data_3UFJ
# 
_entry.id   3UFJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UFJ         
NDB   NA1370       
RCSB  RCSB068690   
WWPDB D_1000068690 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2RBA 
_pdbx_database_related.details        'Complex with abasic DNA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UFJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pozharski, E.' 1 
'Maiti, A.'     2 
'Drohat, A.C.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Lesion processing by a repair enzyme is severely curtailed by residues needed to prevent aberrant activity on undamaged DNA.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            109 
_citation.page_first                8091 
_citation.page_last                 8096 
_citation.year                      2012 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22573813 
_citation.pdbx_database_id_DOI      10.1073/pnas.1201010109 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Maiti, A.'       1 
primary 'Noon, M.S.'      2 
primary 'Mackerell, A.D.' 3 
primary 'Pozharski, E.'   4 
primary 'Drohat, A.C.'    5 
# 
_cell.entry_id           3UFJ 
_cell.length_a           162.537 
_cell.length_b           162.537 
_cell.length_c           54.959 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UFJ 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G/T mismatch-specific thymine DNA glycosylase'                                     23070.670 2 3.2.2.29 ? 
'Core domain (UNP residues 111-308)' ? 
2 polymer syn "5'-D(*CP*AP*GP*CP*TP*CP*TP*GP*TP*AP*CP*GP*TP*GP*AP*GP*CP*AP*GP*TP*GP*GP*A)-3'"     7121.597  2 ?        ? ? ? 
3 polymer syn "5'-D(*CP*CP*AP*CP*TP*GP*CP*TP*CP*AP*(UF2)P*GP*TP*AP*CP*AP*GP*AP*GP*CP*TP*GP*T)-3'" 7020.500  2 ?        ? ? ? 
4 water   nat water                                                                               18.015    1 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Thymine-DNA glycosylase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET
LCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
;GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET
LCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
A,B ? 
2 polydeoxyribonucleotide no no  
;(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DA)(DG)(DC)(DA)(DG)(DT)
(DG)(DG)(DA)
;
CAGCTCTGTACGTGAGCAGTGGA C,E ? 
3 polydeoxyribonucleotide no yes 
;(DC)(DC)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DA)(UF2)(DG)(DT)(DA)(DC)(DA)(DG)(DA)(DG)
(DC)(DT)(DG)(DT)
;
CCACTGCTCAXGTACAGAGCTGT D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   SER n 
1 7   PHE n 
1 8   ASN n 
1 9   GLY n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  LYS n 
1 19  THR n 
1 20  LEU n 
1 21  PRO n 
1 22  ASP n 
1 23  ILE n 
1 24  LEU n 
1 25  THR n 
1 26  PHE n 
1 27  ASN n 
1 28  LEU n 
1 29  ASP n 
1 30  ILE n 
1 31  VAL n 
1 32  ILE n 
1 33  ILE n 
1 34  GLY n 
1 35  ILE n 
1 36  ASN n 
1 37  PRO n 
1 38  GLY n 
1 39  LEU n 
1 40  MET n 
1 41  ALA n 
1 42  ALA n 
1 43  TYR n 
1 44  LYS n 
1 45  GLY n 
1 46  HIS n 
1 47  HIS n 
1 48  TYR n 
1 49  PRO n 
1 50  GLY n 
1 51  PRO n 
1 52  GLY n 
1 53  ASN n 
1 54  HIS n 
1 55  PHE n 
1 56  TRP n 
1 57  LYS n 
1 58  CYS n 
1 59  LEU n 
1 60  PHE n 
1 61  MET n 
1 62  SER n 
1 63  GLY n 
1 64  LEU n 
1 65  SER n 
1 66  GLU n 
1 67  VAL n 
1 68  GLN n 
1 69  LEU n 
1 70  ASN n 
1 71  HIS n 
1 72  MET n 
1 73  ASP n 
1 74  ASP n 
1 75  HIS n 
1 76  THR n 
1 77  LEU n 
1 78  PRO n 
1 79  GLY n 
1 80  LYS n 
1 81  TYR n 
1 82  GLY n 
1 83  ILE n 
1 84  GLY n 
1 85  PHE n 
1 86  THR n 
1 87  ASN n 
1 88  MET n 
1 89  VAL n 
1 90  GLU n 
1 91  ARG n 
1 92  THR n 
1 93  THR n 
1 94  PRO n 
1 95  GLY n 
1 96  SER n 
1 97  LYS n 
1 98  ASP n 
1 99  LEU n 
1 100 SER n 
1 101 SER n 
1 102 LYS n 
1 103 GLU n 
1 104 PHE n 
1 105 ARG n 
1 106 GLU n 
1 107 GLY n 
1 108 GLY n 
1 109 ARG n 
1 110 ILE n 
1 111 LEU n 
1 112 VAL n 
1 113 GLN n 
1 114 LYS n 
1 115 LEU n 
1 116 GLN n 
1 117 LYS n 
1 118 TYR n 
1 119 GLN n 
1 120 PRO n 
1 121 ARG n 
1 122 ILE n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 ASN n 
1 127 GLY n 
1 128 LYS n 
1 129 CYS n 
1 130 ILE n 
1 131 TYR n 
1 132 GLU n 
1 133 ILE n 
1 134 PHE n 
1 135 SER n 
1 136 LYS n 
1 137 GLU n 
1 138 VAL n 
1 139 PHE n 
1 140 GLY n 
1 141 VAL n 
1 142 LYS n 
1 143 VAL n 
1 144 LYS n 
1 145 ASN n 
1 146 LEU n 
1 147 GLU n 
1 148 PHE n 
1 149 GLY n 
1 150 LEU n 
1 151 GLN n 
1 152 PRO n 
1 153 HIS n 
1 154 LYS n 
1 155 ILE n 
1 156 PRO n 
1 157 ASP n 
1 158 THR n 
1 159 GLU n 
1 160 THR n 
1 161 LEU n 
1 162 CYS n 
1 163 TYR n 
1 164 VAL n 
1 165 MET n 
1 166 PRO n 
1 167 SER n 
1 168 SER n 
1 169 SER n 
1 170 ALA n 
1 171 ARG n 
1 172 CYS n 
1 173 ALA n 
1 174 GLN n 
1 175 PHE n 
1 176 PRO n 
1 177 ARG n 
1 178 ALA n 
1 179 GLN n 
1 180 ASP n 
1 181 LYS n 
1 182 VAL n 
1 183 HIS n 
1 184 TYR n 
1 185 TYR n 
1 186 ILE n 
1 187 LYS n 
1 188 LEU n 
1 189 LYS n 
1 190 ASP n 
1 191 LEU n 
1 192 ARG n 
1 193 ASP n 
1 194 GLN n 
1 195 LEU n 
1 196 LYS n 
1 197 GLY n 
1 198 ILE n 
1 199 GLU n 
1 200 ARG n 
1 201 ASN n 
1 202 MET n 
1 203 ASP n 
1 204 VAL n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DC  n 
2 5   DT  n 
2 6   DC  n 
2 7   DT  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DG  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
2 16  DG  n 
2 17  DC  n 
2 18  DA  n 
2 19  DG  n 
2 20  DT  n 
2 21  DG  n 
2 22  DG  n 
2 23  DA  n 
3 1   DC  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   DT  n 
3 6   DG  n 
3 7   DC  n 
3 8   DT  n 
3 9   DC  n 
3 10  DA  n 
3 11  UF2 n 
3 12  DG  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
3 16  DA  n 
3 17  DG  n 
3 18  DA  n 
3 19  DG  n 
3 20  DC  n 
3 21  DT  n 
3 22  DG  n 
3 23  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TDG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TDG_HUMAN Q13569 1 
;FNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFT
NMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMP
SSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
111 ? 
2 PDB 3UFJ      3UFJ   2 CAGCTCTGTACGTGAGCAGTGGA ?   ? 
3 PDB 3UFJ      3UFJ   3 'CCACTGCTCA(UF2)GTACAGAGCTGT' ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UFJ A 7 ? 204 ? Q13569 111 ? 308 ? 111 308 
2 1 3UFJ B 7 ? 204 ? Q13569 111 ? 308 ? 111 308 
3 2 3UFJ C 1 ? 23  ? 3UFJ   1   ? 23  ? 1   23  
4 2 3UFJ E 1 ? 23  ? 3UFJ   1   ? 23  ? 1   23  
5 3 3UFJ D 1 ? 23  ? 3UFJ   1   ? 23  ? 1   23  
6 3 3UFJ F 1 ? 23  ? 3UFJ   1   ? 23  ? 1   23  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UFJ GLY A 1 ? UNP Q13569 ? ? 'EXPRESSION TAG' 105 1  
1 3UFJ SER A 2 ? UNP Q13569 ? ? 'EXPRESSION TAG' 106 2  
1 3UFJ HIS A 3 ? UNP Q13569 ? ? 'EXPRESSION TAG' 107 3  
1 3UFJ MET A 4 ? UNP Q13569 ? ? 'EXPRESSION TAG' 108 4  
1 3UFJ ALA A 5 ? UNP Q13569 ? ? 'EXPRESSION TAG' 109 5  
1 3UFJ SER A 6 ? UNP Q13569 ? ? 'EXPRESSION TAG' 110 6  
2 3UFJ GLY B 1 ? UNP Q13569 ? ? 'EXPRESSION TAG' 105 7  
2 3UFJ SER B 2 ? UNP Q13569 ? ? 'EXPRESSION TAG' 106 8  
2 3UFJ HIS B 3 ? UNP Q13569 ? ? 'EXPRESSION TAG' 107 9  
2 3UFJ MET B 4 ? UNP Q13569 ? ? 'EXPRESSION TAG' 108 10 
2 3UFJ ALA B 5 ? UNP Q13569 ? ? 'EXPRESSION TAG' 109 11 
2 3UFJ SER B 6 ? UNP Q13569 ? ? 'EXPRESSION TAG' 110 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                 ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                              ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                         ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                ? 'C3 H7 N O2 S' 
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                    ? 
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                     ? 
'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                    ? 
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                               ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                         ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                 ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                               ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                   ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                              ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                 ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                  ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                              ? 
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                           ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                 ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                  ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                               ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                              ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                ? 'C9 H11 N O3' 
181.189 
UF2 'DNA linking'       n '1-(2-deoxy-2-fluoro-5-O-phosphono-beta-D-arabinofuranosyl)pyrimidine-2,4(1H,3H)-dione' 
"2'-fluoro-2'-deoxyuridine" 'C9 H12 F N2 O8 P' 326.172 
VAL 'L-peptide linking' y VALINE                                                                                  ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          3UFJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.82 
_exptl_crystal.density_percent_sol   56.32 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
'20% PEG3350, 0.2 M potassium sodium tartrate tetrahydrate, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-05-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'side scattering I-beam bent single crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3UFJ 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             140.761 
_reflns.d_resolution_high            2.967 
_reflns.number_obs                   17456 
_reflns.number_all                   17486 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.3 
_reflns.B_iso_Wilson_estimate        102.2 
_reflns.pdbx_redundancy              11.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.967 
_reflns_shell.d_res_low              3.04 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.1 
_reflns_shell.pdbx_redundancy        11.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3UFJ 
_refine.ls_number_reflns_obs                     17438 
_refine.ls_number_reflns_all                     17438 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.634 
_refine.ls_d_res_high                            2.967 
_refine.ls_percent_reflns_obs                    99.61 
_refine.ls_R_factor_obs                          0.26504 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.26294 
_refine.ls_R_factor_R_free                       0.30435 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  881 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.921 
_refine.correlation_coeff_Fo_to_Fc_free          0.891 
_refine.B_iso_mean                               104.441 
_refine.aniso_B[1][1]                            -52.00 
_refine.aniso_B[2][2]                            -52.00 
_refine.aniso_B[3][3]                            104.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT 
U VALUES      : REFINED INDIVIDUALLY
;
_refine.pdbx_starting_model                      'PDB ENTRY 2RBA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.102 
_refine.overall_SU_ML                            0.581 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             38.948 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2629 
_refine_hist.pdbx_number_atoms_nucleic_acid   1876 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               4506 
_refine_hist.d_res_high                       2.967 
_refine_hist.d_res_low                        40.634 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.007  0.016  ? 4805 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.106  1.682  ? 6932 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.613  5.000  ? 367  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       35.467 23.524 ? 105  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       18.577 15.000 ? 338  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       11.768 15.000 ? 10   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.068  0.200  ? 685  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.005  0.021  ? 3102 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 107 0.070  0.500 1 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1 1 'TIGHT THERMAL'     A 124 10.720 0.500 2 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 107 10.490 2.000 3 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 'TIGHT THERMAL'     C 473 13.000 0.500 4 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 1 'TIGHT THERMAL'     D 465 15.590 0.500 5 ? ? ? ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.967 
_refine_ls_shell.d_res_low                        3.043 
_refine_ls_shell.number_reflns_R_work             1167 
_refine_ls_shell.R_factor_R_work                  0.384 
_refine_ls_shell.percent_reflns_obs               95.92 
_refine_ls_shell.R_factor_R_free                  0.480 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000  0.000000  0.000000 0.000000  1.000000 0.000000  0.000000 0.000000  1.000000  0.00000 0.00000  0.00000   
2 given ? -0.378435 -0.924920 0.036192 -0.923551 0.374680 -0.081667 0.061975 -0.064331 -0.996002 0.21862 -0.77200 -17.42732 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 C 
2 2 E 
3 1 D 
3 2 F 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 2 A 124 A 154 ? . . . . . . . . 
1 2 1 2 B 124 B 154 ? . . . . . . . . 
2 1 1 1 C 1   C 25  ? . . . . . . . . 
2 2 1 1 E 1   E 25  ? . . . . . . . . 
3 1 1 1 D 1   D 25  ? . . . . . . . . 
3 2 1 1 F 1   F 25  ? . . . . . . . . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  3UFJ 
_struct.title                     
;Human Thymine DNA Glycosylase Bound to Substrate Analog 2'-fluoro-2'-deoxyuridine
;
_struct.pdbx_descriptor           'G/T mismatch-specific thymine DNA glycosylase (E.C.3.2.2.29)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UFJ 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'DNA damage, DNA repair, DNA binding, glycosidase, nucleus, HYDROLASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 38  ? GLY A 45  ? GLY A 142 GLY A 149 1 ? 8  
HELX_P HELX_P2  2  HIS A 54  ? SER A 62  ? HIS A 158 SER A 166 1 ? 9  
HELX_P HELX_P3  3  ASN A 70  ? HIS A 75  ? ASN A 174 HIS A 179 5 ? 6  
HELX_P HELX_P4  4  THR A 76  ? GLY A 82  ? THR A 180 GLY A 186 1 ? 7  
HELX_P HELX_P5  5  SER A 100 ? GLN A 119 ? SER A 204 GLN A 223 1 ? 20 
HELX_P HELX_P6  6  GLY A 127 ? PHE A 139 ? GLY A 231 PHE A 243 1 ? 13 
HELX_P HELX_P7  7  VAL A 182 ? ILE A 198 ? VAL A 286 ILE A 302 1 ? 17 
HELX_P HELX_P8  8  GLY B 38  ? GLY B 45  ? GLY B 142 GLY B 149 1 ? 8  
HELX_P HELX_P9  9  HIS B 54  ? SER B 62  ? HIS B 158 SER B 166 1 ? 9  
HELX_P HELX_P10 10 ASN B 70  ? HIS B 75  ? ASN B 174 HIS B 179 5 ? 6  
HELX_P HELX_P11 11 THR B 76  ? GLY B 82  ? THR B 180 GLY B 186 1 ? 7  
HELX_P HELX_P12 12 SER B 101 ? GLN B 119 ? SER B 205 GLN B 223 1 ? 19 
HELX_P HELX_P13 13 GLY B 127 ? PHE B 139 ? GLY B 231 PHE B 243 1 ? 13 
HELX_P HELX_P14 14 VAL B 182 ? ILE B 198 ? VAL B 286 ILE B 302 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? D DA 10 "O3'" ? ? ? 1_555 D UF2 11 P  ? ? D DA 10 D UF2 11 1_555 ? ? ? ? ? ? ?               1.599 ? 
covale2   covale ? ? F DA 10 "O3'" ? ? ? 1_555 F UF2 11 P  ? ? F DA 10 F UF2 11 1_555 ? ? ? ? ? ? ?               1.592 ? 
hydrog1   hydrog ? ? C DC 1  N3    ? ? ? 1_555 D DG  22 N1 ? ? C DC 1  D DG  22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? C DC 1  N4    ? ? ? 1_555 D DG  22 O6 ? ? C DC 1  D DG  22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? C DC 1  O2    ? ? ? 1_555 D DG  22 N2 ? ? C DC 1  D DG  22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? C DA 2  N1    ? ? ? 1_555 D DT  21 N3 ? ? C DA 2  D DT  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? C DA 2  N6    ? ? ? 1_555 D DT  21 O4 ? ? C DA 2  D DT  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? C DG 3  N1    ? ? ? 1_555 D DC  20 N3 ? ? C DG 3  D DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? C DG 3  N2    ? ? ? 1_555 D DC  20 O2 ? ? C DG 3  D DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? C DG 3  O6    ? ? ? 1_555 D DC  20 N4 ? ? C DG 3  D DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? C DC 4  N3    ? ? ? 1_555 D DG  19 N1 ? ? C DC 4  D DG  19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? C DC 4  N4    ? ? ? 1_555 D DG  19 O6 ? ? C DC 4  D DG  19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? C DC 4  O2    ? ? ? 1_555 D DG  19 N2 ? ? C DC 4  D DG  19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? C DT 5  N3    ? ? ? 1_555 D DA  18 N1 ? ? C DT 5  D DA  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? C DT 5  O4    ? ? ? 1_555 D DA  18 N6 ? ? C DT 5  D DA  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? C DC 6  N3    ? ? ? 1_555 D DG  17 N1 ? ? C DC 6  D DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? C DC 6  N4    ? ? ? 1_555 D DG  17 O6 ? ? C DC 6  D DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? C DC 6  O2    ? ? ? 1_555 D DG  17 N2 ? ? C DC 6  D DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? C DT 7  N3    ? ? ? 1_555 D DA  16 N1 ? ? C DT 7  D DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? C DT 7  O4    ? ? ? 1_555 D DA  16 N6 ? ? C DT 7  D DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? C DG 8  N1    ? ? ? 1_555 D DC  15 N3 ? ? C DG 8  D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? C DG 8  N2    ? ? ? 1_555 D DC  15 O2 ? ? C DG 8  D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? C DG 8  O6    ? ? ? 1_555 D DC  15 N4 ? ? C DG 8  D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? C DG 8  N2    ? ? ? 1_555 F DA  3  N7 ? ? C DG 8  F DA  3  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog23  hydrog ? ? C DT 9  N3    ? ? ? 1_555 D DA  14 N1 ? ? C DT 9  D DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? C DT 9  O4    ? ? ? 1_555 D DA  14 N6 ? ? C DT 9  D DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? C DT 9  O2    ? ? ? 1_555 F DC  4  N4 ? ? C DT 9  F DC  4  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog26  hydrog ? ? C DA 10 N1    ? ? ? 1_555 D DT  13 N3 ? ? C DA 10 D DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? C DA 10 N6    ? ? ? 1_555 D DT  13 O4 ? ? C DA 10 D DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? C DA 10 N1    ? ? ? 1_555 E DA  18 N6 ? ? C DA 10 E DA  18 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog29  hydrog ? ? C DC 11 N3    ? ? ? 1_555 D DG  12 N1 ? ? C DC 11 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? C DC 11 N4    ? ? ? 1_555 D DG  12 O6 ? ? C DC 11 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? C DC 11 O2    ? ? ? 1_555 D DG  12 N2 ? ? C DC 11 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? C DG 12 O6    ? ? ? 1_555 E DG  16 N1 ? ? C DG 12 E DG  16 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog33  hydrog ? ? C DT 13 N3    ? ? ? 1_555 D DA  10 N1 ? ? C DT 13 D DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? C DT 13 O4    ? ? ? 1_555 D DA  10 N6 ? ? C DT 13 D DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? C DG 14 N1    ? ? ? 1_555 D DC  9  N3 ? ? C DG 14 D DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? C DG 14 N2    ? ? ? 1_555 D DC  9  O2 ? ? C DG 14 D DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? C DG 14 O6    ? ? ? 1_555 D DC  9  N4 ? ? C DG 14 D DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? C DG 14 O6    ? ? ? 1_555 F DC  9  N4 ? ? C DG 14 F DC  9  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog39  hydrog ? ? C DA 15 N1    ? ? ? 1_555 D DT  8  N3 ? ? C DA 15 D DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? C DA 15 N6    ? ? ? 1_555 D DT  8  O4 ? ? C DA 15 D DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? C DA 15 N1    ? ? ? 1_555 F DC  9  N4 ? ? C DA 15 F DC  9  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog42  hydrog ? ? C DA 15 N1    ? ? ? 1_555 F DA  10 N6 ? ? C DA 15 F DA  10 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog43  hydrog ? ? C DG 16 N1    ? ? ? 1_555 D DC  7  N3 ? ? C DG 16 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? C DG 16 N2    ? ? ? 1_555 D DC  7  O2 ? ? C DG 16 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? C DG 16 O6    ? ? ? 1_555 D DC  7  N4 ? ? C DG 16 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? C DG 16 N1    ? ? ? 1_555 E DG  12 O6 ? ? C DG 16 E DG  12 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog47  hydrog ? ? C DG 16 N2    ? ? ? 1_555 F DA  10 N1 ? ? C DG 16 F DA  10 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog48  hydrog ? ? C DC 17 N3    ? ? ? 1_555 D DG  6  N1 ? ? C DC 17 D DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? C DC 17 N4    ? ? ? 1_555 D DG  6  O6 ? ? C DC 17 D DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? C DC 17 O2    ? ? ? 1_555 D DG  6  N2 ? ? C DC 17 D DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? C DA 18 N1    ? ? ? 1_555 D DT  5  N3 ? ? C DA 18 D DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? C DA 18 N6    ? ? ? 1_555 D DT  5  O4 ? ? C DA 18 D DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? C DA 18 N6    ? ? ? 1_555 E DA  10 N1 ? ? C DA 18 E DA  10 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog54  hydrog ? ? C DG 19 N1    ? ? ? 1_555 D DC  4  N3 ? ? C DG 19 D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? C DG 19 N2    ? ? ? 1_555 D DC  4  O2 ? ? C DG 19 D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? C DG 19 O6    ? ? ? 1_555 D DC  4  N4 ? ? C DG 19 D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? C DG 19 N2    ? ? ? 1_555 D DT  5  O2 ? ? C DG 19 D DT  5  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog58  hydrog ? ? C DG 19 N1    ? ? ? 1_555 E DA  10 N3 ? ? C DG 19 E DA  10 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog59  hydrog ? ? C DT 20 N3    ? ? ? 1_555 D DA  3  N1 ? ? C DT 20 D DA  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? C DT 20 O4    ? ? ? 1_555 D DA  3  N6 ? ? C DT 20 D DA  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? C DG 21 N1    ? ? ? 1_555 D DC  2  N3 ? ? C DG 21 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? C DG 21 N2    ? ? ? 1_555 D DC  2  O2 ? ? C DG 21 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? C DG 21 O6    ? ? ? 1_555 D DC  2  N4 ? ? C DG 21 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? C DG 22 N1    ? ? ? 1_555 D DC  1  N3 ? ? C DG 22 D DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? C DG 22 N2    ? ? ? 1_555 D DC  1  O2 ? ? C DG 22 D DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? C DG 22 O6    ? ? ? 1_555 D DC  1  N4 ? ? C DG 22 D DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? D DA 3  N7    ? ? ? 1_555 E DG  8  N2 ? ? D DA 3  E DG  8  1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog68  hydrog ? ? D DA 3  N6    ? ? ? 1_555 F DA  14 N1 ? ? D DA 3  F DA  14 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog69  hydrog ? ? D DA 3  N6    ? ? ? 1_555 F DC  15 N3 ? ? D DA 3  F DC  15 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog70  hydrog ? ? D DC 4  N4    ? ? ? 1_555 E DT  9  O2 ? ? D DC 4  E DT  9  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog71  hydrog ? ? D DC 7  O2    ? ? ? 1_555 F DA  10 N6 ? ? D DC 7  F DA  10 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog72  hydrog ? ? D DC 9  N4    ? ? ? 1_555 E DG  14 O6 ? ? D DC 9  E DG  14 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog73  hydrog ? ? D DC 9  N4    ? ? ? 1_555 E DA  15 N1 ? ? D DC 9  E DA  15 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog74  hydrog ? ? D DA 10 N6    ? ? ? 1_555 E DA  15 N1 ? ? D DA 10 E DA  15 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog75  hydrog ? ? D DA 10 N1    ? ? ? 1_555 E DG  16 N2 ? ? D DA 10 E DG  16 1_555 ? ? ? ? ? ? TYPE_10_PAIR    ?     ? 
hydrog76  hydrog ? ? D DA 10 N6    ? ? ? 1_555 E DG  16 N3 ? ? D DA 10 E DG  16 1_555 ? ? ? ? ? ? TYPE_10_PAIR    ?     ? 
hydrog77  hydrog ? ? D DA 10 N6    ? ? ? 1_555 F DC  7  O2 ? ? D DA 10 F DC  7  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog78  hydrog ? ? D DA 14 N1    ? ? ? 1_555 F DA  3  N6 ? ? D DA 14 F DA  3  1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog79  hydrog ? ? D DC 15 N3    ? ? ? 1_555 F DA  3  N6 ? ? D DC 15 F DA  3  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog80  hydrog ? ? E DC 1  N3    ? ? ? 1_555 F DG  22 N1 ? ? E DC 1  F DG  22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? E DC 1  N4    ? ? ? 1_555 F DG  22 O6 ? ? E DC 1  F DG  22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? E DC 1  O2    ? ? ? 1_555 F DG  22 N2 ? ? E DC 1  F DG  22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? E DA 2  N1    ? ? ? 1_555 F DT  21 N3 ? ? E DA 2  F DT  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? E DA 2  N6    ? ? ? 1_555 F DT  21 O4 ? ? E DA 2  F DT  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? E DG 3  N1    ? ? ? 1_555 F DC  20 N3 ? ? E DG 3  F DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? E DG 3  N2    ? ? ? 1_555 F DC  20 O2 ? ? E DG 3  F DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? E DG 3  O6    ? ? ? 1_555 F DC  20 N4 ? ? E DG 3  F DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? E DC 4  N3    ? ? ? 1_555 F DG  19 N1 ? ? E DC 4  F DG  19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? E DC 4  N4    ? ? ? 1_555 F DG  19 O6 ? ? E DC 4  F DG  19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? E DC 4  O2    ? ? ? 1_555 F DG  19 N2 ? ? E DC 4  F DG  19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? E DT 5  N3    ? ? ? 1_555 F DA  18 N1 ? ? E DT 5  F DA  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? E DT 5  O4    ? ? ? 1_555 F DA  18 N6 ? ? E DT 5  F DA  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? E DC 6  N3    ? ? ? 1_555 F DG  17 N1 ? ? E DC 6  F DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? E DC 6  N4    ? ? ? 1_555 F DG  17 O6 ? ? E DC 6  F DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? E DC 6  O2    ? ? ? 1_555 F DG  17 N2 ? ? E DC 6  F DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? E DT 7  N3    ? ? ? 1_555 F DA  16 N1 ? ? E DT 7  F DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? E DT 7  O4    ? ? ? 1_555 F DA  16 N6 ? ? E DT 7  F DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? E DG 8  N1    ? ? ? 1_555 F DC  15 N3 ? ? E DG 8  F DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? E DG 8  N2    ? ? ? 1_555 F DC  15 O2 ? ? E DG 8  F DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? E DG 8  O6    ? ? ? 1_555 F DC  15 N4 ? ? E DG 8  F DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? E DT 9  N3    ? ? ? 1_555 F DA  14 N1 ? ? E DT 9  F DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? E DT 9  O4    ? ? ? 1_555 F DA  14 N6 ? ? E DT 9  F DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? E DA 10 N1    ? ? ? 1_555 F DT  13 N3 ? ? E DA 10 F DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? E DA 10 N6    ? ? ? 1_555 F DT  13 O4 ? ? E DA 10 F DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? E DC 11 N3    ? ? ? 1_555 F DG  12 N1 ? ? E DC 11 F DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? E DC 11 N4    ? ? ? 1_555 F DG  12 O6 ? ? E DC 11 F DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? E DC 11 O2    ? ? ? 1_555 F DG  12 N2 ? ? E DC 11 F DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? E DT 13 N3    ? ? ? 1_555 F DA  10 N1 ? ? E DT 13 F DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? E DT 13 O4    ? ? ? 1_555 F DA  10 N6 ? ? E DT 13 F DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? E DG 14 N1    ? ? ? 1_555 F DC  9  N3 ? ? E DG 14 F DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? E DG 14 N2    ? ? ? 1_555 F DC  9  O2 ? ? E DG 14 F DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? E DG 14 O6    ? ? ? 1_555 F DC  9  N4 ? ? E DG 14 F DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? E DA 15 N1    ? ? ? 1_555 F DT  8  N3 ? ? E DA 15 F DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? E DA 15 N6    ? ? ? 1_555 F DT  8  O4 ? ? E DA 15 F DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? E DG 16 N1    ? ? ? 1_555 F DC  7  N3 ? ? E DG 16 F DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? E DG 16 N2    ? ? ? 1_555 F DC  7  O2 ? ? E DG 16 F DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? E DG 16 O6    ? ? ? 1_555 F DC  7  N4 ? ? E DG 16 F DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? E DC 17 N3    ? ? ? 1_555 F DG  6  N1 ? ? E DC 17 F DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? E DC 17 N4    ? ? ? 1_555 F DG  6  O6 ? ? E DC 17 F DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? E DC 17 O2    ? ? ? 1_555 F DG  6  N2 ? ? E DC 17 F DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? E DA 18 N1    ? ? ? 1_555 F DT  5  N3 ? ? E DA 18 F DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? E DA 18 N6    ? ? ? 1_555 F DT  5  O4 ? ? E DA 18 F DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? E DG 19 N1    ? ? ? 1_555 F DC  4  N3 ? ? E DG 19 F DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? E DG 19 N2    ? ? ? 1_555 F DC  4  O2 ? ? E DG 19 F DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? E DG 19 O6    ? ? ? 1_555 F DC  4  N4 ? ? E DG 19 F DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? E DG 19 N2    ? ? ? 1_555 F DT  5  O2 ? ? E DG 19 F DT  5  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog127 hydrog ? ? E DT 20 N3    ? ? ? 1_555 F DA  3  N1 ? ? E DT 20 F DA  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? E DT 20 O4    ? ? ? 1_555 F DA  3  N6 ? ? E DT 20 F DA  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? E DG 21 N1    ? ? ? 1_555 F DC  2  N3 ? ? E DG 21 F DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? E DG 21 N2    ? ? ? 1_555 F DC  2  O2 ? ? E DG 21 F DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? E DG 21 O6    ? ? ? 1_555 F DC  2  N4 ? ? E DG 21 F DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? E DG 22 N1    ? ? ? 1_555 F DC  1  N3 ? ? E DG 22 F DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? E DG 22 N2    ? ? ? 1_555 F DC  1  O2 ? ? E DG 22 F DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? E DG 22 O6    ? ? ? 1_555 F DC  1  N4 ? ? E DG 22 F DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 17 A . ? THR 121 A LYS 18 A ? LYS 122 A 1 -3.50  
2 GLY 50 A . ? GLY 154 A PRO 51 A ? PRO 155 A 1 -13.70 
3 PRO 51 A . ? PRO 155 A GLY 52 A ? GLY 156 A 1 12.33  
4 PRO 94 A . ? PRO 198 A GLY 95 A ? GLY 199 A 1 4.31   
5 GLY 50 B . ? GLY 154 B PRO 51 B ? PRO 155 B 1 2.97   
6 PRO 94 B . ? PRO 198 B GLY 95 B ? GLY 199 B 1 -0.44  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 83  ? ASN A 87  ? ILE A 187 ASN A 191 
A 2 ILE A 30  ? GLY A 34  ? ILE A 134 GLY A 138 
A 3 ILE A 122 ? ASN A 126 ? ILE A 226 ASN A 230 
A 4 LEU A 161 ? MET A 165 ? LEU A 265 MET A 269 
A 5 GLY A 149 ? GLN A 151 ? GLY A 253 GLN A 255 
B 1 ILE B 83  ? ASN B 87  ? ILE B 187 ASN B 191 
B 2 ILE B 30  ? GLY B 34  ? ILE B 134 GLY B 138 
B 3 ILE B 122 ? ASN B 126 ? ILE B 226 ASN B 230 
B 4 LEU B 161 ? MET B 165 ? LEU B 265 MET B 269 
B 5 GLY B 149 ? LYS B 154 ? GLY B 253 LYS B 258 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 84  ? O GLY A 188 N ILE A 30  ? N ILE A 134 
A 2 3 N VAL A 31  ? N VAL A 135 O VAL A 124 ? O VAL A 228 
A 3 4 N ALA A 123 ? N ALA A 227 O LEU A 161 ? O LEU A 265 
A 4 5 O VAL A 164 ? O VAL A 268 N GLY A 149 ? N GLY A 253 
B 1 2 O THR B 86  ? O THR B 190 N GLY B 34  ? N GLY B 138 
B 2 3 N VAL B 31  ? N VAL B 135 O VAL B 124 ? O VAL B 228 
B 3 4 N ALA B 123 ? N ALA B 227 O LEU B 161 ? O LEU B 265 
B 4 5 O VAL B 164 ? O VAL B 268 N GLY B 149 ? N GLY B 253 
# 
_database_PDB_matrix.entry_id          3UFJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UFJ 
_atom_sites.fract_transf_matrix[1][1]   0.006152 
_atom_sites.fract_transf_matrix[1][2]   0.003552 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007104 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018195 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LEU A 1 16  ? -45.692 67.438 -15.269 1.00 134.22 ? 120 LEU A N     1 
ATOM   2    C CA    . LEU A 1 16  ? -44.507 67.913 -14.494 1.00 135.55 ? 120 LEU A CA    1 
ATOM   3    C C     . LEU A 1 16  ? -44.256 67.041 -13.263 1.00 133.89 ? 120 LEU A C     1 
ATOM   4    O O     . LEU A 1 16  ? -45.183 66.757 -12.500 1.00 126.89 ? 120 LEU A O     1 
ATOM   5    C CB    . LEU A 1 16  ? -44.689 69.381 -14.083 1.00 138.84 ? 120 LEU A CB    1 
ATOM   6    N N     . THR A 1 17  ? -43.003 66.619 -13.086 1.00 149.35 ? 121 THR A N     1 
ATOM   7    C CA    . THR A 1 17  ? -42.585 65.794 -11.936 1.00 144.69 ? 121 THR A CA    1 
ATOM   8    C C     . THR A 1 17  ? -42.168 66.555 -10.636 1.00 140.09 ? 121 THR A C     1 
ATOM   9    O O     . THR A 1 17  ? -42.612 66.162 -9.542  1.00 110.24 ? 121 THR A O     1 
ATOM   10   C CB    . THR A 1 17  ? -41.505 64.755 -12.333 1.00 125.78 ? 121 THR A CB    1 
ATOM   11   N N     . LYS A 1 18  ? -41.332 67.611 -10.709 1.00 142.55 ? 122 LYS A N     1 
ATOM   12   C CA    . LYS A 1 18  ? -40.659 68.140 -11.925 1.00 132.17 ? 122 LYS A CA    1 
ATOM   13   C C     . LYS A 1 18  ? -39.213 68.622 -11.662 1.00 123.40 ? 122 LYS A C     1 
ATOM   14   O O     . LYS A 1 18  ? -38.347 68.555 -12.546 1.00 119.02 ? 122 LYS A O     1 
ATOM   15   C CB    . LYS A 1 18  ? -41.451 69.313 -12.532 1.00 129.91 ? 122 LYS A CB    1 
ATOM   16   N N     . THR A 1 19  ? -38.960 69.133 -10.459 1.00 108.80 ? 123 THR A N     1 
ATOM   17   C CA    . THR A 1 19  ? -37.713 69.836 -10.193 1.00 97.63  ? 123 THR A CA    1 
ATOM   18   C C     . THR A 1 19  ? -37.245 69.644 -8.756  1.00 98.25  ? 123 THR A C     1 
ATOM   19   O O     . THR A 1 19  ? -38.037 69.644 -7.807  1.00 97.25  ? 123 THR A O     1 
ATOM   20   C CB    . THR A 1 19  ? -37.814 71.349 -10.557 1.00 100.18 ? 123 THR A CB    1 
ATOM   21   O OG1   . THR A 1 19  ? -36.514 71.867 -10.870 1.00 100.46 ? 123 THR A OG1   1 
ATOM   22   C CG2   . THR A 1 19  ? -38.454 72.196 -9.423  1.00 89.22  ? 123 THR A CG2   1 
ATOM   23   N N     . LEU A 1 20  ? -35.940 69.469 -8.619  1.00 89.09  ? 124 LEU A N     1 
ATOM   24   C CA    . LEU A 1 20  ? -35.297 69.337 -7.319  1.00 79.84  ? 124 LEU A CA    1 
ATOM   25   C C     . LEU A 1 20  ? -34.680 70.689 -6.927  1.00 88.25  ? 124 LEU A C     1 
ATOM   26   O O     . LEU A 1 20  ? -34.030 71.341 -7.749  1.00 102.59 ? 124 LEU A O     1 
ATOM   27   C CB    . LEU A 1 20  ? -34.219 68.255 -7.394  1.00 72.16  ? 124 LEU A CB    1 
ATOM   28   C CG    . LEU A 1 20  ? -33.558 67.688 -6.138  1.00 77.86  ? 124 LEU A CG    1 
ATOM   29   C CD1   . LEU A 1 20  ? -34.555 67.205 -5.097  1.00 95.98  ? 124 LEU A CD1   1 
ATOM   30   C CD2   . LEU A 1 20  ? -32.684 66.516 -6.501  1.00 75.81  ? 124 LEU A CD2   1 
ATOM   31   N N     . PRO A 1 21  ? -34.878 71.115 -5.669  1.00 87.22  ? 125 PRO A N     1 
ATOM   32   C CA    . PRO A 1 21  ? -34.454 72.448 -5.249  1.00 78.56  ? 125 PRO A CA    1 
ATOM   33   C C     . PRO A 1 21  ? -32.955 72.508 -4.887  1.00 78.12  ? 125 PRO A C     1 
ATOM   34   O O     . PRO A 1 21  ? -32.382 71.516 -4.417  1.00 77.15  ? 125 PRO A O     1 
ATOM   35   C CB    . PRO A 1 21  ? -35.316 72.681 -4.007  1.00 76.37  ? 125 PRO A CB    1 
ATOM   36   C CG    . PRO A 1 21  ? -35.429 71.316 -3.401  1.00 77.44  ? 125 PRO A CG    1 
ATOM   37   C CD    . PRO A 1 21  ? -35.574 70.393 -4.583  1.00 88.66  ? 125 PRO A CD    1 
ATOM   38   N N     . ASP A 1 22  ? -32.330 73.663 -5.093  1.00 71.51  ? 126 ASP A N     1 
ATOM   39   C CA    . ASP A 1 22  ? -30.938 73.836 -4.684  1.00 78.01  ? 126 ASP A CA    1 
ATOM   40   C C     . ASP A 1 22  ? -30.849 74.131 -3.208  1.00 73.76  ? 126 ASP A C     1 
ATOM   41   O O     . ASP A 1 22  ? -31.370 75.136 -2.741  1.00 84.39  ? 126 ASP A O     1 
ATOM   42   C CB    . ASP A 1 22  ? -30.272 74.980 -5.454  1.00 79.26  ? 126 ASP A CB    1 
ATOM   43   C CG    . ASP A 1 22  ? -30.085 74.653 -6.902  1.00 79.56  ? 126 ASP A CG    1 
ATOM   44   O OD1   . ASP A 1 22  ? -30.010 73.431 -7.226  1.00 70.30  ? 126 ASP A OD1   1 
ATOM   45   O OD2   . ASP A 1 22  ? -30.009 75.621 -7.700  1.00 79.26  ? 126 ASP A OD2   1 
ATOM   46   N N     . ILE A 1 23  ? -30.197 73.255 -2.471  1.00 64.04  ? 127 ILE A N     1 
ATOM   47   C CA    . ILE A 1 23  ? -29.818 73.589 -1.121  1.00 63.05  ? 127 ILE A CA    1 
ATOM   48   C C     . ILE A 1 23  ? -28.472 74.307 -1.210  1.00 71.66  ? 127 ILE A C     1 
ATOM   49   O O     . ILE A 1 23  ? -27.437 73.673 -1.415  1.00 90.60  ? 127 ILE A O     1 
ATOM   50   C CB    . ILE A 1 23  ? -29.669 72.315 -0.294  1.00 68.89  ? 127 ILE A CB    1 
ATOM   51   C CG1   . ILE A 1 23  ? -31.053 71.719 -0.020  1.00 67.54  ? 127 ILE A CG1   1 
ATOM   52   C CG2   . ILE A 1 23  ? -28.898 72.600 0.983   1.00 67.47  ? 127 ILE A CG2   1 
ATOM   53   C CD1   . ILE A 1 23  ? -31.013 70.238 0.263   1.00 60.41  ? 127 ILE A CD1   1 
ATOM   54   N N     . LEU A 1 24  ? -28.473 75.622 -1.070  1.00 65.85  ? 128 LEU A N     1 
ATOM   55   C CA    . LEU A 1 24  ? -27.243 76.399 -1.162  1.00 65.28  ? 128 LEU A CA    1 
ATOM   56   C C     . LEU A 1 24  ? -27.229 77.597 -0.211  1.00 73.20  ? 128 LEU A C     1 
ATOM   57   O O     . LEU A 1 24  ? -28.219 78.315 -0.082  1.00 86.78  ? 128 LEU A O     1 
ATOM   58   C CB    . LEU A 1 24  ? -27.057 76.909 -2.601  1.00 69.54  ? 128 LEU A CB    1 
ATOM   59   C CG    . LEU A 1 24  ? -26.730 75.904 -3.707  1.00 68.10  ? 128 LEU A CG    1 
ATOM   60   C CD1   . LEU A 1 24  ? -26.669 76.596 -5.063  1.00 66.88  ? 128 LEU A CD1   1 
ATOM   61   C CD2   . LEU A 1 24  ? -25.410 75.193 -3.434  1.00 65.21  ? 128 LEU A CD2   1 
ATOM   62   N N     . THR A 1 25  ? -26.091 77.819 0.435   1.00 79.22  ? 129 THR A N     1 
ATOM   63   C CA    . THR A 1 25  ? -25.869 78.969 1.335   1.00 76.22  ? 129 THR A CA    1 
ATOM   64   C C     . THR A 1 25  ? -24.556 79.701 1.024   1.00 78.74  ? 129 THR A C     1 
ATOM   65   O O     . THR A 1 25  ? -23.769 79.293 0.164   1.00 74.94  ? 129 THR A O     1 
ATOM   66   C CB    . THR A 1 25  ? -25.798 78.505 2.796   1.00 67.81  ? 129 THR A CB    1 
ATOM   67   O OG1   . THR A 1 25  ? -24.894 77.383 2.885   1.00 63.36  ? 129 THR A OG1   1 
ATOM   68   C CG2   . THR A 1 25  ? -27.179 78.085 3.259   1.00 71.05  ? 129 THR A CG2   1 
ATOM   69   N N     . PHE A 1 26  ? -24.315 80.795 1.731   1.00 85.85  ? 130 PHE A N     1 
ATOM   70   C CA    . PHE A 1 26  ? -23.044 81.509 1.612   1.00 86.46  ? 130 PHE A CA    1 
ATOM   71   C C     . PHE A 1 26  ? -21.988 80.874 2.497   1.00 82.76  ? 130 PHE A C     1 
ATOM   72   O O     . PHE A 1 26  ? -22.300 80.318 3.535   1.00 86.63  ? 130 PHE A O     1 
ATOM   73   C CB    . PHE A 1 26  ? -23.214 82.979 1.979   1.00 74.34  ? 130 PHE A CB    1 
ATOM   74   C CG    . PHE A 1 26  ? -23.860 83.810 0.892   1.00 76.93  ? 130 PHE A CG    1 
ATOM   75   C CD1   . PHE A 1 26  ? -23.070 84.389 -0.118  1.00 76.30  ? 130 PHE A CD1   1 
ATOM   76   C CD2   . PHE A 1 26  ? -25.247 84.028 0.870   1.00 70.94  ? 130 PHE A CD2   1 
ATOM   77   C CE1   . PHE A 1 26  ? -23.645 85.185 -1.113  1.00 72.61  ? 130 PHE A CE1   1 
ATOM   78   C CE2   . PHE A 1 26  ? -25.828 84.831 -0.120  1.00 79.21  ? 130 PHE A CE2   1 
ATOM   79   C CZ    . PHE A 1 26  ? -25.027 85.416 -1.107  1.00 77.79  ? 130 PHE A CZ    1 
ATOM   80   N N     . ASN A 1 27  ? -20.735 80.961 2.074   1.00 93.71  ? 131 ASN A N     1 
ATOM   81   C CA    . ASN A 1 27  ? -19.601 80.503 2.883   1.00 93.03  ? 131 ASN A CA    1 
ATOM   82   C C     . ASN A 1 27  ? -19.780 79.035 3.283   1.00 83.33  ? 131 ASN A C     1 
ATOM   83   O O     . ASN A 1 27  ? -20.101 78.702 4.427   1.00 82.76  ? 131 ASN A O     1 
ATOM   84   C CB    . ASN A 1 27  ? -19.375 81.435 4.093   1.00 104.57 ? 131 ASN A CB    1 
ATOM   85   C CG    . ASN A 1 27  ? -18.551 80.785 5.184   1.00 113.66 ? 131 ASN A CG    1 
ATOM   86   O OD1   . ASN A 1 27  ? -17.421 80.332 4.946   1.00 106.28 ? 131 ASN A OD1   1 
ATOM   87   N ND2   . ASN A 1 27  ? -19.124 80.704 6.387   1.00 107.12 ? 131 ASN A ND2   1 
ATOM   88   N N     . LEU A 1 28  ? -19.563 78.170 2.301   1.00 74.83  ? 132 LEU A N     1 
ATOM   89   C CA    . LEU A 1 28  ? -19.874 76.769 2.393   1.00 68.86  ? 132 LEU A CA    1 
ATOM   90   C C     . LEU A 1 28  ? -18.611 76.009 2.086   1.00 78.33  ? 132 LEU A C     1 
ATOM   91   O O     . LEU A 1 28  ? -17.846 76.412 1.206   1.00 88.55  ? 132 LEU A O     1 
ATOM   92   C CB    . LEU A 1 28  ? -20.939 76.454 1.352   1.00 72.98  ? 132 LEU A CB    1 
ATOM   93   C CG    . LEU A 1 28  ? -21.967 75.319 1.512   1.00 83.48  ? 132 LEU A CG    1 
ATOM   94   C CD1   . LEU A 1 28  ? -22.564 75.155 2.908   1.00 80.20  ? 132 LEU A CD1   1 
ATOM   95   C CD2   . LEU A 1 28  ? -23.064 75.628 0.519   1.00 68.53  ? 132 LEU A CD2   1 
ATOM   96   N N     . ASP A 1 29  ? -18.360 74.919 2.802   1.00 73.11  ? 133 ASP A N     1 
ATOM   97   C CA    . ASP A 1 29  ? -17.138 74.177 2.557   1.00 74.35  ? 133 ASP A CA    1 
ATOM   98   C C     . ASP A 1 29  ? -17.257 73.480 1.216   1.00 83.65  ? 133 ASP A C     1 
ATOM   99   O O     . ASP A 1 29  ? -16.608 73.890 0.247   1.00 92.43  ? 133 ASP A O     1 
ATOM   100  C CB    . ASP A 1 29  ? -16.877 73.177 3.672   1.00 79.70  ? 133 ASP A CB    1 
ATOM   101  C CG    . ASP A 1 29  ? -16.815 73.835 5.023   1.00 87.36  ? 133 ASP A CG    1 
ATOM   102  O OD1   . ASP A 1 29  ? -16.954 75.070 5.062   1.00 85.07  ? 133 ASP A OD1   1 
ATOM   103  O OD2   . ASP A 1 29  ? -16.628 73.133 6.047   1.00 91.10  ? 133 ASP A OD2   1 
ATOM   104  N N     . ILE A 1 30  ? -18.121 72.469 1.161   1.00 71.23  ? 134 ILE A N     1 
ATOM   105  C CA    . ILE A 1 30  ? -18.317 71.651 -0.023  1.00 67.85  ? 134 ILE A CA    1 
ATOM   106  C C     . ILE A 1 30  ? -19.659 71.931 -0.707  1.00 74.82  ? 134 ILE A C     1 
ATOM   107  O O     . ILE A 1 30  ? -20.679 72.126 -0.048  1.00 90.03  ? 134 ILE A O     1 
ATOM   108  C CB    . ILE A 1 30  ? -18.303 70.180 0.380   1.00 71.37  ? 134 ILE A CB    1 
ATOM   109  C CG1   . ILE A 1 30  ? -16.954 69.824 1.046   1.00 71.27  ? 134 ILE A CG1   1 
ATOM   110  C CG2   . ILE A 1 30  ? -18.634 69.293 -0.822  1.00 71.73  ? 134 ILE A CG2   1 
ATOM   111  C CD1   . ILE A 1 30  ? -17.039 68.628 1.978   1.00 63.09  ? 134 ILE A CD1   1 
ATOM   112  N N     . VAL A 1 31  ? -19.667 71.930 -2.031  1.00 71.62  ? 135 VAL A N     1 
ATOM   113  C CA    . VAL A 1 31  ? -20.921 71.818 -2.774  1.00 65.74  ? 135 VAL A CA    1 
ATOM   114  C C     . VAL A 1 31  ? -20.926 70.583 -3.679  1.00 73.15  ? 135 VAL A C     1 
ATOM   115  O O     . VAL A 1 31  ? -20.010 70.417 -4.511  1.00 81.86  ? 135 VAL A O     1 
ATOM   116  C CB    . VAL A 1 31  ? -21.146 73.061 -3.583  1.00 62.54  ? 135 VAL A CB    1 
ATOM   117  C CG1   . VAL A 1 31  ? -22.160 72.791 -4.690  1.00 58.16  ? 135 VAL A CG1   1 
ATOM   118  C CG2   . VAL A 1 31  ? -21.602 74.172 -2.654  1.00 58.30  ? 135 VAL A CG2   1 
ATOM   119  N N     . ILE A 1 32  ? -21.917 69.703 -3.512  1.00 61.52  ? 136 ILE A N     1 
ATOM   120  C CA    . ILE A 1 32  ? -21.940 68.489 -4.323  1.00 61.66  ? 136 ILE A CA    1 
ATOM   121  C C     . ILE A 1 32  ? -22.682 68.798 -5.608  1.00 73.89  ? 136 ILE A C     1 
ATOM   122  O O     . ILE A 1 32  ? -23.730 69.454 -5.580  1.00 87.26  ? 136 ILE A O     1 
ATOM   123  C CB    . ILE A 1 32  ? -22.610 67.322 -3.601  1.00 58.10  ? 136 ILE A CB    1 
ATOM   124  C CG1   . ILE A 1 32  ? -22.085 67.173 -2.177  1.00 61.44  ? 136 ILE A CG1   1 
ATOM   125  C CG2   . ILE A 1 32  ? -22.342 66.021 -4.326  1.00 57.48  ? 136 ILE A CG2   1 
ATOM   126  C CD1   . ILE A 1 32  ? -20.594 66.907 -2.085  1.00 69.66  ? 136 ILE A CD1   1 
ATOM   127  N N     . ILE A 1 33  ? -22.146 68.351 -6.737  1.00 68.92  ? 137 ILE A N     1 
ATOM   128  C CA    . ILE A 1 33  ? -22.731 68.725 -8.023  1.00 71.09  ? 137 ILE A CA    1 
ATOM   129  C C     . ILE A 1 33  ? -23.051 67.512 -8.891  1.00 73.16  ? 137 ILE A C     1 
ATOM   130  O O     . ILE A 1 33  ? -22.139 66.844 -9.396  1.00 72.86  ? 137 ILE A O     1 
ATOM   131  C CB    . ILE A 1 33  ? -21.804 69.675 -8.790  1.00 63.86  ? 137 ILE A CB    1 
ATOM   132  C CG1   . ILE A 1 33  ? -21.530 70.911 -7.960  1.00 59.03  ? 137 ILE A CG1   1 
ATOM   133  C CG2   . ILE A 1 33  ? -22.429 70.062 -10.119 1.00 67.76  ? 137 ILE A CG2   1 
ATOM   134  C CD1   . ILE A 1 33  ? -20.478 71.803 -8.586  1.00 64.10  ? 137 ILE A CD1   1 
ATOM   135  N N     . GLY A 1 34  ? -24.345 67.236 -9.049  1.00 71.93  ? 138 GLY A N     1 
ATOM   136  C CA    . GLY A 1 34  ? -24.801 66.120 -9.878  1.00 71.29  ? 138 GLY A CA    1 
ATOM   137  C C     . GLY A 1 34  ? -25.077 66.532 -11.310 1.00 79.37  ? 138 GLY A C     1 
ATOM   138  O O     . GLY A 1 34  ? -25.098 67.745 -11.634 1.00 73.32  ? 138 GLY A O     1 
ATOM   139  N N     . ILE A 1 35  ? -25.273 65.525 -12.164 1.00 74.13  ? 139 ILE A N     1 
ATOM   140  C CA    . ILE A 1 35  ? -25.631 65.758 -13.561 1.00 78.17  ? 139 ILE A CA    1 
ATOM   141  C C     . ILE A 1 35  ? -26.993 66.466 -13.569 1.00 83.79  ? 139 ILE A C     1 
ATOM   142  O O     . ILE A 1 35  ? -27.100 67.652 -13.875 1.00 85.69  ? 139 ILE A O     1 
ATOM   143  C CB    . ILE A 1 35  ? -25.700 64.444 -14.388 1.00 74.05  ? 139 ILE A CB    1 
ATOM   144  C CG1   . ILE A 1 35  ? -24.412 63.605 -14.297 1.00 68.92  ? 139 ILE A CG1   1 
ATOM   145  C CG2   . ILE A 1 35  ? -25.935 64.793 -15.850 1.00 74.53  ? 139 ILE A CG2   1 
ATOM   146  C CD1   . ILE A 1 35  ? -24.247 62.811 -13.034 1.00 71.56  ? 139 ILE A CD1   1 
ATOM   147  N N     . ASN A 1 36  ? -28.027 65.756 -13.169 1.00 82.14  ? 140 ASN A N     1 
ATOM   148  C CA    . ASN A 1 36  ? -29.311 66.370 -12.969 1.00 76.95  ? 140 ASN A CA    1 
ATOM   149  C C     . ASN A 1 36  ? -30.086 65.442 -12.058 1.00 82.54  ? 140 ASN A C     1 
ATOM   150  O O     . ASN A 1 36  ? -29.601 64.376 -11.696 1.00 75.23  ? 140 ASN A O     1 
ATOM   151  C CB    . ASN A 1 36  ? -30.022 66.462 -14.287 1.00 74.55  ? 140 ASN A CB    1 
ATOM   152  C CG    . ASN A 1 36  ? -30.301 65.116 -14.857 1.00 71.97  ? 140 ASN A CG    1 
ATOM   153  O OD1   . ASN A 1 36  ? -29.577 64.174 -14.619 1.00 66.14  ? 140 ASN A OD1   1 
ATOM   154  N ND2   . ASN A 1 36  ? -31.357 65.011 -15.592 1.00 82.86  ? 140 ASN A ND2   1 
ATOM   155  N N     . PRO A 1 37  ? -31.310 65.815 -11.716 1.00 77.68  ? 141 PRO A N     1 
ATOM   156  C CA    . PRO A 1 37  ? -32.043 64.995 -10.754 1.00 76.49  ? 141 PRO A CA    1 
ATOM   157  C C     . PRO A 1 37  ? -32.713 63.813 -11.427 1.00 79.55  ? 141 PRO A C     1 
ATOM   158  O O     . PRO A 1 37  ? -33.314 63.954 -12.512 1.00 85.97  ? 141 PRO A O     1 
ATOM   159  C CB    . PRO A 1 37  ? -33.079 65.960 -10.177 1.00 71.21  ? 141 PRO A CB    1 
ATOM   160  C CG    . PRO A 1 37  ? -33.276 66.969 -11.263 1.00 76.82  ? 141 PRO A CG    1 
ATOM   161  C CD    . PRO A 1 37  ? -31.912 67.141 -11.886 1.00 81.53  ? 141 PRO A CD    1 
ATOM   162  N N     . GLY A 1 38  ? -32.570 62.651 -10.794 1.00 78.02  ? 142 GLY A N     1 
ATOM   163  C CA    . GLY A 1 38  ? -33.070 61.412 -11.343 1.00 67.60  ? 142 GLY A CA    1 
ATOM   164  C C     . GLY A 1 38  ? -34.553 61.368 -11.102 1.00 78.28  ? 142 GLY A C     1 
ATOM   165  O O     . GLY A 1 38  ? -35.104 62.166 -10.324 1.00 81.63  ? 142 GLY A O     1 
ATOM   166  N N     . LEU A 1 39  ? -35.207 60.419 -11.756 1.00 83.19  ? 143 LEU A N     1 
ATOM   167  C CA    . LEU A 1 39  ? -36.624 60.216 -11.560 1.00 69.47  ? 143 LEU A CA    1 
ATOM   168  C C     . LEU A 1 39  ? -36.961 60.144 -10.095 1.00 73.48  ? 143 LEU A C     1 
ATOM   169  O O     . LEU A 1 39  ? -37.811 60.909 -9.636  1.00 77.94  ? 143 LEU A O     1 
ATOM   170  C CB    . LEU A 1 39  ? -37.058 58.944 -12.245 1.00 74.40  ? 143 LEU A CB    1 
ATOM   171  C CG    . LEU A 1 39  ? -37.143 59.041 -13.756 1.00 76.84  ? 143 LEU A CG    1 
ATOM   172  C CD1   . LEU A 1 39  ? -37.700 57.725 -14.285 1.00 77.84  ? 143 LEU A CD1   1 
ATOM   173  C CD2   . LEU A 1 39  ? -38.022 60.212 -14.162 1.00 67.97  ? 143 LEU A CD2   1 
ATOM   174  N N     . MET A 1 40  ? -36.294 59.246 -9.357  1.00 70.08  ? 144 MET A N     1 
ATOM   175  C CA    . MET A 1 40  ? -36.575 59.088 -7.926  1.00 66.58  ? 144 MET A CA    1 
ATOM   176  C C     . MET A 1 40  ? -36.386 60.420 -7.231  1.00 75.15  ? 144 MET A C     1 
ATOM   177  O O     . MET A 1 40  ? -37.336 60.967 -6.666  1.00 79.62  ? 144 MET A O     1 
ATOM   178  C CB    . MET A 1 40  ? -35.667 58.056 -7.295  1.00 70.99  ? 144 MET A CB    1 
ATOM   179  C CG    . MET A 1 40  ? -35.937 57.826 -5.812  1.00 84.09  ? 144 MET A CG    1 
ATOM   180  S SD    . MET A 1 40  ? -37.267 56.631 -5.503  1.00 96.88  ? 144 MET A SD    1 
ATOM   181  C CE    . MET A 1 40  ? -36.507 55.103 -6.051  1.00 78.12  ? 144 MET A CE    1 
ATOM   182  N N     . ALA A 1 41  ? -35.164 60.953 -7.309  1.00 74.37  ? 145 ALA A N     1 
ATOM   183  C CA    . ALA A 1 41  ? -34.823 62.237 -6.724  1.00 68.60  ? 145 ALA A CA    1 
ATOM   184  C C     . ALA A 1 41  ? -35.973 63.233 -6.903  1.00 76.85  ? 145 ALA A C     1 
ATOM   185  O O     . ALA A 1 41  ? -36.490 63.789 -5.929  1.00 76.88  ? 145 ALA A O     1 
ATOM   186  C CB    . ALA A 1 41  ? -33.566 62.756 -7.379  1.00 72.51  ? 145 ALA A CB    1 
ATOM   187  N N     . ALA A 1 42  ? -36.389 63.417 -8.155  1.00 73.11  ? 146 ALA A N     1 
ATOM   188  C CA    . ALA A 1 42  ? -37.428 64.374 -8.486  1.00 78.77  ? 146 ALA A CA    1 
ATOM   189  C C     . ALA A 1 42  ? -38.735 64.043 -7.741  1.00 90.31  ? 146 ALA A C     1 
ATOM   190  O O     . ALA A 1 42  ? -39.375 64.932 -7.167  1.00 99.76  ? 146 ALA A O     1 
ATOM   191  C CB    . ALA A 1 42  ? -37.636 64.432 -9.995  1.00 67.66  ? 146 ALA A CB    1 
ATOM   192  N N     . TYR A 1 43  ? -39.113 62.764 -7.735  1.00 84.89  ? 147 TYR A N     1 
ATOM   193  C CA    . TYR A 1 43  ? -40.331 62.328 -7.057  1.00 85.51  ? 147 TYR A CA    1 
ATOM   194  C C     . TYR A 1 43  ? -40.202 62.494 -5.550  1.00 85.04  ? 147 TYR A C     1 
ATOM   195  O O     . TYR A 1 43  ? -41.081 63.077 -4.922  1.00 83.73  ? 147 TYR A O     1 
ATOM   196  C CB    . TYR A 1 43  ? -40.667 60.875 -7.407  1.00 86.89  ? 147 TYR A CB    1 
ATOM   197  C CG    . TYR A 1 43  ? -41.690 60.233 -6.486  1.00 84.31  ? 147 TYR A CG    1 
ATOM   198  C CD1   . TYR A 1 43  ? -43.045 60.569 -6.565  1.00 87.02  ? 147 TYR A CD1   1 
ATOM   199  C CD2   . TYR A 1 43  ? -41.304 59.283 -5.544  1.00 86.58  ? 147 TYR A CD2   1 
ATOM   200  C CE1   . TYR A 1 43  ? -43.983 59.976 -5.728  1.00 88.71  ? 147 TYR A CE1   1 
ATOM   201  C CE2   . TYR A 1 43  ? -42.235 58.675 -4.704  1.00 90.93  ? 147 TYR A CE2   1 
ATOM   202  C CZ    . TYR A 1 43  ? -43.571 59.024 -4.798  1.00 93.82  ? 147 TYR A CZ    1 
ATOM   203  O OH    . TYR A 1 43  ? -44.488 58.432 -3.955  1.00 93.95  ? 147 TYR A OH    1 
ATOM   204  N N     . LYS A 1 44  ? -39.098 62.006 -4.984  1.00 82.86  ? 148 LYS A N     1 
ATOM   205  C CA    . LYS A 1 44  ? -38.878 62.051 -3.539  1.00 84.25  ? 148 LYS A CA    1 
ATOM   206  C C     . LYS A 1 44  ? -38.674 63.470 -3.017  1.00 90.87  ? 148 LYS A C     1 
ATOM   207  O O     . LYS A 1 44  ? -38.900 63.718 -1.843  1.00 111.41 ? 148 LYS A O     1 
ATOM   208  C CB    . LYS A 1 44  ? -37.693 61.178 -3.143  1.00 81.52  ? 148 LYS A CB    1 
ATOM   209  C CG    . LYS A 1 44  ? -37.826 60.530 -1.778  1.00 82.90  ? 148 LYS A CG    1 
ATOM   210  N N     . GLY A 1 45  ? -38.271 64.392 -3.894  1.00 92.63  ? 149 GLY A N     1 
ATOM   211  C CA    . GLY A 1 45  ? -37.975 65.786 -3.522  1.00 90.96  ? 149 GLY A CA    1 
ATOM   212  C C     . GLY A 1 45  ? -36.738 65.967 -2.644  1.00 96.71  ? 149 GLY A C     1 
ATOM   213  O O     . GLY A 1 45  ? -36.646 66.927 -1.882  1.00 106.06 ? 149 GLY A O     1 
ATOM   214  N N     . HIS A 1 46  ? -35.788 65.040 -2.754  1.00 91.08  ? 150 HIS A N     1 
ATOM   215  C CA    . HIS A 1 46  ? -34.562 65.056 -1.951  1.00 97.11  ? 150 HIS A CA    1 
ATOM   216  C C     . HIS A 1 46  ? -33.385 64.492 -2.696  1.00 94.96  ? 150 HIS A C     1 
ATOM   217  O O     . HIS A 1 46  ? -33.544 63.639 -3.577  1.00 98.09  ? 150 HIS A O     1 
ATOM   218  C CB    . HIS A 1 46  ? -34.739 64.299 -0.636  1.00 105.19 ? 150 HIS A CB    1 
ATOM   219  C CG    . HIS A 1 46  ? -35.742 64.925 0.299   1.00 113.53 ? 150 HIS A CG    1 
ATOM   220  N ND1   . HIS A 1 46  ? -35.421 65.929 1.137   1.00 105.12 ? 150 HIS A ND1   1 
ATOM   221  C CD2   . HIS A 1 46  ? -37.093 64.652 0.502   1.00 104.06 ? 150 HIS A CD2   1 
ATOM   222  C CE1   . HIS A 1 46  ? -36.512 66.283 1.838   1.00 112.72 ? 150 HIS A CE1   1 
ATOM   223  N NE2   . HIS A 1 46  ? -37.535 65.498 1.447   1.00 119.19 ? 150 HIS A NE2   1 
ATOM   224  N N     . HIS A 1 47  ? -32.189 64.956 -2.324  1.00 76.88  ? 151 HIS A N     1 
ATOM   225  C CA    . HIS A 1 47  ? -31.010 64.723 -3.096  1.00 66.60  ? 151 HIS A CA    1 
ATOM   226  C C     . HIS A 1 47  ? -30.433 63.382 -2.807  1.00 80.94  ? 151 HIS A C     1 
ATOM   227  O O     . HIS A 1 47  ? -30.359 62.950 -1.644  1.00 81.11  ? 151 HIS A O     1 
ATOM   228  C CB    . HIS A 1 47  ? -29.975 65.801 -2.824  1.00 73.17  ? 151 HIS A CB    1 
ATOM   229  C CG    . HIS A 1 47  ? -30.281 67.115 -3.479  1.00 66.05  ? 151 HIS A CG    1 
ATOM   230  N ND1   . HIS A 1 47  ? -29.802 67.448 -4.694  1.00 68.04  ? 151 HIS A ND1   1 
ATOM   231  C CD2   . HIS A 1 47  ? -31.038 68.191 -3.044  1.00 61.20  ? 151 HIS A CD2   1 
ATOM   232  C CE1   . HIS A 1 47  ? -30.238 68.675 -5.030  1.00 67.14  ? 151 HIS A CE1   1 
ATOM   233  N NE2   . HIS A 1 47  ? -30.996 69.131 -4.014  1.00 69.17  ? 151 HIS A NE2   1 
ATOM   234  N N     . TYR A 1 48  ? -29.983 62.732 -3.881  1.00 82.16  ? 152 TYR A N     1 
ATOM   235  C CA    . TYR A 1 48  ? -29.329 61.426 -3.841  1.00 77.04  ? 152 TYR A CA    1 
ATOM   236  C C     . TYR A 1 48  ? -30.084 60.454 -2.964  1.00 78.84  ? 152 TYR A C     1 
ATOM   237  O O     . TYR A 1 48  ? -29.537 60.016 -1.969  1.00 83.22  ? 152 TYR A O     1 
ATOM   238  C CB    . TYR A 1 48  ? -27.851 61.550 -3.423  1.00 73.12  ? 152 TYR A CB    1 
ATOM   239  C CG    . TYR A 1 48  ? -27.096 62.483 -4.327  1.00 76.12  ? 152 TYR A CG    1 
ATOM   240  C CD1   . TYR A 1 48  ? -26.799 62.123 -5.633  1.00 83.64  ? 152 TYR A CD1   1 
ATOM   241  C CD2   . TYR A 1 48  ? -26.722 63.740 -3.895  1.00 87.75  ? 152 TYR A CD2   1 
ATOM   242  C CE1   . TYR A 1 48  ? -26.140 62.988 -6.489  1.00 85.04  ? 152 TYR A CE1   1 
ATOM   243  C CE2   . TYR A 1 48  ? -26.049 64.610 -4.737  1.00 96.63  ? 152 TYR A CE2   1 
ATOM   244  C CZ    . TYR A 1 48  ? -25.770 64.224 -6.036  1.00 95.72  ? 152 TYR A CZ    1 
ATOM   245  O OH    . TYR A 1 48  ? -25.113 65.083 -6.880  1.00 108.05 ? 152 TYR A OH    1 
ATOM   246  N N     . PRO A 1 49  ? -31.343 60.123 -3.333  1.00 87.14  ? 153 PRO A N     1 
ATOM   247  C CA    . PRO A 1 49  ? -32.188 59.263 -2.514  1.00 88.30  ? 153 PRO A CA    1 
ATOM   248  C C     . PRO A 1 49  ? -31.731 57.829 -2.617  1.00 94.97  ? 153 PRO A C     1 
ATOM   249  O O     . PRO A 1 49  ? -30.764 57.445 -1.960  1.00 109.61 ? 153 PRO A O     1 
ATOM   250  C CB    . PRO A 1 49  ? -33.585 59.421 -3.139  1.00 87.72  ? 153 PRO A CB    1 
ATOM   251  C CG    . PRO A 1 49  ? -33.468 60.488 -4.170  1.00 91.65  ? 153 PRO A CG    1 
ATOM   252  C CD    . PRO A 1 49  ? -32.029 60.507 -4.576  1.00 95.22  ? 153 PRO A CD    1 
ATOM   253  N N     . GLY A 1 50  ? -32.427 57.045 -3.431  1.00 106.82 ? 154 GLY A N     1 
ATOM   254  C CA    . GLY A 1 50  ? -32.086 55.645 -3.645  1.00 119.55 ? 154 GLY A CA    1 
ATOM   255  C C     . GLY A 1 50  ? -32.668 54.588 -2.702  1.00 136.45 ? 154 GLY A C     1 
ATOM   256  O O     . GLY A 1 50  ? -33.839 54.668 -2.309  1.00 147.51 ? 154 GLY A O     1 
ATOM   257  N N     . PRO A 1 51  ? -31.876 53.525 -2.435  1.00 138.18 ? 155 PRO A N     1 
ATOM   258  C CA    . PRO A 1 51  ? -30.682 53.283 -3.263  1.00 136.73 ? 155 PRO A CA    1 
ATOM   259  C C     . PRO A 1 51  ? -31.109 52.912 -4.693  1.00 139.68 ? 155 PRO A C     1 
ATOM   260  O O     . PRO A 1 51  ? -32.296 52.601 -4.899  1.00 137.52 ? 155 PRO A O     1 
ATOM   261  C CB    . PRO A 1 51  ? -29.978 52.125 -2.543  1.00 123.69 ? 155 PRO A CB    1 
ATOM   262  C CG    . PRO A 1 51  ? -30.450 52.236 -1.126  1.00 120.25 ? 155 PRO A CG    1 
ATOM   263  C CD    . PRO A 1 51  ? -31.890 52.667 -1.237  1.00 127.82 ? 155 PRO A CD    1 
ATOM   264  N N     . GLY A 1 52  ? -30.200 52.934 -5.677  1.00 145.45 ? 156 GLY A N     1 
ATOM   265  C CA    . GLY A 1 52  ? -28.761 53.037 -5.485  1.00 141.16 ? 156 GLY A CA    1 
ATOM   266  C C     . GLY A 1 52  ? -28.122 54.400 -5.650  1.00 128.49 ? 156 GLY A C     1 
ATOM   267  O O     . GLY A 1 52  ? -28.034 54.971 -6.752  1.00 121.32 ? 156 GLY A O     1 
ATOM   268  N N     . ASN A 1 53  ? -27.680 54.904 -4.508  1.00 112.41 ? 157 ASN A N     1 
ATOM   269  C CA    . ASN A 1 53  ? -26.737 55.983 -4.428  1.00 105.66 ? 157 ASN A CA    1 
ATOM   270  C C     . ASN A 1 53  ? -25.901 55.685 -3.217  1.00 97.80  ? 157 ASN A C     1 
ATOM   271  O O     . ASN A 1 53  ? -26.418 55.420 -2.139  1.00 94.38  ? 157 ASN A O     1 
ATOM   272  C CB    . ASN A 1 53  ? -27.439 57.323 -4.323  1.00 105.56 ? 157 ASN A CB    1 
ATOM   273  C CG    . ASN A 1 53  ? -27.943 57.811 -5.669  1.00 123.03 ? 157 ASN A CG    1 
ATOM   274  O OD1   . ASN A 1 53  ? -27.164 58.300 -6.487  1.00 123.02 ? 157 ASN A OD1   1 
ATOM   275  N ND2   . ASN A 1 53  ? -29.248 57.670 -5.915  1.00 125.65 ? 157 ASN A ND2   1 
ATOM   276  N N     . HIS A 1 54  ? -24.598 55.667 -3.423  1.00 91.02  ? 158 HIS A N     1 
ATOM   277  C CA    . HIS A 1 54  ? -23.674 55.389 -2.356  1.00 90.86  ? 158 HIS A CA    1 
ATOM   278  C C     . HIS A 1 54  ? -23.397 56.646 -1.563  1.00 92.62  ? 158 HIS A C     1 
ATOM   279  O O     . HIS A 1 54  ? -22.659 56.612 -0.567  1.00 92.07  ? 158 HIS A O     1 
ATOM   280  C CB    . HIS A 1 54  ? -22.406 54.790 -2.949  1.00 99.36  ? 158 HIS A CB    1 
ATOM   281  C CG    . HIS A 1 54  ? -22.674 53.838 -4.099  1.00 117.03 ? 158 HIS A CG    1 
ATOM   282  N ND1   . HIS A 1 54  ? -23.257 52.633 -3.926  1.00 128.80 ? 158 HIS A ND1   1 
ATOM   283  C CD2   . HIS A 1 54  ? -22.440 53.966 -5.470  1.00 126.60 ? 158 HIS A CD2   1 
ATOM   284  C CE1   . HIS A 1 54  ? -23.392 52.023 -5.120  1.00 124.77 ? 158 HIS A CE1   1 
ATOM   285  N NE2   . HIS A 1 54  ? -22.884 52.837 -6.064  1.00 127.50 ? 158 HIS A NE2   1 
ATOM   286  N N     . PHE A 1 55  ? -24.013 57.759 -1.971  1.00 74.60  ? 159 PHE A N     1 
ATOM   287  C CA    . PHE A 1 55  ? -23.649 59.050 -1.408  1.00 82.09  ? 159 PHE A CA    1 
ATOM   288  C C     . PHE A 1 55  ? -23.752 59.097 0.111   1.00 89.98  ? 159 PHE A C     1 
ATOM   289  O O     . PHE A 1 55  ? -22.748 59.360 0.801   1.00 86.36  ? 159 PHE A O     1 
ATOM   290  C CB    . PHE A 1 55  ? -24.434 60.214 -2.027  1.00 80.79  ? 159 PHE A CB    1 
ATOM   291  C CG    . PHE A 1 55  ? -24.277 61.501 -1.272  1.00 76.87  ? 159 PHE A CG    1 
ATOM   292  C CD1   . PHE A 1 55  ? -23.013 62.085 -1.103  1.00 84.49  ? 159 PHE A CD1   1 
ATOM   293  C CD2   . PHE A 1 55  ? -25.378 62.119 -0.692  1.00 82.82  ? 159 PHE A CD2   1 
ATOM   294  C CE1   . PHE A 1 55  ? -22.858 63.269 -0.387  1.00 70.80  ? 159 PHE A CE1   1 
ATOM   295  C CE2   . PHE A 1 55  ? -25.233 63.313 0.013   1.00 78.16  ? 159 PHE A CE2   1 
ATOM   296  C CZ    . PHE A 1 55  ? -23.969 63.881 0.164   1.00 68.91  ? 159 PHE A CZ    1 
ATOM   297  N N     . TRP A 1 56  ? -24.955 58.828 0.624   1.00 91.60  ? 160 TRP A N     1 
ATOM   298  C CA    . TRP A 1 56  ? -25.230 58.958 2.059   1.00 89.51  ? 160 TRP A CA    1 
ATOM   299  C C     . TRP A 1 56  ? -24.440 57.971 2.884   1.00 99.15  ? 160 TRP A C     1 
ATOM   300  O O     . TRP A 1 56  ? -24.023 58.277 4.020   1.00 97.86  ? 160 TRP A O     1 
ATOM   301  C CB    . TRP A 1 56  ? -26.712 58.836 2.319   1.00 78.63  ? 160 TRP A CB    1 
ATOM   302  C CG    . TRP A 1 56  ? -27.506 59.940 1.670   1.00 76.60  ? 160 TRP A CG    1 
ATOM   303  C CD1   . TRP A 1 56  ? -28.305 59.864 0.544   1.00 73.57  ? 160 TRP A CD1   1 
ATOM   304  C CD2   . TRP A 1 56  ? -27.594 61.345 2.098   1.00 72.28  ? 160 TRP A CD2   1 
ATOM   305  N NE1   . TRP A 1 56  ? -28.880 61.094 0.262   1.00 67.81  ? 160 TRP A NE1   1 
ATOM   306  C CE2   . TRP A 1 56  ? -28.492 62.010 1.148   1.00 69.08  ? 160 TRP A CE2   1 
ATOM   307  C CE3   . TRP A 1 56  ? -27.049 62.082 3.142   1.00 65.36  ? 160 TRP A CE3   1 
ATOM   308  C CZ2   . TRP A 1 56  ? -28.792 63.350 1.249   1.00 75.45  ? 160 TRP A CZ2   1 
ATOM   309  C CZ3   . TRP A 1 56  ? -27.376 63.427 3.247   1.00 58.21  ? 160 TRP A CZ3   1 
ATOM   310  C CH2   . TRP A 1 56  ? -28.223 64.049 2.325   1.00 70.32  ? 160 TRP A CH2   1 
ATOM   311  N N     . LYS A 1 57  ? -24.207 56.785 2.318   1.00 97.22  ? 161 LYS A N     1 
ATOM   312  C CA    . LYS A 1 57  ? -23.367 55.798 2.988   1.00 106.74 ? 161 LYS A CA    1 
ATOM   313  C C     . LYS A 1 57  ? -21.954 56.349 3.077   1.00 105.03 ? 161 LYS A C     1 
ATOM   314  O O     . LYS A 1 57  ? -21.315 56.307 4.133   1.00 112.78 ? 161 LYS A O     1 
ATOM   315  C CB    . LYS A 1 57  ? -23.375 54.450 2.252   1.00 104.89 ? 161 LYS A CB    1 
ATOM   316  N N     . CYS A 1 58  ? -21.475 56.887 1.964   1.00 94.98  ? 162 CYS A N     1 
ATOM   317  C CA    . CYS A 1 58  ? -20.110 57.375 1.914   1.00 98.69  ? 162 CYS A CA    1 
ATOM   318  C C     . CYS A 1 58  ? -19.948 58.584 2.818   1.00 97.14  ? 162 CYS A C     1 
ATOM   319  O O     . CYS A 1 58  ? -18.959 58.674 3.552   1.00 79.74  ? 162 CYS A O     1 
ATOM   320  C CB    . CYS A 1 58  ? -19.705 57.696 0.477   1.00 98.09  ? 162 CYS A CB    1 
ATOM   321  S SG    . CYS A 1 58  ? -19.632 56.212 -0.557  1.00 98.63  ? 162 CYS A SG    1 
ATOM   322  N N     . LEU A 1 59  ? -20.936 59.489 2.772   1.00 85.67  ? 163 LEU A N     1 
ATOM   323  C CA    . LEU A 1 59  ? -20.936 60.708 3.576   1.00 74.79  ? 163 LEU A CA    1 
ATOM   324  C C     . LEU A 1 59  ? -20.699 60.336 5.031   1.00 87.48  ? 163 LEU A C     1 
ATOM   325  O O     . LEU A 1 59  ? -19.879 60.955 5.721   1.00 79.60  ? 163 LEU A O     1 
ATOM   326  C CB    . LEU A 1 59  ? -22.276 61.404 3.420   1.00 67.60  ? 163 LEU A CB    1 
ATOM   327  C CG    . LEU A 1 59  ? -22.405 62.921 3.308   1.00 72.72  ? 163 LEU A CG    1 
ATOM   328  C CD1   . LEU A 1 59  ? -22.844 63.516 4.624   1.00 74.99  ? 163 LEU A CD1   1 
ATOM   329  C CD2   . LEU A 1 59  ? -21.135 63.588 2.771   1.00 80.81  ? 163 LEU A CD2   1 
ATOM   330  N N     . PHE A 1 60  ? -21.415 59.307 5.485   1.00 98.55  ? 164 PHE A N     1 
ATOM   331  C CA    . PHE A 1 60  ? -21.204 58.749 6.806   1.00 94.03  ? 164 PHE A CA    1 
ATOM   332  C C     . PHE A 1 60  ? -19.847 58.053 6.886   1.00 88.37  ? 164 PHE A C     1 
ATOM   333  O O     . PHE A 1 60  ? -18.955 58.493 7.623   1.00 90.44  ? 164 PHE A O     1 
ATOM   334  C CB    . PHE A 1 60  ? -22.336 57.785 7.174   1.00 113.71 ? 164 PHE A CB    1 
ATOM   335  C CG    . PHE A 1 60  ? -22.043 56.945 8.390   1.00 123.40 ? 164 PHE A CG    1 
ATOM   336  C CD1   . PHE A 1 60  ? -21.780 57.548 9.623   1.00 121.10 ? 164 PHE A CD1   1 
ATOM   337  C CD2   . PHE A 1 60  ? -22.018 55.558 8.304   1.00 119.32 ? 164 PHE A CD2   1 
ATOM   338  C CE1   . PHE A 1 60  ? -21.504 56.789 10.741  1.00 117.96 ? 164 PHE A CE1   1 
ATOM   339  C CE2   . PHE A 1 60  ? -21.739 54.790 9.420   1.00 131.78 ? 164 PHE A CE2   1 
ATOM   340  C CZ    . PHE A 1 60  ? -21.483 55.407 10.640  1.00 136.43 ? 164 PHE A CZ    1 
ATOM   341  N N     . MET A 1 61  ? -19.689 56.979 6.116   1.00 79.56  ? 165 MET A N     1 
ATOM   342  C CA    . MET A 1 61  ? -18.473 56.160 6.182   1.00 91.27  ? 165 MET A CA    1 
ATOM   343  C C     . MET A 1 61  ? -17.161 56.988 6.168   1.00 91.82  ? 165 MET A C     1 
ATOM   344  O O     . MET A 1 61  ? -16.232 56.698 6.898   1.00 92.00  ? 165 MET A O     1 
ATOM   345  C CB    . MET A 1 61  ? -18.500 55.076 5.090   1.00 83.14  ? 165 MET A CB    1 
ATOM   346  N N     . SER A 1 62  ? -17.121 58.031 5.343   1.00 109.88 ? 166 SER A N     1 
ATOM   347  C CA    . SER A 1 62  ? -15.959 58.919 5.193   1.00 99.68  ? 166 SER A CA    1 
ATOM   348  C C     . SER A 1 62  ? -15.575 59.637 6.479   1.00 101.42 ? 166 SER A C     1 
ATOM   349  O O     . SER A 1 62  ? -14.405 59.934 6.700   1.00 102.37 ? 166 SER A O     1 
ATOM   350  C CB    . SER A 1 62  ? -16.261 59.991 4.137   1.00 95.44  ? 166 SER A CB    1 
ATOM   351  O OG    . SER A 1 62  ? -17.310 60.845 4.573   1.00 91.46  ? 166 SER A OG    1 
ATOM   352  N N     . GLY A 1 63  ? -16.566 59.952 7.304   1.00 100.44 ? 167 GLY A N     1 
ATOM   353  C CA    . GLY A 1 63  ? -16.338 60.796 8.464   1.00 94.74  ? 167 GLY A CA    1 
ATOM   354  C C     . GLY A 1 63  ? -16.817 62.216 8.252   1.00 92.14  ? 167 GLY A C     1 
ATOM   355  O O     . GLY A 1 63  ? -16.666 63.066 9.140   1.00 101.92 ? 167 GLY A O     1 
ATOM   356  N N     . LEU A 1 64  ? -17.402 62.481 7.088   1.00 87.00  ? 168 LEU A N     1 
ATOM   357  C CA    . LEU A 1 64  ? -17.948 63.819 6.807   1.00 91.15  ? 168 LEU A CA    1 
ATOM   358  C C     . LEU A 1 64  ? -19.230 64.093 7.559   1.00 95.29  ? 168 LEU A C     1 
ATOM   359  O O     . LEU A 1 64  ? -19.553 65.257 7.827   1.00 110.27 ? 168 LEU A O     1 
ATOM   360  C CB    . LEU A 1 64  ? -18.149 64.052 5.308   1.00 89.87  ? 168 LEU A CB    1 
ATOM   361  C CG    . LEU A 1 64  ? -16.852 64.110 4.501   1.00 87.93  ? 168 LEU A CG    1 
ATOM   362  C CD1   . LEU A 1 64  ? -17.111 63.792 3.036   1.00 100.20 ? 168 LEU A CD1   1 
ATOM   363  C CD2   . LEU A 1 64  ? -16.233 65.486 4.680   1.00 84.34  ? 168 LEU A CD2   1 
ATOM   364  N N     . SER A 1 65  ? -19.961 63.027 7.888   1.00 103.70 ? 169 SER A N     1 
ATOM   365  C CA    . SER A 1 65  ? -21.139 63.128 8.763   1.00 110.41 ? 169 SER A CA    1 
ATOM   366  C C     . SER A 1 65  ? -20.882 62.418 10.085  1.00 113.34 ? 169 SER A C     1 
ATOM   367  O O     . SER A 1 65  ? -20.139 61.431 10.128  1.00 115.11 ? 169 SER A O     1 
ATOM   368  C CB    . SER A 1 65  ? -22.396 62.576 8.093   1.00 97.51  ? 169 SER A CB    1 
ATOM   369  O OG    . SER A 1 65  ? -22.337 61.171 7.935   1.00 98.87  ? 169 SER A OG    1 
ATOM   370  N N     . GLU A 1 66  ? -21.490 62.931 11.156  1.00 112.02 ? 170 GLU A N     1 
ATOM   371  C CA    . GLU A 1 66  ? -21.336 62.337 12.483  1.00 110.35 ? 170 GLU A CA    1 
ATOM   372  C C     . GLU A 1 66  ? -21.902 60.910 12.492  1.00 115.99 ? 170 GLU A C     1 
ATOM   373  O O     . GLU A 1 66  ? -21.209 59.964 12.878  1.00 118.41 ? 170 GLU A O     1 
ATOM   374  C CB    . GLU A 1 66  ? -21.975 63.220 13.569  1.00 99.51  ? 170 GLU A CB    1 
ATOM   375  C CG    . GLU A 1 66  ? -23.477 63.388 13.447  1.00 103.38 ? 170 GLU A CG    1 
ATOM   376  C CD    . GLU A 1 66  ? -23.996 64.679 14.031  1.00 119.03 ? 170 GLU A CD    1 
ATOM   377  O OE1   . GLU A 1 66  ? -23.467 65.758 13.680  1.00 129.89 ? 170 GLU A OE1   1 
ATOM   378  O OE2   . GLU A 1 66  ? -24.962 64.611 14.818  1.00 130.13 ? 170 GLU A OE2   1 
ATOM   379  N N     . VAL A 1 67  ? -23.143 60.767 12.030  1.00 104.04 ? 171 VAL A N     1 
ATOM   380  C CA    . VAL A 1 67  ? -23.827 59.482 11.962  1.00 105.96 ? 171 VAL A CA    1 
ATOM   381  C C     . VAL A 1 67  ? -24.387 59.249 10.564  1.00 104.05 ? 171 VAL A C     1 
ATOM   382  O O     . VAL A 1 67  ? -24.199 60.072 9.679   1.00 127.25 ? 171 VAL A O     1 
ATOM   383  C CB    . VAL A 1 67  ? -24.966 59.388 13.000  1.00 115.83 ? 171 VAL A CB    1 
ATOM   384  C CG1   . VAL A 1 67  ? -24.389 59.298 14.408  1.00 113.23 ? 171 VAL A CG1   1 
ATOM   385  C CG2   . VAL A 1 67  ? -25.956 60.547 12.853  1.00 103.37 ? 171 VAL A CG2   1 
ATOM   386  N N     . GLN A 1 68  ? -25.056 58.117 10.365  1.00 107.91 ? 172 GLN A N     1 
ATOM   387  C CA    . GLN A 1 68  ? -25.705 57.799 9.092   1.00 103.59 ? 172 GLN A CA    1 
ATOM   388  C C     . GLN A 1 68  ? -26.872 58.732 8.844   1.00 99.08  ? 172 GLN A C     1 
ATOM   389  O O     . GLN A 1 68  ? -27.588 59.097 9.764   1.00 111.80 ? 172 GLN A O     1 
ATOM   390  C CB    . GLN A 1 68  ? -26.204 56.356 9.077   1.00 100.99 ? 172 GLN A CB    1 
ATOM   391  C CG    . GLN A 1 68  ? -26.754 55.887 7.742   1.00 98.29  ? 172 GLN A CG    1 
ATOM   392  C CD    . GLN A 1 68  ? -25.667 55.667 6.710   1.00 117.25 ? 172 GLN A CD    1 
ATOM   393  O OE1   . GLN A 1 68  ? -24.602 55.106 6.999   1.00 117.21 ? 172 GLN A OE1   1 
ATOM   394  N NE2   . GLN A 1 68  ? -25.936 56.104 5.487   1.00 120.31 ? 172 GLN A NE2   1 
ATOM   395  N N     . LEU A 1 69  ? -27.049 59.118 7.590   1.00 90.67  ? 173 LEU A N     1 
ATOM   396  C CA    . LEU A 1 69  ? -28.112 60.020 7.213   1.00 84.73  ? 173 LEU A CA    1 
ATOM   397  C C     . LEU A 1 69  ? -28.751 59.543 5.916   1.00 87.94  ? 173 LEU A C     1 
ATOM   398  O O     . LEU A 1 69  ? -28.434 58.451 5.415   1.00 92.82  ? 173 LEU A O     1 
ATOM   399  C CB    . LEU A 1 69  ? -27.566 61.426 7.027   1.00 84.17  ? 173 LEU A CB    1 
ATOM   400  C CG    . LEU A 1 69  ? -26.986 62.168 8.223   1.00 91.11  ? 173 LEU A CG    1 
ATOM   401  C CD1   . LEU A 1 69  ? -26.098 63.305 7.730   1.00 99.39  ? 173 LEU A CD1   1 
ATOM   402  C CD2   . LEU A 1 69  ? -28.091 62.701 9.117   1.00 82.08  ? 173 LEU A CD2   1 
ATOM   403  N N     . ASN A 1 70  ? -29.648 60.364 5.376   1.00 67.93  ? 174 ASN A N     1 
ATOM   404  C CA    . ASN A 1 70  ? -30.357 60.022 4.179   1.00 73.76  ? 174 ASN A CA    1 
ATOM   405  C C     . ASN A 1 70  ? -31.094 61.237 3.614   1.00 81.10  ? 174 ASN A C     1 
ATOM   406  O O     . ASN A 1 70  ? -31.217 62.284 4.258   1.00 76.01  ? 174 ASN A O     1 
ATOM   407  C CB    . ASN A 1 70  ? -31.328 58.845 4.429   1.00 83.72  ? 174 ASN A CB    1 
ATOM   408  C CG    . ASN A 1 70  ? -32.350 59.144 5.520   1.00 94.31  ? 174 ASN A CG    1 
ATOM   409  O OD1   . ASN A 1 70  ? -33.202 60.029 5.369   1.00 96.20  ? 174 ASN A OD1   1 
ATOM   410  N ND2   . ASN A 1 70  ? -32.265 58.415 6.632   1.00 102.22 ? 174 ASN A ND2   1 
ATOM   411  N N     . HIS A 1 71  ? -31.624 61.059 2.411   1.00 85.16  ? 175 HIS A N     1 
ATOM   412  C CA    . HIS A 1 71  ? -32.146 62.139 1.616   1.00 85.93  ? 175 HIS A CA    1 
ATOM   413  C C     . HIS A 1 71  ? -33.009 63.091 2.355   1.00 85.45  ? 175 HIS A C     1 
ATOM   414  O O     . HIS A 1 71  ? -33.154 64.248 1.948   1.00 86.26  ? 175 HIS A O     1 
ATOM   415  C CB    . HIS A 1 71  ? -32.844 61.600 0.373   1.00 102.14 ? 175 HIS A CB    1 
ATOM   416  C CG    . HIS A 1 71  ? -33.779 60.461 0.641   1.00 104.10 ? 175 HIS A CG    1 
ATOM   417  N ND1   . HIS A 1 71  ? -35.116 60.575 0.489   1.00 106.08 ? 175 HIS A ND1   1 
ATOM   418  C CD2   . HIS A 1 71  ? -33.535 59.152 1.056   1.00 101.51 ? 175 HIS A CD2   1 
ATOM   419  C CE1   . HIS A 1 71  ? -35.701 59.406 0.801   1.00 109.03 ? 175 HIS A CE1   1 
ATOM   420  N NE2   . HIS A 1 71  ? -34.732 58.535 1.153   1.00 122.08 ? 175 HIS A NE2   1 
ATOM   421  N N     . MET A 1 72  ? -33.575 62.630 3.464   1.00 95.83  ? 176 MET A N     1 
ATOM   422  C CA    . MET A 1 72  ? -34.480 63.470 4.267   1.00 99.22  ? 176 MET A CA    1 
ATOM   423  C C     . MET A 1 72  ? -33.708 64.575 4.982   1.00 91.34  ? 176 MET A C     1 
ATOM   424  O O     . MET A 1 72  ? -34.251 65.647 5.273   1.00 84.77  ? 176 MET A O     1 
ATOM   425  C CB    . MET A 1 72  ? -35.299 62.603 5.235   1.00 92.50  ? 176 MET A CB    1 
ATOM   426  C CG    . MET A 1 72  ? -36.464 61.891 4.552   1.00 97.48  ? 176 MET A CG    1 
ATOM   427  S SD    . MET A 1 72  ? -37.597 63.042 3.719   1.00 127.33 ? 176 MET A SD    1 
ATOM   428  C CE    . MET A 1 72  ? -38.421 61.951 2.559   1.00 126.17 ? 176 MET A CE    1 
ATOM   429  N N     . ASP A 1 73  ? -32.421 64.315 5.209   1.00 80.24  ? 177 ASP A N     1 
ATOM   430  C CA    . ASP A 1 73  ? -31.558 65.219 5.951   1.00 80.69  ? 177 ASP A CA    1 
ATOM   431  C C     . ASP A 1 73  ? -30.884 66.269 5.066   1.00 91.75  ? 177 ASP A C     1 
ATOM   432  O O     . ASP A 1 73  ? -30.080 67.095 5.542   1.00 83.13  ? 177 ASP A O     1 
ATOM   433  C CB    . ASP A 1 73  ? -30.507 64.394 6.660   1.00 76.46  ? 177 ASP A CB    1 
ATOM   434  C CG    . ASP A 1 73  ? -31.110 63.409 7.623   1.00 88.34  ? 177 ASP A CG    1 
ATOM   435  O OD1   . ASP A 1 73  ? -32.093 63.759 8.324   1.00 92.08  ? 177 ASP A OD1   1 
ATOM   436  O OD2   . ASP A 1 73  ? -30.599 62.273 7.678   1.00 83.58  ? 177 ASP A OD2   1 
ATOM   437  N N     . ASP A 1 74  ? -31.219 66.250 3.777   1.00 91.13  ? 178 ASP A N     1 
ATOM   438  C CA    . ASP A 1 74  ? -30.469 67.026 2.804   1.00 79.33  ? 178 ASP A CA    1 
ATOM   439  C C     . ASP A 1 74  ? -30.469 68.524 3.088   1.00 71.99  ? 178 ASP A C     1 
ATOM   440  O O     . ASP A 1 74  ? -29.459 69.185 2.901   1.00 78.71  ? 178 ASP A O     1 
ATOM   441  C CB    . ASP A 1 74  ? -30.876 66.673 1.362   1.00 78.30  ? 178 ASP A CB    1 
ATOM   442  C CG    . ASP A 1 74  ? -32.287 67.098 1.015   1.00 79.61  ? 178 ASP A CG    1 
ATOM   443  O OD1   . ASP A 1 74  ? -33.211 66.893 1.821   1.00 91.41  ? 178 ASP A OD1   1 
ATOM   444  O OD2   . ASP A 1 74  ? -32.479 67.625 -0.093  1.00 69.30  ? 178 ASP A OD2   1 
ATOM   445  N N     . HIS A 1 75  ? -31.569 69.053 3.590   1.00 76.57  ? 179 HIS A N     1 
ATOM   446  C CA    . HIS A 1 75  ? -31.645 70.505 3.859   1.00 83.71  ? 179 HIS A CA    1 
ATOM   447  C C     . HIS A 1 75  ? -31.010 70.932 5.146   1.00 72.83  ? 179 HIS A C     1 
ATOM   448  O O     . HIS A 1 75  ? -30.907 72.117 5.408   1.00 87.29  ? 179 HIS A O     1 
ATOM   449  C CB    . HIS A 1 75  ? -33.085 71.031 3.759   1.00 99.24  ? 179 HIS A CB    1 
ATOM   450  C CG    . HIS A 1 75  ? -34.047 70.415 4.769   1.00 121.22 ? 179 HIS A CG    1 
ATOM   451  N ND1   . HIS A 1 75  ? -34.030 69.099 5.096   1.00 121.33 ? 179 HIS A ND1   1 
ATOM   452  C CD2   . HIS A 1 75  ? -35.095 70.982 5.495   1.00 119.53 ? 179 HIS A CD2   1 
ATOM   453  C CE1   . HIS A 1 75  ? -34.993 68.850 6.001   1.00 109.40 ? 179 HIS A CE1   1 
ATOM   454  N NE2   . HIS A 1 75  ? -35.650 70.001 6.237   1.00 115.32 ? 179 HIS A NE2   1 
ATOM   455  N N     . THR A 1 76  ? -30.556 69.985 5.956   1.00 69.69  ? 180 THR A N     1 
ATOM   456  C CA    . THR A 1 76  ? -29.827 70.332 7.186   1.00 77.54  ? 180 THR A CA    1 
ATOM   457  C C     . THR A 1 76  ? -28.302 70.403 6.985   1.00 84.30  ? 180 THR A C     1 
ATOM   458  O O     . THR A 1 76  ? -27.565 70.891 7.847   1.00 88.54  ? 180 THR A O     1 
ATOM   459  C CB    . THR A 1 76  ? -30.128 69.343 8.341   1.00 76.37  ? 180 THR A CB    1 
ATOM   460  O OG1   . THR A 1 76  ? -29.488 68.080 8.088   1.00 79.54  ? 180 THR A OG1   1 
ATOM   461  C CG2   . THR A 1 76  ? -31.638 69.146 8.510   1.00 81.73  ? 180 THR A CG2   1 
ATOM   462  N N     . LEU A 1 77  ? -27.839 69.901 5.843   1.00 80.34  ? 181 LEU A N     1 
ATOM   463  C CA    . LEU A 1 77  ? -26.420 69.668 5.627   1.00 68.06  ? 181 LEU A CA    1 
ATOM   464  C C     . LEU A 1 77  ? -25.605 70.959 5.693   1.00 76.14  ? 181 LEU A C     1 
ATOM   465  O O     . LEU A 1 77  ? -24.563 70.983 6.371   1.00 76.66  ? 181 LEU A O     1 
ATOM   466  C CB    . LEU A 1 77  ? -26.204 68.909 4.315   1.00 63.46  ? 181 LEU A CB    1 
ATOM   467  C CG    . LEU A 1 77  ? -26.200 67.381 4.284   1.00 61.05  ? 181 LEU A CG    1 
ATOM   468  C CD1   . LEU A 1 77  ? -24.852 66.854 3.901   1.00 69.04  ? 181 LEU A CD1   1 
ATOM   469  C CD2   . LEU A 1 77  ? -26.592 66.744 5.604   1.00 76.27  ? 181 LEU A CD2   1 
ATOM   470  N N     . PRO A 1 78  ? -26.071 72.044 5.017   1.00 72.35  ? 182 PRO A N     1 
ATOM   471  C CA    . PRO A 1 78  ? -25.327 73.316 5.119   1.00 77.29  ? 182 PRO A CA    1 
ATOM   472  C C     . PRO A 1 78  ? -25.213 73.838 6.560   1.00 83.22  ? 182 PRO A C     1 
ATOM   473  O O     . PRO A 1 78  ? -24.140 74.300 6.955   1.00 76.52  ? 182 PRO A O     1 
ATOM   474  C CB    . PRO A 1 78  ? -26.143 74.300 4.255   1.00 65.30  ? 182 PRO A CB    1 
ATOM   475  C CG    . PRO A 1 78  ? -27.456 73.659 4.077   1.00 63.92  ? 182 PRO A CG    1 
ATOM   476  C CD    . PRO A 1 78  ? -27.239 72.171 4.135   1.00 62.95  ? 182 PRO A CD    1 
ATOM   477  N N     . GLY A 1 79  ? -26.306 73.751 7.327   1.00 86.66  ? 183 GLY A N     1 
ATOM   478  C CA    . GLY A 1 79  ? -26.322 74.218 8.716   1.00 83.91  ? 183 GLY A CA    1 
ATOM   479  C C     . GLY A 1 79  ? -25.389 73.443 9.628   1.00 87.01  ? 183 GLY A C     1 
ATOM   480  O O     . GLY A 1 79  ? -24.610 74.023 10.381  1.00 102.06 ? 183 GLY A O     1 
ATOM   481  N N     . LYS A 1 80  ? -25.466 72.125 9.554   1.00 83.84  ? 184 LYS A N     1 
ATOM   482  C CA    . LYS A 1 80  ? -24.757 71.267 10.475  1.00 86.95  ? 184 LYS A CA    1 
ATOM   483  C C     . LYS A 1 80  ? -23.371 70.949 9.988   1.00 86.68  ? 184 LYS A C     1 
ATOM   484  O O     . LYS A 1 80  ? -22.422 71.089 10.747  1.00 103.30 ? 184 LYS A O     1 
ATOM   485  C CB    . LYS A 1 80  ? -25.542 69.962 10.709  1.00 106.24 ? 184 LYS A CB    1 
ATOM   486  C CG    . LYS A 1 80  ? -26.178 69.813 12.090  1.00 110.65 ? 184 LYS A CG    1 
ATOM   487  C CD    . LYS A 1 80  ? -25.260 69.065 13.054  1.00 101.24 ? 184 LYS A CD    1 
ATOM   488  N N     . TYR A 1 81  ? -23.256 70.500 8.735   1.00 95.32  ? 185 TYR A N     1 
ATOM   489  C CA    . TYR A 1 81  ? -21.973 70.030 8.172   1.00 86.30  ? 185 TYR A CA    1 
ATOM   490  C C     . TYR A 1 81  ? -21.368 70.926 7.076   1.00 78.50  ? 185 TYR A C     1 
ATOM   491  O O     . TYR A 1 81  ? -20.387 70.560 6.446   1.00 87.16  ? 185 TYR A O     1 
ATOM   492  C CB    . TYR A 1 81  ? -22.102 68.602 7.648   1.00 79.78  ? 185 TYR A CB    1 
ATOM   493  C CG    . TYR A 1 81  ? -22.716 67.620 8.614   1.00 91.17  ? 185 TYR A CG    1 
ATOM   494  C CD1   . TYR A 1 81  ? -21.987 67.117 9.692   1.00 103.11 ? 185 TYR A CD1   1 
ATOM   495  C CD2   . TYR A 1 81  ? -24.020 67.169 8.435   1.00 92.37  ? 185 TYR A CD2   1 
ATOM   496  C CE1   . TYR A 1 81  ? -22.551 66.202 10.577  1.00 111.36 ? 185 TYR A CE1   1 
ATOM   497  C CE2   . TYR A 1 81  ? -24.589 66.252 9.304   1.00 99.80  ? 185 TYR A CE2   1 
ATOM   498  C CZ    . TYR A 1 81  ? -23.859 65.771 10.372  1.00 109.48 ? 185 TYR A CZ    1 
ATOM   499  O OH    . TYR A 1 81  ? -24.453 64.867 11.219  1.00 115.94 ? 185 TYR A OH    1 
ATOM   500  N N     . GLY A 1 82  ? -21.952 72.093 6.844   1.00 75.00  ? 186 GLY A N     1 
ATOM   501  C CA    . GLY A 1 82  ? -21.437 72.994 5.821   1.00 82.24  ? 186 GLY A CA    1 
ATOM   502  C C     . GLY A 1 82  ? -21.298 72.406 4.413   1.00 84.99  ? 186 GLY A C     1 
ATOM   503  O O     . GLY A 1 82  ? -20.348 72.751 3.691   1.00 78.30  ? 186 GLY A O     1 
ATOM   504  N N     . ILE A 1 83  ? -22.245 71.538 4.030   1.00 77.05  ? 187 ILE A N     1 
ATOM   505  C CA    . ILE A 1 83  ? -22.319 70.959 2.694   1.00 63.91  ? 187 ILE A CA    1 
ATOM   506  C C     . ILE A 1 83  ? -23.553 71.456 1.949   1.00 72.62  ? 187 ILE A C     1 
ATOM   507  O O     . ILE A 1 83  ? -24.623 71.607 2.554   1.00 71.50  ? 187 ILE A O     1 
ATOM   508  C CB    . ILE A 1 83  ? -22.398 69.450 2.796   1.00 59.11  ? 187 ILE A CB    1 
ATOM   509  C CG1   . ILE A 1 83  ? -21.034 68.868 3.243   1.00 62.49  ? 187 ILE A CG1   1 
ATOM   510  C CG2   . ILE A 1 83  ? -22.786 68.858 1.448   1.00 65.35  ? 187 ILE A CG2   1 
ATOM   511  C CD1   . ILE A 1 83  ? -21.100 67.365 3.523   1.00 49.20  ? 187 ILE A CD1   1 
ATOM   512  N N     . GLY A 1 84  ? -23.414 71.734 0.646   1.00 71.87  ? 188 GLY A N     1 
ATOM   513  C CA    . GLY A 1 84  ? -24.553 72.196 -0.194  1.00 61.75  ? 188 GLY A CA    1 
ATOM   514  C C     . GLY A 1 84  ? -24.908 71.136 -1.236  1.00 66.98  ? 188 GLY A C     1 
ATOM   515  O O     . GLY A 1 84  ? -24.297 70.064 -1.267  1.00 71.42  ? 188 GLY A O     1 
ATOM   516  N N     . PHE A 1 85  ? -25.886 71.431 -2.094  1.00 62.87  ? 189 PHE A N     1 
ATOM   517  C CA    . PHE A 1 85  ? -26.281 70.528 -3.189  1.00 58.06  ? 189 PHE A CA    1 
ATOM   518  C C     . PHE A 1 85  ? -26.727 71.358 -4.364  1.00 64.70  ? 189 PHE A C     1 
ATOM   519  O O     . PHE A 1 85  ? -27.286 72.439 -4.165  1.00 67.80  ? 189 PHE A O     1 
ATOM   520  C CB    . PHE A 1 85  ? -27.433 69.614 -2.785  1.00 60.86  ? 189 PHE A CB    1 
ATOM   521  C CG    . PHE A 1 85  ? -27.058 68.568 -1.768  1.00 63.54  ? 189 PHE A CG    1 
ATOM   522  C CD1   . PHE A 1 85  ? -26.348 67.446 -2.131  1.00 71.21  ? 189 PHE A CD1   1 
ATOM   523  C CD2   . PHE A 1 85  ? -27.423 68.710 -0.447  1.00 61.62  ? 189 PHE A CD2   1 
ATOM   524  C CE1   . PHE A 1 85  ? -25.989 66.499 -1.188  1.00 77.87  ? 189 PHE A CE1   1 
ATOM   525  C CE2   . PHE A 1 85  ? -27.078 67.770 0.495   1.00 65.14  ? 189 PHE A CE2   1 
ATOM   526  C CZ    . PHE A 1 85  ? -26.347 66.666 0.135   1.00 68.97  ? 189 PHE A CZ    1 
ATOM   527  N N     . THR A 1 86  ? -26.460 70.855 -5.574  1.00 67.48  ? 190 THR A N     1 
ATOM   528  C CA    . THR A 1 86  ? -27.023 71.389 -6.833  1.00 63.63  ? 190 THR A CA    1 
ATOM   529  C C     . THR A 1 86  ? -26.681 70.450 -7.986  1.00 69.25  ? 190 THR A C     1 
ATOM   530  O O     . THR A 1 86  ? -25.928 69.470 -7.774  1.00 82.08  ? 190 THR A O     1 
ATOM   531  C CB    . THR A 1 86  ? -26.528 72.791 -7.125  1.00 62.27  ? 190 THR A CB    1 
ATOM   532  O OG1   . THR A 1 86  ? -27.577 73.517 -7.748  1.00 67.25  ? 190 THR A OG1   1 
ATOM   533  C CG2   . THR A 1 86  ? -25.365 72.745 -8.054  1.00 75.39  ? 190 THR A CG2   1 
ATOM   534  N N     . ASN A 1 87  ? -27.231 70.699 -9.185  1.00 63.60  ? 191 ASN A N     1 
ATOM   535  C CA    . ASN A 1 87  ? -26.821 69.876 -10.353 1.00 65.97  ? 191 ASN A CA    1 
ATOM   536  C C     . ASN A 1 87  ? -26.584 70.732 -11.597 1.00 63.73  ? 191 ASN A C     1 
ATOM   537  O O     . ASN A 1 87  ? -27.104 71.834 -11.666 1.00 66.06  ? 191 ASN A O     1 
ATOM   538  C CB    . ASN A 1 87  ? -27.793 68.731 -10.640 1.00 69.62  ? 191 ASN A CB    1 
ATOM   539  C CG    . ASN A 1 87  ? -28.626 68.329 -9.428  1.00 74.70  ? 191 ASN A CG    1 
ATOM   540  O OD1   . ASN A 1 87  ? -28.349 67.317 -8.779  1.00 87.01  ? 191 ASN A OD1   1 
ATOM   541  N ND2   . ASN A 1 87  ? -29.650 69.121 -9.118  1.00 64.98  ? 191 ASN A ND2   1 
ATOM   542  N N     . MET A 1 88  ? -25.779 70.241 -12.549 1.00 66.11  ? 192 MET A N     1 
ATOM   543  C CA    . MET A 1 88  ? -25.467 70.984 -13.803 1.00 65.61  ? 192 MET A CA    1 
ATOM   544  C C     . MET A 1 88  ? -26.716 71.373 -14.500 1.00 64.17  ? 192 MET A C     1 
ATOM   545  O O     . MET A 1 88  ? -26.894 72.545 -14.808 1.00 78.12  ? 192 MET A O     1 
ATOM   546  C CB    . MET A 1 88  ? -24.682 70.153 -14.820 1.00 69.45  ? 192 MET A CB    1 
ATOM   547  C CG    . MET A 1 88  ? -23.181 70.187 -14.706 1.00 66.45  ? 192 MET A CG    1 
ATOM   548  S SD    . MET A 1 88  ? -22.450 71.476 -15.714 1.00 100.38 ? 192 MET A SD    1 
ATOM   549  C CE    . MET A 1 88  ? -22.064 70.647 -17.252 1.00 80.48  ? 192 MET A CE    1 
ATOM   550  N N     . VAL A 1 89  ? -27.577 70.385 -14.739 1.00 62.50  ? 193 VAL A N     1 
ATOM   551  C CA    . VAL A 1 89  ? -28.829 70.587 -15.472 1.00 76.34  ? 193 VAL A CA    1 
ATOM   552  C C     . VAL A 1 89  ? -30.025 70.390 -14.546 1.00 75.36  ? 193 VAL A C     1 
ATOM   553  O O     . VAL A 1 89  ? -30.071 69.423 -13.794 1.00 87.61  ? 193 VAL A O     1 
ATOM   554  C CB    . VAL A 1 89  ? -28.921 69.625 -16.680 1.00 72.40  ? 193 VAL A CB    1 
ATOM   555  C CG1   . VAL A 1 89  ? -30.029 70.062 -17.624 1.00 75.86  ? 193 VAL A CG1   1 
ATOM   556  C CG2   . VAL A 1 89  ? -27.579 69.537 -17.410 1.00 74.30  ? 193 VAL A CG2   1 
ATOM   557  N N     . GLU A 1 90  ? -30.991 71.295 -14.588 1.00 80.88  ? 194 GLU A N     1 
ATOM   558  C CA    . GLU A 1 90  ? -32.157 71.176 -13.690 1.00 95.09  ? 194 GLU A CA    1 
ATOM   559  C C     . GLU A 1 90  ? -33.208 70.186 -14.180 1.00 84.33  ? 194 GLU A C     1 
ATOM   560  O O     . GLU A 1 90  ? -33.786 69.467 -13.377 1.00 86.52  ? 194 GLU A O     1 
ATOM   561  C CB    . GLU A 1 90  ? -32.790 72.545 -13.374 1.00 102.48 ? 194 GLU A CB    1 
ATOM   562  C CG    . GLU A 1 90  ? -33.482 73.231 -14.548 1.00 112.11 ? 194 GLU A CG    1 
ATOM   563  C CD    . GLU A 1 90  ? -33.573 74.743 -14.371 1.00 128.58 ? 194 GLU A CD    1 
ATOM   564  O OE1   . GLU A 1 90  ? -32.499 75.392 -14.303 1.00 128.64 ? 194 GLU A OE1   1 
ATOM   565  O OE2   . GLU A 1 90  ? -34.711 75.283 -14.304 1.00 124.41 ? 194 GLU A OE2   1 
ATOM   566  N N     . ARG A 1 91  ? -33.443 70.142 -15.488 1.00 84.08  ? 195 ARG A N     1 
ATOM   567  C CA    . ARG A 1 91  ? -34.439 69.236 -16.066 1.00 80.81  ? 195 ARG A CA    1 
ATOM   568  C C     . ARG A 1 91  ? -34.223 67.814 -15.561 1.00 81.86  ? 195 ARG A C     1 
ATOM   569  O O     . ARG A 1 91  ? -33.091 67.337 -15.488 1.00 87.32  ? 195 ARG A O     1 
ATOM   570  C CB    . ARG A 1 91  ? -34.368 69.266 -17.599 1.00 87.97  ? 195 ARG A CB    1 
ATOM   571  C CG    . ARG A 1 91  ? -35.560 68.624 -18.294 1.00 89.04  ? 195 ARG A CG    1 
ATOM   572  C CD    . ARG A 1 91  ? -35.322 68.449 -19.784 1.00 86.24  ? 195 ARG A CD    1 
ATOM   573  N NE    . ARG A 1 91  ? -34.547 67.254 -20.115 1.00 95.39  ? 195 ARG A NE    1 
ATOM   574  C CZ    . ARG A 1 91  ? -34.223 66.886 -21.359 1.00 103.55 ? 195 ARG A CZ    1 
ATOM   575  N NH1   . ARG A 1 91  ? -34.605 67.613 -22.401 1.00 105.83 ? 195 ARG A NH1   1 
ATOM   576  N NH2   . ARG A 1 91  ? -33.506 65.789 -21.573 1.00 109.11 ? 195 ARG A NH2   1 
ATOM   577  N N     . THR A 1 92  ? -35.306 67.140 -15.199 1.00 80.80  ? 196 THR A N     1 
ATOM   578  C CA    . THR A 1 92  ? -35.195 65.772 -14.694 1.00 78.40  ? 196 THR A CA    1 
ATOM   579  C C     . THR A 1 92  ? -35.366 64.741 -15.809 1.00 78.68  ? 196 THR A C     1 
ATOM   580  O O     . THR A 1 92  ? -36.160 64.944 -16.731 1.00 84.88  ? 196 THR A O     1 
ATOM   581  C CB    . THR A 1 92  ? -36.228 65.498 -13.601 1.00 65.99  ? 196 THR A CB    1 
ATOM   582  O OG1   . THR A 1 92  ? -36.206 64.106 -13.276 1.00 67.55  ? 196 THR A OG1   1 
ATOM   583  C CG2   . THR A 1 92  ? -37.581 65.829 -14.114 1.00 70.28  ? 196 THR A CG2   1 
ATOM   584  N N     . THR A 1 93  ? -34.615 63.646 -15.719 1.00 72.10  ? 197 THR A N     1 
ATOM   585  C CA    . THR A 1 93  ? -34.735 62.517 -16.648 1.00 77.78  ? 197 THR A CA    1 
ATOM   586  C C     . THR A 1 93  ? -34.161 61.269 -15.961 1.00 85.14  ? 197 THR A C     1 
ATOM   587  O O     . THR A 1 93  ? -33.541 61.397 -14.904 1.00 85.13  ? 197 THR A O     1 
ATOM   588  C CB    . THR A 1 93  ? -33.939 62.718 -17.969 1.00 81.54  ? 197 THR A CB    1 
ATOM   589  O OG1   . THR A 1 93  ? -32.540 62.554 -17.712 1.00 80.95  ? 197 THR A OG1   1 
ATOM   590  C CG2   . THR A 1 93  ? -34.174 64.071 -18.606 1.00 79.53  ? 197 THR A CG2   1 
ATOM   591  N N     . PRO A 1 94  ? -34.358 60.069 -16.561 1.00 88.48  ? 198 PRO A N     1 
ATOM   592  C CA    . PRO A 1 94  ? -33.867 58.780 -16.100 1.00 95.57  ? 198 PRO A CA    1 
ATOM   593  C C     . PRO A 1 94  ? -32.513 58.766 -15.350 1.00 105.39 ? 198 PRO A C     1 
ATOM   594  O O     . PRO A 1 94  ? -32.541 58.629 -14.130 1.00 118.99 ? 198 PRO A O     1 
ATOM   595  C CB    . PRO A 1 94  ? -33.829 57.947 -17.390 1.00 105.11 ? 198 PRO A CB    1 
ATOM   596  C CG    . PRO A 1 94  ? -34.773 58.629 -18.335 1.00 101.95 ? 198 PRO A CG    1 
ATOM   597  C CD    . PRO A 1 94  ? -35.308 59.857 -17.660 1.00 97.89  ? 198 PRO A CD    1 
ATOM   598  N N     . GLY A 1 95  ? -31.353 58.913 -16.006 1.00 98.23  ? 199 GLY A N     1 
ATOM   599  C CA    . GLY A 1 95  ? -31.199 59.187 -17.438 1.00 99.22  ? 199 GLY A CA    1 
ATOM   600  C C     . GLY A 1 95  ? -30.239 60.332 -17.727 1.00 91.27  ? 199 GLY A C     1 
ATOM   601  O O     . GLY A 1 95  ? -30.620 61.483 -17.623 1.00 97.57  ? 199 GLY A O     1 
ATOM   602  N N     . SER A 1 96  ? -28.997 60.026 -18.100 1.00 83.79  ? 200 SER A N     1 
ATOM   603  C CA    . SER A 1 96  ? -28.052 61.075 -18.509 1.00 95.45  ? 200 SER A CA    1 
ATOM   604  C C     . SER A 1 96  ? -27.834 61.033 -20.005 1.00 98.46  ? 200 SER A C     1 
ATOM   605  O O     . SER A 1 96  ? -27.677 62.074 -20.646 1.00 101.35 ? 200 SER A O     1 
ATOM   606  C CB    . SER A 1 96  ? -26.711 60.962 -17.788 1.00 93.76  ? 200 SER A CB    1 
ATOM   607  O OG    . SER A 1 96  ? -26.141 59.683 -17.980 1.00 105.37 ? 200 SER A OG    1 
ATOM   608  N N     . LYS A 1 97  ? -27.850 59.826 -20.559 1.00 99.63  ? 201 LYS A N     1 
ATOM   609  C CA    . LYS A 1 97  ? -27.814 59.642 -22.002 1.00 102.85 ? 201 LYS A CA    1 
ATOM   610  C C     . LYS A 1 97  ? -29.027 60.306 -22.669 1.00 109.73 ? 201 LYS A C     1 
ATOM   611  O O     . LYS A 1 97  ? -29.145 60.317 -23.894 1.00 118.57 ? 201 LYS A O     1 
ATOM   612  C CB    . LYS A 1 97  ? -27.762 58.150 -22.336 1.00 103.33 ? 201 LYS A CB    1 
ATOM   613  N N     . ASP A 1 98  ? -29.914 60.871 -21.849 1.00 111.16 ? 202 ASP A N     1 
ATOM   614  C CA    . ASP A 1 98  ? -31.150 61.507 -22.317 1.00 101.98 ? 202 ASP A CA    1 
ATOM   615  C C     . ASP A 1 98  ? -31.034 63.018 -22.455 1.00 96.11  ? 202 ASP A C     1 
ATOM   616  O O     . ASP A 1 98  ? -32.032 63.699 -22.727 1.00 95.38  ? 202 ASP A O     1 
ATOM   617  C CB    . ASP A 1 98  ? -32.318 61.164 -21.381 1.00 97.54  ? 202 ASP A CB    1 
ATOM   618  C CG    . ASP A 1 98  ? -32.741 59.704 -21.472 1.00 104.41 ? 202 ASP A CG    1 
ATOM   619  O OD1   . ASP A 1 98  ? -31.919 58.811 -21.162 1.00 113.17 ? 202 ASP A OD1   1 
ATOM   620  O OD2   . ASP A 1 98  ? -33.904 59.452 -21.857 1.00 100.61 ? 202 ASP A OD2   1 
ATOM   621  N N     . LEU A 1 99  ? -29.821 63.544 -22.283 1.00 91.40  ? 203 LEU A N     1 
ATOM   622  C CA    . LEU A 1 99  ? -29.633 64.999 -22.193 1.00 91.39  ? 203 LEU A CA    1 
ATOM   623  C C     . LEU A 1 99  ? -28.936 65.604 -23.397 1.00 97.27  ? 203 LEU A C     1 
ATOM   624  O O     . LEU A 1 99  ? -27.942 65.060 -23.887 1.00 106.51 ? 203 LEU A O     1 
ATOM   625  C CB    . LEU A 1 99  ? -28.868 65.359 -20.911 1.00 96.91  ? 203 LEU A CB    1 
ATOM   626  C CG    . LEU A 1 99  ? -29.628 65.173 -19.595 1.00 93.37  ? 203 LEU A CG    1 
ATOM   627  C CD1   . LEU A 1 99  ? -28.645 65.043 -18.464 1.00 83.05  ? 203 LEU A CD1   1 
ATOM   628  C CD2   . LEU A 1 99  ? -30.617 66.298 -19.337 1.00 90.35  ? 203 LEU A CD2   1 
ATOM   629  N N     . SER A 1 100 ? -29.454 66.739 -23.860 1.00 103.67 ? 204 SER A N     1 
ATOM   630  C CA    . SER A 1 100 ? -28.884 67.438 -25.008 1.00 109.51 ? 204 SER A CA    1 
ATOM   631  C C     . SER A 1 100 ? -27.507 68.018 -24.690 1.00 121.26 ? 204 SER A C     1 
ATOM   632  O O     . SER A 1 100 ? -27.274 68.527 -23.583 1.00 126.80 ? 204 SER A O     1 
ATOM   633  C CB    . SER A 1 100 ? -29.814 68.559 -25.474 1.00 103.21 ? 204 SER A CB    1 
ATOM   634  O OG    . SER A 1 100 ? -29.148 69.401 -26.405 1.00 109.20 ? 204 SER A OG    1 
ATOM   635  N N     . SER A 1 101 ? -26.607 67.939 -25.671 1.00 122.15 ? 205 SER A N     1 
ATOM   636  C CA    . SER A 1 101 ? -25.280 68.554 -25.583 1.00 125.54 ? 205 SER A CA    1 
ATOM   637  C C     . SER A 1 101 ? -25.402 70.030 -25.214 1.00 123.60 ? 205 SER A C     1 
ATOM   638  O O     . SER A 1 101 ? -24.627 70.546 -24.403 1.00 127.34 ? 205 SER A O     1 
ATOM   639  C CB    . SER A 1 101 ? -24.526 68.423 -26.913 1.00 137.21 ? 205 SER A CB    1 
ATOM   640  O OG    . SER A 1 101 ? -24.554 67.093 -27.413 1.00 162.00 ? 205 SER A OG    1 
ATOM   641  N N     . LYS A 1 102 ? -26.389 70.695 -25.814 1.00 120.22 ? 206 LYS A N     1 
ATOM   642  C CA    . LYS A 1 102 ? -26.629 72.119 -25.596 1.00 122.15 ? 206 LYS A CA    1 
ATOM   643  C C     . LYS A 1 102 ? -27.130 72.410 -24.189 1.00 115.76 ? 206 LYS A C     1 
ATOM   644  O O     . LYS A 1 102 ? -26.890 73.494 -23.654 1.00 125.09 ? 206 LYS A O     1 
ATOM   645  C CB    . LYS A 1 102 ? -27.623 72.668 -26.625 1.00 124.66 ? 206 LYS A CB    1 
ATOM   646  N N     . GLU A 1 103 ? -27.825 71.445 -23.598 1.00 101.08 ? 207 GLU A N     1 
ATOM   647  C CA    . GLU A 1 103 ? -28.371 71.615 -22.257 1.00 98.02  ? 207 GLU A CA    1 
ATOM   648  C C     . GLU A 1 103 ? -27.261 71.718 -21.226 1.00 94.82  ? 207 GLU A C     1 
ATOM   649  O O     . GLU A 1 103 ? -27.291 72.599 -20.369 1.00 94.97  ? 207 GLU A O     1 
ATOM   650  C CB    . GLU A 1 103 ? -29.309 70.463 -21.903 1.00 103.89 ? 207 GLU A CB    1 
ATOM   651  C CG    . GLU A 1 103 ? -30.741 70.660 -22.370 1.00 96.57  ? 207 GLU A CG    1 
ATOM   652  C CD    . GLU A 1 103 ? -31.650 69.551 -21.903 1.00 93.31  ? 207 GLU A CD    1 
ATOM   653  O OE1   . GLU A 1 103 ? -31.345 68.363 -22.153 1.00 92.20  ? 207 GLU A OE1   1 
ATOM   654  O OE2   . GLU A 1 103 ? -32.682 69.878 -21.292 1.00 99.39  ? 207 GLU A OE2   1 
ATOM   655  N N     . PHE A 1 104 ? -26.290 70.812 -21.324 1.00 94.49  ? 208 PHE A N     1 
ATOM   656  C CA    . PHE A 1 104 ? -25.081 70.863 -20.517 1.00 94.98  ? 208 PHE A CA    1 
ATOM   657  C C     . PHE A 1 104 ? -24.398 72.241 -20.564 1.00 95.27  ? 208 PHE A C     1 
ATOM   658  O O     . PHE A 1 104 ? -24.158 72.850 -19.517 1.00 98.84  ? 208 PHE A O     1 
ATOM   659  C CB    . PHE A 1 104 ? -24.102 69.806 -20.993 1.00 89.56  ? 208 PHE A CB    1 
ATOM   660  C CG    . PHE A 1 104 ? -24.441 68.409 -20.562 1.00 92.73  ? 208 PHE A CG    1 
ATOM   661  C CD1   . PHE A 1 104 ? -24.332 68.037 -19.236 1.00 86.81  ? 208 PHE A CD1   1 
ATOM   662  C CD2   . PHE A 1 104 ? -24.798 67.437 -21.504 1.00 104.20 ? 208 PHE A CD2   1 
ATOM   663  C CE1   . PHE A 1 104 ? -24.585 66.719 -18.844 1.00 91.42  ? 208 PHE A CE1   1 
ATOM   664  C CE2   . PHE A 1 104 ? -25.060 66.132 -21.125 1.00 104.78 ? 208 PHE A CE2   1 
ATOM   665  C CZ    . PHE A 1 104 ? -24.958 65.769 -19.789 1.00 94.56  ? 208 PHE A CZ    1 
ATOM   666  N N     . ARG A 1 105 ? -24.097 72.726 -21.770 1.00 92.04  ? 209 ARG A N     1 
ATOM   667  C CA    . ARG A 1 105 ? -23.481 74.041 -21.938 1.00 90.09  ? 209 ARG A CA    1 
ATOM   668  C C     . ARG A 1 105 ? -24.269 75.124 -21.189 1.00 93.38  ? 209 ARG A C     1 
ATOM   669  O O     . ARG A 1 105 ? -23.683 75.923 -20.441 1.00 88.05  ? 209 ARG A O     1 
ATOM   670  C CB    . ARG A 1 105 ? -23.359 74.398 -23.419 1.00 102.95 ? 209 ARG A CB    1 
ATOM   671  N N     . GLU A 1 106 ? -25.594 75.138 -21.355 1.00 85.04  ? 210 GLU A N     1 
ATOM   672  C CA    . GLU A 1 106 ? -26.415 76.129 -20.645 1.00 86.65  ? 210 GLU A CA    1 
ATOM   673  C C     . GLU A 1 106 ? -26.370 75.906 -19.126 1.00 87.44  ? 210 GLU A C     1 
ATOM   674  O O     . GLU A 1 106 ? -26.528 76.849 -18.347 1.00 83.59  ? 210 GLU A O     1 
ATOM   675  C CB    . GLU A 1 106 ? -27.851 76.143 -21.157 1.00 75.35  ? 210 GLU A CB    1 
ATOM   676  N N     . GLY A 1 107 ? -26.109 74.664 -18.722 1.00 80.74  ? 211 GLY A N     1 
ATOM   677  C CA    . GLY A 1 107 ? -26.052 74.308 -17.310 1.00 80.61  ? 211 GLY A CA    1 
ATOM   678  C C     . GLY A 1 107 ? -24.830 74.881 -16.637 1.00 84.97  ? 211 GLY A C     1 
ATOM   679  O O     . GLY A 1 107 ? -24.933 75.641 -15.663 1.00 80.18  ? 211 GLY A O     1 
ATOM   680  N N     . GLY A 1 108 ? -23.669 74.516 -17.170 1.00 87.48  ? 212 GLY A N     1 
ATOM   681  C CA    . GLY A 1 108 ? -22.384 74.973 -16.651 1.00 79.51  ? 212 GLY A CA    1 
ATOM   682  C C     . GLY A 1 108 ? -22.352 76.480 -16.552 1.00 86.35  ? 212 GLY A C     1 
ATOM   683  O O     . GLY A 1 108 ? -21.871 77.039 -15.565 1.00 79.43  ? 212 GLY A O     1 
ATOM   684  N N     . ARG A 1 109 ? -22.890 77.137 -17.579 1.00 93.78  ? 213 ARG A N     1 
ATOM   685  C CA    . ARG A 1 109 ? -23.015 78.582 -17.584 1.00 93.98  ? 213 ARG A CA    1 
ATOM   686  C C     . ARG A 1 109 ? -23.782 78.998 -16.340 1.00 91.33  ? 213 ARG A C     1 
ATOM   687  O O     . ARG A 1 109 ? -23.296 79.809 -15.547 1.00 90.41  ? 213 ARG A O     1 
ATOM   688  C CB    . ARG A 1 109 ? -23.750 79.026 -18.845 1.00 100.69 ? 213 ARG A CB    1 
ATOM   689  C CG    . ARG A 1 109 ? -23.090 80.174 -19.584 1.00 118.34 ? 213 ARG A CG    1 
ATOM   690  C CD    . ARG A 1 109 ? -23.168 81.480 -18.796 1.00 140.04 ? 213 ARG A CD    1 
ATOM   691  N NE    . ARG A 1 109 ? -24.546 81.941 -18.624 1.00 147.03 ? 213 ARG A NE    1 
ATOM   692  C CZ    . ARG A 1 109 ? -24.892 83.111 -18.091 1.00 139.34 ? 213 ARG A CZ    1 
ATOM   693  N NH1   . ARG A 1 109 ? -23.953 83.957 -17.670 1.00 121.78 ? 213 ARG A NH1   1 
ATOM   694  N NH2   . ARG A 1 109 ? -26.181 83.433 -17.986 1.00 124.75 ? 213 ARG A NH2   1 
ATOM   695  N N     . ILE A 1 110 ? -24.968 78.408 -16.163 1.00 86.77  ? 214 ILE A N     1 
ATOM   696  C CA    . ILE A 1 110 ? -25.826 78.705 -15.022 1.00 77.27  ? 214 ILE A CA    1 
ATOM   697  C C     . ILE A 1 110 ? -25.101 78.363 -13.734 1.00 77.54  ? 214 ILE A C     1 
ATOM   698  O O     . ILE A 1 110 ? -25.119 79.152 -12.785 1.00 83.98  ? 214 ILE A O     1 
ATOM   699  C CB    . ILE A 1 110 ? -27.142 77.919 -15.094 1.00 78.06  ? 214 ILE A CB    1 
ATOM   700  C CG1   . ILE A 1 110 ? -28.043 78.501 -16.175 1.00 70.41  ? 214 ILE A CG1   1 
ATOM   701  C CG2   . ILE A 1 110 ? -27.870 77.911 -13.747 1.00 85.93  ? 214 ILE A CG2   1 
ATOM   702  C CD1   . ILE A 1 110 ? -29.196 77.587 -16.514 1.00 80.04  ? 214 ILE A CD1   1 
ATOM   703  N N     . LEU A 1 111 ? -24.457 77.198 -13.709 1.00 69.21  ? 215 LEU A N     1 
ATOM   704  C CA    . LEU A 1 111 ? -23.740 76.735 -12.520 1.00 63.58  ? 215 LEU A CA    1 
ATOM   705  C C     . LEU A 1 111 ? -22.651 77.741 -12.132 1.00 71.15  ? 215 LEU A C     1 
ATOM   706  O O     . LEU A 1 111 ? -22.790 78.435 -11.127 1.00 84.19  ? 215 LEU A O     1 
ATOM   707  C CB    . LEU A 1 111 ? -23.179 75.337 -12.743 1.00 55.03  ? 215 LEU A CB    1 
ATOM   708  C CG    . LEU A 1 111 ? -22.380 74.644 -11.636 1.00 59.65  ? 215 LEU A CG    1 
ATOM   709  C CD1   . LEU A 1 111 ? -23.111 74.646 -10.297 1.00 61.63  ? 215 LEU A CD1   1 
ATOM   710  C CD2   . LEU A 1 111 ? -22.088 73.200 -12.058 1.00 52.76  ? 215 LEU A CD2   1 
ATOM   711  N N     . VAL A 1 112 ? -21.603 77.857 -12.941 1.00 67.99  ? 216 VAL A N     1 
ATOM   712  C CA    . VAL A 1 112 ? -20.539 78.819 -12.692 1.00 66.07  ? 216 VAL A CA    1 
ATOM   713  C C     . VAL A 1 112 ? -21.110 80.015 -11.936 1.00 70.86  ? 216 VAL A C     1 
ATOM   714  O O     . VAL A 1 112 ? -20.629 80.377 -10.858 1.00 69.56  ? 216 VAL A O     1 
ATOM   715  C CB    . VAL A 1 112 ? -19.883 79.313 -14.000 1.00 62.52  ? 216 VAL A CB    1 
ATOM   716  C CG1   . VAL A 1 112 ? -18.795 80.306 -13.689 1.00 61.79  ? 216 VAL A CG1   1 
ATOM   717  C CG2   . VAL A 1 112 ? -19.283 78.158 -14.768 1.00 73.64  ? 216 VAL A CG2   1 
ATOM   718  N N     . GLN A 1 113 ? -22.162 80.601 -12.494 1.00 71.28  ? 217 GLN A N     1 
ATOM   719  C CA    . GLN A 1 113 ? -22.830 81.730 -11.850 1.00 78.16  ? 217 GLN A CA    1 
ATOM   720  C C     . GLN A 1 113 ? -23.108 81.440 -10.395 1.00 76.17  ? 217 GLN A C     1 
ATOM   721  O O     . GLN A 1 113 ? -22.510 82.066 -9.512  1.00 83.73  ? 217 GLN A O     1 
ATOM   722  C CB    . GLN A 1 113 ? -24.129 82.079 -12.547 1.00 71.20  ? 217 GLN A CB    1 
ATOM   723  C CG    . GLN A 1 113 ? -23.909 82.757 -13.869 1.00 68.26  ? 217 GLN A CG    1 
ATOM   724  C CD    . GLN A 1 113 ? -24.982 83.771 -14.149 1.00 83.42  ? 217 GLN A CD    1 
ATOM   725  O OE1   . GLN A 1 113 ? -26.179 83.550 -13.844 1.00 73.51  ? 217 GLN A OE1   1 
ATOM   726  N NE2   . GLN A 1 113 ? -24.573 84.908 -14.742 1.00 89.05  ? 217 GLN A NE2   1 
ATOM   727  N N     . LYS A 1 114 ? -23.985 80.472 -10.148 1.00 65.30  ? 218 LYS A N     1 
ATOM   728  C CA    . LYS A 1 114 ? -24.255 80.049 -8.781  1.00 70.63  ? 218 LYS A CA    1 
ATOM   729  C C     . LYS A 1 114 ? -23.006 80.070 -7.905  1.00 72.28  ? 218 LYS A C     1 
ATOM   730  O O     . LYS A 1 114 ? -23.023 80.698 -6.828  1.00 72.99  ? 218 LYS A O     1 
ATOM   731  C CB    . LYS A 1 114 ? -24.913 78.682 -8.747  1.00 61.87  ? 218 LYS A CB    1 
ATOM   732  C CG    . LYS A 1 114 ? -26.368 78.720 -9.199  1.00 68.15  ? 218 LYS A CG    1 
ATOM   733  C CD    . LYS A 1 114 ? -27.022 77.364 -8.996  1.00 70.07  ? 218 LYS A CD    1 
ATOM   734  C CE    . LYS A 1 114 ? -28.318 77.273 -9.747  1.00 66.31  ? 218 LYS A CE    1 
ATOM   735  N NZ    . LYS A 1 114 ? -28.526 75.830 -10.057 1.00 78.72  ? 218 LYS A NZ    1 
ATOM   736  N N     . LEU A 1 115 ? -21.926 79.448 -8.377  1.00 62.90  ? 219 LEU A N     1 
ATOM   737  C CA    . LEU A 1 115 ? -20.706 79.353 -7.559  1.00 71.44  ? 219 LEU A CA    1 
ATOM   738  C C     . LEU A 1 115 ? -20.061 80.705 -7.335  1.00 72.99  ? 219 LEU A C     1 
ATOM   739  O O     . LEU A 1 115 ? -19.637 81.017 -6.236  1.00 82.45  ? 219 LEU A O     1 
ATOM   740  C CB    . LEU A 1 115 ? -19.707 78.337 -8.117  1.00 64.34  ? 219 LEU A CB    1 
ATOM   741  C CG    . LEU A 1 115 ? -20.368 76.985 -8.439  1.00 68.36  ? 219 LEU A CG    1 
ATOM   742  C CD1   . LEU A 1 115 ? -19.367 75.840 -8.530  1.00 57.22  ? 219 LEU A CD1   1 
ATOM   743  C CD2   . LEU A 1 115 ? -21.443 76.645 -7.412  1.00 71.97  ? 219 LEU A CD2   1 
ATOM   744  N N     . GLN A 1 116 ? -20.030 81.523 -8.377  1.00 73.87  ? 220 GLN A N     1 
ATOM   745  C CA    . GLN A 1 116 ? -19.566 82.888 -8.256  1.00 71.35  ? 220 GLN A CA    1 
ATOM   746  C C     . GLN A 1 116 ? -20.377 83.665 -7.245  1.00 72.81  ? 220 GLN A C     1 
ATOM   747  O O     . GLN A 1 116 ? -19.910 84.653 -6.709  1.00 90.05  ? 220 GLN A O     1 
ATOM   748  C CB    . GLN A 1 116 ? -19.654 83.577 -9.599  1.00 78.64  ? 220 GLN A CB    1 
ATOM   749  C CG    . GLN A 1 116 ? -18.852 82.905 -10.709 1.00 77.57  ? 220 GLN A CG    1 
ATOM   750  C CD    . GLN A 1 116 ? -18.885 83.723 -11.988 1.00 80.38  ? 220 GLN A CD    1 
ATOM   751  O OE1   . GLN A 1 116 ? -19.766 84.576 -12.179 1.00 89.76  ? 220 GLN A OE1   1 
ATOM   752  N NE2   . GLN A 1 116 ? -17.919 83.490 -12.861 1.00 80.36  ? 220 GLN A NE2   1 
ATOM   753  N N     . LYS A 1 117 ? -21.593 83.213 -6.978  1.00 86.03  ? 221 LYS A N     1 
ATOM   754  C CA    . LYS A 1 117 ? -22.497 83.886 -6.032  1.00 81.32  ? 221 LYS A CA    1 
ATOM   755  C C     . LYS A 1 117 ? -22.266 83.372 -4.599  1.00 83.52  ? 221 LYS A C     1 
ATOM   756  O O     . LYS A 1 117 ? -22.097 84.168 -3.691  1.00 88.37  ? 221 LYS A O     1 
ATOM   757  C CB    . LYS A 1 117 ? -23.964 83.689 -6.461  1.00 67.93  ? 221 LYS A CB    1 
ATOM   758  C CG    . LYS A 1 117 ? -24.969 84.241 -5.478  1.00 71.52  ? 221 LYS A CG    1 
ATOM   759  C CD    . LYS A 1 117 ? -26.406 83.851 -5.825  1.00 80.74  ? 221 LYS A CD    1 
ATOM   760  C CE    . LYS A 1 117 ? -26.949 84.554 -7.072  1.00 92.08  ? 221 LYS A CE    1 
ATOM   761  N NZ    . LYS A 1 117 ? -27.959 83.745 -7.838  1.00 98.49  ? 221 LYS A NZ    1 
ATOM   762  N N     . TYR A 1 118 ? -22.254 82.052 -4.413  1.00 78.89  ? 222 TYR A N     1 
ATOM   763  C CA    . TYR A 1 118 ? -22.178 81.436 -3.082  1.00 82.34  ? 222 TYR A CA    1 
ATOM   764  C C     . TYR A 1 118 ? -20.744 81.196 -2.592  1.00 87.90  ? 222 TYR A C     1 
ATOM   765  O O     . TYR A 1 118 ? -20.503 80.930 -1.397  1.00 86.19  ? 222 TYR A O     1 
ATOM   766  C CB    . TYR A 1 118 ? -22.959 80.116 -3.079  1.00 77.41  ? 222 TYR A CB    1 
ATOM   767  C CG    . TYR A 1 118 ? -24.438 80.361 -3.135  1.00 82.96  ? 222 TYR A CG    1 
ATOM   768  C CD1   . TYR A 1 118 ? -25.156 80.712 -1.980  1.00 79.86  ? 222 TYR A CD1   1 
ATOM   769  C CD2   . TYR A 1 118 ? -25.126 80.292 -4.350  1.00 83.30  ? 222 TYR A CD2   1 
ATOM   770  C CE1   . TYR A 1 118 ? -26.512 80.964 -2.036  1.00 78.72  ? 222 TYR A CE1   1 
ATOM   771  C CE2   . TYR A 1 118 ? -26.483 80.540 -4.409  1.00 79.79  ? 222 TYR A CE2   1 
ATOM   772  C CZ    . TYR A 1 118 ? -27.166 80.883 -3.259  1.00 77.46  ? 222 TYR A CZ    1 
ATOM   773  O OH    . TYR A 1 118 ? -28.514 81.151 -3.344  1.00 82.51  ? 222 TYR A OH    1 
ATOM   774  N N     . GLN A 1 119 ? -19.810 81.279 -3.533  1.00 81.46  ? 223 GLN A N     1 
ATOM   775  C CA    . GLN A 1 119 ? -18.387 81.058 -3.287  1.00 78.13  ? 223 GLN A CA    1 
ATOM   776  C C     . GLN A 1 119 ? -18.142 79.970 -2.228  1.00 80.41  ? 223 GLN A C     1 
ATOM   777  O O     . GLN A 1 119 ? -17.670 80.258 -1.121  1.00 80.16  ? 223 GLN A O     1 
ATOM   778  C CB    . GLN A 1 119 ? -17.699 82.385 -2.955  1.00 86.59  ? 223 GLN A CB    1 
ATOM   779  C CG    . GLN A 1 119 ? -17.974 83.503 -3.962  1.00 98.47  ? 223 GLN A CG    1 
ATOM   780  C CD    . GLN A 1 119 ? -17.450 84.868 -3.526  1.00 107.87 ? 223 GLN A CD    1 
ATOM   781  O OE1   . GLN A 1 119 ? -17.723 85.334 -2.419  1.00 114.13 ? 223 GLN A OE1   1 
ATOM   782  N NE2   . GLN A 1 119 ? -16.705 85.523 -4.410  1.00 110.40 ? 223 GLN A NE2   1 
ATOM   783  N N     . PRO A 1 120 ? -18.497 78.706 -2.555  1.00 77.96  ? 224 PRO A N     1 
ATOM   784  C CA    . PRO A 1 120 ? -18.147 77.621 -1.649  1.00 71.38  ? 224 PRO A CA    1 
ATOM   785  C C     . PRO A 1 120 ? -16.664 77.397 -1.737  1.00 71.06  ? 224 PRO A C     1 
ATOM   786  O O     . PRO A 1 120 ? -16.061 77.786 -2.733  1.00 71.83  ? 224 PRO A O     1 
ATOM   787  C CB    . PRO A 1 120 ? -18.856 76.416 -2.242  1.00 71.93  ? 224 PRO A CB    1 
ATOM   788  C CG    . PRO A 1 120 ? -19.022 76.713 -3.681  1.00 69.20  ? 224 PRO A CG    1 
ATOM   789  C CD    . PRO A 1 120 ? -19.100 78.209 -3.808  1.00 78.93  ? 224 PRO A CD    1 
ATOM   790  N N     . ARG A 1 121 ? -16.072 76.774 -0.724  1.00 69.61  ? 225 ARG A N     1 
ATOM   791  C CA    . ARG A 1 121 ? -14.637 76.554 -0.765  1.00 64.71  ? 225 ARG A CA    1 
ATOM   792  C C     . ARG A 1 121 ? -14.294 75.593 -1.904  1.00 76.46  ? 225 ARG A C     1 
ATOM   793  O O     . ARG A 1 121 ? -13.430 75.919 -2.720  1.00 83.07  ? 225 ARG A O     1 
ATOM   794  C CB    . ARG A 1 121 ? -14.143 76.051 0.576   1.00 65.18  ? 225 ARG A CB    1 
ATOM   795  C CG    . ARG A 1 121 ? -14.198 77.117 1.654   1.00 76.86  ? 225 ARG A CG    1 
ATOM   796  C CD    . ARG A 1 121 ? -13.684 76.607 2.995   1.00 75.26  ? 225 ARG A CD    1 
ATOM   797  N NE    . ARG A 1 121 ? -13.436 77.695 3.948   1.00 82.95  ? 225 ARG A NE    1 
ATOM   798  C CZ    . ARG A 1 121 ? -14.245 78.049 4.951   1.00 84.15  ? 225 ARG A CZ    1 
ATOM   799  N NH1   . ARG A 1 121 ? -15.395 77.439 5.173   1.00 85.74  ? 225 ARG A NH1   1 
ATOM   800  N NH2   . ARG A 1 121 ? -13.895 79.036 5.744   1.00 93.45  ? 225 ARG A NH2   1 
ATOM   801  N N     . ILE A 1 122 ? -15.006 74.456 -1.980  1.00 67.27  ? 226 ILE A N     1 
ATOM   802  C CA    . ILE A 1 122 ? -14.768 73.411 -2.966  1.00 62.22  ? 226 ILE A CA    1 
ATOM   803  C C     . ILE A 1 122 ? -16.030 73.027 -3.768  1.00 68.10  ? 226 ILE A C     1 
ATOM   804  O O     . ILE A 1 122 ? -17.082 72.745 -3.203  1.00 74.94  ? 226 ILE A O     1 
ATOM   805  C CB    . ILE A 1 122 ? -14.317 72.103 -2.282  1.00 62.25  ? 226 ILE A CB    1 
ATOM   806  C CG1   . ILE A 1 122 ? -13.387 72.383 -1.099  1.00 54.60  ? 226 ILE A CG1   1 
ATOM   807  C CG2   . ILE A 1 122 ? -13.770 71.070 -3.300  1.00 49.97  ? 226 ILE A CG2   1 
ATOM   808  C CD1   . ILE A 1 122 ? -12.771 71.104 -0.498  1.00 50.36  ? 226 ILE A CD1   1 
ATOM   809  N N     . ALA A 1 123 ? -15.918 72.957 -5.087  1.00 63.07  ? 227 ALA A N     1 
ATOM   810  C CA    . ALA A 1 123 ? -16.993 72.393 -5.871  1.00 61.36  ? 227 ALA A CA    1 
ATOM   811  C C     . ALA A 1 123 ? -16.687 70.919 -6.181  1.00 64.89  ? 227 ALA A C     1 
ATOM   812  O O     . ALA A 1 123 ? -15.709 70.599 -6.867  1.00 69.79  ? 227 ALA A O     1 
ATOM   813  C CB    . ALA A 1 123 ? -17.175 73.188 -7.143  1.00 59.77  ? 227 ALA A CB    1 
ATOM   814  N N     . VAL A 1 124 ? -17.514 70.023 -5.657  1.00 60.42  ? 228 VAL A N     1 
ATOM   815  C CA    . VAL A 1 124 ? -17.326 68.600 -5.885  1.00 59.75  ? 228 VAL A CA    1 
ATOM   816  C C     . VAL A 1 124 ? -18.160 68.132 -7.051  1.00 66.72  ? 228 VAL A C     1 
ATOM   817  O O     . VAL A 1 124 ? -19.363 68.400 -7.102  1.00 81.38  ? 228 VAL A O     1 
ATOM   818  C CB    . VAL A 1 124 ? -17.708 67.743 -4.664  1.00 55.90  ? 228 VAL A CB    1 
ATOM   819  C CG1   . VAL A 1 124 ? -17.866 66.298 -5.104  1.00 45.92  ? 228 VAL A CG1   1 
ATOM   820  C CG2   . VAL A 1 124 ? -16.631 67.850 -3.593  1.00 49.23  ? 228 VAL A CG2   1 
ATOM   821  N N     . PHE A 1 125 ? -17.540 67.413 -7.977  1.00 62.36  ? 229 PHE A N     1 
ATOM   822  C CA    . PHE A 1 125 ? -18.251 67.017 -9.162  1.00 63.86  ? 229 PHE A CA    1 
ATOM   823  C C     . PHE A 1 125 ? -18.528 65.561 -9.064  1.00 70.11  ? 229 PHE A C     1 
ATOM   824  O O     . PHE A 1 125 ? -17.604 64.748 -8.983  1.00 77.71  ? 229 PHE A O     1 
ATOM   825  C CB    . PHE A 1 125 ? -17.443 67.342 -10.413 1.00 63.34  ? 229 PHE A CB    1 
ATOM   826  C CG    . PHE A 1 125 ? -17.407 68.802 -10.745 1.00 61.55  ? 229 PHE A CG    1 
ATOM   827  C CD1   . PHE A 1 125 ? -16.471 69.633 -10.169 1.00 65.00  ? 229 PHE A CD1   1 
ATOM   828  C CD2   . PHE A 1 125 ? -18.317 69.343 -11.631 1.00 63.80  ? 229 PHE A CD2   1 
ATOM   829  C CE1   . PHE A 1 125 ? -16.455 70.992 -10.462 1.00 72.71  ? 229 PHE A CE1   1 
ATOM   830  C CE2   . PHE A 1 125 ? -18.288 70.698 -11.962 1.00 70.59  ? 229 PHE A CE2   1 
ATOM   831  C CZ    . PHE A 1 125 ? -17.363 71.532 -11.369 1.00 65.38  ? 229 PHE A CZ    1 
ATOM   832  N N     . ASN A 1 126 ? -19.808 65.224 -9.046  1.00 69.68  ? 230 ASN A N     1 
ATOM   833  C CA    . ASN A 1 126 ? -20.175 63.842 -8.960  1.00 71.76  ? 230 ASN A CA    1 
ATOM   834  C C     . ASN A 1 126 ? -19.986 63.211 -10.331 1.00 82.09  ? 230 ASN A C     1 
ATOM   835  O O     . ASN A 1 126 ? -20.788 63.409 -11.240 1.00 79.30  ? 230 ASN A O     1 
ATOM   836  C CB    . ASN A 1 126 ? -21.597 63.706 -8.449  1.00 71.61  ? 230 ASN A CB    1 
ATOM   837  C CG    . ASN A 1 126 ? -21.762 62.541 -7.489  1.00 90.18  ? 230 ASN A CG    1 
ATOM   838  O OD1   . ASN A 1 126 ? -20.972 61.598 -7.497  1.00 90.55  ? 230 ASN A OD1   1 
ATOM   839  N ND2   . ASN A 1 126 ? -22.797 62.603 -6.650  1.00 91.62  ? 230 ASN A ND2   1 
ATOM   840  N N     . GLY A 1 127 ? -18.883 62.490 -10.493 1.00 90.69  ? 231 GLY A N     1 
ATOM   841  C CA    . GLY A 1 127 ? -18.647 61.757 -11.727 1.00 92.95  ? 231 GLY A CA    1 
ATOM   842  C C     . GLY A 1 127 ? -17.903 62.539 -12.786 1.00 99.24  ? 231 GLY A C     1 
ATOM   843  O O     . GLY A 1 127 ? -18.167 63.735 -13.006 1.00 79.89  ? 231 GLY A O     1 
ATOM   844  N N     . LYS A 1 128 ? -16.986 61.837 -13.459 1.00 93.74  ? 232 LYS A N     1 
ATOM   845  C CA    . LYS A 1 128 ? -16.107 62.463 -14.428 1.00 79.20  ? 232 LYS A CA    1 
ATOM   846  C C     . LYS A 1 128 ? -16.862 63.143 -15.568 1.00 93.22  ? 232 LYS A C     1 
ATOM   847  O O     . LYS A 1 128 ? -16.548 64.291 -15.901 1.00 100.78 ? 232 LYS A O     1 
ATOM   848  C CB    . LYS A 1 128 ? -15.047 61.495 -14.932 1.00 71.30  ? 232 LYS A CB    1 
ATOM   849  N N     . CYS A 1 129 ? -17.876 62.478 -16.132 1.00 90.57  ? 233 CYS A N     1 
ATOM   850  C CA    A CYS A 1 129 ? -18.587 63.019 -17.292 0.50 90.42  ? 233 CYS A CA    1 
ATOM   851  C CA    B CYS A 1 129 ? -18.577 63.032 -17.292 0.50 88.72  ? 233 CYS A CA    1 
ATOM   852  C C     . CYS A 1 129 ? -18.883 64.502 -17.089 1.00 87.84  ? 233 CYS A C     1 
ATOM   853  O O     . CYS A 1 129 ? -18.553 65.341 -17.933 1.00 110.27 ? 233 CYS A O     1 
ATOM   854  C CB    A CYS A 1 129 ? -19.883 62.237 -17.588 0.50 94.64  ? 233 CYS A CB    1 
ATOM   855  C CB    B CYS A 1 129 ? -19.867 62.273 -17.593 0.50 90.37  ? 233 CYS A CB    1 
ATOM   856  S SG    A CYS A 1 129 ? -19.704 60.541 -18.245 0.50 102.74 ? 233 CYS A SG    1 
ATOM   857  S SG    B CYS A 1 129 ? -21.226 62.638 -16.468 0.50 92.46  ? 233 CYS A SG    1 
ATOM   858  N N     . ILE A 1 130 ? -19.485 64.819 -15.958 1.00 83.05  ? 234 ILE A N     1 
ATOM   859  C CA    . ILE A 1 130 ? -19.987 66.169 -15.697 1.00 81.64  ? 234 ILE A CA    1 
ATOM   860  C C     . ILE A 1 130 ? -18.855 67.214 -15.703 1.00 89.80  ? 234 ILE A C     1 
ATOM   861  O O     . ILE A 1 130 ? -19.057 68.367 -16.103 1.00 80.29  ? 234 ILE A O     1 
ATOM   862  C CB    . ILE A 1 130 ? -20.837 66.186 -14.397 1.00 71.81  ? 234 ILE A CB    1 
ATOM   863  C CG1   . ILE A 1 130 ? -21.505 67.517 -14.207 1.00 70.15  ? 234 ILE A CG1   1 
ATOM   864  C CG2   . ILE A 1 130 ? -19.996 65.854 -13.166 1.00 78.67  ? 234 ILE A CG2   1 
ATOM   865  C CD1   . ILE A 1 130 ? -21.913 67.753 -12.769 1.00 89.20  ? 234 ILE A CD1   1 
ATOM   866  N N     . TYR A 1 131 ? -17.660 66.810 -15.277 1.00 92.19  ? 235 TYR A N     1 
ATOM   867  C CA    . TYR A 1 131 ? -16.528 67.737 -15.284 1.00 95.71  ? 235 TYR A CA    1 
ATOM   868  C C     . TYR A 1 131 ? -15.870 67.825 -16.659 1.00 101.34 ? 235 TYR A C     1 
ATOM   869  O O     . TYR A 1 131 ? -15.571 68.931 -17.129 1.00 103.57 ? 235 TYR A O     1 
ATOM   870  C CB    . TYR A 1 131 ? -15.485 67.365 -14.238 1.00 85.73  ? 235 TYR A CB    1 
ATOM   871  C CG    . TYR A 1 131 ? -14.388 68.393 -14.107 1.00 79.88  ? 235 TYR A CG    1 
ATOM   872  C CD1   . TYR A 1 131 ? -14.651 69.653 -13.594 1.00 81.24  ? 235 TYR A CD1   1 
ATOM   873  C CD2   . TYR A 1 131 ? -13.089 68.107 -14.498 1.00 81.44  ? 235 TYR A CD2   1 
ATOM   874  C CE1   . TYR A 1 131 ? -13.646 70.604 -13.470 1.00 84.58  ? 235 TYR A CE1   1 
ATOM   875  C CE2   . TYR A 1 131 ? -12.080 69.046 -14.375 1.00 73.70  ? 235 TYR A CE2   1 
ATOM   876  C CZ    . TYR A 1 131 ? -12.363 70.291 -13.860 1.00 82.77  ? 235 TYR A CZ    1 
ATOM   877  O OH    . TYR A 1 131 ? -11.373 71.241 -13.725 1.00 102.21 ? 235 TYR A OH    1 
ATOM   878  N N     . GLU A 1 132 ? -15.646 66.668 -17.291 1.00 87.52  ? 236 GLU A N     1 
ATOM   879  C CA    . GLU A 1 132 ? -15.151 66.622 -18.662 1.00 91.78  ? 236 GLU A CA    1 
ATOM   880  C C     . GLU A 1 132 ? -15.878 67.678 -19.517 1.00 100.56 ? 236 GLU A C     1 
ATOM   881  O O     . GLU A 1 132 ? -15.235 68.462 -20.229 1.00 115.48 ? 236 GLU A O     1 
ATOM   882  C CB    . GLU A 1 132 ? -15.293 65.213 -19.247 1.00 79.88  ? 236 GLU A CB    1 
ATOM   883  N N     . ILE A 1 133 ? -17.207 67.727 -19.413 1.00 93.85  ? 237 ILE A N     1 
ATOM   884  C CA    . ILE A 1 133 ? -17.983 68.771 -20.085 1.00 93.24  ? 237 ILE A CA    1 
ATOM   885  C C     . ILE A 1 133 ? -17.685 70.162 -19.506 1.00 87.83  ? 237 ILE A C     1 
ATOM   886  O O     . ILE A 1 133 ? -17.319 71.085 -20.236 1.00 86.33  ? 237 ILE A O     1 
ATOM   887  C CB    . ILE A 1 133 ? -19.497 68.470 -20.051 1.00 74.08  ? 237 ILE A CB    1 
ATOM   888  N N     . PHE A 1 134 ? -17.828 70.294 -18.190 1.00 95.07  ? 238 PHE A N     1 
ATOM   889  C CA    . PHE A 1 134 ? -17.655 71.572 -17.489 1.00 89.89  ? 238 PHE A CA    1 
ATOM   890  C C     . PHE A 1 134 ? -16.335 72.229 -17.845 1.00 88.08  ? 238 PHE A C     1 
ATOM   891  O O     . PHE A 1 134 ? -16.293 73.438 -18.039 1.00 82.96  ? 238 PHE A O     1 
ATOM   892  C CB    . PHE A 1 134 ? -17.758 71.371 -15.968 1.00 88.49  ? 238 PHE A CB    1 
ATOM   893  C CG    . PHE A 1 134 ? -17.601 72.636 -15.177 1.00 68.29  ? 238 PHE A CG    1 
ATOM   894  C CD1   . PHE A 1 134 ? -18.641 73.523 -15.057 1.00 69.08  ? 238 PHE A CD1   1 
ATOM   895  C CD2   . PHE A 1 134 ? -16.412 72.929 -14.546 1.00 63.87  ? 238 PHE A CD2   1 
ATOM   896  C CE1   . PHE A 1 134 ? -18.497 74.708 -14.338 1.00 74.46  ? 238 PHE A CE1   1 
ATOM   897  C CE2   . PHE A 1 134 ? -16.246 74.110 -13.832 1.00 65.95  ? 238 PHE A CE2   1 
ATOM   898  C CZ    . PHE A 1 134 ? -17.293 75.000 -13.716 1.00 65.59  ? 238 PHE A CZ    1 
ATOM   899  N N     . SER A 1 135 ? -15.264 71.434 -17.929 1.00 92.84  ? 239 SER A N     1 
ATOM   900  C CA    . SER A 1 135 ? -13.942 71.946 -18.338 1.00 107.62 ? 239 SER A CA    1 
ATOM   901  C C     . SER A 1 135 ? -13.982 72.441 -19.787 1.00 116.37 ? 239 SER A C     1 
ATOM   902  O O     . SER A 1 135 ? -13.653 73.600 -20.062 1.00 112.39 ? 239 SER A O     1 
ATOM   903  C CB    . SER A 1 135 ? -12.852 70.881 -18.161 1.00 94.30  ? 239 SER A CB    1 
ATOM   904  N N     . LYS A 1 136 ? -14.430 71.562 -20.691 1.00 116.77 ? 240 LYS A N     1 
ATOM   905  C CA    . LYS A 1 136 ? -14.560 71.858 -22.125 1.00 108.74 ? 240 LYS A CA    1 
ATOM   906  C C     . LYS A 1 136 ? -15.422 73.093 -22.414 1.00 110.01 ? 240 LYS A C     1 
ATOM   907  O O     . LYS A 1 136 ? -15.348 73.655 -23.508 1.00 122.64 ? 240 LYS A O     1 
ATOM   908  C CB    . LYS A 1 136 ? -15.133 70.639 -22.870 1.00 85.74  ? 240 LYS A CB    1 
ATOM   909  N N     . GLU A 1 137 ? -16.225 73.508 -21.431 1.00 108.38 ? 241 GLU A N     1 
ATOM   910  C CA    . GLU A 1 137 ? -17.240 74.557 -21.612 1.00 106.32 ? 241 GLU A CA    1 
ATOM   911  C C     . GLU A 1 137 ? -17.021 75.815 -20.757 1.00 104.87 ? 241 GLU A C     1 
ATOM   912  O O     . GLU A 1 137 ? -17.419 76.917 -21.142 1.00 95.83  ? 241 GLU A O     1 
ATOM   913  C CB    . GLU A 1 137 ? -18.632 73.979 -21.347 1.00 92.93  ? 241 GLU A CB    1 
ATOM   914  N N     . VAL A 1 138 ? -16.409 75.652 -19.587 1.00 113.93 ? 242 VAL A N     1 
ATOM   915  C CA    . VAL A 1 138 ? -16.101 76.806 -18.736 1.00 110.27 ? 242 VAL A CA    1 
ATOM   916  C C     . VAL A 1 138 ? -14.649 77.239 -18.904 1.00 104.69 ? 242 VAL A C     1 
ATOM   917  O O     . VAL A 1 138 ? -14.347 78.420 -18.789 1.00 98.36  ? 242 VAL A O     1 
ATOM   918  C CB    . VAL A 1 138 ? -16.429 76.566 -17.243 1.00 95.78  ? 242 VAL A CB    1 
ATOM   919  N N     . PHE A 1 139 ? -13.764 76.283 -19.178 1.00 104.94 ? 243 PHE A N     1 
ATOM   920  C CA    . PHE A 1 139 ? -12.344 76.578 -19.403 1.00 110.04 ? 243 PHE A CA    1 
ATOM   921  C C     . PHE A 1 139 ? -11.941 76.388 -20.867 1.00 126.54 ? 243 PHE A C     1 
ATOM   922  O O     . PHE A 1 139 ? -10.883 76.861 -21.289 1.00 130.47 ? 243 PHE A O     1 
ATOM   923  C CB    . PHE A 1 139 ? -11.457 75.675 -18.540 1.00 100.34 ? 243 PHE A CB    1 
ATOM   924  C CG    . PHE A 1 139 ? -11.776 75.714 -17.073 1.00 91.02  ? 243 PHE A CG    1 
ATOM   925  C CD1   . PHE A 1 139 ? -11.607 76.881 -16.340 1.00 83.30  ? 243 PHE A CD1   1 
ATOM   926  C CD2   . PHE A 1 139 ? -12.217 74.570 -16.414 1.00 86.09  ? 243 PHE A CD2   1 
ATOM   927  C CE1   . PHE A 1 139 ? -11.879 76.919 -14.979 1.00 75.80  ? 243 PHE A CE1   1 
ATOM   928  C CE2   . PHE A 1 139 ? -12.494 74.605 -15.055 1.00 85.88  ? 243 PHE A CE2   1 
ATOM   929  C CZ    . PHE A 1 139 ? -12.321 75.784 -14.335 1.00 78.37  ? 243 PHE A CZ    1 
ATOM   930  N N     . GLY A 1 140 ? -12.775 75.684 -21.634 1.00 136.17 ? 244 GLY A N     1 
ATOM   931  C CA    . GLY A 1 140 ? -12.425 75.282 -22.998 1.00 122.30 ? 244 GLY A CA    1 
ATOM   932  C C     . GLY A 1 140 ? -11.143 74.456 -23.022 1.00 125.17 ? 244 GLY A C     1 
ATOM   933  O O     . GLY A 1 140 ? -10.159 74.848 -23.653 1.00 122.58 ? 244 GLY A O     1 
ATOM   934  N N     . VAL A 1 141 ? -11.160 73.324 -22.312 1.00 121.46 ? 245 VAL A N     1 
ATOM   935  C CA    . VAL A 1 141 ? -10.037 72.369 -22.272 1.00 116.73 ? 245 VAL A CA    1 
ATOM   936  C C     . VAL A 1 141 ? -10.547 70.933 -22.083 1.00 123.35 ? 245 VAL A C     1 
ATOM   937  O O     . VAL A 1 141 ? -11.233 70.639 -21.097 1.00 141.99 ? 245 VAL A O     1 
ATOM   938  C CB    . VAL A 1 141 ? -9.038  72.699 -21.140 1.00 104.30 ? 245 VAL A CB    1 
ATOM   939  N N     . LYS A 1 142 ? -10.223 70.047 -23.026 1.00 109.46 ? 246 LYS A N     1 
ATOM   940  C CA    . LYS A 1 142 ? -10.647 68.646 -22.946 1.00 104.92 ? 246 LYS A CA    1 
ATOM   941  C C     . LYS A 1 142 ? -9.592  67.833 -22.201 1.00 105.76 ? 246 LYS A C     1 
ATOM   942  O O     . LYS A 1 142 ? -8.568  67.490 -22.775 1.00 109.62 ? 246 LYS A O     1 
ATOM   943  C CB    . LYS A 1 142 ? -10.884 68.071 -24.347 1.00 93.34  ? 246 LYS A CB    1 
ATOM   944  N N     . VAL A 1 143 ? -9.838  67.530 -20.927 1.00 112.18 ? 247 VAL A N     1 
ATOM   945  C CA    . VAL A 1 143 ? -8.790  66.969 -20.052 1.00 125.72 ? 247 VAL A CA    1 
ATOM   946  C C     . VAL A 1 143 ? -8.223  65.625 -20.516 1.00 121.28 ? 247 VAL A C     1 
ATOM   947  O O     . VAL A 1 143 ? -8.962  64.680 -20.797 1.00 132.21 ? 247 VAL A O     1 
ATOM   948  C CB    . VAL A 1 143 ? -9.244  66.854 -18.577 1.00 119.24 ? 247 VAL A CB    1 
ATOM   949  N N     . LYS A 1 144 ? -6.899  65.557 -20.593 1.00 117.96 ? 248 LYS A N     1 
ATOM   950  C CA    . LYS A 1 144 ? -6.207  64.312 -20.924 1.00 125.88 ? 248 LYS A CA    1 
ATOM   951  C C     . LYS A 1 144 ? -6.303  63.291 -19.776 1.00 114.92 ? 248 LYS A C     1 
ATOM   952  O O     . LYS A 1 144 ? -6.127  63.636 -18.599 1.00 94.66  ? 248 LYS A O     1 
ATOM   953  C CB    . LYS A 1 144 ? -4.736  64.597 -21.273 1.00 119.86 ? 248 LYS A CB    1 
ATOM   954  N N     . ASN A 1 145 ? -6.582  62.041 -20.128 1.00 103.16 ? 249 ASN A N     1 
ATOM   955  C CA    . ASN A 1 145 ? -6.642  60.962 -19.152 1.00 117.15 ? 249 ASN A CA    1 
ATOM   956  C C     . ASN A 1 145 ? -6.946  61.474 -17.729 1.00 110.95 ? 249 ASN A C     1 
ATOM   957  O O     . ASN A 1 145 ? -6.071  61.476 -16.845 1.00 108.90 ? 249 ASN A O     1 
ATOM   958  C CB    . ASN A 1 145 ? -5.343  60.143 -19.201 1.00 119.82 ? 249 ASN A CB    1 
ATOM   959  N N     . LEU A 1 146 ? -8.192  61.924 -17.544 1.00 105.11 ? 250 LEU A N     1 
ATOM   960  C CA    . LEU A 1 146 ? -8.659  62.539 -16.299 1.00 81.65  ? 250 LEU A CA    1 
ATOM   961  C C     . LEU A 1 146 ? -8.618  61.583 -15.127 1.00 85.50  ? 250 LEU A C     1 
ATOM   962  O O     . LEU A 1 146 ? -9.028  60.412 -15.219 1.00 85.91  ? 250 LEU A O     1 
ATOM   963  C CB    . LEU A 1 146 ? -10.080 63.049 -16.471 1.00 81.54  ? 250 LEU A CB    1 
ATOM   964  C CG    . LEU A 1 146 ? -10.723 63.748 -15.274 1.00 90.52  ? 250 LEU A CG    1 
ATOM   965  C CD1   . LEU A 1 146 ? -9.784  64.797 -14.677 1.00 106.36 ? 250 LEU A CD1   1 
ATOM   966  C CD2   . LEU A 1 146 ? -12.053 64.391 -15.638 1.00 80.57  ? 250 LEU A CD2   1 
ATOM   967  N N     . GLU A 1 147 ? -8.104  62.078 -14.014 1.00 87.86  ? 251 GLU A N     1 
ATOM   968  C CA    . GLU A 1 147 ? -8.143  61.295 -12.789 1.00 91.35  ? 251 GLU A CA    1 
ATOM   969  C C     . GLU A 1 147 ? -8.974  62.013 -11.716 1.00 86.62  ? 251 GLU A C     1 
ATOM   970  O O     . GLU A 1 147 ? -9.139  63.250 -11.708 1.00 78.29  ? 251 GLU A O     1 
ATOM   971  C CB    . GLU A 1 147 ? -6.727  60.955 -12.293 1.00 82.07  ? 251 GLU A CB    1 
ATOM   972  N N     . PHE A 1 148 ? -9.507  61.222 -10.806 1.00 82.74  ? 252 PHE A N     1 
ATOM   973  C CA    . PHE A 1 148 ? -10.255 61.771 -9.697  1.00 78.68  ? 252 PHE A CA    1 
ATOM   974  C C     . PHE A 1 148 ? -9.352  62.580 -8.791  1.00 78.02  ? 252 PHE A C     1 
ATOM   975  O O     . PHE A 1 148 ? -8.148  62.341 -8.732  1.00 85.19  ? 252 PHE A O     1 
ATOM   976  C CB    . PHE A 1 148 ? -10.916 60.642 -8.936  1.00 72.31  ? 252 PHE A CB    1 
ATOM   977  C CG    . PHE A 1 148 ? -11.844 59.816 -9.792  1.00 83.13  ? 252 PHE A CG    1 
ATOM   978  C CD1   . PHE A 1 148 ? -12.822 60.436 -10.586 1.00 72.25  ? 252 PHE A CD1   1 
ATOM   979  C CD2   . PHE A 1 148 ? -11.747 58.429 -9.810  1.00 79.46  ? 252 PHE A CD2   1 
ATOM   980  C CE1   . PHE A 1 148 ? -13.673 59.687 -11.377 1.00 66.74  ? 252 PHE A CE1   1 
ATOM   981  C CE2   . PHE A 1 148 ? -12.612 57.689 -10.602 1.00 87.68  ? 252 PHE A CE2   1 
ATOM   982  C CZ    . PHE A 1 148 ? -13.570 58.322 -11.384 1.00 69.44  ? 252 PHE A CZ    1 
ATOM   983  N N     . GLY A 1 149 ? -9.946  63.550 -8.107  1.00 75.83  ? 253 GLY A N     1 
ATOM   984  C CA    . GLY A 1 149 ? -9.259  64.336 -7.097  1.00 65.03  ? 253 GLY A CA    1 
ATOM   985  C C     . GLY A 1 149 ? -9.231  65.785 -7.488  1.00 68.28  ? 253 GLY A C     1 
ATOM   986  O O     . GLY A 1 149 ? -10.063 66.253 -8.277  1.00 89.18  ? 253 GLY A O     1 
ATOM   987  N N     . LEU A 1 150 ? -8.257  66.501 -6.959  1.00 69.20  ? 254 LEU A N     1 
ATOM   988  C CA    . LEU A 1 150 ? -8.167  67.940 -7.197  1.00 73.38  ? 254 LEU A CA    1 
ATOM   989  C C     . LEU A 1 150 ? -7.932  68.259 -8.669  1.00 75.23  ? 254 LEU A C     1 
ATOM   990  O O     . LEU A 1 150 ? -7.271  67.501 -9.390  1.00 82.10  ? 254 LEU A O     1 
ATOM   991  C CB    . LEU A 1 150 ? -7.030  68.522 -6.356  1.00 60.49  ? 254 LEU A CB    1 
ATOM   992  C CG    . LEU A 1 150 ? -7.040  70.013 -6.070  1.00 54.07  ? 254 LEU A CG    1 
ATOM   993  C CD1   . LEU A 1 150 ? -8.424  70.491 -5.739  1.00 58.27  ? 254 LEU A CD1   1 
ATOM   994  C CD2   . LEU A 1 150 ? -6.097  70.331 -4.908  1.00 65.65  ? 254 LEU A CD2   1 
ATOM   995  N N     . GLN A 1 151 ? -8.464  69.384 -9.106  1.00 66.47  ? 255 GLN A N     1 
ATOM   996  C CA    . GLN A 1 151 ? -8.204  69.850 -10.453 1.00 72.76  ? 255 GLN A CA    1 
ATOM   997  C C     . GLN A 1 151 ? -7.452  71.178 -10.403 1.00 71.98  ? 255 GLN A C     1 
ATOM   998  O O     . GLN A 1 151 ? -7.586  71.924 -9.428  1.00 82.92  ? 255 GLN A O     1 
ATOM   999  C CB    . GLN A 1 151 ? -9.511  70.000 -11.228 1.00 77.19  ? 255 GLN A CB    1 
ATOM   1000 C CG    . GLN A 1 151 ? -10.308 68.712 -11.327 1.00 77.32  ? 255 GLN A CG    1 
ATOM   1001 C CD    . GLN A 1 151 ? -9.540  67.600 -12.007 1.00 71.26  ? 255 GLN A CD    1 
ATOM   1002 O OE1   . GLN A 1 151 ? -9.104  67.745 -13.147 1.00 78.73  ? 255 GLN A OE1   1 
ATOM   1003 N NE2   . GLN A 1 151 ? -9.401  66.470 -11.319 1.00 64.47  ? 255 GLN A NE2   1 
ATOM   1004 N N     . PRO A 1 152 ? -6.665  71.483 -11.452 1.00 64.89  ? 256 PRO A N     1 
ATOM   1005 C CA    . PRO A 1 152 ? -5.782  72.646 -11.450 1.00 68.80  ? 256 PRO A CA    1 
ATOM   1006 C C     . PRO A 1 152 ? -6.506  73.963 -11.310 1.00 77.60  ? 256 PRO A C     1 
ATOM   1007 O O     . PRO A 1 152 ? -6.208  74.741 -10.384 1.00 70.39  ? 256 PRO A O     1 
ATOM   1008 C CB    . PRO A 1 152 ? -5.107  72.585 -12.814 1.00 74.12  ? 256 PRO A CB    1 
ATOM   1009 C CG    . PRO A 1 152 ? -5.925  71.652 -13.627 1.00 79.59  ? 256 PRO A CG    1 
ATOM   1010 C CD    . PRO A 1 152 ? -6.464  70.657 -12.651 1.00 72.31  ? 256 PRO A CD    1 
ATOM   1011 N N     . HIS A 1 153 ? -7.456  74.200 -12.216 1.00 82.20  ? 257 HIS A N     1 
ATOM   1012 C CA    . HIS A 1 153 ? -8.069  75.524 -12.371 1.00 85.72  ? 257 HIS A CA    1 
ATOM   1013 C C     . HIS A 1 153 ? -9.141  75.758 -11.348 1.00 78.55  ? 257 HIS A C     1 
ATOM   1014 O O     . HIS A 1 153 ? -9.837  74.835 -10.959 1.00 80.92  ? 257 HIS A O     1 
ATOM   1015 C CB    . HIS A 1 153 ? -8.605  75.679 -13.794 1.00 87.59  ? 257 HIS A CB    1 
ATOM   1016 C CG    . HIS A 1 153 ? -7.815  74.893 -14.826 1.00 90.80  ? 257 HIS A CG    1 
ATOM   1017 N ND1   . HIS A 1 153 ? -6.659  75.339 -15.339 1.00 97.16  ? 257 HIS A ND1   1 
ATOM   1018 C CD2   . HIS A 1 153 ? -8.046  73.645 -15.410 1.00 93.49  ? 257 HIS A CD2   1 
ATOM   1019 C CE1   . HIS A 1 153 ? -6.177  74.431 -16.216 1.00 101.11 ? 257 HIS A CE1   1 
ATOM   1020 N NE2   . HIS A 1 153 ? -7.027  73.396 -16.256 1.00 91.00  ? 257 HIS A NE2   1 
ATOM   1021 N N     . LYS A 1 154 ? -9.260  77.000 -10.902 1.00 71.75  ? 258 LYS A N     1 
ATOM   1022 C CA    . LYS A 1 154 ? -10.296 77.408 -9.967  1.00 85.55  ? 258 LYS A CA    1 
ATOM   1023 C C     . LYS A 1 154 ? -11.541 77.971 -10.688 1.00 87.90  ? 258 LYS A C     1 
ATOM   1024 O O     . LYS A 1 154 ? -11.510 78.225 -11.892 1.00 90.77  ? 258 LYS A O     1 
ATOM   1025 C CB    . LYS A 1 154 ? -9.733  78.441 -8.980  1.00 97.21  ? 258 LYS A CB    1 
ATOM   1026 C CG    . LYS A 1 154 ? -8.599  77.920 -8.096  1.00 94.69  ? 258 LYS A CG    1 
ATOM   1027 C CD    . LYS A 1 154 ? -8.224  78.968 -7.067  1.00 99.92  ? 258 LYS A CD    1 
ATOM   1028 C CE    . LYS A 1 154 ? -7.113  78.511 -6.140  1.00 101.86 ? 258 LYS A CE    1 
ATOM   1029 N NZ    . LYS A 1 154 ? -7.063  79.374 -4.917  1.00 109.42 ? 258 LYS A NZ    1 
ATOM   1030 N N     . ILE A 1 155 ? -12.637 78.151 -9.947  1.00 82.92  ? 259 ILE A N     1 
ATOM   1031 C CA    . ILE A 1 155 ? -13.881 78.685 -10.507 1.00 79.65  ? 259 ILE A CA    1 
ATOM   1032 C C     . ILE A 1 155 ? -13.661 80.176 -10.795 1.00 87.94  ? 259 ILE A C     1 
ATOM   1033 O O     . ILE A 1 155 ? -13.242 80.922 -9.900  1.00 92.93  ? 259 ILE A O     1 
ATOM   1034 C CB    . ILE A 1 155 ? -15.066 78.482 -9.542  1.00 74.44  ? 259 ILE A CB    1 
ATOM   1035 C CG1   . ILE A 1 155 ? -15.403 76.996 -9.366  1.00 79.80  ? 259 ILE A CG1   1 
ATOM   1036 C CG2   . ILE A 1 155 ? -16.296 79.212 -10.019 1.00 82.18  ? 259 ILE A CG2   1 
ATOM   1037 C CD1   . ILE A 1 155 ? -15.618 76.221 -10.650 1.00 83.56  ? 259 ILE A CD1   1 
ATOM   1038 N N     . PRO A 1 156 ? -13.891 80.606 -12.057 1.00 93.31  ? 260 PRO A N     1 
ATOM   1039 C CA    . PRO A 1 156 ? -13.563 81.983 -12.501 1.00 85.03  ? 260 PRO A CA    1 
ATOM   1040 C C     . PRO A 1 156 ? -14.011 83.057 -11.519 1.00 83.92  ? 260 PRO A C     1 
ATOM   1041 O O     . PRO A 1 156 ? -15.156 83.065 -11.092 1.00 92.64  ? 260 PRO A O     1 
ATOM   1042 C CB    . PRO A 1 156 ? -14.315 82.105 -13.831 1.00 83.77  ? 260 PRO A CB    1 
ATOM   1043 C CG    . PRO A 1 156 ? -14.345 80.691 -14.366 1.00 91.45  ? 260 PRO A CG    1 
ATOM   1044 C CD    . PRO A 1 156 ? -14.342 79.750 -13.183 1.00 89.95  ? 260 PRO A CD    1 
ATOM   1045 N N     . ASP A 1 157 ? -13.098 83.936 -11.141 1.00 83.85  ? 261 ASP A N     1 
ATOM   1046 C CA    . ASP A 1 157 ? -13.390 85.007 -10.182 1.00 96.58  ? 261 ASP A CA    1 
ATOM   1047 C C     . ASP A 1 157 ? -13.671 84.491 -8.761  1.00 99.33  ? 261 ASP A C     1 
ATOM   1048 O O     . ASP A 1 157 ? -14.354 85.147 -7.956  1.00 98.64  ? 261 ASP A O     1 
ATOM   1049 C CB    . ASP A 1 157 ? -14.530 85.910 -10.686 1.00 102.14 ? 261 ASP A CB    1 
ATOM   1050 C CG    . ASP A 1 157 ? -14.196 86.586 -12.009 1.00 120.24 ? 261 ASP A CG    1 
ATOM   1051 O OD1   . ASP A 1 157 ? -13.476 85.973 -12.838 1.00 113.17 ? 261 ASP A OD1   1 
ATOM   1052 O OD2   . ASP A 1 157 ? -14.655 87.735 -12.220 1.00 138.15 ? 261 ASP A OD2   1 
ATOM   1053 N N     . THR A 1 158 ? -13.130 83.317 -8.450  1.00 90.44  ? 262 THR A N     1 
ATOM   1054 C CA    . THR A 1 158 ? -13.359 82.731 -7.148  1.00 94.63  ? 262 THR A CA    1 
ATOM   1055 C C     . THR A 1 158 ? -12.179 81.940 -6.687  1.00 92.36  ? 262 THR A C     1 
ATOM   1056 O O     . THR A 1 158 ? -11.336 81.519 -7.490  1.00 102.47 ? 262 THR A O     1 
ATOM   1057 C CB    . THR A 1 158 ? -14.532 81.741 -7.164  1.00 99.51  ? 262 THR A CB    1 
ATOM   1058 O OG1   . THR A 1 158 ? -15.123 81.712 -8.464  1.00 98.13  ? 262 THR A OG1   1 
ATOM   1059 C CG2   . THR A 1 158 ? -15.578 82.121 -6.081  1.00 112.91 ? 262 THR A CG2   1 
ATOM   1060 N N     . GLU A 1 159 ? -12.150 81.706 -5.381  1.00 90.04  ? 263 GLU A N     1 
ATOM   1061 C CA    . GLU A 1 159 ? -11.148 80.850 -4.783  1.00 90.21  ? 263 GLU A CA    1 
ATOM   1062 C C     . GLU A 1 159 ? -11.647 79.407 -4.691  1.00 91.42  ? 263 GLU A C     1 
ATOM   1063 O O     . GLU A 1 159 ? -11.068 78.600 -3.950  1.00 102.98 ? 263 GLU A O     1 
ATOM   1064 C CB    . GLU A 1 159 ? -10.749 81.385 -3.402  1.00 94.96  ? 263 GLU A CB    1 
ATOM   1065 C CG    . GLU A 1 159 ? -10.216 82.819 -3.392  1.00 95.02  ? 263 GLU A CG    1 
ATOM   1066 C CD    . GLU A 1 159 ? -9.055  83.036 -4.349  1.00 94.37  ? 263 GLU A CD    1 
ATOM   1067 O OE1   . GLU A 1 159 ? -8.137  82.174 -4.379  1.00 98.74  ? 263 GLU A OE1   1 
ATOM   1068 O OE2   . GLU A 1 159 ? -9.069  84.071 -5.070  1.00 88.25  ? 263 GLU A OE2   1 
ATOM   1069 N N     . THR A 1 160 ? -12.696 79.074 -5.451  1.00 73.27  ? 264 THR A N     1 
ATOM   1070 C CA    . THR A 1 160 ? -13.341 77.777 -5.299  1.00 66.25  ? 264 THR A CA    1 
ATOM   1071 C C     . THR A 1 160 ? -12.590 76.705 -6.078  1.00 68.62  ? 264 THR A C     1 
ATOM   1072 O O     . THR A 1 160 ? -12.462 76.804 -7.297  1.00 79.28  ? 264 THR A O     1 
ATOM   1073 C CB    . THR A 1 160 ? -14.821 77.826 -5.733  1.00 65.76  ? 264 THR A CB    1 
ATOM   1074 O OG1   . THR A 1 160 ? -15.524 78.787 -4.949  1.00 71.10  ? 264 THR A OG1   1 
ATOM   1075 C CG2   . THR A 1 160 ? -15.506 76.483 -5.525  1.00 72.84  ? 264 THR A CG2   1 
ATOM   1076 N N     . LEU A 1 161 ? -12.099 75.681 -5.382  1.00 63.07  ? 265 LEU A N     1 
ATOM   1077 C CA    . LEU A 1 161 ? -11.398 74.597 -6.061  1.00 69.89  ? 265 LEU A CA    1 
ATOM   1078 C C     . LEU A 1 161 ? -12.374 73.600 -6.663  1.00 73.60  ? 265 LEU A C     1 
ATOM   1079 O O     . LEU A 1 161 ? -13.543 73.539 -6.262  1.00 79.84  ? 265 LEU A O     1 
ATOM   1080 C CB    . LEU A 1 161 ? -10.402 73.861 -5.144  1.00 68.75  ? 265 LEU A CB    1 
ATOM   1081 C CG    . LEU A 1 161 ? -9.580  74.602 -4.086  1.00 69.16  ? 265 LEU A CG    1 
ATOM   1082 C CD1   . LEU A 1 161 ? -8.750  73.602 -3.304  1.00 75.67  ? 265 LEU A CD1   1 
ATOM   1083 C CD2   . LEU A 1 161 ? -8.674  75.650 -4.688  1.00 76.29  ? 265 LEU A CD2   1 
ATOM   1084 N N     . CYS A 1 162 ? -11.878 72.808 -7.615  1.00 67.40  ? 266 CYS A N     1 
ATOM   1085 C CA    . CYS A 1 162 ? -12.682 71.815 -8.301  1.00 61.27  ? 266 CYS A CA    1 
ATOM   1086 C C     . CYS A 1 162 ? -12.102 70.489 -8.003  1.00 69.91  ? 266 CYS A C     1 
ATOM   1087 O O     . CYS A 1 162 ? -10.915 70.265 -8.239  1.00 76.33  ? 266 CYS A O     1 
ATOM   1088 C CB    . CYS A 1 162 ? -12.657 72.036 -9.808  1.00 64.78  ? 266 CYS A CB    1 
ATOM   1089 S SG    . CYS A 1 162 ? -13.572 73.508 -10.340 1.00 77.70  ? 266 CYS A SG    1 
ATOM   1090 N N     . TYR A 1 163 ? -12.951 69.586 -7.518  1.00 68.76  ? 267 TYR A N     1 
ATOM   1091 C CA    . TYR A 1 163 ? -12.526 68.285 -7.058  1.00 59.08  ? 267 TYR A CA    1 
ATOM   1092 C C     . TYR A 1 163 ? -13.455 67.303 -7.695  1.00 64.20  ? 267 TYR A C     1 
ATOM   1093 O O     . TYR A 1 163 ? -14.660 67.490 -7.615  1.00 79.32  ? 267 TYR A O     1 
ATOM   1094 C CB    . TYR A 1 163 ? -12.655 68.247 -5.551  1.00 55.89  ? 267 TYR A CB    1 
ATOM   1095 C CG    . TYR A 1 163 ? -12.209 66.970 -4.910  1.00 62.19  ? 267 TYR A CG    1 
ATOM   1096 C CD1   . TYR A 1 163 ? -10.876 66.735 -4.660  1.00 61.69  ? 267 TYR A CD1   1 
ATOM   1097 C CD2   . TYR A 1 163 ? -13.127 65.990 -4.536  1.00 63.71  ? 267 TYR A CD2   1 
ATOM   1098 C CE1   . TYR A 1 163 ? -10.463 65.548 -4.061  1.00 62.74  ? 267 TYR A CE1   1 
ATOM   1099 C CE2   . TYR A 1 163 ? -12.720 64.803 -3.934  1.00 64.83  ? 267 TYR A CE2   1 
ATOM   1100 C CZ    . TYR A 1 163 ? -11.377 64.599 -3.697  1.00 63.15  ? 267 TYR A CZ    1 
ATOM   1101 O OH    . TYR A 1 163 ? -10.929 63.438 -3.107  1.00 71.95  ? 267 TYR A OH    1 
ATOM   1102 N N     . VAL A 1 164 ? -12.923 66.268 -8.347  1.00 61.31  ? 268 VAL A N     1 
ATOM   1103 C CA    . VAL A 1 164 ? -13.784 65.336 -9.078  1.00 68.20  ? 268 VAL A CA    1 
ATOM   1104 C C     . VAL A 1 164 ? -13.922 63.993 -8.366  1.00 72.03  ? 268 VAL A C     1 
ATOM   1105 O O     . VAL A 1 164 ? -12.943 63.300 -8.151  1.00 83.94  ? 268 VAL A O     1 
ATOM   1106 C CB    . VAL A 1 164 ? -13.299 65.128 -10.551 1.00 71.19  ? 268 VAL A CB    1 
ATOM   1107 C CG1   . VAL A 1 164 ? -14.002 63.936 -11.190 1.00 69.02  ? 268 VAL A CG1   1 
ATOM   1108 C CG2   . VAL A 1 164 ? -13.529 66.361 -11.404 1.00 53.69  ? 268 VAL A CG2   1 
ATOM   1109 N N     . MET A 1 165 ? -15.148 63.629 -8.016  1.00 77.34  ? 269 MET A N     1 
ATOM   1110 C CA    . MET A 1 165 ? -15.458 62.342 -7.388  1.00 74.54  ? 269 MET A CA    1 
ATOM   1111 C C     . MET A 1 165 ? -16.071 61.379 -8.389  1.00 77.55  ? 269 MET A C     1 
ATOM   1112 O O     . MET A 1 165 ? -16.764 61.810 -9.324  1.00 85.88  ? 269 MET A O     1 
ATOM   1113 C CB    . MET A 1 165 ? -16.497 62.562 -6.296  1.00 78.92  ? 269 MET A CB    1 
ATOM   1114 C CG    . MET A 1 165 ? -16.507 61.478 -5.237  1.00 89.89  ? 269 MET A CG    1 
ATOM   1115 S SD    . MET A 1 165 ? -15.600 62.014 -3.789  1.00 102.79 ? 269 MET A SD    1 
ATOM   1116 C CE    . MET A 1 165 ? -16.605 63.433 -3.368  1.00 86.87  ? 269 MET A CE    1 
ATOM   1117 N N     . PRO A 1 166 ? -15.852 60.072 -8.204  1.00 71.55  ? 270 PRO A N     1 
ATOM   1118 C CA    . PRO A 1 166 ? -16.601 59.123 -9.039  1.00 81.04  ? 270 PRO A CA    1 
ATOM   1119 C C     . PRO A 1 166 ? -18.063 59.159 -8.676  1.00 80.38  ? 270 PRO A C     1 
ATOM   1120 O O     . PRO A 1 166 ? -18.405 59.223 -7.492  1.00 82.85  ? 270 PRO A O     1 
ATOM   1121 C CB    . PRO A 1 166 ? -16.002 57.750 -8.688  1.00 78.64  ? 270 PRO A CB    1 
ATOM   1122 C CG    . PRO A 1 166 ? -15.291 57.966 -7.404  1.00 90.90  ? 270 PRO A CG    1 
ATOM   1123 C CD    . PRO A 1 166 ? -14.851 59.408 -7.368  1.00 80.39  ? 270 PRO A CD    1 
ATOM   1124 N N     . SER A 1 167 ? -18.915 59.129 -9.695  1.00 89.06  ? 271 SER A N     1 
ATOM   1125 C CA    . SER A 1 167 ? -20.363 59.270 -9.524  1.00 90.28  ? 271 SER A CA    1 
ATOM   1126 C C     . SER A 1 167 ? -20.904 58.417 -8.387  1.00 93.00  ? 271 SER A C     1 
ATOM   1127 O O     . SER A 1 167 ? -20.703 57.202 -8.361  1.00 86.27  ? 271 SER A O     1 
ATOM   1128 C CB    . SER A 1 167 ? -21.091 58.913 -10.817 1.00 88.84  ? 271 SER A CB    1 
ATOM   1129 O OG    . SER A 1 167 ? -22.463 58.719 -10.563 1.00 90.22  ? 271 SER A OG    1 
ATOM   1130 N N     . SER A 1 168 ? -21.597 59.064 -7.452  1.00 93.38  ? 272 SER A N     1 
ATOM   1131 C CA    . SER A 1 168 ? -22.195 58.373 -6.312  1.00 88.56  ? 272 SER A CA    1 
ATOM   1132 C C     . SER A 1 168 ? -23.256 57.418 -6.779  1.00 87.74  ? 272 SER A C     1 
ATOM   1133 O O     . SER A 1 168 ? -23.552 56.446 -6.087  1.00 101.88 ? 272 SER A O     1 
ATOM   1134 C CB    . SER A 1 168 ? -22.825 59.375 -5.358  1.00 85.23  ? 272 SER A CB    1 
ATOM   1135 O OG    . SER A 1 168 ? -24.000 59.911 -5.928  1.00 94.98  ? 272 SER A OG    1 
ATOM   1136 N N     . SER A 1 169 ? -23.849 57.723 -7.934  1.00 86.12  ? 273 SER A N     1 
ATOM   1137 C CA    . SER A 1 169 ? -24.850 56.869 -8.551  1.00 91.28  ? 273 SER A CA    1 
ATOM   1138 C C     . SER A 1 169 ? -24.351 55.438 -8.614  1.00 92.47  ? 273 SER A C     1 
ATOM   1139 O O     . SER A 1 169 ? -23.220 55.135 -8.206  1.00 98.60  ? 273 SER A O     1 
ATOM   1140 C CB    . SER A 1 169 ? -25.205 57.376 -9.961  1.00 105.65 ? 273 SER A CB    1 
ATOM   1141 O OG    . SER A 1 169 ? -25.539 56.308 -10.852 1.00 102.81 ? 273 SER A OG    1 
ATOM   1142 N N     . ALA A 1 170 ? -25.197 54.559 -9.126  1.00 93.75  ? 274 ALA A N     1 
ATOM   1143 C CA    . ALA A 1 170 ? -24.847 53.158 -9.204  1.00 117.00 ? 274 ALA A CA    1 
ATOM   1144 C C     . ALA A 1 170 ? -25.149 52.573 -10.590 1.00 123.38 ? 274 ALA A C     1 
ATOM   1145 O O     . ALA A 1 170 ? -25.882 51.593 -10.747 1.00 107.60 ? 274 ALA A O     1 
ATOM   1146 C CB    . ALA A 1 170 ? -25.535 52.384 -8.089  1.00 119.24 ? 274 ALA A CB    1 
ATOM   1147 N N     . ARG A 1 171 ? -24.562 53.206 -11.594 1.00 129.09 ? 275 ARG A N     1 
ATOM   1148 C CA    . ARG A 1 171 ? -24.535 52.688 -12.941 1.00 133.73 ? 275 ARG A CA    1 
ATOM   1149 C C     . ARG A 1 171 ? -23.080 52.473 -13.268 1.00 145.16 ? 275 ARG A C     1 
ATOM   1150 O O     . ARG A 1 171 ? -22.740 51.978 -14.342 1.00 153.16 ? 275 ARG A O     1 
ATOM   1151 C CB    . ARG A 1 171 ? -25.125 53.708 -13.888 1.00 134.29 ? 275 ARG A CB    1 
ATOM   1152 C CG    . ARG A 1 171 ? -26.404 53.261 -14.545 1.00 145.08 ? 275 ARG A CG    1 
ATOM   1153 C CD    . ARG A 1 171 ? -27.115 54.461 -15.127 1.00 161.56 ? 275 ARG A CD    1 
ATOM   1154 N NE    . ARG A 1 171 ? -28.425 54.127 -15.679 1.00 188.51 ? 275 ARG A NE    1 
ATOM   1155 C CZ    . ARG A 1 171 ? -29.120 54.919 -16.490 1.00 192.46 ? 275 ARG A CZ    1 
ATOM   1156 N NH1   . ARG A 1 171 ? -28.626 56.090 -16.869 1.00 192.33 ? 275 ARG A NH1   1 
ATOM   1157 N NH2   . ARG A 1 171 ? -30.310 54.537 -16.934 1.00 189.66 ? 275 ARG A NH2   1 
ATOM   1158 N N     . CYS A 1 172 ? -22.239 52.828 -12.294 1.00 145.86 ? 276 CYS A N     1 
ATOM   1159 C CA    . CYS A 1 172 ? -20.792 52.849 -12.413 1.00 141.45 ? 276 CYS A CA    1 
ATOM   1160 C C     . CYS A 1 172 ? -20.178 51.581 -11.837 1.00 155.64 ? 276 CYS A C     1 
ATOM   1161 O O     . CYS A 1 172 ? -20.329 51.306 -10.648 1.00 158.61 ? 276 CYS A O     1 
ATOM   1162 C CB    . CYS A 1 172 ? -20.255 54.067 -11.669 1.00 130.95 ? 276 CYS A CB    1 
ATOM   1163 S SG    . CYS A 1 172 ? -18.529 54.463 -11.991 1.00 147.17 ? 276 CYS A SG    1 
ATOM   1164 N N     . ALA A 1 173 ? -19.487 50.820 -12.685 1.00 152.29 ? 277 ALA A N     1 
ATOM   1165 C CA    . ALA A 1 173 ? -18.919 49.527 -12.295 1.00 138.78 ? 277 ALA A CA    1 
ATOM   1166 C C     . ALA A 1 173 ? -17.485 49.622 -11.799 1.00 129.60 ? 277 ALA A C     1 
ATOM   1167 O O     . ALA A 1 173 ? -16.978 48.672 -11.207 1.00 130.23 ? 277 ALA A O     1 
ATOM   1168 C CB    . ALA A 1 173 ? -19.003 48.535 -13.442 1.00 139.30 ? 277 ALA A CB    1 
ATOM   1169 N N     . GLN A 1 174 ? -16.815 50.741 -12.058 1.00 128.29 ? 278 GLN A N     1 
ATOM   1170 C CA    . GLN A 1 174 ? -15.466 50.933 -11.530 1.00 135.78 ? 278 GLN A CA    1 
ATOM   1171 C C     . GLN A 1 174 ? -15.579 51.114 -10.014 1.00 150.52 ? 278 GLN A C     1 
ATOM   1172 O O     . GLN A 1 174 ? -14.717 50.660 -9.252  1.00 136.19 ? 278 GLN A O     1 
ATOM   1173 C CB    . GLN A 1 174 ? -14.785 52.128 -12.187 1.00 130.92 ? 278 GLN A CB    1 
ATOM   1174 N N     . PHE A 1 175 ? -16.671 51.758 -9.596  1.00 148.49 ? 279 PHE A N     1 
ATOM   1175 C CA    . PHE A 1 175 ? -17.044 51.843 -8.192  1.00 137.31 ? 279 PHE A CA    1 
ATOM   1176 C C     . PHE A 1 175 ? -18.313 51.002 -7.948  1.00 132.38 ? 279 PHE A C     1 
ATOM   1177 O O     . PHE A 1 175 ? -19.387 51.548 -7.673  1.00 133.17 ? 279 PHE A O     1 
ATOM   1178 C CB    . PHE A 1 175 ? -17.244 53.304 -7.784  1.00 114.91 ? 279 PHE A CB    1 
ATOM   1179 N N     . PRO A 1 176 ? -18.197 49.665 -8.060  1.00 128.83 ? 280 PRO A N     1 
ATOM   1180 C CA    . PRO A 1 176 ? -19.401 48.829 -8.014  1.00 133.04 ? 280 PRO A CA    1 
ATOM   1181 C C     . PRO A 1 176 ? -20.118 48.848 -6.667  1.00 132.70 ? 280 PRO A C     1 
ATOM   1182 O O     . PRO A 1 176 ? -21.345 48.921 -6.630  1.00 130.99 ? 280 PRO A O     1 
ATOM   1183 C CB    . PRO A 1 176 ? -18.871 47.427 -8.316  1.00 134.89 ? 280 PRO A CB    1 
ATOM   1184 C CG    . PRO A 1 176 ? -17.435 47.461 -7.926  1.00 135.41 ? 280 PRO A CG    1 
ATOM   1185 C CD    . PRO A 1 176 ? -16.972 48.857 -8.216  1.00 128.08 ? 280 PRO A CD    1 
ATOM   1186 N N     . ARG A 1 177 ? -19.348 48.763 -5.584  1.00 129.54 ? 281 ARG A N     1 
ATOM   1187 C CA    . ARG A 1 177 ? -19.870 48.873 -4.230  1.00 120.44 ? 281 ARG A CA    1 
ATOM   1188 C C     . ARG A 1 177 ? -19.692 50.307 -3.751  1.00 128.36 ? 281 ARG A C     1 
ATOM   1189 O O     . ARG A 1 177 ? -18.953 51.082 -4.357  1.00 130.45 ? 281 ARG A O     1 
ATOM   1190 C CB    . ARG A 1 177 ? -19.134 47.913 -3.289  1.00 117.70 ? 281 ARG A CB    1 
ATOM   1191 N N     . ALA A 1 178 ? -20.375 50.651 -2.663  1.00 133.58 ? 282 ALA A N     1 
ATOM   1192 C CA    . ALA A 1 178 ? -20.174 51.928 -1.991  1.00 121.43 ? 282 ALA A CA    1 
ATOM   1193 C C     . ALA A 1 178 ? -18.835 51.949 -1.241  1.00 121.91 ? 282 ALA A C     1 
ATOM   1194 O O     . ALA A 1 178 ? -18.280 53.016 -0.985  1.00 118.11 ? 282 ALA A O     1 
ATOM   1195 C CB    . ALA A 1 178 ? -21.323 52.198 -1.043  1.00 116.11 ? 282 ALA A CB    1 
ATOM   1196 N N     . GLN A 1 179 ? -18.320 50.766 -0.906  1.00 128.21 ? 283 GLN A N     1 
ATOM   1197 C CA    . GLN A 1 179 ? -17.013 50.638 -0.256  1.00 129.50 ? 283 GLN A CA    1 
ATOM   1198 C C     . GLN A 1 179 ? -15.872 51.084 -1.176  1.00 132.90 ? 283 GLN A C     1 
ATOM   1199 O O     . GLN A 1 179 ? -14.835 51.561 -0.708  1.00 137.11 ? 283 GLN A O     1 
ATOM   1200 C CB    . GLN A 1 179 ? -16.779 49.200 0.207   1.00 133.05 ? 283 GLN A CB    1 
ATOM   1201 N N     . ASP A 1 180 ? -16.084 50.935 -2.484  1.00 128.53 ? 284 ASP A N     1 
ATOM   1202 C CA    . ASP A 1 180 ? -15.087 51.282 -3.501  1.00 124.11 ? 284 ASP A CA    1 
ATOM   1203 C C     . ASP A 1 180 ? -14.868 52.792 -3.648  1.00 118.41 ? 284 ASP A C     1 
ATOM   1204 O O     . ASP A 1 180 ? -13.769 53.238 -3.978  1.00 122.70 ? 284 ASP A O     1 
ATOM   1205 C CB    . ASP A 1 180 ? -15.498 50.689 -4.849  1.00 116.89 ? 284 ASP A CB    1 
ATOM   1206 C CG    . ASP A 1 180 ? -15.529 49.175 -4.834  1.00 117.77 ? 284 ASP A CG    1 
ATOM   1207 O OD1   . ASP A 1 180 ? -14.470 48.547 -4.646  1.00 122.26 ? 284 ASP A OD1   1 
ATOM   1208 O OD2   . ASP A 1 180 ? -16.615 48.598 -5.018  1.00 113.06 ? 284 ASP A OD2   1 
ATOM   1209 N N     . LYS A 1 181 ? -15.916 53.566 -3.388  1.00 106.23 ? 285 LYS A N     1 
ATOM   1210 C CA    . LYS A 1 181 ? -15.906 55.007 -3.614  1.00 100.48 ? 285 LYS A CA    1 
ATOM   1211 C C     . LYS A 1 181 ? -15.564 55.850 -2.380  1.00 95.80  ? 285 LYS A C     1 
ATOM   1212 O O     . LYS A 1 181 ? -15.551 57.066 -2.474  1.00 91.82  ? 285 LYS A O     1 
ATOM   1213 C CB    . LYS A 1 181 ? -17.259 55.453 -4.196  1.00 91.01  ? 285 LYS A CB    1 
ATOM   1214 N N     . VAL A 1 182 ? -15.272 55.211 -1.247  1.00 99.28  ? 286 VAL A N     1 
ATOM   1215 C CA    . VAL A 1 182 ? -15.089 55.921 0.039   1.00 97.96  ? 286 VAL A CA    1 
ATOM   1216 C C     . VAL A 1 182 ? -13.858 56.832 0.059   1.00 100.09 ? 286 VAL A C     1 
ATOM   1217 O O     . VAL A 1 182 ? -13.908 57.951 0.573   1.00 110.79 ? 286 VAL A O     1 
ATOM   1218 C CB    . VAL A 1 182 ? -15.014 54.941 1.240   1.00 92.83  ? 286 VAL A CB    1 
ATOM   1219 C CG1   . VAL A 1 182 ? -15.018 55.679 2.575   1.00 82.54  ? 286 VAL A CG1   1 
ATOM   1220 C CG2   . VAL A 1 182 ? -16.173 53.968 1.205   1.00 108.77 ? 286 VAL A CG2   1 
ATOM   1221 N N     . HIS A 1 183 ? -12.759 56.337 -0.497  1.00 102.37 ? 287 HIS A N     1 
ATOM   1222 C CA    . HIS A 1 183 ? -11.477 57.045 -0.511  1.00 102.70 ? 287 HIS A CA    1 
ATOM   1223 C C     . HIS A 1 183 ? -11.603 58.524 -0.754  1.00 103.81 ? 287 HIS A C     1 
ATOM   1224 O O     . HIS A 1 183 ? -11.280 59.341 0.109   1.00 103.85 ? 287 HIS A O     1 
ATOM   1225 C CB    . HIS A 1 183 ? -10.565 56.436 -1.575  1.00 105.62 ? 287 HIS A CB    1 
ATOM   1226 C CG    . HIS A 1 183 ? -9.141  56.879 -1.461  1.00 96.54  ? 287 HIS A CG    1 
ATOM   1227 N ND1   . HIS A 1 183 ? -8.344  56.486 -0.450  1.00 99.55  ? 287 HIS A ND1   1 
ATOM   1228 C CD2   . HIS A 1 183 ? -8.385  57.727 -2.255  1.00 101.63 ? 287 HIS A CD2   1 
ATOM   1229 C CE1   . HIS A 1 183 ? -7.132  57.050 -0.592  1.00 102.81 ? 287 HIS A CE1   1 
ATOM   1230 N NE2   . HIS A 1 183 ? -7.158  57.810 -1.699  1.00 101.15 ? 287 HIS A NE2   1 
ATOM   1231 N N     . TYR A 1 184 ? -12.091 58.874 -1.938  1.00 98.71  ? 288 TYR A N     1 
ATOM   1232 C CA    . TYR A 1 184 ? -12.236 60.260 -2.364  1.00 96.69  ? 288 TYR A CA    1 
ATOM   1233 C C     . TYR A 1 184 ? -13.027 61.155 -1.410  1.00 96.08  ? 288 TYR A C     1 
ATOM   1234 O O     . TYR A 1 184 ? -12.841 62.371 -1.419  1.00 91.68  ? 288 TYR A O     1 
ATOM   1235 C CB    . TYR A 1 184 ? -12.865 60.291 -3.754  1.00 105.88 ? 288 TYR A CB    1 
ATOM   1236 C CG    . TYR A 1 184 ? -12.120 59.437 -4.728  1.00 109.25 ? 288 TYR A CG    1 
ATOM   1237 C CD1   . TYR A 1 184 ? -10.828 59.779 -5.132  1.00 115.61 ? 288 TYR A CD1   1 
ATOM   1238 C CD2   . TYR A 1 184 ? -12.680 58.272 -5.221  1.00 109.31 ? 288 TYR A CD2   1 
ATOM   1239 C CE1   . TYR A 1 184 ? -10.123 58.989 -6.019  1.00 114.05 ? 288 TYR A CE1   1 
ATOM   1240 C CE2   . TYR A 1 184 ? -11.988 57.477 -6.116  1.00 128.44 ? 288 TYR A CE2   1 
ATOM   1241 C CZ    . TYR A 1 184 ? -10.714 57.843 -6.513  1.00 126.69 ? 288 TYR A CZ    1 
ATOM   1242 O OH    . TYR A 1 184 ? -10.037 57.050 -7.403  1.00 138.65 ? 288 TYR A OH    1 
ATOM   1243 N N     . TYR A 1 185 ? -13.919 60.565 -0.608  1.00 89.09  ? 289 TYR A N     1 
ATOM   1244 C CA    . TYR A 1 185 ? -14.585 61.308 0.456   1.00 77.48  ? 289 TYR A CA    1 
ATOM   1245 C C     . TYR A 1 185 ? -13.627 61.530 1.635   1.00 75.38  ? 289 TYR A C     1 
ATOM   1246 O O     . TYR A 1 185 ? -13.557 62.631 2.186   1.00 75.98  ? 289 TYR A O     1 
ATOM   1247 C CB    . TYR A 1 185 ? -15.828 60.589 0.922   1.00 77.53  ? 289 TYR A CB    1 
ATOM   1248 C CG    . TYR A 1 185 ? -16.976 60.596 -0.056  1.00 76.73  ? 289 TYR A CG    1 
ATOM   1249 C CD1   . TYR A 1 185 ? -17.055 59.659 -1.071  1.00 72.14  ? 289 TYR A CD1   1 
ATOM   1250 C CD2   . TYR A 1 185 ? -18.013 61.504 0.068   1.00 78.40  ? 289 TYR A CD2   1 
ATOM   1251 C CE1   . TYR A 1 185 ? -18.120 59.643 -1.951  1.00 67.78  ? 289 TYR A CE1   1 
ATOM   1252 C CE2   . TYR A 1 185 ? -19.068 61.500 -0.833  1.00 72.47  ? 289 TYR A CE2   1 
ATOM   1253 C CZ    . TYR A 1 185 ? -19.099 60.566 -1.833  1.00 70.84  ? 289 TYR A CZ    1 
ATOM   1254 O OH    . TYR A 1 185 ? -20.138 60.548 -2.718  1.00 92.05  ? 289 TYR A OH    1 
ATOM   1255 N N     . ILE A 1 186 ? -12.885 60.501 2.031   1.00 66.69  ? 290 ILE A N     1 
ATOM   1256 C CA    . ILE A 1 186 ? -11.856 60.713 3.046   1.00 78.05  ? 290 ILE A CA    1 
ATOM   1257 C C     . ILE A 1 186 ? -10.978 61.863 2.581   1.00 84.05  ? 290 ILE A C     1 
ATOM   1258 O O     . ILE A 1 186 ? -10.873 62.891 3.254   1.00 91.23  ? 290 ILE A O     1 
ATOM   1259 C CB    . ILE A 1 186 ? -10.983 59.466 3.318   1.00 70.86  ? 290 ILE A CB    1 
ATOM   1260 N N     . LYS A 1 187 ? -10.392 61.691 1.395   1.00 89.92  ? 291 LYS A N     1 
ATOM   1261 C CA    . LYS A 1 187 ? -9.513  62.685 0.794   1.00 80.11  ? 291 LYS A CA    1 
ATOM   1262 C C     . LYS A 1 187 ? -10.219 64.044 0.699   1.00 72.03  ? 291 LYS A C     1 
ATOM   1263 O O     . LYS A 1 187 ? -9.632  65.095 0.978   1.00 68.65  ? 291 LYS A O     1 
ATOM   1264 C CB    . LYS A 1 187 ? -9.019  62.193 -0.567  1.00 79.89  ? 291 LYS A CB    1 
ATOM   1265 N N     . LEU A 1 188 ? -11.496 64.024 0.363   1.00 66.93  ? 292 LEU A N     1 
ATOM   1266 C CA    . LEU A 1 188 ? -12.234 65.273 0.325   1.00 75.07  ? 292 LEU A CA    1 
ATOM   1267 C C     . LEU A 1 188 ? -12.178 65.928 1.686   1.00 79.16  ? 292 LEU A C     1 
ATOM   1268 O O     . LEU A 1 188 ? -11.759 67.081 1.790   1.00 84.20  ? 292 LEU A O     1 
ATOM   1269 C CB    . LEU A 1 188 ? -13.675 65.084 -0.106  1.00 70.38  ? 292 LEU A CB    1 
ATOM   1270 C CG    . LEU A 1 188 ? -14.230 66.324 -0.774  1.00 73.65  ? 292 LEU A CG    1 
ATOM   1271 C CD1   . LEU A 1 188 ? -15.549 65.946 -1.405  1.00 89.88  ? 292 LEU A CD1   1 
ATOM   1272 C CD2   . LEU A 1 188 ? -14.452 67.460 0.184   1.00 81.24  ? 292 LEU A CD2   1 
ATOM   1273 N N     . LYS A 1 189 ? -12.568 65.191 2.724   1.00 83.39  ? 293 LYS A N     1 
ATOM   1274 C CA    . LYS A 1 189 ? -12.488 65.714 4.095   1.00 92.93  ? 293 LYS A CA    1 
ATOM   1275 C C     . LYS A 1 189 ? -11.138 66.381 4.362   1.00 95.83  ? 293 LYS A C     1 
ATOM   1276 O O     . LYS A 1 189 ? -11.089 67.564 4.710   1.00 103.55 ? 293 LYS A O     1 
ATOM   1277 C CB    . LYS A 1 189 ? -12.765 64.625 5.134   1.00 89.78  ? 293 LYS A CB    1 
ATOM   1278 C CG    . LYS A 1 189 ? -12.911 65.126 6.575   1.00 77.97  ? 293 LYS A CG    1 
ATOM   1279 C CD    . LYS A 1 189 ? -13.512 64.061 7.485   1.00 73.20  ? 293 LYS A CD    1 
ATOM   1280 C CE    . LYS A 1 189 ? -12.499 62.978 7.890   1.00 85.70  ? 293 LYS A CE    1 
ATOM   1281 N NZ    . LYS A 1 189 ? -11.472 63.395 8.907   1.00 80.41  ? 293 LYS A NZ    1 
ATOM   1282 N N     . ASP A 1 190 ? -10.054 65.638 4.154   1.00 90.28  ? 294 ASP A N     1 
ATOM   1283 C CA    . ASP A 1 190 ? -8.708  66.152 4.404   1.00 96.38  ? 294 ASP A CA    1 
ATOM   1284 C C     . ASP A 1 190 ? -8.489  67.483 3.731   1.00 94.82  ? 294 ASP A C     1 
ATOM   1285 O O     . ASP A 1 190 ? -8.095  68.463 4.377   1.00 100.13 ? 294 ASP A O     1 
ATOM   1286 C CB    . ASP A 1 190 ? -7.653  65.167 3.928   1.00 106.07 ? 294 ASP A CB    1 
ATOM   1287 C CG    . ASP A 1 190 ? -7.484  63.997 4.868   1.00 121.65 ? 294 ASP A CG    1 
ATOM   1288 O OD1   . ASP A 1 190 ? -7.932  64.089 6.031   1.00 136.26 ? 294 ASP A OD1   1 
ATOM   1289 O OD2   . ASP A 1 190 ? -6.896  62.981 4.442   1.00 137.88 ? 294 ASP A OD2   1 
ATOM   1290 N N     . LEU A 1 191 ? -8.764  67.521 2.432   1.00 86.37  ? 295 LEU A N     1 
ATOM   1291 C CA    . LEU A 1 191 ? -8.626  68.752 1.659   1.00 79.86  ? 295 LEU A CA    1 
ATOM   1292 C C     . LEU A 1 191 ? -9.333  69.951 2.324   1.00 74.14  ? 295 LEU A C     1 
ATOM   1293 O O     . LEU A 1 191 ? -8.744  71.032 2.467   1.00 66.83  ? 295 LEU A O     1 
ATOM   1294 C CB    . LEU A 1 191 ? -9.109  68.514 0.219   1.00 67.64  ? 295 LEU A CB    1 
ATOM   1295 C CG    . LEU A 1 191 ? -9.321  69.699 -0.716  1.00 63.94  ? 295 LEU A CG    1 
ATOM   1296 C CD1   . LEU A 1 191 ? -8.097  70.570 -0.776  1.00 61.35  ? 295 LEU A CD1   1 
ATOM   1297 C CD2   . LEU A 1 191 ? -9.648  69.157 -2.084  1.00 66.11  ? 295 LEU A CD2   1 
ATOM   1298 N N     . ARG A 1 192 ? -10.585 69.761 2.728   1.00 74.28  ? 296 ARG A N     1 
ATOM   1299 C CA    . ARG A 1 192 ? -11.340 70.862 3.325   1.00 87.97  ? 296 ARG A CA    1 
ATOM   1300 C C     . ARG A 1 192 ? -10.704 71.304 4.655   1.00 92.38  ? 296 ARG A C     1 
ATOM   1301 O O     . ARG A 1 192 ? -10.563 72.508 4.925   1.00 82.85  ? 296 ARG A O     1 
ATOM   1302 C CB    . ARG A 1 192 ? -12.815 70.499 3.490   1.00 86.12  ? 296 ARG A CB    1 
ATOM   1303 C CG    . ARG A 1 192 ? -13.111 69.643 4.701   1.00 89.34  ? 296 ARG A CG    1 
ATOM   1304 C CD    . ARG A 1 192 ? -13.542 70.508 5.882   1.00 86.50  ? 296 ARG A CD    1 
ATOM   1305 N NE    . ARG A 1 192 ? -14.954 70.297 6.118   1.00 87.02  ? 296 ARG A NE    1 
ATOM   1306 C CZ    . ARG A 1 192 ? -15.440 69.310 6.859   1.00 94.60  ? 296 ARG A CZ    1 
ATOM   1307 N NH1   . ARG A 1 192 ? -14.597 68.477 7.479   1.00 85.01  ? 296 ARG A NH1   1 
ATOM   1308 N NH2   . ARG A 1 192 ? -16.766 69.169 6.983   1.00 89.29  ? 296 ARG A NH2   1 
ATOM   1309 N N     . ASP A 1 193 ? -10.310 70.317 5.461   1.00 91.15  ? 297 ASP A N     1 
ATOM   1310 C CA    . ASP A 1 193 ? -9.611  70.573 6.709   1.00 95.18  ? 297 ASP A CA    1 
ATOM   1311 C C     . ASP A 1 193 ? -8.334  71.369 6.449   1.00 96.47  ? 297 ASP A C     1 
ATOM   1312 O O     . ASP A 1 193 ? -8.145  72.428 7.059   1.00 104.56 ? 297 ASP A O     1 
ATOM   1313 C CB    . ASP A 1 193 ? -9.320  69.270 7.444   1.00 101.64 ? 297 ASP A CB    1 
ATOM   1314 C CG    . ASP A 1 193 ? -10.581 68.596 7.944   1.00 103.01 ? 297 ASP A CG    1 
ATOM   1315 O OD1   . ASP A 1 193 ? -11.515 69.312 8.369   1.00 116.12 ? 297 ASP A OD1   1 
ATOM   1316 O OD2   . ASP A 1 193 ? -10.642 67.348 7.901   1.00 111.26 ? 297 ASP A OD2   1 
ATOM   1317 N N     . GLN A 1 194 ? -7.490  70.895 5.527   1.00 91.74  ? 298 GLN A N     1 
ATOM   1318 C CA    . GLN A 1 194 ? -6.335  71.687 5.065   1.00 94.06  ? 298 GLN A CA    1 
ATOM   1319 C C     . GLN A 1 194 ? -6.753  73.128 4.794   1.00 86.93  ? 298 GLN A C     1 
ATOM   1320 O O     . GLN A 1 194 ? -6.090  74.066 5.221   1.00 88.49  ? 298 GLN A O     1 
ATOM   1321 C CB    . GLN A 1 194 ? -5.725  71.131 3.771   1.00 98.44  ? 298 GLN A CB    1 
ATOM   1322 C CG    . GLN A 1 194 ? -4.899  69.858 3.850   1.00 104.07 ? 298 GLN A CG    1 
ATOM   1323 C CD    . GLN A 1 194 ? -3.875  69.779 2.702   1.00 113.31 ? 298 GLN A CD    1 
ATOM   1324 O OE1   . GLN A 1 194 ? -3.126  70.735 2.456   1.00 102.11 ? 298 GLN A OE1   1 
ATOM   1325 N NE2   . GLN A 1 194 ? -3.840  68.642 1.999   1.00 107.50 ? 298 GLN A NE2   1 
ATOM   1326 N N     . LEU A 1 195 ? -7.864  73.304 4.085   1.00 85.86  ? 299 LEU A N     1 
ATOM   1327 C CA    . LEU A 1 195 ? -8.271  74.640 3.679   1.00 87.28  ? 299 LEU A CA    1 
ATOM   1328 C C     . LEU A 1 195 ? -8.731  75.469 4.863   1.00 87.57  ? 299 LEU A C     1 
ATOM   1329 O O     . LEU A 1 195 ? -8.473  76.674 4.918   1.00 81.38  ? 299 LEU A O     1 
ATOM   1330 C CB    . LEU A 1 195 ? -9.339  74.567 2.591   1.00 90.82  ? 299 LEU A CB    1 
ATOM   1331 C CG    . LEU A 1 195 ? -8.890  74.235 1.161   1.00 79.64  ? 299 LEU A CG    1 
ATOM   1332 C CD1   . LEU A 1 195 ? -9.997  73.490 0.446   1.00 69.40  ? 299 LEU A CD1   1 
ATOM   1333 C CD2   . LEU A 1 195 ? -8.551  75.510 0.406   1.00 71.24  ? 299 LEU A CD2   1 
ATOM   1334 N N     . LYS A 1 196 ? -9.399  74.819 5.817   1.00 98.55  ? 300 LYS A N     1 
ATOM   1335 C CA    . LYS A 1 196 ? -9.781  75.482 7.072   1.00 99.55  ? 300 LYS A CA    1 
ATOM   1336 C C     . LYS A 1 196 ? -8.549  75.774 7.967   1.00 106.21 ? 300 LYS A C     1 
ATOM   1337 O O     . LYS A 1 196 ? -8.436  76.870 8.534   1.00 109.85 ? 300 LYS A O     1 
ATOM   1338 C CB    . LYS A 1 196 ? -10.859 74.693 7.809   1.00 79.15  ? 300 LYS A CB    1 
ATOM   1339 N N     . GLY A 1 197 ? -7.626  74.816 8.065   1.00 90.45  ? 301 GLY A N     1 
ATOM   1340 C CA    . GLY A 1 197 ? -6.328  75.054 8.705   1.00 96.63  ? 301 GLY A CA    1 
ATOM   1341 C C     . GLY A 1 197 ? -5.742  76.431 8.386   1.00 110.47 ? 301 GLY A C     1 
ATOM   1342 O O     . GLY A 1 197 ? -5.489  77.233 9.292   1.00 119.27 ? 301 GLY A O     1 
ATOM   1343 N N     . ILE A 1 198 ? -5.554  76.724 7.097   1.00 109.05 ? 302 ILE A N     1 
ATOM   1344 C CA    . ILE A 1 198 ? -4.954  77.999 6.669   1.00 109.68 ? 302 ILE A CA    1 
ATOM   1345 C C     . ILE A 1 198 ? -5.778  79.235 7.096   1.00 118.30 ? 302 ILE A C     1 
ATOM   1346 O O     . ILE A 1 198 ? -5.342  80.378 6.918   1.00 98.63  ? 302 ILE A O     1 
ATOM   1347 C CB    . ILE A 1 198 ? -4.650  78.012 5.154   1.00 102.64 ? 302 ILE A CB    1 
ATOM   1348 N N     . GLU A 1 199 ? -6.953  79.002 7.685   1.00 129.50 ? 303 GLU A N     1 
ATOM   1349 C CA    . GLU A 1 199 ? -7.722  80.081 8.322   1.00 135.86 ? 303 GLU A CA    1 
ATOM   1350 C C     . GLU A 1 199 ? -7.146  80.514 9.681   1.00 135.96 ? 303 GLU A C     1 
ATOM   1351 O O     . GLU A 1 199 ? -7.885  80.644 10.669  1.00 129.58 ? 303 GLU A O     1 
ATOM   1352 C CB    . GLU A 1 199 ? -9.202  79.703 8.473   1.00 131.52 ? 303 GLU A CB    1 
ATOM   1353 C CG    . GLU A 1 199 ? -10.114 80.329 7.425   1.00 140.90 ? 303 GLU A CG    1 
ATOM   1354 C CD    . GLU A 1 199 ? -11.514 80.644 7.954   1.00 149.61 ? 303 GLU A CD    1 
ATOM   1355 O OE1   . GLU A 1 199 ? -11.980 79.974 8.910   1.00 154.84 ? 303 GLU A OE1   1 
ATOM   1356 O OE2   . GLU A 1 199 ? -12.160 81.569 7.407   1.00 136.89 ? 303 GLU A OE2   1 
ATOM   1357 N N     . ARG A 1 200 ? -5.829  80.737 9.712   1.00 146.92 ? 304 ARG A N     1 
ATOM   1358 C CA    . ARG A 1 200 ? -5.085  81.196 10.909  1.00 144.50 ? 304 ARG A CA    1 
ATOM   1359 C C     . ARG A 1 200 ? -3.564  81.090 10.723  1.00 135.48 ? 304 ARG A C     1 
ATOM   1360 O O     . ARG A 1 200 ? -3.023  80.008 10.460  1.00 129.14 ? 304 ARG A O     1 
ATOM   1361 C CB    . ARG A 1 200 ? -5.529  80.462 12.193  1.00 138.82 ? 304 ARG A CB    1 
ATOM   1362 C CG    . ARG A 1 200 ? -5.534  78.936 12.106  1.00 137.45 ? 304 ARG A CG    1 
ATOM   1363 C CD    . ARG A 1 200 ? -6.598  78.307 12.994  1.00 144.66 ? 304 ARG A CD    1 
ATOM   1364 N NE    . ARG A 1 200 ? -7.952  78.769 12.675  1.00 153.86 ? 304 ARG A NE    1 
ATOM   1365 C CZ    . ARG A 1 200 ? -9.069  78.238 13.169  1.00 151.45 ? 304 ARG A CZ    1 
ATOM   1366 N NH1   . ARG A 1 200 ? -9.011  77.200 14.002  1.00 135.08 ? 304 ARG A NH1   1 
ATOM   1367 N NH2   . ARG A 1 200 ? -10.249 78.742 12.822  1.00 151.14 ? 304 ARG A NH2   1 
ATOM   1368 N N     . THR B 1 19  ? -51.785 61.518 -13.470 1.00 72.60  ? 123 THR B N     1 
ATOM   1369 C CA    . THR B 1 19  ? -50.456 61.261 -14.113 1.00 88.33  ? 123 THR B CA    1 
ATOM   1370 C C     . THR B 1 19  ? -50.506 60.666 -15.573 1.00 103.12 ? 123 THR B C     1 
ATOM   1371 O O     . THR B 1 19  ? -50.378 61.435 -16.553 1.00 92.37  ? 123 THR B O     1 
ATOM   1372 C CB    . THR B 1 19  ? -49.570 60.422 -13.181 1.00 87.23  ? 123 THR B CB    1 
ATOM   1373 N N     . LEU B 1 20  ? -50.683 59.331 -15.700 1.00 102.29 ? 124 LEU B N     1 
ATOM   1374 C CA    . LEU B 1 20  ? -50.725 58.584 -16.992 1.00 95.75  ? 124 LEU B CA    1 
ATOM   1375 C C     . LEU B 1 20  ? -52.162 58.434 -17.517 1.00 104.73 ? 124 LEU B C     1 
ATOM   1376 O O     . LEU B 1 20  ? -53.065 58.070 -16.753 1.00 109.45 ? 124 LEU B O     1 
ATOM   1377 C CB    . LEU B 1 20  ? -50.079 57.185 -16.831 1.00 89.03  ? 124 LEU B CB    1 
ATOM   1378 C CG    . LEU B 1 20  ? -49.716 56.270 -18.014 1.00 94.68  ? 124 LEU B CG    1 
ATOM   1379 C CD1   . LEU B 1 20  ? -48.806 56.930 -19.046 1.00 96.72  ? 124 LEU B CD1   1 
ATOM   1380 C CD2   . LEU B 1 20  ? -49.042 55.000 -17.526 1.00 95.76  ? 124 LEU B CD2   1 
ATOM   1381 N N     . PRO B 1 21  ? -52.384 58.709 -18.821 1.00 105.96 ? 125 PRO B N     1 
ATOM   1382 C CA    . PRO B 1 21  ? -53.752 58.727 -19.385 1.00 106.55 ? 125 PRO B CA    1 
ATOM   1383 C C     . PRO B 1 21  ? -54.351 57.346 -19.701 1.00 114.10 ? 125 PRO B C     1 
ATOM   1384 O O     . PRO B 1 21  ? -53.617 56.428 -20.080 1.00 124.53 ? 125 PRO B O     1 
ATOM   1385 C CB    . PRO B 1 21  ? -53.571 59.506 -20.685 1.00 99.28  ? 125 PRO B CB    1 
ATOM   1386 C CG    . PRO B 1 21  ? -52.175 59.170 -21.103 1.00 106.95 ? 125 PRO B CG    1 
ATOM   1387 C CD    . PRO B 1 21  ? -51.375 59.095 -19.829 1.00 101.14 ? 125 PRO B CD    1 
ATOM   1388 N N     . ASP B 1 22  ? -55.673 57.214 -19.563 1.00 104.54 ? 126 ASP B N     1 
ATOM   1389 C CA    . ASP B 1 22  ? -56.361 55.969 -19.906 1.00 93.66  ? 126 ASP B CA    1 
ATOM   1390 C C     . ASP B 1 22  ? -56.594 55.867 -21.391 1.00 90.79  ? 126 ASP B C     1 
ATOM   1391 O O     . ASP B 1 22  ? -57.414 56.595 -21.943 1.00 113.11 ? 126 ASP B O     1 
ATOM   1392 C CB    . ASP B 1 22  ? -57.715 55.863 -19.190 1.00 91.46  ? 126 ASP B CB    1 
ATOM   1393 C CG    . ASP B 1 22  ? -57.571 55.688 -17.699 1.00 89.39  ? 126 ASP B CG    1 
ATOM   1394 O OD1   . ASP B 1 22  ? -56.488 55.232 -17.258 1.00 87.18  ? 126 ASP B OD1   1 
ATOM   1395 O OD2   . ASP B 1 22  ? -58.544 55.998 -16.967 1.00 79.91  ? 126 ASP B OD2   1 
ATOM   1396 N N     . ILE B 1 23  ? -55.874 54.971 -22.039 1.00 83.26  ? 127 ILE B N     1 
ATOM   1397 C CA    . ILE B 1 23  ? -56.232 54.570 -23.386 1.00 93.31  ? 127 ILE B CA    1 
ATOM   1398 C C     . ILE B 1 23  ? -57.429 53.606 -23.318 1.00 103.66 ? 127 ILE B C     1 
ATOM   1399 O O     . ILE B 1 23  ? -57.263 52.413 -23.010 1.00 116.71 ? 127 ILE B O     1 
ATOM   1400 C CB    . ILE B 1 23  ? -55.046 53.885 -24.097 1.00 87.05  ? 127 ILE B CB    1 
ATOM   1401 C CG1   . ILE B 1 23  ? -53.928 54.894 -24.364 1.00 72.68  ? 127 ILE B CG1   1 
ATOM   1402 C CG2   . ILE B 1 23  ? -55.509 53.203 -25.386 1.00 95.47  ? 127 ILE B CG2   1 
ATOM   1403 C CD1   . ILE B 1 23  ? -52.614 54.232 -24.738 1.00 68.14  ? 127 ILE B CD1   1 
ATOM   1404 N N     . LEU B 1 24  ? -58.626 54.122 -23.589 1.00 96.14  ? 128 LEU B N     1 
ATOM   1405 C CA    . LEU B 1 24  ? -59.842 53.307 -23.518 1.00 93.75  ? 128 LEU B CA    1 
ATOM   1406 C C     . LEU B 1 24  ? -60.876 53.679 -24.583 1.00 95.28  ? 128 LEU B C     1 
ATOM   1407 O O     . LEU B 1 24  ? -61.124 54.857 -24.849 1.00 106.42 ? 128 LEU B O     1 
ATOM   1408 C CB    . LEU B 1 24  ? -60.468 53.378 -22.114 1.00 87.94  ? 128 LEU B CB    1 
ATOM   1409 C CG    . LEU B 1 24  ? -59.680 52.818 -20.922 1.00 91.24  ? 128 LEU B CG    1 
ATOM   1410 C CD1   . LEU B 1 24  ? -60.349 53.109 -19.591 1.00 89.85  ? 128 LEU B CD1   1 
ATOM   1411 C CD2   . LEU B 1 24  ? -59.465 51.322 -21.079 1.00 106.25 ? 128 LEU B CD2   1 
ATOM   1412 N N     . THR B 1 25  ? -61.483 52.657 -25.174 1.00 111.76 ? 129 THR B N     1 
ATOM   1413 C CA    . THR B 1 25  ? -62.556 52.812 -26.157 1.00 119.30 ? 129 THR B CA    1 
ATOM   1414 C C     . THR B 1 25  ? -63.737 51.885 -25.839 1.00 115.13 ? 129 THR B C     1 
ATOM   1415 O O     . THR B 1 25  ? -63.659 51.049 -24.928 1.00 109.50 ? 129 THR B O     1 
ATOM   1416 C CB    . THR B 1 25  ? -62.039 52.493 -27.572 1.00 128.68 ? 129 THR B CB    1 
ATOM   1417 O OG1   . THR B 1 25  ? -61.322 51.249 -27.548 1.00 141.80 ? 129 THR B OG1   1 
ATOM   1418 C CG2   . THR B 1 25  ? -61.109 53.584 -28.056 1.00 119.06 ? 129 THR B CG2   1 
ATOM   1419 N N     . PHE B 1 26  ? -64.828 52.046 -26.588 1.00 119.99 ? 130 PHE B N     1 
ATOM   1420 C CA    . PHE B 1 26  ? -65.982 51.145 -26.502 1.00 122.58 ? 130 PHE B CA    1 
ATOM   1421 C C     . PHE B 1 26  ? -65.764 49.869 -27.315 1.00 136.97 ? 130 PHE B C     1 
ATOM   1422 O O     . PHE B 1 26  ? -65.043 49.878 -28.327 1.00 128.11 ? 130 PHE B O     1 
ATOM   1423 C CB    . PHE B 1 26  ? -67.249 51.847 -26.996 1.00 108.13 ? 130 PHE B CB    1 
ATOM   1424 C CG    . PHE B 1 26  ? -67.846 52.786 -25.997 1.00 100.36 ? 130 PHE B CG    1 
ATOM   1425 C CD1   . PHE B 1 26  ? -68.629 52.307 -24.951 1.00 97.92  ? 130 PHE B CD1   1 
ATOM   1426 C CD2   . PHE B 1 26  ? -67.628 54.148 -26.101 1.00 101.91 ? 130 PHE B CD2   1 
ATOM   1427 C CE1   . PHE B 1 26  ? -69.178 53.174 -24.023 1.00 92.92  ? 130 PHE B CE1   1 
ATOM   1428 C CE2   . PHE B 1 26  ? -68.173 55.024 -25.175 1.00 102.32 ? 130 PHE B CE2   1 
ATOM   1429 C CZ    . PHE B 1 26  ? -68.949 54.534 -24.132 1.00 99.11  ? 130 PHE B CZ    1 
ATOM   1430 N N     . ASN B 1 27  ? -66.405 48.782 -26.881 1.00 141.00 ? 131 ASN B N     1 
ATOM   1431 C CA    . ASN B 1 27  ? -66.336 47.510 -27.601 1.00 149.79 ? 131 ASN B CA    1 
ATOM   1432 C C     . ASN B 1 27  ? -64.875 47.124 -27.892 1.00 146.69 ? 131 ASN B C     1 
ATOM   1433 O O     . ASN B 1 27  ? -64.374 47.253 -29.019 1.00 120.50 ? 131 ASN B O     1 
ATOM   1434 C CB    . ASN B 1 27  ? -67.198 47.554 -28.878 1.00 151.30 ? 131 ASN B CB    1 
ATOM   1435 C CG    . ASN B 1 27  ? -66.833 46.462 -29.872 1.00 157.61 ? 131 ASN B CG    1 
ATOM   1436 O OD1   . ASN B 1 27  ? -66.890 45.266 -29.558 1.00 139.87 ? 131 ASN B OD1   1 
ATOM   1437 N ND2   . ASN B 1 27  ? -66.446 46.871 -31.079 1.00 150.92 ? 131 ASN B ND2   1 
ATOM   1438 N N     . LEU B 1 28  ? -64.208 46.664 -26.838 1.00 142.77 ? 132 LEU B N     1 
ATOM   1439 C CA    . LEU B 1 28  ? -62.787 46.367 -26.856 1.00 117.73 ? 132 LEU B CA    1 
ATOM   1440 C C     . LEU B 1 28  ? -62.617 44.910 -26.455 1.00 104.15 ? 132 LEU B C     1 
ATOM   1441 O O     . LEU B 1 28  ? -63.353 44.411 -25.603 1.00 111.27 ? 132 LEU B O     1 
ATOM   1442 C CB    . LEU B 1 28  ? -62.105 47.284 -25.840 1.00 114.92 ? 132 LEU B CB    1 
ATOM   1443 C CG    . LEU B 1 28  ? -60.655 47.745 -25.945 1.00 107.34 ? 132 LEU B CG    1 
ATOM   1444 C CD1   . LEU B 1 28  ? -60.251 48.120 -27.363 1.00 99.52  ? 132 LEU B CD1   1 
ATOM   1445 C CD2   . LEU B 1 28  ? -60.498 48.934 -25.010 1.00 102.84 ? 132 LEU B CD2   1 
ATOM   1446 N N     . ASP B 1 29  ? -61.662 44.222 -27.062 1.00 93.67  ? 133 ASP B N     1 
ATOM   1447 C CA    . ASP B 1 29  ? -61.368 42.851 -26.652 1.00 96.11  ? 133 ASP B CA    1 
ATOM   1448 C C     . ASP B 1 29  ? -60.761 42.810 -25.245 1.00 102.89 ? 133 ASP B C     1 
ATOM   1449 O O     . ASP B 1 29  ? -61.452 42.512 -24.264 1.00 120.42 ? 133 ASP B O     1 
ATOM   1450 C CB    . ASP B 1 29  ? -60.437 42.164 -27.651 1.00 88.80  ? 133 ASP B CB    1 
ATOM   1451 C CG    . ASP B 1 29  ? -60.969 42.192 -29.054 1.00 95.99  ? 133 ASP B CG    1 
ATOM   1452 O OD1   . ASP B 1 29  ? -62.004 42.856 -29.281 1.00 100.58 ? 133 ASP B OD1   1 
ATOM   1453 O OD2   . ASP B 1 29  ? -60.346 41.538 -29.923 1.00 95.30  ? 133 ASP B OD2   1 
ATOM   1454 N N     . ILE B 1 30  ? -59.479 43.145 -25.155 1.00 90.63  ? 134 ILE B N     1 
ATOM   1455 C CA    . ILE B 1 30  ? -58.738 43.091 -23.909 1.00 85.56  ? 134 ILE B CA    1 
ATOM   1456 C C     . ILE B 1 30  ? -58.507 44.475 -23.300 1.00 89.37  ? 134 ILE B C     1 
ATOM   1457 O O     . ILE B 1 30  ? -58.241 45.450 -24.006 1.00 95.58  ? 134 ILE B O     1 
ATOM   1458 C CB    . ILE B 1 30  ? -57.372 42.421 -24.144 1.00 79.48  ? 134 ILE B CB    1 
ATOM   1459 N N     . VAL B 1 31  ? -58.605 44.556 -21.981 1.00 88.22  ? 135 VAL B N     1 
ATOM   1460 C CA    . VAL B 1 31  ? -58.125 45.740 -21.248 1.00 81.55  ? 135 VAL B CA    1 
ATOM   1461 C C     . VAL B 1 31  ? -57.019 45.338 -20.246 1.00 83.80  ? 135 VAL B C     1 
ATOM   1462 O O     . VAL B 1 31  ? -57.237 44.511 -19.362 1.00 86.60  ? 135 VAL B O     1 
ATOM   1463 C CB    . VAL B 1 31  ? -59.290 46.458 -20.568 1.00 69.08  ? 135 VAL B CB    1 
ATOM   1464 C CG1   . VAL B 1 31  ? -58.820 47.380 -19.469 1.00 73.11  ? 135 VAL B CG1   1 
ATOM   1465 C CG2   . VAL B 1 31  ? -60.054 47.256 -21.599 1.00 82.18  ? 135 VAL B CG2   1 
ATOM   1466 N N     . ILE B 1 32  ? -55.831 45.898 -20.398 1.00 71.12  ? 136 ILE B N     1 
ATOM   1467 C CA    . ILE B 1 32  ? -54.754 45.577 -19.485 1.00 68.13  ? 136 ILE B CA    1 
ATOM   1468 C C     . ILE B 1 32  ? -54.914 46.477 -18.284 1.00 73.38  ? 136 ILE B C     1 
ATOM   1469 O O     . ILE B 1 32  ? -55.353 47.605 -18.421 1.00 83.84  ? 136 ILE B O     1 
ATOM   1470 C CB    . ILE B 1 32  ? -53.382 45.782 -20.137 1.00 72.33  ? 136 ILE B CB    1 
ATOM   1471 C CG1   . ILE B 1 32  ? -53.323 45.105 -21.533 1.00 64.90  ? 136 ILE B CG1   1 
ATOM   1472 C CG2   . ILE B 1 32  ? -52.283 45.270 -19.211 1.00 76.38  ? 136 ILE B CG2   1 
ATOM   1473 C CD1   . ILE B 1 32  ? -53.908 43.703 -21.558 1.00 69.14  ? 136 ILE B CD1   1 
ATOM   1474 N N     . ILE B 1 33  ? -54.603 45.979 -17.098 1.00 78.54  ? 137 ILE B N     1 
ATOM   1475 C CA    . ILE B 1 33  ? -54.906 46.738 -15.879 1.00 85.12  ? 137 ILE B CA    1 
ATOM   1476 C C     . ILE B 1 33  ? -53.761 46.608 -14.892 1.00 93.39  ? 137 ILE B C     1 
ATOM   1477 O O     . ILE B 1 33  ? -53.560 45.546 -14.271 1.00 91.21  ? 137 ILE B O     1 
ATOM   1478 C CB    . ILE B 1 33  ? -56.207 46.265 -15.206 1.00 78.97  ? 137 ILE B CB    1 
ATOM   1479 C CG1   . ILE B 1 33  ? -57.387 46.409 -16.149 1.00 78.61  ? 137 ILE B CG1   1 
ATOM   1480 C CG2   . ILE B 1 33  ? -56.459 47.017 -13.917 1.00 86.73  ? 137 ILE B CG2   1 
ATOM   1481 C CD1   . ILE B 1 33  ? -58.644 45.778 -15.605 1.00 89.15  ? 137 ILE B CD1   1 
ATOM   1482 N N     . GLY B 1 34  ? -53.008 47.694 -14.756 1.00 96.88  ? 138 GLY B N     1 
ATOM   1483 C CA    . GLY B 1 34  ? -51.865 47.725 -13.842 1.00 99.17  ? 138 GLY B CA    1 
ATOM   1484 C C     . GLY B 1 34  ? -52.244 48.166 -12.442 1.00 92.71  ? 138 GLY B C     1 
ATOM   1485 O O     . GLY B 1 34  ? -53.382 48.611 -12.188 1.00 78.95  ? 138 GLY B O     1 
ATOM   1486 N N     . ILE B 1 35  ? -51.291 48.032 -11.531 1.00 79.49  ? 139 ILE B N     1 
ATOM   1487 C CA    . ILE B 1 35  ? -51.473 48.542 -10.182 1.00 83.77  ? 139 ILE B CA    1 
ATOM   1488 C C     . ILE B 1 35  ? -51.571 50.072 -10.295 1.00 89.81  ? 139 ILE B C     1 
ATOM   1489 O O     . ILE B 1 35  ? -52.657 50.627 -10.122 1.00 102.19 ? 139 ILE B O     1 
ATOM   1490 C CB    . ILE B 1 35  ? -50.320 48.113 -9.242  1.00 85.60  ? 139 ILE B CB    1 
ATOM   1491 C CG1   . ILE B 1 35  ? -50.058 46.594 -9.323  1.00 78.50  ? 139 ILE B CG1   1 
ATOM   1492 C CG2   . ILE B 1 35  ? -50.617 48.518 -7.813  1.00 71.34  ? 139 ILE B CG2   1 
ATOM   1493 C CD1   . ILE B 1 35  ? -49.339 46.127 -10.581 1.00 68.37  ? 139 ILE B CD1   1 
ATOM   1494 N N     . ASN B 1 36  ? -50.454 50.735 -10.615 1.00 76.36  ? 140 ASN B N     1 
ATOM   1495 C CA    . ASN B 1 36  ? -50.424 52.188 -10.826 1.00 75.99  ? 140 ASN B CA    1 
ATOM   1496 C C     . ASN B 1 36  ? -49.222 52.558 -11.681 1.00 82.90  ? 140 ASN B C     1 
ATOM   1497 O O     . ASN B 1 36  ? -48.283 51.765 -11.773 1.00 77.52  ? 140 ASN B O     1 
ATOM   1498 C CB    . ASN B 1 36  ? -50.339 52.936 -9.510  1.00 68.86  ? 140 ASN B CB    1 
ATOM   1499 C CG    . ASN B 1 36  ? -49.083 52.627 -8.755  1.00 76.32  ? 140 ASN B CG    1 
ATOM   1500 O OD1   . ASN B 1 36  ? -48.682 51.471 -8.633  1.00 77.64  ? 140 ASN B OD1   1 
ATOM   1501 N ND2   . ASN B 1 36  ? -48.440 53.657 -8.251  1.00 78.52  ? 140 ASN B ND2   1 
ATOM   1502 N N     . PRO B 1 37  ? -49.236 53.756 -12.304 1.00 81.03  ? 141 PRO B N     1 
ATOM   1503 C CA    . PRO B 1 37  ? -48.139 54.048 -13.214 1.00 87.73  ? 141 PRO B CA    1 
ATOM   1504 C C     . PRO B 1 37  ? -46.821 54.179 -12.476 1.00 90.15  ? 141 PRO B C     1 
ATOM   1505 O O     . PRO B 1 37  ? -46.768 54.793 -11.406 1.00 98.53  ? 141 PRO B O     1 
ATOM   1506 C CB    . PRO B 1 37  ? -48.567 55.366 -13.882 1.00 86.64  ? 141 PRO B CB    1 
ATOM   1507 C CG    . PRO B 1 37  ? -49.567 55.952 -12.964 1.00 84.23  ? 141 PRO B CG    1 
ATOM   1508 C CD    . PRO B 1 37  ? -50.275 54.794 -12.347 1.00 84.27  ? 141 PRO B CD    1 
ATOM   1509 N N     . GLY B 1 38  ? -45.776 53.571 -13.033 1.00 91.39  ? 142 GLY B N     1 
ATOM   1510 C CA    . GLY B 1 38  ? -44.436 53.633 -12.447 1.00 84.13  ? 142 GLY B CA    1 
ATOM   1511 C C     . GLY B 1 38  ? -43.842 54.995 -12.709 1.00 88.33  ? 142 GLY B C     1 
ATOM   1512 O O     . GLY B 1 38  ? -44.343 55.767 -13.538 1.00 90.31  ? 142 GLY B O     1 
ATOM   1513 N N     . LEU B 1 39  ? -42.770 55.298 -11.995 1.00 90.74  ? 143 LEU B N     1 
ATOM   1514 C CA    . LEU B 1 39  ? -42.059 56.551 -12.175 1.00 69.18  ? 143 LEU B CA    1 
ATOM   1515 C C     . LEU B 1 39  ? -41.729 56.751 -13.619 1.00 67.55  ? 143 LEU B C     1 
ATOM   1516 O O     . LEU B 1 39  ? -42.018 57.813 -14.161 1.00 66.46  ? 143 LEU B O     1 
ATOM   1517 C CB    . LEU B 1 39  ? -40.777 56.514 -11.381 1.00 66.18  ? 143 LEU B CB    1 
ATOM   1518 C CG    . LEU B 1 39  ? -40.960 56.716 -9.895  1.00 57.94  ? 143 LEU B CG    1 
ATOM   1519 C CD1   . LEU B 1 39  ? -39.541 56.726 -9.306  1.00 60.55  ? 143 LEU B CD1   1 
ATOM   1520 C CD2   . LEU B 1 39  ? -41.718 58.029 -9.695  1.00 44.01  ? 143 LEU B CD2   1 
ATOM   1521 N N     . MET B 1 40  ? -41.148 55.728 -14.249 1.00 64.93  ? 144 MET B N     1 
ATOM   1522 C CA    . MET B 1 40  ? -40.813 55.854 -15.669 1.00 70.57  ? 144 MET B CA    1 
ATOM   1523 C C     . MET B 1 40  ? -42.076 56.138 -16.479 1.00 72.37  ? 144 MET B C     1 
ATOM   1524 O O     . MET B 1 40  ? -42.193 57.166 -17.123 1.00 74.91  ? 144 MET B O     1 
ATOM   1525 C CB    . MET B 1 40  ? -40.149 54.604 -16.189 1.00 69.36  ? 144 MET B CB    1 
ATOM   1526 C CG    . MET B 1 40  ? -39.801 54.712 -17.659 1.00 80.08  ? 144 MET B CG    1 
ATOM   1527 S SD    . MET B 1 40  ? -38.216 55.528 -17.834 1.00 89.14  ? 144 MET B SD    1 
ATOM   1528 C CE    . MET B 1 40  ? -37.110 54.228 -17.225 1.00 74.16  ? 144 MET B CE    1 
ATOM   1529 N N     . ALA B 1 41  ? -43.034 55.230 -16.397 1.00 71.71  ? 145 ALA B N     1 
ATOM   1530 C CA    . ALA B 1 41  ? -44.286 55.360 -17.091 1.00 73.76  ? 145 ALA B CA    1 
ATOM   1531 C C     . ALA B 1 41  ? -44.754 56.802 -17.039 1.00 85.70  ? 145 ALA B C     1 
ATOM   1532 O O     . ALA B 1 41  ? -44.961 57.432 -18.083 1.00 83.89  ? 145 ALA B O     1 
ATOM   1533 C CB    . ALA B 1 41  ? -45.318 54.450 -16.443 1.00 81.82  ? 145 ALA B CB    1 
ATOM   1534 N N     . ALA B 1 42  ? -44.904 57.314 -15.815 1.00 81.13  ? 146 ALA B N     1 
ATOM   1535 C CA    . ALA B 1 42  ? -45.373 58.667 -15.593 1.00 81.38  ? 146 ALA B CA    1 
ATOM   1536 C C     . ALA B 1 42  ? -44.512 59.692 -16.357 1.00 85.58  ? 146 ALA B C     1 
ATOM   1537 O O     . ALA B 1 42  ? -45.042 60.555 -17.054 1.00 87.51  ? 146 ALA B O     1 
ATOM   1538 C CB    . ALA B 1 42  ? -45.400 58.976 -14.103 1.00 74.58  ? 146 ALA B CB    1 
ATOM   1539 N N     . TYR B 1 43  ? -43.193 59.581 -16.228 1.00 79.54  ? 147 TYR B N     1 
ATOM   1540 C CA    . TYR B 1 43  ? -42.280 60.453 -16.954 1.00 85.13  ? 147 TYR B CA    1 
ATOM   1541 C C     . TYR B 1 43  ? -42.404 60.295 -18.492 1.00 84.74  ? 147 TYR B C     1 
ATOM   1542 O O     . TYR B 1 43  ? -42.524 61.275 -19.220 1.00 87.42  ? 147 TYR B O     1 
ATOM   1543 C CB    . TYR B 1 43  ? -40.818 60.263 -16.477 1.00 77.15  ? 147 TYR B CB    1 
ATOM   1544 C CG    . TYR B 1 43  ? -39.809 60.932 -17.377 1.00 68.99  ? 147 TYR B CG    1 
ATOM   1545 C CD1   . TYR B 1 43  ? -39.657 62.331 -17.397 1.00 69.09  ? 147 TYR B CD1   1 
ATOM   1546 C CD2   . TYR B 1 43  ? -39.047 60.178 -18.251 1.00 72.24  ? 147 TYR B CD2   1 
ATOM   1547 C CE1   . TYR B 1 43  ? -38.758 62.945 -18.276 1.00 69.92  ? 147 TYR B CE1   1 
ATOM   1548 C CE2   . TYR B 1 43  ? -38.148 60.778 -19.128 1.00 77.77  ? 147 TYR B CE2   1 
ATOM   1549 C CZ    . TYR B 1 43  ? -38.006 62.154 -19.137 1.00 74.50  ? 147 TYR B CZ    1 
ATOM   1550 O OH    . TYR B 1 43  ? -37.102 62.704 -20.005 1.00 82.93  ? 147 TYR B OH    1 
ATOM   1551 N N     . LYS B 1 44  ? -42.385 59.063 -18.969 1.00 81.17  ? 148 LYS B N     1 
ATOM   1552 C CA    . LYS B 1 44  ? -42.391 58.800 -20.395 1.00 84.15  ? 148 LYS B CA    1 
ATOM   1553 C C     . LYS B 1 44  ? -43.743 59.115 -21.047 1.00 91.69  ? 148 LYS B C     1 
ATOM   1554 O O     . LYS B 1 44  ? -43.810 59.290 -22.261 1.00 108.67 ? 148 LYS B O     1 
ATOM   1555 C CB    . LYS B 1 44  ? -42.011 57.347 -20.670 1.00 81.43  ? 148 LYS B CB    1 
ATOM   1556 C CG    . LYS B 1 44  ? -41.185 57.143 -21.925 1.00 81.27  ? 148 LYS B CG    1 
ATOM   1557 C CD    . LYS B 1 44  ? -39.699 57.336 -21.631 1.00 73.97  ? 148 LYS B CD    1 
ATOM   1558 N N     . GLY B 1 45  ? -44.805 59.201 -20.247 1.00 94.34  ? 149 GLY B N     1 
ATOM   1559 C CA    . GLY B 1 45  ? -46.172 59.430 -20.757 1.00 89.51  ? 149 GLY B CA    1 
ATOM   1560 C C     . GLY B 1 45  ? -46.781 58.265 -21.565 1.00 106.26 ? 149 GLY B C     1 
ATOM   1561 O O     . GLY B 1 45  ? -47.694 58.475 -22.376 1.00 96.65  ? 149 GLY B O     1 
ATOM   1562 N N     . HIS B 1 46  ? -46.284 57.042 -21.343 1.00 101.76 ? 150 HIS B N     1 
ATOM   1563 C CA    . HIS B 1 46  ? -46.729 55.853 -22.075 1.00 102.47 ? 150 HIS B CA    1 
ATOM   1564 C C     . HIS B 1 46  ? -46.705 54.612 -21.227 1.00 114.90 ? 150 HIS B C     1 
ATOM   1565 O O     . HIS B 1 46  ? -45.912 54.490 -20.281 1.00 119.23 ? 150 HIS B O     1 
ATOM   1566 C CB    . HIS B 1 46  ? -45.883 55.622 -23.325 1.00 103.58 ? 150 HIS B CB    1 
ATOM   1567 C CG    . HIS B 1 46  ? -45.994 56.725 -24.345 1.00 108.67 ? 150 HIS B CG    1 
ATOM   1568 N ND1   . HIS B 1 46  ? -46.988 56.773 -25.246 1.00 100.69 ? 150 HIS B ND1   1 
ATOM   1569 C CD2   . HIS B 1 46  ? -45.192 57.846 -24.578 1.00 102.45 ? 150 HIS B CD2   1 
ATOM   1570 C CE1   . HIS B 1 46  ? -46.834 57.861 -26.018 1.00 103.38 ? 150 HIS B CE1   1 
ATOM   1571 N NE2   . HIS B 1 46  ? -45.729 58.516 -25.608 1.00 95.51  ? 150 HIS B NE2   1 
ATOM   1572 N N     . HIS B 1 47  ? -47.556 53.657 -21.593 1.00 105.37 ? 151 HIS B N     1 
ATOM   1573 C CA    . HIS B 1 47  ? -47.818 52.498 -20.763 1.00 85.37  ? 151 HIS B CA    1 
ATOM   1574 C C     . HIS B 1 47  ? -46.797 51.417 -20.917 1.00 88.27  ? 151 HIS B C     1 
ATOM   1575 O O     . HIS B 1 47  ? -46.401 51.073 -22.038 1.00 90.73  ? 151 HIS B O     1 
ATOM   1576 C CB    . HIS B 1 47  ? -49.192 51.946 -21.071 1.00 86.45  ? 151 HIS B CB    1 
ATOM   1577 C CG    . HIS B 1 47  ? -50.311 52.781 -20.527 1.00 81.52  ? 151 HIS B CG    1 
ATOM   1578 N ND1   . HIS B 1 47  ? -50.832 52.580 -19.309 1.00 87.26  ? 151 HIS B ND1   1 
ATOM   1579 C CD2   . HIS B 1 47  ? -51.010 53.847 -21.086 1.00 88.34  ? 151 HIS B CD2   1 
ATOM   1580 C CE1   . HIS B 1 47  ? -51.814 53.474 -19.083 1.00 87.28  ? 151 HIS B CE1   1 
ATOM   1581 N NE2   . HIS B 1 47  ? -51.918 54.252 -20.174 1.00 96.13  ? 151 HIS B NE2   1 
ATOM   1582 N N     . TYR B 1 48  ? -46.396 50.853 -19.778 1.00 81.18  ? 152 TYR B N     1 
ATOM   1583 C CA    . TYR B 1 48  ? -45.423 49.767 -19.715 1.00 83.30  ? 152 TYR B CA    1 
ATOM   1584 C C     . TYR B 1 48  ? -44.187 50.064 -20.558 1.00 85.45  ? 152 TYR B C     1 
ATOM   1585 O O     . TYR B 1 48  ? -43.923 49.366 -21.530 1.00 91.62  ? 152 TYR B O     1 
ATOM   1586 C CB    . TYR B 1 48  ? -46.076 48.419 -20.065 1.00 86.18  ? 152 TYR B CB    1 
ATOM   1587 C CG    . TYR B 1 48  ? -47.290 48.152 -19.200 1.00 96.24  ? 152 TYR B CG    1 
ATOM   1588 C CD1   . TYR B 1 48  ? -47.152 47.839 -17.849 1.00 95.52  ? 152 TYR B CD1   1 
ATOM   1589 C CD2   . TYR B 1 48  ? -48.578 48.268 -19.715 1.00 99.84  ? 152 TYR B CD2   1 
ATOM   1590 C CE1   . TYR B 1 48  ? -48.250 47.645 -17.037 1.00 91.13  ? 152 TYR B CE1   1 
ATOM   1591 C CE2   . TYR B 1 48  ? -49.686 48.063 -18.910 1.00 97.73  ? 152 TYR B CE2   1 
ATOM   1592 C CZ    . TYR B 1 48  ? -49.507 47.751 -17.573 1.00 98.64  ? 152 TYR B CZ    1 
ATOM   1593 O OH    . TYR B 1 48  ? -50.589 47.541 -16.762 1.00 116.75 ? 152 TYR B OH    1 
ATOM   1594 N N     . PRO B 1 49  ? -43.429 51.117 -20.187 1.00 88.83  ? 153 PRO B N     1 
ATOM   1595 C CA    . PRO B 1 49  ? -42.250 51.516 -20.947 1.00 90.74  ? 153 PRO B CA    1 
ATOM   1596 C C     . PRO B 1 49  ? -41.109 50.536 -20.706 1.00 102.98 ? 153 PRO B C     1 
ATOM   1597 O O     . PRO B 1 49  ? -41.100 49.470 -21.312 1.00 128.28 ? 153 PRO B O     1 
ATOM   1598 C CB    . PRO B 1 49  ? -41.908 52.905 -20.379 1.00 89.77  ? 153 PRO B CB    1 
ATOM   1599 C CG    . PRO B 1 49  ? -43.021 53.258 -19.442 1.00 86.77  ? 153 PRO B CG    1 
ATOM   1600 C CD    . PRO B 1 49  ? -43.616 51.969 -18.999 1.00 88.64  ? 153 PRO B CD    1 
ATOM   1601 N N     . GLY B 1 50  ? -40.172 50.877 -19.827 1.00 102.98 ? 154 GLY B N     1 
ATOM   1602 C CA    . GLY B 1 50  ? -39.015 50.026 -19.549 1.00 117.77 ? 154 GLY B CA    1 
ATOM   1603 C C     . GLY B 1 50  ? -37.854 50.234 -20.517 1.00 141.52 ? 154 GLY B C     1 
ATOM   1604 O O     . GLY B 1 50  ? -37.232 51.295 -20.512 1.00 160.84 ? 154 GLY B O     1 
ATOM   1605 N N     . PRO B 1 51  ? -37.580 49.246 -21.398 1.00 147.62 ? 155 PRO B N     1 
ATOM   1606 C CA    . PRO B 1 51  ? -38.315 47.998 -21.579 1.00 149.54 ? 155 PRO B CA    1 
ATOM   1607 C C     . PRO B 1 51  ? -37.809 46.849 -20.693 1.00 149.03 ? 155 PRO B C     1 
ATOM   1608 O O     . PRO B 1 51  ? -37.565 45.731 -21.181 1.00 125.95 ? 155 PRO B O     1 
ATOM   1609 C CB    . PRO B 1 51  ? -38.119 47.686 -23.068 1.00 148.80 ? 155 PRO B CB    1 
ATOM   1610 C CG    . PRO B 1 51  ? -36.844 48.365 -23.444 1.00 152.80 ? 155 PRO B CG    1 
ATOM   1611 C CD    . PRO B 1 51  ? -36.468 49.345 -22.360 1.00 151.67 ? 155 PRO B CD    1 
ATOM   1612 N N     . GLY B 1 52  ? -37.661 47.139 -19.399 1.00 141.25 ? 156 GLY B N     1 
ATOM   1613 C CA    . GLY B 1 52  ? -37.549 46.107 -18.386 1.00 133.24 ? 156 GLY B CA    1 
ATOM   1614 C C     . GLY B 1 52  ? -38.869 45.370 -18.322 1.00 142.61 ? 156 GLY B C     1 
ATOM   1615 O O     . GLY B 1 52  ? -38.911 44.152 -18.547 1.00 143.45 ? 156 GLY B O     1 
ATOM   1616 N N     . ASN B 1 53  ? -39.947 46.107 -18.030 1.00 123.22 ? 157 ASN B N     1 
ATOM   1617 C CA    . ASN B 1 53  ? -41.291 45.555 -18.112 1.00 110.43 ? 157 ASN B CA    1 
ATOM   1618 C C     . ASN B 1 53  ? -41.446 44.723 -19.388 1.00 114.86 ? 157 ASN B C     1 
ATOM   1619 O O     . ASN B 1 53  ? -41.248 45.215 -20.499 1.00 122.41 ? 157 ASN B O     1 
ATOM   1620 C CB    . ASN B 1 53  ? -42.334 46.659 -18.053 1.00 117.10 ? 157 ASN B CB    1 
ATOM   1621 C CG    . ASN B 1 53  ? -43.715 46.186 -18.485 1.00 132.18 ? 157 ASN B CG    1 
ATOM   1622 O OD1   . ASN B 1 53  ? -43.860 45.188 -19.196 1.00 120.09 ? 157 ASN B OD1   1 
ATOM   1623 N ND2   . ASN B 1 53  ? -44.736 46.902 -18.047 1.00 141.95 ? 157 ASN B ND2   1 
ATOM   1624 N N     . HIS B 1 54  ? -41.816 43.459 -19.203 1.00 111.51 ? 158 HIS B N     1 
ATOM   1625 C CA    . HIS B 1 54  ? -41.779 42.454 -20.252 1.00 95.64  ? 158 HIS B CA    1 
ATOM   1626 C C     . HIS B 1 54  ? -42.975 42.510 -21.155 1.00 89.89  ? 158 HIS B C     1 
ATOM   1627 O O     . HIS B 1 54  ? -43.133 41.647 -22.036 1.00 90.20  ? 158 HIS B O     1 
ATOM   1628 C CB    . HIS B 1 54  ? -41.713 41.075 -19.622 1.00 104.09 ? 158 HIS B CB    1 
ATOM   1629 C CG    . HIS B 1 54  ? -40.966 41.034 -18.320 1.00 115.72 ? 158 HIS B CG    1 
ATOM   1630 N ND1   . HIS B 1 54  ? -39.625 41.014 -18.260 1.00 134.52 ? 158 HIS B ND1   1 
ATOM   1631 C CD2   . HIS B 1 54  ? -41.422 40.986 -17.006 1.00 121.17 ? 158 HIS B CD2   1 
ATOM   1632 C CE1   . HIS B 1 54  ? -39.234 40.968 -16.972 1.00 135.77 ? 158 HIS B CE1   1 
ATOM   1633 N NE2   . HIS B 1 54  ? -40.336 40.950 -16.205 1.00 134.81 ? 158 HIS B NE2   1 
ATOM   1634 N N     . PHE B 1 55  ? -43.827 43.516 -20.961 1.00 72.75  ? 159 PHE B N     1 
ATOM   1635 C CA    . PHE B 1 55  ? -45.115 43.538 -21.634 1.00 75.51  ? 159 PHE B CA    1 
ATOM   1636 C C     . PHE B 1 55  ? -44.988 43.416 -23.148 1.00 85.37  ? 159 PHE B C     1 
ATOM   1637 O O     . PHE B 1 55  ? -45.424 42.412 -23.727 1.00 84.13  ? 159 PHE B O     1 
ATOM   1638 C CB    . PHE B 1 55  ? -45.933 44.766 -21.229 1.00 77.85  ? 159 PHE B CB    1 
ATOM   1639 C CG    . PHE B 1 55  ? -47.151 44.990 -22.074 1.00 74.17  ? 159 PHE B CG    1 
ATOM   1640 C CD1   . PHE B 1 55  ? -48.128 44.027 -22.185 1.00 77.35  ? 159 PHE B CD1   1 
ATOM   1641 C CD2   . PHE B 1 55  ? -47.320 46.174 -22.752 1.00 90.84  ? 159 PHE B CD2   1 
ATOM   1642 C CE1   . PHE B 1 55  ? -49.257 44.230 -22.968 1.00 80.84  ? 159 PHE B CE1   1 
ATOM   1643 C CE2   . PHE B 1 55  ? -48.452 46.395 -23.530 1.00 101.99 ? 159 PHE B CE2   1 
ATOM   1644 C CZ    . PHE B 1 55  ? -49.423 45.412 -23.647 1.00 91.17  ? 159 PHE B CZ    1 
ATOM   1645 N N     . TRP B 1 56  ? -44.360 44.414 -23.776 1.00 89.58  ? 160 TRP B N     1 
ATOM   1646 C CA    . TRP B 1 56  ? -44.364 44.537 -25.235 1.00 84.09  ? 160 TRP B CA    1 
ATOM   1647 C C     . TRP B 1 56  ? -43.745 43.358 -25.920 1.00 84.48  ? 160 TRP B C     1 
ATOM   1648 O O     . TRP B 1 56  ? -44.239 42.904 -26.962 1.00 91.69  ? 160 TRP B O     1 
ATOM   1649 C CB    . TRP B 1 56  ? -43.739 45.847 -25.681 1.00 81.11  ? 160 TRP B CB    1 
ATOM   1650 C CG    . TRP B 1 56  ? -44.479 47.050 -25.136 1.00 77.40  ? 160 TRP B CG    1 
ATOM   1651 C CD1   . TRP B 1 56  ? -44.119 47.853 -24.052 1.00 83.50  ? 160 TRP B CD1   1 
ATOM   1652 C CD2   . TRP B 1 56  ? -45.741 47.610 -25.613 1.00 68.99  ? 160 TRP B CD2   1 
ATOM   1653 N NE1   . TRP B 1 56  ? -45.059 48.849 -23.839 1.00 80.84  ? 160 TRP B NE1   1 
ATOM   1654 C CE2   . TRP B 1 56  ? -46.043 48.767 -24.731 1.00 69.28  ? 160 TRP B CE2   1 
ATOM   1655 C CE3   . TRP B 1 56  ? -46.617 47.294 -26.633 1.00 65.22  ? 160 TRP B CE3   1 
ATOM   1656 C CZ2   . TRP B 1 56  ? -47.172 49.535 -24.887 1.00 71.45  ? 160 TRP B CZ2   1 
ATOM   1657 C CZ3   . TRP B 1 56  ? -47.769 48.079 -26.784 1.00 63.10  ? 160 TRP B CZ3   1 
ATOM   1658 C CH2   . TRP B 1 56  ? -48.039 49.174 -25.930 1.00 76.58  ? 160 TRP B CH2   1 
ATOM   1659 N N     . LYS B 1 57  ? -42.682 42.826 -25.331 1.00 82.53  ? 161 LYS B N     1 
ATOM   1660 C CA    . LYS B 1 57  ? -42.064 41.609 -25.857 1.00 89.71  ? 161 LYS B CA    1 
ATOM   1661 C C     . LYS B 1 57  ? -43.081 40.457 -25.899 1.00 96.16  ? 161 LYS B C     1 
ATOM   1662 O O     . LYS B 1 57  ? -43.257 39.799 -26.929 1.00 104.29 ? 161 LYS B O     1 
ATOM   1663 C CB    . LYS B 1 57  ? -40.823 41.241 -25.043 1.00 78.38  ? 161 LYS B CB    1 
ATOM   1664 N N     . CYS B 1 58  ? -43.768 40.246 -24.782 1.00 109.02 ? 162 CYS B N     1 
ATOM   1665 C CA    . CYS B 1 58  ? -44.827 39.228 -24.687 1.00 118.78 ? 162 CYS B CA    1 
ATOM   1666 C C     . CYS B 1 58  ? -45.973 39.470 -25.678 1.00 117.21 ? 162 CYS B C     1 
ATOM   1667 O O     . CYS B 1 58  ? -46.395 38.548 -26.381 1.00 112.05 ? 162 CYS B O     1 
ATOM   1668 C CB    . CYS B 1 58  ? -45.375 39.167 -23.267 1.00 109.00 ? 162 CYS B CB    1 
ATOM   1669 S SG    . CYS B 1 58  ? -44.084 38.933 -22.039 1.00 102.39 ? 162 CYS B SG    1 
ATOM   1670 N N     . LEU B 1 59  ? -46.462 40.712 -25.725 1.00 104.90 ? 163 LEU B N     1 
ATOM   1671 C CA    . LEU B 1 59  ? -47.495 41.106 -26.671 1.00 96.72  ? 163 LEU B CA    1 
ATOM   1672 C C     . LEU B 1 59  ? -47.054 40.746 -28.094 1.00 105.92 ? 163 LEU B C     1 
ATOM   1673 O O     . LEU B 1 59  ? -47.852 40.251 -28.913 1.00 94.21  ? 163 LEU B O     1 
ATOM   1674 C CB    . LEU B 1 59  ? -47.757 42.604 -26.552 1.00 90.52  ? 163 LEU B CB    1 
ATOM   1675 C CG    . LEU B 1 59  ? -49.181 43.160 -26.689 1.00 87.27  ? 163 LEU B CG    1 
ATOM   1676 C CD1   . LEU B 1 59  ? -49.716 43.091 -28.097 1.00 97.45  ? 163 LEU B CD1   1 
ATOM   1677 C CD2   . LEU B 1 59  ? -50.132 42.441 -25.777 1.00 94.72  ? 163 LEU B CD2   1 
ATOM   1678 N N     . PHE B 1 60  ? -45.775 40.983 -28.383 1.00 106.29 ? 164 PHE B N     1 
ATOM   1679 C CA    . PHE B 1 60  ? -45.223 40.531 -29.645 1.00 111.29 ? 164 PHE B CA    1 
ATOM   1680 C C     . PHE B 1 60  ? -45.279 39.018 -29.672 1.00 101.02 ? 164 PHE B C     1 
ATOM   1681 O O     . PHE B 1 60  ? -46.208 38.455 -30.245 1.00 110.62 ? 164 PHE B O     1 
ATOM   1682 C CB    . PHE B 1 60  ? -43.798 41.059 -29.907 1.00 111.35 ? 164 PHE B CB    1 
ATOM   1683 C CG    . PHE B 1 60  ? -43.136 40.442 -31.122 1.00 115.15 ? 164 PHE B CG    1 
ATOM   1684 C CD1   . PHE B 1 60  ? -43.819 40.344 -32.347 1.00 118.22 ? 164 PHE B CD1   1 
ATOM   1685 C CD2   . PHE B 1 60  ? -41.837 39.951 -31.048 1.00 112.71 ? 164 PHE B CD2   1 
ATOM   1686 C CE1   . PHE B 1 60  ? -43.212 39.764 -33.456 1.00 117.07 ? 164 PHE B CE1   1 
ATOM   1687 C CE2   . PHE B 1 60  ? -41.221 39.384 -32.160 1.00 106.96 ? 164 PHE B CE2   1 
ATOM   1688 C CZ    . PHE B 1 60  ? -41.910 39.287 -33.363 1.00 106.03 ? 164 PHE B CZ    1 
ATOM   1689 N N     . MET B 1 61  ? -44.314 38.381 -29.010 1.00 101.93 ? 165 MET B N     1 
ATOM   1690 C CA    . MET B 1 61  ? -44.152 36.919 -28.995 1.00 105.38 ? 165 MET B CA    1 
ATOM   1691 C C     . MET B 1 61  ? -45.474 36.132 -29.071 1.00 107.81 ? 165 MET B C     1 
ATOM   1692 O O     . MET B 1 61  ? -45.592 35.167 -29.831 1.00 103.58 ? 165 MET B O     1 
ATOM   1693 C CB    . MET B 1 61  ? -43.325 36.488 -27.768 1.00 92.11  ? 165 MET B CB    1 
ATOM   1694 N N     . SER B 1 62  ? -46.466 36.579 -28.299 1.00 117.87 ? 166 SER B N     1 
ATOM   1695 C CA    . SER B 1 62  ? -47.747 35.887 -28.149 1.00 107.31 ? 166 SER B CA    1 
ATOM   1696 C C     . SER B 1 62  ? -48.487 35.720 -29.459 1.00 102.36 ? 166 SER B C     1 
ATOM   1697 O O     . SER B 1 62  ? -49.239 34.767 -29.622 1.00 105.72 ? 166 SER B O     1 
ATOM   1698 C CB    . SER B 1 62  ? -48.643 36.639 -27.158 1.00 118.21 ? 166 SER B CB    1 
ATOM   1699 N N     . GLY B 1 63  ? -48.272 36.651 -30.382 1.00 103.96 ? 167 GLY B N     1 
ATOM   1700 C CA    . GLY B 1 63  ? -49.040 36.708 -31.611 1.00 98.25  ? 167 GLY B CA    1 
ATOM   1701 C C     . GLY B 1 63  ? -50.223 37.642 -31.447 1.00 106.44 ? 167 GLY B C     1 
ATOM   1702 O O     . GLY B 1 63  ? -51.095 37.691 -32.316 1.00 121.88 ? 167 GLY B O     1 
ATOM   1703 N N     . LEU B 1 64  ? -50.265 38.378 -30.335 1.00 106.30 ? 168 LEU B N     1 
ATOM   1704 C CA    . LEU B 1 64  ? -51.300 39.401 -30.123 1.00 107.22 ? 168 LEU B CA    1 
ATOM   1705 C C     . LEU B 1 64  ? -50.985 40.676 -30.920 1.00 113.12 ? 168 LEU B C     1 
ATOM   1706 O O     . LEU B 1 64  ? -51.890 41.454 -31.247 1.00 114.67 ? 168 LEU B O     1 
ATOM   1707 C CB    . LEU B 1 64  ? -51.482 39.713 -28.632 1.00 105.51 ? 168 LEU B CB    1 
ATOM   1708 C CG    . LEU B 1 64  ? -51.815 38.573 -27.662 1.00 91.14  ? 168 LEU B CG    1 
ATOM   1709 N N     . SER B 1 65  ? -49.698 40.876 -31.227 1.00 129.38 ? 169 SER B N     1 
ATOM   1710 C CA    . SER B 1 65  ? -49.231 41.964 -32.110 1.00 127.55 ? 169 SER B CA    1 
ATOM   1711 C C     . SER B 1 65  ? -48.606 41.396 -33.392 1.00 131.10 ? 169 SER B C     1 
ATOM   1712 O O     . SER B 1 65  ? -48.021 40.301 -33.362 1.00 118.82 ? 169 SER B O     1 
ATOM   1713 C CB    . SER B 1 65  ? -48.211 42.845 -31.381 1.00 110.22 ? 169 SER B CB    1 
ATOM   1714 O OG    . SER B 1 65  ? -47.060 42.108 -31.032 1.00 105.31 ? 169 SER B OG    1 
ATOM   1715 N N     . GLU B 1 66  ? -48.726 42.124 -34.508 1.00 132.89 ? 170 GLU B N     1 
ATOM   1716 C CA    . GLU B 1 66  ? -48.118 41.658 -35.768 1.00 139.04 ? 170 GLU B CA    1 
ATOM   1717 C C     . GLU B 1 66  ? -46.590 41.635 -35.695 1.00 137.39 ? 170 GLU B C     1 
ATOM   1718 O O     . GLU B 1 66  ? -45.976 40.594 -35.909 1.00 139.99 ? 170 GLU B O     1 
ATOM   1719 C CB    . GLU B 1 66  ? -48.624 42.416 -37.008 1.00 133.67 ? 170 GLU B CB    1 
ATOM   1720 C CG    . GLU B 1 66  ? -48.519 43.926 -36.949 1.00 138.37 ? 170 GLU B CG    1 
ATOM   1721 C CD    . GLU B 1 66  ? -49.402 44.607 -37.974 1.00 145.20 ? 170 GLU B CD    1 
ATOM   1722 O OE1   . GLU B 1 66  ? -50.638 44.399 -37.935 1.00 147.95 ? 170 GLU B OE1   1 
ATOM   1723 O OE2   . GLU B 1 66  ? -48.857 45.363 -38.810 1.00 135.76 ? 170 GLU B OE2   1 
ATOM   1724 N N     . VAL B 1 67  ? -45.994 42.779 -35.372 1.00 135.71 ? 171 VAL B N     1 
ATOM   1725 C CA    . VAL B 1 67  ? -44.546 42.885 -35.164 1.00 132.53 ? 171 VAL B CA    1 
ATOM   1726 C C     . VAL B 1 67  ? -44.232 43.251 -33.713 1.00 127.81 ? 171 VAL B C     1 
ATOM   1727 O O     . VAL B 1 67  ? -45.140 43.320 -32.870 1.00 135.29 ? 171 VAL B O     1 
ATOM   1728 C CB    . VAL B 1 67  ? -43.913 43.938 -36.101 1.00 118.65 ? 171 VAL B CB    1 
ATOM   1729 N N     . GLN B 1 68  ? -42.948 43.466 -33.427 1.00 116.04 ? 172 GLN B N     1 
ATOM   1730 C CA    . GLN B 1 68  ? -42.509 43.958 -32.119 1.00 117.62 ? 172 GLN B CA    1 
ATOM   1731 C C     . GLN B 1 68  ? -42.953 45.415 -31.958 1.00 111.69 ? 172 GLN B C     1 
ATOM   1732 O O     . GLN B 1 68  ? -42.894 46.182 -32.908 1.00 114.01 ? 172 GLN B O     1 
ATOM   1733 C CB    . GLN B 1 68  ? -40.983 43.834 -31.984 1.00 105.99 ? 172 GLN B CB    1 
ATOM   1734 C CG    . GLN B 1 68  ? -40.415 44.277 -30.638 1.00 113.04 ? 172 GLN B CG    1 
ATOM   1735 C CD    . GLN B 1 68  ? -40.742 43.329 -29.491 1.00 119.31 ? 172 GLN B CD    1 
ATOM   1736 O OE1   . GLN B 1 68  ? -40.630 42.111 -29.616 1.00 126.26 ? 172 GLN B OE1   1 
ATOM   1737 N NE2   . GLN B 1 68  ? -41.133 43.895 -28.359 1.00 118.68 ? 172 GLN B NE2   1 
ATOM   1738 N N     . LEU B 1 69  ? -43.422 45.790 -30.774 1.00 106.71 ? 173 LEU B N     1 
ATOM   1739 C CA    . LEU B 1 69  ? -43.817 47.176 -30.545 1.00 103.14 ? 173 LEU B CA    1 
ATOM   1740 C C     . LEU B 1 69  ? -43.204 47.728 -29.269 1.00 108.37 ? 173 LEU B C     1 
ATOM   1741 O O     . LEU B 1 69  ? -42.340 47.086 -28.657 1.00 109.49 ? 173 LEU B O     1 
ATOM   1742 C CB    . LEU B 1 69  ? -45.338 47.324 -30.504 1.00 89.09  ? 173 LEU B CB    1 
ATOM   1743 C CG    . LEU B 1 69  ? -46.173 46.915 -31.712 1.00 85.27  ? 173 LEU B CG    1 
ATOM   1744 C CD1   . LEU B 1 69  ? -47.635 47.155 -31.365 1.00 82.28  ? 173 LEU B CD1   1 
ATOM   1745 C CD2   . LEU B 1 69  ? -45.819 47.675 -32.973 1.00 84.41  ? 173 LEU B CD2   1 
ATOM   1746 N N     . ASN B 1 70  ? -43.650 48.924 -28.885 1.00 100.45 ? 174 ASN B N     1 
ATOM   1747 C CA    . ASN B 1 70  ? -43.176 49.580 -27.676 1.00 101.35 ? 174 ASN B CA    1 
ATOM   1748 C C     . ASN B 1 70  ? -44.116 50.712 -27.236 1.00 102.63 ? 174 ASN B C     1 
ATOM   1749 O O     . ASN B 1 70  ? -45.106 51.006 -27.910 1.00 98.57  ? 174 ASN B O     1 
ATOM   1750 C CB    . ASN B 1 70  ? -41.720 50.051 -27.843 1.00 108.73 ? 174 ASN B CB    1 
ATOM   1751 C CG    . ASN B 1 70  ? -41.520 50.923 -29.071 1.00 116.94 ? 174 ASN B CG    1 
ATOM   1752 O OD1   . ASN B 1 70  ? -42.090 52.012 -29.162 1.00 123.95 ? 174 ASN B OD1   1 
ATOM   1753 N ND2   . ASN B 1 70  ? -40.695 50.461 -30.011 1.00 102.68 ? 174 ASN B ND2   1 
ATOM   1754 N N     . HIS B 1 71  ? -43.796 51.342 -26.108 1.00 95.93  ? 175 HIS B N     1 
ATOM   1755 C CA    . HIS B 1 71  ? -44.707 52.262 -25.429 1.00 96.60  ? 175 HIS B CA    1 
ATOM   1756 C C     . HIS B 1 71  ? -45.170 53.380 -26.297 1.00 97.92  ? 175 HIS B C     1 
ATOM   1757 O O     . HIS B 1 71  ? -46.219 53.977 -26.045 1.00 87.22  ? 175 HIS B O     1 
ATOM   1758 C CB    . HIS B 1 71  ? -44.051 52.806 -24.161 1.00 103.88 ? 175 HIS B CB    1 
ATOM   1759 C CG    . HIS B 1 71  ? -42.640 53.295 -24.371 1.00 103.73 ? 175 HIS B CG    1 
ATOM   1760 N ND1   . HIS B 1 71  ? -42.316 54.601 -24.319 1.00 102.55 ? 175 HIS B ND1   1 
ATOM   1761 C CD2   . HIS B 1 71  ? -41.457 52.601 -24.655 1.00 98.72  ? 175 HIS B CD2   1 
ATOM   1762 C CE1   . HIS B 1 71  ? -40.995 54.743 -24.559 1.00 98.21  ? 175 HIS B CE1   1 
ATOM   1763 N NE2   . HIS B 1 71  ? -40.474 53.517 -24.769 1.00 100.47 ? 175 HIS B NE2   1 
ATOM   1764 N N     . MET B 1 72  ? -44.385 53.668 -27.333 1.00 103.59 ? 176 MET B N     1 
ATOM   1765 C CA    . MET B 1 72  ? -44.683 54.736 -28.284 1.00 107.11 ? 176 MET B CA    1 
ATOM   1766 C C     . MET B 1 72  ? -45.834 54.353 -29.191 1.00 111.53 ? 176 MET B C     1 
ATOM   1767 O O     . MET B 1 72  ? -46.563 55.211 -29.680 1.00 120.61 ? 176 MET B O     1 
ATOM   1768 C CB    . MET B 1 72  ? -43.441 55.047 -29.107 1.00 112.48 ? 176 MET B CB    1 
ATOM   1769 C CG    . MET B 1 72  ? -42.420 55.865 -28.335 1.00 115.15 ? 176 MET B CG    1 
ATOM   1770 S SD    . MET B 1 72  ? -43.162 57.428 -27.822 1.00 136.60 ? 176 MET B SD    1 
ATOM   1771 C CE    . MET B 1 72  ? -42.960 58.393 -29.326 1.00 100.86 ? 176 MET B CE    1 
ATOM   1772 N N     . ASP B 1 73  ? -45.997 53.052 -29.399 1.00 111.72 ? 177 ASP B N     1 
ATOM   1773 C CA    . ASP B 1 73  ? -47.075 52.524 -30.224 1.00 103.20 ? 177 ASP B CA    1 
ATOM   1774 C C     . ASP B 1 73  ? -48.344 52.317 -29.392 1.00 98.85  ? 177 ASP B C     1 
ATOM   1775 O O     . ASP B 1 73  ? -49.356 51.839 -29.909 1.00 96.15  ? 177 ASP B O     1 
ATOM   1776 C CB    . ASP B 1 73  ? -46.629 51.217 -30.928 1.00 104.22 ? 177 ASP B CB    1 
ATOM   1777 C CG    . ASP B 1 73  ? -45.392 51.416 -31.835 1.00 107.16 ? 177 ASP B CG    1 
ATOM   1778 O OD1   . ASP B 1 73  ? -45.145 52.551 -32.315 1.00 98.45  ? 177 ASP B OD1   1 
ATOM   1779 O OD2   . ASP B 1 73  ? -44.651 50.439 -32.069 1.00 111.49 ? 177 ASP B OD2   1 
ATOM   1780 N N     . ASP B 1 74  ? -48.298 52.700 -28.113 1.00 102.51 ? 178 ASP B N     1 
ATOM   1781 C CA    . ASP B 1 74  ? -49.380 52.396 -27.168 1.00 100.26 ? 178 ASP B CA    1 
ATOM   1782 C C     . ASP B 1 74  ? -50.731 52.962 -27.562 1.00 86.21  ? 178 ASP B C     1 
ATOM   1783 O O     . ASP B 1 74  ? -51.737 52.310 -27.347 1.00 90.47  ? 178 ASP B O     1 
ATOM   1784 C CB    . ASP B 1 74  ? -49.024 52.825 -25.736 1.00 108.91 ? 178 ASP B CB    1 
ATOM   1785 C CG    . ASP B 1 74  ? -49.130 54.322 -25.525 1.00 111.88 ? 178 ASP B CG    1 
ATOM   1786 O OD1   . ASP B 1 74  ? -48.815 55.088 -26.479 1.00 103.30 ? 178 ASP B OD1   1 
ATOM   1787 O OD2   . ASP B 1 74  ? -49.528 54.716 -24.399 1.00 111.07 ? 178 ASP B OD2   1 
ATOM   1788 N N     . HIS B 1 75  ? -50.750 54.163 -28.136 1.00 93.64  ? 179 HIS B N     1 
ATOM   1789 C CA    . HIS B 1 75  ? -52.013 54.806 -28.548 1.00 101.77 ? 179 HIS B CA    1 
ATOM   1790 C C     . HIS B 1 75  ? -52.672 54.157 -29.754 1.00 93.16  ? 179 HIS B C     1 
ATOM   1791 O O     . HIS B 1 75  ? -53.855 54.388 -30.014 1.00 91.69  ? 179 HIS B O     1 
ATOM   1792 C CB    . HIS B 1 75  ? -51.806 56.301 -28.779 1.00 100.64 ? 179 HIS B CB    1 
ATOM   1793 N N     . THR B 1 76  ? -51.913 53.325 -30.471 1.00 83.90  ? 180 THR B N     1 
ATOM   1794 C CA    . THR B 1 76  ? -52.398 52.602 -31.641 1.00 93.16  ? 180 THR B CA    1 
ATOM   1795 C C     . THR B 1 76  ? -53.075 51.246 -31.293 1.00 100.21 ? 180 THR B C     1 
ATOM   1796 O O     . THR B 1 76  ? -53.813 50.669 -32.116 1.00 101.37 ? 180 THR B O     1 
ATOM   1797 C CB    . THR B 1 76  ? -51.256 52.374 -32.671 1.00 78.28  ? 180 THR B CB    1 
ATOM   1798 N N     . LEU B 1 77  ? -52.835 50.754 -30.077 1.00 95.47  ? 181 LEU B N     1 
ATOM   1799 C CA    . LEU B 1 77  ? -53.213 49.380 -29.715 1.00 95.11  ? 181 LEU B CA    1 
ATOM   1800 C C     . LEU B 1 77  ? -54.712 49.078 -29.854 1.00 93.86  ? 181 LEU B C     1 
ATOM   1801 O O     . LEU B 1 77  ? -55.059 48.066 -30.457 1.00 92.88  ? 181 LEU B O     1 
ATOM   1802 C CB    . LEU B 1 77  ? -52.677 48.983 -28.325 1.00 88.63  ? 181 LEU B CB    1 
ATOM   1803 N N     . PRO B 1 78  ? -55.599 49.948 -29.310 1.00 95.61  ? 182 PRO B N     1 
ATOM   1804 C CA    . PRO B 1 78  ? -57.045 49.654 -29.406 1.00 94.37  ? 182 PRO B CA    1 
ATOM   1805 C C     . PRO B 1 78  ? -57.565 49.664 -30.833 1.00 98.76  ? 182 PRO B C     1 
ATOM   1806 O O     . PRO B 1 78  ? -58.352 48.793 -31.201 1.00 96.70  ? 182 PRO B O     1 
ATOM   1807 C CB    . PRO B 1 78  ? -57.711 50.768 -28.581 1.00 83.78  ? 182 PRO B CB    1 
ATOM   1808 C CG    . PRO B 1 78  ? -56.679 51.827 -28.466 1.00 91.11  ? 182 PRO B CG    1 
ATOM   1809 C CD    . PRO B 1 78  ? -55.339 51.164 -28.517 1.00 92.64  ? 182 PRO B CD    1 
ATOM   1810 N N     . GLY B 1 79  ? -57.127 50.643 -31.622 1.00 104.15 ? 183 GLY B N     1 
ATOM   1811 C CA    . GLY B 1 79  ? -57.540 50.738 -33.010 1.00 97.38  ? 183 GLY B CA    1 
ATOM   1812 C C     . GLY B 1 79  ? -57.100 49.522 -33.807 1.00 96.93  ? 183 GLY B C     1 
ATOM   1813 O O     . GLY B 1 79  ? -57.907 48.903 -34.476 1.00 103.56 ? 183 GLY B O     1 
ATOM   1814 N N     . LYS B 1 80  ? -55.817 49.184 -33.739 1.00 95.19  ? 184 LYS B N     1 
ATOM   1815 C CA    . LYS B 1 80  ? -55.262 48.140 -34.589 1.00 95.78  ? 184 LYS B CA    1 
ATOM   1816 C C     . LYS B 1 80  ? -55.437 46.742 -33.994 1.00 98.91  ? 184 LYS B C     1 
ATOM   1817 O O     . LYS B 1 80  ? -55.867 45.829 -34.692 1.00 106.76 ? 184 LYS B O     1 
ATOM   1818 C CB    . LYS B 1 80  ? -53.784 48.428 -34.930 1.00 89.19  ? 184 LYS B CB    1 
ATOM   1819 N N     . TYR B 1 81  ? -55.099 46.568 -32.716 1.00 105.08 ? 185 TYR B N     1 
ATOM   1820 C CA    . TYR B 1 81  ? -55.164 45.245 -32.084 1.00 95.75  ? 185 TYR B CA    1 
ATOM   1821 C C     . TYR B 1 81  ? -56.256 45.102 -31.005 1.00 87.44  ? 185 TYR B C     1 
ATOM   1822 O O     . TYR B 1 81  ? -56.287 44.109 -30.279 1.00 94.62  ? 185 TYR B O     1 
ATOM   1823 C CB    . TYR B 1 81  ? -53.788 44.829 -31.532 1.00 108.80 ? 185 TYR B CB    1 
ATOM   1824 C CG    . TYR B 1 81  ? -52.604 44.984 -32.489 1.00 119.29 ? 185 TYR B CG    1 
ATOM   1825 C CD1   . TYR B 1 81  ? -52.782 45.122 -33.872 1.00 126.47 ? 185 TYR B CD1   1 
ATOM   1826 C CD2   . TYR B 1 81  ? -51.304 44.962 -32.008 1.00 117.56 ? 185 TYR B CD2   1 
ATOM   1827 C CE1   . TYR B 1 81  ? -51.699 45.266 -34.732 1.00 126.63 ? 185 TYR B CE1   1 
ATOM   1828 C CE2   . TYR B 1 81  ? -50.220 45.104 -32.861 1.00 122.24 ? 185 TYR B CE2   1 
ATOM   1829 C CZ    . TYR B 1 81  ? -50.419 45.245 -34.216 1.00 119.29 ? 185 TYR B CZ    1 
ATOM   1830 O OH    . TYR B 1 81  ? -49.335 45.372 -35.041 1.00 111.00 ? 185 TYR B OH    1 
ATOM   1831 N N     . GLY B 1 82  ? -57.154 46.082 -30.917 1.00 82.73  ? 186 GLY B N     1 
ATOM   1832 C CA    . GLY B 1 82  ? -58.262 46.067 -29.955 1.00 84.33  ? 186 GLY B CA    1 
ATOM   1833 C C     . GLY B 1 82  ? -57.918 45.851 -28.483 1.00 90.36  ? 186 GLY B C     1 
ATOM   1834 O O     . GLY B 1 82  ? -58.583 45.061 -27.798 1.00 79.54  ? 186 GLY B O     1 
ATOM   1835 N N     . ILE B 1 83  ? -56.885 46.545 -27.996 1.00 88.63  ? 187 ILE B N     1 
ATOM   1836 C CA    . ILE B 1 83  ? -56.477 46.447 -26.594 1.00 87.01  ? 187 ILE B CA    1 
ATOM   1837 C C     . ILE B 1 83  ? -56.433 47.822 -25.938 1.00 86.70  ? 187 ILE B C     1 
ATOM   1838 O O     . ILE B 1 83  ? -55.905 48.777 -26.515 1.00 84.92  ? 187 ILE B O     1 
ATOM   1839 C CB    . ILE B 1 83  ? -55.116 45.713 -26.416 1.00 70.98  ? 187 ILE B CB    1 
ATOM   1840 N N     . GLY B 1 84  ? -56.998 47.924 -24.735 1.00 93.23  ? 188 GLY B N     1 
ATOM   1841 C CA    . GLY B 1 84  ? -56.944 49.163 -23.945 1.00 93.98  ? 188 GLY B CA    1 
ATOM   1842 C C     . GLY B 1 84  ? -55.933 49.070 -22.803 1.00 91.79  ? 188 GLY B C     1 
ATOM   1843 O O     . GLY B 1 84  ? -55.338 48.012 -22.576 1.00 89.63  ? 188 GLY B O     1 
ATOM   1844 N N     . PHE B 1 85  ? -55.745 50.181 -22.089 1.00 92.51  ? 189 PHE B N     1 
ATOM   1845 C CA    . PHE B 1 85  ? -54.809 50.266 -20.956 1.00 80.88  ? 189 PHE B CA    1 
ATOM   1846 C C     . PHE B 1 85  ? -55.394 51.121 -19.834 1.00 79.70  ? 189 PHE B C     1 
ATOM   1847 O O     . PHE B 1 85  ? -56.080 52.107 -20.114 1.00 73.83  ? 189 PHE B O     1 
ATOM   1848 C CB    . PHE B 1 85  ? -53.511 50.906 -21.400 1.00 74.60  ? 189 PHE B CB    1 
ATOM   1849 C CG    . PHE B 1 85  ? -52.711 50.068 -22.358 1.00 73.95  ? 189 PHE B CG    1 
ATOM   1850 C CD1   . PHE B 1 85  ? -51.811 49.125 -21.882 1.00 76.48  ? 189 PHE B CD1   1 
ATOM   1851 C CD2   . PHE B 1 85  ? -52.822 50.249 -23.733 1.00 70.10  ? 189 PHE B CD2   1 
ATOM   1852 C CE1   . PHE B 1 85  ? -51.039 48.373 -22.753 1.00 73.06  ? 189 PHE B CE1   1 
ATOM   1853 C CE2   . PHE B 1 85  ? -52.061 49.501 -24.611 1.00 73.05  ? 189 PHE B CE2   1 
ATOM   1854 C CZ    . PHE B 1 85  ? -51.167 48.557 -24.119 1.00 79.15  ? 189 PHE B CZ    1 
ATOM   1855 N N     . THR B 1 86  ? -55.127 50.725 -18.582 1.00 72.61  ? 190 THR B N     1 
ATOM   1856 C CA    . THR B 1 86  ? -55.483 51.506 -17.374 1.00 73.07  ? 190 THR B CA    1 
ATOM   1857 C C     . THR B 1 86  ? -54.884 50.922 -16.075 1.00 81.04  ? 190 THR B C     1 
ATOM   1858 O O     . THR B 1 86  ? -54.116 49.941 -16.137 1.00 91.91  ? 190 THR B O     1 
ATOM   1859 C CB    . THR B 1 86  ? -56.991 51.709 -17.254 1.00 72.18  ? 190 THR B CB    1 
ATOM   1860 O OG1   . THR B 1 86  ? -57.225 53.016 -16.760 1.00 76.64  ? 190 THR B OG1   1 
ATOM   1861 C CG2   . THR B 1 86  ? -57.596 50.758 -16.297 1.00 81.28  ? 190 THR B CG2   1 
ATOM   1862 N N     . ASN B 1 87  ? -55.205 51.515 -14.916 1.00 75.59  ? 191 ASN B N     1 
ATOM   1863 C CA    . ASN B 1 87  ? -54.708 50.998 -13.611 1.00 81.66  ? 191 ASN B CA    1 
ATOM   1864 C C     . ASN B 1 87  ? -55.724 51.172 -12.477 1.00 79.96  ? 191 ASN B C     1 
ATOM   1865 O O     . ASN B 1 87  ? -56.660 51.962 -12.602 1.00 75.20  ? 191 ASN B O     1 
ATOM   1866 C CB    . ASN B 1 87  ? -53.366 51.631 -13.173 1.00 72.79  ? 191 ASN B CB    1 
ATOM   1867 C CG    . ASN B 1 87  ? -52.475 52.004 -14.333 1.00 83.72  ? 191 ASN B CG    1 
ATOM   1868 O OD1   . ASN B 1 87  ? -51.664 51.207 -14.813 1.00 96.57  ? 191 ASN B OD1   1 
ATOM   1869 N ND2   . ASN B 1 87  ? -52.620 53.225 -14.791 1.00 85.02  ? 191 ASN B ND2   1 
ATOM   1870 N N     . MET B 1 88  ? -55.516 50.429 -11.383 1.00 76.13  ? 192 MET B N     1 
ATOM   1871 C CA    . MET B 1 88  ? -56.316 50.548 -10.165 1.00 75.45  ? 192 MET B CA    1 
ATOM   1872 C C     . MET B 1 88  ? -56.257 51.951 -9.638  1.00 78.50  ? 192 MET B C     1 
ATOM   1873 O O     . MET B 1 88  ? -57.299 52.606 -9.515  1.00 90.86  ? 192 MET B O     1 
ATOM   1874 C CB    . MET B 1 88  ? -55.831 49.595 -9.074  1.00 83.44  ? 192 MET B CB    1 
ATOM   1875 C CG    . MET B 1 88  ? -56.447 48.208 -9.162  1.00 95.76  ? 192 MET B CG    1 
ATOM   1876 S SD    . MET B 1 88  ? -57.915 47.950 -8.149  1.00 117.95 ? 192 MET B SD    1 
ATOM   1877 C CE    . MET B 1 88  ? -57.220 47.385 -6.597  1.00 106.73 ? 192 MET B CE    1 
ATOM   1878 N N     . VAL B 1 89  ? -55.044 52.411 -9.326  1.00 77.28  ? 193 VAL B N     1 
ATOM   1879 C CA    . VAL B 1 89  ? -54.850 53.777 -8.840  1.00 82.51  ? 193 VAL B CA    1 
ATOM   1880 C C     . VAL B 1 89  ? -54.058 54.598 -9.865  1.00 98.67  ? 193 VAL B C     1 
ATOM   1881 O O     . VAL B 1 89  ? -53.079 54.119 -10.431 1.00 113.35 ? 193 VAL B O     1 
ATOM   1882 C CB    . VAL B 1 89  ? -54.217 53.812 -7.429  1.00 71.32  ? 193 VAL B CB    1 
ATOM   1883 C CG1   . VAL B 1 89  ? -54.363 52.473 -6.731  1.00 71.66  ? 193 VAL B CG1   1 
ATOM   1884 C CG2   . VAL B 1 89  ? -52.771 54.189 -7.490  1.00 81.69  ? 193 VAL B CG2   1 
ATOM   1885 N N     . GLU B 1 90  ? -54.496 55.822 -10.135 1.00 100.01 ? 194 GLU B N     1 
ATOM   1886 C CA    . GLU B 1 90  ? -53.844 56.636 -11.160 1.00 90.95  ? 194 GLU B CA    1 
ATOM   1887 C C     . GLU B 1 90  ? -52.622 57.364 -10.591 1.00 90.53  ? 194 GLU B C     1 
ATOM   1888 O O     . GLU B 1 90  ? -51.701 57.707 -11.344 1.00 96.83  ? 194 GLU B O     1 
ATOM   1889 C CB    . GLU B 1 90  ? -54.842 57.621 -11.801 1.00 89.85  ? 194 GLU B CB    1 
ATOM   1890 N N     . ARG B 1 91  ? -52.626 57.615 -9.277  1.00 84.15  ? 195 ARG B N     1 
ATOM   1891 C CA    . ARG B 1 91  ? -51.489 58.212 -8.585  1.00 83.35  ? 195 ARG B CA    1 
ATOM   1892 C C     . ARG B 1 91  ? -50.244 57.447 -8.997  1.00 86.49  ? 195 ARG B C     1 
ATOM   1893 O O     . ARG B 1 91  ? -50.254 56.214 -9.018  1.00 97.12  ? 195 ARG B O     1 
ATOM   1894 C CB    . ARG B 1 91  ? -51.664 58.111 -7.052  1.00 98.11  ? 195 ARG B CB    1 
ATOM   1895 C CG    . ARG B 1 91  ? -50.584 58.819 -6.234  1.00 100.72 ? 195 ARG B CG    1 
ATOM   1896 C CD    . ARG B 1 91  ? -50.782 58.648 -4.741  1.00 105.97 ? 195 ARG B CD    1 
ATOM   1897 N NE    . ARG B 1 91  ? -50.000 57.550 -4.162  1.00 117.47 ? 195 ARG B NE    1 
ATOM   1898 C CZ    . ARG B 1 91  ? -49.766 57.396 -2.849  1.00 118.15 ? 195 ARG B CZ    1 
ATOM   1899 N NH1   . ARG B 1 91  ? -50.261 58.271 -1.978  1.00 116.18 ? 195 ARG B NH1   1 
ATOM   1900 N NH2   . ARG B 1 91  ? -49.043 56.368 -2.387  1.00 103.87 ? 195 ARG B NH2   1 
ATOM   1901 N N     . THR B 1 92  ? -49.178 58.166 -9.334  1.00 83.11  ? 196 THR B N     1 
ATOM   1902 C CA    . THR B 1 92  ? -47.909 57.524 -9.647  1.00 77.97  ? 196 THR B CA    1 
ATOM   1903 C C     . THR B 1 92  ? -47.018 57.407 -8.410  1.00 75.84  ? 196 THR B C     1 
ATOM   1904 O O     . THR B 1 92  ? -47.009 58.315 -7.598  1.00 79.92  ? 196 THR B O     1 
ATOM   1905 C CB    . THR B 1 92  ? -47.158 58.260 -10.765 1.00 73.32  ? 196 THR B CB    1 
ATOM   1906 O OG1   . THR B 1 92  ? -45.896 57.619 -10.971 1.00 76.73  ? 196 THR B OG1   1 
ATOM   1907 C CG2   . THR B 1 92  ? -46.920 59.707 -10.397 1.00 84.34  ? 196 THR B CG2   1 
ATOM   1908 N N     . THR B 1 93  ? -46.311 56.277 -8.281  1.00 68.21  ? 197 THR B N     1 
ATOM   1909 C CA    . THR B 1 93  ? -45.311 56.038 -7.244  1.00 70.31  ? 197 THR B CA    1 
ATOM   1910 C C     . THR B 1 93  ? -44.287 54.994 -7.738  1.00 82.05  ? 197 THR B C     1 
ATOM   1911 O O     . THR B 1 93  ? -44.510 54.402 -8.793  1.00 92.13  ? 197 THR B O     1 
ATOM   1912 C CB    . THR B 1 93  ? -45.937 55.493 -5.944  1.00 79.99  ? 197 THR B CB    1 
ATOM   1913 O OG1   . THR B 1 93  ? -46.081 54.065 -6.042  1.00 86.73  ? 197 THR B OG1   1 
ATOM   1914 C CG2   . THR B 1 93  ? -47.281 56.195 -5.585  1.00 61.50  ? 197 THR B CG2   1 
ATOM   1915 N N     . PRO B 1 94  ? -43.178 54.759 -6.977  1.00 93.77  ? 198 PRO B N     1 
ATOM   1916 C CA    . PRO B 1 94  ? -42.098 53.840 -7.353  1.00 103.26 ? 198 PRO B CA    1 
ATOM   1917 C C     . PRO B 1 94  ? -42.511 52.587 -8.143  1.00 106.75 ? 198 PRO B C     1 
ATOM   1918 O O     . PRO B 1 94  ? -42.260 52.564 -9.350  1.00 118.34 ? 198 PRO B O     1 
ATOM   1919 C CB    . PRO B 1 94  ? -41.424 53.493 -6.010  1.00 96.66  ? 198 PRO B CB    1 
ATOM   1920 C CG    . PRO B 1 94  ? -41.881 54.537 -5.046  1.00 102.40 ? 198 PRO B CG    1 
ATOM   1921 C CD    . PRO B 1 94  ? -42.788 55.501 -5.769  1.00 107.00 ? 198 PRO B CD    1 
ATOM   1922 N N     . GLY B 1 95  ? -43.120 51.563 -7.530  1.00 101.03 ? 199 GLY B N     1 
ATOM   1923 C CA    . GLY B 1 95  ? -43.454 51.481 -6.111  1.00 107.34 ? 199 GLY B CA    1 
ATOM   1924 C C     . GLY B 1 95  ? -44.885 51.013 -5.892  1.00 119.37 ? 199 GLY B C     1 
ATOM   1925 O O     . GLY B 1 95  ? -45.832 51.774 -6.124  1.00 118.94 ? 199 GLY B O     1 
ATOM   1926 N N     . SER B 1 96  ? -45.049 49.761 -5.455  1.00 113.35 ? 200 SER B N     1 
ATOM   1927 C CA    . SER B 1 96  ? -46.366 49.248 -5.049  1.00 113.97 ? 200 SER B CA    1 
ATOM   1928 C C     . SER B 1 96  ? -46.471 49.224 -3.526  1.00 113.84 ? 200 SER B C     1 
ATOM   1929 O O     . SER B 1 96  ? -47.507 49.599 -2.953  1.00 113.06 ? 200 SER B O     1 
ATOM   1930 C CB    . SER B 1 96  ? -46.645 47.859 -5.635  1.00 116.01 ? 200 SER B CB    1 
ATOM   1931 O OG    . SER B 1 96  ? -45.844 46.871 -5.010  1.00 118.68 ? 200 SER B OG    1 
ATOM   1932 N N     . LYS B 1 97  ? -45.379 48.802 -2.884  1.00 114.77 ? 201 LYS B N     1 
ATOM   1933 C CA    . LYS B 1 97  ? -45.240 48.834 -1.422  1.00 110.57 ? 201 LYS B CA    1 
ATOM   1934 C C     . LYS B 1 97  ? -45.400 50.247 -0.877  1.00 95.81  ? 201 LYS B C     1 
ATOM   1935 O O     . LYS B 1 97  ? -45.373 50.458 0.322   1.00 102.25 ? 201 LYS B O     1 
ATOM   1936 C CB    . LYS B 1 97  ? -43.881 48.258 -0.987  1.00 110.48 ? 201 LYS B CB    1 
ATOM   1937 N N     . ASP B 1 98  ? -45.580 51.205 -1.772  1.00 94.46  ? 202 ASP B N     1 
ATOM   1938 C CA    . ASP B 1 98  ? -45.737 52.603 -1.403  1.00 93.61  ? 202 ASP B CA    1 
ATOM   1939 C C     . ASP B 1 98  ? -47.191 53.032 -1.398  1.00 89.41  ? 202 ASP B C     1 
ATOM   1940 O O     . ASP B 1 98  ? -47.484 54.234 -1.317  1.00 89.89  ? 202 ASP B O     1 
ATOM   1941 C CB    . ASP B 1 98  ? -44.931 53.497 -2.364  1.00 97.43  ? 202 ASP B CB    1 
ATOM   1942 N N     . LEU B 1 99  ? -48.111 52.069 -1.467  1.00 105.80 ? 203 LEU B N     1 
ATOM   1943 C CA    . LEU B 1 99  ? -49.514 52.429 -1.779  1.00 118.37 ? 203 LEU B CA    1 
ATOM   1944 C C     . LEU B 1 99  ? -50.512 52.711 -0.639  1.00 117.40 ? 203 LEU B C     1 
ATOM   1945 O O     . LEU B 1 99  ? -50.971 53.846 -0.510  1.00 114.09 ? 203 LEU B O     1 
ATOM   1946 C CB    . LEU B 1 99  ? -50.093 51.548 -2.895  1.00 109.76 ? 203 LEU B CB    1 
ATOM   1947 C CG    . LEU B 1 99  ? -49.693 52.334 -4.157  1.00 113.06 ? 203 LEU B CG    1 
ATOM   1948 C CD1   . LEU B 1 99  ? -49.191 51.460 -5.297  1.00 111.76 ? 203 LEU B CD1   1 
ATOM   1949 C CD2   . LEU B 1 99  ? -50.790 53.304 -4.601  1.00 99.84  ? 203 LEU B CD2   1 
ATOM   1950 N N     . SER B 1 100 ? -50.846 51.706 0.170   1.00 113.69 ? 204 SER B N     1 
ATOM   1951 C CA    . SER B 1 100 ? -51.771 51.883 1.301   1.00 117.30 ? 204 SER B CA    1 
ATOM   1952 C C     . SER B 1 100 ? -52.754 50.714 1.424   1.00 129.07 ? 204 SER B C     1 
ATOM   1953 O O     . SER B 1 100 ? -52.351 49.554 1.614   1.00 133.22 ? 204 SER B O     1 
ATOM   1954 C CB    . SER B 1 100 ? -52.545 53.219 1.199   1.00 115.89 ? 204 SER B CB    1 
ATOM   1955 O OG    . SER B 1 100 ? -53.453 53.229 0.108   1.00 108.64 ? 204 SER B OG    1 
ATOM   1956 N N     . SER B 1 101 ? -54.041 51.048 1.325   1.00 122.41 ? 205 SER B N     1 
ATOM   1957 C CA    . SER B 1 101 ? -55.137 50.101 1.315   1.00 124.23 ? 205 SER B CA    1 
ATOM   1958 C C     . SER B 1 101 ? -56.351 50.921 0.942   1.00 126.93 ? 205 SER B C     1 
ATOM   1959 O O     . SER B 1 101 ? -56.904 50.769 -0.150  1.00 127.05 ? 205 SER B O     1 
ATOM   1960 C CB    . SER B 1 101 ? -55.316 49.438 2.688   1.00 114.89 ? 205 SER B CB    1 
ATOM   1961 O OG    . SER B 1 101 ? -54.314 48.451 2.902   1.00 109.84 ? 205 SER B OG    1 
ATOM   1962 N N     . LYS B 1 102 ? -56.740 51.811 1.853   1.00 134.86 ? 206 LYS B N     1 
ATOM   1963 C CA    . LYS B 1 102 ? -57.802 52.772 1.593   1.00 142.97 ? 206 LYS B CA    1 
ATOM   1964 C C     . LYS B 1 102 ? -57.795 53.112 0.107   1.00 144.88 ? 206 LYS B C     1 
ATOM   1965 O O     . LYS B 1 102 ? -58.820 53.002 -0.585  1.00 134.83 ? 206 LYS B O     1 
ATOM   1966 C CB    . LYS B 1 102 ? -57.593 54.037 2.434   1.00 137.69 ? 206 LYS B CB    1 
ATOM   1967 N N     . GLU B 1 103 ? -56.608 53.474 -0.377  1.00 139.86 ? 207 GLU B N     1 
ATOM   1968 C CA    . GLU B 1 103 ? -56.408 53.871 -1.764  1.00 130.97 ? 207 GLU B CA    1 
ATOM   1969 C C     . GLU B 1 103 ? -56.914 52.841 -2.769  1.00 132.33 ? 207 GLU B C     1 
ATOM   1970 O O     . GLU B 1 103 ? -57.658 53.189 -3.689  1.00 130.86 ? 207 GLU B O     1 
ATOM   1971 C CB    . GLU B 1 103 ? -54.931 54.158 -2.016  1.00 130.11 ? 207 GLU B CB    1 
ATOM   1972 C CG    . GLU B 1 103 ? -54.480 55.535 -1.570  1.00 124.74 ? 207 GLU B CG    1 
ATOM   1973 C CD    . GLU B 1 103 ? -53.131 55.896 -2.128  1.00 104.13 ? 207 GLU B CD    1 
ATOM   1974 O OE1   . GLU B 1 103 ? -52.143 55.274 -1.702  1.00 115.26 ? 207 GLU B OE1   1 
ATOM   1975 O OE2   . GLU B 1 103 ? -53.068 56.793 -2.991  1.00 95.02  ? 207 GLU B OE2   1 
ATOM   1976 N N     . PHE B 1 104 ? -56.501 51.583 -2.582  1.00 140.54 ? 208 PHE B N     1 
ATOM   1977 C CA    . PHE B 1 104 ? -56.904 50.470 -3.448  1.00 135.20 ? 208 PHE B CA    1 
ATOM   1978 C C     . PHE B 1 104 ? -58.420 50.353 -3.570  1.00 128.41 ? 208 PHE B C     1 
ATOM   1979 O O     . PHE B 1 104 ? -58.970 50.316 -4.677  1.00 108.93 ? 208 PHE B O     1 
ATOM   1980 C CB    . PHE B 1 104 ? -56.381 49.142 -2.895  1.00 128.52 ? 208 PHE B CB    1 
ATOM   1981 C CG    . PHE B 1 104 ? -54.902 48.952 -3.027  1.00 134.15 ? 208 PHE B CG    1 
ATOM   1982 C CD1   . PHE B 1 104 ? -54.252 49.178 -4.238  1.00 120.23 ? 208 PHE B CD1   1 
ATOM   1983 C CD2   . PHE B 1 104 ? -54.164 48.490 -1.943  1.00 142.16 ? 208 PHE B CD2   1 
ATOM   1984 C CE1   . PHE B 1 104 ? -52.888 48.974 -4.353  1.00 114.69 ? 208 PHE B CE1   1 
ATOM   1985 C CE2   . PHE B 1 104 ? -52.798 48.269 -2.059  1.00 138.16 ? 208 PHE B CE2   1 
ATOM   1986 C CZ    . PHE B 1 104 ? -52.160 48.519 -3.265  1.00 128.85 ? 208 PHE B CZ    1 
ATOM   1987 N N     . ARG B 1 105 ? -59.077 50.282 -2.413  1.00 128.92 ? 209 ARG B N     1 
ATOM   1988 C CA    . ARG B 1 105 ? -60.511 50.098 -2.346  1.00 122.78 ? 209 ARG B CA    1 
ATOM   1989 C C     . ARG B 1 105 ? -61.212 51.203 -3.139  1.00 120.47 ? 209 ARG B C     1 
ATOM   1990 O O     . ARG B 1 105 ? -62.116 50.920 -3.933  1.00 128.60 ? 209 ARG B O     1 
ATOM   1991 C CB    . ARG B 1 105 ? -60.971 50.044 -0.883  1.00 131.97 ? 209 ARG B CB    1 
ATOM   1992 C CG    . ARG B 1 105 ? -60.505 48.801 -0.123  1.00 115.73 ? 209 ARG B CG    1 
ATOM   1993 N N     . GLU B 1 106 ? -60.766 52.446 -2.958  1.00 110.52 ? 210 GLU B N     1 
ATOM   1994 C CA    . GLU B 1 106 ? -61.304 53.582 -3.723  1.00 110.85 ? 210 GLU B CA    1 
ATOM   1995 C C     . GLU B 1 106 ? -60.996 53.469 -5.221  1.00 114.81 ? 210 GLU B C     1 
ATOM   1996 O O     . GLU B 1 106 ? -61.761 53.951 -6.067  1.00 102.54 ? 210 GLU B O     1 
ATOM   1997 C CB    . GLU B 1 106 ? -60.757 54.897 -3.181  1.00 91.17  ? 210 GLU B CB    1 
ATOM   1998 N N     . GLY B 1 107 ? -59.872 52.822 -5.534  1.00 121.46 ? 211 GLY B N     1 
ATOM   1999 C CA    . GLY B 1 107 ? -59.434 52.624 -6.913  1.00 119.21 ? 211 GLY B CA    1 
ATOM   2000 C C     . GLY B 1 107 ? -60.332 51.651 -7.642  1.00 119.37 ? 211 GLY B C     1 
ATOM   2001 O O     . GLY B 1 107 ? -60.843 51.960 -8.718  1.00 123.62 ? 211 GLY B O     1 
ATOM   2002 N N     . GLY B 1 108 ? -60.527 50.475 -7.047  1.00 115.33 ? 212 GLY B N     1 
ATOM   2003 C CA    . GLY B 1 108 ? -61.384 49.437 -7.619  1.00 101.81 ? 212 GLY B CA    1 
ATOM   2004 C C     . GLY B 1 108 ? -62.758 49.981 -7.907  1.00 101.37 ? 212 GLY B C     1 
ATOM   2005 O O     . GLY B 1 108 ? -63.354 49.684 -8.951  1.00 93.84  ? 212 GLY B O     1 
ATOM   2006 N N     . ARG B 1 109 ? -63.251 50.791 -6.971  1.00 104.83 ? 213 ARG B N     1 
ATOM   2007 C CA    . ARG B 1 109 ? -64.505 51.507 -7.134  1.00 100.39 ? 213 ARG B CA    1 
ATOM   2008 C C     . ARG B 1 109 ? -64.462 52.376 -8.409  1.00 108.40 ? 213 ARG B C     1 
ATOM   2009 O O     . ARG B 1 109 ? -65.357 52.275 -9.273  1.00 106.51 ? 213 ARG B O     1 
ATOM   2010 C CB    . ARG B 1 109 ? -64.801 52.335 -5.884  1.00 81.70  ? 213 ARG B CB    1 
ATOM   2011 N N     . ILE B 1 110 ? -63.414 53.197 -8.536  1.00 107.23 ? 214 ILE B N     1 
ATOM   2012 C CA    . ILE B 1 110 ? -63.234 54.054 -9.724  1.00 109.86 ? 214 ILE B CA    1 
ATOM   2013 C C     . ILE B 1 110 ? -63.057 53.189 -10.983 1.00 108.18 ? 214 ILE B C     1 
ATOM   2014 O O     . ILE B 1 110 ? -63.620 53.491 -12.043 1.00 103.14 ? 214 ILE B O     1 
ATOM   2015 C CB    . ILE B 1 110 ? -62.061 55.059 -9.570  1.00 85.06  ? 214 ILE B CB    1 
ATOM   2016 N N     . LEU B 1 111 ? -62.291 52.102 -10.842 1.00 107.30 ? 215 LEU B N     1 
ATOM   2017 C CA    . LEU B 1 111 ? -62.111 51.125 -11.911 1.00 96.36  ? 215 LEU B CA    1 
ATOM   2018 C C     . LEU B 1 111 ? -63.477 50.557 -12.306 1.00 105.47 ? 215 LEU B C     1 
ATOM   2019 O O     . LEU B 1 111 ? -63.987 50.875 -13.393 1.00 112.28 ? 215 LEU B O     1 
ATOM   2020 C CB    . LEU B 1 111 ? -61.138 50.002 -11.506 1.00 88.62  ? 215 LEU B CB    1 
ATOM   2021 C CG    . LEU B 1 111 ? -60.707 49.028 -12.617 1.00 77.97  ? 215 LEU B CG    1 
ATOM   2022 N N     . VAL B 1 112 ? -64.083 49.758 -11.422 1.00 84.56  ? 216 VAL B N     1 
ATOM   2023 C CA    . VAL B 1 112 ? -65.322 49.076 -11.762 1.00 95.54  ? 216 VAL B CA    1 
ATOM   2024 C C     . VAL B 1 112 ? -66.183 49.990 -12.669 1.00 95.40  ? 216 VAL B C     1 
ATOM   2025 O O     . VAL B 1 112 ? -66.619 49.577 -13.756 1.00 80.44  ? 216 VAL B O     1 
ATOM   2026 C CB    . VAL B 1 112 ? -66.076 48.611 -10.496 1.00 88.07  ? 216 VAL B CB    1 
ATOM   2027 N N     . GLN B 1 113 ? -66.355 51.243 -12.234 1.00 92.43  ? 217 GLN B N     1 
ATOM   2028 C CA    . GLN B 1 113 ? -67.186 52.224 -12.934 1.00 94.59  ? 217 GLN B CA    1 
ATOM   2029 C C     . GLN B 1 113 ? -66.740 52.399 -14.389 1.00 96.18  ? 217 GLN B C     1 
ATOM   2030 O O     . GLN B 1 113 ? -67.518 52.160 -15.313 1.00 103.08 ? 217 GLN B O     1 
ATOM   2031 C CB    . GLN B 1 113 ? -67.204 53.560 -12.183 1.00 81.67  ? 217 GLN B CB    1 
ATOM   2032 N N     . LYS B 1 114 ? -65.485 52.792 -14.587 1.00 91.49  ? 218 LYS B N     1 
ATOM   2033 C CA    . LYS B 1 114 ? -64.918 52.940 -15.925 1.00 96.25  ? 218 LYS B CA    1 
ATOM   2034 C C     . LYS B 1 114 ? -65.239 51.713 -16.814 1.00 106.77 ? 218 LYS B C     1 
ATOM   2035 O O     . LYS B 1 114 ? -65.697 51.862 -17.960 1.00 93.06  ? 218 LYS B O     1 
ATOM   2036 C CB    . LYS B 1 114 ? -63.390 53.191 -15.834 1.00 83.49  ? 218 LYS B CB    1 
ATOM   2037 N N     . LEU B 1 115 ? -65.003 50.512 -16.271 1.00 106.51 ? 219 LEU B N     1 
ATOM   2038 C CA    . LEU B 1 115 ? -65.238 49.260 -17.003 1.00 112.65 ? 219 LEU B CA    1 
ATOM   2039 C C     . LEU B 1 115 ? -66.738 49.003 -17.233 1.00 109.70 ? 219 LEU B C     1 
ATOM   2040 O O     . LEU B 1 115 ? -67.128 48.457 -18.269 1.00 101.58 ? 219 LEU B O     1 
ATOM   2041 C CB    . LEU B 1 115 ? -64.545 48.068 -16.312 1.00 111.01 ? 219 LEU B CB    1 
ATOM   2042 N N     . GLN B 1 116 ? -67.570 49.409 -16.272 1.00 110.40 ? 220 GLN B N     1 
ATOM   2043 C CA    . GLN B 1 116 ? -69.026 49.396 -16.453 1.00 108.62 ? 220 GLN B CA    1 
ATOM   2044 C C     . GLN B 1 116 ? -69.437 50.396 -17.532 1.00 109.25 ? 220 GLN B C     1 
ATOM   2045 O O     . GLN B 1 116 ? -70.558 50.355 -18.028 1.00 121.59 ? 220 GLN B O     1 
ATOM   2046 C CB    . GLN B 1 116 ? -69.759 49.740 -15.154 1.00 98.95  ? 220 GLN B CB    1 
ATOM   2047 C CG    . GLN B 1 116 ? -69.536 48.779 -14.002 1.00 93.13  ? 220 GLN B CG    1 
ATOM   2048 C CD    . GLN B 1 116 ? -70.286 49.192 -12.749 1.00 93.45  ? 220 GLN B CD    1 
ATOM   2049 O OE1   . GLN B 1 116 ? -71.035 50.169 -12.744 1.00 97.01  ? 220 GLN B OE1   1 
ATOM   2050 N NE2   . GLN B 1 116 ? -70.083 48.448 -11.675 1.00 103.28 ? 220 GLN B NE2   1 
ATOM   2051 N N     . LYS B 1 117 ? -68.534 51.304 -17.879 1.00 103.25 ? 221 LYS B N     1 
ATOM   2052 C CA    . LYS B 1 117 ? -68.808 52.260 -18.939 1.00 110.13 ? 221 LYS B CA    1 
ATOM   2053 C C     . LYS B 1 117 ? -68.395 51.704 -20.311 1.00 108.00 ? 221 LYS B C     1 
ATOM   2054 O O     . LYS B 1 117 ? -69.209 51.663 -21.239 1.00 102.86 ? 221 LYS B O     1 
ATOM   2055 C CB    . LYS B 1 117 ? -68.138 53.612 -18.651 1.00 102.21 ? 221 LYS B CB    1 
ATOM   2056 N N     . TYR B 1 118 ? -67.141 51.273 -20.430 1.00 100.89 ? 222 TYR B N     1 
ATOM   2057 C CA    . TYR B 1 118 ? -66.607 50.840 -21.718 1.00 99.05  ? 222 TYR B CA    1 
ATOM   2058 C C     . TYR B 1 118 ? -66.912 49.373 -22.044 1.00 102.48 ? 222 TYR B C     1 
ATOM   2059 O O     . TYR B 1 118 ? -66.790 48.956 -23.210 1.00 92.95  ? 222 TYR B O     1 
ATOM   2060 C CB    . TYR B 1 118 ? -65.099 51.070 -21.770 1.00 93.17  ? 222 TYR B CB    1 
ATOM   2061 C CG    . TYR B 1 118 ? -64.674 52.509 -21.842 1.00 89.64  ? 222 TYR B CG    1 
ATOM   2062 C CD1   . TYR B 1 118 ? -64.813 53.244 -23.019 1.00 87.38  ? 222 TYR B CD1   1 
ATOM   2063 C CD2   . TYR B 1 118 ? -64.093 53.131 -20.732 1.00 95.02  ? 222 TYR B CD2   1 
ATOM   2064 C CE1   . TYR B 1 118 ? -64.407 54.570 -23.088 1.00 89.64  ? 222 TYR B CE1   1 
ATOM   2065 C CE2   . TYR B 1 118 ? -63.675 54.453 -20.786 1.00 89.74  ? 222 TYR B CE2   1 
ATOM   2066 C CZ    . TYR B 1 118 ? -63.839 55.172 -21.965 1.00 98.81  ? 222 TYR B CZ    1 
ATOM   2067 O OH    . TYR B 1 118 ? -63.441 56.499 -22.026 1.00 112.27 ? 222 TYR B OH    1 
ATOM   2068 N N     . GLN B 1 119 ? -67.307 48.622 -21.005 1.00 113.55 ? 223 GLN B N     1 
ATOM   2069 C CA    . GLN B 1 119 ? -67.585 47.174 -21.048 1.00 101.37 ? 223 GLN B CA    1 
ATOM   2070 C C     . GLN B 1 119 ? -66.750 46.456 -22.100 1.00 108.88 ? 223 GLN B C     1 
ATOM   2071 O O     . GLN B 1 119 ? -67.265 46.087 -23.162 1.00 112.87 ? 223 GLN B O     1 
ATOM   2072 C CB    . GLN B 1 119 ? -69.069 46.894 -21.295 1.00 110.84 ? 223 GLN B CB    1 
ATOM   2073 C CG    . GLN B 1 119 ? -70.070 47.492 -20.304 1.00 116.94 ? 223 GLN B CG    1 
ATOM   2074 C CD    . GLN B 1 119 ? -71.485 47.594 -20.891 1.00 115.34 ? 223 GLN B CD    1 
ATOM   2075 O OE1   . GLN B 1 119 ? -71.662 47.849 -22.089 1.00 107.06 ? 223 GLN B OE1   1 
ATOM   2076 N NE2   . GLN B 1 119 ? -72.499 47.388 -20.047 1.00 115.96 ? 223 GLN B NE2   1 
ATOM   2077 N N     . PRO B 1 120 ? -65.445 46.271 -21.823 1.00 113.34 ? 224 PRO B N     1 
ATOM   2078 C CA    . PRO B 1 120 ? -64.597 45.501 -22.741 1.00 103.38 ? 224 PRO B CA    1 
ATOM   2079 C C     . PRO B 1 120 ? -64.935 44.038 -22.581 1.00 106.30 ? 224 PRO B C     1 
ATOM   2080 O O     . PRO B 1 120 ? -65.662 43.671 -21.649 1.00 112.66 ? 224 PRO B O     1 
ATOM   2081 C CB    . PRO B 1 120 ? -63.190 45.740 -22.208 1.00 99.61  ? 224 PRO B CB    1 
ATOM   2082 C CG    . PRO B 1 120 ? -63.387 45.994 -20.743 1.00 100.39 ? 224 PRO B CG    1 
ATOM   2083 C CD    . PRO B 1 120 ? -64.738 46.640 -20.579 1.00 107.74 ? 224 PRO B CD    1 
ATOM   2084 N N     . ARG B 1 121 ? -64.414 43.198 -23.463 1.00 102.75 ? 225 ARG B N     1 
ATOM   2085 C CA    . ARG B 1 121 ? -64.734 41.789 -23.386 1.00 99.73  ? 225 ARG B CA    1 
ATOM   2086 C C     . ARG B 1 121 ? -64.098 41.181 -22.128 1.00 104.20 ? 225 ARG B C     1 
ATOM   2087 O O     . ARG B 1 121 ? -64.778 40.549 -21.308 1.00 105.67 ? 225 ARG B O     1 
ATOM   2088 C CB    . ARG B 1 121 ? -64.310 41.073 -24.670 1.00 94.94  ? 225 ARG B CB    1 
ATOM   2089 C CG    . ARG B 1 121 ? -65.448 40.909 -25.658 1.00 93.32  ? 225 ARG B CG    1 
ATOM   2090 C CD    . ARG B 1 121 ? -64.951 40.445 -27.025 1.00 106.88 ? 225 ARG B CD    1 
ATOM   2091 N NE    . ARG B 1 121 ? -65.145 41.500 -28.026 1.00 128.08 ? 225 ARG B NE    1 
ATOM   2092 C CZ    . ARG B 1 121 ? -66.003 41.449 -29.049 1.00 122.78 ? 225 ARG B CZ    1 
ATOM   2093 N NH1   . ARG B 1 121 ? -66.098 42.493 -29.865 1.00 123.22 ? 225 ARG B NH1   1 
ATOM   2094 N NH2   . ARG B 1 121 ? -66.765 40.375 -29.266 1.00 102.93 ? 225 ARG B NH2   1 
ATOM   2095 N N     . ILE B 1 122 ? -62.804 41.429 -21.963 1.00 91.86  ? 226 ILE B N     1 
ATOM   2096 C CA    . ILE B 1 122 ? -62.017 40.806 -20.923 1.00 83.03  ? 226 ILE B CA    1 
ATOM   2097 C C     . ILE B 1 122 ? -61.215 41.850 -20.148 1.00 95.15  ? 226 ILE B C     1 
ATOM   2098 O O     . ILE B 1 122 ? -60.401 42.588 -20.737 1.00 104.07 ? 226 ILE B O     1 
ATOM   2099 C CB    . ILE B 1 122 ? -60.981 39.875 -21.553 1.00 78.60  ? 226 ILE B CB    1 
ATOM   2100 C CG1   . ILE B 1 122 ? -61.580 39.090 -22.740 1.00 70.34  ? 226 ILE B CG1   1 
ATOM   2101 C CG2   . ILE B 1 122 ? -60.310 39.024 -20.476 1.00 83.08  ? 226 ILE B CG2   1 
ATOM   2102 C CD1   . ILE B 1 122 ? -60.559 38.231 -23.498 1.00 72.74  ? 226 ILE B CD1   1 
ATOM   2103 N N     . ALA B 1 123 ? -61.426 41.909 -18.835 1.00 85.55  ? 227 ALA B N     1 
ATOM   2104 C CA    . ALA B 1 123 ? -60.564 42.708 -17.962 1.00 73.95  ? 227 ALA B CA    1 
ATOM   2105 C C     . ALA B 1 123 ? -59.333 41.894 -17.549 1.00 73.31  ? 227 ALA B C     1 
ATOM   2106 O O     . ALA B 1 123 ? -59.461 40.903 -16.834 1.00 83.14  ? 227 ALA B O     1 
ATOM   2107 C CB    . ALA B 1 123 ? -61.330 43.152 -16.737 1.00 62.15  ? 227 ALA B CB    1 
ATOM   2108 N N     . VAL B 1 124 ? -58.148 42.307 -17.985 1.00 67.70  ? 228 VAL B N     1 
ATOM   2109 C CA    . VAL B 1 124 ? -56.920 41.589 -17.635 1.00 68.63  ? 228 VAL B CA    1 
ATOM   2110 C C     . VAL B 1 124 ? -56.199 42.221 -16.464 1.00 69.62  ? 228 VAL B C     1 
ATOM   2111 O O     . VAL B 1 124 ? -55.923 43.408 -16.479 1.00 83.43  ? 228 VAL B O     1 
ATOM   2112 C CB    . VAL B 1 124 ? -55.933 41.517 -18.806 1.00 67.32  ? 228 VAL B CB    1 
ATOM   2113 C CG1   . VAL B 1 124 ? -54.560 41.108 -18.285 1.00 60.87  ? 228 VAL B CG1   1 
ATOM   2114 C CG2   . VAL B 1 124 ? -56.440 40.535 -19.874 1.00 64.01  ? 228 VAL B CG2   1 
ATOM   2115 N N     . PHE B 1 125 ? -55.896 41.428 -15.444 1.00 70.24  ? 229 PHE B N     1 
ATOM   2116 C CA    . PHE B 1 125 ? -55.204 41.966 -14.270 1.00 67.74  ? 229 PHE B CA    1 
ATOM   2117 C C     . PHE B 1 125 ? -53.748 41.638 -14.344 1.00 71.56  ? 229 PHE B C     1 
ATOM   2118 O O     . PHE B 1 125 ? -53.356 40.463 -14.415 1.00 80.74  ? 229 PHE B O     1 
ATOM   2119 C CB    . PHE B 1 125 ? -55.815 41.450 -12.983 1.00 61.00  ? 229 PHE B CB    1 
ATOM   2120 C CG    . PHE B 1 125 ? -57.213 41.927 -12.764 1.00 62.50  ? 229 PHE B CG    1 
ATOM   2121 C CD1   . PHE B 1 125 ? -58.245 41.543 -13.620 1.00 62.06  ? 229 PHE B CD1   1 
ATOM   2122 C CD2   . PHE B 1 125 ? -57.498 42.766 -11.708 1.00 72.00  ? 229 PHE B CD2   1 
ATOM   2123 C CE1   . PHE B 1 125 ? -59.539 41.998 -13.421 1.00 72.61  ? 229 PHE B CE1   1 
ATOM   2124 C CE2   . PHE B 1 125 ? -58.791 43.233 -11.503 1.00 79.72  ? 229 PHE B CE2   1 
ATOM   2125 C CZ    . PHE B 1 125 ? -59.811 42.851 -12.361 1.00 76.54  ? 229 PHE B CZ    1 
ATOM   2126 N N     . ASN B 1 126 ? -52.949 42.688 -14.388 1.00 65.20  ? 230 ASN B N     1 
ATOM   2127 C CA    . ASN B 1 126 ? -51.529 42.521 -14.475 1.00 71.37  ? 230 ASN B CA    1 
ATOM   2128 C C     . ASN B 1 126 ? -51.031 42.152 -13.076 1.00 82.63  ? 230 ASN B C     1 
ATOM   2129 O O     . ASN B 1 126 ? -50.940 43.003 -12.194 1.00 76.57  ? 230 ASN B O     1 
ATOM   2130 C CB    . ASN B 1 126 ? -50.899 43.812 -14.987 1.00 64.96  ? 230 ASN B CB    1 
ATOM   2131 C CG    . ASN B 1 126 ? -49.644 43.571 -15.778 1.00 81.05  ? 230 ASN B CG    1 
ATOM   2132 O OD1   . ASN B 1 126 ? -49.242 42.424 -16.021 1.00 83.32  ? 230 ASN B OD1   1 
ATOM   2133 N ND2   . ASN B 1 126 ? -48.990 44.657 -16.163 1.00 84.70  ? 230 ASN B ND2   1 
ATOM   2134 N N     . GLY B 1 127 ? -50.757 40.867 -12.864 1.00 93.71  ? 231 GLY B N     1 
ATOM   2135 C CA    . GLY B 1 127 ? -50.233 40.391 -11.581 1.00 100.44 ? 231 GLY B CA    1 
ATOM   2136 C C     . GLY B 1 127 ? -51.267 40.072 -10.514 1.00 100.98 ? 231 GLY B C     1 
ATOM   2137 O O     . GLY B 1 127 ? -52.253 40.825 -10.340 1.00 81.62  ? 231 GLY B O     1 
ATOM   2138 N N     . LYS B 1 128 ? -51.025 38.968 -9.792  1.00 93.79  ? 232 LYS B N     1 
ATOM   2139 C CA    . LYS B 1 128 ? -51.990 38.441 -8.816  1.00 83.06  ? 232 LYS B CA    1 
ATOM   2140 C C     . LYS B 1 128 ? -52.382 39.468 -7.772  1.00 95.14  ? 232 LYS B C     1 
ATOM   2141 O O     . LYS B 1 128 ? -53.576 39.694 -7.537  1.00 97.28  ? 232 LYS B O     1 
ATOM   2142 C CB    . LYS B 1 128 ? -51.489 37.161 -8.162  1.00 76.20  ? 232 LYS B CB    1 
ATOM   2143 N N     . CYS B 1 129 ? -51.383 40.119 -7.180  1.00 98.05  ? 233 CYS B N     1 
ATOM   2144 C CA    . CYS B 1 129 ? -51.612 41.172 -6.187  1.00 99.09  ? 233 CYS B CA    1 
ATOM   2145 C C     . CYS B 1 129 ? -52.854 42.002 -6.461  1.00 91.97  ? 233 CYS B C     1 
ATOM   2146 O O     . CYS B 1 129 ? -53.762 42.085 -5.632  1.00 104.65 ? 233 CYS B O     1 
ATOM   2147 C CB    . CYS B 1 129 ? -50.386 42.079 -6.065  1.00 105.24 ? 233 CYS B CB    1 
ATOM   2148 S SG    . CYS B 1 129 ? -48.943 41.173 -5.442  1.00 144.30 ? 233 CYS B SG    1 
ATOM   2149 N N     . ILE B 1 130 ? -52.900 42.605 -7.634  1.00 89.54  ? 234 ILE B N     1 
ATOM   2150 C CA    . ILE B 1 130 ? -53.982 43.542 -7.962  1.00 96.90  ? 234 ILE B CA    1 
ATOM   2151 C C     . ILE B 1 130 ? -55.374 42.873 -7.880  1.00 107.89 ? 234 ILE B C     1 
ATOM   2152 O O     . ILE B 1 130 ? -56.341 43.486 -7.415  1.00 110.53 ? 234 ILE B O     1 
ATOM   2153 C CB    . ILE B 1 130 ? -53.725 44.228 -9.327  1.00 81.91  ? 234 ILE B CB    1 
ATOM   2154 C CG1   . ILE B 1 130 ? -54.819 45.227 -9.661  1.00 71.71  ? 234 ILE B CG1   1 
ATOM   2155 C CG2   . ILE B 1 130 ? -53.575 43.194 -10.440 1.00 91.83  ? 234 ILE B CG2   1 
ATOM   2156 C CD1   . ILE B 1 130 ? -54.705 45.777 -11.073 1.00 82.74  ? 234 ILE B CD1   1 
ATOM   2157 N N     . TYR B 1 131 ? -55.458 41.609 -8.296  1.00 105.12 ? 235 TYR B N     1 
ATOM   2158 C CA    . TYR B 1 131 ? -56.722 40.877 -8.250  1.00 102.61 ? 235 TYR B CA    1 
ATOM   2159 C C     . TYR B 1 131 ? -57.062 40.402 -6.834  1.00 102.80 ? 235 TYR B C     1 
ATOM   2160 O O     . TYR B 1 131 ? -58.200 40.580 -6.395  1.00 101.08 ? 235 TYR B O     1 
ATOM   2161 C CB    . TYR B 1 131 ? -56.765 39.717 -9.262  1.00 92.55  ? 235 TYR B CB    1 
ATOM   2162 C CG    . TYR B 1 131 ? -58.092 39.002 -9.266  1.00 87.22  ? 235 TYR B CG    1 
ATOM   2163 C CD1   . TYR B 1 131 ? -59.210 39.568 -9.864  1.00 88.15  ? 235 TYR B CD1   1 
ATOM   2164 C CD2   . TYR B 1 131 ? -58.239 37.759 -8.638  1.00 92.04  ? 235 TYR B CD2   1 
ATOM   2165 C CE1   . TYR B 1 131 ? -60.443 38.917 -9.831  1.00 94.01  ? 235 TYR B CE1   1 
ATOM   2166 C CE2   . TYR B 1 131 ? -59.458 37.100 -8.609  1.00 82.19  ? 235 TYR B CE2   1 
ATOM   2167 C CZ    . TYR B 1 131 ? -60.558 37.674 -9.204  1.00 88.63  ? 235 TYR B CZ    1 
ATOM   2168 O OH    . TYR B 1 131 ? -61.768 37.001 -9.168  1.00 96.13  ? 235 TYR B OH    1 
ATOM   2169 N N     . GLU B 1 132 ? -56.095 39.801 -6.132  1.00 95.45  ? 236 GLU B N     1 
ATOM   2170 C CA    . GLU B 1 132 ? -56.263 39.527 -4.709  1.00 100.25 ? 236 GLU B CA    1 
ATOM   2171 C C     . GLU B 1 132 ? -57.162 40.603 -4.089  1.00 106.33 ? 236 GLU B C     1 
ATOM   2172 O O     . GLU B 1 132 ? -58.326 40.360 -3.759  1.00 110.88 ? 236 GLU B O     1 
ATOM   2173 C CB    . GLU B 1 132 ? -54.920 39.590 -4.013  1.00 106.75 ? 236 GLU B CB    1 
ATOM   2174 C CG    . GLU B 1 132 ? -54.840 38.653 -2.839  1.00 116.83 ? 236 GLU B CG    1 
ATOM   2175 C CD    . GLU B 1 132 ? -54.812 37.229 -3.327  1.00 130.57 ? 236 GLU B CD    1 
ATOM   2176 O OE1   . GLU B 1 132 ? -55.637 36.409 -2.863  1.00 144.19 ? 236 GLU B OE1   1 
ATOM   2177 O OE2   . GLU B 1 132 ? -53.975 36.951 -4.210  1.00 111.58 ? 236 GLU B OE2   1 
ATOM   2178 N N     . ILE B 1 133 ? -56.609 41.805 -3.962  1.00 98.73  ? 237 ILE B N     1 
ATOM   2179 C CA    . ILE B 1 133 ? -57.338 42.949 -3.454  1.00 109.18 ? 237 ILE B CA    1 
ATOM   2180 C C     . ILE B 1 133 ? -58.702 43.060 -4.130  1.00 106.78 ? 237 ILE B C     1 
ATOM   2181 O O     . ILE B 1 133 ? -59.733 43.009 -3.462  1.00 113.17 ? 237 ILE B O     1 
ATOM   2182 C CB    . ILE B 1 133 ? -56.541 44.266 -3.648  1.00 110.26 ? 237 ILE B CB    1 
ATOM   2183 N N     . PHE B 1 134 ? -58.698 43.182 -5.455  1.00 104.63 ? 238 PHE B N     1 
ATOM   2184 C CA    . PHE B 1 134 ? -59.917 43.432 -6.233  1.00 101.46 ? 238 PHE B CA    1 
ATOM   2185 C C     . PHE B 1 134 ? -61.046 42.466 -5.911  1.00 99.13  ? 238 PHE B C     1 
ATOM   2186 O O     . PHE B 1 134 ? -62.196 42.877 -5.842  1.00 98.03  ? 238 PHE B O     1 
ATOM   2187 C CB    . PHE B 1 134 ? -59.601 43.390 -7.730  1.00 106.44 ? 238 PHE B CB    1 
ATOM   2188 C CG    . PHE B 1 134 ? -60.785 43.658 -8.611  1.00 103.15 ? 238 PHE B CG    1 
ATOM   2189 C CD1   . PHE B 1 134 ? -61.226 44.954 -8.828  1.00 109.95 ? 238 PHE B CD1   1 
ATOM   2190 C CD2   . PHE B 1 134 ? -61.452 42.616 -9.233  1.00 96.99  ? 238 PHE B CD2   1 
ATOM   2191 C CE1   . PHE B 1 134 ? -62.321 45.207 -9.643  1.00 113.45 ? 238 PHE B CE1   1 
ATOM   2192 C CE2   . PHE B 1 134 ? -62.543 42.863 -10.053 1.00 107.26 ? 238 PHE B CE2   1 
ATOM   2193 C CZ    . PHE B 1 134 ? -62.982 44.159 -10.259 1.00 103.12 ? 238 PHE B CZ    1 
ATOM   2194 N N     . SER B 1 135 ? -60.707 41.189 -5.732  1.00 103.22 ? 239 SER B N     1 
ATOM   2195 C CA    . SER B 1 135 ? -61.661 40.160 -5.318  1.00 105.84 ? 239 SER B CA    1 
ATOM   2196 C C     . SER B 1 135 ? -62.222 40.456 -3.933  1.00 120.67 ? 239 SER B C     1 
ATOM   2197 O O     . SER B 1 135 ? -63.431 40.595 -3.768  1.00 129.50 ? 239 SER B O     1 
ATOM   2198 C CB    . SER B 1 135 ? -60.985 38.791 -5.306  1.00 104.31 ? 239 SER B CB    1 
ATOM   2199 N N     . LYS B 1 136 ? -61.331 40.563 -2.946  1.00 129.19 ? 240 LYS B N     1 
ATOM   2200 C CA    . LYS B 1 136 ? -61.698 40.883 -1.561  1.00 122.09 ? 240 LYS B CA    1 
ATOM   2201 C C     . LYS B 1 136 ? -62.495 42.189 -1.403  1.00 119.59 ? 240 LYS B C     1 
ATOM   2202 O O     . LYS B 1 136 ? -63.170 42.390 -0.392  1.00 125.33 ? 240 LYS B O     1 
ATOM   2203 C CB    . LYS B 1 136 ? -60.440 40.941 -0.691  1.00 111.70 ? 240 LYS B CB    1 
ATOM   2204 N N     . GLU B 1 137 ? -62.421 43.064 -2.402  1.00 111.09 ? 241 GLU B N     1 
ATOM   2205 C CA    . GLU B 1 137 ? -63.067 44.372 -2.328  1.00 114.08 ? 241 GLU B CA    1 
ATOM   2206 C C     . GLU B 1 137 ? -64.305 44.491 -3.225  1.00 122.11 ? 241 GLU B C     1 
ATOM   2207 O O     . GLU B 1 137 ? -65.321 45.056 -2.815  1.00 120.22 ? 241 GLU B O     1 
ATOM   2208 C CB    . GLU B 1 137 ? -62.063 45.480 -2.652  1.00 108.29 ? 241 GLU B CB    1 
ATOM   2209 N N     . VAL B 1 138 ? -64.218 43.959 -4.443  1.00 128.34 ? 242 VAL B N     1 
ATOM   2210 C CA    . VAL B 1 138 ? -65.329 44.021 -5.395  1.00 119.91 ? 242 VAL B CA    1 
ATOM   2211 C C     . VAL B 1 138 ? -66.340 42.891 -5.198  1.00 113.46 ? 242 VAL B C     1 
ATOM   2212 O O     . VAL B 1 138 ? -67.536 43.102 -5.345  1.00 108.79 ? 242 VAL B O     1 
ATOM   2213 C CB    . VAL B 1 138 ? -64.834 44.024 -6.858  1.00 114.25 ? 242 VAL B CB    1 
ATOM   2214 N N     . PHE B 1 139 ? -65.851 41.694 -4.879  1.00 119.85 ? 243 PHE B N     1 
ATOM   2215 C CA    . PHE B 1 139 ? -66.715 40.520 -4.639  1.00 111.99 ? 243 PHE B CA    1 
ATOM   2216 C C     . PHE B 1 139 ? -66.735 40.146 -3.162  1.00 112.80 ? 243 PHE B C     1 
ATOM   2217 O O     . PHE B 1 139 ? -67.553 39.337 -2.735  1.00 109.70 ? 243 PHE B O     1 
ATOM   2218 C CB    . PHE B 1 139 ? -66.233 39.288 -5.434  1.00 95.49  ? 243 PHE B CB    1 
ATOM   2219 C CG    . PHE B 1 139 ? -65.929 39.566 -6.880  1.00 85.32  ? 243 PHE B CG    1 
ATOM   2220 C CD1   . PHE B 1 139 ? -66.918 40.023 -7.738  1.00 78.62  ? 243 PHE B CD1   1 
ATOM   2221 C CD2   . PHE B 1 139 ? -64.648 39.360 -7.386  1.00 87.24  ? 243 PHE B CD2   1 
ATOM   2222 C CE1   . PHE B 1 139 ? -66.644 40.281 -9.075  1.00 80.22  ? 243 PHE B CE1   1 
ATOM   2223 C CE2   . PHE B 1 139 ? -64.364 39.624 -8.724  1.00 88.02  ? 243 PHE B CE2   1 
ATOM   2224 C CZ    . PHE B 1 139 ? -65.363 40.084 -9.572  1.00 77.79  ? 243 PHE B CZ    1 
ATOM   2225 N N     . GLY B 1 140 ? -65.810 40.717 -2.393  1.00 124.68 ? 244 GLY B N     1 
ATOM   2226 C CA    . GLY B 1 140 ? -65.628 40.348 -0.991  1.00 128.21 ? 244 GLY B CA    1 
ATOM   2227 C C     . GLY B 1 140 ? -65.377 38.862 -0.814  1.00 129.71 ? 244 GLY B C     1 
ATOM   2228 O O     . GLY B 1 140 ? -66.040 38.220 -0.001  1.00 131.30 ? 244 GLY B O     1 
ATOM   2229 N N     . VAL B 1 141 ? -64.438 38.317 -1.593  1.00 122.62 ? 245 VAL B N     1 
ATOM   2230 C CA    . VAL B 1 141 ? -64.057 36.903 -1.500  1.00 110.63 ? 245 VAL B CA    1 
ATOM   2231 C C     . VAL B 1 141 ? -62.546 36.799 -1.453  1.00 110.79 ? 245 VAL B C     1 
ATOM   2232 O O     . VAL B 1 141 ? -61.844 37.383 -2.283  1.00 124.38 ? 245 VAL B O     1 
ATOM   2233 C CB    . VAL B 1 141 ? -64.585 36.069 -2.680  1.00 98.13  ? 245 VAL B CB    1 
ATOM   2234 N N     . LYS B 1 142 ? -62.052 36.085 -0.450  1.00 104.20 ? 246 LYS B N     1 
ATOM   2235 C CA    . LYS B 1 142 ? -60.623 35.910 -0.265  1.00 98.16  ? 246 LYS B CA    1 
ATOM   2236 C C     . LYS B 1 142 ? -60.242 34.660 -1.012  1.00 101.00 ? 246 LYS B C     1 
ATOM   2237 O O     . LYS B 1 142 ? -60.565 33.550 -0.588  1.00 116.70 ? 246 LYS B O     1 
ATOM   2238 C CB    . LYS B 1 142 ? -60.278 35.772 1.221   1.00 106.05 ? 246 LYS B CB    1 
ATOM   2239 N N     . VAL B 1 143 ? -59.565 34.828 -2.134  1.00 94.02  ? 247 VAL B N     1 
ATOM   2240 C CA    . VAL B 1 143 ? -59.269 33.682 -2.970  1.00 103.03 ? 247 VAL B CA    1 
ATOM   2241 C C     . VAL B 1 143 ? -58.240 32.740 -2.330  1.00 104.43 ? 247 VAL B C     1 
ATOM   2242 O O     . VAL B 1 143 ? -57.138 33.143 -1.984  1.00 118.21 ? 247 VAL B O     1 
ATOM   2243 C CB    . VAL B 1 143 ? -58.839 34.118 -4.378  1.00 108.65 ? 247 VAL B CB    1 
ATOM   2244 C CG1   . VAL B 1 143 ? -58.629 32.900 -5.265  1.00 107.51 ? 247 VAL B CG1   1 
ATOM   2245 C CG2   . VAL B 1 143 ? -59.894 35.041 -4.980  1.00 111.28 ? 247 VAL B CG2   1 
ATOM   2246 N N     . LYS B 1 144 ? -58.630 31.487 -2.151  1.00 107.58 ? 248 LYS B N     1 
ATOM   2247 C CA    . LYS B 1 144 ? -57.707 30.452 -1.722  1.00 112.74 ? 248 LYS B CA    1 
ATOM   2248 C C     . LYS B 1 144 ? -56.861 30.043 -2.925  1.00 107.52 ? 248 LYS B C     1 
ATOM   2249 O O     . LYS B 1 144 ? -57.361 29.973 -4.049  1.00 105.59 ? 248 LYS B O     1 
ATOM   2250 C CB    . LYS B 1 144 ? -58.471 29.240 -1.156  1.00 105.25 ? 248 LYS B CB    1 
ATOM   2251 N N     . ASN B 1 145 ? -55.584 29.772 -2.674  1.00 107.33 ? 249 ASN B N     1 
ATOM   2252 C CA    . ASN B 1 145 ? -54.634 29.369 -3.712  1.00 102.27 ? 249 ASN B CA    1 
ATOM   2253 C C     . ASN B 1 145 ? -55.083 29.830 -5.098  1.00 106.13 ? 249 ASN B C     1 
ATOM   2254 O O     . ASN B 1 145 ? -55.630 29.035 -5.867  1.00 103.59 ? 249 ASN B O     1 
ATOM   2255 C CB    . ASN B 1 145 ? -54.423 27.857 -3.717  1.00 102.10 ? 249 ASN B CB    1 
ATOM   2256 C CG    . ASN B 1 145 ? -54.642 27.211 -2.357  1.00 109.30 ? 249 ASN B CG    1 
ATOM   2257 O OD1   . ASN B 1 145 ? -53.682 26.842 -1.686  1.00 121.96 ? 249 ASN B OD1   1 
ATOM   2258 N ND2   . ASN B 1 145 ? -55.908 27.040 -1.961  1.00 92.49  ? 249 ASN B ND2   1 
ATOM   2259 N N     . LEU B 1 146 ? -54.889 31.122 -5.384  1.00 107.30 ? 250 LEU B N     1 
ATOM   2260 C CA    . LEU B 1 146 ? -55.258 31.715 -6.676  1.00 97.83  ? 250 LEU B CA    1 
ATOM   2261 C C     . LEU B 1 146 ? -54.276 31.280 -7.747  1.00 97.71  ? 250 LEU B C     1 
ATOM   2262 O O     . LEU B 1 146 ? -53.059 31.252 -7.532  1.00 101.82 ? 250 LEU B O     1 
ATOM   2263 C CB    . LEU B 1 146 ? -55.276 33.243 -6.587  1.00 104.58 ? 250 LEU B CB    1 
ATOM   2264 C CG    . LEU B 1 146 ? -55.562 34.099 -7.826  1.00 92.88  ? 250 LEU B CG    1 
ATOM   2265 N N     . GLU B 1 147 ? -54.807 30.920 -8.902  1.00 88.71  ? 251 GLU B N     1 
ATOM   2266 C CA    . GLU B 1 147 ? -53.955 30.571 -10.011 1.00 84.92  ? 251 GLU B CA    1 
ATOM   2267 C C     . GLU B 1 147 ? -54.341 31.456 -11.177 1.00 87.18  ? 251 GLU B C     1 
ATOM   2268 O O     . GLU B 1 147 ? -55.457 31.989 -11.222 1.00 85.65  ? 251 GLU B O     1 
ATOM   2269 C CB    . GLU B 1 147 ? -54.082 29.089 -10.354 1.00 86.41  ? 251 GLU B CB    1 
ATOM   2270 N N     . PHE B 1 148 ? -53.406 31.622 -12.111 1.00 90.86  ? 252 PHE B N     1 
ATOM   2271 C CA    . PHE B 1 148 ? -53.587 32.513 -13.256 1.00 81.62  ? 252 PHE B CA    1 
ATOM   2272 C C     . PHE B 1 148 ? -54.617 31.962 -14.250 1.00 75.88  ? 252 PHE B C     1 
ATOM   2273 O O     . PHE B 1 148 ? -54.717 30.760 -14.445 1.00 84.29  ? 252 PHE B O     1 
ATOM   2274 C CB    . PHE B 1 148 ? -52.256 32.734 -13.961 1.00 77.05  ? 252 PHE B CB    1 
ATOM   2275 C CG    . PHE B 1 148 ? -51.182 33.317 -13.081 1.00 86.23  ? 252 PHE B CG    1 
ATOM   2276 C CD1   . PHE B 1 148 ? -51.375 34.525 -12.418 1.00 86.64  ? 252 PHE B CD1   1 
ATOM   2277 C CD2   . PHE B 1 148 ? -49.951 32.676 -12.947 1.00 86.26  ? 252 PHE B CD2   1 
ATOM   2278 C CE1   . PHE B 1 148 ? -50.368 35.060 -11.614 1.00 81.94  ? 252 PHE B CE1   1 
ATOM   2279 C CE2   . PHE B 1 148 ? -48.941 33.216 -12.159 1.00 83.53  ? 252 PHE B CE2   1 
ATOM   2280 C CZ    . PHE B 1 148 ? -49.155 34.404 -11.489 1.00 80.93  ? 252 PHE B CZ    1 
ATOM   2281 N N     . GLY B 1 149 ? -55.373 32.858 -14.859 1.00 65.65  ? 253 GLY B N     1 
ATOM   2282 C CA    . GLY B 1 149 ? -56.296 32.519 -15.921 1.00 70.91  ? 253 GLY B CA    1 
ATOM   2283 C C     . GLY B 1 149 ? -57.661 33.154 -15.685 1.00 81.09  ? 253 GLY B C     1 
ATOM   2284 O O     . GLY B 1 149 ? -57.797 34.099 -14.897 1.00 82.26  ? 253 GLY B O     1 
ATOM   2285 N N     . LEU B 1 150 ? -58.673 32.632 -16.374 1.00 72.01  ? 254 LEU B N     1 
ATOM   2286 C CA    . LEU B 1 150 ? -60.043 33.064 -16.175 1.00 73.63  ? 254 LEU B CA    1 
ATOM   2287 C C     . LEU B 1 150 ? -60.457 32.906 -14.719 1.00 74.71  ? 254 LEU B C     1 
ATOM   2288 O O     . LEU B 1 150 ? -60.035 31.950 -14.056 1.00 84.14  ? 254 LEU B O     1 
ATOM   2289 C CB    . LEU B 1 150 ? -60.950 32.206 -17.042 1.00 69.08  ? 254 LEU B CB    1 
ATOM   2290 C CG    . LEU B 1 150 ? -62.402 32.622 -17.156 1.00 67.00  ? 254 LEU B CG    1 
ATOM   2291 C CD1   . LEU B 1 150 ? -62.444 34.012 -17.723 1.00 71.98  ? 254 LEU B CD1   1 
ATOM   2292 C CD2   . LEU B 1 150 ? -63.159 31.658 -18.045 1.00 79.67  ? 254 LEU B CD2   1 
ATOM   2293 N N     . GLN B 1 151 ? -61.270 33.829 -14.218 1.00 62.08  ? 255 GLN B N     1 
ATOM   2294 C CA    . GLN B 1 151 ? -61.803 33.679 -12.866 1.00 72.81  ? 255 GLN B CA    1 
ATOM   2295 C C     . GLN B 1 151 ? -63.318 33.476 -12.929 1.00 79.61  ? 255 GLN B C     1 
ATOM   2296 O O     . GLN B 1 151 ? -63.949 33.832 -13.920 1.00 89.47  ? 255 GLN B O     1 
ATOM   2297 C CB    . GLN B 1 151 ? -61.445 34.866 -11.972 1.00 75.71  ? 255 GLN B CB    1 
ATOM   2298 C CG    . GLN B 1 151 ? -59.976 35.264 -11.974 1.00 73.00  ? 255 GLN B CG    1 
ATOM   2299 C CD    . GLN B 1 151 ? -59.115 34.236 -11.294 1.00 75.73  ? 255 GLN B CD    1 
ATOM   2300 O OE1   . GLN B 1 151 ? -59.291 33.977 -10.100 1.00 81.06  ? 255 GLN B OE1   1 
ATOM   2301 N NE2   . GLN B 1 151 ? -58.184 33.623 -12.049 1.00 66.27  ? 255 GLN B NE2   1 
ATOM   2302 N N     . PRO B 1 152 ? -63.906 32.881 -11.882 1.00 78.39  ? 256 PRO B N     1 
ATOM   2303 C CA    . PRO B 1 152 ? -65.325 32.560 -11.922 1.00 72.73  ? 256 PRO B CA    1 
ATOM   2304 C C     . PRO B 1 152 ? -66.189 33.761 -12.179 1.00 78.37  ? 256 PRO B C     1 
ATOM   2305 O O     . PRO B 1 152 ? -66.885 33.802 -13.193 1.00 90.59  ? 256 PRO B O     1 
ATOM   2306 C CB    . PRO B 1 152 ? -65.611 32.051 -10.508 1.00 80.14  ? 256 PRO B CB    1 
ATOM   2307 C CG    . PRO B 1 152 ? -64.377 32.345 -9.693  1.00 82.90  ? 256 PRO B CG    1 
ATOM   2308 C CD    . PRO B 1 152 ? -63.258 32.328 -10.677 1.00 79.54  ? 256 PRO B CD    1 
ATOM   2309 N N     . HIS B 1 153 ? -66.146 34.725 -11.260 1.00 85.87  ? 257 HIS B N     1 
ATOM   2310 C CA    . HIS B 1 153 ? -67.068 35.885 -11.230 1.00 93.59  ? 257 HIS B CA    1 
ATOM   2311 C C     . HIS B 1 153 ? -66.833 36.897 -12.322 1.00 93.18  ? 257 HIS B C     1 
ATOM   2312 O O     . HIS B 1 153 ? -65.703 37.048 -12.806 1.00 107.48 ? 257 HIS B O     1 
ATOM   2313 C CB    . HIS B 1 153 ? -66.977 36.552 -9.869  1.00 87.53  ? 257 HIS B CB    1 
ATOM   2314 C CG    . HIS B 1 153 ? -66.731 35.570 -8.742  1.00 91.04  ? 257 HIS B CG    1 
ATOM   2315 N ND1   . HIS B 1 153 ? -67.679 34.718 -8.300  1.00 97.13  ? 257 HIS B ND1   1 
ATOM   2316 C CD2   . HIS B 1 153 ? -65.589 35.314 -7.984  1.00 88.15  ? 257 HIS B CD2   1 
ATOM   2317 C CE1   . HIS B 1 153 ? -67.176 33.974 -7.296  1.00 95.17  ? 257 HIS B CE1   1 
ATOM   2318 N NE2   . HIS B 1 153 ? -65.892 34.334 -7.113  1.00 89.54  ? 257 HIS B NE2   1 
ATOM   2319 N N     . LYS B 1 154 ? -67.897 37.578 -12.739 1.00 86.82  ? 258 LYS B N     1 
ATOM   2320 C CA    . LYS B 1 154 ? -67.800 38.569 -13.815 1.00 96.68  ? 258 LYS B CA    1 
ATOM   2321 C C     . LYS B 1 154 ? -67.774 39.967 -13.230 1.00 104.02 ? 258 LYS B C     1 
ATOM   2322 O O     . LYS B 1 154 ? -68.032 40.159 -12.032 1.00 105.01 ? 258 LYS B O     1 
ATOM   2323 C CB    . LYS B 1 154 ? -68.946 38.431 -14.833 1.00 98.07  ? 258 LYS B CB    1 
ATOM   2324 C CG    . LYS B 1 154 ? -68.773 37.237 -15.758 1.00 108.15 ? 258 LYS B CG    1 
ATOM   2325 C CD    . LYS B 1 154 ? -69.931 37.031 -16.728 1.00 103.67 ? 258 LYS B CD    1 
ATOM   2326 C CE    . LYS B 1 154 ? -69.905 35.612 -17.301 1.00 110.82 ? 258 LYS B CE    1 
ATOM   2327 N NZ    . LYS B 1 154 ? -70.756 35.384 -18.511 1.00 110.09 ? 258 LYS B NZ    1 
ATOM   2328 N N     . ILE B 1 155 ? -67.453 40.943 -14.078 1.00 100.90 ? 259 ILE B N     1 
ATOM   2329 C CA    . ILE B 1 155 ? -67.421 42.338 -13.659 1.00 103.15 ? 259 ILE B CA    1 
ATOM   2330 C C     . ILE B 1 155 ? -68.848 42.768 -13.351 1.00 105.09 ? 259 ILE B C     1 
ATOM   2331 O O     . ILE B 1 155 ? -69.715 42.630 -14.211 1.00 112.31 ? 259 ILE B O     1 
ATOM   2332 C CB    . ILE B 1 155 ? -66.771 43.234 -14.727 1.00 94.37  ? 259 ILE B CB    1 
ATOM   2333 C CG1   . ILE B 1 155 ? -65.279 42.950 -14.781 1.00 82.08  ? 259 ILE B CG1   1 
ATOM   2334 C CG2   . ILE B 1 155 ? -66.972 44.705 -14.401 1.00 104.56 ? 259 ILE B CG2   1 
ATOM   2335 C CD1   . ILE B 1 155 ? -64.583 43.689 -15.882 1.00 89.06  ? 259 ILE B CD1   1 
ATOM   2336 N N     . PRO B 1 156 ? -69.095 43.263 -12.117 1.00 103.80 ? 260 PRO B N     1 
ATOM   2337 C CA    . PRO B 1 156 ? -70.454 43.540 -11.634 1.00 99.87  ? 260 PRO B CA    1 
ATOM   2338 C C     . PRO B 1 156 ? -71.345 44.197 -12.688 1.00 103.71 ? 260 PRO B C     1 
ATOM   2339 O O     . PRO B 1 156 ? -70.961 45.202 -13.310 1.00 92.83  ? 260 PRO B O     1 
ATOM   2340 C CB    . PRO B 1 156 ? -70.214 44.468 -10.449 1.00 94.96  ? 260 PRO B CB    1 
ATOM   2341 C CG    . PRO B 1 156 ? -68.900 44.012 -9.905  1.00 96.35  ? 260 PRO B CG    1 
ATOM   2342 C CD    . PRO B 1 156 ? -68.078 43.568 -11.088 1.00 95.85  ? 260 PRO B CD    1 
ATOM   2343 N N     . ASP B 1 157 ? -72.509 43.587 -12.905 1.00 102.06 ? 261 ASP B N     1 
ATOM   2344 C CA    . ASP B 1 157 ? -73.505 44.074 -13.854 1.00 108.52 ? 261 ASP B CA    1 
ATOM   2345 C C     . ASP B 1 157 ? -72.924 44.197 -15.274 1.00 104.96 ? 261 ASP B C     1 
ATOM   2346 O O     . ASP B 1 157 ? -73.281 45.096 -16.031 1.00 111.64 ? 261 ASP B O     1 
ATOM   2347 C CB    . ASP B 1 157 ? -74.097 45.410 -13.363 1.00 117.09 ? 261 ASP B CB    1 
ATOM   2348 C CG    . ASP B 1 157 ? -74.474 45.392 -11.867 1.00 124.03 ? 261 ASP B CG    1 
ATOM   2349 O OD1   . ASP B 1 157 ? -74.052 44.480 -11.113 1.00 118.16 ? 261 ASP B OD1   1 
ATOM   2350 O OD2   . ASP B 1 157 ? -75.203 46.314 -11.440 1.00 128.15 ? 261 ASP B OD2   1 
ATOM   2351 N N     . THR B 1 158 ? -72.031 43.279 -15.624 1.00 106.04 ? 262 THR B N     1 
ATOM   2352 C CA    . THR B 1 158 ? -71.337 43.305 -16.913 1.00 109.65 ? 262 THR B CA    1 
ATOM   2353 C C     . THR B 1 158 ? -70.934 41.887 -17.324 1.00 111.99 ? 262 THR B C     1 
ATOM   2354 O O     . THR B 1 158 ? -70.624 41.050 -16.469 1.00 120.90 ? 262 THR B O     1 
ATOM   2355 C CB    . THR B 1 158 ? -70.073 44.205 -16.872 1.00 89.64  ? 262 THR B CB    1 
ATOM   2356 N N     . GLU B 1 159 ? -70.938 41.621 -18.631 1.00 110.80 ? 263 GLU B N     1 
ATOM   2357 C CA    . GLU B 1 159 ? -70.419 40.354 -19.151 1.00 107.39 ? 263 GLU B CA    1 
ATOM   2358 C C     . GLU B 1 159 ? -68.910 40.425 -19.444 1.00 109.26 ? 263 GLU B C     1 
ATOM   2359 O O     . GLU B 1 159 ? -68.400 39.708 -20.300 1.00 113.65 ? 263 GLU B O     1 
ATOM   2360 C CB    . GLU B 1 159 ? -71.230 39.868 -20.362 1.00 105.99 ? 263 GLU B CB    1 
ATOM   2361 C CG    . GLU B 1 159 ? -72.502 39.108 -19.989 1.00 95.17  ? 263 GLU B CG    1 
ATOM   2362 N N     . THR B 1 160 ? -68.202 41.295 -18.724 1.00 108.64 ? 264 THR B N     1 
ATOM   2363 C CA    . THR B 1 160 ? -66.745 41.332 -18.801 1.00 94.95  ? 264 THR B CA    1 
ATOM   2364 C C     . THR B 1 160 ? -66.189 40.318 -17.804 1.00 89.07  ? 264 THR B C     1 
ATOM   2365 O O     . THR B 1 160 ? -66.502 40.361 -16.619 1.00 93.29  ? 264 THR B O     1 
ATOM   2366 C CB    . THR B 1 160 ? -66.156 42.726 -18.489 1.00 92.39  ? 264 THR B CB    1 
ATOM   2367 O OG1   . THR B 1 160 ? -66.781 43.717 -19.301 1.00 98.26  ? 264 THR B OG1   1 
ATOM   2368 C CG2   . THR B 1 160 ? -64.661 42.748 -18.786 1.00 91.91  ? 264 THR B CG2   1 
ATOM   2369 N N     . LEU B 1 161 ? -65.377 39.404 -18.305 1.00 75.71  ? 265 LEU B N     1 
ATOM   2370 C CA    . LEU B 1 161 ? -64.733 38.390 -17.489 1.00 83.40  ? 265 LEU B CA    1 
ATOM   2371 C C     . LEU B 1 161 ? -63.430 38.925 -16.882 1.00 93.45  ? 265 LEU B C     1 
ATOM   2372 O O     . LEU B 1 161 ? -62.806 39.840 -17.437 1.00 101.77 ? 265 LEU B O     1 
ATOM   2373 C CB    . LEU B 1 161 ? -64.410 37.127 -18.334 1.00 78.19  ? 265 LEU B CB    1 
ATOM   2374 C CG    . LEU B 1 161 ? -65.370 36.638 -19.418 1.00 67.90  ? 265 LEU B CG    1 
ATOM   2375 C CD1   . LEU B 1 161 ? -64.789 35.478 -20.193 1.00 57.15  ? 265 LEU B CD1   1 
ATOM   2376 C CD2   . LEU B 1 161 ? -66.703 36.276 -18.787 1.00 72.31  ? 265 LEU B CD2   1 
ATOM   2377 N N     . CYS B 1 162 ? -63.024 38.319 -15.761 1.00 87.02  ? 266 CYS B N     1 
ATOM   2378 C CA    . CYS B 1 162 ? -61.785 38.637 -15.077 1.00 73.12  ? 266 CYS B CA    1 
ATOM   2379 C C     . CYS B 1 162 ? -60.738 37.603 -15.403 1.00 73.32  ? 266 CYS B C     1 
ATOM   2380 O O     . CYS B 1 162 ? -60.887 36.455 -15.015 1.00 88.05  ? 266 CYS B O     1 
ATOM   2381 C CB    . CYS B 1 162 ? -62.021 38.617 -13.567 1.00 74.77  ? 266 CYS B CB    1 
ATOM   2382 S SG    . CYS B 1 162 ? -63.189 39.879 -13.013 1.00 84.41  ? 266 CYS B SG    1 
ATOM   2383 N N     . TYR B 1 163 ? -59.672 38.019 -16.081 1.00 66.52  ? 267 TYR B N     1 
ATOM   2384 C CA    . TYR B 1 163 ? -58.550 37.158 -16.449 1.00 64.29  ? 267 TYR B CA    1 
ATOM   2385 C C     . TYR B 1 163 ? -57.312 37.632 -15.702 1.00 73.24  ? 267 TYR B C     1 
ATOM   2386 O O     . TYR B 1 163 ? -56.997 38.829 -15.761 1.00 80.17  ? 267 TYR B O     1 
ATOM   2387 C CB    . TYR B 1 163 ? -58.298 37.274 -17.957 1.00 57.71  ? 267 TYR B CB    1 
ATOM   2388 C CG    . TYR B 1 163 ? -57.275 36.314 -18.497 1.00 55.08  ? 267 TYR B CG    1 
ATOM   2389 C CD1   . TYR B 1 163 ? -57.610 35.008 -18.821 1.00 56.01  ? 267 TYR B CD1   1 
ATOM   2390 C CD2   . TYR B 1 163 ? -55.963 36.700 -18.674 1.00 58.13  ? 267 TYR B CD2   1 
ATOM   2391 C CE1   . TYR B 1 163 ? -56.656 34.112 -19.303 1.00 49.80  ? 267 TYR B CE1   1 
ATOM   2392 C CE2   . TYR B 1 163 ? -55.011 35.812 -19.186 1.00 60.96  ? 267 TYR B CE2   1 
ATOM   2393 C CZ    . TYR B 1 163 ? -55.377 34.520 -19.487 1.00 56.93  ? 267 TYR B CZ    1 
ATOM   2394 O OH    . TYR B 1 163 ? -54.434 33.653 -19.989 1.00 72.59  ? 267 TYR B OH    1 
ATOM   2395 N N     . VAL B 1 164 ? -56.602 36.726 -15.009 1.00 64.18  ? 268 VAL B N     1 
ATOM   2396 C CA    . VAL B 1 164 ? -55.441 37.149 -14.222 1.00 64.67  ? 268 VAL B CA    1 
ATOM   2397 C C     . VAL B 1 164 ? -54.134 36.718 -14.866 1.00 67.87  ? 268 VAL B C     1 
ATOM   2398 O O     . VAL B 1 164 ? -53.889 35.540 -15.068 1.00 69.56  ? 268 VAL B O     1 
ATOM   2399 C CB    . VAL B 1 164 ? -55.505 36.692 -12.726 1.00 61.68  ? 268 VAL B CB    1 
ATOM   2400 C CG1   . VAL B 1 164 ? -54.203 37.021 -12.007 1.00 57.24  ? 268 VAL B CG1   1 
ATOM   2401 C CG2   . VAL B 1 164 ? -56.640 37.365 -11.985 1.00 53.84  ? 268 VAL B CG2   1 
ATOM   2402 N N     . MET B 1 165 ? -53.285 37.693 -15.156 1.00 74.22  ? 269 MET B N     1 
ATOM   2403 C CA    . MET B 1 165 ? -51.998 37.442 -15.800 1.00 77.44  ? 269 MET B CA    1 
ATOM   2404 C C     . MET B 1 165 ? -50.892 37.732 -14.788 1.00 82.75  ? 269 MET B C     1 
ATOM   2405 O O     . MET B 1 165 ? -51.052 38.609 -13.919 1.00 84.85  ? 269 MET B O     1 
ATOM   2406 C CB    . MET B 1 165 ? -51.850 38.369 -17.028 1.00 79.34  ? 269 MET B CB    1 
ATOM   2407 C CG    . MET B 1 165 ? -51.098 37.765 -18.204 1.00 77.78  ? 269 MET B CG    1 
ATOM   2408 N N     . PRO B 1 166 ? -49.767 37.006 -14.871 1.00 74.21  ? 270 PRO B N     1 
ATOM   2409 C CA    . PRO B 1 166 ? -48.653 37.412 -14.017 1.00 78.40  ? 270 PRO B CA    1 
ATOM   2410 C C     . PRO B 1 166 ? -48.141 38.783 -14.421 1.00 88.06  ? 270 PRO B C     1 
ATOM   2411 O O     . PRO B 1 166 ? -48.061 39.074 -15.623 1.00 99.93  ? 270 PRO B O     1 
ATOM   2412 C CB    . PRO B 1 166 ? -47.580 36.351 -14.296 1.00 80.27  ? 270 PRO B CB    1 
ATOM   2413 C CG    . PRO B 1 166 ? -47.966 35.722 -15.591 1.00 83.16  ? 270 PRO B CG    1 
ATOM   2414 C CD    . PRO B 1 166 ? -49.469 35.789 -15.638 1.00 79.39  ? 270 PRO B CD    1 
ATOM   2415 N N     . SER B 1 167 ? -47.781 39.601 -13.430 1.00 97.48  ? 271 SER B N     1 
ATOM   2416 C CA    . SER B 1 167 ? -47.308 40.983 -13.636 1.00 100.68 ? 271 SER B CA    1 
ATOM   2417 C C     . SER B 1 167 ? -46.216 41.128 -14.691 1.00 108.71 ? 271 SER B C     1 
ATOM   2418 O O     . SER B 1 167 ? -45.194 40.411 -14.664 1.00 100.50 ? 271 SER B O     1 
ATOM   2419 C CB    . SER B 1 167 ? -46.806 41.588 -12.321 1.00 103.25 ? 271 SER B CB    1 
ATOM   2420 O OG    . SER B 1 167 ? -47.173 42.956 -12.207 1.00 109.57 ? 271 SER B OG    1 
ATOM   2421 N N     . SER B 1 168 ? -46.452 42.064 -15.615 1.00 109.49 ? 272 SER B N     1 
ATOM   2422 C CA    . SER B 1 168 ? -45.461 42.464 -16.619 1.00 104.84 ? 272 SER B CA    1 
ATOM   2423 C C     . SER B 1 168 ? -44.232 43.135 -15.970 1.00 100.93 ? 272 SER B C     1 
ATOM   2424 O O     . SER B 1 168 ? -43.142 43.109 -16.529 1.00 97.47  ? 272 SER B O     1 
ATOM   2425 C CB    . SER B 1 168 ? -46.110 43.393 -17.649 1.00 89.41  ? 272 SER B CB    1 
ATOM   2426 N N     . SER B 1 169 ? -44.421 43.732 -14.792 1.00 98.23  ? 273 SER B N     1 
ATOM   2427 C CA    . SER B 1 169 ? -43.332 44.355 -14.043 1.00 97.92  ? 273 SER B CA    1 
ATOM   2428 C C     . SER B 1 169 ? -42.117 43.437 -14.028 1.00 88.26  ? 273 SER B C     1 
ATOM   2429 O O     . SER B 1 169 ? -42.253 42.226 -13.930 1.00 85.25  ? 273 SER B O     1 
ATOM   2430 C CB    . SER B 1 169 ? -43.788 44.696 -12.611 1.00 97.28  ? 273 SER B CB    1 
ATOM   2431 O OG    . SER B 1 169 ? -42.749 45.284 -11.836 1.00 94.77  ? 273 SER B OG    1 
ATOM   2432 N N     . ALA B 1 170 ? -40.931 44.016 -14.158 1.00 104.34 ? 274 ALA B N     1 
ATOM   2433 C CA    . ALA B 1 170 ? -39.696 43.224 -14.172 1.00 124.49 ? 274 ALA B CA    1 
ATOM   2434 C C     . ALA B 1 170 ? -39.203 42.920 -12.755 1.00 124.47 ? 274 ALA B C     1 
ATOM   2435 O O     . ALA B 1 170 ? -37.996 42.909 -12.476 1.00 99.20  ? 274 ALA B O     1 
ATOM   2436 C CB    . ALA B 1 170 ? -38.617 43.917 -14.996 1.00 126.95 ? 274 ALA B CB    1 
ATOM   2437 N N     . ARG B 1 171 ? -40.154 42.673 -11.862 1.00 131.55 ? 275 ARG B N     1 
ATOM   2438 C CA    . ARG B 1 171 ? -39.831 42.337 -10.483 1.00 148.00 ? 275 ARG B CA    1 
ATOM   2439 C C     . ARG B 1 171 ? -40.292 40.951 -10.092 1.00 154.38 ? 275 ARG B C     1 
ATOM   2440 O O     . ARG B 1 171 ? -40.056 40.505 -8.965  1.00 159.89 ? 275 ARG B O     1 
ATOM   2441 C CB    . ARG B 1 171 ? -40.392 43.379 -9.532  1.00 145.53 ? 275 ARG B CB    1 
ATOM   2442 C CG    . ARG B 1 171 ? -39.286 44.131 -8.844  1.00 143.80 ? 275 ARG B CG    1 
ATOM   2443 C CD    . ARG B 1 171 ? -39.677 45.561 -8.571  1.00 156.89 ? 275 ARG B CD    1 
ATOM   2444 N NE    . ARG B 1 171 ? -40.689 45.705 -7.541  1.00 153.08 ? 275 ARG B NE    1 
ATOM   2445 C CZ    . ARG B 1 171 ? -41.322 46.845 -7.290  1.00 168.80 ? 275 ARG B CZ    1 
ATOM   2446 N NH1   . ARG B 1 171 ? -42.237 46.902 -6.341  1.00 172.02 ? 275 ARG B NH1   1 
ATOM   2447 N NH2   . ARG B 1 171 ? -41.057 47.929 -8.006  1.00 195.03 ? 275 ARG B NH2   1 
ATOM   2448 N N     . CYS B 1 172 ? -40.924 40.269 -11.043 1.00 150.83 ? 276 CYS B N     1 
ATOM   2449 C CA    . CYS B 1 172 ? -41.433 38.933 -10.832 1.00 144.95 ? 276 CYS B CA    1 
ATOM   2450 C C     . CYS B 1 172 ? -40.388 37.915 -11.270 1.00 152.53 ? 276 CYS B C     1 
ATOM   2451 O O     . CYS B 1 172 ? -39.963 37.920 -12.436 1.00 147.85 ? 276 CYS B O     1 
ATOM   2452 C CB    . CYS B 1 172 ? -42.733 38.742 -11.600 1.00 136.41 ? 276 CYS B CB    1 
ATOM   2453 S SG    . CYS B 1 172 ? -43.756 37.402 -10.960 1.00 162.51 ? 276 CYS B SG    1 
ATOM   2454 N N     . ALA B 1 173 ? -39.982 37.070 -10.312 1.00 139.59 ? 277 ALA B N     1 
ATOM   2455 C CA    . ALA B 1 173 ? -38.956 36.041 -10.497 1.00 135.23 ? 277 ALA B CA    1 
ATOM   2456 C C     . ALA B 1 173 ? -39.523 34.662 -10.782 1.00 124.54 ? 277 ALA B C     1 
ATOM   2457 O O     . ALA B 1 173 ? -38.809 33.788 -11.285 1.00 133.93 ? 277 ALA B O     1 
ATOM   2458 C CB    . ALA B 1 173 ? -38.051 35.975 -9.283  1.00 144.67 ? 277 ALA B CB    1 
ATOM   2459 N N     . GLN B 1 174 ? -40.784 34.454 -10.412 1.00 122.62 ? 278 GLN B N     1 
ATOM   2460 C CA    . GLN B 1 174 ? -41.555 33.333 -10.932 1.00 130.44 ? 278 GLN B CA    1 
ATOM   2461 C C     . GLN B 1 174 ? -41.628 33.527 -12.440 1.00 133.56 ? 278 GLN B C     1 
ATOM   2462 O O     . GLN B 1 174 ? -41.697 32.554 -13.204 1.00 117.97 ? 278 GLN B O     1 
ATOM   2463 C CB    . GLN B 1 174 ? -42.966 33.332 -10.339 1.00 127.11 ? 278 GLN B CB    1 
ATOM   2464 N N     . PHE B 1 175 ? -41.577 34.806 -12.838 1.00 140.26 ? 279 PHE B N     1 
ATOM   2465 C CA    . PHE B 1 175 ? -41.645 35.250 -14.229 1.00 138.59 ? 279 PHE B CA    1 
ATOM   2466 C C     . PHE B 1 175 ? -40.387 36.041 -14.631 1.00 131.60 ? 279 PHE B C     1 
ATOM   2467 O O     . PHE B 1 175 ? -40.484 37.195 -15.062 1.00 132.43 ? 279 PHE B O     1 
ATOM   2468 C CB    . PHE B 1 175 ? -42.889 36.115 -14.417 1.00 135.32 ? 279 PHE B CB    1 
ATOM   2469 N N     . PRO B 1 176 ? -39.204 35.413 -14.509 1.00 127.50 ? 280 PRO B N     1 
ATOM   2470 C CA    . PRO B 1 176 ? -37.937 36.131 -14.632 1.00 125.99 ? 280 PRO B CA    1 
ATOM   2471 C C     . PRO B 1 176 ? -37.709 36.772 -16.000 1.00 126.71 ? 280 PRO B C     1 
ATOM   2472 O O     . PRO B 1 176 ? -37.127 37.854 -16.077 1.00 133.86 ? 280 PRO B O     1 
ATOM   2473 C CB    . PRO B 1 176 ? -36.896 35.048 -14.350 1.00 125.39 ? 280 PRO B CB    1 
ATOM   2474 C CG    . PRO B 1 176 ? -37.560 33.769 -14.714 1.00 122.95 ? 280 PRO B CG    1 
ATOM   2475 C CD    . PRO B 1 176 ? -38.994 33.963 -14.335 1.00 133.48 ? 280 PRO B CD    1 
ATOM   2476 N N     . ARG B 1 177 ? -38.163 36.106 -17.058 1.00 131.82 ? 281 ARG B N     1 
ATOM   2477 C CA    . ARG B 1 177 ? -38.031 36.612 -18.418 1.00 134.19 ? 281 ARG B CA    1 
ATOM   2478 C C     . ARG B 1 177 ? -39.436 36.835 -18.964 1.00 136.92 ? 281 ARG B C     1 
ATOM   2479 O O     . ARG B 1 177 ? -40.410 36.414 -18.341 1.00 144.16 ? 281 ARG B O     1 
ATOM   2480 C CB    . ARG B 1 177 ? -37.256 35.599 -19.280 1.00 127.68 ? 281 ARG B CB    1 
ATOM   2481 C CG    . ARG B 1 177 ? -36.422 36.210 -20.399 1.00 120.80 ? 281 ARG B CG    1 
ATOM   2482 C CD    . ARG B 1 177 ? -35.469 35.192 -21.003 1.00 126.43 ? 281 ARG B CD    1 
ATOM   2483 N N     . ALA B 1 178 ? -39.533 37.524 -20.101 1.00 132.19 ? 282 ALA B N     1 
ATOM   2484 C CA    . ALA B 1 178 ? -40.763 37.587 -20.891 1.00 126.64 ? 282 ALA B CA    1 
ATOM   2485 C C     . ALA B 1 178 ? -40.936 36.301 -21.726 1.00 132.57 ? 282 ALA B C     1 
ATOM   2486 O O     . ALA B 1 178 ? -41.996 36.052 -22.324 1.00 123.14 ? 282 ALA B O     1 
ATOM   2487 C CB    . ALA B 1 178 ? -40.745 38.815 -21.785 1.00 113.50 ? 282 ALA B CB    1 
ATOM   2488 N N     . GLN B 1 179 ? -39.880 35.491 -21.760 1.00 141.03 ? 283 GLN B N     1 
ATOM   2489 C CA    . GLN B 1 179 ? -39.922 34.158 -22.350 1.00 157.12 ? 283 GLN B CA    1 
ATOM   2490 C C     . GLN B 1 179 ? -40.636 33.194 -21.392 1.00 161.07 ? 283 GLN B C     1 
ATOM   2491 O O     . GLN B 1 179 ? -41.270 32.228 -21.826 1.00 158.17 ? 283 GLN B O     1 
ATOM   2492 C CB    . GLN B 1 179 ? -38.498 33.676 -22.641 1.00 165.75 ? 283 GLN B CB    1 
ATOM   2493 C CG    . GLN B 1 179 ? -38.388 32.340 -23.369 1.00 176.90 ? 283 GLN B CG    1 
ATOM   2494 C CD    . GLN B 1 179 ? -36.975 31.761 -23.357 1.00 184.71 ? 283 GLN B CD    1 
ATOM   2495 O OE1   . GLN B 1 179 ? -36.061 32.309 -22.730 1.00 177.83 ? 283 GLN B OE1   1 
ATOM   2496 N NE2   . GLN B 1 179 ? -36.793 30.641 -24.055 1.00 187.74 ? 283 GLN B NE2   1 
ATOM   2497 N N     . ASP B 1 180 ? -40.536 33.484 -20.092 1.00 154.52 ? 284 ASP B N     1 
ATOM   2498 C CA    . ASP B 1 180 ? -41.170 32.690 -19.031 1.00 150.32 ? 284 ASP B CA    1 
ATOM   2499 C C     . ASP B 1 180 ? -42.702 32.847 -18.949 1.00 139.66 ? 284 ASP B C     1 
ATOM   2500 O O     . ASP B 1 180 ? -43.413 31.861 -18.750 1.00 156.04 ? 284 ASP B O     1 
ATOM   2501 C CB    . ASP B 1 180 ? -40.541 33.015 -17.666 1.00 135.29 ? 284 ASP B CB    1 
ATOM   2502 N N     . LYS B 1 181 ? -43.187 34.081 -19.106 1.00 118.57 ? 285 LYS B N     1 
ATOM   2503 C CA    . LYS B 1 181 ? -44.600 34.449 -18.940 1.00 108.88 ? 285 LYS B CA    1 
ATOM   2504 C C     . LYS B 1 181 ? -45.350 34.749 -20.258 1.00 106.00 ? 285 LYS B C     1 
ATOM   2505 O O     . LYS B 1 181 ? -46.290 35.549 -20.269 1.00 83.05  ? 285 LYS B O     1 
ATOM   2506 C CB    . LYS B 1 181 ? -44.700 35.669 -18.002 1.00 102.15 ? 285 LYS B CB    1 
ATOM   2507 N N     . VAL B 1 182 ? -44.929 34.140 -21.368 1.00 112.78 ? 286 VAL B N     1 
ATOM   2508 C CA    . VAL B 1 182 ? -45.620 34.363 -22.644 1.00 105.61 ? 286 VAL B CA    1 
ATOM   2509 C C     . VAL B 1 182 ? -46.868 33.496 -22.738 1.00 101.67 ? 286 VAL B C     1 
ATOM   2510 O O     . VAL B 1 182 ? -47.863 33.908 -23.331 1.00 108.31 ? 286 VAL B O     1 
ATOM   2511 C CB    . VAL B 1 182 ? -44.720 34.116 -23.874 1.00 94.30  ? 286 VAL B CB    1 
ATOM   2512 N N     . HIS B 1 183 ? -46.813 32.305 -22.143 1.00 102.01 ? 287 HIS B N     1 
ATOM   2513 C CA    . HIS B 1 183 ? -47.904 31.316 -22.256 1.00 108.17 ? 287 HIS B CA    1 
ATOM   2514 C C     . HIS B 1 183 ? -49.267 31.913 -22.040 1.00 106.90 ? 287 HIS B C     1 
ATOM   2515 O O     . HIS B 1 183 ? -50.130 31.852 -22.922 1.00 113.98 ? 287 HIS B O     1 
ATOM   2516 C CB    . HIS B 1 183 ? -47.682 30.130 -21.315 1.00 109.66 ? 287 HIS B CB    1 
ATOM   2517 N N     . TYR B 1 184 ? -49.456 32.521 -20.873 1.00 101.26 ? 288 TYR B N     1 
ATOM   2518 C CA    . TYR B 1 184 ? -50.700 33.190 -20.503 1.00 93.55  ? 288 TYR B CA    1 
ATOM   2519 C C     . TYR B 1 184 ? -51.253 34.149 -21.555 1.00 98.66  ? 288 TYR B C     1 
ATOM   2520 O O     . TYR B 1 184 ? -52.471 34.284 -21.665 1.00 87.91  ? 288 TYR B O     1 
ATOM   2521 C CB    . TYR B 1 184 ? -50.510 33.913 -19.172 1.00 106.86 ? 288 TYR B CB    1 
ATOM   2522 C CG    . TYR B 1 184 ? -50.177 32.954 -18.051 1.00 121.43 ? 288 TYR B CG    1 
ATOM   2523 C CD1   . TYR B 1 184 ? -51.115 32.021 -17.611 1.00 126.31 ? 288 TYR B CD1   1 
ATOM   2524 C CD2   . TYR B 1 184 ? -48.926 32.960 -17.442 1.00 124.63 ? 288 TYR B CD2   1 
ATOM   2525 C CE1   . TYR B 1 184 ? -50.820 31.126 -16.598 1.00 126.54 ? 288 TYR B CE1   1 
ATOM   2526 C CE2   . TYR B 1 184 ? -48.627 32.073 -16.415 1.00 130.05 ? 288 TYR B CE2   1 
ATOM   2527 C CZ    . TYR B 1 184 ? -49.580 31.157 -15.999 1.00 124.90 ? 288 TYR B CZ    1 
ATOM   2528 O OH    . TYR B 1 184 ? -49.305 30.261 -14.989 1.00 123.87 ? 288 TYR B OH    1 
ATOM   2529 N N     . TYR B 1 185 ? -50.355 34.805 -22.309 1.00 107.20 ? 289 TYR B N     1 
ATOM   2530 C CA    . TYR B 1 185 ? -50.717 35.714 -23.420 1.00 107.82 ? 289 TYR B CA    1 
ATOM   2531 C C     . TYR B 1 185 ? -51.265 34.949 -24.630 1.00 101.25 ? 289 TYR B C     1 
ATOM   2532 O O     . TYR B 1 185 ? -52.247 35.368 -25.278 1.00 82.50  ? 289 TYR B O     1 
ATOM   2533 C CB    . TYR B 1 185 ? -49.503 36.538 -23.871 1.00 101.43 ? 289 TYR B CB    1 
ATOM   2534 C CG    . TYR B 1 185 ? -49.190 37.733 -23.011 1.00 104.88 ? 289 TYR B CG    1 
ATOM   2535 C CD1   . TYR B 1 185 ? -48.324 37.619 -21.939 1.00 99.07  ? 289 TYR B CD1   1 
ATOM   2536 C CD2   . TYR B 1 185 ? -49.755 38.994 -23.280 1.00 113.77 ? 289 TYR B CD2   1 
ATOM   2537 C CE1   . TYR B 1 185 ? -48.025 38.712 -21.142 1.00 99.39  ? 289 TYR B CE1   1 
ATOM   2538 C CE2   . TYR B 1 185 ? -49.463 40.099 -22.485 1.00 98.03  ? 289 TYR B CE2   1 
ATOM   2539 C CZ    . TYR B 1 185 ? -48.595 39.944 -21.416 1.00 103.23 ? 289 TYR B CZ    1 
ATOM   2540 O OH    . TYR B 1 185 ? -48.288 41.009 -20.600 1.00 105.79 ? 289 TYR B OH    1 
ATOM   2541 N N     . ILE B 1 186 ? -50.599 33.842 -24.948 1.00 95.01  ? 290 ILE B N     1 
ATOM   2542 C CA    . ILE B 1 186 ? -51.111 32.921 -25.941 1.00 103.10 ? 290 ILE B CA    1 
ATOM   2543 C C     . ILE B 1 186 ? -52.524 32.538 -25.505 1.00 100.34 ? 290 ILE B C     1 
ATOM   2544 O O     . ILE B 1 186 ? -53.502 32.842 -26.208 1.00 93.92  ? 290 ILE B O     1 
ATOM   2545 C CB    . ILE B 1 186 ? -50.201 31.684 -26.087 1.00 100.79 ? 290 ILE B CB    1 
ATOM   2546 N N     . LYS B 1 187 ? -52.631 31.946 -24.313 1.00 92.35  ? 291 LYS B N     1 
ATOM   2547 C CA    . LYS B 1 187 ? -53.935 31.556 -23.748 1.00 100.44 ? 291 LYS B CA    1 
ATOM   2548 C C     . LYS B 1 187 ? -54.929 32.734 -23.707 1.00 93.55  ? 291 LYS B C     1 
ATOM   2549 O O     . LYS B 1 187 ? -56.113 32.568 -23.976 1.00 87.46  ? 291 LYS B O     1 
ATOM   2550 C CB    . LYS B 1 187 ? -53.764 30.910 -22.366 1.00 97.72  ? 291 LYS B CB    1 
ATOM   2551 N N     . LEU B 1 188 ? -54.440 33.928 -23.403 1.00 95.20  ? 292 LEU B N     1 
ATOM   2552 C CA    . LEU B 1 188 ? -55.288 35.118 -23.468 1.00 103.90 ? 292 LEU B CA    1 
ATOM   2553 C C     . LEU B 1 188 ? -55.842 35.312 -24.862 1.00 98.46  ? 292 LEU B C     1 
ATOM   2554 O O     . LEU B 1 188 ? -57.048 35.538 -25.020 1.00 100.00 ? 292 LEU B O     1 
ATOM   2555 C CB    . LEU B 1 188 ? -54.543 36.384 -23.050 1.00 96.75  ? 292 LEU B CB    1 
ATOM   2556 C CG    . LEU B 1 188 ? -55.423 37.629 -23.219 1.00 98.92  ? 292 LEU B CG    1 
ATOM   2557 C CD1   . LEU B 1 188 ? -56.429 37.841 -22.096 1.00 93.10  ? 292 LEU B CD1   1 
ATOM   2558 C CD2   . LEU B 1 188 ? -54.544 38.853 -23.341 1.00 112.87 ? 292 LEU B CD2   1 
ATOM   2559 N N     . LYS B 1 189 ? -54.966 35.212 -25.861 1.00 88.69  ? 293 LYS B N     1 
ATOM   2560 C CA    . LYS B 1 189 ? -55.391 35.391 -27.246 1.00 98.69  ? 293 LYS B CA    1 
ATOM   2561 C C     . LYS B 1 189 ? -56.532 34.425 -27.560 1.00 97.69  ? 293 LYS B C     1 
ATOM   2562 O O     . LYS B 1 189 ? -57.635 34.840 -27.985 1.00 85.03  ? 293 LYS B O     1 
ATOM   2563 C CB    . LYS B 1 189 ? -54.222 35.189 -28.218 1.00 111.17 ? 293 LYS B CB    1 
ATOM   2564 N N     . ASP B 1 190 ? -56.269 33.143 -27.305 1.00 88.25  ? 294 ASP B N     1 
ATOM   2565 C CA    . ASP B 1 190 ? -57.264 32.093 -27.488 1.00 82.76  ? 294 ASP B CA    1 
ATOM   2566 C C     . ASP B 1 190 ? -58.612 32.507 -26.923 1.00 81.85  ? 294 ASP B C     1 
ATOM   2567 O O     . ASP B 1 190 ? -59.616 32.475 -27.633 1.00 93.11  ? 294 ASP B O     1 
ATOM   2568 C CB    . ASP B 1 190 ? -56.788 30.790 -26.856 1.00 84.60  ? 294 ASP B CB    1 
ATOM   2569 N N     . LEU B 1 191 ? -58.635 32.926 -25.659 1.00 85.09  ? 295 LEU B N     1 
ATOM   2570 C CA    . LEU B 1 191 ? -59.898 33.279 -24.997 1.00 79.89  ? 295 LEU B CA    1 
ATOM   2571 C C     . LEU B 1 191 ? -60.647 34.349 -25.773 1.00 80.14  ? 295 LEU B C     1 
ATOM   2572 O O     . LEU B 1 191 ? -61.871 34.274 -25.890 1.00 80.05  ? 295 LEU B O     1 
ATOM   2573 C CB    . LEU B 1 191 ? -59.686 33.693 -23.521 1.00 75.51  ? 295 LEU B CB    1 
ATOM   2574 C CG    . LEU B 1 191 ? -60.849 34.370 -22.756 1.00 72.28  ? 295 LEU B CG    1 
ATOM   2575 C CD1   . LEU B 1 191 ? -62.104 33.512 -22.689 1.00 80.99  ? 295 LEU B CD1   1 
ATOM   2576 C CD2   . LEU B 1 191 ? -60.439 34.698 -21.346 1.00 71.86  ? 295 LEU B CD2   1 
ATOM   2577 N N     . ARG B 1 192 ? -59.924 35.338 -26.301 1.00 84.95  ? 296 ARG B N     1 
ATOM   2578 C CA    . ARG B 1 192 ? -60.554 36.398 -27.107 1.00 98.22  ? 296 ARG B CA    1 
ATOM   2579 C C     . ARG B 1 192 ? -61.231 35.768 -28.318 1.00 102.34 ? 296 ARG B C     1 
ATOM   2580 O O     . ARG B 1 192 ? -62.433 35.960 -28.540 1.00 95.67  ? 296 ARG B O     1 
ATOM   2581 C CB    . ARG B 1 192 ? -59.537 37.454 -27.567 1.00 90.88  ? 296 ARG B CB    1 
ATOM   2582 N N     . ASP B 1 193 ? -60.447 34.998 -29.075 1.00 94.38  ? 297 ASP B N     1 
ATOM   2583 C CA    . ASP B 1 193 ? -60.960 34.196 -30.182 1.00 98.23  ? 297 ASP B CA    1 
ATOM   2584 C C     . ASP B 1 193 ? -62.224 33.409 -29.789 1.00 98.91  ? 297 ASP B C     1 
ATOM   2585 O O     . ASP B 1 193 ? -63.290 33.592 -30.397 1.00 101.77 ? 297 ASP B O     1 
ATOM   2586 C CB    . ASP B 1 193 ? -59.869 33.254 -30.705 1.00 98.45  ? 297 ASP B CB    1 
ATOM   2587 C CG    . ASP B 1 193 ? -58.699 34.006 -31.357 1.00 98.22  ? 297 ASP B CG    1 
ATOM   2588 O OD1   . ASP B 1 193 ? -58.959 34.979 -32.101 1.00 102.11 ? 297 ASP B OD1   1 
ATOM   2589 O OD2   . ASP B 1 193 ? -57.522 33.622 -31.133 1.00 80.36  ? 297 ASP B OD2   1 
ATOM   2590 N N     . GLN B 1 194 ? -62.112 32.564 -28.761 1.00 97.27  ? 298 GLN B N     1 
ATOM   2591 C CA    . GLN B 1 194 ? -63.270 31.794 -28.266 1.00 102.19 ? 298 GLN B CA    1 
ATOM   2592 C C     . GLN B 1 194 ? -64.478 32.707 -28.024 1.00 105.67 ? 298 GLN B C     1 
ATOM   2593 O O     . GLN B 1 194 ? -65.599 32.373 -28.400 1.00 128.16 ? 298 GLN B O     1 
ATOM   2594 C CB    . GLN B 1 194 ? -62.934 30.976 -27.010 1.00 84.69  ? 298 GLN B CB    1 
ATOM   2595 N N     . LEU B 1 195 ? -64.233 33.870 -27.431 1.00 96.90  ? 299 LEU B N     1 
ATOM   2596 C CA    . LEU B 1 195 ? -65.292 34.825 -27.147 1.00 99.55  ? 299 LEU B CA    1 
ATOM   2597 C C     . LEU B 1 195 ? -65.862 35.459 -28.408 1.00 97.98  ? 299 LEU B C     1 
ATOM   2598 O O     . LEU B 1 195 ? -67.019 35.882 -28.429 1.00 88.96  ? 299 LEU B O     1 
ATOM   2599 C CB    . LEU B 1 195 ? -64.756 35.914 -26.226 1.00 105.66 ? 299 LEU B CB    1 
ATOM   2600 C CG    . LEU B 1 195 ? -65.044 35.743 -24.746 1.00 91.24  ? 299 LEU B CG    1 
ATOM   2601 C CD1   . LEU B 1 195 ? -63.868 36.335 -24.004 1.00 85.43  ? 299 LEU B CD1   1 
ATOM   2602 C CD2   . LEU B 1 195 ? -66.359 36.443 -24.373 1.00 82.10  ? 299 LEU B CD2   1 
ATOM   2603 N N     . LYS B 1 196 ? -65.042 35.540 -29.452 1.00 106.47 ? 300 LYS B N     1 
ATOM   2604 C CA    . LYS B 1 196 ? -65.487 36.098 -30.731 1.00 118.10 ? 300 LYS B CA    1 
ATOM   2605 C C     . LYS B 1 196 ? -66.406 35.112 -31.443 1.00 125.76 ? 300 LYS B C     1 
ATOM   2606 O O     . LYS B 1 196 ? -67.378 35.523 -32.082 1.00 130.56 ? 300 LYS B O     1 
ATOM   2607 C CB    . LYS B 1 196 ? -64.298 36.477 -31.621 1.00 124.59 ? 300 LYS B CB    1 
ATOM   2608 N N     . GLY B 1 197 ? -66.104 33.818 -31.314 1.00 126.31 ? 301 GLY B N     1 
ATOM   2609 C CA    . GLY B 1 197 ? -66.953 32.752 -31.862 1.00 125.72 ? 301 GLY B CA    1 
ATOM   2610 C C     . GLY B 1 197 ? -68.399 32.749 -31.373 1.00 126.59 ? 301 GLY B C     1 
ATOM   2611 O O     . GLY B 1 197 ? -69.321 32.485 -32.155 1.00 142.73 ? 301 GLY B O     1 
ATOM   2612 N N     . ILE B 1 198 ? -68.600 33.049 -30.087 1.00 117.98 ? 302 ILE B N     1 
ATOM   2613 C CA    . ILE B 1 198 ? -69.934 33.046 -29.460 1.00 125.36 ? 302 ILE B CA    1 
ATOM   2614 C C     . ILE B 1 198 ? -70.875 34.172 -29.929 1.00 126.66 ? 302 ILE B C     1 
ATOM   2615 O O     . ILE B 1 198 ? -71.917 34.424 -29.304 1.00 110.37 ? 302 ILE B O     1 
ATOM   2616 C CB    . ILE B 1 198 ? -69.832 33.068 -27.917 1.00 120.39 ? 302 ILE B CB    1 
ATOM   2617 N N     . GLU B 1 199 ? -70.495 34.844 -31.019 1.00 142.07 ? 303 GLU B N     1 
ATOM   2618 C CA    . GLU B 1 199 ? -71.341 35.850 -31.686 1.00 155.36 ? 303 GLU B CA    1 
ATOM   2619 C C     . GLU B 1 199 ? -72.087 35.232 -32.874 1.00 159.66 ? 303 GLU B C     1 
ATOM   2620 O O     . GLU B 1 199 ? -72.651 35.946 -33.716 1.00 150.67 ? 303 GLU B O     1 
ATOM   2621 C CB    . GLU B 1 199 ? -70.499 37.045 -32.150 1.00 148.33 ? 303 GLU B CB    1 
ATOM   2622 N N     . ARG B 1 200 ? -72.079 33.899 -32.924 1.00 166.27 ? 304 ARG B N     1 
ATOM   2623 C CA    . ARG B 1 200 ? -72.678 33.129 -34.016 1.00 165.28 ? 304 ARG B CA    1 
ATOM   2624 C C     . ARG B 1 200 ? -73.448 31.936 -33.465 1.00 166.27 ? 304 ARG B C     1 
ATOM   2625 O O     . ARG B 1 200 ? -72.889 31.123 -32.729 1.00 177.22 ? 304 ARG B O     1 
ATOM   2626 C CB    . ARG B 1 200 ? -71.591 32.646 -34.988 1.00 160.79 ? 304 ARG B CB    1 
ATOM   2627 C CG    . ARG B 1 200 ? -71.106 33.720 -35.943 1.00 162.66 ? 304 ARG B CG    1 
ATOM   2628 C CD    . ARG B 1 200 ? -69.599 33.691 -36.166 1.00 154.55 ? 304 ARG B CD    1 
ATOM   2629 N NE    . ARG B 1 200 ? -69.206 34.777 -37.069 1.00 158.97 ? 304 ARG B NE    1 
ATOM   2630 C CZ    . ARG B 1 200 ? -68.926 36.025 -36.691 1.00 142.40 ? 304 ARG B CZ    1 
ATOM   2631 N NH1   . ARG B 1 200 ? -68.973 36.364 -35.413 1.00 138.23 ? 304 ARG B NH1   1 
ATOM   2632 N NH2   . ARG B 1 200 ? -68.594 36.939 -37.597 1.00 127.69 ? 304 ARG B NH2   1 
ATOM   2633 O "O5'" . DC  C 2 1   ? 0.929   49.832 -34.768 0.56 187.39 ? 1   DC  C "O5'" 1 
ATOM   2634 C "C5'" . DC  C 2 1   ? 0.374   50.274 -33.515 0.56 181.86 ? 1   DC  C "C5'" 1 
ATOM   2635 C "C4'" . DC  C 2 1   ? 0.749   51.714 -33.245 0.56 183.46 ? 1   DC  C "C4'" 1 
ATOM   2636 O "O4'" . DC  C 2 1   ? 1.124   52.372 -34.480 0.56 187.11 ? 1   DC  C "O4'" 1 
ATOM   2637 C "C3'" . DC  C 2 1   ? -0.371  52.563 -32.635 0.56 182.84 ? 1   DC  C "C3'" 1 
ATOM   2638 O "O3'" . DC  C 2 1   ? 0.145   53.459 -31.643 0.56 173.19 ? 1   DC  C "O3'" 1 
ATOM   2639 C "C2'" . DC  C 2 1   ? -0.875  53.375 -33.816 0.56 186.48 ? 1   DC  C "C2'" 1 
ATOM   2640 C "C1'" . DC  C 2 1   ? 0.415   53.595 -34.584 0.56 190.49 ? 1   DC  C "C1'" 1 
ATOM   2641 N N1    . DC  C 2 1   ? 0.262   53.917 -36.012 0.56 191.98 ? 1   DC  C N1    1 
ATOM   2642 C C2    . DC  C 2 1   ? 0.887   55.065 -36.510 0.56 191.93 ? 1   DC  C C2    1 
ATOM   2643 O O2    . DC  C 2 1   ? 1.553   55.769 -35.737 0.56 188.16 ? 1   DC  C O2    1 
ATOM   2644 N N3    . DC  C 2 1   ? 0.757   55.373 -37.822 0.56 195.08 ? 1   DC  C N3    1 
ATOM   2645 C C4    . DC  C 2 1   ? 0.035   54.585 -38.623 0.56 195.92 ? 1   DC  C C4    1 
ATOM   2646 N N4    . DC  C 2 1   ? -0.069  54.929 -39.909 0.56 190.21 ? 1   DC  C N4    1 
ATOM   2647 C C5    . DC  C 2 1   ? -0.613  53.409 -38.141 0.56 196.57 ? 1   DC  C C5    1 
ATOM   2648 C C6    . DC  C 2 1   ? -0.474  53.116 -36.841 0.56 195.95 ? 1   DC  C C6    1 
ATOM   2649 P P     . DA  C 2 2   ? 0.759   53.030 -30.224 0.56 167.30 ? 2   DA  C P     1 
ATOM   2650 O OP1   . DA  C 2 2   ? 1.216   51.617 -30.269 0.56 169.17 ? 2   DA  C OP1   1 
ATOM   2651 O OP2   . DA  C 2 2   ? -0.181  53.468 -29.161 0.56 164.04 ? 2   DA  C OP2   1 
ATOM   2652 O "O5'" . DA  C 2 2   ? 2.057   53.950 -30.146 0.56 180.71 ? 2   DA  C "O5'" 1 
ATOM   2653 C "C5'" . DA  C 2 2   ? 2.446   54.593 -28.917 0.56 185.16 ? 2   DA  C "C5'" 1 
ATOM   2654 C "C4'" . DA  C 2 2   ? 2.348   56.095 -29.048 0.56 193.17 ? 2   DA  C "C4'" 1 
ATOM   2655 O "O4'" . DA  C 2 2   ? 2.591   56.503 -30.413 0.56 200.85 ? 2   DA  C "O4'" 1 
ATOM   2656 C "C3'" . DA  C 2 2   ? 0.985   56.686 -28.709 0.56 190.28 ? 2   DA  C "C3'" 1 
ATOM   2657 O "O3'" . DA  C 2 2   ? 0.884   56.916 -27.301 0.56 183.52 ? 2   DA  C "O3'" 1 
ATOM   2658 C "C2'" . DA  C 2 2   ? 1.000   57.998 -29.472 0.56 195.98 ? 2   DA  C "C2'" 1 
ATOM   2659 C "C1'" . DA  C 2 2   ? 1.871   57.704 -30.691 0.56 201.63 ? 2   DA  C "C1'" 1 
ATOM   2660 N N9    . DA  C 2 2   ? 1.113   57.502 -31.925 0.56 207.95 ? 2   DA  C N9    1 
ATOM   2661 C C8    . DA  C 2 2   ? 0.547   56.337 -32.380 0.56 209.63 ? 2   DA  C C8    1 
ATOM   2662 N N7    . DA  C 2 2   ? -0.082  56.465 -33.523 0.56 212.87 ? 2   DA  C N7    1 
ATOM   2663 C C5    . DA  C 2 2   ? 0.078   57.805 -33.843 0.56 215.60 ? 2   DA  C C5    1 
ATOM   2664 C C6    . DA  C 2 2   ? -0.358  58.576 -34.936 0.56 219.60 ? 2   DA  C C6    1 
ATOM   2665 N N6    . DA  C 2 2   ? -1.069  58.082 -35.953 0.56 221.22 ? 2   DA  C N6    1 
ATOM   2666 N N1    . DA  C 2 2   ? -0.033  59.888 -34.950 0.56 217.66 ? 2   DA  C N1    1 
ATOM   2667 C C2    . DA  C 2 2   ? 0.682   60.381 -33.930 0.56 216.47 ? 2   DA  C C2    1 
ATOM   2668 N N3    . DA  C 2 2   ? 1.148   59.759 -32.848 0.56 214.69 ? 2   DA  C N3    1 
ATOM   2669 C C4    . DA  C 2 2   ? 0.808   58.458 -32.865 0.56 212.98 ? 2   DA  C C4    1 
ATOM   2670 P P     . DG  C 2 3   ? -0.383  57.663 -26.669 0.56 188.16 ? 3   DG  C P     1 
ATOM   2671 O OP1   . DG  C 2 3   ? -0.401  57.359 -25.217 0.56 198.69 ? 3   DG  C OP1   1 
ATOM   2672 O OP2   . DG  C 2 3   ? -1.586  57.370 -27.491 0.56 182.40 ? 3   DG  C OP2   1 
ATOM   2673 O "O5'" . DG  C 2 3   ? -0.025  59.207 -26.827 0.56 179.73 ? 3   DG  C "O5'" 1 
ATOM   2674 C "C5'" . DG  C 2 3   ? -0.988  60.218 -26.486 0.56 180.26 ? 3   DG  C "C5'" 1 
ATOM   2675 C "C4'" . DG  C 2 3   ? -1.478  60.920 -27.732 0.56 187.12 ? 3   DG  C "C4'" 1 
ATOM   2676 O "O4'" . DG  C 2 3   ? -1.363  60.045 -28.877 0.56 195.18 ? 3   DG  C "O4'" 1 
ATOM   2677 C "C3'" . DG  C 2 3   ? -2.942  61.367 -27.678 0.56 184.11 ? 3   DG  C "C3'" 1 
ATOM   2678 O "O3'" . DG  C 2 3   ? -3.021  62.784 -27.855 0.56 178.84 ? 3   DG  C "O3'" 1 
ATOM   2679 C "C2'" . DG  C 2 3   ? -3.610  60.632 -28.831 0.56 193.57 ? 3   DG  C "C2'" 1 
ATOM   2680 C "C1'" . DG  C 2 3   ? -2.448  60.298 -29.745 0.56 201.67 ? 3   DG  C "C1'" 1 
ATOM   2681 N N9    . DG  C 2 3   ? -2.645  59.114 -30.578 0.56 210.78 ? 3   DG  C N9    1 
ATOM   2682 C C8    . DG  C 2 3   ? -2.537  57.801 -30.188 0.56 213.74 ? 3   DG  C C8    1 
ATOM   2683 N N7    . DG  C 2 3   ? -2.765  56.957 -31.158 0.56 221.54 ? 3   DG  C N7    1 
ATOM   2684 C C5    . DG  C 2 3   ? -3.040  57.762 -32.255 0.56 223.28 ? 3   DG  C C5    1 
ATOM   2685 C C6    . DG  C 2 3   ? -3.363  57.413 -33.595 0.56 227.06 ? 3   DG  C C6    1 
ATOM   2686 O O6    . DG  C 2 3   ? -3.478  56.285 -34.093 0.56 224.62 ? 3   DG  C O6    1 
ATOM   2687 N N1    . DG  C 2 3   ? -3.573  58.542 -34.380 0.56 229.97 ? 3   DG  C N1    1 
ATOM   2688 C C2    . DG  C 2 3   ? -3.472  59.840 -33.941 0.56 230.30 ? 3   DG  C C2    1 
ATOM   2689 N N2    . DG  C 2 3   ? -3.708  60.794 -34.855 0.56 233.83 ? 3   DG  C N2    1 
ATOM   2690 N N3    . DG  C 2 3   ? -3.174  60.178 -32.696 0.56 224.45 ? 3   DG  C N3    1 
ATOM   2691 C C4    . DG  C 2 3   ? -2.972  59.096 -31.913 0.56 218.57 ? 3   DG  C C4    1 
ATOM   2692 P P     . DC  C 2 4   ? -4.186  63.621 -27.149 0.56 177.81 ? 4   DC  C P     1 
ATOM   2693 O OP1   . DC  C 2 4   ? -3.700  65.012 -26.956 0.56 186.46 ? 4   DC  C OP1   1 
ATOM   2694 O OP2   . DC  C 2 4   ? -4.686  62.850 -25.983 0.56 174.39 ? 4   DC  C OP2   1 
ATOM   2695 O "O5'" . DC  C 2 4   ? -5.330  63.652 -28.257 0.56 183.63 ? 4   DC  C "O5'" 1 
ATOM   2696 C "C5'" . DC  C 2 4   ? -5.049  64.089 -29.602 0.56 192.94 ? 4   DC  C "C5'" 1 
ATOM   2697 C "C4'" . DC  C 2 4   ? -6.149  63.654 -30.543 0.56 198.12 ? 4   DC  C "C4'" 1 
ATOM   2698 O "O4'" . DC  C 2 4   ? -5.815  62.374 -31.121 0.56 202.44 ? 4   DC  C "O4'" 1 
ATOM   2699 C "C3'" . DC  C 2 4   ? -7.529  63.483 -29.895 0.56 197.25 ? 4   DC  C "C3'" 1 
ATOM   2700 O "O3'" . DC  C 2 4   ? -8.460  64.446 -30.397 0.56 194.47 ? 4   DC  C "O3'" 1 
ATOM   2701 C "C2'" . DC  C 2 4   ? -7.967  62.082 -30.295 0.56 199.45 ? 4   DC  C "C2'" 1 
ATOM   2702 C "C1'" . DC  C 2 4   ? -7.024  61.713 -31.422 0.56 203.80 ? 4   DC  C "C1'" 1 
ATOM   2703 N N1    . DC  C 2 4   ? -6.741  60.274 -31.551 0.56 205.65 ? 4   DC  C N1    1 
ATOM   2704 C C2    . DC  C 2 4   ? -6.545  59.741 -32.829 0.56 212.56 ? 4   DC  C C2    1 
ATOM   2705 O O2    . DC  C 2 4   ? -6.599  60.500 -33.809 0.56 217.17 ? 4   DC  C O2    1 
ATOM   2706 N N3    . DC  C 2 4   ? -6.294  58.418 -32.963 0.56 213.34 ? 4   DC  C N3    1 
ATOM   2707 C C4    . DC  C 2 4   ? -6.242  57.636 -31.882 0.56 210.96 ? 4   DC  C C4    1 
ATOM   2708 N N4    . DC  C 2 4   ? -5.993  56.336 -32.062 0.56 212.97 ? 4   DC  C N4    1 
ATOM   2709 C C5    . DC  C 2 4   ? -6.441  58.152 -30.568 0.56 205.58 ? 4   DC  C C5    1 
ATOM   2710 C C6    . DC  C 2 4   ? -6.690  59.464 -30.450 0.56 202.97 ? 4   DC  C C6    1 
ATOM   2711 P P     . DT  C 2 5   ? -9.527  65.138 -29.418 0.56 192.11 ? 5   DT  C P     1 
ATOM   2712 O OP1   . DT  C 2 5   ? -8.792  66.124 -28.587 0.56 194.76 ? 5   DT  C OP1   1 
ATOM   2713 O OP2   . DT  C 2 5   ? -10.338 64.084 -28.757 0.56 188.83 ? 5   DT  C OP2   1 
ATOM   2714 O "O5'" . DT  C 2 5   ? -10.485 65.941 -30.407 0.56 191.59 ? 5   DT  C "O5'" 1 
ATOM   2715 C "C5'" . DT  C 2 5   ? -10.494 65.669 -31.823 0.56 193.16 ? 5   DT  C "C5'" 1 
ATOM   2716 C "C4'" . DT  C 2 5   ? -11.693 64.829 -32.201 0.56 191.29 ? 5   DT  C "C4'" 1 
ATOM   2717 O "O4'" . DT  C 2 5   ? -11.291 63.452 -32.379 0.56 194.33 ? 5   DT  C "O4'" 1 
ATOM   2718 C "C3'" . DT  C 2 5   ? -12.834 64.819 -31.177 0.56 184.29 ? 5   DT  C "C3'" 1 
ATOM   2719 O "O3'" . DT  C 2 5   ? -14.045 65.277 -31.788 0.56 183.89 ? 5   DT  C "O3'" 1 
ATOM   2720 C "C2'" . DT  C 2 5   ? -12.945 63.363 -30.747 0.56 182.51 ? 5   DT  C "C2'" 1 
ATOM   2721 C "C1'" . DT  C 2 5   ? -12.326 62.612 -31.910 0.56 187.47 ? 5   DT  C "C1'" 1 
ATOM   2722 N N1    . DT  C 2 5   ? -11.728 61.308 -31.564 0.56 190.78 ? 5   DT  C N1    1 
ATOM   2723 C C2    . DT  C 2 5   ? -11.760 60.306 -32.509 0.56 191.45 ? 5   DT  C C2    1 
ATOM   2724 O O2    . DT  C 2 5   ? -12.260 60.446 -33.613 0.56 191.20 ? 5   DT  C O2    1 
ATOM   2725 N N3    . DT  C 2 5   ? -11.181 59.126 -32.110 0.56 194.07 ? 5   DT  C N3    1 
ATOM   2726 C C4    . DT  C 2 5   ? -10.582 58.857 -30.892 0.56 195.61 ? 5   DT  C C4    1 
ATOM   2727 O O4    . DT  C 2 5   ? -10.109 57.744 -30.675 0.56 197.24 ? 5   DT  C O4    1 
ATOM   2728 C C5    . DT  C 2 5   ? -10.590 59.953 -29.948 0.56 194.70 ? 5   DT  C C5    1 
ATOM   2729 C C7    . DT  C 2 5   ? -9.973  59.753 -28.599 0.56 191.32 ? 5   DT  C C7    1 
ATOM   2730 C C6    . DT  C 2 5   ? -11.151 61.108 -30.328 0.56 194.04 ? 5   DT  C C6    1 
ATOM   2731 P P     . DC  C 2 6   ? -15.401 65.462 -30.953 0.56 179.12 ? 6   DC  C P     1 
ATOM   2732 O OP1   . DC  C 2 6   ? -16.117 66.637 -31.511 0.56 176.49 ? 6   DC  C OP1   1 
ATOM   2733 O OP2   . DC  C 2 6   ? -15.084 65.423 -29.502 0.56 184.28 ? 6   DC  C OP2   1 
ATOM   2734 O "O5'" . DC  C 2 6   ? -16.214 64.144 -31.327 0.56 177.51 ? 6   DC  C "O5'" 1 
ATOM   2735 C "C5'" . DC  C 2 6   ? -16.757 63.966 -32.649 0.56 176.41 ? 6   DC  C "C5'" 1 
ATOM   2736 C "C4'" . DC  C 2 6   ? -17.066 62.509 -32.908 0.56 181.03 ? 6   DC  C "C4'" 1 
ATOM   2737 O "O4'" . DC  C 2 6   ? -15.891 61.701 -32.696 0.56 179.52 ? 6   DC  C "O4'" 1 
ATOM   2738 C "C3'" . DC  C 2 6   ? -18.122 61.894 -31.996 0.56 185.22 ? 6   DC  C "C3'" 1 
ATOM   2739 O "O3'" . DC  C 2 6   ? -19.438 62.080 -32.529 0.56 186.77 ? 6   DC  C "O3'" 1 
ATOM   2740 C "C2'" . DC  C 2 6   ? -17.754 60.418 -31.986 0.56 184.53 ? 6   DC  C "C2'" 1 
ATOM   2741 C "C1'" . DC  C 2 6   ? -16.318 60.359 -32.511 0.56 182.16 ? 6   DC  C "C1'" 1 
ATOM   2742 N N1    . DC  C 2 6   ? -15.366 59.693 -31.605 0.56 182.00 ? 6   DC  C N1    1 
ATOM   2743 C C2    . DC  C 2 6   ? -14.865 58.436 -31.962 0.56 184.36 ? 6   DC  C C2    1 
ATOM   2744 O O2    . DC  C 2 6   ? -15.229 57.927 -33.033 0.56 184.14 ? 6   DC  C O2    1 
ATOM   2745 N N3    . DC  C 2 6   ? -13.996 57.811 -31.133 0.56 183.11 ? 6   DC  C N3    1 
ATOM   2746 C C4    . DC  C 2 6   ? -13.634 58.390 -29.986 0.56 182.55 ? 6   DC  C C4    1 
ATOM   2747 N N4    . DC  C 2 6   ? -12.775 57.737 -29.199 0.56 179.36 ? 6   DC  C N4    1 
ATOM   2748 C C5    . DC  C 2 6   ? -14.135 59.667 -29.595 0.56 181.67 ? 6   DC  C C5    1 
ATOM   2749 C C6    . DC  C 2 6   ? -14.992 60.276 -30.425 0.56 181.73 ? 6   DC  C C6    1 
ATOM   2750 P P     . DT  C 2 7   ? -20.619 62.622 -31.591 0.56 190.25 ? 7   DT  C P     1 
ATOM   2751 O OP1   . DT  C 2 7   ? -20.532 64.105 -31.570 0.56 190.03 ? 7   DT  C OP1   1 
ATOM   2752 O OP2   . DT  C 2 7   ? -20.590 61.870 -30.309 0.56 193.33 ? 7   DT  C OP2   1 
ATOM   2753 O "O5'" . DT  C 2 7   ? -21.931 62.201 -32.395 0.56 179.17 ? 7   DT  C "O5'" 1 
ATOM   2754 C "C5'" . DT  C 2 7   ? -22.774 61.124 -31.938 0.56 172.59 ? 7   DT  C "C5'" 1 
ATOM   2755 C "C4'" . DT  C 2 7   ? -22.309 59.811 -32.523 0.56 168.96 ? 7   DT  C "C4'" 1 
ATOM   2756 O "O4'" . DT  C 2 7   ? -20.943 59.553 -32.123 0.56 168.31 ? 7   DT  C "O4'" 1 
ATOM   2757 C "C3'" . DT  C 2 7   ? -23.127 58.590 -32.089 0.56 164.70 ? 7   DT  C "C3'" 1 
ATOM   2758 O "O3'" . DT  C 2 7   ? -23.694 57.948 -33.237 0.56 160.50 ? 7   DT  C "O3'" 1 
ATOM   2759 C "C2'" . DT  C 2 7   ? -22.127 57.691 -31.377 0.56 165.92 ? 7   DT  C "C2'" 1 
ATOM   2760 C "C1'" . DT  C 2 7   ? -20.782 58.169 -31.889 0.56 169.50 ? 7   DT  C "C1'" 1 
ATOM   2761 N N1    . DT  C 2 7   ? -19.673 57.998 -30.929 0.56 175.40 ? 7   DT  C N1    1 
ATOM   2762 C C2    . DT  C 2 7   ? -18.702 57.060 -31.204 0.56 176.50 ? 7   DT  C C2    1 
ATOM   2763 O O2    . DT  C 2 7   ? -18.714 56.360 -32.203 0.56 179.55 ? 7   DT  C O2    1 
ATOM   2764 N N3    . DT  C 2 7   ? -17.711 56.968 -30.256 0.56 175.55 ? 7   DT  C N3    1 
ATOM   2765 C C4    . DT  C 2 7   ? -17.595 57.708 -29.093 0.56 176.62 ? 7   DT  C C4    1 
ATOM   2766 O O4    . DT  C 2 7   ? -16.647 57.514 -28.337 0.56 173.43 ? 7   DT  C O4    1 
ATOM   2767 C C5    . DT  C 2 7   ? -18.646 58.675 -28.871 0.56 181.78 ? 7   DT  C C5    1 
ATOM   2768 C C7    . DT  C 2 7   ? -18.607 59.521 -27.637 0.56 182.86 ? 7   DT  C C7    1 
ATOM   2769 C C6    . DT  C 2 7   ? -19.621 58.768 -29.785 0.56 182.48 ? 7   DT  C C6    1 
ATOM   2770 P P     . DG  C 2 8   ? -24.876 56.875 -33.103 0.56 149.58 ? 8   DG  C P     1 
ATOM   2771 O OP1   . DG  C 2 8   ? -25.367 56.544 -34.465 0.56 146.48 ? 8   DG  C OP1   1 
ATOM   2772 O OP2   . DG  C 2 8   ? -25.833 57.359 -32.074 0.56 150.68 ? 8   DG  C OP2   1 
ATOM   2773 O "O5'" . DG  C 2 8   ? -24.109 55.593 -32.551 0.56 150.08 ? 8   DG  C "O5'" 1 
ATOM   2774 C "C5'" . DG  C 2 8   ? -24.760 54.671 -31.661 0.56 148.87 ? 8   DG  C "C5'" 1 
ATOM   2775 C "C4'" . DG  C 2 8   ? -23.754 53.695 -31.099 0.56 147.30 ? 8   DG  C "C4'" 1 
ATOM   2776 O "O4'" . DG  C 2 8   ? -22.570 54.399 -30.680 0.56 141.94 ? 8   DG  C "O4'" 1 
ATOM   2777 C "C3'" . DG  C 2 8   ? -24.228 52.952 -29.855 0.56 148.93 ? 8   DG  C "C3'" 1 
ATOM   2778 O "O3'" . DG  C 2 8   ? -24.903 51.748 -30.244 0.56 147.00 ? 8   DG  C "O3'" 1 
ATOM   2779 C "C2'" . DG  C 2 8   ? -22.945 52.708 -29.071 0.56 147.61 ? 8   DG  C "C2'" 1 
ATOM   2780 C "C1'" . DG  C 2 8   ? -21.891 53.594 -29.731 0.56 146.98 ? 8   DG  C "C1'" 1 
ATOM   2781 N N9    . DG  C 2 8   ? -21.194 54.480 -28.805 0.56 153.64 ? 8   DG  C N9    1 
ATOM   2782 C C8    . DG  C 2 8   ? -21.461 55.806 -28.568 0.56 153.90 ? 8   DG  C C8    1 
ATOM   2783 N N7    . DG  C 2 8   ? -20.666 56.339 -27.680 0.56 149.88 ? 8   DG  C N7    1 
ATOM   2784 C C5    . DG  C 2 8   ? -19.825 55.300 -27.304 0.56 146.43 ? 8   DG  C C5    1 
ATOM   2785 C C6    . DG  C 2 8   ? -18.758 55.274 -26.368 0.56 140.54 ? 8   DG  C C6    1 
ATOM   2786 O O6    . DG  C 2 8   ? -18.327 56.194 -25.664 0.56 136.46 ? 8   DG  C O6    1 
ATOM   2787 N N1    . DG  C 2 8   ? -18.175 54.013 -26.293 0.56 140.54 ? 8   DG  C N1    1 
ATOM   2788 C C2    . DG  C 2 8   ? -18.566 52.916 -27.022 0.56 145.09 ? 8   DG  C C2    1 
ATOM   2789 N N2    . DG  C 2 8   ? -17.877 51.786 -26.808 0.56 140.17 ? 8   DG  C N2    1 
ATOM   2790 N N3    . DG  C 2 8   ? -19.560 52.927 -27.897 0.56 150.20 ? 8   DG  C N3    1 
ATOM   2791 C C4    . DG  C 2 8   ? -20.140 54.144 -27.987 0.56 152.53 ? 8   DG  C C4    1 
ATOM   2792 P P     . DT  C 2 9   ? -24.224 50.294 -30.235 0.56 143.29 ? 9   DT  C P     1 
ATOM   2793 O OP1   . DT  C 2 9   ? -22.792 50.407 -30.612 0.56 143.45 ? 9   DT  C OP1   1 
ATOM   2794 O OP2   . DT  C 2 9   ? -25.108 49.384 -31.004 0.56 148.33 ? 9   DT  C OP2   1 
ATOM   2795 O "O5'" . DT  C 2 9   ? -24.320 49.899 -28.694 0.56 146.25 ? 9   DT  C "O5'" 1 
ATOM   2796 C "C5'" . DT  C 2 9   ? -24.279 48.523 -28.270 0.56 142.67 ? 9   DT  C "C5'" 1 
ATOM   2797 C "C4'" . DT  C 2 9   ? -22.846 48.070 -28.113 0.56 145.18 ? 9   DT  C "C4'" 1 
ATOM   2798 O "O4'" . DT  C 2 9   ? -21.998 49.205 -27.808 0.56 146.80 ? 9   DT  C "O4'" 1 
ATOM   2799 C "C3'" . DT  C 2 9   ? -22.616 47.056 -26.992 0.56 144.94 ? 9   DT  C "C3'" 1 
ATOM   2800 O "O3'" . DT  C 2 9   ? -21.668 46.076 -27.422 0.56 157.20 ? 9   DT  C "O3'" 1 
ATOM   2801 C "C2'" . DT  C 2 9   ? -22.059 47.900 -25.860 0.56 145.37 ? 9   DT  C "C2'" 1 
ATOM   2802 C "C1'" . DT  C 2 9   ? -21.288 48.977 -26.599 0.56 145.19 ? 9   DT  C "C1'" 1 
ATOM   2803 N N1    . DT  C 2 9   ? -21.190 50.263 -25.879 0.56 141.72 ? 9   DT  C N1    1 
ATOM   2804 C C2    . DT  C 2 9   ? -20.100 50.476 -25.064 0.56 142.37 ? 9   DT  C C2    1 
ATOM   2805 O O2    . DT  C 2 9   ? -19.210 49.655 -24.912 0.56 145.58 ? 9   DT  C O2    1 
ATOM   2806 N N3    . DT  C 2 9   ? -20.087 51.698 -24.436 0.56 133.76 ? 9   DT  C N3    1 
ATOM   2807 C C4    . DT  C 2 9   ? -21.031 52.702 -24.541 0.56 131.22 ? 9   DT  C C4    1 
ATOM   2808 O O4    . DT  C 2 9   ? -20.886 53.746 -23.911 0.56 131.94 ? 9   DT  C O4    1 
ATOM   2809 C C5    . DT  C 2 9   ? -22.150 52.407 -25.408 0.56 126.60 ? 9   DT  C C5    1 
ATOM   2810 C C7    . DT  C 2 9   ? -23.227 53.432 -25.579 0.56 121.86 ? 9   DT  C C7    1 
ATOM   2811 C C6    . DT  C 2 9   ? -22.173 51.219 -26.025 0.56 134.02 ? 9   DT  C C6    1 
ATOM   2812 P P     . DA  C 2 10  ? -21.386 44.771 -26.541 0.56 171.92 ? 10  DA  C P     1 
ATOM   2813 O OP1   . DA  C 2 10  ? -20.732 43.749 -27.400 0.56 172.14 ? 10  DA  C OP1   1 
ATOM   2814 O OP2   . DA  C 2 10  ? -22.635 44.429 -25.811 0.56 163.89 ? 10  DA  C OP2   1 
ATOM   2815 O "O5'" . DA  C 2 10  ? -20.299 45.296 -25.502 0.56 162.92 ? 10  DA  C "O5'" 1 
ATOM   2816 C "C5'" . DA  C 2 10  ? -19.708 44.406 -24.543 0.56 152.65 ? 10  DA  C "C5'" 1 
ATOM   2817 C "C4'" . DA  C 2 10  ? -20.204 44.736 -23.155 0.56 149.30 ? 10  DA  C "C4'" 1 
ATOM   2818 O "O4'" . DA  C 2 10  ? -20.312 46.164 -22.999 0.56 151.35 ? 10  DA  C "O4'" 1 
ATOM   2819 C "C3'" . DA  C 2 10  ? -21.591 44.191 -22.815 0.56 142.42 ? 10  DA  C "C3'" 1 
ATOM   2820 O "O3'" . DA  C 2 10  ? -21.518 42.929 -22.140 0.56 135.93 ? 10  DA  C "O3'" 1 
ATOM   2821 C "C2'" . DA  C 2 10  ? -22.198 45.258 -21.913 0.56 144.66 ? 10  DA  C "C2'" 1 
ATOM   2822 C "C1'" . DA  C 2 10  ? -21.197 46.414 -21.925 0.56 142.02 ? 10  DA  C "C1'" 1 
ATOM   2823 N N9    . DA  C 2 10  ? -21.791 47.735 -22.129 0.56 137.45 ? 10  DA  C N9    1 
ATOM   2824 C C8    . DA  C 2 10  ? -22.949 48.044 -22.799 0.56 132.71 ? 10  DA  C C8    1 
ATOM   2825 N N7    . DA  C 2 10  ? -23.228 49.324 -22.812 0.56 128.10 ? 10  DA  C N7    1 
ATOM   2826 C C5    . DA  C 2 10  ? -22.187 49.899 -22.096 0.56 127.41 ? 10  DA  C C5    1 
ATOM   2827 C C6    . DA  C 2 10  ? -21.900 51.231 -21.747 0.56 124.61 ? 10  DA  C C6    1 
ATOM   2828 N N6    . DA  C 2 10  ? -22.668 52.268 -22.089 0.56 116.02 ? 10  DA  C N6    1 
ATOM   2829 N N1    . DA  C 2 10  ? -20.782 51.465 -21.027 0.56 119.71 ? 10  DA  C N1    1 
ATOM   2830 C C2    . DA  C 2 10  ? -20.012 50.424 -20.683 0.56 129.67 ? 10  DA  C C2    1 
ATOM   2831 N N3    . DA  C 2 10  ? -20.176 49.129 -20.951 0.56 135.19 ? 10  DA  C N3    1 
ATOM   2832 C C4    . DA  C 2 10  ? -21.295 48.932 -21.669 0.56 134.64 ? 10  DA  C C4    1 
ATOM   2833 P P     . DC  C 2 11  ? -20.264 42.464 -21.249 0.56 141.48 ? 11  DC  C P     1 
ATOM   2834 O OP1   . DC  C 2 11  ? -19.091 42.229 -22.134 0.56 133.07 ? 11  DC  C OP1   1 
ATOM   2835 O OP2   . DC  C 2 11  ? -20.735 41.377 -20.355 0.56 145.28 ? 11  DC  C OP2   1 
ATOM   2836 O "O5'" . DC  C 2 11  ? -19.963 43.725 -20.323 0.56 145.37 ? 11  DC  C "O5'" 1 
ATOM   2837 C "C5'" . DC  C 2 11  ? -18.692 43.889 -19.670 0.56 144.18 ? 11  DC  C "C5'" 1 
ATOM   2838 C "C4'" . DC  C 2 11  ? -18.860 44.684 -18.396 0.56 138.67 ? 11  DC  C "C4'" 1 
ATOM   2839 O "O4'" . DC  C 2 11  ? -19.581 45.910 -18.665 0.56 132.36 ? 11  DC  C "O4'" 1 
ATOM   2840 C "C3'" . DC  C 2 11  ? -19.629 43.965 -17.281 0.56 128.04 ? 11  DC  C "C3'" 1 
ATOM   2841 O "O3'" . DC  C 2 11  ? -18.796 43.881 -16.123 0.56 129.70 ? 11  DC  C "O3'" 1 
ATOM   2842 C "C2'" . DC  C 2 11  ? -20.825 44.861 -16.999 0.56 126.34 ? 11  DC  C "C2'" 1 
ATOM   2843 C "C1'" . DC  C 2 11  ? -20.382 46.208 -17.539 0.56 128.97 ? 11  DC  C "C1'" 1 
ATOM   2844 N N1    . DC  C 2 11  ? -21.472 47.092 -17.979 0.56 121.09 ? 11  DC  C N1    1 
ATOM   2845 C C2    . DC  C 2 11  ? -21.246 48.471 -18.017 0.56 122.22 ? 11  DC  C C2    1 
ATOM   2846 O O2    . DC  C 2 11  ? -20.135 48.906 -17.680 0.56 124.67 ? 11  DC  C O2    1 
ATOM   2847 N N3    . DC  C 2 11  ? -22.241 49.293 -18.423 0.56 123.05 ? 11  DC  C N3    1 
ATOM   2848 C C4    . DC  C 2 11  ? -23.424 48.785 -18.777 0.56 131.29 ? 11  DC  C C4    1 
ATOM   2849 N N4    . DC  C 2 11  ? -24.378 49.632 -19.171 0.56 132.48 ? 11  DC  C N4    1 
ATOM   2850 C C5    . DC  C 2 11  ? -23.681 47.383 -18.746 0.56 131.76 ? 11  DC  C C5    1 
ATOM   2851 C C6    . DC  C 2 11  ? -22.686 46.581 -18.344 0.56 128.98 ? 11  DC  C C6    1 
ATOM   2852 P P     . DG  C 2 12  ? -18.986 42.750 -15.014 0.56 133.96 ? 12  DG  C P     1 
ATOM   2853 O OP1   . DG  C 2 12  ? -18.078 41.622 -15.351 0.56 137.74 ? 12  DG  C OP1   1 
ATOM   2854 O OP2   . DG  C 2 12  ? -20.434 42.496 -14.796 0.56 122.45 ? 12  DG  C OP2   1 
ATOM   2855 O "O5'" . DG  C 2 12  ? -18.393 43.483 -13.730 0.56 134.22 ? 12  DG  C "O5'" 1 
ATOM   2856 C "C5'" . DG  C 2 12  ? -18.179 42.768 -12.498 0.56 129.39 ? 12  DG  C "C5'" 1 
ATOM   2857 C "C4'" . DG  C 2 12  ? -19.001 43.387 -11.392 0.56 121.39 ? 12  DG  C "C4'" 1 
ATOM   2858 O "O4'" . DG  C 2 12  ? -19.488 44.676 -11.817 0.56 111.93 ? 12  DG  C "O4'" 1 
ATOM   2859 C "C3'" . DG  C 2 12  ? -20.249 42.595 -11.014 0.56 112.73 ? 12  DG  C "C3'" 1 
ATOM   2860 O "O3'" . DG  C 2 12  ? -19.980 41.697 -9.931  0.56 113.98 ? 12  DG  C "O3'" 1 
ATOM   2861 C "C2'" . DG  C 2 12  ? -21.233 43.664 -10.571 0.56 105.03 ? 12  DG  C "C2'" 1 
ATOM   2862 C "C1'" . DG  C 2 12  ? -20.691 44.974 -11.131 0.56 106.18 ? 12  DG  C "C1'" 1 
ATOM   2863 N N9    . DG  C 2 12  ? -21.595 45.617 -12.075 0.56 107.91 ? 12  DG  C N9    1 
ATOM   2864 C C8    . DG  C 2 12  ? -21.894 45.208 -13.352 0.56 108.77 ? 12  DG  C C8    1 
ATOM   2865 N N7    . DG  C 2 12  ? -22.753 45.987 -13.951 0.56 107.37 ? 12  DG  C N7    1 
ATOM   2866 C C5    . DG  C 2 12  ? -23.038 46.970 -13.014 0.56 104.96 ? 12  DG  C C5    1 
ATOM   2867 C C6    . DG  C 2 12  ? -23.902 48.092 -13.093 0.56 107.54 ? 12  DG  C C6    1 
ATOM   2868 O O6    . DG  C 2 12  ? -24.610 48.455 -14.040 0.56 109.76 ? 12  DG  C O6    1 
ATOM   2869 N N1    . DG  C 2 12  ? -23.893 48.827 -11.911 0.56 111.28 ? 12  DG  C N1    1 
ATOM   2870 C C2    . DG  C 2 12  ? -23.147 48.524 -10.797 0.56 110.96 ? 12  DG  C C2    1 
ATOM   2871 N N2    . DG  C 2 12  ? -23.271 49.358 -9.753  0.56 116.88 ? 12  DG  C N2    1 
ATOM   2872 N N3    . DG  C 2 12  ? -22.342 47.479 -10.709 0.56 102.31 ? 12  DG  C N3    1 
ATOM   2873 C C4    . DG  C 2 12  ? -22.334 46.753 -11.848 0.56 107.02 ? 12  DG  C C4    1 
ATOM   2874 P P     . DT  C 2 13  ? -19.459 42.155 -8.476  0.56 128.43 ? 13  DT  C P     1 
ATOM   2875 O OP1   . DT  C 2 13  ? -19.244 43.625 -8.427  0.56 130.61 ? 13  DT  C OP1   1 
ATOM   2876 O OP2   . DT  C 2 13  ? -18.323 41.259 -8.139  0.56 135.42 ? 13  DT  C OP2   1 
ATOM   2877 O "O5'" . DT  C 2 13  ? -20.666 41.786 -7.500  0.56 110.60 ? 13  DT  C "O5'" 1 
ATOM   2878 C "C5'" . DT  C 2 13  ? -21.938 42.449 -7.590  0.56 102.22 ? 13  DT  C "C5'" 1 
ATOM   2879 C "C4'" . DT  C 2 13  ? -21.923 43.740 -6.801  0.56 103.17 ? 13  DT  C "C4'" 1 
ATOM   2880 O "O4'" . DT  C 2 13  ? -22.177 44.856 -7.686  0.56 97.26  ? 13  DT  C "O4'" 1 
ATOM   2881 C "C3'" . DT  C 2 13  ? -22.977 43.826 -5.699  0.56 99.65  ? 13  DT  C "C3'" 1 
ATOM   2882 O "O3'" . DT  C 2 13  ? -22.478 44.447 -4.508  0.56 95.45  ? 13  DT  C "O3'" 1 
ATOM   2883 C "C2'" . DT  C 2 13  ? -24.109 44.613 -6.336  0.56 93.70  ? 13  DT  C "C2'" 1 
ATOM   2884 C "C1'" . DT  C 2 13  ? -23.424 45.473 -7.388  0.56 94.54  ? 13  DT  C "C1'" 1 
ATOM   2885 N N1    . DT  C 2 13  ? -24.188 45.595 -8.652  0.56 97.66  ? 13  DT  C N1    1 
ATOM   2886 C C2    . DT  C 2 13  ? -24.977 46.711 -8.829  0.56 96.95  ? 13  DT  C C2    1 
ATOM   2887 O O2    . DT  C 2 13  ? -25.066 47.604 -8.002  0.56 95.57  ? 13  DT  C O2    1 
ATOM   2888 N N3    . DT  C 2 13  ? -25.659 46.745 -10.021 0.56 97.17  ? 13  DT  C N3    1 
ATOM   2889 C C4    . DT  C 2 13  ? -25.639 45.792 -11.024 0.56 101.87 ? 13  DT  C C4    1 
ATOM   2890 O O4    . DT  C 2 13  ? -26.311 45.957 -12.040 0.56 104.88 ? 13  DT  C O4    1 
ATOM   2891 C C5    . DT  C 2 13  ? -24.798 44.645 -10.767 0.56 99.00  ? 13  DT  C C5    1 
ATOM   2892 C C7    . DT  C 2 13  ? -24.713 43.563 -11.797 0.56 97.85  ? 13  DT  C C7    1 
ATOM   2893 C C6    . DT  C 2 13  ? -24.129 44.602 -9.607  0.56 98.26  ? 13  DT  C C6    1 
ATOM   2894 P P     . DG  C 2 14  ? -23.077 43.931 -3.103  0.56 100.31 ? 14  DG  C P     1 
ATOM   2895 O OP1   . DG  C 2 14  ? -22.163 44.303 -1.993  0.56 100.43 ? 14  DG  C OP1   1 
ATOM   2896 O OP2   . DG  C 2 14  ? -23.480 42.509 -3.269  0.56 106.26 ? 14  DG  C OP2   1 
ATOM   2897 O "O5'" . DG  C 2 14  ? -24.417 44.771 -2.922  0.56 90.66  ? 14  DG  C "O5'" 1 
ATOM   2898 C "C5'" . DG  C 2 14  ? -24.432 45.950 -2.104  0.56 90.48  ? 14  DG  C "C5'" 1 
ATOM   2899 C "C4'" . DG  C 2 14  ? -25.724 46.705 -2.305  0.56 93.20  ? 14  DG  C "C4'" 1 
ATOM   2900 O "O4'" . DG  C 2 14  ? -26.106 46.688 -3.704  0.56 98.90  ? 14  DG  C "O4'" 1 
ATOM   2901 C "C3'" . DG  C 2 14  ? -26.911 46.141 -1.521  0.56 88.27  ? 14  DG  C "C3'" 1 
ATOM   2902 O "O3'" . DG  C 2 14  ? -27.524 47.215 -0.799  0.56 91.42  ? 14  DG  C "O3'" 1 
ATOM   2903 C "C2'" . DG  C 2 14  ? -27.813 45.548 -2.592  0.56 91.57  ? 14  DG  C "C2'" 1 
ATOM   2904 C "C1'" . DG  C 2 14  ? -27.490 46.397 -3.811  0.56 99.33  ? 14  DG  C "C1'" 1 
ATOM   2905 N N9    . DG  C 2 14  ? -27.717 45.739 -5.098  0.56 92.63  ? 14  DG  C N9    1 
ATOM   2906 C C8    . DG  C 2 14  ? -27.365 44.457 -5.441  0.56 92.95  ? 14  DG  C C8    1 
ATOM   2907 N N7    . DG  C 2 14  ? -27.692 44.146 -6.666  0.56 88.41  ? 14  DG  C N7    1 
ATOM   2908 C C5    . DG  C 2 14  ? -28.303 45.289 -7.160  0.56 94.66  ? 14  DG  C C5    1 
ATOM   2909 C C6    . DG  C 2 14  ? -28.870 45.552 -8.436  0.56 98.13  ? 14  DG  C C6    1 
ATOM   2910 O O6    . DG  C 2 14  ? -28.956 44.797 -9.412  0.56 101.18 ? 14  DG  C O6    1 
ATOM   2911 N N1    . DG  C 2 14  ? -29.383 46.844 -8.513  0.56 91.93  ? 14  DG  C N1    1 
ATOM   2912 C C2    . DG  C 2 14  ? -29.353 47.767 -7.496  0.56 95.94  ? 14  DG  C C2    1 
ATOM   2913 N N2    . DG  C 2 14  ? -29.896 48.964 -7.765  0.56 91.33  ? 14  DG  C N2    1 
ATOM   2914 N N3    . DG  C 2 14  ? -28.828 47.535 -6.302  0.56 106.08 ? 14  DG  C N3    1 
ATOM   2915 C C4    . DG  C 2 14  ? -28.325 46.284 -6.205  0.56 98.35  ? 14  DG  C C4    1 
ATOM   2916 P P     . DA  C 2 15  ? -28.734 46.937 0.211   0.56 100.06 ? 15  DA  C P     1 
ATOM   2917 O OP1   . DA  C 2 15  ? -29.324 48.231 0.652   0.56 99.19  ? 15  DA  C OP1   1 
ATOM   2918 O OP2   . DA  C 2 15  ? -28.284 45.957 1.229   0.56 107.34 ? 15  DA  C OP2   1 
ATOM   2919 O "O5'" . DA  C 2 15  ? -29.788 46.200 -0.726  0.56 98.85  ? 15  DA  C "O5'" 1 
ATOM   2920 C "C5'" . DA  C 2 15  ? -31.193 46.467 -0.609  0.56 99.85  ? 15  DA  C "C5'" 1 
ATOM   2921 C "C4'" . DA  C 2 15  ? -31.577 47.683 -1.420  0.56 92.15  ? 15  DA  C "C4'" 1 
ATOM   2922 O "O4'" . DA  C 2 15  ? -31.039 47.582 -2.759  0.56 83.19  ? 15  DA  C "O4'" 1 
ATOM   2923 C "C3'" . DA  C 2 15  ? -33.084 47.840 -1.598  0.56 92.98  ? 15  DA  C "C3'" 1 
ATOM   2924 O "O3'" . DA  C 2 15  ? -33.457 49.214 -1.714  0.56 97.40  ? 15  DA  C "O3'" 1 
ATOM   2925 C "C2'" . DA  C 2 15  ? -33.359 47.087 -2.884  0.56 90.33  ? 15  DA  C "C2'" 1 
ATOM   2926 C "C1'" . DA  C 2 15  ? -32.089 47.313 -3.690  0.56 91.73  ? 15  DA  C "C1'" 1 
ATOM   2927 N N9    . DA  C 2 15  ? -31.690 46.169 -4.512  0.56 95.88  ? 15  DA  C N9    1 
ATOM   2928 C C8    . DA  C 2 15  ? -30.873 45.117 -4.176  0.56 95.04  ? 15  DA  C C8    1 
ATOM   2929 N N7    . DA  C 2 15  ? -30.688 44.258 -5.149  0.56 88.86  ? 15  DA  C N7    1 
ATOM   2930 C C5    . DA  C 2 15  ? -31.441 44.775 -6.196  0.56 96.83  ? 15  DA  C C5    1 
ATOM   2931 C C6    . DA  C 2 15  ? -31.665 44.330 -7.513  0.56 100.76 ? 15  DA  C C6    1 
ATOM   2932 N N6    . DA  C 2 15  ? -31.133 43.215 -8.020  0.56 95.08  ? 15  DA  C N6    1 
ATOM   2933 N N1    . DA  C 2 15  ? -32.463 45.083 -8.303  0.56 103.12 ? 15  DA  C N1    1 
ATOM   2934 C C2    . DA  C 2 15  ? -32.996 46.203 -7.794  0.56 100.90 ? 15  DA  C C2    1 
ATOM   2935 N N3    . DA  C 2 15  ? -32.860 46.723 -6.576  0.56 95.00  ? 15  DA  C N3    1 
ATOM   2936 C C4    . DA  C 2 15  ? -32.063 45.951 -5.817  0.56 94.38  ? 15  DA  C C4    1 
ATOM   2937 P P     . DG  C 2 16  ? -34.862 49.633 -1.078  0.56 103.87 ? 16  DG  C P     1 
ATOM   2938 O OP1   . DG  C 2 16  ? -35.045 51.096 -1.259  0.56 107.24 ? 16  DG  C OP1   1 
ATOM   2939 O OP2   . DG  C 2 16  ? -34.878 49.059 0.293   0.56 101.90 ? 16  DG  C OP2   1 
ATOM   2940 O "O5'" . DG  C 2 16  ? -35.915 48.896 -2.025  0.56 93.93  ? 16  DG  C "O5'" 1 
ATOM   2941 C "C5'" . DG  C 2 16  ? -36.210 49.420 -3.335  0.56 86.71  ? 16  DG  C "C5'" 1 
ATOM   2942 C "C4'" . DG  C 2 16  ? -37.056 48.459 -4.137  0.56 86.59  ? 16  DG  C "C4'" 1 
ATOM   2943 O "O4'" . DG  C 2 16  ? -36.224 47.437 -4.733  0.56 79.70  ? 16  DG  C "O4'" 1 
ATOM   2944 C "C3'" . DG  C 2 16  ? -38.145 47.724 -3.347  0.56 87.60  ? 16  DG  C "C3'" 1 
ATOM   2945 O "O3'" . DG  C 2 16  ? -39.422 47.873 -3.974  0.56 90.17  ? 16  DG  C "O3'" 1 
ATOM   2946 C "C2'" . DG  C 2 16  ? -37.724 46.266 -3.401  0.56 85.73  ? 16  DG  C "C2'" 1 
ATOM   2947 C "C1'" . DG  C 2 16  ? -36.919 46.207 -4.679  0.56 84.13  ? 16  DG  C "C1'" 1 
ATOM   2948 N N9    . DG  C 2 16  ? -35.934 45.135 -4.707  0.56 90.03  ? 16  DG  C N9    1 
ATOM   2949 C C8    . DG  C 2 16  ? -35.153 44.702 -3.663  0.56 96.31  ? 16  DG  C C8    1 
ATOM   2950 N N7    . DG  C 2 16  ? -34.354 43.725 -3.991  0.56 98.67  ? 16  DG  C N7    1 
ATOM   2951 C C5    . DG  C 2 16  ? -34.626 43.494 -5.332  0.56 95.24  ? 16  DG  C C5    1 
ATOM   2952 C C6    . DG  C 2 16  ? -34.077 42.543 -6.231  0.56 93.26  ? 16  DG  C C6    1 
ATOM   2953 O O6    . DG  C 2 16  ? -33.206 41.691 -6.015  0.56 93.77  ? 16  DG  C O6    1 
ATOM   2954 N N1    . DG  C 2 16  ? -34.646 42.649 -7.496  0.56 95.83  ? 16  DG  C N1    1 
ATOM   2955 C C2    . DG  C 2 16  ? -35.613 43.554 -7.854  0.56 97.06  ? 16  DG  C C2    1 
ATOM   2956 N N2    . DG  C 2 16  ? -36.034 43.497 -9.126  0.56 104.16 ? 16  DG  C N2    1 
ATOM   2957 N N3    . DG  C 2 16  ? -36.141 44.439 -7.024  0.56 94.34  ? 16  DG  C N3    1 
ATOM   2958 C C4    . DG  C 2 16  ? -35.602 44.355 -5.789  0.56 95.30  ? 16  DG  C C4    1 
ATOM   2959 P P     . DC  C 2 17  ? -40.736 47.682 -3.089  0.56 109.35 ? 17  DC  C P     1 
ATOM   2960 O OP1   . DC  C 2 17  ? -41.418 48.999 -3.008  0.56 108.94 ? 17  DC  C OP1   1 
ATOM   2961 O OP2   . DC  C 2 17  ? -40.376 46.969 -1.835  0.56 121.90 ? 17  DC  C OP2   1 
ATOM   2962 O "O5'" . DC  C 2 17  ? -41.635 46.686 -3.948  0.56 119.38 ? 17  DC  C "O5'" 1 
ATOM   2963 C "C5'" . DC  C 2 17  ? -41.583 45.257 -3.745  0.56 122.69 ? 17  DC  C "C5'" 1 
ATOM   2964 C "C4'" . DC  C 2 17  ? -41.058 44.586 -4.993  0.56 119.59 ? 17  DC  C "C4'" 1 
ATOM   2965 O "O4'" . DC  C 2 17  ? -39.690 44.184 -4.796  0.56 122.06 ? 17  DC  C "O4'" 1 
ATOM   2966 C "C3'" . DC  C 2 17  ? -41.801 43.326 -5.436  0.56 115.50 ? 17  DC  C "C3'" 1 
ATOM   2967 O "O3'" . DC  C 2 17  ? -42.696 43.621 -6.515  0.56 109.57 ? 17  DC  C "O3'" 1 
ATOM   2968 C "C2'" . DC  C 2 17  ? -40.700 42.404 -5.941  0.56 116.93 ? 17  DC  C "C2'" 1 
ATOM   2969 C "C1'" . DC  C 2 17  ? -39.398 43.170 -5.733  0.56 115.53 ? 17  DC  C "C1'" 1 
ATOM   2970 N N1    . DC  C 2 17  ? -38.303 42.355 -5.190  0.56 106.62 ? 17  DC  C N1    1 
ATOM   2971 C C2    . DC  C 2 17  ? -37.501 41.625 -6.074  0.56 106.62 ? 17  DC  C C2    1 
ATOM   2972 O O2    . DC  C 2 17  ? -37.732 41.693 -7.291  0.56 99.62  ? 17  DC  C O2    1 
ATOM   2973 N N3    . DC  C 2 17  ? -36.494 40.866 -5.581  0.56 115.35 ? 17  DC  C N3    1 
ATOM   2974 C C4    . DC  C 2 17  ? -36.277 40.820 -4.263  0.56 116.54 ? 17  DC  C C4    1 
ATOM   2975 N N4    . DC  C 2 17  ? -35.274 40.058 -3.820  0.56 110.09 ? 17  DC  C N4    1 
ATOM   2976 C C5    . DC  C 2 17  ? -37.081 41.554 -3.340  0.56 109.60 ? 17  DC  C C5    1 
ATOM   2977 C C6    . DC  C 2 17  ? -38.074 42.299 -3.843  0.56 101.31 ? 17  DC  C C6    1 
ATOM   2978 P P     . DA  C 2 18  ? -44.291 43.564 -6.342  0.56 96.32  ? 18  DA  C P     1 
ATOM   2979 O OP1   . DA  C 2 18  ? -44.867 44.738 -7.050  0.56 105.78 ? 18  DA  C OP1   1 
ATOM   2980 O OP2   . DA  C 2 18  ? -44.605 43.337 -4.910  0.56 101.61 ? 18  DA  C OP2   1 
ATOM   2981 O "O5'" . DA  C 2 18  ? -44.744 42.268 -7.146  0.56 96.48  ? 18  DA  C "O5'" 1 
ATOM   2982 C "C5'" . DA  C 2 18  ? -44.443 42.105 -8.548  0.56 97.21  ? 18  DA  C "C5'" 1 
ATOM   2983 C "C4'" . DA  C 2 18  ? -44.302 40.637 -8.880  0.56 95.96  ? 18  DA  C "C4'" 1 
ATOM   2984 O "O4'" . DA  C 2 18  ? -43.034 40.152 -8.372  0.56 97.63  ? 18  DA  C "O4'" 1 
ATOM   2985 C "C3'" . DA  C 2 18  ? -45.370 39.729 -8.264  0.56 93.65  ? 18  DA  C "C3'" 1 
ATOM   2986 O "O3'" . DA  C 2 18  ? -45.613 38.612 -9.124  0.56 97.02  ? 18  DA  C "O3'" 1 
ATOM   2987 C "C2'" . DA  C 2 18  ? -44.686 39.206 -7.015  0.56 99.26  ? 18  DA  C "C2'" 1 
ATOM   2988 C "C1'" . DA  C 2 18  ? -43.266 39.038 -7.522  0.56 99.72  ? 18  DA  C "C1'" 1 
ATOM   2989 N N9    . DA  C 2 18  ? -42.243 39.037 -6.478  0.56 99.27  ? 18  DA  C N9    1 
ATOM   2990 C C8    . DA  C 2 18  ? -42.283 39.665 -5.257  0.56 102.01 ? 18  DA  C C8    1 
ATOM   2991 N N7    . DA  C 2 18  ? -41.214 39.464 -4.524  0.56 106.97 ? 18  DA  C N7    1 
ATOM   2992 C C5    . DA  C 2 18  ? -40.418 38.646 -5.313  0.56 101.17 ? 18  DA  C C5    1 
ATOM   2993 C C6    . DA  C 2 18  ? -39.150 38.074 -5.105  0.56 102.92 ? 18  DA  C C6    1 
ATOM   2994 N N6    . DA  C 2 18  ? -38.431 38.248 -3.994  0.56 103.96 ? 18  DA  C N6    1 
ATOM   2995 N N1    . DA  C 2 18  ? -38.641 37.301 -6.090  0.56 110.75 ? 18  DA  C N1    1 
ATOM   2996 C C2    . DA  C 2 18  ? -39.364 37.123 -7.203  0.56 108.27 ? 18  DA  C C2    1 
ATOM   2997 N N3    . DA  C 2 18  ? -40.565 37.607 -7.517  0.56 101.55 ? 18  DA  C N3    1 
ATOM   2998 C C4    . DA  C 2 18  ? -41.044 38.368 -6.516  0.56 102.36 ? 18  DA  C C4    1 
ATOM   2999 P P     . DG  C 2 19  ? -47.071 38.119 -9.554  0.56 94.11  ? 19  DG  C P     1 
ATOM   3000 O OP1   . DG  C 2 19  ? -46.937 37.460 -10.884 0.56 84.22  ? 19  DG  C OP1   1 
ATOM   3001 O OP2   . DG  C 2 19  ? -47.996 39.274 -9.386  0.56 97.86  ? 19  DG  C OP2   1 
ATOM   3002 O "O5'" . DG  C 2 19  ? -47.502 36.999 -8.505  0.56 92.13  ? 19  DG  C "O5'" 1 
ATOM   3003 C "C5'" . DG  C 2 19  ? -46.606 36.503 -7.494  0.56 89.02  ? 19  DG  C "C5'" 1 
ATOM   3004 C "C4'" . DG  C 2 19  ? -45.658 35.483 -8.081  0.56 89.33  ? 19  DG  C "C4'" 1 
ATOM   3005 O "O4'" . DG  C 2 19  ? -44.302 35.968 -7.955  0.56 96.88  ? 19  DG  C "O4'" 1 
ATOM   3006 C "C3'" . DG  C 2 19  ? -45.700 34.114 -7.399  0.56 92.78  ? 19  DG  C "C3'" 1 
ATOM   3007 O "O3'" . DG  C 2 19  ? -46.392 33.197 -8.258  0.56 98.44  ? 19  DG  C "O3'" 1 
ATOM   3008 C "C2'" . DG  C 2 19  ? -44.240 33.709 -7.278  0.56 94.06  ? 19  DG  C "C2'" 1 
ATOM   3009 C "C1'" . DG  C 2 19  ? -43.471 35.018 -7.304  0.56 93.24  ? 19  DG  C "C1'" 1 
ATOM   3010 N N9    . DG  C 2 19  ? -43.117 35.551 -5.992  0.56 93.20  ? 19  DG  C N9    1 
ATOM   3011 C C8    . DG  C 2 19  ? -43.765 36.543 -5.295  0.56 90.29  ? 19  DG  C C8    1 
ATOM   3012 N N7    . DG  C 2 19  ? -43.211 36.808 -4.145  0.56 96.36  ? 19  DG  C N7    1 
ATOM   3013 C C5    . DG  C 2 19  ? -42.133 35.937 -4.075  0.56 100.63 ? 19  DG  C C5    1 
ATOM   3014 C C6    . DG  C 2 19  ? -41.157 35.761 -3.058  0.56 105.49 ? 19  DG  C C6    1 
ATOM   3015 O O6    . DG  C 2 19  ? -41.048 36.361 -1.981  0.56 109.10 ? 19  DG  C O6    1 
ATOM   3016 N N1    . DG  C 2 19  ? -40.247 34.761 -3.391  0.56 111.76 ? 19  DG  C N1    1 
ATOM   3017 C C2    . DG  C 2 19  ? -40.268 34.028 -4.554  0.56 108.86 ? 19  DG  C C2    1 
ATOM   3018 N N2    . DG  C 2 19  ? -39.303 33.108 -4.689  0.56 109.32 ? 19  DG  C N2    1 
ATOM   3019 N N3    . DG  C 2 19  ? -41.167 34.189 -5.512  0.56 102.74 ? 19  DG  C N3    1 
ATOM   3020 C C4    . DG  C 2 19  ? -42.062 35.153 -5.208  0.56 97.37  ? 19  DG  C C4    1 
ATOM   3021 P P     . DT  C 2 20  ? -47.017 31.799 -7.785  0.56 96.77  ? 20  DT  C P     1 
ATOM   3022 O OP1   . DT  C 2 20  ? -47.452 31.060 -9.003  0.56 92.85  ? 20  DT  C OP1   1 
ATOM   3023 O OP2   . DT  C 2 20  ? -47.997 32.120 -6.717  0.56 95.58  ? 20  DT  C OP2   1 
ATOM   3024 O "O5'" . DT  C 2 20  ? -45.830 30.986 -7.099  0.56 102.30 ? 20  DT  C "O5'" 1 
ATOM   3025 C "C5'" . DT  C 2 20  ? -44.830 30.296 -7.874  0.56 100.57 ? 20  DT  C "C5'" 1 
ATOM   3026 C "C4'" . DT  C 2 20  ? -43.839 29.622 -6.952  0.56 105.41 ? 20  DT  C "C4'" 1 
ATOM   3027 O "O4'" . DT  C 2 20  ? -43.217 30.607 -6.091  0.56 102.71 ? 20  DT  C "O4'" 1 
ATOM   3028 C "C3'" . DT  C 2 20  ? -44.452 28.564 -6.027  0.56 108.93 ? 20  DT  C "C3'" 1 
ATOM   3029 O "O3'" . DT  C 2 20  ? -43.722 27.335 -6.082  0.56 113.92 ? 20  DT  C "O3'" 1 
ATOM   3030 C "C2'" . DT  C 2 20  ? -44.345 29.176 -4.642  0.56 111.18 ? 20  DT  C "C2'" 1 
ATOM   3031 C "C1'" . DT  C 2 20  ? -43.150 30.098 -4.775  0.56 107.76 ? 20  DT  C "C1'" 1 
ATOM   3032 N N1    . DT  C 2 20  ? -43.185 31.236 -3.836  0.56 106.49 ? 20  DT  C N1    1 
ATOM   3033 C C2    . DT  C 2 20  ? -42.231 31.289 -2.843  0.56 119.09 ? 20  DT  C C2    1 
ATOM   3034 O O2    . DT  C 2 20  ? -41.343 30.459 -2.726  0.56 129.73 ? 20  DT  C O2    1 
ATOM   3035 N N3    . DT  C 2 20  ? -42.353 32.359 -1.990  0.56 116.82 ? 20  DT  C N3    1 
ATOM   3036 C C4    . DT  C 2 20  ? -43.318 33.347 -2.022  0.56 110.15 ? 20  DT  C C4    1 
ATOM   3037 O O4    . DT  C 2 20  ? -43.303 34.244 -1.184  0.56 111.28 ? 20  DT  C O4    1 
ATOM   3038 C C5    . DT  C 2 20  ? -44.294 33.221 -3.083  0.56 112.64 ? 20  DT  C C5    1 
ATOM   3039 C C7    . DT  C 2 20  ? -45.383 34.242 -3.195  0.56 111.66 ? 20  DT  C C7    1 
ATOM   3040 C C6    . DT  C 2 20  ? -44.183 32.182 -3.921  0.56 104.04 ? 20  DT  C C6    1 
ATOM   3041 P P     . DG  C 2 21  ? -44.232 26.040 -5.282  0.56 113.71 ? 21  DG  C P     1 
ATOM   3042 O OP1   . DG  C 2 21  ? -43.622 24.848 -5.929  0.56 109.09 ? 21  DG  C OP1   1 
ATOM   3043 O OP2   . DG  C 2 21  ? -45.708 26.106 -5.124  0.56 107.57 ? 21  DG  C OP2   1 
ATOM   3044 O "O5'" . DG  C 2 21  ? -43.585 26.272 -3.844  0.56 121.43 ? 21  DG  C "O5'" 1 
ATOM   3045 C "C5'" . DG  C 2 21  ? -42.392 25.575 -3.422  0.56 127.49 ? 21  DG  C "C5'" 1 
ATOM   3046 C "C4'" . DG  C 2 21  ? -41.938 26.069 -2.066  0.56 136.08 ? 21  DG  C "C4'" 1 
ATOM   3047 O "O4'" . DG  C 2 21  ? -42.291 27.458 -1.894  0.56 137.29 ? 21  DG  C "O4'" 1 
ATOM   3048 C "C3'" . DG  C 2 21  ? -42.547 25.332 -0.869  0.56 137.68 ? 21  DG  C "C3'" 1 
ATOM   3049 O "O3'" . DG  C 2 21  ? -41.573 24.461 -0.286  0.56 142.53 ? 21  DG  C "O3'" 1 
ATOM   3050 C "C2'" . DG  C 2 21  ? -42.935 26.436 0.107   0.56 135.76 ? 21  DG  C "C2'" 1 
ATOM   3051 C "C1'" . DG  C 2 21  ? -42.376 27.710 -0.506  0.56 135.47 ? 21  DG  C "C1'" 1 
ATOM   3052 N N9    . DG  C 2 21  ? -43.223 28.882 -0.310  0.56 131.99 ? 21  DG  C N9    1 
ATOM   3053 C C8    . DG  C 2 21  ? -44.432 29.145 -0.909  0.56 127.72 ? 21  DG  C C8    1 
ATOM   3054 N N7    . DG  C 2 21  ? -44.962 30.273 -0.521  0.56 120.87 ? 21  DG  C N7    1 
ATOM   3055 C C5    . DG  C 2 21  ? -44.053 30.781 0.397   0.56 133.79 ? 21  DG  C C5    1 
ATOM   3056 C C6    . DG  C 2 21  ? -44.085 31.982 1.155   0.56 142.27 ? 21  DG  C C6    1 
ATOM   3057 O O6    . DG  C 2 21  ? -44.953 32.865 1.166   0.56 143.32 ? 21  DG  C O6    1 
ATOM   3058 N N1    . DG  C 2 21  ? -42.958 32.107 1.963   0.56 149.68 ? 21  DG  C N1    1 
ATOM   3059 C C2    . DG  C 2 21  ? -41.932 31.196 2.034   0.56 150.28 ? 21  DG  C C2    1 
ATOM   3060 N N2    . DG  C 2 21  ? -40.930 31.496 2.875   0.56 152.06 ? 21  DG  C N2    1 
ATOM   3061 N N3    . DG  C 2 21  ? -41.890 30.075 1.332   0.56 147.29 ? 21  DG  C N3    1 
ATOM   3062 C C4    . DG  C 2 21  ? -42.976 29.933 0.541   0.56 135.46 ? 21  DG  C C4    1 
ATOM   3063 P P     . DG  C 2 22  ? -41.901 23.561 0.999   0.56 144.80 ? 22  DG  C P     1 
ATOM   3064 O OP1   . DG  C 2 22  ? -40.754 22.636 1.183   0.56 133.36 ? 22  DG  C OP1   1 
ATOM   3065 O OP2   . DG  C 2 22  ? -43.277 23.016 0.857   0.56 140.99 ? 22  DG  C OP2   1 
ATOM   3066 O "O5'" . DG  C 2 22  ? -41.913 24.603 2.205   0.56 153.66 ? 22  DG  C "O5'" 1 
ATOM   3067 C "C5'" . DG  C 2 22  ? -40.969 24.507 3.291   0.56 162.47 ? 22  DG  C "C5'" 1 
ATOM   3068 C "C4'" . DG  C 2 22  ? -40.661 25.877 3.851   0.56 173.51 ? 22  DG  C "C4'" 1 
ATOM   3069 O "O4'" . DG  C 2 22  ? -41.631 26.836 3.376   0.56 175.16 ? 22  DG  C "O4'" 1 
ATOM   3070 C "C3'" . DG  C 2 22  ? -40.693 25.961 5.381   0.56 179.00 ? 22  DG  C "C3'" 1 
ATOM   3071 O "O3'" . DG  C 2 22  ? -39.377 26.179 5.900   0.56 178.70 ? 22  DG  C "O3'" 1 
ATOM   3072 C "C2'" . DG  C 2 22  ? -41.595 27.148 5.688   0.56 178.98 ? 22  DG  C "C2'" 1 
ATOM   3073 C "C1'" . DG  C 2 22  ? -41.773 27.847 4.352   0.56 172.39 ? 22  DG  C "C1'" 1 
ATOM   3074 N N9    . DG  C 2 22  ? -43.086 28.460 4.176   0.56 166.08 ? 22  DG  C N9    1 
ATOM   3075 C C8    . DG  C 2 22  ? -44.179 27.916 3.544   0.56 161.22 ? 22  DG  C C8    1 
ATOM   3076 N N7    . DG  C 2 22  ? -45.221 28.703 3.553   0.56 161.11 ? 22  DG  C N7    1 
ATOM   3077 C C5    . DG  C 2 22  ? -44.792 29.832 4.238   0.56 163.25 ? 22  DG  C C5    1 
ATOM   3078 C C6    . DG  C 2 22  ? -45.485 31.028 4.562   0.56 162.73 ? 22  DG  C C6    1 
ATOM   3079 O O6    . DG  C 2 22  ? -46.654 31.338 4.303   0.56 151.82 ? 22  DG  C O6    1 
ATOM   3080 N N1    . DG  C 2 22  ? -44.672 31.914 5.264   0.56 169.28 ? 22  DG  C N1    1 
ATOM   3081 C C2    . DG  C 2 22  ? -43.363 31.682 5.609   0.56 168.85 ? 22  DG  C C2    1 
ATOM   3082 N N2    . DG  C 2 22  ? -42.747 32.661 6.287   0.56 175.33 ? 22  DG  C N2    1 
ATOM   3083 N N3    . DG  C 2 22  ? -42.707 30.571 5.313   0.56 160.07 ? 22  DG  C N3    1 
ATOM   3084 C C4    . DG  C 2 22  ? -43.477 29.697 4.630   0.56 163.57 ? 22  DG  C C4    1 
ATOM   3085 P P     . DA  C 2 23  ? -38.856 25.346 7.163   0.56 175.16 ? 23  DA  C P     1 
ATOM   3086 O OP1   . DA  C 2 23  ? -37.452 24.962 6.874   0.56 180.55 ? 23  DA  C OP1   1 
ATOM   3087 O OP2   . DA  C 2 23  ? -39.848 24.292 7.498   0.56 174.36 ? 23  DA  C OP2   1 
ATOM   3088 O "O5'" . DA  C 2 23  ? -38.832 26.431 8.331   0.56 179.87 ? 23  DA  C "O5'" 1 
ATOM   3089 C "C5'" . DA  C 2 23  ? -39.978 26.652 9.178   0.56 184.14 ? 23  DA  C "C5'" 1 
ATOM   3090 C "C4'" . DA  C 2 23  ? -39.915 28.033 9.789   0.56 185.85 ? 23  DA  C "C4'" 1 
ATOM   3091 O "O4'" . DA  C 2 23  ? -40.736 28.939 9.016   0.56 186.83 ? 23  DA  C "O4'" 1 
ATOM   3092 C "C3'" . DA  C 2 23  ? -40.417 28.129 11.231  0.56 186.89 ? 23  DA  C "C3'" 1 
ATOM   3093 O "O3'" . DA  C 2 23  ? -39.588 29.009 11.997  0.56 184.01 ? 23  DA  C "O3'" 1 
ATOM   3094 C "C2'" . DA  C 2 23  ? -41.820 28.691 11.085  0.56 189.42 ? 23  DA  C "C2'" 1 
ATOM   3095 C "C1'" . DA  C 2 23  ? -41.712 29.556 9.842   0.56 192.83 ? 23  DA  C "C1'" 1 
ATOM   3096 N N9    . DA  C 2 23  ? -42.949 29.661 9.069   0.56 196.04 ? 23  DA  C N9    1 
ATOM   3097 C C8    . DA  C 2 23  ? -43.438 28.779 8.137   0.56 185.22 ? 23  DA  C C8    1 
ATOM   3098 N N7    . DA  C 2 23  ? -44.575 29.151 7.601   0.56 185.59 ? 23  DA  C N7    1 
ATOM   3099 C C5    . DA  C 2 23  ? -44.858 30.358 8.224   0.56 195.97 ? 23  DA  C C5    1 
ATOM   3100 C C6    . DA  C 2 23  ? -45.929 31.261 8.098   0.56 196.84 ? 23  DA  C C6    1 
ATOM   3101 N N6    . DA  C 2 23  ? -46.957 31.076 7.266   0.56 192.28 ? 23  DA  C N6    1 
ATOM   3102 N N1    . DA  C 2 23  ? -45.908 32.373 8.866   0.56 199.18 ? 23  DA  C N1    1 
ATOM   3103 C C2    . DA  C 2 23  ? -44.875 32.557 9.699   0.56 204.67 ? 23  DA  C C2    1 
ATOM   3104 N N3    . DA  C 2 23  ? -43.812 31.782 9.907   0.56 205.99 ? 23  DA  C N3    1 
ATOM   3105 C C4    . DA  C 2 23  ? -43.864 30.686 9.130   0.56 200.49 ? 23  DA  C C4    1 
ATOM   3106 O "O5'" . DC  D 3 1   ? -44.791 42.024 10.128  0.56 157.87 ? 1   DC  D "O5'" 1 
ATOM   3107 C "C5'" . DC  D 3 1   ? -45.237 41.013 9.207   0.56 162.74 ? 1   DC  D "C5'" 1 
ATOM   3108 C "C4'" . DC  D 3 1   ? -44.163 39.966 9.019   0.56 171.15 ? 1   DC  D "C4'" 1 
ATOM   3109 O "O4'" . DC  D 3 1   ? -44.761 38.712 8.627   0.56 170.50 ? 1   DC  D "O4'" 1 
ATOM   3110 C "C3'" . DC  D 3 1   ? -43.130 40.300 7.938   0.56 174.75 ? 1   DC  D "C3'" 1 
ATOM   3111 O "O3'" . DC  D 3 1   ? -41.868 40.668 8.513   0.56 179.76 ? 1   DC  D "O3'" 1 
ATOM   3112 C "C2'" . DC  D 3 1   ? -43.034 39.039 7.090   0.56 174.05 ? 1   DC  D "C2'" 1 
ATOM   3113 C "C1'" . DC  D 3 1   ? -43.810 37.991 7.872   0.56 169.12 ? 1   DC  D "C1'" 1 
ATOM   3114 N N1    . DC  D 3 1   ? -44.531 37.019 7.033   0.56 172.72 ? 1   DC  D N1    1 
ATOM   3115 C C2    . DC  D 3 1   ? -44.057 35.704 6.960   0.56 175.97 ? 1   DC  D C2    1 
ATOM   3116 O O2    . DC  D 3 1   ? -43.050 35.392 7.615   0.56 178.02 ? 1   DC  D O2    1 
ATOM   3117 N N3    . DC  D 3 1   ? -44.711 34.807 6.184   0.56 172.58 ? 1   DC  D N3    1 
ATOM   3118 C C4    . DC  D 3 1   ? -45.789 35.185 5.492   0.56 172.09 ? 1   DC  D C4    1 
ATOM   3119 N N4    . DC  D 3 1   ? -46.406 34.266 4.744   0.56 157.59 ? 1   DC  D N4    1 
ATOM   3120 C C5    . DC  D 3 1   ? -46.289 36.519 5.543   0.56 177.18 ? 1   DC  D C5    1 
ATOM   3121 C C6    . DC  D 3 1   ? -45.635 37.396 6.318   0.56 174.19 ? 1   DC  D C6    1 
ATOM   3122 P P     . DC  D 3 2   ? -41.038 39.807 9.594   0.56 184.16 ? 2   DC  D P     1 
ATOM   3123 O OP1   . DC  D 3 2   ? -41.611 38.446 9.769   0.56 181.64 ? 2   DC  D OP1   1 
ATOM   3124 O OP2   . DC  D 3 2   ? -40.843 40.668 10.786  0.56 181.78 ? 2   DC  D OP2   1 
ATOM   3125 O "O5'" . DC  D 3 2   ? -39.623 39.652 8.876   0.56 182.21 ? 2   DC  D "O5'" 1 
ATOM   3126 C "C5'" . DC  D 3 2   ? -39.505 39.013 7.589   0.56 173.34 ? 2   DC  D "C5'" 1 
ATOM   3127 C "C4'" . DC  D 3 2   ? -39.030 37.587 7.753   0.56 162.45 ? 2   DC  D "C4'" 1 
ATOM   3128 O "O4'" . DC  D 3 2   ? -40.039 36.672 7.261   0.56 159.62 ? 2   DC  D "O4'" 1 
ATOM   3129 C "C3'" . DC  D 3 2   ? -37.751 37.249 6.989   0.56 152.49 ? 2   DC  D "C3'" 1 
ATOM   3130 O "O3'" . DC  D 3 2   ? -36.959 36.326 7.742   0.56 146.64 ? 2   DC  D "O3'" 1 
ATOM   3131 C "C2'" . DC  D 3 2   ? -38.267 36.598 5.721   0.56 152.60 ? 2   DC  D "C2'" 1 
ATOM   3132 C "C1'" . DC  D 3 2   ? -39.511 35.876 6.209   0.56 157.73 ? 2   DC  D "C1'" 1 
ATOM   3133 N N1    . DC  D 3 2   ? -40.561 35.718 5.189   0.56 159.09 ? 2   DC  D N1    1 
ATOM   3134 C C2    . DC  D 3 2   ? -40.704 34.482 4.551   0.56 157.36 ? 2   DC  D C2    1 
ATOM   3135 O O2    . DC  D 3 2   ? -39.938 33.555 4.858   0.56 160.43 ? 2   DC  D O2    1 
ATOM   3136 N N3    . DC  D 3 2   ? -41.664 34.331 3.608   0.56 154.71 ? 2   DC  D N3    1 
ATOM   3137 C C4    . DC  D 3 2   ? -42.468 35.354 3.306   0.56 153.86 ? 2   DC  D C4    1 
ATOM   3138 N N4    . DC  D 3 2   ? -43.405 35.159 2.375   0.56 150.75 ? 2   DC  D N4    1 
ATOM   3139 C C5    . DC  D 3 2   ? -42.345 36.623 3.943   0.56 157.48 ? 2   DC  D C5    1 
ATOM   3140 C C6    . DC  D 3 2   ? -41.386 36.760 4.868   0.56 158.68 ? 2   DC  D C6    1 
ATOM   3141 P P     . DA  D 3 3   ? -35.452 36.007 7.318   0.56 143.38 ? 3   DA  D P     1 
ATOM   3142 O OP1   . DA  D 3 3   ? -34.712 35.632 8.549   0.56 139.89 ? 3   DA  D OP1   1 
ATOM   3143 O OP2   . DA  D 3 3   ? -34.955 37.123 6.474   0.56 145.41 ? 3   DA  D OP2   1 
ATOM   3144 O "O5'" . DA  D 3 3   ? -35.627 34.719 6.397   0.56 142.07 ? 3   DA  D "O5'" 1 
ATOM   3145 C "C5'" . DA  D 3 3   ? -34.701 33.622 6.470   0.56 135.38 ? 3   DA  D "C5'" 1 
ATOM   3146 C "C4'" . DA  D 3 3   ? -34.752 32.808 5.198   0.56 135.47 ? 3   DA  D "C4'" 1 
ATOM   3147 O "O4'" . DA  D 3 3   ? -36.070 32.891 4.606   0.56 132.45 ? 3   DA  D "O4'" 1 
ATOM   3148 C "C3'" . DA  D 3 3   ? -33.765 33.248 4.113   0.56 137.34 ? 3   DA  D "C3'" 1 
ATOM   3149 O "O3'" . DA  D 3 3   ? -33.033 32.115 3.635   0.56 142.69 ? 3   DA  D "O3'" 1 
ATOM   3150 C "C2'" . DA  D 3 3   ? -34.649 33.836 3.026   0.56 133.59 ? 3   DA  D "C2'" 1 
ATOM   3151 C "C1'" . DA  D 3 3   ? -35.939 33.068 3.208   0.56 134.19 ? 3   DA  D "C1'" 1 
ATOM   3152 N N9    . DA  D 3 3   ? -37.132 33.765 2.730   0.56 134.03 ? 3   DA  D N9    1 
ATOM   3153 C C8    . DA  D 3 3   ? -37.623 34.974 3.156   0.56 131.94 ? 3   DA  D C8    1 
ATOM   3154 N N7    . DA  D 3 3   ? -38.720 35.345 2.541   0.56 134.29 ? 3   DA  D N7    1 
ATOM   3155 C C5    . DA  D 3 3   ? -38.971 34.309 1.653   0.56 131.56 ? 3   DA  D C5    1 
ATOM   3156 C C6    . DA  D 3 3   ? -39.992 34.098 0.709   0.56 129.73 ? 3   DA  D C6    1 
ATOM   3157 N N6    . DA  D 3 3   ? -40.993 34.956 0.498   0.56 122.44 ? 3   DA  D N6    1 
ATOM   3158 N N1    . DA  D 3 3   ? -39.947 32.963 -0.022  0.56 128.66 ? 3   DA  D N1    1 
ATOM   3159 C C2    . DA  D 3 3   ? -38.942 32.103 0.191   0.56 132.42 ? 3   DA  D C2    1 
ATOM   3160 N N3    . DA  D 3 3   ? -37.925 32.190 1.047   0.56 125.41 ? 3   DA  D N3    1 
ATOM   3161 C C4    . DA  D 3 3   ? -37.999 33.330 1.757   0.56 131.68 ? 3   DA  D C4    1 
ATOM   3162 P P     . DC  D 3 4   ? -31.857 32.279 2.558   0.56 153.10 ? 4   DC  D P     1 
ATOM   3163 O OP1   . DC  D 3 4   ? -30.890 31.168 2.747   0.56 144.51 ? 4   DC  D OP1   1 
ATOM   3164 O OP2   . DC  D 3 4   ? -31.371 33.686 2.580   0.56 151.61 ? 4   DC  D OP2   1 
ATOM   3165 O "O5'" . DC  D 3 4   ? -32.619 32.043 1.180   0.56 144.25 ? 4   DC  D "O5'" 1 
ATOM   3166 C "C5'" . DC  D 3 4   ? -33.594 30.993 1.031   0.56 126.15 ? 4   DC  D "C5'" 1 
ATOM   3167 C "C4'" . DC  D 3 4   ? -34.210 31.050 -0.348  0.56 128.82 ? 4   DC  D "C4'" 1 
ATOM   3168 O "O4'" . DC  D 3 4   ? -35.383 31.898 -0.329  0.56 130.96 ? 4   DC  D "O4'" 1 
ATOM   3169 C "C3'" . DC  D 3 4   ? -33.292 31.609 -1.439  0.56 129.07 ? 4   DC  D "C3'" 1 
ATOM   3170 O "O3'" . DC  D 3 4   ? -33.304 30.745 -2.579  0.56 126.98 ? 4   DC  D "O3'" 1 
ATOM   3171 C "C2'" . DC  D 3 4   ? -33.900 32.961 -1.775  0.56 128.11 ? 4   DC  D "C2'" 1 
ATOM   3172 C "C1'" . DC  D 3 4   ? -35.367 32.743 -1.465  0.56 128.12 ? 4   DC  D "C1'" 1 
ATOM   3173 N N1    . DC  D 3 4   ? -36.121 33.962 -1.132  0.56 126.61 ? 4   DC  D N1    1 
ATOM   3174 C C2    . DC  D 3 4   ? -37.361 34.176 -1.745  0.56 124.15 ? 4   DC  D C2    1 
ATOM   3175 O O2    . DC  D 3 4   ? -37.785 33.333 -2.549  0.56 121.85 ? 4   DC  D O2    1 
ATOM   3176 N N3    . DC  D 3 4   ? -38.066 35.290 -1.440  0.56 120.46 ? 4   DC  D N3    1 
ATOM   3177 C C4    . DC  D 3 4   ? -37.575 36.172 -0.565  0.56 123.89 ? 4   DC  D C4    1 
ATOM   3178 N N4    . DC  D 3 4   ? -38.304 37.257 -0.293  0.56 117.06 ? 4   DC  D N4    1 
ATOM   3179 C C5    . DC  D 3 4   ? -36.316 35.978 0.075   0.56 131.04 ? 4   DC  D C5    1 
ATOM   3180 C C6    . DC  D 3 4   ? -35.629 34.870 -0.236  0.56 132.90 ? 4   DC  D C6    1 
ATOM   3181 P P     . DT  D 3 5   ? -32.012 30.587 -3.512  0.56 125.97 ? 5   DT  D P     1 
ATOM   3182 O OP1   . DT  D 3 5   ? -31.444 29.234 -3.291  0.56 127.14 ? 5   DT  D OP1   1 
ATOM   3183 O OP2   . DT  D 3 5   ? -31.143 31.781 -3.357  0.56 115.85 ? 5   DT  D OP2   1 
ATOM   3184 O "O5'" . DT  D 3 5   ? -32.644 30.608 -4.975  0.56 133.07 ? 5   DT  D "O5'" 1 
ATOM   3185 C "C5'" . DT  D 3 5   ? -33.759 29.758 -5.324  0.56 130.59 ? 5   DT  D "C5'" 1 
ATOM   3186 C "C4'" . DT  D 3 5   ? -34.371 30.203 -6.633  0.56 126.50 ? 5   DT  D "C4'" 1 
ATOM   3187 O "O4'" . DT  D 3 5   ? -35.319 31.268 -6.385  0.56 121.01 ? 5   DT  D "O4'" 1 
ATOM   3188 C "C3'" . DT  D 3 5   ? -33.377 30.756 -7.654  0.56 126.69 ? 5   DT  D "C3'" 1 
ATOM   3189 O "O3'" . DT  D 3 5   ? -33.779 30.416 -8.986  0.56 130.78 ? 5   DT  D "O3'" 1 
ATOM   3190 C "C2'" . DT  D 3 5   ? -33.453 32.256 -7.432  0.56 125.01 ? 5   DT  D "C2'" 1 
ATOM   3191 C "C1'" . DT  D 3 5   ? -34.911 32.460 -7.046  0.56 122.32 ? 5   DT  D "C1'" 1 
ATOM   3192 N N1    . DT  D 3 5   ? -35.159 33.591 -6.129  0.56 119.62 ? 5   DT  D N1    1 
ATOM   3193 C C2    . DT  D 3 5   ? -36.460 34.006 -5.949  0.56 122.50 ? 5   DT  D C2    1 
ATOM   3194 O O2    . DT  D 3 5   ? -37.409 33.495 -6.521  0.56 121.46 ? 5   DT  D O2    1 
ATOM   3195 N N3    . DT  D 3 5   ? -36.609 35.057 -5.075  0.56 119.19 ? 5   DT  D N3    1 
ATOM   3196 C C4    . DT  D 3 5   ? -35.611 35.711 -4.375  0.56 120.10 ? 5   DT  D C4    1 
ATOM   3197 O O4    . DT  D 3 5   ? -35.898 36.641 -3.624  0.56 114.88 ? 5   DT  D O4    1 
ATOM   3198 C C5    . DT  D 3 5   ? -34.270 35.219 -4.612  0.56 116.72 ? 5   DT  D C5    1 
ATOM   3199 C C7    . DT  D 3 5   ? -33.123 35.864 -3.900  0.56 113.50 ? 5   DT  D C7    1 
ATOM   3200 C C6    . DT  D 3 5   ? -34.116 34.195 -5.461  0.56 117.22 ? 5   DT  D C6    1 
ATOM   3201 P P     . DG  D 3 6   ? -32.758 29.750 -10.030 0.56 135.35 ? 6   DG  D P     1 
ATOM   3202 O OP1   . DG  D 3 6   ? -33.484 28.637 -10.692 0.56 125.23 ? 6   DG  D OP1   1 
ATOM   3203 O OP2   . DG  D 3 6   ? -31.473 29.477 -9.332  0.56 132.81 ? 6   DG  D OP2   1 
ATOM   3204 O "O5'" . DG  D 3 6   ? -32.509 30.877 -11.133 0.56 138.73 ? 6   DG  D "O5'" 1 
ATOM   3205 C "C5'" . DG  D 3 6   ? -32.084 32.208 -10.773 0.56 127.25 ? 6   DG  D "C5'" 1 
ATOM   3206 C "C4'" . DG  D 3 6   ? -33.058 33.233 -11.308 0.56 123.93 ? 6   DG  D "C4'" 1 
ATOM   3207 O "O4'" . DG  D 3 6   ? -33.927 33.682 -10.242 0.56 121.11 ? 6   DG  D "O4'" 1 
ATOM   3208 C "C3'" . DG  D 3 6   ? -32.406 34.502 -11.851 0.56 130.63 ? 6   DG  D "C3'" 1 
ATOM   3209 O "O3'" . DG  D 3 6   ? -32.072 34.375 -13.244 0.56 131.75 ? 6   DG  D "O3'" 1 
ATOM   3210 C "C2'" . DG  D 3 6   ? -33.475 35.555 -11.626 0.56 125.53 ? 6   DG  D "C2'" 1 
ATOM   3211 C "C1'" . DG  D 3 6   ? -34.238 35.064 -10.404 0.56 121.02 ? 6   DG  D "C1'" 1 
ATOM   3212 N N9    . DG  D 3 6   ? -33.862 35.764 -9.180  0.56 115.40 ? 6   DG  D N9    1 
ATOM   3213 C C8    . DG  D 3 6   ? -32.767 35.515 -8.388  0.56 116.39 ? 6   DG  D C8    1 
ATOM   3214 N N7    . DG  D 3 6   ? -32.682 36.318 -7.363  0.56 115.59 ? 6   DG  D N7    1 
ATOM   3215 C C5    . DG  D 3 6   ? -33.779 37.159 -7.493  0.56 115.11 ? 6   DG  D C5    1 
ATOM   3216 C C6    . DG  D 3 6   ? -34.213 38.238 -6.677  0.56 114.24 ? 6   DG  D C6    1 
ATOM   3217 O O6    . DG  D 3 6   ? -33.698 38.679 -5.643  0.56 116.26 ? 6   DG  D O6    1 
ATOM   3218 N N1    . DG  D 3 6   ? -35.376 38.819 -7.173  0.56 114.59 ? 6   DG  D N1    1 
ATOM   3219 C C2    . DG  D 3 6   ? -36.038 38.416 -8.307  0.56 114.76 ? 6   DG  D C2    1 
ATOM   3220 N N2    . DG  D 3 6   ? -37.146 39.105 -8.620  0.56 110.66 ? 6   DG  D N2    1 
ATOM   3221 N N3    . DG  D 3 6   ? -35.642 37.416 -9.078  0.56 114.33 ? 6   DG  D N3    1 
ATOM   3222 C C4    . DG  D 3 6   ? -34.515 36.834 -8.613  0.56 114.38 ? 6   DG  D C4    1 
ATOM   3223 P P     . DC  D 3 7   ? -33.134 34.558 -14.446 0.56 125.36 ? 7   DC  D P     1 
ATOM   3224 O OP1   . DC  D 3 7   ? -34.473 34.770 -13.845 0.56 111.49 ? 7   DC  D OP1   1 
ATOM   3225 O OP2   . DC  D 3 7   ? -32.942 33.447 -15.411 0.56 127.91 ? 7   DC  D OP2   1 
ATOM   3226 O "O5'" . DC  D 3 7   ? -32.697 35.901 -15.184 0.56 125.54 ? 7   DC  D "O5'" 1 
ATOM   3227 C "C5'" . DC  D 3 7   ? -32.534 37.137 -14.460 0.56 124.46 ? 7   DC  D "C5'" 1 
ATOM   3228 C "C4'" . DC  D 3 7   ? -33.838 37.901 -14.429 0.56 122.16 ? 7   DC  D "C4'" 1 
ATOM   3229 O "O4'" . DC  D 3 7   ? -34.421 37.817 -13.109 0.56 125.95 ? 7   DC  D "O4'" 1 
ATOM   3230 C "C3'" . DC  D 3 7   ? -33.700 39.388 -14.734 0.56 123.69 ? 7   DC  D "C3'" 1 
ATOM   3231 O "O3'" . DC  D 3 7   ? -33.992 39.575 -16.124 0.56 129.13 ? 7   DC  D "O3'" 1 
ATOM   3232 C "C2'" . DC  D 3 7   ? -34.761 40.033 -13.858 0.56 121.87 ? 7   DC  D "C2'" 1 
ATOM   3233 C "C1'" . DC  D 3 7   ? -34.886 39.088 -12.673 0.56 114.59 ? 7   DC  D "C1'" 1 
ATOM   3234 N N1    . DC  D 3 7   ? -34.115 39.462 -11.475 0.56 105.42 ? 7   DC  D N1    1 
ATOM   3235 C C2    . DC  D 3 7   ? -34.606 40.470 -10.637 0.56 99.42  ? 7   DC  D C2    1 
ATOM   3236 O O2    . DC  D 3 7   ? -35.665 41.039 -10.938 0.56 97.23  ? 7   DC  D O2    1 
ATOM   3237 N N3    . DC  D 3 7   ? -33.912 40.798 -9.522  0.56 100.70 ? 7   DC  D N3    1 
ATOM   3238 C C4    . DC  D 3 7   ? -32.772 40.163 -9.234  0.56 101.72 ? 7   DC  D C4    1 
ATOM   3239 N N4    . DC  D 3 7   ? -32.121 40.519 -8.125  0.56 98.65  ? 7   DC  D N4    1 
ATOM   3240 C C5    . DC  D 3 7   ? -32.251 39.134 -10.071 0.56 105.68 ? 7   DC  D C5    1 
ATOM   3241 C C6    . DC  D 3 7   ? -32.951 38.815 -11.167 0.56 107.29 ? 7   DC  D C6    1 
ATOM   3242 P P     . DT  D 3 8   ? -33.212 40.619 -17.064 0.56 143.18 ? 8   DT  D P     1 
ATOM   3243 O OP1   . DT  D 3 8   ? -33.363 40.148 -18.466 0.56 141.71 ? 8   DT  D OP1   1 
ATOM   3244 O OP2   . DT  D 3 8   ? -31.848 40.910 -16.537 0.56 135.02 ? 8   DT  D OP2   1 
ATOM   3245 O "O5'" . DT  D 3 8   ? -34.083 41.939 -16.868 0.56 126.78 ? 8   DT  D "O5'" 1 
ATOM   3246 C "C5'" . DT  D 3 8   ? -33.539 43.058 -16.152 0.56 120.08 ? 8   DT  D "C5'" 1 
ATOM   3247 C "C4'" . DT  D 3 8   ? -34.645 43.929 -15.605 0.56 114.24 ? 8   DT  D "C4'" 1 
ATOM   3248 O "O4'" . DT  D 3 8   ? -34.969 43.536 -14.255 0.56 114.30 ? 8   DT  D "O4'" 1 
ATOM   3249 C "C3'" . DT  D 3 8   ? -34.307 45.420 -15.559 0.56 110.62 ? 8   DT  D "C3'" 1 
ATOM   3250 O "O3'" . DT  D 3 8   ? -35.328 46.174 -16.229 0.56 107.01 ? 8   DT  D "O3'" 1 
ATOM   3251 C "C2'" . DT  D 3 8   ? -34.206 45.767 -14.080 0.56 98.90  ? 8   DT  D "C2'" 1 
ATOM   3252 C "C1'" . DT  D 3 8   ? -34.493 44.490 -13.319 0.56 98.90  ? 8   DT  D "C1'" 1 
ATOM   3253 N N1    . DT  D 3 8   ? -33.319 43.920 -12.642 0.56 91.93  ? 8   DT  D N1    1 
ATOM   3254 C C2    . DT  D 3 8   ? -33.077 44.307 -11.343 0.56 93.66  ? 8   DT  D C2    1 
ATOM   3255 O O2    . DT  D 3 8   ? -33.780 45.104 -10.744 0.56 96.53  ? 8   DT  D O2    1 
ATOM   3256 N N3    . DT  D 3 8   ? -31.970 43.728 -10.771 0.56 93.39  ? 8   DT  D N3    1 
ATOM   3257 C C4    . DT  D 3 8   ? -31.104 42.822 -11.356 0.56 93.66  ? 8   DT  D C4    1 
ATOM   3258 O O4    . DT  D 3 8   ? -30.151 42.387 -10.718 0.56 97.66  ? 8   DT  D O4    1 
ATOM   3259 C C5    . DT  D 3 8   ? -31.426 42.452 -12.716 0.56 94.52  ? 8   DT  D C5    1 
ATOM   3260 C C7    . DT  D 3 8   ? -30.548 41.473 -13.430 0.56 90.84  ? 8   DT  D C7    1 
ATOM   3261 C C6    . DT  D 3 8   ? -32.503 43.012 -13.282 0.56 96.84  ? 8   DT  D C6    1 
ATOM   3262 P P     . DC  D 3 9   ? -35.075 47.668 -16.764 0.56 111.24 ? 9   DC  D P     1 
ATOM   3263 O OP1   . DC  D 3 9   ? -36.382 48.267 -17.139 0.56 100.84 ? 9   DC  D OP1   1 
ATOM   3264 O OP2   . DC  D 3 9   ? -33.955 47.669 -17.749 0.56 112.47 ? 9   DC  D OP2   1 
ATOM   3265 O "O5'" . DC  D 3 9   ? -34.590 48.410 -15.441 0.56 106.22 ? 9   DC  D "O5'" 1 
ATOM   3266 C "C5'" . DC  D 3 9   ? -35.551 49.009 -14.551 0.56 104.08 ? 9   DC  D "C5'" 1 
ATOM   3267 C "C4'" . DC  D 3 9   ? -34.832 49.800 -13.487 0.56 95.94  ? 9   DC  D "C4'" 1 
ATOM   3268 O "O4'" . DC  D 3 9   ? -33.987 48.903 -12.734 0.56 90.60  ? 9   DC  D "O4'" 1 
ATOM   3269 C "C3'" . DC  D 3 9   ? -33.921 50.899 -14.038 0.56 93.23  ? 9   DC  D "C3'" 1 
ATOM   3270 O "O3'" . DC  D 3 9   ? -34.160 52.118 -13.340 0.56 90.81  ? 9   DC  D "O3'" 1 
ATOM   3271 C "C2'" . DC  D 3 9   ? -32.515 50.389 -13.777 0.56 94.83  ? 9   DC  D "C2'" 1 
ATOM   3272 C "C1'" . DC  D 3 9   ? -32.703 49.473 -12.582 0.56 93.67  ? 9   DC  D "C1'" 1 
ATOM   3273 N N1    . DC  D 3 9   ? -31.732 48.372 -12.501 0.56 91.78  ? 9   DC  D N1    1 
ATOM   3274 C C2    . DC  D 3 9   ? -31.324 47.926 -11.241 0.56 90.32  ? 9   DC  D C2    1 
ATOM   3275 O O2    . DC  D 3 9   ? -31.798 48.469 -10.231 0.56 92.60  ? 9   DC  D O2    1 
ATOM   3276 N N3    . DC  D 3 9   ? -30.423 46.918 -11.155 0.56 90.11  ? 9   DC  D N3    1 
ATOM   3277 C C4    . DC  D 3 9   ? -29.934 46.364 -12.269 0.56 89.69  ? 9   DC  D C4    1 
ATOM   3278 N N4    . DC  D 3 9   ? -29.047 45.375 -12.139 0.56 89.95  ? 9   DC  D N4    1 
ATOM   3279 C C5    . DC  D 3 9   ? -30.334 46.800 -13.566 0.56 90.98  ? 9   DC  D C5    1 
ATOM   3280 C C6    . DC  D 3 9   ? -31.225 47.799 -13.635 0.56 93.44  ? 9   DC  D C6    1 
ATOM   3281 P P     . DA  D 3 10  ? -33.840 53.525 -14.032 0.56 96.03  ? 10  DA  D P     1 
ATOM   3282 O OP1   . DA  D 3 10  ? -35.085 54.344 -14.037 0.56 90.70  ? 10  DA  D OP1   1 
ATOM   3283 O OP2   . DA  D 3 10  ? -33.086 53.302 -15.295 0.56 90.98  ? 10  DA  D OP2   1 
ATOM   3284 O "O5'" . DA  D 3 10  ? -32.847 54.155 -12.959 0.56 92.29  ? 10  DA  D "O5'" 1 
ATOM   3285 C "C5'" . DA  D 3 10  ? -33.156 54.112 -11.553 0.56 84.78  ? 10  DA  D "C5'" 1 
ATOM   3286 C "C4'" . DA  D 3 10  ? -31.885 54.213 -10.744 0.56 81.83  ? 10  DA  D "C4'" 1 
ATOM   3287 O "O4'" . DA  D 3 10  ? -31.132 52.987 -10.873 0.56 87.45  ? 10  DA  D "O4'" 1 
ATOM   3288 C "C3'" . DA  D 3 10  ? -30.939 55.336 -11.173 0.56 83.51  ? 10  DA  D "C3'" 1 
ATOM   3289 O "O3'" . DA  D 3 10  ? -30.414 55.982 -10.011 0.56 83.86  ? 10  DA  D "O3'" 1 
ATOM   3290 C "C2'" . DA  D 3 10  ? -29.837 54.613 -11.927 0.56 83.97  ? 10  DA  D "C2'" 1 
ATOM   3291 C "C1'" . DA  D 3 10  ? -29.786 53.292 -11.192 0.56 88.04  ? 10  DA  D "C1'" 1 
ATOM   3292 N N9    . DA  D 3 10  ? -29.240 52.175 -11.964 0.56 87.89  ? 10  DA  D N9    1 
ATOM   3293 C C8    . DA  D 3 10  ? -29.249 52.003 -13.326 0.56 90.03  ? 10  DA  D C8    1 
ATOM   3294 N N7    . DA  D 3 10  ? -28.680 50.890 -13.723 0.56 87.55  ? 10  DA  D N7    1 
ATOM   3295 C C5    . DA  D 3 10  ? -28.279 50.282 -12.541 0.56 90.08  ? 10  DA  D C5    1 
ATOM   3296 C C6    . DA  D 3 10  ? -27.612 49.071 -12.278 0.56 93.71  ? 10  DA  D C6    1 
ATOM   3297 N N6    . DA  D 3 10  ? -27.219 48.219 -13.228 0.56 95.16  ? 10  DA  D N6    1 
ATOM   3298 N N1    . DA  D 3 10  ? -27.369 48.756 -10.986 0.56 92.39  ? 10  DA  D N1    1 
ATOM   3299 C C2    . DA  D 3 10  ? -27.769 49.608 -10.033 0.56 88.29  ? 10  DA  D C2    1 
ATOM   3300 N N3    . DA  D 3 10  ? -28.397 50.775 -10.155 0.56 81.93  ? 10  DA  D N3    1 
ATOM   3301 C C4    . DA  D 3 10  ? -28.624 51.059 -11.449 0.56 85.05  ? 10  DA  D C4    1 
HETATM 3302 P P     . UF2 D 3 11  ? -30.781 57.510 -9.715  0.56 82.30  ? 11  UF2 D P     1 
HETATM 3303 O O1P   . UF2 D 3 11  ? -32.117 57.873 -10.259 0.56 85.53  ? 11  UF2 D O1P   1 
HETATM 3304 O "O5'" . UF2 D 3 11  ? -29.671 58.277 -10.567 0.56 74.93  ? 11  UF2 D "O5'" 1 
HETATM 3305 C "C5'" . UF2 D 3 11  ? -29.796 58.503 -11.988 0.56 68.53  ? 11  UF2 D "C5'" 1 
HETATM 3306 C "C4'" . UF2 D 3 11  ? -29.023 59.743 -12.368 0.56 71.73  ? 11  UF2 D "C4'" 1 
HETATM 3307 C "C3'" . UF2 D 3 11  ? -27.539 59.688 -12.004 0.56 77.59  ? 11  UF2 D "C3'" 1 
HETATM 3308 O "O3'" . UF2 D 3 11  ? -26.758 59.516 -13.198 0.56 83.89  ? 11  UF2 D "O3'" 1 
HETATM 3309 C "C2'" . UF2 D 3 11  ? -27.245 61.009 -11.303 0.56 75.41  ? 11  UF2 D "C2'" 1 
HETATM 3310 F "F2'" . UF2 D 3 11  ? -26.803 60.785 -10.033 0.56 84.18  ? 11  UF2 D "F2'" 1 
HETATM 3311 C "C1'" . UF2 D 3 11  ? -28.567 61.752 -11.218 0.56 76.61  ? 11  UF2 D "C1'" 1 
HETATM 3312 O "O4'" . UF2 D 3 11  ? -29.578 60.854 -11.643 0.56 77.95  ? 11  UF2 D "O4'" 1 
HETATM 3313 N N1    . UF2 D 3 11  ? -28.948 62.252 -9.887  0.56 75.53  ? 11  UF2 D N1    1 
HETATM 3314 C C6    . UF2 D 3 11  ? -29.825 61.542 -9.099  0.56 77.24  ? 11  UF2 D C6    1 
HETATM 3315 C C5    . UF2 D 3 11  ? -30.239 61.976 -7.905  0.56 77.79  ? 11  UF2 D C5    1 
HETATM 3316 C C4    . UF2 D 3 11  ? -29.771 63.234 -7.407  0.56 77.58  ? 11  UF2 D C4    1 
HETATM 3317 N N3    . UF2 D 3 11  ? -28.891 63.893 -8.241  0.56 74.21  ? 11  UF2 D N3    1 
HETATM 3318 C C2    . UF2 D 3 11  ? -28.454 63.477 -9.475  0.56 74.05  ? 11  UF2 D C2    1 
HETATM 3319 O O2    . UF2 D 3 11  ? -27.690 64.144 -10.150 0.56 77.33  ? 11  UF2 D O2    1 
HETATM 3320 O O4    . UF2 D 3 11  ? -30.079 63.743 -6.328  0.56 75.58  ? 11  UF2 D O4    1 
HETATM 3321 O O2P   . UF2 D 3 11  ? -30.525 57.659 -8.260  0.56 85.57  ? 11  UF2 D O2P   1 
ATOM   3322 P P     . DG  D 3 12  ? -26.831 58.201 -14.142 0.56 81.40  ? 12  DG  D P     1 
ATOM   3323 O OP1   . DG  D 3 12  ? -27.412 58.648 -15.434 0.56 75.45  ? 12  DG  D OP1   1 
ATOM   3324 O OP2   . DG  D 3 12  ? -27.447 57.069 -13.410 0.56 76.06  ? 12  DG  D OP2   1 
ATOM   3325 O "O5'" . DG  D 3 12  ? -25.314 57.770 -14.348 0.56 75.57  ? 12  DG  D "O5'" 1 
ATOM   3326 C "C5'" . DG  D 3 12  ? -24.282 58.757 -14.455 0.56 79.28  ? 12  DG  D "C5'" 1 
ATOM   3327 C "C4'" . DG  D 3 12  ? -22.944 58.111 -14.186 0.56 85.02  ? 12  DG  D "C4'" 1 
ATOM   3328 O "O4'" . DG  D 3 12  ? -22.954 56.754 -14.692 0.56 79.71  ? 12  DG  D "O4'" 1 
ATOM   3329 C "C3'" . DG  D 3 12  ? -21.756 58.800 -14.853 0.56 82.42  ? 12  DG  D "C3'" 1 
ATOM   3330 O "O3'" . DG  D 3 12  ? -20.618 58.710 -13.988 0.56 72.43  ? 12  DG  D "O3'" 1 
ATOM   3331 C "C2'" . DG  D 3 12  ? -21.589 58.015 -16.143 0.56 89.59  ? 12  DG  D "C2'" 1 
ATOM   3332 C "C1'" . DG  D 3 12  ? -22.001 56.607 -15.733 0.56 87.31  ? 12  DG  D "C1'" 1 
ATOM   3333 N N9    . DG  D 3 12  ? -22.620 55.818 -16.792 0.56 93.39  ? 12  DG  D N9    1 
ATOM   3334 C C8    . DG  D 3 12  ? -23.591 56.228 -17.675 0.56 96.52  ? 12  DG  D C8    1 
ATOM   3335 N N7    . DG  D 3 12  ? -23.953 55.293 -18.510 0.56 95.72  ? 12  DG  D N7    1 
ATOM   3336 C C5    . DG  D 3 12  ? -23.180 54.197 -18.153 0.56 99.55  ? 12  DG  D C5    1 
ATOM   3337 C C6    . DG  D 3 12  ? -23.133 52.887 -18.699 0.56 108.36 ? 12  DG  D C6    1 
ATOM   3338 O O6    . DG  D 3 12  ? -23.790 52.420 -19.638 0.56 119.83 ? 12  DG  D O6    1 
ATOM   3339 N N1    . DG  D 3 12  ? -22.206 52.089 -18.036 0.56 109.24 ? 12  DG  D N1    1 
ATOM   3340 C C2    . DG  D 3 12  ? -21.423 52.495 -16.983 0.56 105.78 ? 12  DG  D C2    1 
ATOM   3341 N N2    . DG  D 3 12  ? -20.588 51.576 -16.474 0.56 107.74 ? 12  DG  D N2    1 
ATOM   3342 N N3    . DG  D 3 12  ? -21.456 53.713 -16.465 0.56 104.51 ? 12  DG  D N3    1 
ATOM   3343 C C4    . DG  D 3 12  ? -22.353 54.504 -17.093 0.56 97.83  ? 12  DG  D C4    1 
ATOM   3344 P P     . DT  D 3 13  ? -19.176 59.283 -14.366 0.56 78.72  ? 13  DT  D P     1 
ATOM   3345 O OP1   . DT  D 3 13  ? -18.307 59.294 -13.165 0.56 82.25  ? 13  DT  D OP1   1 
ATOM   3346 O OP2   . DT  D 3 13  ? -19.342 60.540 -15.128 0.56 80.90  ? 13  DT  D OP2   1 
ATOM   3347 O "O5'" . DT  D 3 13  ? -18.592 58.140 -15.309 0.56 83.32  ? 13  DT  D "O5'" 1 
ATOM   3348 C "C5'" . DT  D 3 13  ? -18.243 56.851 -14.768 0.56 85.42  ? 13  DT  D "C5'" 1 
ATOM   3349 C "C4'" . DT  D 3 13  ? -17.392 56.072 -15.744 0.56 91.68  ? 13  DT  D "C4'" 1 
ATOM   3350 O "O4'" . DT  D 3 13  ? -18.228 55.354 -16.686 0.56 95.84  ? 13  DT  D "O4'" 1 
ATOM   3351 C "C3'" . DT  D 3 13  ? -16.430 56.914 -16.587 0.56 93.70  ? 13  DT  D "C3'" 1 
ATOM   3352 O "O3'" . DT  D 3 13  ? -15.190 56.208 -16.675 0.56 95.36  ? 13  DT  D "O3'" 1 
ATOM   3353 C "C2'" . DT  D 3 13  ? -17.099 56.959 -17.949 0.56 96.13  ? 13  DT  D "C2'" 1 
ATOM   3354 C "C1'" . DT  D 3 13  ? -17.754 55.592 -18.002 0.56 98.58  ? 13  DT  D "C1'" 1 
ATOM   3355 N N1    . DT  D 3 13  ? -18.893 55.459 -18.932 0.56 97.37  ? 13  DT  D N1    1 
ATOM   3356 C C2    . DT  D 3 13  ? -19.171 54.206 -19.430 0.56 98.45  ? 13  DT  D C2    1 
ATOM   3357 O O2    . DT  D 3 13  ? -18.527 53.214 -19.133 0.56 103.20 ? 13  DT  D O2    1 
ATOM   3358 N N3    . DT  D 3 13  ? -20.237 54.156 -20.293 0.56 96.96  ? 13  DT  D N3    1 
ATOM   3359 C C4    . DT  D 3 13  ? -21.034 55.209 -20.697 0.56 97.96  ? 13  DT  D C4    1 
ATOM   3360 O O4    . DT  D 3 13  ? -21.958 55.009 -21.478 0.56 102.96 ? 13  DT  D O4    1 
ATOM   3361 C C5    . DT  D 3 13  ? -20.684 56.497 -20.137 0.56 100.48 ? 13  DT  D C5    1 
ATOM   3362 C C7    . DT  D 3 13  ? -21.491 57.698 -20.517 0.56 110.41 ? 13  DT  D C7    1 
ATOM   3363 C C6    . DT  D 3 13  ? -19.645 56.556 -19.295 0.56 95.19  ? 13  DT  D C6    1 
ATOM   3364 P P     . DA  D 3 14  ? -13.820 56.945 -17.006 0.56 99.63  ? 14  DA  D P     1 
ATOM   3365 O OP1   . DA  D 3 14  ? -13.133 57.242 -15.724 0.56 102.25 ? 14  DA  D OP1   1 
ATOM   3366 O OP2   . DA  D 3 14  ? -14.099 58.053 -17.961 0.56 106.95 ? 14  DA  D OP2   1 
ATOM   3367 O "O5'" . DA  D 3 14  ? -13.027 55.791 -17.765 0.56 101.92 ? 14  DA  D "O5'" 1 
ATOM   3368 C "C5'" . DA  D 3 14  ? -12.358 54.745 -17.041 0.56 103.28 ? 14  DA  D "C5'" 1 
ATOM   3369 C "C4'" . DA  D 3 14  ? -12.436 53.439 -17.799 0.56 113.86 ? 14  DA  D "C4'" 1 
ATOM   3370 O "O4'" . DA  D 3 14  ? -13.735 53.288 -18.424 0.56 115.25 ? 14  DA  D "O4'" 1 
ATOM   3371 C "C3'" . DA  D 3 14  ? -11.404 53.264 -18.913 0.56 114.99 ? 14  DA  D "C3'" 1 
ATOM   3372 O "O3'" . DA  D 3 14  ? -10.918 51.916 -18.898 0.56 124.79 ? 14  DA  D "O3'" 1 
ATOM   3373 C "C2'" . DA  D 3 14  ? -12.192 53.558 -20.178 0.56 123.61 ? 14  DA  D "C2'" 1 
ATOM   3374 C "C1'" . DA  D 3 14  ? -13.597 53.091 -19.825 0.56 115.96 ? 14  DA  D "C1'" 1 
ATOM   3375 N N9    . DA  D 3 14  ? -14.677 53.827 -20.487 0.56 115.76 ? 14  DA  D N9    1 
ATOM   3376 C C8    . DA  D 3 14  ? -14.871 55.187 -20.513 0.56 112.51 ? 14  DA  D C8    1 
ATOM   3377 N N7    . DA  D 3 14  ? -15.943 55.557 -21.171 0.56 111.58 ? 14  DA  D N7    1 
ATOM   3378 C C5    . DA  D 3 14  ? -16.495 54.360 -21.608 0.56 110.72 ? 14  DA  D C5    1 
ATOM   3379 C C6    . DA  D 3 14  ? -17.643 54.069 -22.367 0.56 114.93 ? 14  DA  D C6    1 
ATOM   3380 N N6    . DA  D 3 14  ? -18.477 55.000 -22.837 0.56 126.41 ? 14  DA  D N6    1 
ATOM   3381 N N1    . DA  D 3 14  ? -17.913 52.770 -22.627 0.56 115.17 ? 14  DA  D N1    1 
ATOM   3382 C C2    . DA  D 3 14  ? -17.078 51.837 -22.152 0.56 119.31 ? 14  DA  D C2    1 
ATOM   3383 N N3    . DA  D 3 14  ? -15.967 51.985 -21.430 0.56 118.14 ? 14  DA  D N3    1 
ATOM   3384 C C4    . DA  D 3 14  ? -15.728 53.286 -21.190 0.56 113.49 ? 14  DA  D C4    1 
ATOM   3385 P P     . DC  D 3 15  ? -9.677  51.441 -19.788 0.56 130.55 ? 15  DC  D P     1 
ATOM   3386 O OP1   . DC  D 3 15  ? -9.027  50.321 -19.059 0.56 135.44 ? 15  DC  D OP1   1 
ATOM   3387 O OP2   . DC  D 3 15  ? -8.878  52.632 -20.173 0.56 127.60 ? 15  DC  D OP2   1 
ATOM   3388 O "O5'" . DC  D 3 15  ? -10.377 50.866 -21.099 0.56 132.70 ? 15  DC  D "O5'" 1 
ATOM   3389 C "C5'" . DC  D 3 15  ? -11.301 49.765 -21.021 0.56 130.78 ? 15  DC  D "C5'" 1 
ATOM   3390 C "C4'" . DC  D 3 15  ? -12.001 49.565 -22.346 0.56 139.06 ? 15  DC  D "C4'" 1 
ATOM   3391 O "O4'" . DC  D 3 15  ? -12.969 50.615 -22.552 0.56 138.27 ? 15  DC  D "O4'" 1 
ATOM   3392 C "C3'" . DC  D 3 15  ? -11.089 49.583 -23.578 0.56 148.49 ? 15  DC  D "C3'" 1 
ATOM   3393 O "O3'" . DC  D 3 15  ? -10.985 48.267 -24.135 0.56 160.66 ? 15  DC  D "O3'" 1 
ATOM   3394 C "C2'" . DC  D 3 15  ? -11.771 50.541 -24.548 0.56 145.72 ? 15  DC  D "C2'" 1 
ATOM   3395 C "C1'" . DC  D 3 15  ? -13.144 50.771 -23.943 0.56 137.70 ? 15  DC  D "C1'" 1 
ATOM   3396 N N1    . DC  D 3 15  ? -13.705 52.111 -24.181 0.56 134.63 ? 15  DC  D N1    1 
ATOM   3397 C C2    . DC  D 3 15  ? -14.968 52.219 -24.777 0.56 132.24 ? 15  DC  D C2    1 
ATOM   3398 O O2    . DC  D 3 15  ? -15.576 51.183 -25.087 0.56 131.64 ? 15  DC  D O2    1 
ATOM   3399 N N3    . DC  D 3 15  ? -15.493 53.448 -24.996 0.56 131.22 ? 15  DC  D N3    1 
ATOM   3400 C C4    . DC  D 3 15  ? -14.806 54.539 -24.646 0.56 123.31 ? 15  DC  D C4    1 
ATOM   3401 N N4    . DC  D 3 15  ? -15.362 55.730 -24.882 0.56 116.57 ? 15  DC  D N4    1 
ATOM   3402 C C5    . DC  D 3 15  ? -13.518 54.457 -24.038 0.56 124.83 ? 15  DC  D C5    1 
ATOM   3403 C C6    . DC  D 3 15  ? -13.011 53.235 -23.827 0.56 127.86 ? 15  DC  D C6    1 
ATOM   3404 P P     . DA  D 3 16  ? -9.998  47.930 -25.357 0.56 169.55 ? 16  DA  D P     1 
ATOM   3405 O OP1   . DA  D 3 16  ? -9.529  46.530 -25.185 0.56 167.46 ? 16  DA  D OP1   1 
ATOM   3406 O OP2   . DA  D 3 16  ? -8.998  49.024 -25.498 0.56 166.14 ? 16  DA  D OP2   1 
ATOM   3407 O "O5'" . DA  D 3 16  ? -10.978 47.974 -26.612 0.56 151.01 ? 16  DA  D "O5'" 1 
ATOM   3408 C "C5'" . DA  D 3 16  ? -12.090 47.068 -26.712 0.56 143.23 ? 16  DA  D "C5'" 1 
ATOM   3409 C "C4'" . DA  D 3 16  ? -13.051 47.536 -27.779 0.56 154.17 ? 16  DA  D "C4'" 1 
ATOM   3410 O "O4'" . DA  D 3 16  ? -13.465 48.891 -27.504 0.56 158.16 ? 16  DA  D "O4'" 1 
ATOM   3411 C "C3'" . DA  D 3 16  ? -12.484 47.543 -29.203 0.56 153.27 ? 16  DA  D "C3'" 1 
ATOM   3412 O "O3'" . DA  D 3 16  ? -13.167 46.584 -30.017 0.56 151.63 ? 16  DA  D "O3'" 1 
ATOM   3413 C "C2'" . DA  D 3 16  ? -12.740 48.956 -29.709 0.56 155.46 ? 16  DA  D "C2'" 1 
ATOM   3414 C "C1'" . DA  D 3 16  ? -13.762 49.511 -28.735 0.56 156.69 ? 16  DA  D "C1'" 1 
ATOM   3415 N N9    . DA  D 3 16  ? -13.687 50.959 -28.541 0.56 166.95 ? 16  DA  D N9    1 
ATOM   3416 C C8    . DA  D 3 16  ? -12.683 51.677 -27.939 0.56 171.95 ? 16  DA  D C8    1 
ATOM   3417 N N7    . DA  D 3 16  ? -12.895 52.970 -27.920 0.56 174.94 ? 16  DA  D N7    1 
ATOM   3418 C C5    . DA  D 3 16  ? -14.124 53.115 -28.549 0.56 170.49 ? 16  DA  D C5    1 
ATOM   3419 C C6    . DA  D 3 16  ? -14.910 54.245 -28.844 0.56 169.71 ? 16  DA  D C6    1 
ATOM   3420 N N6    . DA  D 3 16  ? -14.557 55.495 -28.532 0.56 165.49 ? 16  DA  D N6    1 
ATOM   3421 N N1    . DA  D 3 16  ? -16.083 54.046 -29.484 0.56 170.60 ? 16  DA  D N1    1 
ATOM   3422 C C2    . DA  D 3 16  ? -16.436 52.792 -29.798 0.56 168.09 ? 16  DA  D C2    1 
ATOM   3423 N N3    . DA  D 3 16  ? -15.785 51.651 -29.573 0.56 168.96 ? 16  DA  D N3    1 
ATOM   3424 C C4    . DA  D 3 16  ? -14.622 51.885 -28.939 0.56 167.98 ? 16  DA  D C4    1 
ATOM   3425 P P     . DG  D 3 17  ? -12.357 45.489 -30.863 0.56 152.80 ? 17  DG  D P     1 
ATOM   3426 O OP1   . DG  D 3 17  ? -13.038 44.182 -30.693 0.56 158.02 ? 17  DG  D OP1   1 
ATOM   3427 O OP2   . DG  D 3 17  ? -10.907 45.601 -30.554 0.56 151.18 ? 17  DG  D OP2   1 
ATOM   3428 O "O5'" . DG  D 3 17  ? -12.604 45.955 -32.365 0.56 161.30 ? 17  DG  D "O5'" 1 
ATOM   3429 C "C5'" . DG  D 3 17  ? -11.945 47.120 -32.896 0.56 170.82 ? 17  DG  D "C5'" 1 
ATOM   3430 C "C4'" . DG  D 3 17  ? -12.947 48.026 -33.574 0.56 173.89 ? 17  DG  D "C4'" 1 
ATOM   3431 O "O4'" . DG  D 3 17  ? -13.189 49.189 -32.748 0.56 175.73 ? 17  DG  D "O4'" 1 
ATOM   3432 C "C3'" . DG  D 3 17  ? -12.503 48.560 -34.937 0.56 176.61 ? 17  DG  D "C3'" 1 
ATOM   3433 O "O3'" . DG  D 3 17  ? -13.607 48.595 -35.847 0.56 174.07 ? 17  DG  D "O3'" 1 
ATOM   3434 C "C2'" . DG  D 3 17  ? -12.008 49.960 -34.627 0.56 176.84 ? 17  DG  D "C2'" 1 
ATOM   3435 C "C1'" . DG  D 3 17  ? -12.902 50.377 -33.470 0.56 177.51 ? 17  DG  D "C1'" 1 
ATOM   3436 N N9    . DG  D 3 17  ? -12.292 51.328 -32.544 0.56 182.17 ? 17  DG  D N9    1 
ATOM   3437 C C8    . DG  D 3 17  ? -11.135 51.156 -31.822 0.56 185.84 ? 17  DG  D C8    1 
ATOM   3438 N N7    . DG  D 3 17  ? -10.838 52.184 -31.075 0.56 178.98 ? 17  DG  D N7    1 
ATOM   3439 C C5    . DG  D 3 17  ? -11.859 53.092 -31.320 0.56 176.88 ? 17  DG  D C5    1 
ATOM   3440 C C6    . DG  D 3 17  ? -12.078 54.394 -30.795 0.56 174.09 ? 17  DG  D C6    1 
ATOM   3441 O O6    . DG  D 3 17  ? -11.391 55.024 -29.981 0.56 174.60 ? 17  DG  D O6    1 
ATOM   3442 N N1    . DG  D 3 17  ? -13.237 54.965 -31.313 0.56 172.99 ? 17  DG  D N1    1 
ATOM   3443 C C2    . DG  D 3 17  ? -14.080 54.363 -32.215 0.56 171.66 ? 17  DG  D C2    1 
ATOM   3444 N N2    . DG  D 3 17  ? -15.148 55.079 -32.596 0.56 171.48 ? 17  DG  D N2    1 
ATOM   3445 N N3    . DG  D 3 17  ? -13.886 53.153 -32.714 0.56 175.37 ? 17  DG  D N3    1 
ATOM   3446 C C4    . DG  D 3 17  ? -12.765 52.579 -32.225 0.56 178.91 ? 17  DG  D C4    1 
ATOM   3447 P P     . DA  D 3 18  ? -13.447 48.038 -37.339 0.56 174.34 ? 18  DA  D P     1 
ATOM   3448 O OP1   . DA  D 3 18  ? -14.437 46.945 -37.519 0.56 174.94 ? 18  DA  D OP1   1 
ATOM   3449 O OP2   . DA  D 3 18  ? -12.008 47.776 -37.611 0.56 176.64 ? 18  DA  D OP2   1 
ATOM   3450 O "O5'" . DA  D 3 18  ? -13.916 49.278 -38.222 0.56 176.48 ? 18  DA  D "O5'" 1 
ATOM   3451 C "C5'" . DA  D 3 18  ? -13.004 50.339 -38.561 0.56 178.05 ? 18  DA  D "C5'" 1 
ATOM   3452 C "C4'" . DA  D 3 18  ? -13.766 51.612 -38.849 0.56 178.35 ? 18  DA  D "C4'" 1 
ATOM   3453 O "O4'" . DA  D 3 18  ? -13.806 52.427 -37.651 0.56 176.48 ? 18  DA  D "O4'" 1 
ATOM   3454 C "C3'" . DA  D 3 18  ? -13.146 52.495 -39.932 0.56 180.35 ? 18  DA  D "C3'" 1 
ATOM   3455 O "O3'" . DA  D 3 18  ? -14.166 53.157 -40.694 0.56 176.99 ? 18  DA  D "O3'" 1 
ATOM   3456 C "C2'" . DA  D 3 18  ? -12.306 53.472 -39.132 0.56 185.17 ? 18  DA  D "C2'" 1 
ATOM   3457 C "C1'" . DA  D 3 18  ? -13.134 53.659 -37.869 0.56 182.33 ? 18  DA  D "C1'" 1 
ATOM   3458 N N9    . DA  D 3 18  ? -12.335 53.953 -36.681 0.56 188.91 ? 18  DA  D N9    1 
ATOM   3459 C C8    . DA  D 3 18  ? -11.450 53.122 -36.039 0.56 189.84 ? 18  DA  D C8    1 
ATOM   3460 N N7    . DA  D 3 18  ? -10.866 53.670 -35.002 0.56 189.40 ? 18  DA  D N7    1 
ATOM   3461 C C5    . DA  D 3 18  ? -11.397 54.952 -34.959 0.56 192.40 ? 18  DA  D C5    1 
ATOM   3462 C C6    . DA  D 3 18  ? -11.182 56.037 -34.091 0.56 193.91 ? 18  DA  D C6    1 
ATOM   3463 N N6    . DA  D 3 18  ? -10.343 56.000 -33.053 0.56 199.83 ? 18  DA  D N6    1 
ATOM   3464 N N1    . DA  D 3 18  ? -11.869 57.177 -34.327 0.56 192.18 ? 18  DA  D N1    1 
ATOM   3465 C C2    . DA  D 3 18  ? -12.713 57.212 -35.367 0.56 190.55 ? 18  DA  D C2    1 
ATOM   3466 N N3    . DA  D 3 18  ? -13.000 56.259 -36.253 0.56 191.75 ? 18  DA  D N3    1 
ATOM   3467 C C4    . DA  D 3 18  ? -12.299 55.142 -35.991 0.56 192.60 ? 18  DA  D C4    1 
ATOM   3468 P P     . DG  D 3 19  ? -13.937 54.564 -41.438 0.56 178.26 ? 19  DG  D P     1 
ATOM   3469 O OP1   . DG  D 3 19  ? -15.242 54.983 -42.009 0.56 180.51 ? 19  DG  D OP1   1 
ATOM   3470 O OP2   . DG  D 3 19  ? -12.750 54.441 -42.327 0.56 174.06 ? 19  DG  D OP2   1 
ATOM   3471 O "O5'" . DG  D 3 19  ? -13.585 55.565 -40.249 0.56 178.19 ? 19  DG  D "O5'" 1 
ATOM   3472 C "C5'" . DG  D 3 19  ? -13.923 56.962 -40.310 0.56 179.64 ? 19  DG  D "C5'" 1 
ATOM   3473 C "C4'" . DG  D 3 19  ? -12.678 57.811 -40.188 0.56 185.08 ? 19  DG  D "C4'" 1 
ATOM   3474 O "O4'" . DG  D 3 19  ? -11.919 57.422 -39.018 0.56 193.00 ? 19  DG  D "O4'" 1 
ATOM   3475 C "C3'" . DG  D 3 19  ? -11.711 57.718 -41.374 0.56 189.46 ? 19  DG  D "C3'" 1 
ATOM   3476 O "O3'" . DG  D 3 19  ? -11.381 59.032 -41.834 0.56 192.91 ? 19  DG  D "O3'" 1 
ATOM   3477 C "C2'" . DG  D 3 19  ? -10.477 57.048 -40.790 0.56 196.10 ? 19  DG  D "C2'" 1 
ATOM   3478 C "C1'" . DG  D 3 19  ? -10.544 57.485 -39.345 0.56 199.50 ? 19  DG  D "C1'" 1 
ATOM   3479 N N9    . DG  D 3 19  ? -9.811  56.644 -38.403 0.56 207.63 ? 19  DG  D N9    1 
ATOM   3480 C C8    . DG  D 3 19  ? -9.472  55.321 -38.554 0.56 212.62 ? 19  DG  D C8    1 
ATOM   3481 N N7    . DG  D 3 19  ? -8.801  54.845 -37.540 0.56 215.20 ? 19  DG  D N7    1 
ATOM   3482 C C5    . DG  D 3 19  ? -8.681  55.921 -36.671 0.56 207.58 ? 19  DG  D C5    1 
ATOM   3483 C C6    . DG  D 3 19  ? -8.050  56.013 -35.402 0.56 204.14 ? 19  DG  D C6    1 
ATOM   3484 O O6    . DG  D 3 19  ? -7.453  55.132 -34.770 0.56 200.54 ? 19  DG  D O6    1 
ATOM   3485 N N1    . DG  D 3 19  ? -8.165  57.292 -34.866 0.56 209.70 ? 19  DG  D N1    1 
ATOM   3486 C C2    . DG  D 3 19  ? -8.805  58.348 -35.471 0.56 215.31 ? 19  DG  D C2    1 
ATOM   3487 N N2    . DG  D 3 19  ? -8.809  59.505 -34.793 0.56 224.21 ? 19  DG  D N2    1 
ATOM   3488 N N3    . DG  D 3 19  ? -9.394  58.275 -36.653 0.56 211.77 ? 19  DG  D N3    1 
ATOM   3489 C C4    . DG  D 3 19  ? -9.296  57.040 -37.191 0.56 208.81 ? 19  DG  D C4    1 
ATOM   3490 P P     . DC  D 3 20  ? -10.569 59.265 -43.194 0.56 201.26 ? 20  DC  D P     1 
ATOM   3491 O OP1   . DC  D 3 20  ? -11.546 59.616 -44.255 0.56 205.07 ? 20  DC  D OP1   1 
ATOM   3492 O OP2   . DC  D 3 20  ? -9.627  58.136 -43.413 0.56 205.40 ? 20  DC  D OP2   1 
ATOM   3493 O "O5'" . DC  D 3 20  ? -9.716  60.570 -42.865 0.56 206.64 ? 20  DC  D "O5'" 1 
ATOM   3494 C "C5'" . DC  D 3 20  ? -8.441  60.471 -42.206 0.56 212.80 ? 20  DC  D "C5'" 1 
ATOM   3495 C "C4'" . DC  D 3 20  ? -8.393  61.410 -41.024 0.56 220.65 ? 20  DC  D "C4'" 1 
ATOM   3496 O "O4'" . DC  D 3 20  ? -8.564  60.654 -39.804 0.56 226.67 ? 20  DC  D "O4'" 1 
ATOM   3497 C "C3'" . DC  D 3 20  ? -7.070  62.152 -40.866 0.56 222.99 ? 20  DC  D "C3'" 1 
ATOM   3498 O "O3'" . DC  D 3 20  ? -7.153  63.413 -41.538 0.56 226.27 ? 20  DC  D "O3'" 1 
ATOM   3499 C "C2'" . DC  D 3 20  ? -6.959  62.348 -39.366 0.56 223.82 ? 20  DC  D "C2'" 1 
ATOM   3500 C "C1'" . DC  D 3 20  ? -7.706  61.151 -38.782 0.56 228.05 ? 20  DC  D "C1'" 1 
ATOM   3501 N N1    . DC  D 3 20  ? -6.853  60.038 -38.323 0.56 229.21 ? 20  DC  D N1    1 
ATOM   3502 C C2    . DC  D 3 20  ? -5.987  60.247 -37.243 0.56 229.31 ? 20  DC  D C2    1 
ATOM   3503 O O2    . DC  D 3 20  ? -5.950  61.366 -36.710 0.56 230.97 ? 20  DC  D O2    1 
ATOM   3504 N N3    . DC  D 3 20  ? -5.212  59.225 -36.810 0.56 230.02 ? 20  DC  D N3    1 
ATOM   3505 C C4    . DC  D 3 20  ? -5.279  58.034 -37.412 0.56 230.64 ? 20  DC  D C4    1 
ATOM   3506 N N4    . DC  D 3 20  ? -4.491  57.057 -36.955 0.56 228.24 ? 20  DC  D N4    1 
ATOM   3507 C C5    . DC  D 3 20  ? -6.154  57.794 -38.512 0.56 230.58 ? 20  DC  D C5    1 
ATOM   3508 C C6    . DC  D 3 20  ? -6.920  58.812 -38.927 0.56 228.27 ? 20  DC  D C6    1 
ATOM   3509 P P     . DT  D 3 21  ? -5.846  64.175 -42.060 0.56 225.43 ? 21  DT  D P     1 
ATOM   3510 O OP1   . DT  D 3 21  ? -6.279  65.175 -43.069 0.56 227.07 ? 21  DT  D OP1   1 
ATOM   3511 O OP2   . DT  D 3 21  ? -4.815  63.170 -42.424 0.56 229.47 ? 21  DT  D OP2   1 
ATOM   3512 O "O5'" . DT  D 3 21  ? -5.364  64.944 -40.750 0.56 222.29 ? 21  DT  D "O5'" 1 
ATOM   3513 C "C5'" . DT  D 3 21  ? -4.644  66.188 -40.837 0.56 217.26 ? 21  DT  D "C5'" 1 
ATOM   3514 C "C4'" . DT  D 3 21  ? -3.282  66.052 -40.196 0.56 215.12 ? 21  DT  D "C4'" 1 
ATOM   3515 O "O4'" . DT  D 3 21  ? -3.268  64.912 -39.302 0.56 214.02 ? 21  DT  D "O4'" 1 
ATOM   3516 C "C3'" . DT  D 3 21  ? -2.128  65.845 -41.183 0.56 212.67 ? 21  DT  D "C3'" 1 
ATOM   3517 O "O3'" . DT  D 3 21  ? -1.109  66.834 -40.973 0.56 217.35 ? 21  DT  D "O3'" 1 
ATOM   3518 C "C2'" . DT  D 3 21  ? -1.647  64.431 -40.898 0.56 211.43 ? 21  DT  D "C2'" 1 
ATOM   3519 C "C1'" . DT  D 3 21  ? -2.038  64.231 -39.447 0.56 210.92 ? 21  DT  D "C1'" 1 
ATOM   3520 N N1    . DT  D 3 21  ? -2.246  62.820 -39.067 0.56 206.05 ? 21  DT  D N1    1 
ATOM   3521 C C2    . DT  D 3 21  ? -1.650  62.351 -37.918 0.56 201.40 ? 21  DT  D C2    1 
ATOM   3522 O O2    . DT  D 3 21  ? -0.969  63.051 -37.186 0.56 196.45 ? 21  DT  D O2    1 
ATOM   3523 N N3    . DT  D 3 21  ? -1.881  61.023 -37.653 0.56 206.16 ? 21  DT  D N3    1 
ATOM   3524 C C4    . DT  D 3 21  ? -2.628  60.139 -38.410 0.56 205.09 ? 21  DT  D C4    1 
ATOM   3525 O O4    . DT  D 3 21  ? -2.744  58.971 -38.048 0.56 203.94 ? 21  DT  D O4    1 
ATOM   3526 C C5    . DT  D 3 21  ? -3.221  60.698 -39.605 0.56 208.96 ? 21  DT  D C5    1 
ATOM   3527 C C7    . DT  D 3 21  ? -4.043  59.816 -40.490 0.56 216.12 ? 21  DT  D C7    1 
ATOM   3528 C C6    . DT  D 3 21  ? -3.001  61.992 -39.870 0.56 208.90 ? 21  DT  D C6    1 
ATOM   3529 P P     . DG  D 3 22  ? 0.470   66.565 -41.137 0.56 226.16 ? 22  DG  D P     1 
ATOM   3530 O OP1   . DG  D 3 22  ? 1.146   67.884 -41.239 0.56 224.81 ? 22  DG  D OP1   1 
ATOM   3531 O OP2   . DG  D 3 22  ? 0.695   65.549 -42.198 0.56 226.38 ? 22  DG  D OP2   1 
ATOM   3532 O "O5'" . DG  D 3 22  ? 0.845   65.902 -39.737 0.56 213.22 ? 22  DG  D "O5'" 1 
ATOM   3533 C "C5'" . DG  D 3 22  ? 1.811   66.499 -38.854 0.56 197.42 ? 22  DG  D "C5'" 1 
ATOM   3534 C "C4'" . DG  D 3 22  ? 2.558   65.424 -38.098 0.56 189.04 ? 22  DG  D "C4'" 1 
ATOM   3535 O "O4'" . DG  D 3 22  ? 1.766   64.211 -38.054 0.56 187.81 ? 22  DG  D "O4'" 1 
ATOM   3536 C "C3'" . DG  D 3 22  ? 3.906   65.034 -38.713 0.56 186.18 ? 22  DG  D "C3'" 1 
ATOM   3537 O "O3'" . DG  D 3 22  ? 4.928   65.037 -37.706 0.56 177.95 ? 22  DG  D "O3'" 1 
ATOM   3538 C "C2'" . DG  D 3 22  ? 3.653   63.651 -39.291 0.56 190.73 ? 22  DG  D "C2'" 1 
ATOM   3539 C "C1'" . DG  D 3 22  ? 2.598   63.105 -38.351 0.56 191.50 ? 22  DG  D "C1'" 1 
ATOM   3540 N N9    . DG  D 3 22  ? 1.766   62.049 -38.920 0.56 192.27 ? 22  DG  D N9    1 
ATOM   3541 C C8    . DG  D 3 22  ? 0.925   62.149 -40.002 0.56 195.63 ? 22  DG  D C8    1 
ATOM   3542 N N7    . DG  D 3 22  ? 0.315   61.030 -40.283 0.56 197.42 ? 22  DG  D N7    1 
ATOM   3543 C C5    . DG  D 3 22  ? 0.789   60.133 -39.335 0.56 194.85 ? 22  DG  D C5    1 
ATOM   3544 C C6    . DG  D 3 22  ? 0.489   58.758 -39.137 0.56 190.06 ? 22  DG  D C6    1 
ATOM   3545 O O6    . DG  D 3 22  ? -0.283  58.036 -39.779 0.56 185.45 ? 22  DG  D O6    1 
ATOM   3546 N N1    . DG  D 3 22  ? 1.194   58.232 -38.059 0.56 190.76 ? 22  DG  D N1    1 
ATOM   3547 C C2    . DG  D 3 22  ? 2.075   58.933 -37.273 0.56 194.43 ? 22  DG  D C2    1 
ATOM   3548 N N2    . DG  D 3 22  ? 2.656   58.246 -36.278 0.56 193.45 ? 22  DG  D N2    1 
ATOM   3549 N N3    . DG  D 3 22  ? 2.362   60.214 -37.445 0.56 194.18 ? 22  DG  D N3    1 
ATOM   3550 C C4    . DG  D 3 22  ? 1.688   60.747 -38.488 0.56 192.52 ? 22  DG  D C4    1 
ATOM   3551 P P     . DT  D 3 23  ? 6.006   63.858 -37.560 0.56 177.54 ? 23  DT  D P     1 
ATOM   3552 O OP1   . DT  D 3 23  ? 6.583   63.564 -38.899 0.56 186.16 ? 23  DT  D OP1   1 
ATOM   3553 O OP2   . DT  D 3 23  ? 5.385   62.763 -36.772 0.56 169.82 ? 23  DT  D OP2   1 
ATOM   3554 O "O5'" . DT  D 3 23  ? 7.146   64.512 -36.660 0.56 184.52 ? 23  DT  D "O5'" 1 
ATOM   3555 C "C5'" . DT  D 3 23  ? 8.501   64.625 -37.139 0.56 187.08 ? 23  DT  D "C5'" 1 
ATOM   3556 C "C4'" . DT  D 3 23  ? 9.302   63.391 -36.788 0.56 191.68 ? 23  DT  D "C4'" 1 
ATOM   3557 O "O4'" . DT  D 3 23  ? 8.436   62.353 -36.282 0.56 193.44 ? 23  DT  D "O4'" 1 
ATOM   3558 C "C3'" . DT  D 3 23  ? 10.029  62.752 -37.965 0.56 195.65 ? 23  DT  D "C3'" 1 
ATOM   3559 O "O3'" . DT  D 3 23  ? 11.320  63.347 -38.134 0.56 199.14 ? 23  DT  D "O3'" 1 
ATOM   3560 C "C2'" . DT  D 3 23  ? 10.156  61.299 -37.541 0.56 194.97 ? 23  DT  D "C2'" 1 
ATOM   3561 C "C1'" . DT  D 3 23  ? 9.017   61.080 -36.544 0.56 190.67 ? 23  DT  D "C1'" 1 
ATOM   3562 N N1    . DT  D 3 23  ? 7.949   60.182 -37.028 0.56 185.78 ? 23  DT  D N1    1 
ATOM   3563 C C2    . DT  D 3 23  ? 7.865   58.913 -36.499 0.56 181.17 ? 23  DT  D C2    1 
ATOM   3564 O O2    . DT  D 3 23  ? 8.629   58.492 -35.646 0.56 175.40 ? 23  DT  D O2    1 
ATOM   3565 N N3    . DT  D 3 23  ? 6.844   58.148 -37.010 0.56 181.56 ? 23  DT  D N3    1 
ATOM   3566 C C4    . DT  D 3 23  ? 5.923   58.519 -37.972 0.56 192.29 ? 23  DT  D C4    1 
ATOM   3567 O O4    . DT  D 3 23  ? 5.066   57.721 -38.338 0.56 196.82 ? 23  DT  D O4    1 
ATOM   3568 C C5    . DT  D 3 23  ? 6.074   59.862 -38.485 0.56 192.77 ? 23  DT  D C5    1 
ATOM   3569 C C7    . DT  D 3 23  ? 5.126   60.349 -39.535 0.56 191.56 ? 23  DT  D C7    1 
ATOM   3570 C C6    . DT  D 3 23  ? 7.068   60.614 -37.996 0.56 187.14 ? 23  DT  D C6    1 
ATOM   3571 O "O5'" . DC  E 2 1   ? -46.991 18.118 12.140  0.44 189.76 ? 1   DC  E "O5'" 1 
ATOM   3572 C "C5'" . DC  E 2 1   ? -47.142 18.788 10.875  0.44 191.45 ? 1   DC  E "C5'" 1 
ATOM   3573 C "C4'" . DC  E 2 1   ? -48.607 18.959 10.543  0.44 189.19 ? 1   DC  E "C4'" 1 
ATOM   3574 O "O4'" . DC  E 2 1   ? -49.392 18.886 11.759  0.44 190.91 ? 1   DC  E "O4'" 1 
ATOM   3575 C "C3'" . DC  E 2 1   ? -48.963 20.298 9.891   0.44 184.86 ? 1   DC  E "C3'" 1 
ATOM   3576 O "O3'" . DC  E 2 1   ? -49.958 20.119 8.875   0.44 175.42 ? 1   DC  E "O3'" 1 
ATOM   3577 C "C2'" . DC  E 2 1   ? -49.565 21.093 11.035  0.44 186.34 ? 1   DC  E "C2'" 1 
ATOM   3578 C "C1'" . DC  E 2 1   ? -50.269 19.997 11.810  0.44 192.64 ? 1   DC  E "C1'" 1 
ATOM   3579 N N1    . DC  E 2 1   ? -50.544 20.299 13.224  0.44 201.38 ? 1   DC  E N1    1 
ATOM   3580 C C2    . DC  E 2 1   ? -51.850 20.148 13.697  0.44 206.26 ? 1   DC  E C2    1 
ATOM   3581 O O2    . DC  E 2 1   ? -52.729 19.763 12.912  0.44 209.45 ? 1   DC  E O2    1 
ATOM   3582 N N3    . DC  E 2 1   ? -52.121 20.426 14.993  0.44 204.40 ? 1   DC  E N3    1 
ATOM   3583 C C4    . DC  E 2 1   ? -51.144 20.838 15.804  0.44 203.96 ? 1   DC  E C4    1 
ATOM   3584 N N4    . DC  E 2 1   ? -51.457 21.103 17.075  0.44 198.18 ? 1   DC  E N4    1 
ATOM   3585 C C5    . DC  E 2 1   ? -49.803 21.001 15.348  0.44 204.45 ? 1   DC  E C5    1 
ATOM   3586 C C6    . DC  E 2 1   ? -49.550 20.724 14.062  0.44 203.44 ? 1   DC  E C6    1 
ATOM   3587 P P     . DA  E 2 2   ? -49.725 19.344 7.485   0.44 161.62 ? 2   DA  E P     1 
ATOM   3588 O OP1   . DA  E 2 2   ? -48.580 18.409 7.616   0.44 156.71 ? 2   DA  E OP1   1 
ATOM   3589 O OP2   . DA  E 2 2   ? -49.740 20.339 6.382   0.44 155.71 ? 2   DA  E OP2   1 
ATOM   3590 O "O5'" . DA  E 2 2   ? -51.057 18.476 7.384   0.44 167.53 ? 2   DA  E "O5'" 1 
ATOM   3591 C "C5'" . DA  E 2 2   ? -51.764 18.339 6.136   0.44 158.61 ? 2   DA  E "C5'" 1 
ATOM   3592 C "C4'" . DA  E 2 2   ? -53.132 18.976 6.226   0.44 159.02 ? 2   DA  E "C4'" 1 
ATOM   3593 O "O4'" . DA  E 2 2   ? -53.623 18.940 7.585   0.44 164.52 ? 2   DA  E "O4'" 1 
ATOM   3594 C "C3'" . DA  E 2 2   ? -53.182 20.449 5.838   0.44 155.18 ? 2   DA  E "C3'" 1 
ATOM   3595 O "O3'" . DA  E 2 2   ? -53.326 20.579 4.421   0.44 140.46 ? 2   DA  E "O3'" 1 
ATOM   3596 C "C2'" . DA  E 2 2   ? -54.419 20.940 6.568   0.44 161.07 ? 2   DA  E "C2'" 1 
ATOM   3597 C "C1'" . DA  E 2 2   ? -54.487 20.053 7.813   0.44 167.19 ? 2   DA  E "C1'" 1 
ATOM   3598 N N9    . DA  E 2 2   ? -54.055 20.716 9.043   0.44 172.29 ? 2   DA  E N9    1 
ATOM   3599 C C8    . DA  E 2 2   ? -52.777 20.823 9.534   0.44 171.13 ? 2   DA  E C8    1 
ATOM   3600 N N7    . DA  E 2 2   ? -52.697 21.487 10.661  0.44 171.56 ? 2   DA  E N7    1 
ATOM   3601 C C5    . DA  E 2 2   ? -54.011 21.843 10.932  0.44 177.86 ? 2   DA  E C5    1 
ATOM   3602 C C6    . DA  E 2 2   ? -54.598 22.561 11.989  0.44 183.47 ? 2   DA  E C6    1 
ATOM   3603 N N6    . DA  E 2 2   ? -53.907 23.070 13.012  0.44 178.98 ? 2   DA  E N6    1 
ATOM   3604 N N1    . DA  E 2 2   ? -55.937 22.742 11.958  0.44 188.31 ? 2   DA  E N1    1 
ATOM   3605 C C2    . DA  E 2 2   ? -56.629 22.230 10.932  0.44 188.08 ? 2   DA  E C2    1 
ATOM   3606 N N3    . DA  E 2 2   ? -56.191 21.537 9.882   0.44 181.86 ? 2   DA  E N3    1 
ATOM   3607 C C4    . DA  E 2 2   ? -54.858 21.376 9.942   0.44 178.04 ? 2   DA  E C4    1 
ATOM   3608 P P     . DG  E 2 3   ? -53.540 22.016 3.756   0.44 123.95 ? 3   DG  E P     1 
ATOM   3609 O OP1   . DG  E 2 3   ? -53.199 21.904 2.318   0.44 121.86 ? 3   DG  E OP1   1 
ATOM   3610 O OP2   . DG  E 2 3   ? -52.856 23.029 4.596   0.44 131.85 ? 3   DG  E OP2   1 
ATOM   3611 O "O5'" . DG  E 2 3   ? -55.107 22.269 3.872   0.44 127.59 ? 3   DG  E "O5'" 1 
ATOM   3612 C "C5'" . DG  E 2 3   ? -55.673 23.532 3.479   0.44 134.16 ? 3   DG  E "C5'" 1 
ATOM   3613 C "C4'" . DG  E 2 3   ? -56.192 24.270 4.690   0.44 145.73 ? 3   DG  E "C4'" 1 
ATOM   3614 O "O4'" . DG  E 2 3   ? -55.446 23.874 5.864   0.44 153.71 ? 3   DG  E "O4'" 1 
ATOM   3615 C "C3'" . DG  E 2 3   ? -56.085 25.797 4.606   0.44 151.00 ? 3   DG  E "C3'" 1 
ATOM   3616 O "O3'" . DG  E 2 3   ? -57.380 26.392 4.741   0.44 147.44 ? 3   DG  E "O3'" 1 
ATOM   3617 C "C2'" . DG  E 2 3   ? -55.186 26.181 5.774   0.44 159.35 ? 3   DG  E "C2'" 1 
ATOM   3618 C "C1'" . DG  E 2 3   ? -55.314 24.997 6.710   0.44 160.81 ? 3   DG  E "C1'" 1 
ATOM   3619 N N9    . DG  E 2 3   ? -54.158 24.774 7.574   0.44 169.93 ? 3   DG  E N9    1 
ATOM   3620 C C8    . DG  E 2 3   ? -52.969 24.178 7.228   0.44 179.20 ? 3   DG  E C8    1 
ATOM   3621 N N7    . DG  E 2 3   ? -52.123 24.109 8.220   0.44 181.98 ? 3   DG  E N7    1 
ATOM   3622 C C5    . DG  E 2 3   ? -52.795 24.692 9.286   0.44 177.61 ? 3   DG  E C5    1 
ATOM   3623 C C6    . DG  E 2 3   ? -52.383 24.902 10.628  0.44 175.61 ? 3   DG  E C6    1 
ATOM   3624 O O6    . DG  E 2 3   ? -51.305 24.607 11.160  0.44 170.80 ? 3   DG  E O6    1 
ATOM   3625 N N1    . DG  E 2 3   ? -53.376 25.528 11.375  0.44 177.46 ? 3   DG  E N1    1 
ATOM   3626 C C2    . DG  E 2 3   ? -54.608 25.902 10.896  0.44 178.92 ? 3   DG  E C2    1 
ATOM   3627 N N2    . DG  E 2 3   ? -55.430 26.494 11.776  0.44 171.67 ? 3   DG  E N2    1 
ATOM   3628 N N3    . DG  E 2 3   ? -55.004 25.712 9.647   0.44 177.89 ? 3   DG  E N3    1 
ATOM   3629 C C4    . DG  E 2 3   ? -54.054 25.106 8.903   0.44 175.55 ? 3   DG  E C4    1 
ATOM   3630 P P     . DC  E 2 4   ? -57.720 27.761 3.981   0.44 145.98 ? 4   DC  E P     1 
ATOM   3631 O OP1   . DC  E 2 4   ? -59.187 27.818 3.754   0.44 138.15 ? 4   DC  E OP1   1 
ATOM   3632 O OP2   . DC  E 2 4   ? -56.794 27.897 2.829   0.44 153.66 ? 4   DC  E OP2   1 
ATOM   3633 O "O5'" . DC  E 2 4   ? -57.339 28.866 5.064   0.44 146.88 ? 4   DC  E "O5'" 1 
ATOM   3634 C "C5'" . DC  E 2 4   ? -57.873 28.795 6.398   0.44 150.00 ? 4   DC  E "C5'" 1 
ATOM   3635 C "C4'" . DC  E 2 4   ? -57.085 29.685 7.330   0.44 148.39 ? 4   DC  E "C4'" 1 
ATOM   3636 O "O4'" . DC  E 2 4   ? -56.033 28.918 7.953   0.44 141.43 ? 4   DC  E "O4'" 1 
ATOM   3637 C "C3'" . DC  E 2 4   ? -56.400 30.884 6.662   0.44 153.90 ? 4   DC  E "C3'" 1 
ATOM   3638 O "O3'" . DC  E 2 4   ? -56.965 32.114 7.128   0.44 157.34 ? 4   DC  E "O3'" 1 
ATOM   3639 C "C2'" . DC  E 2 4   ? -54.942 30.781 7.091   0.44 152.45 ? 4   DC  E "C2'" 1 
ATOM   3640 C "C1'" . DC  E 2 4   ? -54.980 29.807 8.253   0.44 150.92 ? 4   DC  E "C1'" 1 
ATOM   3641 N N1    . DC  E 2 4   ? -53.756 29.015 8.432   0.44 157.76 ? 4   DC  E N1    1 
ATOM   3642 C C2    . DC  E 2 4   ? -53.373 28.663 9.728   0.44 160.02 ? 4   DC  E C2    1 
ATOM   3643 O O2    . DC  E 2 4   ? -54.082 29.023 10.680  0.44 155.17 ? 4   DC  E O2    1 
ATOM   3644 N N3    . DC  E 2 4   ? -52.245 27.939 9.911   0.44 163.04 ? 4   DC  E N3    1 
ATOM   3645 C C4    . DC  E 2 4   ? -51.510 27.571 8.859   0.44 163.85 ? 4   DC  E C4    1 
ATOM   3646 N N4    . DC  E 2 4   ? -50.403 26.860 9.086   0.44 163.55 ? 4   DC  E N4    1 
ATOM   3647 C C5    . DC  E 2 4   ? -51.876 27.920 7.526   0.44 159.28 ? 4   DC  E C5    1 
ATOM   3648 C C6    . DC  E 2 4   ? -52.996 28.637 7.361   0.44 160.37 ? 4   DC  E C6    1 
ATOM   3649 P P     . DT  E 2 5   ? -57.195 33.331 6.112   0.44 166.89 ? 5   DT  E P     1 
ATOM   3650 O OP1   . DT  E 2 5   ? -58.360 32.983 5.256   0.44 165.72 ? 5   DT  E OP1   1 
ATOM   3651 O OP2   . DT  E 2 5   ? -55.894 33.673 5.482   0.44 163.89 ? 5   DT  E OP2   1 
ATOM   3652 O "O5'" . DT  E 2 5   ? -57.611 34.550 7.051   0.44 160.93 ? 5   DT  E "O5'" 1 
ATOM   3653 C "C5'" . DT  E 2 5   ? -57.399 34.491 8.473   0.44 156.77 ? 5   DT  E "C5'" 1 
ATOM   3654 C "C4'" . DT  E 2 5   ? -56.191 35.314 8.856   0.44 151.53 ? 5   DT  E "C4'" 1 
ATOM   3655 O "O4'" . DT  E 2 5   ? -55.060 34.443 9.084   0.44 154.20 ? 5   DT  E "O4'" 1 
ATOM   3656 C "C3'" . DT  E 2 5   ? -55.744 36.337 7.806   0.44 146.08 ? 5   DT  E "C3'" 1 
ATOM   3657 O "O3'" . DT  E 2 5   ? -55.730 37.639 8.396   0.44 138.79 ? 5   DT  E "O3'" 1 
ATOM   3658 C "C2'" . DT  E 2 5   ? -54.339 35.899 7.422   0.44 149.39 ? 5   DT  E "C2'" 1 
ATOM   3659 C "C1'" . DT  E 2 5   ? -53.891 35.087 8.620   0.44 154.18 ? 5   DT  E "C1'" 1 
ATOM   3660 N N1    . DT  E 2 5   ? -52.889 34.045 8.321   0.44 160.43 ? 5   DT  E N1    1 
ATOM   3661 C C2    . DT  E 2 5   ? -51.953 33.746 9.285   0.44 161.90 ? 5   DT  E C2    1 
ATOM   3662 O O2    . DT  E 2 5   ? -51.914 34.302 10.371  0.44 163.15 ? 5   DT  E O2    1 
ATOM   3663 N N3    . DT  E 2 5   ? -51.060 32.766 8.930   0.44 158.37 ? 5   DT  E N3    1 
ATOM   3664 C C4    . DT  E 2 5   ? -51.010 32.073 7.735   0.44 157.96 ? 5   DT  E C4    1 
ATOM   3665 O O4    . DT  E 2 5   ? -50.145 31.219 7.557   0.44 148.54 ? 5   DT  E O4    1 
ATOM   3666 C C5    . DT  E 2 5   ? -52.022 32.438 6.770   0.44 160.71 ? 5   DT  E C5    1 
ATOM   3667 C C7    . DT  E 2 5   ? -52.046 31.743 5.446   0.44 164.92 ? 5   DT  E C7    1 
ATOM   3668 C C6    . DT  E 2 5   ? -52.899 33.392 7.108   0.44 161.80 ? 5   DT  E C6    1 
ATOM   3669 P P     . DC  E 2 6   ? -55.389 38.928 7.523   0.44 132.67 ? 6   DC  E P     1 
ATOM   3670 O OP1   . DC  E 2 6   ? -56.250 40.034 8.017   0.44 130.98 ? 6   DC  E OP1   1 
ATOM   3671 O OP2   . DC  E 2 6   ? -55.433 38.546 6.091   0.44 131.57 ? 6   DC  E OP2   1 
ATOM   3672 O "O5'" . DC  E 2 6   ? -53.873 39.231 7.910   0.44 132.11 ? 6   DC  E "O5'" 1 
ATOM   3673 C "C5'" . DC  E 2 6   ? -53.533 39.726 9.216   0.44 134.41 ? 6   DC  E "C5'" 1 
ATOM   3674 C "C4'" . DC  E 2 6   ? -52.070 39.489 9.511   0.44 141.50 ? 6   DC  E "C4'" 1 
ATOM   3675 O "O4'" . DC  E 2 6   ? -51.745 38.095 9.348   0.44 147.68 ? 6   DC  E "O4'" 1 
ATOM   3676 C "C3'" . DC  E 2 6   ? -51.093 40.218 8.595   0.44 141.45 ? 6   DC  E "C3'" 1 
ATOM   3677 O "O3'" . DC  E 2 6   ? -50.788 41.517 9.111   0.44 143.87 ? 6   DC  E "O3'" 1 
ATOM   3678 C "C2'" . DC  E 2 6   ? -49.856 39.332 8.626   0.44 143.19 ? 6   DC  E "C2'" 1 
ATOM   3679 C "C1'" . DC  E 2 6   ? -50.336 37.994 9.196   0.44 145.74 ? 6   DC  E "C1'" 1 
ATOM   3680 N N1    . DC  E 2 6   ? -50.052 36.835 8.338   0.44 142.81 ? 6   DC  E N1    1 
ATOM   3681 C C2    . DC  E 2 6   ? -49.083 35.915 8.748   0.44 148.24 ? 6   DC  E C2    1 
ATOM   3682 O O2    . DC  E 2 6   ? -48.500 36.100 9.827   0.44 150.30 ? 6   DC  E O2    1 
ATOM   3683 N N3    . DC  E 2 6   ? -48.810 34.848 7.963   0.44 154.91 ? 6   DC  E N3    1 
ATOM   3684 C C4    . DC  E 2 6   ? -49.460 34.686 6.808   0.44 153.25 ? 6   DC  E C4    1 
ATOM   3685 N N4    . DC  E 2 6   ? -49.158 33.618 6.064   0.44 153.82 ? 6   DC  E N4    1 
ATOM   3686 C C5    . DC  E 2 6   ? -50.449 35.611 6.364   0.44 149.02 ? 6   DC  E C5    1 
ATOM   3687 C C6    . DC  E 2 6   ? -50.710 36.662 7.152   0.44 144.67 ? 6   DC  E C6    1 
ATOM   3688 P P     . DT  E 2 7   ? -50.824 42.784 8.133   0.44 147.35 ? 7   DT  E P     1 
ATOM   3689 O OP1   . DT  E 2 7   ? -52.239 43.231 8.050   0.44 149.06 ? 7   DT  E OP1   1 
ATOM   3690 O OP2   . DT  E 2 7   ? -50.092 42.433 6.890   0.44 141.71 ? 7   DT  E OP2   1 
ATOM   3691 O "O5'" . DT  E 2 7   ? -49.981 43.886 8.916   0.44 139.97 ? 7   DT  E "O5'" 1 
ATOM   3692 C "C5'" . DT  E 2 7   ? -48.659 44.252 8.481   0.44 140.19 ? 7   DT  E "C5'" 1 
ATOM   3693 C "C4'" . DT  E 2 7   ? -47.628 43.364 9.137   0.44 149.21 ? 7   DT  E "C4'" 1 
ATOM   3694 O "O4'" . DT  E 2 7   ? -47.876 41.984 8.785   0.44 152.60 ? 7   DT  E "O4'" 1 
ATOM   3695 C "C3'" . DT  E 2 7   ? -46.178 43.661 8.740   0.44 156.22 ? 7   DT  E "C3'" 1 
ATOM   3696 O "O3'" . DT  E 2 7   ? -45.408 43.969 9.907   0.44 159.19 ? 7   DT  E "O3'" 1 
ATOM   3697 C "C2'" . DT  E 2 7   ? -45.694 42.384 8.068   0.44 154.75 ? 7   DT  E "C2'" 1 
ATOM   3698 C "C1'" . DT  E 2 7   ? -46.642 41.321 8.591   0.44 156.55 ? 7   DT  E "C1'" 1 
ATOM   3699 N N1    . DT  E 2 7   ? -46.874 40.201 7.658   0.44 164.95 ? 7   DT  E N1    1 
ATOM   3700 C C2    . DT  E 2 7   ? -46.374 38.960 7.984   0.44 163.84 ? 7   DT  E C2    1 
ATOM   3701 O O2    . DT  E 2 7   ? -45.744 38.743 9.007   0.44 162.66 ? 7   DT  E O2    1 
ATOM   3702 N N3    . DT  E 2 7   ? -46.637 37.977 7.061   0.44 158.71 ? 7   DT  E N3    1 
ATOM   3703 C C4    . DT  E 2 7   ? -47.339 38.109 5.877   0.44 159.24 ? 7   DT  E C4    1 
ATOM   3704 O O4    . DT  E 2 7   ? -47.500 37.134 5.148   0.44 155.43 ? 7   DT  E O4    1 
ATOM   3705 C C5    . DT  E 2 7   ? -47.836 39.438 5.600   0.44 161.31 ? 7   DT  E C5    1 
ATOM   3706 C C7    . DT  E 2 7   ? -48.606 39.677 4.340   0.44 161.57 ? 7   DT  E C7    1 
ATOM   3707 C C6    . DT  E 2 7   ? -47.582 40.404 6.493   0.44 164.06 ? 7   DT  E C6    1 
ATOM   3708 P P     . DG  E 2 8   ? -43.975 44.672 9.786   0.44 153.90 ? 8   DG  E P     1 
ATOM   3709 O OP1   . DG  E 2 8   ? -43.529 45.056 11.151  0.44 148.57 ? 8   DG  E OP1   1 
ATOM   3710 O OP2   . DG  E 2 8   ? -44.040 45.703 8.719   0.44 150.74 ? 8   DG  E OP2   1 
ATOM   3711 O "O5'" . DG  E 2 8   ? -43.065 43.472 9.268   0.44 147.97 ? 8   DG  E "O5'" 1 
ATOM   3712 C "C5'" . DG  E 2 8   ? -41.935 43.723 8.414   0.44 138.75 ? 8   DG  E "C5'" 1 
ATOM   3713 C "C4'" . DG  E 2 8   ? -41.368 42.420 7.904   0.44 130.63 ? 8   DG  E "C4'" 1 
ATOM   3714 O "O4'" . DG  E 2 8   ? -42.442 41.552 7.493   0.44 127.52 ? 8   DG  E "O4'" 1 
ATOM   3715 C "C3'" . DG  E 2 8   ? -40.483 42.557 6.669   0.44 129.50 ? 8   DG  E "C3'" 1 
ATOM   3716 O "O3'" . DG  E 2 8   ? -39.125 42.784 7.064   0.44 128.48 ? 8   DG  E "O3'" 1 
ATOM   3717 C "C2'" . DG  E 2 8   ? -40.677 41.235 5.939   0.44 126.26 ? 8   DG  E "C2'" 1 
ATOM   3718 C "C1'" . DG  E 2 8   ? -41.921 40.604 6.572   0.44 122.78 ? 8   DG  E "C1'" 1 
ATOM   3719 N N9    . DG  E 2 8   ? -42.986 40.254 5.635   0.44 116.25 ? 8   DG  E N9    1 
ATOM   3720 C C8    . DG  E 2 8   ? -44.137 40.962 5.385   0.44 110.40 ? 8   DG  E C8    1 
ATOM   3721 N N7    . DG  E 2 8   ? -44.910 40.390 4.503   0.44 105.57 ? 8   DG  E N7    1 
ATOM   3722 C C5    . DG  E 2 8   ? -44.231 39.230 4.151   0.44 107.27 ? 8   DG  E C5    1 
ATOM   3723 C C6    . DG  E 2 8   ? -44.579 38.202 3.235   0.44 100.36 ? 8   DG  E C6    1 
ATOM   3724 O O6    . DG  E 2 8   ? -45.589 38.109 2.527   0.44 94.68  ? 8   DG  E O6    1 
ATOM   3725 N N1    . DG  E 2 8   ? -43.606 37.209 3.189   0.44 103.43 ? 8   DG  E N1    1 
ATOM   3726 C C2    . DG  E 2 8   ? -42.447 37.202 3.926   0.44 111.36 ? 8   DG  E C2    1 
ATOM   3727 N N2    . DG  E 2 8   ? -41.633 36.152 3.739   0.44 110.41 ? 8   DG  E N2    1 
ATOM   3728 N N3    . DG  E 2 8   ? -42.111 38.154 4.783   0.44 112.25 ? 8   DG  E N3    1 
ATOM   3729 C C4    . DG  E 2 8   ? -43.043 39.130 4.845   0.44 113.34 ? 8   DG  E C4    1 
ATOM   3730 P P     . DT  E 2 9   ? -38.042 41.605 7.101   0.44 130.78 ? 9   DT  E P     1 
ATOM   3731 O OP1   . DT  E 2 9   ? -38.723 40.344 7.485   0.44 128.72 ? 9   DT  E OP1   1 
ATOM   3732 O OP2   . DT  E 2 9   ? -36.876 42.080 7.895   0.44 123.87 ? 9   DT  E OP2   1 
ATOM   3733 O "O5'" . DT  E 2 9   ? -37.615 41.485 5.572   0.44 124.46 ? 9   DT  E "O5'" 1 
ATOM   3734 C "C5'" . DT  E 2 9   ? -36.333 40.942 5.203   0.44 127.43 ? 9   DT  E "C5'" 1 
ATOM   3735 C "C4'" . DT  E 2 9   ? -36.409 39.435 5.121   0.44 123.26 ? 9   DT  E "C4'" 1 
ATOM   3736 O "O4'" . DT  E 2 9   ? -37.762 39.036 4.799   0.44 119.17 ? 9   DT  E "O4'" 1 
ATOM   3737 C "C3'" . DT  E 2 9   ? -35.518 38.812 4.047   0.44 123.96 ? 9   DT  E "C3'" 1 
ATOM   3738 O "O3'" . DT  E 2 9   ? -34.986 37.572 4.519   0.44 125.67 ? 9   DT  E "O3'" 1 
ATOM   3739 C "C2'" . DT  E 2 9   ? -36.473 38.575 2.891   0.44 123.52 ? 9   DT  E "C2'" 1 
ATOM   3740 C "C1'" . DT  E 2 9   ? -37.776 38.265 3.605   0.44 117.59 ? 9   DT  E "C1'" 1 
ATOM   3741 N N1    . DT  E 2 9   ? -38.987 38.629 2.850   0.44 108.42 ? 9   DT  E N1    1 
ATOM   3742 C C2    . DT  E 2 9   ? -39.582 37.666 2.068   0.44 111.16 ? 9   DT  E C2    1 
ATOM   3743 O O2    . DT  E 2 9   ? -39.149 36.530 1.963   0.44 116.52 ? 9   DT  E O2    1 
ATOM   3744 N N3    . DT  E 2 9   ? -40.712 38.085 1.408   0.44 104.67 ? 9   DT  E N3    1 
ATOM   3745 C C4    . DT  E 2 9   ? -41.290 39.340 1.454   0.44 105.92 ? 9   DT  E C4    1 
ATOM   3746 O O4    . DT  E 2 9   ? -42.307 39.570 0.804   0.44 100.54 ? 9   DT  E O4    1 
ATOM   3747 C C5    . DT  E 2 9   ? -40.611 40.300 2.295   0.44 106.07 ? 9   DT  E C5    1 
ATOM   3748 C C7    . DT  E 2 9   ? -41.161 41.687 2.406   0.44 99.54  ? 9   DT  E C7    1 
ATOM   3749 C C6    . DT  E 2 9   ? -39.510 39.900 2.944   0.44 107.26 ? 9   DT  E C6    1 
ATOM   3750 P P     . DA  E 2 10  ? -33.859 36.821 3.674   0.44 124.82 ? 10  DA  E P     1 
ATOM   3751 O OP1   . DA  E 2 10  ? -33.161 35.868 4.580   0.44 112.50 ? 10  DA  E OP1   1 
ATOM   3752 O OP2   . DA  E 2 10  ? -33.083 37.853 2.939   0.44 113.85 ? 10  DA  E OP2   1 
ATOM   3753 O "O5'" . DA  E 2 10  ? -34.714 35.975 2.629   0.44 125.51 ? 10  DA  E "O5'" 1 
ATOM   3754 C "C5'" . DA  E 2 10  ? -34.072 35.056 1.723   0.44 122.49 ? 10  DA  E "C5'" 1 
ATOM   3755 C "C4'" . DA  E 2 10  ? -34.146 35.588 0.311   0.44 120.90 ? 10  DA  E "C4'" 1 
ATOM   3756 O "O4'" . DA  E 2 10  ? -35.434 36.199 0.096   0.44 122.89 ? 10  DA  E "O4'" 1 
ATOM   3757 C "C3'" . DA  E 2 10  ? -33.131 36.684 -0.014  0.44 116.73 ? 10  DA  E "C3'" 1 
ATOM   3758 O "O3'" . DA  E 2 10  ? -31.947 36.135 -0.610  0.44 109.94 ? 10  DA  E "O3'" 1 
ATOM   3759 C "C2'" . DA  E 2 10  ? -33.873 37.603 -0.977  0.44 113.01 ? 10  DA  E "C2'" 1 
ATOM   3760 C "C1'" . DA  E 2 10  ? -35.315 37.094 -0.995  0.44 110.64 ? 10  DA  E "C1'" 1 
ATOM   3761 N N9    . DA  E 2 10  ? -36.334 38.132 -0.835  0.44 99.85  ? 10  DA  E N9    1 
ATOM   3762 C C8    . DA  E 2 10  ? -36.215 39.328 -0.172  0.44 98.68  ? 10  DA  E C8    1 
ATOM   3763 N N7    . DA  E 2 10  ? -37.304 40.057 -0.197  0.44 95.53  ? 10  DA  E N7    1 
ATOM   3764 C C5    . DA  E 2 10  ? -38.201 39.291 -0.926  0.44 91.30  ? 10  DA  E C5    1 
ATOM   3765 C C6    . DA  E 2 10  ? -39.538 39.506 -1.307  0.44 88.62  ? 10  DA  E C6    1 
ATOM   3766 N N6    . DA  E 2 10  ? -40.230 40.603 -0.993  0.44 77.45  ? 10  DA  E N6    1 
ATOM   3767 N N1    . DA  E 2 10  ? -40.148 38.542 -2.032  0.44 90.64  ? 10  DA  E N1    1 
ATOM   3768 C C2    . DA  E 2 10  ? -39.452 37.442 -2.348  0.44 99.37  ? 10  DA  E C2    1 
ATOM   3769 N N3    . DA  E 2 10  ? -38.193 37.125 -2.047  0.44 101.97 ? 10  DA  E N3    1 
ATOM   3770 C C4    . DA  E 2 10  ? -37.617 38.102 -1.326  0.44 96.33  ? 10  DA  E C4    1 
ATOM   3771 P P     . DC  E 2 11  ? -31.964 34.785 -1.470  0.44 115.01 ? 11  DC  E P     1 
ATOM   3772 O OP1   . DC  E 2 11  ? -32.214 33.644 -0.553  0.44 115.69 ? 11  DC  E OP1   1 
ATOM   3773 O OP2   . DC  E 2 11  ? -30.753 34.781 -2.329  0.44 109.35 ? 11  DC  E OP2   1 
ATOM   3774 O "O5'" . DC  E 2 11  ? -33.238 34.944 -2.416  0.44 121.58 ? 11  DC  E "O5'" 1 
ATOM   3775 C "C5'" . DC  E 2 11  ? -33.827 33.795 -3.059  0.44 119.86 ? 11  DC  E "C5'" 1 
ATOM   3776 C "C4'" . DC  E 2 11  ? -34.470 34.185 -4.371  0.44 114.40 ? 11  DC  E "C4'" 1 
ATOM   3777 O "O4'" . DC  E 2 11  ? -35.365 35.300 -4.165  0.44 111.98 ? 11  DC  E "O4'" 1 
ATOM   3778 C "C3'" . DC  E 2 11  ? -33.498 34.604 -5.482  0.44 108.10 ? 11  DC  E "C3'" 1 
ATOM   3779 O "O3'" . DC  E 2 11  ? -33.696 33.780 -6.636  0.44 110.12 ? 11  DC  E "O3'" 1 
ATOM   3780 C "C2'" . DC  E 2 11  ? -33.874 36.046 -5.786  0.44 106.53 ? 11  DC  E "C2'" 1 
ATOM   3781 C "C1'" . DC  E 2 11  ? -35.310 36.135 -5.303  0.44 106.62 ? 11  DC  E "C1'" 1 
ATOM   3782 N N1    . DC  E 2 11  ? -35.752 37.479 -4.898  0.44 98.06  ? 11  DC  E N1    1 
ATOM   3783 C C2    . DC  E 2 11  ? -37.120 37.761 -4.890  0.44 97.55  ? 11  DC  E C2    1 
ATOM   3784 O O2    . DC  E 2 11  ? -37.916 36.872 -5.227  0.44 96.50  ? 11  DC  E O2    1 
ATOM   3785 N N3    . DC  E 2 11  ? -37.539 38.993 -4.521  0.44 95.93  ? 11  DC  E N3    1 
ATOM   3786 C C4    . DC  E 2 11  ? -36.648 39.922 -4.169  0.44 100.17 ? 11  DC  E C4    1 
ATOM   3787 N N4    . DC  E 2 11  ? -37.107 41.125 -3.812  0.44 102.60 ? 11  DC  E N4    1 
ATOM   3788 C C5    . DC  E 2 11  ? -35.247 39.662 -4.171  0.44 90.72  ? 11  DC  E C5    1 
ATOM   3789 C C6    . DC  E 2 11  ? -34.847 38.438 -4.538  0.44 90.48  ? 11  DC  E C6    1 
ATOM   3790 P P     . DG  E 2 12  ? -32.535 33.478 -7.707  0.44 112.89 ? 12  DG  E P     1 
ATOM   3791 O OP1   . DG  E 2 12  ? -31.839 32.223 -7.325  0.44 105.99 ? 12  DG  E OP1   1 
ATOM   3792 O OP2   . DG  E 2 12  ? -31.745 34.718 -7.926  0.44 107.29 ? 12  DG  E OP2   1 
ATOM   3793 O "O5'" . DG  E 2 12  ? -33.400 33.181 -9.013  0.44 110.69 ? 12  DG  E "O5'" 1 
ATOM   3794 C "C5'" . DG  E 2 12  ? -32.787 32.687 -10.219 0.44 108.38 ? 12  DG  E "C5'" 1 
ATOM   3795 C "C4'" . DG  E 2 12  ? -33.037 33.645 -11.360 0.44 110.79 ? 12  DG  E "C4'" 1 
ATOM   3796 O "O4'" . DG  E 2 12  ? -34.072 34.575 -10.979 0.44 111.36 ? 12  DG  E "O4'" 1 
ATOM   3797 C "C3'" . DG  E 2 12  ? -31.838 34.515 -11.730 0.44 114.76 ? 12  DG  E "C3'" 1 
ATOM   3798 O "O3'" . DG  E 2 12  ? -31.042 33.902 -12.753 0.44 112.48 ? 12  DG  E "O3'" 1 
ATOM   3799 C "C2'" . DG  E 2 12  ? -32.472 35.797 -12.245 0.44 110.86 ? 12  DG  E "C2'" 1 
ATOM   3800 C "C1'" . DG  E 2 12  ? -33.898 35.791 -11.694 0.44 108.64 ? 12  DG  E "C1'" 1 
ATOM   3801 N N9    . DG  E 2 12  ? -34.179 36.895 -10.781 0.44 101.71 ? 12  DG  E N9    1 
ATOM   3802 C C8    . DG  E 2 12  ? -33.708 37.056 -9.501  0.44 97.06  ? 12  DG  E C8    1 
ATOM   3803 N N7    . DG  E 2 12  ? -34.124 38.157 -8.936  0.44 97.86  ? 12  DG  E N7    1 
ATOM   3804 C C5    . DG  E 2 12  ? -34.913 38.763 -9.905  0.44 98.25  ? 12  DG  E C5    1 
ATOM   3805 C C6    . DG  E 2 12  ? -35.636 39.984 -9.872  0.44 97.57  ? 12  DG  E C6    1 
ATOM   3806 O O6    . DG  E 2 12  ? -35.730 40.801 -8.946  0.44 94.13  ? 12  DG  E O6    1 
ATOM   3807 N N1    . DG  E 2 12  ? -36.301 40.216 -11.071 0.44 96.31  ? 12  DG  E N1    1 
ATOM   3808 C C2    . DG  E 2 12  ? -36.280 39.382 -12.161 0.44 91.04  ? 12  DG  E C2    1 
ATOM   3809 N N2    . DG  E 2 12  ? -36.990 39.781 -13.226 0.44 93.18  ? 12  DG  E N2    1 
ATOM   3810 N N3    . DG  E 2 12  ? -35.613 38.241 -12.204 0.44 93.39  ? 12  DG  E N3    1 
ATOM   3811 C C4    . DG  E 2 12  ? -34.956 37.997 -11.051 0.44 98.14  ? 12  DG  E C4    1 
ATOM   3812 P P     . DT  E 2 13  ? -31.651 33.523 -14.188 0.44 115.60 ? 13  DT  E P     1 
ATOM   3813 O OP1   . DT  E 2 13  ? -33.088 33.900 -14.242 0.44 120.17 ? 13  DT  E OP1   1 
ATOM   3814 O OP2   . DT  E 2 13  ? -31.255 32.121 -14.478 0.44 119.34 ? 13  DT  E OP2   1 
ATOM   3815 O "O5'" . DT  E 2 13  ? -30.865 34.478 -15.193 0.44 107.52 ? 13  DT  E "O5'" 1 
ATOM   3816 C "C5'" . DT  E 2 13  ? -31.024 35.907 -15.139 0.44 101.74 ? 13  DT  E "C5'" 1 
ATOM   3817 C "C4'" . DT  E 2 13  ? -32.196 36.340 -15.988 0.44 92.06  ? 13  DT  E "C4'" 1 
ATOM   3818 O "O4'" . DT  E 2 13  ? -33.157 37.034 -15.158 0.44 85.34  ? 13  DT  E "O4'" 1 
ATOM   3819 C "C3'" . DT  E 2 13  ? -31.832 37.306 -17.114 0.44 90.35  ? 13  DT  E "C3'" 1 
ATOM   3820 O "O3'" . DT  E 2 13  ? -32.568 37.034 -18.311 0.44 92.50  ? 13  DT  E "O3'" 1 
ATOM   3821 C "C2'" . DT  E 2 13  ? -32.153 38.673 -16.535 0.44 86.47  ? 13  DT  E "C2'" 1 
ATOM   3822 C "C1'" . DT  E 2 13  ? -33.249 38.405 -15.514 0.44 75.49  ? 13  DT  E "C1'" 1 
ATOM   3823 N N1    . DT  E 2 13  ? -33.112 39.202 -14.279 0.44 68.71  ? 13  DT  E N1    1 
ATOM   3824 C C2    . DT  E 2 13  ? -33.823 40.378 -14.183 0.44 71.85  ? 13  DT  E C2    1 
ATOM   3825 O O2    . DT  E 2 13  ? -34.572 40.780 -15.060 0.44 71.96  ? 13  DT  E O2    1 
ATOM   3826 N N3    . DT  E 2 13  ? -33.632 41.065 -13.010 0.44 72.43  ? 13  DT  E N3    1 
ATOM   3827 C C4    . DT  E 2 13  ? -32.817 40.706 -11.951 0.44 75.58  ? 13  DT  E C4    1 
ATOM   3828 O O4    . DT  E 2 13  ? -32.749 41.428 -10.958 0.44 79.30  ? 13  DT  E O4    1 
ATOM   3829 C C5    . DT  E 2 13  ? -32.093 39.467 -12.124 0.44 70.93  ? 13  DT  E C5    1 
ATOM   3830 C C7    . DT  E 2 13  ? -31.176 39.004 -11.033 0.44 64.80  ? 13  DT  E C7    1 
ATOM   3831 C C6    . DT  E 2 13  ? -32.276 38.785 -13.264 0.44 65.40  ? 13  DT  E C6    1 
ATOM   3832 P P     . DG  E 2 14  ? -31.832 37.381 -19.695 0.44 97.77  ? 14  DG  E P     1 
ATOM   3833 O OP1   . DG  E 2 14  ? -32.471 36.617 -20.802 0.44 95.11  ? 14  DG  E OP1   1 
ATOM   3834 O OP2   . DG  E 2 14  ? -30.370 37.248 -19.465 0.44 88.87  ? 14  DG  E OP2   1 
ATOM   3835 O "O5'" . DG  E 2 14  ? -32.155 38.929 -19.896 0.44 86.24  ? 14  DG  E "O5'" 1 
ATOM   3836 C "C5'" . DG  E 2 14  ? -33.166 39.358 -20.822 0.44 81.90  ? 14  DG  E "C5'" 1 
ATOM   3837 C "C4'" . DG  E 2 14  ? -33.414 40.839 -20.665 0.44 88.57  ? 14  DG  E "C4'" 1 
ATOM   3838 O "O4'" . DG  E 2 14  ? -33.278 41.223 -19.276 0.44 92.43  ? 14  DG  E "O4'" 1 
ATOM   3839 C "C3'" . DG  E 2 14  ? -32.458 41.736 -21.454 0.44 88.66  ? 14  DG  E "C3'" 1 
ATOM   3840 O "O3'" . DG  E 2 14  ? -33.233 42.671 -22.210 0.44 87.84  ? 14  DG  E "O3'" 1 
ATOM   3841 C "C2'" . DG  E 2 14  ? -31.612 42.412 -20.386 0.44 83.24  ? 14  DG  E "C2'" 1 
ATOM   3842 C "C1'" . DG  E 2 14  ? -32.538 42.427 -19.185 0.44 86.05  ? 14  DG  E "C1'" 1 
ATOM   3843 N N9    . DG  E 2 14  ? -31.856 42.435 -17.893 0.44 85.41  ? 14  DG  E N9    1 
ATOM   3844 C C8    . DG  E 2 14  ? -30.802 41.638 -17.516 0.44 78.03  ? 14  DG  E C8    1 
ATOM   3845 N N7    . DG  E 2 14  ? -30.398 41.867 -16.296 0.44 83.87  ? 14  DG  E N7    1 
ATOM   3846 C C5    . DG  E 2 14  ? -31.241 42.871 -15.836 0.44 87.47  ? 14  DG  E C5    1 
ATOM   3847 C C6    . DG  E 2 14  ? -31.286 43.531 -14.577 0.44 89.05  ? 14  DG  E C6    1 
ATOM   3848 O O6    . DG  E 2 14  ? -30.567 43.352 -13.586 0.44 91.20  ? 14  DG  E O6    1 
ATOM   3849 N N1    . DG  E 2 14  ? -32.300 44.483 -14.535 0.44 84.22  ? 14  DG  E N1    1 
ATOM   3850 C C2    . DG  E 2 14  ? -33.160 44.766 -15.566 0.44 90.24  ? 14  DG  E C2    1 
ATOM   3851 N N2    . DG  E 2 14  ? -34.075 45.719 -15.326 0.44 90.16  ? 14  DG  E N2    1 
ATOM   3852 N N3    . DG  E 2 14  ? -33.127 44.161 -16.745 0.44 93.07  ? 14  DG  E N3    1 
ATOM   3853 C C4    . DG  E 2 14  ? -32.150 43.231 -16.809 0.44 88.71  ? 14  DG  E C4    1 
ATOM   3854 P P     . DA  E 2 15  ? -32.494 43.658 -23.215 0.44 90.15  ? 15  DA  E P     1 
ATOM   3855 O OP1   . DA  E 2 15  ? -33.459 44.683 -23.684 0.44 93.29  ? 15  DA  E OP1   1 
ATOM   3856 O OP2   . DA  E 2 15  ? -31.722 42.858 -24.201 0.44 99.62  ? 15  DA  E OP2   1 
ATOM   3857 O "O5'" . DA  E 2 15  ? -31.440 44.384 -22.271 0.44 95.78  ? 15  DA  E "O5'" 1 
ATOM   3858 C "C5'" . DA  E 2 15  ? -31.153 45.782 -22.441 0.44 96.18  ? 15  DA  E "C5'" 1 
ATOM   3859 C "C4'" . DA  E 2 15  ? -32.154 46.615 -21.677 0.44 96.19  ? 15  DA  E "C4'" 1 
ATOM   3860 O "O4'" . DA  E 2 15  ? -32.280 46.099 -20.330 0.44 93.75  ? 15  DA  E "O4'" 1 
ATOM   3861 C "C3'" . DA  E 2 15  ? -31.746 48.078 -21.521 0.44 95.33  ? 15  DA  E "C3'" 1 
ATOM   3862 O "O3'" . DA  E 2 15  ? -32.890 48.925 -21.427 0.44 91.63  ? 15  DA  E "O3'" 1 
ATOM   3863 C "C2'" . DA  E 2 15  ? -30.983 48.082 -20.210 0.44 96.59  ? 15  DA  E "C2'" 1 
ATOM   3864 C "C1'" . DA  E 2 15  ? -31.689 47.002 -19.398 0.44 95.43  ? 15  DA  E "C1'" 1 
ATOM   3865 N N9    . DA  E 2 15  ? -30.804 46.233 -18.521 0.44 90.78  ? 15  DA  E N9    1 
ATOM   3866 C C8    . DA  E 2 15  ? -30.131 45.067 -18.794 0.44 87.44  ? 15  DA  E C8    1 
ATOM   3867 N N7    . DA  E 2 15  ? -29.415 44.623 -17.790 0.44 82.13  ? 15  DA  E N7    1 
ATOM   3868 C C5    . DA  E 2 15  ? -29.627 45.562 -16.788 0.44 88.81  ? 15  DA  E C5    1 
ATOM   3869 C C6    . DA  E 2 15  ? -29.150 45.665 -15.469 0.44 90.12  ? 15  DA  E C6    1 
ATOM   3870 N N6    . DA  E 2 15  ? -28.320 44.781 -14.909 0.44 89.13  ? 15  DA  E N6    1 
ATOM   3871 N N1    . DA  E 2 15  ? -29.553 46.727 -14.736 0.44 85.87  ? 15  DA  E N1    1 
ATOM   3872 C C2    . DA  E 2 15  ? -30.380 47.617 -15.298 0.44 86.07  ? 15  DA  E C2    1 
ATOM   3873 N N3    . DA  E 2 15  ? -30.896 47.630 -16.525 0.44 88.47  ? 15  DA  E N3    1 
ATOM   3874 C C4    . DA  E 2 15  ? -30.477 46.562 -17.227 0.44 90.78  ? 15  DA  E C4    1 
ATOM   3875 P P     . DG  E 2 16  ? -32.750 50.346 -22.116 0.44 95.71  ? 16  DG  E P     1 
ATOM   3876 O OP1   . DG  E 2 16  ? -34.041 51.076 -22.011 0.44 99.73  ? 16  DG  E OP1   1 
ATOM   3877 O OP2   . DG  E 2 16  ? -32.159 50.089 -23.456 0.44 93.39  ? 16  DG  E OP2   1 
ATOM   3878 O "O5'" . DG  E 2 16  ? -31.701 51.066 -21.154 0.44 89.37  ? 16  DG  E "O5'" 1 
ATOM   3879 C "C5'" . DG  E 2 16  ? -32.121 51.664 -19.912 0.44 79.24  ? 16  DG  E "C5'" 1 
ATOM   3880 C "C4'" . DG  E 2 16  ? -30.929 52.104 -19.093 0.44 84.69  ? 16  DG  E "C4'" 1 
ATOM   3881 O "O4'" . DG  E 2 16  ? -30.316 50.963 -18.449 0.44 85.84  ? 16  DG  E "O4'" 1 
ATOM   3882 C "C3'" . DG  E 2 16  ? -29.810 52.803 -19.877 0.44 87.30  ? 16  DG  E "C3'" 1 
ATOM   3883 O "O3'" . DG  E 2 16  ? -29.436 54.029 -19.251 0.44 85.69  ? 16  DG  E "O3'" 1 
ATOM   3884 C "C2'" . DG  E 2 16  ? -28.627 51.858 -19.763 0.44 84.63  ? 16  DG  E "C2'" 1 
ATOM   3885 C "C1'" . DG  E 2 16  ? -28.914 51.139 -18.464 0.44 82.70  ? 16  DG  E "C1'" 1 
ATOM   3886 N N9    . DG  E 2 16  ? -28.298 49.823 -18.377 0.44 81.49  ? 16  DG  E N9    1 
ATOM   3887 C C8    . DG  E 2 16  ? -28.181 48.898 -19.385 0.44 85.45  ? 16  DG  E C8    1 
ATOM   3888 N N7    . DG  E 2 16  ? -27.575 47.804 -19.010 0.44 86.25  ? 16  DG  E N7    1 
ATOM   3889 C C5    . DG  E 2 16  ? -27.270 48.022 -17.674 0.44 83.15  ? 16  DG  E C5    1 
ATOM   3890 C C6    . DG  E 2 16  ? -26.604 47.192 -16.737 0.44 84.83  ? 16  DG  E C6    1 
ATOM   3891 O O6    . DG  E 2 16  ? -26.142 46.056 -16.905 0.44 83.49  ? 16  DG  E O6    1 
ATOM   3892 N N1    . DG  E 2 16  ? -26.499 47.807 -15.494 0.44 85.48  ? 16  DG  E N1    1 
ATOM   3893 C C2    . DG  E 2 16  ? -26.969 49.061 -15.190 0.44 86.36  ? 16  DG  E C2    1 
ATOM   3894 N N2    . DG  E 2 16  ? -26.774 49.476 -13.930 0.44 85.73  ? 16  DG  E N2    1 
ATOM   3895 N N3    . DG  E 2 16  ? -27.587 49.848 -16.055 0.44 86.53  ? 16  DG  E N3    1 
ATOM   3896 C C4    . DG  E 2 16  ? -27.706 49.266 -17.269 0.44 85.51  ? 16  DG  E C4    1 
ATOM   3897 P P     . DC  E 2 17  ? -28.814 55.175 -20.160 0.44 90.65  ? 17  DC  E P     1 
ATOM   3898 O OP1   . DC  E 2 17  ? -29.825 56.255 -20.292 0.44 92.32  ? 17  DC  E OP1   1 
ATOM   3899 O OP2   . DC  E 2 17  ? -28.240 54.546 -21.374 0.44 94.92  ? 17  DC  E OP2   1 
ATOM   3900 O "O5'" . DC  E 2 17  ? -27.580 55.711 -19.313 0.44 107.23 ? 17  DC  E "O5'" 1 
ATOM   3901 C "C5'" . DC  E 2 17  ? -26.282 55.105 -19.454 0.44 117.49 ? 17  DC  E "C5'" 1 
ATOM   3902 C "C4'" . DC  E 2 17  ? -25.894 54.422 -18.164 0.44 119.08 ? 17  DC  E "C4'" 1 
ATOM   3903 O "O4'" . DC  E 2 17  ? -26.030 52.994 -18.304 0.44 121.98 ? 17  DC  E "O4'" 1 
ATOM   3904 C "C3'" . DC  E 2 17  ? -24.452 54.663 -17.710 0.44 114.00 ? 17  DC  E "C3'" 1 
ATOM   3905 O "O3'" . DC  E 2 17  ? -24.430 55.601 -16.630 0.44 107.59 ? 17  DC  E "O3'" 1 
ATOM   3906 C "C2'" . DC  E 2 17  ? -23.971 53.303 -17.224 0.44 116.32 ? 17  DC  E "C2'" 1 
ATOM   3907 C "C1'" . DC  E 2 17  ? -25.176 52.381 -17.361 0.44 115.60 ? 17  DC  E "C1'" 1 
ATOM   3908 N N1    . DC  E 2 17  ? -24.838 51.044 -17.860 0.44 107.22 ? 17  DC  E N1    1 
ATOM   3909 C C2    . DC  E 2 17  ? -24.528 50.042 -16.938 0.44 103.44 ? 17  DC  E C2    1 
ATOM   3910 O O2    . DC  E 2 17  ? -24.561 50.312 -15.729 0.44 98.42  ? 17  DC  E O2    1 
ATOM   3911 N N3    . DC  E 2 17  ? -24.205 48.807 -17.387 0.44 106.26 ? 17  DC  E N3    1 
ATOM   3912 C C4    . DC  E 2 17  ? -24.182 48.560 -18.700 0.44 110.20 ? 17  DC  E C4    1 
ATOM   3913 N N4    . DC  E 2 17  ? -23.858 47.329 -19.099 0.44 110.01 ? 17  DC  E N4    1 
ATOM   3914 C C5    . DC  E 2 17  ? -24.490 49.565 -19.661 0.44 111.76 ? 17  DC  E C5    1 
ATOM   3915 C C6    . DC  E 2 17  ? -24.807 50.782 -19.202 0.44 108.55 ? 17  DC  E C6    1 
ATOM   3916 P P     . DA  E 2 18  ? -23.813 57.063 -16.836 0.44 105.00 ? 18  DA  E P     1 
ATOM   3917 O OP1   . DA  E 2 18  ? -24.680 58.063 -16.157 0.44 100.56 ? 18  DA  E OP1   1 
ATOM   3918 O OP2   . DA  E 2 18  ? -23.500 57.219 -18.282 0.44 102.40 ? 18  DA  E OP2   1 
ATOM   3919 O "O5'" . DA  E 2 18  ? -22.443 56.983 -16.028 0.44 99.86  ? 18  DA  E "O5'" 1 
ATOM   3920 C "C5'" . DA  E 2 18  ? -22.425 56.747 -14.611 0.44 96.88  ? 18  DA  E "C5'" 1 
ATOM   3921 C "C4'" . DA  E 2 18  ? -21.118 56.102 -14.212 0.44 97.49  ? 18  DA  E "C4'" 1 
ATOM   3922 O "O4'" . DA  E 2 18  ? -21.113 54.730 -14.675 0.44 98.48  ? 18  DA  E "O4'" 1 
ATOM   3923 C "C3'" . DA  E 2 18  ? -19.866 56.744 -14.814 0.44 98.17  ? 18  DA  E "C3'" 1 
ATOM   3924 O "O3'" . DA  E 2 18  ? -18.750 56.567 -13.934 0.44 98.50  ? 18  DA  E "O3'" 1 
ATOM   3925 C "C2'" . DA  E 2 18  ? -19.607 55.886 -16.037 0.44 101.51 ? 18  DA  E "C2'" 1 
ATOM   3926 C "C1'" . DA  E 2 18  ? -19.980 54.516 -15.504 0.44 100.30 ? 18  DA  E "C1'" 1 
ATOM   3927 N N9    . DA  E 2 18  ? -20.346 53.537 -16.526 0.44 97.78  ? 18  DA  E N9    1 
ATOM   3928 C C8    . DA  E 2 18  ? -20.927 53.768 -17.749 0.44 101.31 ? 18  DA  E C8    1 
ATOM   3929 N N7    . DA  E 2 18  ? -21.130 52.680 -18.452 0.44 102.69 ? 18  DA  E N7    1 
ATOM   3930 C C5    . DA  E 2 18  ? -20.652 51.663 -17.637 0.44 98.51  ? 18  DA  E C5    1 
ATOM   3931 C C6    . DA  E 2 18  ? -20.579 50.269 -17.807 0.44 100.23 ? 18  DA  E C6    1 
ATOM   3932 N N6    . DA  E 2 18  ? -21.010 49.632 -18.899 0.44 95.18  ? 18  DA  E N6    1 
ATOM   3933 N N1    . DA  E 2 18  ? -20.040 49.541 -16.804 0.44 100.95 ? 18  DA  E N1    1 
ATOM   3934 C C2    . DA  E 2 18  ? -19.606 50.182 -15.711 0.44 96.88  ? 18  DA  E C2    1 
ATOM   3935 N N3    . DA  E 2 18  ? -19.620 51.483 -15.434 0.44 88.25  ? 18  DA  E N3    1 
ATOM   3936 C C4    . DA  E 2 18  ? -20.163 52.177 -16.449 0.44 95.64  ? 18  DA  E C4    1 
ATOM   3937 P P     . DG  E 2 19  ? -17.761 57.752 -13.520 0.44 94.22  ? 19  DG  E P     1 
ATOM   3938 O OP1   . DG  E 2 19  ? -17.197 57.424 -12.186 0.44 92.01  ? 19  DG  E OP1   1 
ATOM   3939 O OP2   . DG  E 2 19  ? -18.480 59.037 -13.724 0.44 98.78  ? 19  DG  E OP2   1 
ATOM   3940 O "O5'" . DG  E 2 19  ? -16.567 57.695 -14.571 0.44 98.53  ? 19  DG  E "O5'" 1 
ATOM   3941 C "C5'" . DG  E 2 19  ? -16.461 56.625 -15.525 0.44 104.27 ? 19  DG  E "C5'" 1 
ATOM   3942 C "C4'" . DG  E 2 19  ? -15.839 55.411 -14.876 0.44 107.37 ? 19  DG  E "C4'" 1 
ATOM   3943 O "O4'" . DG  E 2 19  ? -16.769 54.308 -14.960 0.44 106.13 ? 19  DG  E "O4'" 1 
ATOM   3944 C "C3'" . DG  E 2 19  ? -14.534 54.937 -15.522 0.44 109.90 ? 19  DG  E "C3'" 1 
ATOM   3945 O "O3'" . DG  E 2 19  ? -13.444 55.301 -14.666 0.44 109.31 ? 19  DG  E "O3'" 1 
ATOM   3946 C "C2'" . DG  E 2 19  ? -14.667 53.424 -15.564 0.44 108.71 ? 19  DG  E "C2'" 1 
ATOM   3947 C "C1'" . DG  E 2 19  ? -16.167 53.179 -15.570 0.44 107.03 ? 19  DG  E "C1'" 1 
ATOM   3948 N N9    . DG  E 2 19  ? -16.755 53.020 -16.895 0.44 105.90 ? 19  DG  E N9    1 
ATOM   3949 C C8    . DG  E 2 19  ? -17.426 53.969 -17.628 0.44 103.22 ? 19  DG  E C8    1 
ATOM   3950 N N7    . DG  E 2 19  ? -17.843 53.524 -18.783 0.44 105.65 ? 19  DG  E N7    1 
ATOM   3951 C C5    . DG  E 2 19  ? -17.423 52.201 -18.812 0.44 108.29 ? 19  DG  E C5    1 
ATOM   3952 C C6    . DG  E 2 19  ? -17.584 51.206 -19.813 0.44 107.77 ? 19  DG  E C6    1 
ATOM   3953 O O6    . DG  E 2 19  ? -18.150 51.298 -20.910 0.44 114.28 ? 19  DG  E O6    1 
ATOM   3954 N N1    . DG  E 2 19  ? -17.002 50.001 -19.432 0.44 106.99 ? 19  DG  E N1    1 
ATOM   3955 C C2    . DG  E 2 19  ? -16.351 49.779 -18.244 0.44 110.29 ? 19  DG  E C2    1 
ATOM   3956 N N2    . DG  E 2 19  ? -15.854 48.546 -18.062 0.44 113.98 ? 19  DG  E N2    1 
ATOM   3957 N N3    . DG  E 2 19  ? -16.196 50.696 -17.304 0.44 110.41 ? 19  DG  E N3    1 
ATOM   3958 C C4    . DG  E 2 19  ? -16.753 51.875 -17.652 0.44 107.22 ? 19  DG  E C4    1 
ATOM   3959 P P     . DT  E 2 20  ? -11.912 55.323 -15.129 0.44 105.58 ? 20  DT  E P     1 
ATOM   3960 O OP1   . DT  E 2 20  ? -11.084 55.463 -13.900 0.44 106.96 ? 20  DT  E OP1   1 
ATOM   3961 O OP2   . DT  E 2 20  ? -11.775 56.313 -16.228 0.44 96.75  ? 20  DT  E OP2   1 
ATOM   3962 O "O5'" . DT  E 2 20  ? -11.656 53.875 -15.738 0.44 109.04 ? 20  DT  E "O5'" 1 
ATOM   3963 C "C5'" . DT  E 2 20  ? -11.337 52.748 -14.897 0.44 110.71 ? 20  DT  E "C5'" 1 
ATOM   3964 C "C4'" . DT  E 2 20  ? -11.009 51.545 -15.752 0.44 115.91 ? 20  DT  E "C4'" 1 
ATOM   3965 O "O4'" . DT  E 2 20  ? -12.113 51.271 -16.650 0.44 115.75 ? 20  DT  E "O4'" 1 
ATOM   3966 C "C3'" . DT  E 2 20  ? -9.765  51.707 -16.633 0.44 119.41 ? 20  DT  E "C3'" 1 
ATOM   3967 O "O3'" . DT  E 2 20  ? -8.896  50.574 -16.524 0.44 126.26 ? 20  DT  E "O3'" 1 
ATOM   3968 C "C2'" . DT  E 2 20  ? -10.320 51.814 -18.042 0.44 116.02 ? 20  DT  E "C2'" 1 
ATOM   3969 C "C1'" . DT  E 2 20  ? -11.611 51.026 -17.953 0.44 111.98 ? 20  DT  E "C1'" 1 
ATOM   3970 N N1    . DT  E 2 20  ? -12.633 51.457 -18.926 0.44 104.66 ? 20  DT  E N1    1 
ATOM   3971 C C2    . DT  E 2 20  ? -13.024 50.560 -19.892 0.44 101.27 ? 20  DT  E C2    1 
ATOM   3972 O O2    . DT  E 2 20  ? -12.580 49.427 -19.967 0.44 106.45 ? 20  DT  E O2    1 
ATOM   3973 N N3    . DT  E 2 20  ? -13.967 51.039 -20.768 0.44 101.02 ? 20  DT  E N3    1 
ATOM   3974 C C4    . DT  E 2 20  ? -14.533 52.299 -20.779 0.44 102.54 ? 20  DT  E C4    1 
ATOM   3975 O O4    . DT  E 2 20  ? -15.369 52.588 -21.632 0.44 104.24 ? 20  DT  E O4    1 
ATOM   3976 C C5    . DT  E 2 20  ? -14.067 53.193 -19.743 0.44 104.56 ? 20  DT  E C5    1 
ATOM   3977 C C7    . DT  E 2 20  ? -14.623 54.580 -19.677 0.44 106.70 ? 20  DT  E C7    1 
ATOM   3978 C C6    . DT  E 2 20  ? -13.150 52.734 -18.883 0.44 103.09 ? 20  DT  E C6    1 
ATOM   3979 P P     . DG  E 2 21  ? -7.488  50.548 -17.295 0.44 125.86 ? 21  DG  E P     1 
ATOM   3980 O OP1   . DG  E 2 21  ? -6.633  49.537 -16.620 0.44 124.64 ? 21  DG  E OP1   1 
ATOM   3981 O OP2   . DG  E 2 21  ? -6.993  51.941 -17.442 0.44 115.47 ? 21  DG  E OP2   1 
ATOM   3982 O "O5'" . DG  E 2 21  ? -7.893  50.018 -18.744 0.44 128.04 ? 21  DG  E "O5'" 1 
ATOM   3983 C "C5'" . DG  E 2 21  ? -7.688  48.642 -19.123 0.44 121.80 ? 21  DG  E "C5'" 1 
ATOM   3984 C "C4'" . DG  E 2 21  ? -8.275  48.370 -20.491 0.44 121.89 ? 21  DG  E "C4'" 1 
ATOM   3985 O "O4'" . DG  E 2 21  ? -9.428  49.206 -20.725 0.44 119.43 ? 21  DG  E "O4'" 1 
ATOM   3986 C "C3'" . DG  E 2 21  ? -7.330  48.620 -21.671 0.44 121.96 ? 21  DG  E "C3'" 1 
ATOM   3987 O "O3'" . DG  E 2 21  ? -6.889  47.375 -22.224 0.44 129.68 ? 21  DG  E "O3'" 1 
ATOM   3988 C "C2'" . DG  E 2 21  ? -8.183  49.354 -22.698 0.44 113.70 ? 21  DG  E "C2'" 1 
ATOM   3989 C "C1'" . DG  E 2 21  ? -9.591  49.323 -22.123 0.44 112.06 ? 21  DG  E "C1'" 1 
ATOM   3990 N N9    . DG  E 2 21  ? -10.353 50.538 -22.388 0.44 108.10 ? 21  DG  E N9    1 
ATOM   3991 C C8    . DG  E 2 21  ? -10.135 51.786 -21.856 0.44 103.35 ? 21  DG  E C8    1 
ATOM   3992 N N7    . DG  E 2 21  ? -10.967 52.686 -22.304 0.44 100.91 ? 21  DG  E N7    1 
ATOM   3993 C C5    . DG  E 2 21  ? -11.781 51.991 -23.188 0.44 102.55 ? 21  DG  E C5    1 
ATOM   3994 C C6    . DG  E 2 21  ? -12.871 52.438 -23.977 0.44 106.53 ? 21  DG  E C6    1 
ATOM   3995 O O6    . DG  E 2 21  ? -13.354 53.574 -24.052 0.44 113.28 ? 21  DG  E O6    1 
ATOM   3996 N N1    . DG  E 2 21  ? -13.413 51.403 -24.733 0.44 112.84 ? 21  DG  E N1    1 
ATOM   3997 C C2    . DG  E 2 21  ? -12.964 50.105 -24.731 0.44 108.85 ? 21  DG  E C2    1 
ATOM   3998 N N2    . DG  E 2 21  ? -13.618 49.251 -25.533 0.44 113.19 ? 21  DG  E N2    1 
ATOM   3999 N N3    . DG  E 2 21  ? -11.951 49.675 -23.998 0.44 107.41 ? 21  DG  E N3    1 
ATOM   4000 C C4    . DG  E 2 21  ? -11.411 50.665 -23.255 0.44 105.38 ? 21  DG  E C4    1 
ATOM   4001 P P     . DG  E 2 22  ? -5.900  47.324 -23.481 0.44 122.76 ? 22  DG  E P     1 
ATOM   4002 O OP1   . DG  E 2 22  ? -5.483  45.909 -23.629 0.44 127.14 ? 22  DG  E OP1   1 
ATOM   4003 O OP2   . DG  E 2 22  ? -4.875  48.385 -23.315 0.44 117.81 ? 22  DG  E OP2   1 
ATOM   4004 O "O5'" . DG  E 2 22  ? -6.813  47.685 -24.735 0.44 126.87 ? 22  DG  E "O5'" 1 
ATOM   4005 C "C5'" . DG  E 2 22  ? -7.034  46.726 -25.785 0.44 133.18 ? 22  DG  E "C5'" 1 
ATOM   4006 C "C4'" . DG  E 2 22  ? -8.407  46.922 -26.384 0.44 150.79 ? 22  DG  E "C4'" 1 
ATOM   4007 O "O4'" . DG  E 2 22  ? -8.940  48.196 -25.963 0.44 156.49 ? 22  DG  E "O4'" 1 
ATOM   4008 C "C3'" . DG  E 2 22  ? -8.444  46.930 -27.915 0.44 158.23 ? 22  DG  E "C3'" 1 
ATOM   4009 O "O3'" . DG  E 2 22  ? -9.129  45.773 -28.405 0.44 167.61 ? 22  DG  E "O3'" 1 
ATOM   4010 C "C2'" . DG  E 2 22  ? -9.217  48.192 -28.278 0.44 159.12 ? 22  DG  E "C2'" 1 
ATOM   4011 C "C1'" . DG  E 2 22  ? -9.818  48.662 -26.966 0.44 153.77 ? 22  DG  E "C1'" 1 
ATOM   4012 N N9    . DG  E 2 22  ? -9.908  50.113 -26.841 0.44 147.44 ? 22  DG  E N9    1 
ATOM   4013 C C8    . DG  E 2 22  ? -9.017  50.946 -26.207 0.44 144.03 ? 22  DG  E C8    1 
ATOM   4014 N N7    . DG  E 2 22  ? -9.363  52.203 -26.262 0.44 145.11 ? 22  DG  E N7    1 
ATOM   4015 C C5    . DG  E 2 22  ? -10.554 52.201 -26.975 0.44 143.74 ? 22  DG  E C5    1 
ATOM   4016 C C6    . DG  E 2 22  ? -11.401 53.274 -27.352 0.44 146.05 ? 22  DG  E C6    1 
ATOM   4017 O O6    . DG  E 2 22  ? -11.263 54.482 -27.123 0.44 142.27 ? 22  DG  E O6    1 
ATOM   4018 N N1    . DG  E 2 22  ? -12.505 52.826 -28.070 0.44 155.12 ? 22  DG  E N1    1 
ATOM   4019 C C2    . DG  E 2 22  ? -12.765 51.514 -28.384 0.44 155.63 ? 22  DG  E C2    1 
ATOM   4020 N N2    . DG  E 2 22  ? -13.887 51.284 -29.083 0.44 157.51 ? 22  DG  E N2    1 
ATOM   4021 N N3    . DG  E 2 22  ? -11.983 50.504 -28.038 0.44 147.59 ? 22  DG  E N3    1 
ATOM   4022 C C4    . DG  E 2 22  ? -10.904 50.918 -27.340 0.44 145.05 ? 22  DG  E C4    1 
ATOM   4023 P P     . DA  E 2 23  ? -8.523  44.947 -29.632 0.44 168.51 ? 23  DA  E P     1 
ATOM   4024 O OP1   . DA  E 2 23  ? -8.678  43.507 -29.310 0.44 168.66 ? 23  DA  E OP1   1 
ATOM   4025 O OP2   . DA  E 2 23  ? -7.177  45.489 -29.949 0.44 162.10 ? 23  DA  E OP2   1 
ATOM   4026 O "O5'" . DA  E 2 23  ? -9.506  45.292 -30.836 0.44 176.13 ? 23  DA  E "O5'" 1 
ATOM   4027 C "C5'" . DA  E 2 23  ? -9.260  46.422 -31.695 0.44 194.91 ? 23  DA  E "C5'" 1 
ATOM   4028 C "C4'" . DA  E 2 23  ? -10.547 46.864 -32.352 0.44 213.44 ? 23  DA  E "C4'" 1 
ATOM   4029 O "O4'" . DA  E 2 23  ? -11.098 47.990 -31.627 0.44 220.40 ? 23  DA  E "O4'" 1 
ATOM   4030 C "C3'" . DA  E 2 23  ? -10.402 47.323 -33.804 0.44 221.82 ? 23  DA  E "C3'" 1 
ATOM   4031 O "O3'" . DA  E 2 23  ? -11.513 46.868 -34.583 0.44 230.19 ? 23  DA  E "O3'" 1 
ATOM   4032 C "C2'" . DA  E 2 23  ? -10.389 48.838 -33.698 0.44 224.09 ? 23  DA  E "C2'" 1 
ATOM   4033 C "C1'" . DA  E 2 23  ? -11.286 49.095 -32.499 0.44 226.76 ? 23  DA  E "C1'" 1 
ATOM   4034 N N9    . DA  E 2 23  ? -10.965 50.313 -31.754 0.44 230.94 ? 23  DA  E N9    1 
ATOM   4035 C C8    . DA  E 2 23  ? -9.989  50.480 -30.803 0.44 227.83 ? 23  DA  E C8    1 
ATOM   4036 N N7    . DA  E 2 23  ? -9.940  51.691 -30.303 0.44 227.08 ? 23  DA  E N7    1 
ATOM   4037 C C5    . DA  E 2 23  ? -10.953 52.368 -30.967 0.44 228.32 ? 23  DA  E C5    1 
ATOM   4038 C C6    . DA  E 2 23  ? -11.417 53.694 -30.888 0.44 226.05 ? 23  DA  E C6    1 
ATOM   4039 N N6    . DA  E 2 23  ? -10.898 54.614 -30.071 0.44 222.86 ? 23  DA  E N6    1 
ATOM   4040 N N1    . DA  E 2 23  ? -12.448 54.048 -31.687 0.44 228.22 ? 23  DA  E N1    1 
ATOM   4041 C C2    . DA  E 2 23  ? -12.967 53.126 -32.508 0.44 232.04 ? 23  DA  E C2    1 
ATOM   4042 N N3    . DA  E 2 23  ? -12.618 51.851 -32.673 0.44 234.13 ? 23  DA  E N3    1 
ATOM   4043 C C4    . DA  E 2 23  ? -11.594 51.531 -31.864 0.44 232.84 ? 23  DA  E C4    1 
ATOM   4044 O "O5'" . DC  F 3 1   ? -21.739 56.693 -33.210 0.44 150.21 ? 1   DC  F "O5'" 1 
ATOM   4045 C "C5'" . DC  F 3 1   ? -20.629 56.757 -32.295 0.44 151.83 ? 1   DC  F "C5'" 1 
ATOM   4046 C "C4'" . DC  F 3 1   ? -20.073 55.371 -32.061 0.44 156.65 ? 1   DC  F "C4'" 1 
ATOM   4047 O "O4'" . DC  F 3 1   ? -18.696 55.470 -31.645 0.44 161.16 ? 1   DC  F "O4'" 1 
ATOM   4048 C "C3'" . DC  F 3 1   ? -20.788 54.578 -30.963 0.44 158.24 ? 1   DC  F "C3'" 1 
ATOM   4049 O "O3'" . DC  F 3 1   ? -21.611 53.549 -31.524 0.44 155.39 ? 1   DC  F "O3'" 1 
ATOM   4050 C "C2'" . DC  F 3 1   ? -19.666 53.995 -30.113 0.44 162.19 ? 1   DC  F "C2'" 1 
ATOM   4051 C "C1'" . DC  F 3 1   ? -18.389 54.333 -30.866 0.44 160.91 ? 1   DC  F "C1'" 1 
ATOM   4052 N N1    . DC  F 3 1   ? -17.245 54.672 -30.004 0.44 161.26 ? 1   DC  F N1    1 
ATOM   4053 C C2    . DC  F 3 1   ? -16.193 53.759 -29.891 0.44 159.47 ? 1   DC  F C2    1 
ATOM   4054 O O2    . DC  F 3 1   ? -16.258 52.690 -30.516 0.44 161.21 ? 1   DC  F O2    1 
ATOM   4055 N N3    . DC  F 3 1   ? -15.134 54.063 -29.105 0.44 158.20 ? 1   DC  F N3    1 
ATOM   4056 C C4    . DC  F 3 1   ? -15.104 55.224 -28.447 0.44 158.12 ? 1   DC  F C4    1 
ATOM   4057 N N4    . DC  F 3 1   ? -14.040 55.483 -27.682 0.44 151.75 ? 1   DC  F N4    1 
ATOM   4058 C C5    . DC  F 3 1   ? -16.164 56.173 -28.545 0.44 159.22 ? 1   DC  F C5    1 
ATOM   4059 C C6    . DC  F 3 1   ? -17.204 55.859 -29.327 0.44 159.73 ? 1   DC  F C6    1 
ATOM   4060 P P     . DC  F 3 2   ? -21.061 52.443 -32.545 0.44 155.61 ? 2   DC  F P     1 
ATOM   4061 O OP1   . DC  F 3 2   ? -19.577 52.499 -32.612 0.44 144.71 ? 2   DC  F OP1   1 
ATOM   4062 O OP2   . DC  F 3 2   ? -21.858 52.544 -33.794 0.44 165.04 ? 2   DC  F OP2   1 
ATOM   4063 O "O5'" . DC  F 3 2   ? -21.476 51.089 -31.819 0.44 154.00 ? 2   DC  F "O5'" 1 
ATOM   4064 C "C5'" . DC  F 3 2   ? -20.946 50.764 -30.522 0.44 152.43 ? 2   DC  F "C5'" 1 
ATOM   4065 C "C4'" . DC  F 3 2   ? -19.804 49.785 -30.659 0.44 147.73 ? 2   DC  F "C4'" 1 
ATOM   4066 O "O4'" . DC  F 3 2   ? -18.586 50.383 -30.153 0.44 135.94 ? 2   DC  F "O4'" 1 
ATOM   4067 C "C3'" . DC  F 3 2   ? -19.986 48.484 -29.879 0.44 146.72 ? 2   DC  F "C3'" 1 
ATOM   4068 O "O3'" . DC  F 3 2   ? -19.398 47.400 -30.600 0.44 152.14 ? 2   DC  F "O3'" 1 
ATOM   4069 C "C2'" . DC  F 3 2   ? -19.225 48.743 -28.593 0.44 140.61 ? 2   DC  F "C2'" 1 
ATOM   4070 C "C1'" . DC  F 3 2   ? -18.077 49.616 -29.069 0.44 135.47 ? 2   DC  F "C1'" 1 
ATOM   4071 N N1    . DC  F 3 2   ? -17.568 50.551 -28.056 0.44 130.94 ? 2   DC  F N1    1 
ATOM   4072 C C2    . DC  F 3 2   ? -16.394 50.227 -27.370 0.44 129.08 ? 2   DC  F C2    1 
ATOM   4073 O O2    . DC  F 3 2   ? -15.821 49.159 -27.634 0.44 119.96 ? 2   DC  F O2    1 
ATOM   4074 N N3    . DC  F 3 2   ? -15.915 51.083 -26.439 0.44 125.52 ? 2   DC  F N3    1 
ATOM   4075 C C4    . DC  F 3 2   ? -16.563 52.223 -26.185 0.44 127.83 ? 2   DC  F C4    1 
ATOM   4076 N N4    . DC  F 3 2   ? -16.053 53.039 -25.259 0.44 124.83 ? 2   DC  F N4    1 
ATOM   4077 C C5    . DC  F 3 2   ? -17.761 52.577 -26.871 0.44 128.78 ? 2   DC  F C5    1 
ATOM   4078 C C6    . DC  F 3 2   ? -18.223 51.720 -27.790 0.44 128.51 ? 2   DC  F C6    1 
ATOM   4079 P P     . DA  F 3 3   ? -19.671 45.900 -30.129 0.44 161.93 ? 3   DA  F P     1 
ATOM   4080 O OP1   . DA  F 3 3   ? -19.577 45.026 -31.328 0.44 164.56 ? 3   DA  F OP1   1 
ATOM   4081 O OP2   . DA  F 3 3   ? -20.914 45.901 -29.316 0.44 164.18 ? 3   DA  F OP2   1 
ATOM   4082 O "O5'" . DA  F 3 3   ? -18.437 45.590 -29.169 0.44 147.69 ? 3   DA  F "O5'" 1 
ATOM   4083 C "C5'" . DA  F 3 3   ? -17.778 44.310 -29.203 0.44 130.13 ? 3   DA  F "C5'" 1 
ATOM   4084 C "C4'" . DA  F 3 3   ? -17.035 44.067 -27.910 0.44 125.34 ? 3   DA  F "C4'" 1 
ATOM   4085 O "O4'" . DA  F 3 3   ? -16.612 45.326 -27.337 0.44 126.56 ? 3   DA  F "O4'" 1 
ATOM   4086 C "C3'" . DA  F 3 3   ? -17.846 43.350 -26.826 0.44 124.60 ? 3   DA  F "C3'" 1 
ATOM   4087 O "O3'" . DA  F 3 3   ? -17.076 42.266 -26.302 0.44 128.66 ? 3   DA  F "O3'" 1 
ATOM   4088 C "C2'" . DA  F 3 3   ? -18.071 44.414 -25.764 0.44 124.94 ? 3   DA  F "C2'" 1 
ATOM   4089 C "C1'" . DA  F 3 3   ? -16.870 45.322 -25.944 0.44 125.10 ? 3   DA  F "C1'" 1 
ATOM   4090 N N9    . DA  F 3 3   ? -17.079 46.709 -25.522 0.44 123.58 ? 3   DA  F N9    1 
ATOM   4091 C C8    . DA  F 3 3   ? -17.980 47.616 -26.026 0.44 116.52 ? 3   DA  F C8    1 
ATOM   4092 N N7    . DA  F 3 3   ? -17.925 48.791 -25.449 0.44 109.42 ? 3   DA  F N7    1 
ATOM   4093 C C5    . DA  F 3 3   ? -16.921 48.651 -24.501 0.44 113.34 ? 3   DA  F C5    1 
ATOM   4094 C C6    . DA  F 3 3   ? -16.380 49.542 -23.559 0.44 112.67 ? 3   DA  F C6    1 
ATOM   4095 N N6    . DA  F 3 3   ? -16.795 50.802 -23.408 0.44 113.98 ? 3   DA  F N6    1 
ATOM   4096 N N1    . DA  F 3 3   ? -15.386 49.089 -22.764 0.44 109.44 ? 3   DA  F N1    1 
ATOM   4097 C C2    . DA  F 3 3   ? -14.973 47.824 -22.914 0.44 115.67 ? 3   DA  F C2    1 
ATOM   4098 N N3    . DA  F 3 3   ? -15.404 46.891 -23.761 0.44 122.34 ? 3   DA  F N3    1 
ATOM   4099 C C4    . DA  F 3 3   ? -16.390 47.374 -24.536 0.44 120.73 ? 3   DA  F C4    1 
ATOM   4100 P P     . DC  F 3 4   ? -17.701 41.275 -25.217 0.44 139.46 ? 4   DC  F P     1 
ATOM   4101 O OP1   . DC  F 3 4   ? -17.026 39.958 -25.338 0.44 139.09 ? 4   DC  F OP1   1 
ATOM   4102 O OP2   . DC  F 3 4   ? -19.182 41.357 -25.319 0.44 132.51 ? 4   DC  F OP2   1 
ATOM   4103 O "O5'" . DC  F 3 4   ? -17.229 41.911 -23.835 0.44 137.77 ? 4   DC  F "O5'" 1 
ATOM   4104 C "C5'" . DC  F 3 4   ? -15.900 42.441 -23.684 0.44 134.61 ? 4   DC  F "C5'" 1 
ATOM   4105 C "C4'" . DC  F 3 4   ? -15.738 43.057 -22.315 0.44 136.21 ? 4   DC  F "C4'" 1 
ATOM   4106 O "O4'" . DC  F 3 4   ? -16.078 44.463 -22.371 0.44 133.79 ? 4   DC  F "O4'" 1 
ATOM   4107 C "C3'" . DC  F 3 4   ? -16.626 42.445 -21.227 0.44 136.32 ? 4   DC  F "C3'" 1 
ATOM   4108 O "O3'" . DC  F 3 4   ? -15.850 42.201 -20.049 0.44 141.40 ? 4   DC  F "O3'" 1 
ATOM   4109 C "C2'" . DC  F 3 4   ? -17.667 43.518 -20.958 0.44 131.06 ? 4   DC  F "C2'" 1 
ATOM   4110 C "C1'" . DC  F 3 4   ? -16.899 44.786 -21.265 0.44 126.79 ? 4   DC  F "C1'" 1 
ATOM   4111 N N1    . DC  F 3 4   ? -17.734 45.934 -21.644 0.44 119.49 ? 4   DC  F N1    1 
ATOM   4112 C C2    . DC  F 3 4   ? -17.487 47.168 -21.041 0.44 118.32 ? 4   DC  F C2    1 
ATOM   4113 O O2    . DC  F 3 4   ? -16.573 47.254 -20.209 0.44 123.48 ? 4   DC  F O2    1 
ATOM   4114 N N3    . DC  F 3 4   ? -18.246 48.234 -21.381 0.44 117.62 ? 4   DC  F N3    1 
ATOM   4115 C C4    . DC  F 3 4   ? -19.220 48.098 -22.284 0.44 124.66 ? 4   DC  F C4    1 
ATOM   4116 N N4    . DC  F 3 4   ? -19.944 49.178 -22.590 0.44 122.12 ? 4   DC  F N4    1 
ATOM   4117 C C5    . DC  F 3 4   ? -19.492 46.850 -22.915 0.44 124.94 ? 4   DC  F C5    1 
ATOM   4118 C C6    . DC  F 3 4   ? -18.731 45.804 -22.569 0.44 123.52 ? 4   DC  F C6    1 
ATOM   4119 P P     . DT  F 3 5   ? -16.187 40.964 -19.092 0.44 141.00 ? 5   DT  F P     1 
ATOM   4120 O OP1   . DT  F 3 5   ? -15.122 39.941 -19.256 0.44 136.82 ? 5   DT  F OP1   1 
ATOM   4121 O OP2   . DT  F 3 5   ? -17.610 40.584 -19.287 0.44 140.61 ? 5   DT  F OP2   1 
ATOM   4122 O "O5'" . DT  F 3 5   ? -16.027 41.605 -17.644 0.44 135.76 ? 5   DT  F "O5'" 1 
ATOM   4123 C "C5'" . DT  F 3 5   ? -14.825 42.308 -17.281 0.44 128.28 ? 5   DT  F "C5'" 1 
ATOM   4124 C "C4'" . DT  F 3 5   ? -15.033 43.048 -15.981 0.44 124.73 ? 5   DT  F "C4'" 1 
ATOM   4125 O "O4'" . DT  F 3 5   ? -15.658 44.325 -16.253 0.44 120.13 ? 5   DT  F "O4'" 1 
ATOM   4126 C "C3'" . DT  F 3 5   ? -15.950 42.341 -14.984 0.44 121.85 ? 5   DT  F "C3'" 1 
ATOM   4127 O "O3'" . DT  F 3 5   ? -15.542 42.627 -13.641 0.44 128.17 ? 5   DT  F "O3'" 1 
ATOM   4128 C "C2'" . DT  F 3 5   ? -17.305 42.961 -15.267 0.44 119.31 ? 5   DT  F "C2'" 1 
ATOM   4129 C "C1'" . DT  F 3 5   ? -16.941 44.389 -15.641 0.44 112.91 ? 5   DT  F "C1'" 1 
ATOM   4130 N N1    . DT  F 3 5   ? -17.864 45.017 -16.601 0.44 105.53 ? 5   DT  F N1    1 
ATOM   4131 C C2    . DT  F 3 5   ? -17.744 46.370 -16.826 0.44 99.19  ? 5   DT  F C2    1 
ATOM   4132 O O2    . DT  F 3 5   ? -16.920 47.068 -16.258 0.44 88.34  ? 5   DT  F O2    1 
ATOM   4133 N N3    . DT  F 3 5   ? -18.634 46.879 -17.741 0.44 99.24  ? 5   DT  F N3    1 
ATOM   4134 C C4    . DT  F 3 5   ? -19.605 46.184 -18.438 0.44 100.52 ? 5   DT  F C4    1 
ATOM   4135 O O4    . DT  F 3 5   ? -20.334 46.779 -19.229 0.44 92.73  ? 5   DT  F O4    1 
ATOM   4136 C C5    . DT  F 3 5   ? -19.674 44.767 -18.151 0.44 106.06 ? 5   DT  F C5    1 
ATOM   4137 C C7    . DT  F 3 5   ? -20.693 43.931 -18.858 0.44 108.40 ? 5   DT  F C7    1 
ATOM   4138 C C6    . DT  F 3 5   ? -18.809 44.263 -17.262 0.44 105.36 ? 5   DT  F C6    1 
ATOM   4139 P P     . DG  F 3 6   ? -15.323 41.462 -12.561 0.44 133.59 ? 6   DG  F P     1 
ATOM   4140 O OP1   . DG  F 3 6   ? -14.032 41.729 -11.877 0.44 134.75 ? 6   DG  F OP1   1 
ATOM   4141 O OP2   . DG  F 3 6   ? -15.530 40.158 -13.241 0.44 140.93 ? 6   DG  F OP2   1 
ATOM   4142 O "O5'" . DG  F 3 6   ? -16.491 41.674 -11.497 0.44 128.48 ? 6   DG  F "O5'" 1 
ATOM   4143 C "C5'" . DG  F 3 6   ? -17.873 41.776 -11.903 0.44 120.79 ? 6   DG  F "C5'" 1 
ATOM   4144 C "C4'" . DG  F 3 6   ? -18.481 43.058 -11.381 0.44 118.62 ? 6   DG  F "C4'" 1 
ATOM   4145 O "O4'" . DG  F 3 6   ? -18.531 44.039 -12.444 0.44 117.64 ? 6   DG  F "O4'" 1 
ATOM   4146 C "C3'" . DG  F 3 6   ? -19.920 42.934 -10.885 0.44 112.67 ? 6   DG  F "C3'" 1 
ATOM   4147 O "O3'" . DG  F 3 6   ? -19.961 42.575 -9.496  0.44 112.72 ? 6   DG  F "O3'" 1 
ATOM   4148 C "C2'" . DG  F 3 6   ? -20.478 44.328 -11.114 0.44 107.06 ? 6   DG  F "C2'" 1 
ATOM   4149 C "C1'" . DG  F 3 6   ? -19.714 44.825 -12.340 0.44 107.20 ? 6   DG  F "C1'" 1 
ATOM   4150 N N9    . DG  F 3 6   ? -20.450 44.698 -13.594 0.44 105.01 ? 6   DG  F N9    1 
ATOM   4151 C C8    . DG  F 3 6   ? -20.567 43.575 -14.378 0.44 107.17 ? 6   DG  F C8    1 
ATOM   4152 N N7    . DG  F 3 6   ? -21.300 43.766 -15.441 0.44 106.93 ? 6   DG  F N7    1 
ATOM   4153 C C5    . DG  F 3 6   ? -21.698 45.093 -15.350 0.44 107.27 ? 6   DG  F C5    1 
ATOM   4154 C C6    . DG  F 3 6   ? -22.510 45.870 -16.215 0.44 104.49 ? 6   DG  F C6    1 
ATOM   4155 O O6    . DG  F 3 6   ? -23.062 45.528 -17.266 0.44 106.75 ? 6   DG  F O6    1 
ATOM   4156 N N1    . DG  F 3 6   ? -22.657 47.171 -15.745 0.44 106.01 ? 6   DG  F N1    1 
ATOM   4157 C C2    . DG  F 3 6   ? -22.098 47.663 -14.591 0.44 107.24 ? 6   DG  F C2    1 
ATOM   4158 N N2    . DG  F 3 6   ? -22.357 48.948 -14.307 0.44 105.07 ? 6   DG  F N2    1 
ATOM   4159 N N3    . DG  F 3 6   ? -21.342 46.948 -13.775 0.44 106.94 ? 6   DG  F N3    1 
ATOM   4160 C C4    . DG  F 3 6   ? -21.182 45.682 -14.214 0.44 107.30 ? 6   DG  F C4    1 
ATOM   4161 P P     . DC  F 3 7   ? -19.764 43.662 -8.329  0.44 115.87 ? 7   DC  F P     1 
ATOM   4162 O OP1   . DC  F 3 7   ? -19.502 44.958 -8.998  0.44 122.86 ? 7   DC  F OP1   1 
ATOM   4163 O OP2   . DC  F 3 7   ? -18.805 43.150 -7.311  0.44 112.97 ? 7   DC  F OP2   1 
ATOM   4164 O "O5'" . DC  F 3 7   ? -21.199 43.762 -7.650  0.44 107.82 ? 7   DC  F "O5'" 1 
ATOM   4165 C "C5'" . DC  F 3 7   ? -22.355 44.090 -8.439  0.44 102.19 ? 7   DC  F "C5'" 1 
ATOM   4166 C "C4'" . DC  F 3 7   ? -22.558 45.587 -8.468  0.44 96.04  ? 7   DC  F "C4'" 1 
ATOM   4167 O "O4'" . DC  F 3 7   ? -22.219 46.104 -9.777  0.44 91.57  ? 7   DC  F "O4'" 1 
ATOM   4168 C "C3'" . DC  F 3 7   ? -23.992 46.031 -8.190  0.44 93.68  ? 7   DC  F "C3'" 1 
ATOM   4169 O "O3'" . DC  F 3 7   ? -24.083 46.391 -6.806  0.44 96.44  ? 7   DC  F "O3'" 1 
ATOM   4170 C "C2'" . DC  F 3 7   ? -24.171 47.244 -9.086  0.44 85.45  ? 7   DC  F "C2'" 1 
ATOM   4171 C "C1'" . DC  F 3 7   ? -23.223 46.990 -10.251 0.44 81.58  ? 7   DC  F "C1'" 1 
ATOM   4172 N N1    . DC  F 3 7   ? -23.838 46.378 -11.442 0.44 78.88  ? 7   DC  F N1    1 
ATOM   4173 C C2    . DC  F 3 7   ? -24.594 47.180 -12.303 0.44 80.33  ? 7   DC  F C2    1 
ATOM   4174 O O2    . DC  F 3 7   ? -24.745 48.380 -12.028 0.44 79.48  ? 7   DC  F O2    1 
ATOM   4175 N N3    . DC  F 3 7   ? -25.153 46.624 -13.403 0.44 83.51  ? 7   DC  F N3    1 
ATOM   4176 C C4    . DC  F 3 7   ? -24.975 45.326 -13.659 0.44 79.95  ? 7   DC  F C4    1 
ATOM   4177 N N4    . DC  F 3 7   ? -25.546 44.821 -14.754 0.44 79.12  ? 7   DC  F N4    1 
ATOM   4178 C C5    . DC  F 3 7   ? -24.202 44.489 -12.803 0.44 74.76  ? 7   DC  F C5    1 
ATOM   4179 C C6    . DC  F 3 7   ? -23.654 45.052 -11.719 0.44 76.24  ? 7   DC  F C6    1 
ATOM   4180 P P     . DT  F 3 8   ? -25.369 46.107 -5.896  0.44 96.62  ? 8   DT  F P     1 
ATOM   4181 O OP1   . DT  F 3 8   ? -24.933 46.124 -4.476  0.44 98.07  ? 8   DT  F OP1   1 
ATOM   4182 O OP2   . DT  F 3 8   ? -26.131 44.940 -6.424  0.44 94.35  ? 8   DT  F OP2   1 
ATOM   4183 O "O5'" . DT  F 3 8   ? -26.261 47.395 -6.162  0.44 83.55  ? 8   DT  F "O5'" 1 
ATOM   4184 C "C5'" . DT  F 3 8   ? -27.443 47.269 -6.962  0.44 89.66  ? 8   DT  F "C5'" 1 
ATOM   4185 C "C4'" . DT  F 3 8   ? -27.868 48.619 -7.489  0.44 85.27  ? 8   DT  F "C4'" 1 
ATOM   4186 O "O4'" . DT  F 3 8   ? -27.378 48.785 -8.836  0.44 85.11  ? 8   DT  F "O4'" 1 
ATOM   4187 C "C3'" . DT  F 3 8   ? -29.383 48.820 -7.541  0.44 80.21  ? 8   DT  F "C3'" 1 
ATOM   4188 O "O3'" . DT  F 3 8   ? -29.726 50.025 -6.858  0.44 77.11  ? 8   DT  F "O3'" 1 
ATOM   4189 C "C2'" . DT  F 3 8   ? -29.727 48.908 -9.021  0.44 82.34  ? 8   DT  F "C2'" 1 
ATOM   4190 C "C1'" . DT  F 3 8   ? -28.432 48.653 -9.770  0.44 80.70  ? 8   DT  F "C1'" 1 
ATOM   4191 N N1    . DT  F 3 8   ? -28.322 47.325 -10.403 0.44 80.96  ? 8   DT  F N1    1 
ATOM   4192 C C2    . DT  F 3 8   ? -28.753 47.203 -11.704 0.44 83.12  ? 8   DT  F C2    1 
ATOM   4193 O O2    . DT  F 3 8   ? -29.227 48.131 -12.338 0.44 85.34  ? 8   DT  F O2    1 
ATOM   4194 N N3    . DT  F 3 8   ? -28.608 45.946 -12.239 0.44 81.66  ? 8   DT  F N3    1 
ATOM   4195 C C4    . DT  F 3 8   ? -28.087 44.828 -11.616 0.44 80.51  ? 8   DT  F C4    1 
ATOM   4196 O O4    . DT  F 3 8   ? -28.023 43.764 -12.225 0.44 82.17  ? 8   DT  F O4    1 
ATOM   4197 C C5    . DT  F 3 8   ? -27.649 45.031 -10.252 0.44 81.16  ? 8   DT  F C5    1 
ATOM   4198 C C7    . DT  F 3 8   ? -27.070 43.876 -9.496  0.44 76.01  ? 8   DT  F C7    1 
ATOM   4199 C C6    . DT  F 3 8   ? -27.785 46.254 -9.722  0.44 81.87  ? 8   DT  F C6    1 
ATOM   4200 P P     . DC  F 3 9   ? -31.245 50.279 -6.461  0.44 82.53  ? 9   DC  F P     1 
ATOM   4201 O OP1   . DC  F 3 9   ? -31.423 51.719 -6.237  0.44 87.42  ? 9   DC  F OP1   1 
ATOM   4202 O OP2   . DC  F 3 9   ? -31.704 49.311 -5.435  0.44 85.47  ? 9   DC  F OP2   1 
ATOM   4203 O "O5'" . DC  F 3 9   ? -32.042 50.104 -7.824  0.44 82.28  ? 9   DC  F "O5'" 1 
ATOM   4204 C "C5'" . DC  F 3 9   ? -32.198 51.232 -8.696  0.44 78.15  ? 9   DC  F "C5'" 1 
ATOM   4205 C "C4'" . DC  F 3 9   ? -33.201 50.894 -9.770  0.44 77.08  ? 9   DC  F "C4'" 1 
ATOM   4206 O "O4'" . DC  F 3 9   ? -32.709 49.762 -10.524 0.44 74.94  ? 9   DC  F "O4'" 1 
ATOM   4207 C "C3'" . DC  F 3 9   ? -34.578 50.494 -9.236  0.44 76.58  ? 9   DC  F "C3'" 1 
ATOM   4208 O "O3'" . DC  F 3 9   ? -35.598 51.120 -10.017 0.44 73.17  ? 9   DC  F "O3'" 1 
ATOM   4209 C "C2'" . DC  F 3 9   ? -34.616 48.986 -9.413  0.44 79.86  ? 9   DC  F "C2'" 1 
ATOM   4210 C "C1'" . DC  F 3 9   ? -33.721 48.774 -10.620 0.44 80.81  ? 9   DC  F "C1'" 1 
ATOM   4211 N N1    . DC  F 3 9   ? -33.063 47.463 -10.655 0.44 77.56  ? 9   DC  F N1    1 
ATOM   4212 C C2    . DC  F 3 9   ? -32.781 46.882 -11.894 0.44 85.04  ? 9   DC  F C2    1 
ATOM   4213 O O2    . DC  F 3 9   ? -33.106 47.489 -12.927 0.44 88.43  ? 9   DC  F O2    1 
ATOM   4214 N N3    . DC  F 3 9   ? -32.172 45.673 -11.935 0.44 86.71  ? 9   DC  F N3    1 
ATOM   4215 C C4    . DC  F 3 9   ? -31.836 45.057 -10.798 0.44 85.15  ? 9   DC  F C4    1 
ATOM   4216 N N4    . DC  F 3 9   ? -31.235 43.868 -10.883 0.44 80.68  ? 9   DC  F N4    1 
ATOM   4217 C C5    . DC  F 3 9   ? -32.107 45.631 -9.522  0.44 82.40  ? 9   DC  F C5    1 
ATOM   4218 C C6    . DC  F 3 9   ? -32.719 46.822 -9.497  0.44 76.56  ? 9   DC  F C6    1 
ATOM   4219 P P     . DA  F 3 10  ? -37.017 51.363 -9.355  0.44 70.82  ? 10  DA  F P     1 
ATOM   4220 O OP1   . DA  F 3 10  ? -37.244 52.832 -9.338  0.44 67.34  ? 10  DA  F OP1   1 
ATOM   4221 O OP2   . DA  F 3 10  ? -37.112 50.560 -8.099  0.44 66.86  ? 10  DA  F OP2   1 
ATOM   4222 O "O5'" . DA  F 3 10  ? -38.011 50.730 -10.421 0.44 67.12  ? 10  DA  F "O5'" 1 
ATOM   4223 C "C5'" . DA  F 3 10  ? -37.782 50.924 -11.821 0.44 65.17  ? 10  DA  F "C5'" 1 
ATOM   4224 C "C4'" . DA  F 3 10  ? -38.345 49.749 -12.583 0.44 63.11  ? 10  DA  F "C4'" 1 
ATOM   4225 O "O4'" . DA  F 3 10  ? -37.500 48.597 -12.364 0.44 63.40  ? 10  DA  F "O4'" 1 
ATOM   4226 C "C3'" . DA  F 3 10  ? -39.752 49.331 -12.152 0.44 61.99  ? 10  DA  F "C3'" 1 
ATOM   4227 O "O3'" . DA  F 3 10  ? -40.531 49.074 -13.321 0.44 62.82  ? 10  DA  F "O3'" 1 
ATOM   4228 C "C2'" . DA  F 3 10  ? -39.527 48.044 -11.374 0.44 61.77  ? 10  DA  F "C2'" 1 
ATOM   4229 C "C1'" . DA  F 3 10  ? -38.310 47.473 -12.063 0.44 62.04  ? 10  DA  F "C1'" 1 
ATOM   4230 N N9    . DA  F 3 10  ? -37.505 46.555 -11.262 0.44 61.85  ? 10  DA  F N9    1 
ATOM   4231 C C8    . DA  F 3 10  ? -37.337 46.540 -9.901  0.44 65.98  ? 10  DA  F C8    1 
ATOM   4232 N N7    . DA  F 3 10  ? -36.508 45.614 -9.481  0.44 65.00  ? 10  DA  F N7    1 
ATOM   4233 C C5    . DA  F 3 10  ? -36.080 44.997 -10.647 0.44 65.67  ? 10  DA  F C5    1 
ATOM   4234 C C6    . DA  F 3 10  ? -35.181 43.942 -10.885 0.44 67.15  ? 10  DA  F C6    1 
ATOM   4235 N N6    . DA  F 3 10  ? -34.532 43.286 -9.919  0.44 67.87  ? 10  DA  F N6    1 
ATOM   4236 N N1    . DA  F 3 10  ? -34.966 43.579 -12.167 0.44 70.73  ? 10  DA  F N1    1 
ATOM   4237 C C2    . DA  F 3 10  ? -35.615 44.239 -13.137 0.44 68.42  ? 10  DA  F C2    1 
ATOM   4238 N N3    . DA  F 3 10  ? -36.490 45.236 -13.039 0.44 60.95  ? 10  DA  F N3    1 
ATOM   4239 C C4    . DA  F 3 10  ? -36.681 45.572 -11.753 0.44 63.92  ? 10  DA  F C4    1 
HETATM 4240 P P     . UF2 F 3 11  ? -41.784 49.988 -13.682 0.44 60.40  ? 11  UF2 F P     1 
HETATM 4241 O O1P   . UF2 F 3 11  ? -42.026 49.767 -15.130 0.44 69.78  ? 11  UF2 F O1P   1 
HETATM 4242 O "O5'" . UF2 F 3 11  ? -43.002 49.318 -12.900 0.44 61.70  ? 11  UF2 F "O5'" 1 
HETATM 4243 C "C5'" . UF2 F 3 11  ? -43.127 49.372 -11.469 0.44 55.95  ? 11  UF2 F "C5'" 1 
HETATM 4244 C "C4'" . UF2 F 3 11  ? -44.580 49.166 -11.120 0.44 57.46  ? 11  UF2 F "C4'" 1 
HETATM 4245 C "C3'" . UF2 F 3 11  ? -45.111 47.778 -11.472 0.44 62.36  ? 11  UF2 F "C3'" 1 
HETATM 4246 O "O3'" . UF2 F 3 11  ? -45.290 46.993 -10.281 0.44 60.98  ? 11  UF2 F "O3'" 1 
HETATM 4247 C "C2'" . UF2 F 3 11  ? -46.427 48.033 -12.201 0.44 62.77  ? 11  UF2 F "C2'" 1 
HETATM 4248 F "F2'" . UF2 F 3 11  ? -46.375 47.643 -13.505 0.44 71.32  ? 11  UF2 F "F2'" 1 
HETATM 4249 C "C1'" . UF2 F 3 11  ? -46.565 49.535 -12.319 0.44 60.17  ? 11  UF2 F "C1'" 1 
HETATM 4250 O "O4'" . UF2 F 3 11  ? -45.333 50.091 -11.920 0.44 57.21  ? 11  UF2 F "O4'" 1 
HETATM 4251 N N1    . UF2 F 3 11  ? -46.845 50.029 -13.673 0.44 61.98  ? 11  UF2 F N1    1 
HETATM 4252 C C6    . UF2 F 3 11  ? -45.836 50.567 -14.436 0.44 62.62  ? 11  UF2 F C6    1 
HETATM 4253 C C5    . UF2 F 3 11  ? -46.042 51.065 -15.660 0.44 62.05  ? 11  UF2 F C5    1 
HETATM 4254 C C4    . UF2 F 3 11  ? -47.361 51.065 -16.213 0.44 66.08  ? 11  UF2 F C4    1 
HETATM 4255 N N3    . UF2 F 3 11  ? -48.332 50.528 -15.388 0.44 70.87  ? 11  UF2 F N3    1 
HETATM 4256 C C2    . UF2 F 3 11  ? -48.150 50.003 -14.132 0.44 70.11  ? 11  UF2 F C2    1 
HETATM 4257 O O2    . UF2 F 3 11  ? -49.073 49.547 -13.478 0.44 73.97  ? 11  UF2 F O2    1 
HETATM 4258 O O4    . UF2 F 3 11  ? -47.676 51.490 -17.325 0.44 61.55  ? 11  UF2 F O4    1 
HETATM 4259 O O2P   . UF2 F 3 11  ? -41.594 51.358 -13.169 0.44 62.36  ? 11  UF2 F O2P   1 
ATOM   4260 P P     . DG  F 3 12  ? -44.076 46.683 -9.264  0.44 66.82  ? 12  DG  F P     1 
ATOM   4261 O OP1   . DG  F 3 12  ? -44.420 47.333 -7.975  0.44 63.47  ? 12  DG  F OP1   1 
ATOM   4262 O OP2   . DG  F 3 12  ? -42.757 46.972 -9.904  0.44 61.44  ? 12  DG  F OP2   1 
ATOM   4263 O "O5'" . DG  F 3 12  ? -44.185 45.108 -9.062  0.44 62.54  ? 12  DG  F "O5'" 1 
ATOM   4264 C "C5'" . DG  F 3 12  ? -45.470 44.492 -8.919  0.44 66.00  ? 12  DG  F "C5'" 1 
ATOM   4265 C "C4'" . DG  F 3 12  ? -45.376 43.005 -9.170  0.44 69.90  ? 12  DG  F "C4'" 1 
ATOM   4266 O "O4'" . DG  F 3 12  ? -44.136 42.486 -8.634  0.44 69.83  ? 12  DG  F "O4'" 1 
ATOM   4267 C "C3'" . DG  F 3 12  ? -46.484 42.187 -8.510  0.44 69.30  ? 12  DG  F "C3'" 1 
ATOM   4268 O "O3'" . DG  F 3 12  ? -46.780 41.056 -9.332  0.44 65.77  ? 12  DG  F "O3'" 1 
ATOM   4269 C "C2'" . DG  F 3 12  ? -45.863 41.780 -7.188  0.44 70.12  ? 12  DG  F "C2'" 1 
ATOM   4270 C "C1'" . DG  F 3 12  ? -44.400 41.586 -7.558  0.44 74.94  ? 12  DG  F "C1'" 1 
ATOM   4271 N N9    . DG  F 3 12  ? -43.461 41.892 -6.483  0.44 76.80  ? 12  DG  F N9    1 
ATOM   4272 C C8    . DG  F 3 12  ? -43.497 42.978 -5.643  0.44 79.41  ? 12  DG  F C8    1 
ATOM   4273 N N7    . DG  F 3 12  ? -42.504 43.003 -4.795  0.44 84.07  ? 12  DG  F N7    1 
ATOM   4274 C C5    . DG  F 3 12  ? -41.767 41.866 -5.095  0.44 82.08  ? 12  DG  F C5    1 
ATOM   4275 C C6    . DG  F 3 12  ? -40.575 41.363 -4.511  0.44 87.48  ? 12  DG  F C6    1 
ATOM   4276 O O6    . DG  F 3 12  ? -39.913 41.837 -3.580  0.44 91.13  ? 12  DG  F O6    1 
ATOM   4277 N N1    . DG  F 3 12  ? -40.163 40.183 -5.125  0.44 91.23  ? 12  DG  F N1    1 
ATOM   4278 C C2    . DG  F 3 12  ? -40.815 39.565 -6.164  0.44 93.37  ? 12  DG  F C2    1 
ATOM   4279 N N2    . DG  F 3 12  ? -40.258 38.433 -6.620  0.44 95.46  ? 12  DG  F N2    1 
ATOM   4280 N N3    . DG  F 3 12  ? -41.927 40.024 -6.717  0.44 88.24  ? 12  DG  F N3    1 
ATOM   4281 C C4    . DG  F 3 12  ? -42.343 41.170 -6.137  0.44 80.75  ? 12  DG  F C4    1 
ATOM   4282 P P     . DT  F 3 13  ? -47.892 40.002 -8.933  0.44 65.65  ? 13  DT  F P     1 
ATOM   4283 O OP1   . DT  F 3 13  ? -48.189 39.120 -10.090 0.44 71.51  ? 13  DT  F OP1   1 
ATOM   4284 O OP2   . DT  F 3 13  ? -49.008 40.697 -8.268  0.44 66.17  ? 13  DT  F OP2   1 
ATOM   4285 O "O5'" . DT  F 3 13  ? -47.024 39.125 -7.925  0.44 66.50  ? 13  DT  F "O5'" 1 
ATOM   4286 C "C5'" . DT  F 3 13  ? -45.989 38.280 -8.459  0.44 69.45  ? 13  DT  F "C5'" 1 
ATOM   4287 C "C4'" . DT  F 3 13  ? -45.619 37.183 -7.488  0.44 68.55  ? 13  DT  F "C4'" 1 
ATOM   4288 O "O4'" . DT  F 3 13  ? -44.662 37.689 -6.526  0.44 69.07  ? 13  DT  F "O4'" 1 
ATOM   4289 C "C3'" . DT  F 3 13  ? -46.777 36.613 -6.670  0.44 68.71  ? 13  DT  F "C3'" 1 
ATOM   4290 O "O3'" . DT  F 3 13  ? -46.555 35.206 -6.551  0.44 72.61  ? 13  DT  F "O3'" 1 
ATOM   4291 C "C2'" . DT  F 3 13  ? -46.610 37.293 -5.323  0.44 69.47  ? 13  DT  F "C2'" 1 
ATOM   4292 C "C1'" . DT  F 3 13  ? -45.098 37.366 -5.224  0.44 65.59  ? 13  DT  F "C1'" 1 
ATOM   4293 N N1    . DT  F 3 13  ? -44.571 38.385 -4.311  0.44 67.28  ? 13  DT  F N1    1 
ATOM   4294 C C2    . DT  F 3 13  ? -43.319 38.179 -3.779  0.44 77.10  ? 13  DT  F C2    1 
ATOM   4295 O O2    . DT  F 3 13  ? -42.640 37.197 -4.034  0.44 81.70  ? 13  DT  F O2    1 
ATOM   4296 N N3    . DT  F 3 13  ? -42.888 39.170 -2.930  0.44 77.52  ? 13  DT  F N3    1 
ATOM   4297 C C4    . DT  F 3 13  ? -43.568 40.319 -2.575  0.44 70.49  ? 13  DT  F C4    1 
ATOM   4298 O O4    . DT  F 3 13  ? -43.050 41.123 -1.803  0.44 71.88  ? 13  DT  F O4    1 
ATOM   4299 C C5    . DT  F 3 13  ? -44.879 40.469 -3.173  0.44 61.60  ? 13  DT  F C5    1 
ATOM   4300 C C7    . DT  F 3 13  ? -45.693 41.680 -2.847  0.44 55.64  ? 13  DT  F C7    1 
ATOM   4301 C C6    . DT  F 3 13  ? -45.308 39.506 -3.998  0.44 61.96  ? 13  DT  F C6    1 
ATOM   4302 P P     . DA  F 3 14  ? -47.741 34.215 -6.167  0.44 77.62  ? 14  DA  F P     1 
ATOM   4303 O OP1   . DA  F 3 14  ? -48.262 33.580 -7.412  0.44 75.78  ? 14  DA  F OP1   1 
ATOM   4304 O OP2   . DA  F 3 14  ? -48.660 34.985 -5.286  0.44 71.32  ? 14  DA  F OP2   1 
ATOM   4305 O "O5'" . DA  F 3 14  ? -46.964 33.098 -5.338  0.44 76.14  ? 14  DA  F "O5'" 1 
ATOM   4306 C "C5'" . DA  F 3 14  ? -46.302 32.012 -6.014  0.44 82.44  ? 14  DA  F "C5'" 1 
ATOM   4307 C "C4'" . DA  F 3 14  ? -45.065 31.575 -5.261  0.44 83.81  ? 14  DA  F "C4'" 1 
ATOM   4308 O "O4'" . DA  F 3 14  ? -44.411 32.709 -4.644  0.44 80.57  ? 14  DA  F "O4'" 1 
ATOM   4309 C "C3'" . DA  F 3 14  ? -45.310 30.571 -4.138  0.44 86.21  ? 14  DA  F "C3'" 1 
ATOM   4310 O "O3'" . DA  F 3 14  ? -44.218 29.649 -4.121  0.44 94.97  ? 14  DA  F "O3'" 1 
ATOM   4311 C "C2'" . DA  F 3 14  ? -45.340 31.438 -2.891  0.44 87.15  ? 14  DA  F "C2'" 1 
ATOM   4312 C "C1'" . DA  F 3 14  ? -44.363 32.556 -3.230  0.44 83.30  ? 14  DA  F "C1'" 1 
ATOM   4313 N N9    . DA  F 3 14  ? -44.672 33.858 -2.631  0.44 81.95  ? 14  DA  F N9    1 
ATOM   4314 C C8    . DA  F 3 14  ? -45.859 34.548 -2.678  0.44 73.33  ? 14  DA  F C8    1 
ATOM   4315 N N7    . DA  F 3 14  ? -45.819 35.711 -2.073  0.44 73.15  ? 14  DA  F N7    1 
ATOM   4316 C C5    . DA  F 3 14  ? -44.518 35.796 -1.598  0.44 76.59  ? 14  DA  F C5    1 
ATOM   4317 C C6    . DA  F 3 14  ? -43.841 36.788 -0.867  0.44 76.82  ? 14  DA  F C6    1 
ATOM   4318 N N6    . DA  F 3 14  ? -44.406 37.930 -0.470  0.44 80.55  ? 14  DA  F N6    1 
ATOM   4319 N N1    . DA  F 3 14  ? -42.547 36.561 -0.548  0.44 81.39  ? 14  DA  F N1    1 
ATOM   4320 C C2    . DA  F 3 14  ? -41.982 35.414 -0.947  0.44 85.43  ? 14  DA  F C2    1 
ATOM   4321 N N3    . DA  F 3 14  ? -42.513 34.407 -1.641  0.44 80.50  ? 14  DA  F N3    1 
ATOM   4322 C C4    . DA  F 3 14  ? -43.799 34.662 -1.936  0.44 78.60  ? 14  DA  F C4    1 
ATOM   4323 P P     . DC  F 3 15  ? -44.259 28.325 -3.229  0.44 94.33  ? 15  DC  F P     1 
ATOM   4324 O OP1   . DC  F 3 15  ? -43.432 27.312 -3.928  0.44 82.50  ? 15  DC  F OP1   1 
ATOM   4325 O OP2   . DC  F 3 15  ? -45.677 28.027 -2.907  0.44 91.25  ? 15  DC  F OP2   1 
ATOM   4326 O "O5'" . DC  F 3 15  ? -43.509 28.795 -1.902  0.44 93.48  ? 15  DC  F "O5'" 1 
ATOM   4327 C "C5'" . DC  F 3 15  ? -42.140 29.237 -1.948  0.44 96.87  ? 15  DC  F "C5'" 1 
ATOM   4328 C "C4'" . DC  F 3 15  ? -41.729 29.843 -0.626  0.44 106.61 ? 15  DC  F "C4'" 1 
ATOM   4329 O "O4'" . DC  F 3 15  ? -42.326 31.148 -0.463  0.44 109.96 ? 15  DC  F "O4'" 1 
ATOM   4330 C "C3'" . DC  F 3 15  ? -42.126 29.036 0.614   0.44 115.28 ? 15  DC  F "C3'" 1 
ATOM   4331 O "O3'" . DC  F 3 15  ? -40.949 28.467 1.203   0.44 126.16 ? 15  DC  F "O3'" 1 
ATOM   4332 C "C2'" . DC  F 3 15  ? -42.788 30.051 1.539   0.44 115.21 ? 15  DC  F "C2'" 1 
ATOM   4333 C "C1'" . DC  F 3 15  ? -42.456 31.400 0.919   0.44 111.36 ? 15  DC  F "C1'" 1 
ATOM   4334 N N1    . DC  F 3 15  ? -43.492 32.432 1.097   0.44 112.80 ? 15  DC  F N1    1 
ATOM   4335 C C2    . DC  F 3 15  ? -43.132 33.662 1.657   0.44 112.57 ? 15  DC  F C2    1 
ATOM   4336 O O2    . DC  F 3 15  ? -41.949 33.849 1.983   0.44 114.71 ? 15  DC  F O2    1 
ATOM   4337 N N3    . DC  F 3 15  ? -44.078 34.614 1.827   0.44 103.03 ? 15  DC  F N3    1 
ATOM   4338 C C4    . DC  F 3 15  ? -45.339 34.375 1.459   0.44 95.74  ? 15  DC  F C4    1 
ATOM   4339 N N4    . DC  F 3 15  ? -46.239 35.342 1.645   0.44 95.63  ? 15  DC  F N4    1 
ATOM   4340 C C5    . DC  F 3 15  ? -45.733 33.131 0.885   0.44 99.73  ? 15  DC  F C5    1 
ATOM   4341 C C6    . DC  F 3 15  ? -44.787 32.196 0.726   0.44 106.94 ? 15  DC  F C6    1 
ATOM   4342 P P     . DA  F 3 16  ? -41.026 27.474 2.457   0.44 128.98 ? 16  DA  F P     1 
ATOM   4343 O OP1   . DA  F 3 16  ? -39.898 26.511 2.349   0.44 125.78 ? 16  DA  F OP1   1 
ATOM   4344 O OP2   . DA  F 3 16  ? -42.421 26.971 2.565   0.44 128.76 ? 16  DA  F OP2   1 
ATOM   4345 O "O5'" . DA  F 3 16  ? -40.736 28.430 3.697   0.44 126.08 ? 16  DA  F "O5'" 1 
ATOM   4346 C "C5'" . DA  F 3 16  ? -39.478 29.118 3.813   0.44 136.45 ? 16  DA  F "C5'" 1 
ATOM   4347 C "C4'" . DA  F 3 16  ? -39.576 30.207 4.854   0.44 141.54 ? 16  DA  F "C4'" 1 
ATOM   4348 O "O4'" . DA  F 3 16  ? -40.676 31.084 4.532   0.44 140.14 ? 16  DA  F "O4'" 1 
ATOM   4349 C "C3'" . DA  F 3 16  ? -39.830 29.711 6.281   0.44 150.06 ? 16  DA  F "C3'" 1 
ATOM   4350 O "O3'" . DA  F 3 16  ? -38.711 30.016 7.120   0.44 163.44 ? 16  DA  F "O3'" 1 
ATOM   4351 C "C2'" . DA  F 3 16  ? -41.071 30.466 6.736   0.44 146.02 ? 16  DA  F "C2'" 1 
ATOM   4352 C "C1'" . DA  F 3 16  ? -41.180 31.606 5.742   0.44 145.81 ? 16  DA  F "C1'" 1 
ATOM   4353 N N9    . DA  F 3 16  ? -42.546 32.068 5.499   0.44 147.13 ? 16  DA  F N9    1 
ATOM   4354 C C8    . DA  F 3 16  ? -43.568 31.386 4.886   0.44 147.11 ? 16  DA  F C8    1 
ATOM   4355 N N7    . DA  F 3 16  ? -44.689 32.063 4.818   0.44 150.73 ? 16  DA  F N7    1 
ATOM   4356 C C5    . DA  F 3 16  ? -44.386 33.272 5.429   0.44 150.11 ? 16  DA  F C5    1 
ATOM   4357 C C6    . DA  F 3 16  ? -45.152 34.424 5.677   0.44 149.80 ? 16  DA  F C6    1 
ATOM   4358 N N6    . DA  F 3 16  ? -46.433 34.552 5.324   0.44 146.50 ? 16  DA  F N6    1 
ATOM   4359 N N1    . DA  F 3 16  ? -44.549 35.455 6.309   0.44 154.82 ? 16  DA  F N1    1 
ATOM   4360 C C2    . DA  F 3 16  ? -43.263 35.326 6.662   0.44 152.40 ? 16  DA  F C2    1 
ATOM   4361 N N3    . DA  F 3 16  ? -42.439 34.295 6.484   0.44 148.53 ? 16  DA  F N3    1 
ATOM   4362 C C4    . DA  F 3 16  ? -43.069 33.288 5.854   0.44 149.00 ? 16  DA  F C4    1 
ATOM   4363 P P     . DG  F 3 17  ? -38.021 28.877 8.013   0.44 176.89 ? 17  DG  F P     1 
ATOM   4364 O OP1   . DG  F 3 17  ? -36.549 29.004 7.862   0.44 176.22 ? 17  DG  F OP1   1 
ATOM   4365 O OP2   . DG  F 3 17  ? -38.678 27.578 7.714   0.44 180.44 ? 17  DG  F OP2   1 
ATOM   4366 O "O5'" . DG  F 3 17  ? -38.403 29.304 9.500   0.44 170.77 ? 17  DG  F "O5'" 1 
ATOM   4367 C "C5'" . DG  F 3 17  ? -39.744 29.138 9.997   0.44 165.01 ? 17  DG  F "C5'" 1 
ATOM   4368 C "C4'" . DG  F 3 17  ? -40.222 30.418 10.642  0.44 165.28 ? 17  DG  F "C4'" 1 
ATOM   4369 O "O4'" . DG  F 3 17  ? -41.184 31.066 9.776   0.44 168.38 ? 17  DG  F "O4'" 1 
ATOM   4370 C "C3'" . DG  F 3 17  ? -40.922 30.231 11.989  0.44 165.92 ? 17  DG  F "C3'" 1 
ATOM   4371 O "O3'" . DG  F 3 17  ? -40.577 31.296 12.878  0.44 158.27 ? 17  DG  F "O3'" 1 
ATOM   4372 C "C2'" . DG  F 3 17  ? -42.396 30.288 11.632  0.44 168.36 ? 17  DG  F "C2'" 1 
ATOM   4373 C "C1'" . DG  F 3 17  ? -42.414 31.255 10.460  0.44 170.66 ? 17  DG  F "C1'" 1 
ATOM   4374 N N9    . DG  F 3 17  ? -43.497 31.021 9.508   0.44 174.55 ? 17  DG  F N9    1 
ATOM   4375 C C8    . DG  F 3 17  ? -43.743 29.868 8.800   0.44 175.34 ? 17  DG  F C8    1 
ATOM   4376 N N7    . DG  F 3 17  ? -44.790 29.957 8.025   0.44 171.92 ? 17  DG  F N7    1 
ATOM   4377 C C5    . DG  F 3 17  ? -45.265 31.245 8.233   0.44 170.82 ? 17  DG  F C5    1 
ATOM   4378 C C6    . DG  F 3 17  ? -46.380 31.917 7.667   0.44 164.21 ? 17  DG  F C6    1 
ATOM   4379 O O6    . DG  F 3 17  ? -47.198 31.495 6.841   0.44 159.75 ? 17  DG  F O6    1 
ATOM   4380 N N1    . DG  F 3 17  ? -46.497 33.214 8.158   0.44 158.96 ? 17  DG  F N1    1 
ATOM   4381 C C2    . DG  F 3 17  ? -45.653 33.792 9.073   0.44 158.62 ? 17  DG  F C2    1 
ATOM   4382 N N2    . DG  F 3 17  ? -45.934 35.056 9.421   0.44 151.86 ? 17  DG  F N2    1 
ATOM   4383 N N3    . DG  F 3 17  ? -44.611 33.177 9.609   0.44 167.28 ? 17  DG  F N3    1 
ATOM   4384 C C4    . DG  F 3 17  ? -44.478 31.915 9.147   0.44 172.67 ? 17  DG  F C4    1 
ATOM   4385 P P     . DA  F 3 18  ? -40.150 30.960 14.380  0.44 152.94 ? 18  DA  F P     1 
ATOM   4386 O OP1   . DA  F 3 18  ? -38.768 31.469 14.575  0.44 150.46 ? 18  DA  F OP1   1 
ATOM   4387 O OP2   . DA  F 3 18  ? -40.455 29.530 14.654  0.44 141.22 ? 18  DA  F OP2   1 
ATOM   4388 O "O5'" . DA  F 3 18  ? -41.143 31.874 15.226  0.44 146.77 ? 18  DA  F "O5'" 1 
ATOM   4389 C "C5'" . DA  F 3 18  ? -42.478 31.432 15.540  0.44 138.63 ? 18  DA  F "C5'" 1 
ATOM   4390 C "C4'" . DA  F 3 18  ? -43.374 32.622 15.796  0.44 130.41 ? 18  DA  F "C4'" 1 
ATOM   4391 O "O4'" . DA  F 3 18  ? -44.077 32.955 14.576  0.44 127.15 ? 18  DA  F "O4'" 1 
ATOM   4392 C "C3'" . DA  F 3 18  ? -44.452 32.398 16.857  0.44 125.40 ? 18  DA  F "C3'" 1 
ATOM   4393 O "O3'" . DA  F 3 18  ? -44.686 33.591 17.614  0.44 120.65 ? 18  DA  F "O3'" 1 
ATOM   4394 C "C2'" . DA  F 3 18  ? -45.673 32.025 16.038  0.44 127.93 ? 18  DA  F "C2'" 1 
ATOM   4395 C "C1'" . DA  F 3 18  ? -45.479 32.815 14.753  0.44 129.89 ? 18  DA  F "C1'" 1 
ATOM   4396 N N9    . DA  F 3 18  ? -46.014 32.148 13.568  0.44 136.48 ? 18  DA  F N9    1 
ATOM   4397 C C8    . DA  F 3 18  ? -45.551 31.004 12.966  0.44 137.83 ? 18  DA  F C8    1 
ATOM   4398 N N7    . DA  F 3 18  ? -46.252 30.634 11.922  0.44 138.83 ? 18  DA  F N7    1 
ATOM   4399 C C5    . DA  F 3 18  ? -47.246 31.600 11.829  0.44 143.30 ? 18  DA  F C5    1 
ATOM   4400 C C6    . DA  F 3 18  ? -48.311 31.778 10.929  0.44 142.30 ? 18  DA  F C6    1 
ATOM   4401 N N6    . DA  F 3 18  ? -48.562 30.956 9.907   0.44 140.71 ? 18  DA  F N6    1 
ATOM   4402 N N1    . DA  F 3 18  ? -49.120 32.844 11.116  0.44 144.35 ? 18  DA  F N1    1 
ATOM   4403 C C2    . DA  F 3 18  ? -48.868 33.667 12.142  0.44 139.32 ? 18  DA  F C2    1 
ATOM   4404 N N3    . DA  F 3 18  ? -47.899 33.605 13.054  0.44 144.01 ? 18  DA  F N3    1 
ATOM   4405 C C4    . DA  F 3 18  ? -47.113 32.536 12.839  0.44 143.35 ? 18  DA  F C4    1 
ATOM   4406 P P     . DG  F 3 19  ? -46.115 33.917 18.284  0.44 122.98 ? 19  DG  F P     1 
ATOM   4407 O OP1   . DG  F 3 19  ? -46.048 35.305 18.809  0.44 121.73 ? 19  DG  F OP1   1 
ATOM   4408 O OP2   . DG  F 3 19  ? -46.492 32.809 19.198  0.44 111.47 ? 19  DG  F OP2   1 
ATOM   4409 O "O5'" . DG  F 3 19  ? -47.133 33.928 17.057  0.44 117.90 ? 19  DG  F "O5'" 1 
ATOM   4410 C "C5'" . DG  F 3 19  ? -48.288 34.786 17.061  0.44 119.43 ? 19  DG  F "C5'" 1 
ATOM   4411 C "C4'" . DG  F 3 19  ? -49.552 33.965 16.944  0.44 131.72 ? 19  DG  F "C4'" 1 
ATOM   4412 O "O4'" . DG  F 3 19  ? -49.471 33.087 15.796  0.44 137.21 ? 19  DG  F "O4'" 1 
ATOM   4413 C "C3'" . DG  F 3 19  ? -49.864 33.068 18.149  0.44 134.55 ? 19  DG  F "C3'" 1 
ATOM   4414 O "O3'" . DG  F 3 19  ? -51.216 33.284 18.565  0.44 133.04 ? 19  DG  F "O3'" 1 
ATOM   4415 C "C2'" . DG  F 3 19  ? -49.708 31.655 17.609  0.44 138.77 ? 19  DG  F "C2'" 1 
ATOM   4416 C "C1'" . DG  F 3 19  ? -50.048 31.843 16.145  0.44 142.00 ? 19  DG  F "C1'" 1 
ATOM   4417 N N9    . DG  F 3 19  ? -49.516 30.828 15.241  0.44 146.50 ? 19  DG  F N9    1 
ATOM   4418 C C8    . DG  F 3 19  ? -48.413 30.031 15.436  0.44 152.42 ? 19  DG  F C8    1 
ATOM   4419 N N7    . DG  F 3 19  ? -48.191 29.211 14.445  0.44 154.80 ? 19  DG  F N7    1 
ATOM   4420 C C5    . DG  F 3 19  ? -49.211 29.479 13.542  0.44 154.44 ? 19  DG  F C5    1 
ATOM   4421 C C6    . DG  F 3 19  ? -49.494 28.904 12.274  0.44 157.33 ? 19  DG  F C6    1 
ATOM   4422 O O6    . DG  F 3 19  ? -48.879 28.011 11.676  0.44 158.29 ? 19  DG  F O6    1 
ATOM   4423 N N1    . DG  F 3 19  ? -50.625 29.472 11.698  0.44 157.73 ? 19  DG  F N1    1 
ATOM   4424 C C2    . DG  F 3 19  ? -51.386 30.465 12.262  0.44 153.80 ? 19  DG  F C2    1 
ATOM   4425 N N2    . DG  F 3 19  ? -52.440 30.883 11.546  0.44 154.67 ? 19  DG  F N2    1 
ATOM   4426 N N3    . DG  F 3 19  ? -51.133 31.010 13.440  0.44 153.10 ? 19  DG  F N3    1 
ATOM   4427 C C4    . DG  F 3 19  ? -50.039 30.473 14.020  0.44 151.54 ? 19  DG  F C4    1 
ATOM   4428 P P     . DC  F 3 20  ? -51.774 32.624 19.910  0.44 140.84 ? 20  DC  F P     1 
ATOM   4429 O OP1   . DC  F 3 20  ? -51.760 33.658 20.975  0.44 140.92 ? 20  DC  F OP1   1 
ATOM   4430 O OP2   . DC  F 3 20  ? -51.074 31.330 20.126  0.44 139.23 ? 20  DC  F OP2   1 
ATOM   4431 O "O5'" . DC  F 3 20  ? -53.296 32.315 19.562  0.44 137.06 ? 20  DC  F "O5'" 1 
ATOM   4432 C "C5'" . DC  F 3 20  ? -53.661 31.077 18.932  0.44 137.39 ? 20  DC  F "C5'" 1 
ATOM   4433 C "C4'" . DC  F 3 20  ? -54.523 31.349 17.722  0.44 137.65 ? 20  DC  F "C4'" 1 
ATOM   4434 O "O4'" . DC  F 3 20  ? -53.730 31.201 16.525  0.44 142.32 ? 20  DC  F "O4'" 1 
ATOM   4435 C "C3'" . DC  F 3 20  ? -55.696 30.390 17.559  0.44 140.93 ? 20  DC  F "C3'" 1 
ATOM   4436 O "O3'" . DC  F 3 20  ? -56.844 30.958 18.197  0.44 148.08 ? 20  DC  F "O3'" 1 
ATOM   4437 C "C2'" . DC  F 3 20  ? -55.887 30.329 16.054  0.44 140.13 ? 20  DC  F "C2'" 1 
ATOM   4438 C "C1'" . DC  F 3 20  ? -54.486 30.567 15.499  0.44 146.59 ? 20  DC  F "C1'" 1 
ATOM   4439 N N1    . DC  F 3 20  ? -53.765 29.350 15.094  0.44 152.42 ? 20  DC  F N1    1 
ATOM   4440 C C2    . DC  F 3 20  ? -54.266 28.591 14.033  0.44 158.27 ? 20  DC  F C2    1 
ATOM   4441 O O2    . DC  F 3 20  ? -55.308 28.961 13.472  0.44 161.65 ? 20  DC  F O2    1 
ATOM   4442 N N3    . DC  F 3 20  ? -53.606 27.474 13.649  0.44 164.43 ? 20  DC  F N3    1 
ATOM   4443 C C4    . DC  F 3 20  ? -52.487 27.110 14.280  0.44 162.57 ? 20  DC  F C4    1 
ATOM   4444 N N4    . DC  F 3 20  ? -51.868 26.001 13.868  0.44 165.86 ? 20  DC  F N4    1 
ATOM   4445 C C5    . DC  F 3 20  ? -51.951 27.869 15.361  0.44 160.24 ? 20  DC  F C5    1 
ATOM   4446 C C6    . DC  F 3 20  ? -52.615 28.972 15.731  0.44 157.01 ? 20  DC  F C6    1 
ATOM   4447 P P     . DT  F 3 21  ? -58.052 30.045 18.714  0.44 150.94 ? 21  DT  F P     1 
ATOM   4448 O OP1   . DT  F 3 21  ? -58.848 30.838 19.689  0.44 130.26 ? 21  DT  F OP1   1 
ATOM   4449 O OP2   . DT  F 3 21  ? -57.489 28.728 19.113  0.44 145.58 ? 21  DT  F OP2   1 
ATOM   4450 O "O5'" . DT  F 3 21  ? -58.918 29.845 17.391  0.44 153.29 ? 21  DT  F "O5'" 1 
ATOM   4451 C "C5'" . DT  F 3 21  ? -60.342 29.642 17.457  0.44 152.04 ? 21  DT  F "C5'" 1 
ATOM   4452 C "C4'" . DT  F 3 21  ? -60.706 28.314 16.835  0.44 154.44 ? 21  DT  F "C4'" 1 
ATOM   4453 O "O4'" . DT  F 3 21  ? -59.624 27.860 15.988  0.44 161.03 ? 21  DT  F "O4'" 1 
ATOM   4454 C "C3'" . DT  F 3 21  ? -60.972 27.188 17.839  0.44 157.77 ? 21  DT  F "C3'" 1 
ATOM   4455 O "O3'" . DT  F 3 21  ? -62.265 26.620 17.599  0.44 164.18 ? 21  DT  F "O3'" 1 
ATOM   4456 C "C2'" . DT  F 3 21  ? -59.854 26.188 17.588  0.44 157.35 ? 21  DT  F "C2'" 1 
ATOM   4457 C "C1'" . DT  F 3 21  ? -59.467 26.464 16.149  0.44 162.32 ? 21  DT  F "C1'" 1 
ATOM   4458 N N1    . DT  F 3 21  ? -58.071 26.122 15.814  0.44 166.75 ? 21  DT  F N1    1 
ATOM   4459 C C2    . DT  F 3 21  ? -57.834 25.366 14.688  0.44 170.27 ? 21  DT  F C2    1 
ATOM   4460 O O2    . DT  F 3 21  ? -58.723 24.971 13.951  0.44 167.27 ? 21  DT  F O2    1 
ATOM   4461 N N3    . DT  F 3 21  ? -56.509 25.087 14.454  0.44 174.50 ? 21  DT  F N3    1 
ATOM   4462 C C4    . DT  F 3 21  ? -55.425 25.482 15.217  0.44 168.51 ? 21  DT  F C4    1 
ATOM   4463 O O4    . DT  F 3 21  ? -54.289 25.157 14.882  0.44 164.08 ? 21  DT  F O4    1 
ATOM   4464 C C5    . DT  F 3 21  ? -55.749 26.271 16.385  0.44 169.25 ? 21  DT  F C5    1 
ATOM   4465 C C7    . DT  F 3 21  ? -54.641 26.742 17.273  0.44 168.29 ? 21  DT  F C7    1 
ATOM   4466 C C6    . DT  F 3 21  ? -57.038 26.546 16.621  0.44 168.81 ? 21  DT  F C6    1 
ATOM   4467 P P     . DG  F 3 22  ? -62.572 25.057 17.785  0.44 170.54 ? 22  DG  F P     1 
ATOM   4468 O OP1   . DG  F 3 22  ? -64.048 24.900 17.844  0.44 175.33 ? 22  DG  F OP1   1 
ATOM   4469 O OP2   . DG  F 3 22  ? -61.732 24.514 18.884  0.44 164.37 ? 22  DG  F OP2   1 
ATOM   4470 O "O5'" . DG  F 3 22  ? -62.066 24.420 16.415  0.44 165.46 ? 22  DG  F "O5'" 1 
ATOM   4471 C "C5'" . DG  F 3 22  ? -62.975 23.719 15.548  0.44 165.75 ? 22  DG  F "C5'" 1 
ATOM   4472 C "C4'" . DG  F 3 22  ? -62.248 22.611 14.822  0.44 168.46 ? 22  DG  F "C4'" 1 
ATOM   4473 O "O4'" . DG  F 3 22  ? -60.828 22.892 14.800  0.44 173.63 ? 22  DG  F "O4'" 1 
ATOM   4474 C "C3'" . DG  F 3 22  ? -62.403 21.223 15.451  0.44 166.52 ? 22  DG  F "C3'" 1 
ATOM   4475 O "O3'" . DG  F 3 22  ? -62.751 20.266 14.445  0.44 165.99 ? 22  DG  F "O3'" 1 
ATOM   4476 C "C2'" . DG  F 3 22  ? -61.032 20.932 16.038  0.44 169.33 ? 22  DG  F "C2'" 1 
ATOM   4477 C "C1'" . DG  F 3 22  ? -60.115 21.713 15.118  0.44 176.28 ? 22  DG  F "C1'" 1 
ATOM   4478 N N9    . DG  F 3 22  ? -58.843 22.104 15.718  0.44 187.32 ? 22  DG  F N9    1 
ATOM   4479 C C8    . DG  F 3 22  ? -58.651 22.953 16.781  0.44 193.69 ? 22  DG  F C8    1 
ATOM   4480 N N7    . DG  F 3 22  ? -57.393 23.106 17.094  0.44 195.81 ? 22  DG  F N7    1 
ATOM   4481 C C5    . DG  F 3 22  ? -56.713 22.309 16.184  0.44 191.76 ? 22  DG  F C5    1 
ATOM   4482 C C6    . DG  F 3 22  ? -55.321 22.070 16.030  0.44 192.58 ? 22  DG  F C6    1 
ATOM   4483 O O6    . DG  F 3 22  ? -54.381 22.530 16.690  0.44 193.55 ? 22  DG  F O6    1 
ATOM   4484 N N1    . DG  F 3 22  ? -55.068 21.193 14.981  0.44 197.68 ? 22  DG  F N1    1 
ATOM   4485 C C2    . DG  F 3 22  ? -56.025 20.619 14.182  0.44 199.72 ? 22  DG  F C2    1 
ATOM   4486 N N2    . DG  F 3 22  ? -55.578 19.799 13.220  0.44 206.74 ? 22  DG  F N2    1 
ATOM   4487 N N3    . DG  F 3 22  ? -57.324 20.833 14.314  0.44 196.26 ? 22  DG  F N3    1 
ATOM   4488 C C4    . DG  F 3 22  ? -57.594 21.683 15.328  0.44 191.37 ? 22  DG  F C4    1 
ATOM   4489 P P     . DT  F 3 23  ? -62.045 18.831 14.368  0.44 165.06 ? 23  DT  F P     1 
ATOM   4490 O OP1   . DT  F 3 23  ? -62.038 18.240 15.730  0.44 163.94 ? 23  DT  F OP1   1 
ATOM   4491 O OP2   . DT  F 3 23  ? -60.766 18.980 13.626  0.44 156.69 ? 23  DT  F OP2   1 
ATOM   4492 O "O5'" . DT  F 3 23  ? -63.050 17.991 13.460  0.44 170.54 ? 23  DT  F "O5'" 1 
ATOM   4493 C "C5'" . DT  F 3 23  ? -63.679 16.795 13.957  0.44 180.01 ? 23  DT  F "C5'" 1 
ATOM   4494 C "C4'" . DT  F 3 23  ? -62.829 15.585 13.645  0.44 192.39 ? 23  DT  F "C4'" 1 
ATOM   4495 O "O4'" . DT  F 3 23  ? -61.532 16.000 13.167  0.44 194.19 ? 23  DT  F "O4'" 1 
ATOM   4496 C "C3'" . DT  F 3 23  ? -62.532 14.688 14.841  0.44 198.96 ? 23  DT  F "C3'" 1 
ATOM   4497 O "O3'" . DT  F 3 23  ? -63.571 13.718 15.007  0.44 204.69 ? 23  DT  F "O3'" 1 
ATOM   4498 C "C2'" . DT  F 3 23  ? -61.223 14.021 14.452  0.44 199.57 ? 23  DT  F "C2'" 1 
ATOM   4499 C "C1'" . DT  F 3 23  ? -60.572 14.990 13.460  0.44 195.38 ? 23  DT  F "C1'" 1 
ATOM   4500 N N1    . DT  F 3 23  ? -59.352 15.653 13.963  0.44 193.34 ? 23  DT  F N1    1 
ATOM   4501 C C2    . DT  F 3 23  ? -58.131 15.235 13.482  0.44 192.35 ? 23  DT  F C2    1 
ATOM   4502 O O2    . DT  F 3 23  ? -58.010 14.343 12.658  0.44 185.90 ? 23  DT  F O2    1 
ATOM   4503 N N3    . DT  F 3 23  ? -57.050 15.904 14.004  0.44 194.91 ? 23  DT  F N3    1 
ATOM   4504 C C4    . DT  F 3 23  ? -57.071 16.925 14.937  0.44 193.24 ? 23  DT  F C4    1 
ATOM   4505 O O4    . DT  F 3 23  ? -56.016 17.431 15.314  0.44 190.68 ? 23  DT  F O4    1 
ATOM   4506 C C5    . DT  F 3 23  ? -58.386 17.311 15.398  0.44 191.02 ? 23  DT  F C5    1 
ATOM   4507 C C7    . DT  F 3 23  ? -58.508 18.406 16.409  0.44 190.53 ? 23  DT  F C7    1 
ATOM   4508 C C6    . DT  F 3 23  ? -59.445 16.664 14.895  0.44 192.05 ? 23  DT  F C6    1 
HETATM 4509 O O     . HOH G 4 .   ? -31.014 62.078 -14.706 1.00 65.79  ? 1   HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   105 ?   ?   ?   A . n 
A 1 2   SER 2   106 ?   ?   ?   A . n 
A 1 3   HIS 3   107 ?   ?   ?   A . n 
A 1 4   MET 4   108 ?   ?   ?   A . n 
A 1 5   ALA 5   109 ?   ?   ?   A . n 
A 1 6   SER 6   110 ?   ?   ?   A . n 
A 1 7   PHE 7   111 ?   ?   ?   A . n 
A 1 8   ASN 8   112 ?   ?   ?   A . n 
A 1 9   GLY 9   113 ?   ?   ?   A . n 
A 1 10  VAL 10  114 ?   ?   ?   A . n 
A 1 11  SER 11  115 ?   ?   ?   A . n 
A 1 12  GLU 12  116 ?   ?   ?   A . n 
A 1 13  ALA 13  117 ?   ?   ?   A . n 
A 1 14  GLU 14  118 ?   ?   ?   A . n 
A 1 15  LEU 15  119 ?   ?   ?   A . n 
A 1 16  LEU 16  120 120 LEU LEU A . n 
A 1 17  THR 17  121 121 THR THR A . n 
A 1 18  LYS 18  122 122 LYS LYS A . n 
A 1 19  THR 19  123 123 THR THR A . n 
A 1 20  LEU 20  124 124 LEU LEU A . n 
A 1 21  PRO 21  125 125 PRO PRO A . n 
A 1 22  ASP 22  126 126 ASP ASP A . n 
A 1 23  ILE 23  127 127 ILE ILE A . n 
A 1 24  LEU 24  128 128 LEU LEU A . n 
A 1 25  THR 25  129 129 THR THR A . n 
A 1 26  PHE 26  130 130 PHE PHE A . n 
A 1 27  ASN 27  131 131 ASN ASN A . n 
A 1 28  LEU 28  132 132 LEU LEU A . n 
A 1 29  ASP 29  133 133 ASP ASP A . n 
A 1 30  ILE 30  134 134 ILE ILE A . n 
A 1 31  VAL 31  135 135 VAL VAL A . n 
A 1 32  ILE 32  136 136 ILE ILE A . n 
A 1 33  ILE 33  137 137 ILE ILE A . n 
A 1 34  GLY 34  138 138 GLY GLY A . n 
A 1 35  ILE 35  139 139 ILE ILE A . n 
A 1 36  ASN 36  140 140 ASN ASN A . n 
A 1 37  PRO 37  141 141 PRO PRO A . n 
A 1 38  GLY 38  142 142 GLY GLY A . n 
A 1 39  LEU 39  143 143 LEU LEU A . n 
A 1 40  MET 40  144 144 MET MET A . n 
A 1 41  ALA 41  145 145 ALA ALA A . n 
A 1 42  ALA 42  146 146 ALA ALA A . n 
A 1 43  TYR 43  147 147 TYR TYR A . n 
A 1 44  LYS 44  148 148 LYS LYS A . n 
A 1 45  GLY 45  149 149 GLY GLY A . n 
A 1 46  HIS 46  150 150 HIS HIS A . n 
A 1 47  HIS 47  151 151 HIS HIS A . n 
A 1 48  TYR 48  152 152 TYR TYR A . n 
A 1 49  PRO 49  153 153 PRO PRO A . n 
A 1 50  GLY 50  154 154 GLY GLY A . n 
A 1 51  PRO 51  155 155 PRO PRO A . n 
A 1 52  GLY 52  156 156 GLY GLY A . n 
A 1 53  ASN 53  157 157 ASN ASN A . n 
A 1 54  HIS 54  158 158 HIS HIS A . n 
A 1 55  PHE 55  159 159 PHE PHE A . n 
A 1 56  TRP 56  160 160 TRP TRP A . n 
A 1 57  LYS 57  161 161 LYS LYS A . n 
A 1 58  CYS 58  162 162 CYS CYS A . n 
A 1 59  LEU 59  163 163 LEU LEU A . n 
A 1 60  PHE 60  164 164 PHE PHE A . n 
A 1 61  MET 61  165 165 MET MET A . n 
A 1 62  SER 62  166 166 SER SER A . n 
A 1 63  GLY 63  167 167 GLY GLY A . n 
A 1 64  LEU 64  168 168 LEU LEU A . n 
A 1 65  SER 65  169 169 SER SER A . n 
A 1 66  GLU 66  170 170 GLU GLU A . n 
A 1 67  VAL 67  171 171 VAL VAL A . n 
A 1 68  GLN 68  172 172 GLN GLN A . n 
A 1 69  LEU 69  173 173 LEU LEU A . n 
A 1 70  ASN 70  174 174 ASN ASN A . n 
A 1 71  HIS 71  175 175 HIS HIS A . n 
A 1 72  MET 72  176 176 MET MET A . n 
A 1 73  ASP 73  177 177 ASP ASP A . n 
A 1 74  ASP 74  178 178 ASP ASP A . n 
A 1 75  HIS 75  179 179 HIS HIS A . n 
A 1 76  THR 76  180 180 THR THR A . n 
A 1 77  LEU 77  181 181 LEU LEU A . n 
A 1 78  PRO 78  182 182 PRO PRO A . n 
A 1 79  GLY 79  183 183 GLY GLY A . n 
A 1 80  LYS 80  184 184 LYS LYS A . n 
A 1 81  TYR 81  185 185 TYR TYR A . n 
A 1 82  GLY 82  186 186 GLY GLY A . n 
A 1 83  ILE 83  187 187 ILE ILE A . n 
A 1 84  GLY 84  188 188 GLY GLY A . n 
A 1 85  PHE 85  189 189 PHE PHE A . n 
A 1 86  THR 86  190 190 THR THR A . n 
A 1 87  ASN 87  191 191 ASN ASN A . n 
A 1 88  MET 88  192 192 MET MET A . n 
A 1 89  VAL 89  193 193 VAL VAL A . n 
A 1 90  GLU 90  194 194 GLU GLU A . n 
A 1 91  ARG 91  195 195 ARG ARG A . n 
A 1 92  THR 92  196 196 THR THR A . n 
A 1 93  THR 93  197 197 THR THR A . n 
A 1 94  PRO 94  198 198 PRO PRO A . n 
A 1 95  GLY 95  199 199 GLY GLY A . n 
A 1 96  SER 96  200 200 SER SER A . n 
A 1 97  LYS 97  201 201 LYS LYS A . n 
A 1 98  ASP 98  202 202 ASP ASP A . n 
A 1 99  LEU 99  203 203 LEU LEU A . n 
A 1 100 SER 100 204 204 SER SER A . n 
A 1 101 SER 101 205 205 SER SER A . n 
A 1 102 LYS 102 206 206 LYS LYS A . n 
A 1 103 GLU 103 207 207 GLU GLU A . n 
A 1 104 PHE 104 208 208 PHE PHE A . n 
A 1 105 ARG 105 209 209 ARG ARG A . n 
A 1 106 GLU 106 210 210 GLU GLU A . n 
A 1 107 GLY 107 211 211 GLY GLY A . n 
A 1 108 GLY 108 212 212 GLY GLY A . n 
A 1 109 ARG 109 213 213 ARG ARG A . n 
A 1 110 ILE 110 214 214 ILE ILE A . n 
A 1 111 LEU 111 215 215 LEU LEU A . n 
A 1 112 VAL 112 216 216 VAL VAL A . n 
A 1 113 GLN 113 217 217 GLN GLN A . n 
A 1 114 LYS 114 218 218 LYS LYS A . n 
A 1 115 LEU 115 219 219 LEU LEU A . n 
A 1 116 GLN 116 220 220 GLN GLN A . n 
A 1 117 LYS 117 221 221 LYS LYS A . n 
A 1 118 TYR 118 222 222 TYR TYR A . n 
A 1 119 GLN 119 223 223 GLN GLN A . n 
A 1 120 PRO 120 224 224 PRO PRO A . n 
A 1 121 ARG 121 225 225 ARG ARG A . n 
A 1 122 ILE 122 226 226 ILE ILE A . n 
A 1 123 ALA 123 227 227 ALA ALA A . n 
A 1 124 VAL 124 228 228 VAL VAL A . n 
A 1 125 PHE 125 229 229 PHE PHE A . n 
A 1 126 ASN 126 230 230 ASN ASN A . n 
A 1 127 GLY 127 231 231 GLY GLY A . n 
A 1 128 LYS 128 232 232 LYS LYS A . n 
A 1 129 CYS 129 233 233 CYS CYS A . n 
A 1 130 ILE 130 234 234 ILE ILE A . n 
A 1 131 TYR 131 235 235 TYR TYR A . n 
A 1 132 GLU 132 236 236 GLU GLU A . n 
A 1 133 ILE 133 237 237 ILE ILE A . n 
A 1 134 PHE 134 238 238 PHE PHE A . n 
A 1 135 SER 135 239 239 SER SER A . n 
A 1 136 LYS 136 240 240 LYS LYS A . n 
A 1 137 GLU 137 241 241 GLU GLU A . n 
A 1 138 VAL 138 242 242 VAL VAL A . n 
A 1 139 PHE 139 243 243 PHE PHE A . n 
A 1 140 GLY 140 244 244 GLY GLY A . n 
A 1 141 VAL 141 245 245 VAL VAL A . n 
A 1 142 LYS 142 246 246 LYS LYS A . n 
A 1 143 VAL 143 247 247 VAL VAL A . n 
A 1 144 LYS 144 248 248 LYS LYS A . n 
A 1 145 ASN 145 249 249 ASN ASN A . n 
A 1 146 LEU 146 250 250 LEU LEU A . n 
A 1 147 GLU 147 251 251 GLU GLU A . n 
A 1 148 PHE 148 252 252 PHE PHE A . n 
A 1 149 GLY 149 253 253 GLY GLY A . n 
A 1 150 LEU 150 254 254 LEU LEU A . n 
A 1 151 GLN 151 255 255 GLN GLN A . n 
A 1 152 PRO 152 256 256 PRO PRO A . n 
A 1 153 HIS 153 257 257 HIS HIS A . n 
A 1 154 LYS 154 258 258 LYS LYS A . n 
A 1 155 ILE 155 259 259 ILE ILE A . n 
A 1 156 PRO 156 260 260 PRO PRO A . n 
A 1 157 ASP 157 261 261 ASP ASP A . n 
A 1 158 THR 158 262 262 THR THR A . n 
A 1 159 GLU 159 263 263 GLU GLU A . n 
A 1 160 THR 160 264 264 THR THR A . n 
A 1 161 LEU 161 265 265 LEU LEU A . n 
A 1 162 CYS 162 266 266 CYS CYS A . n 
A 1 163 TYR 163 267 267 TYR TYR A . n 
A 1 164 VAL 164 268 268 VAL VAL A . n 
A 1 165 MET 165 269 269 MET MET A . n 
A 1 166 PRO 166 270 270 PRO PRO A . n 
A 1 167 SER 167 271 271 SER SER A . n 
A 1 168 SER 168 272 272 SER SER A . n 
A 1 169 SER 169 273 273 SER SER A . n 
A 1 170 ALA 170 274 274 ALA ALA A . n 
A 1 171 ARG 171 275 275 ARG ARG A . n 
A 1 172 CYS 172 276 276 CYS CYS A . n 
A 1 173 ALA 173 277 277 ALA ALA A . n 
A 1 174 GLN 174 278 278 GLN GLN A . n 
A 1 175 PHE 175 279 279 PHE PHE A . n 
A 1 176 PRO 176 280 280 PRO PRO A . n 
A 1 177 ARG 177 281 281 ARG ARG A . n 
A 1 178 ALA 178 282 282 ALA ALA A . n 
A 1 179 GLN 179 283 283 GLN GLN A . n 
A 1 180 ASP 180 284 284 ASP ASP A . n 
A 1 181 LYS 181 285 285 LYS LYS A . n 
A 1 182 VAL 182 286 286 VAL VAL A . n 
A 1 183 HIS 183 287 287 HIS HIS A . n 
A 1 184 TYR 184 288 288 TYR TYR A . n 
A 1 185 TYR 185 289 289 TYR TYR A . n 
A 1 186 ILE 186 290 290 ILE ILE A . n 
A 1 187 LYS 187 291 291 LYS LYS A . n 
A 1 188 LEU 188 292 292 LEU LEU A . n 
A 1 189 LYS 189 293 293 LYS LYS A . n 
A 1 190 ASP 190 294 294 ASP ASP A . n 
A 1 191 LEU 191 295 295 LEU LEU A . n 
A 1 192 ARG 192 296 296 ARG ARG A . n 
A 1 193 ASP 193 297 297 ASP ASP A . n 
A 1 194 GLN 194 298 298 GLN GLN A . n 
A 1 195 LEU 195 299 299 LEU LEU A . n 
A 1 196 LYS 196 300 300 LYS LYS A . n 
A 1 197 GLY 197 301 301 GLY GLY A . n 
A 1 198 ILE 198 302 302 ILE ILE A . n 
A 1 199 GLU 199 303 303 GLU GLU A . n 
A 1 200 ARG 200 304 304 ARG ARG A . n 
A 1 201 ASN 201 305 ?   ?   ?   A . n 
A 1 202 MET 202 306 ?   ?   ?   A . n 
A 1 203 ASP 203 307 ?   ?   ?   A . n 
A 1 204 VAL 204 308 ?   ?   ?   A . n 
B 1 1   GLY 1   105 ?   ?   ?   B . n 
B 1 2   SER 2   106 ?   ?   ?   B . n 
B 1 3   HIS 3   107 ?   ?   ?   B . n 
B 1 4   MET 4   108 ?   ?   ?   B . n 
B 1 5   ALA 5   109 ?   ?   ?   B . n 
B 1 6   SER 6   110 ?   ?   ?   B . n 
B 1 7   PHE 7   111 ?   ?   ?   B . n 
B 1 8   ASN 8   112 ?   ?   ?   B . n 
B 1 9   GLY 9   113 ?   ?   ?   B . n 
B 1 10  VAL 10  114 ?   ?   ?   B . n 
B 1 11  SER 11  115 ?   ?   ?   B . n 
B 1 12  GLU 12  116 ?   ?   ?   B . n 
B 1 13  ALA 13  117 ?   ?   ?   B . n 
B 1 14  GLU 14  118 ?   ?   ?   B . n 
B 1 15  LEU 15  119 ?   ?   ?   B . n 
B 1 16  LEU 16  120 ?   ?   ?   B . n 
B 1 17  THR 17  121 ?   ?   ?   B . n 
B 1 18  LYS 18  122 ?   ?   ?   B . n 
B 1 19  THR 19  123 123 THR THR B . n 
B 1 20  LEU 20  124 124 LEU LEU B . n 
B 1 21  PRO 21  125 125 PRO PRO B . n 
B 1 22  ASP 22  126 126 ASP ASP B . n 
B 1 23  ILE 23  127 127 ILE ILE B . n 
B 1 24  LEU 24  128 128 LEU LEU B . n 
B 1 25  THR 25  129 129 THR THR B . n 
B 1 26  PHE 26  130 130 PHE PHE B . n 
B 1 27  ASN 27  131 131 ASN ASN B . n 
B 1 28  LEU 28  132 132 LEU LEU B . n 
B 1 29  ASP 29  133 133 ASP ASP B . n 
B 1 30  ILE 30  134 134 ILE ILE B . n 
B 1 31  VAL 31  135 135 VAL VAL B . n 
B 1 32  ILE 32  136 136 ILE ILE B . n 
B 1 33  ILE 33  137 137 ILE ILE B . n 
B 1 34  GLY 34  138 138 GLY GLY B . n 
B 1 35  ILE 35  139 139 ILE ILE B . n 
B 1 36  ASN 36  140 140 ASN ASN B . n 
B 1 37  PRO 37  141 141 PRO PRO B . n 
B 1 38  GLY 38  142 142 GLY GLY B . n 
B 1 39  LEU 39  143 143 LEU LEU B . n 
B 1 40  MET 40  144 144 MET MET B . n 
B 1 41  ALA 41  145 145 ALA ALA B . n 
B 1 42  ALA 42  146 146 ALA ALA B . n 
B 1 43  TYR 43  147 147 TYR TYR B . n 
B 1 44  LYS 44  148 148 LYS LYS B . n 
B 1 45  GLY 45  149 149 GLY GLY B . n 
B 1 46  HIS 46  150 150 HIS HIS B . n 
B 1 47  HIS 47  151 151 HIS HIS B . n 
B 1 48  TYR 48  152 152 TYR TYR B . n 
B 1 49  PRO 49  153 153 PRO PRO B . n 
B 1 50  GLY 50  154 154 GLY GLY B . n 
B 1 51  PRO 51  155 155 PRO PRO B . n 
B 1 52  GLY 52  156 156 GLY GLY B . n 
B 1 53  ASN 53  157 157 ASN ASN B . n 
B 1 54  HIS 54  158 158 HIS HIS B . n 
B 1 55  PHE 55  159 159 PHE PHE B . n 
B 1 56  TRP 56  160 160 TRP TRP B . n 
B 1 57  LYS 57  161 161 LYS LYS B . n 
B 1 58  CYS 58  162 162 CYS CYS B . n 
B 1 59  LEU 59  163 163 LEU LEU B . n 
B 1 60  PHE 60  164 164 PHE PHE B . n 
B 1 61  MET 61  165 165 MET MET B . n 
B 1 62  SER 62  166 166 SER SER B . n 
B 1 63  GLY 63  167 167 GLY GLY B . n 
B 1 64  LEU 64  168 168 LEU LEU B . n 
B 1 65  SER 65  169 169 SER SER B . n 
B 1 66  GLU 66  170 170 GLU GLU B . n 
B 1 67  VAL 67  171 171 VAL VAL B . n 
B 1 68  GLN 68  172 172 GLN GLN B . n 
B 1 69  LEU 69  173 173 LEU LEU B . n 
B 1 70  ASN 70  174 174 ASN ASN B . n 
B 1 71  HIS 71  175 175 HIS HIS B . n 
B 1 72  MET 72  176 176 MET MET B . n 
B 1 73  ASP 73  177 177 ASP ASP B . n 
B 1 74  ASP 74  178 178 ASP ASP B . n 
B 1 75  HIS 75  179 179 HIS HIS B . n 
B 1 76  THR 76  180 180 THR THR B . n 
B 1 77  LEU 77  181 181 LEU LEU B . n 
B 1 78  PRO 78  182 182 PRO PRO B . n 
B 1 79  GLY 79  183 183 GLY GLY B . n 
B 1 80  LYS 80  184 184 LYS LYS B . n 
B 1 81  TYR 81  185 185 TYR TYR B . n 
B 1 82  GLY 82  186 186 GLY GLY B . n 
B 1 83  ILE 83  187 187 ILE ILE B . n 
B 1 84  GLY 84  188 188 GLY GLY B . n 
B 1 85  PHE 85  189 189 PHE PHE B . n 
B 1 86  THR 86  190 190 THR THR B . n 
B 1 87  ASN 87  191 191 ASN ASN B . n 
B 1 88  MET 88  192 192 MET MET B . n 
B 1 89  VAL 89  193 193 VAL VAL B . n 
B 1 90  GLU 90  194 194 GLU GLU B . n 
B 1 91  ARG 91  195 195 ARG ARG B . n 
B 1 92  THR 92  196 196 THR THR B . n 
B 1 93  THR 93  197 197 THR THR B . n 
B 1 94  PRO 94  198 198 PRO PRO B . n 
B 1 95  GLY 95  199 199 GLY GLY B . n 
B 1 96  SER 96  200 200 SER SER B . n 
B 1 97  LYS 97  201 201 LYS LYS B . n 
B 1 98  ASP 98  202 202 ASP ASP B . n 
B 1 99  LEU 99  203 203 LEU LEU B . n 
B 1 100 SER 100 204 204 SER SER B . n 
B 1 101 SER 101 205 205 SER SER B . n 
B 1 102 LYS 102 206 206 LYS LYS B . n 
B 1 103 GLU 103 207 207 GLU GLU B . n 
B 1 104 PHE 104 208 208 PHE PHE B . n 
B 1 105 ARG 105 209 209 ARG ARG B . n 
B 1 106 GLU 106 210 210 GLU GLU B . n 
B 1 107 GLY 107 211 211 GLY GLY B . n 
B 1 108 GLY 108 212 212 GLY GLY B . n 
B 1 109 ARG 109 213 213 ARG ARG B . n 
B 1 110 ILE 110 214 214 ILE ILE B . n 
B 1 111 LEU 111 215 215 LEU LEU B . n 
B 1 112 VAL 112 216 216 VAL VAL B . n 
B 1 113 GLN 113 217 217 GLN GLN B . n 
B 1 114 LYS 114 218 218 LYS LYS B . n 
B 1 115 LEU 115 219 219 LEU LEU B . n 
B 1 116 GLN 116 220 220 GLN GLN B . n 
B 1 117 LYS 117 221 221 LYS LYS B . n 
B 1 118 TYR 118 222 222 TYR TYR B . n 
B 1 119 GLN 119 223 223 GLN GLN B . n 
B 1 120 PRO 120 224 224 PRO PRO B . n 
B 1 121 ARG 121 225 225 ARG ARG B . n 
B 1 122 ILE 122 226 226 ILE ILE B . n 
B 1 123 ALA 123 227 227 ALA ALA B . n 
B 1 124 VAL 124 228 228 VAL VAL B . n 
B 1 125 PHE 125 229 229 PHE PHE B . n 
B 1 126 ASN 126 230 230 ASN ASN B . n 
B 1 127 GLY 127 231 231 GLY GLY B . n 
B 1 128 LYS 128 232 232 LYS LYS B . n 
B 1 129 CYS 129 233 233 CYS CYS B . n 
B 1 130 ILE 130 234 234 ILE ILE B . n 
B 1 131 TYR 131 235 235 TYR TYR B . n 
B 1 132 GLU 132 236 236 GLU GLU B . n 
B 1 133 ILE 133 237 237 ILE ILE B . n 
B 1 134 PHE 134 238 238 PHE PHE B . n 
B 1 135 SER 135 239 239 SER SER B . n 
B 1 136 LYS 136 240 240 LYS LYS B . n 
B 1 137 GLU 137 241 241 GLU GLU B . n 
B 1 138 VAL 138 242 242 VAL VAL B . n 
B 1 139 PHE 139 243 243 PHE PHE B . n 
B 1 140 GLY 140 244 244 GLY GLY B . n 
B 1 141 VAL 141 245 245 VAL VAL B . n 
B 1 142 LYS 142 246 246 LYS LYS B . n 
B 1 143 VAL 143 247 247 VAL VAL B . n 
B 1 144 LYS 144 248 248 LYS LYS B . n 
B 1 145 ASN 145 249 249 ASN ASN B . n 
B 1 146 LEU 146 250 250 LEU LEU B . n 
B 1 147 GLU 147 251 251 GLU GLU B . n 
B 1 148 PHE 148 252 252 PHE PHE B . n 
B 1 149 GLY 149 253 253 GLY GLY B . n 
B 1 150 LEU 150 254 254 LEU LEU B . n 
B 1 151 GLN 151 255 255 GLN GLN B . n 
B 1 152 PRO 152 256 256 PRO PRO B . n 
B 1 153 HIS 153 257 257 HIS HIS B . n 
B 1 154 LYS 154 258 258 LYS LYS B . n 
B 1 155 ILE 155 259 259 ILE ILE B . n 
B 1 156 PRO 156 260 260 PRO PRO B . n 
B 1 157 ASP 157 261 261 ASP ASP B . n 
B 1 158 THR 158 262 262 THR THR B . n 
B 1 159 GLU 159 263 263 GLU GLU B . n 
B 1 160 THR 160 264 264 THR THR B . n 
B 1 161 LEU 161 265 265 LEU LEU B . n 
B 1 162 CYS 162 266 266 CYS CYS B . n 
B 1 163 TYR 163 267 267 TYR TYR B . n 
B 1 164 VAL 164 268 268 VAL VAL B . n 
B 1 165 MET 165 269 269 MET MET B . n 
B 1 166 PRO 166 270 270 PRO PRO B . n 
B 1 167 SER 167 271 271 SER SER B . n 
B 1 168 SER 168 272 272 SER SER B . n 
B 1 169 SER 169 273 273 SER SER B . n 
B 1 170 ALA 170 274 274 ALA ALA B . n 
B 1 171 ARG 171 275 275 ARG ARG B . n 
B 1 172 CYS 172 276 276 CYS CYS B . n 
B 1 173 ALA 173 277 277 ALA ALA B . n 
B 1 174 GLN 174 278 278 GLN GLN B . n 
B 1 175 PHE 175 279 279 PHE PHE B . n 
B 1 176 PRO 176 280 280 PRO PRO B . n 
B 1 177 ARG 177 281 281 ARG ARG B . n 
B 1 178 ALA 178 282 282 ALA ALA B . n 
B 1 179 GLN 179 283 283 GLN GLN B . n 
B 1 180 ASP 180 284 284 ASP ASP B . n 
B 1 181 LYS 181 285 285 LYS LYS B . n 
B 1 182 VAL 182 286 286 VAL VAL B . n 
B 1 183 HIS 183 287 287 HIS HIS B . n 
B 1 184 TYR 184 288 288 TYR TYR B . n 
B 1 185 TYR 185 289 289 TYR TYR B . n 
B 1 186 ILE 186 290 290 ILE ILE B . n 
B 1 187 LYS 187 291 291 LYS LYS B . n 
B 1 188 LEU 188 292 292 LEU LEU B . n 
B 1 189 LYS 189 293 293 LYS LYS B . n 
B 1 190 ASP 190 294 294 ASP ASP B . n 
B 1 191 LEU 191 295 295 LEU LEU B . n 
B 1 192 ARG 192 296 296 ARG ARG B . n 
B 1 193 ASP 193 297 297 ASP ASP B . n 
B 1 194 GLN 194 298 298 GLN GLN B . n 
B 1 195 LEU 195 299 299 LEU LEU B . n 
B 1 196 LYS 196 300 300 LYS LYS B . n 
B 1 197 GLY 197 301 301 GLY GLY B . n 
B 1 198 ILE 198 302 302 ILE ILE B . n 
B 1 199 GLU 199 303 303 GLU GLU B . n 
B 1 200 ARG 200 304 304 ARG ARG B . n 
B 1 201 ASN 201 305 ?   ?   ?   B . n 
B 1 202 MET 202 306 ?   ?   ?   B . n 
B 1 203 ASP 203 307 ?   ?   ?   B . n 
B 1 204 VAL 204 308 ?   ?   ?   B . n 
C 2 1   DC  1   1   1   DC  DC  C . n 
C 2 2   DA  2   2   2   DA  DA  C . n 
C 2 3   DG  3   3   3   DG  DG  C . n 
C 2 4   DC  4   4   4   DC  DC  C . n 
C 2 5   DT  5   5   5   DT  DT  C . n 
C 2 6   DC  6   6   6   DC  DC  C . n 
C 2 7   DT  7   7   7   DT  DT  C . n 
C 2 8   DG  8   8   8   DG  DG  C . n 
C 2 9   DT  9   9   9   DT  DT  C . n 
C 2 10  DA  10  10  10  DA  DA  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
C 2 12  DG  12  12  12  DG  DG  C . n 
C 2 13  DT  13  13  13  DT  DT  C . n 
C 2 14  DG  14  14  14  DG  DG  C . n 
C 2 15  DA  15  15  15  DA  DA  C . n 
C 2 16  DG  16  16  16  DG  DG  C . n 
C 2 17  DC  17  17  17  DC  DC  C . n 
C 2 18  DA  18  18  18  DA  DA  C . n 
C 2 19  DG  19  19  19  DG  DG  C . n 
C 2 20  DT  20  20  20  DT  DT  C . n 
C 2 21  DG  21  21  21  DG  DG  C . n 
C 2 22  DG  22  22  22  DG  DG  C . n 
C 2 23  DA  23  23  23  DA  DA  C . n 
D 3 1   DC  1   1   1   DC  DC  D . n 
D 3 2   DC  2   2   2   DC  DC  D . n 
D 3 3   DA  3   3   3   DA  DA  D . n 
D 3 4   DC  4   4   4   DC  DC  D . n 
D 3 5   DT  5   5   5   DT  DT  D . n 
D 3 6   DG  6   6   6   DG  DG  D . n 
D 3 7   DC  7   7   7   DC  DC  D . n 
D 3 8   DT  8   8   8   DT  DT  D . n 
D 3 9   DC  9   9   9   DC  DC  D . n 
D 3 10  DA  10  10  10  DA  DA  D . n 
D 3 11  UF2 11  11  11  UF2 UMF D . n 
D 3 12  DG  12  12  12  DG  DG  D . n 
D 3 13  DT  13  13  13  DT  DT  D . n 
D 3 14  DA  14  14  14  DA  DA  D . n 
D 3 15  DC  15  15  15  DC  DC  D . n 
D 3 16  DA  16  16  16  DA  DA  D . n 
D 3 17  DG  17  17  17  DG  DG  D . n 
D 3 18  DA  18  18  18  DA  DA  D . n 
D 3 19  DG  19  19  19  DG  DG  D . n 
D 3 20  DC  20  20  20  DC  DC  D . n 
D 3 21  DT  21  21  21  DT  DT  D . n 
D 3 22  DG  22  22  22  DG  DG  D . n 
D 3 23  DT  23  23  23  DT  DT  D . n 
E 2 1   DC  1   1   1   DC  DC  E . n 
E 2 2   DA  2   2   2   DA  DA  E . n 
E 2 3   DG  3   3   3   DG  DG  E . n 
E 2 4   DC  4   4   4   DC  DC  E . n 
E 2 5   DT  5   5   5   DT  DT  E . n 
E 2 6   DC  6   6   6   DC  DC  E . n 
E 2 7   DT  7   7   7   DT  DT  E . n 
E 2 8   DG  8   8   8   DG  DG  E . n 
E 2 9   DT  9   9   9   DT  DT  E . n 
E 2 10  DA  10  10  10  DA  DA  E . n 
E 2 11  DC  11  11  11  DC  DC  E . n 
E 2 12  DG  12  12  12  DG  DG  E . n 
E 2 13  DT  13  13  13  DT  DT  E . n 
E 2 14  DG  14  14  14  DG  DG  E . n 
E 2 15  DA  15  15  15  DA  DA  E . n 
E 2 16  DG  16  16  16  DG  DG  E . n 
E 2 17  DC  17  17  17  DC  DC  E . n 
E 2 18  DA  18  18  18  DA  DA  E . n 
E 2 19  DG  19  19  19  DG  DG  E . n 
E 2 20  DT  20  20  20  DT  DT  E . n 
E 2 21  DG  21  21  21  DG  DG  E . n 
E 2 22  DG  22  22  22  DG  DG  E . n 
E 2 23  DA  23  23  23  DA  DA  E . n 
F 3 1   DC  1   1   1   DC  DC  F . n 
F 3 2   DC  2   2   2   DC  DC  F . n 
F 3 3   DA  3   3   3   DA  DA  F . n 
F 3 4   DC  4   4   4   DC  DC  F . n 
F 3 5   DT  5   5   5   DT  DT  F . n 
F 3 6   DG  6   6   6   DG  DG  F . n 
F 3 7   DC  7   7   7   DC  DC  F . n 
F 3 8   DT  8   8   8   DT  DT  F . n 
F 3 9   DC  9   9   9   DC  DC  F . n 
F 3 10  DA  10  10  10  DA  DA  F . n 
F 3 11  UF2 11  11  11  UF2 UMF F . n 
F 3 12  DG  12  12  12  DG  DG  F . n 
F 3 13  DT  13  13  13  DT  DT  F . n 
F 3 14  DA  14  14  14  DA  DA  F . n 
F 3 15  DC  15  15  15  DC  DC  F . n 
F 3 16  DA  16  16  16  DA  DA  F . n 
F 3 17  DG  17  17  17  DG  DG  F . n 
F 3 18  DA  18  18  18  DA  DA  F . n 
F 3 19  DG  19  19  19  DG  DG  F . n 
F 3 20  DC  20  20  20  DC  DC  F . n 
F 3 21  DT  21  21  21  DT  DT  F . n 
F 3 22  DG  22  22  22  DG  DG  F . n 
F 3 23  DT  23  23  23  DT  DT  F . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 D UF2 11 D UF2 11 ? DU ? 
2 F UF2 11 F UF2 11 ? DU ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,G 
2 1 A,B,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-04-25 
2 'Structure model' 1 1 2012-05-23 
3 'Structure model' 1 2 2012-06-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice   'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.6.0117 ? 3 
DENZO     'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N A GLY 156 ? ? OP1 F DC 9 ? ? 1.81 
2 1 O A PRO 155 ? ? OP1 F DC 9 ? ? 1.82 
3 1 C A PRO 155 ? ? OP1 F DC 9 ? ? 1.98 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CE2 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            TRP 
_pdbx_validate_rmsd_bond.auth_seq_id_1             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            TRP 
_pdbx_validate_rmsd_bond.auth_seq_id_2             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.486 
_pdbx_validate_rmsd_bond.bond_target_value         1.409 
_pdbx_validate_rmsd_bond.bond_deviation            0.077 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O5'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             F 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_1              9 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             P 
_pdbx_validate_rmsd_angle.auth_asym_id_2             F 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_2              9 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OP1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             F 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_3              9 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                100.26 
_pdbx_validate_rmsd_angle.angle_target_value         105.70 
_pdbx_validate_rmsd_angle.angle_deviation            -5.44 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 122 ? ? -141.82 -32.13  
2  1 ASN A 131 ? ? 55.72   74.78   
3  1 ASP A 133 ? ? -70.97  -70.09  
4  1 PRO A 153 ? ? -74.33  -100.54 
5  1 PRO A 198 ? ? -32.14  -74.97  
6  1 VAL A 216 ? ? -28.65  -53.79  
7  1 GLN A 223 ? ? 35.00   66.73   
8  1 ASN A 249 ? ? 24.15   70.55   
9  1 SER A 273 ? ? -49.57  178.24  
10 1 PHE A 279 ? ? -110.69 68.16   
11 1 GLU A 303 ? ? -75.59  47.87   
12 1 ASN B 131 ? ? 51.02   75.53   
13 1 ASP B 133 ? ? -67.82  -77.45  
14 1 ILE B 139 ? ? -65.18  -70.45  
15 1 PRO B 153 ? ? -74.03  -99.24  
16 1 PRO B 155 ? ? -89.59  49.49   
17 1 PHE B 164 ? ? -63.64  -80.13  
18 1 THR B 190 ? ? -171.75 -176.55 
19 1 PRO B 198 ? ? -33.93  -74.99  
20 1 LYS B 201 ? ? -58.33  -2.52   
21 1 LEU B 203 ? ? -92.36  -65.88  
22 1 SER B 204 ? ? 138.28  -120.13 
23 1 SER B 205 ? ? -170.22 -67.83  
24 1 GLN B 223 ? ? 29.64   74.08   
25 1 GLU B 236 ? ? -30.73  -71.80  
26 1 ASN B 249 ? ? 23.03   77.26   
27 1 ALA B 274 ? ? -84.16  37.35   
28 1 ILE B 302 ? ? -69.43  13.02   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LEU 120 ? CG  ? A LEU 16  CG  
2   1 Y 1 A LEU 120 ? CD1 ? A LEU 16  CD1 
3   1 Y 1 A LEU 120 ? CD2 ? A LEU 16  CD2 
4   1 Y 1 A THR 121 ? OG1 ? A THR 17  OG1 
5   1 Y 1 A THR 121 ? CG2 ? A THR 17  CG2 
6   1 Y 1 A LYS 122 ? CG  ? A LYS 18  CG  
7   1 Y 1 A LYS 122 ? CD  ? A LYS 18  CD  
8   1 Y 1 A LYS 122 ? CE  ? A LYS 18  CE  
9   1 Y 1 A LYS 122 ? NZ  ? A LYS 18  NZ  
10  1 Y 1 A LYS 148 ? CD  ? A LYS 44  CD  
11  1 Y 1 A LYS 148 ? CE  ? A LYS 44  CE  
12  1 Y 1 A LYS 148 ? NZ  ? A LYS 44  NZ  
13  1 Y 1 A LYS 161 ? CG  ? A LYS 57  CG  
14  1 Y 1 A LYS 161 ? CD  ? A LYS 57  CD  
15  1 Y 1 A LYS 161 ? CE  ? A LYS 57  CE  
16  1 Y 1 A LYS 161 ? NZ  ? A LYS 57  NZ  
17  1 Y 1 A MET 165 ? CG  ? A MET 61  CG  
18  1 Y 1 A MET 165 ? SD  ? A MET 61  SD  
19  1 Y 1 A MET 165 ? CE  ? A MET 61  CE  
20  1 Y 1 A LYS 184 ? CE  ? A LYS 80  CE  
21  1 Y 1 A LYS 184 ? NZ  ? A LYS 80  NZ  
22  1 Y 1 A LYS 201 ? CG  ? A LYS 97  CG  
23  1 Y 1 A LYS 201 ? CD  ? A LYS 97  CD  
24  1 Y 1 A LYS 201 ? CE  ? A LYS 97  CE  
25  1 Y 1 A LYS 201 ? NZ  ? A LYS 97  NZ  
26  1 Y 1 A LYS 206 ? CG  ? A LYS 102 CG  
27  1 Y 1 A LYS 206 ? CD  ? A LYS 102 CD  
28  1 Y 1 A LYS 206 ? CE  ? A LYS 102 CE  
29  1 Y 1 A LYS 206 ? NZ  ? A LYS 102 NZ  
30  1 Y 1 A ARG 209 ? CG  ? A ARG 105 CG  
31  1 Y 1 A ARG 209 ? CD  ? A ARG 105 CD  
32  1 Y 1 A ARG 209 ? NE  ? A ARG 105 NE  
33  1 Y 1 A ARG 209 ? CZ  ? A ARG 105 CZ  
34  1 Y 1 A ARG 209 ? NH1 ? A ARG 105 NH1 
35  1 Y 1 A ARG 209 ? NH2 ? A ARG 105 NH2 
36  1 Y 1 A GLU 210 ? CG  ? A GLU 106 CG  
37  1 Y 1 A GLU 210 ? CD  ? A GLU 106 CD  
38  1 Y 1 A GLU 210 ? OE1 ? A GLU 106 OE1 
39  1 Y 1 A GLU 210 ? OE2 ? A GLU 106 OE2 
40  1 Y 1 A LYS 232 ? CG  ? A LYS 128 CG  
41  1 Y 1 A LYS 232 ? CD  ? A LYS 128 CD  
42  1 Y 1 A LYS 232 ? CE  ? A LYS 128 CE  
43  1 Y 1 A LYS 232 ? NZ  ? A LYS 128 NZ  
44  1 Y 1 A GLU 236 ? CG  ? A GLU 132 CG  
45  1 Y 1 A GLU 236 ? CD  ? A GLU 132 CD  
46  1 Y 1 A GLU 236 ? OE1 ? A GLU 132 OE1 
47  1 Y 1 A GLU 236 ? OE2 ? A GLU 132 OE2 
48  1 Y 1 A ILE 237 ? CG1 ? A ILE 133 CG1 
49  1 Y 1 A ILE 237 ? CG2 ? A ILE 133 CG2 
50  1 Y 1 A ILE 237 ? CD1 ? A ILE 133 CD1 
51  1 Y 1 A SER 239 ? OG  ? A SER 135 OG  
52  1 Y 1 A LYS 240 ? CG  ? A LYS 136 CG  
53  1 Y 1 A LYS 240 ? CD  ? A LYS 136 CD  
54  1 Y 1 A LYS 240 ? CE  ? A LYS 136 CE  
55  1 Y 1 A LYS 240 ? NZ  ? A LYS 136 NZ  
56  1 Y 1 A GLU 241 ? CG  ? A GLU 137 CG  
57  1 Y 1 A GLU 241 ? CD  ? A GLU 137 CD  
58  1 Y 1 A GLU 241 ? OE1 ? A GLU 137 OE1 
59  1 Y 1 A GLU 241 ? OE2 ? A GLU 137 OE2 
60  1 Y 1 A VAL 242 ? CG1 ? A VAL 138 CG1 
61  1 Y 1 A VAL 242 ? CG2 ? A VAL 138 CG2 
62  1 Y 1 A VAL 245 ? CG1 ? A VAL 141 CG1 
63  1 Y 1 A VAL 245 ? CG2 ? A VAL 141 CG2 
64  1 Y 1 A LYS 246 ? CG  ? A LYS 142 CG  
65  1 Y 1 A LYS 246 ? CD  ? A LYS 142 CD  
66  1 Y 1 A LYS 246 ? CE  ? A LYS 142 CE  
67  1 Y 1 A LYS 246 ? NZ  ? A LYS 142 NZ  
68  1 Y 1 A VAL 247 ? CG1 ? A VAL 143 CG1 
69  1 Y 1 A VAL 247 ? CG2 ? A VAL 143 CG2 
70  1 Y 1 A LYS 248 ? CG  ? A LYS 144 CG  
71  1 Y 1 A LYS 248 ? CD  ? A LYS 144 CD  
72  1 Y 1 A LYS 248 ? CE  ? A LYS 144 CE  
73  1 Y 1 A LYS 248 ? NZ  ? A LYS 144 NZ  
74  1 Y 1 A ASN 249 ? CG  ? A ASN 145 CG  
75  1 Y 1 A ASN 249 ? OD1 ? A ASN 145 OD1 
76  1 Y 1 A ASN 249 ? ND2 ? A ASN 145 ND2 
77  1 Y 1 A GLU 251 ? CG  ? A GLU 147 CG  
78  1 Y 1 A GLU 251 ? CD  ? A GLU 147 CD  
79  1 Y 1 A GLU 251 ? OE1 ? A GLU 147 OE1 
80  1 Y 1 A GLU 251 ? OE2 ? A GLU 147 OE2 
81  1 Y 1 A GLN 278 ? CG  ? A GLN 174 CG  
82  1 Y 1 A GLN 278 ? CD  ? A GLN 174 CD  
83  1 Y 1 A GLN 278 ? OE1 ? A GLN 174 OE1 
84  1 Y 1 A GLN 278 ? NE2 ? A GLN 174 NE2 
85  1 Y 1 A PHE 279 ? CG  ? A PHE 175 CG  
86  1 Y 1 A PHE 279 ? CD1 ? A PHE 175 CD1 
87  1 Y 1 A PHE 279 ? CD2 ? A PHE 175 CD2 
88  1 Y 1 A PHE 279 ? CE1 ? A PHE 175 CE1 
89  1 Y 1 A PHE 279 ? CE2 ? A PHE 175 CE2 
90  1 Y 1 A PHE 279 ? CZ  ? A PHE 175 CZ  
91  1 Y 1 A ARG 281 ? CG  ? A ARG 177 CG  
92  1 Y 1 A ARG 281 ? CD  ? A ARG 177 CD  
93  1 Y 1 A ARG 281 ? NE  ? A ARG 177 NE  
94  1 Y 1 A ARG 281 ? CZ  ? A ARG 177 CZ  
95  1 Y 1 A ARG 281 ? NH1 ? A ARG 177 NH1 
96  1 Y 1 A ARG 281 ? NH2 ? A ARG 177 NH2 
97  1 Y 1 A GLN 283 ? CG  ? A GLN 179 CG  
98  1 Y 1 A GLN 283 ? CD  ? A GLN 179 CD  
99  1 Y 1 A GLN 283 ? OE1 ? A GLN 179 OE1 
100 1 Y 1 A GLN 283 ? NE2 ? A GLN 179 NE2 
101 1 Y 1 A LYS 285 ? CG  ? A LYS 181 CG  
102 1 Y 1 A LYS 285 ? CD  ? A LYS 181 CD  
103 1 Y 1 A LYS 285 ? CE  ? A LYS 181 CE  
104 1 Y 1 A LYS 285 ? NZ  ? A LYS 181 NZ  
105 1 Y 1 A ILE 290 ? CG1 ? A ILE 186 CG1 
106 1 Y 1 A ILE 290 ? CG2 ? A ILE 186 CG2 
107 1 Y 1 A ILE 290 ? CD1 ? A ILE 186 CD1 
108 1 Y 1 A LYS 291 ? CG  ? A LYS 187 CG  
109 1 Y 1 A LYS 291 ? CD  ? A LYS 187 CD  
110 1 Y 1 A LYS 291 ? CE  ? A LYS 187 CE  
111 1 Y 1 A LYS 291 ? NZ  ? A LYS 187 NZ  
112 1 Y 1 A LYS 300 ? CG  ? A LYS 196 CG  
113 1 Y 1 A LYS 300 ? CD  ? A LYS 196 CD  
114 1 Y 1 A LYS 300 ? CE  ? A LYS 196 CE  
115 1 Y 1 A LYS 300 ? NZ  ? A LYS 196 NZ  
116 1 Y 1 A ILE 302 ? CG1 ? A ILE 198 CG1 
117 1 Y 1 A ILE 302 ? CG2 ? A ILE 198 CG2 
118 1 Y 1 A ILE 302 ? CD1 ? A ILE 198 CD1 
119 1 Y 1 B THR 123 ? OG1 ? B THR 19  OG1 
120 1 Y 1 B THR 123 ? CG2 ? B THR 19  CG2 
121 1 Y 1 B ILE 134 ? CG1 ? B ILE 30  CG1 
122 1 Y 1 B ILE 134 ? CG2 ? B ILE 30  CG2 
123 1 Y 1 B ILE 134 ? CD1 ? B ILE 30  CD1 
124 1 Y 1 B LYS 148 ? CE  ? B LYS 44  CE  
125 1 Y 1 B LYS 148 ? NZ  ? B LYS 44  NZ  
126 1 Y 1 B LYS 161 ? CG  ? B LYS 57  CG  
127 1 Y 1 B LYS 161 ? CD  ? B LYS 57  CD  
128 1 Y 1 B LYS 161 ? CE  ? B LYS 57  CE  
129 1 Y 1 B LYS 161 ? NZ  ? B LYS 57  NZ  
130 1 Y 1 B MET 165 ? CG  ? B MET 61  CG  
131 1 Y 1 B MET 165 ? SD  ? B MET 61  SD  
132 1 Y 1 B MET 165 ? CE  ? B MET 61  CE  
133 1 Y 1 B SER 166 ? OG  ? B SER 62  OG  
134 1 Y 1 B LEU 168 ? CD1 ? B LEU 64  CD1 
135 1 Y 1 B LEU 168 ? CD2 ? B LEU 64  CD2 
136 1 Y 1 B VAL 171 ? CG1 ? B VAL 67  CG1 
137 1 Y 1 B VAL 171 ? CG2 ? B VAL 67  CG2 
138 1 Y 1 B HIS 179 ? CG  ? B HIS 75  CG  
139 1 Y 1 B HIS 179 ? ND1 ? B HIS 75  ND1 
140 1 Y 1 B HIS 179 ? CD2 ? B HIS 75  CD2 
141 1 Y 1 B HIS 179 ? CE1 ? B HIS 75  CE1 
142 1 Y 1 B HIS 179 ? NE2 ? B HIS 75  NE2 
143 1 Y 1 B THR 180 ? OG1 ? B THR 76  OG1 
144 1 Y 1 B THR 180 ? CG2 ? B THR 76  CG2 
145 1 Y 1 B LEU 181 ? CG  ? B LEU 77  CG  
146 1 Y 1 B LEU 181 ? CD1 ? B LEU 77  CD1 
147 1 Y 1 B LEU 181 ? CD2 ? B LEU 77  CD2 
148 1 Y 1 B LYS 184 ? CG  ? B LYS 80  CG  
149 1 Y 1 B LYS 184 ? CD  ? B LYS 80  CD  
150 1 Y 1 B LYS 184 ? CE  ? B LYS 80  CE  
151 1 Y 1 B LYS 184 ? NZ  ? B LYS 80  NZ  
152 1 Y 1 B ILE 187 ? CG1 ? B ILE 83  CG1 
153 1 Y 1 B ILE 187 ? CG2 ? B ILE 83  CG2 
154 1 Y 1 B ILE 187 ? CD1 ? B ILE 83  CD1 
155 1 Y 1 B GLU 194 ? CG  ? B GLU 90  CG  
156 1 Y 1 B GLU 194 ? CD  ? B GLU 90  CD  
157 1 Y 1 B GLU 194 ? OE1 ? B GLU 90  OE1 
158 1 Y 1 B GLU 194 ? OE2 ? B GLU 90  OE2 
159 1 Y 1 B LYS 201 ? CG  ? B LYS 97  CG  
160 1 Y 1 B LYS 201 ? CD  ? B LYS 97  CD  
161 1 Y 1 B LYS 201 ? CE  ? B LYS 97  CE  
162 1 Y 1 B LYS 201 ? NZ  ? B LYS 97  NZ  
163 1 Y 1 B ASP 202 ? CG  ? B ASP 98  CG  
164 1 Y 1 B ASP 202 ? OD1 ? B ASP 98  OD1 
165 1 Y 1 B ASP 202 ? OD2 ? B ASP 98  OD2 
166 1 Y 1 B LYS 206 ? CG  ? B LYS 102 CG  
167 1 Y 1 B LYS 206 ? CD  ? B LYS 102 CD  
168 1 Y 1 B LYS 206 ? CE  ? B LYS 102 CE  
169 1 Y 1 B LYS 206 ? NZ  ? B LYS 102 NZ  
170 1 Y 1 B ARG 209 ? CD  ? B ARG 105 CD  
171 1 Y 1 B ARG 209 ? NE  ? B ARG 105 NE  
172 1 Y 1 B ARG 209 ? CZ  ? B ARG 105 CZ  
173 1 Y 1 B ARG 209 ? NH1 ? B ARG 105 NH1 
174 1 Y 1 B ARG 209 ? NH2 ? B ARG 105 NH2 
175 1 Y 1 B GLU 210 ? CG  ? B GLU 106 CG  
176 1 Y 1 B GLU 210 ? CD  ? B GLU 106 CD  
177 1 Y 1 B GLU 210 ? OE1 ? B GLU 106 OE1 
178 1 Y 1 B GLU 210 ? OE2 ? B GLU 106 OE2 
179 1 Y 1 B ARG 213 ? CG  ? B ARG 109 CG  
180 1 Y 1 B ARG 213 ? CD  ? B ARG 109 CD  
181 1 Y 1 B ARG 213 ? NE  ? B ARG 109 NE  
182 1 Y 1 B ARG 213 ? CZ  ? B ARG 109 CZ  
183 1 Y 1 B ARG 213 ? NH1 ? B ARG 109 NH1 
184 1 Y 1 B ARG 213 ? NH2 ? B ARG 109 NH2 
185 1 Y 1 B ILE 214 ? CG1 ? B ILE 110 CG1 
186 1 Y 1 B ILE 214 ? CG2 ? B ILE 110 CG2 
187 1 Y 1 B ILE 214 ? CD1 ? B ILE 110 CD1 
188 1 Y 1 B LEU 215 ? CD1 ? B LEU 111 CD1 
189 1 Y 1 B LEU 215 ? CD2 ? B LEU 111 CD2 
190 1 Y 1 B VAL 216 ? CG1 ? B VAL 112 CG1 
191 1 Y 1 B VAL 216 ? CG2 ? B VAL 112 CG2 
192 1 Y 1 B GLN 217 ? CG  ? B GLN 113 CG  
193 1 Y 1 B GLN 217 ? CD  ? B GLN 113 CD  
194 1 Y 1 B GLN 217 ? OE1 ? B GLN 113 OE1 
195 1 Y 1 B GLN 217 ? NE2 ? B GLN 113 NE2 
196 1 Y 1 B LYS 218 ? CG  ? B LYS 114 CG  
197 1 Y 1 B LYS 218 ? CD  ? B LYS 114 CD  
198 1 Y 1 B LYS 218 ? CE  ? B LYS 114 CE  
199 1 Y 1 B LYS 218 ? NZ  ? B LYS 114 NZ  
200 1 Y 1 B LEU 219 ? CG  ? B LEU 115 CG  
201 1 Y 1 B LEU 219 ? CD1 ? B LEU 115 CD1 
202 1 Y 1 B LEU 219 ? CD2 ? B LEU 115 CD2 
203 1 Y 1 B LYS 221 ? CG  ? B LYS 117 CG  
204 1 Y 1 B LYS 221 ? CD  ? B LYS 117 CD  
205 1 Y 1 B LYS 221 ? CE  ? B LYS 117 CE  
206 1 Y 1 B LYS 221 ? NZ  ? B LYS 117 NZ  
207 1 Y 1 B LYS 232 ? CG  ? B LYS 128 CG  
208 1 Y 1 B LYS 232 ? CD  ? B LYS 128 CD  
209 1 Y 1 B LYS 232 ? CE  ? B LYS 128 CE  
210 1 Y 1 B LYS 232 ? NZ  ? B LYS 128 NZ  
211 1 Y 1 B ILE 237 ? CG1 ? B ILE 133 CG1 
212 1 Y 1 B ILE 237 ? CG2 ? B ILE 133 CG2 
213 1 Y 1 B ILE 237 ? CD1 ? B ILE 133 CD1 
214 1 Y 1 B SER 239 ? OG  ? B SER 135 OG  
215 1 Y 1 B LYS 240 ? CG  ? B LYS 136 CG  
216 1 Y 1 B LYS 240 ? CD  ? B LYS 136 CD  
217 1 Y 1 B LYS 240 ? CE  ? B LYS 136 CE  
218 1 Y 1 B LYS 240 ? NZ  ? B LYS 136 NZ  
219 1 Y 1 B GLU 241 ? CG  ? B GLU 137 CG  
220 1 Y 1 B GLU 241 ? CD  ? B GLU 137 CD  
221 1 Y 1 B GLU 241 ? OE1 ? B GLU 137 OE1 
222 1 Y 1 B GLU 241 ? OE2 ? B GLU 137 OE2 
223 1 Y 1 B VAL 242 ? CG1 ? B VAL 138 CG1 
224 1 Y 1 B VAL 242 ? CG2 ? B VAL 138 CG2 
225 1 Y 1 B VAL 245 ? CG1 ? B VAL 141 CG1 
226 1 Y 1 B VAL 245 ? CG2 ? B VAL 141 CG2 
227 1 Y 1 B LYS 246 ? CG  ? B LYS 142 CG  
228 1 Y 1 B LYS 246 ? CD  ? B LYS 142 CD  
229 1 Y 1 B LYS 246 ? CE  ? B LYS 142 CE  
230 1 Y 1 B LYS 246 ? NZ  ? B LYS 142 NZ  
231 1 Y 1 B LYS 248 ? CG  ? B LYS 144 CG  
232 1 Y 1 B LYS 248 ? CD  ? B LYS 144 CD  
233 1 Y 1 B LYS 248 ? CE  ? B LYS 144 CE  
234 1 Y 1 B LYS 248 ? NZ  ? B LYS 144 NZ  
235 1 Y 1 B LEU 250 ? CD1 ? B LEU 146 CD1 
236 1 Y 1 B LEU 250 ? CD2 ? B LEU 146 CD2 
237 1 Y 1 B GLU 251 ? CG  ? B GLU 147 CG  
238 1 Y 1 B GLU 251 ? CD  ? B GLU 147 CD  
239 1 Y 1 B GLU 251 ? OE1 ? B GLU 147 OE1 
240 1 Y 1 B GLU 251 ? OE2 ? B GLU 147 OE2 
241 1 Y 1 B THR 262 ? OG1 ? B THR 158 OG1 
242 1 Y 1 B THR 262 ? CG2 ? B THR 158 CG2 
243 1 Y 1 B GLU 263 ? CD  ? B GLU 159 CD  
244 1 Y 1 B GLU 263 ? OE1 ? B GLU 159 OE1 
245 1 Y 1 B GLU 263 ? OE2 ? B GLU 159 OE2 
246 1 Y 1 B MET 269 ? SD  ? B MET 165 SD  
247 1 Y 1 B MET 269 ? CE  ? B MET 165 CE  
248 1 Y 1 B SER 272 ? OG  ? B SER 168 OG  
249 1 Y 1 B GLN 278 ? CG  ? B GLN 174 CG  
250 1 Y 1 B GLN 278 ? CD  ? B GLN 174 CD  
251 1 Y 1 B GLN 278 ? OE1 ? B GLN 174 OE1 
252 1 Y 1 B GLN 278 ? NE2 ? B GLN 174 NE2 
253 1 Y 1 B PHE 279 ? CG  ? B PHE 175 CG  
254 1 Y 1 B PHE 279 ? CD1 ? B PHE 175 CD1 
255 1 Y 1 B PHE 279 ? CD2 ? B PHE 175 CD2 
256 1 Y 1 B PHE 279 ? CE1 ? B PHE 175 CE1 
257 1 Y 1 B PHE 279 ? CE2 ? B PHE 175 CE2 
258 1 Y 1 B PHE 279 ? CZ  ? B PHE 175 CZ  
259 1 Y 1 B ARG 281 ? NE  ? B ARG 177 NE  
260 1 Y 1 B ARG 281 ? CZ  ? B ARG 177 CZ  
261 1 Y 1 B ARG 281 ? NH1 ? B ARG 177 NH1 
262 1 Y 1 B ARG 281 ? NH2 ? B ARG 177 NH2 
263 1 Y 1 B ASP 284 ? CG  ? B ASP 180 CG  
264 1 Y 1 B ASP 284 ? OD1 ? B ASP 180 OD1 
265 1 Y 1 B ASP 284 ? OD2 ? B ASP 180 OD2 
266 1 Y 1 B LYS 285 ? CG  ? B LYS 181 CG  
267 1 Y 1 B LYS 285 ? CD  ? B LYS 181 CD  
268 1 Y 1 B LYS 285 ? CE  ? B LYS 181 CE  
269 1 Y 1 B LYS 285 ? NZ  ? B LYS 181 NZ  
270 1 Y 1 B VAL 286 ? CG1 ? B VAL 182 CG1 
271 1 Y 1 B VAL 286 ? CG2 ? B VAL 182 CG2 
272 1 Y 1 B HIS 287 ? CG  ? B HIS 183 CG  
273 1 Y 1 B HIS 287 ? ND1 ? B HIS 183 ND1 
274 1 Y 1 B HIS 287 ? CD2 ? B HIS 183 CD2 
275 1 Y 1 B HIS 287 ? CE1 ? B HIS 183 CE1 
276 1 Y 1 B HIS 287 ? NE2 ? B HIS 183 NE2 
277 1 Y 1 B ILE 290 ? CG1 ? B ILE 186 CG1 
278 1 Y 1 B ILE 290 ? CG2 ? B ILE 186 CG2 
279 1 Y 1 B ILE 290 ? CD1 ? B ILE 186 CD1 
280 1 Y 1 B LYS 291 ? CG  ? B LYS 187 CG  
281 1 Y 1 B LYS 291 ? CD  ? B LYS 187 CD  
282 1 Y 1 B LYS 291 ? CE  ? B LYS 187 CE  
283 1 Y 1 B LYS 291 ? NZ  ? B LYS 187 NZ  
284 1 Y 1 B LYS 293 ? CG  ? B LYS 189 CG  
285 1 Y 1 B LYS 293 ? CD  ? B LYS 189 CD  
286 1 Y 1 B LYS 293 ? CE  ? B LYS 189 CE  
287 1 Y 1 B LYS 293 ? NZ  ? B LYS 189 NZ  
288 1 Y 1 B ASP 294 ? CG  ? B ASP 190 CG  
289 1 Y 1 B ASP 294 ? OD1 ? B ASP 190 OD1 
290 1 Y 1 B ASP 294 ? OD2 ? B ASP 190 OD2 
291 1 Y 1 B ARG 296 ? CG  ? B ARG 192 CG  
292 1 Y 1 B ARG 296 ? CD  ? B ARG 192 CD  
293 1 Y 1 B ARG 296 ? NE  ? B ARG 192 NE  
294 1 Y 1 B ARG 296 ? CZ  ? B ARG 192 CZ  
295 1 Y 1 B ARG 296 ? NH1 ? B ARG 192 NH1 
296 1 Y 1 B ARG 296 ? NH2 ? B ARG 192 NH2 
297 1 Y 1 B GLN 298 ? CG  ? B GLN 194 CG  
298 1 Y 1 B GLN 298 ? CD  ? B GLN 194 CD  
299 1 Y 1 B GLN 298 ? OE1 ? B GLN 194 OE1 
300 1 Y 1 B GLN 298 ? NE2 ? B GLN 194 NE2 
301 1 Y 1 B LYS 300 ? CG  ? B LYS 196 CG  
302 1 Y 1 B LYS 300 ? CD  ? B LYS 196 CD  
303 1 Y 1 B LYS 300 ? CE  ? B LYS 196 CE  
304 1 Y 1 B LYS 300 ? NZ  ? B LYS 196 NZ  
305 1 Y 1 B ILE 302 ? CG1 ? B ILE 198 CG1 
306 1 Y 1 B ILE 302 ? CG2 ? B ILE 198 CG2 
307 1 Y 1 B ILE 302 ? CD1 ? B ILE 198 CD1 
308 1 Y 1 B GLU 303 ? CG  ? B GLU 199 CG  
309 1 Y 1 B GLU 303 ? CD  ? B GLU 199 CD  
310 1 Y 1 B GLU 303 ? OE1 ? B GLU 199 OE1 
311 1 Y 1 B GLU 303 ? OE2 ? B GLU 199 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 105 ? A GLY 1   
2  1 Y 1 A SER 106 ? A SER 2   
3  1 Y 1 A HIS 107 ? A HIS 3   
4  1 Y 1 A MET 108 ? A MET 4   
5  1 Y 1 A ALA 109 ? A ALA 5   
6  1 Y 1 A SER 110 ? A SER 6   
7  1 Y 1 A PHE 111 ? A PHE 7   
8  1 Y 1 A ASN 112 ? A ASN 8   
9  1 Y 1 A GLY 113 ? A GLY 9   
10 1 Y 1 A VAL 114 ? A VAL 10  
11 1 Y 1 A SER 115 ? A SER 11  
12 1 Y 1 A GLU 116 ? A GLU 12  
13 1 Y 1 A ALA 117 ? A ALA 13  
14 1 Y 1 A GLU 118 ? A GLU 14  
15 1 Y 1 A LEU 119 ? A LEU 15  
16 1 Y 1 A ASN 305 ? A ASN 201 
17 1 Y 1 A MET 306 ? A MET 202 
18 1 Y 1 A ASP 307 ? A ASP 203 
19 1 Y 1 A VAL 308 ? A VAL 204 
20 1 Y 1 B GLY 105 ? B GLY 1   
21 1 Y 1 B SER 106 ? B SER 2   
22 1 Y 1 B HIS 107 ? B HIS 3   
23 1 Y 1 B MET 108 ? B MET 4   
24 1 Y 1 B ALA 109 ? B ALA 5   
25 1 Y 1 B SER 110 ? B SER 6   
26 1 Y 1 B PHE 111 ? B PHE 7   
27 1 Y 1 B ASN 112 ? B ASN 8   
28 1 Y 1 B GLY 113 ? B GLY 9   
29 1 Y 1 B VAL 114 ? B VAL 10  
30 1 Y 1 B SER 115 ? B SER 11  
31 1 Y 1 B GLU 116 ? B GLU 12  
32 1 Y 1 B ALA 117 ? B ALA 13  
33 1 Y 1 B GLU 118 ? B GLU 14  
34 1 Y 1 B LEU 119 ? B LEU 15  
35 1 Y 1 B LEU 120 ? B LEU 16  
36 1 Y 1 B THR 121 ? B THR 17  
37 1 Y 1 B LYS 122 ? B LYS 18  
38 1 Y 1 B ASN 305 ? B ASN 201 
39 1 Y 1 B MET 306 ? B MET 202 
40 1 Y 1 B ASP 307 ? B ASP 203 
41 1 Y 1 B VAL 308 ? B VAL 204 
# 
_ndb_struct_conf_na.entry_id   3UFJ 
_ndb_struct_conf_na.feature    'mismatched base pair' 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_nonpoly_scheme.asym_id         G 
_pdbx_nonpoly_scheme.entity_id       4 
_pdbx_nonpoly_scheme.mon_id          HOH 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     1 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      HOH 
_pdbx_nonpoly_scheme.auth_mon_id     HOH 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
#