 50  ? 26.472  30.378  57.231  1.00 52.68  ? 46  PRO H N   1 
ATOM   8371  C CA  . PRO H 1 50  ? 25.455  29.853  58.153  1.00 53.90  ? 46  PRO H CA  1 
ATOM   8372  C C   . PRO H 1 50  ? 24.404  28.971  57.481  1.00 47.93  ? 46  PRO H C   1 
ATOM   8373  O O   . PRO H 1 50  ? 24.147  27.863  57.949  1.00 43.95  ? 46  PRO H O   1 
ATOM   8374  C CB  . PRO H 1 50  ? 24.798  31.122  58.703  1.00 49.32  ? 46  PRO H CB  1 
ATOM   8375  C CG  . PRO H 1 50  ? 25.854  32.156  58.614  1.00 42.26  ? 46  PRO H CG  1 
ATOM   8376  C CD  . PRO H 1 50  ? 26.643  31.835  57.380  1.00 37.15  ? 46  PRO H CD  1 
ATOM   8377  N N   . VAL H 1 51  ? 23.797  29.465  56.407  1.00 49.89  ? 47  VAL H N   1 
ATOM   8378  C CA  . VAL H 1 51  ? 22.743  28.729  55.715  1.00 46.68  ? 47  VAL H CA  1 
ATOM   8379  C C   . VAL H 1 51  ? 23.239  27.391  55.174  1.00 51.00  ? 47  VAL H C   1 
ATOM   8380  O O   . VAL H 1 51  ? 22.595  26.360  55.366  1.00 55.82  ? 47  VAL H O   1 
ATOM   8381  C CB  . VAL H 1 51  ? 22.160  29.554  54.551  1.00 45.43  ? 47  VAL H CB  1 
ATOM   8382  C CG1 . VAL H 1 51  ? 21.462  28.650  53.543  1.00 36.89  ? 47  VAL H CG1 1 
ATOM   8383  C CG2 . VAL H 1 51  ? 21.201  30.608  55.081  1.00 56.09  ? 47  VAL H CG2 1 
ATOM   8384  N N   . CYS H 1 52  ? 24.382  27.413  54.496  1.00 43.24  ? 48  CYS H N   1 
ATOM   8385  C CA  . CYS H 1 52  ? 24.931  26.209  53.882  1.00 35.09  ? 48  CYS H CA  1 
ATOM   8386  C C   . CYS H 1 52  ? 25.471  25.242  54.934  1.00 32.70  ? 48  CYS H C   1 
ATOM   8387  O O   . CYS H 1 52  ? 25.543  24.035  54.700  1.00 41.00  ? 48  CYS H O   1 
ATOM   8388  C CB  . CYS H 1 52  ? 26.033  26.577  52.886  1.00 29.18  ? 48  CYS H CB  1 
ATOM   8389  S SG  . CYS H 1 52  ? 25.436  27.487  51.446  1.00 49.31  ? 48  CYS H SG  1 
ATOM   8390  N N   . TYR H 1 53  ? 25.852  25.774  56.090  1.00 25.18  ? 49  TYR H N   1 
ATOM   8391  C CA  . TYR H 1 53  ? 26.284  24.935  57.199  1.00 28.97  ? 49  TYR H CA  1 
ATOM   8392  C C   . TYR H 1 53  ? 25.126  24.056  57.655  1.00 29.68  ? 49  TYR H C   1 
ATOM   8393  O O   . TYR H 1 53  ? 25.308  22.875  57.945  1.00 33.23  ? 49  TYR H O   1 
ATOM   8394  C CB  . TYR H 1 53  ? 26.778  25.791  58.367  1.00 47.87  ? 49  TYR H CB  1 
ATOM   8395  C CG  . TYR H 1 53  ? 27.216  24.982  59.570  1.00 62.86  ? 49  TYR H CG  1 
ATOM   8396  C CD1 . TYR H 1 53  ? 26.288  24.521  60.497  1.00 59.76  ? 49  TYR H CD1 1 
ATOM   8397  C CD2 . TYR H 1 53  ? 28.555  24.680  59.779  1.00 62.57  ? 49  TYR H CD2 1 
ATOM   8398  C CE1 . TYR H 1 53  ? 26.683  23.780  61.596  1.00 47.48  ? 49  TYR H CE1 1 
ATOM   8399  C CE2 . TYR H 1 53  ? 28.959  23.941  60.876  1.00 55.16  ? 49  TYR H CE2 1 
ATOM   8400  C CZ  . TYR H 1 53  ? 28.019  23.496  61.782  1.00 49.62  ? 49  TYR H CZ  1 
ATOM   8401  O OH  . TYR H 1 53  ? 28.414  22.759  62.876  1.00 42.17  ? 49  TYR H OH  1 
ATOM   8402  N N   . LEU H 1 54  ? 23.935  24.643  57.717  1.00 38.52  ? 50  LEU H N   1 
ATOM   8403  C CA  . LEU H 1 54  ? 22.738  23.916  58.124  1.00 41.63  ? 50  LEU H CA  1 
ATOM   8404  C C   . LEU H 1 54  ? 22.309  22.914  57.061  1.00 54.10  ? 50  LEU H C   1 
ATOM   8405  O O   . LEU H 1 54  ? 21.799  21.841  57.382  1.00 64.92  ? 50  LEU H O   1 
ATOM   8406  C CB  . LEU H 1 54  ? 21.590  24.887  58.410  1.00 41.06  ? 50  LEU H CB  1 
ATOM   8407  C CG  . LEU H 1 54  ? 21.730  25.759  59.660  1.00 44.05  ? 50  LEU H CG  1 
ATOM   8408  C CD1 . LEU H 1 54  ? 20.525  26.683  59.798  1.00 42.38  ? 50  LEU H CD1 1 
ATOM   8409  C CD2 . LEU H 1 54  ? 21.899  24.903  60.909  1.00 28.76  ? 50  LEU H CD2 1 
ATOM   8410  N N   . LYS H 1 55  ? 22.506  23.267  55.795  1.00 63.07  ? 51  LYS H N   1 
ATOM   8411  C CA  . LYS H 1 55  ? 22.167  22.365  54.703  1.00 59.13  ? 51  LYS H CA  1 
ATOM   8412  C C   . LYS H 1 55  ? 23.022  21.108  54.783  1.00 54.66  ? 51  LYS H C   1 
ATOM   8413  O O   . LYS H 1 55  ? 22.502  19.993  54.771  1.00 60.01  ? 51  LYS H O   1 
ATOM   8414  C CB  . LYS H 1 55  ? 22.350  23.053  53.349  1.00 59.10  ? 51  LYS H CB  1 
ATOM   8415  C CG  . LYS H 1 55  ? 21.315  24.134  53.072  1.00 67.11  ? 51  LYS H CG  1 
ATOM   8416  C CD  . LYS H 1 55  ? 21.276  24.528  51.602  1.00 73.94  ? 51  LYS H CD  1 
ATOM   8417  C CE  . LYS H 1 55  ? 20.853  23.367  50.715  1.00 78.61  ? 51  LYS H CE  1 
ATOM   8418  N NZ  . LYS H 1 55  ? 20.454  23.814  49.352  1.00 80.55  ? 51  LYS H NZ  1 
ATOM   8419  N N   . LYS H 1 56  ? 24.336  21.294  54.872  1.00 49.27  ? 52  LYS H N   1 
ATOM   8420  C CA  . LYS H 1 56  ? 25.256  20.176  55.053  1.00 38.08  ? 52  LYS H CA  1 
ATOM   8421  C C   . LYS H 1 56  ? 24.934  19.419  56.333  1.00 47.55  ? 52  LYS H C   1 
ATOM   8422  O O   . LYS H 1 56  ? 24.748  18.202  56.319  1.00 61.97  ? 52  LYS H O   1 
ATOM   8423  C CB  . LYS H 1 56  ? 26.702  20.671  55.110  1.00 36.11  ? 52  LYS H CB  1 
ATOM   8424  C CG  . LYS H 1 56  ? 27.478  20.482  53.823  1.00 59.95  ? 52  LYS H CG  1 
ATOM   8425  C CD  . LYS H 1 56  ? 27.569  19.015  53.451  1.00 78.27  ? 52  LYS H CD  1 
ATOM   8426  C CE  . LYS H 1 56  ? 28.654  18.762  52.426  1.00 86.01  ? 52  LYS H CE  1 
ATOM   8427  N NZ  . LYS H 1 56  ? 29.027  17.320  52.390  1.00 94.89  ? 52  LYS H NZ  1 
ATOM   8428  N N   . ALA H 1 57  ? 24.873  20.151  57.439  1.00 52.54  ? 53  ALA H N   1 
ATOM   8429  C CA  . ALA H 1 57  ? 24.636  19.556  58.747  1.00 53.62  ? 53  ALA H CA  1 
ATOM   8430  C C   . ALA H 1 57  ? 23.382  18.686  58.740  1.00 62.22  ? 53  ALA H C   1 
ATOM   8431  O O   . ALA H 1 57  ? 23.392  17.566  59.250  1.00 57.00  ? 53  ALA H O   1 
ATOM   8432  C CB  . ALA H 1 57  ? 24.518  20.644  59.798  1.00 47.30  ? 53  ALA H CB  1 
ATOM   8433  N N   . PHE H 1 58  ? 22.308  19.205  58.152  1.00 64.13  ? 54  PHE H N   1 
ATOM   8434  C CA  . PHE H 1 58  ? 21.028  18.505  58.130  1.00 55.56  ? 54  PHE H CA  1 
ATOM   8435  C C   . PHE H 1 58  ? 21.158  17.118  57.507  1.00 60.61  ? 54  PHE H C   1 
ATOM   8436  O O   . PHE H 1 58  ? 20.721  16.126  58.089  1.00 73.47  ? 54  PHE H O   1 
ATOM   8437  C CB  . PHE H 1 58  ? 19.985  19.325  57.369  1.00 50.19  ? 54  PHE H CB  1 
ATOM   8438  C CG  . PHE H 1 58  ? 18.638  18.666  57.292  1.00 62.45  ? 54  PHE H CG  1 
ATOM   8439  C CD1 . PHE H 1 58  ? 17.761  18.722  58.364  1.00 59.86  ? 54  PHE H CD1 1 
ATOM   8440  C CD2 . PHE H 1 58  ? 18.249  17.986  56.150  1.00 75.75  ? 54  PHE H CD2 1 
ATOM   8441  C CE1 . PHE H 1 58  ? 16.521  18.116  58.296  1.00 57.66  ? 54  PHE H CE1 1 
ATOM   8442  C CE2 . PHE H 1 58  ? 17.010  17.378  56.076  1.00 74.39  ? 54  PHE H CE2 1 
ATOM   8443  C CZ  . PHE H 1 58  ? 16.145  17.443  57.151  1.00 60.25  ? 54  PHE H CZ  1 
ATOM   8444  N N   . LEU H 1 59  ? 21.759  17.054  56.323  1.00 34.12  ? 55  LEU H N   1 
ATOM   8445  C CA  . LEU H 1 59  ? 21.949  15.785  55.631  1.00 23.80  ? 55  LEU H CA  1 
ATOM   8446  C C   . LEU H 1 59  ? 22.801  14.842  56.472  1.00 25.67  ? 55  LEU H C   1 
ATOM   8447  O O   . LEU H 1 59  ? 22.518  13.648  56.568  1.00 34.75  ? 55  LEU H O   1 
ATOM   8448  C CB  . LEU H 1 59  ? 22.622  16.011  54.277  1.00 40.37  ? 55  LEU H CB  1 
ATOM   8449  C CG  . LEU H 1 59  ? 21.879  16.905  53.284  1.00 49.32  ? 55  LEU H CG  1 
ATOM   8450  C CD1 . LEU H 1 59  ? 22.720  17.117  52.036  1.00 58.47  ? 55  LEU H CD1 1 
ATOM   8451  C CD2 . LEU H 1 59  ? 20.527  16.308  52.926  1.00 61.85  ? 55  LEU H CD2 1 
ATOM   8452  N N   . LEU H 1 60  ? 23.850  15.387  57.076  1.00 27.95  ? 56  LEU H N   1 
ATOM   8453  C CA  . LEU H 1 60  ? 24.759  14.595  57.894  1.00 39.07  ? 56  LEU H CA  1 
ATOM   8454  C C   . LEU H 1 60  ? 24.070  14.107  59.166  1.00 40.54  ? 56  LEU H C   1 
ATOM   8455  O O   . LEU H 1 60  ? 24.396  13.038  59.686  1.00 31.76  ? 56  LEU H O   1 
ATOM   8456  C CB  . LEU H 1 60  ? 26.005  15.415  58.235  1.00 34.74  ? 56  LEU H CB  1 
ATOM   8457  C CG  . LEU H 1 60  ? 26.887  15.740  57.027  1.00 30.21  ? 56  LEU H CG  1 
ATOM   8458  C CD1 . LEU H 1 60  ? 27.866  16.848  57.355  1.00 26.96  ? 56  LEU H CD1 1 
ATOM   8459  C CD2 . LEU H 1 60  ? 27.623  14.494  56.561  1.00 31.98  ? 56  LEU H CD2 1 
ATOM   8460  N N   . VAL H 1 61  ? 23.114  14.887  59.664  1.00 39.58  ? 57  VAL H N   1 
ATOM   8461  C CA  . VAL H 1 61  ? 22.326  14.472  60.820  1.00 44.25  ? 57  VAL H CA  1 
ATOM   8462  C C   . VAL H 1 61  ? 21.487  13.250  60.465  1.00 44.97  ? 57  VAL H C   1 
ATOM   8463  O O   . VAL H 1 61  ? 21.236  12.393  61.311  1.00 51.29  ? 57  VAL H O   1 
ATOM   8464  C CB  . VAL H 1 61  ? 21.403  15.601  61.327  1.00 40.32  ? 57  VAL H CB  1 
ATOM   8465  C CG1 . VAL H 1 61  ? 20.248  15.030  62.144  1.00 28.53  ? 57  VAL H CG1 1 
ATOM   8466  C CG2 . VAL H 1 61  ? 22.197  16.604  62.152  1.00 41.87  ? 57  VAL H CG2 1 
ATOM   8467  N N   . GLN H 1 62  ? 21.055  13.174  59.210  1.00 35.81  ? 58  GLN H N   1 
ATOM   8468  C CA  . GLN H 1 62  ? 20.276  12.035  58.744  1.00 21.94  ? 58  GLN H CA  1 
ATOM   8469  C C   . GLN H 1 62  ? 21.105  10.763  58.847  1.00 27.74  ? 58  GLN H C   1 
ATOM   8470  O O   . GLN H 1 62  ? 20.610  9.725   59.283  1.00 37.49  ? 58  GLN H O   1 
ATOM   8471  C CB  . GLN H 1 62  ? 19.815  12.244  57.300  1.00 24.38  ? 58  GLN H CB  1 
ATOM   8472  C CG  . GLN H 1 62  ? 19.010  13.513  57.091  1.00 42.33  ? 58  GLN H CG  1 
ATOM   8473  C CD  . GLN H 1 62  ? 17.944  13.702  58.153  1.00 41.67  ? 58  GLN H CD  1 
ATOM   8474  O OE1 . GLN H 1 62  ? 17.180  12.784  58.448  1.00 39.90  ? 58  GLN H OE1 1 
ATOM   8475  N NE2 . GLN H 1 62  ? 17.896  14.892  58.742  1.00 42.14  ? 58  GLN H NE2 1 
ATOM   8476  N N   . ASP H 1 63  ? 22.369  10.853  58.443  1.00 32.96  ? 59  ASP H N   1 
ATOM   8477  C CA  . ASP H 1 63  ? 23.291  9.728   58.556  1.00 34.15  ? 59  ASP H CA  1 
ATOM   8478  C C   . ASP H 1 63  ? 23.575  9.415   60.023  1.00 35.52  ? 59  ASP H C   1 
ATOM   8479  O O   . ASP H 1 63  ? 23.710  8.253   60.405  1.00 47.21  ? 59  ASP H O   1 
ATOM   8480  C CB  . ASP H 1 63  ? 24.602  10.035  57.829  1.00 40.41  ? 59  ASP H CB  1 
ATOM   8481  C CG  . ASP H 1 63  ? 24.437  10.098  56.324  1.00 44.82  ? 59  ASP H CG  1 
ATOM   8482  O OD1 . ASP H 1 63  ? 23.719  9.243   55.764  1.00 38.03  ? 59  ASP H OD1 1 
ATOM   8483  O OD2 . ASP H 1 63  ? 25.033  11.002  55.700  1.00 55.61  ? 59  ASP H OD2 1 
ATOM   8484  N N   . ILE H 1 64  ? 23.669  10.459  60.840  1.00 23.25  ? 60  ILE H N   1 
ATOM   8485  C CA  . ILE H 1 64  ? 23.917  10.298  62.270  1.00 26.54  ? 60  ILE H CA  1 
ATOM   8486  C C   . ILE H 1 64  ? 22.765  9.575   62.963  1.00 31.41  ? 60  ILE H C   1 
ATOM   8487  O O   . ILE H 1 64  ? 22.987  8.675   63.771  1.00 27.89  ? 60  ILE H O   1 
ATOM   8488  C CB  . ILE H 1 64  ? 24.151  11.661  62.950  1.00 25.13  ? 60  ILE H CB  1 
ATOM   8489  C CG1 . ILE H 1 64  ? 25.554  12.174  62.607  1.00 31.95  ? 60  ILE H CG1 1 
ATOM   8490  C CG2 . ILE H 1 64  ? 23.973  11.549  64.465  1.00 0.96   ? 60  ILE H CG2 1 
ATOM   8491  C CD1 . ILE H 1 64  ? 25.832  13.589  63.056  1.00 28.40  ? 60  ILE H CD1 1 
ATOM   8492  N N   . MET H 1 65  ? 21.537  9.971   62.644  1.00 35.97  ? 61  MET H N   1 
ATOM   8493  C CA  . MET H 1 65  ? 20.357  9.356   63.240  1.00 30.65  ? 61  MET H CA  1 
ATOM   8494  C C   . MET H 1 65  ? 20.240  7.892   62.836  1.00 41.74  ? 61  MET H C   1 
ATOM   8495  O O   . MET H 1 65  ? 19.682  7.080   63.573  1.00 54.06  ? 61  MET H O   1 
ATOM   8496  C CB  . MET H 1 65  ? 19.089  10.104  62.824  1.00 21.65  ? 61  MET H CB  1 
ATOM   8497  C CG  . MET H 1 65  ? 18.885  11.433  63.535  1.00 13.59  ? 61  MET H CG  1 
ATOM   8498  S SD  . MET H 1 65  ? 17.205  12.071  63.356  1.00 33.32  ? 61  MET H SD  1 
ATOM   8499  C CE  . MET H 1 65  ? 17.143  12.401  61.593  1.00 21.42  ? 61  MET H CE  1 
ATOM   8500  N N   . GLU H 1 66  ? 20.771  7.563   61.662  1.00 39.38  ? 62  GLU H N   1 
ATOM   8501  C CA  . GLU H 1 66  ? 20.654  6.217   61.111  1.00 51.07  ? 62  GLU H CA  1 
ATOM   8502  C C   . GLU H 1 66  ? 21.789  5.306   61.581  1.00 58.89  ? 62  GLU H C   1 
ATOM   8503  O O   . GLU H 1 66  ? 21.548  4.197   62.060  1.00 62.81  ? 62  GLU H O   1 
ATOM   8504  C CB  . GLU H 1 66  ? 20.636  6.285   59.579  1.00 46.55  ? 62  GLU H CB  1 
ATOM   8505  C CG  . GLU H 1 66  ? 20.720  4.936   58.880  1.00 36.12  ? 62  GLU H CG  1 
ATOM   8506  C CD  . GLU H 1 66  ? 19.522  4.053   59.164  1.00 47.58  ? 62  GLU H CD  1 
ATOM   8507  O OE1 . GLU H 1 66  ? 18.392  4.583   59.240  1.00 53.64  ? 62  GLU H OE1 1 
ATOM   8508  O OE2 . GLU H 1 66  ? 19.711  2.828   59.315  1.00 44.59  ? 62  GLU H OE2 1 
ATOM   8509  N N   . ASP H 1 67  ? 23.023  5.785   61.449  1.00 47.38  ? 63  ASP H N   1 
ATOM   8510  C CA  . ASP H 1 67  ? 24.203  4.967   61.717  1.00 57.62  ? 63  ASP H CA  1 
ATOM   8511  C C   . ASP H 1 67  ? 24.603  4.949   63.191  1.00 53.88  ? 63  ASP H C   1 
ATOM   8512  O O   . ASP H 1 67  ? 25.083  3.936   63.699  1.00 70.69  ? 63  ASP H O   1 
ATOM   8513  C CB  . ASP H 1 67  ? 25.392  5.471   60.894  1.00 59.28  ? 63  ASP H CB  1 
ATOM   8514  C CG  . ASP H 1 67  ? 25.156  5.374   59.403  1.00 45.61  ? 63  ASP H CG  1 
ATOM   8515  O OD1 . ASP H 1 67  ? 24.465  4.430   58.969  1.00 54.08  ? 63  ASP H OD1 1 
ATOM   8516  O OD2 . ASP H 1 67  ? 25.668  6.241   58.664  1.00 35.63  ? 63  ASP H OD2 1 
ATOM   8517  N N   . THR H 1 68  ? 24.413  6.074   63.870  1.00 34.70  ? 64  THR H N   1 
ATOM   8518  C CA  . THR H 1 68  ? 24.973  6.265   65.202  1.00 34.64  ? 64  THR H CA  1 
ATOM   8519  C C   . THR H 1 68  ? 23.934  6.152   66.322  1.00 35.28  ? 64  THR H C   1 
ATOM   8520  O O   . THR H 1 68  ? 24.133  5.411   67.284  1.00 39.90  ? 64  THR H O   1 
ATOM   8521  C CB  . THR H 1 68  ? 25.665  7.636   65.297  1.00 35.28  ? 64  THR H CB  1 
ATOM   8522  O OG1 . THR H 1 68  ? 26.665  7.739   64.273  1.00 35.81  ? 64  THR H OG1 1 
ATOM   8523  C CG2 . THR H 1 68  ? 26.312  7.816   66.656  1.00 26.64  ? 64  THR H CG2 1 
ATOM   8524  N N   . MET H 1 69  ? 22.834  6.888   66.203  1.00 23.61  ? 65  MET H N   1 
ATOM   8525  C CA  . MET H 1 69  ? 21.819  6.918   67.254  1.00 46.76  ? 65  MET H CA  1 
ATOM   8526  C C   . MET H 1 69  ? 20.787  5.808   67.091  1.00 71.28  ? 65  MET H C   1 
ATOM   8527  O O   . MET H 1 69  ? 19.881  5.904   66.262  1.00 93.03  ? 65  MET H O   1 
ATOM   8528  C CB  . MET H 1 69  ? 21.106  8.266   67.259  1.00 42.87  ? 65  MET H CB  1 
ATOM   8529  C CG  . MET H 1 69  ? 22.035  9.456   67.384  1.00 18.82  ? 65  MET H CG  1 
ATOM   8530  S SD  . MET H 1 69  ? 21.195  10.997  67.006  1.00 68.34  ? 65  MET H SD  1 
ATOM   8531  C CE  . MET H 1 69  ? 19.716  10.811  67.995  1.00 21.95  ? 65  MET H CE  1 
ATOM   8532  N N   . ARG H 1 70  ? 20.922  4.763   67.900  1.00 61.02  ? 66  ARG H N   1 
ATOM   8533  C CA  . ARG H 1 70  ? 19.996  3.639   67.873  1.00 53.79  ? 66  ARG H CA  1 
ATOM   8534  C C   . ARG H 1 70  ? 19.468  3.355   69.275  1.00 45.73  ? 66  ARG H C   1 
ATOM   8535  O O   . ARG H 1 70  ? 20.229  3.351   70.243  1.00 47.24  ? 66  ARG H O   1 
ATOM   8536  C CB  . ARG H 1 70  ? 20.694  2.398   67.322  1.00 70.53  ? 66  ARG H CB  1 
ATOM   8537  C CG  . ARG H 1 70  ? 21.290  2.582   65.936  1.00 88.86  ? 66  ARG H CG  1 
ATOM   8538  C CD  . ARG H 1 70  ? 22.012  1.317   65.489  1.00 101.25 ? 66  ARG H CD  1 
ATOM   8539  N NE  . ARG H 1 70  ? 23.467  1.440   65.580  1.00 110.03 ? 66  ARG H NE  1 
ATOM   8540  C CZ  . ARG H 1 70  ? 24.307  0.417   65.728  1.00 110.34 ? 66  ARG H CZ  1 
ATOM   8541  N NH1 . ARG H 1 70  ? 23.856  -0.828  65.818  1.00 110.65 ? 66  ARG H NH1 1 
ATOM   8542  N NH2 . ARG H 1 70  ? 25.612  0.643   65.796  1.00 108.65 ? 66  ARG H NH2 1 
ATOM   8543  N N   . PHE H 1 71  ? 18.162  3.118   69.372  1.00 49.96  ? 67  PHE H N   1 
ATOM   8544  C CA  . PHE H 1 71  ? 17.508  2.850   70.648  1.00 41.31  ? 67  PHE H CA  1 
ATOM   8545  C C   . PHE H 1 71  ? 16.648  1.594   70.565  1.00 52.70  ? 67  PHE H C   1 
ATOM   8546  O O   . PHE H 1 71  ? 16.222  1.191   69.480  1.00 45.39  ? 67  PHE H O   1 
ATOM   8547  C CB  . PHE H 1 71  ? 16.623  4.029   71.045  1.00 31.79  ? 67  PHE H CB  1 
ATOM   8548  C CG  . PHE H 1 71  ? 17.378  5.294   71.303  1.00 28.07  ? 67  PHE H CG  1 
ATOM   8549  C CD1 . PHE H 1 71  ? 17.843  5.589   72.571  1.00 34.01  ? 67  PHE H CD1 1 
ATOM   8550  C CD2 . PHE H 1 71  ? 17.619  6.192   70.278  1.00 39.02  ? 67  PHE H CD2 1 
ATOM   8551  C CE1 . PHE H 1 71  ? 18.537  6.756   72.816  1.00 35.60  ? 67  PHE H CE1 1 
ATOM   8552  C CE2 . PHE H 1 71  ? 18.313  7.362   70.514  1.00 39.00  ? 67  PHE H CE2 1 
ATOM   8553  C CZ  . PHE H 1 71  ? 18.773  7.645   71.786  1.00 32.95  ? 67  PHE H CZ  1 
ATOM   8554  N N   . ARG H 1 72  ? 16.389  0.986   71.719  1.00 59.93  ? 68  ARG H N   1 
ATOM   8555  C CA  . ARG H 1 72  ? 15.547  -0.205  71.795  1.00 55.88  ? 68  ARG H CA  1 
ATOM   8556  C C   . ARG H 1 72  ? 14.154  0.087   71.244  1.00 60.50  ? 68  ARG H C   1 
ATOM   8557  O O   . ARG H 1 72  ? 13.601  1.160   71.477  1.00 71.13  ? 68  ARG H O   1 
ATOM   8558  C CB  . ARG H 1 72  ? 15.445  -0.692  73.241  1.00 47.75  ? 68  ARG H CB  1 
ATOM   8559  N N   . ASP H 1 73  ? 13.586  -0.879  70.525  1.00 46.85  ? 69  ASP H N   1 
ATOM   8560  C CA  . ASP H 1 73  ? 12.325  -0.671  69.813  1.00 49.57  ? 69  ASP H CA  1 
ATOM   8561  C C   . ASP H 1 73  ? 11.164  -0.276  70.725  1.00 40.90  ? 69  ASP H C   1 
ATOM   8562  O O   . ASP H 1 73  ? 11.069  -0.728  71.866  1.00 37.20  ? 69  ASP H O   1 
ATOM   8563  C CB  . ASP H 1 73  ? 11.950  -1.925  69.019  1.00 45.72  ? 69  ASP H CB  1 
ATOM   8564  C CG  . ASP H 1 73  ? 12.864  -2.155  67.836  1.00 52.17  ? 69  ASP H CG  1 
ATOM   8565  O OD1 . ASP H 1 73  ? 12.584  -1.596  66.755  1.00 71.79  ? 69  ASP H OD1 1 
ATOM   8566  O OD2 . ASP H 1 73  ? 13.863  -2.889  67.989  1.00 58.30  ? 69  ASP H OD2 1 
ATOM   8567  N N   . ASN H 1 74  ? 10.292  0.582   70.203  1.00 48.85  ? 70  ASN H N   1 
ATOM   8568  C CA  . ASN H 1 74  ? 9.065   0.979   70.891  1.00 54.20  ? 70  ASN H CA  1 
ATOM   8569  C C   . ASN H 1 74  ? 9.300   1.766   72.178  1.00 49.74  ? 70  ASN H C   1 
ATOM   8570  O O   . ASN H 1 74  ? 8.377   1.957   72.968  1.00 56.19  ? 70  ASN H O   1 
ATOM   8571  C CB  . ASN H 1 74  ? 8.206   -0.251  71.189  1.00 63.13  ? 70  ASN H CB  1 
ATOM   8572  C CG  . ASN H 1 74  ? 7.778   -0.978  69.933  1.00 70.59  ? 70  ASN H CG  1 
ATOM   8573  O OD1 . ASN H 1 74  ? 8.101   -2.149  69.739  1.00 71.53  ? 70  ASN H OD1 1 
ATOM   8574  N ND2 . ASN H 1 74  ? 7.046   -0.284  69.069  1.00 72.28  ? 70  ASN H ND2 1 
ATOM   8575  N N   . THR H 1 75  ? 10.530  2.222   72.388  1.00 46.70  ? 71  THR H N   1 
ATOM   8576  C CA  . THR H 1 75  ? 10.843  3.045   73.550  1.00 48.03  ? 71  THR H CA  1 
ATOM   8577  C C   . THR H 1 75  ? 10.690  4.519   73.186  1.00 50.88  ? 71  THR H C   1 
ATOM   8578  O O   . THR H 1 75  ? 10.833  4.889   72.021  1.00 59.41  ? 71  THR H O   1 
ATOM   8579  C CB  . THR H 1 75  ? 12.274  2.789   74.064  1.00 53.99  ? 71  THR H CB  1 
ATOM   8580  O OG1 . THR H 1 75  ? 13.230  3.258   73.102  1.00 59.33  ? 71  THR H OG1 1 
ATOM   8581  C CG2 . THR H 1 75  ? 12.494  1.304   74.326  1.00 50.35  ? 71  THR H CG2 1 
ATOM   8582  N N   . PRO H 1 76  ? 10.393  5.367   74.183  1.00 43.88  ? 72  PRO H N   1 
ATOM   8583  C CA  . PRO H 1 76  ? 10.164  6.797   73.944  1.00 34.49  ? 72  PRO H CA  1 
ATOM   8584  C C   . PRO H 1 76  ? 11.214  7.433   73.034  1.00 43.24  ? 72  PRO H C   1 
ATOM   8585  O O   . PRO H 1 76  ? 10.866  8.251   72.181  1.00 42.49  ? 72  PRO H O   1 
ATOM   8586  C CB  . PRO H 1 76  ? 10.239  7.396   75.349  1.00 22.45  ? 72  PRO H CB  1 
ATOM   8587  C CG  . PRO H 1 76  ? 9.784   6.301   76.242  1.00 24.29  ? 72  PRO H CG  1 
ATOM   8588  C CD  . PRO H 1 76  ? 10.246  5.018   75.608  1.00 38.54  ? 72  PRO H CD  1 
ATOM   8589  N N   . ASN H 1 77  ? 12.477  7.058   73.211  1.00 34.90  ? 73  ASN H N   1 
ATOM   8590  C CA  . ASN H 1 77  ? 13.561  7.642   72.428  1.00 48.18  ? 73  ASN H CA  1 
ATOM   8591  C C   . ASN H 1 77  ? 13.673  7.034   71.034  1.00 49.77  ? 73  ASN H C   1 
ATOM   8592  O O   . ASN H 1 77  ? 13.972  7.738   70.070  1.00 54.17  ? 73  ASN H O   1 
ATOM   8593  C CB  . ASN H 1 77  ? 14.892  7.508   73.169  1.00 58.07  ? 73  ASN H CB  1 
ATOM   8594  C CG  . ASN H 1 77  ? 14.974  8.409   74.387  1.00 63.80  ? 73  ASN H CG  1 
ATOM   8595  O OD1 . ASN H 1 77  ? 14.238  9.391   74.496  1.00 52.88  ? 73  ASN H OD1 1 
ATOM   8596  N ND2 . ASN H 1 77  ? 15.874  8.081   75.307  1.00 64.61  ? 73  ASN H ND2 1 
ATOM   8597  N N   . ALA H 1 78  ? 13.437  5.729   70.926  1.00 40.66  ? 74  ALA H N   1 
ATOM   8598  C CA  . ALA H 1 78  ? 13.461  5.061   69.628  1.00 37.84  ? 74  ALA H CA  1 
ATOM   8599  C C   . ALA H 1 78  ? 12.367  5.622   68.729  1.00 44.23  ? 74  ALA H C   1 
ATOM   8600  O O   . ALA H 1 78  ? 12.596  5.902   67.554  1.00 56.65  ? 74  ALA H O   1 
ATOM   8601  C CB  . ALA H 1 78  ? 13.283  3.569   69.799  1.00 35.61  ? 74  ALA H CB  1 
ATOM   8602  N N   . ILE H 1 79  ? 11.176  5.784   69.296  1.00 45.04  ? 75  ILE H N   1 
ATOM   8603  C CA  . ILE H 1 79  ? 10.036  6.314   68.562  1.00 46.00  ? 75  ILE H CA  1 
ATOM   8604  C C   . ILE H 1 79  ? 10.298  7.760   68.157  1.00 44.95  ? 75  ILE H C   1 
ATOM   8605  O O   . ILE H 1 79  ? 9.935   8.184   67.060  1.00 35.76  ? 75  ILE H O   1 
ATOM   8606  C CB  . ILE H 1 79  ? 8.753   6.252   69.414  1.00 45.04  ? 75  ILE H CB  1 
ATOM   8607  C CG1 . ILE H 1 79  ? 8.432   4.802   69.783  1.00 38.87  ? 75  ILE H CG1 1 
ATOM   8608  C CG2 . ILE H 1 79  ? 7.580   6.877   68.668  1.00 30.08  ? 75  ILE H CG2 1 
ATOM   8609  C CD1 . ILE H 1 79  ? 7.444   4.665   70.916  1.00 51.17  ? 75  ILE H CD1 1 
ATOM   8610  N N   . ALA H 1 80  ? 10.933  8.512   69.051  1.00 45.18  ? 76  ALA H N   1 
ATOM   8611  C CA  . ALA H 1 80  ? 11.254  9.908   68.787  1.00 41.50  ? 76  ALA H CA  1 
ATOM   8612  C C   . ALA H 1 80  ? 12.159  10.030  67.565  1.00 51.18  ? 76  ALA H C   1 
ATOM   8613  O O   . ALA H 1 80  ? 11.890  10.819  66.659  1.00 63.50  ? 76  ALA H O   1 
ATOM   8614  C CB  . ALA H 1 80  ? 11.918  10.534  70.002  1.00 43.98  ? 76  ALA H CB  1 
ATOM   8615  N N   . ILE H 1 81  ? 13.230  9.243   67.543  1.00 48.54  ? 77  ILE H N   1 
ATOM   8616  C CA  . ILE H 1 81  ? 14.178  9.283   66.436  1.00 44.28  ? 77  ILE H CA  1 
ATOM   8617  C C   . ILE H 1 81  ? 13.492  8.898   65.131  1.00 48.19  ? 77  ILE H C   1 
ATOM   8618  O O   . ILE H 1 81  ? 13.709  9.531   64.095  1.00 50.10  ? 77  ILE H O   1 
ATOM   8619  C CB  . ILE H 1 81  ? 15.377  8.344   66.680  1.00 33.67  ? 77  ILE H CB  1 
ATOM   8620  C CG1 . ILE H 1 81  ? 16.166  8.797   67.908  1.00 36.53  ? 77  ILE H CG1 1 
ATOM   8621  C CG2 . ILE H 1 81  ? 16.290  8.314   65.464  1.00 33.38  ? 77  ILE H CG2 1 
ATOM   8622  C CD1 . ILE H 1 81  ? 16.686  10.216  67.815  1.00 41.97  ? 77  ILE H CD1 1 
ATOM   8623  N N   . VAL H 1 82  ? 12.660  7.862   65.183  1.00 24.54  ? 78  VAL H N   1 
ATOM   8624  C CA  . VAL H 1 82  ? 11.931  7.418   64.001  1.00 30.04  ? 78  VAL H CA  1 
ATOM   8625  C C   . VAL H 1 82  ? 11.119  8.571   63.421  1.00 33.97  ? 78  VAL H C   1 
ATOM   8626  O O   . VAL H 1 82  ? 11.057  8.747   62.205  1.00 27.86  ? 78  VAL H O   1 
ATOM   8627  C CB  . VAL H 1 82  ? 10.992  6.237   64.325  1.00 34.70  ? 78  VAL H CB  1 
ATOM   8628  C CG1 . VAL H 1 82  ? 10.026  5.983   63.178  1.00 39.80  ? 78  VAL H CG1 1 
ATOM   8629  C CG2 . VAL H 1 82  ? 11.796  4.983   64.622  1.00 36.88  ? 78  VAL H CG2 1 
ATOM   8630  N N   . GLN H 1 83  ? 10.506  9.359   64.299  1.00 38.25  ? 79  GLN H N   1 
ATOM   8631  C CA  . GLN H 1 83  ? 9.671   10.476  63.868  1.00 41.00  ? 79  GLN H CA  1 
ATOM   8632  C C   . GLN H 1 83  ? 10.509  11.606  63.277  1.00 45.10  ? 79  GLN H C   1 
ATOM   8633  O O   . GLN H 1 83  ? 10.056  12.319  62.382  1.00 47.05  ? 79  GLN H O   1 
ATOM   8634  C CB  . GLN H 1 83  ? 8.831   10.997  65.036  1.00 44.15  ? 79  GLN H CB  1 
ATOM   8635  C CG  . GLN H 1 83  ? 7.728   10.045  65.476  1.00 55.57  ? 79  GLN H CG  1 
ATOM   8636  C CD  . GLN H 1 83  ? 6.925   10.581  66.647  1.00 70.60  ? 79  GLN H CD  1 
ATOM   8637  O OE1 . GLN H 1 83  ? 6.989   11.768  66.969  1.00 70.36  ? 79  GLN H OE1 1 
ATOM   8638  N NE2 . GLN H 1 83  ? 6.164   9.704   67.293  1.00 75.02  ? 79  GLN H NE2 1 
ATOM   8639  N N   . LEU H 1 84  ? 11.731  11.767  63.776  1.00 51.84  ? 80  LEU H N   1 
ATOM   8640  C CA  . LEU H 1 84  ? 12.637  12.785  63.255  1.00 45.60  ? 80  LEU H CA  1 
ATOM   8641  C C   . LEU H 1 84  ? 13.158  12.395  61.872  1.00 41.72  ? 80  LEU H C   1 
ATOM   8642  O O   . LEU H 1 84  ? 13.399  13.256  61.027  1.00 38.84  ? 80  LEU H O   1 
ATOM   8643  C CB  . LEU H 1 84  ? 13.807  13.006  64.217  1.00 50.02  ? 80  LEU H CB  1 
ATOM   8644  C CG  . LEU H 1 84  ? 13.487  13.746  65.520  1.00 38.86  ? 80  LEU H CG  1 
ATOM   8645  C CD1 . LEU H 1 84  ? 14.669  13.680  66.479  1.00 39.89  ? 80  LEU H CD1 1 
ATOM   8646  C CD2 . LEU H 1 84  ? 13.107  15.197  65.243  1.00 27.07  ? 80  LEU H CD2 1 
ATOM   8647  N N   . GLN H 1 85  ? 13.328  11.096  61.646  1.00 40.31  ? 81  GLN H N   1 
ATOM   8648  C CA  . GLN H 1 85  ? 13.787  10.601  60.351  1.00 49.98  ? 81  GLN H CA  1 
ATOM   8649  C C   . GLN H 1 85  ? 12.654  10.641  59.329  1.00 52.55  ? 81  GLN H C   1 
ATOM   8650  O O   . GLN H 1 85  ? 12.873  10.951  58.157  1.00 62.49  ? 81  GLN H O   1 
ATOM   8651  C CB  . GLN H 1 85  ? 14.333  9.178   60.484  1.00 36.67  ? 81  GLN H CB  1 
ATOM   8652  C CG  . GLN H 1 85  ? 15.583  9.078   61.341  1.00 37.49  ? 81  GLN H CG  1 
ATOM   8653  C CD  . GLN H 1 85  ? 16.037  7.648   61.542  1.00 58.31  ? 81  GLN H CD  1 
ATOM   8654  O OE1 . GLN H 1 85  ? 15.514  6.932   62.396  1.00 59.80  ? 81  GLN H OE1 1 
ATOM   8655  N NE2 . GLN H 1 85  ? 17.017  7.222   60.752  1.00 64.65  ? 81  GLN H NE2 1 
ATOM   8656  N N   . GLU H 1 86  ? 11.445  10.322  59.779  1.00 37.38  ? 82  GLU H N   1 
ATOM   8657  C CA  . GLU H 1 86  ? 10.258  10.418  58.937  1.00 47.11  ? 82  GLU H CA  1 
ATOM   8658  C C   . GLU H 1 86  ? 10.008  11.879  58.587  1.00 44.07  ? 82  GLU H C   1 
ATOM   8659  O O   . GLU H 1 86  ? 9.678   12.214  57.449  1.00 41.27  ? 82  GLU H O   1 
ATOM   8660  C CB  . GLU H 1 86  ? 9.044   9.843   59.668  1.00 67.66  ? 82  GLU H CB  1 
ATOM   8661  C CG  . GLU H 1 86  ? 7.749   9.898   58.872  1.00 84.49  ? 82  GLU H CG  1 
ATOM   8662  C CD  . GLU H 1 86  ? 7.670   8.827   57.801  1.00 99.63  ? 82  GLU H CD  1 
ATOM   8663  O OE1 . GLU H 1 86  ? 8.226   7.729   58.010  1.00 102.37 ? 82  GLU H OE1 1 
ATOM   8664  O OE2 . GLU H 1 86  ? 7.050   9.086   56.748  1.00 106.35 ? 82  GLU H OE2 1 
ATOM   8665  N N   . LEU H 1 87  ? 10.167  12.743  59.583  1.00 40.10  ? 83  LEU H N   1 
ATOM   8666  C CA  . LEU H 1 87  ? 10.022  14.180  59.402  1.00 35.81  ? 83  LEU H CA  1 
ATOM   8667  C C   . LEU H 1 87  ? 11.039  14.713  58.401  1.00 49.31  ? 83  LEU H C   1 
ATOM   8668  O O   . LEU H 1 87  ? 10.740  15.606  57.609  1.00 56.73  ? 83  LEU H O   1 
ATOM   8669  C CB  . LEU H 1 87  ? 10.209  14.888  60.745  1.00 28.70  ? 83  LEU H CB  1 
ATOM   8670  C CG  . LEU H 1 87  ? 10.628  16.358  60.690  1.00 38.16  ? 83  LEU H CG  1 
ATOM   8671  C CD1 . LEU H 1 87  ? 9.501   17.217  60.149  1.00 61.27  ? 83  LEU H CD1 1 
ATOM   8672  C CD2 . LEU H 1 87  ? 11.063  16.831  62.066  1.00 44.25  ? 83  LEU H CD2 1 
ATOM   8673  N N   . SER H 1 88  ? 12.246  14.160  58.444  1.00 53.19  ? 84  SER H N   1 
ATOM   8674  C CA  . SER H 1 88  ? 13.348  14.670  57.638  1.00 42.39  ? 84  SER H CA  1 
ATOM   8675  C C   . SER H 1 88  ? 13.234  14.262  56.173  1.00 31.57  ? 84  SER H C   1 
ATOM   8676  O O   . SER H 1 88  ? 13.777  14.933  55.297  1.00 44.52  ? 84  SER H O   1 
ATOM   8677  C CB  . SER H 1 88  ? 14.683  14.201  58.213  1.00 42.67  ? 84  SER H CB  1 
ATOM   8678  O OG  . SER H 1 88  ? 14.877  14.719  59.518  1.00 41.05  ? 84  SER H OG  1 
ATOM   8679  N N   . LEU H 1 89  ? 12.538  13.163  55.905  1.00 38.31  ? 85  LEU H N   1 
ATOM   8680  C CA  . LEU H 1 89  ? 12.305  12.738  54.528  1.00 50.79  ? 85  LEU H CA  1 
ATOM   8681  C C   . LEU H 1 89  ? 11.418  13.747  53.803  1.00 56.02  ? 85  LEU H C   1 
ATOM   8682  O O   . LEU H 1 89  ? 11.639  14.053  52.631  1.00 56.92  ? 85  LEU H O   1 
ATOM   8683  C CB  . LEU H 1 89  ? 11.664  11.347  54.487  1.00 52.22  ? 85  LEU H CB  1 
ATOM   8684  C CG  . LEU H 1 89  ? 12.600  10.159  54.729  1.00 55.40  ? 85  LEU H CG  1 
ATOM   8685  C CD1 . LEU H 1 89  ? 11.813  8.862   54.816  1.00 59.38  ? 85  LEU H CD1 1 
ATOM   8686  C CD2 . LEU H 1 89  ? 13.646  10.066  53.631  1.00 50.15  ? 85  LEU H CD2 1 
ATOM   8687  N N   . ARG H 1 90  ? 10.418  14.262  54.512  1.00 55.03  ? 86  ARG H N   1 
ATOM   8688  C CA  . ARG H 1 90  ? 9.507   15.252  53.954  1.00 41.83  ? 86  ARG H CA  1 
ATOM   8689  C C   . ARG H 1 90  ? 10.186  16.615  53.860  1.00 47.14  ? 86  ARG H C   1 
ATOM   8690  O O   . ARG H 1 90  ? 9.949   17.373  52.918  1.00 50.07  ? 86  ARG H O   1 
ATOM   8691  C CB  . ARG H 1 90  ? 8.245   15.356  54.814  1.00 50.17  ? 86  ARG H CB  1 
ATOM   8692  C CG  . ARG H 1 90  ? 7.437   14.068  54.884  1.00 62.86  ? 86  ARG H CG  1 
ATOM   8693  C CD  . ARG H 1 90  ? 6.097   14.277  55.576  1.00 67.23  ? 86  ARG H CD  1 
ATOM   8694  N NE  . ARG H 1 90  ? 5.746   13.151  56.441  1.00 71.18  ? 86  ARG H NE  1 
ATOM   8695  C CZ  . ARG H 1 90  ? 5.982   13.098  57.750  1.00 79.89  ? 86  ARG H CZ  1 
ATOM   8696  N NH1 . ARG H 1 90  ? 6.570   14.108  58.382  1.00 93.81  ? 86  ARG H NH1 1 
ATOM   8697  N NH2 . ARG H 1 90  ? 5.623   12.025  58.439  1.00 66.87  ? 86  ARG H NH2 1 
ATOM   8698  N N   . LEU H 1 91  ? 11.034  16.918  54.837  1.00 52.77  ? 87  LEU H N   1 
ATOM   8699  C CA  . LEU H 1 91  ? 11.750  18.192  54.872  1.00 42.61  ? 87  LEU H CA  1 
ATOM   8700  C C   . LEU H 1 91  ? 12.656  18.388  53.660  1.00 33.95  ? 87  LEU H C   1 
ATOM   8701  O O   . LEU H 1 91  ? 12.995  19.517  53.315  1.00 59.55  ? 87  LEU H O   1 
ATOM   8702  C CB  . LEU H 1 91  ? 12.587  18.297  56.148  1.00 53.88  ? 87  LEU H CB  1 
ATOM   8703  C CG  . LEU H 1 91  ? 12.017  19.160  57.272  1.00 61.03  ? 87  LEU H CG  1 
ATOM   8704  C CD1 . LEU H 1 91  ? 12.838  18.979  58.537  1.00 66.58  ? 87  LEU H CD1 1 
ATOM   8705  C CD2 . LEU H 1 91  ? 11.989  20.623  56.857  1.00 65.72  ? 87  LEU H CD2 1 
ATOM   8706  N N   . LYS H 1 92  ? 13.050  17.293  53.017  1.00 31.03  ? 88  LYS H N   1 
ATOM   8707  C CA  . LYS H 1 92  ? 13.966  17.363  51.883  1.00 62.02  ? 88  LYS H CA  1 
ATOM   8708  C C   . LYS H 1 92  ? 13.372  18.109  50.687  1.00 81.01  ? 88  LYS H C   1 
ATOM   8709  O O   . LYS H 1 92  ? 14.107  18.646  49.858  1.00 92.59  ? 88  LYS H O   1 
ATOM   8710  C CB  . LYS H 1 92  ? 14.401  15.959  51.457  1.00 73.55  ? 88  LYS H CB  1 
ATOM   8711  C CG  . LYS H 1 92  ? 15.534  15.382  52.292  1.00 75.74  ? 88  LYS H CG  1 
ATOM   8712  C CD  . LYS H 1 92  ? 16.110  14.128  51.651  1.00 85.31  ? 88  LYS H CD  1 
ATOM   8713  C CE  . LYS H 1 92  ? 15.161  12.946  51.773  1.00 90.05  ? 88  LYS H CE  1 
ATOM   8714  N NZ  . LYS H 1 92  ? 15.525  11.831  50.852  1.00 77.64  ? 88  LYS H NZ  1 
ATOM   8715  N N   . SER H 1 93  ? 12.046  18.141  50.597  1.00 80.62  ? 89  SER H N   1 
ATOM   8716  C CA  . SER H 1 93  ? 11.379  18.841  49.503  1.00 77.80  ? 89  SER H CA  1 
ATOM   8717  C C   . SER H 1 93  ? 11.723  20.330  49.515  1.00 78.30  ? 89  SER H C   1 
ATOM   8718  O O   . SER H 1 93  ? 11.589  21.016  48.500  1.00 72.88  ? 89  SER H O   1 
ATOM   8719  C CB  . SER H 1 93  ? 9.861   18.654  49.590  1.00 72.04  ? 89  SER H CB  1 
ATOM   8720  O OG  . SER H 1 93  ? 9.322   19.297  50.733  1.00 72.19  ? 89  SER H OG  1 
ATOM   8721  N N   . CYS H 1 94  ? 12.174  20.817  50.668  1.00 78.44  ? 90  CYS H N   1 
ATOM   8722  C CA  . CYS H 1 94  ? 12.479  22.231  50.851  1.00 73.28  ? 90  CYS H CA  1 
ATOM   8723  C C   . CYS H 1 94  ? 13.970  22.509  50.666  1.00 82.29  ? 90  CYS H C   1 
ATOM   8724  O O   . CYS H 1 94  ? 14.418  23.646  50.813  1.00 81.03  ? 90  CYS H O   1 
ATOM   8725  C CB  . CYS H 1 94  ? 12.042  22.676  52.246  1.00 68.47  ? 90  CYS H CB  1 
ATOM   8726  S SG  . CYS H 1 94  ? 10.392  22.112  52.713  1.00 93.83  ? 90  CYS H SG  1 
ATOM   8727  N N   . PHE H 1 95  ? 14.733  21.464  50.357  1.00 85.61  ? 91  PHE H N   1 
ATOM   8728  C CA  . PHE H 1 95  ? 16.159  21.603  50.078  1.00 78.85  ? 91  PHE H CA  1 
ATOM   8729  C C   . PHE H 1 95  ? 16.445  21.265  48.618  1.00 96.93  ? 91  PHE H C   1 
ATOM   8730  O O   . PHE H 1 95  ? 16.441  20.094  48.235  1.00 106.07 ? 91  PHE H O   1 
ATOM   8731  C CB  . PHE H 1 95  ? 16.981  20.676  50.981  1.00 56.48  ? 91  PHE H CB  1 
ATOM   8732  C CG  . PHE H 1 95  ? 16.916  21.027  52.443  1.00 61.81  ? 91  PHE H CG  1 
ATOM   8733  C CD1 . PHE H 1 95  ? 15.752  20.829  53.164  1.00 63.49  ? 91  PHE H CD1 1 
ATOM   8734  C CD2 . PHE H 1 95  ? 18.025  21.537  53.101  1.00 70.56  ? 91  PHE H CD2 1 
ATOM   8735  C CE1 . PHE H 1 95  ? 15.687  21.144  54.511  1.00 56.91  ? 91  PHE H CE1 1 
ATOM   8736  C CE2 . PHE H 1 95  ? 17.967  21.854  54.450  1.00 64.01  ? 91  PHE H CE2 1 
ATOM   8737  C CZ  . PHE H 1 95  ? 16.796  21.656  55.153  1.00 49.59  ? 91  PHE H CZ  1 
ATOM   8738  N N   . THR H 1 96  ? 16.691  22.287  47.803  1.00 93.55  ? 92  THR H N   1 
ATOM   8739  C CA  . THR H 1 96  ? 17.065  22.063  46.412  1.00 80.48  ? 92  THR H CA  1 
ATOM   8740  C C   . THR H 1 96  ? 18.393  21.317  46.377  1.00 82.94  ? 92  THR H C   1 
ATOM   8741  O O   . THR H 1 96  ? 19.356  21.714  47.035  1.00 77.24  ? 92  THR H O   1 
ATOM   8742  C CB  . THR H 1 96  ? 17.183  23.385  45.620  1.00 65.28  ? 92  THR H CB  1 
ATOM   8743  O OG1 . THR H 1 96  ? 18.136  24.250  46.250  1.00 67.77  ? 92  THR H OG1 1 
ATOM   8744  C CG2 . THR H 1 96  ? 15.834  24.088  45.547  1.00 54.28  ? 92  THR H CG2 1 
ATOM   8745  N N   . LYS H 1 97  ? 18.437  20.227  45.618  1.00 84.34  ? 93  LYS H N   1 
ATOM   8746  C CA  . LYS H 1 97  ? 19.615  19.368  45.586  1.00 77.05  ? 93  LYS H CA  1 
ATOM   8747  C C   . LYS H 1 97  ? 20.836  20.061  44.990  1.00 72.77  ? 93  LYS H C   1 
ATOM   8748  O O   . LYS H 1 97  ? 20.777  20.627  43.899  1.00 81.81  ? 93  LYS H O   1 
ATOM   8749  C CB  . LYS H 1 97  ? 19.320  18.084  44.805  1.00 85.64  ? 93  LYS H CB  1 
ATOM   8750  C CG  . LYS H 1 97  ? 18.664  16.988  45.632  1.00 95.78  ? 93  LYS H CG  1 
ATOM   8751  C CD  . LYS H 1 97  ? 19.614  16.455  46.697  1.00 101.99 ? 93  LYS H CD  1 
ATOM   8752  C CE  . LYS H 1 97  ? 18.987  15.323  47.492  1.00 104.78 ? 93  LYS H CE  1 
ATOM   8753  N NZ  . LYS H 1 97  ? 19.903  14.813  48.551  1.00 100.30 ? 93  LYS H NZ  1 
ATOM   8754  N N   . ASP H 1 98  ? 21.938  20.017  45.733  1.00 76.27  ? 94  ASP H N   1 
ATOM   8755  C CA  . ASP H 1 98  ? 23.236  20.454  45.239  1.00 74.88  ? 94  ASP H CA  1 
ATOM   8756  C C   . ASP H 1 98  ? 24.078  19.211  44.987  1.00 89.84  ? 94  ASP H C   1 
ATOM   8757  O O   . ASP H 1 98  ? 23.551  18.099  44.939  1.00 101.08 ? 94  ASP H O   1 
ATOM   8758  C CB  . ASP H 1 98  ? 23.931  21.341  46.273  1.00 64.56  ? 94  ASP H CB  1 
ATOM   8759  C CG  . ASP H 1 98  ? 23.130  22.577  46.618  1.00 67.16  ? 94  ASP H CG  1 
ATOM   8760  O OD1 . ASP H 1 98  ? 22.496  23.151  45.707  1.00 76.99  ? 94  ASP H OD1 1 
ATOM   8761  O OD2 . ASP H 1 98  ? 23.134  22.974  47.803  1.00 60.52  ? 94  ASP H OD2 1 
ATOM   8762  N N   . TYR H 1 99  ? 25.385  19.393  44.824  1.00 94.00  ? 95  TYR H N   1 
ATOM   8763  C CA  . TYR H 1 99  ? 26.301  18.260  44.788  1.00 108.21 ? 95  TYR H CA  1 
ATOM   8764  C C   . TYR H 1 99  ? 27.019  18.135  46.127  1.00 112.98 ? 95  TYR H C   1 
ATOM   8765  O O   . TYR H 1 99  ? 27.688  19.067  46.572  1.00 118.54 ? 95  TYR H O   1 
ATOM   8766  C CB  . TYR H 1 99  ? 27.318  18.405  43.655  1.00 116.33 ? 95  TYR H CB  1 
ATOM   8767  C CG  . TYR H 1 99  ? 28.409  17.359  43.708  1.00 123.01 ? 95  TYR H CG  1 
ATOM   8768  C CD1 . TYR H 1 99  ? 28.118  16.014  43.525  1.00 119.42 ? 95  TYR H CD1 1 
ATOM   8769  C CD2 . TYR H 1 99  ? 29.729  17.715  43.949  1.00 125.86 ? 95  TYR H CD2 1 
ATOM   8770  C CE1 . TYR H 1 99  ? 29.109  15.054  43.580  1.00 115.59 ? 95  TYR H CE1 1 
ATOM   8771  C CE2 . TYR H 1 99  ? 30.728  16.761  44.004  1.00 120.75 ? 95  TYR H CE2 1 
ATOM   8772  C CZ  . TYR H 1 99  ? 30.413  15.433  43.818  1.00 116.10 ? 95  TYR H CZ  1 
ATOM   8773  O OH  . TYR H 1 99  ? 31.405  14.482  43.873  1.00 113.89 ? 95  TYR H OH  1 
ATOM   8774  N N   . GLU H 1 100 ? 26.871  16.979  46.770  1.00 111.24 ? 96  GLU H N   1 
ATOM   8775  C CA  . GLU H 1 100 ? 27.491  16.736  48.069  1.00 109.81 ? 96  GLU H CA  1 
ATOM   8776  C C   . GLU H 1 100 ? 28.304  15.444  48.051  1.00 102.43 ? 96  GLU H C   1 
ATOM   8777  O O   . GLU H 1 100 ? 29.533  15.470  48.143  1.00 92.67  ? 96  GLU H O   1 
ATOM   8778  C CB  . GLU H 1 100 ? 26.427  16.667  49.167  1.00 109.23 ? 96  GLU H CB  1 
ATOM   8779  C CG  . GLU H 1 100 ? 25.581  17.931  49.294  1.00 105.92 ? 96  GLU H CG  1 
ATOM   8780  C CD  . GLU H 1 100 ? 24.157  17.749  48.796  1.00 102.28 ? 96  GLU H CD  1 
ATOM   8781  O OE1 . GLU H 1 100 ? 23.868  16.714  48.157  1.00 100.51 ? 96  GLU H OE1 1 
ATOM   8782  O OE2 . GLU H 1 100 ? 23.323  18.646  49.046  1.00 95.27  ? 96  GLU H OE2 1 
ATOM   8783  N N   . ALA H 1 105 ? 32.569  15.892  51.496  1.00 39.96  ? 101 ALA H N   1 
ATOM   8784  C CA  . ALA H 1 105 ? 32.827  17.285  51.146  1.00 55.08  ? 101 ALA H CA  1 
ATOM   8785  C C   . ALA H 1 105 ? 32.544  18.198  52.332  1.00 58.31  ? 101 ALA H C   1 
ATOM   8786  O O   . ALA H 1 105 ? 31.450  18.176  52.892  1.00 67.25  ? 101 ALA H O   1 
ATOM   8787  C CB  . ALA H 1 105 ? 31.982  17.695  49.945  1.00 51.48  ? 101 ALA H CB  1 
ATOM   8788  N N   . CYS H 1 106 ? 33.535  19.000  52.708  1.00 52.31  ? 102 CYS H N   1 
ATOM   8789  C CA  . CYS H 1 106 ? 33.411  19.888  53.861  1.00 64.44  ? 102 CYS H CA  1 
ATOM   8790  C C   . CYS H 1 106 ? 33.171  19.102  55.149  1.00 50.11  ? 102 CYS H C   1 
ATOM   8791  O O   . CYS H 1 106 ? 32.683  19.656  56.134  1.00 36.34  ? 102 CYS H O   1 
ATOM   8792  C CB  . CYS H 1 106 ? 32.266  20.884  53.655  1.00 64.55  ? 102 CYS H CB  1 
ATOM   8793  S SG  . CYS H 1 106 ? 32.440  21.942  52.203  1.00 87.21  ? 102 CYS H SG  1 
ATOM   8794  N N   . VAL H 1 107 ? 33.522  17.817  55.140  1.00 36.68  ? 103 VAL H N   1 
ATOM   8795  C CA  . VAL H 1 107 ? 33.268  16.943  56.282  1.00 43.85  ? 103 VAL H CA  1 
ATOM   8796  C C   . VAL H 1 107 ? 34.555  16.502  56.971  1.00 48.29  ? 103 VAL H C   1 
ATOM   8797  O O   . VAL H 1 107 ? 35.604  16.374  56.340  1.00 43.93  ? 103 VAL H O   1 
ATOM   8798  C CB  . VAL H 1 107 ? 32.494  15.678  55.853  1.00 64.25  ? 103 VAL H CB  1 
ATOM   8799  C CG1 . VAL H 1 107 ? 32.462  14.651  56.981  1.00 63.24  ? 103 VAL H CG1 1 
ATOM   8800  C CG2 . VAL H 1 107 ? 31.084  16.040  55.423  1.00 70.76  ? 103 VAL H CG2 1 
ATOM   8801  N N   . ARG H 1 108 ? 34.454  16.269  58.276  1.00 55.46  ? 104 ARG H N   1 
ATOM   8802  C CA  . ARG H 1 108 ? 35.553  15.726  59.062  1.00 42.00  ? 104 ARG H CA  1 
ATOM   8803  C C   . ARG H 1 108 ? 34.999  14.674  60.011  1.00 41.90  ? 104 ARG H C   1 
ATOM   8804  O O   . ARG H 1 108 ? 33.786  14.558  60.178  1.00 57.13  ? 104 ARG H O   1 
ATOM   8805  C CB  . ARG H 1 108 ? 36.231  16.831  59.868  1.00 25.32  ? 104 ARG H CB  1 
ATOM   8806  C CG  . ARG H 1 108 ? 35.254  17.664  60.674  1.00 39.75  ? 104 ARG H CG  1 
ATOM   8807  C CD  . ARG H 1 108 ? 35.948  18.556  61.688  1.00 46.82  ? 104 ARG H CD  1 
ATOM   8808  N NE  . ARG H 1 108 ? 36.336  17.810  62.881  1.00 57.92  ? 104 ARG H NE  1 
ATOM   8809  C CZ  . ARG H 1 108 ? 36.631  18.363  64.055  1.00 61.43  ? 104 ARG H CZ  1 
ATOM   8810  N NH1 . ARG H 1 108 ? 36.583  19.679  64.210  1.00 58.77  ? 104 ARG H NH1 1 
ATOM   8811  N NH2 . ARG H 1 108 ? 36.969  17.594  65.081  1.00 70.06  ? 104 ARG H NH2 1 
ATOM   8812  N N   . THR H 1 109 ? 35.887  13.908  60.633  1.00 47.00  ? 105 THR H N   1 
ATOM   8813  C CA  . THR H 1 109 ? 35.471  12.938  61.637  1.00 46.10  ? 105 THR H CA  1 
ATOM   8814  C C   . THR H 1 109 ? 35.638  13.525  63.035  1.00 40.33  ? 105 THR H C   1 
ATOM   8815  O O   . THR H 1 109 ? 36.657  14.147  63.339  1.00 38.38  ? 105 THR H O   1 
ATOM   8816  C CB  . THR H 1 109 ? 36.275  11.630  61.534  1.00 30.28  ? 105 THR H CB  1 
ATOM   8817  O OG1 . THR H 1 109 ? 35.986  10.984  60.289  1.00 36.79  ? 105 THR H OG1 1 
ATOM   8818  C CG2 . THR H 1 109 ? 35.915  10.693  62.674  1.00 25.02  ? 105 THR H CG2 1 
ATOM   8819  N N   . PHE H 1 110 ? 34.627  13.329  63.875  1.00 25.47  ? 106 PHE H N   1 
ATOM   8820  C CA  . PHE H 1 110 ? 34.668  13.801  65.253  1.00 42.68  ? 106 PHE H CA  1 
ATOM   8821  C C   . PHE H 1 110 ? 34.844  12.634  66.209  1.00 41.12  ? 106 PHE H C   1 
ATOM   8822  O O   . PHE H 1 110 ? 34.420  11.513  65.926  1.00 39.61  ? 106 PHE H O   1 
ATOM   8823  C CB  . PHE H 1 110 ? 33.381  14.546  65.610  1.00 44.81  ? 106 PHE H CB  1 
ATOM   8824  C CG  . PHE H 1 110 ? 33.315  15.943  65.067  1.00 37.71  ? 106 PHE H CG  1 
ATOM   8825  C CD1 . PHE H 1 110 ? 32.929  16.174  63.758  1.00 26.29  ? 106 PHE H CD1 1 
ATOM   8826  C CD2 . PHE H 1 110 ? 33.625  17.027  65.870  1.00 44.02  ? 106 PHE H CD2 1 
ATOM   8827  C CE1 . PHE H 1 110 ? 32.862  17.460  63.257  1.00 26.85  ? 106 PHE H CE1 1 
ATOM   8828  C CE2 . PHE H 1 110 ? 33.558  18.316  65.375  1.00 53.14  ? 106 PHE H CE2 1 
ATOM   8829  C CZ  . PHE H 1 110 ? 33.175  18.532  64.066  1.00 42.33  ? 106 PHE H CZ  1 
ATOM   8830  N N   . TYR H 1 111 ? 35.472  12.908  67.345  1.00 34.43  ? 107 TYR H N   1 
ATOM   8831  C CA  . TYR H 1 111 ? 35.592  11.924  68.409  1.00 29.66  ? 107 TYR H CA  1 
ATOM   8832  C C   . TYR H 1 111 ? 35.153  12.582  69.713  1.00 29.49  ? 107 TYR H C   1 
ATOM   8833  O O   . TYR H 1 111 ? 35.978  13.023  70.512  1.00 46.26  ? 107 TYR H O   1 
ATOM   8834  C CB  . TYR H 1 111 ? 37.029  11.402  68.500  1.00 26.16  ? 107 TYR H CB  1 
ATOM   8835  C CG  . TYR H 1 111 ? 37.174  10.149  69.335  1.00 26.61  ? 107 TYR H CG  1 
ATOM   8836  C CD1 . TYR H 1 111 ? 36.398  9.025   69.079  1.00 21.82  ? 107 TYR H CD1 1 
ATOM   8837  C CD2 . TYR H 1 111 ? 38.082  10.093  70.384  1.00 37.70  ? 107 TYR H CD2 1 
ATOM   8838  C CE1 . TYR H 1 111 ? 36.525  7.880   69.844  1.00 23.22  ? 107 TYR H CE1 1 
ATOM   8839  C CE2 . TYR H 1 111 ? 38.218  8.953   71.152  1.00 22.06  ? 107 TYR H CE2 1 
ATOM   8840  C CZ  . TYR H 1 111 ? 37.437  7.851   70.879  1.00 31.97  ? 107 TYR H CZ  1 
ATOM   8841  O OH  . TYR H 1 111 ? 37.570  6.717   71.648  1.00 43.93  ? 107 TYR H OH  1 
ATOM   8842  N N   . GLU H 1 112 ? 33.840  12.655  69.908  1.00 25.69  ? 108 GLU H N   1 
ATOM   8843  C CA  . GLU H 1 112 ? 33.260  13.340  71.056  1.00 35.93  ? 108 GLU H CA  1 
ATOM   8844  C C   . GLU H 1 112 ? 32.306  12.428  71.814  1.00 43.90  ? 108 GLU H C   1 
ATOM   8845  O O   . GLU H 1 112 ? 32.048  11.302  71.394  1.00 53.93  ? 108 GLU H O   1 
ATOM   8846  C CB  . GLU H 1 112 ? 32.512  14.589  70.595  1.00 33.95  ? 108 GLU H CB  1 
ATOM   8847  C CG  . GLU H 1 112 ? 33.385  15.589  69.863  1.00 49.42  ? 108 GLU H CG  1 
ATOM   8848  C CD  . GLU H 1 112 ? 32.621  16.830  69.450  1.00 61.14  ? 108 GLU H CD  1 
ATOM   8849  O OE1 . GLU H 1 112 ? 33.264  17.824  69.049  1.00 70.31  ? 108 GLU H OE1 1 
ATOM   8850  O OE2 . GLU H 1 112 ? 31.375  16.809  69.528  1.00 54.89  ? 108 GLU H OE2 1 
ATOM   8851  N N   . THR H 1 113 ? 31.779  12.924  72.929  1.00 38.33  ? 109 THR H N   1 
ATOM   8852  C CA  . THR H 1 113 ? 30.853  12.150  73.747  1.00 44.43  ? 109 THR H CA  1 
ATOM   8853  C C   . THR H 1 113 ? 29.467  12.121  73.102  1.00 35.78  ? 109 THR H C   1 
ATOM   8854  O O   . THR H 1 113 ? 29.129  12.999  72.306  1.00 36.64  ? 109 THR H O   1 
ATOM   8855  C CB  . THR H 1 113 ? 30.741  12.726  75.184  1.00 45.46  ? 109 THR H CB  1 
ATOM   8856  O OG1 . THR H 1 113 ? 30.074  13.995  75.156  1.00 35.92  ? 109 THR H OG1 1 
ATOM   8857  C CG2 . THR H 1 113 ? 32.123  12.899  75.816  1.00 30.39  ? 109 THR H CG2 1 
ATOM   8858  N N   . PRO H 1 114 ? 28.662  11.100  73.435  1.00 35.20  ? 110 PRO H N   1 
ATOM   8859  C CA  . PRO H 1 114 ? 27.278  11.016  72.957  1.00 39.70  ? 110 PRO H CA  1 
ATOM   8860  C C   . PRO H 1 114 ? 26.499  12.308  73.191  1.00 32.23  ? 110 PRO H C   1 
ATOM   8861  O O   . PRO H 1 114 ? 25.897  12.834  72.257  1.00 31.09  ? 110 PRO H O   1 
ATOM   8862  C CB  . PRO H 1 114 ? 26.693  9.879   73.797  1.00 47.82  ? 110 PRO H CB  1 
ATOM   8863  C CG  . PRO H 1 114 ? 27.858  8.996   74.074  1.00 53.83  ? 110 PRO H CG  1 
ATOM   8864  C CD  . PRO H 1 114 ? 29.047  9.909   74.214  1.00 53.23  ? 110 PRO H CD  1 
ATOM   8865  N N   . LEU H 1 115 ? 26.519  12.810  74.422  1.00 34.06  ? 111 LEU H N   1 
ATOM   8866  C CA  . LEU H 1 115 ? 25.809  14.040  74.761  1.00 20.53  ? 111 LEU H CA  1 
ATOM   8867  C C   . LEU H 1 115 ? 26.207  15.189  73.837  1.00 31.14  ? 111 LEU H C   1 
ATOM   8868  O O   . LEU H 1 115 ? 25.368  16.004  73.449  1.00 50.79  ? 111 LEU H O   1 
ATOM   8869  C CB  . LEU H 1 115 ? 26.077  14.426  76.218  1.00 21.36  ? 111 LEU H CB  1 
ATOM   8870  C CG  . LEU H 1 115 ? 25.436  13.527  77.278  1.00 25.92  ? 111 LEU H CG  1 
ATOM   8871  C CD1 . LEU H 1 115 ? 26.028  13.804  78.654  1.00 15.75  ? 111 LEU H CD1 1 
ATOM   8872  C CD2 . LEU H 1 115 ? 23.930  13.722  77.303  1.00 20.57  ? 111 LEU H CD2 1 
ATOM   8873  N N   . GLN H 1 116 ? 27.486  15.251  73.482  1.00 28.47  ? 112 GLN H N   1 
ATOM   8874  C CA  . GLN H 1 116 ? 27.981  16.305  72.605  1.00 27.76  ? 112 GLN H CA  1 
ATOM   8875  C C   . GLN H 1 116 ? 27.502  16.095  71.175  1.00 32.92  ? 112 GLN H C   1 
ATOM   8876  O O   . GLN H 1 116 ? 27.218  17.057  70.462  1.00 48.71  ? 112 GLN H O   1 
ATOM   8877  C CB  . GLN H 1 116 ? 29.505  16.369  72.653  1.00 19.42  ? 112 GLN H CB  1 
ATOM   8878  C CG  . GLN H 1 116 ? 30.047  16.842  73.991  1.00 28.74  ? 112 GLN H CG  1 
ATOM   8879  C CD  . GLN H 1 116 ? 31.555  16.725  74.086  1.00 46.17  ? 112 GLN H CD  1 
ATOM   8880  O OE1 . GLN H 1 116 ? 32.125  15.657  73.856  1.00 36.31  ? 112 GLN H OE1 1 
ATOM   8881  N NE2 . GLN H 1 116 ? 32.211  17.828  74.423  1.00 65.11  ? 112 GLN H NE2 1 
ATOM   8882  N N   . LEU H 1 117 ? 27.415  14.835  70.758  1.00 22.50  ? 113 LEU H N   1 
ATOM   8883  C CA  . LEU H 1 117 ? 26.833  14.506  69.462  1.00 32.18  ? 113 LEU H CA  1 
ATOM   8884  C C   . LEU H 1 117 ? 25.355  14.882  69.439  1.00 43.55  ? 113 LEU H C   1 
ATOM   8885  O O   . LEU H 1 117 ? 24.847  15.381  68.434  1.00 34.37  ? 113 LEU H O   1 
ATOM   8886  C CB  . LEU H 1 117 ? 26.992  13.014  69.157  1.00 39.82  ? 113 LEU H CB  1 
ATOM   8887  C CG  . LEU H 1 117 ? 26.165  12.494  67.975  1.00 31.13  ? 113 LEU H CG  1 
ATOM   8888  C CD1 . LEU H 1 117 ? 26.553  13.197  66.686  1.00 8.93   ? 113 LEU H CD1 1 
ATOM   8889  C CD2 . LEU H 1 117 ? 26.312  10.988  67.827  1.00 23.07  ? 113 LEU H CD2 1 
ATOM   8890  N N   . LEU H 1 118 ? 24.672  14.641  70.554  1.00 54.67  ? 114 LEU H N   1 
ATOM   8891  C CA  . LEU H 1 118 ? 23.245  14.920  70.659  1.00 55.02  ? 114 LEU H CA  1 
ATOM   8892  C C   . LEU H 1 118 ? 22.971  16.420  70.677  1.00 55.96  ? 114 LEU H C   1 
ATOM   8893  O O   . LEU H 1 118 ? 21.953  16.879  70.159  1.00 49.05  ? 114 LEU H O   1 
ATOM   8894  C CB  . LEU H 1 118 ? 22.664  14.270  71.917  1.00 36.47  ? 114 LEU H CB  1 
ATOM   8895  C CG  . LEU H 1 118 ? 22.634  12.739  71.925  1.00 37.48  ? 114 LEU H CG  1 
ATOM   8896  C CD1 . LEU H 1 118 ? 22.218  12.227  73.289  1.00 34.84  ? 114 LEU H CD1 1 
ATOM   8897  C CD2 . LEU H 1 118 ? 21.696  12.209  70.848  1.00 39.22  ? 114 LEU H CD2 1 
ATOM   8898  N N   . GLU H 1 119 ? 23.880  17.182  71.277  1.00 53.23  ? 115 GLU H N   1 
ATOM   8899  C CA  . GLU H 1 119 ? 23.733  18.631  71.326  1.00 46.69  ? 115 GLU H CA  1 
ATOM   8900  C C   . GLU H 1 119 ? 23.781  19.198  69.913  1.00 43.25  ? 115 GLU H C   1 
ATOM   8901  O O   . GLU H 1 119 ? 23.016  20.098  69.566  1.00 44.79  ? 115 GLU H O   1 
ATOM   8902  C CB  . GLU H 1 119 ? 24.835  19.257  72.181  1.00 45.00  ? 115 GLU H CB  1 
ATOM   8903  C CG  . GLU H 1 119 ? 24.630  20.737  72.465  1.00 49.97  ? 115 GLU H CG  1 
ATOM   8904  C CD  . GLU H 1 119 ? 23.390  21.008  73.297  1.00 60.62  ? 115 GLU H CD  1 
ATOM   8905  O OE1 . GLU H 1 119 ? 22.823  20.046  73.860  1.00 63.80  ? 115 GLU H OE1 1 
ATOM   8906  O OE2 . GLU H 1 119 ? 22.982  22.186  73.387  1.00 59.44  ? 115 GLU H OE2 1 
ATOM   8907  N N   . LYS H 1 120 ? 24.687  18.662  69.101  1.00 46.92  ? 116 LYS H N   1 
ATOM   8908  C CA  . LYS H 1 120 ? 24.798  19.059  67.703  1.00 34.60  ? 116 LYS H CA  1 
ATOM   8909  C C   . LYS H 1 120 ? 23.498  18.762  66.964  1.00 43.46  ? 116 LYS H C   1 
ATOM   8910  O O   . LYS H 1 120 ? 22.992  19.602  66.220  1.00 49.35  ? 116 LYS H O   1 
ATOM   8911  C CB  . LYS H 1 120 ? 25.954  18.318  67.030  1.00 36.83  ? 116 LYS H CB  1 
ATOM   8912  C CG  . LYS H 1 120 ? 27.334  18.778  67.470  1.00 38.68  ? 116 LYS H CG  1 
ATOM   8913  C CD  . LYS H 1 120 ? 28.427  17.934  66.835  1.00 33.47  ? 116 LYS H CD  1 
ATOM   8914  C CE  . LYS H 1 120 ? 29.766  18.654  66.848  1.00 33.60  ? 116 LYS H CE  1 
ATOM   8915  N NZ  . LYS H 1 120 ? 30.214  19.004  68.223  1.00 43.62  ? 116 LYS H NZ  1 
ATOM   8916  N N   . VAL H 1 121 ? 22.959  17.565  67.176  1.00 33.81  ? 117 VAL H N   1 
ATOM   8917  C CA  . VAL H 1 121 ? 21.722  17.159  66.517  1.00 38.03  ? 117 VAL H CA  1 
ATOM   8918  C C   . VAL H 1 121 ? 20.567  18.071  66.926  1.00 46.87  ? 117 VAL H C   1 
ATOM   8919  O O   . VAL H 1 121 ? 19.761  18.476  66.088  1.00 47.66  ? 117 VAL H O   1 
ATOM   8920  C CB  . VAL H 1 121 ? 21.356  15.693  66.834  1.00 39.95  ? 117 VAL H CB  1 
ATOM   8921  C CG1 . VAL H 1 121 ? 19.995  15.343  66.247  1.00 41.78  ? 117 VAL H CG1 1 
ATOM   8922  C CG2 . VAL H 1 121 ? 22.422  14.748  66.295  1.00 34.69  ? 117 VAL H CG2 1 
ATOM   8923  N N   . LYS H 1 122 ? 20.490  18.394  68.213  1.00 46.28  ? 118 LYS H N   1 
ATOM   8924  C CA  . LYS H 1 122 ? 19.451  19.291  68.701  1.00 27.84  ? 118 LYS H CA  1 
ATOM   8925  C C   . LYS H 1 122 ? 19.574  20.642  68.011  1.00 16.65  ? 118 LYS H C   1 
ATOM   8926  O O   . LYS H 1 122 ? 18.628  21.118  67.383  1.00 29.90  ? 118 LYS H O   1 
ATOM   8927  C CB  . LYS H 1 122 ? 19.546  19.475  70.218  1.00 31.47  ? 118 LYS H CB  1 
ATOM   8928  C CG  . LYS H 1 122 ? 18.376  20.260  70.798  1.00 43.90  ? 118 LYS H CG  1 
ATOM   8929  C CD  . LYS H 1 122 ? 18.512  20.484  72.294  1.00 53.81  ? 118 LYS H CD  1 
ATOM   8930  C CE  . LYS H 1 122 ? 19.614  21.479  72.616  1.00 55.65  ? 118 LYS H CE  1 
ATOM   8931  N NZ  . LYS H 1 122 ? 19.602  21.872  74.054  1.00 40.45  ? 118 LYS H NZ  1 
ATOM   8932  N N   . ASN H 1 123 ? 20.750  21.249  68.122  1.00 18.49  ? 119 ASN H N   1 
ATOM   8933  C CA  . ASN H 1 123 ? 20.997  22.561  67.532  1.00 25.97  ? 119 ASN H CA  1 
ATOM   8934  C C   . ASN H 1 123 ? 20.648  22.615  66.048  1.00 32.02  ? 119 ASN H C   1 
ATOM   8935  O O   . ASN H 1 123 ? 20.063  23.589  65.581  1.00 35.88  ? 119 ASN H O   1 
ATOM   8936  C CB  . ASN H 1 123 ? 22.456  22.973  67.742  1.00 37.85  ? 119 ASN H CB  1 
ATOM   8937  C CG  . ASN H 1 123 ? 22.766  23.312  69.190  1.00 54.85  ? 119 ASN H CG  1 
ATOM   8938  O OD1 . ASN H 1 123 ? 22.000  22.980  70.097  1.00 62.89  ? 119 ASN H OD1 1 
ATOM   8939  N ND2 . ASN H 1 123 ? 23.892  23.979  69.413  1.00 43.49  ? 119 ASN H ND2 1 
ATOM   8940  N N   . VAL H 1 124 ? 21.004  21.570  65.308  1.00 44.70  ? 120 VAL H N   1 
ATOM   8941  C CA  . VAL H 1 124 ? 20.733  21.534  63.874  1.00 37.69  ? 120 VAL H CA  1 
ATOM   8942  C C   . VAL H 1 124 ? 19.236  21.637  63.594  1.00 36.11  ? 120 VAL H C   1 
ATOM   8943  O O   . VAL H 1 124 ? 18.813  22.412  62.736  1.00 31.46  ? 120 VAL H O   1 
ATOM   8944  C CB  . VAL H 1 124 ? 21.286  20.252  63.221  1.00 48.00  ? 120 VAL H CB  1 
ATOM   8945  C CG1 . VAL H 1 124 ? 20.676  20.047  61.839  1.00 54.72  ? 120 VAL H CG1 1 
ATOM   8946  C CG2 . VAL H 1 124 ? 22.803  20.316  63.127  1.00 39.58  ? 120 VAL H CG2 1 
ATOM   8947  N N   . PHE H 1 125 ? 18.440  20.857  64.319  1.00 37.33  ? 121 PHE H N   1 
ATOM   8948  C CA  . PHE H 1 125 ? 16.990  20.887  64.153  1.00 23.56  ? 121 PHE H CA  1 
ATOM   8949  C C   . PHE H 1 125 ? 16.423  22.233  64.595  1.00 38.09  ? 121 PHE H C   1 
ATOM   8950  O O   . PHE H 1 125 ? 15.625  22.841  63.882  1.00 34.77  ? 121 PHE H O   1 
ATOM   8951  C CB  . PHE H 1 125 ? 16.327  19.746  64.931  1.00 35.36  ? 121 PHE H CB  1 
ATOM   8952  C CG  . PHE H 1 125 ? 16.337  18.430  64.201  1.00 43.67  ? 121 PHE H CG  1 
ATOM   8953  C CD1 . PHE H 1 125 ? 15.543  18.241  63.081  1.00 35.19  ? 121 PHE H CD1 1 
ATOM   8954  C CD2 . PHE H 1 125 ? 17.133  17.382  64.636  1.00 38.96  ? 121 PHE H CD2 1 
ATOM   8955  C CE1 . PHE H 1 125 ? 15.546  17.035  62.403  1.00 33.80  ? 121 PHE H CE1 1 
ATOM   8956  C CE2 . PHE H 1 125 ? 17.140  16.172  63.963  1.00 43.51  ? 121 PHE H CE2 1 
ATOM   8957  C CZ  . PHE H 1 125 ? 16.345  16.000  62.845  1.00 42.77  ? 121 PHE H CZ  1 
ATOM   8958  N N   . ASN H 1 126 ? 16.842  22.696  65.768  1.00 38.03  ? 122 ASN H N   1 
ATOM   8959  C CA  . ASN H 1 126 ? 16.415  23.995  66.274  1.00 36.62  ? 122 ASN H CA  1 
ATOM   8960  C C   . ASN H 1 126 ? 16.761  25.115  65.298  1.00 44.03  ? 122 ASN H C   1 
ATOM   8961  O O   . ASN H 1 126 ? 15.892  25.887  64.895  1.00 57.71  ? 122 ASN H O   1 
ATOM   8962  C CB  . ASN H 1 126 ? 17.050  24.273  67.639  1.00 50.36  ? 122 ASN H CB  1 
ATOM   8963  C CG  . ASN H 1 126 ? 16.252  23.680  68.787  1.00 42.07  ? 122 ASN H CG  1 
ATOM   8964  O OD1 . ASN H 1 126 ? 15.456  24.371  69.423  1.00 38.21  ? 122 ASN H OD1 1 
ATOM   8965  N ND2 . ASN H 1 126 ? 16.458  22.396  69.054  1.00 31.91  ? 122 ASN H ND2 1 
ATOM   8966  N N   . GLU H 1 127 ? 18.034  25.196  64.922  1.00 38.24  ? 123 GLU H N   1 
ATOM   8967  C CA  . GLU H 1 127 ? 18.497  26.196  63.965  1.00 33.78  ? 123 GLU H CA  1 
ATOM   8968  C C   . GLU H 1 127 ? 17.658  26.141  62.695  1.00 36.27  ? 123 GLU H C   1 
ATOM   8969  O O   . GLU H 1 127 ? 17.295  27.175  62.136  1.00 50.60  ? 123 GLU H O   1 
ATOM   8970  C CB  . GLU H 1 127 ? 19.971  25.968  63.618  1.00 48.19  ? 123 GLU H CB  1 
ATOM   8971  C CG  . GLU H 1 127 ? 20.940  26.250  64.758  1.00 62.28  ? 123 GLU H CG  1 
ATOM   8972  C CD  . GLU H 1 127 ? 21.123  27.732  65.025  1.00 72.89  ? 123 GLU H CD  1 
ATOM   8973  O OE1 . GLU H 1 127 ? 20.774  28.547  64.144  1.00 68.57  ? 123 GLU H OE1 1 
ATOM   8974  O OE2 . GLU H 1 127 ? 21.614  28.081  66.120  1.00 77.16  ? 123 GLU H OE2 1 
ATOM   8975  N N   . THR H 1 128 ? 17.354  24.927  62.247  1.00 29.75  ? 124 THR H N   1 
ATOM   8976  C CA  . THR H 1 128 ? 16.559  24.730  61.040  1.00 26.28  ? 124 THR H CA  1 
ATOM   8977  C C   . THR H 1 128 ? 15.148  25.287  61.219  1.00 39.59  ? 124 THR H C   1 
ATOM   8978  O O   . THR H 1 128 ? 14.639  25.998  60.353  1.00 50.12  ? 124 THR H O   1 
ATOM   8979  C CB  . THR H 1 128 ? 16.470  23.233  60.666  1.00 22.46  ? 124 THR H CB  1 
ATOM   8980  O OG1 . THR H 1 128 ? 17.760  22.756  60.263  1.00 23.65  ? 124 THR H OG1 1 
ATOM   8981  C CG2 . THR H 1 128 ? 15.489  23.017  59.529  1.00 21.74  ? 124 THR H CG2 1 
ATOM   8982  N N   . LYS H 1 129 ? 14.522  24.967  62.348  1.00 37.20  ? 125 LYS H N   1 
ATOM   8983  C CA  . LYS H 1 129 ? 13.151  25.393  62.603  1.00 41.95  ? 125 LYS H CA  1 
ATOM   8984  C C   . LYS H 1 129 ? 13.034  26.910  62.721  1.00 48.03  ? 125 LYS H C   1 
ATOM   8985  O O   . LYS H 1 129 ? 12.183  27.519  62.073  1.00 51.38  ? 125 LYS H O   1 
ATOM   8986  C CB  . LYS H 1 129 ? 12.602  24.742  63.874  1.00 42.64  ? 125 LYS H CB  1 
ATOM   8987  C CG  . LYS H 1 129 ? 11.234  25.278  64.263  1.00 52.91  ? 125 LYS H CG  1 
ATOM   8988  C CD  . LYS H 1 129 ? 10.633  24.535  65.439  1.00 52.69  ? 125 LYS H CD  1 
ATOM   8989  C CE  . LYS H 1 129 ? 9.267   25.100  65.800  1.00 37.64  ? 125 LYS H CE  1 
ATOM   8990  N NZ  . LYS H 1 129 ? 9.352   26.501  66.302  1.00 24.47  ? 125 LYS H NZ  1 
ATOM   8991  N N   . ASN H 1 130 ? 13.877  27.514  63.555  1.00 46.78  ? 126 ASN H N   1 
ATOM   8992  C CA  . ASN H 1 130 ? 13.844  28.960  63.758  1.00 40.79  ? 126 ASN H CA  1 
ATOM   8993  C C   . ASN H 1 130 ? 13.819  29.712  62.433  1.00 58.11  ? 126 ASN H C   1 
ATOM   8994  O O   . ASN H 1 130 ? 13.050  30.656  62.261  1.00 77.84  ? 126 ASN H O   1 
ATOM   8995  C CB  . ASN H 1 130 ? 15.053  29.426  64.573  1.00 37.69  ? 126 ASN H CB  1 
ATOM   8996  C CG  . ASN H 1 130 ? 15.082  28.841  65.968  1.00 39.70  ? 126 ASN H CG  1 
ATOM   8997  O OD1 . ASN H 1 130 ? 14.083  28.315  66.457  1.00 47.93  ? 126 ASN H OD1 1 
ATOM   8998  N ND2 . ASN H 1 130 ? 16.234  28.939  66.623  1.00 40.58  ? 126 ASN H ND2 1 
ATOM   8999  N N   . LEU H 1 131 ? 14.668  29.291  61.501  1.00 49.98  ? 127 LEU H N   1 
ATOM   9000  C CA  . LEU H 1 131 ? 14.784  29.966  60.214  1.00 38.84  ? 127 LEU H CA  1 
ATOM   9001  C C   . LEU H 1 131 ? 13.594  29.667  59.308  1.00 50.56  ? 127 LEU H C   1 
ATOM   9002  O O   . LEU H 1 131 ? 13.055  30.570  58.672  1.00 63.25  ? 127 LEU H O   1 
ATOM   9003  C CB  . LEU H 1 131 ? 16.085  29.565  59.519  1.00 41.22  ? 127 LEU H CB  1 
ATOM   9004  C CG  . LEU H 1 131 ? 17.365  29.922  60.278  1.00 47.66  ? 127 LEU H CG  1 
ATOM   9005  C CD1 . LEU H 1 131 ? 18.590  29.620  59.424  1.00 51.06  ? 127 LEU H CD1 1 
ATOM   9006  C CD2 . LEU H 1 131 ? 17.355  31.381  60.715  1.00 41.83  ? 127 LEU H CD2 1 
ATOM   9007  N N   . LEU H 1 132 ? 13.184  28.404  59.252  1.00 47.52  ? 128 LEU H N   1 
ATOM   9008  C CA  . LEU H 1 132 ? 12.065  28.008  58.401  1.00 45.48  ? 128 LEU H CA  1 
ATOM   9009  C C   . LEU H 1 132 ? 10.773  28.723  58.794  1.00 55.68  ? 128 LEU H C   1 
ATOM   9010  O O   . LEU H 1 132 ? 9.876   28.893  57.966  1.00 58.61  ? 128 LEU H O   1 
ATOM   9011  C CB  . LEU H 1 132 ? 11.860  26.493  58.447  1.00 46.21  ? 128 LEU H CB  1 
ATOM   9012  C CG  . LEU H 1 132 ? 12.791  25.659  57.562  1.00 49.62  ? 128 LEU H CG  1 
ATOM   9013  C CD1 . LEU H 1 132 ? 12.547  24.174  57.784  1.00 53.38  ? 128 LEU H CD1 1 
ATOM   9014  C CD2 . LEU H 1 132 ? 12.605  26.012  56.092  1.00 42.98  ? 128 LEU H CD2 1 
ATOM   9015  N N   . ASP H 1 133 ? 10.679  29.138  60.054  1.00 53.62  ? 129 ASP H N   1 
ATOM   9016  C CA  . ASP H 1 133 ? 9.518   29.887  60.520  1.00 65.43  ? 129 ASP H CA  1 
ATOM   9017  C C   . ASP H 1 133 ? 9.465   31.252  59.846  1.00 81.79  ? 129 ASP H C   1 
ATOM   9018  O O   . ASP H 1 133 ? 8.395   31.714  59.455  1.00 95.89  ? 129 ASP H O   1 
ATOM   9019  C CB  . ASP H 1 133 ? 9.548   30.065  62.042  1.00 70.48  ? 129 ASP H CB  1 
ATOM   9020  C CG  . ASP H 1 133 ? 9.149   28.806  62.792  1.00 73.39  ? 129 ASP H CG  1 
ATOM   9021  O OD1 . ASP H 1 133 ? 8.429   27.967  62.212  1.00 75.95  ? 129 ASP H OD1 1 
ATOM   9022  O OD2 . ASP H 1 133 ? 9.548   28.664  63.968  1.00 67.71  ? 129 ASP H OD2 1 
ATOM   9023  N N   . LYS H 1 134 ? 10.623  31.893  59.714  1.00 82.86  ? 130 LYS H N   1 
ATOM   9024  C CA  . LYS H 1 134 ? 10.696  33.226  59.122  1.00 83.14  ? 130 LYS H CA  1 
ATOM   9025  C C   . LYS H 1 134 ? 10.837  33.176  57.600  1.00 78.73  ? 130 LYS H C   1 
ATOM   9026  O O   . LYS H 1 134 ? 10.137  33.890  56.884  1.00 82.94  ? 130 LYS H O   1 
ATOM   9027  C CB  . LYS H 1 134 ? 11.857  34.021  59.730  1.00 87.68  ? 130 LYS H CB  1 
ATOM   9028  C CG  . LYS H 1 134 ? 11.577  34.560  61.129  1.00 89.14  ? 130 LYS H CG  1 
ATOM   9029  C CD  . LYS H 1 134 ? 12.204  33.700  62.216  1.00 86.47  ? 130 LYS H CD  1 
ATOM   9030  C CE  . LYS H 1 134 ? 13.718  33.860  62.256  1.00 79.47  ? 130 LYS H CE  1 
ATOM   9031  N NZ  . LYS H 1 134 ? 14.327  33.184  63.436  1.00 66.67  ? 130 LYS H NZ  1 
ATOM   9032  N N   . ASP H 1 135 ? 11.740  32.331  57.113  1.00 73.24  ? 131 ASP H N   1 
ATOM   9033  C CA  . ASP H 1 135 ? 12.017  32.240  55.682  1.00 72.37  ? 131 ASP H CA  1 
ATOM   9034  C C   . ASP H 1 135 ? 12.023  30.782  55.228  1.00 64.83  ? 131 ASP H C   1 
ATOM   9035  O O   . ASP H 1 135 ? 13.073  30.145  55.174  1.00 73.72  ? 131 ASP H O   1 
ATOM   9036  C CB  . ASP H 1 135 ? 13.368  32.887  55.373  1.00 75.49  ? 131 ASP H CB  1 
ATOM   9037  C CG  . ASP H 1 135 ? 13.577  33.125  53.891  1.00 86.41  ? 131 ASP H CG  1 
ATOM   9038  O OD1 . ASP H 1 135 ? 12.807  32.573  53.077  1.00 92.42  ? 131 ASP H OD1 1 
ATOM   9039  O OD2 . ASP H 1 135 ? 14.520  33.864  53.540  1.00 85.75  ? 131 ASP H OD2 1 
ATOM   9040  N N   . TRP H 1 136 ? 10.845  30.265  54.895  1.00 58.70  ? 132 TRP H N   1 
ATOM   9041  C CA  . TRP H 1 136 ? 10.695  28.854  54.534  1.00 63.23  ? 132 TRP H CA  1 
ATOM   9042  C C   . TRP H 1 136 ? 11.449  28.460  53.262  1.00 60.40  ? 132 TRP H C   1 
ATOM   9043  O O   . TRP H 1 136 ? 11.749  27.283  53.056  1.00 50.03  ? 132 TRP H O   1 
ATOM   9044  C CB  . TRP H 1 136 ? 9.212   28.483  54.399  1.00 74.40  ? 132 TRP H CB  1 
ATOM   9045  C CG  . TRP H 1 136 ? 8.387   29.463  53.608  1.00 89.71  ? 132 TRP H CG  1 
ATOM   9046  C CD1 . TRP H 1 136 ? 7.670   30.516  54.102  1.00 96.46  ? 132 TRP H CD1 1 
ATOM   9047  C CD2 . TRP H 1 136 ? 8.187   29.474  52.188  1.00 95.38  ? 132 TRP H CD2 1 
ATOM   9048  N NE1 . TRP H 1 136 ? 7.042   31.183  53.079  1.00 106.21 ? 132 TRP H NE1 1 
ATOM   9049  C CE2 . TRP H 1 136 ? 7.343   30.564  51.893  1.00 102.18 ? 132 TRP H CE2 1 
ATOM   9050  C CE3 . TRP H 1 136 ? 8.641   28.671  51.136  1.00 89.56  ? 132 TRP H CE3 1 
ATOM   9051  C CZ2 . TRP H 1 136 ? 6.944   30.872  50.593  1.00 95.99  ? 132 TRP H CZ2 1 
ATOM   9052  C CZ3 . TRP H 1 136 ? 8.244   28.979  49.846  1.00 88.61  ? 132 TRP H CZ3 1 
ATOM   9053  C CH2 . TRP H 1 136 ? 7.405   30.069  49.586  1.00 89.11  ? 132 TRP H CH2 1 
ATOM   9054  N N   . ASN H 1 137 ? 11.760  29.438  52.418  1.00 70.88  ? 133 ASN H N   1 
ATOM   9055  C CA  . ASN H 1 137 ? 12.444  29.167  51.156  1.00 67.28  ? 133 ASN H CA  1 
ATOM   9056  C C   . ASN H 1 137 ? 13.958  29.332  51.279  1.00 63.92  ? 133 ASN H C   1 
ATOM   9057  O O   . ASN H 1 137 ? 14.683  29.247  50.290  1.00 76.94  ? 133 ASN H O   1 
ATOM   9058  C CB  . ASN H 1 137 ? 11.903  30.089  50.057  1.00 66.05  ? 133 ASN H CB  1 
ATOM   9059  C CG  . ASN H 1 137 ? 12.438  29.737  48.679  1.00 71.06  ? 133 ASN H CG  1 
ATOM   9060  O OD1 . ASN H 1 137 ? 11.942  28.820  48.024  1.00 64.16  ? 133 ASN H OD1 1 
ATOM   9061  N ND2 . ASN H 1 137 ? 13.449  30.474  48.229  1.00 69.88  ? 133 ASN H ND2 1 
ATOM   9062  N N   . ILE H 1 138 ? 14.430  29.555  52.502  1.00 55.60  ? 134 ILE H N   1 
ATOM   9063  C CA  . ILE H 1 138 ? 15.839  29.854  52.743  1.00 50.32  ? 134 ILE H CA  1 
ATOM   9064  C C   . ILE H 1 138 ? 16.783  28.757  52.255  1.00 55.60  ? 134 ILE H C   1 
ATOM   9065  O O   . ILE H 1 138 ? 17.942  29.027  51.943  1.00 67.37  ? 134 ILE H O   1 
ATOM   9066  C CB  . ILE H 1 138 ? 16.107  30.087  54.242  1.00 44.91  ? 134 ILE H CB  1 
ATOM   9067  C CG1 . ILE H 1 138 ? 17.552  30.536  54.462  1.00 42.74  ? 134 ILE H CG1 1 
ATOM   9068  C CG2 . ILE H 1 138 ? 15.823  28.819  55.040  1.00 36.25  ? 134 ILE H CG2 1 
ATOM   9069  C CD1 . ILE H 1 138 ? 17.812  31.069  55.854  1.00 49.95  ? 134 ILE H CD1 1 
ATOM   9070  N N   . PHE H 1 139 ? 16.291  27.524  52.190  1.00 55.29  ? 135 PHE H N   1 
ATOM   9071  C CA  . PHE H 1 139 ? 17.144  26.385  51.864  1.00 54.47  ? 135 PHE H CA  1 
ATOM   9072  C C   . PHE H 1 139 ? 17.121  26.021  50.382  1.00 61.23  ? 135 PHE H C   1 
ATOM   9073  O O   . PHE H 1 139 ? 17.549  24.932  50.000  1.00 68.11  ? 135 PHE H O   1 
ATOM   9074  C CB  . PHE H 1 139 ? 16.756  25.175  52.718  1.00 49.61  ? 135 PHE H CB  1 
ATOM   9075  C CG  . PHE H 1 139 ? 17.170  25.299  54.158  1.00 45.78  ? 135 PHE H CG  1 
ATOM   9076  C CD1 . PHE H 1 139 ? 18.475  25.624  54.490  1.00 41.46  ? 135 PHE H CD1 1 
ATOM   9077  C CD2 . PHE H 1 139 ? 16.253  25.108  55.177  1.00 39.87  ? 135 PHE H CD2 1 
ATOM   9078  C CE1 . PHE H 1 139 ? 18.860  25.745  55.811  1.00 45.83  ? 135 PHE H CE1 1 
ATOM   9079  C CE2 . PHE H 1 139 ? 16.633  25.230  56.501  1.00 41.77  ? 135 PHE H CE2 1 
ATOM   9080  C CZ  . PHE H 1 139 ? 17.937  25.549  56.819  1.00 32.77  ? 135 PHE H CZ  1 
ATOM   9081  N N   . SER H 1 140 ? 16.630  26.936  49.552  1.00 67.40  ? 136 SER H N   1 
ATOM   9082  C CA  . SER H 1 140 ? 16.709  26.774  48.105  1.00 68.56  ? 136 SER H CA  1 
ATOM   9083  C C   . SER H 1 140 ? 18.018  27.373  47.592  1.00 68.35  ? 136 SER H C   1 
ATOM   9084  O O   . SER H 1 140 ? 18.303  27.339  46.393  1.00 74.18  ? 136 SER H O   1 
ATOM   9085  C CB  . SER H 1 140 ? 15.517  27.446  47.420  1.00 63.19  ? 136 SER H CB  1 
ATOM   9086  O OG  . SER H 1 140 ? 15.519  28.848  47.634  1.00 70.56  ? 136 SER H OG  1 
ATOM   9087  N N   . LYS H 1 141 ? 18.808  27.919  48.512  1.00 55.01  ? 137 LYS H N   1 
ATOM   9088  C CA  . LYS H 1 141 ? 20.078  28.550  48.176  1.00 50.56  ? 137 LYS H CA  1 
ATOM   9089  C C   . LYS H 1 141 ? 21.058  27.569  47.541  1.00 66.40  ? 137 LYS H C   1 
ATOM   9090  O O   . LYS H 1 141 ? 21.082  26.387  47.885  1.00 74.33  ? 137 LYS H O   1 
ATOM   9091  C CB  . LYS H 1 141 ? 20.707  29.157  49.432  1.00 36.06  ? 137 LYS H CB  1 
ATOM   9092  C CG  . LYS H 1 141 ? 22.131  29.655  49.236  1.00 42.54  ? 137 LYS H CG  1 
ATOM   9093  C CD  . LYS H 1 141 ? 22.657  30.340  50.490  1.00 47.90  ? 137 LYS H CD  1 
ATOM   9094  C CE  . LYS H 1 141 ? 24.062  30.892  50.282  1.00 48.92  ? 137 LYS H CE  1 
ATOM   9095  N NZ  . LYS H 1 141 ? 24.436  31.880  51.332  1.00 48.19  ? 137 LYS H NZ  1 
ATOM   9096  N N   . ASN H 1 142 ? 21.869  28.071  46.613  1.00 68.98  ? 138 ASN H N   1 
ATOM   9097  C CA  . ASN H 1 142 ? 22.919  27.271  45.999  1.00 72.24  ? 138 ASN H CA  1 
ATOM   9098  C C   . ASN H 1 142 ? 24.164  27.299  46.876  1.00 74.61  ? 138 ASN H C   1 
ATOM   9099  O O   . ASN H 1 142 ? 24.680  28.371  47.198  1.00 71.51  ? 138 ASN H O   1 
ATOM   9100  C CB  . ASN H 1 142 ? 23.249  27.801  44.602  1.00 69.58  ? 138 ASN H CB  1 
ATOM   9101  C CG  . ASN H 1 142 ? 24.173  26.876  43.829  1.00 74.54  ? 138 ASN H CG  1 
ATOM   9102  O OD1 . ASN H 1 142 ? 25.380  26.839  44.072  1.00 66.37  ? 138 ASN H OD1 1 
ATOM   9103  N ND2 . ASN H 1 142 ? 23.610  26.130  42.884  1.00 73.19  ? 138 ASN H ND2 1 
ATOM   9104  N N   . CYS H 1 143 ? 24.642  26.121  47.265  1.00 66.38  ? 139 CYS H N   1 
ATOM   9105  C CA  . CYS H 1 143 ? 25.777  26.022  48.175  1.00 60.25  ? 139 CYS H CA  1 
ATOM   9106  C C   . CYS H 1 143 ? 26.967  25.294  47.559  1.00 66.11  ? 139 CYS H C   1 
ATOM   9107  O O   . CYS H 1 143 ? 27.795  24.735  48.276  1.00 69.03  ? 139 CYS H O   1 
ATOM   9108  C CB  . CYS H 1 143 ? 25.354  25.315  49.462  1.00 58.67  ? 139 CYS H CB  1 
ATOM   9109  S SG  . CYS H 1 143 ? 24.171  26.250  50.444  1.00 44.57  ? 139 CYS H SG  1 
ATOM   9110  N N   . ASN H 1 144 ? 27.054  25.302  46.233  1.00 68.27  ? 140 ASN H N   1 
ATOM   9111  C CA  . ASN H 1 144 ? 28.192  24.697  45.553  1.00 64.92  ? 140 ASN H CA  1 
ATOM   9112  C C   . ASN H 1 144 ? 29.452  25.535  45.747  1.00 64.68  ? 140 ASN H C   1 
ATOM   9113  O O   . ASN H 1 144 ? 30.541  24.998  45.951  1.00 65.42  ? 140 ASN H O   1 
ATOM   9114  C CB  . ASN H 1 144 ? 27.897  24.520  44.063  1.00 79.37  ? 140 ASN H CB  1 
ATOM   9115  C CG  . ASN H 1 144 ? 26.896  23.411  43.794  1.00 85.23  ? 140 ASN H CG  1 
ATOM   9116  O OD1 . ASN H 1 144 ? 26.852  22.411  44.512  1.00 82.00  ? 140 ASN H OD1 1 
ATOM   9117  N ND2 . ASN H 1 144 ? 26.089  23.581  42.753  1.00 79.48  ? 140 ASN H ND2 1 
ATOM   9118  N N   . ASN H 1 145 ? 29.296  26.855  45.688  1.00 73.25  ? 141 ASN H N   1 
ATOM   9119  C CA  . ASN H 1 145 ? 30.411  27.771  45.904  1.00 80.71  ? 141 ASN H CA  1 
ATOM   9120  C C   . ASN H 1 145 ? 30.978  27.611  47.307  1.00 80.73  ? 141 ASN H C   1 
ATOM   9121  O O   . ASN H 1 145 ? 32.192  27.519  47.492  1.00 85.93  ? 141 ASN H O   1 
ATOM   9122  C CB  . ASN H 1 145 ? 29.965  29.220  45.696  1.00 79.90  ? 141 ASN H CB  1 
ATOM   9123  C CG  . ASN H 1 145 ? 29.617  29.526  44.251  1.00 81.10  ? 141 ASN H CG  1 
ATOM   9124  O OD1 . ASN H 1 145 ? 29.418  28.621  43.440  1.00 75.48  ? 141 ASN H OD1 1 
ATOM   9125  N ND2 . ASN H 1 145 ? 29.541  30.812  43.923  1.00 79.92  ? 141 ASN H ND2 1 
ATOM   9126  N N   . SER H 1 146 ? 30.089  27.581  48.294  1.00 65.83  ? 142 SER H N   1 
ATOM   9127  C CA  . SER H 1 146 ? 30.496  27.414  49.681  1.00 47.09  ? 142 SER H CA  1 
ATOM   9128  C C   . SER H 1 146 ? 31.152  26.049  49.880  1.00 42.16  ? 142 SER H C   1 
ATOM   9129  O O   . SER H 1 146 ? 32.177  25.939  50.554  1.00 48.53  ? 142 SER H O   1 
ATOM   9130  C CB  . SER H 1 146 ? 29.291  27.570  50.611  1.00 52.25  ? 142 SER H CB  1 
ATOM   9131  O OG  . SER H 1 146 ? 28.653  28.821  50.415  1.00 45.22  ? 142 SER H OG  1 
ATOM   9132  N N   . PHE H 1 147 ? 30.565  25.015  49.282  1.00 45.15  ? 143 PHE H N   1 
ATOM   9133  C CA  . PHE H 1 147 ? 31.095  23.656  49.392  1.00 59.57  ? 143 PHE H CA  1 
ATOM   9134  C C   . PHE H 1 147 ? 32.406  23.505  48.626  1.00 74.59  ? 143 PHE H C   1 
ATOM   9135  O O   . PHE H 1 147 ? 33.159  22.558  48.853  1.00 79.59  ? 143 PHE H O   1 
ATOM   9136  C CB  . PHE H 1 147 ? 30.085  22.629  48.865  1.00 50.52  ? 143 PHE H CB  1 
ATOM   9137  C CG  . PHE H 1 147 ? 28.814  22.549  49.669  1.00 53.59  ? 143 PHE H CG  1 
ATOM   9138  C CD1 . PHE H 1 147 ? 28.672  23.255  50.854  1.00 57.31  ? 143 PHE H CD1 1 
ATOM   9139  C CD2 . PHE H 1 147 ? 27.757  21.759  49.237  1.00 52.74  ? 143 PHE H CD2 1 
ATOM   9140  C CE1 . PHE H 1 147 ? 27.503  23.177  51.587  1.00 58.63  ? 143 PHE H CE1 1 
ATOM   9141  C CE2 . PHE H 1 147 ? 26.586  21.679  49.970  1.00 48.51  ? 143 PHE H CE2 1 
ATOM   9142  C CZ  . PHE H 1 147 ? 26.459  22.389  51.144  1.00 51.49  ? 143 PHE H CZ  1 
ATOM   9143  N N   . ALA H 1 148 ? 32.672  24.435  47.715  1.00 76.64  ? 144 ALA H N   1 
ATOM   9144  C CA  . ALA H 1 148 ? 33.885  24.385  46.907  1.00 83.89  ? 144 ALA H CA  1 
ATOM   9145  C C   . ALA H 1 148 ? 35.104  24.828  47.712  1.00 84.34  ? 144 ALA H C   1 
ATOM   9146  O O   . ALA H 1 148 ? 36.173  24.223  47.618  1.00 93.41  ? 144 ALA H O   1 
ATOM   9147  C CB  . ALA H 1 148 ? 33.726  25.249  45.659  1.00 89.68  ? 144 ALA H CB  1 
ATOM   9148  N N   . GLU H 1 149 ? 34.935  25.878  48.511  1.00 74.41  ? 145 GLU H N   1 
ATOM   9149  C CA  . GLU H 1 149 ? 36.042  26.453  49.270  1.00 86.55  ? 145 GLU H CA  1 
ATOM   9150  C C   . GLU H 1 149 ? 36.580  25.482  50.320  1.00 98.58  ? 145 GLU H C   1 
ATOM   9151  O O   . GLU H 1 149 ? 37.748  25.555  50.704  1.00 101.02 ? 145 GLU H O   1 
ATOM   9152  C CB  . GLU H 1 149 ? 35.606  27.756  49.944  1.00 84.99  ? 145 GLU H CB  1 
ATOM   9153  C CG  . GLU H 1 149 ? 35.181  28.843  48.968  1.00 94.09  ? 145 GLU H CG  1 
ATOM   9154  C CD  . GLU H 1 149 ? 34.799  30.138  49.661  1.00 103.84 ? 145 GLU H CD  1 
ATOM   9155  O OE1 . GLU H 1 149 ? 33.753  30.719  49.303  1.00 107.59 ? 145 GLU H OE1 1 
ATOM   9156  O OE2 . GLU H 1 149 ? 35.550  30.580  50.556  1.00 108.03 ? 145 GLU H OE2 1 
ATOM   9157  N N   . CYS H 1 150 ? 35.724  24.576  50.783  1.00 97.20  ? 146 CYS H N   1 
ATOM   9158  C CA  . CYS H 1 150 ? 36.114  23.602  51.796  1.00 79.75  ? 146 CYS H CA  1 
ATOM   9159  C C   . CYS H 1 150 ? 37.290  22.761  51.309  1.00 56.12  ? 146 CYS H C   1 
ATOM   9160  O O   . CYS H 1 150 ? 37.347  22.376  50.141  1.00 52.50  ? 146 CYS H O   1 
ATOM   9161  C CB  . CYS H 1 150 ? 34.935  22.690  52.150  1.00 78.46  ? 146 CYS H CB  1 
ATOM   9162  S SG  . CYS H 1 150 ? 33.510  23.534  52.874  1.00 67.17  ? 146 CYS H SG  1 
ATOM   9163  N N   . VAL I 1 7   ? 11.794  -8.531  21.631  1.00 81.67  ? 3   VAL I N   1 
ATOM   9164  C CA  . VAL I 1 7   ? 11.254  -8.713  20.289  1.00 87.38  ? 3   VAL I CA  1 
ATOM   9165  C C   . VAL I 1 7   ? 9.744   -8.943  20.345  1.00 88.85  ? 3   VAL I C   1 
ATOM   9166  O O   . VAL I 1 7   ? 9.235   -9.538  21.296  1.00 75.95  ? 3   VAL I O   1 
ATOM   9167  C CB  . VAL I 1 7   ? 11.930  -9.899  19.577  1.00 82.48  ? 3   VAL I CB  1 
ATOM   9168  C CG1 . VAL I 1 7   ? 11.633  -11.194 20.306  1.00 85.89  ? 3   VAL I CG1 1 
ATOM   9169  C CG2 . VAL I 1 7   ? 11.478  -9.985  18.128  1.00 84.22  ? 3   VAL I CG2 1 
ATOM   9170  N N   . SER I 1 8   ? 9.038   -8.472  19.320  1.00 98.46  ? 4   SER I N   1 
ATOM   9171  C CA  . SER I 1 8   ? 7.579   -8.522  19.292  1.00 93.70  ? 4   SER I CA  1 
ATOM   9172  C C   . SER I 1 8   ? 7.066   -9.347  18.109  1.00 79.29  ? 4   SER I C   1 
ATOM   9173  O O   . SER I 1 8   ? 7.748   -9.482  17.093  1.00 68.29  ? 4   SER I O   1 
ATOM   9174  C CB  . SER I 1 8   ? 7.017   -7.098  19.218  1.00 95.58  ? 4   SER I CB  1 
ATOM   9175  O OG  . SER I 1 8   ? 5.614   -7.067  19.427  1.00 98.83  ? 4   SER I OG  1 
ATOM   9176  N N   . GLU I 1 9   ? 5.865   -9.900  18.252  1.00 74.32  ? 5   GLU I N   1 
ATOM   9177  C CA  . GLU I 1 9   ? 5.212   -10.637 17.171  1.00 61.25  ? 5   GLU I CA  1 
ATOM   9178  C C   . GLU I 1 9   ? 4.802   -9.723  16.017  1.00 68.35  ? 5   GLU I C   1 
ATOM   9179  O O   . GLU I 1 9   ? 4.361   -10.195 14.969  1.00 73.71  ? 5   GLU I O   1 
ATOM   9180  C CB  . GLU I 1 9   ? 3.979   -11.365 17.707  1.00 57.92  ? 5   GLU I CB  1 
ATOM   9181  C CG  . GLU I 1 9   ? 4.295   -12.444 18.728  1.00 67.85  ? 5   GLU I CG  1 
ATOM   9182  C CD  . GLU I 1 9   ? 3.430   -12.347 19.971  1.00 73.23  ? 5   GLU I CD  1 
ATOM   9183  O OE1 . GLU I 1 9   ? 3.397   -11.261 20.590  1.00 76.57  ? 5   GLU I OE1 1 
ATOM   9184  O OE2 . GLU I 1 9   ? 2.784   -13.355 20.330  1.00 64.32  ? 5   GLU I OE2 1 
ATOM   9185  N N   . TYR I 1 10  ? 4.940   -8.416  16.220  1.00 69.35  ? 6   TYR I N   1 
ATOM   9186  C CA  . TYR I 1 10  ? 4.613   -7.435  15.193  1.00 64.24  ? 6   TYR I CA  1 
ATOM   9187  C C   . TYR I 1 10  ? 5.800   -7.177  14.267  1.00 64.00  ? 6   TYR I C   1 
ATOM   9188  O O   . TYR I 1 10  ? 5.677   -6.459  13.272  1.00 60.73  ? 6   TYR I O   1 
ATOM   9189  C CB  . TYR I 1 10  ? 4.172   -6.123  15.843  1.00 60.61  ? 6   TYR I CB  1 
ATOM   9190  N N   . CYS I 1 11  ? 6.949   -7.761  14.596  1.00 60.83  ? 7   CYS I N   1 
ATOM   9191  C CA  . CYS I 1 11  ? 8.153   -7.592  13.790  1.00 46.71  ? 7   CYS I CA  1 
ATOM   9192  C C   . CYS I 1 11  ? 7.973   -8.199  12.403  1.00 54.83  ? 7   CYS I C   1 
ATOM   9193  O O   . CYS I 1 11  ? 8.633   -7.793  11.445  1.00 51.24  ? 7   CYS I O   1 
ATOM   9194  C CB  . CYS I 1 11  ? 9.358   -8.222  14.491  1.00 33.30  ? 7   CYS I CB  1 
ATOM   9195  S SG  . CYS I 1 11  ? 9.848   -7.369  16.009  1.00 70.62  ? 7   CYS I SG  1 
ATOM   9196  N N   . SER I 1 12  ? 7.074   -9.172  12.303  1.00 66.54  ? 8   SER I N   1 
ATOM   9197  C CA  . SER I 1 12  ? 6.767   -9.803  11.026  1.00 73.24  ? 8   SER I CA  1 
ATOM   9198  C C   . SER I 1 12  ? 5.920   -8.877  10.157  1.00 75.05  ? 8   SER I C   1 
ATOM   9199  O O   . SER I 1 12  ? 5.790   -9.090  8.952   1.00 69.21  ? 8   SER I O   1 
ATOM   9200  C CB  . SER I 1 12  ? 6.034   -11.128 11.252  1.00 74.16  ? 8   SER I CB  1 
ATOM   9201  O OG  . SER I 1 12  ? 4.904   -10.956 12.088  1.00 76.06  ? 8   SER I OG  1 
ATOM   9202  N N   . HIS I 1 13  ? 5.352   -7.845  10.775  1.00 75.10  ? 9   HIS I N   1 
ATOM   9203  C CA  . HIS I 1 13  ? 4.474   -6.916  10.075  1.00 70.46  ? 9   HIS I CA  1 
ATOM   9204  C C   . HIS I 1 13  ? 5.114   -5.539  9.899   1.00 67.57  ? 9   HIS I C   1 
ATOM   9205  O O   . HIS I 1 13  ? 4.429   -4.570  9.570   1.00 72.06  ? 9   HIS I O   1 
ATOM   9206  C CB  . HIS I 1 13  ? 3.146   -6.782  10.825  1.00 72.29  ? 9   HIS I CB  1 
ATOM   9207  C CG  . HIS I 1 13  ? 2.247   -7.971  10.679  1.00 86.72  ? 9   HIS I CG  1 
ATOM   9208  N ND1 . HIS I 1 13  ? 1.486   -8.192  9.551   1.00 90.69  ? 9   HIS I ND1 1 
ATOM   9209  C CD2 . HIS I 1 13  ? 1.984   -8.999  11.518  1.00 94.70  ? 9   HIS I CD2 1 
ATOM   9210  C CE1 . HIS I 1 13  ? 0.795   -9.308  9.701   1.00 98.42  ? 9   HIS I CE1 1 
ATOM   9211  N NE2 . HIS I 1 13  ? 1.078   -9.818  10.886  1.00 98.57  ? 9   HIS I NE2 1 
ATOM   9212  N N   . MET I 1 14  ? 6.425   -5.455  10.108  1.00 52.79  ? 10  MET I N   1 
ATOM   9213  C CA  . MET I 1 14  ? 7.141   -4.194  9.950   1.00 44.54  ? 10  MET I CA  1 
ATOM   9214  C C   . MET I 1 14  ? 7.324   -3.884  8.473   1.00 40.49  ? 10  MET I C   1 
ATOM   9215  O O   . MET I 1 14  ? 6.791   -2.901  7.959   1.00 50.95  ? 10  MET I O   1 
ATOM   9216  C CB  . MET I 1 14  ? 8.514   -4.269  10.617  1.00 42.53  ? 10  MET I CB  1 
ATOM   9217  C CG  . MET I 1 14  ? 8.476   -4.503  12.110  1.00 34.22  ? 10  MET I CG  1 
ATOM   9218  S SD  . MET I 1 14  ? 8.166   -3.000  13.049  1.00 86.46  ? 10  MET I SD  1 
ATOM   9219  C CE  . MET I 1 14  ? 9.046   -3.383  14.561  1.00 58.47  ? 10  MET I CE  1 
ATOM   9220  N N   . ILE I 1 15  ? 8.077   -4.744  7.797   1.00 41.65  ? 11  ILE I N   1 
ATOM   9221  C CA  . ILE I 1 15  ? 8.447   -4.521  6.407   1.00 55.00  ? 11  ILE I CA  1 
ATOM   9222  C C   . ILE I 1 15  ? 7.320   -4.948  5.474   1.00 72.28  ? 11  ILE I C   1 
ATOM   9223  O O   . ILE I 1 15  ? 7.059   -6.139  5.304   1.00 87.52  ? 11  ILE I O   1 
ATOM   9224  C CB  . ILE I 1 15  ? 9.714   -5.311  6.029   1.00 52.73  ? 11  ILE I CB  1 
ATOM   9225  C CG1 . ILE I 1 15  ? 10.789  -5.158  7.110   1.00 25.88  ? 11  ILE I CG1 1 
ATOM   9226  C CG2 . ILE I 1 15  ? 10.239  -4.848  4.675   1.00 65.44  ? 11  ILE I CG2 1 
ATOM   9227  C CD1 . ILE I 1 15  ? 12.046  -5.953  6.837   1.00 39.93  ? 11  ILE I CD1 1 
ATOM   9228  N N   . GLY I 1 16  ? 6.653   -3.969  4.871   1.00 66.27  ? 12  GLY I N   1 
ATOM   9229  C CA  . GLY I 1 16  ? 5.599   -4.244  3.912   1.00 64.09  ? 12  GLY I CA  1 
ATOM   9230  C C   . GLY I 1 16  ? 6.133   -4.291  2.494   1.00 57.36  ? 12  GLY I C   1 
ATOM   9231  O O   . GLY I 1 16  ? 7.151   -3.671  2.186   1.00 67.37  ? 12  GLY I O   1 
ATOM   9232  N N   . SER I 1 17  ? 5.446   -5.029  1.629   1.00 56.97  ? 13  SER I N   1 
ATOM   9233  C CA  . SER I 1 17  ? 5.839   -5.129  0.229   1.00 67.38  ? 13  SER I CA  1 
ATOM   9234  C C   . SER I 1 17  ? 6.043   -3.746  -0.382  1.00 74.00  ? 13  SER I C   1 
ATOM   9235  O O   . SER I 1 17  ? 6.861   -3.571  -1.284  1.00 80.21  ? 13  SER I O   1 
ATOM   9236  C CB  . SER I 1 17  ? 4.784   -5.900  -0.566  1.00 68.25  ? 13  SER I CB  1 
ATOM   9237  O OG  . SER I 1 17  ? 4.698   -7.245  -0.127  1.00 67.24  ? 13  SER I OG  1 
ATOM   9238  N N   . GLY I 1 18  ? 5.296   -2.766  0.117   1.00 78.93  ? 14  GLY I N   1 
ATOM   9239  C CA  . GLY I 1 18  ? 5.413   -1.399  -0.358  1.00 80.64  ? 14  GLY I CA  1 
ATOM   9240  C C   . GLY I 1 18  ? 6.830   -0.872  -0.244  1.00 79.44  ? 14  GLY I C   1 
ATOM   9241  O O   . GLY I 1 18  ? 7.314   -0.176  -1.138  1.00 89.21  ? 14  GLY I O   1 
ATOM   9242  N N   . HIS I 1 19  ? 7.496   -1.198  0.860   1.00 57.76  ? 15  HIS I N   1 
ATOM   9243  C CA  . HIS I 1 19  ? 8.879   -0.786  1.066   1.00 52.71  ? 15  HIS I CA  1 
ATOM   9244  C C   . HIS I 1 19  ? 9.794   -1.473  0.062   1.00 56.35  ? 15  HIS I C   1 
ATOM   9245  O O   . HIS I 1 19  ? 10.708  -0.857  -0.488  1.00 52.11  ? 15  HIS I O   1 
ATOM   9246  C CB  . HIS I 1 19  ? 9.338   -1.128  2.484   1.00 52.33  ? 15  HIS I CB  1 
ATOM   9247  C CG  . HIS I 1 19  ? 8.646   -0.344  3.554   1.00 52.88  ? 15  HIS I CG  1 
ATOM   9248  N ND1 . HIS I 1 19  ? 7.712   -0.902  4.400   1.00 61.77  ? 15  HIS I ND1 1 
ATOM   9249  C CD2 . HIS I 1 19  ? 8.756   0.955   3.921   1.00 60.95  ? 15  HIS I CD2 1 
ATOM   9250  C CE1 . HIS I 1 19  ? 7.275   0.019   5.240   1.00 70.50  ? 15  HIS I CE1 1 
ATOM   9251  N NE2 . HIS I 1 19  ? 7.893   1.155   4.969   1.00 68.44  ? 15  HIS I NE2 1 
ATOM   9252  N N   . LEU I 1 20  ? 9.541   -2.756  -0.172  1.00 59.44  ? 16  LEU I N   1 
ATOM   9253  C CA  . LEU I 1 20  ? 10.385  -3.556  -1.050  1.00 51.66  ? 16  LEU I CA  1 
ATOM   9254  C C   . LEU I 1 20  ? 10.203  -3.158  -2.511  1.00 49.88  ? 16  LEU I C   1 
ATOM   9255  O O   . LEU I 1 20  ? 11.154  -3.188  -3.291  1.00 42.74  ? 16  LEU I O   1 
ATOM   9256  C CB  . LEU I 1 20  ? 10.073  -5.042  -0.864  1.00 43.94  ? 16  LEU I CB  1 
ATOM   9257  C CG  . LEU I 1 20  ? 10.133  -5.529  0.586   1.00 31.10  ? 16  LEU I CG  1 
ATOM   9258  C CD1 . LEU I 1 20  ? 9.906   -7.027  0.662   1.00 33.79  ? 16  LEU I CD1 1 
ATOM   9259  C CD2 . LEU I 1 20  ? 11.462  -5.153  1.231   1.00 32.27  ? 16  LEU I CD2 1 
ATOM   9260  N N   . GLN I 1 21  ? 8.980   -2.782  -2.874  1.00 60.90  ? 17  GLN I N   1 
ATOM   9261  C CA  . GLN I 1 21  ? 8.686   -2.362  -4.239  1.00 77.28  ? 17  GLN I CA  1 
ATOM   9262  C C   . GLN I 1 21  ? 9.391   -1.049  -4.568  1.00 72.37  ? 17  GLN I C   1 
ATOM   9263  O O   . GLN I 1 21  ? 9.912   -0.875  -5.670  1.00 69.93  ? 17  GLN I O   1 
ATOM   9264  C CB  . GLN I 1 21  ? 7.178   -2.209  -4.445  1.00 95.77  ? 17  GLN I CB  1 
ATOM   9265  C CG  . GLN I 1 21  ? 6.400   -3.514  -4.332  1.00 113.65 ? 17  GLN I CG  1 
ATOM   9266  C CD  . GLN I 1 21  ? 5.349   -3.675  -5.417  1.00 126.80 ? 17  GLN I CD  1 
ATOM   9267  O OE1 . GLN I 1 21  ? 5.326   -2.928  -6.394  1.00 130.49 ? 17  GLN I OE1 1 
ATOM   9268  N NE2 . GLN I 1 21  ? 4.471   -4.657  -5.246  1.00 130.35 ? 17  GLN I NE2 1 
ATOM   9269  N N   . SER I 1 22  ? 9.407   -0.129  -3.610  1.00 71.51  ? 18  SER I N   1 
ATOM   9270  C CA  . SER I 1 22  ? 10.070  1.156   -3.799  1.00 83.78  ? 18  SER I CA  1 
ATOM   9271  C C   . SER I 1 22  ? 11.585  0.987   -3.910  1.00 75.71  ? 18  SER I C   1 
ATOM   9272  O O   . SER I 1 22  ? 12.264  1.812   -4.522  1.00 71.09  ? 18  SER I O   1 
ATOM   9273  C CB  . SER I 1 22  ? 9.725   2.115   -2.657  1.00 93.40  ? 18  SER I CB  1 
ATOM   9274  O OG  . SER I 1 22  ? 10.090  1.578   -1.397  1.00 102.13 ? 18  SER I OG  1 
ATOM   9275  N N   . LEU I 1 23  ? 12.110  -0.082  -3.319  1.00 70.86  ? 19  LEU I N   1 
ATOM   9276  C CA  . LEU I 1 23  ? 13.537  -0.375  -3.410  1.00 65.03  ? 19  LEU I CA  1 
ATOM   9277  C C   . LEU I 1 23  ? 13.890  -0.847  -4.812  1.00 62.14  ? 19  LEU I C   1 
ATOM   9278  O O   . LEU I 1 23  ? 14.895  -0.428  -5.384  1.00 62.24  ? 19  LEU I O   1 
ATOM   9279  C CB  . LEU I 1 23  ? 13.944  -1.440  -2.389  1.00 60.20  ? 19  LEU I CB  1 
ATOM   9280  C CG  . LEU I 1 23  ? 14.732  -0.926  -1.183  1.00 53.98  ? 19  LEU I CG  1 
ATOM   9281  C CD1 . LEU I 1 23  ? 14.938  -2.032  -0.161  1.00 56.49  ? 19  LEU I CD1 1 
ATOM   9282  C CD2 . LEU I 1 23  ? 16.072  -0.348  -1.624  1.00 39.21  ? 19  LEU I CD2 1 
ATOM   9283  N N   . GLN I 1 24  ? 13.060  -1.725  -5.364  1.00 58.08  ? 20  GLN I N   1 
ATOM   9284  C CA  . GLN I 1 24  ? 13.279  -2.210  -6.717  1.00 44.98  ? 20  GLN I CA  1 
ATOM   9285  C C   . GLN I 1 24  ? 13.063  -1.075  -7.709  1.00 38.39  ? 20  GLN I C   1 
ATOM   9286  O O   . GLN I 1 24  ? 13.854  -0.893  -8.631  1.00 43.25  ? 20  GLN I O   1 
ATOM   9287  C CB  . GLN I 1 24  ? 12.344  -3.376  -7.039  1.00 30.29  ? 20  GLN I CB  1 
ATOM   9288  C CG  . GLN I 1 24  ? 12.687  -4.085  -8.338  1.00 54.55  ? 20  GLN I CG  1 
ATOM   9289  C CD  . GLN I 1 24  ? 14.032  -4.785  -8.284  1.00 73.19  ? 20  GLN I CD  1 
ATOM   9290  O OE1 . GLN I 1 24  ? 14.169  -5.842  -7.670  1.00 81.13  ? 20  GLN I OE1 1 
ATOM   9291  N NE2 . GLN I 1 24  ? 15.033  -4.195  -8.927  1.00 77.07  ? 20  GLN I NE2 1 
ATOM   9292  N N   . ARG I 1 25  ? 11.991  -0.312  -7.513  1.00 50.38  ? 21  ARG I N   1 
ATOM   9293  C CA  . ARG I 1 25  ? 11.705  0.842   -8.360  1.00 58.63  ? 21  ARG I CA  1 
ATOM   9294  C C   . ARG I 1 25  ? 12.877  1.816   -8.326  1.00 60.49  ? 21  ARG I C   1 
ATOM   9295  O O   . ARG I 1 25  ? 13.181  2.479   -9.319  1.00 49.12  ? 21  ARG I O   1 
ATOM   9296  C CB  . ARG I 1 25  ? 10.428  1.544   -7.897  1.00 61.51  ? 21  ARG I CB  1 
ATOM   9297  C CG  . ARG I 1 25  ? 9.155   0.756   -8.158  1.00 76.39  ? 21  ARG I CG  1 
ATOM   9298  C CD  . ARG I 1 25  ? 7.943   1.438   -7.542  1.00 92.17  ? 21  ARG I CD  1 
ATOM   9299  N NE  . ARG I 1 25  ? 6.734   0.629   -7.670  1.00 104.45 ? 21  ARG I NE  1 
ATOM   9300  C CZ  . ARG I 1 25  ? 5.536   0.994   -7.224  1.00 111.91 ? 21  ARG I CZ  1 
ATOM   9301  N NH1 . ARG I 1 25  ? 5.373   2.161   -6.615  1.00 116.57 ? 21  ARG I NH1 1 
ATOM   9302  N NH2 . ARG I 1 25  ? 4.495   0.189   -7.387  1.00 112.23 ? 21  ARG I NH2 1 
ATOM   9303  N N   . LEU I 1 26  ? 13.530  1.894   -7.172  1.00 62.25  ? 22  LEU I N   1 
ATOM   9304  C CA  . LEU I 1 26  ? 14.708  2.734   -7.005  1.00 52.05  ? 22  LEU I CA  1 
ATOM   9305  C C   . LEU I 1 26  ? 15.862  2.170   -7.827  1.00 43.27  ? 22  LEU I C   1 
ATOM   9306  O O   . LEU I 1 26  ? 16.554  2.905   -8.531  1.00 45.84  ? 22  LEU I O   1 
ATOM   9307  C CB  . LEU I 1 26  ? 15.086  2.809   -5.524  1.00 58.47  ? 22  LEU I CB  1 
ATOM   9308  C CG  . LEU I 1 26  ? 16.284  3.671   -5.131  1.00 44.98  ? 22  LEU I CG  1 
ATOM   9309  C CD1 . LEU I 1 26  ? 16.056  4.271   -3.757  1.00 41.13  ? 22  LEU I CD1 1 
ATOM   9310  C CD2 . LEU I 1 26  ? 17.566  2.853   -5.144  1.00 45.22  ? 22  LEU I CD2 1 
ATOM   9311  N N   . ILE I 1 27  ? 16.056  0.859   -7.737  1.00 50.48  ? 23  ILE I N   1 
ATOM   9312  C CA  . ILE I 1 27  ? 17.112  0.180   -8.482  1.00 49.82  ? 23  ILE I CA  1 
ATOM   9313  C C   . ILE I 1 27  ? 16.894  0.302   -9.987  1.00 49.50  ? 23  ILE I C   1 
ATOM   9314  O O   . ILE I 1 27  ? 17.819  0.617   -10.736 1.00 45.82  ? 23  ILE I O   1 
ATOM   9315  C CB  . ILE I 1 27  ? 17.184  -1.313  -8.100  1.00 44.17  ? 23  ILE I CB  1 
ATOM   9316  C CG1 . ILE I 1 27  ? 17.727  -1.463  -6.679  1.00 48.64  ? 23  ILE I CG1 1 
ATOM   9317  C CG2 . ILE I 1 27  ? 18.072  -2.076  -9.074  1.00 50.39  ? 23  ILE I CG2 1 
ATOM   9318  C CD1 . ILE I 1 27  ? 17.673  -2.878  -6.139  1.00 48.12  ? 23  ILE I CD1 1 
ATOM   9319  N N   . ASP I 1 28  ? 15.663  0.051   -10.420 1.00 47.15  ? 24  ASP I N   1 
ATOM   9320  C CA  . ASP I 1 28  ? 15.321  0.068   -11.837 1.00 40.15  ? 24  ASP I CA  1 
ATOM   9321  C C   . ASP I 1 28  ? 15.664  1.410   -12.478 1.00 52.31  ? 24  ASP I C   1 
ATOM   9322  O O   . ASP I 1 28  ? 16.044  1.470   -13.648 1.00 56.58  ? 24  ASP I O   1 
ATOM   9323  C CB  . ASP I 1 28  ? 13.827  -0.216  -12.022 1.00 29.03  ? 24  ASP I CB  1 
ATOM   9324  C CG  . ASP I 1 28  ? 13.406  -1.554  -11.437 1.00 59.07  ? 24  ASP I CG  1 
ATOM   9325  O OD1 . ASP I 1 28  ? 14.181  -2.529  -11.547 1.00 55.83  ? 24  ASP I OD1 1 
ATOM   9326  O OD2 . ASP I 1 28  ? 12.295  -1.630  -10.868 1.00 63.61  ? 24  ASP I OD2 1 
ATOM   9327  N N   . SER I 1 29  ? 15.531  2.482   -11.704 1.00 57.30  ? 25  SER I N   1 
ATOM   9328  C CA  . SER I 1 29  ? 15.692  3.836   -12.226 1.00 45.04  ? 25  SER I CA  1 
ATOM   9329  C C   . SER I 1 29  ? 17.154  4.256   -12.389 1.00 45.09  ? 25  SER I C   1 
ATOM   9330  O O   . SER I 1 29  ? 17.438  5.294   -12.984 1.00 47.09  ? 25  SER I O   1 
ATOM   9331  C CB  . SER I 1 29  ? 14.967  4.839   -11.322 1.00 48.75  ? 25  SER I CB  1 
ATOM   9332  O OG  . SER I 1 29  ? 15.464  4.792   -9.995  1.00 49.73  ? 25  SER I OG  1 
ATOM   9333  N N   . GLN I 1 30  ? 18.079  3.459   -11.866 1.00 46.01  ? 26  GLN I N   1 
ATOM   9334  C CA  . GLN I 1 30  ? 19.496  3.791   -11.962 1.00 43.02  ? 26  GLN I CA  1 
ATOM   9335  C C   . GLN I 1 30  ? 20.062  3.423   -13.329 1.00 55.88  ? 26  GLN I C   1 
ATOM   9336  O O   . GLN I 1 30  ? 19.760  2.362   -13.876 1.00 48.75  ? 26  GLN I O   1 
ATOM   9337  C CB  . GLN I 1 30  ? 20.288  3.089   -10.857 1.00 45.68  ? 26  GLN I CB  1 
ATOM   9338  C CG  . GLN I 1 30  ? 19.842  3.472   -9.462  1.00 44.77  ? 26  GLN I CG  1 
ATOM   9339  C CD  . GLN I 1 30  ? 19.748  4.972   -9.285  1.00 38.92  ? 26  GLN I CD  1 
ATOM   9340  O OE1 . GLN I 1 30  ? 20.706  5.701   -9.545  1.00 33.16  ? 26  GLN I OE1 1 
ATOM   9341  N NE2 . GLN I 1 30  ? 18.584  5.446   -8.857  1.00 40.93  ? 26  GLN I NE2 1 
ATOM   9342  N N   . MET I 1 31  ? 20.883  4.315   -13.873 1.00 60.70  ? 27  MET I N   1 
ATOM   9343  C CA  . MET I 1 31  ? 21.492  4.107   -15.180 1.00 52.02  ? 27  MET I CA  1 
ATOM   9344  C C   . MET I 1 31  ? 22.620  3.091   -15.073 1.00 57.95  ? 27  MET I C   1 
ATOM   9345  O O   . MET I 1 31  ? 23.433  3.148   -14.151 1.00 55.59  ? 27  MET I O   1 
ATOM   9346  C CB  . MET I 1 31  ? 22.031  5.431   -15.727 1.00 45.07  ? 27  MET I CB  1 
ATOM   9347  C CG  . MET I 1 31  ? 22.410  5.392   -17.201 1.00 28.72  ? 27  MET I CG  1 
ATOM   9348  S SD  . MET I 1 31  ? 22.779  7.029   -17.865 1.00 72.55  ? 27  MET I SD  1 
ATOM   9349  C CE  . MET I 1 31  ? 24.291  7.416   -16.992 1.00 51.09  ? 27  MET I CE  1 
ATOM   9350  N N   . GLU I 1 32  ? 22.664  2.162   -16.023 1.00 70.30  ? 28  GLU I N   1 
ATOM   9351  C CA  . GLU I 1 32  ? 23.662  1.100   -16.011 1.00 64.04  ? 28  GLU I CA  1 
ATOM   9352  C C   . GLU I 1 32  ? 25.013  1.628   -16.478 1.00 67.53  ? 28  GLU I C   1 
ATOM   9353  O O   . GLU I 1 32  ? 25.213  1.889   -17.665 1.00 68.68  ? 28  GLU I O   1 
ATOM   9354  C CB  . GLU I 1 32  ? 23.213  -0.060  -16.899 1.00 63.96  ? 28  GLU I CB  1 
ATOM   9355  C CG  . GLU I 1 32  ? 21.844  -0.613  -16.539 1.00 72.32  ? 28  GLU I CG  1 
ATOM   9356  C CD  . GLU I 1 32  ? 21.468  -1.824  -17.369 1.00 86.37  ? 28  GLU I CD  1 
ATOM   9357  O OE1 . GLU I 1 32  ? 20.521  -2.541  -16.982 1.00 91.85  ? 28  GLU I OE1 1 
ATOM   9358  O OE2 . GLU I 1 32  ? 22.118  -2.059  -18.410 1.00 82.46  ? 28  GLU I OE2 1 
ATOM   9359  N N   . THR I 1 33  ? 25.936  1.785   -15.534 1.00 71.44  ? 29  THR I N   1 
ATOM   9360  C CA  . THR I 1 33  ? 27.259  2.318   -15.833 1.00 64.37  ? 29  THR I CA  1 
ATOM   9361  C C   . THR I 1 33  ? 28.345  1.458   -15.197 1.00 71.62  ? 29  THR I C   1 
ATOM   9362  O O   . THR I 1 33  ? 28.077  0.686   -14.276 1.00 68.51  ? 29  THR I O   1 
ATOM   9363  C CB  . THR I 1 33  ? 27.413  3.756   -15.310 1.00 57.22  ? 29  THR I CB  1 
ATOM   9364  O OG1 . THR I 1 33  ? 27.566  3.736   -13.886 1.00 64.92  ? 29  THR I OG1 1 
ATOM   9365  C CG2 . THR I 1 33  ? 26.198  4.595   -15.678 1.00 62.96  ? 29  THR I CG2 1 
ATOM   9366  N N   . SER I 1 34  ? 29.569  1.599   -15.697 1.00 80.96  ? 30  SER I N   1 
ATOM   9367  C CA  . SER I 1 34  ? 30.709  0.868   -15.158 1.00 75.89  ? 30  SER I CA  1 
ATOM   9368  C C   . SER I 1 34  ? 31.282  1.587   -13.942 1.00 64.86  ? 30  SER I C   1 
ATOM   9369  O O   . SER I 1 34  ? 32.024  1.000   -13.154 1.00 58.36  ? 30  SER I O   1 
ATOM   9370  C CB  . SER I 1 34  ? 31.798  0.718   -16.224 1.00 72.53  ? 30  SER I CB  1 
ATOM   9371  O OG  . SER I 1 34  ? 31.316  0.024   -17.360 1.00 71.50  ? 30  SER I OG  1 
ATOM   9372  N N   . CYS I 1 35  ? 30.929  2.861   -13.795 1.00 70.78  ? 31  CYS I N   1 
ATOM   9373  C CA  . CYS I 1 35  ? 31.474  3.692   -12.732 1.00 83.00  ? 31  CYS I CA  1 
ATOM   9374  C C   . CYS I 1 35  ? 31.289  3.015   -11.376 1.00 87.33  ? 31  CYS I C   1 
ATOM   9375  O O   . CYS I 1 35  ? 30.166  2.733   -10.958 1.00 93.00  ? 31  CYS I O   1 
ATOM   9376  C CB  . CYS I 1 35  ? 30.813  5.074   -12.754 1.00 86.84  ? 31  CYS I CB  1 
ATOM   9377  S SG  . CYS I 1 35  ? 29.244  5.198   -11.864 1.00 187.68 ? 31  CYS I SG  1 
ATOM   9378  N N   . GLN I 1 36  ? 32.403  2.743   -10.701 1.00 86.78  ? 32  GLN I N   1 
ATOM   9379  C CA  . GLN I 1 36  ? 32.370  2.037   -9.425  1.00 91.09  ? 32  GLN I CA  1 
ATOM   9380  C C   . GLN I 1 36  ? 32.565  2.992   -8.252  1.00 92.89  ? 32  GLN I C   1 
ATOM   9381  O O   . GLN I 1 36  ? 33.099  4.090   -8.411  1.00 96.71  ? 32  GLN I O   1 
ATOM   9382  C CB  . GLN I 1 36  ? 33.440  0.943   -9.394  1.00 88.78  ? 32  GLN I CB  1 
ATOM   9383  C CG  . GLN I 1 36  ? 33.261  -0.128  -10.461 1.00 87.65  ? 32  GLN I CG  1 
ATOM   9384  C CD  . GLN I 1 36  ? 34.155  -1.333  -10.238 1.00 79.37  ? 32  GLN I CD  1 
ATOM   9385  O OE1 . GLN I 1 36  ? 35.109  -1.277  -9.461  1.00 91.65  ? 32  GLN I OE1 1 
ATOM   9386  N NE2 . GLN I 1 36  ? 33.848  -2.433  -10.918 1.00 44.79  ? 32  GLN I NE2 1 
ATOM   9387  N N   . ILE I 1 37  ? 32.120  2.560   -7.075  1.00 78.09  ? 33  ILE I N   1 
ATOM   9388  C CA  . ILE I 1 37  ? 32.233  3.361   -5.862  1.00 63.02  ? 33  ILE I CA  1 
ATOM   9389  C C   . ILE I 1 37  ? 32.803  2.530   -4.719  1.00 64.18  ? 33  ILE I C   1 
ATOM   9390  O O   . ILE I 1 37  ? 32.986  1.318   -4.849  1.00 71.10  ? 33  ILE I O   1 
ATOM   9391  C CB  . ILE I 1 37  ? 30.864  3.918   -5.430  1.00 57.62  ? 33  ILE I CB  1 
ATOM   9392  C CG1 . ILE I 1 37  ? 29.894  2.771   -5.122  1.00 68.22  ? 33  ILE I CG1 1 
ATOM   9393  C CG2 . ILE I 1 37  ? 30.299  4.824   -6.513  1.00 30.56  ? 33  ILE I CG2 1 
ATOM   9394  C CD1 . ILE I 1 37  ? 28.561  3.218   -4.545  1.00 57.44  ? 33  ILE I CD1 1 
ATOM   9395  N N   . THR I 1 38  ? 33.078  3.191   -3.599  1.00 55.34  ? 34  THR I N   1 
ATOM   9396  C CA  . THR I 1 38  ? 33.620  2.522   -2.423  1.00 55.25  ? 34  THR I CA  1 
ATOM   9397  C C   . THR I 1 38  ? 32.643  2.605   -1.254  1.00 62.79  ? 34  THR I C   1 
ATOM   9398  O O   . THR I 1 38  ? 32.000  3.633   -1.043  1.00 51.17  ? 34  THR I O   1 
ATOM   9399  C CB  . THR I 1 38  ? 34.962  3.146   -1.997  1.00 61.07  ? 34  THR I CB  1 
ATOM   9400  O OG1 . THR I 1 38  ? 35.881  3.106   -3.096  1.00 71.66  ? 34  THR I OG1 1 
ATOM   9401  C CG2 . THR I 1 38  ? 35.556  2.393   -0.815  1.00 47.61  ? 34  THR I CG2 1 
ATOM   9402  N N   . PHE I 1 39  ? 32.539  1.516   -0.497  1.00 71.11  ? 35  PHE I N   1 
ATOM   9403  C CA  . PHE I 1 39  ? 31.649  1.464   0.659   1.00 60.29  ? 35  PHE I CA  1 
ATOM   9404  C C   . PHE I 1 39  ? 31.989  0.277   1.554   1.00 60.76  ? 35  PHE I C   1 
ATOM   9405  O O   . PHE I 1 39  ? 32.594  -0.696  1.104   1.00 61.38  ? 35  PHE I O   1 
ATOM   9406  C CB  . PHE I 1 39  ? 30.193  1.362   0.203   1.00 48.78  ? 35  PHE I CB  1 
ATOM   9407  C CG  . PHE I 1 39  ? 29.915  0.177   -0.679  1.00 38.99  ? 35  PHE I CG  1 
ATOM   9408  C CD1 . PHE I 1 39  ? 29.753  -1.086  -0.134  1.00 40.29  ? 35  PHE I CD1 1 
ATOM   9409  C CD2 . PHE I 1 39  ? 29.817  0.327   -2.052  1.00 17.44  ? 35  PHE I CD2 1 
ATOM   9410  C CE1 . PHE I 1 39  ? 29.496  -2.176  -0.942  1.00 31.86  ? 35  PHE I CE1 1 
ATOM   9411  C CE2 . PHE I 1 39  ? 29.561  -0.760  -2.866  1.00 24.71  ? 35  PHE I CE2 1 
ATOM   9412  C CZ  . PHE I 1 39  ? 29.401  -2.013  -2.311  1.00 36.45  ? 35  PHE I CZ  1 
ATOM   9413  N N   . GLU I 1 40  ? 31.594  0.358   2.822   1.00 63.92  ? 36  GLU I N   1 
ATOM   9414  C CA  . GLU I 1 40  ? 31.848  -0.723  3.770   1.00 77.03  ? 36  GLU I CA  1 
ATOM   9415  C C   . GLU I 1 40  ? 30.596  -1.568  3.975   1.00 91.74  ? 36  GLU I C   1 
ATOM   9416  O O   . GLU I 1 40  ? 29.504  -1.035  4.172   1.00 100.98 ? 36  GLU I O   1 
ATOM   9417  C CB  . GLU I 1 40  ? 32.320  -0.164  5.113   1.00 73.68  ? 36  GLU I CB  1 
ATOM   9418  C CG  . GLU I 1 40  ? 33.598  0.652   5.028   1.00 85.14  ? 36  GLU I CG  1 
ATOM   9419  C CD  . GLU I 1 40  ? 34.268  0.823   6.377   1.00 102.29 ? 36  GLU I CD  1 
ATOM   9420  O OE1 . GLU I 1 40  ? 33.642  0.476   7.401   1.00 109.98 ? 36  GLU I OE1 1 
ATOM   9421  O OE2 . GLU I 1 40  ? 35.420  1.303   6.413   1.00 108.39 ? 36  GLU I OE2 1 
ATOM   9422  N N   . PHE I 1 41  ? 30.762  -2.886  3.935   1.00 87.55  ? 37  PHE I N   1 
ATOM   9423  C CA  . PHE I 1 41  ? 29.636  -3.799  4.088   1.00 78.90  ? 37  PHE I CA  1 
ATOM   9424  C C   . PHE I 1 41  ? 30.095  -5.122  4.697   1.00 82.81  ? 37  PHE I C   1 
ATOM   9425  O O   . PHE I 1 41  ? 31.281  -5.312  4.969   1.00 84.27  ? 37  PHE I O   1 
ATOM   9426  C CB  . PHE I 1 41  ? 28.962  -4.034  2.733   1.00 78.35  ? 37  PHE I CB  1 
ATOM   9427  C CG  . PHE I 1 41  ? 27.542  -4.510  2.837   1.00 77.78  ? 37  PHE I CG  1 
ATOM   9428  C CD1 . PHE I 1 41  ? 26.569  -3.708  3.410   1.00 76.29  ? 37  PHE I CD1 1 
ATOM   9429  C CD2 . PHE I 1 41  ? 27.181  -5.763  2.371   1.00 78.46  ? 37  PHE I CD2 1 
ATOM   9430  C CE1 . PHE I 1 41  ? 25.260  -4.145  3.511   1.00 74.41  ? 37  PHE I CE1 1 
ATOM   9431  C CE2 . PHE I 1 41  ? 25.874  -6.205  2.468   1.00 74.15  ? 37  PHE I CE2 1 
ATOM   9432  C CZ  . PHE I 1 41  ? 24.913  -5.395  3.040   1.00 65.41  ? 37  PHE I CZ  1 
ATOM   9433  N N   . VAL I 1 42  ? 29.150  -6.031  4.915   1.00 89.54  ? 38  VAL I N   1 
ATOM   9434  C CA  . VAL I 1 42  ? 29.447  -7.328  5.517   1.00 83.63  ? 38  VAL I CA  1 
ATOM   9435  C C   . VAL I 1 42  ? 30.198  -8.240  4.553   1.00 86.35  ? 38  VAL I C   1 
ATOM   9436  O O   . VAL I 1 42  ? 30.032  -8.148  3.336   1.00 87.31  ? 38  VAL I O   1 
ATOM   9437  C CB  . VAL I 1 42  ? 28.155  -8.045  5.953   1.00 70.66  ? 38  VAL I CB  1 
ATOM   9438  C CG1 . VAL I 1 42  ? 28.480  -9.350  6.669   1.00 67.55  ? 38  VAL I CG1 1 
ATOM   9439  C CG2 . VAL I 1 42  ? 27.322  -7.140  6.842   1.00 54.38  ? 38  VAL I CG2 1 
ATOM   9440  N N   . ASP I 1 43  ? 31.019  -9.125  5.108   1.00 93.28  ? 39  ASP I N   1 
ATOM   9441  C CA  . ASP I 1 43  ? 31.749  -10.100 4.310   1.00 111.75 ? 39  ASP I CA  1 
ATOM   9442  C C   . ASP I 1 43  ? 30.913  -11.369 4.175   1.00 130.16 ? 39  ASP I C   1 
ATOM   9443  O O   . ASP I 1 43  ? 30.636  -12.049 5.163   1.00 136.77 ? 39  ASP I O   1 
ATOM   9444  C CB  . ASP I 1 43  ? 33.095  -10.419 4.963   1.00 113.00 ? 39  ASP I CB  1 
ATOM   9445  C CG  . ASP I 1 43  ? 34.083  -11.040 3.993   1.00 121.87 ? 39  ASP I CG  1 
ATOM   9446  O OD1 . ASP I 1 43  ? 33.641  -11.669 3.010   1.00 124.85 ? 39  ASP I OD1 1 
ATOM   9447  O OD2 . ASP I 1 43  ? 35.304  -10.898 4.216   1.00 127.32 ? 39  ASP I OD2 1 
ATOM   9448  N N   . GLN I 1 44  ? 30.512  -11.680 2.946   1.00 133.20 ? 40  GLN I N   1 
ATOM   9449  C CA  . GLN I 1 44  ? 29.635  -12.816 2.683   1.00 128.42 ? 40  GLN I CA  1 
ATOM   9450  C C   . GLN I 1 44  ? 30.328  -14.146 2.972   1.00 123.90 ? 40  GLN I C   1 
ATOM   9451  O O   . GLN I 1 44  ? 29.682  -15.119 3.364   1.00 122.23 ? 40  GLN I O   1 
ATOM   9452  C CB  . GLN I 1 44  ? 29.162  -12.781 1.227   1.00 129.28 ? 40  GLN I CB  1 
ATOM   9453  C CG  . GLN I 1 44  ? 27.952  -13.656 0.942   1.00 136.01 ? 40  GLN I CG  1 
ATOM   9454  C CD  . GLN I 1 44  ? 27.441  -13.498 -0.479  1.00 139.22 ? 40  GLN I CD  1 
ATOM   9455  O OE1 . GLN I 1 44  ? 28.216  -13.513 -1.435  1.00 135.82 ? 40  GLN I OE1 1 
ATOM   9456  N NE2 . GLN I 1 44  ? 26.129  -13.336 -0.623  1.00 140.12 ? 40  GLN I NE2 1 
ATOM   9457  N N   . GLU I 1 45  ? 31.643  -14.181 2.777   1.00 120.60 ? 41  GLU I N   1 
ATOM   9458  C CA  . GLU I 1 45  ? 32.419  -15.399 2.982   1.00 112.78 ? 41  GLU I CA  1 
ATOM   9459  C C   . GLU I 1 45  ? 32.776  -15.590 4.453   1.00 108.91 ? 41  GLU I C   1 
ATOM   9460  O O   . GLU I 1 45  ? 32.690  -16.698 4.983   1.00 109.03 ? 41  GLU I O   1 
ATOM   9461  C CB  . GLU I 1 45  ? 33.699  -15.354 2.144   1.00 110.61 ? 41  GLU I CB  1 
ATOM   9462  C CG  . GLU I 1 45  ? 34.498  -16.648 2.152   1.00 119.47 ? 41  GLU I CG  1 
ATOM   9463  C CD  . GLU I 1 45  ? 33.792  -17.777 1.425   1.00 123.80 ? 41  GLU I CD  1 
ATOM   9464  O OE1 . GLU I 1 45  ? 32.755  -17.517 0.779   1.00 126.61 ? 41  GLU I OE1 1 
ATOM   9465  O OE2 . GLU I 1 45  ? 34.276  -18.927 1.498   1.00 121.41 ? 41  GLU I OE2 1 
ATOM   9466  N N   . GLN I 1 46  ? 33.175  -14.503 5.106   1.00 104.35 ? 42  GLN I N   1 
ATOM   9467  C CA  . GLN I 1 46  ? 33.614  -14.549 6.497   1.00 98.18  ? 42  GLN I CA  1 
ATOM   9468  C C   . GLN I 1 46  ? 32.455  -14.874 7.437   1.00 94.77  ? 42  GLN I C   1 
ATOM   9469  O O   . GLN I 1 46  ? 32.638  -15.535 8.461   1.00 79.54  ? 42  GLN I O   1 
ATOM   9470  C CB  . GLN I 1 46  ? 34.233  -13.207 6.894   1.00 97.76  ? 42  GLN I CB  1 
ATOM   9471  C CG  . GLN I 1 46  ? 35.063  -13.242 8.165   1.00 99.38  ? 42  GLN I CG  1 
ATOM   9472  C CD  . GLN I 1 46  ? 36.433  -13.857 7.956   1.00 92.03  ? 42  GLN I CD  1 
ATOM   9473  O OE1 . GLN I 1 46  ? 36.567  -14.915 7.338   1.00 72.74  ? 42  GLN I OE1 1 
ATOM   9474  N NE2 . GLN I 1 46  ? 37.464  -13.191 8.466   1.00 95.90  ? 42  GLN I NE2 1 
ATOM   9475  N N   . LEU I 1 47  ? 31.265  -14.398 7.084   1.00 97.74  ? 43  LEU I N   1 
ATOM   9476  C CA  . LEU I 1 47  ? 30.073  -14.619 7.895   1.00 85.66  ? 43  LEU I CA  1 
ATOM   9477  C C   . LEU I 1 47  ? 29.050  -15.424 7.098   1.00 81.43  ? 43  LEU I C   1 
ATOM   9478  O O   . LEU I 1 47  ? 28.289  -14.869 6.305   1.00 74.66  ? 43  LEU I O   1 
ATOM   9479  C CB  . LEU I 1 47  ? 29.484  -13.276 8.335   1.00 67.01  ? 43  LEU I CB  1 
ATOM   9480  C CG  . LEU I 1 47  ? 28.337  -13.297 9.348   1.00 57.35  ? 43  LEU I CG  1 
ATOM   9481  C CD1 . LEU I 1 47  ? 28.644  -14.209 10.525  1.00 43.30  ? 43  LEU I CD1 1 
ATOM   9482  C CD2 . LEU I 1 47  ? 28.062  -11.884 9.835   1.00 52.70  ? 43  LEU I CD2 1 
ATOM   9483  N N   . LYS I 1 48  ? 29.042  -16.736 7.314   1.00 87.11  ? 44  LYS I N   1 
ATOM   9484  C CA  . LYS I 1 48  ? 28.198  -17.642 6.542   1.00 89.26  ? 44  LYS I CA  1 
ATOM   9485  C C   . LYS I 1 48  ? 26.786  -17.731 7.114   1.00 70.65  ? 44  LYS I C   1 
ATOM   9486  O O   . LYS I 1 48  ? 25.811  -17.770 6.366   1.00 45.45  ? 44  LYS I O   1 
ATOM   9487  C CB  . LYS I 1 48  ? 28.823  -19.038 6.502   1.00 106.20 ? 44  LYS I CB  1 
ATOM   9488  C CG  . LYS I 1 48  ? 28.129  -20.006 5.554   1.00 116.66 ? 44  LYS I CG  1 
ATOM   9489  C CD  . LYS I 1 48  ? 28.771  -21.388 5.595   1.00 121.94 ? 44  LYS I CD  1 
ATOM   9490  C CE  . LYS I 1 48  ? 28.433  -22.140 6.876   1.00 117.87 ? 44  LYS I CE  1 
ATOM   9491  N NZ  . LYS I 1 48  ? 27.013  -22.590 6.915   1.00 112.86 ? 44  LYS I NZ  1 
ATOM   9492  N N   . ASP I 1 49  ? 26.683  -17.769 8.440   1.00 80.49  ? 45  ASP I N   1 
ATOM   9493  C CA  . ASP I 1 49  ? 25.389  -17.892 9.105   1.00 87.49  ? 45  ASP I CA  1 
ATOM   9494  C C   . ASP I 1 49  ? 24.446  -16.771 8.672   1.00 87.31  ? 45  ASP I C   1 
ATOM   9495  O O   . ASP I 1 49  ? 24.697  -15.601 8.963   1.00 91.20  ? 45  ASP I O   1 
ATOM   9496  C CB  . ASP I 1 49  ? 25.564  -17.865 10.624  1.00 93.09  ? 45  ASP I CB  1 
ATOM   9497  C CG  . ASP I 1 49  ? 24.262  -18.108 11.364  1.00 91.68  ? 45  ASP I CG  1 
ATOM   9498  O OD1 . ASP I 1 49  ? 23.378  -18.790 10.804  1.00 82.90  ? 45  ASP I OD1 1 
ATOM   9499  O OD2 . ASP I 1 49  ? 24.121  -17.618 12.505  1.00 92.83  ? 45  ASP I OD2 1 
ATOM   9500  N N   . PRO I 1 50  ? 23.355  -17.126 7.973   1.00 80.50  ? 46  PRO I N   1 
ATOM   9501  C CA  . PRO I 1 50  ? 22.401  -16.140 7.448   1.00 78.41  ? 46  PRO I CA  1 
ATOM   9502  C C   . PRO I 1 50  ? 21.867  -15.177 8.509   1.00 69.88  ? 46  PRO I C   1 
ATOM   9503  O O   . PRO I 1 50  ? 21.971  -13.963 8.339   1.00 65.50  ? 46  PRO I O   1 
ATOM   9504  C CB  . PRO I 1 50  ? 21.264  -17.012 6.906   1.00 78.95  ? 46  PRO I CB  1 
ATOM   9505  C CG  . PRO I 1 50  ? 21.914  -18.302 6.565   1.00 74.27  ? 46  PRO I CG  1 
ATOM   9506  C CD  . PRO I 1 50  ? 22.982  -18.501 7.596   1.00 76.67  ? 46  PRO I CD  1 
ATOM   9507  N N   . VAL I 1 51  ? 21.301  -15.715 9.584   1.00 57.47  ? 47  VAL I N   1 
ATOM   9508  C CA  . VAL I 1 51  ? 20.695  -14.888 10.621  1.00 56.86  ? 47  VAL I CA  1 
ATOM   9509  C C   . VAL I 1 51  ? 21.681  -13.848 11.144  1.00 67.19  ? 47  VAL I C   1 
ATOM   9510  O O   . VAL I 1 51  ? 21.348  -12.668 11.253  1.00 64.62  ? 47  VAL I O   1 
ATOM   9511  C CB  . VAL I 1 51  ? 20.187  -15.742 11.800  1.00 63.39  ? 47  VAL I CB  1 
ATOM   9512  C CG1 . VAL I 1 51  ? 19.745  -14.853 12.956  1.00 66.22  ? 47  VAL I CG1 1 
ATOM   9513  C CG2 . VAL I 1 51  ? 19.044  -16.643 11.353  1.00 60.74  ? 47  VAL I CG2 1 
ATOM   9514  N N   . CYS I 1 52  ? 22.893  -14.288 11.464  1.00 72.05  ? 48  CYS I N   1 
ATOM   9515  C CA  . CYS I 1 52  ? 23.910  -13.388 11.997  1.00 70.29  ? 48  CYS I CA  1 
ATOM   9516  C C   . CYS I 1 52  ? 24.411  -12.425 10.926  1.00 71.27  ? 48  CYS I C   1 
ATOM   9517  O O   . CYS I 1 52  ? 24.767  -11.284 11.225  1.00 62.01  ? 48  CYS I O   1 
ATOM   9518  C CB  . CYS I 1 52  ? 25.076  -14.185 12.587  1.00 63.15  ? 48  CYS I CB  1 
ATOM   9519  S SG  . CYS I 1 52  ? 24.664  -15.052 14.117  1.00 76.92  ? 48  CYS I SG  1 
ATOM   9520  N N   . TYR I 1 53  ? 24.436  -12.886 9.679   1.00 67.39  ? 49  TYR I N   1 
ATOM   9521  C CA  . TYR I 1 53  ? 24.827  -12.030 8.568   1.00 58.66  ? 49  TYR I CA  1 
ATOM   9522  C C   . TYR I 1 53  ? 23.848  -10.873 8.431   1.00 57.81  ? 49  TYR I C   1 
ATOM   9523  O O   . TYR I 1 53  ? 24.236  -9.749  8.111   1.00 63.39  ? 49  TYR I O   1 
ATOM   9524  C CB  . TYR I 1 53  ? 24.876  -12.823 7.262   1.00 60.93  ? 49  TYR I CB  1 
ATOM   9525  C CG  . TYR I 1 53  ? 25.106  -11.955 6.046   1.00 66.98  ? 49  TYR I CG  1 
ATOM   9526  C CD1 . TYR I 1 53  ? 24.043  -11.346 5.392   1.00 68.28  ? 49  TYR I CD1 1 
ATOM   9527  C CD2 . TYR I 1 53  ? 26.387  -11.737 5.558   1.00 72.12  ? 49  TYR I CD2 1 
ATOM   9528  C CE1 . TYR I 1 53  ? 24.249  -10.547 4.283   1.00 72.49  ? 49  TYR I CE1 1 
ATOM   9529  C CE2 . TYR I 1 53  ? 26.603  -10.941 4.451   1.00 83.59  ? 49  TYR I CE2 1 
ATOM   9530  C CZ  . TYR I 1 53  ? 25.531  -10.348 3.817   1.00 84.76  ? 49  TYR I CZ  1 
ATOM   9531  O OH  . TYR I 1 53  ? 25.744  -9.555  2.713   1.00 85.50  ? 49  TYR I OH  1 
ATOM   9532  N N   . LEU I 1 54  ? 22.574  -11.157 8.677   1.00 48.66  ? 50  LEU I N   1 
ATOM   9533  C CA  . LEU I 1 54  ? 21.530  -10.150 8.561   1.00 44.75  ? 50  LEU I CA  1 
ATOM   9534  C C   . LEU I 1 54  ? 21.557  -9.174  9.735   1.00 40.49  ? 50  LEU I C   1 
ATOM   9535  O O   . LEU I 1 54  ? 21.252  -7.994  9.569   1.00 41.05  ? 50  LEU I O   1 
ATOM   9536  C CB  . LEU I 1 54  ? 20.160  -10.822 8.468   1.00 45.06  ? 50  LEU I CB  1 
ATOM   9537  C CG  . LEU I 1 54  ? 19.939  -11.683 7.222   1.00 41.89  ? 50  LEU I CG  1 
ATOM   9538  C CD1 . LEU I 1 54  ? 18.654  -12.484 7.349   1.00 34.83  ? 50  LEU I CD1 1 
ATOM   9539  C CD2 . LEU I 1 54  ? 19.918  -10.822 5.963   1.00 40.11  ? 50  LEU I CD2 1 
ATOM   9540  N N   . LYS I 1 55  ? 21.918  -9.665  10.917  1.00 51.71  ? 51  LYS I N   1 
ATOM   9541  C CA  . LYS I 1 55  ? 21.991  -8.811  12.100  1.00 55.19  ? 51  LYS I CA  1 
ATOM   9542  C C   . LYS I 1 55  ? 23.073  -7.753  11.925  1.00 60.47  ? 51  LYS I C   1 
ATOM   9543  O O   . LYS I 1 55  ? 22.881  -6.590  12.283  1.00 53.48  ? 51  LYS I O   1 
ATOM   9544  C CB  . LYS I 1 55  ? 22.270  -9.639  13.357  1.00 60.44  ? 51  LYS I CB  1 
ATOM   9545  C CG  . LYS I 1 55  ? 21.112  -10.531 13.786  1.00 69.06  ? 51  LYS I CG  1 
ATOM   9546  C CD  . LYS I 1 55  ? 21.302  -11.073 15.196  1.00 57.62  ? 51  LYS I CD  1 
ATOM   9547  C CE  . LYS I 1 55  ? 21.085  -9.997  16.248  1.00 37.70  ? 51  LYS I CE  1 
ATOM   9548  N NZ  . LYS I 1 55  ? 21.180  -10.547 17.628  1.00 48.17  ? 51  LYS I NZ  1 
ATOM   9549  N N   . LYS I 1 56  ? 24.208  -8.162  11.370  1.00 68.22  ? 52  LYS I N   1 
ATOM   9550  C CA  . LYS I 1 56  ? 25.316  -7.246  11.125  1.00 67.11  ? 52  LYS I CA  1 
ATOM   9551  C C   . LYS I 1 56  ? 25.021  -6.344  9.931   1.00 60.66  ? 52  LYS I C   1 
ATOM   9552  O O   . LYS I 1 56  ? 25.240  -5.134  9.987   1.00 65.81  ? 52  LYS I O   1 
ATOM   9553  C CB  . LYS I 1 56  ? 26.608  -8.030  10.880  1.00 70.14  ? 52  LYS I CB  1 
ATOM   9554  C CG  . LYS I 1 56  ? 27.791  -7.168  10.469  1.00 74.25  ? 52  LYS I CG  1 
ATOM   9555  C CD  . LYS I 1 56  ? 28.948  -7.294  11.440  1.00 82.94  ? 52  LYS I CD  1 
ATOM   9556  C CE  . LYS I 1 56  ? 28.614  -6.704  12.799  1.00 80.45  ? 52  LYS I CE  1 
ATOM   9557  N NZ  . LYS I 1 56  ? 29.715  -6.922  13.777  1.00 75.97  ? 52  LYS I NZ  1 
ATOM   9558  N N   . ALA I 1 57  ? 24.526  -6.941  8.851   1.00 58.20  ? 53  ALA I N   1 
ATOM   9559  C CA  . ALA I 1 57  ? 24.211  -6.193  7.639   1.00 61.03  ? 53  ALA I CA  1 
ATOM   9560  C C   . ALA I 1 57  ? 23.231  -5.065  7.937   1.00 52.85  ? 53  ALA I C   1 
ATOM   9561  O O   . ALA I 1 57  ? 23.424  -3.931  7.502   1.00 60.70  ? 53  ALA I O   1 
ATOM   9562  C CB  . ALA I 1 57  ? 23.637  -7.123  6.583   1.00 60.18  ? 53  ALA I CB  1 
ATOM   9563  N N   . PHE I 1 58  ? 22.182  -5.382  8.686   1.00 58.42  ? 54  PHE I N   1 
ATOM   9564  C CA  . PHE I 1 58  ? 21.150  -4.406  9.012   1.00 66.58  ? 54  PHE I CA  1 
ATOM   9565  C C   . PHE I 1 58  ? 21.744  -3.146  9.643   1.00 75.42  ? 54  PHE I C   1 
ATOM   9566  O O   . PHE I 1 58  ? 21.405  -2.031  9.248   1.00 97.61  ? 54  PHE I O   1 
ATOM   9567  C CB  . PHE I 1 58  ? 20.113  -5.030  9.945   1.00 61.37  ? 54  PHE I CB  1 
ATOM   9568  C CG  . PHE I 1 58  ? 19.006  -4.095  10.329  1.00 67.00  ? 54  PHE I CG  1 
ATOM   9569  C CD1 . PHE I 1 58  ? 18.075  -3.680  9.391   1.00 69.23  ? 54  PHE I CD1 1 
ATOM   9570  C CD2 . PHE I 1 58  ? 18.899  -3.625  11.627  1.00 64.38  ? 54  PHE I CD2 1 
ATOM   9571  C CE1 . PHE I 1 58  ? 17.055  -2.816  9.743   1.00 78.92  ? 54  PHE I CE1 1 
ATOM   9572  C CE2 . PHE I 1 58  ? 17.881  -2.763  11.986  1.00 58.80  ? 54  PHE I CE2 1 
ATOM   9573  C CZ  . PHE I 1 58  ? 16.960  -2.358  11.043  1.00 75.37  ? 54  PHE I CZ  1 
ATOM   9574  N N   . LEU I 1 59  ? 22.630  -3.328  10.619  1.00 58.27  ? 55  LEU I N   1 
ATOM   9575  C CA  . LEU I 1 59  ? 23.284  -2.201  11.281  1.00 45.71  ? 55  LEU I CA  1 
ATOM   9576  C C   . LEU I 1 59  ? 24.023  -1.322  10.276  1.00 65.94  ? 55  LEU I C   1 
ATOM   9577  O O   . LEU I 1 59  ? 23.956  -0.094  10.342  1.00 70.13  ? 55  LEU I O   1 
ATOM   9578  C CB  . LEU I 1 59  ? 24.278  -2.699  12.332  1.00 38.89  ? 55  LEU I CB  1 
ATOM   9579  C CG  . LEU I 1 59  ? 23.714  -3.458  13.535  1.00 57.13  ? 55  LEU I CG  1 
ATOM   9580  C CD1 . LEU I 1 59  ? 24.846  -3.890  14.457  1.00 48.93  ? 55  LEU I CD1 1 
ATOM   9581  C CD2 . LEU I 1 59  ? 22.696  -2.613  14.289  1.00 57.76  ? 55  LEU I CD2 1 
ATOM   9582  N N   . LEU I 1 60  ? 24.732  -1.963  9.351   1.00 63.15  ? 56  LEU I N   1 
ATOM   9583  C CA  . LEU I 1 60  ? 25.551  -1.256  8.373   1.00 49.82  ? 56  LEU I CA  1 
ATOM   9584  C C   . LEU I 1 60  ? 24.711  -0.458  7.383   1.00 55.03  ? 56  LEU I C   1 
ATOM   9585  O O   . LEU I 1 60  ? 25.061  0.669   7.034   1.00 46.72  ? 56  LEU I O   1 
ATOM   9586  C CB  . LEU I 1 60  ? 26.433  -2.249  7.614   1.00 41.07  ? 56  LEU I CB  1 
ATOM   9587  C CG  . LEU I 1 60  ? 27.584  -2.851  8.421   1.00 34.12  ? 56  LEU I CG  1 
ATOM   9588  C CD1 . LEU I 1 60  ? 28.088  -4.113  7.756   1.00 29.96  ? 56  LEU I CD1 1 
ATOM   9589  C CD2 . LEU I 1 60  ? 28.709  -1.840  8.578   1.00 39.24  ? 56  LEU I CD2 1 
ATOM   9590  N N   . VAL I 1 61  ? 23.610  -1.048  6.928   1.00 68.27  ? 57  VAL I N   1 
ATOM   9591  C CA  . VAL I 1 61  ? 22.753  -0.403  5.939   1.00 69.20  ? 57  VAL I CA  1 
ATOM   9592  C C   . VAL I 1 61  ? 22.348  0.992   6.401   1.00 66.79  ? 57  VAL I C   1 
ATOM   9593  O O   . VAL I 1 61  ? 22.213  1.906   5.589   1.00 77.05  ? 57  VAL I O   1 
ATOM   9594  C CB  . VAL I 1 61  ? 21.484  -1.233  5.659   1.00 65.95  ? 57  VAL I CB  1 
ATOM   9595  C CG1 . VAL I 1 61  ? 20.502  -0.438  4.815   1.00 56.42  ? 57  VAL I CG1 1 
ATOM   9596  C CG2 . VAL I 1 61  ? 21.844  -2.533  4.960   1.00 67.77  ? 57  VAL I CG2 1 
ATOM   9597  N N   . GLN I 1 62  ? 22.160  1.150   7.707   1.00 61.44  ? 58  GLN I N   1 
ATOM   9598  C CA  . GLN I 1 62  ? 21.803  2.446   8.276   1.00 63.83  ? 58  GLN I CA  1 
ATOM   9599  C C   . GLN I 1 62  ? 22.782  3.533   7.839   1.00 56.30  ? 58  GLN I C   1 
ATOM   9600  O O   . GLN I 1 62  ? 22.373  4.608   7.399   1.00 53.59  ? 58  GLN I O   1 
ATOM   9601  C CB  . GLN I 1 62  ? 21.762  2.365   9.803   1.00 66.66  ? 58  GLN I CB  1 
ATOM   9602  C CG  . GLN I 1 62  ? 20.626  1.516   10.355  1.00 77.82  ? 58  GLN I CG  1 
ATOM   9603  C CD  . GLN I 1 62  ? 19.258  2.118   10.079  1.00 91.01  ? 58  GLN I CD  1 
ATOM   9604  O OE1 . GLN I 1 62  ? 18.841  2.242   8.927   1.00 72.22  ? 58  GLN I OE1 1 
ATOM   9605  N NE2 . GLN I 1 62  ? 18.555  2.501   11.140  1.00 98.23  ? 58  GLN I NE2 1 
ATOM   9606  N N   . ASP I 1 63  ? 24.074  3.246   7.961   1.00 50.21  ? 59  ASP I N   1 
ATOM   9607  C CA  . ASP I 1 63  ? 25.111  4.191   7.562   1.00 54.97  ? 59  ASP I CA  1 
ATOM   9608  C C   . ASP I 1 63  ? 25.132  4.402   6.049   1.00 48.65  ? 59  ASP I C   1 
ATOM   9609  O O   . ASP I 1 63  ? 25.290  5.528   5.576   1.00 55.24  ? 59  ASP I O   1 
ATOM   9610  C CB  . ASP I 1 63  ? 26.483  3.709   8.040   1.00 69.35  ? 59  ASP I CB  1 
ATOM   9611  C CG  . ASP I 1 63  ? 26.636  3.782   9.548   1.00 72.86  ? 59  ASP I CG  1 
ATOM   9612  O OD1 . ASP I 1 63  ? 26.195  4.789   10.144  1.00 76.61  ? 59  ASP I OD1 1 
ATOM   9613  O OD2 . ASP I 1 63  ? 27.200  2.835   10.139  1.00 57.50  ? 59  ASP I OD2 1 
ATOM   9614  N N   . ILE I 1 64  ? 24.967  3.321   5.293   1.00 40.05  ? 60  ILE I N   1 
ATOM   9615  C CA  . ILE I 1 64  ? 25.033  3.398   3.835   1.00 50.20  ? 60  ILE I CA  1 
ATOM   9616  C C   . ILE I 1 64  ? 23.870  4.192   3.244   1.00 61.54  ? 60  ILE I C   1 
ATOM   9617  O O   . ILE I 1 64  ? 24.046  4.930   2.277   1.00 61.76  ? 60  ILE I O   1 
ATOM   9618  C CB  . ILE I 1 64  ? 25.075  1.995   3.197   1.00 46.96  ? 60  ILE I CB  1 
ATOM   9619  C CG1 . ILE I 1 64  ? 26.470  1.387   3.368   1.00 53.53  ? 60  ILE I CG1 1 
ATOM   9620  C CG2 . ILE I 1 64  ? 24.721  2.067   1.717   1.00 47.34  ? 60  ILE I CG2 1 
ATOM   9621  C CD1 . ILE I 1 64  ? 26.622  0.011   2.763   1.00 59.26  ? 60  ILE I CD1 1 
ATOM   9622  N N   . MET I 1 65  ? 22.684  4.038   3.823   1.00 65.42  ? 61  MET I N   1 
ATOM   9623  C CA  . MET I 1 65  ? 21.512  4.762   3.346   1.00 53.64  ? 61  MET I CA  1 
ATOM   9624  C C   . MET I 1 65  ? 21.664  6.260   3.595   1.00 67.41  ? 61  MET I C   1 
ATOM   9625  O O   . MET I 1 65  ? 21.168  7.081   2.823   1.00 72.13  ? 61  MET I O   1 
ATOM   9626  C CB  . MET I 1 65  ? 20.244  4.246   4.031   1.00 41.01  ? 61  MET I CB  1 
ATOM   9627  C CG  . MET I 1 65  ? 19.840  2.841   3.610   1.00 47.69  ? 61  MET I CG  1 
ATOM   9628  S SD  . MET I 1 65  ? 18.211  2.355   4.218   1.00 43.49  ? 61  MET I SD  1 
ATOM   9629  C CE  . MET I 1 65  ? 18.431  2.521   5.990   1.00 50.22  ? 61  MET I CE  1 
ATOM   9630  N N   . GLU I 1 66  ? 22.359  6.609   4.673   1.00 76.65  ? 62  GLU I N   1 
ATOM   9631  C CA  . GLU I 1 66  ? 22.524  8.004   5.069   1.00 70.88  ? 62  GLU I CA  1 
ATOM   9632  C C   . GLU I 1 66  ? 23.697  8.675   4.358   1.00 71.58  ? 62  GLU I C   1 
ATOM   9633  O O   . GLU I 1 66  ? 23.608  9.836   3.956   1.00 63.72  ? 62  GLU I O   1 
ATOM   9634  C CB  . GLU I 1 66  ? 22.732  8.093   6.583   1.00 71.15  ? 62  GLU I CB  1 
ATOM   9635  C CG  . GLU I 1 66  ? 22.967  9.504   7.101   1.00 68.56  ? 62  GLU I CG  1 
ATOM   9636  C CD  . GLU I 1 66  ? 21.767  10.406  6.895   1.00 76.39  ? 62  GLU I CD  1 
ATOM   9637  O OE1 . GLU I 1 66  ? 20.947  10.527  7.829   1.00 79.81  ? 62  GLU I OE1 1 
ATOM   9638  O OE2 . GLU I 1 66  ? 21.642  10.992  5.799   1.00 78.05  ? 62  GLU I OE2 1 
ATOM   9639  N N   . ASP I 1 67  ? 24.794  7.941   4.207   1.00 73.76  ? 63  ASP I N   1 
ATOM   9640  C CA  . ASP I 1 67  ? 26.036  8.516   3.701   1.00 68.42  ? 63  ASP I CA  1 
ATOM   9641  C C   . ASP I 1 67  ? 26.219  8.298   2.203   1.00 69.69  ? 63  ASP I C   1 
ATOM   9642  O O   . ASP I 1 67  ? 26.738  9.168   1.503   1.00 72.80  ? 63  ASP I O   1 
ATOM   9643  C CB  . ASP I 1 67  ? 27.232  7.916   4.445   1.00 64.36  ? 63  ASP I CB  1 
ATOM   9644  C CG  . ASP I 1 67  ? 27.109  8.045   5.950   1.00 66.17  ? 63  ASP I CG  1 
ATOM   9645  O OD1 . ASP I 1 67  ? 26.465  9.007   6.421   1.00 71.96  ? 63  ASP I OD1 1 
ATOM   9646  O OD2 . ASP I 1 67  ? 27.661  7.182   6.664   1.00 70.31  ? 63  ASP I OD2 1 
ATOM   9647  N N   . THR I 1 68  ? 25.795  7.136   1.716   1.00 68.53  ? 64  THR I N   1 
ATOM   9648  C CA  . THR I 1 68  ? 26.075  6.734   0.341   1.00 73.45  ? 64  THR I CA  1 
ATOM   9649  C C   . THR I 1 68  ? 24.889  6.961   -0.596  1.00 83.84  ? 64  THR I C   1 
ATOM   9650  O O   . THR I 1 68  ? 25.026  7.602   -1.639  1.00 86.98  ? 64  THR I O   1 
ATOM   9651  C CB  . THR I 1 68  ? 26.476  5.247   0.276   1.00 63.21  ? 64  THR I CB  1 
ATOM   9652  O OG1 . THR I 1 68  ? 27.478  4.975   1.265   1.00 61.23  ? 64  THR I OG1 1 
ATOM   9653  C CG2 . THR I 1 68  ? 27.010  4.893   -1.104  1.00 53.11  ? 64  THR I CG2 1 
ATOM   9654  N N   . MET I 1 69  ? 23.729  6.428   -0.225  1.00 82.41  ? 65  MET I N   1 
ATOM   9655  C CA  . MET I 1 69  ? 22.545  6.505   -1.074  1.00 73.59  ? 65  MET I CA  1 
ATOM   9656  C C   . MET I 1 69  ? 21.790  7.814   -0.861  1.00 56.69  ? 65  MET I C   1 
ATOM   9657  O O   . MET I 1 69  ? 20.909  7.899   -0.006  1.00 47.14  ? 65  MET I O   1 
ATOM   9658  C CB  . MET I 1 69  ? 21.623  5.318   -0.792  1.00 73.52  ? 65  MET I CB  1 
ATOM   9659  C CG  . MET I 1 69  ? 22.263  3.969   -1.084  1.00 73.60  ? 65  MET I CG  1 
ATOM   9660  S SD  . MET I 1 69  ? 21.347  2.581   -0.389  1.00 51.88  ? 65  MET I SD  1 
ATOM   9661  C CE  . MET I 1 69  ? 19.736  2.839   -1.118  1.00 32.79  ? 65  MET I CE  1 
ATOM   9662  N N   . ARG I 1 70  ? 22.139  8.826   -1.652  1.00 51.89  ? 66  ARG I N   1 
ATOM   9663  C CA  . ARG I 1 70  ? 21.525  10.146  -1.539  1.00 48.92  ? 66  ARG I CA  1 
ATOM   9664  C C   . ARG I 1 70  ? 20.855  10.565  -2.847  1.00 38.74  ? 66  ARG I C   1 
ATOM   9665  O O   . ARG I 1 70  ? 21.428  10.419  -3.925  1.00 38.17  ? 66  ARG I O   1 
ATOM   9666  C CB  . ARG I 1 70  ? 22.575  11.183  -1.136  1.00 46.35  ? 66  ARG I CB  1 
ATOM   9667  N N   . PHE I 1 71  ? 19.642  11.098  -2.741  1.00 52.14  ? 67  PHE I N   1 
ATOM   9668  C CA  . PHE I 1 71  ? 18.867  11.484  -3.914  1.00 60.31  ? 67  PHE I CA  1 
ATOM   9669  C C   . PHE I 1 71  ? 18.389  12.928  -3.825  1.00 67.42  ? 67  PHE I C   1 
ATOM   9670  O O   . PHE I 1 71  ? 18.194  13.466  -2.734  1.00 68.15  ? 67  PHE I O   1 
ATOM   9671  C CB  . PHE I 1 71  ? 17.660  10.557  -4.074  1.00 58.81  ? 67  PHE I CB  1 
ATOM   9672  C CG  . PHE I 1 71  ? 18.029  9.113   -4.243  1.00 69.02  ? 67  PHE I CG  1 
ATOM   9673  C CD1 . PHE I 1 71  ? 18.278  8.315   -3.139  1.00 80.44  ? 67  PHE I CD1 1 
ATOM   9674  C CD2 . PHE I 1 71  ? 18.135  8.555   -5.505  1.00 79.14  ? 67  PHE I CD2 1 
ATOM   9675  C CE1 . PHE I 1 71  ? 18.623  6.986   -3.291  1.00 86.95  ? 67  PHE I CE1 1 
ATOM   9676  C CE2 . PHE I 1 71  ? 18.478  7.226   -5.663  1.00 84.05  ? 67  PHE I CE2 1 
ATOM   9677  C CZ  . PHE I 1 71  ? 18.723  6.442   -4.555  1.00 87.95  ? 67  PHE I CZ  1 
ATOM   9678  N N   . ARG I 1 72  ? 18.207  13.550  -4.985  1.00 71.57  ? 68  ARG I N   1 
ATOM   9679  C CA  A ARG I 1 72  ? 17.703  14.915  -5.059  0.62 70.01  ? 68  ARG I CA  1 
ATOM   9680  C CA  B ARG I 1 72  ? 17.708  14.917  -5.048  0.38 70.04  ? 68  ARG I CA  1 
ATOM   9681  C C   . ARG I 1 72  ? 16.470  15.061  -4.170  1.00 74.08  ? 68  ARG I C   1 
ATOM   9682  O O   . ARG I 1 72  ? 15.580  14.211  -4.190  1.00 75.06  ? 68  ARG I O   1 
ATOM   9683  C CB  A ARG I 1 72  ? 17.362  15.265  -6.510  0.62 67.15  ? 68  ARG I CB  1 
ATOM   9684  C CB  B ARG I 1 72  ? 17.391  15.303  -6.494  0.38 67.43  ? 68  ARG I CB  1 
ATOM   9685  C CG  A ARG I 1 72  ? 17.028  16.730  -6.747  0.62 66.39  ? 68  ARG I CG  1 
ATOM   9686  C CG  B ARG I 1 72  ? 16.533  16.548  -6.635  0.38 66.21  ? 68  ARG I CG  1 
ATOM   9687  C CD  A ARG I 1 72  ? 16.627  16.984  -8.196  0.62 64.59  ? 68  ARG I CD  1 
ATOM   9688  C CD  B ARG I 1 72  ? 16.740  17.210  -7.987  0.38 65.38  ? 68  ARG I CD  1 
ATOM   9689  N NE  A ARG I 1 72  ? 17.625  17.766  -8.928  0.62 63.26  ? 68  ARG I NE  1 
ATOM   9690  N NE  B ARG I 1 72  ? 15.498  17.747  -8.538  0.38 67.44  ? 68  ARG I NE  1 
ATOM   9691  C CZ  A ARG I 1 72  ? 18.641  17.252  -9.619  0.62 64.81  ? 68  ARG I CZ  1 
ATOM   9692  C CZ  B ARG I 1 72  ? 14.916  18.872  -8.135  0.38 69.10  ? 68  ARG I CZ  1 
ATOM   9693  N NH1 A ARG I 1 72  ? 18.826  15.939  -9.690  0.62 67.93  ? 68  ARG I NH1 1 
ATOM   9694  N NH1 B ARG I 1 72  ? 15.450  19.597  -7.160  0.38 74.99  ? 68  ARG I NH1 1 
ATOM   9695  N NH2 A ARG I 1 72  ? 19.485  18.060  -10.245 0.62 58.70  ? 68  ARG I NH2 1 
ATOM   9696  N NH2 B ARG I 1 72  ? 13.789  19.272  -8.705  0.38 66.29  ? 68  ARG I NH2 1 
ATOM   9697  N N   . ASP I 1 73  ? 16.427  16.137  -3.391  1.00 68.88  ? 69  ASP I N   1 
ATOM   9698  C CA  . ASP I 1 73  ? 15.342  16.360  -2.438  1.00 63.00  ? 69  ASP I CA  1 
ATOM   9699  C C   . ASP I 1 73  ? 13.948  16.251  -3.055  1.00 44.70  ? 69  ASP I C   1 
ATOM   9700  O O   . ASP I 1 73  ? 13.724  16.654  -4.196  1.00 42.00  ? 69  ASP I O   1 
ATOM   9701  C CB  . ASP I 1 73  ? 15.496  17.728  -1.770  1.00 63.87  ? 69  ASP I CB  1 
ATOM   9702  C CG  . ASP I 1 73  ? 16.575  17.740  -0.703  1.00 72.34  ? 69  ASP I CG  1 
ATOM   9703  O OD1 . ASP I 1 73  ? 16.813  16.681  -0.082  1.00 60.12  ? 69  ASP I OD1 1 
ATOM   9704  O OD2 . ASP I 1 73  ? 17.180  18.811  -0.482  1.00 77.31  ? 69  ASP I OD2 1 
ATOM   9705  N N   . ASN I 1 74  ? 13.023  15.693  -2.280  1.00 47.99  ? 70  ASN I N   1 
ATOM   9706  C CA  . ASN I 1 74  ? 11.605  15.658  -2.633  1.00 63.20  ? 70  ASN I CA  1 
ATOM   9707  C C   . ASN I 1 74  ? 11.255  14.777  -3.832  1.00 63.82  ? 70  ASN I C   1 
ATOM   9708  O O   . ASN I 1 74  ? 10.132  14.834  -4.330  1.00 72.76  ? 70  ASN I O   1 
ATOM   9709  C CB  . ASN I 1 74  ? 11.084  17.079  -2.871  1.00 66.92  ? 70  ASN I CB  1 
ATOM   9710  C CG  . ASN I 1 74  ? 11.142  17.937  -1.624  1.00 77.23  ? 70  ASN I CG  1 
ATOM   9711  O OD1 . ASN I 1 74  ? 11.164  17.424  -0.505  1.00 83.25  ? 70  ASN I OD1 1 
ATOM   9712  N ND2 . ASN I 1 74  ? 11.162  19.251  -1.810  1.00 85.70  ? 70  ASN I ND2 1 
ATOM   9713  N N   . THR I 1 75  ? 12.199  13.961  -4.289  1.00 46.39  ? 71  THR I N   1 
ATOM   9714  C CA  . THR I 1 75  ? 11.930  13.044  -5.393  1.00 39.69  ? 71  THR I CA  1 
ATOM   9715  C C   . THR I 1 75  ? 11.464  11.696  -4.849  1.00 50.04  ? 71  THR I C   1 
ATOM   9716  O O   . THR I 1 75  ? 11.774  11.344  -3.710  1.00 53.81  ? 71  THR I O   1 
ATOM   9717  C CB  . THR I 1 75  ? 13.171  12.828  -6.280  1.00 37.35  ? 71  THR I CB  1 
ATOM   9718  O OG1 . THR I 1 75  ? 14.176  12.113  -5.549  1.00 52.36  ? 71  THR I OG1 1 
ATOM   9719  C CG2 . THR I 1 75  ? 13.728  14.161  -6.759  1.00 27.30  ? 71  THR I CG2 1 
ATOM   9720  N N   . PRO I 1 76  ? 10.716  10.934  -5.664  1.00 47.71  ? 72  PRO I N   1 
ATOM   9721  C CA  . PRO I 1 76  ? 10.164  9.651   -5.217  1.00 37.14  ? 72  PRO I CA  1 
ATOM   9722  C C   . PRO I 1 76  ? 11.212  8.774   -4.546  1.00 31.45  ? 72  PRO I C   1 
ATOM   9723  O O   . PRO I 1 76  ? 10.914  8.118   -3.548  1.00 43.51  ? 72  PRO I O   1 
ATOM   9724  C CB  . PRO I 1 76  ? 9.679   9.008   -6.519  1.00 26.48  ? 72  PRO I CB  1 
ATOM   9725  C CG  . PRO I 1 76  ? 9.377   10.160  -7.409  1.00 41.92  ? 72  PRO I CG  1 
ATOM   9726  C CD  . PRO I 1 76  ? 10.410  11.198  -7.080  1.00 46.83  ? 72  PRO I CD  1 
ATOM   9727  N N   . ASN I 1 77  ? 12.425  8.766   -5.087  1.00 33.55  ? 73  ASN I N   1 
ATOM   9728  C CA  . ASN I 1 77  ? 13.507  7.984   -4.503  1.00 32.22  ? 73  ASN I CA  1 
ATOM   9729  C C   . ASN I 1 77  ? 13.890  8.514   -3.130  1.00 25.69  ? 73  ASN I C   1 
ATOM   9730  O O   . ASN I 1 77  ? 13.971  7.754   -2.168  1.00 41.36  ? 73  ASN I O   1 
ATOM   9731  C CB  . ASN I 1 77  ? 14.729  7.978   -5.422  1.00 35.36  ? 73  ASN I CB  1 
ATOM   9732  C CG  . ASN I 1 77  ? 14.510  7.153   -6.676  1.00 42.17  ? 73  ASN I CG  1 
ATOM   9733  O OD1 . ASN I 1 77  ? 13.635  6.287   -6.719  1.00 39.70  ? 73  ASN I OD1 1 
ATOM   9734  N ND2 . ASN I 1 77  ? 15.312  7.411   -7.701  1.00 35.70  ? 73  ASN I ND2 1 
ATOM   9735  N N   . ALA I 1 78  ? 14.121  9.820   -3.043  1.00 24.30  ? 74  ALA I N   1 
ATOM   9736  C CA  . ALA I 1 78  ? 14.492  10.445  -1.779  1.00 37.39  ? 74  ALA I CA  1 
ATOM   9737  C C   . ALA I 1 78  ? 13.526  10.021  -0.679  1.00 51.06  ? 74  ALA I C   1 
ATOM   9738  O O   . ALA I 1 78  ? 13.940  9.587   0.397   1.00 49.15  ? 74  ALA I O   1 
ATOM   9739  C CB  . ALA I 1 78  ? 14.505  11.959  -1.921  1.00 32.02  ? 74  ALA I CB  1 
ATOM   9740  N N   . ILE I 1 79  ? 12.235  10.144  -0.964  1.00 54.57  ? 75  ILE I N   1 
ATOM   9741  C CA  . ILE I 1 79  ? 11.200  9.758   -0.017  1.00 48.48  ? 75  ILE I CA  1 
ATOM   9742  C C   . ILE I 1 79  ? 11.348  8.285   0.334   1.00 42.42  ? 75  ILE I C   1 
ATOM   9743  O O   . ILE I 1 79  ? 11.232  7.898   1.496   1.00 51.87  ? 75  ILE I O   1 
ATOM   9744  C CB  . ILE I 1 79  ? 9.794   9.995   -0.600  1.00 56.36  ? 75  ILE I CB  1 
ATOM   9745  C CG1 . ILE I 1 79  ? 9.579   11.484  -0.880  1.00 66.89  ? 75  ILE I CG1 1 
ATOM   9746  C CG2 . ILE I 1 79  ? 8.728   9.487   0.359   1.00 56.68  ? 75  ILE I CG2 1 
ATOM   9747  C CD1 . ILE I 1 79  ? 8.383   11.774  -1.759  1.00 68.77  ? 75  ILE I CD1 1 
ATOM   9748  N N   . ALA I 1 80  ? 11.612  7.467   -0.680  1.00 49.20  ? 76  ALA I N   1 
ATOM   9749  C CA  . ALA I 1 80  ? 11.732  6.026   -0.493  1.00 41.78  ? 76  ALA I CA  1 
ATOM   9750  C C   . ALA I 1 80  ? 12.819  5.680   0.519   1.00 36.51  ? 76  ALA I C   1 
ATOM   9751  O O   . ALA I 1 80  ? 12.637  4.793   1.350   1.00 54.11  ? 76  ALA I O   1 
ATOM   9752  C CB  . ALA I 1 80  ? 12.011  5.341   -1.826  1.00 39.55  ? 76  ALA I CB  1 
ATOM   9753  N N   . ILE I 1 81  ? 13.947  6.377   0.451   1.00 34.57  ? 77  ILE I N   1 
ATOM   9754  C CA  . ILE I 1 81  ? 15.062  6.093   1.346   1.00 19.31  ? 77  ILE I CA  1 
ATOM   9755  C C   . ILE I 1 81  ? 14.680  6.408   2.781   1.00 37.84  ? 77  ILE I C   1 
ATOM   9756  O O   . ILE I 1 81  ? 14.926  5.609   3.683   1.00 54.68  ? 77  ILE I O   1 
ATOM   9757  C CB  . ILE I 1 81  ? 16.316  6.898   0.968   1.00 36.42  ? 77  ILE I CB  1 
ATOM   9758  C CG1 . ILE I 1 81  ? 16.799  6.509   -0.431  1.00 48.66  ? 77  ILE I CG1 1 
ATOM   9759  C CG2 . ILE I 1 81  ? 17.423  6.659   1.979   1.00 38.80  ? 77  ILE I CG2 1 
ATOM   9760  C CD1 . ILE I 1 81  ? 17.180  5.052   -0.558  1.00 38.52  ? 77  ILE I CD1 1 
ATOM   9761  N N   . VAL I 1 82  ? 14.076  7.573   2.993   1.00 49.62  ? 78  VAL I N   1 
ATOM   9762  C CA  . VAL I 1 82  ? 13.638  7.959   4.329   1.00 48.54  ? 78  VAL I CA  1 
ATOM   9763  C C   . VAL I 1 82  ? 12.730  6.882   4.910   1.00 36.71  ? 78  VAL I C   1 
ATOM   9764  O O   . VAL I 1 82  ? 12.928  6.443   6.040   1.00 39.21  ? 78  VAL I O   1 
ATOM   9765  C CB  . VAL I 1 82  ? 12.900  9.312   4.327   1.00 45.63  ? 78  VAL I CB  1 
ATOM   9766  C CG1 . VAL I 1 82  ? 12.243  9.564   5.682   1.00 42.29  ? 78  VAL I CG1 1 
ATOM   9767  C CG2 . VAL I 1 82  ? 13.862  10.440  3.975   1.00 27.74  ? 78  VAL I CG2 1 
ATOM   9768  N N   . GLN I 1 83  ? 11.740  6.455   4.130   1.00 42.77  ? 79  GLN I N   1 
ATOM   9769  C CA  . GLN I 1 83  ? 10.853  5.373   4.542   1.00 48.24  ? 79  GLN I CA  1 
ATOM   9770  C C   . GLN I 1 83  ? 11.668  4.207   5.089   1.00 54.53  ? 79  GLN I C   1 
ATOM   9771  O O   . GLN I 1 83  ? 11.383  3.685   6.168   1.00 64.96  ? 79  GLN I O   1 
ATOM   9772  C CB  . GLN I 1 83  ? 10.008  4.886   3.364   1.00 60.34  ? 79  GLN I CB  1 
ATOM   9773  C CG  . GLN I 1 83  ? 8.950   5.866   2.890   1.00 82.61  ? 79  GLN I CG  1 
ATOM   9774  C CD  . GLN I 1 83  ? 8.104   5.298   1.766   1.00 98.87  ? 79  GLN I CD  1 
ATOM   9775  O OE1 . GLN I 1 83  ? 8.119   4.093   1.512   1.00 98.11  ? 79  GLN I OE1 1 
ATOM   9776  N NE2 . GLN I 1 83  ? 7.365   6.165   1.084   1.00 107.37 ? 79  GLN I NE2 1 
ATOM   9777  N N   . LEU I 1 84  ? 12.682  3.805   4.331   1.00 41.17  ? 80  LEU I N   1 
ATOM   9778  C CA  . LEU I 1 84  ? 13.543  2.697   4.717   1.00 43.68  ? 80  LEU I CA  1 
ATOM   9779  C C   . LEU I 1 84  ? 14.324  3.038   5.980   1.00 46.30  ? 80  LEU I C   1 
ATOM   9780  O O   . LEU I 1 84  ? 14.538  2.181   6.838   1.00 42.23  ? 80  LEU I O   1 
ATOM   9781  C CB  . LEU I 1 84  ? 14.511  2.362   3.580   1.00 46.88  ? 80  LEU I CB  1 
ATOM   9782  C CG  . LEU I 1 84  ? 13.868  1.939   2.257   1.00 36.77  ? 80  LEU I CG  1 
ATOM   9783  C CD1 . LEU I 1 84  ? 14.899  1.955   1.137   1.00 21.86  ? 80  LEU I CD1 1 
ATOM   9784  C CD2 . LEU I 1 84  ? 13.223  0.565   2.380   1.00 37.66  ? 80  LEU I CD2 1 
ATOM   9785  N N   . GLN I 1 85  ? 14.746  4.295   6.089   1.00 43.86  ? 81  GLN I N   1 
ATOM   9786  C CA  . GLN I 1 85  ? 15.527  4.746   7.236   1.00 36.43  ? 81  GLN I CA  1 
ATOM   9787  C C   . GLN I 1 85  ? 14.694  4.760   8.513   1.00 38.48  ? 81  GLN I C   1 
ATOM   9788  O O   . GLN I 1 85  ? 15.200  4.456   9.594   1.00 38.14  ? 81  GLN I O   1 
ATOM   9789  C CB  . GLN I 1 85  ? 16.099  6.140   6.977   1.00 40.59  ? 81  GLN I CB  1 
ATOM   9790  C CG  . GLN I 1 85  ? 17.192  6.168   5.926   1.00 29.21  ? 81  GLN I CG  1 
ATOM   9791  C CD  . GLN I 1 85  ? 17.909  7.498   5.872   1.00 37.60  ? 81  GLN I CD  1 
ATOM   9792  O OE1 . GLN I 1 85  ? 17.458  8.436   5.215   1.00 53.46  ? 81  GLN I OE1 1 
ATOM   9793  N NE2 . GLN I 1 85  ? 19.035  7.587   6.569   1.00 42.64  ? 81  GLN I NE2 1 
ATOM   9794  N N   . GLU I 1 86  ? 13.420  5.117   8.386   1.00 44.21  ? 82  GLU I N   1 
ATOM   9795  C CA  . GLU I 1 86  ? 12.515  5.127   9.529   1.00 47.74  ? 82  GLU I CA  1 
ATOM   9796  C C   . GLU I 1 86  ? 12.053  3.709   9.837   1.00 56.55  ? 82  GLU I C   1 
ATOM   9797  O O   . GLU I 1 86  ? 11.888  3.338   10.998  1.00 72.55  ? 82  GLU I O   1 
ATOM   9798  C CB  . GLU I 1 86  ? 11.313  6.037   9.263   1.00 49.42  ? 82  GLU I CB  1 
ATOM   9799  C CG  . GLU I 1 86  ? 10.333  6.119   10.428  1.00 60.19  ? 82  GLU I CG  1 
ATOM   9800  C CD  . GLU I 1 86  ? 9.544   7.418   10.450  1.00 72.12  ? 82  GLU I CD  1 
ATOM   9801  O OE1 . GLU I 1 86  ? 9.936   8.373   9.745   1.00 72.85  ? 82  GLU I OE1 1 
ATOM   9802  O OE2 . GLU I 1 86  ? 8.530   7.484   11.178  1.00 69.08  ? 82  GLU I OE2 1 
ATOM   9803  N N   . LEU I 1 87  ? 11.852  2.917   8.788   1.00 41.10  ? 83  LEU I N   1 
ATOM   9804  C CA  . LEU I 1 87  ? 11.507  1.511   8.946   1.00 38.53  ? 83  LEU I CA  1 
ATOM   9805  C C   . LEU I 1 87  ? 12.565  0.803   9.782   1.00 51.14  ? 83  LEU I C   1 
ATOM   9806  O O   . LEU I 1 87  ? 12.251  -0.064  10.597  1.00 62.58  ? 83  LEU I O   1 
ATOM   9807  C CB  . LEU I 1 87  ? 11.392  0.835   7.580   1.00 28.45  ? 83  LEU I CB  1 
ATOM   9808  C CG  . LEU I 1 87  ? 11.364  -0.696  7.591   1.00 24.95  ? 83  LEU I CG  1 
ATOM   9809  C CD1 . LEU I 1 87  ? 10.159  -1.219  8.364   1.00 20.00  ? 83  LEU I CD1 1 
ATOM   9810  C CD2 . LEU I 1 87  ? 11.373  -1.234  6.165   1.00 25.65  ? 83  LEU I CD2 1 
ATOM   9811  N N   . SER I 1 88  ? 13.821  1.182   9.575   1.00 43.54  ? 84  SER I N   1 
ATOM   9812  C CA  . SER I 1 88  ? 14.928  0.572   10.298  1.00 32.43  ? 84  SER I CA  1 
ATOM   9813  C C   . SER I 1 88  ? 14.935  0.999   11.763  1.00 49.09  ? 84  SER I C   1 
ATOM   9814  O O   . SER I 1 88  ? 15.346  0.233   12.633  1.00 58.57  ? 84  SER I O   1 
ATOM   9815  C CB  . SER I 1 88  ? 16.258  0.925   9.632   1.00 38.01  ? 84  SER I CB  1 
ATOM   9816  O OG  . SER I 1 88  ? 16.353  0.330   8.350   1.00 47.13  ? 84  SER I OG  1 
ATOM   9817  N N   . LEU I 1 89  ? 14.483  2.221   12.037  1.00 45.36  ? 85  LEU I N   1 
ATOM   9818  C CA  . LEU I 1 89  ? 14.344  2.681   13.415  1.00 43.54  ? 85  LEU I CA  1 
ATOM   9819  C C   . LEU I 1 89  ? 13.314  1.825   14.141  1.00 54.48  ? 85  LEU I C   1 
ATOM   9820  O O   . LEU I 1 89  ? 13.488  1.486   15.312  1.00 58.72  ? 85  LEU I O   1 
ATOM   9821  C CB  . LEU I 1 89  ? 13.928  4.155   13.469  1.00 41.35  ? 85  LEU I CB  1 
ATOM   9822  C CG  . LEU I 1 89  ? 14.977  5.182   13.035  1.00 51.49  ? 85  LEU I CG  1 
ATOM   9823  C CD1 . LEU I 1 89  ? 14.377  6.580   13.033  1.00 50.32  ? 85  LEU I CD1 1 
ATOM   9824  C CD2 . LEU I 1 89  ? 16.202  5.126   13.936  1.00 50.37  ? 85  LEU I CD2 1 
ATOM   9825  N N   . ARG I 1 90  ? 12.239  1.478   13.439  1.00 54.21  ? 86  ARG I N   1 
ATOM   9826  C CA  A ARG I 1 90  ? 11.189  0.639   14.003  0.50 50.05  ? 86  ARG I CA  1 
ATOM   9827  C CA  B ARG I 1 90  ? 11.195  0.644   14.018  0.50 50.04  ? 86  ARG I CA  1 
ATOM   9828  C C   . ARG I 1 90  ? 11.666  -0.804  14.128  1.00 50.02  ? 86  ARG I C   1 
ATOM   9829  O O   . ARG I 1 90  ? 11.230  -1.539  15.014  1.00 52.70  ? 86  ARG I O   1 
ATOM   9830  C CB  A ARG I 1 90  ? 9.933   0.684   13.128  0.50 50.12  ? 86  ARG I CB  1 
ATOM   9831  C CB  B ARG I 1 90  ? 9.919   0.719   13.177  0.50 49.01  ? 86  ARG I CB  1 
ATOM   9832  C CG  A ARG I 1 90  ? 9.337   2.073   12.947  0.50 42.89  ? 86  ARG I CG  1 
ATOM   9833  C CG  B ARG I 1 90  ? 9.400   2.132   12.950  0.50 42.87  ? 86  ARG I CG  1 
ATOM   9834  C CD  A ARG I 1 90  ? 7.921   2.007   12.387  0.50 33.83  ? 86  ARG I CD  1 
ATOM   9835  C CD  B ARG I 1 90  ? 8.016   2.123   12.315  0.50 35.09  ? 86  ARG I CD  1 
ATOM   9836  N NE  A ARG I 1 90  ? 7.811   2.623   11.063  0.50 36.61  ? 86  ARG I NE  1 
ATOM   9837  N NE  B ARG I 1 90  ? 7.645   3.429   11.774  0.50 30.10  ? 86  ARG I NE  1 
ATOM   9838  C CZ  A ARG I 1 90  ? 7.759   1.960   9.908   0.50 34.09  ? 86  ARG I CZ  1 
ATOM   9839  C CZ  B ARG I 1 90  ? 7.180   4.446   12.495  0.50 37.18  ? 86  ARG I CZ  1 
ATOM   9840  N NH1 A ARG I 1 90  ? 7.797   0.633   9.871   0.50 31.75  ? 86  ARG I NH1 1 
ATOM   9841  N NH1 B ARG I 1 90  ? 7.026   4.329   13.808  0.50 48.31  ? 86  ARG I NH1 1 
ATOM   9842  N NH2 A ARG I 1 90  ? 7.662   2.635   8.771   0.50 20.20  ? 86  ARG I NH2 1 
ATOM   9843  N NH2 B ARG I 1 90  ? 6.873   5.590   11.901  0.50 40.86  ? 86  ARG I NH2 1 
ATOM   9844  N N   . LEU I 1 91  ? 12.561  -1.205  13.230  1.00 54.58  ? 87  LEU I N   1 
ATOM   9845  C CA  . LEU I 1 91  ? 13.054  -2.581  13.197  1.00 53.26  ? 87  LEU I CA  1 
ATOM   9846  C C   . LEU I 1 91  ? 14.055  -2.903  14.303  1.00 56.23  ? 87  LEU I C   1 
ATOM   9847  O O   . LEU I 1 91  ? 14.236  -4.068  14.651  1.00 65.21  ? 87  LEU I O   1 
ATOM   9848  C CB  . LEU I 1 91  ? 13.689  -2.888  11.837  1.00 47.10  ? 87  LEU I CB  1 
ATOM   9849  C CG  . LEU I 1 91  ? 12.768  -3.471  10.764  1.00 56.08  ? 87  LEU I CG  1 
ATOM   9850  C CD1 . LEU I 1 91  ? 13.510  -3.596  9.441   1.00 48.55  ? 87  LEU I CD1 1 
ATOM   9851  C CD2 . LEU I 1 91  ? 12.217  -4.825  11.197  1.00 63.99  ? 87  LEU I CD2 1 
ATOM   9852  N N   . LYS I 1 92  ? 14.705  -1.884  14.856  1.00 65.71  ? 88  LYS I N   1 
ATOM   9853  C CA  . LYS I 1 92  ? 15.701  -2.111  15.901  1.00 72.84  ? 88  LYS I CA  1 
ATOM   9854  C C   . LYS I 1 92  ? 15.084  -2.735  17.154  1.00 61.20  ? 88  LYS I C   1 
ATOM   9855  O O   . LYS I 1 92  ? 15.799  -3.179  18.053  1.00 71.82  ? 88  LYS I O   1 
ATOM   9856  C CB  . LYS I 1 92  ? 16.423  -0.811  16.260  1.00 74.46  ? 88  LYS I CB  1 
ATOM   9857  C CG  . LYS I 1 92  ? 17.380  -0.328  15.184  1.00 78.69  ? 88  LYS I CG  1 
ATOM   9858  C CD  . LYS I 1 92  ? 18.464  0.566   15.761  1.00 92.64  ? 88  LYS I CD  1 
ATOM   9859  C CE  . LYS I 1 92  ? 19.458  0.988   14.691  1.00 99.64  ? 88  LYS I CE  1 
ATOM   9860  N NZ  . LYS I 1 92  ? 20.753  1.443   15.268  1.00 95.40  ? 88  LYS I NZ  1 
ATOM   9861  N N   . SER I 1 93  ? 13.756  -2.766  17.209  1.00 48.53  ? 89  SER I N   1 
ATOM   9862  C CA  . SER I 1 93  ? 13.051  -3.415  18.306  1.00 58.17  ? 89  SER I CA  1 
ATOM   9863  C C   . SER I 1 93  ? 12.886  -4.910  18.034  1.00 71.37  ? 89  SER I C   1 
ATOM   9864  O O   . SER I 1 93  ? 12.337  -5.641  18.859  1.00 70.75  ? 89  SER I O   1 
ATOM   9865  C CB  . SER I 1 93  ? 11.679  -2.770  18.501  1.00 64.88  ? 89  SER I CB  1 
ATOM   9866  O OG  . SER I 1 93  ? 11.795  -1.371  18.697  1.00 75.08  ? 89  SER I OG  1 
ATOM   9867  N N   . CYS I 1 94  ? 13.361  -5.351  16.872  1.00 74.45  ? 90  CYS I N   1 
ATOM   9868  C CA  . CYS I 1 94  ? 13.289  -6.755  16.480  1.00 72.34  ? 90  CYS I CA  1 
ATOM   9869  C C   . CYS I 1 94  ? 14.665  -7.417  16.537  1.00 75.54  ? 90  CYS I C   1 
ATOM   9870  O O   . CYS I 1 94  ? 14.768  -8.643  16.577  1.00 84.94  ? 90  CYS I O   1 
ATOM   9871  C CB  . CYS I 1 94  ? 12.715  -6.886  15.067  1.00 67.99  ? 90  CYS I CB  1 
ATOM   9872  S SG  . CYS I 1 94  ? 11.051  -6.207  14.856  1.00 78.96  ? 90  CYS I SG  1 
ATOM   9873  N N   . PHE I 1 95  ? 15.717  -6.601  16.525  1.00 65.36  ? 91  PHE I N   1 
ATOM   9874  C CA  . PHE I 1 95  ? 17.086  -7.098  16.620  1.00 59.76  ? 91  PHE I CA  1 
ATOM   9875  C C   . PHE I 1 95  ? 17.651  -6.861  18.018  1.00 67.10  ? 91  PHE I C   1 
ATOM   9876  O O   . PHE I 1 95  ? 17.719  -5.720  18.477  1.00 68.03  ? 91  PHE I O   1 
ATOM   9877  C CB  . PHE I 1 95  ? 17.983  -6.389  15.604  1.00 55.53  ? 91  PHE I CB  1 
ATOM   9878  C CG  . PHE I 1 95  ? 17.707  -6.763  14.175  1.00 48.38  ? 91  PHE I CG  1 
ATOM   9879  C CD1 . PHE I 1 95  ? 16.701  -6.134  13.461  1.00 59.95  ? 91  PHE I CD1 1 
ATOM   9880  C CD2 . PHE I 1 95  ? 18.469  -7.728  13.540  1.00 33.96  ? 91  PHE I CD2 1 
ATOM   9881  C CE1 . PHE I 1 95  ? 16.452  -6.470  12.140  1.00 49.02  ? 91  PHE I CE1 1 
ATOM   9882  C CE2 . PHE I 1 95  ? 18.225  -8.069  12.219  1.00 35.15  ? 91  PHE I CE2 1 
ATOM   9883  C CZ  . PHE I 1 95  ? 17.216  -7.438  11.519  1.00 30.97  ? 91  PHE I CZ  1 
ATOM   9884  N N   . THR I 1 96  ? 18.062  -7.934  18.690  1.00 68.41  ? 92  THR I N   1 
ATOM   9885  C CA  . THR I 1 96  ? 18.692  -7.807  20.003  1.00 75.83  ? 92  THR I CA  1 
ATOM   9886  C C   . THR I 1 96  ? 20.173  -7.480  19.840  1.00 90.70  ? 92  THR I C   1 
ATOM   9887  O O   . THR I 1 96  ? 20.868  -8.091  19.028  1.00 96.08  ? 92  THR I O   1 
ATOM   9888  C CB  . THR I 1 96  ? 18.552  -9.090  20.843  1.00 64.86  ? 92  THR I CB  1 
ATOM   9889  O OG1 . THR I 1 96  ? 19.239  -10.171 20.199  1.00 79.63  ? 92  THR I OG1 1 
ATOM   9890  C CG2 . THR I 1 96  ? 17.085  -9.452  21.031  1.00 57.40  ? 92  THR I CG2 1 
ATOM   9891  N N   . LYS I 1 97  ? 20.649  -6.516  20.620  1.00 94.74  ? 93  LYS I N   1 
ATOM   9892  C CA  . LYS I 1 97  ? 22.028  -6.056  20.514  1.00 93.36  ? 93  LYS I CA  1 
ATOM   9893  C C   . LYS I 1 97  ? 23.023  -7.150  20.888  1.00 96.98  ? 93  LYS I C   1 
ATOM   9894  O O   . LYS I 1 97  ? 22.752  -7.985  21.753  1.00 81.34  ? 93  LYS I O   1 
ATOM   9895  C CB  . LYS I 1 97  ? 22.245  -4.829  21.403  1.00 91.34  ? 93  LYS I CB  1 
ATOM   9896  C CG  . LYS I 1 97  ? 21.397  -3.624  21.019  1.00 91.41  ? 93  LYS I CG  1 
ATOM   9897  C CD  . LYS I 1 97  ? 21.717  -3.136  19.614  1.00 95.03  ? 93  LYS I CD  1 
ATOM   9898  C CE  . LYS I 1 97  ? 20.913  -1.896  19.258  1.00 97.43  ? 93  LYS I CE  1 
ATOM   9899  N NZ  . LYS I 1 97  ? 21.240  -1.393  17.896  1.00 93.31  ? 93  LYS I NZ  1 
ATOM   9900  N N   . ASP I 1 98  ? 24.174  -7.138  20.222  1.00 109.25 ? 94  ASP I N   1 
ATOM   9901  C CA  . ASP I 1 98  ? 25.247  -8.086  20.504  1.00 110.68 ? 94  ASP I CA  1 
ATOM   9902  C C   . ASP I 1 98  ? 26.555  -7.355  20.797  1.00 108.58 ? 94  ASP I C   1 
ATOM   9903  O O   . ASP I 1 98  ? 27.070  -6.618  19.955  1.00 106.52 ? 94  ASP I O   1 
ATOM   9904  C CB  . ASP I 1 98  ? 25.435  -9.044  19.325  1.00 109.53 ? 94  ASP I CB  1 
ATOM   9905  C CG  . ASP I 1 98  ? 24.425  -10.177 19.326  1.00 101.35 ? 94  ASP I CG  1 
ATOM   9906  O OD1 . ASP I 1 98  ? 23.962  -10.564 20.419  1.00 100.73 ? 94  ASP I OD1 1 
ATOM   9907  O OD2 . ASP I 1 98  ? 24.099  -10.684 18.232  1.00 88.38  ? 94  ASP I OD2 1 
ATOM   9908  N N   . LYS I 1 104 ? 33.555  -2.531  13.322  1.00 82.37  ? 100 LYS I N   1 
ATOM   9909  C CA  . LYS I 1 104 ? 33.974  -3.044  12.022  1.00 83.21  ? 100 LYS I CA  1 
ATOM   9910  C C   . LYS I 1 104 ? 34.447  -4.494  12.118  1.00 80.13  ? 100 LYS I C   1 
ATOM   9911  O O   . LYS I 1 104 ? 35.473  -4.863  11.547  1.00 72.23  ? 100 LYS I O   1 
ATOM   9912  C CB  . LYS I 1 104 ? 35.077  -2.161  11.431  1.00 85.10  ? 100 LYS I CB  1 
ATOM   9913  C CG  . LYS I 1 104 ? 34.553  -0.947  10.679  1.00 89.53  ? 100 LYS I CG  1 
ATOM   9914  C CD  . LYS I 1 104 ? 35.664  0.032   10.347  1.00 90.89  ? 100 LYS I CD  1 
ATOM   9915  C CE  . LYS I 1 104 ? 36.021  0.891   11.547  1.00 87.55  ? 100 LYS I CE  1 
ATOM   9916  N NZ  . LYS I 1 104 ? 37.163  1.801   11.269  1.00 87.34  ? 100 LYS I NZ  1 
ATOM   9917  N N   . ALA I 1 105 ? 33.691  -5.311  12.845  1.00 87.26  ? 101 ALA I N   1 
ATOM   9918  C CA  . ALA I 1 105 ? 33.978  -6.737  12.944  1.00 98.12  ? 101 ALA I CA  1 
ATOM   9919  C C   . ALA I 1 105 ? 33.168  -7.498  11.899  1.00 101.74 ? 101 ALA I C   1 
ATOM   9920  O O   . ALA I 1 105 ? 31.952  -7.332  11.809  1.00 100.30 ? 101 ALA I O   1 
ATOM   9921  C CB  . ALA I 1 105 ? 33.654  -7.246  14.338  1.00 95.74  ? 101 ALA I CB  1 
ATOM   9922  N N   . CYS I 1 106 ? 33.847  -8.329  11.114  1.00 99.68  ? 102 CYS I N   1 
ATOM   9923  C CA  . CYS I 1 106 ? 33.204  -9.085  10.042  1.00 94.32  ? 102 CYS I CA  1 
ATOM   9924  C C   . CYS I 1 106 ? 32.736  -8.166  8.917   1.00 92.57  ? 102 CYS I C   1 
ATOM   9925  O O   . CYS I 1 106 ? 31.698  -8.409  8.300   1.00 93.25  ? 102 CYS I O   1 
ATOM   9926  C CB  . CYS I 1 106 ? 32.021  -9.892  10.584  1.00 94.01  ? 102 CYS I CB  1 
ATOM   9927  S SG  . CYS I 1 106 ? 32.456  -11.030 11.915  1.00 141.25 ? 102 CYS I SG  1 
ATOM   9928  N N   . VAL I 1 107 ? 33.508  -7.116  8.650   1.00 89.49  ? 103 VAL I N   1 
ATOM   9929  C CA  . VAL I 1 107 ? 33.185  -6.182  7.577   1.00 77.56  ? 103 VAL I CA  1 
ATOM   9930  C C   . VAL I 1 107 ? 34.419  -5.883  6.733   1.00 73.31  ? 103 VAL I C   1 
ATOM   9931  O O   . VAL I 1 107 ? 35.546  -5.946  7.224   1.00 83.46  ? 103 VAL I O   1 
ATOM   9932  C CB  . VAL I 1 107 ? 32.626  -4.851  8.128   1.00 66.86  ? 103 VAL I CB  1 
ATOM   9933  C CG1 . VAL I 1 107 ? 31.614  -5.115  9.237   1.00 51.73  ? 103 VAL I CG1 1 
ATOM   9934  C CG2 . VAL I 1 107 ? 33.753  -3.959  8.633   1.00 53.25  ? 103 VAL I CG2 1 
ATOM   9935  N N   . ARG I 1 108 ? 34.195  -5.560  5.463   1.00 59.66  ? 104 ARG I N   1 
ATOM   9936  C CA  . ARG I 1 108 ? 35.279  -5.215  4.550   1.00 67.11  ? 104 ARG I CA  1 
ATOM   9937  C C   . ARG I 1 108 ? 34.873  -4.049  3.660   1.00 80.49  ? 104 ARG I C   1 
ATOM   9938  O O   . ARG I 1 108 ? 33.695  -3.703  3.574   1.00 93.72  ? 104 ARG I O   1 
ATOM   9939  C CB  . ARG I 1 108 ? 35.649  -6.415  3.676   1.00 58.14  ? 104 ARG I CB  1 
ATOM   9940  C CG  . ARG I 1 108 ? 34.461  -7.027  2.957   1.00 62.72  ? 104 ARG I CG  1 
ATOM   9941  C CD  . ARG I 1 108 ? 34.878  -7.900  1.786   1.00 70.09  ? 104 ARG I CD  1 
ATOM   9942  N NE  . ARG I 1 108 ? 35.312  -7.106  0.638   1.00 81.99  ? 104 ARG I NE  1 
ATOM   9943  C CZ  . ARG I 1 108 ? 35.400  -7.569  -0.607  1.00 80.56  ? 104 ARG I CZ  1 
ATOM   9944  N NH1 . ARG I 1 108 ? 35.081  -8.826  -0.884  1.00 78.19  ? 104 ARG I NH1 1 
ATOM   9945  N NH2 . ARG I 1 108 ? 35.802  -6.768  -1.585  1.00 81.02  ? 104 ARG I NH2 1 
ATOM   9946  N N   . THR I 1 109 ? 35.854  -3.449  2.995   1.00 74.56  ? 105 THR I N   1 
ATOM   9947  C CA  . THR I 1 109 ? 35.590  -2.372  2.051   1.00 72.49  ? 105 THR I CA  1 
ATOM   9948  C C   . THR I 1 109 ? 35.377  -2.959  0.661   1.00 72.76  ? 105 THR I C   1 
ATOM   9949  O O   . THR I 1 109 ? 36.073  -3.892  0.260   1.00 70.62  ? 105 THR I O   1 
ATOM   9950  C CB  . THR I 1 109 ? 36.748  -1.356  2.011   1.00 77.17  ? 105 THR I CB  1 
ATOM   9951  O OG1 . THR I 1 109 ? 36.871  -0.714  3.287   1.00 80.40  ? 105 THR I OG1 1 
ATOM   9952  C CG2 . THR I 1 109 ? 36.501  -0.299  0.942   1.00 71.25  ? 105 THR I CG2 1 
ATOM   9953  N N   . PHE I 1 110 ? 34.407  -2.412  -0.065  1.00 76.88  ? 106 PHE I N   1 
ATOM   9954  C CA  . PHE I 1 110 ? 34.060  -2.910  -1.391  1.00 69.43  ? 106 PHE I CA  1 
ATOM   9955  C C   . PHE I 1 110 ? 34.335  -1.872  -2.468  1.00 70.34  ? 106 PHE I C   1 
ATOM   9956  O O   . PHE I 1 110 ? 34.139  -0.676  -2.257  1.00 62.65  ? 106 PHE I O   1 
ATOM   9957  C CB  . PHE I 1 110 ? 32.581  -3.293  -1.441  1.00 62.79  ? 106 PHE I CB  1 
ATOM   9958  C CG  . PHE I 1 110 ? 32.246  -4.530  -0.660  1.00 52.93  ? 106 PHE I CG  1 
ATOM   9959  C CD1 . PHE I 1 110 ? 32.103  -4.479  0.717   1.00 54.56  ? 106 PHE I CD1 1 
ATOM   9960  C CD2 . PHE I 1 110 ? 32.064  -5.742  -1.305  1.00 47.37  ? 106 PHE I CD2 1 
ATOM   9961  C CE1 . PHE I 1 110 ? 31.791  -5.617  1.437   1.00 61.37  ? 106 PHE I CE1 1 
ATOM   9962  C CE2 . PHE I 1 110 ? 31.752  -6.882  -0.591  1.00 63.54  ? 106 PHE I CE2 1 
ATOM   9963  C CZ  . PHE I 1 110 ? 31.615  -6.819  0.782   1.00 71.56  ? 106 PHE I CZ  1 
ATOM   9964  N N   . TYR I 1 111 ? 34.795  -2.342  -3.622  1.00 87.42  ? 107 TYR I N   1 
ATOM   9965  C CA  . TYR I 1 111 ? 34.938  -1.498  -4.800  1.00 93.67  ? 107 TYR I CA  1 
ATOM   9966  C C   . TYR I 1 111 ? 33.982  -2.013  -5.865  1.00 86.53  ? 107 TYR I C   1 
ATOM   9967  O O   . TYR I 1 111 ? 34.383  -2.740  -6.773  1.00 87.68  ? 107 TYR I O   1 
ATOM   9968  C CB  . TYR I 1 111 ? 36.374  -1.531  -5.323  1.00 98.27  ? 107 TYR I CB  1 
ATOM   9969  C CG  . TYR I 1 111 ? 37.402  -1.092  -4.307  1.00 98.97  ? 107 TYR I CG  1 
ATOM   9970  C CD1 . TYR I 1 111 ? 37.713  0.251   -4.143  1.00 102.43 ? 107 TYR I CD1 1 
ATOM   9971  C CD2 . TYR I 1 111 ? 38.063  -2.019  -3.513  1.00 94.16  ? 107 TYR I CD2 1 
ATOM   9972  C CE1 . TYR I 1 111 ? 38.652  0.659   -3.215  1.00 100.01 ? 107 TYR I CE1 1 
ATOM   9973  C CE2 . TYR I 1 111 ? 39.004  -1.621  -2.582  1.00 93.52  ? 107 TYR I CE2 1 
ATOM   9974  C CZ  . TYR I 1 111 ? 39.295  -0.280  -2.438  1.00 94.76  ? 107 TYR I CZ  1 
ATOM   9975  O OH  . TYR I 1 111 ? 40.231  0.122   -1.513  1.00 90.14  ? 107 TYR I OH  1 
ATOM   9976  N N   . GLU I 1 112 ? 32.713  -1.640  -5.744  1.00 78.67  ? 108 GLU I N   1 
ATOM   9977  C CA  . GLU I 1 112 ? 31.680  -2.165  -6.627  1.00 79.29  ? 108 GLU I CA  1 
ATOM   9978  C C   . GLU I 1 112 ? 30.732  -1.067  -7.095  1.00 94.41  ? 108 GLU I C   1 
ATOM   9979  O O   . GLU I 1 112 ? 30.677  0.011   -6.507  1.00 101.69 ? 108 GLU I O   1 
ATOM   9980  C CB  . GLU I 1 112 ? 30.903  -3.274  -5.916  1.00 63.92  ? 108 GLU I CB  1 
ATOM   9981  C CG  . GLU I 1 112 ? 31.788  -4.422  -5.450  1.00 66.57  ? 108 GLU I CG  1 
ATOM   9982  C CD  . GLU I 1 112 ? 31.010  -5.542  -4.786  1.00 65.58  ? 108 GLU I CD  1 
ATOM   9983  O OE1 . GLU I 1 112 ? 31.560  -6.660  -4.670  1.00 36.93  ? 108 GLU I OE1 1 
ATOM   9984  O OE2 . GLU I 1 112 ? 29.852  -5.306  -4.378  1.00 76.37  ? 108 GLU I OE2 1 
ATOM   9985  N N   . THR I 1 113 ? 29.987  -1.356  -8.159  1.00 88.28  ? 109 THR I N   1 
ATOM   9986  C CA  . THR I 1 113 ? 29.082  -0.379  -8.753  1.00 74.08  ? 109 THR I CA  1 
ATOM   9987  C C   . THR I 1 113 ? 27.969  -0.023  -7.774  1.00 83.22  ? 109 THR I C   1 
ATOM   9988  O O   . THR I 1 113 ? 27.756  -0.729  -6.786  1.00 91.79  ? 109 THR I O   1 
ATOM   9989  C CB  . THR I 1 113 ? 28.434  -0.913  -10.052 1.00 51.72  ? 109 THR I CB  1 
ATOM   9990  O OG1 . THR I 1 113 ? 27.507  -1.960  -9.735  1.00 52.07  ? 109 THR I OG1 1 
ATOM   9991  C CG2 . THR I 1 113 ? 29.487  -1.440  -11.023 1.00 41.32  ? 109 THR I CG2 1 
ATOM   9992  N N   . PRO I 1 114 ? 27.256  1.081   -8.040  1.00 76.42  ? 110 PRO I N   1 
ATOM   9993  C CA  . PRO I 1 114 ? 26.095  1.431   -7.217  1.00 76.92  ? 110 PRO I CA  1 
ATOM   9994  C C   . PRO I 1 114 ? 25.004  0.372   -7.339  1.00 74.12  ? 110 PRO I C   1 
ATOM   9995  O O   . PRO I 1 114 ? 24.277  0.113   -6.381  1.00 65.62  ? 110 PRO I O   1 
ATOM   9996  C CB  . PRO I 1 114 ? 25.622  2.761   -7.818  1.00 68.24  ? 110 PRO I CB  1 
ATOM   9997  C CG  . PRO I 1 114 ? 26.797  3.292   -8.572  1.00 60.28  ? 110 PRO I CG  1 
ATOM   9998  C CD  . PRO I 1 114 ? 27.518  2.089   -9.080  1.00 68.40  ? 110 PRO I CD  1 
ATOM   9999  N N   . LEU I 1 115 ? 24.904  -0.236  -8.517  1.00 63.72  ? 111 LEU I N   1 
ATOM   10000 C CA  . LEU I 1 115 ? 23.905  -1.266  -8.773  1.00 60.93  ? 111 LEU I CA  1 
ATOM   10001 C C   . LEU I 1 115 ? 24.224  -2.550  -8.014  1.00 52.37  ? 111 LEU I C   1 
ATOM   10002 O O   . LEU I 1 115 ? 23.318  -3.269  -7.594  1.00 54.54  ? 111 LEU I O   1 
ATOM   10003 C CB  . LEU I 1 115 ? 23.816  -1.551  -10.272 1.00 65.37  ? 111 LEU I CB  1 
ATOM   10004 C CG  . LEU I 1 115 ? 23.225  -0.408  -11.098 1.00 63.28  ? 111 LEU I CG  1 
ATOM   10005 C CD1 . LEU I 1 115 ? 23.777  -0.417  -12.511 1.00 67.25  ? 111 LEU I CD1 1 
ATOM   10006 C CD2 . LEU I 1 115 ? 21.707  -0.501  -11.116 1.00 46.07  ? 111 LEU I CD2 1 
ATOM   10007 N N   . GLN I 1 116 ? 25.512  -2.836  -7.844  1.00 37.77  ? 112 GLN I N   1 
ATOM   10008 C CA  . GLN I 1 116 ? 25.934  -3.998  -7.070  1.00 45.18  ? 112 GLN I CA  1 
ATOM   10009 C C   . GLN I 1 116 ? 25.689  -3.749  -5.587  1.00 56.52  ? 112 GLN I C   1 
ATOM   10010 O O   . GLN I 1 116 ? 25.365  -4.671  -4.838  1.00 58.88  ? 112 GLN I O   1 
ATOM   10011 C CB  . GLN I 1 116 ? 27.410  -4.319  -7.324  1.00 62.36  ? 112 GLN I CB  1 
ATOM   10012 C CG  . GLN I 1 116 ? 27.672  -4.977  -8.676  1.00 80.77  ? 112 GLN I CG  1 
ATOM   10013 C CD  . GLN I 1 116 ? 29.136  -5.313  -8.897  1.00 82.57  ? 112 GLN I CD  1 
ATOM   10014 O OE1 . GLN I 1 116 ? 29.987  -4.426  -8.958  1.00 85.66  ? 112 GLN I OE1 1 
ATOM   10015 N NE2 . GLN I 1 116 ? 29.436  -6.602  -9.018  1.00 78.98  ? 112 GLN I NE2 1 
ATOM   10016 N N   . LEU I 1 117 ? 25.842  -2.497  -5.170  1.00 61.90  ? 113 LEU I N   1 
ATOM   10017 C CA  . LEU I 1 117 ? 25.521  -2.109  -3.804  1.00 63.17  ? 113 LEU I CA  1 
ATOM   10018 C C   . LEU I 1 117 ? 24.019  -2.226  -3.573  1.00 66.81  ? 113 LEU I C   1 
ATOM   10019 O O   . LEU I 1 117 ? 23.572  -2.955  -2.688  1.00 77.36  ? 113 LEU I O   1 
ATOM   10020 C CB  . LEU I 1 117 ? 25.978  -0.675  -3.530  1.00 57.32  ? 113 LEU I CB  1 
ATOM   10021 C CG  . LEU I 1 117 ? 25.511  -0.079  -2.198  1.00 39.51  ? 113 LEU I CG  1 
ATOM   10022 C CD1 . LEU I 1 117 ? 25.955  -0.947  -1.030  1.00 25.40  ? 113 LEU I CD1 1 
ATOM   10023 C CD2 . LEU I 1 117 ? 26.020  1.347   -2.032  1.00 36.76  ? 113 LEU I CD2 1 
ATOM   10024 N N   . LEU I 1 118 ? 23.247  -1.507  -4.381  1.00 53.07  ? 114 LEU I N   1 
ATOM   10025 C CA  . LEU I 1 118 ? 21.795  -1.495  -4.248  1.00 56.05  ? 114 LEU I CA  1 
ATOM   10026 C C   . LEU I 1 118 ? 21.228  -2.912  -4.226  1.00 61.17  ? 114 LEU I C   1 
ATOM   10027 O O   . LEU I 1 118 ? 20.245  -3.184  -3.534  1.00 54.90  ? 114 LEU I O   1 
ATOM   10028 C CB  . LEU I 1 118 ? 21.161  -0.695  -5.388  1.00 48.47  ? 114 LEU I CB  1 
ATOM   10029 C CG  . LEU I 1 118 ? 21.413  0.815   -5.366  1.00 50.73  ? 114 LEU I CG  1 
ATOM   10030 C CD1 . LEU I 1 118 ? 21.011  1.452   -6.685  1.00 43.42  ? 114 LEU I CD1 1 
ATOM   10031 C CD2 . LEU I 1 118 ? 20.662  1.461   -4.214  1.00 41.14  ? 114 LEU I CD2 1 
ATOM   10032 N N   . GLU I 1 119 ? 21.850  -3.812  -4.980  1.00 57.90  ? 115 GLU I N   1 
ATOM   10033 C CA  . GLU I 1 119 ? 21.411  -5.200  -5.015  1.00 58.89  ? 115 GLU I CA  1 
ATOM   10034 C C   . GLU I 1 119 ? 21.596  -5.825  -3.637  1.00 58.60  ? 115 GLU I C   1 
ATOM   10035 O O   . GLU I 1 119 ? 20.701  -6.499  -3.124  1.00 73.50  ? 115 GLU I O   1 
ATOM   10036 C CB  . GLU I 1 119 ? 22.199  -5.990  -6.061  1.00 71.90  ? 115 GLU I CB  1 
ATOM   10037 C CG  . GLU I 1 119 ? 21.525  -7.282  -6.492  1.00 93.73  ? 115 GLU I CG  1 
ATOM   10038 C CD  . GLU I 1 119 ? 20.270  -7.037  -7.308  1.00 104.87 ? 115 GLU I CD  1 
ATOM   10039 O OE1 . GLU I 1 119 ? 20.328  -6.231  -8.261  1.00 102.24 ? 115 GLU I OE1 1 
ATOM   10040 O OE2 . GLU I 1 119 ? 19.225  -7.646  -6.994  1.00 108.61 ? 115 GLU I OE2 1 
ATOM   10041 N N   . LYS I 1 120 ? 22.762  -5.592  -3.041  1.00 50.65  ? 116 LYS I N   1 
ATOM   10042 C CA  . LYS I 1 120 ? 23.055  -6.098  -1.706  1.00 47.97  ? 116 LYS I CA  1 
ATOM   10043 C C   . LYS I 1 120 ? 22.028  -5.592  -0.702  1.00 50.32  ? 116 LYS I C   1 
ATOM   10044 O O   . LYS I 1 120 ? 21.530  -6.352  0.125   1.00 51.86  ? 116 LYS I O   1 
ATOM   10045 C CB  . LYS I 1 120 ? 24.456  -5.670  -1.263  1.00 63.41  ? 116 LYS I CB  1 
ATOM   10046 C CG  . LYS I 1 120 ? 25.581  -6.516  -1.831  1.00 74.81  ? 116 LYS I CG  1 
ATOM   10047 C CD  . LYS I 1 120 ? 26.936  -6.033  -1.334  1.00 70.72  ? 116 LYS I CD  1 
ATOM   10048 C CE  . LYS I 1 120 ? 28.021  -7.077  -1.547  1.00 67.52  ? 116 LYS I CE  1 
ATOM   10049 N NZ  . LYS I 1 120 ? 28.211  -7.419  -2.985  1.00 69.69  ? 116 LYS I NZ  1 
ATOM   10050 N N   . VAL I 1 121 ? 21.719  -4.302  -0.779  1.00 57.82  ? 117 VAL I N   1 
ATOM   10051 C CA  . VAL I 1 121 ? 20.775  -3.684  0.144   1.00 50.47  ? 117 VAL I CA  1 
ATOM   10052 C C   . VAL I 1 121 ? 19.396  -4.311  -0.013  1.00 50.26  ? 117 VAL I C   1 
ATOM   10053 O O   . VAL I 1 121 ? 18.746  -4.658  0.974   1.00 40.52  ? 117 VAL I O   1 
ATOM   10054 C CB  . VAL I 1 121 ? 20.666  -2.165  -0.089  1.00 43.27  ? 117 VAL I CB  1 
ATOM   10055 C CG1 . VAL I 1 121 ? 19.640  -1.551  0.859   1.00 44.87  ? 117 VAL I CG1 1 
ATOM   10056 C CG2 . VAL I 1 121 ? 22.024  -1.499  0.087   1.00 28.69  ? 117 VAL I CG2 1 
ATOM   10057 N N   . LYS I 1 122 ? 18.952  -4.450  -1.258  1.00 54.91  ? 118 LYS I N   1 
ATOM   10058 C CA  . LYS I 1 122 ? 17.664  -5.067  -1.546  1.00 66.14  ? 118 LYS I CA  1 
ATOM   10059 C C   . LYS I 1 122 ? 17.588  -6.463  -0.944  1.00 73.16  ? 118 LYS I C   1 
ATOM   10060 O O   . LYS I 1 122 ? 16.575  -6.841  -0.355  1.00 82.45  ? 118 LYS I O   1 
ATOM   10061 C CB  . LYS I 1 122 ? 17.430  -5.142  -3.056  1.00 74.86  ? 118 LYS I CB  1 
ATOM   10062 C CG  . LYS I 1 122 ? 16.361  -6.147  -3.460  1.00 78.04  ? 118 LYS I CG  1 
ATOM   10063 C CD  . LYS I 1 122 ? 16.049  -6.084  -4.947  1.00 79.95  ? 118 LYS I CD  1 
ATOM   10064 C CE  . LYS I 1 122 ? 15.765  -7.469  -5.512  1.00 84.52  ? 118 LYS I CE  1 
ATOM   10065 N NZ  . LYS I 1 122 ? 16.981  -8.087  -6.109  1.00 85.48  ? 118 LYS I NZ  1 
ATOM   10066 N N   . ASN I 1 123 ? 18.667  -7.226  -1.092  1.00 58.54  ? 119 ASN I N   1 
ATOM   10067 C CA  . ASN I 1 123 ? 18.712  -8.592  -0.587  1.00 54.08  ? 119 ASN I CA  1 
ATOM   10068 C C   . ASN I 1 123 ? 18.536  -8.646  0.929   1.00 47.37  ? 119 ASN I C   1 
ATOM   10069 O O   . ASN I 1 123 ? 17.926  -9.575  1.458   1.00 56.37  ? 119 ASN I O   1 
ATOM   10070 C CB  . ASN I 1 123 ? 20.030  -9.260  -0.986  1.00 54.34  ? 119 ASN I CB  1 
ATOM   10071 C CG  . ASN I 1 123 ? 20.100  -10.714 -0.557  1.00 71.41  ? 119 ASN I CG  1 
ATOM   10072 O OD1 . ASN I 1 123 ? 20.649  -11.037 0.497   1.00 60.99  ? 119 ASN I OD1 1 
ATOM   10073 N ND2 . ASN I 1 123 ? 19.540  -11.599 -1.375  1.00 79.45  ? 119 ASN I ND2 1 
ATOM   10074 N N   . VAL I 1 124 ? 19.071  -7.645  1.621   1.00 28.60  ? 120 VAL I N   1 
ATOM   10075 C CA  . VAL I 1 124 ? 18.980  -7.585  3.075   1.00 32.90  ? 120 VAL I CA  1 
ATOM   10076 C C   . VAL I 1 124 ? 17.531  -7.468  3.536   1.00 35.02  ? 120 VAL I C   1 
ATOM   10077 O O   . VAL I 1 124 ? 17.049  -8.301  4.302   1.00 37.87  ? 120 VAL I O   1 
ATOM   10078 C CB  . VAL I 1 124 ? 19.790  -6.399  3.641   1.00 49.08  ? 120 VAL I CB  1 
ATOM   10079 C CG1 . VAL I 1 124 ? 19.439  -6.154  5.106   1.00 47.93  ? 120 VAL I CG1 1 
ATOM   10080 C CG2 . VAL I 1 124 ? 21.281  -6.653  3.484   1.00 50.96  ? 120 VAL I CG2 1 
ATOM   10081 N N   . PHE I 1 125 ? 16.841  -6.433  3.069   1.00 42.19  ? 121 PHE I N   1 
ATOM   10082 C CA  . PHE I 1 125 ? 15.460  -6.189  3.478   1.00 36.28  ? 121 PHE I CA  1 
ATOM   10083 C C   . PHE I 1 125 ? 14.542  -7.343  3.085   1.00 45.80  ? 121 PHE I C   1 
ATOM   10084 O O   . PHE I 1 125 ? 13.598  -7.665  3.808   1.00 47.15  ? 121 PHE I O   1 
ATOM   10085 C CB  . PHE I 1 125 ? 14.941  -4.881  2.876   1.00 29.52  ? 121 PHE I CB  1 
ATOM   10086 C CG  . PHE I 1 125 ? 15.340  -3.655  3.651   1.00 25.03  ? 121 PHE I CG  1 
ATOM   10087 C CD1 . PHE I 1 125 ? 14.614  -3.255  4.761   1.00 39.40  ? 121 PHE I CD1 1 
ATOM   10088 C CD2 . PHE I 1 125 ? 16.436  -2.901  3.267   1.00 23.19  ? 121 PHE I CD2 1 
ATOM   10089 C CE1 . PHE I 1 125 ? 14.977  -2.129  5.477   1.00 49.22  ? 121 PHE I CE1 1 
ATOM   10090 C CE2 . PHE I 1 125 ? 16.803  -1.774  3.979   1.00 31.25  ? 121 PHE I CE2 1 
ATOM   10091 C CZ  . PHE I 1 125 ? 16.073  -1.388  5.084   1.00 42.20  ? 121 PHE I CZ  1 
ATOM   10092 N N   . ASN I 1 126 ? 14.824  -7.962  1.942   1.00 46.63  ? 122 ASN I N   1 
ATOM   10093 C CA  . ASN I 1 126 ? 14.008  -9.066  1.450   1.00 45.73  ? 122 ASN I CA  1 
ATOM   10094 C C   . ASN I 1 126 ? 14.114  -10.292 2.345   1.00 36.08  ? 122 ASN I C   1 
ATOM   10095 O O   . ASN I 1 126 ? 13.126  -10.726 2.935   1.00 44.01  ? 122 ASN I O   1 
ATOM   10096 C CB  . ASN I 1 126 ? 14.401  -9.433  0.017   1.00 50.80  ? 122 ASN I CB  1 
ATOM   10097 C CG  . ASN I 1 126 ? 13.899  -8.429  -1.001  1.00 51.10  ? 122 ASN I CG  1 
ATOM   10098 O OD1 . ASN I 1 126 ? 12.906  -7.740  -0.770  1.00 46.31  ? 122 ASN I OD1 1 
ATOM   10099 N ND2 . ASN I 1 126 ? 14.580  -8.344  -2.138  1.00 66.49  ? 122 ASN I ND2 1 
ATOM   10100 N N   . GLU I 1 127 ? 15.316  -10.848 2.446   1.00 40.67  ? 123 GLU I N   1 
ATOM   10101 C CA  . GLU I 1 127 ? 15.536  -12.028 3.274   1.00 55.60  ? 123 GLU I CA  1 
ATOM   10102 C C   . GLU I 1 127 ? 15.151  -11.741 4.723   1.00 50.41  ? 123 GLU I C   1 
ATOM   10103 O O   . GLU I 1 127 ? 14.630  -12.612 5.421   1.00 47.22  ? 123 GLU I O   1 
ATOM   10104 C CB  . GLU I 1 127 ? 16.998  -12.475 3.192   1.00 74.05  ? 123 GLU I CB  1 
ATOM   10105 C CG  . GLU I 1 127 ? 17.277  -13.822 3.847   1.00 88.99  ? 123 GLU I CG  1 
ATOM   10106 C CD  . GLU I 1 127 ? 16.667  -14.987 3.086   1.00 96.34  ? 123 GLU I CD  1 
ATOM   10107 O OE1 . GLU I 1 127 ? 15.934  -14.744 2.103   1.00 102.36 ? 123 GLU I OE1 1 
ATOM   10108 O OE2 . GLU I 1 127 ? 16.923  -16.148 3.469   1.00 86.56  ? 123 GLU I OE2 1 
ATOM   10109 N N   . THR I 1 128 ? 15.403  -10.516 5.170   1.00 43.20  ? 124 THR I N   1 
ATOM   10110 C CA  . THR I 1 128 ? 15.040  -10.111 6.521   1.00 41.39  ? 124 THR I CA  1 
ATOM   10111 C C   . THR I 1 128 ? 13.534  -10.245 6.714   1.00 46.62  ? 124 THR I C   1 
ATOM   10112 O O   . THR I 1 128 ? 13.074  -10.796 7.713   1.00 57.57  ? 124 THR I O   1 
ATOM   10113 C CB  . THR I 1 128 ? 15.470  -8.660  6.808   1.00 43.90  ? 124 THR I CB  1 
ATOM   10114 O OG1 . THR I 1 128 ? 16.900  -8.582  6.858   1.00 49.00  ? 124 THR I OG1 1 
ATOM   10115 C CG2 . THR I 1 128 ? 14.904  -8.181  8.134   1.00 38.60  ? 124 THR I CG2 1 
ATOM   10116 N N   . LYS I 1 129 ? 12.767  -9.746  5.750   1.00 55.97  ? 125 LYS I N   1 
ATOM   10117 C CA  . LYS I 1 129 ? 11.313  -9.834  5.818   1.00 62.08  ? 125 LYS I CA  1 
ATOM   10118 C C   . LYS I 1 129 ? 10.859  -11.288 5.795   1.00 64.36  ? 125 LYS I C   1 
ATOM   10119 O O   . LYS I 1 129 ? 10.106  -11.725 6.665   1.00 71.33  ? 125 LYS I O   1 
ATOM   10120 C CB  . LYS I 1 129 ? 10.666  -9.078  4.656   1.00 60.27  ? 125 LYS I CB  1 
ATOM   10121 C CG  . LYS I 1 129 ? 9.165   -9.310  4.550   1.00 65.99  ? 125 LYS I CG  1 
ATOM   10122 C CD  . LYS I 1 129 ? 8.545   -8.518  3.413   1.00 69.91  ? 125 LYS I CD  1 
ATOM   10123 C CE  . LYS I 1 129 ? 7.041   -8.729  3.341   1.00 52.38  ? 125 LYS I CE  1 
ATOM   10124 N NZ  . LYS I 1 129 ? 6.690   -10.111 2.913   1.00 43.17  ? 125 LYS I NZ  1 
ATOM   10125 N N   . ASN I 1 130 ? 11.322  -12.030 4.793   1.00 55.41  ? 126 ASN I N   1 
ATOM   10126 C CA  . ASN I 1 130 ? 10.910  -13.417 4.604   1.00 56.83  ? 126 ASN I CA  1 
ATOM   10127 C C   . ASN I 1 130 ? 11.106  -14.266 5.855   1.00 52.13  ? 126 ASN I C   1 
ATOM   10128 O O   . ASN I 1 130 ? 10.291  -15.138 6.151   1.00 75.55  ? 126 ASN I O   1 
ATOM   10129 C CB  . ASN I 1 130 ? 11.661  -14.043 3.426   1.00 67.77  ? 126 ASN I CB  1 
ATOM   10130 C CG  . ASN I 1 130 ? 11.257  -13.444 2.091   1.00 73.22  ? 126 ASN I CG  1 
ATOM   10131 O OD1 . ASN I 1 130 ? 10.225  -12.781 1.980   1.00 60.69  ? 126 ASN I OD1 1 
ATOM   10132 N ND2 . ASN I 1 130 ? 12.067  -13.686 1.066   1.00 77.36  ? 126 ASN I ND2 1 
ATOM   10133 N N   . LEU I 1 131 ? 12.185  -14.011 6.589   1.00 35.34  ? 127 LEU I N   1 
ATOM   10134 C CA  . LEU I 1 131 ? 12.464  -14.761 7.809   1.00 29.16  ? 127 LEU I CA  1 
ATOM   10135 C C   . LEU I 1 131 ? 11.608  -14.270 8.976   1.00 44.36  ? 127 LEU I C   1 
ATOM   10136 O O   . LEU I 1 131 ? 11.140  -15.069 9.786   1.00 57.44  ? 127 LEU I O   1 
ATOM   10137 C CB  . LEU I 1 131 ? 13.948  -14.672 8.171   1.00 41.79  ? 127 LEU I CB  1 
ATOM   10138 C CG  . LEU I 1 131 ? 14.929  -15.282 7.164   1.00 53.64  ? 127 LEU I CG  1 
ATOM   10139 C CD1 . LEU I 1 131 ? 16.333  -15.329 7.753   1.00 50.49  ? 127 LEU I CD1 1 
ATOM   10140 C CD2 . LEU I 1 131 ? 14.482  -16.669 6.723   1.00 47.17  ? 127 LEU I CD2 1 
ATOM   10141 N N   . LEU I 1 132 ? 11.403  -12.959 9.058   1.00 44.30  ? 128 LEU I N   1 
ATOM   10142 C CA  . LEU I 1 132 ? 10.588  -12.381 10.125  1.00 52.34  ? 128 LEU I CA  1 
ATOM   10143 C C   . LEU I 1 132 ? 9.135   -12.834 10.028  1.00 61.42  ? 128 LEU I C   1 
ATOM   10144 O O   . LEU I 1 132 ? 8.501   -13.129 11.042  1.00 54.05  ? 128 LEU I O   1 
ATOM   10145 C CB  . LEU I 1 132 ? 10.663  -10.853 10.091  1.00 58.54  ? 128 LEU I CB  1 
ATOM   10146 C CG  . LEU I 1 132 ? 11.903  -10.242 10.747  1.00 60.20  ? 128 LEU I CG  1 
ATOM   10147 C CD1 . LEU I 1 132 ? 12.009  -8.755  10.435  1.00 53.65  ? 128 LEU I CD1 1 
ATOM   10148 C CD2 . LEU I 1 132 ? 11.873  -10.469 12.252  1.00 59.67  ? 128 LEU I CD2 1 
ATOM   10149 N N   . ASP I 1 133 ? 8.613   -12.890 8.808   1.00 64.23  ? 129 ASP I N   1 
ATOM   10150 C CA  . ASP I 1 133 ? 7.243   -13.336 8.587   1.00 46.14  ? 129 ASP I CA  1 
ATOM   10151 C C   . ASP I 1 133 ? 7.061   -14.763 9.084   1.00 59.91  ? 129 ASP I C   1 
ATOM   10152 O O   . ASP I 1 133 ? 5.971   -15.149 9.506   1.00 86.87  ? 129 ASP I O   1 
ATOM   10153 C CB  . ASP I 1 133 ? 6.879   -13.255 7.103   1.00 38.95  ? 129 ASP I CB  1 
ATOM   10154 C CG  . ASP I 1 133 ? 6.979   -11.848 6.554   1.00 52.07  ? 129 ASP I CG  1 
ATOM   10155 O OD1 . ASP I 1 133 ? 7.182   -10.907 7.352   1.00 75.63  ? 129 ASP I OD1 1 
ATOM   10156 O OD2 . ASP I 1 133 ? 6.847   -11.679 5.323   1.00 40.10  ? 129 ASP I OD2 1 
ATOM   10157 N N   . LYS I 1 134 ? 8.137   -15.541 9.038   1.00 41.78  ? 130 LYS I N   1 
ATOM   10158 C CA  . LYS I 1 134 ? 8.078   -16.950 9.405   1.00 58.29  ? 130 LYS I CA  1 
ATOM   10159 C C   . LYS I 1 134 ? 8.491   -17.180 10.860  1.00 69.61  ? 130 LYS I C   1 
ATOM   10160 O O   . LYS I 1 134 ? 8.086   -18.166 11.478  1.00 57.30  ? 130 LYS I O   1 
ATOM   10161 C CB  . LYS I 1 134 ? 8.957   -17.764 8.455   1.00 54.19  ? 130 LYS I CB  1 
ATOM   10162 C CG  . LYS I 1 134 ? 8.567   -17.587 6.995   1.00 56.90  ? 130 LYS I CG  1 
ATOM   10163 C CD  . LYS I 1 134 ? 9.553   -18.248 6.043   1.00 34.10  ? 130 LYS I CD  1 
ATOM   10164 C CE  . LYS I 1 134 ? 9.261   -17.852 4.600   1.00 32.94  ? 130 LYS I CE  1 
ATOM   10165 N NZ  . LYS I 1 134 ? 9.905   -18.756 3.606   1.00 53.24  ? 130 LYS I NZ  1 
ATOM   10166 N N   . ASP I 1 135 ? 9.293   -16.268 11.403  1.00 71.92  ? 131 ASP I N   1 
ATOM   10167 C CA  . ASP I 1 135 ? 9.691   -16.337 12.807  1.00 61.16  ? 131 ASP I CA  1 
ATOM   10168 C C   . ASP I 1 135 ? 10.074  -14.953 13.327  1.00 59.49  ? 131 ASP I C   1 
ATOM   10169 O O   . ASP I 1 135 ? 11.221  -14.520 13.209  1.00 52.81  ? 131 ASP I O   1 
ATOM   10170 C CB  . ASP I 1 135 ? 10.851  -17.315 12.993  1.00 57.85  ? 131 ASP I CB  1 
ATOM   10171 C CG  . ASP I 1 135 ? 11.134  -17.612 14.455  1.00 58.32  ? 131 ASP I CG  1 
ATOM   10172 O OD1 . ASP I 1 135 ? 10.713  -16.814 15.318  1.00 47.04  ? 131 ASP I OD1 1 
ATOM   10173 O OD2 . ASP I 1 135 ? 11.773  -18.648 14.740  1.00 48.33  ? 131 ASP I OD2 1 
ATOM   10174 N N   . TRP I 1 136 ? 9.094   -14.270 13.907  1.00 53.32  ? 132 TRP I N   1 
ATOM   10175 C CA  . TRP I 1 136 ? 9.275   -12.918 14.432  1.00 46.08  ? 132 TRP I CA  1 
ATOM   10176 C C   . TRP I 1 136 ? 10.343  -12.821 15.526  1.00 54.91  ? 132 TRP I C   1 
ATOM   10177 O O   . TRP I 1 136 ? 10.807  -11.726 15.843  1.00 33.38  ? 132 TRP I O   1 
ATOM   10178 C CB  . TRP I 1 136 ? 7.940   -12.388 14.969  1.00 50.45  ? 132 TRP I CB  1 
ATOM   10179 C CG  . TRP I 1 136 ? 7.257   -13.333 15.913  1.00 61.40  ? 132 TRP I CG  1 
ATOM   10180 C CD1 . TRP I 1 136 ? 6.348   -14.299 15.592  1.00 67.07  ? 132 TRP I CD1 1 
ATOM   10181 C CD2 . TRP I 1 136 ? 7.430   -13.401 17.335  1.00 74.60  ? 132 TRP I CD2 1 
ATOM   10182 N NE1 . TRP I 1 136 ? 5.946   -14.966 16.724  1.00 78.00  ? 132 TRP I NE1 1 
ATOM   10183 C CE2 . TRP I 1 136 ? 6.594   -14.435 17.805  1.00 84.05  ? 132 TRP I CE2 1 
ATOM   10184 C CE3 . TRP I 1 136 ? 8.209   -12.690 18.252  1.00 78.50  ? 132 TRP I CE3 1 
ATOM   10185 C CZ2 . TRP I 1 136 ? 6.517   -14.773 19.156  1.00 91.63  ? 132 TRP I CZ2 1 
ATOM   10186 C CZ3 . TRP I 1 136 ? 8.130   -13.029 19.592  1.00 86.00  ? 132 TRP I CZ3 1 
ATOM   10187 C CH2 . TRP I 1 136 ? 7.291   -14.061 20.030  1.00 90.88  ? 132 TRP I CH2 1 
ATOM   10188 N N   . ASN I 1 137 ? 10.729  -13.959 16.098  1.00 77.27  ? 133 ASN I N   1 
ATOM   10189 C CA  . ASN I 1 137 ? 11.699  -13.984 17.191  1.00 71.31  ? 133 ASN I CA  1 
ATOM   10190 C C   . ASN I 1 137 ? 13.058  -14.520 16.740  1.00 62.00  ? 133 ASN I C   1 
ATOM   10191 O O   . ASN I 1 137 ? 13.854  -14.981 17.556  1.00 61.32  ? 133 ASN I O   1 
ATOM   10192 C CB  . ASN I 1 137 ? 11.162  -14.851 18.332  1.00 83.53  ? 133 ASN I CB  1 
ATOM   10193 C CG  . ASN I 1 137 ? 11.875  -14.602 19.650  1.00 100.44 ? 133 ASN I CG  1 
ATOM   10194 O OD1 . ASN I 1 137 ? 12.975  -14.048 19.684  1.00 111.27 ? 133 ASN I OD1 1 
ATOM   10195 N ND2 . ASN I 1 137 ? 11.251  -15.021 20.745  1.00 97.05  ? 133 ASN I ND2 1 
ATOM   10196 N N   . ILE I 1 138 ? 13.322  -14.455 15.440  1.00 45.90  ? 134 ILE I N   1 
ATOM   10197 C CA  . ILE I 1 138 ? 14.527  -15.059 14.881  1.00 53.83  ? 134 ILE I CA  1 
ATOM   10198 C C   . ILE I 1 138 ? 15.794  -14.250 15.166  1.00 57.79  ? 134 ILE I C   1 
ATOM   10199 O O   . ILE I 1 138 ? 16.874  -14.822 15.323  1.00 51.88  ? 134 ILE I O   1 
ATOM   10200 C CB  . ILE I 1 138 ? 14.399  -15.269 13.357  1.00 63.19  ? 134 ILE I CB  1 
ATOM   10201 C CG1 . ILE I 1 138 ? 15.586  -16.083 12.838  1.00 54.43  ? 134 ILE I CG1 1 
ATOM   10202 C CG2 . ILE I 1 138 ? 14.310  -13.930 12.629  1.00 64.43  ? 134 ILE I CG2 1 
ATOM   10203 C CD1 . ILE I 1 138 ? 15.426  -16.558 11.417  1.00 51.11  ? 134 ILE I CD1 1 
ATOM   10204 N N   . PHE I 1 139 ? 15.664  -12.929 15.240  1.00 62.54  ? 135 PHE I N   1 
ATOM   10205 C CA  . PHE I 1 139 ? 16.831  -12.061 15.390  1.00 51.72  ? 135 PHE I CA  1 
ATOM   10206 C C   . PHE I 1 139 ? 17.186  -11.765 16.846  1.00 60.34  ? 135 PHE I C   1 
ATOM   10207 O O   . PHE I 1 139 ? 17.947  -10.839 17.126  1.00 67.66  ? 135 PHE I O   1 
ATOM   10208 C CB  . PHE I 1 139 ? 16.629  -10.752 14.623  1.00 53.36  ? 135 PHE I CB  1 
ATOM   10209 C CG  . PHE I 1 139 ? 16.637  -10.921 13.130  1.00 55.08  ? 135 PHE I CG  1 
ATOM   10210 C CD1 . PHE I 1 139 ? 17.725  -11.492 12.492  1.00 53.76  ? 135 PHE I CD1 1 
ATOM   10211 C CD2 . PHE I 1 139 ? 15.564  -10.503 12.366  1.00 49.00  ? 135 PHE I CD2 1 
ATOM   10212 C CE1 . PHE I 1 139 ? 17.737  -11.651 11.121  1.00 50.82  ? 135 PHE I CE1 1 
ATOM   10213 C CE2 . PHE I 1 139 ? 15.571  -10.657 10.993  1.00 47.31  ? 135 PHE I CE2 1 
ATOM   10214 C CZ  . PHE I 1 139 ? 16.658  -11.232 10.370  1.00 51.43  ? 135 PHE I CZ  1 
ATOM   10215 N N   . SER I 1 140 ? 16.638  -12.550 17.769  1.00 59.95  ? 136 SER I N   1 
ATOM   10216 C CA  . SER I 1 140 ? 17.060  -12.486 19.163  1.00 58.26  ? 136 SER I CA  1 
ATOM   10217 C C   . SER I 1 140 ? 18.267  -13.401 19.356  1.00 58.85  ? 136 SER I C   1 
ATOM   10218 O O   . SER I 1 140 ? 18.851  -13.465 20.439  1.00 55.85  ? 136 SER I O   1 
ATOM   10219 C CB  . SER I 1 140 ? 15.921  -12.902 20.098  1.00 52.58  ? 136 SER I CB  1 
ATOM   10220 O OG  . SER I 1 140 ? 15.579  -14.264 19.915  1.00 41.42  ? 136 SER I OG  1 
ATOM   10221 N N   . LYS I 1 141 ? 18.635  -14.102 18.287  1.00 64.52  ? 137 LYS I N   1 
ATOM   10222 C CA  . LYS I 1 141 ? 19.747  -15.043 18.307  1.00 61.02  ? 137 LYS I CA  1 
ATOM   10223 C C   . LYS I 1 141 ? 21.054  -14.377 18.729  1.00 70.82  ? 137 LYS I C   1 
ATOM   10224 O O   . LYS I 1 141 ? 21.323  -13.229 18.373  1.00 70.35  ? 137 LYS I O   1 
ATOM   10225 C CB  . LYS I 1 141 ? 19.910  -15.669 16.920  1.00 67.01  ? 137 LYS I CB  1 
ATOM   10226 C CG  . LYS I 1 141 ? 21.125  -16.567 16.772  1.00 62.21  ? 137 LYS I CG  1 
ATOM   10227 C CD  . LYS I 1 141 ? 21.169  -17.202 15.391  1.00 38.06  ? 137 LYS I CD  1 
ATOM   10228 C CE  . LYS I 1 141 ? 22.380  -18.105 15.226  1.00 40.22  ? 137 LYS I CE  1 
ATOM   10229 N NZ  . LYS I 1 141 ? 22.337  -18.862 13.942  1.00 44.88  ? 137 LYS I NZ  1 
ATOM   10230 N N   . ASN I 1 142 ? 21.860  -15.114 19.489  1.00 81.39  ? 138 ASN I N   1 
ATOM   10231 C CA  . ASN I 1 142 ? 23.176  -14.646 19.916  1.00 90.34  ? 138 ASN I CA  1 
ATOM   10232 C C   . ASN I 1 142 ? 24.214  -14.878 18.825  1.00 82.09  ? 138 ASN I C   1 
ATOM   10233 O O   . ASN I 1 142 ? 24.523  -16.021 18.487  1.00 63.51  ? 138 ASN I O   1 
ATOM   10234 C CB  . ASN I 1 142 ? 23.602  -15.370 21.196  1.00 100.27 ? 138 ASN I CB  1 
ATOM   10235 C CG  . ASN I 1 142 ? 25.015  -15.019 21.626  1.00 113.55 ? 138 ASN I CG  1 
ATOM   10236 O OD1 . ASN I 1 142 ? 25.990  -15.513 21.058  1.00 118.62 ? 138 ASN I OD1 1 
ATOM   10237 N ND2 . ASN I 1 142 ? 25.132  -14.175 22.645  1.00 115.25 ? 138 ASN I ND2 1 
ATOM   10238 N N   . CYS I 1 143 ? 24.751  -13.792 18.277  1.00 90.18  ? 139 CYS I N   1 
ATOM   10239 C CA  . CYS I 1 143 ? 25.700  -13.884 17.173  1.00 97.01  ? 139 CYS I CA  1 
ATOM   10240 C C   . CYS I 1 143 ? 27.103  -13.432 17.573  1.00 95.49  ? 139 CYS I C   1 
ATOM   10241 O O   . CYS I 1 143 ? 27.836  -12.871 16.759  1.00 97.19  ? 139 CYS I O   1 
ATOM   10242 C CB  . CYS I 1 143 ? 25.208  -13.057 15.983  1.00 102.45 ? 139 CYS I CB  1 
ATOM   10243 S SG  . CYS I 1 143 ? 23.677  -13.668 15.232  1.00 52.75  ? 139 CYS I SG  1 
ATOM   10244 N N   . ASN I 1 144 ? 27.476  -13.677 18.825  1.00 86.93  ? 140 ASN I N   1 
ATOM   10245 C CA  . ASN I 1 144 ? 28.827  -13.374 19.285  1.00 79.80  ? 140 ASN I CA  1 
ATOM   10246 C C   . ASN I 1 144 ? 29.808  -14.439 18.811  1.00 74.79  ? 140 ASN I C   1 
ATOM   10247 O O   . ASN I 1 144 ? 30.907  -14.125 18.354  1.00 75.40  ? 140 ASN I O   1 
ATOM   10248 C CB  . ASN I 1 144 ? 28.874  -13.265 20.811  1.00 85.48  ? 140 ASN I CB  1 
ATOM   10249 C CG  . ASN I 1 144 ? 28.336  -11.940 21.321  1.00 93.68  ? 140 ASN I CG  1 
ATOM   10250 O OD1 . ASN I 1 144 ? 28.399  -10.923 20.631  1.00 92.98  ? 140 ASN I OD1 1 
ATOM   10251 N ND2 . ASN I 1 144 ? 27.813  -11.945 22.542  1.00 99.91  ? 140 ASN I ND2 1 
ATOM   10252 N N   . ASN I 1 145 ? 29.398  -15.699 18.917  1.00 80.17  ? 141 ASN I N   1 
ATOM   10253 C CA  . ASN I 1 145 ? 30.230  -16.820 18.494  1.00 92.96  ? 141 ASN I CA  1 
ATOM   10254 C C   . ASN I 1 145 ? 30.200  -17.002 16.977  1.00 94.10  ? 141 ASN I C   1 
ATOM   10255 O O   . ASN I 1 145 ? 30.792  -17.941 16.442  1.00 90.40  ? 141 ASN I O   1 
ATOM   10256 C CB  . ASN I 1 145 ? 29.782  -18.109 19.189  1.00 106.44 ? 141 ASN I CB  1 
ATOM   10257 C CG  . ASN I 1 145 ? 29.689  -17.959 20.700  1.00 114.44 ? 141 ASN I CG  1 
ATOM   10258 O OD1 . ASN I 1 145 ? 30.299  -17.065 21.287  1.00 109.85 ? 141 ASN I OD1 1 
ATOM   10259 N ND2 . ASN I 1 145 ? 28.928  -18.843 21.337  1.00 116.61 ? 141 ASN I ND2 1 
ATOM   10260 N N   . SER I 1 146 ? 29.490  -16.107 16.293  1.00 95.30  ? 142 SER I N   1 
ATOM   10261 C CA  . SER I 1 146 ? 29.504  -16.049 14.836  1.00 91.32  ? 142 SER I CA  1 
ATOM   10262 C C   . SER I 1 146 ? 30.321  -14.844 14.375  1.00 80.99  ? 142 SER I C   1 
ATOM   10263 O O   . SER I 1 146 ? 30.980  -14.893 13.336  1.00 63.04  ? 142 SER I O   1 
ATOM   10264 C CB  . SER I 1 146 ? 28.079  -15.970 14.285  1.00 87.67  ? 142 SER I CB  1 
ATOM   10265 O OG  . SER I 1 146 ? 27.399  -17.205 14.437  1.00 81.00  ? 142 SER I OG  1 
ATOM   10266 N N   . PHE I 1 147 ? 30.271  -13.763 15.152  1.00 91.18  ? 143 PHE I N   1 
ATOM   10267 C CA  . PHE I 1 147 ? 31.099  -12.589 14.893  1.00 95.39  ? 143 PHE I CA  1 
ATOM   10268 C C   . PHE I 1 147 ? 32.524  -12.841 15.377  1.00 94.01  ? 143 PHE I C   1 
ATOM   10269 O O   . PHE I 1 147 ? 33.481  -12.283 14.841  1.00 96.97  ? 143 PHE I O   1 
ATOM   10270 C CB  . PHE I 1 147 ? 30.528  -11.347 15.588  1.00 94.44  ? 143 PHE I CB  1 
ATOM   10271 C CG  . PHE I 1 147 ? 29.181  -10.916 15.068  1.00 98.66  ? 143 PHE I CG  1 
ATOM   10272 C CD1 . PHE I 1 147 ? 28.607  -11.539 13.970  1.00 96.97  ? 143 PHE I CD1 1 
ATOM   10273 C CD2 . PHE I 1 147 ? 28.491  -9.879  15.677  1.00 96.88  ? 143 PHE I CD2 1 
ATOM   10274 C CE1 . PHE I 1 147 ? 27.372  -11.140 13.496  1.00 87.33  ? 143 PHE I CE1 1 
ATOM   10275 C CE2 . PHE I 1 147 ? 27.254  -9.477  15.203  1.00 90.78  ? 143 PHE I CE2 1 
ATOM   10276 C CZ  . PHE I 1 147 ? 26.695  -10.108 14.112  1.00 83.76  ? 143 PHE I CZ  1 
ATOM   10277 N N   . ALA I 1 148 ? 32.655  -13.687 16.395  1.00 90.22  ? 144 ALA I N   1 
ATOM   10278 C CA  . ALA I 1 148 ? 33.963  -14.044 16.935  1.00 95.66  ? 144 ALA I CA  1 
ATOM   10279 C C   . ALA I 1 148 ? 34.752  -14.863 15.920  1.00 97.37  ? 144 ALA I C   1 
ATOM   10280 O O   . ALA I 1 148 ? 35.984  -14.864 15.932  1.00 92.62  ? 144 ALA I O   1 
ATOM   10281 C CB  . ALA I 1 148 ? 33.805  -14.823 18.233  1.00 96.42  ? 144 ALA I CB  1 
ATOM   10282 N N   . GLU I 1 149 ? 34.036  -15.555 15.039  1.00 99.15  ? 145 GLU I N   1 
ATOM   10283 C CA  . GLU I 1 149 ? 34.665  -16.391 14.024  1.00 101.87 ? 145 GLU I CA  1 
ATOM   10284 C C   . GLU I 1 149 ? 35.017  -15.592 12.769  1.00 98.70  ? 145 GLU I C   1 
ATOM   10285 O O   . GLU I 1 149 ? 35.151  -16.159 11.684  1.00 86.52  ? 145 GLU I O   1 
ATOM   10286 C CB  . GLU I 1 149 ? 33.741  -17.557 13.658  1.00 107.51 ? 145 GLU I CB  1 
ATOM   10287 C CG  . GLU I 1 149 ? 33.455  -18.507 14.813  1.00 109.82 ? 145 GLU I CG  1 
ATOM   10288 C CD  . GLU I 1 149 ? 32.440  -19.577 14.456  1.00 110.33 ? 145 GLU I CD  1 
ATOM   10289 O OE1 . GLU I 1 149 ? 31.899  -19.535 13.331  1.00 111.46 ? 145 GLU I OE1 1 
ATOM   10290 O OE2 . GLU I 1 149 ? 32.184  -20.461 15.300  1.00 103.71 ? 145 GLU I OE2 1 
ATOM   10291 N N   . CYS I 1 150 ? 35.164  -14.278 12.921  1.00 106.25 ? 146 CYS I N   1 
ATOM   10292 C CA  . CYS I 1 150 ? 35.544  -13.411 11.810  1.00 111.16 ? 146 CYS I CA  1 
ATOM   10293 C C   . CYS I 1 150 ? 36.931  -12.819 12.037  1.00 106.25 ? 146 CYS I C   1 
ATOM   10294 O O   . CYS I 1 150 ? 37.100  -11.905 12.844  1.00 111.72 ? 146 CYS I O   1 
ATOM   10295 C CB  . CYS I 1 150 ? 34.523  -12.284 11.636  1.00 115.18 ? 146 CYS I CB  1 
ATOM   10296 S SG  . CYS I 1 150 ? 32.895  -12.825 11.069  1.00 120.43 ? 146 CYS I SG  1 
ATOM   10297 N N   . SER I 1 151 ? 37.920  -13.346 11.321  1.00 93.02  ? 147 SER I N   1 
ATOM   10298 C CA  . SER I 1 151 ? 39.290  -12.856 11.423  1.00 93.37  ? 147 SER I CA  1 
ATOM   10299 C C   . SER I 1 151 ? 39.574  -11.824 10.336  1.00 85.63  ? 147 SER I C   1 
ATOM   10300 O O   . SER I 1 151 ? 39.617  -10.622 10.603  1.00 84.13  ? 147 SER I O   1 
ATOM   10301 C CB  . SER I 1 151 ? 40.279  -14.018 11.305  1.00 98.75  ? 147 SER I CB  1 
ATOM   10302 O OG  . SER I 1 151 ? 41.608  -13.587 11.538  1.00 92.15  ? 147 SER I OG  1 
ATOM   10303 N N   . VAL J 1 7   ? 12.359  20.972  -43.904 1.00 73.08  ? 3   VAL J N   1 
ATOM   10304 C CA  . VAL J 1 7   ? 11.743  21.502  -42.695 1.00 69.16  ? 3   VAL J CA  1 
ATOM   10305 C C   . VAL J 1 7   ? 10.284  21.867  -42.943 1.00 64.02  ? 3   VAL J C   1 
ATOM   10306 O O   . VAL J 1 7   ? 9.936   22.389  -44.003 1.00 55.02  ? 3   VAL J O   1 
ATOM   10307 C CB  . VAL J 1 7   ? 12.484  22.753  -42.186 1.00 67.25  ? 3   VAL J CB  1 
ATOM   10308 C CG1 . VAL J 1 7   ? 11.792  23.319  -40.952 1.00 64.39  ? 3   VAL J CG1 1 
ATOM   10309 C CG2 . VAL J 1 7   ? 13.938  22.425  -41.886 1.00 55.61  ? 3   VAL J CG2 1 
ATOM   10310 N N   . SER J 1 8   ? 9.438   21.592  -41.954 1.00 69.89  ? 4   SER J N   1 
ATOM   10311 C CA  . SER J 1 8   ? 8.016   21.906  -42.037 1.00 67.14  ? 4   SER J CA  1 
ATOM   10312 C C   . SER J 1 8   ? 7.568   22.728  -40.833 1.00 71.19  ? 4   SER J C   1 
ATOM   10313 O O   . SER J 1 8   ? 8.308   22.879  -39.861 1.00 65.33  ? 4   SER J O   1 
ATOM   10314 C CB  . SER J 1 8   ? 7.194   20.620  -42.121 1.00 52.04  ? 4   SER J CB  1 
ATOM   10315 O OG  . SER J 1 8   ? 7.413   19.807  -40.984 1.00 56.61  ? 4   SER J OG  1 
ATOM   10316 N N   . GLU J 1 9   ? 6.345   23.246  -40.902 1.00 75.35  ? 5   GLU J N   1 
ATOM   10317 C CA  . GLU J 1 9   ? 5.823   24.138  -39.872 1.00 78.15  ? 5   GLU J CA  1 
ATOM   10318 C C   . GLU J 1 9   ? 5.525   23.418  -38.560 1.00 68.95  ? 5   GLU J C   1 
ATOM   10319 O O   . GLU J 1 9   ? 5.637   24.010  -37.485 1.00 57.98  ? 5   GLU J O   1 
ATOM   10320 C CB  . GLU J 1 9   ? 4.555   24.842  -40.369 1.00 98.48  ? 5   GLU J CB  1 
ATOM   10321 C CG  . GLU J 1 9   ? 3.366   23.914  -40.594 1.00 112.30 ? 5   GLU J CG  1 
ATOM   10322 C CD  . GLU J 1 9   ? 2.117   24.655  -41.040 1.00 123.18 ? 5   GLU J CD  1 
ATOM   10323 O OE1 . GLU J 1 9   ? 2.137   25.904  -41.059 1.00 127.66 ? 5   GLU J OE1 1 
ATOM   10324 O OE2 . GLU J 1 9   ? 1.115   23.986  -41.372 1.00 124.35 ? 5   GLU J OE2 1 
ATOM   10325 N N   . TYR J 1 10  ? 5.150   22.146  -38.638 1.00 67.58  ? 6   TYR J N   1 
ATOM   10326 C CA  . TYR J 1 10  ? 4.774   21.410  -37.435 1.00 72.62  ? 6   TYR J CA  1 
ATOM   10327 C C   . TYR J 1 10  ? 5.993   20.976  -36.618 1.00 72.16  ? 6   TYR J C   1 
ATOM   10328 O O   . TYR J 1 10  ? 5.861   20.251  -35.632 1.00 73.01  ? 6   TYR J O   1 
ATOM   10329 C CB  . TYR J 1 10  ? 3.881   20.210  -37.771 1.00 80.54  ? 6   TYR J CB  1 
ATOM   10330 C CG  . TYR J 1 10  ? 4.573   19.057  -38.466 1.00 103.86 ? 6   TYR J CG  1 
ATOM   10331 C CD1 . TYR J 1 10  ? 5.352   18.154  -37.752 1.00 119.62 ? 6   TYR J CD1 1 
ATOM   10332 C CD2 . TYR J 1 10  ? 4.414   18.847  -39.829 1.00 109.66 ? 6   TYR J CD2 1 
ATOM   10333 C CE1 . TYR J 1 10  ? 5.973   17.092  -38.379 1.00 119.28 ? 6   TYR J CE1 1 
ATOM   10334 C CE2 . TYR J 1 10  ? 5.032   17.787  -40.465 1.00 116.13 ? 6   TYR J CE2 1 
ATOM   10335 C CZ  . TYR J 1 10  ? 5.808   16.912  -39.735 1.00 116.98 ? 6   TYR J CZ  1 
ATOM   10336 O OH  . TYR J 1 10  ? 6.426   15.853  -40.362 1.00 118.05 ? 6   TYR J OH  1 
ATOM   10337 N N   . CYS J 1 11  ? 7.176   21.426  -37.024 1.00 66.27  ? 7   CYS J N   1 
ATOM   10338 C CA  . CYS J 1 11  ? 8.379   21.216  -36.230 1.00 59.42  ? 7   CYS J CA  1 
ATOM   10339 C C   . CYS J 1 11  ? 8.329   22.057  -34.959 1.00 57.82  ? 7   CYS J C   1 
ATOM   10340 O O   . CYS J 1 11  ? 9.026   21.767  -33.985 1.00 57.10  ? 7   CYS J O   1 
ATOM   10341 C CB  . CYS J 1 11  ? 9.624   21.576  -37.044 1.00 60.50  ? 7   CYS J CB  1 
ATOM   10342 S SG  . CYS J 1 11  ? 9.916   20.510  -38.472 1.00 66.91  ? 7   CYS J SG  1 
ATOM   10343 N N   . SER J 1 12  ? 7.501   23.097  -34.972 1.00 55.92  ? 8   SER J N   1 
ATOM   10344 C CA  . SER J 1 12  ? 7.391   24.000  -33.834 1.00 66.71  ? 8   SER J CA  1 
ATOM   10345 C C   . SER J 1 12  ? 6.847   23.293  -32.593 1.00 70.47  ? 8   SER J C   1 
ATOM   10346 O O   . SER J 1 12  ? 7.276   23.577  -31.475 1.00 79.86  ? 8   SER J O   1 
ATOM   10347 C CB  . SER J 1 12  ? 6.512   25.205  -34.186 1.00 73.26  ? 8   SER J CB  1 
ATOM   10348 O OG  . SER J 1 12  ? 5.231   24.808  -34.648 1.00 77.23  ? 8   SER J OG  1 
ATOM   10349 N N   . HIS J 1 13  ? 5.916   22.365  -32.792 1.00 56.53  ? 9   HIS J N   1 
ATOM   10350 C CA  . HIS J 1 13  ? 5.291   21.664  -31.676 1.00 64.29  ? 9   HIS J CA  1 
ATOM   10351 C C   . HIS J 1 13  ? 5.564   20.167  -31.742 1.00 62.45  ? 9   HIS J C   1 
ATOM   10352 O O   . HIS J 1 13  ? 4.681   19.352  -31.470 1.00 63.95  ? 9   HIS J O   1 
ATOM   10353 C CB  . HIS J 1 13  ? 3.784   21.925  -31.652 1.00 79.58  ? 9   HIS J CB  1 
ATOM   10354 C CG  . HIS J 1 13  ? 3.420   23.317  -31.240 1.00 85.45  ? 9   HIS J CG  1 
ATOM   10355 N ND1 . HIS J 1 13  ? 3.660   24.417  -32.034 1.00 90.98  ? 9   HIS J ND1 1 
ATOM   10356 C CD2 . HIS J 1 13  ? 2.834   23.788  -30.113 1.00 77.47  ? 9   HIS J CD2 1 
ATOM   10357 C CE1 . HIS J 1 13  ? 3.236   25.506  -31.417 1.00 83.99  ? 9   HIS J CE1 1 
ATOM   10358 N NE2 . HIS J 1 13  ? 2.731   25.150  -30.248 1.00 75.69  ? 9   HIS J NE2 1 
ATOM   10359 N N   . MET J 1 14  ? 6.792   19.812  -32.105 1.00 45.73  ? 10  MET J N   1 
ATOM   10360 C CA  . MET J 1 14  ? 7.199   18.416  -32.142 1.00 42.10  ? 10  MET J CA  1 
ATOM   10361 C C   . MET J 1 14  ? 7.573   17.974  -30.735 1.00 50.25  ? 10  MET J C   1 
ATOM   10362 O O   . MET J 1 14  ? 7.079   16.965  -30.235 1.00 61.28  ? 10  MET J O   1 
ATOM   10363 C CB  . MET J 1 14  ? 8.401   18.232  -33.066 1.00 45.25  ? 10  MET J CB  1 
ATOM   10364 C CG  . MET J 1 14  ? 8.645   16.790  -33.463 1.00 41.59  ? 10  MET J CG  1 
ATOM   10365 S SD  . MET J 1 14  ? 7.832   16.373  -35.015 1.00 61.64  ? 10  MET J SD  1 
ATOM   10366 C CE  . MET J 1 14  ? 8.962   17.123  -36.184 1.00 33.28  ? 10  MET J CE  1 
ATOM   10367 N N   . ILE J 1 15  ? 8.449   18.749  -30.104 1.00 53.34  ? 11  ILE J N   1 
ATOM   10368 C CA  . ILE J 1 15  ? 8.923   18.450  -28.761 1.00 43.58  ? 11  ILE J CA  1 
ATOM   10369 C C   . ILE J 1 15  ? 7.942   19.008  -27.734 1.00 55.42  ? 11  ILE J C   1 
ATOM   10370 O O   . ILE J 1 15  ? 7.806   20.223  -27.586 1.00 70.93  ? 11  ILE J O   1 
ATOM   10371 C CB  . ILE J 1 15  ? 10.319  19.058  -28.515 1.00 34.86  ? 11  ILE J CB  1 
ATOM   10372 C CG1 . ILE J 1 15  ? 11.254  18.729  -29.684 1.00 33.40  ? 11  ILE J CG1 1 
ATOM   10373 C CG2 . ILE J 1 15  ? 10.895  18.550  -27.197 1.00 26.18  ? 11  ILE J CG2 1 
ATOM   10374 C CD1 . ILE J 1 15  ? 12.643  19.317  -29.549 1.00 42.04  ? 11  ILE J CD1 1 
ATOM   10375 N N   . GLY J 1 16  ? 7.258   18.115  -27.027 1.00 45.38  ? 12  GLY J N   1 
ATOM   10376 C CA  . GLY J 1 16  ? 6.239   18.512  -26.072 1.00 36.66  ? 12  GLY J CA  1 
ATOM   10377 C C   . GLY J 1 16  ? 6.703   18.444  -24.631 1.00 48.96  ? 12  GLY J C   1 
ATOM   10378 O O   . GLY J 1 16  ? 7.763   17.893  -24.330 1.00 41.45  ? 12  GLY J O   1 
ATOM   10379 N N   . SER J 1 17  ? 5.894   19.007  -23.739 1.00 61.30  ? 13  SER J N   1 
ATOM   10380 C CA  . SER J 1 17  ? 6.198   19.022  -22.313 1.00 53.04  ? 13  SER J CA  1 
ATOM   10381 C C   . SER J 1 17  ? 6.437   17.613  -21.781 1.00 60.10  ? 13  SER J C   1 
ATOM   10382 O O   . SER J 1 17  ? 7.240   17.413  -20.870 1.00 71.29  ? 13  SER J O   1 
ATOM   10383 C CB  . SER J 1 17  ? 5.054   19.677  -21.538 1.00 52.02  ? 13  SER J CB  1 
ATOM   10384 O OG  . SER J 1 17  ? 4.859   21.018  -21.953 1.00 60.96  ? 13  SER J OG  1 
ATOM   10385 N N   . GLY J 1 18  ? 5.734   16.639  -22.349 1.00 61.43  ? 14  GLY J N   1 
ATOM   10386 C CA  . GLY J 1 18  ? 5.866   15.258  -21.924 1.00 61.22  ? 14  GLY J CA  1 
ATOM   10387 C C   . GLY J 1 18  ? 7.286   14.743  -22.063 1.00 54.88  ? 14  GLY J C   1 
ATOM   10388 O O   . GLY J 1 18  ? 7.790   14.044  -21.183 1.00 50.28  ? 14  GLY J O   1 
ATOM   10389 N N   . HIS J 1 19  ? 7.931   15.089  -23.172 1.00 52.85  ? 15  HIS J N   1 
ATOM   10390 C CA  . HIS J 1 19  ? 9.292   14.638  -23.440 1.00 49.82  ? 15  HIS J CA  1 
ATOM   10391 C C   . HIS J 1 19  ? 10.280  15.207  -22.428 1.00 60.12  ? 15  HIS J C   1 
ATOM   10392 O O   . HIS J 1 19  ? 11.205  14.520  -21.996 1.00 66.54  ? 15  HIS J O   1 
ATOM   10393 C CB  . HIS J 1 19  ? 9.716   15.039  -24.854 1.00 46.52  ? 15  HIS J CB  1 
ATOM   10394 C CG  . HIS J 1 19  ? 8.959   14.334  -25.936 1.00 55.27  ? 15  HIS J CG  1 
ATOM   10395 N ND1 . HIS J 1 19  ? 7.888   14.905  -26.589 1.00 65.99  ? 15  HIS J ND1 1 
ATOM   10396 C CD2 . HIS J 1 19  ? 9.118   13.104  -26.479 1.00 58.09  ? 15  HIS J CD2 1 
ATOM   10397 C CE1 . HIS J 1 19  ? 7.421   14.059  -27.490 1.00 64.60  ? 15  HIS J CE1 1 
ATOM   10398 N NE2 . HIS J 1 19  ? 8.149   12.958  -27.443 1.00 61.74  ? 15  HIS J NE2 1 
ATOM   10399 N N   . LEU J 1 20  ? 10.081  16.466  -22.054 1.00 69.54  ? 16  LEU J N   1 
ATOM   10400 C CA  . LEU J 1 20  ? 10.975  17.136  -21.119 1.00 64.04  ? 16  LEU J CA  1 
ATOM   10401 C C   . LEU J 1 20  ? 10.765  16.613  -19.704 1.00 69.05  ? 16  LEU J C   1 
ATOM   10402 O O   . LEU J 1 20  ? 11.708  16.527  -18.918 1.00 69.38  ? 16  LEU J O   1 
ATOM   10403 C CB  . LEU J 1 20  ? 10.745  18.647  -21.155 1.00 61.27  ? 16  LEU J CB  1 
ATOM   10404 C CG  . LEU J 1 20  ? 10.797  19.286  -22.544 1.00 66.78  ? 16  LEU J CG  1 
ATOM   10405 C CD1 . LEU J 1 20  ? 10.656  20.793  -22.439 1.00 65.50  ? 16  LEU J CD1 1 
ATOM   10406 C CD2 . LEU J 1 20  ? 12.083  18.914  -23.268 1.00 70.13  ? 16  LEU J CD2 1 
ATOM   10407 N N   . GLN J 1 21  ? 9.522   16.266  -19.384 1.00 74.22  ? 17  GLN J N   1 
ATOM   10408 C CA  . GLN J 1 21  ? 9.202   15.708  -18.077 1.00 73.38  ? 17  GLN J CA  1 
ATOM   10409 C C   . GLN J 1 21  ? 9.816   14.321  -17.929 1.00 62.45  ? 17  GLN J C   1 
ATOM   10410 O O   . GLN J 1 21  ? 10.355  13.983  -16.878 1.00 53.99  ? 17  GLN J O   1 
ATOM   10411 C CB  . GLN J 1 21  ? 7.687   15.644  -17.877 1.00 75.32  ? 17  GLN J CB  1 
ATOM   10412 C CG  . GLN J 1 21  ? 7.026   17.007  -17.747 1.00 83.97  ? 17  GLN J CG  1 
ATOM   10413 C CD  . GLN J 1 21  ? 5.514   16.925  -17.783 1.00 97.13  ? 17  GLN J CD  1 
ATOM   10414 O OE1 . GLN J 1 21  ? 4.938   15.841  -17.696 1.00 105.49 ? 17  GLN J OE1 1 
ATOM   10415 N NE2 . GLN J 1 21  ? 4.862   18.075  -17.915 1.00 97.16  ? 17  GLN J NE2 1 
ATOM   10416 N N   . SER J 1 22  ? 9.739   13.519  -18.985 1.00 54.27  ? 18  SER J N   1 
ATOM   10417 C CA  . SER J 1 22  ? 10.341  12.193  -18.971 1.00 49.61  ? 18  SER J CA  1 
ATOM   10418 C C   . SER J 1 22  ? 11.862  12.291  -18.890 1.00 50.71  ? 18  SER J C   1 
ATOM   10419 O O   . SER J 1 22  ? 12.534  11.347  -18.473 1.00 45.33  ? 18  SER J O   1 
ATOM   10420 C CB  . SER J 1 22  ? 9.929   11.403  -20.213 1.00 56.23  ? 18  SER J CB  1 
ATOM   10421 O OG  . SER J 1 22  ? 10.431  12.002  -21.395 1.00 75.27  ? 18  SER J OG  1 
ATOM   10422 N N   . LEU J 1 23  ? 12.397  13.440  -19.286 1.00 56.06  ? 19  LEU J N   1 
ATOM   10423 C CA  . LEU J 1 23  ? 13.836  13.660  -19.276 1.00 60.26  ? 19  LEU J CA  1 
ATOM   10424 C C   . LEU J 1 23  ? 14.284  14.196  -17.920 1.00 58.64  ? 19  LEU J C   1 
ATOM   10425 O O   . LEU J 1 23  ? 15.375  13.878  -17.448 1.00 73.44  ? 19  LEU J O   1 
ATOM   10426 C CB  . LEU J 1 23  ? 14.222  14.630  -20.393 1.00 62.03  ? 19  LEU J CB  1 
ATOM   10427 C CG  . LEU J 1 23  ? 15.708  14.780  -20.724 1.00 45.20  ? 19  LEU J CG  1 
ATOM   10428 C CD1 . LEU J 1 23  ? 16.443  13.455  -20.614 1.00 32.74  ? 19  LEU J CD1 1 
ATOM   10429 C CD2 . LEU J 1 23  ? 15.854  15.348  -22.127 1.00 39.37  ? 19  LEU J CD2 1 
ATOM   10430 N N   . GLN J 1 24  ? 13.438  15.010  -17.297 1.00 49.87  ? 20  GLN J N   1 
ATOM   10431 C CA  . GLN J 1 24  ? 13.710  15.510  -15.955 1.00 46.44  ? 20  GLN J CA  1 
ATOM   10432 C C   . GLN J 1 24  ? 13.490  14.388  -14.946 1.00 59.10  ? 20  GLN J C   1 
ATOM   10433 O O   . GLN J 1 24  ? 14.352  14.115  -14.113 1.00 60.40  ? 20  GLN J O   1 
ATOM   10434 C CB  . GLN J 1 24  ? 12.810  16.702  -15.626 1.00 54.91  ? 20  GLN J CB  1 
ATOM   10435 C CG  . GLN J 1 24  ? 13.107  17.354  -14.280 1.00 48.41  ? 20  GLN J CG  1 
ATOM   10436 C CD  . GLN J 1 24  ? 14.471  18.023  -14.236 1.00 44.18  ? 20  GLN J CD  1 
ATOM   10437 O OE1 . GLN J 1 24  ? 14.751  18.943  -15.006 1.00 35.46  ? 20  GLN J OE1 1 
ATOM   10438 N NE2 . GLN J 1 24  ? 15.328  17.561  -13.330 1.00 42.06  ? 20  GLN J NE2 1 
ATOM   10439 N N   . ARG J 1 25  ? 12.326  13.746  -15.023 1.00 61.18  ? 21  ARG J N   1 
ATOM   10440 C CA  A ARG J 1 25  ? 12.019  12.599  -14.175 0.48 56.57  ? 21  ARG J CA  1 
ATOM   10441 C CA  B ARG J 1 25  ? 12.027  12.611  -14.157 0.52 56.64  ? 21  ARG J CA  1 
ATOM   10442 C C   . ARG J 1 25  ? 13.161  11.594  -14.217 1.00 53.35  ? 21  ARG J C   1 
ATOM   10443 O O   . ARG J 1 25  ? 13.489  10.958  -13.214 1.00 52.65  ? 21  ARG J O   1 
ATOM   10444 C CB  A ARG J 1 25  ? 10.731  11.917  -14.641 0.48 53.92  ? 21  ARG J CB  1 
ATOM   10445 C CB  B ARG J 1 25  ? 10.706  11.951  -14.560 0.52 51.94  ? 21  ARG J CB  1 
ATOM   10446 C CG  A ARG J 1 25  ? 9.454   12.646  -14.252 0.48 43.44  ? 21  ARG J CG  1 
ATOM   10447 C CG  B ARG J 1 25  ? 9.465   12.748  -14.181 0.52 43.01  ? 21  ARG J CG  1 
ATOM   10448 C CD  A ARG J 1 25  ? 8.216   11.906  -14.743 0.48 33.68  ? 21  ARG J CD  1 
ATOM   10449 C CD  B ARG J 1 25  ? 8.212   11.883  -14.233 0.52 36.95  ? 21  ARG J CD  1 
ATOM   10450 N NE  A ARG J 1 25  ? 8.320   10.462  -14.524 0.48 30.78  ? 21  ARG J NE  1 
ATOM   10451 N NE  B ARG J 1 25  ? 7.881   11.444  -15.589 0.52 26.74  ? 21  ARG J NE  1 
ATOM   10452 C CZ  A ARG J 1 25  ? 8.556   9.557   -15.474 0.48 34.23  ? 21  ARG J CZ  1 
ATOM   10453 C CZ  B ARG J 1 25  ? 7.034   12.067  -16.407 0.52 27.31  ? 21  ARG J CZ  1 
ATOM   10454 N NH1 A ARG J 1 25  ? 8.705   9.916   -16.743 0.48 13.18  ? 21  ARG J NH1 1 
ATOM   10455 N NH1 B ARG J 1 25  ? 6.412   13.178  -16.028 0.52 35.10  ? 21  ARG J NH1 1 
ATOM   10456 N NH2 A ARG J 1 25  ? 8.635   8.273   -15.153 0.48 46.29  ? 21  ARG J NH2 1 
ATOM   10457 N NH2 B ARG J 1 25  ? 6.805   11.576  -17.617 0.52 15.56  ? 21  ARG J NH2 1 
ATOM   10458 N N   . LEU J 1 26  ? 13.760  11.452  -15.394 1.00 43.57  ? 22  LEU J N   1 
ATOM   10459 C CA  . LEU J 1 26  ? 14.868  10.531  -15.589 1.00 43.17  ? 22  LEU J CA  1 
ATOM   10460 C C   . LEU J 1 26  ? 16.092  10.996  -14.806 1.00 49.82  ? 22  LEU J C   1 
ATOM   10461 O O   . LEU J 1 26  ? 16.855  10.180  -14.290 1.00 62.31  ? 22  LEU J O   1 
ATOM   10462 C CB  . LEU J 1 26  ? 15.197  10.419  -17.077 1.00 42.06  ? 22  LEU J CB  1 
ATOM   10463 C CG  . LEU J 1 26  ? 16.283  9.419   -17.460 1.00 39.32  ? 22  LEU J CG  1 
ATOM   10464 C CD1 . LEU J 1 26  ? 15.993  8.851   -18.836 1.00 45.71  ? 22  LEU J CD1 1 
ATOM   10465 C CD2 . LEU J 1 26  ? 17.654  10.073  -17.434 1.00 36.84  ? 22  LEU J CD2 1 
ATOM   10466 N N   . ILE J 1 27  ? 16.269  12.312  -14.718 1.00 40.40  ? 23  ILE J N   1 
ATOM   10467 C CA  . ILE J 1 27  ? 17.372  12.896  -13.960 1.00 46.30  ? 23  ILE J CA  1 
ATOM   10468 C C   . ILE J 1 27  ? 17.137  12.819  -12.455 1.00 45.32  ? 23  ILE J C   1 
ATOM   10469 O O   . ILE J 1 27  ? 18.015  12.403  -11.701 1.00 47.42  ? 23  ILE J O   1 
ATOM   10470 C CB  . ILE J 1 27  ? 17.586  14.375  -14.338 1.00 48.73  ? 23  ILE J CB  1 
ATOM   10471 C CG1 . ILE J 1 27  ? 18.218  14.477  -15.726 1.00 34.38  ? 23  ILE J CG1 1 
ATOM   10472 C CG2 . ILE J 1 27  ? 18.469  15.073  -13.304 1.00 40.01  ? 23  ILE J CG2 1 
ATOM   10473 C CD1 . ILE J 1 27  ? 18.349  15.896  -16.238 1.00 38.08  ? 23  ILE J CD1 1 
ATOM   10474 N N   . ASP J 1 28  ? 15.947  13.227  -12.026 1.00 50.50  ? 24  ASP J N   1 
ATOM   10475 C CA  . ASP J 1 28  ? 15.621  13.303  -10.606 1.00 40.10  ? 24  ASP J CA  1 
ATOM   10476 C C   . ASP J 1 28  ? 15.837  11.973  -9.897  1.00 37.51  ? 24  ASP J C   1 
ATOM   10477 O O   . ASP J 1 28  ? 16.174  11.941  -8.714  1.00 47.76  ? 24  ASP J O   1 
ATOM   10478 C CB  . ASP J 1 28  ? 14.169  13.752  -10.421 1.00 48.13  ? 24  ASP J CB  1 
ATOM   10479 C CG  . ASP J 1 28  ? 13.924  15.166  -10.918 1.00 50.47  ? 24  ASP J CG  1 
ATOM   10480 O OD1 . ASP J 1 28  ? 14.869  15.982  -10.885 1.00 53.87  ? 24  ASP J OD1 1 
ATOM   10481 O OD2 . ASP J 1 28  ? 12.788  15.463  -11.342 1.00 57.43  ? 24  ASP J OD2 1 
ATOM   10482 N N   . SER J 1 29  ? 15.643  10.877  -10.623 1.00 46.90  ? 25  SER J N   1 
ATOM   10483 C CA  . SER J 1 29  ? 15.710  9.545   -10.029 1.00 54.17  ? 25  SER J CA  1 
ATOM   10484 C C   . SER J 1 29  ? 17.143  9.025   -9.879  1.00 53.61  ? 25  SER J C   1 
ATOM   10485 O O   . SER J 1 29  ? 17.383  8.065   -9.144  1.00 44.60  ? 25  SER J O   1 
ATOM   10486 C CB  . SER J 1 29  ? 14.869  8.557   -10.848 1.00 41.33  ? 25  SER J CB  1 
ATOM   10487 O OG  . SER J 1 29  ? 15.314  8.485   -12.191 1.00 35.66  ? 25  SER J OG  1 
ATOM   10488 N N   . GLN J 1 30  ? 18.091  9.658   -10.561 1.00 48.86  ? 26  GLN J N   1 
ATOM   10489 C CA  . GLN J 1 30  ? 19.482  9.219   -10.506 1.00 55.44  ? 26  GLN J CA  1 
ATOM   10490 C C   . GLN J 1 30  ? 20.121  9.524   -9.155  1.00 52.52  ? 26  GLN J C   1 
ATOM   10491 O O   . GLN J 1 30  ? 20.006  10.634  -8.637  1.00 35.89  ? 26  GLN J O   1 
ATOM   10492 C CB  . GLN J 1 30  ? 20.296  9.877   -11.620 1.00 56.84  ? 26  GLN J CB  1 
ATOM   10493 C CG  . GLN J 1 30  ? 19.772  9.585   -13.011 1.00 69.52  ? 26  GLN J CG  1 
ATOM   10494 C CD  . GLN J 1 30  ? 19.533  8.107   -13.246 1.00 63.36  ? 26  GLN J CD  1 
ATOM   10495 O OE1 . GLN J 1 30  ? 20.455  7.295   -13.167 1.00 57.25  ? 26  GLN J OE1 1 
ATOM   10496 N NE2 . GLN J 1 30  ? 18.288  7.749   -13.531 1.00 61.27  ? 26  GLN J NE2 1 
ATOM   10497 N N   . MET J 1 31  ? 20.802  8.528   -8.595  1.00 53.98  ? 27  MET J N   1 
ATOM   10498 C CA  . MET J 1 31  ? 21.461  8.672   -7.303  1.00 53.89  ? 27  MET J CA  1 
ATOM   10499 C C   . MET J 1 31  ? 22.736  9.495   -7.446  1.00 51.04  ? 27  MET J C   1 
ATOM   10500 O O   . MET J 1 31  ? 23.481  9.337   -8.413  1.00 50.76  ? 27  MET J O   1 
ATOM   10501 C CB  . MET J 1 31  ? 21.793  7.295   -6.724  1.00 52.81  ? 27  MET J CB  1 
ATOM   10502 C CG  . MET J 1 31  ? 22.287  7.332   -5.289  1.00 51.68  ? 27  MET J CG  1 
ATOM   10503 S SD  . MET J 1 31  ? 22.465  5.688   -4.573  1.00 63.43  ? 27  MET J SD  1 
ATOM   10504 C CE  . MET J 1 31  ? 23.882  5.071   -5.476  1.00 77.68  ? 27  MET J CE  1 
ATOM   10505 N N   . GLU J 1 32  ? 22.982  10.371  -6.476  1.00 47.17  ? 28  GLU J N   1 
ATOM   10506 C CA  . GLU J 1 32  ? 24.141  11.256  -6.515  1.00 55.96  ? 28  GLU J CA  1 
ATOM   10507 C C   . GLU J 1 32  ? 25.401  10.528  -6.056  1.00 76.50  ? 28  GLU J C   1 
ATOM   10508 O O   . GLU J 1 32  ? 25.500  10.102  -4.905  1.00 81.59  ? 28  GLU J O   1 
ATOM   10509 C CB  . GLU J 1 32  ? 23.898  12.490  -5.644  1.00 55.26  ? 28  GLU J CB  1 
ATOM   10510 C CG  . GLU J 1 32  ? 22.683  13.308  -6.063  1.00 56.54  ? 28  GLU J CG  1 
ATOM   10511 C CD  . GLU J 1 32  ? 22.501  14.567  -5.231  1.00 61.83  ? 28  GLU J CD  1 
ATOM   10512 O OE1 . GLU J 1 32  ? 21.931  15.546  -5.756  1.00 56.55  ? 28  GLU J OE1 1 
ATOM   10513 O OE2 . GLU J 1 32  ? 22.920  14.576  -4.054  1.00 61.86  ? 28  GLU J OE2 1 
ATOM   10514 N N   . THR J 1 33  ? 26.359  10.390  -6.967  1.00 81.22  ? 29  THR J N   1 
ATOM   10515 C CA  . THR J 1 33  ? 27.608  9.697   -6.674  1.00 89.12  ? 29  THR J CA  1 
ATOM   10516 C C   . THR J 1 33  ? 28.797  10.464  -7.240  1.00 92.59  ? 29  THR J C   1 
ATOM   10517 O O   . THR J 1 33  ? 28.637  11.337  -8.092  1.00 90.02  ? 29  THR J O   1 
ATOM   10518 C CB  . THR J 1 33  ? 27.611  8.279   -7.272  1.00 97.96  ? 29  THR J CB  1 
ATOM   10519 O OG1 . THR J 1 33  ? 27.480  8.358   -8.697  1.00 106.65 ? 29  THR J OG1 1 
ATOM   10520 C CG2 . THR J 1 33  ? 26.467  7.454   -6.703  1.00 93.99  ? 29  THR J CG2 1 
ATOM   10521 N N   . SER J 1 34  ? 29.991  10.128  -6.760  1.00 102.45 ? 30  SER J N   1 
ATOM   10522 C CA  . SER J 1 34  ? 31.216  10.769  -7.221  1.00 106.77 ? 30  SER J CA  1 
ATOM   10523 C C   . SER J 1 34  ? 31.743  10.095  -8.486  1.00 115.38 ? 30  SER J C   1 
ATOM   10524 O O   . SER J 1 34  ? 32.605  10.638  -9.176  1.00 118.54 ? 30  SER J O   1 
ATOM   10525 C CB  . SER J 1 34  ? 32.285  10.712  -6.128  1.00 97.90  ? 30  SER J CB  1 
ATOM   10526 O OG  . SER J 1 34  ? 32.590  9.370   -5.787  1.00 91.69  ? 30  SER J OG  1 
ATOM   10527 N N   . CYS J 1 35  ? 31.219  8.909   -8.780  1.00 118.71 ? 31  CYS J N   1 
ATOM   10528 C CA  . CYS J 1 35  ? 31.675  8.125   -9.920  1.00 122.59 ? 31  CYS J CA  1 
ATOM   10529 C C   . CYS J 1 35  ? 31.537  8.912   -11.222 1.00 124.61 ? 31  CYS J C   1 
ATOM   10530 O O   . CYS J 1 35  ? 30.536  9.596   -11.441 1.00 127.06 ? 31  CYS J O   1 
ATOM   10531 C CB  . CYS J 1 35  ? 30.884  6.818   -10.000 1.00 125.13 ? 31  CYS J CB  1 
ATOM   10532 S SG  . CYS J 1 35  ? 29.287  6.949   -10.836 1.00 78.51  ? 31  CYS J SG  1 
ATOM   10533 N N   . GLN J 1 36  ? 32.549  8.814   -12.079 1.00 124.10 ? 32  GLN J N   1 
ATOM   10534 C CA  . GLN J 1 36  ? 32.568  9.558   -13.334 1.00 127.57 ? 32  GLN J CA  1 
ATOM   10535 C C   . GLN J 1 36  ? 32.646  8.622   -14.537 1.00 123.06 ? 32  GLN J C   1 
ATOM   10536 O O   . GLN J 1 36  ? 33.175  7.515   -14.442 1.00 130.57 ? 32  GLN J O   1 
ATOM   10537 C CB  . GLN J 1 36  ? 33.750  10.529  -13.352 1.00 135.85 ? 32  GLN J CB  1 
ATOM   10538 C CG  . GLN J 1 36  ? 33.665  11.625  -12.302 1.00 142.02 ? 32  GLN J CG  1 
ATOM   10539 C CD  . GLN J 1 36  ? 34.876  12.537  -12.314 1.00 148.20 ? 32  GLN J CD  1 
ATOM   10540 O OE1 . GLN J 1 36  ? 35.921  12.192  -12.865 1.00 151.07 ? 32  GLN J OE1 1 
ATOM   10541 N NE2 . GLN J 1 36  ? 34.739  13.711  -11.708 1.00 149.61 ? 32  GLN J NE2 1 
ATOM   10542 N N   . ILE J 1 37  ? 32.114  9.079   -15.668 1.00 107.51 ? 33  ILE J N   1 
ATOM   10543 C CA  . ILE J 1 37  ? 32.136  8.301   -16.902 1.00 87.27  ? 33  ILE J CA  1 
ATOM   10544 C C   . ILE J 1 37  ? 32.665  9.137   -18.062 1.00 74.30  ? 33  ILE J C   1 
ATOM   10545 O O   . ILE J 1 37  ? 32.853  10.347  -17.936 1.00 66.43  ? 33  ILE J O   1 
ATOM   10546 C CB  . ILE J 1 37  ? 30.733  7.787   -17.275 1.00 85.92  ? 33  ILE J CB  1 
ATOM   10547 C CG1 . ILE J 1 37  ? 29.766  8.961   -17.452 1.00 91.96  ? 33  ILE J CG1 1 
ATOM   10548 C CG2 . ILE J 1 37  ? 30.221  6.824   -16.213 1.00 79.30  ? 33  ILE J CG2 1 
ATOM   10549 C CD1 . ILE J 1 37  ? 28.450  8.583   -18.096 1.00 91.41  ? 33  ILE J CD1 1 
ATOM   10550 N N   . THR J 1 38  ? 32.893  8.479   -19.195 1.00 81.00  ? 34  THR J N   1 
ATOM   10551 C CA  . THR J 1 38  ? 33.412  9.142   -20.385 1.00 74.45  ? 34  THR J CA  1 
ATOM   10552 C C   . THR J 1 38  ? 32.361  9.169   -21.488 1.00 70.72  ? 34  THR J C   1 
ATOM   10553 O O   . THR J 1 38  ? 31.541  8.255   -21.598 1.00 57.07  ? 34  THR J O   1 
ATOM   10554 C CB  . THR J 1 38  ? 34.668  8.425   -20.916 1.00 77.62  ? 34  THR J CB  1 
ATOM   10555 O OG1 . THR J 1 38  ? 35.649  8.335   -19.875 1.00 79.14  ? 34  THR J OG1 1 
ATOM   10556 C CG2 . THR J 1 38  ? 35.256  9.173   -22.106 1.00 80.71  ? 34  THR J CG2 1 
ATOM   10557 N N   . PHE J 1 39  ? 32.391  10.220  -22.301 1.00 78.59  ? 35  PHE J N   1 
ATOM   10558 C CA  . PHE J 1 39  ? 31.464  10.353  -23.420 1.00 77.40  ? 35  PHE J CA  1 
ATOM   10559 C C   . PHE J 1 39  ? 31.887  11.481  -24.358 1.00 58.95  ? 35  PHE J C   1 
ATOM   10560 O O   . PHE J 1 39  ? 32.508  12.455  -23.932 1.00 44.76  ? 35  PHE J O   1 
ATOM   10561 C CB  . PHE J 1 39  ? 30.044  10.611  -22.910 1.00 81.72  ? 35  PHE J CB  1 
ATOM   10562 C CG  . PHE J 1 39  ? 29.898  11.897  -22.148 1.00 81.48  ? 35  PHE J CG  1 
ATOM   10563 C CD1 . PHE J 1 39  ? 29.693  13.094  -22.815 1.00 86.23  ? 35  PHE J CD1 1 
ATOM   10564 C CD2 . PHE J 1 39  ? 29.963  11.910  -20.764 1.00 83.04  ? 35  PHE J CD2 1 
ATOM   10565 C CE1 . PHE J 1 39  ? 29.557  14.280  -22.117 1.00 84.46  ? 35  PHE J CE1 1 
ATOM   10566 C CE2 . PHE J 1 39  ? 29.827  13.093  -20.060 1.00 86.28  ? 35  PHE J CE2 1 
ATOM   10567 C CZ  . PHE J 1 39  ? 29.625  14.279  -20.738 1.00 86.76  ? 35  PHE J CZ  1 
ATOM   10568 N N   . GLU J 1 40  ? 31.546  11.341  -25.636 1.00 56.16  ? 36  GLU J N   1 
ATOM   10569 C CA  . GLU J 1 40  ? 31.865  12.353  -26.637 1.00 66.62  ? 36  GLU J CA  1 
ATOM   10570 C C   . GLU J 1 40  ? 30.740  13.376  -26.729 1.00 62.32  ? 36  GLU J C   1 
ATOM   10571 O O   . GLU J 1 40  ? 29.565  13.012  -26.786 1.00 70.51  ? 36  GLU J O   1 
ATOM   10572 C CB  . GLU J 1 40  ? 32.075  11.701  -28.006 1.00 85.75  ? 36  GLU J CB  1 
ATOM   10573 C CG  . GLU J 1 40  ? 33.214  10.695  -28.055 1.00 97.61  ? 36  GLU J CG  1 
ATOM   10574 C CD  . GLU J 1 40  ? 34.579  11.351  -27.995 1.00 111.43 ? 36  GLU J CD  1 
ATOM   10575 O OE1 . GLU J 1 40  ? 34.642  12.597  -27.943 1.00 118.65 ? 36  GLU J OE1 1 
ATOM   10576 O OE2 . GLU J 1 40  ? 35.591  10.619  -28.002 1.00 112.49 ? 36  GLU J OE2 1 
ATOM   10577 N N   . PHE J 1 41  ? 31.101  14.655  -26.749 1.00 59.94  ? 37  PHE J N   1 
ATOM   10578 C CA  . PHE J 1 41  ? 30.114  15.725  -26.817 1.00 63.78  ? 37  PHE J CA  1 
ATOM   10579 C C   . PHE J 1 41  ? 30.733  16.994  -27.402 1.00 68.11  ? 37  PHE J C   1 
ATOM   10580 O O   . PHE J 1 41  ? 31.949  17.077  -27.569 1.00 83.57  ? 37  PHE J O   1 
ATOM   10581 C CB  . PHE J 1 41  ? 29.548  16.001  -25.425 1.00 62.94  ? 37  PHE J CB  1 
ATOM   10582 C CG  . PHE J 1 41  ? 28.190  16.638  -25.439 1.00 66.76  ? 37  PHE J CG  1 
ATOM   10583 C CD1 . PHE J 1 41  ? 27.134  16.031  -26.099 1.00 79.10  ? 37  PHE J CD1 1 
ATOM   10584 C CD2 . PHE J 1 41  ? 27.969  17.846  -24.799 1.00 71.20  ? 37  PHE J CD2 1 
ATOM   10585 C CE1 . PHE J 1 41  ? 25.882  16.614  -26.116 1.00 85.91  ? 37  PHE J CE1 1 
ATOM   10586 C CE2 . PHE J 1 41  ? 26.718  18.432  -24.812 1.00 84.19  ? 37  PHE J CE2 1 
ATOM   10587 C CZ  . PHE J 1 41  ? 25.674  17.816  -25.472 1.00 91.80  ? 37  PHE J CZ  1 
ATOM   10588 N N   . VAL J 1 42  ? 29.895  17.981  -27.709 1.00 51.63  ? 38  VAL J N   1 
ATOM   10589 C CA  . VAL J 1 42  ? 30.363  19.218  -28.330 1.00 49.43  ? 38  VAL J CA  1 
ATOM   10590 C C   . VAL J 1 42  ? 31.148  20.079  -27.346 1.00 68.32  ? 38  VAL J C   1 
ATOM   10591 O O   . VAL J 1 42  ? 30.884  20.065  -26.143 1.00 68.84  ? 38  VAL J O   1 
ATOM   10592 C CB  . VAL J 1 42  ? 29.190  20.054  -28.875 1.00 54.95  ? 38  VAL J CB  1 
ATOM   10593 C CG1 . VAL J 1 42  ? 29.702  21.319  -29.551 1.00 49.00  ? 38  VAL J CG1 1 
ATOM   10594 C CG2 . VAL J 1 42  ? 28.360  19.234  -29.844 1.00 58.07  ? 38  VAL J CG2 1 
ATOM   10595 N N   . ASP J 1 43  ? 32.112  20.829  -27.870 1.00 77.02  ? 39  ASP J N   1 
ATOM   10596 C CA  . ASP J 1 43  ? 32.904  21.744  -27.058 1.00 80.42  ? 39  ASP J CA  1 
ATOM   10597 C C   . ASP J 1 43  ? 32.387  23.167  -27.240 1.00 74.83  ? 39  ASP J C   1 
ATOM   10598 O O   . ASP J 1 43  ? 32.471  23.733  -28.330 1.00 83.60  ? 39  ASP J O   1 
ATOM   10599 C CB  . ASP J 1 43  ? 34.380  21.662  -27.454 1.00 97.52  ? 39  ASP J CB  1 
ATOM   10600 C CG  . ASP J 1 43  ? 35.292  22.353  -26.458 1.00 103.02 ? 39  ASP J CG  1 
ATOM   10601 O OD1 . ASP J 1 43  ? 34.986  23.496  -26.059 1.00 103.62 ? 39  ASP J OD1 1 
ATOM   10602 O OD2 . ASP J 1 43  ? 36.317  21.752  -26.074 1.00 97.97  ? 39  ASP J OD2 1 
ATOM   10603 N N   . GLN J 1 44  ? 31.850  23.741  -26.168 1.00 72.30  ? 40  GLN J N   1 
ATOM   10604 C CA  . GLN J 1 44  ? 31.223  25.058  -26.240 1.00 91.82  ? 40  GLN J CA  1 
ATOM   10605 C C   . GLN J 1 44  ? 32.214  26.187  -26.532 1.00 91.27  ? 40  GLN J C   1 
ATOM   10606 O O   . GLN J 1 44  ? 31.808  27.308  -26.838 1.00 73.11  ? 40  GLN J O   1 
ATOM   10607 C CB  . GLN J 1 44  ? 30.463  25.349  -24.945 1.00 107.95 ? 40  GLN J CB  1 
ATOM   10608 C CG  . GLN J 1 44  ? 29.186  24.545  -24.798 1.00 119.72 ? 40  GLN J CG  1 
ATOM   10609 C CD  . GLN J 1 44  ? 28.634  24.591  -23.389 1.00 123.81 ? 40  GLN J CD  1 
ATOM   10610 O OE1 . GLN J 1 44  ? 29.370  24.819  -22.429 1.00 123.59 ? 40  GLN J OE1 1 
ATOM   10611 N NE2 . GLN J 1 44  ? 27.331  24.380  -23.256 1.00 124.70 ? 40  GLN J NE2 1 
ATOM   10612 N N   . GLU J 1 45  ? 33.507  25.895  -26.440 1.00 108.96 ? 41  GLU J N   1 
ATOM   10613 C CA  . GLU J 1 45  ? 34.532  26.887  -26.747 1.00 120.00 ? 41  GLU J CA  1 
ATOM   10614 C C   . GLU J 1 45  ? 34.854  26.886  -28.238 1.00 125.14 ? 41  GLU J C   1 
ATOM   10615 O O   . GLU J 1 45  ? 34.921  27.941  -28.870 1.00 131.62 ? 41  GLU J O   1 
ATOM   10616 C CB  . GLU J 1 45  ? 35.800  26.613  -25.937 1.00 123.51 ? 41  GLU J CB  1 
ATOM   10617 C CG  . GLU J 1 45  ? 36.894  27.651  -26.131 1.00 127.30 ? 41  GLU J CG  1 
ATOM   10618 C CD  . GLU J 1 45  ? 36.467  29.039  -25.693 1.00 132.86 ? 41  GLU J CD  1 
ATOM   10619 O OE1 . GLU J 1 45  ? 35.449  29.154  -24.978 1.00 133.48 ? 41  GLU J OE1 1 
ATOM   10620 O OE2 . GLU J 1 45  ? 37.149  30.018  -26.064 1.00 136.39 ? 41  GLU J OE2 1 
ATOM   10621 N N   . GLN J 1 46  ? 35.053  25.695  -28.796 1.00 119.21 ? 42  GLN J N   1 
ATOM   10622 C CA  . GLN J 1 46  ? 35.322  25.552  -30.222 1.00 122.39 ? 42  GLN J CA  1 
ATOM   10623 C C   . GLN J 1 46  ? 34.092  25.941  -31.037 1.00 114.24 ? 42  GLN J C   1 
ATOM   10624 O O   . GLN J 1 46  ? 34.206  26.383  -32.181 1.00 116.91 ? 42  GLN J O   1 
ATOM   10625 C CB  . GLN J 1 46  ? 35.721  24.111  -30.548 1.00 132.27 ? 42  GLN J CB  1 
ATOM   10626 C CG  . GLN J 1 46  ? 36.983  23.641  -29.844 1.00 137.15 ? 42  GLN J CG  1 
ATOM   10627 C CD  . GLN J 1 46  ? 38.214  24.416  -30.273 1.00 139.64 ? 42  GLN J CD  1 
ATOM   10628 O OE1 . GLN J 1 46  ? 38.294  24.903  -31.401 1.00 138.91 ? 42  GLN J OE1 1 
ATOM   10629 N NE2 . GLN J 1 46  ? 39.179  24.538  -29.370 1.00 138.55 ? 42  GLN J NE2 1 
ATOM   10630 N N   . LEU J 1 47  ? 32.918  25.775  -30.436 1.00 100.63 ? 43  LEU J N   1 
ATOM   10631 C CA  . LEU J 1 47  ? 31.656  26.072  -31.102 1.00 85.51  ? 43  LEU J CA  1 
ATOM   10632 C C   . LEU J 1 47  ? 30.840  27.045  -30.254 1.00 78.79  ? 43  LEU J C   1 
ATOM   10633 O O   . LEU J 1 47  ? 30.396  26.700  -29.160 1.00 72.79  ? 43  LEU J O   1 
ATOM   10634 C CB  . LEU J 1 47  ? 30.875  24.775  -31.329 1.00 77.27  ? 43  LEU J CB  1 
ATOM   10635 C CG  . LEU J 1 47  ? 29.716  24.785  -32.328 1.00 77.44  ? 43  LEU J CG  1 
ATOM   10636 C CD1 . LEU J 1 47  ? 30.036  25.630  -33.548 1.00 70.90  ? 43  LEU J CD1 1 
ATOM   10637 C CD2 . LEU J 1 47  ? 29.405  23.357  -32.750 1.00 76.79  ? 43  LEU J CD2 1 
ATOM   10638 N N   . LYS J 1 48  ? 30.648  28.259  -30.763 1.00 78.51  ? 44  LYS J N   1 
ATOM   10639 C CA  . LYS J 1 48  ? 30.007  29.325  -29.994 1.00 80.64  ? 44  LYS J CA  1 
ATOM   10640 C C   . LYS J 1 48  ? 28.540  29.503  -30.374 1.00 67.86  ? 44  LYS J C   1 
ATOM   10641 O O   . LYS J 1 48  ? 27.656  29.413  -29.522 1.00 67.94  ? 44  LYS J O   1 
ATOM   10642 C CB  . LYS J 1 48  ? 30.742  30.647  -30.212 1.00 89.12  ? 44  LYS J CB  1 
ATOM   10643 C CG  . LYS J 1 48  ? 32.244  30.564  -30.011 1.00 92.09  ? 44  LYS J CG  1 
ATOM   10644 C CD  . LYS J 1 48  ? 32.613  30.293  -28.561 1.00 88.52  ? 44  LYS J CD  1 
ATOM   10645 C CE  . LYS J 1 48  ? 32.239  31.457  -27.656 1.00 87.16  ? 44  LYS J CE  1 
ATOM   10646 N NZ  . LYS J 1 48  ? 33.027  31.451  -26.391 1.00 85.49  ? 44  LYS J NZ  1 
ATOM   10647 N N   . ASP J 1 49  ? 28.296  29.786  -31.651 1.00 55.68  ? 45  ASP J N   1 
ATOM   10648 C CA  . ASP J 1 49  ? 26.937  29.969  -32.161 1.00 72.24  ? 45  ASP J CA  1 
ATOM   10649 C C   . ASP J 1 49  ? 25.980  28.938  -31.570 1.00 86.62  ? 45  ASP J C   1 
ATOM   10650 O O   . ASP J 1 49  ? 26.008  27.767  -31.955 1.00 93.10  ? 45  ASP J O   1 
ATOM   10651 C CB  . ASP J 1 49  ? 26.911  29.868  -33.689 1.00 75.62  ? 45  ASP J CB  1 
ATOM   10652 C CG  . ASP J 1 49  ? 25.539  30.166  -34.270 1.00 78.55  ? 45  ASP J CG  1 
ATOM   10653 O OD1 . ASP J 1 49  ? 24.818  31.006  -33.692 1.00 79.38  ? 45  ASP J OD1 1 
ATOM   10654 O OD2 . ASP J 1 49  ? 25.183  29.563  -35.304 1.00 76.10  ? 45  ASP J OD2 1 
ATOM   10655 N N   . PRO J 1 50  ? 25.123  29.372  -30.632 1.00 84.03  ? 46  PRO J N   1 
ATOM   10656 C CA  . PRO J 1 50  ? 24.184  28.465  -29.964 1.00 78.75  ? 46  PRO J CA  1 
ATOM   10657 C C   . PRO J 1 50  ? 23.398  27.570  -30.925 1.00 63.89  ? 46  PRO J C   1 
ATOM   10658 O O   . PRO J 1 50  ? 23.109  26.427  -30.574 1.00 67.28  ? 46  PRO J O   1 
ATOM   10659 C CB  . PRO J 1 50  ? 23.251  29.423  -29.222 1.00 85.86  ? 46  PRO J CB  1 
ATOM   10660 C CG  . PRO J 1 50  ? 24.106  30.598  -28.922 1.00 90.35  ? 46  PRO J CG  1 
ATOM   10661 C CD  . PRO J 1 50  ? 25.015  30.747  -30.112 1.00 88.84  ? 46  PRO J CD  1 
ATOM   10662 N N   . VAL J 1 51  ? 23.070  28.071  -32.112 1.00 52.53  ? 47  VAL J N   1 
ATOM   10663 C CA  . VAL J 1 51  ? 22.319  27.282  -33.084 1.00 56.41  ? 47  VAL J CA  1 
ATOM   10664 C C   . VAL J 1 51  ? 23.142  26.093  -33.561 1.00 69.82  ? 47  VAL J C   1 
ATOM   10665 O O   . VAL J 1 51  ? 22.748  24.941  -33.379 1.00 78.91  ? 47  VAL J O   1 
ATOM   10666 C CB  . VAL J 1 51  ? 21.911  28.122  -34.309 1.00 46.16  ? 47  VAL J CB  1 
ATOM   10667 C CG1 . VAL J 1 51  ? 21.552  27.219  -35.495 1.00 25.34  ? 47  VAL J CG1 1 
ATOM   10668 C CG2 . VAL J 1 51  ? 20.755  29.050  -33.958 1.00 49.93  ? 47  VAL J CG2 1 
ATOM   10669 N N   . CYS J 1 52  ? 24.292  26.381  -34.164 1.00 74.59  ? 48  CYS J N   1 
ATOM   10670 C CA  . CYS J 1 52  ? 25.148  25.332  -34.708 1.00 66.69  ? 48  CYS J CA  1 
ATOM   10671 C C   . CYS J 1 52  ? 25.639  24.413  -33.595 1.00 55.38  ? 48  CYS J C   1 
ATOM   10672 O O   . CYS J 1 52  ? 25.982  23.257  -33.846 1.00 59.30  ? 48  CYS J O   1 
ATOM   10673 C CB  . CYS J 1 52  ? 26.348  25.921  -35.457 1.00 64.43  ? 48  CYS J CB  1 
ATOM   10674 S SG  . CYS J 1 52  ? 25.966  26.696  -37.041 1.00 54.68  ? 48  CYS J SG  1 
ATOM   10675 N N   . TYR J 1 53  ? 25.689  24.932  -32.371 1.00 46.79  ? 49  TYR J N   1 
ATOM   10676 C CA  . TYR J 1 53  ? 26.011  24.103  -31.214 1.00 56.60  ? 49  TYR J CA  1 
ATOM   10677 C C   . TYR J 1 53  ? 24.917  23.059  -31.021 1.00 68.60  ? 49  TYR J C   1 
ATOM   10678 O O   . TYR J 1 53  ? 25.201  21.876  -30.829 1.00 79.87  ? 49  TYR J O   1 
ATOM   10679 C CB  . TYR J 1 53  ? 26.160  24.943  -29.940 1.00 50.79  ? 49  TYR J CB  1 
ATOM   10680 C CG  . TYR J 1 53  ? 26.509  24.115  -28.719 1.00 70.16  ? 49  TYR J CG  1 
ATOM   10681 C CD1 . TYR J 1 53  ? 27.824  23.760  -28.448 1.00 84.40  ? 49  TYR J CD1 1 
ATOM   10682 C CD2 . TYR J 1 53  ? 25.521  23.678  -27.844 1.00 81.05  ? 49  TYR J CD2 1 
ATOM   10683 C CE1 . TYR J 1 53  ? 28.146  22.999  -27.338 1.00 87.85  ? 49  TYR J CE1 1 
ATOM   10684 C CE2 . TYR J 1 53  ? 25.836  22.916  -26.733 1.00 87.86  ? 49  TYR J CE2 1 
ATOM   10685 C CZ  . TYR J 1 53  ? 27.149  22.584  -26.485 1.00 91.76  ? 49  TYR J CZ  1 
ATOM   10686 O OH  . TYR J 1 53  ? 27.459  21.825  -25.382 1.00 92.33  ? 49  TYR J OH  1 
ATOM   10687 N N   . LEU J 1 54  ? 23.666  23.505  -31.082 1.00 63.36  ? 50  LEU J N   1 
ATOM   10688 C CA  . LEU J 1 54  ? 22.519  22.615  -30.944 1.00 59.61  ? 50  LEU J CA  1 
ATOM   10689 C C   . LEU J 1 54  ? 22.434  21.652  -32.125 1.00 68.18  ? 50  LEU J C   1 
ATOM   10690 O O   . LEU J 1 54  ? 22.003  20.510  -31.971 1.00 77.82  ? 50  LEU J O   1 
ATOM   10691 C CB  . LEU J 1 54  ? 21.224  23.425  -30.831 1.00 53.58  ? 50  LEU J CB  1 
ATOM   10692 C CG  . LEU J 1 54  ? 21.025  24.229  -29.540 1.00 52.50  ? 50  LEU J CG  1 
ATOM   10693 C CD1 . LEU J 1 54  ? 19.765  25.076  -29.625 1.00 50.29  ? 50  LEU J CD1 1 
ATOM   10694 C CD2 . LEU J 1 54  ? 20.965  23.313  -28.332 1.00 44.96  ? 50  LEU J CD2 1 
ATOM   10695 N N   . LYS J 1 55  ? 22.853  22.111  -33.302 1.00 65.92  ? 51  LYS J N   1 
ATOM   10696 C CA  . LYS J 1 55  ? 22.824  21.270  -34.495 1.00 63.09  ? 51  LYS J CA  1 
ATOM   10697 C C   . LYS J 1 55  ? 23.721  20.047  -34.325 1.00 65.02  ? 51  LYS J C   1 
ATOM   10698 O O   . LYS J 1 55  ? 23.251  18.912  -34.399 1.00 62.50  ? 51  LYS J O   1 
ATOM   10699 C CB  . LYS J 1 55  ? 23.246  22.057  -35.738 1.00 56.63  ? 51  LYS J CB  1 
ATOM   10700 C CG  . LYS J 1 55  ? 22.221  23.075  -36.211 1.00 66.11  ? 51  LYS J CG  1 
ATOM   10701 C CD  . LYS J 1 55  ? 22.316  23.300  -37.716 1.00 63.06  ? 51  LYS J CD  1 
ATOM   10702 C CE  . LYS J 1 55  ? 21.491  22.278  -38.485 1.00 56.25  ? 51  LYS J CE  1 
ATOM   10703 N NZ  . LYS J 1 55  ? 21.785  22.302  -39.943 1.00 57.74  ? 51  LYS J NZ  1 
ATOM   10704 N N   . LYS J 1 56  ? 25.010  20.278  -34.097 1.00 68.19  ? 52  LYS J N   1 
ATOM   10705 C CA  . LYS J 1 56  ? 25.952  19.179  -33.920 1.00 62.42  ? 52  LYS J CA  1 
ATOM   10706 C C   . LYS J 1 56  ? 25.641  18.400  -32.648 1.00 69.65  ? 52  LYS J C   1 
ATOM   10707 O O   . LYS J 1 56  ? 25.797  17.180  -32.603 1.00 81.53  ? 52  LYS J O   1 
ATOM   10708 C CB  . LYS J 1 56  ? 27.392  19.692  -33.878 1.00 59.11  ? 52  LYS J CB  1 
ATOM   10709 C CG  . LYS J 1 56  ? 28.421  18.582  -33.688 1.00 71.26  ? 52  LYS J CG  1 
ATOM   10710 C CD  . LYS J 1 56  ? 29.842  19.048  -33.975 1.00 73.02  ? 52  LYS J CD  1 
ATOM   10711 C CE  . LYS J 1 56  ? 29.995  19.581  -35.393 1.00 75.39  ? 52  LYS J CE  1 
ATOM   10712 N NZ  . LYS J 1 56  ? 29.415  18.668  -36.420 1.00 76.58  ? 52  LYS J NZ  1 
ATOM   10713 N N   . ALA J 1 57  ? 25.200  19.111  -31.615 1.00 65.35  ? 53  ALA J N   1 
ATOM   10714 C CA  . ALA J 1 57  ? 24.858  18.481  -30.347 1.00 59.16  ? 53  ALA J CA  1 
ATOM   10715 C C   . ALA J 1 57  ? 23.706  17.499  -30.527 1.00 60.05  ? 53  ALA J C   1 
ATOM   10716 O O   . ALA J 1 57  ? 23.648  16.466  -29.862 1.00 66.45  ? 53  ALA J O   1 
ATOM   10717 C CB  . ALA J 1 57  ? 24.496  19.536  -29.315 1.00 56.58  ? 53  ALA J CB  1 
ATOM   10718 N N   . PHE J 1 58  ? 22.792  17.823  -31.436 1.00 74.12  ? 54  PHE J N   1 
ATOM   10719 C CA  . PHE J 1 58  ? 21.612  16.996  -31.662 1.00 83.09  ? 54  PHE J CA  1 
ATOM   10720 C C   . PHE J 1 58  ? 21.957  15.662  -32.321 1.00 83.97  ? 54  PHE J C   1 
ATOM   10721 O O   . PHE J 1 58  ? 21.211  14.691  -32.198 1.00 83.70  ? 54  PHE J O   1 
ATOM   10722 C CB  . PHE J 1 58  ? 20.592  17.747  -32.519 1.00 92.67  ? 54  PHE J CB  1 
ATOM   10723 C CG  . PHE J 1 58  ? 19.399  16.919  -32.893 1.00 98.84  ? 54  PHE J CG  1 
ATOM   10724 C CD1 . PHE J 1 58  ? 18.383  16.691  -31.980 1.00 92.25  ? 54  PHE J CD1 1 
ATOM   10725 C CD2 . PHE J 1 58  ? 19.298  16.359  -34.155 1.00 103.56 ? 54  PHE J CD2 1 
ATOM   10726 C CE1 . PHE J 1 58  ? 17.287  15.925  -32.321 1.00 92.40  ? 54  PHE J CE1 1 
ATOM   10727 C CE2 . PHE J 1 58  ? 18.204  15.593  -34.502 1.00 104.46 ? 54  PHE J CE2 1 
ATOM   10728 C CZ  . PHE J 1 58  ? 17.198  15.375  -33.583 1.00 99.67  ? 54  PHE J CZ  1 
ATOM   10729 N N   . LEU J 1 59  ? 23.082  15.617  -33.028 1.00 83.28  ? 55  LEU J N   1 
ATOM   10730 C CA  . LEU J 1 59  ? 23.537  14.383  -33.658 1.00 79.14  ? 55  LEU J CA  1 
ATOM   10731 C C   . LEU J 1 59  ? 24.201  13.472  -32.632 1.00 79.97  ? 55  LEU J C   1 
ATOM   10732 O O   . LEU J 1 59  ? 24.087  12.249  -32.707 1.00 90.42  ? 55  LEU J O   1 
ATOM   10733 C CB  . LEU J 1 59  ? 24.524  14.692  -34.785 1.00 82.39  ? 55  LEU J CB  1 
ATOM   10734 C CG  . LEU J 1 59  ? 23.940  15.321  -36.051 1.00 80.63  ? 55  LEU J CG  1 
ATOM   10735 C CD1 . LEU J 1 59  ? 24.985  16.176  -36.747 1.00 88.58  ? 55  LEU J CD1 1 
ATOM   10736 C CD2 . LEU J 1 59  ? 23.422  14.244  -36.993 1.00 71.73  ? 55  LEU J CD2 1 
ATOM   10737 N N   . LEU J 1 60  ? 24.892  14.077  -31.672 1.00 68.66  ? 56  LEU J N   1 
ATOM   10738 C CA  . LEU J 1 60  ? 25.652  13.325  -30.681 1.00 69.08  ? 56  LEU J CA  1 
ATOM   10739 C C   . LEU J 1 60  ? 24.751  12.697  -29.624 1.00 78.24  ? 56  LEU J C   1 
ATOM   10740 O O   . LEU J 1 60  ? 24.987  11.568  -29.194 1.00 88.89  ? 56  LEU J O   1 
ATOM   10741 C CB  . LEU J 1 60  ? 26.685  14.234  -30.016 1.00 71.84  ? 56  LEU J CB  1 
ATOM   10742 C CG  . LEU J 1 60  ? 27.814  14.687  -30.944 1.00 71.20  ? 56  LEU J CG  1 
ATOM   10743 C CD1 . LEU J 1 60  ? 28.476  15.938  -30.405 1.00 68.81  ? 56  LEU J CD1 1 
ATOM   10744 C CD2 . LEU J 1 60  ? 28.833  13.571  -31.128 1.00 62.00  ? 56  LEU J CD2 1 
ATOM   10745 N N   . VAL J 1 61  ? 23.723  13.429  -29.206 1.00 78.39  ? 57  VAL J N   1 
ATOM   10746 C CA  . VAL J 1 61  ? 22.787  12.922  -28.209 1.00 68.60  ? 57  VAL J CA  1 
ATOM   10747 C C   . VAL J 1 61  ? 22.247  11.564  -28.643 1.00 82.89  ? 57  VAL J C   1 
ATOM   10748 O O   . VAL J 1 61  ? 21.858  10.744  -27.811 1.00 91.06  ? 57  VAL J O   1 
ATOM   10749 C CB  . VAL J 1 61  ? 21.609  13.889  -27.991 1.00 54.33  ? 57  VAL J CB  1 
ATOM   10750 C CG1 . VAL J 1 61  ? 20.778  14.005  -29.254 1.00 57.37  ? 57  VAL J CG1 1 
ATOM   10751 C CG2 . VAL J 1 61  ? 20.751  13.425  -26.826 1.00 54.95  ? 57  VAL J CG2 1 
ATOM   10752 N N   . GLN J 1 62  ? 22.225  11.334  -29.952 1.00 79.55  ? 58  GLN J N   1 
ATOM   10753 C CA  . GLN J 1 62  ? 21.785  10.057  -30.500 1.00 72.88  ? 58  GLN J CA  1 
ATOM   10754 C C   . GLN J 1 62  ? 22.709  8.938   -30.034 1.00 64.61  ? 58  GLN J C   1 
ATOM   10755 O O   . GLN J 1 62  ? 22.252  7.895   -29.565 1.00 50.84  ? 58  GLN J O   1 
ATOM   10756 C CB  . GLN J 1 62  ? 21.766  10.113  -32.028 1.00 73.57  ? 58  GLN J CB  1 
ATOM   10757 C CG  . GLN J 1 62  ? 20.850  11.182  -32.605 1.00 66.18  ? 58  GLN J CG  1 
ATOM   10758 C CD  . GLN J 1 62  ? 19.389  10.921  -32.302 1.00 85.36  ? 58  GLN J CD  1 
ATOM   10759 O OE1 . GLN J 1 62  ? 18.931  11.114  -31.175 1.00 92.99  ? 58  GLN J OE1 1 
ATOM   10760 N NE2 . GLN J 1 62  ? 18.648  10.473  -33.310 1.00 98.32  ? 58  GLN J NE2 1 
ATOM   10761 N N   . ASP J 1 63  ? 24.013  9.161   -30.172 1.00 67.66  ? 59  ASP J N   1 
ATOM   10762 C CA  . ASP J 1 63  ? 25.008  8.195   -29.724 1.00 68.09  ? 59  ASP J CA  1 
ATOM   10763 C C   . ASP J 1 63  ? 24.952  8.020   -28.211 1.00 66.45  ? 59  ASP J C   1 
ATOM   10764 O O   . ASP J 1 63  ? 25.157  6.922   -27.696 1.00 69.35  ? 59  ASP J O   1 
ATOM   10765 C CB  . ASP J 1 63  ? 26.409  8.648   -30.137 1.00 75.28  ? 59  ASP J CB  1 
ATOM   10766 C CG  . ASP J 1 63  ? 26.579  8.714   -31.639 1.00 80.74  ? 59  ASP J CG  1 
ATOM   10767 O OD1 . ASP J 1 63  ? 26.939  7.681   -32.243 1.00 80.19  ? 59  ASP J OD1 1 
ATOM   10768 O OD2 . ASP J 1 63  ? 26.351  9.799   -32.215 1.00 88.00  ? 59  ASP J OD2 1 
ATOM   10769 N N   . ILE J 1 64  ? 24.671  9.109   -27.504 1.00 60.41  ? 60  ILE J N   1 
ATOM   10770 C CA  . ILE J 1 64  ? 24.633  9.089   -26.049 1.00 55.45  ? 60  ILE J CA  1 
ATOM   10771 C C   . ILE J 1 64  ? 23.454  8.276   -25.527 1.00 56.14  ? 60  ILE J C   1 
ATOM   10772 O O   . ILE J 1 64  ? 23.586  7.530   -24.557 1.00 59.68  ? 60  ILE J O   1 
ATOM   10773 C CB  . ILE J 1 64  ? 24.547  10.513  -25.480 1.00 45.36  ? 60  ILE J CB  1 
ATOM   10774 C CG1 . ILE J 1 64  ? 25.830  11.284  -25.803 1.00 53.22  ? 60  ILE J CG1 1 
ATOM   10775 C CG2 . ILE J 1 64  ? 24.319  10.468  -23.978 1.00 29.53  ? 60  ILE J CG2 1 
ATOM   10776 C CD1 . ILE J 1 64  ? 25.775  12.752  -25.444 1.00 48.53  ? 60  ILE J CD1 1 
ATOM   10777 N N   . MET J 1 65  ? 22.300  8.425   -26.167 1.00 52.81  ? 61  MET J N   1 
ATOM   10778 C CA  . MET J 1 65  ? 21.105  7.704   -25.747 1.00 55.66  ? 61  MET J CA  1 
ATOM   10779 C C   . MET J 1 65  ? 21.194  6.227   -26.111 1.00 66.00  ? 61  MET J C   1 
ATOM   10780 O O   . MET J 1 65  ? 20.755  5.362   -25.353 1.00 68.90  ? 61  MET J O   1 
ATOM   10781 C CB  . MET J 1 65  ? 19.858  8.327   -26.373 1.00 47.99  ? 61  MET J CB  1 
ATOM   10782 C CG  . MET J 1 65  ? 19.476  9.663   -25.760 1.00 51.36  ? 61  MET J CG  1 
ATOM   10783 S SD  . MET J 1 65  ? 17.863  10.245  -26.308 1.00 67.20  ? 61  MET J SD  1 
ATOM   10784 C CE  . MET J 1 65  ? 18.176  10.521  -28.045 1.00 59.63  ? 61  MET J CE  1 
ATOM   10785 N N   . GLU J 1 66  ? 21.771  5.946   -27.274 1.00 73.93  ? 62  GLU J N   1 
ATOM   10786 C CA  . GLU J 1 66  ? 21.905  4.577   -27.757 1.00 76.84  ? 62  GLU J CA  1 
ATOM   10787 C C   . GLU J 1 66  ? 22.987  3.808   -27.002 1.00 78.67  ? 62  GLU J C   1 
ATOM   10788 O O   . GLU J 1 66  ? 22.815  2.629   -26.690 1.00 88.63  ? 62  GLU J O   1 
ATOM   10789 C CB  . GLU J 1 66  ? 22.225  4.584   -29.255 1.00 90.87  ? 62  GLU J CB  1 
ATOM   10790 C CG  . GLU J 1 66  ? 22.680  3.241   -29.809 1.00 101.59 ? 62  GLU J CG  1 
ATOM   10791 C CD  . GLU J 1 66  ? 21.627  2.161   -29.669 1.00 108.47 ? 62  GLU J CD  1 
ATOM   10792 O OE1 . GLU J 1 66  ? 20.435  2.508   -29.527 1.00 110.26 ? 62  GLU J OE1 1 
ATOM   10793 O OE2 . GLU J 1 66  ? 21.993  0.966   -29.695 1.00 103.13 ? 62  GLU J OE2 1 
ATOM   10794 N N   . ASP J 1 67  ? 24.094  4.479   -26.704 1.00 78.04  ? 63  ASP J N   1 
ATOM   10795 C CA  . ASP J 1 67  ? 25.273  3.808   -26.164 1.00 73.74  ? 63  ASP J CA  1 
ATOM   10796 C C   . ASP J 1 67  ? 25.454  3.999   -24.656 1.00 67.59  ? 63  ASP J C   1 
ATOM   10797 O O   . ASP J 1 67  ? 25.984  3.119   -23.977 1.00 63.59  ? 63  ASP J O   1 
ATOM   10798 C CB  . ASP J 1 67  ? 26.531  4.296   -26.893 1.00 64.00  ? 63  ASP J CB  1 
ATOM   10799 C CG  . ASP J 1 67  ? 26.456  4.085   -28.396 1.00 75.80  ? 63  ASP J CG  1 
ATOM   10800 O OD1 . ASP J 1 67  ? 25.875  3.068   -28.829 1.00 79.97  ? 63  ASP J OD1 1 
ATOM   10801 O OD2 . ASP J 1 67  ? 26.979  4.936   -29.146 1.00 78.92  ? 63  ASP J OD2 1 
ATOM   10802 N N   . THR J 1 68  ? 25.016  5.141   -24.132 1.00 60.38  ? 64  THR J N   1 
ATOM   10803 C CA  . THR J 1 68  ? 25.317  5.501   -22.747 1.00 58.18  ? 64  THR J CA  1 
ATOM   10804 C C   . THR J 1 68  ? 24.101  5.439   -21.823 1.00 62.94  ? 64  THR J C   1 
ATOM   10805 O O   . THR J 1 68  ? 24.123  4.746   -20.805 1.00 69.27  ? 64  THR J O   1 
ATOM   10806 C CB  . THR J 1 68  ? 25.929  6.915   -22.664 1.00 58.76  ? 64  THR J CB  1 
ATOM   10807 O OG1 . THR J 1 68  ? 27.035  7.014   -23.571 1.00 72.28  ? 64  THR J OG1 1 
ATOM   10808 C CG2 . THR J 1 68  ? 26.401  7.216   -21.247 1.00 48.80  ? 64  THR J CG2 1 
ATOM   10809 N N   . MET J 1 69  ? 23.046  6.166   -22.176 1.00 50.95  ? 65  MET J N   1 
ATOM   10810 C CA  . MET J 1 69  ? 21.875  6.281   -21.312 1.00 36.91  ? 65  MET J CA  1 
ATOM   10811 C C   . MET J 1 69  ? 20.976  5.052   -21.414 1.00 45.05  ? 65  MET J C   1 
ATOM   10812 O O   . MET J 1 69  ? 19.902  5.106   -22.016 1.00 60.44  ? 65  MET J O   1 
ATOM   10813 C CB  . MET J 1 69  ? 21.082  7.542   -21.667 1.00 12.16  ? 65  MET J CB  1 
ATOM   10814 C CG  . MET J 1 69  ? 21.856  8.836   -21.436 1.00 20.61  ? 65  MET J CG  1 
ATOM   10815 S SD  . MET J 1 69  ? 21.070  10.286  -22.165 1.00 69.69  ? 65  MET J SD  1 
ATOM   10816 C CE  . MET J 1 69  ? 19.440  10.183  -21.436 1.00 45.05  ? 65  MET J CE  1 
ATOM   10817 N N   . ARG J 1 70  ? 21.416  3.950   -20.812 1.00 53.38  ? 66  ARG J N   1 
ATOM   10818 C CA  . ARG J 1 70  ? 20.669  2.697   -20.867 1.00 58.13  ? 66  ARG J CA  1 
ATOM   10819 C C   . ARG J 1 70  ? 20.107  2.291   -19.509 1.00 55.51  ? 66  ARG J C   1 
ATOM   10820 O O   . ARG J 1 70  ? 20.767  2.428   -18.479 1.00 59.90  ? 66  ARG J O   1 
ATOM   10821 C CB  . ARG J 1 70  ? 21.546  1.573   -21.433 1.00 61.65  ? 66  ARG J CB  1 
ATOM   10822 C CG  . ARG J 1 70  ? 21.752  1.654   -22.939 1.00 65.27  ? 66  ARG J CG  1 
ATOM   10823 C CD  . ARG J 1 70  ? 20.457  2.047   -23.633 1.00 64.26  ? 66  ARG J CD  1 
ATOM   10824 N NE  . ARG J 1 70  ? 20.486  1.829   -25.073 1.00 65.29  ? 66  ARG J NE  1 
ATOM   10825 C CZ  . ARG J 1 70  ? 19.488  2.146   -25.891 1.00 80.71  ? 66  ARG J CZ  1 
ATOM   10826 N NH1 . ARG J 1 70  ? 18.380  2.699   -25.413 1.00 76.12  ? 66  ARG J NH1 1 
ATOM   10827 N NH2 . ARG J 1 70  ? 19.597  1.912   -27.190 1.00 90.59  ? 66  ARG J NH2 1 
ATOM   10828 N N   . PHE J 1 71  ? 18.877  1.789   -19.527 1.00 38.37  ? 67  PHE J N   1 
ATOM   10829 C CA  . PHE J 1 71  ? 18.194  1.371   -18.313 1.00 41.59  ? 67  PHE J CA  1 
ATOM   10830 C C   . PHE J 1 71  ? 17.607  -0.021  -18.492 1.00 61.32  ? 67  PHE J C   1 
ATOM   10831 O O   . PHE J 1 71  ? 17.472  -0.507  -19.616 1.00 44.64  ? 67  PHE J O   1 
ATOM   10832 C CB  . PHE J 1 71  ? 17.084  2.364   -17.962 1.00 35.10  ? 67  PHE J CB  1 
ATOM   10833 C CG  . PHE J 1 71  ? 17.579  3.763   -17.736 1.00 30.07  ? 67  PHE J CG  1 
ATOM   10834 C CD1 . PHE J 1 71  ? 17.964  4.179   -16.474 1.00 27.28  ? 67  PHE J CD1 1 
ATOM   10835 C CD2 . PHE J 1 71  ? 17.667  4.658   -18.787 1.00 39.22  ? 67  PHE J CD2 1 
ATOM   10836 C CE1 . PHE J 1 71  ? 18.424  5.464   -16.265 1.00 30.58  ? 67  PHE J CE1 1 
ATOM   10837 C CE2 . PHE J 1 71  ? 18.128  5.944   -18.584 1.00 38.48  ? 67  PHE J CE2 1 
ATOM   10838 C CZ  . PHE J 1 71  ? 18.507  6.347   -17.321 1.00 25.64  ? 67  PHE J CZ  1 
ATOM   10839 N N   . ARG J 1 72  ? 17.264  -0.661  -17.380 1.00 82.17  ? 68  ARG J N   1 
ATOM   10840 C CA  . ARG J 1 72  ? 16.662  -1.986  -17.423 1.00 82.36  ? 68  ARG J CA  1 
ATOM   10841 C C   . ARG J 1 72  ? 15.416  -1.945  -18.299 1.00 66.73  ? 68  ARG J C   1 
ATOM   10842 O O   . ARG J 1 72  ? 14.591  -1.041  -18.176 1.00 67.30  ? 68  ARG J O   1 
ATOM   10843 C CB  . ARG J 1 72  ? 16.311  -2.462  -16.012 1.00 86.06  ? 68  ARG J CB  1 
ATOM   10844 C CG  . ARG J 1 72  ? 15.960  -3.940  -15.926 1.00 87.53  ? 68  ARG J CG  1 
ATOM   10845 C CD  . ARG J 1 72  ? 15.665  -4.372  -14.498 1.00 87.49  ? 68  ARG J CD  1 
ATOM   10846 N NE  . ARG J 1 72  ? 16.807  -4.172  -13.609 1.00 100.39 ? 68  ARG J NE  1 
ATOM   10847 C CZ  . ARG J 1 72  ? 16.850  -4.573  -12.341 1.00 105.02 ? 68  ARG J CZ  1 
ATOM   10848 N NH1 . ARG J 1 72  ? 15.814  -5.204  -11.804 1.00 112.88 ? 68  ARG J NH1 1 
ATOM   10849 N NH2 . ARG J 1 72  ? 17.932  -4.347  -11.608 1.00 89.68  ? 68  ARG J NH2 1 
ATOM   10850 N N   . ASP J 1 73  ? 15.293  -2.923  -19.190 1.00 59.85  ? 69  ASP J N   1 
ATOM   10851 C CA  . ASP J 1 73  ? 14.199  -2.956  -20.156 1.00 58.26  ? 69  ASP J CA  1 
ATOM   10852 C C   . ASP J 1 73  ? 12.836  -2.742  -19.506 1.00 48.08  ? 69  ASP J C   1 
ATOM   10853 O O   . ASP J 1 73  ? 12.577  -3.216  -18.400 1.00 47.76  ? 69  ASP J O   1 
ATOM   10854 C CB  . ASP J 1 73  ? 14.194  -4.290  -20.906 1.00 74.26  ? 69  ASP J CB  1 
ATOM   10855 C CG  . ASP J 1 73  ? 15.345  -4.418  -21.882 1.00 83.75  ? 69  ASP J CG  1 
ATOM   10856 O OD1 . ASP J 1 73  ? 15.853  -3.376  -22.348 1.00 90.06  ? 69  ASP J OD1 1 
ATOM   10857 O OD2 . ASP J 1 73  ? 15.736  -5.564  -22.188 1.00 85.11  ? 69  ASP J OD2 1 
ATOM   10858 N N   . ASN J 1 74  ? 11.973  -2.016  -20.211 1.00 51.66  ? 70  ASN J N   1 
ATOM   10859 C CA  . ASN J 1 74  ? 10.580  -1.828  -19.809 1.00 52.40  ? 70  ASN J CA  1 
ATOM   10860 C C   . ASN J 1 74  ? 10.376  -1.025  -18.524 1.00 50.52  ? 70  ASN J C   1 
ATOM   10861 O O   . ASN J 1 74  ? 9.274   -1.001  -17.979 1.00 60.18  ? 70  ASN J O   1 
ATOM   10862 C CB  . ASN J 1 74  ? 9.875   -3.183  -19.696 1.00 49.12  ? 70  ASN J CB  1 
ATOM   10863 C CG  . ASN J 1 74  ? 9.826   -3.921  -21.017 1.00 44.06  ? 70  ASN J CG  1 
ATOM   10864 O OD1 . ASN J 1 74  ? 10.307  -5.048  -21.131 1.00 45.44  ? 70  ASN J OD1 1 
ATOM   10865 N ND2 . ASN J 1 74  ? 9.248   -3.284  -22.028 1.00 42.59  ? 70  ASN J ND2 1 
ATOM   10866 N N   . THR J 1 75  ? 11.425  -0.364  -18.048 1.00 56.08  ? 71  THR J N   1 
ATOM   10867 C CA  . THR J 1 75  ? 11.292  0.529   -16.902 1.00 54.16  ? 71  THR J CA  1 
ATOM   10868 C C   . THR J 1 75  ? 10.944  1.924   -17.406 1.00 47.69  ? 71  THR J C   1 
ATOM   10869 O O   . THR J 1 75  ? 11.298  2.284   -18.528 1.00 44.59  ? 71  THR J O   1 
ATOM   10870 C CB  . THR J 1 75  ? 12.580  0.591   -16.056 1.00 48.56  ? 71  THR J CB  1 
ATOM   10871 O OG1 . THR J 1 75  ? 13.638  1.188   -16.817 1.00 57.14  ? 71  THR J OG1 1 
ATOM   10872 C CG2 . THR J 1 75  ? 12.992  -0.801  -15.606 1.00 38.08  ? 71  THR J CG2 1 
ATOM   10873 N N   . PRO J 1 76  ? 10.241  2.713   -16.577 1.00 55.44  ? 72  PRO J N   1 
ATOM   10874 C CA  . PRO J 1 76  ? 9.775   4.049   -16.965 1.00 54.93  ? 72  PRO J CA  1 
ATOM   10875 C C   . PRO J 1 76  ? 10.848  4.874   -17.669 1.00 60.42  ? 72  PRO J C   1 
ATOM   10876 O O   . PRO J 1 76  ? 10.545  5.574   -18.636 1.00 65.20  ? 72  PRO J O   1 
ATOM   10877 C CB  . PRO J 1 76  ? 9.403   4.685   -15.625 1.00 50.42  ? 72  PRO J CB  1 
ATOM   10878 C CG  . PRO J 1 76  ? 8.996   3.537   -14.777 1.00 55.18  ? 72  PRO J CG  1 
ATOM   10879 C CD  . PRO J 1 76  ? 9.869   2.384   -15.189 1.00 60.31  ? 72  PRO J CD  1 
ATOM   10880 N N   . ASN J 1 77  ? 12.084  4.791   -17.190 1.00 49.36  ? 73  ASN J N   1 
ATOM   10881 C CA  . ASN J 1 77  ? 13.183  5.523   -17.804 1.00 47.47  ? 73  ASN J CA  1 
ATOM   10882 C C   . ASN J 1 77  ? 13.595  4.899   -19.129 1.00 55.64  ? 73  ASN J C   1 
ATOM   10883 O O   . ASN J 1 77  ? 13.830  5.605   -20.110 1.00 59.21  ? 73  ASN J O   1 
ATOM   10884 C CB  . ASN J 1 77  ? 14.380  5.581   -16.858 1.00 55.05  ? 73  ASN J CB  1 
ATOM   10885 C CG  . ASN J 1 77  ? 14.137  6.489   -15.674 1.00 64.02  ? 73  ASN J CG  1 
ATOM   10886 O OD1 . ASN J 1 77  ? 13.301  7.392   -15.730 1.00 62.77  ? 73  ASN J OD1 1 
ATOM   10887 N ND2 . ASN J 1 77  ? 14.869  6.258   -14.592 1.00 72.80  ? 73  ASN J ND2 1 
ATOM   10888 N N   . ALA J 1 78  ? 13.682  3.574   -19.155 1.00 57.24  ? 74  ALA J N   1 
ATOM   10889 C CA  . ALA J 1 78  ? 14.013  2.866   -20.382 1.00 48.55  ? 74  ALA J CA  1 
ATOM   10890 C C   . ALA J 1 78  ? 13.053  3.281   -21.487 1.00 36.41  ? 74  ALA J C   1 
ATOM   10891 O O   . ALA J 1 78  ? 13.473  3.605   -22.596 1.00 26.42  ? 74  ALA J O   1 
ATOM   10892 C CB  . ALA J 1 78  ? 13.947  1.370   -20.162 1.00 41.33  ? 74  ALA J CB  1 
ATOM   10893 N N   . ILE J 1 79  ? 11.761  3.274   -21.166 1.00 39.03  ? 75  ILE J N   1 
ATOM   10894 C CA  . ILE J 1 79  ? 10.719  3.635   -22.121 1.00 47.91  ? 75  ILE J CA  1 
ATOM   10895 C C   . ILE J 1 79  ? 10.847  5.096   -22.533 1.00 52.67  ? 75  ILE J C   1 
ATOM   10896 O O   . ILE J 1 79  ? 10.637  5.443   -23.695 1.00 63.57  ? 75  ILE J O   1 
ATOM   10897 C CB  . ILE J 1 79  ? 9.315   3.395   -21.528 1.00 51.36  ? 75  ILE J CB  1 
ATOM   10898 C CG1 . ILE J 1 79  ? 9.111   1.906   -21.236 1.00 47.34  ? 75  ILE J CG1 1 
ATOM   10899 C CG2 . ILE J 1 79  ? 8.233   3.897   -22.483 1.00 36.79  ? 75  ILE J CG2 1 
ATOM   10900 C CD1 . ILE J 1 79  ? 7.948   1.614   -20.310 1.00 50.91  ? 75  ILE J CD1 1 
ATOM   10901 N N   . ALA J 1 80  ? 11.192  5.950   -21.575 1.00 49.14  ? 76  ALA J N   1 
ATOM   10902 C CA  . ALA J 1 80  ? 11.390  7.366   -21.853 1.00 31.27  ? 76  ALA J CA  1 
ATOM   10903 C C   . ALA J 1 80  ? 12.450  7.546   -22.933 1.00 46.50  ? 76  ALA J C   1 
ATOM   10904 O O   . ALA J 1 80  ? 12.258  8.306   -23.881 1.00 62.76  ? 76  ALA J O   1 
ATOM   10905 C CB  . ALA J 1 80  ? 11.796  8.100   -20.585 1.00 20.64  ? 76  ALA J CB  1 
ATOM   10906 N N   . ILE J 1 81  ? 13.565  6.837   -22.787 1.00 60.03  ? 77  ILE J N   1 
ATOM   10907 C CA  . ILE J 1 81  ? 14.670  6.942   -23.733 1.00 54.33  ? 77  ILE J CA  1 
ATOM   10908 C C   . ILE J 1 81  ? 14.224  6.569   -25.140 1.00 43.60  ? 77  ILE J C   1 
ATOM   10909 O O   . ILE J 1 81  ? 14.592  7.230   -26.110 1.00 68.56  ? 77  ILE J O   1 
ATOM   10910 C CB  . ILE J 1 81  ? 15.847  6.035   -23.335 1.00 55.02  ? 77  ILE J CB  1 
ATOM   10911 C CG1 . ILE J 1 81  ? 16.438  6.481   -21.997 1.00 64.28  ? 77  ILE J CG1 1 
ATOM   10912 C CG2 . ILE J 1 81  ? 16.922  6.059   -24.411 1.00 51.72  ? 77  ILE J CG2 1 
ATOM   10913 C CD1 . ILE J 1 81  ? 17.012  7.878   -22.017 1.00 62.94  ? 77  ILE J CD1 1 
ATOM   10914 N N   . VAL J 1 82  ? 13.433  5.507   -25.248 1.00 31.54  ? 78  VAL J N   1 
ATOM   10915 C CA  . VAL J 1 82  ? 12.916  5.073   -26.541 1.00 48.86  ? 78  VAL J CA  1 
ATOM   10916 C C   . VAL J 1 82  ? 12.121  6.192   -27.204 1.00 44.75  ? 78  VAL J C   1 
ATOM   10917 O O   . VAL J 1 82  ? 12.333  6.505   -28.375 1.00 38.62  ? 78  VAL J O   1 
ATOM   10918 C CB  . VAL J 1 82  ? 12.013  3.831   -26.403 1.00 52.33  ? 78  VAL J CB  1 
ATOM   10919 C CG1 . VAL J 1 82  ? 11.265  3.565   -27.706 1.00 40.28  ? 78  VAL J CG1 1 
ATOM   10920 C CG2 . VAL J 1 82  ? 12.838  2.618   -25.996 1.00 55.51  ? 78  VAL J CG2 1 
ATOM   10921 N N   . GLN J 1 83  ? 11.211  6.795   -26.446 1.00 44.70  ? 79  GLN J N   1 
ATOM   10922 C CA  . GLN J 1 83  ? 10.381  7.875   -26.965 1.00 46.63  ? 79  GLN J CA  1 
ATOM   10923 C C   . GLN J 1 83  ? 11.240  9.042   -27.438 1.00 47.47  ? 79  GLN J C   1 
ATOM   10924 O O   . GLN J 1 83  ? 11.006  9.598   -28.512 1.00 49.36  ? 79  GLN J O   1 
ATOM   10925 C CB  . GLN J 1 83  ? 9.383   8.338   -25.902 1.00 55.07  ? 79  GLN J CB  1 
ATOM   10926 C CG  . GLN J 1 83  ? 8.312   7.307   -25.581 1.00 63.15  ? 79  GLN J CG  1 
ATOM   10927 C CD  . GLN J 1 83  ? 7.373   7.761   -24.483 1.00 87.79  ? 79  GLN J CD  1 
ATOM   10928 O OE1 . GLN J 1 83  ? 7.668   8.704   -23.747 1.00 93.02  ? 79  GLN J OE1 1 
ATOM   10929 N NE2 . GLN J 1 83  ? 6.231   7.093   -24.369 1.00 99.07  ? 79  GLN J NE2 1 
ATOM   10930 N N   . LEU J 1 84  ? 12.238  9.409   -26.638 1.00 41.62  ? 80  LEU J N   1 
ATOM   10931 C CA  . LEU J 1 84  ? 13.171  10.461  -27.026 1.00 43.03  ? 80  LEU J CA  1 
ATOM   10932 C C   . LEU J 1 84  ? 13.861  10.096  -28.337 1.00 45.08  ? 80  LEU J C   1 
ATOM   10933 O O   . LEU J 1 84  ? 14.121  10.959  -29.175 1.00 37.33  ? 80  LEU J O   1 
ATOM   10934 C CB  . LEU J 1 84  ? 14.213  10.694  -25.927 1.00 27.51  ? 80  LEU J CB  1 
ATOM   10935 C CG  . LEU J 1 84  ? 13.712  11.393  -24.658 1.00 35.15  ? 80  LEU J CG  1 
ATOM   10936 C CD1 . LEU J 1 84  ? 14.806  11.450  -23.600 1.00 18.41  ? 80  LEU J CD1 1 
ATOM   10937 C CD2 . LEU J 1 84  ? 13.204  12.796  -24.970 1.00 38.73  ? 80  LEU J CD2 1 
ATOM   10938 N N   . GLN J 1 85  ? 14.148  8.810   -28.510 1.00 53.13  ? 81  GLN J N   1 
ATOM   10939 C CA  . GLN J 1 85  ? 14.802  8.324   -29.720 1.00 52.08  ? 81  GLN J CA  1 
ATOM   10940 C C   . GLN J 1 85  ? 13.849  8.321   -30.915 1.00 44.02  ? 81  GLN J C   1 
ATOM   10941 O O   . GLN J 1 85  ? 14.270  8.550   -32.050 1.00 38.17  ? 81  GLN J O   1 
ATOM   10942 C CB  . GLN J 1 85  ? 15.373  6.924   -29.491 1.00 55.46  ? 81  GLN J CB  1 
ATOM   10943 C CG  . GLN J 1 85  ? 16.584  6.900   -28.571 1.00 63.60  ? 81  GLN J CG  1 
ATOM   10944 C CD  . GLN J 1 85  ? 17.138  5.503   -28.366 1.00 60.69  ? 81  GLN J CD  1 
ATOM   10945 O OE1 . GLN J 1 85  ? 16.509  4.659   -27.726 1.00 45.19  ? 81  GLN J OE1 1 
ATOM   10946 N NE2 . GLN J 1 85  ? 18.322  5.250   -28.914 1.00 70.13  ? 81  GLN J NE2 1 
ATOM   10947 N N   . GLU J 1 86  ? 12.570  8.057   -30.659 1.00 43.43  ? 82  GLU J N   1 
ATOM   10948 C CA  . GLU J 1 86  ? 11.550  8.122   -31.704 1.00 34.26  ? 82  GLU J CA  1 
ATOM   10949 C C   . GLU J 1 86  ? 11.364  9.568   -32.145 1.00 49.35  ? 82  GLU J C   1 
ATOM   10950 O O   . GLU J 1 86  ? 11.345  9.869   -33.338 1.00 47.41  ? 82  GLU J O   1 
ATOM   10951 C CB  . GLU J 1 86  ? 10.219  7.561   -31.198 1.00 32.18  ? 82  GLU J CB  1 
ATOM   10952 C CG  . GLU J 1 86  ? 10.227  6.062   -30.935 1.00 35.90  ? 82  GLU J CG  1 
ATOM   10953 C CD  . GLU J 1 86  ? 8.962   5.581   -30.246 1.00 53.61  ? 82  GLU J CD  1 
ATOM   10954 O OE1 . GLU J 1 86  ? 8.911   4.395   -29.856 1.00 71.56  ? 82  GLU J OE1 1 
ATOM   10955 O OE2 . GLU J 1 86  ? 8.020   6.386   -30.096 1.00 64.76  ? 82  GLU J OE2 1 
ATOM   10956 N N   . LEU J 1 87  ? 11.227  10.457  -31.166 1.00 54.40  ? 83  LEU J N   1 
ATOM   10957 C CA  . LEU J 1 87  ? 11.098  11.885  -31.425 1.00 40.06  ? 83  LEU J CA  1 
ATOM   10958 C C   . LEU J 1 87  ? 12.278  12.389  -32.245 1.00 52.89  ? 83  LEU J C   1 
ATOM   10959 O O   . LEU J 1 87  ? 12.106  13.162  -33.188 1.00 57.95  ? 83  LEU J O   1 
ATOM   10960 C CB  . LEU J 1 87  ? 11.026  12.647  -30.104 1.00 31.24  ? 83  LEU J CB  1 
ATOM   10961 C CG  . LEU J 1 87  ? 11.172  14.169  -30.181 1.00 32.71  ? 83  LEU J CG  1 
ATOM   10962 C CD1 . LEU J 1 87  ? 9.989   14.790  -30.908 1.00 23.18  ? 83  LEU J CD1 1 
ATOM   10963 C CD2 . LEU J 1 87  ? 11.332  14.760  -28.780 1.00 21.38  ? 83  LEU J CD2 1 
ATOM   10964 N N   . SER J 1 88  ? 13.476  11.943  -31.880 1.00 56.07  ? 84  SER J N   1 
ATOM   10965 C CA  . SER J 1 88  ? 14.694  12.368  -32.557 1.00 43.51  ? 84  SER J CA  1 
ATOM   10966 C C   . SER J 1 88  ? 14.645  12.032  -34.042 1.00 46.52  ? 84  SER J C   1 
ATOM   10967 O O   . SER J 1 88  ? 15.076  12.826  -34.878 1.00 67.03  ? 84  SER J O   1 
ATOM   10968 C CB  . SER J 1 88  ? 15.912  11.706  -31.919 1.00 37.16  ? 84  SER J CB  1 
ATOM   10969 O OG  . SER J 1 88  ? 15.982  11.989  -30.534 1.00 45.41  ? 84  SER J OG  1 
ATOM   10970 N N   . LEU J 1 89  ? 14.123  10.856  -34.372 1.00 37.97  ? 85  LEU J N   1 
ATOM   10971 C CA  . LEU J 1 89  ? 13.993  10.459  -35.769 1.00 49.02  ? 85  LEU J CA  1 
ATOM   10972 C C   . LEU J 1 89  ? 13.066  11.418  -36.508 1.00 54.25  ? 85  LEU J C   1 
ATOM   10973 O O   . LEU J 1 89  ? 13.325  11.785  -37.654 1.00 58.94  ? 85  LEU J O   1 
ATOM   10974 C CB  . LEU J 1 89  ? 13.471  9.025   -35.883 1.00 52.01  ? 85  LEU J CB  1 
ATOM   10975 C CG  . LEU J 1 89  ? 14.451  7.917   -35.490 1.00 54.99  ? 85  LEU J CG  1 
ATOM   10976 C CD1 . LEU J 1 89  ? 13.780  6.555   -35.593 1.00 54.57  ? 85  LEU J CD1 1 
ATOM   10977 C CD2 . LEU J 1 89  ? 15.703  7.959   -36.354 1.00 53.61  ? 85  LEU J CD2 1 
ATOM   10978 N N   . ARG J 1 90  ? 11.988  11.828  -35.845 1.00 44.87  ? 86  ARG J N   1 
ATOM   10979 C CA  . ARG J 1 90  ? 11.051  12.773  -36.435 1.00 35.40  ? 86  ARG J CA  1 
ATOM   10980 C C   . ARG J 1 90  ? 11.710  14.142  -36.560 1.00 56.22  ? 86  ARG J C   1 
ATOM   10981 O O   . ARG J 1 90  ? 11.452  14.883  -37.510 1.00 48.48  ? 86  ARG J O   1 
ATOM   10982 C CB  . ARG J 1 90  ? 9.780   12.884  -35.588 1.00 39.02  ? 86  ARG J CB  1 
ATOM   10983 C CG  . ARG J 1 90  ? 9.141   11.548  -35.229 1.00 52.62  ? 86  ARG J CG  1 
ATOM   10984 C CD  . ARG J 1 90  ? 7.675   11.712  -34.844 1.00 52.19  ? 86  ARG J CD  1 
ATOM   10985 N NE  . ARG J 1 90  ? 7.241   10.691  -33.891 1.00 56.14  ? 86  ARG J NE  1 
ATOM   10986 C CZ  . ARG J 1 90  ? 7.245   10.837  -32.566 1.00 58.50  ? 86  ARG J CZ  1 
ATOM   10987 N NH1 . ARG J 1 90  ? 7.655   11.970  -32.006 1.00 54.86  ? 86  ARG J NH1 1 
ATOM   10988 N NH2 . ARG J 1 90  ? 6.834   9.842   -31.792 1.00 58.76  ? 86  ARG J NH2 1 
ATOM   10989 N N   . LEU J 1 91  ? 12.567  14.467  -35.596 1.00 63.72  ? 87  LEU J N   1 
ATOM   10990 C CA  . LEU J 1 91  ? 13.259  15.752  -35.578 1.00 49.95  ? 87  LEU J CA  1 
ATOM   10991 C C   . LEU J 1 91  ? 14.285  15.875  -36.707 1.00 52.93  ? 87  LEU J C   1 
ATOM   10992 O O   . LEU J 1 91  ? 14.551  16.977  -37.184 1.00 44.63  ? 87  LEU J O   1 
ATOM   10993 C CB  . LEU J 1 91  ? 13.942  15.972  -34.224 1.00 40.97  ? 87  LEU J CB  1 
ATOM   10994 C CG  . LEU J 1 91  ? 13.059  16.421  -33.056 1.00 41.60  ? 87  LEU J CG  1 
ATOM   10995 C CD1 . LEU J 1 91  ? 13.893  16.531  -31.790 1.00 25.91  ? 87  LEU J CD1 1 
ATOM   10996 C CD2 . LEU J 1 91  ? 12.371  17.748  -33.352 1.00 47.87  ? 87  LEU J CD2 1 
ATOM   10997 N N   . LYS J 1 92  ? 14.850  14.750  -37.140 1.00 66.34  ? 88  LYS J N   1 
ATOM   10998 C CA  . LYS J 1 92  ? 15.852  14.756  -38.207 1.00 63.23  ? 88  LYS J CA  1 
ATOM   10999 C C   . LYS J 1 92  ? 15.389  15.572  -39.406 1.00 63.74  ? 88  LYS J C   1 
ATOM   11000 O O   . LYS J 1 92  ? 16.203  16.148  -40.129 1.00 82.13  ? 88  LYS J O   1 
ATOM   11001 C CB  . LYS J 1 92  ? 16.168  13.331  -38.670 1.00 73.87  ? 88  LYS J CB  1 
ATOM   11002 C CG  . LYS J 1 92  ? 17.099  12.556  -37.752 1.00 82.64  ? 88  LYS J CG  1 
ATOM   11003 C CD  . LYS J 1 92  ? 17.933  11.541  -38.529 1.00 83.91  ? 88  LYS J CD  1 
ATOM   11004 C CE  . LYS J 1 92  ? 17.070  10.582  -39.341 1.00 83.38  ? 88  LYS J CE  1 
ATOM   11005 N NZ  . LYS J 1 92  ? 17.108  10.872  -40.807 1.00 65.37  ? 88  LYS J NZ  1 
ATOM   11006 N N   . SER J 1 93  ? 14.079  15.607  -39.620 1.00 52.90  ? 89  SER J N   1 
ATOM   11007 C CA  . SER J 1 93  ? 13.507  16.313  -40.761 1.00 59.59  ? 89  SER J CA  1 
ATOM   11008 C C   . SER J 1 93  ? 13.482  17.833  -40.575 1.00 66.96  ? 89  SER J C   1 
ATOM   11009 O O   . SER J 1 93  ? 13.278  18.575  -41.537 1.00 86.94  ? 89  SER J O   1 
ATOM   11010 C CB  . SER J 1 93  ? 12.095  15.794  -41.051 1.00 66.25  ? 89  SER J CB  1 
ATOM   11011 O OG  . SER J 1 93  ? 11.268  15.849  -39.900 1.00 70.01  ? 89  SER J OG  1 
ATOM   11012 N N   . CYS J 1 94  ? 13.691  18.294  -39.345 1.00 47.64  ? 90  CYS J N   1 
ATOM   11013 C CA  . CYS J 1 94  ? 13.737  19.727  -39.059 1.00 57.08  ? 90  CYS J CA  1 
ATOM   11014 C C   . CYS J 1 94  ? 15.172  20.247  -39.127 1.00 60.82  ? 90  CYS J C   1 
ATOM   11015 O O   . CYS J 1 94  ? 15.398  21.446  -39.288 1.00 67.52  ? 90  CYS J O   1 
ATOM   11016 C CB  . CYS J 1 94  ? 13.141  20.021  -37.680 1.00 65.38  ? 90  CYS J CB  1 
ATOM   11017 S SG  . CYS J 1 94  ? 11.409  19.536  -37.498 1.00 76.39  ? 90  CYS J SG  1 
ATOM   11018 N N   . PHE J 1 95  ? 16.133  19.336  -38.995 1.00 60.28  ? 91  PHE J N   1 
ATOM   11019 C CA  . PHE J 1 95  ? 17.548  19.673  -39.113 1.00 48.80  ? 91  PHE J CA  1 
ATOM   11020 C C   . PHE J 1 95  ? 18.051  19.316  -40.508 1.00 62.97  ? 91  PHE J C   1 
ATOM   11021 O O   . PHE J 1 95  ? 17.755  18.238  -41.026 1.00 74.05  ? 91  PHE J O   1 
ATOM   11022 C CB  . PHE J 1 95  ? 18.370  18.915  -38.068 1.00 64.33  ? 91  PHE J CB  1 
ATOM   11023 C CG  . PHE J 1 95  ? 18.112  19.353  -36.651 1.00 80.78  ? 91  PHE J CG  1 
ATOM   11024 C CD1 . PHE J 1 95  ? 16.890  19.108  -36.048 1.00 82.81  ? 91  PHE J CD1 1 
ATOM   11025 C CD2 . PHE J 1 95  ? 19.098  19.994  -35.919 1.00 83.49  ? 91  PHE J CD2 1 
ATOM   11026 C CE1 . PHE J 1 95  ? 16.650  19.506  -34.745 1.00 78.93  ? 91  PHE J CE1 1 
ATOM   11027 C CE2 . PHE J 1 95  ? 18.864  20.393  -34.613 1.00 77.70  ? 91  PHE J CE2 1 
ATOM   11028 C CZ  . PHE J 1 95  ? 17.639  20.148  -34.027 1.00 74.19  ? 91  PHE J CZ  1 
ATOM   11029 N N   . THR J 1 96  ? 18.812  20.220  -41.115 1.00 55.37  ? 92  THR J N   1 
ATOM   11030 C CA  . THR J 1 96  ? 19.368  19.977  -42.442 1.00 55.32  ? 92  THR J CA  1 
ATOM   11031 C C   . THR J 1 96  ? 20.799  19.458  -42.345 1.00 59.62  ? 92  THR J C   1 
ATOM   11032 O O   . THR J 1 96  ? 21.592  19.945  -41.539 1.00 65.81  ? 92  THR J O   1 
ATOM   11033 C CB  . THR J 1 96  ? 19.353  21.254  -43.304 1.00 46.00  ? 92  THR J CB  1 
ATOM   11034 O OG1 . THR J 1 96  ? 20.163  22.264  -42.689 1.00 49.39  ? 92  THR J OG1 1 
ATOM   11035 C CG2 . THR J 1 96  ? 17.930  21.771  -43.472 1.00 41.63  ? 92  THR J CG2 1 
ATOM   11036 N N   . LYS J 1 97  ? 21.120  18.466  -43.171 1.00 62.81  ? 93  LYS J N   1 
ATOM   11037 C CA  . LYS J 1 97  ? 22.462  17.893  -43.211 1.00 64.44  ? 93  LYS J CA  1 
ATOM   11038 C C   . LYS J 1 97  ? 23.514  18.967  -43.471 1.00 59.70  ? 93  LYS J C   1 
ATOM   11039 O O   . LYS J 1 97  ? 23.267  19.929  -44.200 1.00 56.18  ? 93  LYS J O   1 
ATOM   11040 C CB  . LYS J 1 97  ? 22.547  16.825  -44.304 1.00 71.53  ? 93  LYS J CB  1 
ATOM   11041 C CG  . LYS J 1 97  ? 21.759  15.557  -44.009 1.00 72.29  ? 93  LYS J CG  1 
ATOM   11042 C CD  . LYS J 1 97  ? 22.482  14.668  -43.012 1.00 60.84  ? 93  LYS J CD  1 
ATOM   11043 C CE  . LYS J 1 97  ? 21.791  13.321  -42.861 1.00 66.71  ? 93  LYS J CE  1 
ATOM   11044 N NZ  . LYS J 1 97  ? 20.462  13.433  -42.202 1.00 63.74  ? 93  LYS J NZ  1 
ATOM   11045 N N   . ASP J 1 98  ? 24.688  18.794  -42.871 1.00 57.33  ? 94  ASP J N   1 
ATOM   11046 C CA  . ASP J 1 98  ? 25.805  19.707  -43.081 1.00 64.58  ? 94  ASP J CA  1 
ATOM   11047 C C   . ASP J 1 98  ? 27.060  18.934  -43.473 1.00 63.99  ? 94  ASP J C   1 
ATOM   11048 O O   . ASP J 1 98  ? 27.311  17.840  -42.965 1.00 67.33  ? 94  ASP J O   1 
ATOM   11049 C CB  . ASP J 1 98  ? 26.074  20.526  -41.818 1.00 72.62  ? 94  ASP J CB  1 
ATOM   11050 C CG  . ASP J 1 98  ? 24.975  21.529  -41.526 1.00 74.02  ? 94  ASP J CG  1 
ATOM   11051 O OD1 . ASP J 1 98  ? 24.320  21.994  -42.483 1.00 60.52  ? 94  ASP J OD1 1 
ATOM   11052 O OD2 . ASP J 1 98  ? 24.768  21.854  -40.338 1.00 83.67  ? 94  ASP J OD2 1 
ATOM   11053 N N   . ALA J 1 105 ? 36.014  16.895  -34.745 1.00 108.51 ? 101 ALA J N   1 
ATOM   11054 C CA  . ALA J 1 105 ? 35.167  17.836  -35.467 1.00 106.43 ? 101 ALA J CA  1 
ATOM   11055 C C   . ALA J 1 105 ? 34.278  18.608  -34.498 1.00 115.47 ? 101 ALA J C   1 
ATOM   11056 O O   . ALA J 1 105 ? 33.105  18.280  -34.327 1.00 128.46 ? 101 ALA J O   1 
ATOM   11057 C CB  . ALA J 1 105 ? 34.318  17.100  -36.491 1.00 97.56  ? 101 ALA J CB  1 
ATOM   11058 N N   . CYS J 1 106 ? 34.845  19.634  -33.868 1.00 111.07 ? 102 CYS J N   1 
ATOM   11059 C CA  . CYS J 1 106 ? 34.121  20.443  -32.889 1.00 105.13 ? 102 CYS J CA  1 
ATOM   11060 C C   . CYS J 1 106 ? 33.632  19.602  -31.713 1.00 95.06  ? 102 CYS J C   1 
ATOM   11061 O O   . CYS J 1 106 ? 32.737  20.012  -30.973 1.00 98.62  ? 102 CYS J O   1 
ATOM   11062 C CB  . CYS J 1 106 ? 32.942  21.158  -33.553 1.00 106.20 ? 102 CYS J CB  1 
ATOM   11063 S SG  . CYS J 1 106 ? 33.432  22.343  -34.823 1.00 105.14 ? 102 CYS J SG  1 
ATOM   11064 N N   . VAL J 1 107 ? 34.236  18.431  -31.535 1.00 86.40  ? 103 VAL J N   1 
ATOM   11065 C CA  . VAL J 1 107 ? 33.848  17.525  -30.462 1.00 82.14  ? 103 VAL J CA  1 
ATOM   11066 C C   . VAL J 1 107 ? 35.026  17.234  -29.542 1.00 84.38  ? 103 VAL J C   1 
ATOM   11067 O O   . VAL J 1 107 ? 36.177  17.191  -29.979 1.00 82.50  ? 103 VAL J O   1 
ATOM   11068 C CB  . VAL J 1 107 ? 33.297  16.196  -31.020 1.00 85.92  ? 103 VAL J CB  1 
ATOM   11069 C CG1 . VAL J 1 107 ? 33.374  15.092  -29.970 1.00 73.79  ? 103 VAL J CG1 1 
ATOM   11070 C CG2 . VAL J 1 107 ? 31.867  16.380  -31.505 1.00 93.56  ? 103 VAL J CG2 1 
ATOM   11071 N N   . ARG J 1 108 ? 34.723  17.042  -28.263 1.00 87.21  ? 104 ARG J N   1 
ATOM   11072 C CA  . ARG J 1 108 ? 35.726  16.693  -27.268 1.00 84.84  ? 104 ARG J CA  1 
ATOM   11073 C C   . ARG J 1 108 ? 35.250  15.500  -26.451 1.00 82.67  ? 104 ARG J C   1 
ATOM   11074 O O   . ARG J 1 108 ? 34.056  15.209  -26.401 1.00 97.79  ? 104 ARG J O   1 
ATOM   11075 C CB  . ARG J 1 108 ? 35.984  17.881  -26.339 1.00 84.44  ? 104 ARG J CB  1 
ATOM   11076 C CG  . ARG J 1 108 ? 36.308  17.483  -24.904 1.00 88.15  ? 104 ARG J CG  1 
ATOM   11077 C CD  . ARG J 1 108 ? 36.302  18.674  -23.967 1.00 98.78  ? 104 ARG J CD  1 
ATOM   11078 N NE  . ARG J 1 108 ? 36.299  18.248  -22.569 1.00 104.79 ? 104 ARG J NE  1 
ATOM   11079 C CZ  . ARG J 1 108 ? 36.053  19.049  -21.535 1.00 106.06 ? 104 ARG J CZ  1 
ATOM   11080 N NH1 . ARG J 1 108 ? 35.783  20.333  -21.729 1.00 104.47 ? 104 ARG J NH1 1 
ATOM   11081 N NH2 . ARG J 1 108 ? 36.072  18.561  -20.302 1.00 106.68 ? 104 ARG J NH2 1 
ATOM   11082 N N   . THR J 1 109 ? 36.189  14.810  -25.813 1.00 70.91  ? 105 THR J N   1 
ATOM   11083 C CA  . THR J 1 109 ? 35.845  13.751  -24.874 1.00 80.07  ? 105 THR J CA  1 
ATOM   11084 C C   . THR J 1 109 ? 35.683  14.352  -23.483 1.00 92.21  ? 105 THR J C   1 
ATOM   11085 O O   . THR J 1 109 ? 36.597  14.994  -22.965 1.00 108.98 ? 105 THR J O   1 
ATOM   11086 C CB  . THR J 1 109 ? 36.923  12.656  -24.829 1.00 82.95  ? 105 THR J CB  1 
ATOM   11087 O OG1 . THR J 1 109 ? 37.038  12.039  -26.118 1.00 102.66 ? 105 THR J OG1 1 
ATOM   11088 C CG2 . THR J 1 109 ? 36.569  11.597  -23.794 1.00 61.78  ? 105 THR J CG2 1 
ATOM   11089 N N   . PHE J 1 110 ? 34.515  14.144  -22.883 1.00 80.76  ? 106 PHE J N   1 
ATOM   11090 C CA  . PHE J 1 110 ? 34.209  14.717  -21.579 1.00 75.69  ? 106 PHE J CA  1 
ATOM   11091 C C   . PHE J 1 110 ? 34.300  13.673  -20.473 1.00 76.11  ? 106 PHE J C   1 
ATOM   11092 O O   . PHE J 1 110 ? 33.907  12.522  -20.657 1.00 79.13  ? 106 PHE J O   1 
ATOM   11093 C CB  . PHE J 1 110 ? 32.808  15.332  -21.590 1.00 81.25  ? 106 PHE J CB  1 
ATOM   11094 C CG  . PHE J 1 110 ? 32.726  16.643  -22.321 1.00 68.82  ? 106 PHE J CG  1 
ATOM   11095 C CD1 . PHE J 1 110 ? 32.770  16.685  -23.704 1.00 70.43  ? 106 PHE J CD1 1 
ATOM   11096 C CD2 . PHE J 1 110 ? 32.599  17.833  -21.623 1.00 64.24  ? 106 PHE J CD2 1 
ATOM   11097 C CE1 . PHE J 1 110 ? 32.695  17.890  -24.378 1.00 74.32  ? 106 PHE J CE1 1 
ATOM   11098 C CE2 . PHE J 1 110 ? 32.522  19.040  -22.291 1.00 72.23  ? 106 PHE J CE2 1 
ATOM   11099 C CZ  . PHE J 1 110 ? 32.571  19.068  -23.670 1.00 75.25  ? 106 PHE J CZ  1 
ATOM   11100 N N   . TYR J 1 111 ? 34.823  14.089  -19.324 1.00 80.91  ? 107 TYR J N   1 
ATOM   11101 C CA  . TYR J 1 111 ? 34.903  13.223  -18.155 1.00 94.93  ? 107 TYR J CA  1 
ATOM   11102 C C   . TYR J 1 111 ? 34.104  13.843  -17.014 1.00 105.41 ? 107 TYR J C   1 
ATOM   11103 O O   . TYR J 1 111 ? 34.615  14.659  -16.249 1.00 106.75 ? 107 TYR J O   1 
ATOM   11104 C CB  . TYR J 1 111 ? 36.360  13.007  -17.736 1.00 112.99 ? 107 TYR J CB  1 
ATOM   11105 C CG  . TYR J 1 111 ? 37.089  14.272  -17.338 1.00 132.83 ? 107 TYR J CG  1 
ATOM   11106 C CD1 . TYR J 1 111 ? 37.592  15.139  -18.299 1.00 139.68 ? 107 TYR J CD1 1 
ATOM   11107 C CD2 . TYR J 1 111 ? 37.276  14.597  -16.000 1.00 139.38 ? 107 TYR J CD2 1 
ATOM   11108 C CE1 . TYR J 1 111 ? 38.258  16.296  -17.939 1.00 147.05 ? 107 TYR J CE1 1 
ATOM   11109 C CE2 . TYR J 1 111 ? 37.940  15.752  -15.631 1.00 145.95 ? 107 TYR J CE2 1 
ATOM   11110 C CZ  . TYR J 1 111 ? 38.430  16.597  -16.604 1.00 150.77 ? 107 TYR J CZ  1 
ATOM   11111 O OH  . TYR J 1 111 ? 39.093  17.747  -16.242 1.00 152.54 ? 107 TYR J OH  1 
ATOM   11112 N N   . GLU J 1 112 ? 32.838  13.455  -16.912 1.00 105.13 ? 108 GLU J N   1 
ATOM   11113 C CA  . GLU J 1 112 ? 31.948  14.027  -15.912 1.00 93.09  ? 108 GLU J CA  1 
ATOM   11114 C C   . GLU J 1 112 ? 31.007  12.971  -15.354 1.00 86.66  ? 108 GLU J C   1 
ATOM   11115 O O   . GLU J 1 112 ? 30.869  11.886  -15.916 1.00 71.23  ? 108 GLU J O   1 
ATOM   11116 C CB  . GLU J 1 112 ? 31.142  15.175  -16.521 1.00 87.57  ? 108 GLU J CB  1 
ATOM   11117 C CG  . GLU J 1 112 ? 31.995  16.332  -17.011 1.00 88.37  ? 108 GLU J CG  1 
ATOM   11118 C CD  . GLU J 1 112 ? 31.186  17.380  -17.748 1.00 94.25  ? 108 GLU J CD  1 
ATOM   11119 O OE1 . GLU J 1 112 ? 31.725  18.477  -18.008 1.00 98.24  ? 108 GLU J OE1 1 
ATOM   11120 O OE2 . GLU J 1 112 ? 30.012  17.103  -18.073 1.00 92.20  ? 108 GLU J OE2 1 
ATOM   11121 N N   . THR J 1 113 ? 30.363  13.300  -14.239 1.00 98.89  ? 109 THR J N   1 
ATOM   11122 C CA  . THR J 1 113 ? 29.432  12.383  -13.594 1.00 98.57  ? 109 THR J CA  1 
ATOM   11123 C C   . THR J 1 113 ? 28.193  12.170  -14.463 1.00 86.50  ? 109 THR J C   1 
ATOM   11124 O O   . THR J 1 113 ? 27.824  13.043  -15.251 1.00 86.94  ? 109 THR J O   1 
ATOM   11125 C CB  . THR J 1 113 ? 28.994  12.900  -12.205 1.00 91.32  ? 109 THR J CB  1 
ATOM   11126 O OG1 . THR J 1 113 ? 28.256  14.121  -12.346 1.00 84.46  ? 109 THR J OG1 1 
ATOM   11127 C CG2 . THR J 1 113 ? 30.207  13.135  -11.309 1.00 86.14  ? 109 THR J CG2 1 
ATOM   11128 N N   . PRO J 1 114 ? 27.550  11.000  -14.325 1.00 75.34  ? 110 PRO J N   1 
ATOM   11129 C CA  . PRO J 1 114 ? 26.339  10.671  -15.085 1.00 71.01  ? 110 PRO J CA  1 
ATOM   11130 C C   . PRO J 1 114 ? 25.298  11.787  -15.051 1.00 75.12  ? 110 PRO J C   1 
ATOM   11131 O O   . PRO J 1 114 ? 24.649  12.050  -16.063 1.00 83.95  ? 110 PRO J O   1 
ATOM   11132 C CB  . PRO J 1 114 ? 25.813  9.426   -14.368 1.00 66.53  ? 110 PRO J CB  1 
ATOM   11133 C CG  . PRO J 1 114 ? 27.031  8.776   -13.819 1.00 69.17  ? 110 PRO J CG  1 
ATOM   11134 C CD  . PRO J 1 114 ? 27.958  9.896   -13.437 1.00 78.16  ? 110 PRO J CD  1 
ATOM   11135 N N   . LEU J 1 115 ? 25.142  12.432  -13.900 1.00 69.50  ? 111 LEU J N   1 
ATOM   11136 C CA  . LEU J 1 115 ? 24.195  13.533  -13.765 1.00 62.87  ? 111 LEU J CA  1 
ATOM   11137 C C   . LEU J 1 115 ? 24.561  14.679  -14.704 1.00 53.59  ? 111 LEU J C   1 
ATOM   11138 O O   . LEU J 1 115 ? 23.720  15.173  -15.457 1.00 34.27  ? 111 LEU J O   1 
ATOM   11139 C CB  . LEU J 1 115 ? 24.163  14.030  -12.318 1.00 62.32  ? 111 LEU J CB  1 
ATOM   11140 C CG  . LEU J 1 115 ? 23.507  13.085  -11.309 1.00 74.35  ? 111 LEU J CG  1 
ATOM   11141 C CD1 . LEU J 1 115 ? 23.915  13.447  -9.890  1.00 80.89  ? 111 LEU J CD1 1 
ATOM   11142 C CD2 . LEU J 1 115 ? 21.995  13.124  -11.449 1.00 78.64  ? 111 LEU J CD2 1 
ATOM   11143 N N   . GLN J 1 116 ? 25.823  15.094  -14.659 1.00 54.18  ? 112 GLN J N   1 
ATOM   11144 C CA  . GLN J 1 116 ? 26.296  16.199  -15.484 1.00 60.81  ? 112 GLN J CA  1 
ATOM   11145 C C   . GLN J 1 116 ? 26.131  15.896  -16.971 1.00 65.70  ? 112 GLN J C   1 
ATOM   11146 O O   . GLN J 1 116 ? 26.066  16.809  -17.794 1.00 67.98  ? 112 GLN J O   1 
ATOM   11147 C CB  . GLN J 1 116 ? 27.761  16.509  -15.166 1.00 68.06  ? 112 GLN J CB  1 
ATOM   11148 C CG  . GLN J 1 116 ? 27.971  17.133  -13.793 1.00 72.60  ? 112 GLN J CG  1 
ATOM   11149 C CD  . GLN J 1 116 ? 29.433  17.382  -13.479 1.00 82.17  ? 112 GLN J CD  1 
ATOM   11150 O OE1 . GLN J 1 116 ? 30.219  16.444  -13.341 1.00 91.19  ? 112 GLN J OE1 1 
ATOM   11151 N NE2 . GLN J 1 116 ? 29.807  18.652  -13.369 1.00 82.91  ? 112 GLN J NE2 1 
ATOM   11152 N N   . LEU J 1 117 ? 26.067  14.612  -17.309 1.00 67.77  ? 113 LEU J N   1 
ATOM   11153 C CA  . LEU J 1 117 ? 25.837  14.197  -18.689 1.00 61.08  ? 113 LEU J CA  1 
ATOM   11154 C C   . LEU J 1 117 ? 24.369  14.363  -19.063 1.00 53.64  ? 113 LEU J C   1 
ATOM   11155 O O   . LEU J 1 117 ? 24.047  14.868  -20.138 1.00 69.67  ? 113 LEU J O   1 
ATOM   11156 C CB  . LEU J 1 117 ? 26.265  12.741  -18.891 1.00 52.96  ? 113 LEU J CB  1 
ATOM   11157 C CG  . LEU J 1 117 ? 25.777  12.081  -20.183 1.00 50.87  ? 113 LEU J CG  1 
ATOM   11158 C CD1 . LEU J 1 117 ? 26.222  12.868  -21.407 1.00 39.93  ? 113 LEU J CD1 1 
ATOM   11159 C CD2 . LEU J 1 117 ? 26.266  10.643  -20.264 1.00 55.86  ? 113 LEU J CD2 1 
ATOM   11160 N N   . LEU J 1 118 ? 23.482  13.939  -18.171 1.00 43.33  ? 114 LEU J N   1 
ATOM   11161 C CA  . LEU J 1 118 ? 22.047  14.031  -18.416 1.00 45.30  ? 114 LEU J CA  1 
ATOM   11162 C C   . LEU J 1 118 ? 21.600  15.483  -18.583 1.00 48.40  ? 114 LEU J C   1 
ATOM   11163 O O   . LEU J 1 118 ? 20.858  15.806  -19.512 1.00 39.29  ? 114 LEU J O   1 
ATOM   11164 C CB  . LEU J 1 118 ? 21.271  13.367  -17.277 1.00 46.95  ? 114 LEU J CB  1 
ATOM   11165 C CG  . LEU J 1 118 ? 21.371  11.841  -17.204 1.00 35.91  ? 114 LEU J CG  1 
ATOM   11166 C CD1 . LEU J