data_3UGM
# 
_entry.id   3UGM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UGM         
NDB   NA1372       
RCSB  RCSB068729   
WWPDB D_1000068729 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UGM 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mak, A.N.S.'     1 
'Bradley, P.'     2 
'Cernadas, R.A.'  3 
'Bogdanove, A.J.' 4 
'Stoddard, B.L.'  5 
# 
_citation.id                        primary 
_citation.title                     'The Crystal Structure of TAL Effector PthXo1 Bound to Its DNA Target.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            335 
_citation.page_first                716 
_citation.page_last                 719 
_citation.year                      2012 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22223736 
_citation.pdbx_database_id_DOI      10.1126/science.1216211 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mak, A.N.'       1 
primary 'Bradley, P.'     2 
primary 'Cernadas, R.A.'  3 
primary 'Bogdanove, A.J.' 4 
primary 'Stoddard, B.L.'  5 
# 
_cell.entry_id           3UGM 
_cell.length_a           95.578 
_cell.length_b           248.481 
_cell.length_c           54.646 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UGM 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TAL effector AvrBs3/PthA' 108904.258 1   ? ? 'UNP residues 21-1043' ? 
2 polymer syn DNA-1                      11527.443  1   ? ? ?                      ? 
3 polymer syn DNA-2                      11860.620  1   ? ? ?                      ? 
4 water   nat water                      18.015     216 ? ? ?                      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MASSHHHHHHSSGLVPRGSSGSSMAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEA
LVGHGFTHAHIVALSQHPAALGTVAVTYQHIITALPEATHEDIVGVGKQWSGARALEALLTDAGELRGPPLQLDTGQLVK
IAKRGGVTAMEAVHASRNALTGAPLNLTPAQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALE
TMQRLLPVLCQAHGLPPDQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHGGGKQALETVQRLLPVLCQA
HGLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIA
SNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQTHGLTPAQVVAIASHDGGKQALETVQ
QLLPVLCQAHGLTPDQVVAIASNIGGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGL
TPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQVQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHD
GGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQEQVVAIASNNGGKQALETVQRL
LPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTL
AQVVAIASNIGGKQALETVQRLLPVLCQAHGLTQDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGG
KQALETVQRLLPVLCQDHGLTLDQVVAIASNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNSGGKQALETVQRLLPV
LCQDHGLTPNQVVAIASNGGKQALESIVAQLSRPDPALAALTNDHLVALACLGGRPAMDAVKKGLPHAPELIRRVNRRIG
ERTSHRV
;
;MASSHHHHHHSSGLVPRGSSGSSMAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEA
LVGHGFTHAHIVALSQHPAALGTVAVTYQHIITALPEATHEDIVGVGKQWSGARALEALLTDAGELRGPPLQLDTGQLVK
IAKRGGVTAMEAVHASRNALTGAPLNLTPAQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALE
TMQRLLPVLCQAHGLPPDQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHGGGKQALETVQRLLPVLCQA
HGLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIA
SNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQTHGLTPAQVVAIASHDGGKQALETVQ
QLLPVLCQAHGLTPDQVVAIASNIGGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGL
TPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQVQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHD
GGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQEQVVAIASNNGGKQALETVQRL
LPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTL
AQVVAIASNIGGKQALETVQRLLPVLCQAHGLTQDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGG
KQALETVQRLLPVLCQDHGLTLDQVVAIASNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNSGGKQALETVQRLLPV
LCQDHGLTPNQVVAIASNGGKQALESIVAQLSRPDPALAALTNDHLVALACLGGRPAMDAVKKGLPHAPELIRRVNRRIG
ERTSHRV
;
A ? 
2 polydeoxyribonucleotide no no 
;(DT)(DA)(DG)(DA)(DT)(DA)(DT)(DG)(DC)(DA)(DT)(DC)(DT)(DC)(DC)(DC)(DC)(DC)(DT)(DA)
(DC)(DT)(DG)(DT)(DA)(DC)(DA)(DC)(DC)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)
;
TAGATATGCATCTCCCCCTACTGTACACCACCAAAAGT B ? 
3 polydeoxyribonucleotide no no 
;(DT)(DT)(DT)(DT)(DG)(DG)(DT)(DG)(DG)(DT)(DG)(DT)(DA)(DC)(DA)(DG)(DT)(DA)(DG)(DG)
(DG)(DG)(DG)(DA)(DG)(DA)(DT)(DG)(DC)(DA)(DT)(DA)(DT)(DC)(DT)(DA)(DA)(DC)
;
TTTTGGTGGTGTACAGTAGGGGGAGATGCATATCTAAC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ALA n 
1 3    SER n 
1 4    SER n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   SER n 
1 12   SER n 
1 13   GLY n 
1 14   LEU n 
1 15   VAL n 
1 16   PRO n 
1 17   ARG n 
1 18   GLY n 
1 19   SER n 
1 20   SER n 
1 21   GLY n 
1 22   SER n 
1 23   SER n 
1 24   MET n 
1 25   ALA n 
1 26   ALA n 
1 27   ARG n 
1 28   PRO n 
1 29   PRO n 
1 30   ARG n 
1 31   ALA n 
1 32   LYS n 
1 33   PRO n 
1 34   ALA n 
1 35   PRO n 
1 36   ARG n 
1 37   ARG n 
1 38   ARG n 
1 39   ALA n 
1 40   ALA n 
1 41   GLN n 
1 42   PRO n 
1 43   SER n 
1 44   ASP n 
1 45   ALA n 
1 46   SER n 
1 47   PRO n 
1 48   ALA n 
1 49   ALA n 
1 50   GLN n 
1 51   VAL n 
1 52   ASP n 
1 53   LEU n 
1 54   ARG n 
1 55   THR n 
1 56   LEU n 
1 57   GLY n 
1 58   TYR n 
1 59   SER n 
1 60   GLN n 
1 61   GLN n 
1 62   GLN n 
1 63   GLN n 
1 64   GLU n 
1 65   LYS n 
1 66   ILE n 
1 67   LYS n 
1 68   PRO n 
1 69   LYS n 
1 70   VAL n 
1 71   ARG n 
1 72   SER n 
1 73   THR n 
1 74   VAL n 
1 75   ALA n 
1 76   GLN n 
1 77   HIS n 
1 78   HIS n 
1 79   GLU n 
1 80   ALA n 
1 81   LEU n 
1 82   VAL n 
1 83   GLY n 
1 84   HIS n 
1 85   GLY n 
1 86   PHE n 
1 87   THR n 
1 88   HIS n 
1 89   ALA n 
1 90   HIS n 
1 91   ILE n 
1 92   VAL n 
1 93   ALA n 
1 94   LEU n 
1 95   SER n 
1 96   GLN n 
1 97   HIS n 
1 98   PRO n 
1 99   ALA n 
1 100  ALA n 
1 101  LEU n 
1 102  GLY n 
1 103  THR n 
1 104  VAL n 
1 105  ALA n 
1 106  VAL n 
1 107  THR n 
1 108  TYR n 
1 109  GLN n 
1 110  HIS n 
1 111  ILE n 
1 112  ILE n 
1 113  THR n 
1 114  ALA n 
1 115  LEU n 
1 116  PRO n 
1 117  GLU n 
1 118  ALA n 
1 119  THR n 
1 120  HIS n 
1 121  GLU n 
1 122  ASP n 
1 123  ILE n 
1 124  VAL n 
1 125  GLY n 
1 126  VAL n 
1 127  GLY n 
1 128  LYS n 
1 129  GLN n 
1 130  TRP n 
1 131  SER n 
1 132  GLY n 
1 133  ALA n 
1 134  ARG n 
1 135  ALA n 
1 136  LEU n 
1 137  GLU n 
1 138  ALA n 
1 139  LEU n 
1 140  LEU n 
1 141  THR n 
1 142  ASP n 
1 143  ALA n 
1 144  GLY n 
1 145  GLU n 
1 146  LEU n 
1 147  ARG n 
1 148  GLY n 
1 149  PRO n 
1 150  PRO n 
1 151  LEU n 
1 152  GLN n 
1 153  LEU n 
1 154  ASP n 
1 155  THR n 
1 156  GLY n 
1 157  GLN n 
1 158  LEU n 
1 159  VAL n 
1 160  LYS n 
1 161  ILE n 
1 162  ALA n 
1 163  LYS n 
1 164  ARG n 
1 165  GLY n 
1 166  GLY n 
1 167  VAL n 
1 168  THR n 
1 169  ALA n 
1 170  MET n 
1 171  GLU n 
1 172  ALA n 
1 173  VAL n 
1 174  HIS n 
1 175  ALA n 
1 176  SER n 
1 177  ARG n 
1 178  ASN n 
1 179  ALA n 
1 180  LEU n 
1 181  THR n 
1 182  GLY n 
1 183  ALA n 
1 184  PRO n 
1 185  LEU n 
1 186  ASN n 
1 187  LEU n 
1 188  THR n 
1 189  PRO n 
1 190  ALA n 
1 191  GLN n 
1 192  VAL n 
1 193  VAL n 
1 194  ALA n 
1 195  ILE n 
1 196  ALA n 
1 197  SER n 
1 198  ASN n 
1 199  ASN n 
1 200  GLY n 
1 201  GLY n 
1 202  LYS n 
1 203  GLN n 
1 204  ALA n 
1 205  LEU n 
1 206  GLU n 
1 207  THR n 
1 208  VAL n 
1 209  GLN n 
1 210  ARG n 
1 211  LEU n 
1 212  LEU n 
1 213  PRO n 
1 214  VAL n 
1 215  LEU n 
1 216  CYS n 
1 217  GLN n 
1 218  ALA n 
1 219  HIS n 
1 220  GLY n 
1 221  LEU n 
1 222  THR n 
1 223  PRO n 
1 224  ALA n 
1 225  GLN n 
1 226  VAL n 
1 227  VAL n 
1 228  ALA n 
1 229  ILE n 
1 230  ALA n 
1 231  SER n 
1 232  HIS n 
1 233  ASP n 
1 234  GLY n 
1 235  GLY n 
1 236  LYS n 
1 237  GLN n 
1 238  ALA n 
1 239  LEU n 
1 240  GLU n 
1 241  THR n 
1 242  MET n 
1 243  GLN n 
1 244  ARG n 
1 245  LEU n 
1 246  LEU n 
1 247  PRO n 
1 248  VAL n 
1 249  LEU n 
1 250  CYS n 
1 251  GLN n 
1 252  ALA n 
1 253  HIS n 
1 254  GLY n 
1 255  LEU n 
1 256  PRO n 
1 257  PRO n 
1 258  ASP n 
1 259  GLN n 
1 260  VAL n 
1 261  VAL n 
1 262  ALA n 
1 263  ILE n 
1 264  ALA n 
1 265  SER n 
1 266  ASN n 
1 267  ILE n 
1 268  GLY n 
1 269  GLY n 
1 270  LYS n 
1 271  GLN n 
1 272  ALA n 
1 273  LEU n 
1 274  GLU n 
1 275  THR n 
1 276  VAL n 
1 277  GLN n 
1 278  ARG n 
1 279  LEU n 
1 280  LEU n 
1 281  PRO n 
1 282  VAL n 
1 283  LEU n 
1 284  CYS n 
1 285  GLN n 
1 286  ALA n 
1 287  HIS n 
1 288  GLY n 
1 289  LEU n 
1 290  THR n 
1 291  PRO n 
1 292  ASP n 
1 293  GLN n 
1 294  VAL n 
1 295  VAL n 
1 296  ALA n 
1 297  ILE n 
1 298  ALA n 
1 299  SER n 
1 300  HIS n 
1 301  GLY n 
1 302  GLY n 
1 303  GLY n 
1 304  LYS n 
1 305  GLN n 
1 306  ALA n 
1 307  LEU n 
1 308  GLU n 
1 309  THR n 
1 310  VAL n 
1 311  GLN n 
1 312  ARG n 
1 313  LEU n 
1 314  LEU n 
1 315  PRO n 
1 316  VAL n 
1 317  LEU n 
1 318  CYS n 
1 319  GLN n 
1 320  ALA n 
1 321  HIS n 
1 322  GLY n 
1 323  LEU n 
1 324  THR n 
1 325  PRO n 
1 326  ASP n 
1 327  GLN n 
1 328  VAL n 
1 329  VAL n 
1 330  ALA n 
1 331  ILE n 
1 332  ALA n 
1 333  SER n 
1 334  HIS n 
1 335  ASP n 
1 336  GLY n 
1 337  GLY n 
1 338  LYS n 
1 339  GLN n 
1 340  ALA n 
1 341  LEU n 
1 342  GLU n 
1 343  THR n 
1 344  VAL n 
1 345  GLN n 
1 346  ARG n 
1 347  LEU n 
1 348  LEU n 
1 349  PRO n 
1 350  VAL n 
1 351  LEU n 
1 352  CYS n 
1 353  GLN n 
1 354  ALA n 
1 355  HIS n 
1 356  GLY n 
1 357  LEU n 
1 358  THR n 
1 359  PRO n 
1 360  ASP n 
1 361  GLN n 
1 362  VAL n 
1 363  VAL n 
1 364  ALA n 
1 365  ILE n 
1 366  ALA n 
1 367  SER n 
1 368  ASN n 
1 369  GLY n 
1 370  GLY n 
1 371  GLY n 
1 372  LYS n 
1 373  GLN n 
1 374  ALA n 
1 375  LEU n 
1 376  GLU n 
1 377  THR n 
1 378  VAL n 
1 379  GLN n 
1 380  ARG n 
1 381  LEU n 
1 382  LEU n 
1 383  PRO n 
1 384  VAL n 
1 385  LEU n 
1 386  CYS n 
1 387  GLN n 
1 388  ALA n 
1 389  HIS n 
1 390  GLY n 
1 391  LEU n 
1 392  THR n 
1 393  PRO n 
1 394  ASP n 
1 395  GLN n 
1 396  VAL n 
1 397  VAL n 
1 398  ALA n 
1 399  ILE n 
1 400  ALA n 
1 401  SER n 
1 402  ASN n 
1 403  GLY n 
1 404  GLY n 
1 405  LYS n 
1 406  GLN n 
1 407  ALA n 
1 408  LEU n 
1 409  GLU n 
1 410  THR n 
1 411  VAL n 
1 412  GLN n 
1 413  ARG n 
1 414  LEU n 
1 415  LEU n 
1 416  PRO n 
1 417  VAL n 
1 418  LEU n 
1 419  CYS n 
1 420  GLN n 
1 421  ALA n 
1 422  HIS n 
1 423  GLY n 
1 424  LEU n 
1 425  THR n 
1 426  PRO n 
1 427  ASP n 
1 428  GLN n 
1 429  VAL n 
1 430  VAL n 
1 431  ALA n 
1 432  ILE n 
1 433  ALA n 
1 434  SER n 
1 435  HIS n 
1 436  ASP n 
1 437  GLY n 
1 438  GLY n 
1 439  LYS n 
1 440  GLN n 
1 441  ALA n 
1 442  LEU n 
1 443  GLU n 
1 444  THR n 
1 445  VAL n 
1 446  GLN n 
1 447  ARG n 
1 448  LEU n 
1 449  LEU n 
1 450  PRO n 
1 451  VAL n 
1 452  LEU n 
1 453  CYS n 
1 454  GLN n 
1 455  THR n 
1 456  HIS n 
1 457  GLY n 
1 458  LEU n 
1 459  THR n 
1 460  PRO n 
1 461  ALA n 
1 462  GLN n 
1 463  VAL n 
1 464  VAL n 
1 465  ALA n 
1 466  ILE n 
1 467  ALA n 
1 468  SER n 
1 469  HIS n 
1 470  ASP n 
1 471  GLY n 
1 472  GLY n 
1 473  LYS n 
1 474  GLN n 
1 475  ALA n 
1 476  LEU n 
1 477  GLU n 
1 478  THR n 
1 479  VAL n 
1 480  GLN n 
1 481  GLN n 
1 482  LEU n 
1 483  LEU n 
1 484  PRO n 
1 485  VAL n 
1 486  LEU n 
1 487  CYS n 
1 488  GLN n 
1 489  ALA n 
1 490  HIS n 
1 491  GLY n 
1 492  LEU n 
1 493  THR n 
1 494  PRO n 
1 495  ASP n 
1 496  GLN n 
1 497  VAL n 
1 498  VAL n 
1 499  ALA n 
1 500  ILE n 
1 501  ALA n 
1 502  SER n 
1 503  ASN n 
1 504  ILE n 
1 505  GLY n 
1 506  GLY n 
1 507  LYS n 
1 508  GLN n 
1 509  ALA n 
1 510  LEU n 
1 511  ALA n 
1 512  THR n 
1 513  VAL n 
1 514  GLN n 
1 515  ARG n 
1 516  LEU n 
1 517  LEU n 
1 518  PRO n 
1 519  VAL n 
1 520  LEU n 
1 521  CYS n 
1 522  GLN n 
1 523  ALA n 
1 524  HIS n 
1 525  GLY n 
1 526  LEU n 
1 527  THR n 
1 528  PRO n 
1 529  ASP n 
1 530  GLN n 
1 531  VAL n 
1 532  VAL n 
1 533  ALA n 
1 534  ILE n 
1 535  ALA n 
1 536  SER n 
1 537  ASN n 
1 538  GLY n 
1 539  GLY n 
1 540  GLY n 
1 541  LYS n 
1 542  GLN n 
1 543  ALA n 
1 544  LEU n 
1 545  GLU n 
1 546  THR n 
1 547  VAL n 
1 548  GLN n 
1 549  ARG n 
1 550  LEU n 
1 551  LEU n 
1 552  PRO n 
1 553  VAL n 
1 554  LEU n 
1 555  CYS n 
1 556  GLN n 
1 557  ALA n 
1 558  HIS n 
1 559  GLY n 
1 560  LEU n 
1 561  THR n 
1 562  PRO n 
1 563  ASP n 
1 564  GLN n 
1 565  VAL n 
1 566  VAL n 
1 567  ALA n 
1 568  ILE n 
1 569  ALA n 
1 570  SER n 
1 571  ASN n 
1 572  GLY n 
1 573  GLY n 
1 574  GLY n 
1 575  LYS n 
1 576  GLN n 
1 577  ALA n 
1 578  LEU n 
1 579  GLU n 
1 580  THR n 
1 581  VAL n 
1 582  GLN n 
1 583  ARG n 
1 584  LEU n 
1 585  LEU n 
1 586  PRO n 
1 587  VAL n 
1 588  LEU n 
1 589  CYS n 
1 590  GLN n 
1 591  ALA n 
1 592  HIS n 
1 593  GLY n 
1 594  LEU n 
1 595  THR n 
1 596  GLN n 
1 597  VAL n 
1 598  GLN n 
1 599  VAL n 
1 600  VAL n 
1 601  ALA n 
1 602  ILE n 
1 603  ALA n 
1 604  SER n 
1 605  ASN n 
1 606  ILE n 
1 607  GLY n 
1 608  GLY n 
1 609  LYS n 
1 610  GLN n 
1 611  ALA n 
1 612  LEU n 
1 613  GLU n 
1 614  THR n 
1 615  VAL n 
1 616  GLN n 
1 617  ARG n 
1 618  LEU n 
1 619  LEU n 
1 620  PRO n 
1 621  VAL n 
1 622  LEU n 
1 623  CYS n 
1 624  GLN n 
1 625  ALA n 
1 626  HIS n 
1 627  GLY n 
1 628  LEU n 
1 629  THR n 
1 630  PRO n 
1 631  ALA n 
1 632  GLN n 
1 633  VAL n 
1 634  VAL n 
1 635  ALA n 
1 636  ILE n 
1 637  ALA n 
1 638  SER n 
1 639  HIS n 
1 640  ASP n 
1 641  GLY n 
1 642  GLY n 
1 643  LYS n 
1 644  GLN n 
1 645  ALA n 
1 646  LEU n 
1 647  GLU n 
1 648  THR n 
1 649  VAL n 
1 650  GLN n 
1 651  ARG n 
1 652  LEU n 
1 653  LEU n 
1 654  PRO n 
1 655  VAL n 
1 656  LEU n 
1 657  CYS n 
1 658  GLN n 
1 659  ALA n 
1 660  HIS n 
1 661  GLY n 
1 662  LEU n 
1 663  THR n 
1 664  PRO n 
1 665  ASP n 
1 666  GLN n 
1 667  VAL n 
1 668  VAL n 
1 669  ALA n 
1 670  ILE n 
1 671  ALA n 
1 672  SER n 
1 673  ASN n 
1 674  GLY n 
1 675  GLY n 
1 676  GLY n 
1 677  LYS n 
1 678  GLN n 
1 679  ALA n 
1 680  LEU n 
1 681  GLU n 
1 682  THR n 
1 683  VAL n 
1 684  GLN n 
1 685  ARG n 
1 686  LEU n 
1 687  LEU n 
1 688  PRO n 
1 689  VAL n 
1 690  LEU n 
1 691  CYS n 
1 692  GLN n 
1 693  ALA n 
1 694  HIS n 
1 695  GLY n 
1 696  LEU n 
1 697  THR n 
1 698  GLN n 
1 699  GLU n 
1 700  GLN n 
1 701  VAL n 
1 702  VAL n 
1 703  ALA n 
1 704  ILE n 
1 705  ALA n 
1 706  SER n 
1 707  ASN n 
1 708  ASN n 
1 709  GLY n 
1 710  GLY n 
1 711  LYS n 
1 712  GLN n 
1 713  ALA n 
1 714  LEU n 
1 715  GLU n 
1 716  THR n 
1 717  VAL n 
1 718  GLN n 
1 719  ARG n 
1 720  LEU n 
1 721  LEU n 
1 722  PRO n 
1 723  VAL n 
1 724  LEU n 
1 725  CYS n 
1 726  GLN n 
1 727  ALA n 
1 728  HIS n 
1 729  GLY n 
1 730  LEU n 
1 731  THR n 
1 732  PRO n 
1 733  ASP n 
1 734  GLN n 
1 735  VAL n 
1 736  VAL n 
1 737  ALA n 
1 738  ILE n 
1 739  ALA n 
1 740  SER n 
1 741  ASN n 
1 742  GLY n 
1 743  GLY n 
1 744  GLY n 
1 745  LYS n 
1 746  GLN n 
1 747  ALA n 
1 748  LEU n 
1 749  GLU n 
1 750  THR n 
1 751  VAL n 
1 752  GLN n 
1 753  ARG n 
1 754  LEU n 
1 755  LEU n 
1 756  PRO n 
1 757  VAL n 
1 758  LEU n 
1 759  CYS n 
1 760  GLN n 
1 761  ALA n 
1 762  HIS n 
1 763  GLY n 
1 764  LEU n 
1 765  THR n 
1 766  PRO n 
1 767  ALA n 
1 768  GLN n 
1 769  VAL n 
1 770  VAL n 
1 771  ALA n 
1 772  ILE n 
1 773  ALA n 
1 774  SER n 
1 775  ASN n 
1 776  ILE n 
1 777  GLY n 
1 778  GLY n 
1 779  LYS n 
1 780  GLN n 
1 781  ALA n 
1 782  LEU n 
1 783  GLU n 
1 784  THR n 
1 785  VAL n 
1 786  GLN n 
1 787  ARG n 
1 788  LEU n 
1 789  LEU n 
1 790  PRO n 
1 791  VAL n 
1 792  LEU n 
1 793  CYS n 
1 794  GLN n 
1 795  ASP n 
1 796  HIS n 
1 797  GLY n 
1 798  LEU n 
1 799  THR n 
1 800  LEU n 
1 801  ALA n 
1 802  GLN n 
1 803  VAL n 
1 804  VAL n 
1 805  ALA n 
1 806  ILE n 
1 807  ALA n 
1 808  SER n 
1 809  ASN n 
1 810  ILE n 
1 811  GLY n 
1 812  GLY n 
1 813  LYS n 
1 814  GLN n 
1 815  ALA n 
1 816  LEU n 
1 817  GLU n 
1 818  THR n 
1 819  VAL n 
1 820  GLN n 
1 821  ARG n 
1 822  LEU n 
1 823  LEU n 
1 824  PRO n 
1 825  VAL n 
1 826  LEU n 
1 827  CYS n 
1 828  GLN n 
1 829  ALA n 
1 830  HIS n 
1 831  GLY n 
1 832  LEU n 
1 833  THR n 
1 834  GLN n 
1 835  ASP n 
1 836  GLN n 
1 837  VAL n 
1 838  VAL n 
1 839  ALA n 
1 840  ILE n 
1 841  ALA n 
1 842  SER n 
1 843  ASN n 
1 844  ILE n 
1 845  GLY n 
1 846  GLY n 
1 847  LYS n 
1 848  GLN n 
1 849  ALA n 
1 850  LEU n 
1 851  GLU n 
1 852  THR n 
1 853  VAL n 
1 854  GLN n 
1 855  ARG n 
1 856  LEU n 
1 857  LEU n 
1 858  PRO n 
1 859  VAL n 
1 860  LEU n 
1 861  CYS n 
1 862  GLN n 
1 863  ASP n 
1 864  HIS n 
1 865  GLY n 
1 866  LEU n 
1 867  THR n 
1 868  PRO n 
1 869  ASP n 
1 870  GLN n 
1 871  VAL n 
1 872  VAL n 
1 873  ALA n 
1 874  ILE n 
1 875  ALA n 
1 876  SER n 
1 877  ASN n 
1 878  ILE n 
1 879  GLY n 
1 880  GLY n 
1 881  LYS n 
1 882  GLN n 
1 883  ALA n 
1 884  LEU n 
1 885  GLU n 
1 886  THR n 
1 887  VAL n 
1 888  GLN n 
1 889  ARG n 
1 890  LEU n 
1 891  LEU n 
1 892  PRO n 
1 893  VAL n 
1 894  LEU n 
1 895  CYS n 
1 896  GLN n 
1 897  ASP n 
1 898  HIS n 
1 899  GLY n 
1 900  LEU n 
1 901  THR n 
1 902  LEU n 
1 903  ASP n 
1 904  GLN n 
1 905  VAL n 
1 906  VAL n 
1 907  ALA n 
1 908  ILE n 
1 909  ALA n 
1 910  SER n 
1 911  ASN n 
1 912  GLY n 
1 913  GLY n 
1 914  LYS n 
1 915  GLN n 
1 916  ALA n 
1 917  LEU n 
1 918  GLU n 
1 919  THR n 
1 920  VAL n 
1 921  GLN n 
1 922  ARG n 
1 923  LEU n 
1 924  LEU n 
1 925  PRO n 
1 926  VAL n 
1 927  LEU n 
1 928  CYS n 
1 929  GLN n 
1 930  ASP n 
1 931  HIS n 
1 932  GLY n 
1 933  LEU n 
1 934  THR n 
1 935  PRO n 
1 936  ASP n 
1 937  GLN n 
1 938  VAL n 
1 939  VAL n 
1 940  ALA n 
1 941  ILE n 
1 942  ALA n 
1 943  SER n 
1 944  ASN n 
1 945  SER n 
1 946  GLY n 
1 947  GLY n 
1 948  LYS n 
1 949  GLN n 
1 950  ALA n 
1 951  LEU n 
1 952  GLU n 
1 953  THR n 
1 954  VAL n 
1 955  GLN n 
1 956  ARG n 
1 957  LEU n 
1 958  LEU n 
1 959  PRO n 
1 960  VAL n 
1 961  LEU n 
1 962  CYS n 
1 963  GLN n 
1 964  ASP n 
1 965  HIS n 
1 966  GLY n 
1 967  LEU n 
1 968  THR n 
1 969  PRO n 
1 970  ASN n 
1 971  GLN n 
1 972  VAL n 
1 973  VAL n 
1 974  ALA n 
1 975  ILE n 
1 976  ALA n 
1 977  SER n 
1 978  ASN n 
1 979  GLY n 
1 980  GLY n 
1 981  LYS n 
1 982  GLN n 
1 983  ALA n 
1 984  LEU n 
1 985  GLU n 
1 986  SER n 
1 987  ILE n 
1 988  VAL n 
1 989  ALA n 
1 990  GLN n 
1 991  LEU n 
1 992  SER n 
1 993  ARG n 
1 994  PRO n 
1 995  ASP n 
1 996  PRO n 
1 997  ALA n 
1 998  LEU n 
1 999  ALA n 
1 1000 ALA n 
1 1001 LEU n 
1 1002 THR n 
1 1003 ASN n 
1 1004 ASP n 
1 1005 HIS n 
1 1006 LEU n 
1 1007 VAL n 
1 1008 ALA n 
1 1009 LEU n 
1 1010 ALA n 
1 1011 CYS n 
1 1012 LEU n 
1 1013 GLY n 
1 1014 GLY n 
1 1015 ARG n 
1 1016 PRO n 
1 1017 ALA n 
1 1018 MET n 
1 1019 ASP n 
1 1020 ALA n 
1 1021 VAL n 
1 1022 LYS n 
1 1023 LYS n 
1 1024 GLY n 
1 1025 LEU n 
1 1026 PRO n 
1 1027 HIS n 
1 1028 ALA n 
1 1029 PRO n 
1 1030 GLU n 
1 1031 LEU n 
1 1032 ILE n 
1 1033 ARG n 
1 1034 ARG n 
1 1035 VAL n 
1 1036 ASN n 
1 1037 ARG n 
1 1038 ARG n 
1 1039 ILE n 
1 1040 GLY n 
1 1041 GLU n 
1 1042 ARG n 
1 1043 THR n 
1 1044 SER n 
1 1045 HIS n 
1 1046 ARG n 
1 1047 VAL n 
2 1    DT  n 
2 2    DA  n 
2 3    DG  n 
2 4    DA  n 
2 5    DT  n 
2 6    DA  n 
2 7    DT  n 
2 8    DG  n 
2 9    DC  n 
2 10   DA  n 
2 11   DT  n 
2 12   DC  n 
2 13   DT  n 
2 14   DC  n 
2 15   DC  n 
2 16   DC  n 
2 17   DC  n 
2 18   DC  n 
2 19   DT  n 
2 20   DA  n 
2 21   DC  n 
2 22   DT  n 
2 23   DG  n 
2 24   DT  n 
2 25   DA  n 
2 26   DC  n 
2 27   DA  n 
2 28   DC  n 
2 29   DC  n 
2 30   DA  n 
2 31   DC  n 
2 32   DC  n 
2 33   DA  n 
2 34   DA  n 
2 35   DA  n 
2 36   DA  n 
2 37   DG  n 
2 38   DT  n 
3 1    DT  n 
3 2    DT  n 
3 3    DT  n 
3 4    DT  n 
3 5    DG  n 
3 6    DG  n 
3 7    DT  n 
3 8    DG  n 
3 9    DG  n 
3 10   DT  n 
3 11   DG  n 
3 12   DT  n 
3 13   DA  n 
3 14   DC  n 
3 15   DA  n 
3 16   DG  n 
3 17   DT  n 
3 18   DA  n 
3 19   DG  n 
3 20   DG  n 
3 21   DG  n 
3 22   DG  n 
3 23   DG  n 
3 24   DA  n 
3 25   DG  n 
3 26   DA  n 
3 27   DT  n 
3 28   DG  n 
3 29   DC  n 
3 30   DA  n 
3 31   DT  n 
3 32   DA  n 
3 33   DT  n 
3 34   DC  n 
3 35   DT  n 
3 36   DA  n 
3 37   DA  n 
3 38   DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'pthXo1, PXO_00227' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    PXO99A 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Xanthomonas oryzae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     360094 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'synthetic DNA' 
3 1 sample ? ? ? ? ? 'synthetic DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP B2SU53_XANOP B2SU53 1 
;AARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVGSTVAQHHEALVGHGFTHAHIVALSRHPAALGTV
AVKYQDMIAALPEATHEDIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLVKIAKRGGVTAVEAVHASRNALTGAP
LNLTPAQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETMQRLLPVLCQAHGLPPDQVVAIA
SNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETV
QRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGKQALETVQRLLPVLCQAHGL
TPDQVVAIASHDGGKQALETVQRLLPVLCQTHGLTPAQVVAIASHDGGKQALETVQQLLPVLCQAHGLTPDQVVAIASNI
GGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRL
LPVLCQAHGLTQVQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETVQRLLPVLCQAHGLTP
DQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQEQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGG
KQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTLAQVVAIASNIGGKQALETVQRLLP
VLCQAHGLTQDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTLDQ
VVAIASNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNSGGKQALETVQRLLPVLCQDHGLTPNQVVAIASNGGKQAL
ESIVAQLSRPDPALAALTNDHLVALACLGGRPAMDAVKKGLPHAPELIRRVNRRIGERTSHRV
;
21 ? 
2 PDB 3UGM         3UGM   2 ? ?  ? 
3 PDB 3UGM         3UGM   3 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UGM A 25 ? 1047 ? B2SU53 21 ? 1043 ? 127 1149 
2 2 3UGM B 1  ? 38   ? 3UGM   -6 ? 31   ? -6  31   
3 3 3UGM C 1  ? 38   ? 3UGM   1  ? 38   ? 1   38   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UGM MET A 1   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      103 1  
1 3UGM ALA A 2   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      104 2  
1 3UGM SER A 3   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      105 3  
1 3UGM SER A 4   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      106 4  
1 3UGM HIS A 5   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      107 5  
1 3UGM HIS A 6   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      108 6  
1 3UGM HIS A 7   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      109 7  
1 3UGM HIS A 8   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      110 8  
1 3UGM HIS A 9   ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      111 9  
1 3UGM HIS A 10  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      112 10 
1 3UGM SER A 11  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      113 11 
1 3UGM SER A 12  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      114 12 
1 3UGM GLY A 13  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      115 13 
1 3UGM LEU A 14  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      116 14 
1 3UGM VAL A 15  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      117 15 
1 3UGM PRO A 16  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      118 16 
1 3UGM ARG A 17  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      119 17 
1 3UGM GLY A 18  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      120 18 
1 3UGM SER A 19  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      121 19 
1 3UGM SER A 20  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      122 20 
1 3UGM GLY A 21  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      123 21 
1 3UGM SER A 22  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      124 22 
1 3UGM SER A 23  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      125 23 
1 3UGM MET A 24  ? UNP B2SU53 ?   ?   'EXPRESSION TAG'      126 24 
1 3UGM ARG A 71  ? UNP B2SU53 GLY 67  'ENGINEERED MUTATION' 173 25 
1 3UGM GLN A 96  ? UNP B2SU53 ARG 92  'ENGINEERED MUTATION' 198 26 
1 3UGM THR A 107 ? UNP B2SU53 LYS 103 'ENGINEERED MUTATION' 209 27 
1 3UGM HIS A 110 ? UNP B2SU53 ASP 106 'ENGINEERED MUTATION' 212 28 
1 3UGM ILE A 111 ? UNP B2SU53 MET 107 'ENGINEERED MUTATION' 213 29 
1 3UGM THR A 113 ? UNP B2SU53 ALA 109 'ENGINEERED MUTATION' 215 30 
1 3UGM ASP A 142 ? UNP B2SU53 VAL 138 'ENGINEERED MUTATION' 244 31 
1 3UGM MET A 170 ? UNP B2SU53 VAL 166 'ENGINEERED MUTATION' 272 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3UGM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.85 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '20mM Tris HCl, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.975 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.975 
# 
_reflns.entry_id                     3UGM 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   25841 
_reflns.number_all                   26980 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3UGM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.0000 
_refine.ls_d_res_low                             50.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    95.3000 
_refine.ls_number_reflns_obs                     25725 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2664 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2937 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.8000 
_refine.ls_number_reflns_R_free                  1308 
_refine.ls_number_reflns_R_work                  24417 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               85.0875 
_refine.solvent_model_param_bsol                 84.6854 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -6.6310 
_refine.aniso_B[2][2]                            5.3240 
_refine.aniso_B[3][3]                            1.3070 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                200.000 
_refine.B_iso_min                                10.150 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6085 
_refine_hist.pdbx_number_atoms_nucleic_acid   1552 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             216 
_refine_hist.number_atoms_total               7853 
_refine_hist.d_res_high                       3.0000 
_refine_hist.d_res_low                        50.0000 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 CNS_TOPPAR:protein_rep.param ? 
'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param ? 
'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param   ? 
'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param         ? 
# 
_struct.entry_id                  3UGM 
_struct.title                     'Structure of TAL effector PthXo1 bound to its DNA target' 
_struct.pdbx_descriptor           'TAL effector AvrBs3/PthA/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UGM 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'Tal effector, TRANSCRIPTION-DNA complex, DNA binding protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 119 ? GLY A 127 ? THR A 221  GLY A 229  1 ? 9  
HELX_P HELX_P2  2  SER A 131 ? GLY A 144 ? SER A 233  GLY A 246  1 ? 14 
HELX_P HELX_P3  3  THR A 155 ? GLY A 165 ? THR A 257  GLY A 267  1 ? 11 
HELX_P HELX_P4  4  GLY A 165 ? THR A 181 ? GLY A 267  THR A 283  1 ? 17 
HELX_P HELX_P5  5  THR A 188 ? SER A 197 ? THR A 290  SER A 299  1 ? 10 
HELX_P HELX_P6  6  GLY A 200 ? LEU A 212 ? GLY A 302  LEU A 314  1 ? 13 
HELX_P HELX_P7  7  LEU A 212 ? ALA A 218 ? LEU A 314  ALA A 320  1 ? 7  
HELX_P HELX_P8  8  THR A 222 ? VAL A 227 ? THR A 324  VAL A 329  1 ? 6  
HELX_P HELX_P9  9  GLY A 234 ? HIS A 253 ? GLY A 336  HIS A 355  1 ? 20 
HELX_P HELX_P10 10 PRO A 256 ? SER A 265 ? PRO A 358  SER A 367  1 ? 10 
HELX_P HELX_P11 11 GLY A 268 ? LEU A 280 ? GLY A 370  LEU A 382  1 ? 13 
HELX_P HELX_P12 12 LEU A 280 ? GLY A 288 ? LEU A 382  GLY A 390  1 ? 9  
HELX_P HELX_P13 13 THR A 290 ? SER A 299 ? THR A 392  SER A 401  1 ? 10 
HELX_P HELX_P14 14 GLY A 302 ? HIS A 321 ? GLY A 404  HIS A 423  1 ? 20 
HELX_P HELX_P15 15 THR A 324 ? SER A 333 ? THR A 426  SER A 435  1 ? 10 
HELX_P HELX_P16 16 GLY A 337 ? GLN A 353 ? GLY A 439  GLN A 455  1 ? 17 
HELX_P HELX_P17 17 THR A 358 ? SER A 367 ? THR A 460  SER A 469  1 ? 10 
HELX_P HELX_P18 18 GLY A 370 ? GLN A 387 ? GLY A 472  GLN A 489  1 ? 18 
HELX_P HELX_P19 19 THR A 392 ? GLY A 403 ? THR A 494  GLY A 505  1 ? 12 
HELX_P HELX_P20 20 GLY A 403 ? GLN A 420 ? GLY A 505  GLN A 522  1 ? 18 
HELX_P HELX_P21 21 THR A 425 ? SER A 434 ? THR A 527  SER A 536  1 ? 10 
HELX_P HELX_P22 22 GLY A 438 ? GLN A 454 ? GLY A 540  GLN A 556  1 ? 17 
HELX_P HELX_P23 23 THR A 459 ? ALA A 467 ? THR A 561  ALA A 569  1 ? 9  
HELX_P HELX_P24 24 GLY A 471 ? HIS A 490 ? GLY A 573  HIS A 592  1 ? 20 
HELX_P HELX_P25 25 PRO A 494 ? SER A 502 ? PRO A 596  SER A 604  1 ? 9  
HELX_P HELX_P26 26 GLY A 505 ? LEU A 517 ? GLY A 607  LEU A 619  1 ? 13 
HELX_P HELX_P27 27 PRO A 518 ? CYS A 521 ? PRO A 620  CYS A 623  5 ? 4  
HELX_P HELX_P28 28 PRO A 528 ? SER A 536 ? PRO A 630  SER A 638  1 ? 9  
HELX_P HELX_P29 29 GLY A 540 ? CYS A 555 ? GLY A 642  CYS A 657  1 ? 16 
HELX_P HELX_P30 30 THR A 561 ? ALA A 569 ? THR A 663  ALA A 671  1 ? 9  
HELX_P HELX_P31 31 GLY A 573 ? LEU A 585 ? GLY A 675  LEU A 687  1 ? 13 
HELX_P HELX_P32 32 LEU A 585 ? GLY A 593 ? LEU A 687  GLY A 695  1 ? 9  
HELX_P HELX_P33 33 GLN A 596 ? ALA A 601 ? GLN A 698  ALA A 703  1 ? 6  
HELX_P HELX_P34 34 GLY A 608 ? HIS A 626 ? GLY A 710  HIS A 728  1 ? 19 
HELX_P HELX_P35 35 PRO A 630 ? SER A 638 ? PRO A 732  SER A 740  1 ? 9  
HELX_P HELX_P36 36 GLY A 641 ? LEU A 653 ? GLY A 743  LEU A 755  1 ? 13 
HELX_P HELX_P37 37 PRO A 654 ? ALA A 659 ? PRO A 756  ALA A 761  1 ? 6  
HELX_P HELX_P38 38 THR A 663 ? VAL A 668 ? THR A 765  VAL A 770  1 ? 6  
HELX_P HELX_P39 39 GLY A 675 ? LEU A 687 ? GLY A 777  LEU A 789  1 ? 13 
HELX_P HELX_P40 40 THR A 697 ? SER A 706 ? THR A 799  SER A 808  1 ? 10 
HELX_P HELX_P41 41 GLY A 709 ? CYS A 725 ? GLY A 811  CYS A 827  1 ? 17 
HELX_P HELX_P42 42 PRO A 732 ? SER A 740 ? PRO A 834  SER A 842  1 ? 9  
HELX_P HELX_P43 43 GLY A 743 ? ARG A 753 ? GLY A 845  ARG A 855  1 ? 11 
HELX_P HELX_P44 44 THR A 765 ? SER A 774 ? THR A 867  SER A 876  1 ? 10 
HELX_P HELX_P45 45 GLY A 777 ? HIS A 796 ? GLY A 879  HIS A 898  1 ? 20 
HELX_P HELX_P46 46 THR A 799 ? SER A 808 ? THR A 901  SER A 910  1 ? 10 
HELX_P HELX_P47 47 GLY A 811 ? GLN A 828 ? GLY A 913  GLN A 930  1 ? 18 
HELX_P HELX_P48 48 THR A 833 ? SER A 842 ? THR A 935  SER A 944  1 ? 10 
HELX_P HELX_P49 49 GLY A 845 ? LEU A 857 ? GLY A 947  LEU A 959  1 ? 13 
HELX_P HELX_P50 50 LEU A 857 ? ASP A 863 ? LEU A 959  ASP A 965  1 ? 7  
HELX_P HELX_P51 51 THR A 867 ? ALA A 875 ? THR A 969  ALA A 977  1 ? 9  
HELX_P HELX_P52 52 GLN A 882 ? GLN A 896 ? GLN A 984  GLN A 998  1 ? 15 
HELX_P HELX_P53 53 THR A 901 ? SER A 910 ? THR A 1003 SER A 1012 1 ? 10 
HELX_P HELX_P54 54 GLY A 912 ? ARG A 922 ? GLY A 1014 ARG A 1024 1 ? 11 
HELX_P HELX_P55 55 LEU A 923 ? ASP A 930 ? LEU A 1025 ASP A 1032 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DT 1  N3 ? ? ? 1_555 C DA 36 N1 ? ? B DT -6 C DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DT 1  O4 ? ? ? 1_555 C DA 36 N6 ? ? B DT -6 C DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DA 2  N1 ? ? ? 1_555 C DT 35 N3 ? ? B DA -5 C DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DA 2  N6 ? ? ? 1_555 C DT 35 O4 ? ? B DA -5 C DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DG 3  N1 ? ? ? 1_555 C DC 34 N3 ? ? B DG -4 C DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DG 3  N2 ? ? ? 1_555 C DC 34 O2 ? ? B DG -4 C DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DG 3  O6 ? ? ? 1_555 C DC 34 N4 ? ? B DG -4 C DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DT 33 N3 ? ? B DA -3 C DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DT 33 O4 ? ? B DA -3 C DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 32 N1 ? ? B DT -2 C DA 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 32 N6 ? ? B DT -2 C DA 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 31 N3 ? ? B DA -1 C DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 31 O4 ? ? B DA -1 C DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DT 7  N3 ? ? ? 1_555 C DA 30 N1 ? ? B DT 0  C DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DT 7  O4 ? ? ? 1_555 C DA 30 N6 ? ? B DT 0  C DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DG 8  N1 ? ? ? 1_555 C DC 29 N3 ? ? B DG 1  C DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DG 8  N2 ? ? ? 1_555 C DC 29 O2 ? ? B DG 1  C DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DG 8  O6 ? ? ? 1_555 C DC 29 N4 ? ? B DG 1  C DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 28 N1 ? ? B DC 2  C DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 28 O6 ? ? B DC 2  C DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 28 N2 ? ? B DC 2  C DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 27 N3 ? ? B DA 3  C DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 27 O4 ? ? B DA 3  C DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DT 11 N3 ? ? ? 1_555 C DA 26 N1 ? ? B DT 4  C DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DA 26 N6 ? ? B DT 4  C DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? B DC 12 N3 ? ? ? 1_555 C DG 25 N1 ? ? B DC 5  C DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DC 12 N4 ? ? ? 1_555 C DG 25 O6 ? ? B DC 5  C DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DC 12 O2 ? ? ? 1_555 C DG 25 N2 ? ? B DC 5  C DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DT 13 N3 ? ? ? 1_555 C DA 24 N1 ? ? B DT 6  C DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DT 13 O4 ? ? ? 1_555 C DA 24 N6 ? ? B DT 6  C DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DC 14 N3 ? ? ? 1_555 C DG 23 N1 ? ? B DC 7  C DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? B DC 14 N4 ? ? ? 1_555 C DG 23 O6 ? ? B DC 7  C DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? B DC 14 O2 ? ? ? 1_555 C DG 23 N2 ? ? B DC 7  C DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? B DC 15 N3 ? ? ? 1_555 C DG 22 N1 ? ? B DC 8  C DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? B DC 15 N4 ? ? ? 1_555 C DG 22 O6 ? ? B DC 8  C DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? B DC 15 O2 ? ? ? 1_555 C DG 22 N2 ? ? B DC 8  C DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? B DC 16 N3 ? ? ? 1_555 C DG 21 N1 ? ? B DC 9  C DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? B DC 16 N4 ? ? ? 1_555 C DG 21 O6 ? ? B DC 9  C DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? B DC 16 O2 ? ? ? 1_555 C DG 21 N2 ? ? B DC 9  C DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? B DC 17 N3 ? ? ? 1_555 C DG 20 N1 ? ? B DC 10 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? B DC 17 N4 ? ? ? 1_555 C DG 20 O6 ? ? B DC 10 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? B DC 17 O2 ? ? ? 1_555 C DG 20 N2 ? ? B DC 10 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? B DC 18 N3 ? ? ? 1_555 C DG 19 N1 ? ? B DC 11 C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? B DC 18 N4 ? ? ? 1_555 C DG 19 O6 ? ? B DC 11 C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? B DC 18 O2 ? ? ? 1_555 C DG 19 N2 ? ? B DC 11 C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? B DT 19 N3 ? ? ? 1_555 C DA 18 N1 ? ? B DT 12 C DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? B DT 19 O4 ? ? ? 1_555 C DA 18 N6 ? ? B DT 12 C DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? B DA 20 N1 ? ? ? 1_555 C DT 17 N3 ? ? B DA 13 C DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? B DA 20 N6 ? ? ? 1_555 C DT 17 O4 ? ? B DA 13 C DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? B DC 21 N3 ? ? ? 1_555 C DG 16 N1 ? ? B DC 14 C DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? B DC 21 N4 ? ? ? 1_555 C DG 16 O6 ? ? B DC 14 C DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? B DC 21 O2 ? ? ? 1_555 C DG 16 N2 ? ? B DC 14 C DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? B DT 22 N3 ? ? ? 1_555 C DA 15 N1 ? ? B DT 15 C DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? B DT 22 O4 ? ? ? 1_555 C DA 15 N6 ? ? B DT 15 C DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? B DG 23 N1 ? ? ? 1_555 C DC 14 N3 ? ? B DG 16 C DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? B DG 23 N2 ? ? ? 1_555 C DC 14 O2 ? ? B DG 16 C DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? B DG 23 O6 ? ? ? 1_555 C DC 14 N4 ? ? B DG 16 C DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? B DT 24 N3 ? ? ? 1_555 C DA 13 N1 ? ? B DT 17 C DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? B DT 24 O4 ? ? ? 1_555 C DA 13 N6 ? ? B DT 17 C DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? B DA 25 N1 ? ? ? 1_555 C DT 12 N3 ? ? B DA 18 C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? B DA 25 N6 ? ? ? 1_555 C DT 12 O4 ? ? B DA 18 C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? B DC 26 N3 ? ? ? 1_555 C DG 11 N1 ? ? B DC 19 C DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? B DC 26 N4 ? ? ? 1_555 C DG 11 O6 ? ? B DC 19 C DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? B DC 26 O2 ? ? ? 1_555 C DG 11 N2 ? ? B DC 19 C DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? B DA 27 N1 ? ? ? 1_555 C DT 10 N3 ? ? B DA 20 C DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? B DA 27 N6 ? ? ? 1_555 C DT 10 O4 ? ? B DA 20 C DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? B DC 28 N3 ? ? ? 1_555 C DG 9  N1 ? ? B DC 21 C DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68 hydrog ? ? B DC 28 N4 ? ? ? 1_555 C DG 9  O6 ? ? B DC 21 C DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? B DC 28 O2 ? ? ? 1_555 C DG 9  N2 ? ? B DC 21 C DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? B DC 29 N3 ? ? ? 1_555 C DG 8  N1 ? ? B DC 22 C DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? B DC 29 N4 ? ? ? 1_555 C DG 8  O6 ? ? B DC 22 C DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? B DC 29 O2 ? ? ? 1_555 C DG 8  N2 ? ? B DC 22 C DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? B DA 30 N1 ? ? ? 1_555 C DT 7  N3 ? ? B DA 23 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? B DA 30 N6 ? ? ? 1_555 C DT 7  O4 ? ? B DA 23 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? B DC 31 N3 ? ? ? 1_555 C DG 6  N1 ? ? B DC 24 C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? B DC 31 N4 ? ? ? 1_555 C DG 6  O6 ? ? B DC 24 C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77 hydrog ? ? B DC 31 O2 ? ? ? 1_555 C DG 6  N2 ? ? B DC 24 C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78 hydrog ? ? B DC 32 N3 ? ? ? 1_555 C DG 5  N1 ? ? B DC 25 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79 hydrog ? ? B DC 32 N4 ? ? ? 1_555 C DG 5  O6 ? ? B DC 25 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80 hydrog ? ? B DC 32 O2 ? ? ? 1_555 C DG 5  N2 ? ? B DC 25 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81 hydrog ? ? B DA 33 N1 ? ? ? 1_555 C DT 4  N3 ? ? B DA 26 C DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82 hydrog ? ? B DA 33 N6 ? ? ? 1_555 C DT 4  O4 ? ? B DA 26 C DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83 hydrog ? ? B DA 34 N1 ? ? ? 1_555 C DT 3  N3 ? ? B DA 27 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84 hydrog ? ? B DA 34 N6 ? ? ? 1_555 C DT 3  O4 ? ? B DA 27 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85 hydrog ? ? B DA 35 N1 ? ? ? 1_555 C DT 2  N3 ? ? B DA 28 C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86 hydrog ? ? B DA 35 N6 ? ? ? 1_555 C DT 2  O4 ? ? B DA 28 C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87 hydrog ? ? B DA 36 N1 ? ? ? 1_555 C DT 1  N3 ? ? B DA 29 C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88 hydrog ? ? B DA 36 N6 ? ? ? 1_555 C DT 1  O4 ? ? B DA 29 C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 101 A . ? LEU 203  A GLY 102 A ? GLY 204  A 1 -0.63  
2 GLY 102 A . ? GLY 204  A THR 103 A ? THR 205  A 1 3.97   
3 HIS 110 A . ? HIS 212  A ILE 111 A ? ILE 213  A 1 -10.04 
4 VAL 939 A . ? VAL 1041 A ALA 940 A ? ALA 1042 A 1 0.02   
5 ASN 944 A . ? ASN 1046 A SER 945 A ? SER 1047 A 1 4.41   
# 
_database_PDB_matrix.entry_id          3UGM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UGM 
_atom_sites.fract_transf_matrix[1][1]   0.010463 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004024 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018300 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 67  ? 31.723  101.150 -9.895  1.00 107.85 ? 169  LYS A N     1 
ATOM   2    C CA    . LYS A 1 67  ? 31.980  99.760  -10.040 1.00 107.85 ? 169  LYS A CA    1 
ATOM   3    C C     . LYS A 1 67  ? 30.833  98.861  -10.405 1.00 107.85 ? 169  LYS A C     1 
ATOM   4    O O     . LYS A 1 67  ? 30.169  98.235  -9.550  1.00 107.85 ? 169  LYS A O     1 
ATOM   5    C CB    . LYS A 1 67  ? 32.429  99.377  -8.981  1.00 63.82  ? 169  LYS A CB    1 
ATOM   6    N N     . PRO A 1 68  ? 30.693  98.725  -11.709 1.00 137.28 ? 170  PRO A N     1 
ATOM   7    C CA    . PRO A 1 68  ? 29.539  98.507  -12.424 1.00 136.93 ? 170  PRO A CA    1 
ATOM   8    C C     . PRO A 1 68  ? 29.265  97.148  -12.534 1.00 137.19 ? 170  PRO A C     1 
ATOM   9    O O     . PRO A 1 68  ? 29.837  96.543  -13.335 1.00 137.79 ? 170  PRO A O     1 
ATOM   10   C CB    . PRO A 1 68  ? 29.732  98.969  -13.669 1.00 48.22  ? 170  PRO A CB    1 
ATOM   11   N N     . LYS A 1 69  ? 28.315  96.672  -11.772 1.00 164.45 ? 171  LYS A N     1 
ATOM   12   C CA    . LYS A 1 69  ? 27.817  95.375  -11.896 1.00 163.91 ? 171  LYS A CA    1 
ATOM   13   C C     . LYS A 1 69  ? 27.419  95.613  -13.222 1.00 164.27 ? 171  LYS A C     1 
ATOM   14   O O     . LYS A 1 69  ? 26.593  96.323  -13.397 1.00 164.82 ? 171  LYS A O     1 
ATOM   15   C CB    . LYS A 1 69  ? 26.718  95.287  -11.147 1.00 52.89  ? 171  LYS A CB    1 
ATOM   16   N N     . VAL A 1 70  ? 27.986  95.019  -14.215 1.00 97.02  ? 172  VAL A N     1 
ATOM   17   C CA    . VAL A 1 70  ? 27.662  95.399  -15.605 1.00 97.02  ? 172  VAL A CA    1 
ATOM   18   C C     . VAL A 1 70  ? 26.329  94.855  -16.090 1.00 97.02  ? 172  VAL A C     1 
ATOM   19   O O     . VAL A 1 70  ? 25.667  94.410  -15.363 1.00 97.02  ? 172  VAL A O     1 
ATOM   20   N N     . ARG A 1 71  ? 26.099  94.851  -17.381 1.00 104.74 ? 173  ARG A N     1 
ATOM   21   C CA    . ARG A 1 71  ? 24.871  94.682  -18.137 1.00 104.74 ? 173  ARG A CA    1 
ATOM   22   C C     . ARG A 1 71  ? 24.551  93.387  -18.977 1.00 104.74 ? 173  ARG A C     1 
ATOM   23   O O     . ARG A 1 71  ? 23.861  93.394  -20.000 1.00 104.74 ? 173  ARG A O     1 
ATOM   24   C CB    . ARG A 1 71  ? 24.848  95.764  -19.038 1.00 49.90  ? 173  ARG A CB    1 
ATOM   25   N N     . GLU A 1 79  ? 18.889  106.161 -15.127 1.00 86.72  ? 181  GLU A N     1 
ATOM   26   C CA    . GLU A 1 79  ? 17.840  106.724 -14.348 1.00 86.72  ? 181  GLU A CA    1 
ATOM   27   C C     . GLU A 1 79  ? 16.830  105.635 -13.911 1.00 86.72  ? 181  GLU A C     1 
ATOM   28   O O     . GLU A 1 79  ? 16.399  105.541 -12.749 1.00 86.72  ? 181  GLU A O     1 
ATOM   29   C CB    . GLU A 1 79  ? 17.197  107.845 -15.144 1.00 63.62  ? 181  GLU A CB    1 
ATOM   30   N N     . LEU A 1 81  ? 19.801  104.205 -11.281 1.00 99.27  ? 183  LEU A N     1 
ATOM   31   C CA    . LEU A 1 81  ? 19.972  103.966 -9.912  1.00 99.27  ? 183  LEU A CA    1 
ATOM   32   C C     . LEU A 1 81  ? 19.277  105.085 -9.316  1.00 99.27  ? 183  LEU A C     1 
ATOM   33   O O     . LEU A 1 81  ? 18.229  105.458 -9.729  1.00 99.27  ? 183  LEU A O     1 
ATOM   34   C CB    . LEU A 1 81  ? 21.383  104.063 -9.567  1.00 72.26  ? 183  LEU A CB    1 
ATOM   35   N N     . VAL A 1 82  ? 19.948  105.640 -8.343  1.00 109.25 ? 184  VAL A N     1 
ATOM   36   C CA    . VAL A 1 82  ? 19.530  106.757 -7.599  1.00 109.25 ? 184  VAL A CA    1 
ATOM   37   C C     . VAL A 1 82  ? 20.818  107.505 -7.561  1.00 109.25 ? 184  VAL A C     1 
ATOM   38   O O     . VAL A 1 82  ? 21.452  107.589 -8.577  1.00 109.25 ? 184  VAL A O     1 
ATOM   39   C CB    . VAL A 1 82  ? 19.124  106.328 -6.270  1.00 109.69 ? 184  VAL A CB    1 
ATOM   40   N N     . ALA A 1 89  ? 20.775  107.769 -0.362  1.00 87.50  ? 191  ALA A N     1 
ATOM   41   C CA    . ALA A 1 89  ? 20.549  108.283 -1.580  1.00 87.50  ? 191  ALA A CA    1 
ATOM   42   C C     . ALA A 1 89  ? 21.639  107.796 -2.199  1.00 87.50  ? 191  ALA A C     1 
ATOM   43   O O     . ALA A 1 89  ? 22.144  108.410 -2.891  1.00 87.50  ? 191  ALA A O     1 
ATOM   44   C CB    . ALA A 1 89  ? 20.669  109.477 -1.512  1.00 57.40  ? 191  ALA A CB    1 
ATOM   45   N N     . HIS A 1 90  ? 21.966  106.579 -1.928  1.00 139.33 ? 192  HIS A N     1 
ATOM   46   C CA    . HIS A 1 90  ? 22.979  105.670 -2.550  1.00 139.33 ? 192  HIS A CA    1 
ATOM   47   C C     . HIS A 1 90  ? 22.814  105.106 -3.950  1.00 139.33 ? 192  HIS A C     1 
ATOM   48   O O     . HIS A 1 90  ? 21.784  104.626 -4.306  1.00 139.33 ? 192  HIS A O     1 
ATOM   49   C CB    . HIS A 1 90  ? 23.052  104.514 -1.723  1.00 65.52  ? 192  HIS A CB    1 
ATOM   50   N N     . ILE A 1 91  ? 23.853  104.979 -4.720  1.00 172.62 ? 193  ILE A N     1 
ATOM   51   C CA    . ILE A 1 91  ? 23.605  104.408 -5.998  1.00 172.62 ? 193  ILE A CA    1 
ATOM   52   C C     . ILE A 1 91  ? 23.060  103.137 -5.553  1.00 172.62 ? 193  ILE A C     1 
ATOM   53   O O     . ILE A 1 91  ? 23.186  102.822 -4.436  1.00 172.62 ? 193  ILE A O     1 
ATOM   54   C CB    . ILE A 1 91  ? 24.788  104.211 -6.620  1.00 62.21  ? 193  ILE A CB    1 
ATOM   55   N N     . VAL A 1 92  ? 22.438  102.393 -6.461  1.00 187.51 ? 194  VAL A N     1 
ATOM   56   C CA    . VAL A 1 92  ? 21.856  101.107 -6.125  1.00 187.51 ? 194  VAL A CA    1 
ATOM   57   C C     . VAL A 1 92  ? 22.585  100.148 -5.205  1.00 187.51 ? 194  VAL A C     1 
ATOM   58   O O     . VAL A 1 92  ? 22.017  99.656  -4.230  1.00 187.51 ? 194  VAL A O     1 
ATOM   59   N N     . ALA A 1 93  ? 23.849  99.881  -5.517  1.00 187.92 ? 195  ALA A N     1 
ATOM   60   C CA    . ALA A 1 93  ? 24.662  98.975  -4.715  1.00 187.92 ? 195  ALA A CA    1 
ATOM   61   C C     . ALA A 1 93  ? 24.945  99.721  -3.415  1.00 187.92 ? 195  ALA A C     1 
ATOM   62   O O     . ALA A 1 93  ? 25.990  100.355 -3.268  1.00 187.92 ? 195  ALA A O     1 
ATOM   63   C CB    . ALA A 1 93  ? 25.960  98.650  -5.436  1.00 99.44  ? 195  ALA A CB    1 
ATOM   64   N N     . LEU A 1 94  ? 24.008  99.642  -2.476  1.00 119.43 ? 196  LEU A N     1 
ATOM   65   C CA    . LEU A 1 94  ? 24.155  100.306 -1.195  1.00 119.43 ? 196  LEU A CA    1 
ATOM   66   C C     . LEU A 1 94  ? 24.503  99.341  -0.078  1.00 119.43 ? 196  LEU A C     1 
ATOM   67   O O     . LEU A 1 94  ? 25.675  99.144  0.242   1.00 119.43 ? 196  LEU A O     1 
ATOM   68   N N     . SER A 1 95  ? 23.479  98.736  0.515   1.00 162.97 ? 197  SER A N     1 
ATOM   69   C CA    . SER A 1 95  ? 23.677  97.785  1.603   1.00 162.97 ? 197  SER A CA    1 
ATOM   70   C C     . SER A 1 95  ? 23.833  96.587  0.672   1.00 162.97 ? 197  SER A C     1 
ATOM   71   O O     . SER A 1 95  ? 22.846  96.008  0.218   1.00 162.97 ? 197  SER A O     1 
ATOM   72   C CB    . SER A 1 95  ? 22.439  97.723  2.484   1.00 77.47  ? 197  SER A CB    1 
ATOM   73   N N     . GLN A 1 96  ? 25.079  96.220  0.393   1.00 130.03 ? 198  GLN A N     1 
ATOM   74   C CA    . GLN A 1 96  ? 25.367  95.090  -0.483  1.00 130.03 ? 198  GLN A CA    1 
ATOM   75   C C     . GLN A 1 96  ? 24.565  93.921  0.079   1.00 130.03 ? 198  GLN A C     1 
ATOM   76   O O     . GLN A 1 96  ? 24.837  93.442  1.179   1.00 130.03 ? 198  GLN A O     1 
ATOM   77   C CB    . GLN A 1 96  ? 26.856  94.870  -0.263  1.00 122.39 ? 198  GLN A CB    1 
ATOM   78   N N     . HIS A 1 97  ? 23.576  93.468  -0.684  1.00 136.87 ? 199  HIS A N     1 
ATOM   79   C CA    . HIS A 1 97  ? 22.731  92.356  -0.262  1.00 136.87 ? 199  HIS A CA    1 
ATOM   80   C C     . HIS A 1 97  ? 22.633  91.431  -1.470  1.00 136.87 ? 199  HIS A C     1 
ATOM   81   O O     . HIS A 1 97  ? 22.875  90.228  -1.363  1.00 136.87 ? 199  HIS A O     1 
ATOM   82   C CB    . HIS A 1 97  ? 21.445  92.876  0.383   1.00 186.83 ? 199  HIS A CB    1 
ATOM   83   C CG    . HIS A 1 97  ? 20.875  91.958  1.420   1.00 186.83 ? 199  HIS A CG    1 
ATOM   84   N ND1   . HIS A 1 97  ? 21.302  90.658  1.578   1.00 186.83 ? 199  HIS A ND1   1 
ATOM   85   C CD2   . HIS A 1 97  ? 19.912  92.154  2.351   1.00 186.83 ? 199  HIS A CD2   1 
ATOM   86   C CE1   . HIS A 1 97  ? 20.627  90.091  2.562   1.00 186.83 ? 199  HIS A CE1   1 
ATOM   87   N NE2   . HIS A 1 97  ? 19.777  90.978  3.048   1.00 186.83 ? 199  HIS A NE2   1 
ATOM   88   N N     . PRO A 1 98  ? 22.277  91.998  -2.617  1.00 90.50  ? 200  PRO A N     1 
ATOM   89   C CA    . PRO A 1 98  ? 22.148  91.246  -3.809  1.00 90.50  ? 200  PRO A CA    1 
ATOM   90   C C     . PRO A 1 98  ? 21.942  91.879  -4.984  1.00 90.50  ? 200  PRO A C     1 
ATOM   91   O O     . PRO A 1 98  ? 22.248  92.887  -4.971  1.00 90.50  ? 200  PRO A O     1 
ATOM   92   C CB    . PRO A 1 98  ? 20.847  90.550  -3.399  1.00 173.67 ? 200  PRO A CB    1 
ATOM   93   C CG    . PRO A 1 98  ? 20.156  91.529  -2.515  1.00 173.67 ? 200  PRO A CG    1 
ATOM   94   C CD    . PRO A 1 98  ? 21.063  92.718  -2.453  1.00 173.67 ? 200  PRO A CD    1 
ATOM   95   N N     . ALA A 1 99  ? 21.858  91.263  -6.052  1.00 104.02 ? 201  ALA A N     1 
ATOM   96   C CA    . ALA A 1 99  ? 22.085  92.026  -7.085  1.00 104.02 ? 201  ALA A CA    1 
ATOM   97   C C     . ALA A 1 99  ? 20.990  91.989  -7.780  1.00 104.02 ? 201  ALA A C     1 
ATOM   98   O O     . ALA A 1 99  ? 20.982  92.373  -8.872  1.00 104.02 ? 201  ALA A O     1 
ATOM   99   C CB    . ALA A 1 99  ? 23.481  92.098  -7.686  1.00 55.32  ? 201  ALA A CB    1 
ATOM   100  N N     . ALA A 1 100 ? 20.033  91.417  -7.080  1.00 121.70 ? 202  ALA A N     1 
ATOM   101  C CA    . ALA A 1 100 ? 18.760  90.912  -7.323  1.00 121.70 ? 202  ALA A CA    1 
ATOM   102  C C     . ALA A 1 100 ? 18.144  92.185  -7.250  1.00 121.70 ? 202  ALA A C     1 
ATOM   103  O O     . ALA A 1 100 ? 17.795  92.486  -6.213  1.00 121.70 ? 202  ALA A O     1 
ATOM   104  C CB    . ALA A 1 100 ? 18.545  90.342  -6.126  1.00 39.07  ? 202  ALA A CB    1 
ATOM   105  N N     . LEU A 1 101 ? 18.185  93.008  -8.320  1.00 129.43 ? 203  LEU A N     1 
ATOM   106  C CA    . LEU A 1 101 ? 17.624  94.415  -8.539  1.00 129.43 ? 203  LEU A CA    1 
ATOM   107  C C     . LEU A 1 101 ? 17.815  94.843  -10.045 1.00 129.43 ? 203  LEU A C     1 
ATOM   108  O O     . LEU A 1 101 ? 18.631  94.340  -10.660 1.00 129.43 ? 203  LEU A O     1 
ATOM   109  C CB    . LEU A 1 101 ? 18.302  95.422  -7.607  1.00 86.64  ? 203  LEU A CB    1 
ATOM   110  C CG    . LEU A 1 101 ? 18.045  95.239  -6.109  1.00 86.64  ? 203  LEU A CG    1 
ATOM   111  C CD1   . LEU A 1 101 ? 18.891  96.208  -5.298  1.00 86.64  ? 203  LEU A CD1   1 
ATOM   112  C CD2   . LEU A 1 101 ? 16.569  95.412  -5.791  1.00 86.64  ? 203  LEU A CD2   1 
ATOM   113  N N     . GLY A 1 102 ? 16.970  95.740  -10.543 1.00 112.01 ? 204  GLY A N     1 
ATOM   114  C CA    . GLY A 1 102 ? 15.888  96.319  -9.766  1.00 112.01 ? 204  GLY A CA    1 
ATOM   115  C C     . GLY A 1 102 ? 14.829  95.248  -9.584  1.00 112.01 ? 204  GLY A C     1 
ATOM   116  O O     . GLY A 1 102 ? 14.865  94.234  -10.281 1.00 112.01 ? 204  GLY A O     1 
ATOM   117  N N     . THR A 1 103 ? 13.914  95.427  -8.635  1.00 83.03  ? 205  THR A N     1 
ATOM   118  C CA    . THR A 1 103 ? 13.813  96.621  -7.815  1.00 82.65  ? 205  THR A CA    1 
ATOM   119  C C     . THR A 1 103 ? 13.460  98.035  -8.230  1.00 82.91  ? 205  THR A C     1 
ATOM   120  O O     . THR A 1 103 ? 14.016  99.001  -7.707  1.00 83.78  ? 205  THR A O     1 
ATOM   121  N N     . VAL A 1 104 ? 12.531  98.158  -9.173  1.00 115.08 ? 206  VAL A N     1 
ATOM   122  C CA    . VAL A 1 104 ? 12.106  99.469  -9.654  1.00 114.84 ? 206  VAL A CA    1 
ATOM   123  C C     . VAL A 1 104 ? 11.015  100.387 -9.102  1.00 115.47 ? 206  VAL A C     1 
ATOM   124  O O     . VAL A 1 104 ? 10.488  101.219 -9.841  1.00 115.28 ? 206  VAL A O     1 
ATOM   125  C CB    . VAL A 1 104 ? 11.769  99.047  -11.081 1.00 115.22 ? 206  VAL A CB    1 
ATOM   126  N N     . ALA A 1 105 ? 10.652  100.246 -7.830  1.00 104.12 ? 207  ALA A N     1 
ATOM   127  C CA    . ALA A 1 105 ? 9.636   101.014 -7.347  1.00 103.76 ? 207  ALA A CA    1 
ATOM   128  C C     . ALA A 1 105 ? 10.384  102.244 -7.078  1.00 103.44 ? 207  ALA A C     1 
ATOM   129  O O     . ALA A 1 105 ? 10.065  103.127 -6.451  1.00 105.24 ? 207  ALA A O     1 
ATOM   130  C CB    . ALA A 1 105 ? 8.995   100.571 -6.235  1.00 18.73  ? 207  ALA A CB    1 
ATOM   131  N N     . VAL A 1 106 ? 11.522  102.187 -7.762  1.00 68.58  ? 208  VAL A N     1 
ATOM   132  C CA    . VAL A 1 106 ? 12.571  103.155 -7.650  1.00 66.99  ? 208  VAL A CA    1 
ATOM   133  C C     . VAL A 1 106 ? 12.522  103.504 -6.191  1.00 67.01  ? 208  VAL A C     1 
ATOM   134  O O     . VAL A 1 106 ? 12.449  104.684 -5.849  1.00 66.72  ? 208  VAL A O     1 
ATOM   135  C CB    . VAL A 1 106 ? 12.197  104.479 -8.338  1.00 135.87 ? 208  VAL A CB    1 
ATOM   136  C CG1   . VAL A 1 106 ? 13.182  105.573 -7.954  1.00 135.87 ? 208  VAL A CG1   1 
ATOM   137  C CG2   . VAL A 1 106 ? 12.153  104.298 -9.848  1.00 135.87 ? 208  VAL A CG2   1 
ATOM   138  N N     . THR A 1 107 ? 12.538  102.509 -5.302  1.00 112.99 ? 209  THR A N     1 
ATOM   139  C CA    . THR A 1 107 ? 12.323  102.929 -4.037  1.00 113.57 ? 209  THR A CA    1 
ATOM   140  C C     . THR A 1 107 ? 12.656  101.717 -3.227  1.00 114.50 ? 209  THR A C     1 
ATOM   141  O O     . THR A 1 107 ? 12.161  100.713 -3.311  1.00 114.68 ? 209  THR A O     1 
ATOM   142  C CB    . THR A 1 107 ? 11.017  103.585 -3.551  1.00 69.43  ? 209  THR A CB    1 
ATOM   143  O OG1   . THR A 1 107 ? 11.099  103.831 -2.143  1.00 69.43  ? 209  THR A OG1   1 
ATOM   144  C CG2   . THR A 1 107 ? 9.854   102.611 -3.670  1.00 69.43  ? 209  THR A CG2   1 
ATOM   145  N N     . TYR A 1 108 ? 13.550  101.991 -2.373  1.00 120.02 ? 210  TYR A N     1 
ATOM   146  C CA    . TYR A 1 108 ? 14.589  101.339 -1.830  1.00 120.47 ? 210  TYR A CA    1 
ATOM   147  C C     . TYR A 1 108 ? 14.819  101.135 -0.414  1.00 120.96 ? 210  TYR A C     1 
ATOM   148  O O     . TYR A 1 108 ? 15.007  100.047 -0.018  1.00 120.90 ? 210  TYR A O     1 
ATOM   149  C CB    . TYR A 1 108 ? 15.642  102.077 -2.447  1.00 120.53 ? 210  TYR A CB    1 
ATOM   150  C CG    . TYR A 1 108 ? 15.865  101.322 -3.597  1.00 120.53 ? 210  TYR A CG    1 
ATOM   151  C CD1   . TYR A 1 108 ? 15.166  100.289 -3.789  1.00 120.53 ? 210  TYR A CD1   1 
ATOM   152  C CD2   . TYR A 1 108 ? 16.840  101.555 -4.418  1.00 120.53 ? 210  TYR A CD2   1 
ATOM   153  C CE1   . TYR A 1 108 ? 15.469  99.485  -4.730  1.00 120.53 ? 210  TYR A CE1   1 
ATOM   154  C CE2   . TYR A 1 108 ? 17.093  100.793 -5.391  1.00 120.53 ? 210  TYR A CE2   1 
ATOM   155  C CZ    . TYR A 1 108 ? 16.429  99.759  -5.554  1.00 120.53 ? 210  TYR A CZ    1 
ATOM   156  O OH    . TYR A 1 108 ? 16.736  98.952  -6.592  1.00 120.53 ? 210  TYR A OH    1 
ATOM   157  N N     . GLN A 1 109 ? 15.096  102.136 0.401   1.00 108.86 ? 211  GLN A N     1 
ATOM   158  C CA    . GLN A 1 109 ? 15.756  101.838 1.705   1.00 108.80 ? 211  GLN A CA    1 
ATOM   159  C C     . GLN A 1 109 ? 15.251  100.555 2.468   1.00 109.35 ? 211  GLN A C     1 
ATOM   160  O O     . GLN A 1 109 ? 14.046  100.375 2.640   1.00 110.01 ? 211  GLN A O     1 
ATOM   161  C CB    . GLN A 1 109 ? 15.654  103.061 2.620   1.00 106.92 ? 211  GLN A CB    1 
ATOM   162  N N     . HIS A 1 110 ? 16.175  99.659  2.871   1.00 84.06  ? 212  HIS A N     1 
ATOM   163  C CA    . HIS A 1 110 ? 16.384  99.203  4.161   1.00 84.06  ? 212  HIS A CA    1 
ATOM   164  C C     . HIS A 1 110 ? 17.135  100.268 4.775   1.00 84.06  ? 212  HIS A C     1 
ATOM   165  O O     . HIS A 1 110 ? 18.016  100.725 4.180   1.00 84.06  ? 212  HIS A O     1 
ATOM   166  C CB    . HIS A 1 110 ? 17.035  98.073  4.112   1.00 95.72  ? 212  HIS A CB    1 
ATOM   167  N N     . ILE A 1 111 ? 16.765  100.634 5.996   1.00 170.02 ? 213  ILE A N     1 
ATOM   168  C CA    . ILE A 1 111 ? 15.523  100.156 6.624   1.00 170.02 ? 213  ILE A CA    1 
ATOM   169  C C     . ILE A 1 111 ? 15.048  98.685  6.593   1.00 170.02 ? 213  ILE A C     1 
ATOM   170  O O     . ILE A 1 111 ? 14.089  98.343  5.900   1.00 170.02 ? 213  ILE A O     1 
ATOM   171  C CB    . ILE A 1 111 ? 14.344  101.013 6.158   1.00 50.73  ? 213  ILE A CB    1 
ATOM   172  N N     . ILE A 1 112 ? 15.727  97.842  7.365   1.00 105.85 ? 214  ILE A N     1 
ATOM   173  C CA    . ILE A 1 112 ? 15.240  96.631  7.892   1.00 105.85 ? 214  ILE A CA    1 
ATOM   174  C C     . ILE A 1 112 ? 15.184  96.248  9.139   1.00 105.85 ? 214  ILE A C     1 
ATOM   175  O O     . ILE A 1 112 ? 15.869  96.669  9.864   1.00 105.85 ? 214  ILE A O     1 
ATOM   176  C CB    . ILE A 1 112 ? 16.239  95.743  7.125   1.00 174.61 ? 214  ILE A CB    1 
ATOM   177  C CG1   . ILE A 1 112 ? 16.138  96.003  5.621   1.00 174.61 ? 214  ILE A CG1   1 
ATOM   178  C CG2   . ILE A 1 112 ? 15.993  94.275  7.435   1.00 174.61 ? 214  ILE A CG2   1 
ATOM   179  C CD1   . ILE A 1 112 ? 17.254  95.374  4.817   1.00 174.61 ? 214  ILE A CD1   1 
ATOM   180  N N     . THR A 1 113 ? 14.067  95.626  9.484   1.00 142.93 ? 215  THR A N     1 
ATOM   181  C CA    . THR A 1 113 ? 13.658  95.431  10.868  1.00 142.93 ? 215  THR A CA    1 
ATOM   182  C C     . THR A 1 113 ? 13.020  94.083  10.793  1.00 142.93 ? 215  THR A C     1 
ATOM   183  O O     . THR A 1 113 ? 11.827  93.891  11.030  1.00 142.93 ? 215  THR A O     1 
ATOM   184  C CB    . THR A 1 113 ? 12.621  96.472  11.309  1.00 127.57 ? 215  THR A CB    1 
ATOM   185  O OG1   . THR A 1 113 ? 11.750  96.778  10.212  1.00 127.57 ? 215  THR A OG1   1 
ATOM   186  C CG2   . THR A 1 113 ? 13.310  97.746  11.774  1.00 127.57 ? 215  THR A CG2   1 
ATOM   187  N N     . ALA A 1 114 ? 13.878  93.148  10.439  1.00 182.19 ? 216  ALA A N     1 
ATOM   188  C CA    . ALA A 1 114 ? 13.572  92.046  9.726   1.00 182.19 ? 216  ALA A CA    1 
ATOM   189  C C     . ALA A 1 114 ? 12.356  91.251  9.721   1.00 182.19 ? 216  ALA A C     1 
ATOM   190  O O     . ALA A 1 114 ? 11.643  91.145  8.767   1.00 182.19 ? 216  ALA A O     1 
ATOM   191  C CB    . ALA A 1 114 ? 14.430  91.120  10.134  1.00 66.09  ? 216  ALA A CB    1 
ATOM   192  N N     . LEU A 1 115 ? 12.157  90.723  10.904  1.00 154.56 ? 217  LEU A N     1 
ATOM   193  C CA    . LEU A 1 115 ? 11.151  89.815  11.332  1.00 154.56 ? 217  LEU A CA    1 
ATOM   194  C C     . LEU A 1 115 ? 11.069  88.708  10.334  1.00 154.56 ? 217  LEU A C     1 
ATOM   195  O O     . LEU A 1 115 ? 12.083  88.175  9.929   1.00 154.56 ? 217  LEU A O     1 
ATOM   196  C CB    . LEU A 1 115 ? 9.798   90.515  11.485  1.00 65.50  ? 217  LEU A CB    1 
ATOM   197  C CG    . LEU A 1 115 ? 9.699   91.563  12.596  1.00 65.50  ? 217  LEU A CG    1 
ATOM   198  C CD1   . LEU A 1 115 ? 8.359   92.279  12.540  1.00 65.50  ? 217  LEU A CD1   1 
ATOM   199  C CD2   . LEU A 1 115 ? 9.914   90.924  13.959  1.00 65.50  ? 217  LEU A CD2   1 
ATOM   200  N N     . ALA A 1 118 ? 11.772  88.069  6.821   1.00 121.22 ? 220  ALA A N     1 
ATOM   201  C CA    . ALA A 1 118 ? 11.895  86.824  6.072   1.00 121.22 ? 220  ALA A CA    1 
ATOM   202  C C     . ALA A 1 118 ? 13.017  86.907  5.043   1.00 121.22 ? 220  ALA A C     1 
ATOM   203  O O     . ALA A 1 118 ? 13.826  87.835  5.067   1.00 121.22 ? 220  ALA A O     1 
ATOM   204  C CB    . ALA A 1 118 ? 10.577  86.479  5.397   1.00 87.20  ? 220  ALA A CB    1 
ATOM   205  N N     . THR A 1 119 ? 13.059  85.933  4.141   1.00 86.03  ? 221  THR A N     1 
ATOM   206  C CA    . THR A 1 119 ? 14.082  85.894  3.102   1.00 83.13  ? 221  THR A CA    1 
ATOM   207  C C     . THR A 1 119 ? 14.228  87.251  2.421   1.00 80.89  ? 221  THR A C     1 
ATOM   208  O O     . THR A 1 119 ? 13.445  88.168  2.669   1.00 80.43  ? 221  THR A O     1 
ATOM   209  C CB    . THR A 1 119 ? 13.765  84.827  2.037   1.00 80.24  ? 221  THR A CB    1 
ATOM   210  O OG1   . THR A 1 119 ? 12.989  85.414  0.985   1.00 79.54  ? 221  THR A OG1   1 
ATOM   211  C CG2   . THR A 1 119 ? 12.986  83.675  2.654   1.00 79.60  ? 221  THR A CG2   1 
ATOM   212  N N     . HIS A 1 120 ? 15.234  87.370  1.561   1.00 84.20  ? 222  HIS A N     1 
ATOM   213  C CA    . HIS A 1 120 ? 15.476  88.571  0.867   1.00 84.72  ? 222  HIS A CA    1 
ATOM   214  C C     . HIS A 1 120 ? 14.516  88.455  -0.298  1.00 80.50  ? 222  HIS A C     1 
ATOM   215  O O     . HIS A 1 120 ? 13.874  89.455  -0.672  1.00 81.22  ? 222  HIS A O     1 
ATOM   216  C CB    . HIS A 1 120 ? 16.917  88.737  0.425   1.00 165.95 ? 222  HIS A CB    1 
ATOM   217  C CG    . HIS A 1 120 ? 17.282  90.154  0.078   1.00 173.42 ? 222  HIS A CG    1 
ATOM   218  N ND1   . HIS A 1 120 ? 18.302  90.443  -0.815  1.00 176.90 ? 222  HIS A ND1   1 
ATOM   219  C CD2   . HIS A 1 120 ? 16.805  91.359  0.494   1.00 167.63 ? 222  HIS A CD2   1 
ATOM   220  C CE1   . HIS A 1 120 ? 18.427  91.751  -0.928  1.00 169.94 ? 222  HIS A CE1   1 
ATOM   221  N NE2   . HIS A 1 120 ? 17.530  92.338  -0.143  1.00 163.55 ? 222  HIS A NE2   1 
ATOM   222  N N     . GLU A 1 121 ? 14.376  87.244  -0.836  1.00 114.21 ? 223  GLU A N     1 
ATOM   223  C CA    . GLU A 1 121 ? 13.503  86.971  -1.979  1.00 116.04 ? 223  GLU A CA    1 
ATOM   224  C C     . GLU A 1 121 ? 12.052  87.437  -1.836  1.00 119.81 ? 223  GLU A C     1 
ATOM   225  O O     . GLU A 1 121 ? 11.379  87.712  -2.833  1.00 122.36 ? 223  GLU A O     1 
ATOM   226  C CB    . GLU A 1 121 ? 13.533  85.490  -2.288  1.00 64.96  ? 223  GLU A CB    1 
ATOM   227  N N     . ASP A 1 122 ? 11.576  87.500  -0.595  1.00 107.76 ? 224  ASP A N     1 
ATOM   228  C CA    . ASP A 1 122 ? 10.217  87.937  -0.267  1.00 103.72 ? 224  ASP A CA    1 
ATOM   229  C C     . ASP A 1 122 ? 10.103  89.460  -0.282  1.00 99.65  ? 224  ASP A C     1 
ATOM   230  O O     . ASP A 1 122 ? 9.479   90.023  -1.176  1.00 100.84 ? 224  ASP A O     1 
ATOM   231  C CB    . ASP A 1 122 ? 9.823   87.422  1.114   1.00 113.42 ? 224  ASP A CB    1 
ATOM   232  C CG    . ASP A 1 122 ? 9.655   85.927  1.142   1.00 116.15 ? 224  ASP A CG    1 
ATOM   233  O OD1   . ASP A 1 122 ? 10.136  85.287  0.183   1.00 114.63 ? 224  ASP A OD1   1 
ATOM   234  O OD2   . ASP A 1 122 ? 9.060   85.400  2.119   1.00 116.66 ? 224  ASP A OD2   1 
ATOM   235  N N     . ILE A 1 123 ? 10.702  90.121  0.709   1.00 75.66  ? 225  ILE A N     1 
ATOM   236  C CA    . ILE A 1 123 ? 10.686  91.600  0.813   1.00 68.92  ? 225  ILE A CA    1 
ATOM   237  C C     . ILE A 1 123 ? 11.049  92.268  -0.542  1.00 63.30  ? 225  ILE A C     1 
ATOM   238  O O     . ILE A 1 123 ? 10.399  93.200  -0.972  1.00 58.68  ? 225  ILE A O     1 
ATOM   239  C CB    . ILE A 1 123 ? 11.628  92.089  1.976   1.00 76.51  ? 225  ILE A CB    1 
ATOM   240  C CG1   . ILE A 1 123 ? 13.052  91.533  1.793   1.00 76.55  ? 225  ILE A CG1   1 
ATOM   241  C CG2   . ILE A 1 123 ? 11.051  91.640  3.317   1.00 74.91  ? 225  ILE A CG2   1 
ATOM   242  C CD1   . ILE A 1 123 ? 14.087  92.156  2.707   1.00 78.50  ? 225  ILE A CD1   1 
ATOM   243  N N     . VAL A 1 124 ? 12.097  91.793  -1.200  1.00 63.88  ? 226  VAL A N     1 
ATOM   244  C CA    . VAL A 1 124 ? 12.423  92.265  -2.538  1.00 60.34  ? 226  VAL A CA    1 
ATOM   245  C C     . VAL A 1 124 ? 11.201  92.043  -3.420  1.00 58.21  ? 226  VAL A C     1 
ATOM   246  O O     . VAL A 1 124 ? 10.728  92.952  -4.103  1.00 53.96  ? 226  VAL A O     1 
ATOM   247  C CB    . VAL A 1 124 ? 13.546  91.457  -3.173  1.00 49.95  ? 226  VAL A CB    1 
ATOM   248  C CG1   . VAL A 1 124 ? 13.687  91.842  -4.624  1.00 46.64  ? 226  VAL A CG1   1 
ATOM   249  C CG2   . VAL A 1 124 ? 14.839  91.765  -2.385  1.00 55.57  ? 226  VAL A CG2   1 
ATOM   250  N N     . GLY A 1 125 ? 10.694  90.813  -3.417  1.00 74.73  ? 227  GLY A N     1 
ATOM   251  C CA    . GLY A 1 125 ? 9.512   90.487  -4.201  1.00 69.54  ? 227  GLY A CA    1 
ATOM   252  C C     . GLY A 1 125 ? 8.313   91.381  -3.905  1.00 67.99  ? 227  GLY A C     1 
ATOM   253  O O     . GLY A 1 125 ? 7.312   91.317  -4.590  1.00 73.08  ? 227  GLY A O     1 
ATOM   254  N N     . VAL A 1 126 ? 8.422   92.252  -2.911  1.00 76.10  ? 228  VAL A N     1 
ATOM   255  C CA    . VAL A 1 126 ? 7.322   93.128  -2.512  1.00 71.73  ? 228  VAL A CA    1 
ATOM   256  C C     . VAL A 1 126 ? 7.575   94.598  -2.826  1.00 71.93  ? 228  VAL A C     1 
ATOM   257  O O     . VAL A 1 126 ? 6.634   95.317  -3.197  1.00 72.42  ? 228  VAL A O     1 
ATOM   258  C CB    . VAL A 1 126 ? 7.011   92.905  -1.037  1.00 45.04  ? 228  VAL A CB    1 
ATOM   259  C CG1   . VAL A 1 126 ? 6.574   94.149  -0.368  1.00 44.08  ? 228  VAL A CG1   1 
ATOM   260  C CG2   . VAL A 1 126 ? 5.950   91.876  -0.922  1.00 42.21  ? 228  VAL A CG2   1 
ATOM   261  N N     . GLY A 1 127 ? 8.821   95.046  -2.666  1.00 48.87  ? 229  GLY A N     1 
ATOM   262  C CA    . GLY A 1 127 ? 9.172   96.396  -3.050  1.00 46.45  ? 229  GLY A CA    1 
ATOM   263  C C     . GLY A 1 127 ? 9.458   96.354  -4.548  1.00 46.57  ? 229  GLY A C     1 
ATOM   264  O O     . GLY A 1 127 ? 10.156  97.217  -5.061  1.00 49.92  ? 229  GLY A O     1 
ATOM   265  N N     . LYS A 1 128 ? 8.969   95.341  -5.264  1.00 55.33  ? 230  LYS A N     1 
ATOM   266  C CA    . LYS A 1 128 ? 9.146   95.265  -6.723  1.00 54.33  ? 230  LYS A CA    1 
ATOM   267  C C     . LYS A 1 128 ? 7.858   95.837  -7.364  1.00 50.98  ? 230  LYS A C     1 
ATOM   268  O O     . LYS A 1 128 ? 7.818   96.171  -8.566  1.00 46.03  ? 230  LYS A O     1 
ATOM   269  C CB    . LYS A 1 128 ? 9.306   93.781  -7.130  1.00 81.74  ? 230  LYS A CB    1 
ATOM   270  C CG    . LYS A 1 128 ? 9.863   93.534  -8.538  1.00 83.93  ? 230  LYS A CG    1 
ATOM   271  C CD    . LYS A 1 128 ? 8.913   92.717  -9.429  1.00 85.73  ? 230  LYS A CD    1 
ATOM   272  C CE    . LYS A 1 128 ? 9.359   91.252  -9.592  1.00 85.26  ? 230  LYS A CE    1 
ATOM   273  N NZ    . LYS A 1 128 ? 8.901   90.403  -8.435  1.00 88.90  ? 230  LYS A NZ    1 
ATOM   274  N N     . GLN A 1 129 ? 6.840   95.982  -6.510  1.00 68.86  ? 231  GLN A N     1 
ATOM   275  C CA    . GLN A 1 129 ? 5.462   96.302  -6.871  1.00 66.92  ? 231  GLN A CA    1 
ATOM   276  C C     . GLN A 1 129 ? 5.059   97.723  -6.794  1.00 69.04  ? 231  GLN A C     1 
ATOM   277  O O     . GLN A 1 129 ? 5.663   98.445  -6.057  1.00 75.11  ? 231  GLN A O     1 
ATOM   278  C CB    . GLN A 1 129 ? 4.566   95.533  -5.904  1.00 48.05  ? 231  GLN A CB    1 
ATOM   279  C CG    . GLN A 1 129 ? 4.957   94.048  -5.652  1.00 44.18  ? 231  GLN A CG    1 
ATOM   280  C CD    . GLN A 1 129 ? 5.179   93.322  -6.958  1.00 40.79  ? 231  GLN A CD    1 
ATOM   281  O OE1   . GLN A 1 129 ? 4.354   93.403  -7.917  1.00 36.66  ? 231  GLN A OE1   1 
ATOM   282  N NE2   . GLN A 1 129 ? 6.317   92.645  -7.039  1.00 42.42  ? 231  GLN A NE2   1 
ATOM   283  N N     . TRP A 1 130 ? 4.053   98.148  -7.544  1.00 53.46  ? 232  TRP A N     1 
ATOM   284  C CA    . TRP A 1 130 ? 3.523   99.495  -7.336  1.00 51.99  ? 232  TRP A CA    1 
ATOM   285  C C     . TRP A 1 130 ? 3.246   99.467  -5.802  1.00 55.67  ? 232  TRP A C     1 
ATOM   286  O O     . TRP A 1 130 ? 2.755   98.457  -5.227  1.00 63.27  ? 232  TRP A O     1 
ATOM   287  C CB    . TRP A 1 130 ? 2.183   99.637  -8.045  1.00 53.27  ? 232  TRP A CB    1 
ATOM   288  C CG    . TRP A 1 130 ? 1.017   98.971  -7.255  1.00 51.17  ? 232  TRP A CG    1 
ATOM   289  C CD1   . TRP A 1 130 ? 0.694   97.634  -7.208  1.00 49.80  ? 232  TRP A CD1   1 
ATOM   290  C CD2   . TRP A 1 130 ? 0.141   99.613  -6.327  1.00 50.41  ? 232  TRP A CD2   1 
ATOM   291  N NE1   . TRP A 1 130 ? -0.323  97.411  -6.321  1.00 48.61  ? 232  TRP A NE1   1 
ATOM   292  C CE2   . TRP A 1 130 ? -0.685  98.611  -5.766  1.00 50.53  ? 232  TRP A CE2   1 
ATOM   293  C CE3   . TRP A 1 130 ? -0.025  100.938 -5.908  1.00 49.27  ? 232  TRP A CE3   1 
ATOM   294  C CZ2   . TRP A 1 130 ? -1.669  98.903  -4.810  1.00 51.87  ? 232  TRP A CZ2   1 
ATOM   295  C CZ3   . TRP A 1 130 ? -0.970  101.232 -4.979  1.00 49.59  ? 232  TRP A CZ3   1 
ATOM   296  C CH2   . TRP A 1 130 ? -1.798  100.222 -4.433  1.00 51.77  ? 232  TRP A CH2   1 
ATOM   297  N N     . SER A 1 131 ? 3.533   100.549 -5.114  1.00 52.42  ? 233  SER A N     1 
ATOM   298  C CA    . SER A 1 131 ? 3.293   100.621 -3.634  1.00 52.90  ? 233  SER A CA    1 
ATOM   299  C C     . SER A 1 131 ? 4.197   99.747  -2.774  1.00 55.25  ? 233  SER A C     1 
ATOM   300  O O     . SER A 1 131 ? 3.825   99.385  -1.669  1.00 59.89  ? 233  SER A O     1 
ATOM   301  C CB    . SER A 1 131 ? 1.801   100.310 -3.274  1.00 39.06  ? 233  SER A CB    1 
ATOM   302  O OG    . SER A 1 131 ? 1.574   98.923  -2.941  1.00 37.58  ? 233  SER A OG    1 
ATOM   303  N N     . GLY A 1 132 ? 5.403   99.463  -3.253  1.00 66.67  ? 234  GLY A N     1 
ATOM   304  C CA    . GLY A 1 132 ? 6.354   98.610  -2.533  1.00 69.56  ? 234  GLY A CA    1 
ATOM   305  C C     . GLY A 1 132 ? 6.698   99.034  -1.126  1.00 72.13  ? 234  GLY A C     1 
ATOM   306  O O     . GLY A 1 132 ? 6.335   98.359  -0.153  1.00 74.42  ? 234  GLY A O     1 
ATOM   307  N N     . ALA A 1 133 ? 7.410   100.151 -1.024  1.00 59.25  ? 235  ALA A N     1 
ATOM   308  C CA    . ALA A 1 133 ? 7.790   100.691 0.275   1.00 57.88  ? 235  ALA A CA    1 
ATOM   309  C C     . ALA A 1 133 ? 6.618   100.835 1.229   1.00 59.55  ? 235  ALA A C     1 
ATOM   310  O O     . ALA A 1 133 ? 6.649   100.306 2.343   1.00 67.37  ? 235  ALA A O     1 
ATOM   311  C CB    . ALA A 1 133 ? 8.442   102.044 0.117   1.00 19.40  ? 235  ALA A CB    1 
ATOM   312  N N     . ARG A 1 134 ? 5.596   101.569 0.807   1.00 45.43  ? 236  ARG A N     1 
ATOM   313  C CA    . ARG A 1 134 ? 4.444   101.794 1.678   1.00 46.78  ? 236  ARG A CA    1 
ATOM   314  C C     . ARG A 1 134 ? 3.808   100.520 2.124   1.00 47.49  ? 236  ARG A C     1 
ATOM   315  O O     . ARG A 1 134 ? 3.149   100.488 3.205   1.00 47.02  ? 236  ARG A O     1 
ATOM   316  C CB    . ARG A 1 134 ? 3.405   102.708 1.008   1.00 58.08  ? 236  ARG A CB    1 
ATOM   317  C CG    . ARG A 1 134 ? 3.697   104.186 1.199   1.00 55.57  ? 236  ARG A CG    1 
ATOM   318  C CD    . ARG A 1 134 ? 3.149   104.982 0.041   1.00 56.05  ? 236  ARG A CD    1 
ATOM   319  N NE    . ARG A 1 134 ? 1.685   105.005 0.059   1.00 59.10  ? 236  ARG A NE    1 
ATOM   320  C CZ    . ARG A 1 134 ? 0.908   104.514 -0.907  1.00 61.08  ? 236  ARG A CZ    1 
ATOM   321  N NH1   . ARG A 1 134 ? 1.480   103.958 -1.986  1.00 63.50  ? 236  ARG A NH1   1 
ATOM   322  N NH2   . ARG A 1 134 ? -0.428  104.545 -0.777  1.00 57.84  ? 236  ARG A NH2   1 
ATOM   323  N N     . ALA A 1 135 ? 4.020   99.479  1.304   1.00 74.91  ? 237  ALA A N     1 
ATOM   324  C CA    . ALA A 1 135 ? 3.543   98.154  1.653   1.00 78.49  ? 237  ALA A CA    1 
ATOM   325  C C     . ALA A 1 135 ? 4.482   97.533  2.730   1.00 83.71  ? 237  ALA A C     1 
ATOM   326  O O     . ALA A 1 135 ? 4.011   96.851  3.651   1.00 91.02  ? 237  ALA A O     1 
ATOM   327  C CB    . ALA A 1 135 ? 3.487   97.282  0.447   1.00 30.68  ? 237  ALA A CB    1 
ATOM   328  N N     . LEU A 1 136 ? 5.797   97.771  2.637   1.00 88.21  ? 238  LEU A N     1 
ATOM   329  C CA    . LEU A 1 136 ? 6.739   97.204  3.617   1.00 90.98  ? 238  LEU A CA    1 
ATOM   330  C C     . LEU A 1 136 ? 6.536   97.779  5.028   1.00 93.69  ? 238  LEU A C     1 
ATOM   331  O O     . LEU A 1 136 ? 6.607   97.048  6.044   1.00 93.35  ? 238  LEU A O     1 
ATOM   332  C CB    . LEU A 1 136 ? 8.177   97.420  3.131   1.00 48.48  ? 238  LEU A CB    1 
ATOM   333  C CG    . LEU A 1 136 ? 8.722   96.471  2.012   1.00 44.18  ? 238  LEU A CG    1 
ATOM   334  C CD1   . LEU A 1 136 ? 10.058  96.966  1.502   1.00 42.19  ? 238  LEU A CD1   1 
ATOM   335  C CD2   . LEU A 1 136 ? 8.908   95.045  2.510   1.00 40.97  ? 238  LEU A CD2   1 
ATOM   336  N N     . GLU A 1 137 ? 6.244   99.085  5.054   1.00 81.73  ? 239  GLU A N     1 
ATOM   337  C CA    . GLU A 1 137 ? 5.981   99.861  6.283   1.00 82.08  ? 239  GLU A CA    1 
ATOM   338  C C     . GLU A 1 137 ? 4.611   99.534  6.930   1.00 82.83  ? 239  GLU A C     1 
ATOM   339  O O     . GLU A 1 137 ? 4.512   99.356  8.158   1.00 83.31  ? 239  GLU A O     1 
ATOM   340  C CB    . GLU A 1 137 ? 6.094   101.366 5.974   1.00 66.30  ? 239  GLU A CB    1 
ATOM   341  C CG    . GLU A 1 137 ? 7.177   101.661 4.934   1.00 66.23  ? 239  GLU A CG    1 
ATOM   342  C CD    . GLU A 1 137 ? 7.968   102.959 5.182   1.00 69.32  ? 239  GLU A CD    1 
ATOM   343  O OE1   . GLU A 1 137 ? 9.081   102.884 5.756   1.00 68.75  ? 239  GLU A OE1   1 
ATOM   344  O OE2   . GLU A 1 137 ? 7.484   104.060 4.798   1.00 72.08  ? 239  GLU A OE2   1 
ATOM   345  N N     . ALA A 1 138 ? 3.567   99.462  6.107   1.00 74.82  ? 240  ALA A N     1 
ATOM   346  C CA    . ALA A 1 138 ? 2.247   99.082  6.605   1.00 80.88  ? 240  ALA A CA    1 
ATOM   347  C C     . ALA A 1 138 ? 2.377   97.686  7.265   1.00 90.36  ? 240  ALA A C     1 
ATOM   348  O O     . ALA A 1 138 ? 1.842   97.443  8.362   1.00 97.48  ? 240  ALA A O     1 
ATOM   349  C CB    . ALA A 1 138 ? 1.250   99.024  5.454   1.00 72.50  ? 240  ALA A CB    1 
ATOM   350  N N     . LEU A 1 139 ? 3.081   96.782  6.571   1.00 95.84  ? 241  LEU A N     1 
ATOM   351  C CA    . LEU A 1 139 ? 3.351   95.432  7.043   1.00 93.00  ? 241  LEU A CA    1 
ATOM   352  C C     . LEU A 1 139 ? 3.911   95.562  8.455   1.00 100.69 ? 241  LEU A C     1 
ATOM   353  O O     . LEU A 1 139 ? 3.555   94.775  9.336   1.00 103.31 ? 241  LEU A O     1 
ATOM   354  C CB    . LEU A 1 139 ? 4.400   94.744  6.152   1.00 73.15  ? 241  LEU A CB    1 
ATOM   355  C CG    . LEU A 1 139 ? 4.659   93.234  6.436   1.00 74.65  ? 241  LEU A CG    1 
ATOM   356  C CD1   . LEU A 1 139 ? 3.516   92.328  5.849   1.00 70.21  ? 241  LEU A CD1   1 
ATOM   357  C CD2   . LEU A 1 139 ? 5.989   92.830  5.844   1.00 72.13  ? 241  LEU A CD2   1 
ATOM   358  N N     . LEU A 1 140 ? 4.796   96.548  8.655   1.00 98.73  ? 242  LEU A N     1 
ATOM   359  C CA    . LEU A 1 140 ? 5.392   96.812  9.963   1.00 103.01 ? 242  LEU A CA    1 
ATOM   360  C C     . LEU A 1 140 ? 4.353   97.175  11.032  1.00 105.65 ? 242  LEU A C     1 
ATOM   361  O O     . LEU A 1 140 ? 4.535   96.833  12.206  1.00 121.95 ? 242  LEU A O     1 
ATOM   362  C CB    . LEU A 1 140 ? 6.453   97.913  9.848   1.00 129.65 ? 242  LEU A CB    1 
ATOM   363  C CG    . LEU A 1 140 ? 6.706   99.098  10.817  1.00 137.61 ? 242  LEU A CG    1 
ATOM   364  C CD1   . LEU A 1 140 ? 5.657   100.182 10.604  1.00 135.97 ? 242  LEU A CD1   1 
ATOM   365  C CD2   . LEU A 1 140 ? 6.765   98.661  12.293  1.00 140.17 ? 242  LEU A CD2   1 
ATOM   366  N N     . THR A 1 141 ? 3.266   97.851  10.646  1.00 80.91  ? 243  THR A N     1 
ATOM   367  C CA    . THR A 1 141 ? 2.228   98.207  11.611  1.00 81.54  ? 243  THR A CA    1 
ATOM   368  C C     . THR A 1 141 ? 1.287   97.019  11.940  1.00 87.80  ? 243  THR A C     1 
ATOM   369  O O     . THR A 1 141 ? 0.759   96.921  13.064  1.00 95.26  ? 243  THR A O     1 
ATOM   370  C CB    . THR A 1 141 ? 1.449   99.448  11.130  1.00 83.07  ? 243  THR A CB    1 
ATOM   371  O OG1   . THR A 1 141 ? 2.347   100.565 11.049  1.00 73.76  ? 243  THR A OG1   1 
ATOM   372  C CG2   . THR A 1 141 ? 0.344   99.805  12.124  1.00 85.56  ? 243  THR A CG2   1 
ATOM   373  N N     . ASP A 1 142 ? 1.102   96.110  10.979  1.00 108.04 ? 244  ASP A N     1 
ATOM   374  C CA    . ASP A 1 142 ? 0.283   94.880  11.186  1.00 113.18 ? 244  ASP A CA    1 
ATOM   375  C C     . ASP A 1 142 ? 1.142   93.709  11.797  1.00 118.92 ? 244  ASP A C     1 
ATOM   376  O O     . ASP A 1 142 ? 0.625   92.845  12.542  1.00 113.00 ? 244  ASP A O     1 
ATOM   377  C CB    . ASP A 1 142 ? -0.344  94.438  9.825   1.00 121.15 ? 244  ASP A CB    1 
ATOM   378  C CG    . ASP A 1 142 ? -1.108  93.081  9.895   1.00 117.48 ? 244  ASP A CG    1 
ATOM   379  O OD1   . ASP A 1 142 ? -0.449  92.021  9.896   1.00 115.39 ? 244  ASP A OD1   1 
ATOM   380  O OD2   . ASP A 1 142 ? -2.365  93.073  9.933   1.00 108.97 ? 244  ASP A OD2   1 
ATOM   381  N N     . ALA A 1 143 ? 2.447   93.702  11.479  1.00 127.37 ? 245  ALA A N     1 
ATOM   382  C CA    . ALA A 1 143 ? 3.385   92.664  11.942  1.00 130.33 ? 245  ALA A CA    1 
ATOM   383  C C     . ALA A 1 143 ? 3.758   92.809  13.415  1.00 136.57 ? 245  ALA A C     1 
ATOM   384  O O     . ALA A 1 143 ? 3.923   91.805  14.105  1.00 134.05 ? 245  ALA A O     1 
ATOM   385  C CB    . ALA A 1 143 ? 4.643   92.653  11.062  1.00 76.92  ? 245  ALA A CB    1 
ATOM   386  N N     . GLY A 1 144 ? 3.926   94.058  13.863  1.00 150.72 ? 246  GLY A N     1 
ATOM   387  C CA    . GLY A 1 144 ? 4.176   94.352  15.264  1.00 152.91 ? 246  GLY A CA    1 
ATOM   388  C C     . GLY A 1 144 ? 2.806   94.144  15.904  1.00 152.80 ? 246  GLY A C     1 
ATOM   389  O O     . GLY A 1 144 ? 2.690   93.681  17.053  1.00 156.72 ? 246  GLY A O     1 
ATOM   390  N N     . GLU A 1 145 ? 1.765   94.516  15.148  1.00 111.15 ? 247  GLU A N     1 
ATOM   391  C CA    . GLU A 1 145 ? 0.380   94.315  15.555  1.00 106.58 ? 247  GLU A CA    1 
ATOM   392  C C     . GLU A 1 145 ? 0.087   92.859  15.184  1.00 104.51 ? 247  GLU A C     1 
ATOM   393  O O     . GLU A 1 145 ? -0.997  92.525  14.708  1.00 97.94  ? 247  GLU A O     1 
ATOM   394  C CB    . GLU A 1 145 ? -0.568  95.270  14.811  1.00 118.15 ? 247  GLU A CB    1 
ATOM   395  C CG    . GLU A 1 145 ? -1.895  95.493  15.506  1.00 120.64 ? 247  GLU A CG    1 
ATOM   396  C CD    . GLU A 1 145 ? -3.054  94.786  14.822  1.00 119.55 ? 247  GLU A CD    1 
ATOM   397  O OE1   . GLU A 1 145 ? -3.706  95.406  13.941  1.00 117.45 ? 247  GLU A OE1   1 
ATOM   398  O OE2   . GLU A 1 145 ? -3.310  93.605  15.162  1.00 123.14 ? 247  GLU A OE2   1 
ATOM   399  N N     . LEU A 1 146 ? 1.103   92.009  15.331  1.00 200.00 ? 248  LEU A N     1 
ATOM   400  C CA    . LEU A 1 146 ? 0.939   90.558  15.147  1.00 200.00 ? 248  LEU A CA    1 
ATOM   401  C C     . LEU A 1 146 ? 1.685   89.794  16.255  1.00 200.00 ? 248  LEU A C     1 
ATOM   402  O O     . LEU A 1 146 ? 1.078   88.960  16.948  1.00 200.00 ? 248  LEU A O     1 
ATOM   403  C CB    . LEU A 1 146 ? 1.432   90.028  13.780  1.00 81.70  ? 248  LEU A CB    1 
ATOM   404  C CG    . LEU A 1 146 ? 1.626   88.499  13.735  1.00 62.86  ? 248  LEU A CG    1 
ATOM   405  C CD1   . LEU A 1 146 ? 0.469   87.891  12.992  1.00 56.18  ? 248  LEU A CD1   1 
ATOM   406  C CD2   . LEU A 1 146 ? 2.973   88.174  13.038  1.00 53.75  ? 248  LEU A CD2   1 
ATOM   407  N N     . ARG A 1 147 ? 2.975   90.113  16.440  1.00 200.00 ? 249  ARG A N     1 
ATOM   408  C CA    . ARG A 1 147 ? 3.831   89.390  17.387  1.00 200.00 ? 249  ARG A CA    1 
ATOM   409  C C     . ARG A 1 147 ? 3.790   89.750  18.864  1.00 200.00 ? 249  ARG A C     1 
ATOM   410  O O     . ARG A 1 147 ? 4.779   89.626  19.601  1.00 200.00 ? 249  ARG A O     1 
ATOM   411  C CB    . ARG A 1 147 ? 5.277   89.341  16.854  1.00 192.57 ? 249  ARG A CB    1 
ATOM   412  C CG    . ARG A 1 147 ? 5.927   87.966  16.994  1.00 185.75 ? 249  ARG A CG    1 
ATOM   413  C CD    . ARG A 1 147 ? 7.089   87.789  16.035  1.00 184.47 ? 249  ARG A CD    1 
ATOM   414  N NE    . ARG A 1 147 ? 7.283   86.380  15.694  1.00 182.52 ? 249  ARG A NE    1 
ATOM   415  C CZ    . ARG A 1 147 ? 8.364   85.890  15.089  1.00 180.68 ? 249  ARG A CZ    1 
ATOM   416  N NH1   . ARG A 1 147 ? 9.368   86.695  14.753  1.00 180.92 ? 249  ARG A NH1   1 
ATOM   417  N NH2   . ARG A 1 147 ? 8.443   84.592  14.812  1.00 176.59 ? 249  ARG A NH2   1 
ATOM   418  N N     . GLY A 1 148 ? 2.606   90.195  19.268  1.00 192.99 ? 250  GLY A N     1 
ATOM   419  C CA    . GLY A 1 148 ? 2.305   90.476  20.652  1.00 192.19 ? 250  GLY A CA    1 
ATOM   420  C C     . GLY A 1 148 ? 0.974   89.755  20.916  1.00 193.80 ? 250  GLY A C     1 
ATOM   421  O O     . GLY A 1 148 ? 0.918   88.712  21.585  1.00 189.53 ? 250  GLY A O     1 
ATOM   422  N N     . PRO A 1 149 ? -0.129  90.286  20.353  1.00 200.00 ? 251  PRO A N     1 
ATOM   423  C CA    . PRO A 1 149 ? -1.499  89.776  20.477  1.00 200.00 ? 251  PRO A CA    1 
ATOM   424  C C     . PRO A 1 149 ? -1.990  88.810  19.392  1.00 200.00 ? 251  PRO A C     1 
ATOM   425  O O     . PRO A 1 149 ? -1.308  88.585  18.383  1.00 196.00 ? 251  PRO A O     1 
ATOM   426  C CB    . PRO A 1 149 ? -2.329  91.058  20.512  1.00 180.40 ? 251  PRO A CB    1 
ATOM   427  C CG    . PRO A 1 149 ? -1.564  92.011  19.626  1.00 176.95 ? 251  PRO A CG    1 
ATOM   428  C CD    . PRO A 1 149 ? -0.109  91.561  19.615  1.00 176.37 ? 251  PRO A CD    1 
ATOM   429  N N     . PRO A 1 150 ? -3.197  88.229  19.595  1.00 112.21 ? 252  PRO A N     1 
ATOM   430  C CA    . PRO A 1 150 ? -3.805  87.285  18.650  1.00 97.53  ? 252  PRO A CA    1 
ATOM   431  C C     . PRO A 1 150 ? -4.072  87.895  17.302  1.00 79.49  ? 252  PRO A C     1 
ATOM   432  O O     . PRO A 1 150 ? -5.134  88.470  17.058  1.00 69.13  ? 252  PRO A O     1 
ATOM   433  C CB    . PRO A 1 150 ? -5.118  86.875  19.329  1.00 166.69 ? 252  PRO A CB    1 
ATOM   434  C CG    . PRO A 1 150 ? -5.408  88.005  20.283  1.00 174.86 ? 252  PRO A CG    1 
ATOM   435  C CD    . PRO A 1 150 ? -4.043  88.377  20.798  1.00 179.10 ? 252  PRO A CD    1 
ATOM   436  N N     . LEU A 1 151 ? -3.114  87.835  16.413  1.00 106.40 ? 253  LEU A N     1 
ATOM   437  C CA    . LEU A 1 151 ? -3.503  88.347  15.159  1.00 109.85 ? 253  LEU A CA    1 
ATOM   438  C C     . LEU A 1 151 ? -3.877  86.930  14.611  1.00 111.26 ? 253  LEU A C     1 
ATOM   439  O O     . LEU A 1 151 ? -3.506  85.877  15.129  1.00 119.06 ? 253  LEU A O     1 
ATOM   440  C CB    . LEU A 1 151 ? -2.385  89.157  14.484  1.00 70.99  ? 253  LEU A CB    1 
ATOM   441  C CG    . LEU A 1 151 ? -2.938  90.018  13.301  1.00 64.81  ? 253  LEU A CG    1 
ATOM   442  C CD1   . LEU A 1 151 ? -3.957  91.049  13.780  1.00 60.11  ? 253  LEU A CD1   1 
ATOM   443  C CD2   . LEU A 1 151 ? -1.807  90.708  12.536  1.00 66.29  ? 253  LEU A CD2   1 
ATOM   444  N N     . GLN A 1 152 ? -4.846  86.995  13.733  1.00 100.29 ? 254  GLN A N     1 
ATOM   445  C CA    . GLN A 1 152 ? -5.497  85.964  12.946  1.00 90.70  ? 254  GLN A CA    1 
ATOM   446  C C     . GLN A 1 152 ? -4.622  85.207  11.918  1.00 85.31  ? 254  GLN A C     1 
ATOM   447  O O     . GLN A 1 152 ? -5.089  84.237  11.292  1.00 82.06  ? 254  GLN A O     1 
ATOM   448  C CB    . GLN A 1 152 ? -6.480  86.809  12.176  1.00 71.42  ? 254  GLN A CB    1 
ATOM   449  C CG    . GLN A 1 152 ? -6.590  88.216  12.843  1.00 74.83  ? 254  GLN A CG    1 
ATOM   450  C CD    . GLN A 1 152 ? -7.226  88.196  14.287  1.00 80.71  ? 254  GLN A CD    1 
ATOM   451  O OE1   . GLN A 1 152 ? -6.634  87.705  15.257  1.00 83.28  ? 254  GLN A OE1   1 
ATOM   452  N NE2   . GLN A 1 152 ? -8.447  88.731  14.403  1.00 83.62  ? 254  GLN A NE2   1 
ATOM   453  N N     . LEU A 1 153 ? -3.376  85.666  11.730  1.00 88.43  ? 255  LEU A N     1 
ATOM   454  C CA    . LEU A 1 153 ? -2.504  85.220  10.608  1.00 82.94  ? 255  LEU A CA    1 
ATOM   455  C C     . LEU A 1 153 ? -1.110  84.636  10.791  1.00 79.49  ? 255  LEU A C     1 
ATOM   456  O O     . LEU A 1 153 ? -0.429  84.855  11.810  1.00 75.19  ? 255  LEU A O     1 
ATOM   457  C CB    . LEU A 1 153 ? -2.366  86.414  9.631   1.00 67.79  ? 255  LEU A CB    1 
ATOM   458  C CG    . LEU A 1 153 ? -3.640  87.066  9.041   1.00 66.44  ? 255  LEU A CG    1 
ATOM   459  C CD1   . LEU A 1 153 ? -3.277  88.329  8.271   1.00 62.57  ? 255  LEU A CD1   1 
ATOM   460  C CD2   . LEU A 1 153 ? -4.396  86.043  8.149   1.00 60.35  ? 255  LEU A CD2   1 
ATOM   461  N N     . ASP A 1 154 ? -0.705  83.943  9.727   1.00 88.12  ? 256  ASP A N     1 
ATOM   462  C CA    . ASP A 1 154 ? 0.599   83.305  9.590   1.00 87.03  ? 256  ASP A CA    1 
ATOM   463  C C     . ASP A 1 154 ? 1.633   84.428  9.282   1.00 84.31  ? 256  ASP A C     1 
ATOM   464  O O     . ASP A 1 154 ? 1.321   85.592  9.509   1.00 83.99  ? 256  ASP A O     1 
ATOM   465  C CB    . ASP A 1 154 ? 0.527   82.382  8.387   1.00 101.87 ? 256  ASP A CB    1 
ATOM   466  C CG    . ASP A 1 154 ? 1.075   80.997  8.655   1.00 104.04 ? 256  ASP A CG    1 
ATOM   467  O OD1   . ASP A 1 154 ? 2.085   80.861  9.372   1.00 112.85 ? 256  ASP A OD1   1 
ATOM   468  O OD2   . ASP A 1 154 ? 0.498   80.035  8.110   1.00 104.96 ? 256  ASP A OD2   1 
ATOM   469  N N     . THR A 1 155 ? 2.821   84.085  8.737   1.00 70.25  ? 257  THR A N     1 
ATOM   470  C CA    . THR A 1 155 ? 3.856   85.066  8.343   1.00 66.24  ? 257  THR A CA    1 
ATOM   471  C C     . THR A 1 155 ? 3.990   85.330  6.832   1.00 66.15  ? 257  THR A C     1 
ATOM   472  O O     . THR A 1 155 ? 3.403   86.278  6.337   1.00 65.71  ? 257  THR A O     1 
ATOM   473  C CB    . THR A 1 155 ? 5.197   84.668  8.862   1.00 64.38  ? 257  THR A CB    1 
ATOM   474  O OG1   . THR A 1 155 ? 5.098   84.584  10.285  1.00 65.19  ? 257  THR A OG1   1 
ATOM   475  C CG2   . THR A 1 155 ? 6.262   85.684  8.456   1.00 59.77  ? 257  THR A CG2   1 
ATOM   476  N N     . GLY A 1 156 ? 4.776   84.525  6.106   1.00 88.34  ? 258  GLY A N     1 
ATOM   477  C CA    . GLY A 1 156 ? 4.938   84.658  4.643   1.00 87.57  ? 258  GLY A CA    1 
ATOM   478  C C     . GLY A 1 156 ? 3.592   84.858  3.974   1.00 86.75  ? 258  GLY A C     1 
ATOM   479  O O     . GLY A 1 156 ? 3.499   85.169  2.781   1.00 83.75  ? 258  GLY A O     1 
ATOM   480  N N     . GLN A 1 157 ? 2.574   84.529  4.776   1.00 84.02  ? 259  GLN A N     1 
ATOM   481  C CA    . GLN A 1 157 ? 1.166   84.759  4.550   1.00 81.44  ? 259  GLN A CA    1 
ATOM   482  C C     . GLN A 1 157 ? 1.153   86.319  4.424   1.00 85.18  ? 259  GLN A C     1 
ATOM   483  O O     . GLN A 1 157 ? 0.834   86.873  3.370   1.00 91.49  ? 259  GLN A O     1 
ATOM   484  C CB    . GLN A 1 157 ? 0.431   84.401  5.824   1.00 88.82  ? 259  GLN A CB    1 
ATOM   485  C CG    . GLN A 1 157 ? -1.065  84.446  5.772   1.00 89.75  ? 259  GLN A CG    1 
ATOM   486  C CD    . GLN A 1 157 ? -1.682  83.058  5.869   1.00 89.93  ? 259  GLN A CD    1 
ATOM   487  O OE1   . GLN A 1 157 ? -1.265  82.133  5.155   1.00 91.75  ? 259  GLN A OE1   1 
ATOM   488  N NE2   . GLN A 1 157 ? -2.695  82.905  6.740   1.00 86.07  ? 259  GLN A NE2   1 
ATOM   489  N N     . LEU A 1 158 ? 1.507   87.034  5.501   1.00 66.24  ? 260  LEU A N     1 
ATOM   490  C CA    . LEU A 1 158 ? 1.541   88.503  5.502   1.00 60.70  ? 260  LEU A CA    1 
ATOM   491  C C     . LEU A 1 158 ? 2.397   89.014  4.374   1.00 58.87  ? 260  LEU A C     1 
ATOM   492  O O     . LEU A 1 158 ? 2.058   90.039  3.796   1.00 61.04  ? 260  LEU A O     1 
ATOM   493  C CB    . LEU A 1 158 ? 2.045   89.051  6.837   1.00 76.78  ? 260  LEU A CB    1 
ATOM   494  C CG    . LEU A 1 158 ? 1.031   89.334  7.963   1.00 79.90  ? 260  LEU A CG    1 
ATOM   495  C CD1   . LEU A 1 158 ? -0.056  90.237  7.442   1.00 83.37  ? 260  LEU A CD1   1 
ATOM   496  C CD2   . LEU A 1 158 ? 0.409   88.057  8.502   1.00 81.41  ? 260  LEU A CD2   1 
ATOM   497  N N     . VAL A 1 159 ? 3.500   88.331  4.056   1.00 76.84  ? 261  VAL A N     1 
ATOM   498  C CA    . VAL A 1 159 ? 4.316   88.739  2.912   1.00 74.05  ? 261  VAL A CA    1 
ATOM   499  C C     . VAL A 1 159 ? 3.461   88.573  1.640   1.00 71.08  ? 261  VAL A C     1 
ATOM   500  O O     . VAL A 1 159 ? 3.537   89.393  0.728   1.00 71.02  ? 261  VAL A O     1 
ATOM   501  C CB    . VAL A 1 159 ? 5.569   87.890  2.785   1.00 47.24  ? 261  VAL A CB    1 
ATOM   502  C CG1   . VAL A 1 159 ? 6.337   88.244  1.459   1.00 43.14  ? 261  VAL A CG1   1 
ATOM   503  C CG2   . VAL A 1 159 ? 6.469   88.155  3.991   1.00 45.60  ? 261  VAL A CG2   1 
ATOM   504  N N     . LYS A 1 160 ? 2.642   87.522  1.584   1.00 61.89  ? 262  LYS A N     1 
ATOM   505  C CA    . LYS A 1 160 ? 1.775   87.298  0.436   1.00 57.79  ? 262  LYS A CA    1 
ATOM   506  C C     . LYS A 1 160 ? 0.736   88.445  0.422   1.00 56.45  ? 262  LYS A C     1 
ATOM   507  O O     . LYS A 1 160 ? 0.402   88.985  -0.634  1.00 53.27  ? 262  LYS A O     1 
ATOM   508  C CB    . LYS A 1 160 ? 1.102   85.907  0.531   1.00 61.36  ? 262  LYS A CB    1 
ATOM   509  C CG    . LYS A 1 160 ? 0.163   85.485  -0.591  1.00 58.17  ? 262  LYS A CG    1 
ATOM   510  C CD    . LYS A 1 160 ? -0.815  84.425  -0.029  1.00 61.13  ? 262  LYS A CD    1 
ATOM   511  C CE    . LYS A 1 160 ? -1.948  84.029  -0.978  1.00 60.43  ? 262  LYS A CE    1 
ATOM   512  N NZ    . LYS A 1 160 ? -2.761  82.927  -0.345  1.00 60.13  ? 262  LYS A NZ    1 
ATOM   513  N N     . ILE A 1 161 ? 0.239   88.884  1.571   1.00 55.93  ? 263  ILE A N     1 
ATOM   514  C CA    . ILE A 1 161 ? -0.805  89.931  1.510   1.00 55.23  ? 263  ILE A CA    1 
ATOM   515  C C     . ILE A 1 161 ? -0.191  91.195  0.928   1.00 51.52  ? 263  ILE A C     1 
ATOM   516  O O     . ILE A 1 161 ? -0.836  91.918  0.168   1.00 50.96  ? 263  ILE A O     1 
ATOM   517  C CB    . ILE A 1 161 ? -1.416  90.358  2.896   1.00 57.72  ? 263  ILE A CB    1 
ATOM   518  C CG1   . ILE A 1 161 ? -1.201  89.300  4.001   1.00 60.53  ? 263  ILE A CG1   1 
ATOM   519  C CG2   . ILE A 1 161 ? -2.859  90.718  2.701   1.00 58.06  ? 263  ILE A CG2   1 
ATOM   520  C CD1   . ILE A 1 161 ? -2.218  88.222  4.100   1.00 59.50  ? 263  ILE A CD1   1 
ATOM   521  N N     . ALA A 1 162 ? 1.061   91.450  1.292   1.00 43.55  ? 264  ALA A N     1 
ATOM   522  C CA    . ALA A 1 162 ? 1.745   92.641  0.831   1.00 43.52  ? 264  ALA A CA    1 
ATOM   523  C C     . ALA A 1 162 ? 2.284   92.522  -0.594  1.00 44.35  ? 264  ALA A C     1 
ATOM   524  O O     . ALA A 1 162 ? 2.442   93.535  -1.309  1.00 44.52  ? 264  ALA A O     1 
ATOM   525  C CB    . ALA A 1 162 ? 2.885   92.984  1.764   1.00 200.00 ? 264  ALA A CB    1 
ATOM   526  N N     . LYS A 1 163 ? 2.582   91.296  -1.019  1.00 42.67  ? 265  LYS A N     1 
ATOM   527  C CA    . LYS A 1 163 ? 3.138   91.085  -2.334  1.00 41.26  ? 265  LYS A CA    1 
ATOM   528  C C     . LYS A 1 163 ? 2.120   91.445  -3.370  1.00 39.59  ? 265  LYS A C     1 
ATOM   529  O O     . LYS A 1 163 ? 2.371   92.274  -4.219  1.00 35.98  ? 265  LYS A O     1 
ATOM   530  C CB    . LYS A 1 163 ? 3.563   89.623  -2.497  1.00 62.08  ? 265  LYS A CB    1 
ATOM   531  C CG    . LYS A 1 163 ? 4.313   89.296  -3.797  1.00 63.24  ? 265  LYS A CG    1 
ATOM   532  C CD    . LYS A 1 163 ? 5.317   88.120  -3.641  1.00 65.76  ? 265  LYS A CD    1 
ATOM   533  C CE    . LYS A 1 163 ? 4.631   86.719  -3.612  1.00 70.27  ? 265  LYS A CE    1 
ATOM   534  N NZ    . LYS A 1 163 ? 3.974   86.293  -2.313  1.00 69.83  ? 265  LYS A NZ    1 
ATOM   535  N N     . ARG A 1 164 ? 0.940   90.865  -3.248  1.00 69.05  ? 266  ARG A N     1 
ATOM   536  C CA    . ARG A 1 164 ? -0.089  91.001  -4.261  1.00 69.69  ? 266  ARG A CA    1 
ATOM   537  C C     . ARG A 1 164 ? -1.202  91.945  -3.908  1.00 71.43  ? 266  ARG A C     1 
ATOM   538  O O     . ARG A 1 164 ? -1.836  92.523  -4.791  1.00 72.80  ? 266  ARG A O     1 
ATOM   539  C CB    . ARG A 1 164 ? -0.677  89.600  -4.601  1.00 65.56  ? 266  ARG A CB    1 
ATOM   540  C CG    . ARG A 1 164 ? 0.378   88.502  -5.016  1.00 64.97  ? 266  ARG A CG    1 
ATOM   541  C CD    . ARG A 1 164 ? -0.265  87.176  -5.487  1.00 63.03  ? 266  ARG A CD    1 
ATOM   542  N NE    . ARG A 1 164 ? -0.286  87.035  -6.957  1.00 62.29  ? 266  ARG A NE    1 
ATOM   543  C CZ    . ARG A 1 164 ? -1.315  87.396  -7.740  1.00 62.02  ? 266  ARG A CZ    1 
ATOM   544  N NH1   . ARG A 1 164 ? -2.408  87.931  -7.224  1.00 59.47  ? 266  ARG A NH1   1 
ATOM   545  N NH2   . ARG A 1 164 ? -1.285  87.158  -9.053  1.00 61.77  ? 266  ARG A NH2   1 
ATOM   546  N N     . GLY A 1 165 ? -1.439  92.104  -2.614  1.00 65.55  ? 267  GLY A N     1 
ATOM   547  C CA    . GLY A 1 165 ? -2.513  92.972  -2.164  1.00 64.66  ? 267  GLY A CA    1 
ATOM   548  C C     . GLY A 1 165 ? -2.130  94.453  -2.186  1.00 64.30  ? 267  GLY A C     1 
ATOM   549  O O     . GLY A 1 165 ? -2.954  95.357  -2.384  1.00 62.37  ? 267  GLY A O     1 
ATOM   550  N N     . GLY A 1 166 ? -0.850  94.713  -1.984  1.00 61.06  ? 268  GLY A N     1 
ATOM   551  C CA    . GLY A 1 166 ? -0.383  96.088  -1.944  1.00 63.24  ? 268  GLY A CA    1 
ATOM   552  C C     . GLY A 1 166 ? -0.641  96.768  -0.613  1.00 63.71  ? 268  GLY A C     1 
ATOM   553  O O     . GLY A 1 166 ? -1.332  96.214  0.237   1.00 64.92  ? 268  GLY A O     1 
ATOM   554  N N     . VAL A 1 167 ? -0.072  97.958  -0.420  1.00 54.98  ? 269  VAL A N     1 
ATOM   555  C CA    . VAL A 1 167 ? -0.278  98.697  0.828   1.00 55.73  ? 269  VAL A CA    1 
ATOM   556  C C     . VAL A 1 167 ? -1.767  98.804  1.102   1.00 55.26  ? 269  VAL A C     1 
ATOM   557  O O     . VAL A 1 167 ? -2.223  98.786  2.251   1.00 57.10  ? 269  VAL A O     1 
ATOM   558  C CB    . VAL A 1 167 ? 0.312   100.153 0.783   1.00 47.21  ? 269  VAL A CB    1 
ATOM   559  C CG1   . VAL A 1 167 ? -0.408  101.047 -0.233  1.00 45.09  ? 269  VAL A CG1   1 
ATOM   560  C CG2   . VAL A 1 167 ? 0.205   100.778 2.157   1.00 48.36  ? 269  VAL A CG2   1 
ATOM   561  N N     . THR A 1 168 ? -2.513  98.858  0.009   1.00 33.72  ? 270  THR A N     1 
ATOM   562  C CA    . THR A 1 168 ? -3.938  99.011  0.001   1.00 33.61  ? 270  THR A CA    1 
ATOM   563  C C     . THR A 1 168 ? -4.633  97.894  0.742   1.00 33.95  ? 270  THR A C     1 
ATOM   564  O O     . THR A 1 168 ? -5.272  98.138  1.717   1.00 34.38  ? 270  THR A O     1 
ATOM   565  C CB    . THR A 1 168 ? -4.358  99.104  -1.466  1.00 75.63  ? 270  THR A CB    1 
ATOM   566  O OG1   . THR A 1 168 ? -5.056  100.322 -1.653  1.00 73.12  ? 270  THR A OG1   1 
ATOM   567  C CG2   . THR A 1 168 ? -5.174  97.900  -1.932  1.00 76.58  ? 270  THR A CG2   1 
ATOM   568  N N     . ALA A 1 169 ? -4.503  96.659  0.289   1.00 54.77  ? 271  ALA A N     1 
ATOM   569  C CA    . ALA A 1 169 ? -5.160  95.553  0.960   1.00 57.31  ? 271  ALA A CA    1 
ATOM   570  C C     . ALA A 1 169 ? -4.673  95.449  2.408   1.00 59.77  ? 271  ALA A C     1 
ATOM   571  O O     . ALA A 1 169 ? -5.458  95.203  3.337   1.00 61.68  ? 271  ALA A O     1 
ATOM   572  C CB    . ALA A 1 169 ? -4.878  94.231  0.200   1.00 59.71  ? 271  ALA A CB    1 
ATOM   573  N N     . MET A 1 170 ? -3.380  95.672  2.600   1.00 48.67  ? 272  MET A N     1 
ATOM   574  C CA    . MET A 1 170 ? -2.841  95.540  3.918   1.00 53.84  ? 272  MET A CA    1 
ATOM   575  C C     . MET A 1 170 ? -3.519  96.477  4.884   1.00 56.80  ? 272  MET A C     1 
ATOM   576  O O     . MET A 1 170 ? -3.742  96.090  6.053   1.00 58.05  ? 272  MET A O     1 
ATOM   577  C CB    . MET A 1 170 ? -1.360  95.749  3.899   1.00 67.07  ? 272  MET A CB    1 
ATOM   578  C CG    . MET A 1 170 ? -0.734  95.230  5.148   1.00 73.61  ? 272  MET A CG    1 
ATOM   579  S SD    . MET A 1 170 ? 0.899   94.504  4.777   1.00 80.53  ? 272  MET A SD    1 
ATOM   580  C CE    . MET A 1 170 ? 1.485   95.795  3.621   1.00 74.71  ? 272  MET A CE    1 
ATOM   581  N N     . GLU A 1 171 ? -3.862  97.688  4.412   1.00 99.94  ? 273  GLU A N     1 
ATOM   582  C CA    . GLU A 1 171 ? -4.573  98.663  5.251   1.00 103.55 ? 273  GLU A CA    1 
ATOM   583  C C     . GLU A 1 171 ? -5.997  98.164  5.551   1.00 105.18 ? 273  GLU A C     1 
ATOM   584  O O     . GLU A 1 171 ? -6.428  98.172  6.711   1.00 109.83 ? 273  GLU A O     1 
ATOM   585  C CB    . GLU A 1 171 ? -4.619  100.038 4.583   1.00 74.93  ? 273  GLU A CB    1 
ATOM   586  C CG    . GLU A 1 171 ? -3.524  100.962 5.051   1.00 80.44  ? 273  GLU A CG    1 
ATOM   587  C CD    . GLU A 1 171 ? -3.248  102.099 4.071   1.00 84.86  ? 273  GLU A CD    1 
ATOM   588  O OE1   . GLU A 1 171 ? -4.170  102.428 3.261   1.00 92.14  ? 273  GLU A OE1   1 
ATOM   589  O OE2   . GLU A 1 171 ? -2.107  102.655 4.123   1.00 80.74  ? 273  GLU A OE2   1 
ATOM   590  N N     . ALA A 1 172 ? -6.714  97.727  4.516   1.00 71.32  ? 274  ALA A N     1 
ATOM   591  C CA    . ALA A 1 172 ? -8.058  97.183  4.697   1.00 73.92  ? 274  ALA A CA    1 
ATOM   592  C C     . ALA A 1 172 ? -8.048  95.926  5.619   1.00 75.72  ? 274  ALA A C     1 
ATOM   593  O O     . ALA A 1 172 ? -9.109  95.436  6.037   1.00 74.30  ? 274  ALA A O     1 
ATOM   594  C CB    . ALA A 1 172 ? -8.696  96.838  3.335   1.00 43.86  ? 274  ALA A CB    1 
ATOM   595  N N     . VAL A 1 173 ? -6.875  95.388  5.940   1.00 65.76  ? 275  VAL A N     1 
ATOM   596  C CA    . VAL A 1 173 ? -6.883  94.250  6.829   1.00 68.84  ? 275  VAL A CA    1 
ATOM   597  C C     . VAL A 1 173 ? -6.644  94.691  8.283   1.00 70.34  ? 275  VAL A C     1 
ATOM   598  O O     . VAL A 1 173 ? -7.551  94.498  9.087   1.00 73.86  ? 275  VAL A O     1 
ATOM   599  C CB    . VAL A 1 173 ? -5.905  93.121  6.373   1.00 76.82  ? 275  VAL A CB    1 
ATOM   600  C CG1   . VAL A 1 173 ? -5.994  91.940  7.318   1.00 76.84  ? 275  VAL A CG1   1 
ATOM   601  C CG2   . VAL A 1 173 ? -6.295  92.627  4.985   1.00 74.10  ? 275  VAL A CG2   1 
ATOM   602  N N     . HIS A 1 174 ? -5.504  95.304  8.660   1.00 63.81  ? 276  HIS A N     1 
ATOM   603  C CA    . HIS A 1 174 ? -5.413  95.663  10.086  1.00 68.81  ? 276  HIS A CA    1 
ATOM   604  C C     . HIS A 1 174 ? -6.335  96.777  10.493  1.00 67.70  ? 276  HIS A C     1 
ATOM   605  O O     . HIS A 1 174 ? -6.181  97.408  11.553  1.00 68.26  ? 276  HIS A O     1 
ATOM   606  C CB    . HIS A 1 174 ? -3.974  95.789  10.700  1.00 93.46  ? 276  HIS A CB    1 
ATOM   607  C CG    . HIS A 1 174 ? -3.018  96.707  10.002  1.00 94.01  ? 276  HIS A CG    1 
ATOM   608  N ND1   . HIS A 1 174 ? -2.830  96.701  8.629   1.00 90.90  ? 276  HIS A ND1   1 
ATOM   609  C CD2   . HIS A 1 174 ? -2.097  97.567  10.499  1.00 92.59  ? 276  HIS A CD2   1 
ATOM   610  C CE1   . HIS A 1 174 ? -1.841  97.517  8.324   1.00 93.08  ? 276  HIS A CE1   1 
ATOM   611  N NE2   . HIS A 1 174 ? -1.375  98.057  9.441   1.00 95.42  ? 276  HIS A NE2   1 
ATOM   612  N N     . ALA A 1 175 ? -7.323  96.977  9.630   1.00 57.69  ? 277  ALA A N     1 
ATOM   613  C CA    . ALA A 1 175 ? -8.412  97.849  9.940   1.00 61.68  ? 277  ALA A CA    1 
ATOM   614  C C     . ALA A 1 175 ? -9.543  96.845  10.171  1.00 65.71  ? 277  ALA A C     1 
ATOM   615  O O     . ALA A 1 175 ? -9.937  96.593  11.300  1.00 74.75  ? 277  ALA A O     1 
ATOM   616  C CB    . ALA A 1 175 ? -8.789  98.750  8.803   1.00 122.41 ? 277  ALA A CB    1 
ATOM   617  N N     . SER A 1 176 ? -10.036 96.234  9.101   1.00 105.92 ? 278  SER A N     1 
ATOM   618  C CA    . SER A 1 176 ? -11.194 95.317  9.142   1.00 107.67 ? 278  SER A CA    1 
ATOM   619  C C     . SER A 1 176 ? -11.067 93.964  9.834   1.00 110.01 ? 278  SER A C     1 
ATOM   620  O O     . SER A 1 176 ? -12.014 93.188  9.833   1.00 113.11 ? 278  SER A O     1 
ATOM   621  C CB    . SER A 1 176 ? -11.659 95.068  7.702   1.00 74.08  ? 278  SER A CB    1 
ATOM   622  O OG    . SER A 1 176 ? -12.918 94.439  7.656   1.00 71.58  ? 278  SER A OG    1 
ATOM   623  N N     . ARG A 1 177 ? -9.941  93.693  10.478  1.00 79.33  ? 279  ARG A N     1 
ATOM   624  C CA    . ARG A 1 177 ? -9.743  92.364  11.010  1.00 90.98  ? 279  ARG A CA    1 
ATOM   625  C C     . ARG A 1 177 ? -10.772 91.845  11.965  1.00 94.41  ? 279  ARG A C     1 
ATOM   626  O O     . ARG A 1 177 ? -11.265 90.742  11.768  1.00 100.79 ? 279  ARG A O     1 
ATOM   627  C CB    . ARG A 1 177 ? -8.301  92.183  11.542  1.00 110.69 ? 279  ARG A CB    1 
ATOM   628  C CG    . ARG A 1 177 ? -7.969  92.695  12.932  1.00 116.45 ? 279  ARG A CG    1 
ATOM   629  C CD    . ARG A 1 177 ? -7.558  94.134  12.926  1.00 111.55 ? 279  ARG A CD    1 
ATOM   630  N NE    . ARG A 1 177 ? -8.732  94.989  12.973  1.00 113.00 ? 279  ARG A NE    1 
ATOM   631  C CZ    . ARG A 1 177 ? -9.269  95.446  14.093  1.00 116.62 ? 279  ARG A CZ    1 
ATOM   632  N NH1   . ARG A 1 177 ? -8.731  95.132  15.264  1.00 117.22 ? 279  ARG A NH1   1 
ATOM   633  N NH2   . ARG A 1 177 ? -10.342 96.220  14.037  1.00 125.51 ? 279  ARG A NH2   1 
ATOM   634  N N     . ASN A 1 178 ? -11.128 92.630  12.972  1.00 124.24 ? 280  ASN A N     1 
ATOM   635  C CA    . ASN A 1 178 ? -12.144 92.200  13.943  1.00 128.95 ? 280  ASN A CA    1 
ATOM   636  C C     . ASN A 1 178 ? -13.531 91.963  13.315  1.00 125.16 ? 280  ASN A C     1 
ATOM   637  O O     . ASN A 1 178 ? -14.302 91.124  13.787  1.00 123.13 ? 280  ASN A O     1 
ATOM   638  C CB    . ASN A 1 178 ? -12.273 93.236  15.067  1.00 134.13 ? 280  ASN A CB    1 
ATOM   639  C CG    . ASN A 1 178 ? -11.098 93.218  16.009  1.00 139.22 ? 280  ASN A CG    1 
ATOM   640  O OD1   . ASN A 1 178 ? -10.051 92.664  15.689  1.00 140.81 ? 280  ASN A OD1   1 
ATOM   641  N ND2   . ASN A 1 178 ? -11.261 93.836  17.175  1.00 143.47 ? 280  ASN A ND2   1 
ATOM   642  N N     . ALA A 1 179 ? -13.847 92.721  12.268  1.00 117.37 ? 281  ALA A N     1 
ATOM   643  C CA    . ALA A 1 179 ? -15.117 92.584  11.572  1.00 113.12 ? 281  ALA A CA    1 
ATOM   644  C C     . ALA A 1 179 ? -15.139 91.249  10.838  1.00 112.14 ? 281  ALA A C     1 
ATOM   645  O O     . ALA A 1 179 ? -16.196 90.669  10.618  1.00 113.76 ? 281  ALA A O     1 
ATOM   646  C CB    . ALA A 1 179 ? -15.309 93.751  10.595  1.00 46.80  ? 281  ALA A CB    1 
ATOM   647  N N     . LEU A 1 180 ? -13.961 90.764  10.465  1.00 100.21 ? 282  LEU A N     1 
ATOM   648  C CA    . LEU A 1 180 ? -13.848 89.472  9.792   1.00 98.31  ? 282  LEU A CA    1 
ATOM   649  C C     . LEU A 1 180 ? -13.772 88.344  10.845  1.00 109.68 ? 282  LEU A C     1 
ATOM   650  O O     . LEU A 1 180 ? -14.282 87.238  10.634  1.00 111.50 ? 282  LEU A O     1 
ATOM   651  C CB    . LEU A 1 180 ? -12.584 89.434  8.898   1.00 56.54  ? 282  LEU A CB    1 
ATOM   652  C CG    . LEU A 1 180 ? -12.427 90.629  7.934   1.00 48.11  ? 282  LEU A CG    1 
ATOM   653  C CD1   . LEU A 1 180 ? -10.968 90.742  7.450   1.00 40.51  ? 282  LEU A CD1   1 
ATOM   654  C CD2   . LEU A 1 180 ? -13.430 90.532  6.756   1.00 41.94  ? 282  LEU A CD2   1 
ATOM   655  N N     . THR A 1 181 ? -13.144 88.628  11.983  1.00 198.85 ? 283  THR A N     1 
ATOM   656  C CA    . THR A 1 181 ? -12.965 87.627  13.037  1.00 199.86 ? 283  THR A CA    1 
ATOM   657  C C     . THR A 1 181 ? -14.255 87.190  13.721  1.00 199.86 ? 283  THR A C     1 
ATOM   658  O O     . THR A 1 181 ? -14.648 86.026  13.607  1.00 199.86 ? 283  THR A O     1 
ATOM   659  C CB    . THR A 1 181 ? -11.914 88.121  14.097  1.00 120.44 ? 283  THR A CB    1 
ATOM   660  O OG1   . THR A 1 181 ? -10.599 87.980  13.551  1.00 111.99 ? 283  THR A OG1   1 
ATOM   661  C CG2   . THR A 1 181 ? -12.001 87.326  15.408  1.00 123.04 ? 283  THR A CG2   1 
ATOM   662  N N     . PRO A 1 184 ? -19.455 89.959  12.853  1.00 107.52 ? 286  PRO A N     1 
ATOM   663  C CA    . PRO A 1 184 ? -18.805 88.868  12.168  1.00 107.45 ? 286  PRO A CA    1 
ATOM   664  C C     . PRO A 1 184 ? -19.839 87.923  11.559  1.00 108.00 ? 286  PRO A C     1 
ATOM   665  O O     . PRO A 1 184 ? -20.944 88.434  11.399  1.00 108.42 ? 286  PRO A O     1 
ATOM   666  C CB    . PRO A 1 184 ? -18.148 88.162  13.361  1.00 114.69 ? 286  PRO A CB    1 
ATOM   667  C CG    . PRO A 1 184 ? -17.504 89.338  14.019  1.00 114.23 ? 286  PRO A CG    1 
ATOM   668  C CD    . PRO A 1 184 ? -18.494 90.521  13.811  1.00 114.43 ? 286  PRO A CD    1 
ATOM   669  N N     . LEU A 1 185 ? -19.241 87.166  10.631  1.00 130.38 ? 287  LEU A N     1 
ATOM   670  C CA    . LEU A 1 185 ? -18.040 86.378  10.995  1.00 129.31 ? 287  LEU A CA    1 
ATOM   671  C C     . LEU A 1 185 ? -17.304 86.134  9.720   1.00 129.21 ? 287  LEU A C     1 
ATOM   672  O O     . LEU A 1 185 ? -16.142 85.692  9.742   1.00 130.72 ? 287  LEU A O     1 
ATOM   673  C CB    . LEU A 1 185 ? -18.114 85.143  11.685  1.00 66.67  ? 287  LEU A CB    1 
ATOM   674  N N     . ASN A 1 186 ? -17.925 86.312  8.579   1.00 131.18 ? 288  ASN A N     1 
ATOM   675  C CA    . ASN A 1 186 ? -17.027 85.980  7.551   1.00 121.59 ? 288  ASN A CA    1 
ATOM   676  C C     . ASN A 1 186 ? -16.497 84.522  7.696   1.00 116.88 ? 288  ASN A C     1 
ATOM   677  O O     . ASN A 1 186 ? -17.061 83.628  8.280   1.00 116.71 ? 288  ASN A O     1 
ATOM   678  C CB    . ASN A 1 186 ? -15.909 86.997  7.698   1.00 83.15  ? 288  ASN A CB    1 
ATOM   679  C CG    . ASN A 1 186 ? -16.433 88.317  7.534   1.00 76.94  ? 288  ASN A CG    1 
ATOM   680  O OD1   . ASN A 1 186 ? -15.752 89.313  7.615   1.00 83.18  ? 288  ASN A OD1   1 
ATOM   681  N ND2   . ASN A 1 186 ? -17.722 88.342  7.256   1.00 65.87  ? 288  ASN A ND2   1 
ATOM   682  N N     . LEU A 1 187 ? -15.327 84.479  7.149   1.00 123.47 ? 289  LEU A N     1 
ATOM   683  C CA    . LEU A 1 187 ? -14.295 83.545  6.834   1.00 117.77 ? 289  LEU A CA    1 
ATOM   684  C C     . LEU A 1 187 ? -13.176 83.158  7.784   1.00 117.32 ? 289  LEU A C     1 
ATOM   685  O O     . LEU A 1 187 ? -12.890 83.853  8.716   1.00 121.39 ? 289  LEU A O     1 
ATOM   686  C CB    . LEU A 1 187 ? -13.612 84.412  5.816   1.00 91.63  ? 289  LEU A CB    1 
ATOM   687  C CG    . LEU A 1 187 ? -14.456 85.625  5.370   1.00 88.94  ? 289  LEU A CG    1 
ATOM   688  C CD1   . LEU A 1 187 ? -13.533 86.656  4.767   1.00 84.37  ? 289  LEU A CD1   1 
ATOM   689  C CD2   . LEU A 1 187 ? -15.509 85.167  4.338   1.00 87.11  ? 289  LEU A CD2   1 
ATOM   690  N N     . THR A 1 188 ? -12.408 82.155  7.347   1.00 106.00 ? 290  THR A N     1 
ATOM   691  C CA    . THR A 1 188 ? -11.155 81.736  7.991   1.00 104.79 ? 290  THR A CA    1 
ATOM   692  C C     . THR A 1 188 ? -10.024 82.671  7.465   1.00 104.16 ? 290  THR A C     1 
ATOM   693  O O     . THR A 1 188 ? -10.207 83.412  6.457   1.00 107.18 ? 290  THR A O     1 
ATOM   694  C CB    . THR A 1 188 ? -10.593 80.427  7.399   1.00 94.18  ? 290  THR A CB    1 
ATOM   695  O OG1   . THR A 1 188 ? -11.656 79.642  6.869   1.00 97.19  ? 290  THR A OG1   1 
ATOM   696  C CG2   . THR A 1 188 ? -9.729  79.641  8.398   1.00 95.08  ? 290  THR A CG2   1 
ATOM   697  N N     . PRO A 1 189 ? -8.882  82.696  8.191   1.00 97.64  ? 291  PRO A N     1 
ATOM   698  C CA    . PRO A 1 189 ? -7.703  83.427  7.729   1.00 95.70  ? 291  PRO A CA    1 
ATOM   699  C C     . PRO A 1 189 ? -7.346  82.792  6.341   1.00 91.99  ? 291  PRO A C     1 
ATOM   700  O O     . PRO A 1 189 ? -6.729  83.415  5.474   1.00 86.34  ? 291  PRO A O     1 
ATOM   701  C CB    . PRO A 1 189 ? -6.639  82.982  8.725   1.00 88.84  ? 291  PRO A CB    1 
ATOM   702  C CG    . PRO A 1 189 ? -7.403  82.692  10.004  1.00 87.15  ? 291  PRO A CG    1 
ATOM   703  C CD    . PRO A 1 189 ? -8.897  82.806  9.661   1.00 89.59  ? 291  PRO A CD    1 
ATOM   704  N N     . ALA A 1 190 ? -7.666  81.505  6.206   1.00 91.10  ? 292  ALA A N     1 
ATOM   705  C CA    . ALA A 1 190 ? -7.403  80.719  4.996   1.00 85.50  ? 292  ALA A CA    1 
ATOM   706  C C     . ALA A 1 190 ? -7.898  81.500  3.830   1.00 83.06  ? 292  ALA A C     1 
ATOM   707  O O     . ALA A 1 190 ? -7.168  81.769  2.883   1.00 87.14  ? 292  ALA A O     1 
ATOM   708  C CB    . ALA A 1 190 ? -8.144  79.338  5.069   1.00 104.36 ? 292  ALA A CB    1 
ATOM   709  N N     . GLN A 1 191 ? -9.152  81.897  3.949   1.00 71.43  ? 293  GLN A N     1 
ATOM   710  C CA    . GLN A 1 191 ? -9.847  82.608  2.889   1.00 71.26  ? 293  GLN A CA    1 
ATOM   711  C C     . GLN A 1 191 ? -9.856  84.152  2.936   1.00 72.41  ? 293  GLN A C     1 
ATOM   712  O O     . GLN A 1 191 ? -10.472 84.828  2.075   1.00 71.88  ? 293  GLN A O     1 
ATOM   713  C CB    . GLN A 1 191 ? -11.276 82.063  2.785   1.00 88.48  ? 293  GLN A CB    1 
ATOM   714  C CG    . GLN A 1 191 ? -12.014 82.081  4.098   1.00 85.84  ? 293  GLN A CG    1 
ATOM   715  C CD    . GLN A 1 191 ? -12.760 80.798  4.371   1.00 81.50  ? 293  GLN A CD    1 
ATOM   716  O OE1   . GLN A 1 191 ? -13.198 80.601  5.488   1.00 79.06  ? 293  GLN A OE1   1 
ATOM   717  N NE2   . GLN A 1 191 ? -12.904 79.914  3.350   1.00 78.68  ? 293  GLN A NE2   1 
ATOM   718  N N     . VAL A 1 192 ? -9.208  84.698  3.954   1.00 68.39  ? 294  VAL A N     1 
ATOM   719  C CA    . VAL A 1 192 ? -9.074  86.132  4.009   1.00 65.17  ? 294  VAL A CA    1 
ATOM   720  C C     . VAL A 1 192 ? -7.832  86.351  3.158   1.00 61.08  ? 294  VAL A C     1 
ATOM   721  O O     . VAL A 1 192 ? -7.882  86.915  2.061   1.00 60.52  ? 294  VAL A O     1 
ATOM   722  C CB    . VAL A 1 192 ? -8.839  86.653  5.436   1.00 73.43  ? 294  VAL A CB    1 
ATOM   723  C CG1   . VAL A 1 192 ? -8.182  88.031  5.411   1.00 69.55  ? 294  VAL A CG1   1 
ATOM   724  C CG2   . VAL A 1 192 ? -10.191 86.725  6.165   1.00 78.98  ? 294  VAL A CG2   1 
ATOM   725  N N     . VAL A 1 193 ? -6.706  85.876  3.648   1.00 55.64  ? 295  VAL A N     1 
ATOM   726  C CA    . VAL A 1 193 ? -5.464  85.994  2.890   1.00 52.68  ? 295  VAL A CA    1 
ATOM   727  C C     . VAL A 1 193 ? -5.748  85.762  1.405   1.00 49.20  ? 295  VAL A C     1 
ATOM   728  O O     . VAL A 1 193 ? -5.136  86.401  0.550   1.00 44.67  ? 295  VAL A O     1 
ATOM   729  C CB    . VAL A 1 193 ? -4.438  84.933  3.358   1.00 62.04  ? 295  VAL A CB    1 
ATOM   730  C CG1   . VAL A 1 193 ? -3.110  85.155  2.681   1.00 62.64  ? 295  VAL A CG1   1 
ATOM   731  C CG2   . VAL A 1 193 ? -4.275  84.996  4.862   1.00 64.00  ? 295  VAL A CG2   1 
ATOM   732  N N     . ALA A 1 194 ? -6.730  84.891  1.129   1.00 64.93  ? 296  ALA A N     1 
ATOM   733  C CA    . ALA A 1 194 ? -7.062  84.463  -0.219  1.00 63.95  ? 296  ALA A CA    1 
ATOM   734  C C     . ALA A 1 194 ? -7.705  85.467  -1.084  1.00 61.80  ? 296  ALA A C     1 
ATOM   735  O O     . ALA A 1 194 ? -7.731  85.280  -2.280  1.00 62.87  ? 296  ALA A O     1 
ATOM   736  C CB    . ALA A 1 194 ? -7.944  83.221  -0.166  1.00 169.16 ? 296  ALA A CB    1 
ATOM   737  N N     . ILE A 1 195 ? -8.239  86.526  -0.493  1.00 65.89  ? 297  ILE A N     1 
ATOM   738  C CA    . ILE A 1 195 ? -8.987  87.519  -1.276  1.00 67.83  ? 297  ILE A CA    1 
ATOM   739  C C     . ILE A 1 195 ? -8.439  88.934  -1.144  1.00 66.31  ? 297  ILE A C     1 
ATOM   740  O O     . ILE A 1 195 ? -8.690  89.825  -1.980  1.00 65.92  ? 297  ILE A O     1 
ATOM   741  C CB    . ILE A 1 195 ? -10.482 87.464  -0.946  1.00 70.34  ? 297  ILE A CB    1 
ATOM   742  C CG1   . ILE A 1 195 ? -10.692 87.808  0.536   1.00 74.19  ? 297  ILE A CG1   1 
ATOM   743  C CG2   . ILE A 1 195 ? -11.037 86.102  -1.385  1.00 68.80  ? 297  ILE A CG2   1 
ATOM   744  C CD1   . ILE A 1 195 ? -11.879 87.093  1.188   1.00 77.99  ? 297  ILE A CD1   1 
ATOM   745  N N     . ALA A 1 196 ? -7.689  89.137  -0.078  1.00 57.10  ? 298  ALA A N     1 
ATOM   746  C CA    . ALA A 1 196 ? -6.943  90.364  0.080   1.00 53.27  ? 298  ALA A CA    1 
ATOM   747  C C     . ALA A 1 196 ? -5.729  90.249  -0.863  1.00 51.37  ? 298  ALA A C     1 
ATOM   748  O O     . ALA A 1 196 ? -5.272  91.280  -1.402  1.00 50.63  ? 298  ALA A O     1 
ATOM   749  C CB    . ALA A 1 196 ? -6.431  90.478  1.504   1.00 22.65  ? 298  ALA A CB    1 
ATOM   750  N N     . SER A 1 197 ? -5.210  89.019  -1.040  1.00 63.37  ? 299  SER A N     1 
ATOM   751  C CA    . SER A 1 197 ? -4.003  88.778  -1.847  1.00 66.02  ? 299  SER A CA    1 
ATOM   752  C C     . SER A 1 197 ? -4.042  88.869  -3.384  1.00 64.59  ? 299  SER A C     1 
ATOM   753  O O     . SER A 1 197 ? -3.555  87.978  -4.090  1.00 66.38  ? 299  SER A O     1 
ATOM   754  C CB    . SER A 1 197 ? -3.307  87.468  -1.404  1.00 90.75  ? 299  SER A CB    1 
ATOM   755  O OG    . SER A 1 197 ? -3.038  86.577  -2.487  1.00 91.69  ? 299  SER A OG    1 
ATOM   756  N N     . ASN A 1 198 ? -4.679  89.920  -3.887  1.00 72.15  ? 300  ASN A N     1 
ATOM   757  C CA    . ASN A 1 198 ? -4.621  90.238  -5.292  1.00 69.94  ? 300  ASN A CA    1 
ATOM   758  C C     . ASN A 1 198 ? -4.738  91.753  -5.510  1.00 72.01  ? 300  ASN A C     1 
ATOM   759  O O     . ASN A 1 198 ? -4.530  92.572  -4.606  1.00 72.60  ? 300  ASN A O     1 
ATOM   760  C CB    . ASN A 1 198 ? -5.660  89.533  -6.186  1.00 44.73  ? 300  ASN A CB    1 
ATOM   761  C CG    . ASN A 1 198 ? -6.084  88.198  -5.676  1.00 44.63  ? 300  ASN A CG    1 
ATOM   762  O OD1   . ASN A 1 198 ? -5.294  87.320  -5.430  1.00 44.62  ? 300  ASN A OD1   1 
ATOM   763  N ND2   . ASN A 1 198 ? -7.376  88.043  -5.518  1.00 46.04  ? 300  ASN A ND2   1 
ATOM   764  N N     . ASN A 1 199 ? -5.116  92.110  -6.725  1.00 34.39  ? 301  ASN A N     1 
ATOM   765  C CA    . ASN A 1 199 ? -5.127  93.454  -7.143  1.00 32.64  ? 301  ASN A CA    1 
ATOM   766  C C     . ASN A 1 199 ? -6.335  94.114  -6.647  1.00 34.24  ? 301  ASN A C     1 
ATOM   767  O O     . ASN A 1 199 ? -6.302  95.291  -6.197  1.00 38.37  ? 301  ASN A O     1 
ATOM   768  C CB    . ASN A 1 199 ? -5.035  93.493  -8.657  1.00 48.98  ? 301  ASN A CB    1 
ATOM   769  C CG    . ASN A 1 199 ? -3.617  93.757  -9.137  1.00 49.64  ? 301  ASN A CG    1 
ATOM   770  O OD1   . ASN A 1 199 ? -2.635  93.476  -8.400  1.00 48.59  ? 301  ASN A OD1   1 
ATOM   771  N ND2   . ASN A 1 199 ? -3.491  94.308  -10.374 1.00 46.11  ? 301  ASN A ND2   1 
ATOM   772  N N     . GLY A 1 200 ? -7.447  93.425  -6.712  1.00 36.71  ? 302  GLY A N     1 
ATOM   773  C CA    . GLY A 1 200 ? -8.616  94.116  -6.131  1.00 38.23  ? 302  GLY A CA    1 
ATOM   774  C C     . GLY A 1 200 ? -8.583  94.093  -4.614  1.00 36.44  ? 302  GLY A C     1 
ATOM   775  O O     . GLY A 1 200 ? -9.522  94.419  -3.946  1.00 34.63  ? 302  GLY A O     1 
ATOM   776  N N     . GLY A 1 201 ? -7.455  93.682  -4.095  1.00 45.67  ? 303  GLY A N     1 
ATOM   777  C CA    . GLY A 1 201 ? -7.315  93.516  -2.674  1.00 51.71  ? 303  GLY A CA    1 
ATOM   778  C C     . GLY A 1 201 ? -8.469  94.019  -1.810  1.00 55.77  ? 303  GLY A C     1 
ATOM   779  O O     . GLY A 1 201 ? -9.522  93.331  -1.506  1.00 55.38  ? 303  GLY A O     1 
ATOM   780  N N     . LYS A 1 202 ? -8.252  95.277  -1.427  1.00 69.68  ? 304  LYS A N     1 
ATOM   781  C CA    . LYS A 1 202 ? -9.125  96.026  -0.545  1.00 71.24  ? 304  LYS A CA    1 
ATOM   782  C C     . LYS A 1 202 ? -10.569 96.047  -1.002  1.00 72.12  ? 304  LYS A C     1 
ATOM   783  O O     . LYS A 1 202 ? -11.465 95.974  -0.173  1.00 75.38  ? 304  LYS A O     1 
ATOM   784  C CB    . LYS A 1 202 ? -8.529  97.450  -0.332  1.00 69.08  ? 304  LYS A CB    1 
ATOM   785  C CG    . LYS A 1 202 ? -9.456  98.552  0.226   1.00 74.77  ? 304  LYS A CG    1 
ATOM   786  C CD    . LYS A 1 202 ? -9.824  99.566  -0.865  1.00 75.69  ? 304  LYS A CD    1 
ATOM   787  C CE    . LYS A 1 202 ? -9.781  100.980 -0.360  1.00 75.03  ? 304  LYS A CE    1 
ATOM   788  N NZ    . LYS A 1 202 ? -8.432  101.350 0.127   1.00 76.67  ? 304  LYS A NZ    1 
ATOM   789  N N     . GLN A 1 203 ? -10.801 96.102  -2.308  1.00 41.50  ? 305  GLN A N     1 
ATOM   790  C CA    . GLN A 1 203 ? -12.163 96.177  -2.827  1.00 41.56  ? 305  GLN A CA    1 
ATOM   791  C C     . GLN A 1 203 ? -12.754 94.821  -2.678  1.00 42.54  ? 305  GLN A C     1 
ATOM   792  O O     . GLN A 1 203 ? -13.762 94.667  -1.955  1.00 42.24  ? 305  GLN A O     1 
ATOM   793  C CB    . GLN A 1 203 ? -12.177 96.638  -4.282  1.00 80.40  ? 305  GLN A CB    1 
ATOM   794  C CG    . GLN A 1 203 ? -11.190 97.792  -4.498  1.00 86.47  ? 305  GLN A CG    1 
ATOM   795  C CD    . GLN A 1 203 ? -11.798 98.984  -5.166  1.00 93.22  ? 305  GLN A CD    1 
ATOM   796  O OE1   . GLN A 1 203 ? -12.740 98.852  -5.960  1.00 102.25 ? 305  GLN A OE1   1 
ATOM   797  N NE2   . GLN A 1 203 ? -11.249 100.165 -4.879  1.00 94.50  ? 305  GLN A NE2   1 
ATOM   798  N N     . ALA A 1 204 ? -12.136 93.822  -3.320  1.00 65.28  ? 306  ALA A N     1 
ATOM   799  C CA    . ALA A 1 204 ? -12.604 92.437  -3.205  1.00 67.21  ? 306  ALA A CA    1 
ATOM   800  C C     . ALA A 1 204 ? -13.030 92.263  -1.754  1.00 71.19  ? 306  ALA A C     1 
ATOM   801  O O     . ALA A 1 204 ? -14.165 91.930  -1.453  1.00 75.86  ? 306  ALA A O     1 
ATOM   802  C CB    . ALA A 1 204 ? -11.483 91.512  -3.525  1.00 86.42  ? 306  ALA A CB    1 
ATOM   803  N N     . LEU A 1 205 ? -12.108 92.542  -0.847  1.00 57.14  ? 307  LEU A N     1 
ATOM   804  C CA    . LEU A 1 205 ? -12.392 92.446  0.575   1.00 58.49  ? 307  LEU A CA    1 
ATOM   805  C C     . LEU A 1 205 ? -13.663 93.178  1.001   1.00 64.43  ? 307  LEU A C     1 
ATOM   806  O O     . LEU A 1 205 ? -14.620 92.556  1.405   1.00 66.85  ? 307  LEU A O     1 
ATOM   807  C CB    . LEU A 1 205 ? -11.234 93.052  1.309   1.00 72.93  ? 307  LEU A CB    1 
ATOM   808  C CG    . LEU A 1 205 ? -10.448 92.231  2.290   1.00 70.80  ? 307  LEU A CG    1 
ATOM   809  C CD1   . LEU A 1 205 ? -9.026  92.849  2.492   1.00 66.40  ? 307  LEU A CD1   1 
ATOM   810  C CD2   . LEU A 1 205 ? -11.256 92.175  3.573   1.00 70.14  ? 307  LEU A CD2   1 
ATOM   811  N N     . GLU A 1 206 ? -13.639 94.508  0.914   1.00 93.62  ? 308  GLU A N     1 
ATOM   812  C CA    . GLU A 1 206 ? -14.750 95.369  1.348   1.00 96.03  ? 308  GLU A CA    1 
ATOM   813  C C     . GLU A 1 206 ? -16.051 94.902  0.747   1.00 93.85  ? 308  GLU A C     1 
ATOM   814  O O     . GLU A 1 206 ? -17.077 94.915  1.425   1.00 100.09 ? 308  GLU A O     1 
ATOM   815  C CB    . GLU A 1 206 ? -14.510 96.872  1.002   1.00 139.97 ? 308  GLU A CB    1 
ATOM   816  C CG    . GLU A 1 206 ? -13.193 97.518  1.537   1.00 145.06 ? 308  GLU A CG    1 
ATOM   817  C CD    . GLU A 1 206 ? -13.178 97.782  3.036   1.00 150.83 ? 308  GLU A CD    1 
ATOM   818  O OE1   . GLU A 1 206 ? -13.326 96.821  3.830   1.00 152.68 ? 308  GLU A OE1   1 
ATOM   819  O OE2   . GLU A 1 206 ? -13.006 98.961  3.413   1.00 150.78 ? 308  GLU A OE2   1 
ATOM   820  N N     . THR A 1 207 ? -16.003 94.467  -0.508  1.00 59.07  ? 309  THR A N     1 
ATOM   821  C CA    . THR A 1 207 ? -17.205 93.976  -1.175  1.00 58.91  ? 309  THR A CA    1 
ATOM   822  C C     . THR A 1 207 ? -17.772 92.712  -0.525  1.00 61.16  ? 309  THR A C     1 
ATOM   823  O O     . THR A 1 207 ? -18.953 92.649  -0.200  1.00 63.95  ? 309  THR A O     1 
ATOM   824  C CB    . THR A 1 207 ? -16.948 93.661  -2.669  1.00 65.76  ? 309  THR A CB    1 
ATOM   825  O OG1   . THR A 1 207 ? -16.492 94.854  -3.341  1.00 68.92  ? 309  THR A OG1   1 
ATOM   826  C CG2   . THR A 1 207 ? -18.236 93.150  -3.332  1.00 64.16  ? 309  THR A CG2   1 
ATOM   827  N N     . VAL A 1 208 ? -16.923 91.712  -0.329  1.00 81.60  ? 310  VAL A N     1 
ATOM   828  C CA    . VAL A 1 208 ? -17.371 90.451  0.241   1.00 83.52  ? 310  VAL A CA    1 
ATOM   829  C C     . VAL A 1 208 ? -18.100 90.655  1.569   1.00 88.98  ? 310  VAL A C     1 
ATOM   830  O O     . VAL A 1 208 ? -19.103 90.007  1.850   1.00 92.09  ? 310  VAL A O     1 
ATOM   831  C CB    . VAL A 1 208 ? -16.191 89.430  0.346   1.00 75.99  ? 310  VAL A CB    1 
ATOM   832  C CG1   . VAL A 1 208 ? -16.209 88.695  1.688   1.00 76.59  ? 310  VAL A CG1   1 
ATOM   833  C CG2   . VAL A 1 208 ? -16.304 88.425  -0.828  1.00 72.30  ? 310  VAL A CG2   1 
ATOM   834  N N     . GLN A 1 209 ? -17.618 91.572  2.388   1.00 74.26  ? 311  GLN A N     1 
ATOM   835  C CA    . GLN A 1 209 ? -18.317 91.853  3.632   1.00 79.76  ? 311  GLN A CA    1 
ATOM   836  C C     . GLN A 1 209 ? -19.635 92.584  3.340   1.00 76.23  ? 311  GLN A C     1 
ATOM   837  O O     . GLN A 1 209 ? -20.447 92.787  4.221   1.00 80.49  ? 311  GLN A O     1 
ATOM   838  C CB    . GLN A 1 209 ? -17.432 92.646  4.607   1.00 110.42 ? 311  GLN A CB    1 
ATOM   839  C CG    . GLN A 1 209 ? -16.668 91.725  5.573   1.00 116.99 ? 311  GLN A CG    1 
ATOM   840  C CD    . GLN A 1 209 ? -16.413 92.357  6.929   1.00 116.57 ? 311  GLN A CD    1 
ATOM   841  O OE1   . GLN A 1 209 ? -15.957 93.491  7.008   1.00 117.71 ? 311  GLN A OE1   1 
ATOM   842  N NE2   . GLN A 1 209 ? -16.694 91.621  8.001   1.00 120.10 ? 311  GLN A NE2   1 
ATOM   843  N N     . ARG A 1 210 ? -19.851 92.972  2.096   1.00 56.37  ? 312  ARG A N     1 
ATOM   844  C CA    . ARG A 1 210 ? -21.122 93.594  1.708   1.00 57.85  ? 312  ARG A CA    1 
ATOM   845  C C     . ARG A 1 210 ? -22.065 92.588  1.037   1.00 57.83  ? 312  ARG A C     1 
ATOM   846  O O     . ARG A 1 210 ? -23.272 92.648  1.241   1.00 61.34  ? 312  ARG A O     1 
ATOM   847  C CB    . ARG A 1 210 ? -20.920 94.743  0.713   1.00 96.70  ? 312  ARG A CB    1 
ATOM   848  C CG    . ARG A 1 210 ? -22.210 95.195  -0.007  1.00 97.45  ? 312  ARG A CG    1 
ATOM   849  C CD    . ARG A 1 210 ? -22.012 96.511  -0.802  1.00 96.66  ? 312  ARG A CD    1 
ATOM   850  N NE    . ARG A 1 210 ? -21.398 96.349  -2.120  1.00 93.05  ? 312  ARG A NE    1 
ATOM   851  C CZ    . ARG A 1 210 ? -20.100 96.509  -2.384  1.00 91.71  ? 312  ARG A CZ    1 
ATOM   852  N NH1   . ARG A 1 210 ? -19.246 96.848  -1.419  1.00 92.29  ? 312  ARG A NH1   1 
ATOM   853  N NH2   . ARG A 1 210 ? -19.654 96.321  -3.623  1.00 93.19  ? 312  ARG A NH2   1 
ATOM   854  N N     . LEU A 1 211 ? -21.520 91.656  0.253   1.00 84.28  ? 313  LEU A N     1 
ATOM   855  C CA    . LEU A 1 211 ? -22.376 90.723  -0.470  1.00 84.78  ? 313  LEU A CA    1 
ATOM   856  C C     . LEU A 1 211 ? -22.261 89.225  -0.203  1.00 86.95  ? 313  LEU A C     1 
ATOM   857  O O     . LEU A 1 211 ? -22.773 88.427  -0.977  1.00 90.08  ? 313  LEU A O     1 
ATOM   858  C CB    . LEU A 1 211 ? -22.256 90.992  -1.978  1.00 66.43  ? 313  LEU A CB    1 
ATOM   859  C CG    . LEU A 1 211 ? -22.453 92.424  -2.465  1.00 60.16  ? 313  LEU A CG    1 
ATOM   860  C CD1   . LEU A 1 211 ? -22.512 92.404  -4.003  1.00 58.81  ? 313  LEU A CD1   1 
ATOM   861  C CD2   . LEU A 1 211 ? -23.735 93.051  -1.889  1.00 61.87  ? 313  LEU A CD2   1 
ATOM   862  N N     . LEU A 1 212 ? -21.595 88.828  0.871   1.00 81.78  ? 314  LEU A N     1 
ATOM   863  C CA    . LEU A 1 212 ? -21.525 87.402  1.184   1.00 85.80  ? 314  LEU A CA    1 
ATOM   864  C C     . LEU A 1 212 ? -22.888 86.926  1.721   1.00 91.87  ? 314  LEU A C     1 
ATOM   865  O O     . LEU A 1 212 ? -23.387 85.900  1.269   1.00 97.00  ? 314  LEU A O     1 
ATOM   866  C CB    . LEU A 1 212 ? -20.431 87.076  2.225   1.00 95.04  ? 314  LEU A CB    1 
ATOM   867  C CG    . LEU A 1 212 ? -20.352 85.610  2.678   1.00 93.55  ? 314  LEU A CG    1 
ATOM   868  C CD1   . LEU A 1 212 ? -20.064 84.723  1.478   1.00 89.38  ? 314  LEU A CD1   1 
ATOM   869  C CD2   . LEU A 1 212 ? -19.291 85.438  3.746   1.00 93.38  ? 314  LEU A CD2   1 
ATOM   870  N N     . PRO A 1 213 ? -23.508 87.662  2.679   1.00 86.67  ? 315  PRO A N     1 
ATOM   871  C CA    . PRO A 1 213 ? -24.810 87.250  3.225   1.00 90.47  ? 315  PRO A CA    1 
ATOM   872  C C     . PRO A 1 213 ? -25.929 87.213  2.169   1.00 94.68  ? 315  PRO A C     1 
ATOM   873  O O     . PRO A 1 213 ? -26.708 86.270  2.121   1.00 99.99  ? 315  PRO A O     1 
ATOM   874  C CB    . PRO A 1 213 ? -25.093 88.291  4.319   1.00 93.70  ? 315  PRO A CB    1 
ATOM   875  C CG    . PRO A 1 213 ? -23.769 88.908  4.614   1.00 90.05  ? 315  PRO A CG    1 
ATOM   876  C CD    . PRO A 1 213 ? -23.057 88.921  3.304   1.00 86.89  ? 315  PRO A CD    1 
ATOM   877  N N     . VAL A 1 214 ? -26.014 88.246  1.339   1.00 131.02 ? 316  VAL A N     1 
ATOM   878  C CA    . VAL A 1 214 ? -27.020 88.317  0.271   1.00 131.53 ? 316  VAL A CA    1 
ATOM   879  C C     . VAL A 1 214 ? -26.809 87.201  -0.761  1.00 132.99 ? 316  VAL A C     1 
ATOM   880  O O     . VAL A 1 214 ? -27.718 86.904  -1.544  1.00 144.70 ? 316  VAL A O     1 
ATOM   881  C CB    . VAL A 1 214 ? -26.962 89.681  -0.488  1.00 81.88  ? 316  VAL A CB    1 
ATOM   882  C CG1   . VAL A 1 214 ? -27.928 89.675  -1.662  1.00 76.54  ? 316  VAL A CG1   1 
ATOM   883  C CG2   . VAL A 1 214 ? -27.282 90.833  0.459   1.00 80.35  ? 316  VAL A CG2   1 
ATOM   884  N N     . LEU A 1 215 ? -25.607 86.609  -0.779  1.00 93.31  ? 317  LEU A N     1 
ATOM   885  C CA    . LEU A 1 215 ? -25.298 85.514  -1.707  1.00 87.07  ? 317  LEU A CA    1 
ATOM   886  C C     . LEU A 1 215 ? -25.653 84.136  -1.103  1.00 87.78  ? 317  LEU A C     1 
ATOM   887  O O     . LEU A 1 215 ? -26.099 83.224  -1.812  1.00 87.04  ? 317  LEU A O     1 
ATOM   888  C CB    . LEU A 1 215 ? -23.823 85.574  -2.135  1.00 110.22 ? 317  LEU A CB    1 
ATOM   889  C CG    . LEU A 1 215 ? -23.484 86.762  -3.064  1.00 107.93 ? 317  LEU A CG    1 
ATOM   890  C CD1   . LEU A 1 215 ? -22.115 86.588  -3.744  1.00 99.75  ? 317  LEU A CD1   1 
ATOM   891  C CD2   . LEU A 1 215 ? -24.568 86.882  -4.124  1.00 106.27 ? 317  LEU A CD2   1 
ATOM   892  N N     . CYS A 1 216 ? -25.456 83.996  0.204   1.00 93.39  ? 318  CYS A N     1 
ATOM   893  C CA    . CYS A 1 216 ? -25.822 82.779  0.909   1.00 99.93  ? 318  CYS A CA    1 
ATOM   894  C C     . CYS A 1 216 ? -27.326 82.800  1.263   1.00 100.53 ? 318  CYS A C     1 
ATOM   895  O O     . CYS A 1 216 ? -27.908 81.748  1.568   1.00 96.29  ? 318  CYS A O     1 
ATOM   896  C CB    . CYS A 1 216 ? -24.958 82.632  2.148   1.00 134.76 ? 318  CYS A CB    1 
ATOM   897  S SG    . CYS A 1 216 ? -23.239 82.512  1.672   1.00 142.22 ? 318  CYS A SG    1 
ATOM   898  N N     . GLN A 1 217 ? -27.947 83.989  1.196   1.00 123.34 ? 319  GLN A N     1 
ATOM   899  C CA    . GLN A 1 217 ? -29.390 84.147  1.425   1.00 123.77 ? 319  GLN A CA    1 
ATOM   900  C C     . GLN A 1 217 ? -30.301 84.035  0.199   1.00 121.68 ? 319  GLN A C     1 
ATOM   901  O O     . GLN A 1 217 ? -31.026 83.050  0.045   1.00 131.81 ? 319  GLN A O     1 
ATOM   902  C CB    . GLN A 1 217 ? -29.742 85.495  2.049   1.00 145.78 ? 319  GLN A CB    1 
ATOM   903  C CG    . GLN A 1 217 ? -29.698 85.549  3.565   1.00 146.15 ? 319  GLN A CG    1 
ATOM   904  C CD    . GLN A 1 217 ? -30.357 86.816  4.130   1.00 147.79 ? 319  GLN A CD    1 
ATOM   905  O OE1   . GLN A 1 217 ? -30.634 87.783  3.406   1.00 144.25 ? 319  GLN A OE1   1 
ATOM   906  N NE2   . GLN A 1 217 ? -30.597 86.811  5.434   1.00 151.87 ? 319  GLN A NE2   1 
ATOM   907  N N     . ALA A 1 218 ? -30.274 85.051  -0.658  1.00 93.31  ? 320  ALA A N     1 
ATOM   908  C CA    . ALA A 1 218 ? -31.189 85.125  -1.794  1.00 95.36  ? 320  ALA A CA    1 
ATOM   909  C C     . ALA A 1 218 ? -30.867 84.168  -2.915  1.00 94.69  ? 320  ALA A C     1 
ATOM   910  O O     . ALA A 1 218 ? -31.690 83.952  -3.818  1.00 94.61  ? 320  ALA A O     1 
ATOM   911  C CB    . ALA A 1 218 ? -31.295 86.594  -2.326  1.00 131.03 ? 320  ALA A CB    1 
ATOM   912  N N     . HIS A 1 219 ? -29.662 83.613  -2.861  1.00 131.56 ? 321  HIS A N     1 
ATOM   913  C CA    . HIS A 1 219 ? -29.247 82.629  -3.850  1.00 129.96 ? 321  HIS A CA    1 
ATOM   914  C C     . HIS A 1 219 ? -28.644 81.349  -3.260  1.00 128.24 ? 321  HIS A C     1 
ATOM   915  O O     . HIS A 1 219 ? -28.330 80.404  -4.005  1.00 124.52 ? 321  HIS A O     1 
ATOM   916  C CB    . HIS A 1 219 ? -28.284 83.238  -4.861  1.00 114.60 ? 321  HIS A CB    1 
ATOM   917  C CG    . HIS A 1 219 ? -28.972 83.875  -6.013  1.00 111.94 ? 321  HIS A CG    1 
ATOM   918  N ND1   . HIS A 1 219 ? -29.104 85.241  -6.130  1.00 112.79 ? 321  HIS A ND1   1 
ATOM   919  C CD2   . HIS A 1 219 ? -29.599 83.344  -7.089  1.00 111.89 ? 321  HIS A CD2   1 
ATOM   920  C CE1   . HIS A 1 219 ? -29.778 85.518  -7.229  1.00 114.91 ? 321  HIS A CE1   1 
ATOM   921  N NE2   . HIS A 1 219 ? -30.093 84.383  -7.835  1.00 114.41 ? 321  HIS A NE2   1 
ATOM   922  N N     . GLY A 1 220 ? -28.502 81.318  -1.934  1.00 97.63  ? 322  GLY A N     1 
ATOM   923  C CA    . GLY A 1 220 ? -27.956 80.163  -1.256  1.00 94.60  ? 322  GLY A CA    1 
ATOM   924  C C     . GLY A 1 220 ? -26.674 79.647  -1.880  1.00 91.86  ? 322  GLY A C     1 
ATOM   925  O O     . GLY A 1 220 ? -26.688 78.699  -2.663  1.00 87.95  ? 322  GLY A O     1 
ATOM   926  N N     . LEU A 1 221 ? -25.565 80.290  -1.547  1.00 119.78 ? 323  LEU A N     1 
ATOM   927  C CA    . LEU A 1 221 ? -24.250 79.908  -2.036  1.00 115.89 ? 323  LEU A CA    1 
ATOM   928  C C     . LEU A 1 221 ? -23.501 79.601  -0.744  1.00 113.87 ? 323  LEU A C     1 
ATOM   929  O O     . LEU A 1 221 ? -24.122 79.390  0.297   1.00 114.34 ? 323  LEU A O     1 
ATOM   930  C CB    . LEU A 1 221 ? -23.600 81.091  -2.770  1.00 91.49  ? 323  LEU A CB    1 
ATOM   931  C CG    . LEU A 1 221 ? -23.750 81.275  -4.312  1.00 89.72  ? 323  LEU A CG    1 
ATOM   932  C CD1   . LEU A 1 221 ? -25.176 80.993  -4.824  1.00 90.46  ? 323  LEU A CD1   1 
ATOM   933  C CD2   . LEU A 1 221 ? -23.326 82.690  -4.703  1.00 84.19  ? 323  LEU A CD2   1 
ATOM   934  N N     . THR A 1 222 ? -22.170 79.637  -0.791  1.00 108.46 ? 324  THR A N     1 
ATOM   935  C CA    . THR A 1 222 ? -21.351 79.357  0.401   1.00 103.62 ? 324  THR A CA    1 
ATOM   936  C C     . THR A 1 222 ? -20.211 80.310  0.738   1.00 102.57 ? 324  THR A C     1 
ATOM   937  O O     . THR A 1 222 ? -19.807 81.132  -0.102  1.00 98.89  ? 324  THR A O     1 
ATOM   938  C CB    . THR A 1 222 ? -20.574 78.068  0.234   1.00 83.82  ? 324  THR A CB    1 
ATOM   939  O OG1   . THR A 1 222 ? -19.967 78.100  -1.061  1.00 80.63  ? 324  THR A OG1   1 
ATOM   940  C CG2   . THR A 1 222 ? -21.449 76.826  0.400   1.00 79.80  ? 324  THR A CG2   1 
ATOM   941  N N     . PRO A 1 223 ? -19.752 80.270  2.010   1.00 75.41  ? 325  PRO A N     1 
ATOM   942  C CA    . PRO A 1 223 ? -18.586 81.063  2.357   1.00 73.77  ? 325  PRO A CA    1 
ATOM   943  C C     . PRO A 1 223 ? -17.490 80.468  1.403   1.00 73.24  ? 325  PRO A C     1 
ATOM   944  O O     . PRO A 1 223 ? -16.514 81.131  1.085   1.00 71.05  ? 325  PRO A O     1 
ATOM   945  C CB    . PRO A 1 223 ? -18.306 80.625  3.785   1.00 75.09  ? 325  PRO A CB    1 
ATOM   946  C CG    . PRO A 1 223 ? -19.660 80.493  4.368   1.00 76.32  ? 325  PRO A CG    1 
ATOM   947  C CD    . PRO A 1 223 ? -20.630 80.226  3.192   1.00 75.92  ? 325  PRO A CD    1 
ATOM   948  N N     . ALA A 1 224 ? -17.624 79.195  1.004   1.00 108.20 ? 326  ALA A N     1 
ATOM   949  C CA    . ALA A 1 224 ? -16.648 78.545  0.099   1.00 107.34 ? 326  ALA A CA    1 
ATOM   950  C C     . ALA A 1 224 ? -16.651 79.134  -1.333  1.00 107.89 ? 326  ALA A C     1 
ATOM   951  O O     . ALA A 1 224 ? -15.645 79.713  -1.750  1.00 106.71 ? 326  ALA A O     1 
ATOM   952  C CB    . ALA A 1 224 ? -16.884 77.029  0.055   1.00 96.64  ? 326  ALA A CB    1 
ATOM   953  N N     . GLN A 1 225 ? -17.759 79.028  -2.078  1.00 86.75  ? 327  GLN A N     1 
ATOM   954  C CA    . GLN A 1 225 ? -17.761 79.556  -3.448  1.00 81.03  ? 327  GLN A CA    1 
ATOM   955  C C     . GLN A 1 225 ? -17.573 81.032  -3.557  1.00 75.36  ? 327  GLN A C     1 
ATOM   956  O O     . GLN A 1 225 ? -16.771 81.506  -4.356  1.00 75.73  ? 327  GLN A O     1 
ATOM   957  C CB    . GLN A 1 225 ? -19.000 79.164  -4.258  1.00 80.99  ? 327  GLN A CB    1 
ATOM   958  C CG    . GLN A 1 225 ? -20.341 79.462  -3.666  1.00 87.00  ? 327  GLN A CG    1 
ATOM   959  C CD    . GLN A 1 225 ? -21.407 78.436  -4.108  1.00 95.28  ? 327  GLN A CD    1 
ATOM   960  O OE1   . GLN A 1 225 ? -22.409 78.244  -3.412  1.00 100.45 ? 327  GLN A OE1   1 
ATOM   961  N NE2   . GLN A 1 225 ? -21.191 77.783  -5.260  1.00 92.40  ? 327  GLN A NE2   1 
ATOM   962  N N     . VAL A 1 226 ? -18.278 81.790  -2.747  1.00 67.31  ? 328  VAL A N     1 
ATOM   963  C CA    . VAL A 1 226 ? -18.138 83.242  -2.874  1.00 65.08  ? 328  VAL A CA    1 
ATOM   964  C C     . VAL A 1 226 ? -16.672 83.634  -2.719  1.00 59.89  ? 328  VAL A C     1 
ATOM   965  O O     . VAL A 1 226 ? -16.134 84.188  -3.632  1.00 54.84  ? 328  VAL A O     1 
ATOM   966  C CB    . VAL A 1 226 ? -19.108 83.991  -1.887  1.00 120.08 ? 328  VAL A CB    1 
ATOM   967  C CG1   . VAL A 1 226 ? -18.705 85.448  -1.703  1.00 121.57 ? 328  VAL A CG1   1 
ATOM   968  C CG2   . VAL A 1 226 ? -20.526 83.909  -2.445  1.00 122.35 ? 328  VAL A CG2   1 
ATOM   969  N N     . VAL A 1 227 ? -16.028 83.276  -1.616  1.00 61.80  ? 329  VAL A N     1 
ATOM   970  C CA    . VAL A 1 227 ? -14.649 83.637  -1.443  1.00 59.24  ? 329  VAL A CA    1 
ATOM   971  C C     . VAL A 1 227 ? -13.784 82.966  -2.467  1.00 56.69  ? 329  VAL A C     1 
ATOM   972  O O     . VAL A 1 227 ? -12.565 83.123  -2.404  1.00 53.26  ? 329  VAL A O     1 
ATOM   973  C CB    . VAL A 1 227 ? -14.088 83.296  -0.043  1.00 65.15  ? 329  VAL A CB    1 
ATOM   974  C CG1   . VAL A 1 227 ? -15.019 83.906  1.038   1.00 66.01  ? 329  VAL A CG1   1 
ATOM   975  C CG2   . VAL A 1 227 ? -13.882 81.800  0.128   1.00 66.30  ? 329  VAL A CG2   1 
ATOM   976  N N     . ALA A 1 228 ? -14.391 82.224  -3.398  1.00 85.25  ? 330  ALA A N     1 
ATOM   977  C CA    . ALA A 1 228 ? -13.627 81.541  -4.449  1.00 85.28  ? 330  ALA A CA    1 
ATOM   978  C C     . ALA A 1 228 ? -13.739 82.339  -5.733  1.00 82.01  ? 330  ALA A C     1 
ATOM   979  O O     . ALA A 1 228 ? -13.103 82.022  -6.742  1.00 82.98  ? 330  ALA A O     1 
ATOM   980  C CB    . ALA A 1 228 ? -14.134 80.112  -4.666  1.00 159.44 ? 330  ALA A CB    1 
ATOM   981  N N     . ILE A 1 229 ? -14.556 83.383  -5.694  1.00 50.09  ? 331  ILE A N     1 
ATOM   982  C CA    . ILE A 1 229 ? -14.729 84.271  -6.867  1.00 49.65  ? 331  ILE A CA    1 
ATOM   983  C C     . ILE A 1 229 ? -13.942 85.608  -6.591  1.00 44.69  ? 331  ILE A C     1 
ATOM   984  O O     . ILE A 1 229 ? -13.320 86.220  -7.478  1.00 40.38  ? 331  ILE A O     1 
ATOM   985  C CB    . ILE A 1 229 ? -16.239 84.558  -7.150  1.00 70.18  ? 331  ILE A CB    1 
ATOM   986  C CG1   . ILE A 1 229 ? -17.045 83.264  -7.113  1.00 70.90  ? 331  ILE A CG1   1 
ATOM   987  C CG2   . ILE A 1 229 ? -16.376 85.161  -8.507  1.00 71.91  ? 331  ILE A CG2   1 
ATOM   988  C CD1   . ILE A 1 229 ? -18.511 83.458  -6.934  1.00 69.92  ? 331  ILE A CD1   1 
ATOM   989  N N     . ALA A 1 230 ? -13.964 86.019  -5.331  1.00 46.47  ? 332  ALA A N     1 
ATOM   990  C CA    . ALA A 1 230 ? -13.259 87.175  -4.844  1.00 44.90  ? 332  ALA A CA    1 
ATOM   991  C C     . ALA A 1 230 ? -11.799 86.845  -4.790  1.00 44.95  ? 332  ALA A C     1 
ATOM   992  O O     . ALA A 1 230 ? -10.960 87.700  -4.750  1.00 47.09  ? 332  ALA A O     1 
ATOM   993  C CB    . ALA A 1 230 ? -13.681 87.422  -3.487  1.00 14.06  ? 332  ALA A CB    1 
ATOM   994  N N     . SER A 1 231 ? -11.499 85.567  -4.747  1.00 54.73  ? 333  SER A N     1 
ATOM   995  C CA    . SER A 1 231 ? -10.152 85.092  -4.588  1.00 55.20  ? 333  SER A CA    1 
ATOM   996  C C     . SER A 1 231 ? -9.222  85.418  -5.725  1.00 53.15  ? 333  SER A C     1 
ATOM   997  O O     . SER A 1 231 ? -7.983  85.328  -5.563  1.00 53.46  ? 333  SER A O     1 
ATOM   998  C CB    . SER A 1 231 ? -10.190 83.594  -4.319  1.00 125.22 ? 333  SER A CB    1 
ATOM   999  O OG    . SER A 1 231 ? -10.885 82.907  -5.344  1.00 130.96 ? 333  SER A OG    1 
ATOM   1000 N N     . HIS A 1 232 ? -9.774  85.773  -6.883  1.00 63.26  ? 334  HIS A N     1 
ATOM   1001 C CA    . HIS A 1 232 ? -8.906  86.168  -7.991  1.00 62.28  ? 334  HIS A CA    1 
ATOM   1002 C C     . HIS A 1 232 ? -9.073  87.668  -8.283  1.00 62.82  ? 334  HIS A C     1 
ATOM   1003 O O     . HIS A 1 232 ? -10.022 88.299  -7.884  1.00 68.71  ? 334  HIS A O     1 
ATOM   1004 C CB    . HIS A 1 232 ? -9.240  85.392  -9.257  1.00 69.19  ? 334  HIS A CB    1 
ATOM   1005 C CG    . HIS A 1 232 ? -9.550  83.943  -9.026  1.00 71.01  ? 334  HIS A CG    1 
ATOM   1006 N ND1   . HIS A 1 232 ? -9.062  83.226  -7.935  1.00 71.32  ? 334  HIS A ND1   1 
ATOM   1007 C CD2   . HIS A 1 232 ? -10.293 83.068  -9.739  1.00 72.15  ? 334  HIS A CD2   1 
ATOM   1008 C CE1   . HIS A 1 232 ? -9.492  81.981  -8.011  1.00 74.28  ? 334  HIS A CE1   1 
ATOM   1009 N NE2   . HIS A 1 232 ? -10.239 81.854  -9.099  1.00 74.87  ? 334  HIS A NE2   1 
ATOM   1010 N N     . ASP A 1 233 ? -8.083  88.249  -8.911  1.00 48.97  ? 335  ASP A N     1 
ATOM   1011 C CA    . ASP A 1 233 ? -8.123  89.614  -9.394  1.00 50.07  ? 335  ASP A CA    1 
ATOM   1012 C C     . ASP A 1 233 ? -9.464  89.889  -10.052 1.00 51.79  ? 335  ASP A C     1 
ATOM   1013 O O     . ASP A 1 233 ? -9.849  89.179  -11.005 1.00 50.17  ? 335  ASP A O     1 
ATOM   1014 C CB    . ASP A 1 233 ? -7.047  89.762  -10.469 1.00 68.16  ? 335  ASP A CB    1 
ATOM   1015 C CG    . ASP A 1 233 ? -5.627  89.551  -9.934  1.00 71.99  ? 335  ASP A CG    1 
ATOM   1016 O OD1   . ASP A 1 233 ? -5.355  88.497  -9.290  1.00 80.33  ? 335  ASP A OD1   1 
ATOM   1017 O OD2   . ASP A 1 233 ? -4.778  90.444  -10.162 1.00 74.70  ? 335  ASP A OD2   1 
ATOM   1018 N N     . GLY A 1 234 ? -10.179 90.916  -9.583  1.00 69.08  ? 336  GLY A N     1 
ATOM   1019 C CA    . GLY A 1 234 ? -11.459 91.259  -10.211 1.00 72.77  ? 336  GLY A CA    1 
ATOM   1020 C C     . GLY A 1 234 ? -12.712 90.895  -9.414  1.00 75.14  ? 336  GLY A C     1 
ATOM   1021 O O     . GLY A 1 234 ? -13.854 91.039  -9.913  1.00 75.15  ? 336  GLY A O     1 
ATOM   1022 N N     . GLY A 1 235 ? -12.483 90.403  -8.187  1.00 86.06  ? 337  GLY A N     1 
ATOM   1023 C CA    . GLY A 1 235 ? -13.545 89.996  -7.286  1.00 86.27  ? 337  GLY A CA    1 
ATOM   1024 C C     . GLY A 1 235 ? -14.678 90.991  -7.274  1.00 88.82  ? 337  GLY A C     1 
ATOM   1025 O O     . GLY A 1 235 ? -15.855 90.559  -7.217  1.00 89.27  ? 337  GLY A O     1 
ATOM   1026 N N     . LYS A 1 236 ? -14.337 92.301  -7.297  1.00 51.95  ? 338  LYS A N     1 
ATOM   1027 C CA    . LYS A 1 236 ? -15.358 93.360  -7.323  1.00 49.54  ? 338  LYS A CA    1 
ATOM   1028 C C     . LYS A 1 236 ? -16.153 93.295  -8.661  1.00 50.22  ? 338  LYS A C     1 
ATOM   1029 O O     . LYS A 1 236 ? -17.373 93.270  -8.646  1.00 55.75  ? 338  LYS A O     1 
ATOM   1030 C CB    . LYS A 1 236 ? -14.718 94.718  -7.122  1.00 63.44  ? 338  LYS A CB    1 
ATOM   1031 C CG    . LYS A 1 236 ? -15.652 95.805  -6.646  1.00 63.85  ? 338  LYS A CG    1 
ATOM   1032 C CD    . LYS A 1 236 ? -15.488 97.071  -7.504  1.00 64.22  ? 338  LYS A CD    1 
ATOM   1033 C CE    . LYS A 1 236 ? -16.109 98.284  -6.810  1.00 66.33  ? 338  LYS A CE    1 
ATOM   1034 N NZ    . LYS A 1 236 ? -15.572 98.342  -5.403  1.00 70.99  ? 338  LYS A NZ    1 
ATOM   1035 N N     . GLN A 1 237 ? -15.485 93.256  -9.804  1.00 53.59  ? 339  GLN A N     1 
ATOM   1036 C CA    . GLN A 1 237 ? -16.215 93.114  -11.041 1.00 54.91  ? 339  GLN A CA    1 
ATOM   1037 C C     . GLN A 1 237 ? -16.837 91.688  -11.005 1.00 56.86  ? 339  GLN A C     1 
ATOM   1038 O O     . GLN A 1 237 ? -17.963 91.429  -11.527 1.00 59.78  ? 339  GLN A O     1 
ATOM   1039 C CB    . GLN A 1 237 ? -15.309 93.202  -12.291 1.00 65.16  ? 339  GLN A CB    1 
ATOM   1040 C CG    . GLN A 1 237 ? -14.358 94.369  -12.368 1.00 66.08  ? 339  GLN A CG    1 
ATOM   1041 C CD    . GLN A 1 237 ? -14.926 95.698  -11.812 1.00 68.70  ? 339  GLN A CD    1 
ATOM   1042 O OE1   . GLN A 1 237 ? -14.951 96.731  -12.522 1.00 72.19  ? 339  GLN A OE1   1 
ATOM   1043 N NE2   . GLN A 1 237 ? -15.361 95.680  -10.545 1.00 67.09  ? 339  GLN A NE2   1 
ATOM   1044 N N     . ALA A 1 238 ? -16.121 90.758  -10.390 1.00 63.45  ? 340  ALA A N     1 
ATOM   1045 C CA    . ALA A 1 238 ? -16.605 89.400  -10.398 1.00 65.48  ? 340  ALA A CA    1 
ATOM   1046 C C     . ALA A 1 238 ? -17.927 89.248  -9.710  1.00 67.11  ? 340  ALA A C     1 
ATOM   1047 O O     . ALA A 1 238 ? -18.897 88.832  -10.344 1.00 70.08  ? 340  ALA A O     1 
ATOM   1048 C CB    . ALA A 1 238 ? -15.588 88.486  -9.780  1.00 200.00 ? 340  ALA A CB    1 
ATOM   1049 N N     . LEU A 1 239 ? -17.948 89.568  -8.415  1.00 47.69  ? 341  LEU A N     1 
ATOM   1050 C CA    . LEU A 1 239 ? -19.159 89.463  -7.613  1.00 49.90  ? 341  LEU A CA    1 
ATOM   1051 C C     . LEU A 1 239 ? -20.301 90.338  -8.156  1.00 54.81  ? 341  LEU A C     1 
ATOM   1052 O O     . LEU A 1 239 ? -21.468 89.951  -8.132  1.00 61.03  ? 341  LEU A O     1 
ATOM   1053 C CB    . LEU A 1 239 ? -18.889 89.880  -6.171  1.00 56.92  ? 341  LEU A CB    1 
ATOM   1054 C CG    . LEU A 1 239 ? -17.916 88.993  -5.404  1.00 60.39  ? 341  LEU A CG    1 
ATOM   1055 C CD1   . LEU A 1 239 ? -17.308 89.763  -4.234  1.00 62.60  ? 341  LEU A CD1   1 
ATOM   1056 C CD2   . LEU A 1 239 ? -18.649 87.723  -4.874  1.00 60.32  ? 341  LEU A CD2   1 
ATOM   1057 N N     . GLU A 1 240 ? -19.973 91.507  -8.662  1.00 73.73  ? 342  GLU A N     1 
ATOM   1058 C CA    . GLU A 1 240 ? -21.032 92.364  -9.058  1.00 83.07  ? 342  GLU A CA    1 
ATOM   1059 C C     . GLU A 1 240 ? -21.736 91.887  -10.301 1.00 84.37  ? 342  GLU A C     1 
ATOM   1060 O O     . GLU A 1 240 ? -22.955 91.762  -10.294 1.00 91.71  ? 342  GLU A O     1 
ATOM   1061 C CB    . GLU A 1 240 ? -20.539 93.838  -9.139  1.00 107.89 ? 342  GLU A CB    1 
ATOM   1062 C CG    . GLU A 1 240 ? -20.327 94.486  -7.731  1.00 109.74 ? 342  GLU A CG    1 
ATOM   1063 C CD    . GLU A 1 240 ? -19.911 95.949  -7.761  1.00 114.10 ? 342  GLU A CD    1 
ATOM   1064 O OE1   . GLU A 1 240 ? -20.039 96.582  -8.825  1.00 115.01 ? 342  GLU A OE1   1 
ATOM   1065 O OE2   . GLU A 1 240 ? -19.473 96.470  -6.707  1.00 113.59 ? 342  GLU A OE2   1 
ATOM   1066 N N     . THR A 1 241 ? -21.007 91.589  -11.359 1.00 65.37  ? 343  THR A N     1 
ATOM   1067 C CA    . THR A 1 241 ? -21.691 91.137  -12.574 1.00 67.51  ? 343  THR A CA    1 
ATOM   1068 C C     . THR A 1 241 ? -22.300 89.745  -12.342 1.00 70.34  ? 343  THR A C     1 
ATOM   1069 O O     . THR A 1 241 ? -22.928 89.155  -13.228 1.00 70.40  ? 343  THR A O     1 
ATOM   1070 C CB    . THR A 1 241 ? -20.746 91.124  -13.821 1.00 66.64  ? 343  THR A CB    1 
ATOM   1071 O OG1   . THR A 1 241 ? -19.381 91.008  -13.398 1.00 64.64  ? 343  THR A OG1   1 
ATOM   1072 C CG2   . THR A 1 241 ? -20.906 92.400  -14.633 1.00 63.64  ? 343  THR A CG2   1 
ATOM   1073 N N     . MET A 1 242 ? -22.116 89.241  -11.126 1.00 116.23 ? 344  MET A N     1 
ATOM   1074 C CA    . MET A 1 242 ? -22.652 87.946  -10.701 1.00 123.28 ? 344  MET A CA    1 
ATOM   1075 C C     . MET A 1 242 ? -24.055 88.199  -10.123 1.00 129.28 ? 344  MET A C     1 
ATOM   1076 O O     . MET A 1 242 ? -24.964 87.377  -10.276 1.00 133.16 ? 344  MET A O     1 
ATOM   1077 C CB    . MET A 1 242 ? -21.727 87.339  -9.632  1.00 91.03  ? 344  MET A CB    1 
ATOM   1078 C CG    . MET A 1 242 ? -22.210 86.072  -8.956  1.00 92.53  ? 344  MET A CG    1 
ATOM   1079 S SD    . MET A 1 242 ? -22.093 84.641  -10.029 1.00 100.79 ? 344  MET A SD    1 
ATOM   1080 C CE    . MET A 1 242 ? -22.162 83.343  -8.797  1.00 97.27  ? 344  MET A CE    1 
ATOM   1081 N N     . GLN A 1 243 ? -24.218 89.345  -9.460  1.00 102.69 ? 345  GLN A N     1 
ATOM   1082 C CA    . GLN A 1 243 ? -25.493 89.736  -8.862  1.00 99.49  ? 345  GLN A CA    1 
ATOM   1083 C C     . GLN A 1 243 ? -26.423 90.380  -9.887  1.00 95.99  ? 345  GLN A C     1 
ATOM   1084 O O     . GLN A 1 243 ? -27.631 90.443  -9.677  1.00 97.87  ? 345  GLN A O     1 
ATOM   1085 C CB    . GLN A 1 243 ? -25.258 90.672  -7.668  1.00 118.30 ? 345  GLN A CB    1 
ATOM   1086 C CG    . GLN A 1 243 ? -25.518 89.998  -6.334  1.00 123.16 ? 345  GLN A CG    1 
ATOM   1087 C CD    . GLN A 1 243 ? -25.508 88.471  -6.431  1.00 124.97 ? 345  GLN A CD    1 
ATOM   1088 O OE1   . GLN A 1 243 ? -24.465 87.857  -6.658  1.00 121.49 ? 345  GLN A OE1   1 
ATOM   1089 N NE2   . GLN A 1 243 ? -26.681 87.856  -6.259  1.00 127.67 ? 345  GLN A NE2   1 
ATOM   1090 N N     . ARG A 1 244 ? -25.876 90.825  -11.013 1.00 102.57 ? 346  ARG A N     1 
ATOM   1091 C CA    . ARG A 1 244 ? -26.707 91.445  -12.034 1.00 106.00 ? 346  ARG A CA    1 
ATOM   1092 C C     . ARG A 1 244 ? -27.132 90.439  -13.076 1.00 107.51 ? 346  ARG A C     1 
ATOM   1093 O O     . ARG A 1 244 ? -28.274 90.471  -13.542 1.00 105.02 ? 346  ARG A O     1 
ATOM   1094 C CB    . ARG A 1 244 ? -25.976 92.590  -12.764 1.00 100.01 ? 346  ARG A CB    1 
ATOM   1095 C CG    . ARG A 1 244 ? -25.294 93.638  -11.877 1.00 104.35 ? 346  ARG A CG    1 
ATOM   1096 C CD    . ARG A 1 244 ? -26.112 93.952  -10.620 1.00 113.16 ? 346  ARG A CD    1 
ATOM   1097 N NE    . ARG A 1 244 ? -25.239 94.304  -9.499  1.00 119.71 ? 346  ARG A NE    1 
ATOM   1098 C CZ    . ARG A 1 244 ? -25.470 93.992  -8.223  1.00 122.62 ? 346  ARG A CZ    1 
ATOM   1099 N NH1   . ARG A 1 244 ? -26.555 93.313  -7.880  1.00 123.27 ? 346  ARG A NH1   1 
ATOM   1100 N NH2   . ARG A 1 244 ? -24.607 94.358  -7.281  1.00 124.79 ? 346  ARG A NH2   1 
ATOM   1101 N N     . LEU A 1 245 ? -26.216 89.539  -13.429 1.00 127.12 ? 347  LEU A N     1 
ATOM   1102 C CA    . LEU A 1 245 ? -26.467 88.577  -14.498 1.00 125.64 ? 347  LEU A CA    1 
ATOM   1103 C C     . LEU A 1 245 ? -26.830 87.136  -14.132 1.00 126.81 ? 347  LEU A C     1 
ATOM   1104 O O     . LEU A 1 245 ? -27.298 86.396  -14.999 1.00 131.51 ? 347  LEU A O     1 
ATOM   1105 C CB    . LEU A 1 245 ? -25.278 88.600  -15.482 1.00 98.48  ? 347  LEU A CB    1 
ATOM   1106 C CG    . LEU A 1 245 ? -25.449 89.395  -16.805 1.00 95.68  ? 347  LEU A CG    1 
ATOM   1107 C CD1   . LEU A 1 245 ? -24.103 89.648  -17.487 1.00 91.96  ? 347  LEU A CD1   1 
ATOM   1108 C CD2   . LEU A 1 245 ? -26.372 88.646  -17.758 1.00 94.62  ? 347  LEU A CD2   1 
ATOM   1109 N N     . LEU A 1 246 ? -26.628 86.737  -12.877 1.00 89.70  ? 348  LEU A N     1 
ATOM   1110 C CA    . LEU A 1 246 ? -26.970 85.380  -12.460 1.00 87.44  ? 348  LEU A CA    1 
ATOM   1111 C C     . LEU A 1 246 ? -28.345 85.028  -13.111 1.00 92.25  ? 348  LEU A C     1 
ATOM   1112 O O     . LEU A 1 246 ? -28.448 83.989  -13.774 1.00 96.68  ? 348  LEU A O     1 
ATOM   1113 C CB    . LEU A 1 246 ? -26.949 85.274  -10.908 1.00 80.33  ? 348  LEU A CB    1 
ATOM   1114 C CG    . LEU A 1 246 ? -27.218 83.932  -10.190 1.00 80.39  ? 348  LEU A CG    1 
ATOM   1115 C CD1   . LEU A 1 246 ? -26.789 82.745  -11.035 1.00 79.40  ? 348  LEU A CD1   1 
ATOM   1116 C CD2   . LEU A 1 246 ? -26.477 83.936  -8.859  1.00 76.91  ? 348  LEU A CD2   1 
ATOM   1117 N N     . PRO A 1 247 ? -29.401 85.879  -12.926 1.00 118.41 ? 349  PRO A N     1 
ATOM   1118 C CA    . PRO A 1 247 ? -30.738 85.703  -13.515 1.00 115.31 ? 349  PRO A CA    1 
ATOM   1119 C C     . PRO A 1 247 ? -30.818 85.573  -15.044 1.00 111.30 ? 349  PRO A C     1 
ATOM   1120 O O     . PRO A 1 247 ? -31.253 84.548  -15.556 1.00 108.78 ? 349  PRO A O     1 
ATOM   1121 C CB    . PRO A 1 247 ? -31.451 86.959  -13.092 1.00 122.71 ? 349  PRO A CB    1 
ATOM   1122 C CG    . PRO A 1 247 ? -31.015 87.104  -11.693 1.00 124.66 ? 349  PRO A CG    1 
ATOM   1123 C CD    . PRO A 1 247 ? -29.529 86.723  -11.711 1.00 125.26 ? 349  PRO A CD    1 
ATOM   1124 N N     . VAL A 1 248 ? -30.454 86.631  -15.769 1.00 67.45  ? 350  VAL A N     1 
ATOM   1125 C CA    . VAL A 1 248 ? -30.525 86.614  -17.256 1.00 67.41  ? 350  VAL A CA    1 
ATOM   1126 C C     . VAL A 1 248 ? -30.078 85.276  -17.845 1.00 68.54  ? 350  VAL A C     1 
ATOM   1127 O O     . VAL A 1 248 ? -30.674 84.800  -18.794 1.00 72.46  ? 350  VAL A O     1 
ATOM   1128 C CB    . VAL A 1 248 ? -29.665 87.784  -17.915 1.00 45.73  ? 350  VAL A CB    1 
ATOM   1129 C CG1   . VAL A 1 248 ? -29.770 87.755  -19.411 1.00 41.71  ? 350  VAL A CG1   1 
ATOM   1130 C CG2   . VAL A 1 248 ? -30.132 89.120  -17.406 1.00 50.45  ? 350  VAL A CG2   1 
ATOM   1131 N N     . LEU A 1 249 ? -29.042 84.679  -17.243 1.00 87.45  ? 351  LEU A N     1 
ATOM   1132 C CA    . LEU A 1 249 ? -28.446 83.414  -17.689 1.00 86.23  ? 351  LEU A CA    1 
ATOM   1133 C C     . LEU A 1 249 ? -29.354 82.222  -17.505 1.00 90.46  ? 351  LEU A C     1 
ATOM   1134 O O     . LEU A 1 249 ? -29.373 81.344  -18.359 1.00 87.64  ? 351  LEU A O     1 
ATOM   1135 C CB    . LEU A 1 249 ? -27.108 83.155  -16.964 1.00 101.68 ? 351  LEU A CB    1 
ATOM   1136 C CG    . LEU A 1 249 ? -25.971 84.193  -17.011 1.00 102.11 ? 351  LEU A CG    1 
ATOM   1137 C CD1   . LEU A 1 249 ? -24.676 83.519  -16.474 1.00 102.10 ? 351  LEU A CD1   1 
ATOM   1138 C CD2   . LEU A 1 249 ? -25.750 84.747  -18.467 1.00 95.64  ? 351  LEU A CD2   1 
ATOM   1139 N N     . CYS A 1 250 ? -30.108 82.202  -16.403 1.00 144.15 ? 352  CYS A N     1 
ATOM   1140 C CA    . CYS A 1 250 ? -31.008 81.086  -16.093 1.00 145.57 ? 352  CYS A CA    1 
ATOM   1141 C C     . CYS A 1 250 ? -32.460 81.366  -16.482 1.00 146.92 ? 352  CYS A C     1 
ATOM   1142 O O     . CYS A 1 250 ? -33.248 80.441  -16.671 1.00 150.26 ? 352  CYS A O     1 
ATOM   1143 C CB    . CYS A 1 250 ? -30.911 80.744  -14.604 1.00 110.58 ? 352  CYS A CB    1 
ATOM   1144 S SG    . CYS A 1 250 ? -29.215 80.871  -13.905 1.00 92.71  ? 352  CYS A SG    1 
ATOM   1145 N N     . GLN A 1 251 ? -32.799 82.648  -16.579 1.00 72.12  ? 353  GLN A N     1 
ATOM   1146 C CA    . GLN A 1 251 ? -34.121 83.096  -17.006 1.00 74.06  ? 353  GLN A CA    1 
ATOM   1147 C C     . GLN A 1 251 ? -34.257 82.981  -18.526 1.00 73.99  ? 353  GLN A C     1 
ATOM   1148 O O     . GLN A 1 251 ? -35.358 83.056  -19.053 1.00 76.96  ? 353  GLN A O     1 
ATOM   1149 C CB    . GLN A 1 251 ? -34.355 84.559  -16.644 1.00 130.08 ? 353  GLN A CB    1 
ATOM   1150 C CG    . GLN A 1 251 ? -34.530 84.840  -15.168 1.00 138.20 ? 353  GLN A CG    1 
ATOM   1151 C CD    . GLN A 1 251 ? -34.516 86.331  -14.861 1.00 140.95 ? 353  GLN A CD    1 
ATOM   1152 O OE1   . GLN A 1 251 ? -33.709 87.080  -15.421 1.00 149.19 ? 353  GLN A OE1   1 
ATOM   1153 N NE2   . GLN A 1 251 ? -35.393 86.767  -13.959 1.00 133.55 ? 353  GLN A NE2   1 
ATOM   1154 N N     . ALA A 1 252 ? -33.153 82.779  -19.232 1.00 151.73 ? 354  ALA A N     1 
ATOM   1155 C CA    . ALA A 1 252 ? -33.201 82.701  -20.686 1.00 155.42 ? 354  ALA A CA    1 
ATOM   1156 C C     . ALA A 1 252 ? -32.245 81.656  -21.268 1.00 154.20 ? 354  ALA A C     1 
ATOM   1157 O O     . ALA A 1 252 ? -32.312 81.350  -22.474 1.00 156.70 ? 354  ALA A O     1 
ATOM   1158 C CB    . ALA A 1 252 ? -32.884 84.080  -21.276 1.00 54.51  ? 354  ALA A CB    1 
ATOM   1159 N N     . HIS A 1 253 ? -31.360 81.112  -20.428 1.00 93.23  ? 355  HIS A N     1 
ATOM   1160 C CA    . HIS A 1 253 ? -30.387 80.144  -20.910 1.00 93.01  ? 355  HIS A CA    1 
ATOM   1161 C C     . HIS A 1 253 ? -30.255 78.935  -20.008 1.00 85.96  ? 355  HIS A C     1 
ATOM   1162 O O     . HIS A 1 253 ? -29.608 77.957  -20.365 1.00 82.74  ? 355  HIS A O     1 
ATOM   1163 C CB    . HIS A 1 253 ? -29.038 80.837  -21.100 1.00 125.61 ? 355  HIS A CB    1 
ATOM   1164 C CG    . HIS A 1 253 ? -29.151 82.307  -21.376 1.00 131.15 ? 355  HIS A CG    1 
ATOM   1165 N ND1   . HIS A 1 253 ? -28.935 82.867  -22.625 1.00 136.73 ? 355  HIS A ND1   1 
ATOM   1166 C CD2   . HIS A 1 253 ? -29.439 83.344  -20.555 1.00 132.17 ? 355  HIS A CD2   1 
ATOM   1167 C CE1   . HIS A 1 253 ? -29.080 84.175  -22.547 1.00 133.51 ? 355  HIS A CE1   1 
ATOM   1168 N NE2   . HIS A 1 253 ? -29.388 84.496  -21.298 1.00 133.43 ? 355  HIS A NE2   1 
ATOM   1169 N N     . GLY A 1 254 ? -30.848 79.028  -18.827 1.00 90.31  ? 356  GLY A N     1 
ATOM   1170 C CA    . GLY A 1 254 ? -30.866 77.921  -17.897 1.00 90.29  ? 356  GLY A CA    1 
ATOM   1171 C C     . GLY A 1 254 ? -29.614 77.109  -17.631 1.00 89.52  ? 356  GLY A C     1 
ATOM   1172 O O     . GLY A 1 254 ? -29.563 75.867  -17.770 1.00 88.61  ? 356  GLY A O     1 
ATOM   1173 N N     . LEU A 1 255 ? -28.570 77.812  -17.244 1.00 88.76  ? 357  LEU A N     1 
ATOM   1174 C CA    . LEU A 1 255 ? -27.346 77.122  -16.876 1.00 84.81  ? 357  LEU A CA    1 
ATOM   1175 C C     . LEU A 1 255 ? -27.463 76.982  -15.334 1.00 83.51  ? 357  LEU A C     1 
ATOM   1176 O O     . LEU A 1 255 ? -27.735 77.966  -14.627 1.00 76.54  ? 357  LEU A O     1 
ATOM   1177 C CB    . LEU A 1 255 ? -26.113 77.967  -17.250 1.00 67.78  ? 357  LEU A CB    1 
ATOM   1178 C CG    . LEU A 1 255 ? -26.218 79.035  -18.371 1.00 66.20  ? 357  LEU A CG    1 
ATOM   1179 C CD1   . LEU A 1 255 ? -25.016 79.950  -18.279 1.00 67.34  ? 357  LEU A CD1   1 
ATOM   1180 C CD2   . LEU A 1 255 ? -26.308 78.448  -19.785 1.00 62.55  ? 357  LEU A CD2   1 
ATOM   1181 N N     . PRO A 1 256 ? -27.299 75.762  -14.803 1.00 95.71  ? 358  PRO A N     1 
ATOM   1182 C CA    . PRO A 1 256 ? -27.375 75.507  -13.348 1.00 99.67  ? 358  PRO A CA    1 
ATOM   1183 C C     . PRO A 1 256 ? -26.408 76.446  -12.629 1.00 105.46 ? 358  PRO A C     1 
ATOM   1184 O O     . PRO A 1 256 ? -25.313 76.683  -13.127 1.00 104.25 ? 358  PRO A O     1 
ATOM   1185 C CB    . PRO A 1 256 ? -26.936 74.053  -13.210 1.00 125.42 ? 358  PRO A CB    1 
ATOM   1186 C CG    . PRO A 1 256 ? -27.351 73.434  -14.504 1.00 126.67 ? 358  PRO A CG    1 
ATOM   1187 C CD    . PRO A 1 256 ? -27.145 74.517  -15.569 1.00 126.77 ? 358  PRO A CD    1 
ATOM   1188 N N     . PRO A 1 257 ? -26.779 76.969  -11.447 1.00 167.30 ? 359  PRO A N     1 
ATOM   1189 C CA    . PRO A 1 257 ? -25.962 77.908  -10.648 1.00 166.40 ? 359  PRO A CA    1 
ATOM   1190 C C     . PRO A 1 257 ? -24.482 77.569  -10.467 1.00 167.92 ? 359  PRO A C     1 
ATOM   1191 O O     . PRO A 1 257 ? -23.617 78.454  -10.601 1.00 166.97 ? 359  PRO A O     1 
ATOM   1192 C CB    . PRO A 1 257 ? -26.681 77.957  -9.291  1.00 70.21  ? 359  PRO A CB    1 
ATOM   1193 C CG    . PRO A 1 257 ? -28.071 77.578  -9.622  1.00 73.38  ? 359  PRO A CG    1 
ATOM   1194 C CD    . PRO A 1 257 ? -27.950 76.517  -10.682 1.00 75.15  ? 359  PRO A CD    1 
ATOM   1195 N N     . ASP A 1 258 ? -24.210 76.304  -10.128 1.00 96.13  ? 360  ASP A N     1 
ATOM   1196 C CA    . ASP A 1 258 ? -22.850 75.822  -9.944  1.00 85.93  ? 360  ASP A CA    1 
ATOM   1197 C C     . ASP A 1 258 ? -22.037 76.029  -11.216 1.00 79.08  ? 360  ASP A C     1 
ATOM   1198 O O     . ASP A 1 258 ? -20.812 76.108  -11.143 1.00 81.47  ? 360  ASP A O     1 
ATOM   1199 C CB    . ASP A 1 258 ? -22.873 74.351  -9.552  1.00 97.19  ? 360  ASP A CB    1 
ATOM   1200 C CG    . ASP A 1 258 ? -23.690 74.102  -8.284  1.00 97.83  ? 360  ASP A CG    1 
ATOM   1201 O OD1   . ASP A 1 258 ? -24.159 75.089  -7.669  1.00 94.80  ? 360  ASP A OD1   1 
ATOM   1202 O OD2   . ASP A 1 258 ? -23.862 72.919  -7.903  1.00 97.52  ? 360  ASP A OD2   1 
ATOM   1203 N N     . GLN A 1 259 ? -22.724 76.114  -12.363 1.00 85.36  ? 361  GLN A N     1 
ATOM   1204 C CA    . GLN A 1 259 ? -22.099 76.385  -13.667 1.00 86.02  ? 361  GLN A CA    1 
ATOM   1205 C C     . GLN A 1 259 ? -21.755 77.870  -13.832 1.00 85.08  ? 361  GLN A C     1 
ATOM   1206 O O     . GLN A 1 259 ? -20.806 78.181  -14.550 1.00 84.18  ? 361  GLN A O     1 
ATOM   1207 C CB    . GLN A 1 259 ? -23.003 75.980  -14.829 1.00 93.09  ? 361  GLN A CB    1 
ATOM   1208 C CG    . GLN A 1 259 ? -22.716 74.623  -15.403 1.00 105.13 ? 361  GLN A CG    1 
ATOM   1209 C CD    . GLN A 1 259 ? -23.719 74.238  -16.478 1.00 114.30 ? 361  GLN A CD    1 
ATOM   1210 O OE1   . GLN A 1 259 ? -24.200 75.090  -17.247 1.00 114.89 ? 361  GLN A OE1   1 
ATOM   1211 N NE2   . GLN A 1 259 ? -24.033 72.943  -16.548 1.00 114.69 ? 361  GLN A NE2   1 
ATOM   1212 N N     . VAL A 1 260 ? -22.523 78.793  -13.223 1.00 97.71  ? 362  VAL A N     1 
ATOM   1213 C CA    . VAL A 1 260 ? -22.183 80.241  -13.312 1.00 92.17  ? 362  VAL A CA    1 
ATOM   1214 C C     . VAL A 1 260 ? -21.070 80.523  -12.299 1.00 91.01  ? 362  VAL A C     1 
ATOM   1215 O O     . VAL A 1 260 ? -20.246 81.401  -12.528 1.00 89.81  ? 362  VAL A O     1 
ATOM   1216 C CB    . VAL A 1 260 ? -23.371 81.187  -13.032 1.00 71.23  ? 362  VAL A CB    1 
ATOM   1217 C CG1   . VAL A 1 260 ? -24.566 80.745  -13.843 1.00 77.78  ? 362  VAL A CG1   1 
ATOM   1218 C CG2   . VAL A 1 260 ? -23.658 81.254  -11.529 1.00 69.79  ? 362  VAL A CG2   1 
ATOM   1219 N N     . VAL A 1 261 ? -21.054 79.775  -11.187 1.00 75.50  ? 363  VAL A N     1 
ATOM   1220 C CA    . VAL A 1 261 ? -19.960 79.877  -10.220 1.00 68.63  ? 363  VAL A CA    1 
ATOM   1221 C C     . VAL A 1 261 ? -18.655 79.416  -10.946 1.00 64.01  ? 363  VAL A C     1 
ATOM   1222 O O     . VAL A 1 261 ? -17.573 79.922  -10.675 1.00 60.03  ? 363  VAL A O     1 
ATOM   1223 C CB    . VAL A 1 261 ? -20.259 79.037  -8.959  1.00 79.43  ? 363  VAL A CB    1 
ATOM   1224 C CG1   . VAL A 1 261 ? -18.971 78.547  -8.301  1.00 80.69  ? 363  VAL A CG1   1 
ATOM   1225 C CG2   . VAL A 1 261 ? -21.054 79.898  -7.994  1.00 78.65  ? 363  VAL A CG2   1 
ATOM   1226 N N     . ALA A 1 262 ? -18.770 78.473  -11.879 1.00 87.32  ? 364  ALA A N     1 
ATOM   1227 C CA    . ALA A 1 262 ? -17.611 78.026  -12.660 1.00 86.95  ? 364  ALA A CA    1 
ATOM   1228 C C     . ALA A 1 262 ? -17.208 79.026  -13.777 1.00 84.47  ? 364  ALA A C     1 
ATOM   1229 O O     . ALA A 1 262 ? -16.095 78.944  -14.294 1.00 83.08  ? 364  ALA A O     1 
ATOM   1230 C CB    . ALA A 1 262 ? -17.864 76.623  -13.265 1.00 70.85  ? 364  ALA A CB    1 
ATOM   1231 N N     . ILE A 1 263 ? -18.092 79.964  -14.128 1.00 60.18  ? 365  ILE A N     1 
ATOM   1232 C CA    . ILE A 1 263 ? -17.815 80.975  -15.169 1.00 56.90  ? 365  ILE A CA    1 
ATOM   1233 C C     . ILE A 1 263 ? -17.177 82.203  -14.530 1.00 54.79  ? 365  ILE A C     1 
ATOM   1234 O O     . ILE A 1 263 ? -16.278 82.833  -15.074 1.00 54.44  ? 365  ILE A O     1 
ATOM   1235 C CB    . ILE A 1 263 ? -19.088 81.539  -15.838 1.00 54.53  ? 365  ILE A CB    1 
ATOM   1236 C CG1   . ILE A 1 263 ? -19.919 80.419  -16.470 1.00 59.43  ? 365  ILE A CG1   1 
ATOM   1237 C CG2   . ILE A 1 263 ? -18.710 82.609  -16.881 1.00 53.58  ? 365  ILE A CG2   1 
ATOM   1238 C CD1   . ILE A 1 263 ? -21.428 80.739  -16.500 1.00 58.16  ? 365  ILE A CD1   1 
ATOM   1239 N N     . ALA A 1 264 ? -17.638 82.538  -13.342 1.00 64.37  ? 366  ALA A N     1 
ATOM   1240 C CA    . ALA A 1 264 ? -17.158 83.717  -12.629 1.00 60.85  ? 366  ALA A CA    1 
ATOM   1241 C C     . ALA A 1 264 ? -15.884 83.540  -11.852 1.00 60.44  ? 366  ALA A C     1 
ATOM   1242 O O     . ALA A 1 264 ? -15.075 84.439  -11.803 1.00 60.95  ? 366  ALA A O     1 
ATOM   1243 C CB    . ALA A 1 264 ? -18.198 84.167  -11.686 1.00 29.32  ? 366  ALA A CB    1 
ATOM   1244 N N     . SER A 1 265 ? -15.730 82.387  -11.209 1.00 48.48  ? 367  SER A N     1 
ATOM   1245 C CA    . SER A 1 265 ? -14.571 82.043  -10.357 1.00 45.98  ? 367  SER A CA    1 
ATOM   1246 C C     . SER A 1 265 ? -13.287 81.916  -11.146 1.00 41.84  ? 367  SER A C     1 
ATOM   1247 O O     . SER A 1 265 ? -12.637 80.904  -11.125 1.00 36.31  ? 367  SER A O     1 
ATOM   1248 C CB    . SER A 1 265 ? -14.860 80.743  -9.596  1.00 52.49  ? 367  SER A CB    1 
ATOM   1249 O OG    . SER A 1 265 ? -14.773 80.929  -8.178  1.00 53.85  ? 367  SER A OG    1 
ATOM   1250 N N     . ASN A 1 266 ? -12.928 83.027  -11.771 1.00 73.17  ? 368  ASN A N     1 
ATOM   1251 C CA    . ASN A 1 266 ? -11.784 83.177  -12.661 1.00 72.28  ? 368  ASN A CA    1 
ATOM   1252 C C     . ASN A 1 266 ? -11.336 84.659  -12.837 1.00 72.14  ? 368  ASN A C     1 
ATOM   1253 O O     . ASN A 1 266 ? -12.049 85.598  -12.420 1.00 72.36  ? 368  ASN A O     1 
ATOM   1254 C CB    . ASN A 1 266 ? -12.153 82.584  -14.035 1.00 58.85  ? 368  ASN A CB    1 
ATOM   1255 C CG    . ASN A 1 266 ? -11.855 81.090  -14.122 1.00 56.76  ? 368  ASN A CG    1 
ATOM   1256 O OD1   . ASN A 1 266 ? -11.459 80.474  -13.145 1.00 55.27  ? 368  ASN A OD1   1 
ATOM   1257 N ND2   . ASN A 1 266 ? -12.060 80.506  -15.291 1.00 57.48  ? 368  ASN A ND2   1 
ATOM   1258 N N     . ILE A 1 267 ? -10.187 84.851  -13.498 1.00 43.38  ? 369  ILE A N     1 
ATOM   1259 C CA    . ILE A 1 267 ? -9.632  86.162  -13.682 1.00 43.70  ? 369  ILE A CA    1 
ATOM   1260 C C     . ILE A 1 267 ? -10.505 87.060  -14.638 1.00 46.67  ? 369  ILE A C     1 
ATOM   1261 O O     . ILE A 1 267 ? -10.901 88.198  -14.268 1.00 46.96  ? 369  ILE A O     1 
ATOM   1262 C CB    . ILE A 1 267 ? -8.129  86.078  -14.080 1.00 43.31  ? 369  ILE A CB    1 
ATOM   1263 C CG1   . ILE A 1 267 ? -7.281  86.783  -13.028 1.00 45.49  ? 369  ILE A CG1   1 
ATOM   1264 C CG2   . ILE A 1 267 ? -7.859  86.830  -15.363 1.00 42.20  ? 369  ILE A CG2   1 
ATOM   1265 C CD1   . ILE A 1 267 ? -6.632  85.899  -11.986 1.00 47.64  ? 369  ILE A CD1   1 
ATOM   1266 N N     . GLY A 1 268 ? -10.826 86.620  -15.844 1.00 54.12  ? 370  GLY A N     1 
ATOM   1267 C CA    . GLY A 1 268 ? -11.723 87.478  -16.618 1.00 59.08  ? 370  GLY A CA    1 
ATOM   1268 C C     . GLY A 1 268 ? -13.199 87.459  -16.110 1.00 61.41  ? 370  GLY A C     1 
ATOM   1269 O O     . GLY A 1 268 ? -14.088 88.041  -16.741 1.00 58.77  ? 370  GLY A O     1 
ATOM   1270 N N     . GLY A 1 269 ? -13.454 86.789  -14.973 1.00 49.57  ? 371  GLY A N     1 
ATOM   1271 C CA    . GLY A 1 269 ? -14.784 86.637  -14.385 1.00 52.83  ? 371  GLY A CA    1 
ATOM   1272 C C     . GLY A 1 269 ? -15.872 87.347  -15.147 1.00 55.23  ? 371  GLY A C     1 
ATOM   1273 O O     . GLY A 1 269 ? -16.606 86.742  -15.899 1.00 56.20  ? 371  GLY A O     1 
ATOM   1274 N N     . LYS A 1 270 ? -15.986 88.648  -14.915 1.00 72.91  ? 372  LYS A N     1 
ATOM   1275 C CA    . LYS A 1 270 ? -16.911 89.564  -15.604 1.00 73.31  ? 372  LYS A CA    1 
ATOM   1276 C C     . LYS A 1 270 ? -16.922 89.271  -17.122 1.00 72.97  ? 372  LYS A C     1 
ATOM   1277 O O     . LYS A 1 270 ? -17.913 88.831  -17.664 1.00 80.03  ? 372  LYS A O     1 
ATOM   1278 C CB    . LYS A 1 270 ? -16.380 90.956  -15.375 1.00 63.73  ? 372  LYS A CB    1 
ATOM   1279 C CG    . LYS A 1 270 ? -17.349 92.063  -15.466 1.00 68.66  ? 372  LYS A CG    1 
ATOM   1280 C CD    . LYS A 1 270 ? -16.575 93.394  -15.490 1.00 69.07  ? 372  LYS A CD    1 
ATOM   1281 C CE    . LYS A 1 270 ? -17.408 94.569  -15.034 1.00 70.04  ? 372  LYS A CE    1 
ATOM   1282 N NZ    . LYS A 1 270 ? -16.503 95.744  -14.981 1.00 80.52  ? 372  LYS A NZ    1 
ATOM   1283 N N     . GLN A 1 271 ? -15.800 89.517  -17.789 1.00 55.52  ? 373  GLN A N     1 
ATOM   1284 C CA    . GLN A 1 271 ? -15.627 89.265  -19.216 1.00 57.84  ? 373  GLN A CA    1 
ATOM   1285 C C     . GLN A 1 271 ? -16.085 87.859  -19.672 1.00 62.31  ? 373  GLN A C     1 
ATOM   1286 O O     . GLN A 1 271 ? -16.310 87.603  -20.895 1.00 63.47  ? 373  GLN A O     1 
ATOM   1287 C CB    . GLN A 1 271 ? -14.166 89.470  -19.590 1.00 66.55  ? 373  GLN A CB    1 
ATOM   1288 C CG    . GLN A 1 271 ? -13.832 90.836  -20.208 1.00 65.29  ? 373  GLN A CG    1 
ATOM   1289 C CD    . GLN A 1 271 ? -14.168 92.045  -19.335 1.00 66.48  ? 373  GLN A CD    1 
ATOM   1290 O OE1   . GLN A 1 271 ? -14.380 91.926  -18.133 1.00 68.53  ? 373  GLN A OE1   1 
ATOM   1291 N NE2   . GLN A 1 271 ? -14.200 93.227  -19.956 1.00 63.81  ? 373  GLN A NE2   1 
ATOM   1292 N N     . ALA A 1 272 ? -16.179 86.924  -18.727 1.00 100.28 ? 374  ALA A N     1 
ATOM   1293 C CA    . ALA A 1 272 ? -16.722 85.613  -19.069 1.00 104.99 ? 374  ALA A CA    1 
ATOM   1294 C C     . ALA A 1 272 ? -18.242 85.812  -19.011 1.00 110.28 ? 374  ALA A C     1 
ATOM   1295 O O     . ALA A 1 272 ? -18.942 85.659  -20.028 1.00 117.60 ? 374  ALA A O     1 
ATOM   1296 C CB    . ALA A 1 272 ? -16.310 84.564  -18.069 1.00 200.00 ? 374  ALA A CB    1 
ATOM   1297 N N     . LEU A 1 273 ? -18.743 86.172  -17.823 1.00 69.35  ? 375  LEU A N     1 
ATOM   1298 C CA    . LEU A 1 273 ? -20.182 86.400  -17.635 1.00 68.79  ? 375  LEU A CA    1 
ATOM   1299 C C     . LEU A 1 273 ? -20.720 87.249  -18.816 1.00 68.81  ? 375  LEU A C     1 
ATOM   1300 O O     . LEU A 1 273 ? -21.672 86.881  -19.476 1.00 70.14  ? 375  LEU A O     1 
ATOM   1301 C CB    . LEU A 1 273 ? -20.456 87.077  -16.276 1.00 61.09  ? 375  LEU A CB    1 
ATOM   1302 C CG    . LEU A 1 273 ? -20.249 86.112  -15.103 1.00 63.38  ? 375  LEU A CG    1 
ATOM   1303 C CD1   . LEU A 1 273 ? -20.715 86.741  -13.789 1.00 65.65  ? 375  LEU A CD1   1 
ATOM   1304 C CD2   . LEU A 1 273 ? -21.033 84.868  -15.328 1.00 65.00  ? 375  LEU A CD2   1 
ATOM   1305 N N     . GLU A 1 274 ? -20.066 88.360  -19.102 1.00 67.21  ? 376  GLU A N     1 
ATOM   1306 C CA    . GLU A 1 274 ? -20.462 89.227  -20.177 1.00 75.22  ? 376  GLU A CA    1 
ATOM   1307 C C     . GLU A 1 274 ? -20.554 88.530  -21.515 1.00 78.81  ? 376  GLU A C     1 
ATOM   1308 O O     . GLU A 1 274 ? -21.599 88.564  -22.161 1.00 82.20  ? 376  GLU A O     1 
ATOM   1309 C CB    . GLU A 1 274 ? -19.453 90.360  -20.316 1.00 130.20 ? 376  GLU A CB    1 
ATOM   1310 C CG    . GLU A 1 274 ? -19.876 91.698  -19.743 1.00 132.14 ? 376  GLU A CG    1 
ATOM   1311 C CD    . GLU A 1 274 ? -18.704 92.667  -19.590 1.00 133.04 ? 376  GLU A CD    1 
ATOM   1312 O OE1   . GLU A 1 274 ? -17.729 92.581  -20.367 1.00 130.88 ? 376  GLU A OE1   1 
ATOM   1313 O OE2   . GLU A 1 274 ? -18.770 93.527  -18.690 1.00 131.74 ? 376  GLU A OE2   1 
ATOM   1314 N N     . THR A 1 275 ? -19.464 87.895  -21.940 1.00 112.01 ? 377  THR A N     1 
ATOM   1315 C CA    . THR A 1 275 ? -19.430 87.321  -23.280 1.00 114.30 ? 377  THR A CA    1 
ATOM   1316 C C     . THR A 1 275 ? -20.262 86.066  -23.456 1.00 119.38 ? 377  THR A C     1 
ATOM   1317 O O     . THR A 1 275 ? -20.486 85.600  -24.591 1.00 122.19 ? 377  THR A O     1 
ATOM   1318 C CB    . THR A 1 275 ? -17.961 87.159  -23.770 1.00 94.03  ? 377  THR A CB    1 
ATOM   1319 O OG1   . THR A 1 275 ? -17.168 88.212  -23.191 1.00 94.11  ? 377  THR A OG1   1 
ATOM   1320 C CG2   . THR A 1 275 ? -17.878 87.300  -25.323 1.00 87.38  ? 377  THR A CG2   1 
ATOM   1321 N N     . VAL A 1 276 ? -20.736 85.529  -22.331 1.00 106.45 ? 378  VAL A N     1 
ATOM   1322 C CA    . VAL A 1 276 ? -21.647 84.386  -22.387 1.00 106.90 ? 378  VAL A CA    1 
ATOM   1323 C C     . VAL A 1 276 ? -22.920 84.943  -23.059 1.00 107.28 ? 378  VAL A C     1 
ATOM   1324 O O     . VAL A 1 276 ? -23.188 84.612  -24.223 1.00 110.02 ? 378  VAL A O     1 
ATOM   1325 C CB    . VAL A 1 276 ? -21.953 83.825  -20.966 1.00 70.20  ? 378  VAL A CB    1 
ATOM   1326 C CG1   . VAL A 1 276 ? -23.141 82.879  -21.010 1.00 68.38  ? 378  VAL A CG1   1 
ATOM   1327 C CG2   . VAL A 1 276 ? -20.728 83.086  -20.436 1.00 62.72  ? 378  VAL A CG2   1 
ATOM   1328 N N     . GLN A 1 277 ? -23.650 85.817  -22.335 1.00 70.59  ? 379  GLN A N     1 
ATOM   1329 C CA    . GLN A 1 277 ? -24.900 86.472  -22.814 1.00 76.56  ? 379  GLN A CA    1 
ATOM   1330 C C     . GLN A 1 277 ? -24.815 87.026  -24.276 1.00 73.49  ? 379  GLN A C     1 
ATOM   1331 O O     . GLN A 1 277 ? -25.644 86.748  -25.134 1.00 69.00  ? 379  GLN A O     1 
ATOM   1332 C CB    . GLN A 1 277 ? -25.273 87.591  -21.841 1.00 96.93  ? 379  GLN A CB    1 
ATOM   1333 C CG    . GLN A 1 277 ? -26.537 88.342  -22.175 1.00 104.22 ? 379  GLN A CG    1 
ATOM   1334 C CD    . GLN A 1 277 ? -26.599 89.679  -21.462 1.00 107.34 ? 379  GLN A CD    1 
ATOM   1335 O OE1   . GLN A 1 277 ? -25.772 89.972  -20.590 1.00 106.91 ? 379  GLN A OE1   1 
ATOM   1336 N NE2   . GLN A 1 277 ? -27.584 90.497  -21.821 1.00 105.79 ? 379  GLN A NE2   1 
ATOM   1337 N N     . ARG A 1 278 ? -23.771 87.785  -24.549 1.00 156.73 ? 380  ARG A N     1 
ATOM   1338 C CA    . ARG A 1 278 ? -23.562 88.352  -25.869 1.00 158.13 ? 380  ARG A CA    1 
ATOM   1339 C C     . ARG A 1 278 ? -23.425 87.275  -26.934 1.00 158.77 ? 380  ARG A C     1 
ATOM   1340 O O     . ARG A 1 278 ? -23.901 87.443  -28.061 1.00 166.33 ? 380  ARG A O     1 
ATOM   1341 C CB    . ARG A 1 278 ? -22.276 89.201  -25.888 1.00 84.47  ? 380  ARG A CB    1 
ATOM   1342 C CG    . ARG A 1 278 ? -22.365 90.601  -25.369 1.00 85.63  ? 380  ARG A CG    1 
ATOM   1343 C CD    . ARG A 1 278 ? -23.583 90.791  -24.474 1.00 91.14  ? 380  ARG A CD    1 
ATOM   1344 N NE    . ARG A 1 278 ? -23.272 91.432  -23.188 1.00 96.55  ? 380  ARG A NE    1 
ATOM   1345 C CZ    . ARG A 1 278 ? -23.019 92.733  -23.014 1.00 98.50  ? 380  ARG A CZ    1 
ATOM   1346 N NH1   . ARG A 1 278 ? -23.046 93.566  -24.060 1.00 98.22  ? 380  ARG A NH1   1 
ATOM   1347 N NH2   . ARG A 1 278 ? -22.712 93.200  -21.795 1.00 101.39 ? 380  ARG A NH2   1 
ATOM   1348 N N     . LEU A 1 279 ? -22.810 86.152  -26.570 1.00 98.18  ? 381  LEU A N     1 
ATOM   1349 C CA    . LEU A 1 279 ? -22.509 85.149  -27.569 1.00 95.75  ? 381  LEU A CA    1 
ATOM   1350 C C     . LEU A 1 279 ? -22.957 83.714  -27.281 1.00 96.32  ? 381  LEU A C     1 
ATOM   1351 O O     . LEU A 1 279 ? -22.593 82.790  -27.996 1.00 101.13 ? 381  LEU A O     1 
ATOM   1352 C CB    . LEU A 1 279 ? -21.001 85.247  -27.846 1.00 82.72  ? 381  LEU A CB    1 
ATOM   1353 C CG    . LEU A 1 279 ? -20.323 84.842  -29.178 1.00 86.13  ? 381  LEU A CG    1 
ATOM   1354 C CD1   . LEU A 1 279 ? -21.342 84.639  -30.295 1.00 91.23  ? 381  LEU A CD1   1 
ATOM   1355 C CD2   . LEU A 1 279 ? -19.286 85.922  -29.575 1.00 84.40  ? 381  LEU A CD2   1 
ATOM   1356 N N     . LEU A 1 280 ? -23.782 83.526  -26.260 1.00 78.27  ? 382  LEU A N     1 
ATOM   1357 C CA    . LEU A 1 280 ? -24.242 82.184  -25.951 1.00 81.41  ? 382  LEU A CA    1 
ATOM   1358 C C     . LEU A 1 280 ? -25.044 81.559  -27.081 1.00 88.04  ? 382  LEU A C     1 
ATOM   1359 O O     . LEU A 1 280 ? -24.708 80.459  -27.530 1.00 87.95  ? 382  LEU A O     1 
ATOM   1360 C CB    . LEU A 1 280 ? -25.069 82.157  -24.657 1.00 85.85  ? 382  LEU A CB    1 
ATOM   1361 C CG    . LEU A 1 280 ? -24.869 80.945  -23.709 1.00 84.55  ? 382  LEU A CG    1 
ATOM   1362 C CD1   . LEU A 1 280 ? -25.825 81.057  -22.499 1.00 85.97  ? 382  LEU A CD1   1 
ATOM   1363 C CD2   . LEU A 1 280 ? -25.069 79.613  -24.441 1.00 85.28  ? 382  LEU A CD2   1 
ATOM   1364 N N     . PRO A 1 281 ? -26.087 82.260  -27.584 1.00 99.15  ? 383  PRO A N     1 
ATOM   1365 C CA    . PRO A 1 281 ? -26.906 81.693  -28.655 1.00 98.75  ? 383  PRO A CA    1 
ATOM   1366 C C     . PRO A 1 281 ? -26.479 81.960  -30.091 1.00 97.53  ? 383  PRO A C     1 
ATOM   1367 O O     . PRO A 1 281 ? -26.785 81.169  -30.993 1.00 98.43  ? 383  PRO A O     1 
ATOM   1368 C CB    . PRO A 1 281 ? -28.279 82.278  -28.363 1.00 96.01  ? 383  PRO A CB    1 
ATOM   1369 C CG    . PRO A 1 281 ? -27.953 83.660  -27.839 1.00 92.61  ? 383  PRO A CG    1 
ATOM   1370 C CD    . PRO A 1 281 ? -26.570 83.605  -27.219 1.00 92.37  ? 383  PRO A CD    1 
ATOM   1371 N N     . VAL A 1 282 ? -25.763 83.056  -30.310 1.00 95.34  ? 384  VAL A N     1 
ATOM   1372 C CA    . VAL A 1 282 ? -25.379 83.416  -31.674 1.00 100.85 ? 384  VAL A CA    1 
ATOM   1373 C C     . VAL A 1 282 ? -24.491 82.382  -32.388 1.00 104.26 ? 384  VAL A C     1 
ATOM   1374 O O     . VAL A 1 282 ? -24.102 82.566  -33.552 1.00 105.83 ? 384  VAL A O     1 
ATOM   1375 C CB    . VAL A 1 282 ? -24.770 84.857  -31.720 1.00 109.92 ? 384  VAL A CB    1 
ATOM   1376 C CG1   . VAL A 1 282 ? -25.079 85.520  -33.076 1.00 108.59 ? 384  VAL A CG1   1 
ATOM   1377 C CG2   . VAL A 1 282 ? -25.381 85.709  -30.591 1.00 106.90 ? 384  VAL A CG2   1 
ATOM   1378 N N     . LEU A 1 283 ? -24.196 81.290  -31.674 1.00 158.83 ? 385  LEU A N     1 
ATOM   1379 C CA    . LEU A 1 283 ? -23.435 80.159  -32.217 1.00 159.62 ? 385  LEU A CA    1 
ATOM   1380 C C     . LEU A 1 283 ? -24.363 78.941  -32.303 1.00 167.23 ? 385  LEU A C     1 
ATOM   1381 O O     . LEU A 1 283 ? -24.577 78.431  -33.388 1.00 173.92 ? 385  LEU A O     1 
ATOM   1382 C CB    . LEU A 1 283 ? -22.201 79.790  -31.357 1.00 95.03  ? 385  LEU A CB    1 
ATOM   1383 C CG    . LEU A 1 283 ? -20.959 80.683  -31.492 1.00 95.18  ? 385  LEU A CG    1 
ATOM   1384 C CD1   . LEU A 1 283 ? -20.410 81.059  -30.119 1.00 91.76  ? 385  LEU A CD1   1 
ATOM   1385 C CD2   . LEU A 1 283 ? -19.902 79.977  -32.329 1.00 94.89  ? 385  LEU A CD2   1 
ATOM   1386 N N     . CYS A 1 284 ? -24.936 78.506  -31.175 1.00 143.46 ? 386  CYS A N     1 
ATOM   1387 C CA    . CYS A 1 284 ? -25.799 77.316  -31.133 1.00 140.49 ? 386  CYS A CA    1 
ATOM   1388 C C     . CYS A 1 284 ? -26.755 77.195  -32.310 1.00 145.71 ? 386  CYS A C     1 
ATOM   1389 O O     . CYS A 1 284 ? -26.983 76.083  -32.819 1.00 152.90 ? 386  CYS A O     1 
ATOM   1390 C CB    . CYS A 1 284 ? -26.597 77.258  -29.823 1.00 120.95 ? 386  CYS A CB    1 
ATOM   1391 S SG    . CYS A 1 284 ? -25.576 77.150  -28.376 1.00 116.68 ? 386  CYS A SG    1 
ATOM   1392 N N     . GLN A 1 285 ? -27.284 78.347  -32.732 1.00 155.16 ? 387  GLN A N     1 
ATOM   1393 C CA    . GLN A 1 285 ? -28.220 78.454  -33.851 1.00 157.57 ? 387  GLN A CA    1 
ATOM   1394 C C     . GLN A 1 285 ? -27.534 78.829  -35.161 1.00 160.08 ? 387  GLN A C     1 
ATOM   1395 O O     . GLN A 1 285 ? -28.199 79.199  -36.134 1.00 169.09 ? 387  GLN A O     1 
ATOM   1396 C CB    . GLN A 1 285 ? -29.304 79.480  -33.542 1.00 88.39  ? 387  GLN A CB    1 
ATOM   1397 C CG    . GLN A 1 285 ? -29.816 79.393  -32.118 1.00 88.27  ? 387  GLN A CG    1 
ATOM   1398 C CD    . GLN A 1 285 ? -31.269 79.796  -32.026 1.00 95.40  ? 387  GLN A CD    1 
ATOM   1399 O OE1   . GLN A 1 285 ? -31.999 79.714  -33.017 1.00 99.13  ? 387  GLN A OE1   1 
ATOM   1400 N NE2   . GLN A 1 285 ? -31.706 80.217  -30.841 1.00 92.43  ? 387  GLN A NE2   1 
ATOM   1401 N N     . ALA A 1 286 ? -26.209 78.721  -35.177 1.00 170.69 ? 388  ALA A N     1 
ATOM   1402 C CA    . ALA A 1 286 ? -25.393 78.998  -36.365 1.00 166.00 ? 388  ALA A CA    1 
ATOM   1403 C C     . ALA A 1 286 ? -24.168 78.053  -36.402 1.00 166.16 ? 388  ALA A C     1 
ATOM   1404 O O     . ALA A 1 286 ? -23.394 78.034  -37.360 1.00 163.97 ? 388  ALA A O     1 
ATOM   1405 C CB    . ALA A 1 286 ? -24.913 80.442  -36.321 1.00 91.49  ? 388  ALA A CB    1 
ATOM   1406 N N     . HIS A 1 287 ? -24.058 77.242  -35.350 1.00 95.75  ? 389  HIS A N     1 
ATOM   1407 C CA    . HIS A 1 287 ? -22.952 76.303  -35.207 1.00 96.59  ? 389  HIS A CA    1 
ATOM   1408 C C     . HIS A 1 287 ? -23.239 74.967  -34.501 1.00 89.79  ? 389  HIS A C     1 
ATOM   1409 O O     . HIS A 1 287 ? -22.487 74.011  -34.685 1.00 80.75  ? 389  HIS A O     1 
ATOM   1410 C CB    . HIS A 1 287 ? -21.800 76.957  -34.439 1.00 200.00 ? 389  HIS A CB    1 
ATOM   1411 C CG    . HIS A 1 287 ? -20.983 77.902  -35.265 1.00 200.00 ? 389  HIS A CG    1 
ATOM   1412 N ND1   . HIS A 1 287 ? -20.154 77.478  -36.281 1.00 200.00 ? 389  HIS A ND1   1 
ATOM   1413 C CD2   . HIS A 1 287 ? -20.868 79.251  -35.224 1.00 200.00 ? 389  HIS A CD2   1 
ATOM   1414 C CE1   . HIS A 1 287 ? -19.564 78.524  -36.831 1.00 200.00 ? 389  HIS A CE1   1 
ATOM   1415 N NE2   . HIS A 1 287 ? -19.980 79.612  -36.208 1.00 200.00 ? 389  HIS A NE2   1 
ATOM   1416 N N     . GLY A 1 288 ? -24.294 74.887  -33.688 1.00 157.38 ? 390  GLY A N     1 
ATOM   1417 C CA    . GLY A 1 288 ? -24.481 73.682  -32.882 1.00 153.92 ? 390  GLY A CA    1 
ATOM   1418 C C     . GLY A 1 288 ? -23.744 73.260  -31.610 1.00 150.40 ? 390  GLY A C     1 
ATOM   1419 O O     . GLY A 1 288 ? -23.511 72.076  -31.345 1.00 160.52 ? 390  GLY A O     1 
ATOM   1420 N N     . LEU A 1 289 ? -23.366 74.256  -30.815 1.00 65.66  ? 391  LEU A N     1 
ATOM   1421 C CA    . LEU A 1 289 ? -22.565 74.022  -29.619 1.00 60.79  ? 391  LEU A CA    1 
ATOM   1422 C C     . LEU A 1 289 ? -23.398 73.671  -28.388 1.00 51.44  ? 391  LEU A C     1 
ATOM   1423 O O     . LEU A 1 289 ? -24.146 74.501  -27.872 1.00 43.97  ? 391  LEU A O     1 
ATOM   1424 C CB    . LEU A 1 289 ? -21.686 75.240  -29.322 1.00 182.73 ? 391  LEU A CB    1 
ATOM   1425 C CG    . LEU A 1 289 ? -21.481 75.585  -27.845 1.00 182.54 ? 391  LEU A CG    1 
ATOM   1426 C CD1   . LEU A 1 289 ? -20.165 75.015  -27.338 1.00 178.66 ? 391  LEU A CD1   1 
ATOM   1427 C CD2   . LEU A 1 289 ? -21.535 77.090  -27.633 1.00 184.70 ? 391  LEU A CD2   1 
ATOM   1428 N N     . THR A 1 290 ? -23.251 72.435  -27.922 1.00 79.76  ? 392  THR A N     1 
ATOM   1429 C CA    . THR A 1 290 ? -23.875 71.994  -26.690 1.00 85.72  ? 392  THR A CA    1 
ATOM   1430 C C     . THR A 1 290 ? -23.576 73.106  -25.671 1.00 82.89  ? 392  THR A C     1 
ATOM   1431 O O     . THR A 1 290 ? -22.453 73.551  -25.532 1.00 85.34  ? 392  THR A O     1 
ATOM   1432 C CB    . THR A 1 290 ? -23.327 70.575  -26.268 1.00 98.60  ? 392  THR A CB    1 
ATOM   1433 O OG1   . THR A 1 290 ? -22.988 69.801  -27.438 1.00 105.87 ? 392  THR A OG1   1 
ATOM   1434 C CG2   . THR A 1 290 ? -24.396 69.805  -25.482 1.00 97.20  ? 392  THR A CG2   1 
ATOM   1435 N N     . PRO A 1 291 ? -24.616 73.675  -25.092 1.00 79.95  ? 393  PRO A N     1 
ATOM   1436 C CA    . PRO A 1 291 ? -24.623 74.741  -24.091 1.00 74.83  ? 393  PRO A CA    1 
ATOM   1437 C C     . PRO A 1 291 ? -23.673 74.517  -22.930 1.00 72.51  ? 393  PRO A C     1 
ATOM   1438 O O     . PRO A 1 291 ? -23.258 75.477  -22.268 1.00 68.22  ? 393  PRO A O     1 
ATOM   1439 C CB    . PRO A 1 291 ? -26.098 74.751  -23.613 1.00 87.04  ? 393  PRO A CB    1 
ATOM   1440 C CG    . PRO A 1 291 ? -26.861 73.945  -24.690 1.00 93.51  ? 393  PRO A CG    1 
ATOM   1441 C CD    . PRO A 1 291 ? -25.886 73.707  -25.830 1.00 92.07  ? 393  PRO A CD    1 
ATOM   1442 N N     . ASP A 1 292 ? -23.363 73.251  -22.661 1.00 79.43  ? 394  ASP A N     1 
ATOM   1443 C CA    . ASP A 1 292 ? -22.459 72.885  -21.576 1.00 76.19  ? 394  ASP A CA    1 
ATOM   1444 C C     . ASP A 1 292 ? -21.026 72.978  -22.074 1.00 75.76  ? 394  ASP A C     1 
ATOM   1445 O O     . ASP A 1 292 ? -20.088 73.115  -21.261 1.00 72.66  ? 394  ASP A O     1 
ATOM   1446 C CB    . ASP A 1 292 ? -22.729 71.464  -21.132 1.00 85.52  ? 394  ASP A CB    1 
ATOM   1447 C CG    . ASP A 1 292 ? -24.185 71.169  -21.034 1.00 89.05  ? 394  ASP A CG    1 
ATOM   1448 O OD1   . ASP A 1 292 ? -24.663 70.961  -19.902 1.00 94.18  ? 394  ASP A OD1   1 
ATOM   1449 O OD2   . ASP A 1 292 ? -24.848 71.153  -22.091 1.00 94.48  ? 394  ASP A OD2   1 
ATOM   1450 N N     . GLN A 1 293 ? -20.879 72.878  -23.406 1.00 87.92  ? 395  GLN A N     1 
ATOM   1451 C CA    . GLN A 1 293 ? -19.594 73.029  -24.103 1.00 87.16  ? 395  GLN A CA    1 
ATOM   1452 C C     . GLN A 1 293 ? -19.056 74.432  -23.797 1.00 85.57  ? 395  GLN A C     1 
ATOM   1453 O O     . GLN A 1 293 ? -17.988 74.573  -23.172 1.00 86.37  ? 395  GLN A O     1 
ATOM   1454 C CB    . GLN A 1 293 ? -19.744 72.848  -25.626 1.00 83.47  ? 395  GLN A CB    1 
ATOM   1455 C CG    . GLN A 1 293 ? -19.960 71.370  -26.019 1.00 88.09  ? 395  GLN A CG    1 
ATOM   1456 C CD    . GLN A 1 293 ? -19.988 71.132  -27.519 1.00 88.76  ? 395  GLN A CD    1 
ATOM   1457 O OE1   . GLN A 1 293 ? -20.372 72.005  -28.291 1.00 91.65  ? 395  GLN A OE1   1 
ATOM   1458 N NE2   . GLN A 1 293 ? -19.596 69.938  -27.933 1.00 89.52  ? 395  GLN A NE2   1 
ATOM   1459 N N     . VAL A 1 294 ? -19.786 75.469  -24.214 1.00 70.61  ? 396  VAL A N     1 
ATOM   1460 C CA    . VAL A 1 294 ? -19.355 76.837  -23.940 1.00 66.73  ? 396  VAL A CA    1 
ATOM   1461 C C     . VAL A 1 294 ? -19.420 77.249  -22.487 1.00 64.96  ? 396  VAL A C     1 
ATOM   1462 O O     . VAL A 1 294 ? -18.780 78.242  -22.142 1.00 66.65  ? 396  VAL A O     1 
ATOM   1463 C CB    . VAL A 1 294 ? -20.086 77.878  -24.749 1.00 73.84  ? 396  VAL A CB    1 
ATOM   1464 C CG1   . VAL A 1 294 ? -19.397 78.049  -26.054 1.00 74.80  ? 396  VAL A CG1   1 
ATOM   1465 C CG2   . VAL A 1 294 ? -21.527 77.491  -24.930 1.00 83.81  ? 396  VAL A CG2   1 
ATOM   1466 N N     . VAL A 1 295 ? -20.194 76.568  -21.635 1.00 53.47  ? 397  VAL A N     1 
ATOM   1467 C CA    . VAL A 1 295 ? -20.075 76.923  -20.216 1.00 52.20  ? 397  VAL A CA    1 
ATOM   1468 C C     . VAL A 1 295 ? -18.592 76.544  -19.914 1.00 53.68  ? 397  VAL A C     1 
ATOM   1469 O O     . VAL A 1 295 ? -17.836 77.331  -19.335 1.00 53.68  ? 397  VAL A O     1 
ATOM   1470 C CB    . VAL A 1 295 ? -20.975 76.091  -19.253 1.00 46.50  ? 397  VAL A CB    1 
ATOM   1471 C CG1   . VAL A 1 295 ? -20.652 76.441  -17.788 1.00 42.04  ? 397  VAL A CG1   1 
ATOM   1472 C CG2   . VAL A 1 295 ? -22.461 76.331  -19.518 1.00 48.06  ? 397  VAL A CG2   1 
ATOM   1473 N N     . ALA A 1 296 ? -18.154 75.361  -20.347 1.00 108.04 ? 398  ALA A N     1 
ATOM   1474 C CA    . ALA A 1 296 ? -16.775 74.934  -20.074 1.00 106.04 ? 398  ALA A CA    1 
ATOM   1475 C C     . ALA A 1 296 ? -15.694 75.520  -20.996 1.00 100.62 ? 398  ALA A C     1 
ATOM   1476 O O     . ALA A 1 296 ? -14.511 75.222  -20.848 1.00 105.63 ? 398  ALA A O     1 
ATOM   1477 C CB    . ALA A 1 296 ? -16.694 73.405  -20.013 1.00 160.98 ? 398  ALA A CB    1 
ATOM   1478 N N     . ILE A 1 297 ? -16.107 76.338  -21.960 1.00 35.30  ? 399  ILE A N     1 
ATOM   1479 C CA    . ILE A 1 297 ? -15.175 77.095  -22.804 1.00 29.38  ? 399  ILE A CA    1 
ATOM   1480 C C     . ILE A 1 297 ? -15.032 78.447  -22.106 1.00 31.24  ? 399  ILE A C     1 
ATOM   1481 O O     . ILE A 1 297 ? -14.209 79.207  -22.426 1.00 29.67  ? 399  ILE A O     1 
ATOM   1482 C CB    . ILE A 1 297 ? -15.756 77.413  -24.105 1.00 23.64  ? 399  ILE A CB    1 
ATOM   1483 C CG1   . ILE A 1 297 ? -15.174 76.466  -25.161 1.00 22.48  ? 399  ILE A CG1   1 
ATOM   1484 C CG2   . ILE A 1 297 ? -15.507 78.861  -24.408 1.00 21.53  ? 399  ILE A CG2   1 
ATOM   1485 C CD1   . ILE A 1 297 ? -15.755 76.678  -26.663 1.00 23.37  ? 399  ILE A CD1   1 
ATOM   1486 N N     . ALA A 1 298 ? -15.859 78.738  -21.124 1.00 65.72  ? 400  ALA A N     1 
ATOM   1487 C CA    . ALA A 1 298 ? -15.787 80.006  -20.418 1.00 67.09  ? 400  ALA A CA    1 
ATOM   1488 C C     . ALA A 1 298 ? -15.336 79.802  -18.992 1.00 67.14  ? 400  ALA A C     1 
ATOM   1489 O O     . ALA A 1 298 ? -15.109 80.782  -18.275 1.00 73.71  ? 400  ALA A O     1 
ATOM   1490 C CB    . ALA A 1 298 ? -17.140 80.700  -20.466 1.00 102.61 ? 400  ALA A CB    1 
ATOM   1491 N N     . SER A 1 299 ? -15.196 78.536  -18.590 1.00 57.31  ? 401  SER A N     1 
ATOM   1492 C CA    . SER A 1 299 ? -14.683 78.228  -17.269 1.00 55.41  ? 401  SER A CA    1 
ATOM   1493 C C     . SER A 1 299 ? -13.137 78.306  -17.090 1.00 49.46  ? 401  SER A C     1 
ATOM   1494 O O     . SER A 1 299 ? -12.574 77.467  -16.432 1.00 48.66  ? 401  SER A O     1 
ATOM   1495 C CB    . SER A 1 299 ? -15.240 76.882  -16.795 1.00 95.32  ? 401  SER A CB    1 
ATOM   1496 O OG    . SER A 1 299 ? -16.547 77.030  -16.251 1.00 102.91 ? 401  SER A OG    1 
ATOM   1497 N N     . HIS A 1 300 ? -12.484 79.294  -17.712 1.00 56.87  ? 402  HIS A N     1 
ATOM   1498 C CA    . HIS A 1 300 ? -11.045 79.600  -17.661 1.00 53.47  ? 402  HIS A CA    1 
ATOM   1499 C C     . HIS A 1 300 ? -10.716 81.139  -17.767 1.00 55.06  ? 402  HIS A C     1 
ATOM   1500 O O     . HIS A 1 300 ? -11.627 81.998  -17.886 1.00 58.16  ? 402  HIS A O     1 
ATOM   1501 C CB    . HIS A 1 300 ? -10.422 78.936  -18.839 1.00 53.79  ? 402  HIS A CB    1 
ATOM   1502 C CG    . HIS A 1 300 ? -10.781 77.495  -18.985 1.00 57.54  ? 402  HIS A CG    1 
ATOM   1503 N ND1   . HIS A 1 300 ? -10.331 76.511  -18.127 1.00 58.93  ? 402  HIS A ND1   1 
ATOM   1504 C CD2   . HIS A 1 300 ? -11.609 76.871  -19.856 1.00 59.97  ? 402  HIS A CD2   1 
ATOM   1505 C CE1   . HIS A 1 300 ? -10.873 75.357  -18.463 1.00 57.34  ? 402  HIS A CE1   1 
ATOM   1506 N NE2   . HIS A 1 300 ? -11.657 75.542  -19.511 1.00 58.45  ? 402  HIS A NE2   1 
ATOM   1507 N N     . GLY A 1 301 ? -9.433  81.505  -17.701 1.00 51.34  ? 403  GLY A N     1 
ATOM   1508 C CA    . GLY A 1 301 ? -9.047  82.901  -17.815 1.00 51.33  ? 403  GLY A CA    1 
ATOM   1509 C C     . GLY A 1 301 ? -8.819  83.225  -19.275 1.00 54.04  ? 403  GLY A C     1 
ATOM   1510 O O     . GLY A 1 301 ? -7.765  82.833  -19.860 1.00 50.87  ? 403  GLY A O     1 
ATOM   1511 N N     . GLY A 1 302 ? -9.787  83.950  -19.868 1.00 59.27  ? 404  GLY A N     1 
ATOM   1512 C CA    . GLY A 1 302 ? -9.714  84.332  -21.283 1.00 63.12  ? 404  GLY A CA    1 
ATOM   1513 C C     . GLY A 1 302 ? -11.026 84.104  -22.000 1.00 67.30  ? 404  GLY A C     1 
ATOM   1514 O O     . GLY A 1 302 ? -11.075 84.110  -23.243 1.00 68.40  ? 404  GLY A O     1 
ATOM   1515 N N     . GLY A 1 303 ? -12.077 83.897  -21.186 1.00 58.24  ? 405  GLY A N     1 
ATOM   1516 C CA    . GLY A 1 303 ? -13.434 83.633  -21.659 1.00 58.14  ? 405  GLY A CA    1 
ATOM   1517 C C     . GLY A 1 303 ? -13.811 84.455  -22.875 1.00 60.49  ? 405  GLY A C     1 
ATOM   1518 O O     . GLY A 1 303 ? -14.066 83.918  -23.948 1.00 63.16  ? 405  GLY A O     1 
ATOM   1519 N N     . LYS A 1 304 ? -13.906 85.763  -22.678 1.00 62.28  ? 406  LYS A N     1 
ATOM   1520 C CA    . LYS A 1 304 ? -14.175 86.702  -23.736 1.00 61.37  ? 406  LYS A CA    1 
ATOM   1521 C C     . LYS A 1 304 ? -13.332 86.236  -24.953 1.00 63.84  ? 406  LYS A C     1 
ATOM   1522 O O     . LYS A 1 304 ? -13.841 86.101  -26.066 1.00 73.17  ? 406  LYS A O     1 
ATOM   1523 C CB    . LYS A 1 304 ? -13.674 88.081  -23.285 1.00 54.72  ? 406  LYS A CB    1 
ATOM   1524 C CG    . LYS A 1 304 ? -14.604 89.235  -23.576 1.00 56.46  ? 406  LYS A CG    1 
ATOM   1525 C CD    . LYS A 1 304 ? -13.849 90.539  -23.988 1.00 58.78  ? 406  LYS A CD    1 
ATOM   1526 C CE    . LYS A 1 304 ? -13.199 90.389  -25.386 1.00 60.32  ? 406  LYS A CE    1 
ATOM   1527 N NZ    . LYS A 1 304 ? -12.596 91.646  -25.931 1.00 57.06  ? 406  LYS A NZ    1 
ATOM   1528 N N     . GLN A 1 305 ? -12.056 85.916  -24.733 1.00 56.00  ? 407  GLN A N     1 
ATOM   1529 C CA    . GLN A 1 305 ? -11.163 85.627  -25.838 1.00 55.89  ? 407  GLN A CA    1 
ATOM   1530 C C     . GLN A 1 305 ? -11.310 84.293  -26.477 1.00 57.76  ? 407  GLN A C     1 
ATOM   1531 O O     . GLN A 1 305 ? -10.893 84.078  -27.609 1.00 61.62  ? 407  GLN A O     1 
ATOM   1532 C CB    . GLN A 1 305 ? -9.706  85.911  -25.390 1.00 56.43  ? 407  GLN A CB    1 
ATOM   1533 C CG    . GLN A 1 305 ? -9.493  87.352  -24.875 1.00 56.38  ? 407  GLN A CG    1 
ATOM   1534 C CD    . GLN A 1 305 ? -10.108 88.411  -25.817 1.00 62.57  ? 407  GLN A CD    1 
ATOM   1535 O OE1   . GLN A 1 305 ? -11.286 88.330  -26.239 1.00 62.94  ? 407  GLN A OE1   1 
ATOM   1536 N NE2   . GLN A 1 305 ? -9.314  89.410  -26.138 1.00 63.44  ? 407  GLN A NE2   1 
ATOM   1537 N N     . ALA A 1 306 ? -11.934 83.383  -25.768 1.00 52.83  ? 408  ALA A N     1 
ATOM   1538 C CA    . ALA A 1 306 ? -12.082 82.029  -26.304 1.00 57.06  ? 408  ALA A CA    1 
ATOM   1539 C C     . ALA A 1 306 ? -13.284 81.891  -27.223 1.00 58.01  ? 408  ALA A C     1 
ATOM   1540 O O     . ALA A 1 306 ? -13.160 81.379  -28.320 1.00 56.77  ? 408  ALA A O     1 
ATOM   1541 C CB    . ALA A 1 306 ? -12.160 81.022  -25.150 1.00 113.88 ? 408  ALA A CB    1 
ATOM   1542 N N     . LEU A 1 307 ? -14.449 82.348  -26.786 1.00 58.55  ? 409  LEU A N     1 
ATOM   1543 C CA    . LEU A 1 307 ? -15.630 82.285  -27.644 1.00 61.63  ? 409  LEU A CA    1 
ATOM   1544 C C     . LEU A 1 307 ? -15.502 83.238  -28.850 1.00 66.69  ? 409  LEU A C     1 
ATOM   1545 O O     . LEU A 1 307 ? -16.007 82.927  -29.939 1.00 70.93  ? 409  LEU A O     1 
ATOM   1546 C CB    . LEU A 1 307 ? -16.890 82.628  -26.844 1.00 49.34  ? 409  LEU A CB    1 
ATOM   1547 C CG    . LEU A 1 307 ? -16.891 82.085  -25.408 1.00 45.21  ? 409  LEU A CG    1 
ATOM   1548 C CD1   . LEU A 1 307 ? -16.603 83.239  -24.534 1.00 44.22  ? 409  LEU A CD1   1 
ATOM   1549 C CD2   . LEU A 1 307 ? -18.243 81.458  -24.996 1.00 47.13  ? 409  LEU A CD2   1 
ATOM   1550 N N     . GLU A 1 308 ? -14.841 84.387  -28.665 1.00 66.60  ? 410  GLU A N     1 
ATOM   1551 C CA    . GLU A 1 308 ? -14.660 85.293  -29.782 1.00 73.52  ? 410  GLU A CA    1 
ATOM   1552 C C     . GLU A 1 308 ? -13.738 84.700  -30.860 1.00 72.99  ? 410  GLU A C     1 
ATOM   1553 O O     . GLU A 1 308 ? -13.830 85.125  -32.032 1.00 75.25  ? 410  GLU A O     1 
ATOM   1554 C CB    . GLU A 1 308 ? -14.139 86.655  -29.314 1.00 144.29 ? 410  GLU A CB    1 
ATOM   1555 C CG    . GLU A 1 308 ? -15.241 87.566  -28.735 1.00 148.37 ? 410  GLU A CG    1 
ATOM   1556 C CD    . GLU A 1 308 ? -14.814 89.023  -28.599 1.00 154.76 ? 410  GLU A CD    1 
ATOM   1557 O OE1   . GLU A 1 308 ? -15.048 89.578  -27.502 1.00 156.81 ? 410  GLU A OE1   1 
ATOM   1558 O OE2   . GLU A 1 308 ? -14.267 89.604  -29.577 1.00 156.80 ? 410  GLU A OE2   1 
ATOM   1559 N N     . THR A 1 309 ? -12.866 83.748  -30.468 1.00 77.51  ? 411  THR A N     1 
ATOM   1560 C CA    . THR A 1 309 ? -11.984 83.067  -31.417 1.00 76.97  ? 411  THR A CA    1 
ATOM   1561 C C     . THR A 1 309 ? -12.573 81.710  -31.794 1.00 79.65  ? 411  THR A C     1 
ATOM   1562 O O     . THR A 1 309 ? -12.097 81.043  -32.727 1.00 83.82  ? 411  THR A O     1 
ATOM   1563 C CB    . THR A 1 309 ? -10.585 82.875  -30.898 1.00 79.37  ? 411  THR A CB    1 
ATOM   1564 O OG1   . THR A 1 309 ? -10.327 83.847  -29.879 1.00 80.25  ? 411  THR A OG1   1 
ATOM   1565 C CG2   . THR A 1 309 ? -9.586  83.077  -32.061 1.00 83.56  ? 411  THR A CG2   1 
ATOM   1566 N N     . VAL A 1 310 ? -13.585 81.273  -31.051 1.00 75.45  ? 412  VAL A N     1 
ATOM   1567 C CA    . VAL A 1 310 ? -14.309 80.070  -31.438 1.00 74.66  ? 412  VAL A CA    1 
ATOM   1568 C C     . VAL A 1 310 ? -15.206 80.575  -32.606 1.00 78.80  ? 412  VAL A C     1 
ATOM   1569 O O     . VAL A 1 310 ? -14.987 80.235  -33.778 1.00 81.12  ? 412  VAL A O     1 
ATOM   1570 C CB    . VAL A 1 310 ? -15.200 79.534  -30.309 1.00 61.14  ? 412  VAL A CB    1 
ATOM   1571 C CG1   . VAL A 1 310 ? -16.502 78.995  -30.885 1.00 62.69  ? 412  VAL A CG1   1 
ATOM   1572 C CG2   . VAL A 1 310 ? -14.503 78.402  -29.602 1.00 58.43  ? 412  VAL A CG2   1 
ATOM   1573 N N     . GLN A 1 311 ? -16.179 81.432  -32.275 1.00 79.00  ? 413  GLN A N     1 
ATOM   1574 C CA    . GLN A 1 311 ? -17.149 82.006  -33.226 1.00 78.64  ? 413  GLN A CA    1 
ATOM   1575 C C     . GLN A 1 311 ? -16.493 82.484  -34.504 1.00 75.10  ? 413  GLN A C     1 
ATOM   1576 O O     . GLN A 1 311 ? -16.860 82.051  -35.569 1.00 71.16  ? 413  GLN A O     1 
ATOM   1577 C CB    . GLN A 1 311 ? -17.920 83.130  -32.524 1.00 96.62  ? 413  GLN A CB    1 
ATOM   1578 C CG    . GLN A 1 311 ? -19.205 83.536  -33.175 1.00 105.85 ? 413  GLN A CG    1 
ATOM   1579 C CD    . GLN A 1 311 ? -18.997 84.636  -34.182 1.00 107.88 ? 413  GLN A CD    1 
ATOM   1580 O OE1   . GLN A 1 311 ? -18.058 85.430  -34.047 1.00 108.88 ? 413  GLN A OE1   1 
ATOM   1581 N NE2   . GLN A 1 311 ? -19.882 84.712  -35.193 1.00 106.43 ? 413  GLN A NE2   1 
ATOM   1582 N N     . ARG A 1 312 ? -15.516 83.370  -34.386 1.00 69.63  ? 414  ARG A N     1 
ATOM   1583 C CA    . ARG A 1 312 ? -14.711 83.884  -35.517 1.00 75.08  ? 414  ARG A CA    1 
ATOM   1584 C C     . ARG A 1 312 ? -14.002 82.784  -36.348 1.00 81.12  ? 414  ARG A C     1 
ATOM   1585 O O     . ARG A 1 312 ? -14.408 82.510  -37.474 1.00 89.27  ? 414  ARG A O     1 
ATOM   1586 C CB    . ARG A 1 312 ? -13.614 84.843  -34.986 1.00 100.26 ? 414  ARG A CB    1 
ATOM   1587 C CG    . ARG A 1 312 ? -13.136 85.928  -35.929 1.00 107.02 ? 414  ARG A CG    1 
ATOM   1588 C CD    . ARG A 1 312 ? -13.779 87.297  -35.599 1.00 107.97 ? 414  ARG A CD    1 
ATOM   1589 N NE    . ARG A 1 312 ? -15.096 87.514  -36.219 1.00 115.75 ? 414  ARG A NE    1 
ATOM   1590 C CZ    . ARG A 1 312 ? -16.268 87.593  -35.570 1.00 115.91 ? 414  ARG A CZ    1 
ATOM   1591 N NH1   . ARG A 1 312 ? -16.349 87.482  -34.240 1.00 114.03 ? 414  ARG A NH1   1 
ATOM   1592 N NH2   . ARG A 1 312 ? -17.379 87.781  -36.271 1.00 117.02 ? 414  ARG A NH2   1 
ATOM   1593 N N     . LEU A 1 313 ? -12.975 82.148  -35.765 1.00 126.11 ? 415  LEU A N     1 
ATOM   1594 C CA    . LEU A 1 313 ? -12.109 81.151  -36.445 1.00 124.47 ? 415  LEU A CA    1 
ATOM   1595 C C     . LEU A 1 313 ? -12.624 79.737  -36.689 1.00 128.71 ? 415  LEU A C     1 
ATOM   1596 O O     . LEU A 1 313 ? -12.068 79.001  -37.510 1.00 131.46 ? 415  LEU A O     1 
ATOM   1597 C CB    . LEU A 1 313 ? -10.741 81.039  -35.705 1.00 93.23  ? 415  LEU A CB    1 
ATOM   1598 C CG    . LEU A 1 313 ? -9.301  81.148  -36.317 1.00 90.25  ? 415  LEU A CG    1 
ATOM   1599 C CD1   . LEU A 1 313 ? -9.229  80.454  -37.692 1.00 88.05  ? 415  LEU A CD1   1 
ATOM   1600 C CD2   . LEU A 1 313 ? -8.853  82.621  -36.476 1.00 92.22  ? 415  LEU A CD2   1 
ATOM   1601 N N     . LEU A 1 314 ? -13.681 79.372  -35.978 1.00 112.27 ? 416  LEU A N     1 
ATOM   1602 C CA    . LEU A 1 314 ? -14.259 78.037  -36.069 1.00 116.35 ? 416  LEU A CA    1 
ATOM   1603 C C     . LEU A 1 314 ? -14.357 77.358  -37.466 1.00 125.30 ? 416  LEU A C     1 
ATOM   1604 O O     . LEU A 1 314 ? -14.030 76.165  -37.581 1.00 132.98 ? 416  LEU A O     1 
ATOM   1605 C CB    . LEU A 1 314 ? -15.635 78.029  -35.338 1.00 74.90  ? 416  LEU A CB    1 
ATOM   1606 C CG    . LEU A 1 314 ? -16.599 76.816  -35.239 1.00 71.44  ? 416  LEU A CG    1 
ATOM   1607 C CD1   . LEU A 1 314 ? -16.259 75.870  -34.087 1.00 68.75  ? 416  LEU A CD1   1 
ATOM   1608 C CD2   . LEU A 1 314 ? -17.986 77.382  -35.050 1.00 73.08  ? 416  LEU A CD2   1 
ATOM   1609 N N     . PRO A 1 315 ? -14.797 78.083  -38.529 1.00 131.15 ? 417  PRO A N     1 
ATOM   1610 C CA    . PRO A 1 315 ? -14.884 77.414  -39.828 1.00 131.06 ? 417  PRO A CA    1 
ATOM   1611 C C     . PRO A 1 315 ? -13.576 77.117  -40.535 1.00 134.11 ? 417  PRO A C     1 
ATOM   1612 O O     . PRO A 1 315 ? -13.354 75.971  -40.915 1.00 147.20 ? 417  PRO A O     1 
ATOM   1613 C CB    . PRO A 1 315 ? -15.761 78.340  -40.648 1.00 109.08 ? 417  PRO A CB    1 
ATOM   1614 C CG    . PRO A 1 315 ? -15.515 79.678  -40.080 1.00 110.94 ? 417  PRO A CG    1 
ATOM   1615 C CD    . PRO A 1 315 ? -15.362 79.444  -38.602 1.00 110.19 ? 417  PRO A CD    1 
ATOM   1616 N N     . VAL A 1 316 ? -12.718 78.125  -40.715 1.00 85.92  ? 418  VAL A N     1 
ATOM   1617 C CA    . VAL A 1 316 ? -11.428 77.936  -41.400 1.00 83.77  ? 418  VAL A CA    1 
ATOM   1618 C C     . VAL A 1 316 ? -10.898 76.518  -41.209 1.00 90.36  ? 418  VAL A C     1 
ATOM   1619 O O     . VAL A 1 316 ? -10.576 75.825  -42.194 1.00 94.24  ? 418  VAL A O     1 
ATOM   1620 C CB    . VAL A 1 316 ? -10.388 78.968  -40.930 1.00 71.88  ? 418  VAL A CB    1 
ATOM   1621 C CG1   . VAL A 1 316 ? -9.009  78.574  -41.375 1.00 70.73  ? 418  VAL A CG1   1 
ATOM   1622 C CG2   . VAL A 1 316 ? -10.750 80.365  -41.527 1.00 71.44  ? 418  VAL A CG2   1 
ATOM   1623 N N     . LEU A 1 317 ? -10.837 76.087  -39.944 1.00 87.51  ? 419  LEU A N     1 
ATOM   1624 C CA    . LEU A 1 317 ? -10.436 74.722  -39.581 1.00 84.92  ? 419  LEU A CA    1 
ATOM   1625 C C     . LEU A 1 317 ? -11.553 73.731  -39.997 1.00 94.19  ? 419  LEU A C     1 
ATOM   1626 O O     . LEU A 1 317 ? -11.347 72.955  -40.920 1.00 98.50  ? 419  LEU A O     1 
ATOM   1627 C CB    . LEU A 1 317 ? -10.182 74.608  -38.067 1.00 72.15  ? 419  LEU A CB    1 
ATOM   1628 C CG    . LEU A 1 317 ? -10.331 75.872  -37.196 1.00 69.68  ? 419  LEU A CG    1 
ATOM   1629 C CD1   . LEU A 1 317 ? -11.336 75.597  -36.086 1.00 63.14  ? 419  LEU A CD1   1 
ATOM   1630 C CD2   . LEU A 1 317 ? -8.946  76.340  -36.634 1.00 62.64  ? 419  LEU A CD2   1 
ATOM   1631 N N     . CYS A 1 318 ? -12.726 73.758  -39.337 1.00 127.73 ? 420  CYS A N     1 
ATOM   1632 C CA    . CYS A 1 318 ? -13.844 72.848  -39.677 1.00 129.79 ? 420  CYS A CA    1 
ATOM   1633 C C     . CYS A 1 318 ? -14.109 72.762  -41.187 1.00 133.39 ? 420  CYS A C     1 
ATOM   1634 O O     . CYS A 1 318 ? -14.773 71.837  -41.662 1.00 138.73 ? 420  CYS A O     1 
ATOM   1635 C CB    . CYS A 1 318 ? -15.122 73.241  -38.917 1.00 83.91  ? 420  CYS A CB    1 
ATOM   1636 S SG    . CYS A 1 318 ? -15.187 72.650  -37.196 1.00 82.96  ? 420  CYS A SG    1 
ATOM   1637 N N     . GLN A 1 319 ? -13.574 73.738  -41.924 1.00 101.65 ? 421  GLN A N     1 
ATOM   1638 C CA    . GLN A 1 319 ? -13.622 73.782  -43.378 1.00 94.17  ? 421  GLN A CA    1 
ATOM   1639 C C     . GLN A 1 319 ? -12.477 72.979  -44.001 1.00 95.51  ? 421  GLN A C     1 
ATOM   1640 O O     . GLN A 1 319 ? -12.687 71.884  -44.533 1.00 96.17  ? 421  GLN A O     1 
ATOM   1641 C CB    . GLN A 1 319 ? -13.454 75.202  -43.900 1.00 122.27 ? 421  GLN A CB    1 
ATOM   1642 C CG    . GLN A 1 319 ? -14.558 75.628  -44.828 1.00 124.81 ? 421  GLN A CG    1 
ATOM   1643 C CD    . GLN A 1 319 ? -14.047 76.380  -46.050 1.00 126.48 ? 421  GLN A CD    1 
ATOM   1644 O OE1   . GLN A 1 319 ? -12.902 76.188  -46.504 1.00 126.96 ? 421  GLN A OE1   1 
ATOM   1645 N NE2   . GLN A 1 319 ? -14.906 77.228  -46.605 1.00 125.05 ? 421  GLN A NE2   1 
ATOM   1646 N N     . ALA A 1 320 ? -11.271 73.555  -43.977 1.00 143.49 ? 422  ALA A N     1 
ATOM   1647 C CA    . ALA A 1 320 ? -10.099 72.951  -44.609 1.00 144.32 ? 422  ALA A CA    1 
ATOM   1648 C C     . ALA A 1 320 ? -9.130  72.313  -43.641 1.00 144.95 ? 422  ALA A C     1 
ATOM   1649 O O     . ALA A 1 320 ? -7.954  72.126  -43.954 1.00 152.66 ? 422  ALA A O     1 
ATOM   1650 C CB    . ALA A 1 320 ? -9.383  73.984  -45.522 1.00 62.81  ? 422  ALA A CB    1 
ATOM   1651 N N     . HIS A 1 321 ? -9.630  72.038  -42.439 1.00 98.47  ? 423  HIS A N     1 
ATOM   1652 C CA    . HIS A 1 321 ? -8.875  71.280  -41.424 1.00 90.34  ? 423  HIS A CA    1 
ATOM   1653 C C     . HIS A 1 321 ? -9.910  70.298  -40.896 1.00 87.00  ? 423  HIS A C     1 
ATOM   1654 O O     . HIS A 1 321 ? -9.580  69.240  -40.383 1.00 86.38  ? 423  HIS A O     1 
ATOM   1655 C CB    . HIS A 1 321 ? -8.293  72.138  -40.283 1.00 115.04 ? 423  HIS A CB    1 
ATOM   1656 C CG    . HIS A 1 321 ? -7.430  73.291  -40.736 1.00 112.28 ? 423  HIS A CG    1 
ATOM   1657 N ND1   . HIS A 1 321 ? -6.651  73.264  -41.884 1.00 113.53 ? 423  HIS A ND1   1 
ATOM   1658 C CD2   . HIS A 1 321 ? -7.211  74.504  -40.173 1.00 107.10 ? 423  HIS A CD2   1 
ATOM   1659 C CE1   . HIS A 1 321 ? -6.009  74.409  -41.997 1.00 108.80 ? 423  HIS A CE1   1 
ATOM   1660 N NE2   . HIS A 1 321 ? -6.330  75.182  -40.971 1.00 108.43 ? 423  HIS A NE2   1 
ATOM   1661 N N     . GLY A 1 322 ? -11.173 70.683  -41.039 1.00 115.13 ? 424  GLY A N     1 
ATOM   1662 C CA    . GLY A 1 322 ? -12.304 69.832  -40.719 1.00 122.51 ? 424  GLY A CA    1 
ATOM   1663 C C     . GLY A 1 322 ? -12.504 69.200  -39.365 1.00 119.79 ? 424  GLY A C     1 
ATOM   1664 O O     . GLY A 1 322 ? -13.209 68.186  -39.237 1.00 114.43 ? 424  GLY A O     1 
ATOM   1665 N N     . LEU A 1 323 ? -11.908 69.800  -38.345 1.00 79.28  ? 425  LEU A N     1 
ATOM   1666 C CA    . LEU A 1 323 ? -12.056 69.271  -36.997 1.00 65.41  ? 425  LEU A CA    1 
ATOM   1667 C C     . LEU A 1 323 ? -13.503 69.244  -36.619 1.00 59.50  ? 425  LEU A C     1 
ATOM   1668 O O     . LEU A 1 323 ? -14.307 70.038  -37.073 1.00 60.23  ? 425  LEU A O     1 
ATOM   1669 C CB    . LEU A 1 323 ? -11.290 70.136  -35.988 1.00 97.62  ? 425  LEU A CB    1 
ATOM   1670 C CG    . LEU A 1 323 ? -9.769  69.995  -35.969 1.00 98.99  ? 425  LEU A CG    1 
ATOM   1671 C CD1   . LEU A 1 323 ? -9.296  70.465  -34.628 1.00 93.72  ? 425  LEU A CD1   1 
ATOM   1672 C CD2   . LEU A 1 323 ? -9.348  68.518  -36.171 1.00 97.24  ? 425  LEU A CD2   1 
ATOM   1673 N N     . THR A 1 324 ? -13.831 68.318  -35.755 1.00 63.70  ? 426  THR A N     1 
ATOM   1674 C CA    . THR A 1 324 ? -15.201 68.193  -35.292 1.00 65.27  ? 426  THR A CA    1 
ATOM   1675 C C     . THR A 1 324 ? -15.643 69.440  -34.495 1.00 66.70  ? 426  THR A C     1 
ATOM   1676 O O     . THR A 1 324 ? -14.918 70.457  -34.420 1.00 62.28  ? 426  THR A O     1 
ATOM   1677 C CB    . THR A 1 324 ? -15.343 67.022  -34.316 1.00 93.39  ? 426  THR A CB    1 
ATOM   1678 O OG1   . THR A 1 324 ? -14.928 67.464  -33.017 1.00 94.88  ? 426  THR A OG1   1 
ATOM   1679 C CG2   . THR A 1 324 ? -14.449 65.877  -34.730 1.00 92.78  ? 426  THR A CG2   1 
ATOM   1680 N N     . PRO A 1 325 ? -16.896 69.403  -33.982 1.00 91.75  ? 427  PRO A N     1 
ATOM   1681 C CA    . PRO A 1 325 ? -17.200 70.565  -33.164 1.00 91.17  ? 427  PRO A CA    1 
ATOM   1682 C C     . PRO A 1 325 ? -16.293 70.405  -31.910 1.00 87.12  ? 427  PRO A C     1 
ATOM   1683 O O     . PRO A 1 325 ? -15.341 71.167  -31.714 1.00 82.01  ? 427  PRO A O     1 
ATOM   1684 C CB    . PRO A 1 325 ? -18.640 70.340  -32.741 1.00 82.60  ? 427  PRO A CB    1 
ATOM   1685 C CG    . PRO A 1 325 ? -19.248 69.584  -33.857 1.00 81.55  ? 427  PRO A CG    1 
ATOM   1686 C CD    . PRO A 1 325 ? -18.138 68.718  -34.425 1.00 80.07  ? 427  PRO A CD    1 
ATOM   1687 N N     . ASP A 1 326 ? -16.562 69.366  -31.106 1.00 110.20 ? 428  ASP A N     1 
ATOM   1688 C CA    . ASP A 1 326 ? -15.881 69.162  -29.810 1.00 107.44 ? 428  ASP A CA    1 
ATOM   1689 C C     . ASP A 1 326 ? -14.373 69.184  -29.752 1.00 102.74 ? 428  ASP A C     1 
ATOM   1690 O O     . ASP A 1 326 ? -13.809 69.348  -28.660 1.00 97.38  ? 428  ASP A O     1 
ATOM   1691 C CB    . ASP A 1 326 ? -16.437 67.919  -29.051 1.00 159.16 ? 428  ASP A CB    1 
ATOM   1692 C CG    . ASP A 1 326 ? -16.648 66.718  -29.944 1.00 165.25 ? 428  ASP A CG    1 
ATOM   1693 O OD1   . ASP A 1 326 ? -17.516 65.879  -29.634 1.00 168.66 ? 428  ASP A OD1   1 
ATOM   1694 O OD2   . ASP A 1 326 ? -15.938 66.605  -30.956 1.00 168.67 ? 428  ASP A OD2   1 
ATOM   1695 N N     . GLN A 1 327 ? -13.739 69.055  -30.920 1.00 76.73  ? 429  GLN A N     1 
ATOM   1696 C CA    . GLN A 1 327 ? -12.285 69.080  -31.031 1.00 69.53  ? 429  GLN A CA    1 
ATOM   1697 C C     . GLN A 1 327 ? -11.837 70.524  -30.934 1.00 65.92  ? 429  GLN A C     1 
ATOM   1698 O O     . GLN A 1 327 ? -11.106 70.920  -30.000 1.00 61.11  ? 429  GLN A O     1 
ATOM   1699 C CB    . GLN A 1 327 ? -11.827 68.450  -32.348 1.00 88.41  ? 429  GLN A CB    1 
ATOM   1700 C CG    . GLN A 1 327 ? -11.719 66.940  -32.228 1.00 89.96  ? 429  GLN A CG    1 
ATOM   1701 C CD    . GLN A 1 327 ? -11.156 66.270  -33.464 1.00 93.74  ? 429  GLN A CD    1 
ATOM   1702 O OE1   . GLN A 1 327 ? -10.505 66.915  -34.325 1.00 90.24  ? 429  GLN A OE1   1 
ATOM   1703 N NE2   . GLN A 1 327 ? -11.380 64.949  -33.554 1.00 100.93 ? 429  GLN A NE2   1 
ATOM   1704 N N     . VAL A 1 328 ? -12.233 71.328  -31.904 1.00 69.79  ? 430  VAL A N     1 
ATOM   1705 C CA    . VAL A 1 328 ? -11.900 72.731  -31.793 1.00 68.07  ? 430  VAL A CA    1 
ATOM   1706 C C     . VAL A 1 328 ? -12.358 73.129  -30.376 1.00 64.31  ? 430  VAL A C     1 
ATOM   1707 O O     . VAL A 1 328 ? -11.605 73.700  -29.604 1.00 63.87  ? 430  VAL A O     1 
ATOM   1708 C CB    . VAL A 1 328 ? -12.685 73.572  -32.812 1.00 82.19  ? 430  VAL A CB    1 
ATOM   1709 C CG1   . VAL A 1 328 ? -12.370 75.092  -32.623 1.00 82.80  ? 430  VAL A CG1   1 
ATOM   1710 C CG2   . VAL A 1 328 ? -12.365 73.097  -34.224 1.00 85.34  ? 430  VAL A CG2   1 
ATOM   1711 N N     . VAL A 1 329 ? -13.596 72.809  -30.040 1.00 48.43  ? 431  VAL A N     1 
ATOM   1712 C CA    . VAL A 1 329 ? -14.093 73.160  -28.743 1.00 46.55  ? 431  VAL A CA    1 
ATOM   1713 C C     . VAL A 1 329 ? -13.103 72.915  -27.631 1.00 43.94  ? 431  VAL A C     1 
ATOM   1714 O O     . VAL A 1 329 ? -12.754 73.856  -26.985 1.00 41.56  ? 431  VAL A O     1 
ATOM   1715 C CB    . VAL A 1 329 ? -15.388 72.449  -28.407 1.00 62.84  ? 431  VAL A CB    1 
ATOM   1716 C CG1   . VAL A 1 329 ? -15.631 72.470  -26.871 1.00 61.03  ? 431  VAL A CG1   1 
ATOM   1717 C CG2   . VAL A 1 329 ? -16.529 73.126  -29.158 1.00 64.17  ? 431  VAL A CG2   1 
ATOM   1718 N N     . ALA A 1 330 ? -12.639 71.684  -27.408 1.00 59.39  ? 432  ALA A N     1 
ATOM   1719 C CA    . ALA A 1 330 ? -11.698 71.352  -26.317 1.00 54.95  ? 432  ALA A CA    1 
ATOM   1720 C C     . ALA A 1 330 ? -10.314 71.924  -26.458 1.00 51.63  ? 432  ALA A C     1 
ATOM   1721 O O     . ALA A 1 330 ? -9.589  71.976  -25.505 1.00 49.39  ? 432  ALA A O     1 
ATOM   1722 C CB    . ALA A 1 330 ? -11.636 69.823  -26.087 1.00 95.36  ? 432  ALA A CB    1 
ATOM   1723 N N     . ILE A 1 331 ? -9.930  72.337  -27.652 1.00 43.04  ? 433  ILE A N     1 
ATOM   1724 C CA    . ILE A 1 331 ? -8.658  73.051  -27.803 1.00 43.68  ? 433  ILE A CA    1 
ATOM   1725 C C     . ILE A 1 331 ? -8.913  74.385  -27.121 1.00 43.41  ? 433  ILE A C     1 
ATOM   1726 O O     . ILE A 1 331 ? -8.025  75.027  -26.683 1.00 43.44  ? 433  ILE A O     1 
ATOM   1727 C CB    . ILE A 1 331 ? -8.346  73.450  -29.256 1.00 55.55  ? 433  ILE A CB    1 
ATOM   1728 C CG1   . ILE A 1 331 ? -7.745  72.300  -30.037 1.00 57.27  ? 433  ILE A CG1   1 
ATOM   1729 C CG2   . ILE A 1 331 ? -7.429  74.618  -29.277 1.00 54.39  ? 433  ILE A CG2   1 
ATOM   1730 C CD1   . ILE A 1 331 ? -7.612  72.627  -31.541 1.00 57.79  ? 433  ILE A CD1   1 
ATOM   1731 N N     . ALA A 1 332 ? -10.156 74.804  -27.032 1.00 74.85  ? 434  ALA A N     1 
ATOM   1732 C CA    . ALA A 1 332 ? -10.494 76.123  -26.511 1.00 76.83  ? 434  ALA A CA    1 
ATOM   1733 C C     . ALA A 1 332 ? -10.797 76.226  -25.051 1.00 75.64  ? 434  ALA A C     1 
ATOM   1734 O O     . ALA A 1 332 ? -10.733 77.323  -24.515 1.00 81.75  ? 434  ALA A O     1 
ATOM   1735 C CB    . ALA A 1 332 ? -11.674 76.714  -27.340 1.00 104.94 ? 434  ALA A CB    1 
ATOM   1736 N N     . SER A 1 333 ? -11.119 75.109  -24.407 1.00 55.39  ? 435  SER A N     1 
ATOM   1737 C CA    . SER A 1 333 ? -11.446 75.132  -22.987 1.00 53.64  ? 435  SER A CA    1 
ATOM   1738 C C     . SER A 1 333 ? -10.239 75.079  -22.008 1.00 52.91  ? 435  SER A C     1 
ATOM   1739 O O     . SER A 1 333 ? -10.166 74.171  -21.131 1.00 50.89  ? 435  SER A O     1 
ATOM   1740 C CB    . SER A 1 333 ? -12.395 74.012  -22.658 1.00 50.21  ? 435  SER A CB    1 
ATOM   1741 O OG    . SER A 1 333 ? -12.876 73.418  -23.846 1.00 54.18  ? 435  SER A OG    1 
ATOM   1742 N N     . HIS A 1 334 ? -9.336  76.070  -22.154 1.00 55.81  ? 436  HIS A N     1 
ATOM   1743 C CA    . HIS A 1 334 ? -8.125  76.221  -21.344 1.00 53.59  ? 436  HIS A CA    1 
ATOM   1744 C C     . HIS A 1 334 ? -7.706  77.698  -21.306 1.00 54.36  ? 436  HIS A C     1 
ATOM   1745 O O     . HIS A 1 334 ? -8.159  78.500  -22.072 1.00 55.04  ? 436  HIS A O     1 
ATOM   1746 C CB    . HIS A 1 334 ? -6.954  75.400  -21.933 1.00 47.85  ? 436  HIS A CB    1 
ATOM   1747 C CG    . HIS A 1 334 ? -7.217  73.923  -22.054 1.00 50.11  ? 436  HIS A CG    1 
ATOM   1748 N ND1   . HIS A 1 334 ? -7.093  73.032  -20.998 1.00 50.18  ? 436  HIS A ND1   1 
ATOM   1749 C CD2   . HIS A 1 334 ? -7.534  73.165  -23.129 1.00 52.03  ? 436  HIS A CD2   1 
ATOM   1750 C CE1   . HIS A 1 334 ? -7.318  71.802  -21.422 1.00 50.40  ? 436  HIS A CE1   1 
ATOM   1751 N NE2   . HIS A 1 334 ? -7.589  71.850  -22.715 1.00 51.45  ? 436  HIS A NE2   1 
ATOM   1752 N N     . ASP A 1 335 ? -6.807  78.045  -20.403 1.00 52.96  ? 437  ASP A N     1 
ATOM   1753 C CA    . ASP A 1 335 ? -6.279  79.397  -20.293 1.00 50.76  ? 437  ASP A CA    1 
ATOM   1754 C C     . ASP A 1 335 ? -5.481  79.705  -21.568 1.00 51.16  ? 437  ASP A C     1 
ATOM   1755 O O     . ASP A 1 335 ? -4.660  78.915  -22.112 1.00 50.03  ? 437  ASP A O     1 
ATOM   1756 C CB    . ASP A 1 335 ? -5.379  79.505  -19.036 1.00 41.07  ? 437  ASP A CB    1 
ATOM   1757 C CG    . ASP A 1 335 ? -6.191  79.444  -17.735 1.00 43.98  ? 437  ASP A CG    1 
ATOM   1758 O OD1   . ASP A 1 335 ? -7.402  79.139  -17.789 1.00 44.06  ? 437  ASP A OD1   1 
ATOM   1759 O OD2   . ASP A 1 335 ? -5.647  79.715  -16.643 1.00 46.04  ? 437  ASP A OD2   1 
ATOM   1760 N N     . GLY A 1 336 ? -5.712  80.896  -22.061 1.00 53.12  ? 438  GLY A N     1 
ATOM   1761 C CA    . GLY A 1 336 ? -5.024  81.284  -23.269 1.00 54.86  ? 438  GLY A CA    1 
ATOM   1762 C C     . GLY A 1 336 ? -5.517  80.303  -24.284 1.00 57.65  ? 438  GLY A C     1 
ATOM   1763 O O     . GLY A 1 336 ? -4.753  79.519  -24.859 1.00 60.18  ? 438  GLY A O     1 
ATOM   1764 N N     . GLY A 1 337 ? -6.832  80.290  -24.414 1.00 47.47  ? 439  GLY A N     1 
ATOM   1765 C CA    . GLY A 1 337 ? -7.476  79.451  -25.398 1.00 50.88  ? 439  GLY A CA    1 
ATOM   1766 C C     . GLY A 1 337 ? -7.212  80.021  -26.804 1.00 55.62  ? 439  GLY A C     1 
ATOM   1767 O O     . GLY A 1 337 ? -6.781  79.310  -27.704 1.00 61.59  ? 439  GLY A O     1 
ATOM   1768 N N     . LYS A 1 338 ? -7.465  81.305  -27.006 1.00 45.50  ? 440  LYS A N     1 
ATOM   1769 C CA    . LYS A 1 338 ? -7.250  81.941  -28.296 1.00 47.55  ? 440  LYS A CA    1 
ATOM   1770 C C     . LYS A 1 338 ? -5.994  81.482  -29.044 1.00 51.18  ? 440  LYS A C     1 
ATOM   1771 O O     . LYS A 1 338 ? -6.107  80.890  -30.139 1.00 57.73  ? 440  LYS A O     1 
ATOM   1772 C CB    . LYS A 1 338 ? -7.216  83.473  -28.136 1.00 69.38  ? 440  LYS A CB    1 
ATOM   1773 C CG    . LYS A 1 338 ? -6.650  84.228  -29.336 1.00 71.85  ? 440  LYS A CG    1 
ATOM   1774 C CD    . LYS A 1 338 ? -6.231  85.679  -28.998 1.00 73.70  ? 440  LYS A CD    1 
ATOM   1775 C CE    . LYS A 1 338 ? -7.387  86.716  -29.104 1.00 75.99  ? 440  LYS A CE    1 
ATOM   1776 N NZ    . LYS A 1 338 ? -8.629  86.352  -28.350 1.00 77.34  ? 440  LYS A NZ    1 
ATOM   1777 N N     . GLN A 1 339 ? -4.819  81.713  -28.462 1.00 63.93  ? 441  GLN A N     1 
ATOM   1778 C CA    . GLN A 1 339 ? -3.573  81.387  -29.153 1.00 65.72  ? 441  GLN A CA    1 
ATOM   1779 C C     . GLN A 1 339 ? -3.348  79.923  -29.397 1.00 65.18  ? 441  GLN A C     1 
ATOM   1780 O O     . GLN A 1 339 ? -2.462  79.560  -30.176 1.00 67.72  ? 441  GLN A O     1 
ATOM   1781 C CB    . GLN A 1 339 ? -2.348  81.973  -28.450 1.00 65.04  ? 441  GLN A CB    1 
ATOM   1782 C CG    . GLN A 1 339 ? -2.675  82.913  -27.304 1.00 60.78  ? 441  GLN A CG    1 
ATOM   1783 C CD    . GLN A 1 339 ? -2.796  84.341  -27.724 1.00 60.01  ? 441  GLN A CD    1 
ATOM   1784 O OE1   . GLN A 1 339 ? -1.907  84.869  -28.374 1.00 62.70  ? 441  GLN A OE1   1 
ATOM   1785 N NE2   . GLN A 1 339 ? -3.889  84.988  -27.336 1.00 56.47  ? 441  GLN A NE2   1 
ATOM   1786 N N     . ALA A 1 340 ? -4.114  79.078  -28.715 1.00 76.55  ? 442  ALA A N     1 
ATOM   1787 C CA    . ALA A 1 340 ? -4.059  77.641  -28.985 1.00 81.04  ? 442  ALA A CA    1 
ATOM   1788 C C     . ALA A 1 340 ? -4.699  77.520  -30.373 1.00 84.74  ? 442  ALA A C     1 
ATOM   1789 O O     . ALA A 1 340 ? -4.047  77.089  -31.320 1.00 93.91  ? 442  ALA A O     1 
ATOM   1790 C CB    . ALA A 1 340 ? -4.876  76.881  -27.990 1.00 196.48 ? 442  ALA A CB    1 
ATOM   1791 N N     . LEU A 1 341 ? -5.970  77.919  -30.494 1.00 51.44  ? 443  LEU A N     1 
ATOM   1792 C CA    . LEU A 1 341 ? -6.703  77.911  -31.779 1.00 48.93  ? 443  LEU A CA    1 
ATOM   1793 C C     . LEU A 1 341 ? -5.970  78.707  -32.862 1.00 49.92  ? 443  LEU A C     1 
ATOM   1794 O O     . LEU A 1 341 ? -5.782  78.204  -33.943 1.00 52.55  ? 443  LEU A O     1 
ATOM   1795 C CB    . LEU A 1 341 ? -8.125  78.465  -31.623 1.00 46.78  ? 443  LEU A CB    1 
ATOM   1796 C CG    . LEU A 1 341 ? -9.169  77.717  -30.726 1.00 43.68  ? 443  LEU A CG    1 
ATOM   1797 C CD1   . LEU A 1 341 ? -10.523 78.535  -30.594 1.00 41.60  ? 443  LEU A CD1   1 
ATOM   1798 C CD2   . LEU A 1 341 ? -9.483  76.367  -31.265 1.00 40.36  ? 443  LEU A CD2   1 
ATOM   1799 N N     . GLU A 1 342 ? -5.514  79.921  -32.582 1.00 57.35  ? 444  GLU A N     1 
ATOM   1800 C CA    . GLU A 1 342 ? -4.833  80.678  -33.630 1.00 63.99  ? 444  GLU A CA    1 
ATOM   1801 C C     . GLU A 1 342 ? -3.560  80.026  -34.158 1.00 65.41  ? 444  GLU A C     1 
ATOM   1802 O O     . GLU A 1 342 ? -3.226  80.164  -35.328 1.00 68.51  ? 444  GLU A O     1 
ATOM   1803 C CB    . GLU A 1 342 ? -4.492  82.078  -33.161 1.00 112.79 ? 444  GLU A CB    1 
ATOM   1804 C CG    . GLU A 1 342 ? -5.700  82.947  -32.917 1.00 122.10 ? 444  GLU A CG    1 
ATOM   1805 C CD    . GLU A 1 342 ? -5.355  84.428  -32.778 1.00 131.53 ? 444  GLU A CD    1 
ATOM   1806 O OE1   . GLU A 1 342 ? -4.155  84.775  -32.654 1.00 135.97 ? 444  GLU A OE1   1 
ATOM   1807 O OE2   . GLU A 1 342 ? -6.303  85.244  -32.786 1.00 137.93 ? 444  GLU A OE2   1 
ATOM   1808 N N     . THR A 1 343 ? -2.838  79.318  -33.305 1.00 65.92  ? 445  THR A N     1 
ATOM   1809 C CA    . THR A 1 343 ? -1.614  78.697  -33.771 1.00 67.65  ? 445  THR A CA    1 
ATOM   1810 C C     . THR A 1 343 ? -1.946  77.362  -34.471 1.00 66.56  ? 445  THR A C     1 
ATOM   1811 O O     . THR A 1 343 ? -1.113  76.736  -35.134 1.00 65.04  ? 445  THR A O     1 
ATOM   1812 C CB    . THR A 1 343 ? -0.585  78.603  -32.617 1.00 122.84 ? 445  THR A CB    1 
ATOM   1813 O OG1   . THR A 1 343 ? -0.531  79.876  -31.964 1.00 126.39 ? 445  THR A OG1   1 
ATOM   1814 C CG2   . THR A 1 343 ? 0.824   78.341  -33.165 1.00 123.36 ? 445  THR A CG2   1 
ATOM   1815 N N     . VAL A 1 344 ? -3.198  76.955  -34.352 1.00 68.44  ? 446  VAL A N     1 
ATOM   1816 C CA    . VAL A 1 344 ? -3.654  75.773  -35.065 1.00 72.58  ? 446  VAL A CA    1 
ATOM   1817 C C     . VAL A 1 344 ? -3.780  76.238  -36.547 1.00 79.45  ? 446  VAL A C     1 
ATOM   1818 O O     . VAL A 1 344 ? -3.021  75.802  -37.407 1.00 84.86  ? 446  VAL A O     1 
ATOM   1819 C CB    . VAL A 1 344 ? -5.036  75.295  -34.544 1.00 89.50  ? 446  VAL A CB    1 
ATOM   1820 C CG1   . VAL A 1 344 ? -5.675  74.333  -35.528 1.00 89.20  ? 446  VAL A CG1   1 
ATOM   1821 C CG2   . VAL A 1 344 ? -4.859  74.641  -33.163 1.00 85.95  ? 446  VAL A CG2   1 
ATOM   1822 N N     . GLN A 1 345 ? -4.739  77.130  -36.835 1.00 90.87  ? 447  GLN A N     1 
ATOM   1823 C CA    . GLN A 1 345 ? -4.970  77.690  -38.173 1.00 87.41  ? 447  GLN A CA    1 
ATOM   1824 C C     . GLN A 1 345 ? -3.634  78.031  -38.802 1.00 87.38  ? 447  GLN A C     1 
ATOM   1825 O O     . GLN A 1 345 ? -3.381  77.684  -39.933 1.00 93.33  ? 447  GLN A O     1 
ATOM   1826 C CB    . GLN A 1 345 ? -5.860  78.939  -38.042 1.00 95.55  ? 447  GLN A CB    1 
ATOM   1827 C CG    . GLN A 1 345 ? -5.834  79.924  -39.202 1.00 100.27 ? 447  GLN A CG    1 
ATOM   1828 C CD    . GLN A 1 345 ? -5.003  81.175  -38.900 1.00 101.88 ? 447  GLN A CD    1 
ATOM   1829 O OE1   . GLN A 1 345 ? -5.074  81.738  -37.805 1.00 103.86 ? 447  GLN A OE1   1 
ATOM   1830 N NE2   . GLN A 1 345 ? -4.232  81.626  -39.882 1.00 101.27 ? 447  GLN A NE2   1 
ATOM   1831 N N     . ARG A 1 346 ? -2.770  78.689  -38.041 1.00 54.16  ? 448  ARG A N     1 
ATOM   1832 C CA    . ARG A 1 346 ? -1.456  79.103  -38.512 1.00 55.42  ? 448  ARG A CA    1 
ATOM   1833 C C     . ARG A 1 346 ? -0.586  77.914  -38.777 1.00 54.81  ? 448  ARG A C     1 
ATOM   1834 O O     . ARG A 1 346 ? -0.154  77.722  -39.897 1.00 57.78  ? 448  ARG A O     1 
ATOM   1835 C CB    . ARG A 1 346 ? -0.764  79.994  -37.468 1.00 84.90  ? 448  ARG A CB    1 
ATOM   1836 C CG    . ARG A 1 346 ? 0.470   80.758  -37.902 1.00 85.50  ? 448  ARG A CG    1 
ATOM   1837 C CD    . ARG A 1 346 ? 1.034   81.534  -36.697 1.00 85.89  ? 448  ARG A CD    1 
ATOM   1838 N NE    . ARG A 1 346 ? 2.285   80.972  -36.183 1.00 88.85  ? 448  ARG A NE    1 
ATOM   1839 C CZ    . ARG A 1 346 ? 2.703   81.039  -34.910 1.00 91.59  ? 448  ARG A CZ    1 
ATOM   1840 N NH1   . ARG A 1 346 ? 1.976   81.644  -33.955 1.00 89.75  ? 448  ARG A NH1   1 
ATOM   1841 N NH2   . ARG A 1 346 ? 3.874   80.486  -34.583 1.00 95.57  ? 448  ARG A NH2   1 
ATOM   1842 N N     . LEU A 1 347 ? -0.367  77.081  -37.761 1.00 97.36  ? 449  LEU A N     1 
ATOM   1843 C CA    . LEU A 1 347 ? 0.571   75.974  -37.894 1.00 101.67 ? 449  LEU A CA    1 
ATOM   1844 C C     . LEU A 1 347 ? 0.111   74.538  -38.185 1.00 107.14 ? 449  LEU A C     1 
ATOM   1845 O O     . LEU A 1 347 ? 0.931   73.714  -38.602 1.00 115.37 ? 449  LEU A O     1 
ATOM   1846 C CB    . LEU A 1 347 ? 1.503   75.975  -36.677 1.00 103.45 ? 449  LEU A CB    1 
ATOM   1847 C CG    . LEU A 1 347 ? 2.669   76.978  -36.639 1.00 107.94 ? 449  LEU A CG    1 
ATOM   1848 C CD1   . LEU A 1 347 ? 3.433   76.812  -35.339 1.00 110.16 ? 449  LEU A CD1   1 
ATOM   1849 C CD2   . LEU A 1 347 ? 3.632   76.759  -37.819 1.00 108.61 ? 449  LEU A CD2   1 
ATOM   1850 N N     . LEU A 1 348 ? -1.176  74.231  -38.002 1.00 97.15  ? 450  LEU A N     1 
ATOM   1851 C CA    . LEU A 1 348 ? -1.661  72.867  -38.226 1.00 94.40  ? 450  LEU A CA    1 
ATOM   1852 C C     . LEU A 1 348 ? -1.144  72.235  -39.524 1.00 98.23  ? 450  LEU A C     1 
ATOM   1853 O O     . LEU A 1 348 ? -0.382  71.255  -39.473 1.00 99.88  ? 450  LEU A O     1 
ATOM   1854 C CB    . LEU A 1 348 ? -3.205  72.788  -38.170 1.00 79.26  ? 450  LEU A CB    1 
ATOM   1855 C CG    . LEU A 1 348 ? -3.801  71.387  -38.478 1.00 77.27  ? 450  LEU A CG    1 
ATOM   1856 C CD1   . LEU A 1 348 ? -4.788  70.931  -37.397 1.00 70.33  ? 450  LEU A CD1   1 
ATOM   1857 C CD2   . LEU A 1 348 ? -4.460  71.398  -39.861 1.00 80.05  ? 450  LEU A CD2   1 
ATOM   1858 N N     . PRO A 1 349 ? -1.522  72.790  -40.695 1.00 81.68  ? 451  PRO A N     1 
ATOM   1859 C CA    . PRO A 1 349 ? -1.073  72.221  -41.963 1.00 83.18  ? 451  PRO A CA    1 
ATOM   1860 C C     . PRO A 1 349 ? 0.420   72.224  -42.094 1.00 82.44  ? 451  PRO A C     1 
ATOM   1861 O O     . PRO A 1 349 ? 1.032   71.167  -42.121 1.00 84.38  ? 451  PRO A O     1 
ATOM   1862 C CB    . PRO A 1 349 ? -1.761  73.093  -43.009 1.00 121.62 ? 451  PRO A CB    1 
ATOM   1863 C CG    . PRO A 1 349 ? -1.871  74.402  -42.361 1.00 123.66 ? 451  PRO A CG    1 
ATOM   1864 C CD    . PRO A 1 349 ? -2.225  74.067  -40.922 1.00 120.01 ? 451  PRO A CD    1 
ATOM   1865 N N     . VAL A 1 350 ? 1.011   73.408  -42.160 1.00 75.55  ? 452  VAL A N     1 
ATOM   1866 C CA    . VAL A 1 350 ? 2.471   73.527  -42.295 1.00 80.92  ? 452  VAL A CA    1 
ATOM   1867 C C     . VAL A 1 350 ? 3.290   72.559  -41.435 1.00 77.52  ? 452  VAL A C     1 
ATOM   1868 O O     . VAL A 1 350 ? 4.467   72.316  -41.709 1.00 76.13  ? 452  VAL A O     1 
ATOM   1869 C CB    . VAL A 1 350 ? 2.946   74.975  -42.038 1.00 126.75 ? 452  VAL A CB    1 
ATOM   1870 C CG1   . VAL A 1 350 ? 3.431   75.583  -43.354 1.00 134.50 ? 452  VAL A CG1   1 
ATOM   1871 C CG2   . VAL A 1 350 ? 1.813   75.806  -41.458 1.00 127.50 ? 452  VAL A CG2   1 
ATOM   1872 N N     . LEU A 1 351 ? 2.663   72.005  -40.401 1.00 91.83  ? 453  LEU A N     1 
ATOM   1873 C CA    . LEU A 1 351 ? 3.314   71.001  -39.557 1.00 91.99  ? 453  LEU A CA    1 
ATOM   1874 C C     . LEU A 1 351 ? 3.307   69.640  -40.263 1.00 96.68  ? 453  LEU A C     1 
ATOM   1875 O O     . LEU A 1 351 ? 4.364   69.198  -40.768 1.00 99.80  ? 453  LEU A O     1 
ATOM   1876 C CB    . LEU A 1 351 ? 2.598   70.845  -38.199 1.00 73.85  ? 453  LEU A CB    1 
ATOM   1877 C CG    . LEU A 1 351 ? 2.726   71.945  -37.116 1.00 67.55  ? 453  LEU A CG    1 
ATOM   1878 C CD1   . LEU A 1 351 ? 1.641   71.715  -36.094 1.00 64.44  ? 453  LEU A CD1   1 
ATOM   1879 C CD2   . LEU A 1 351 ? 4.114   71.967  -36.428 1.00 64.70  ? 453  LEU A CD2   1 
ATOM   1880 N N     . CYS A 1 352 ? 2.117   68.997  -40.314 1.00 94.57  ? 454  CYS A N     1 
ATOM   1881 C CA    . CYS A 1 352 ? 1.933   67.643  -40.911 1.00 94.13  ? 454  CYS A CA    1 
ATOM   1882 C C     . CYS A 1 352 ? 2.203   67.445  -42.404 1.00 95.53  ? 454  CYS A C     1 
ATOM   1883 O O     . CYS A 1 352 ? 2.546   66.346  -42.828 1.00 90.93  ? 454  CYS A O     1 
ATOM   1884 C CB    . CYS A 1 352 ? 0.572   67.043  -40.525 1.00 109.17 ? 454  CYS A CB    1 
ATOM   1885 S SG    . CYS A 1 352 ? -0.771  68.229  -40.453 1.00 110.08 ? 454  CYS A SG    1 
ATOM   1886 N N     . GLN A 1 353 ? 2.064   68.522  -43.171 1.00 143.28 ? 455  GLN A N     1 
ATOM   1887 C CA    . GLN A 1 353 ? 2.344   68.536  -44.610 1.00 148.10 ? 455  GLN A CA    1 
ATOM   1888 C C     . GLN A 1 353 ? 3.813   68.163  -44.857 1.00 146.13 ? 455  GLN A C     1 
ATOM   1889 O O     . GLN A 1 353 ? 4.131   67.454  -45.847 1.00 147.21 ? 455  GLN A O     1 
ATOM   1890 C CB    . GLN A 1 353 ? 2.091   69.932  -45.176 1.00 98.77  ? 455  GLN A CB    1 
ATOM   1891 C CG    . GLN A 1 353 ? 2.820   70.245  -46.506 1.00 101.27 ? 455  GLN A CG    1 
ATOM   1892 C CD    . GLN A 1 353 ? 3.523   71.626  -46.510 1.00 100.56 ? 455  GLN A CD    1 
ATOM   1893 O OE1   . GLN A 1 353 ? 3.356   72.463  -45.601 1.00 98.93  ? 455  GLN A OE1   1 
ATOM   1894 N NE2   . GLN A 1 353 ? 4.310   71.856  -47.547 1.00 98.71  ? 455  GLN A NE2   1 
ATOM   1895 N N     . ALA A 1 354 ? 4.687   68.677  -43.969 1.00 79.70  ? 456  ALA A N     1 
ATOM   1896 C CA    . ALA A 1 354 ? 6.119   68.402  -44.003 1.00 78.85  ? 456  ALA A CA    1 
ATOM   1897 C C     . ALA A 1 354 ? 6.627   68.090  -42.598 1.00 80.61  ? 456  ALA A C     1 
ATOM   1898 O O     . ALA A 1 354 ? 7.662   68.594  -42.245 1.00 79.20  ? 456  ALA A O     1 
ATOM   1899 C CB    . ALA A 1 354 ? 6.882   69.591  -44.584 1.00 88.03  ? 456  ALA A CB    1 
ATOM   1900 N N     . HIS A 1 355 ? 5.865   67.294  -41.835 1.00 199.62 ? 457  HIS A N     1 
ATOM   1901 C CA    . HIS A 1 355 ? 6.085   66.721  -40.480 1.00 199.62 ? 457  HIS A CA    1 
ATOM   1902 C C     . HIS A 1 355 ? 4.858   65.915  -40.472 1.00 199.62 ? 457  HIS A C     1 
ATOM   1903 O O     . HIS A 1 355 ? 3.730   66.494  -40.366 1.00 199.62 ? 457  HIS A O     1 
ATOM   1904 C CB    . HIS A 1 355 ? 5.817   67.556  -39.212 1.00 104.08 ? 457  HIS A CB    1 
ATOM   1905 C CG    . HIS A 1 355 ? 6.841   68.579  -38.895 1.00 102.46 ? 457  HIS A CG    1 
ATOM   1906 N ND1   . HIS A 1 355 ? 8.130   68.573  -39.384 1.00 104.42 ? 457  HIS A ND1   1 
ATOM   1907 C CD2   . HIS A 1 355 ? 6.733   69.684  -38.135 1.00 104.65 ? 457  HIS A CD2   1 
ATOM   1908 C CE1   . HIS A 1 355 ? 8.765   69.645  -38.943 1.00 104.57 ? 457  HIS A CE1   1 
ATOM   1909 N NE2   . HIS A 1 355 ? 7.936   70.337  -38.186 1.00 107.67 ? 457  HIS A NE2   1 
ATOM   1910 N N     . GLY A 1 356 ? 5.118   64.624  -40.372 1.00 110.20 ? 458  GLY A N     1 
ATOM   1911 C CA    . GLY A 1 356 ? 4.206   63.523  -40.394 1.00 104.97 ? 458  GLY A CA    1 
ATOM   1912 C C     . GLY A 1 356 ? 3.778   63.511  -38.987 1.00 95.85  ? 458  GLY A C     1 
ATOM   1913 O O     . GLY A 1 356 ? 4.386   62.938  -38.093 1.00 101.82 ? 458  GLY A O     1 
ATOM   1914 N N     . LEU A 1 357 ? 2.709   64.245  -38.840 1.00 57.42  ? 459  LEU A N     1 
ATOM   1915 C CA    . LEU A 1 357 ? 2.138   64.499  -37.576 1.00 51.31  ? 459  LEU A CA    1 
ATOM   1916 C C     . LEU A 1 357 ? 0.627   64.591  -37.714 1.00 53.27  ? 459  LEU A C     1 
ATOM   1917 O O     . LEU A 1 357 ? 0.093   65.650  -38.097 1.00 54.81  ? 459  LEU A O     1 
ATOM   1918 C CB    . LEU A 1 357 ? 2.657   65.829  -37.098 1.00 53.01  ? 459  LEU A CB    1 
ATOM   1919 C CG    . LEU A 1 357 ? 3.076   65.806  -35.659 1.00 49.56  ? 459  LEU A CG    1 
ATOM   1920 C CD1   . LEU A 1 357 ? 4.556   65.256  -35.659 1.00 48.99  ? 459  LEU A CD1   1 
ATOM   1921 C CD2   . LEU A 1 357 ? 2.945   67.183  -34.993 1.00 44.90  ? 459  LEU A CD2   1 
ATOM   1922 N N     . THR A 1 358 ? -0.058  63.506  -37.359 1.00 56.17  ? 460  THR A N     1 
ATOM   1923 C CA    . THR A 1 358 ? -1.493  63.467  -37.462 1.00 56.23  ? 460  THR A CA    1 
ATOM   1924 C C     . THR A 1 358 ? -2.291  64.712  -36.934 1.00 58.67  ? 460  THR A C     1 
ATOM   1925 O O     . THR A 1 358 ? -1.907  65.345  -35.942 1.00 58.18  ? 460  THR A O     1 
ATOM   1926 C CB    . THR A 1 358 ? -2.032  62.251  -36.741 1.00 69.42  ? 460  THR A CB    1 
ATOM   1927 O OG1   . THR A 1 358 ? -1.966  62.462  -35.325 1.00 66.23  ? 460  THR A OG1   1 
ATOM   1928 C CG2   . THR A 1 358 ? -1.210  61.014  -37.097 1.00 73.49  ? 460  THR A CG2   1 
ATOM   1929 N N     . PRO A 1 359 ? -3.382  65.102  -37.627 1.00 78.60  ? 461  PRO A N     1 
ATOM   1930 C CA    . PRO A 1 359 ? -4.208  66.216  -37.176 1.00 80.97  ? 461  PRO A CA    1 
ATOM   1931 C C     . PRO A 1 359 ? -4.548  66.017  -35.673 1.00 83.71  ? 461  PRO A C     1 
ATOM   1932 O O     . PRO A 1 359 ? -4.420  66.911  -34.817 1.00 79.62  ? 461  PRO A O     1 
ATOM   1933 C CB    . PRO A 1 359 ? -5.483  66.024  -37.968 1.00 70.03  ? 461  PRO A CB    1 
ATOM   1934 C CG    . PRO A 1 359 ? -5.111  65.176  -39.138 1.00 70.33  ? 461  PRO A CG    1 
ATOM   1935 C CD    . PRO A 1 359 ? -3.707  64.747  -39.017 1.00 68.43  ? 461  PRO A CD    1 
ATOM   1936 N N     . ASP A 1 360 ? -5.122  64.849  -35.430 1.00 96.88  ? 462  ASP A N     1 
ATOM   1937 C CA    . ASP A 1 360 ? -5.468  64.313  -34.124 1.00 96.66  ? 462  ASP A CA    1 
ATOM   1938 C C     . ASP A 1 360 ? -4.342  64.670  -33.082 1.00 94.07  ? 462  ASP A C     1 
ATOM   1939 O O     . ASP A 1 360 ? -4.621  65.164  -31.985 1.00 95.24  ? 462  ASP A O     1 
ATOM   1940 C CB    . ASP A 1 360 ? -5.572  62.798  -34.328 1.00 119.35 ? 462  ASP A CB    1 
ATOM   1941 C CG    . ASP A 1 360 ? -6.201  62.424  -35.686 1.00 120.03 ? 462  ASP A CG    1 
ATOM   1942 O OD1   . ASP A 1 360 ? -5.861  63.042  -36.735 1.00 119.90 ? 462  ASP A OD1   1 
ATOM   1943 O OD2   . ASP A 1 360 ? -7.034  61.488  -35.704 1.00 122.34 ? 462  ASP A OD2   1 
ATOM   1944 N N     . GLN A 1 361 ? -3.073  64.401  -33.413 1.00 84.13  ? 463  GLN A N     1 
ATOM   1945 C CA    . GLN A 1 361 ? -1.961  64.718  -32.508 1.00 77.86  ? 463  GLN A CA    1 
ATOM   1946 C C     . GLN A 1 361 ? -1.842  66.226  -32.362 1.00 75.11  ? 463  GLN A C     1 
ATOM   1947 O O     . GLN A 1 361 ? -1.798  66.739  -31.255 1.00 70.78  ? 463  GLN A O     1 
ATOM   1948 C CB    . GLN A 1 361 ? -0.606  64.140  -32.999 1.00 78.23  ? 463  GLN A CB    1 
ATOM   1949 C CG    . GLN A 1 361 ? -0.452  62.623  -32.788 1.00 81.92  ? 463  GLN A CG    1 
ATOM   1950 C CD    . GLN A 1 361 ? 0.920   62.051  -33.209 1.00 82.57  ? 463  GLN A CD    1 
ATOM   1951 O OE1   . GLN A 1 361 ? 1.471   62.421  -34.274 1.00 76.61  ? 463  GLN A OE1   1 
ATOM   1952 N NE2   . GLN A 1 361 ? 1.465   61.120  -32.386 1.00 81.81  ? 463  GLN A NE2   1 
ATOM   1953 N N     . VAL A 1 362 ? -1.812  66.952  -33.470 1.00 57.54  ? 464  VAL A N     1 
ATOM   1954 C CA    . VAL A 1 362 ? -1.642  68.398  -33.351 1.00 52.34  ? 464  VAL A CA    1 
ATOM   1955 C C     . VAL A 1 362 ? -2.685  68.885  -32.366 1.00 51.38  ? 464  VAL A C     1 
ATOM   1956 O O     . VAL A 1 362 ? -2.374  69.588  -31.430 1.00 50.13  ? 464  VAL A O     1 
ATOM   1957 C CB    . VAL A 1 362 ? -1.813  69.135  -34.703 1.00 52.01  ? 464  VAL A CB    1 
ATOM   1958 C CG1   . VAL A 1 362 ? -1.860  70.665  -34.477 1.00 50.31  ? 464  VAL A CG1   1 
ATOM   1959 C CG2   . VAL A 1 362 ? -0.666  68.786  -35.618 1.00 52.33  ? 464  VAL A CG2   1 
ATOM   1960 N N     . VAL A 1 363 ? -3.927  68.496  -32.595 1.00 46.80  ? 465  VAL A N     1 
ATOM   1961 C CA    . VAL A 1 363 ? -5.010  68.858  -31.708 1.00 45.48  ? 465  VAL A CA    1 
ATOM   1962 C C     . VAL A 1 363 ? -4.635  68.541  -30.254 1.00 47.58  ? 465  VAL A C     1 
ATOM   1963 O O     . VAL A 1 363 ? -4.894  69.339  -29.370 1.00 45.95  ? 465  VAL A O     1 
ATOM   1964 C CB    . VAL A 1 363 ? -6.326  68.123  -32.138 1.00 30.77  ? 465  VAL A CB    1 
ATOM   1965 C CG1   . VAL A 1 363 ? -7.408  68.235  -31.100 1.00 27.43  ? 465  VAL A CG1   1 
ATOM   1966 C CG2   . VAL A 1 363 ? -6.792  68.733  -33.454 1.00 32.58  ? 465  VAL A CG2   1 
ATOM   1967 N N     . ALA A 1 364 ? -4.041  67.381  -29.985 1.00 66.28  ? 466  ALA A N     1 
ATOM   1968 C CA    . ALA A 1 364 ? -3.614  67.065  -28.618 1.00 62.73  ? 466  ALA A CA    1 
ATOM   1969 C C     . ALA A 1 364 ? -2.590  68.099  -28.083 1.00 61.91  ? 466  ALA A C     1 
ATOM   1970 O O     . ALA A 1 364 ? -2.741  68.565  -26.952 1.00 61.83  ? 466  ALA A O     1 
ATOM   1971 C CB    . ALA A 1 364 ? -2.996  65.697  -28.571 1.00 126.81 ? 466  ALA A CB    1 
ATOM   1972 N N     . ILE A 1 365 ? -1.552  68.453  -28.868 1.00 77.10  ? 467  ILE A N     1 
ATOM   1973 C CA    . ILE A 1 365 ? -0.532  69.411  -28.392 1.00 73.09  ? 467  ILE A CA    1 
ATOM   1974 C C     . ILE A 1 365 ? -1.115  70.774  -28.258 1.00 76.36  ? 467  ILE A C     1 
ATOM   1975 O O     . ILE A 1 365 ? -0.585  71.602  -27.554 1.00 83.19  ? 467  ILE A O     1 
ATOM   1976 C CB    . ILE A 1 365 ? 0.703   69.554  -29.288 1.00 34.24  ? 467  ILE A CB    1 
ATOM   1977 C CG1   . ILE A 1 365 ? 1.377   68.193  -29.547 1.00 33.63  ? 467  ILE A CG1   1 
ATOM   1978 C CG2   . ILE A 1 365 ? 1.708   70.328  -28.593 1.00 29.00  ? 467  ILE A CG2   1 
ATOM   1979 C CD1   . ILE A 1 365 ? 2.548   68.317  -30.559 1.00 31.91  ? 467  ILE A CD1   1 
ATOM   1980 N N     . ALA A 1 366 ? -2.217  71.045  -28.937 1.00 56.11  ? 468  ALA A N     1 
ATOM   1981 C CA    . ALA A 1 366 ? -2.856  72.365  -28.761 1.00 54.05  ? 468  ALA A CA    1 
ATOM   1982 C C     . ALA A 1 366 ? -3.547  72.458  -27.435 1.00 50.79  ? 468  ALA A C     1 
ATOM   1983 O O     . ALA A 1 366 ? -3.359  73.410  -26.756 1.00 52.18  ? 468  ALA A O     1 
ATOM   1984 C CB    . ALA A 1 366 ? -3.931  72.688  -29.869 1.00 23.82  ? 468  ALA A CB    1 
ATOM   1985 N N     . SER A 1 367 ? -4.286  71.417  -27.069 1.00 39.18  ? 469  SER A N     1 
ATOM   1986 C CA    . SER A 1 367 ? -5.195  71.389  -25.951 1.00 38.54  ? 469  SER A CA    1 
ATOM   1987 C C     . SER A 1 367 ? -4.658  71.313  -24.532 1.00 38.40  ? 469  SER A C     1 
ATOM   1988 O O     . SER A 1 367 ? -5.090  70.418  -23.698 1.00 35.64  ? 469  SER A O     1 
ATOM   1989 C CB    . SER A 1 367 ? -6.156  70.237  -26.164 1.00 64.35  ? 469  SER A CB    1 
ATOM   1990 O OG    . SER A 1 367 ? -5.676  69.052  -25.524 1.00 70.46  ? 469  SER A OG    1 
ATOM   1991 N N     . ASN A 1 368 ? -3.846  72.314  -24.185 1.00 46.62  ? 470  ASN A N     1 
ATOM   1992 C CA    . ASN A 1 368 ? -3.146  72.304  -22.914 1.00 45.44  ? 470  ASN A CA    1 
ATOM   1993 C C     . ASN A 1 368 ? -2.737  73.648  -22.466 1.00 44.23  ? 470  ASN A C     1 
ATOM   1994 O O     . ASN A 1 368 ? -2.554  74.559  -23.259 1.00 40.86  ? 470  ASN A O     1 
ATOM   1995 C CB    . ASN A 1 368 ? -1.863  71.511  -23.097 1.00 68.51  ? 470  ASN A CB    1 
ATOM   1996 C CG    . ASN A 1 368 ? -2.016  70.033  -22.767 1.00 72.71  ? 470  ASN A CG    1 
ATOM   1997 O OD1   . ASN A 1 368 ? -2.657  69.653  -21.765 1.00 76.23  ? 470  ASN A OD1   1 
ATOM   1998 N ND2   . ASN A 1 368 ? -1.457  69.181  -23.618 1.00 72.71  ? 470  ASN A ND2   1 
ATOM   1999 N N     . GLY A 1 369 ? -2.552  73.759  -21.171 1.00 71.08  ? 471  GLY A N     1 
ATOM   2000 C CA    . GLY A 1 369 ? -2.023  74.995  -20.690 1.00 71.68  ? 471  GLY A CA    1 
ATOM   2001 C C     . GLY A 1 369 ? -0.839  75.412  -21.597 1.00 72.47  ? 471  GLY A C     1 
ATOM   2002 O O     . GLY A 1 369 ? 0.197   74.709  -21.757 1.00 74.72  ? 471  GLY A O     1 
ATOM   2003 N N     . GLY A 1 370 ? -1.069  76.534  -22.275 1.00 34.97  ? 472  GLY A N     1 
ATOM   2004 C CA    . GLY A 1 370 ? -0.077  77.203  -23.096 1.00 30.75  ? 472  GLY A CA    1 
ATOM   2005 C C     . GLY A 1 370 ? 0.237   76.622  -24.421 1.00 31.01  ? 472  GLY A C     1 
ATOM   2006 O O     . GLY A 1 370 ? 1.224   77.004  -25.086 1.00 30.54  ? 472  GLY A O     1 
ATOM   2007 N N     . GLY A 1 371 ? -0.591  75.682  -24.838 1.00 28.39  ? 473  GLY A N     1 
ATOM   2008 C CA    . GLY A 1 371 ? -0.312  75.034  -26.136 1.00 29.79  ? 473  GLY A CA    1 
ATOM   2009 C C     . GLY A 1 371 ? 0.448   75.769  -27.315 1.00 28.54  ? 473  GLY A C     1 
ATOM   2010 O O     . GLY A 1 371 ? 1.175   75.163  -28.107 1.00 28.10  ? 473  GLY A O     1 
ATOM   2011 N N     . LYS A 1 372 ? 0.220   77.059  -27.449 1.00 20.04  ? 474  LYS A N     1 
ATOM   2012 C CA    . LYS A 1 372 ? 0.826   77.814  -28.492 1.00 23.83  ? 474  LYS A CA    1 
ATOM   2013 C C     . LYS A 1 372 ? 2.255   77.691  -28.269 1.00 25.06  ? 474  LYS A C     1 
ATOM   2014 O O     . LYS A 1 372 ? 3.008   77.484  -29.210 1.00 28.44  ? 474  LYS A O     1 
ATOM   2015 C CB    . LYS A 1 372 ? 0.469   79.285  -28.406 1.00 65.53  ? 474  LYS A CB    1 
ATOM   2016 C CG    . LYS A 1 372 ? 1.459   80.089  -29.131 1.00 70.29  ? 474  LYS A CG    1 
ATOM   2017 C CD    . LYS A 1 372 ? 1.543   81.509  -28.610 1.00 74.75  ? 474  LYS A CD    1 
ATOM   2018 C CE    . LYS A 1 372 ? 0.679   82.532  -29.412 1.00 78.97  ? 474  LYS A CE    1 
ATOM   2019 N NZ    . LYS A 1 372 ? 0.689   83.896  -28.763 1.00 78.10  ? 474  LYS A NZ    1 
ATOM   2020 N N     . GLN A 1 373 ? 2.656   77.788  -27.013 1.00 43.01  ? 475  GLN A N     1 
ATOM   2021 C CA    . GLN A 1 373 ? 4.063   77.730  -26.679 1.00 44.33  ? 475  GLN A CA    1 
ATOM   2022 C C     . GLN A 1 373 ? 4.613   76.424  -27.186 1.00 44.24  ? 475  GLN A C     1 
ATOM   2023 O O     . GLN A 1 373 ? 5.740   76.359  -27.596 1.00 44.03  ? 475  GLN A O     1 
ATOM   2024 C CB    . GLN A 1 373 ? 4.257   77.977  -25.160 1.00 52.18  ? 475  GLN A CB    1 
ATOM   2025 C CG    . GLN A 1 373 ? 3.924   79.478  -24.753 1.00 52.96  ? 475  GLN A CG    1 
ATOM   2026 C CD    . GLN A 1 373 ? 4.503   80.501  -25.735 1.00 54.97  ? 475  GLN A CD    1 
ATOM   2027 O OE1   . GLN A 1 373 ? 5.653   80.893  -25.661 1.00 57.17  ? 475  GLN A OE1   1 
ATOM   2028 N NE2   . GLN A 1 373 ? 3.697   80.906  -26.669 1.00 55.70  ? 475  GLN A NE2   1 
ATOM   2029 N N     . ALA A 1 374 ? 3.771   75.406  -27.191 1.00 47.84  ? 476  ALA A N     1 
ATOM   2030 C CA    . ALA A 1 374 ? 4.081   74.104  -27.749 1.00 50.82  ? 476  ALA A CA    1 
ATOM   2031 C C     . ALA A 1 374 ? 4.199   74.177  -29.281 1.00 54.15  ? 476  ALA A C     1 
ATOM   2032 O O     . ALA A 1 374 ? 5.296   74.046  -29.802 1.00 61.92  ? 476  ALA A O     1 
ATOM   2033 C CB    . ALA A 1 374 ? 2.997   73.156  -27.412 1.00 46.39  ? 476  ALA A CB    1 
ATOM   2034 N N     . LEU A 1 375 ? 3.089   74.325  -30.012 1.00 28.25  ? 477  LEU A N     1 
ATOM   2035 C CA    . LEU A 1 375 ? 3.169   74.380  -31.470 1.00 30.35  ? 477  LEU A CA    1 
ATOM   2036 C C     . LEU A 1 375 ? 4.362   75.235  -31.908 1.00 33.52  ? 477  LEU A C     1 
ATOM   2037 O O     . LEU A 1 375 ? 5.248   74.810  -32.687 1.00 35.37  ? 477  LEU A O     1 
ATOM   2038 C CB    . LEU A 1 375 ? 1.877   74.934  -32.054 1.00 35.95  ? 477  LEU A CB    1 
ATOM   2039 C CG    . LEU A 1 375 ? 0.645   74.105  -31.659 1.00 37.67  ? 477  LEU A CG    1 
ATOM   2040 C CD1   . LEU A 1 375 ? -0.645  74.830  -32.165 1.00 39.56  ? 477  LEU A CD1   1 
ATOM   2041 C CD2   . LEU A 1 375 ? 0.722   72.697  -32.236 1.00 37.67  ? 477  LEU A CD2   1 
ATOM   2042 N N     . GLU A 1 376 ? 4.428   76.437  -31.384 1.00 45.79  ? 478  GLU A N     1 
ATOM   2043 C CA    . GLU A 1 376 ? 5.543   77.290  -31.734 1.00 52.38  ? 478  GLU A CA    1 
ATOM   2044 C C     . GLU A 1 376 ? 6.814   76.489  -31.539 1.00 51.62  ? 478  GLU A C     1 
ATOM   2045 O O     . GLU A 1 376 ? 7.484   76.126  -32.489 1.00 54.30  ? 478  GLU A O     1 
ATOM   2046 C CB    . GLU A 1 376 ? 5.567   78.528  -30.835 1.00 99.25  ? 478  GLU A CB    1 
ATOM   2047 C CG    . GLU A 1 376 ? 4.967   79.784  -31.425 1.00 106.73 ? 478  GLU A CG    1 
ATOM   2048 C CD    . GLU A 1 376 ? 6.037   80.676  -31.974 1.00 113.80 ? 478  GLU A CD    1 
ATOM   2049 O OE1   . GLU A 1 376 ? 7.029   80.877  -31.243 1.00 116.64 ? 478  GLU A OE1   1 
ATOM   2050 O OE2   . GLU A 1 376 ? 5.899   81.177  -33.114 1.00 120.10 ? 478  GLU A OE2   1 
ATOM   2051 N N     . THR A 1 377 ? 7.102   76.155  -30.294 1.00 73.14  ? 479  THR A N     1 
ATOM   2052 C CA    . THR A 1 377 ? 8.340   75.489  -29.975 1.00 73.54  ? 479  THR A CA    1 
ATOM   2053 C C     . THR A 1 377 ? 8.541   74.283  -30.794 1.00 78.18  ? 479  THR A C     1 
ATOM   2054 O O     . THR A 1 377 ? 9.664   74.036  -31.245 1.00 86.34  ? 479  THR A O     1 
ATOM   2055 C CB    . THR A 1 377 ? 8.412   75.021  -28.512 1.00 50.29  ? 479  THR A CB    1 
ATOM   2056 O OG1   . THR A 1 377 ? 7.932   76.058  -27.660 1.00 47.69  ? 479  THR A OG1   1 
ATOM   2057 C CG2   . THR A 1 377 ? 9.854   74.718  -28.102 1.00 50.17  ? 479  THR A CG2   1 
ATOM   2058 N N     . VAL A 1 378 ? 7.456   73.543  -31.027 1.00 64.70  ? 480  VAL A N     1 
ATOM   2059 C CA    . VAL A 1 378 ? 7.587   72.255  -31.707 1.00 64.43  ? 480  VAL A CA    1 
ATOM   2060 C C     . VAL A 1 378 ? 8.192   72.386  -33.115 1.00 65.66  ? 480  VAL A C     1 
ATOM   2061 O O     . VAL A 1 378 ? 9.254   71.785  -33.378 1.00 68.68  ? 480  VAL A O     1 
ATOM   2062 C CB    . VAL A 1 378 ? 6.232   71.424  -31.619 1.00 64.23  ? 480  VAL A CB    1 
ATOM   2063 C CG1   . VAL A 1 378 ? 5.312   71.652  -32.861 1.00 63.00  ? 480  VAL A CG1   1 
ATOM   2064 C CG2   . VAL A 1 378 ? 6.534   69.935  -31.388 1.00 62.32  ? 480  VAL A CG2   1 
ATOM   2065 N N     . GLN A 1 379 ? 7.597   73.237  -33.965 1.00 51.27  ? 481  GLN A N     1 
ATOM   2066 C CA    . GLN A 1 379 ? 8.101   73.458  -35.322 1.00 53.86  ? 481  GLN A CA    1 
ATOM   2067 C C     . GLN A 1 379 ? 9.640   73.700  -35.348 1.00 53.67  ? 481  GLN A C     1 
ATOM   2068 O O     . GLN A 1 379 ? 10.343  73.367  -36.297 1.00 53.63  ? 481  GLN A O     1 
ATOM   2069 C CB    . GLN A 1 379 ? 7.313   74.605  -35.945 1.00 85.34  ? 481  GLN A CB    1 
ATOM   2070 C CG    . GLN A 1 379 ? 8.113   75.592  -36.739 1.00 95.70  ? 481  GLN A CG    1 
ATOM   2071 C CD    . GLN A 1 379 ? 7.808   77.041  -36.329 1.00 101.62 ? 481  GLN A CD    1 
ATOM   2072 O OE1   . GLN A 1 379 ? 6.627   77.466  -36.284 1.00 107.74 ? 481  GLN A OE1   1 
ATOM   2073 N NE2   . GLN A 1 379 ? 8.873   77.811  -36.033 1.00 98.98  ? 481  GLN A NE2   1 
ATOM   2074 N N     . ARG A 1 380 ? 10.179  74.238  -34.273 1.00 68.84  ? 482  ARG A N     1 
ATOM   2075 C CA    . ARG A 1 380 ? 11.600  74.490  -34.197 1.00 72.14  ? 482  ARG A CA    1 
ATOM   2076 C C     . ARG A 1 380 ? 12.376  73.313  -33.669 1.00 72.08  ? 482  ARG A C     1 
ATOM   2077 O O     . ARG A 1 380 ? 13.542  73.132  -34.026 1.00 72.10  ? 482  ARG A O     1 
ATOM   2078 C CB    . ARG A 1 380 ? 11.888  75.696  -33.288 1.00 77.18  ? 482  ARG A CB    1 
ATOM   2079 C CG    . ARG A 1 380 ? 12.411  76.920  -34.030 1.00 78.78  ? 482  ARG A CG    1 
ATOM   2080 C CD    . ARG A 1 380 ? 12.442  78.183  -33.168 1.00 82.01  ? 482  ARG A CD    1 
ATOM   2081 N NE    . ARG A 1 380 ? 11.100  78.638  -32.822 1.00 83.61  ? 482  ARG A NE    1 
ATOM   2082 C CZ    . ARG A 1 380 ? 10.505  78.425  -31.652 1.00 85.17  ? 482  ARG A CZ    1 
ATOM   2083 N NH1   . ARG A 1 380 ? 11.151  77.761  -30.682 1.00 83.13  ? 482  ARG A NH1   1 
ATOM   2084 N NH2   . ARG A 1 380 ? 9.248   78.854  -31.476 1.00 88.13  ? 482  ARG A NH2   1 
ATOM   2085 N N     . LEU A 1 381 ? 11.757  72.502  -32.827 1.00 81.27  ? 483  LEU A N     1 
ATOM   2086 C CA    . LEU A 1 381 ? 12.507  71.425  -32.189 1.00 83.00  ? 483  LEU A CA    1 
ATOM   2087 C C     . LEU A 1 381 ? 12.255  69.961  -32.602 1.00 85.17  ? 483  LEU A C     1 
ATOM   2088 O O     . LEU A 1 381 ? 12.988  69.051  -32.163 1.00 88.38  ? 483  LEU A O     1 
ATOM   2089 C CB    . LEU A 1 381 ? 12.402  71.563  -30.651 1.00 55.29  ? 483  LEU A CB    1 
ATOM   2090 C CG    . LEU A 1 381 ? 13.017  72.748  -29.866 1.00 52.05  ? 483  LEU A CG    1 
ATOM   2091 C CD1   . LEU A 1 381 ? 13.360  72.309  -28.454 1.00 52.96  ? 483  LEU A CD1   1 
ATOM   2092 C CD2   . LEU A 1 381 ? 14.274  73.244  -30.515 1.00 51.77  ? 483  LEU A CD2   1 
ATOM   2093 N N     . LEU A 1 382 ? 11.256  69.711  -33.453 1.00 60.03  ? 484  LEU A N     1 
ATOM   2094 C CA    . LEU A 1 382 ? 10.993  68.327  -33.849 1.00 62.44  ? 484  LEU A CA    1 
ATOM   2095 C C     . LEU A 1 382 ? 12.196  67.690  -34.543 1.00 63.36  ? 484  LEU A C     1 
ATOM   2096 O O     . LEU A 1 382 ? 12.749  66.723  -34.035 1.00 59.83  ? 484  LEU A O     1 
ATOM   2097 C CB    . LEU A 1 382 ? 9.737   68.198  -34.726 1.00 76.30  ? 484  LEU A CB    1 
ATOM   2098 C CG    . LEU A 1 382 ? 8.558   67.311  -34.274 1.00 75.30  ? 484  LEU A CG    1 
ATOM   2099 C CD1   . LEU A 1 382 ? 7.569   67.133  -35.453 1.00 76.09  ? 484  LEU A CD1   1 
ATOM   2100 C CD2   . LEU A 1 382 ? 9.057   65.936  -33.829 1.00 74.00  ? 484  LEU A CD2   1 
ATOM   2101 N N     . PRO A 1 383 ? 12.653  68.248  -35.665 1.00 92.29  ? 485  PRO A N     1 
ATOM   2102 C CA    . PRO A 1 383 ? 13.785  67.642  -36.363 1.00 100.01 ? 485  PRO A CA    1 
ATOM   2103 C C     . PRO A 1 383 ? 15.150  67.634  -35.678 1.00 101.38 ? 485  PRO A C     1 
ATOM   2104 O O     . PRO A 1 383 ? 15.934  66.699  -35.892 1.00 105.35 ? 485  PRO A O     1 
ATOM   2105 C CB    . PRO A 1 383 ? 13.805  68.392  -37.694 1.00 111.89 ? 485  PRO A CB    1 
ATOM   2106 C CG    . PRO A 1 383 ? 13.424  69.761  -37.309 1.00 107.99 ? 485  PRO A CG    1 
ATOM   2107 C CD    . PRO A 1 383 ? 12.345  69.571  -36.234 1.00 106.15 ? 485  PRO A CD    1 
ATOM   2108 N N     . VAL A 1 384 ? 15.449  68.647  -34.866 1.00 72.12  ? 486  VAL A N     1 
ATOM   2109 C CA    . VAL A 1 384 ? 16.750  68.684  -34.214 1.00 69.38  ? 486  VAL A CA    1 
ATOM   2110 C C     . VAL A 1 384 ? 16.833  67.626  -33.109 1.00 70.77  ? 486  VAL A C     1 
ATOM   2111 O O     . VAL A 1 384 ? 17.893  67.033  -32.896 1.00 73.97  ? 486  VAL A O     1 
ATOM   2112 C CB    . VAL A 1 384 ? 17.113  70.127  -33.692 1.00 76.25  ? 486  VAL A CB    1 
ATOM   2113 C CG1   . VAL A 1 384 ? 16.254  71.188  -34.411 1.00 72.86  ? 486  VAL A CG1   1 
ATOM   2114 C CG2   . VAL A 1 384 ? 16.956  70.218  -32.192 1.00 74.25  ? 486  VAL A CG2   1 
ATOM   2115 N N     . LEU A 1 385 ? 15.713  67.360  -32.432 1.00 79.21  ? 487  LEU A N     1 
ATOM   2116 C CA    . LEU A 1 385 ? 15.664  66.335  -31.390 1.00 74.55  ? 487  LEU A CA    1 
ATOM   2117 C C     . LEU A 1 385 ? 15.761  64.925  -32.004 1.00 78.06  ? 487  LEU A C     1 
ATOM   2118 O O     . LEU A 1 385 ? 16.398  64.038  -31.435 1.00 78.16  ? 487  LEU A O     1 
ATOM   2119 C CB    . LEU A 1 385 ? 14.373  66.502  -30.584 1.00 51.17  ? 487  LEU A CB    1 
ATOM   2120 C CG    . LEU A 1 385 ? 14.375  67.680  -29.601 1.00 45.22  ? 487  LEU A CG    1 
ATOM   2121 C CD1   . LEU A 1 385 ? 13.211  67.464  -28.666 1.00 44.04  ? 487  LEU A CD1   1 
ATOM   2122 C CD2   . LEU A 1 385 ? 15.674  67.705  -28.772 1.00 46.01  ? 487  LEU A CD2   1 
ATOM   2123 N N     . CYS A 1 386 ? 15.137  64.751  -33.170 1.00 80.22  ? 488  CYS A N     1 
ATOM   2124 C CA    . CYS A 1 386 ? 15.132  63.489  -33.916 1.00 84.26  ? 488  CYS A CA    1 
ATOM   2125 C C     . CYS A 1 386 ? 16.467  63.200  -34.621 1.00 90.19  ? 488  CYS A C     1 
ATOM   2126 O O     . CYS A 1 386 ? 16.729  62.055  -35.035 1.00 87.69  ? 488  CYS A O     1 
ATOM   2127 C CB    . CYS A 1 386 ? 14.058  63.544  -35.000 1.00 101.86 ? 488  CYS A CB    1 
ATOM   2128 S SG    . CYS A 1 386 ? 12.422  63.967  -34.404 1.00 107.03 ? 488  CYS A SG    1 
ATOM   2129 N N     . GLN A 1 387 ? 17.273  64.255  -34.770 1.00 81.79  ? 489  GLN A N     1 
ATOM   2130 C CA    . GLN A 1 387 ? 18.537  64.189  -35.471 1.00 84.39  ? 489  GLN A CA    1 
ATOM   2131 C C     . GLN A 1 387 ? 19.763  64.447  -34.611 1.00 84.61  ? 489  GLN A C     1 
ATOM   2132 O O     . GLN A 1 387 ? 20.880  64.610  -35.139 1.00 90.82  ? 489  GLN A O     1 
ATOM   2133 C CB    . GLN A 1 387 ? 18.520  65.160  -36.658 1.00 98.78  ? 489  GLN A CB    1 
ATOM   2134 C CG    . GLN A 1 387 ? 18.444  64.499  -38.013 1.00 99.89  ? 489  GLN A CG    1 
ATOM   2135 C CD    . GLN A 1 387 ? 19.220  65.285  -39.066 1.00 103.56 ? 489  GLN A CD    1 
ATOM   2136 O OE1   . GLN A 1 387 ? 18.866  66.422  -39.394 1.00 103.99 ? 489  GLN A OE1   1 
ATOM   2137 N NE2   . GLN A 1 387 ? 20.289  64.683  -39.595 1.00 102.79 ? 489  GLN A NE2   1 
ATOM   2138 N N     . ALA A 1 388 ? 19.562  64.539  -33.300 1.00 82.63  ? 490  ALA A N     1 
ATOM   2139 C CA    . ALA A 1 388 ? 20.706  64.681  -32.395 1.00 81.17  ? 490  ALA A CA    1 
ATOM   2140 C C     . ALA A 1 388 ? 20.572  63.690  -31.244 1.00 79.00  ? 490  ALA A C     1 
ATOM   2141 O O     . ALA A 1 388 ? 21.540  63.427  -30.536 1.00 81.57  ? 490  ALA A O     1 
ATOM   2142 C CB    . ALA A 1 388 ? 20.833  66.116  -31.856 1.00 60.74  ? 490  ALA A CB    1 
ATOM   2143 N N     . HIS A 1 389 ? 19.363  63.149  -31.064 1.00 103.67 ? 491  HIS A N     1 
ATOM   2144 C CA    . HIS A 1 389 ? 19.079  62.178  -30.002 1.00 100.88 ? 491  HIS A CA    1 
ATOM   2145 C C     . HIS A 1 389 ? 18.293  61.021  -30.592 1.00 96.77  ? 491  HIS A C     1 
ATOM   2146 O O     . HIS A 1 389 ? 17.936  60.072  -29.899 1.00 92.28  ? 491  HIS A O     1 
ATOM   2147 C CB    . HIS A 1 389 ? 18.346  62.880  -28.857 1.00 124.44 ? 491  HIS A CB    1 
ATOM   2148 C CG    . HIS A 1 389 ? 18.901  64.241  -28.551 1.00 129.18 ? 491  HIS A CG    1 
ATOM   2149 N ND1   . HIS A 1 389 ? 20.237  64.467  -28.249 1.00 128.36 ? 491  HIS A ND1   1 
ATOM   2150 C CD2   . HIS A 1 389 ? 18.312  65.459  -28.548 1.00 132.38 ? 491  HIS A CD2   1 
ATOM   2151 C CE1   . HIS A 1 389 ? 20.431  65.758  -28.076 1.00 130.15 ? 491  HIS A CE1   1 
ATOM   2152 N NE2   . HIS A 1 389 ? 19.280  66.386  -28.251 1.00 130.18 ? 491  HIS A NE2   1 
ATOM   2153 N N     . GLY A 1 390 ? 18.075  61.134  -31.902 1.00 100.60 ? 492  GLY A N     1 
ATOM   2154 C CA    . GLY A 1 390 ? 17.416  60.126  -32.707 1.00 100.01 ? 492  GLY A CA    1 
ATOM   2155 C C     . GLY A 1 390 ? 16.028  59.803  -32.249 1.00 96.40  ? 492  GLY A C     1 
ATOM   2156 O O     . GLY A 1 390 ? 15.509  58.704  -32.487 1.00 97.26  ? 492  GLY A O     1 
ATOM   2157 N N     . LEU A 1 391 ? 15.420  60.788  -31.602 1.00 89.42  ? 493  LEU A N     1 
ATOM   2158 C CA    . LEU A 1 391 ? 14.087  60.628  -31.046 1.00 84.39  ? 493  LEU A CA    1 
ATOM   2159 C C     . LEU A 1 391 ? 13.017  60.403  -32.079 1.00 87.42  ? 493  LEU A C     1 
ATOM   2160 O O     . LEU A 1 391 ? 13.077  60.921  -33.210 1.00 86.08  ? 493  LEU A O     1 
ATOM   2161 C CB    . LEU A 1 391 ? 13.677  61.839  -30.210 1.00 39.88  ? 493  LEU A CB    1 
ATOM   2162 C CG    . LEU A 1 391 ? 14.447  62.027  -28.942 1.00 38.11  ? 493  LEU A CG    1 
ATOM   2163 C CD1   . LEU A 1 391 ? 13.822  63.151  -28.082 1.00 33.47  ? 493  LEU A CD1   1 
ATOM   2164 C CD2   . LEU A 1 391 ? 14.490  60.721  -28.233 1.00 37.25  ? 493  LEU A CD2   1 
ATOM   2165 N N     . THR A 1 392 ? 12.027  59.610  -31.666 1.00 77.37  ? 494  THR A N     1 
ATOM   2166 C CA    . THR A 1 392 ? 10.861  59.324  -32.498 1.00 76.02  ? 494  THR A CA    1 
ATOM   2167 C C     . THR A 1 392 ? 9.907   60.534  -32.397 1.00 76.42  ? 494  THR A C     1 
ATOM   2168 O O     . THR A 1 392 ? 9.788   61.167  -31.317 1.00 71.83  ? 494  THR A O     1 
ATOM   2169 C CB    . THR A 1 392 ? 10.109  58.048  -32.013 1.00 54.02  ? 494  THR A CB    1 
ATOM   2170 O OG1   . THR A 1 392 ? 9.594   58.264  -30.696 1.00 52.47  ? 494  THR A OG1   1 
ATOM   2171 C CG2   . THR A 1 392 ? 11.062  56.826  -31.963 1.00 51.75  ? 494  THR A CG2   1 
ATOM   2172 N N     . PRO A 1 393 ? 9.235   60.886  -33.521 1.00 89.69  ? 495  PRO A N     1 
ATOM   2173 C CA    . PRO A 1 393 ? 8.300   62.008  -33.535 1.00 87.73  ? 495  PRO A CA    1 
ATOM   2174 C C     . PRO A 1 393 ? 7.172   61.793  -32.542 1.00 85.56  ? 495  PRO A C     1 
ATOM   2175 O O     . PRO A 1 393 ? 6.609   62.745  -32.054 1.00 86.12  ? 495  PRO A O     1 
ATOM   2176 C CB    . PRO A 1 393 ? 7.808   62.022  -34.975 1.00 67.21  ? 495  PRO A CB    1 
ATOM   2177 C CG    . PRO A 1 393 ? 8.982   61.557  -35.732 1.00 66.64  ? 495  PRO A CG    1 
ATOM   2178 C CD    . PRO A 1 393 ? 9.463   60.398  -34.894 1.00 68.22  ? 495  PRO A CD    1 
ATOM   2179 N N     . ASP A 1 394 ? 6.812   60.549  -32.251 1.00 86.40  ? 496  ASP A N     1 
ATOM   2180 C CA    . ASP A 1 394 ? 5.754   60.320  -31.256 1.00 83.65  ? 496  ASP A CA    1 
ATOM   2181 C C     . ASP A 1 394 ? 6.232   60.653  -29.814 1.00 78.58  ? 496  ASP A C     1 
ATOM   2182 O O     . ASP A 1 394 ? 5.417   61.074  -28.976 1.00 75.10  ? 496  ASP A O     1 
ATOM   2183 C CB    . ASP A 1 394 ? 5.154   58.890  -31.401 1.00 106.19 ? 496  ASP A CB    1 
ATOM   2184 C CG    . ASP A 1 394 ? 4.091   58.827  -32.506 1.00 112.80 ? 496  ASP A CG    1 
ATOM   2185 O OD1   . ASP A 1 394 ? 4.291   59.511  -33.531 1.00 111.66 ? 496  ASP A OD1   1 
ATOM   2186 O OD2   . ASP A 1 394 ? 3.068   58.121  -32.366 1.00 117.59 ? 496  ASP A OD2   1 
ATOM   2187 N N     . GLN A 1 395 ? 7.528   60.466  -29.535 1.00 47.19  ? 497  GLN A N     1 
ATOM   2188 C CA    . GLN A 1 395 ? 8.090   60.850  -28.251 1.00 41.81  ? 497  GLN A CA    1 
ATOM   2189 C C     . GLN A 1 395 ? 8.177   62.421  -28.211 1.00 39.98  ? 497  GLN A C     1 
ATOM   2190 O O     . GLN A 1 395 ? 7.702   63.093  -27.310 1.00 38.68  ? 497  GLN A O     1 
ATOM   2191 C CB    . GLN A 1 395 ? 9.514   60.341  -28.099 1.00 70.18  ? 497  GLN A CB    1 
ATOM   2192 C CG    . GLN A 1 395 ? 9.720   58.873  -27.970 1.00 71.21  ? 497  GLN A CG    1 
ATOM   2193 C CD    . GLN A 1 395 ? 11.207  58.552  -28.071 1.00 71.44  ? 497  GLN A CD    1 
ATOM   2194 O OE1   . GLN A 1 395 ? 11.774  58.486  -29.168 1.00 74.60  ? 497  GLN A OE1   1 
ATOM   2195 N NE2   . GLN A 1 395 ? 11.846  58.377  -26.924 1.00 71.78  ? 497  GLN A NE2   1 
ATOM   2196 N N     . VAL A 1 396 ? 8.836   63.034  -29.169 1.00 50.86  ? 498  VAL A N     1 
ATOM   2197 C CA    . VAL A 1 396 ? 8.892   64.469  -29.110 1.00 49.64  ? 498  VAL A CA    1 
ATOM   2198 C C     . VAL A 1 396 ? 7.453   65.021  -28.907 1.00 49.73  ? 498  VAL A C     1 
ATOM   2199 O O     . VAL A 1 396 ? 7.202   65.921  -28.081 1.00 48.57  ? 498  VAL A O     1 
ATOM   2200 C CB    . VAL A 1 396 ? 9.541   65.013  -30.377 1.00 48.70  ? 498  VAL A CB    1 
ATOM   2201 C CG1   . VAL A 1 396 ? 9.364   66.526  -30.419 1.00 49.19  ? 498  VAL A CG1   1 
ATOM   2202 C CG2   . VAL A 1 396 ? 11.033  64.624  -30.381 1.00 49.14  ? 498  VAL A CG2   1 
ATOM   2203 N N     . VAL A 1 397 ? 6.488   64.492  -29.642 1.00 50.19  ? 499  VAL A N     1 
ATOM   2204 C CA    . VAL A 1 397 ? 5.135   64.948  -29.445 1.00 47.06  ? 499  VAL A CA    1 
ATOM   2205 C C     . VAL A 1 397 ? 4.715   64.568  -28.038 1.00 44.12  ? 499  VAL A C     1 
ATOM   2206 O O     . VAL A 1 397 ? 4.434   65.406  -27.242 1.00 43.32  ? 499  VAL A O     1 
ATOM   2207 C CB    . VAL A 1 397 ? 4.190   64.354  -30.495 1.00 43.31  ? 499  VAL A CB    1 
ATOM   2208 C CG1   . VAL A 1 397 ? 2.735   64.454  -30.039 1.00 41.57  ? 499  VAL A CG1   1 
ATOM   2209 C CG2   . VAL A 1 397 ? 4.386   65.068  -31.797 1.00 45.08  ? 499  VAL A CG2   1 
ATOM   2210 N N     . ALA A 1 398 ? 4.704   63.305  -27.689 1.00 49.58  ? 500  ALA A N     1 
ATOM   2211 C CA    . ALA A 1 398 ? 4.311   62.950  -26.330 1.00 46.79  ? 500  ALA A CA    1 
ATOM   2212 C C     . ALA A 1 398 ? 4.867   63.919  -25.309 1.00 45.75  ? 500  ALA A C     1 
ATOM   2213 O O     . ALA A 1 398 ? 4.165   64.217  -24.374 1.00 45.76  ? 500  ALA A O     1 
ATOM   2214 C CB    . ALA A 1 398 ? 4.751   61.468  -25.964 1.00 26.73  ? 500  ALA A CB    1 
ATOM   2215 N N     . ILE A 1 399 ? 6.109   64.396  -25.481 1.00 42.46  ? 501  ILE A N     1 
ATOM   2216 C CA    . ILE A 1 399 ? 6.757   65.354  -24.545 1.00 41.82  ? 501  ILE A CA    1 
ATOM   2217 C C     . ILE A 1 399 ? 6.110   66.708  -24.699 1.00 41.38  ? 501  ILE A C     1 
ATOM   2218 O O     . ILE A 1 399 ? 5.974   67.427  -23.705 1.00 39.83  ? 501  ILE A O     1 
ATOM   2219 C CB    . ILE A 1 399 ? 8.268   65.656  -24.825 1.00 38.48  ? 501  ILE A CB    1 
ATOM   2220 C CG1   . ILE A 1 399 ? 9.174   64.522  -24.379 1.00 42.02  ? 501  ILE A CG1   1 
ATOM   2221 C CG2   . ILE A 1 399 ? 8.729   66.811  -23.992 1.00 36.84  ? 501  ILE A CG2   1 
ATOM   2222 C CD1   . ILE A 1 399 ? 10.644  64.759  -24.761 1.00 42.39  ? 501  ILE A CD1   1 
ATOM   2223 N N     . ALA A 1 400 ? 5.785   67.070  -25.949 1.00 44.60  ? 502  ALA A N     1 
ATOM   2224 C CA    . ALA A 1 400 ? 5.155   68.328  -26.255 1.00 45.50  ? 502  ALA A CA    1 
ATOM   2225 C C     . ALA A 1 400 ? 3.793   68.384  -25.658 1.00 46.91  ? 502  ALA A C     1 
ATOM   2226 O O     . ALA A 1 400 ? 3.310   69.454  -25.276 1.00 51.10  ? 502  ALA A O     1 
ATOM   2227 C CB    . ALA A 1 400 ? 5.027   68.456  -27.698 1.00 43.88  ? 502  ALA A CB    1 
ATOM   2228 N N     . SER A 1 401 ? 3.183   67.225  -25.533 1.00 51.66  ? 503  SER A N     1 
ATOM   2229 C CA    . SER A 1 401 ? 1.827   67.166  -25.101 1.00 53.21  ? 503  SER A CA    1 
ATOM   2230 C C     . SER A 1 401 ? 1.676   67.745  -23.715 1.00 53.55  ? 503  SER A C     1 
ATOM   2231 O O     . SER A 1 401 ? 0.918   68.726  -23.525 1.00 55.44  ? 503  SER A O     1 
ATOM   2232 C CB    . SER A 1 401 ? 1.247   65.804  -25.451 1.00 43.60  ? 503  SER A CB    1 
ATOM   2233 O OG    . SER A 1 401 ? 1.014   65.722  -26.865 1.00 45.82  ? 503  SER A OG    1 
ATOM   2234 N N     . ASN A 1 402 ? 2.441   67.219  -22.764 1.00 36.90  ? 504  ASN A N     1 
ATOM   2235 C CA    . ASN A 1 402 ? 2.303   67.683  -21.397 1.00 37.79  ? 504  ASN A CA    1 
ATOM   2236 C C     . ASN A 1 402 ? 3.527   68.169  -20.603 1.00 38.30  ? 504  ASN A C     1 
ATOM   2237 O O     . ASN A 1 402 ? 3.446   68.556  -19.424 1.00 38.59  ? 504  ASN A O     1 
ATOM   2238 C CB    . ASN A 1 402 ? 1.539   66.496  -20.736 1.00 72.38  ? 504  ASN A CB    1 
ATOM   2239 C CG    . ASN A 1 402 ? 1.986   65.123  -21.272 1.00 74.56  ? 504  ASN A CG    1 
ATOM   2240 O OD1   . ASN A 1 402 ? 1.146   64.254  -21.538 1.00 79.47  ? 504  ASN A OD1   1 
ATOM   2241 N ND2   . ASN A 1 402 ? 3.279   64.928  -21.438 1.00 72.96  ? 504  ASN A ND2   1 
ATOM   2242 N N     . GLY A 1 403 ? 4.664   68.157  -21.264 1.00 50.89  ? 505  GLY A N     1 
ATOM   2243 C CA    . GLY A 1 403 ? 5.820   68.824  -20.701 1.00 49.98  ? 505  GLY A CA    1 
ATOM   2244 C C     . GLY A 1 403 ? 5.847   70.295  -21.239 1.00 49.36  ? 505  GLY A C     1 
ATOM   2245 O O     . GLY A 1 403 ? 6.350   71.196  -20.539 1.00 48.85  ? 505  GLY A O     1 
ATOM   2246 N N     . GLY A 1 404 ? 5.354   70.539  -22.475 1.00 49.10  ? 506  GLY A N     1 
ATOM   2247 C CA    . GLY A 1 404 ? 5.309   71.899  -23.047 1.00 50.32  ? 506  GLY A CA    1 
ATOM   2248 C C     . GLY A 1 404 ? 6.593   72.489  -23.577 1.00 50.35  ? 506  GLY A C     1 
ATOM   2249 O O     . GLY A 1 404 ? 7.543   71.741  -23.777 1.00 54.10  ? 506  GLY A O     1 
ATOM   2250 N N     . LYS A 1 405 ? 6.638   73.805  -23.821 1.00 33.23  ? 507  LYS A N     1 
ATOM   2251 C CA    . LYS A 1 405 ? 7.844   74.474  -24.384 1.00 33.76  ? 507  LYS A CA    1 
ATOM   2252 C C     . LYS A 1 405 ? 9.036   74.203  -23.484 1.00 33.04  ? 507  LYS A C     1 
ATOM   2253 O O     . LYS A 1 405 ? 10.061  73.689  -23.918 1.00 34.22  ? 507  LYS A O     1 
ATOM   2254 C CB    . LYS A 1 405 ? 7.589   75.951  -24.491 1.00 42.39  ? 507  LYS A CB    1 
ATOM   2255 C CG    . LYS A 1 405 ? 8.753   76.823  -24.753 1.00 45.30  ? 507  LYS A CG    1 
ATOM   2256 C CD    . LYS A 1 405 ? 8.264   78.309  -24.573 1.00 47.40  ? 507  LYS A CD    1 
ATOM   2257 C CE    . LYS A 1 405 ? 9.212   79.379  -25.164 1.00 49.65  ? 507  LYS A CE    1 
ATOM   2258 N NZ    . LYS A 1 405 ? 8.931   79.548  -26.639 1.00 53.02  ? 507  LYS A NZ    1 
ATOM   2259 N N     . GLN A 1 406 ? 8.874   74.477  -22.196 1.00 21.63  ? 508  GLN A N     1 
ATOM   2260 C CA    . GLN A 1 406 ? 9.927   74.224  -21.194 1.00 21.69  ? 508  GLN A CA    1 
ATOM   2261 C C     . GLN A 1 406 ? 10.457  72.804  -21.156 1.00 22.12  ? 508  GLN A C     1 
ATOM   2262 O O     . GLN A 1 406 ? 11.594  72.645  -20.831 1.00 23.65  ? 508  GLN A O     1 
ATOM   2263 C CB    . GLN A 1 406 ? 9.432   74.541  -19.748 1.00 41.20  ? 508  GLN A CB    1 
ATOM   2264 C CG    . GLN A 1 406 ? 9.079   76.006  -19.356 1.00 40.31  ? 508  GLN A CG    1 
ATOM   2265 C CD    . GLN A 1 406 ? 9.734   77.015  -20.237 1.00 39.43  ? 508  GLN A CD    1 
ATOM   2266 O OE1   . GLN A 1 406 ? 10.951  77.057  -20.358 1.00 41.40  ? 508  GLN A OE1   1 
ATOM   2267 N NE2   . GLN A 1 406 ? 8.926   77.823  -20.892 1.00 38.14  ? 508  GLN A NE2   1 
ATOM   2268 N N     . ALA A 1 407 ? 9.624   71.784  -21.398 1.00 41.17  ? 509  ALA A N     1 
ATOM   2269 C CA    . ALA A 1 407 ? 10.076  70.395  -21.353 1.00 42.07  ? 509  ALA A CA    1 
ATOM   2270 C C     . ALA A 1 407 ? 10.931  70.050  -22.594 1.00 45.26  ? 509  ALA A C     1 
ATOM   2271 O O     . ALA A 1 407 ? 12.076  69.579  -22.431 1.00 48.86  ? 509  ALA A O     1 
ATOM   2272 C CB    . ALA A 1 407 ? 8.893   69.456  -21.213 1.00 10.15  ? 509  ALA A CB    1 
ATOM   2273 N N     . LEU A 1 408 ? 10.424  70.290  -23.810 1.00 35.79  ? 510  LEU A N     1 
ATOM   2274 C CA    . LEU A 1 408 ? 11.249  70.025  -25.008 1.00 38.02  ? 510  LEU A CA    1 
ATOM   2275 C C     . LEU A 1 408 ? 12.513  70.795  -24.742 1.00 41.61  ? 510  LEU A C     1 
ATOM   2276 O O     . LEU A 1 408 ? 13.560  70.212  -24.543 1.00 43.71  ? 510  LEU A O     1 
ATOM   2277 C CB    . LEU A 1 408 ? 10.613  70.598  -26.245 1.00 46.46  ? 510  LEU A CB    1 
ATOM   2278 C CG    . LEU A 1 408 ? 9.127   70.260  -26.439 1.00 45.75  ? 510  LEU A CG    1 
ATOM   2279 C CD1   . LEU A 1 408 ? 8.393   71.433  -26.931 1.00 45.41  ? 510  LEU A CD1   1 
ATOM   2280 C CD2   . LEU A 1 408 ? 8.993   69.084  -27.398 1.00 45.68  ? 510  LEU A CD2   1 
ATOM   2281 N N     . GLU A 1 409 ? 12.416  72.123  -24.679 1.00 45.25  ? 511  GLU A N     1 
ATOM   2282 C CA    . GLU A 1 409 ? 13.594  72.922  -24.406 1.00 49.53  ? 511  GLU A CA    1 
ATOM   2283 C C     . GLU A 1 409 ? 14.487  72.295  -23.353 1.00 50.89  ? 511  GLU A C     1 
ATOM   2284 O O     . GLU A 1 409 ? 15.593  71.926  -23.652 1.00 56.46  ? 511  GLU A O     1 
ATOM   2285 C CB    . GLU A 1 409 ? 13.202  74.356  -24.066 1.00 65.10  ? 511  GLU A CB    1 
ATOM   2286 C CG    . GLU A 1 409 ? 12.624  75.039  -25.304 1.00 70.03  ? 511  GLU A CG    1 
ATOM   2287 C CD    . GLU A 1 409 ? 12.531  76.566  -25.230 1.00 74.61  ? 511  GLU A CD    1 
ATOM   2288 O OE1   . GLU A 1 409 ? 12.211  77.098  -24.136 1.00 76.45  ? 511  GLU A OE1   1 
ATOM   2289 O OE2   . GLU A 1 409 ? 12.754  77.232  -26.290 1.00 79.83  ? 511  GLU A OE2   1 
ATOM   2290 N N     . THR A 1 410 ? 14.023  72.115  -22.146 1.00 53.01  ? 512  THR A N     1 
ATOM   2291 C CA    . THR A 1 410 ? 14.902  71.540  -21.136 1.00 57.19  ? 512  THR A CA    1 
ATOM   2292 C C     . THR A 1 410 ? 15.569  70.214  -21.631 1.00 59.59  ? 512  THR A C     1 
ATOM   2293 O O     . THR A 1 410 ? 16.679  69.880  -21.219 1.00 62.77  ? 512  THR A O     1 
ATOM   2294 C CB    . THR A 1 410 ? 14.114  71.330  -19.772 1.00 60.36  ? 512  THR A CB    1 
ATOM   2295 O OG1   . THR A 1 410 ? 13.595  72.592  -19.343 1.00 57.34  ? 512  THR A OG1   1 
ATOM   2296 C CG2   . THR A 1 410 ? 15.017  70.731  -18.647 1.00 59.88  ? 512  THR A CG2   1 
ATOM   2297 N N     . VAL A 1 411 ? 14.901  69.460  -22.498 1.00 51.84  ? 513  VAL A N     1 
ATOM   2298 C CA    . VAL A 1 411 ? 15.485  68.212  -23.013 1.00 56.65  ? 513  VAL A CA    1 
ATOM   2299 C C     . VAL A 1 411 ? 16.540  68.496  -24.114 1.00 58.91  ? 513  VAL A C     1 
ATOM   2300 O O     . VAL A 1 411 ? 17.447  67.723  -24.338 1.00 58.50  ? 513  VAL A O     1 
ATOM   2301 C CB    . VAL A 1 411 ? 14.364  67.220  -23.494 1.00 96.35  ? 513  VAL A CB    1 
ATOM   2302 C CG1   . VAL A 1 411 ? 14.879  66.287  -24.594 1.00 96.48  ? 513  VAL A CG1   1 
ATOM   2303 C CG2   . VAL A 1 411 ? 13.905  66.384  -22.310 1.00 94.49  ? 513  VAL A CG2   1 
ATOM   2304 N N     . GLN A 1 412 ? 16.404  69.598  -24.829 1.00 68.73  ? 514  GLN A N     1 
ATOM   2305 C CA    . GLN A 1 412 ? 17.453  70.020  -25.763 1.00 74.94  ? 514  GLN A CA    1 
ATOM   2306 C C     . GLN A 1 412 ? 18.641  70.271  -24.788 1.00 75.92  ? 514  GLN A C     1 
ATOM   2307 O O     . GLN A 1 412 ? 19.609  69.536  -24.769 1.00 78.63  ? 514  GLN A O     1 
ATOM   2308 C CB    . GLN A 1 412 ? 17.066  71.349  -26.428 1.00 127.54 ? 514  GLN A CB    1 
ATOM   2309 C CG    . GLN A 1 412 ? 18.125  71.964  -27.317 1.00 130.61 ? 514  GLN A CG    1 
ATOM   2310 C CD    . GLN A 1 412 ? 17.831  71.743  -28.782 1.00 135.31 ? 514  GLN A CD    1 
ATOM   2311 O OE1   . GLN A 1 412 ? 17.877  72.690  -29.569 1.00 135.53 ? 514  GLN A OE1   1 
ATOM   2312 N NE2   . GLN A 1 412 ? 17.520  70.490  -29.162 1.00 133.85 ? 514  GLN A NE2   1 
ATOM   2313 N N     . ARG A 1 413 ? 18.534  71.298  -23.952 1.00 66.91  ? 515  ARG A N     1 
ATOM   2314 C CA    . ARG A 1 413 ? 19.582  71.626  -22.989 1.00 69.31  ? 515  ARG A CA    1 
ATOM   2315 C C     . ARG A 1 413 ? 20.292  70.429  -22.338 1.00 66.94  ? 515  ARG A C     1 
ATOM   2316 O O     . ARG A 1 413 ? 21.508  70.324  -22.328 1.00 72.82  ? 515  ARG A O     1 
ATOM   2317 C CB    . ARG A 1 413 ? 19.050  72.505  -21.834 1.00 124.66 ? 515  ARG A CB    1 
ATOM   2318 C CG    . ARG A 1 413 ? 18.737  73.979  -22.131 1.00 130.21 ? 515  ARG A CG    1 
ATOM   2319 C CD    . ARG A 1 413 ? 17.212  74.245  -22.177 1.00 131.07 ? 515  ARG A CD    1 
ATOM   2320 N NE    . ARG A 1 413 ? 16.664  75.072  -21.082 1.00 131.35 ? 515  ARG A NE    1 
ATOM   2321 C CZ    . ARG A 1 413 ? 16.515  74.703  -19.802 1.00 128.88 ? 515  ARG A CZ    1 
ATOM   2322 N NH1   . ARG A 1 413 ? 16.872  73.497  -19.386 1.00 129.82 ? 515  ARG A NH1   1 
ATOM   2323 N NH2   . ARG A 1 413 ? 15.988  75.548  -18.925 1.00 120.90 ? 515  ARG A NH2   1 
ATOM   2324 N N     . LEU A 1 414 ? 19.541  69.491  -21.838 1.00 52.49  ? 516  LEU A N     1 
ATOM   2325 C CA    . LEU A 1 414 ? 20.153  68.425  -21.056 1.00 54.19  ? 516  LEU A CA    1 
ATOM   2326 C C     . LEU A 1 414 ? 20.160  66.943  -21.523 1.00 55.93  ? 516  LEU A C     1 
ATOM   2327 O O     . LEU A 1 414 ? 20.566  66.056  -20.734 1.00 53.01  ? 516  LEU A O     1 
ATOM   2328 C CB    . LEU A 1 414 ? 19.558  68.473  -19.622 1.00 49.34  ? 516  LEU A CB    1 
ATOM   2329 C CG    . LEU A 1 414 ? 19.430  69.772  -18.795 1.00 44.68  ? 516  LEU A CG    1 
ATOM   2330 C CD1   . LEU A 1 414 ? 19.127  69.400  -17.342 1.00 41.83  ? 516  LEU A CD1   1 
ATOM   2331 C CD2   . LEU A 1 414 ? 20.692  70.559  -18.858 1.00 46.14  ? 516  LEU A CD2   1 
ATOM   2332 N N     . LEU A 1 415 ? 19.741  66.667  -22.764 1.00 79.62  ? 517  LEU A N     1 
ATOM   2333 C CA    . LEU A 1 415 ? 19.703  65.282  -23.224 1.00 83.81  ? 517  LEU A CA    1 
ATOM   2334 C C     . LEU A 1 415 ? 21.054  64.666  -22.937 1.00 85.68  ? 517  LEU A C     1 
ATOM   2335 O O     . LEU A 1 415 ? 21.146  63.768  -22.094 1.00 83.29  ? 517  LEU A O     1 
ATOM   2336 C CB    . LEU A 1 415 ? 19.375  65.192  -24.714 1.00 90.10  ? 517  LEU A CB    1 
ATOM   2337 C CG    . LEU A 1 415 ? 19.031  63.808  -25.294 1.00 92.06  ? 517  LEU A CG    1 
ATOM   2338 C CD1   . LEU A 1 415 ? 20.285  62.971  -25.546 1.00 96.02  ? 517  LEU A CD1   1 
ATOM   2339 C CD2   . LEU A 1 415 ? 18.063  63.090  -24.360 1.00 94.02  ? 517  LEU A CD2   1 
ATOM   2340 N N     . PRO A 1 416 ? 22.127  65.158  -23.609 1.00 77.50  ? 518  PRO A N     1 
ATOM   2341 C CA    . PRO A 1 416 ? 23.506  64.652  -23.420 1.00 78.54  ? 518  PRO A CA    1 
ATOM   2342 C C     . PRO A 1 416 ? 23.996  64.671  -21.979 1.00 77.45  ? 518  PRO A C     1 
ATOM   2343 O O     . PRO A 1 416 ? 24.443  63.663  -21.431 1.00 78.37  ? 518  PRO A O     1 
ATOM   2344 C CB    . PRO A 1 416 ? 24.367  65.586  -24.275 1.00 85.20  ? 518  PRO A CB    1 
ATOM   2345 C CG    . PRO A 1 416 ? 23.528  66.805  -24.400 1.00 82.70  ? 518  PRO A CG    1 
ATOM   2346 C CD    . PRO A 1 416 ? 22.110  66.284  -24.557 1.00 78.10  ? 518  PRO A CD    1 
ATOM   2347 N N     . VAL A 1 417 ? 23.893  65.834  -21.362 1.00 69.86  ? 519  VAL A N     1 
ATOM   2348 C CA    . VAL A 1 417 ? 24.394  66.008  -19.994 1.00 70.34  ? 519  VAL A CA    1 
ATOM   2349 C C     . VAL A 1 417 ? 23.930  64.930  -19.060 1.00 71.68  ? 519  VAL A C     1 
ATOM   2350 O O     . VAL A 1 417 ? 24.600  64.648  -18.046 1.00 70.72  ? 519  VAL A O     1 
ATOM   2351 C CB    . VAL A 1 417 ? 23.990  67.412  -19.374 1.00 59.73  ? 519  VAL A CB    1 
ATOM   2352 C CG1   . VAL A 1 417 ? 24.903  67.748  -18.209 1.00 59.82  ? 519  VAL A CG1   1 
ATOM   2353 C CG2   . VAL A 1 417 ? 24.030  68.514  -20.446 1.00 57.75  ? 519  VAL A CG2   1 
ATOM   2354 N N     . LEU A 1 418 ? 22.785  64.351  -19.422 1.00 65.95  ? 520  LEU A N     1 
ATOM   2355 C CA    . LEU A 1 418 ? 22.145  63.332  -18.614 1.00 66.22  ? 520  LEU A CA    1 
ATOM   2356 C C     . LEU A 1 418 ? 22.291  61.925  -19.158 1.00 72.32  ? 520  LEU A C     1 
ATOM   2357 O O     . LEU A 1 418 ? 23.056  61.112  -18.621 1.00 77.81  ? 520  LEU A O     1 
ATOM   2358 C CB    . LEU A 1 418 ? 20.655  63.662  -18.431 1.00 70.09  ? 520  LEU A CB    1 
ATOM   2359 C CG    . LEU A 1 418 ? 20.196  64.410  -17.169 1.00 67.17  ? 520  LEU A CG    1 
ATOM   2360 C CD1   . LEU A 1 418 ? 18.841  65.076  -17.403 1.00 60.00  ? 520  LEU A CD1   1 
ATOM   2361 C CD2   . LEU A 1 418 ? 20.117  63.450  -15.998 1.00 69.30  ? 520  LEU A CD2   1 
ATOM   2362 N N     . CYS A 1 419 ? 21.582  61.649  -20.247 1.00 93.20  ? 521  CYS A N     1 
ATOM   2363 C CA    . CYS A 1 419 ? 21.579  60.310  -20.804 1.00 93.46  ? 521  CYS A CA    1 
ATOM   2364 C C     . CYS A 1 419 ? 22.997  59.770  -20.932 1.00 98.49  ? 521  CYS A C     1 
ATOM   2365 O O     . CYS A 1 419 ? 23.262  58.578  -20.640 1.00 103.23 ? 521  CYS A O     1 
ATOM   2366 C CB    . CYS A 1 419 ? 20.823  60.282  -22.130 1.00 79.60  ? 521  CYS A CB    1 
ATOM   2367 S SG    . CYS A 1 419 ? 21.809  60.315  -23.584 1.00 86.92  ? 521  CYS A SG    1 
ATOM   2368 N N     . GLN A 1 420 ? 23.903  60.683  -21.298 1.00 97.26  ? 522  GLN A N     1 
ATOM   2369 C CA    . GLN A 1 420 ? 25.318  60.386  -21.472 1.00 101.78 ? 522  GLN A CA    1 
ATOM   2370 C C     . GLN A 1 420 ? 26.226  60.890  -20.348 1.00 104.62 ? 522  GLN A C     1 
ATOM   2371 O O     . GLN A 1 420 ? 27.347  61.371  -20.604 1.00 100.40 ? 522  GLN A O     1 
ATOM   2372 C CB    . GLN A 1 420 ? 25.814  60.901  -22.837 1.00 83.52  ? 522  GLN A CB    1 
ATOM   2373 C CG    . GLN A 1 420 ? 24.975  60.408  -24.057 1.00 81.14  ? 522  GLN A CG    1 
ATOM   2374 C CD    . GLN A 1 420 ? 24.578  61.548  -25.005 1.00 79.27  ? 522  GLN A CD    1 
ATOM   2375 O OE1   . GLN A 1 420 ? 25.262  62.567  -25.063 1.00 81.07  ? 522  GLN A OE1   1 
ATOM   2376 N NE2   . GLN A 1 420 ? 23.484  61.372  -25.755 1.00 75.55  ? 522  GLN A NE2   1 
ATOM   2377 N N     . ALA A 1 421 ? 25.715  60.872  -19.117 1.00 151.15 ? 523  ALA A N     1 
ATOM   2378 C CA    . ALA A 1 421 ? 26.617  61.134  -17.997 1.00 154.70 ? 523  ALA A CA    1 
ATOM   2379 C C     . ALA A 1 421 ? 26.181  60.379  -16.679 1.00 154.24 ? 523  ALA A C     1 
ATOM   2380 O O     . ALA A 1 421 ? 26.948  59.563  -16.208 1.00 154.83 ? 523  ALA A O     1 
ATOM   2381 C CB    . ALA A 1 421 ? 27.022  62.684  -17.887 1.00 133.70 ? 523  ALA A CB    1 
ATOM   2382 N N     . HIS A 1 422 ? 24.922  60.511  -16.241 1.00 128.52 ? 524  HIS A N     1 
ATOM   2383 C CA    . HIS A 1 422 ? 24.293  59.821  -15.074 1.00 118.45 ? 524  HIS A CA    1 
ATOM   2384 C C     . HIS A 1 422 ? 23.552  58.487  -15.321 1.00 111.38 ? 524  HIS A C     1 
ATOM   2385 O O     . HIS A 1 422 ? 22.562  58.215  -14.626 1.00 105.12 ? 524  HIS A O     1 
ATOM   2386 C CB    . HIS A 1 422 ? 23.202  60.698  -14.585 1.00 133.27 ? 524  HIS A CB    1 
ATOM   2387 C CG    . HIS A 1 422 ? 23.689  61.882  -13.874 1.00 140.25 ? 524  HIS A CG    1 
ATOM   2388 N ND1   . HIS A 1 422 ? 23.716  61.925  -12.499 1.00 142.87 ? 524  HIS A ND1   1 
ATOM   2389 C CD2   . HIS A 1 422 ? 24.119  63.088  -14.308 1.00 142.85 ? 524  HIS A CD2   1 
ATOM   2390 C CE1   . HIS A 1 422 ? 24.126  63.115  -12.122 1.00 142.37 ? 524  HIS A CE1   1 
ATOM   2391 N NE2   . HIS A 1 422 ? 24.379  63.847  -13.200 1.00 141.31 ? 524  HIS A NE2   1 
ATOM   2392 N N     . GLY A 1 423 ? 23.938  57.726  -16.342 1.00 90.96  ? 525  GLY A N     1 
ATOM   2393 C CA    . GLY A 1 423 ? 23.321  56.431  -16.631 1.00 88.51  ? 525  GLY A CA    1 
ATOM   2394 C C     . GLY A 1 423 ? 21.916  56.424  -17.205 1.00 86.90  ? 525  GLY A C     1 
ATOM   2395 O O     . GLY A 1 423 ? 21.167  55.460  -17.002 1.00 89.83  ? 525  GLY A O     1 
ATOM   2396 N N     . LEU A 1 424 ? 21.551  57.469  -17.945 1.00 75.38  ? 526  LEU A N     1 
ATOM   2397 C CA    . LEU A 1 424 ? 20.204  57.536  -18.469 1.00 66.52  ? 526  LEU A CA    1 
ATOM   2398 C C     . LEU A 1 424 ? 20.087  57.261  -19.934 1.00 67.50  ? 526  LEU A C     1 
ATOM   2399 O O     . LEU A 1 424 ? 21.051  57.294  -20.705 1.00 66.30  ? 526  LEU A O     1 
ATOM   2400 C CB    . LEU A 1 424 ? 19.548  58.860  -18.094 1.00 46.09  ? 526  LEU A CB    1 
ATOM   2401 C CG    . LEU A 1 424 ? 19.401  59.193  -16.578 1.00 45.25  ? 526  LEU A CG    1 
ATOM   2402 C CD1   . LEU A 1 424 ? 18.195  60.163  -16.328 1.00 40.03  ? 526  LEU A CD1   1 
ATOM   2403 C CD2   . LEU A 1 424 ? 19.157  57.923  -15.774 1.00 43.58  ? 526  LEU A CD2   1 
ATOM   2404 N N     . THR A 1 425 ? 18.867  56.933  -20.298 1.00 87.08  ? 527  THR A N     1 
ATOM   2405 C CA    . THR A 1 425 ? 18.524  56.573  -21.654 1.00 85.82  ? 527  THR A CA    1 
ATOM   2406 C C     . THR A 1 425 ? 17.602  57.639  -22.140 1.00 86.31  ? 527  THR A C     1 
ATOM   2407 O O     . THR A 1 425 ? 16.819  58.183  -21.364 1.00 86.34  ? 527  THR A O     1 
ATOM   2408 C CB    . THR A 1 425 ? 17.735  55.252  -21.675 1.00 62.45  ? 527  THR A CB    1 
ATOM   2409 O OG1   . THR A 1 425 ? 16.866  55.206  -20.515 1.00 54.24  ? 527  THR A OG1   1 
ATOM   2410 C CG2   . THR A 1 425 ? 18.682  54.051  -21.697 1.00 61.62  ? 527  THR A CG2   1 
ATOM   2411 N N     . PRO A 1 426 ? 17.696  57.976  -23.418 1.00 89.23  ? 528  PRO A N     1 
ATOM   2412 C CA    . PRO A 1 426 ? 16.802  58.987  -23.964 1.00 87.94  ? 528  PRO A CA    1 
ATOM   2413 C C     . PRO A 1 426 ? 15.312  58.572  -23.779 1.00 84.98  ? 528  PRO A C     1 
ATOM   2414 O O     . PRO A 1 426 ? 14.405  59.298  -24.192 1.00 90.57  ? 528  PRO A O     1 
ATOM   2415 C CB    . PRO A 1 426 ? 17.229  59.045  -25.432 1.00 83.51  ? 528  PRO A CB    1 
ATOM   2416 C CG    . PRO A 1 426 ? 18.691  58.890  -25.339 1.00 85.59  ? 528  PRO A CG    1 
ATOM   2417 C CD    . PRO A 1 426 ? 18.890  57.813  -24.261 1.00 83.17  ? 528  PRO A CD    1 
ATOM   2418 N N     . ASP A 1 427 ? 15.056  57.403  -23.190 1.00 62.79  ? 529  ASP A N     1 
ATOM   2419 C CA    . ASP A 1 427 ? 13.673  56.943  -22.963 1.00 53.90  ? 529  ASP A CA    1 
ATOM   2420 C C     . ASP A 1 427 ? 13.306  57.182  -21.497 1.00 50.20  ? 529  ASP A C     1 
ATOM   2421 O O     . ASP A 1 427 ? 12.248  57.696  -21.199 1.00 47.54  ? 529  ASP A O     1 
ATOM   2422 C CB    . ASP A 1 427 ? 13.487  55.503  -23.458 1.00 75.89  ? 529  ASP A CB    1 
ATOM   2423 C CG    . ASP A 1 427 ? 13.428  55.429  -25.007 1.00 76.34  ? 529  ASP A CG    1 
ATOM   2424 O OD1   . ASP A 1 427 ? 13.047  56.455  -25.612 1.00 75.90  ? 529  ASP A OD1   1 
ATOM   2425 O OD2   . ASP A 1 427 ? 13.727  54.378  -25.625 1.00 70.78  ? 529  ASP A OD2   1 
ATOM   2426 N N     . GLN A 1 428 ? 14.191  56.871  -20.570 1.00 52.15  ? 530  GLN A N     1 
ATOM   2427 C CA    . GLN A 1 428 ? 13.944  57.232  -19.190 1.00 51.90  ? 530  GLN A CA    1 
ATOM   2428 C C     . GLN A 1 428 ? 13.875  58.783  -19.199 1.00 52.04  ? 530  GLN A C     1 
ATOM   2429 O O     . GLN A 1 428 ? 13.193  59.391  -18.378 1.00 51.33  ? 530  GLN A O     1 
ATOM   2430 C CB    . GLN A 1 428 ? 15.129  56.826  -18.310 1.00 56.73  ? 530  GLN A CB    1 
ATOM   2431 C CG    . GLN A 1 428 ? 15.081  55.437  -17.734 1.00 60.39  ? 530  GLN A CG    1 
ATOM   2432 C CD    . GLN A 1 428 ? 16.344  55.101  -16.944 1.00 60.67  ? 530  GLN A CD    1 
ATOM   2433 O OE1   . GLN A 1 428 ? 17.403  55.630  -17.250 1.00 59.98  ? 530  GLN A OE1   1 
ATOM   2434 N NE2   . GLN A 1 428 ? 16.236  54.213  -15.935 1.00 59.88  ? 530  GLN A NE2   1 
ATOM   2435 N N     . VAL A 1 429 ? 14.586  59.444  -20.106 1.00 73.86  ? 531  VAL A N     1 
ATOM   2436 C CA    . VAL A 1 429 ? 14.592  60.915  -20.058 1.00 74.31  ? 531  VAL A CA    1 
ATOM   2437 C C     . VAL A 1 429 ? 13.287  61.467  -20.572 1.00 75.18  ? 531  VAL A C     1 
ATOM   2438 O O     . VAL A 1 429 ? 12.666  62.304  -19.899 1.00 74.18  ? 531  VAL A O     1 
ATOM   2439 C CB    . VAL A 1 429 ? 15.808  61.505  -20.808 1.00 50.05  ? 531  VAL A CB    1 
ATOM   2440 C CG1   . VAL A 1 429 ? 15.849  62.987  -20.667 1.00 47.77  ? 531  VAL A CG1   1 
ATOM   2441 C CG2   . VAL A 1 429 ? 17.081  60.936  -20.193 1.00 51.80  ? 531  VAL A CG2   1 
ATOM   2442 N N     . VAL A 1 430 ? 12.871  61.005  -21.751 1.00 60.63  ? 532  VAL A N     1 
ATOM   2443 C CA    . VAL A 1 430 ? 11.581  61.412  -22.285 1.00 55.74  ? 532  VAL A CA    1 
ATOM   2444 C C     . VAL A 1 430 ? 10.564  61.059  -21.178 1.00 53.77  ? 532  VAL A C     1 
ATOM   2445 O O     . VAL A 1 430 ? 9.775   61.895  -20.742 1.00 51.69  ? 532  VAL A O     1 
ATOM   2446 C CB    . VAL A 1 430 ? 11.226  60.658  -23.596 1.00 36.15  ? 532  VAL A CB    1 
ATOM   2447 C CG1   . VAL A 1 430 ? 9.811   61.050  -24.034 1.00 30.87  ? 532  VAL A CG1   1 
ATOM   2448 C CG2   . VAL A 1 430 ? 12.199  61.027  -24.686 1.00 35.46  ? 532  VAL A CG2   1 
ATOM   2449 N N     . ALA A 1 431 ? 10.593  59.821  -20.693 1.00 41.59  ? 533  ALA A N     1 
ATOM   2450 C CA    . ALA A 1 431 ? 9.671   59.451  -19.609 1.00 39.62  ? 533  ALA A CA    1 
ATOM   2451 C C     . ALA A 1 431 ? 9.541   60.604  -18.572 1.00 37.15  ? 533  ALA A C     1 
ATOM   2452 O O     . ALA A 1 431 ? 8.456   60.993  -18.249 1.00 34.00  ? 533  ALA A O     1 
ATOM   2453 C CB    . ALA A 1 431 ? 10.126  58.139  -18.931 1.00 38.67  ? 533  ALA A CB    1 
ATOM   2454 N N     . ILE A 1 432 ? 10.648  61.161  -18.095 1.00 46.62  ? 534  ILE A N     1 
ATOM   2455 C CA    . ILE A 1 432 ? 10.628  62.266  -17.124 1.00 45.70  ? 534  ILE A CA    1 
ATOM   2456 C C     . ILE A 1 432 ? 10.064  63.539  -17.704 1.00 44.01  ? 534  ILE A C     1 
ATOM   2457 O O     . ILE A 1 432 ? 9.287   64.232  -17.040 1.00 42.96  ? 534  ILE A O     1 
ATOM   2458 C CB    . ILE A 1 432 ? 12.025  62.603  -16.564 1.00 44.64  ? 534  ILE A CB    1 
ATOM   2459 C CG1   . ILE A 1 432 ? 12.586  61.405  -15.779 1.00 46.67  ? 534  ILE A CG1   1 
ATOM   2460 C CG2   . ILE A 1 432 ? 11.922  63.782  -15.627 1.00 44.25  ? 534  ILE A CG2   1 
ATOM   2461 C CD1   . ILE A 1 432 ? 13.898  61.762  -15.019 1.00 47.34  ? 534  ILE A CD1   1 
ATOM   2462 N N     . ALA A 1 433 ? 10.440  63.833  -18.943 1.00 54.13  ? 535  ALA A N     1 
ATOM   2463 C CA    . ALA A 1 433 ? 9.972   65.054  -19.604 1.00 53.79  ? 535  ALA A CA    1 
ATOM   2464 C C     . ALA A 1 433 ? 8.582   65.023  -20.187 1.00 51.59  ? 535  ALA A C     1 
ATOM   2465 O O     . ALA A 1 433 ? 8.212   66.001  -20.807 1.00 53.18  ? 535  ALA A O     1 
ATOM   2466 C CB    . ALA A 1 433 ? 10.972  65.507  -20.700 1.00 46.04  ? 535  ALA A CB    1 
ATOM   2467 N N     . SER A 1 434 ? 7.803   63.951  -19.989 1.00 47.67  ? 536  SER A N     1 
ATOM   2468 C CA    . SER A 1 434 ? 6.458   63.901  -20.567 1.00 46.01  ? 536  SER A CA    1 
ATOM   2469 C C     . SER A 1 434 ? 5.339   63.946  -19.524 1.00 45.82  ? 536  SER A C     1 
ATOM   2470 O O     . SER A 1 434 ? 4.475   63.033  -19.465 1.00 46.03  ? 536  SER A O     1 
ATOM   2471 C CB    . SER A 1 434 ? 6.289   62.635  -21.378 1.00 40.70  ? 536  SER A CB    1 
ATOM   2472 O OG    . SER A 1 434 ? 7.502   62.211  -21.998 1.00 44.67  ? 536  SER A OG    1 
ATOM   2473 N N     . HIS A 1 435 ? 5.342   65.019  -18.725 1.00 35.51  ? 537  HIS A N     1 
ATOM   2474 C CA    . HIS A 1 435 ? 4.414   65.326  -17.641 1.00 33.15  ? 537  HIS A CA    1 
ATOM   2475 C C     . HIS A 1 435 ? 4.437   66.876  -17.354 1.00 35.79  ? 537  HIS A C     1 
ATOM   2476 O O     . HIS A 1 435 ? 5.426   67.577  -17.542 1.00 34.19  ? 537  HIS A O     1 
ATOM   2477 C CB    . HIS A 1 435 ? 4.843   64.563  -16.457 1.00 37.98  ? 537  HIS A CB    1 
ATOM   2478 C CG    . HIS A 1 435 ? 4.959   63.078  -16.695 1.00 38.88  ? 537  HIS A CG    1 
ATOM   2479 N ND1   . HIS A 1 435 ? 6.146   62.360  -16.570 1.00 39.86  ? 537  HIS A ND1   1 
ATOM   2480 C CD2   . HIS A 1 435 ? 4.043   62.173  -17.123 1.00 38.84  ? 537  HIS A CD2   1 
ATOM   2481 C CE1   . HIS A 1 435 ? 5.943   61.101  -16.901 1.00 38.07  ? 537  HIS A CE1   1 
ATOM   2482 N NE2   . HIS A 1 435 ? 4.678   60.952  -17.241 1.00 38.65  ? 537  HIS A NE2   1 
ATOM   2483 N N     . ASP A 1 436 ? 3.336   67.451  -16.893 1.00 38.64  ? 538  ASP A N     1 
ATOM   2484 C CA    . ASP A 1 436 ? 3.283   68.900  -16.680 1.00 41.56  ? 538  ASP A CA    1 
ATOM   2485 C C     . ASP A 1 436 ? 4.557   69.357  -16.064 1.00 41.99  ? 538  ASP A C     1 
ATOM   2486 O O     . ASP A 1 436 ? 5.292   70.116  -16.702 1.00 44.63  ? 538  ASP A O     1 
ATOM   2487 C CB    . ASP A 1 436 ? 2.014   69.327  -15.900 1.00 53.84  ? 538  ASP A CB    1 
ATOM   2488 C CG    . ASP A 1 436 ? 0.888   69.757  -16.840 1.00 63.65  ? 538  ASP A CG    1 
ATOM   2489 O OD1   . ASP A 1 436 ? 1.095   69.708  -18.089 1.00 65.38  ? 538  ASP A OD1   1 
ATOM   2490 O OD2   . ASP A 1 436 ? -0.192  70.151  -16.341 1.00 65.84  ? 538  ASP A OD2   1 
ATOM   2491 N N     . GLY A 1 437 ? 4.850   68.911  -14.856 1.00 52.16  ? 539  GLY A N     1 
ATOM   2492 C CA    . GLY A 1 437 ? 6.142   69.284  -14.276 1.00 54.97  ? 539  GLY A CA    1 
ATOM   2493 C C     . GLY A 1 437 ? 7.189   69.673  -15.366 1.00 54.74  ? 539  GLY A C     1 
ATOM   2494 O O     . GLY A 1 437 ? 7.625   70.825  -15.454 1.00 51.97  ? 539  GLY A O     1 
ATOM   2495 N N     . GLY A 1 438 ? 7.587   68.698  -16.187 1.00 43.47  ? 540  GLY A N     1 
ATOM   2496 C CA    . GLY A 1 438 ? 8.529   68.924  -17.267 1.00 45.62  ? 540  GLY A CA    1 
ATOM   2497 C C     . GLY A 1 438 ? 9.965   69.299  -16.898 1.00 45.90  ? 540  GLY A C     1 
ATOM   2498 O O     . GLY A 1 438 ? 10.763  68.500  -16.392 1.00 44.16  ? 540  GLY A O     1 
ATOM   2499 N N     . LYS A 1 439 ? 10.280  70.543  -17.224 1.00 42.60  ? 541  LYS A N     1 
ATOM   2500 C CA    . LYS A 1 439 ? 11.569  71.148  -16.983 1.00 44.86  ? 541  LYS A CA    1 
ATOM   2501 C C     . LYS A 1 439 ? 11.904  70.908  -15.529 1.00 45.08  ? 541  LYS A C     1 
ATOM   2502 O O     . LYS A 1 439 ? 12.895  70.282  -15.195 1.00 48.37  ? 541  LYS A O     1 
ATOM   2503 C CB    . LYS A 1 439 ? 11.425  72.635  -17.267 1.00 60.31  ? 541  LYS A CB    1 
ATOM   2504 C CG    . LYS A 1 439 ? 12.627  73.529  -17.081 1.00 64.30  ? 541  LYS A CG    1 
ATOM   2505 C CD    . LYS A 1 439 ? 12.181  74.989  -16.866 1.00 67.51  ? 541  LYS A CD    1 
ATOM   2506 C CE    . LYS A 1 439 ? 13.186  75.991  -17.379 1.00 71.37  ? 541  LYS A CE    1 
ATOM   2507 N NZ    . LYS A 1 439 ? 13.187  76.097  -18.913 1.00 73.66  ? 541  LYS A NZ    1 
ATOM   2508 N N     . GLN A 1 440 ? 11.047  71.436  -14.676 1.00 43.99  ? 542  GLN A N     1 
ATOM   2509 C CA    . GLN A 1 440 ? 11.121  71.317  -13.228 1.00 42.63  ? 542  GLN A CA    1 
ATOM   2510 C C     . GLN A 1 440 ? 11.645  69.955  -12.729 1.00 41.76  ? 542  GLN A C     1 
ATOM   2511 O O     . GLN A 1 440 ? 12.447  69.927  -11.816 1.00 42.38  ? 542  GLN A O     1 
ATOM   2512 C CB    . GLN A 1 440 ? 9.715   71.575  -12.681 1.00 59.97  ? 542  GLN A CB    1 
ATOM   2513 C CG    . GLN A 1 440 ? 9.460   72.999  -12.156 1.00 59.58  ? 542  GLN A CG    1 
ATOM   2514 C CD    . GLN A 1 440 ? 10.518  73.958  -12.560 1.00 60.22  ? 542  GLN A CD    1 
ATOM   2515 O OE1   . GLN A 1 440 ? 10.320  74.710  -13.516 1.00 58.02  ? 542  GLN A OE1   1 
ATOM   2516 N NE2   . GLN A 1 440 ? 11.654  73.950  -11.851 1.00 60.53  ? 542  GLN A NE2   1 
ATOM   2517 N N     . ALA A 1 441 ? 11.189  68.820  -13.246 1.00 46.71  ? 543  ALA A N     1 
ATOM   2518 C CA    . ALA A 1 441 ? 11.796  67.581  -12.755 1.00 49.69  ? 543  ALA A CA    1 
ATOM   2519 C C     . ALA A 1 441 ? 13.162  67.414  -13.426 1.00 50.88  ? 543  ALA A C     1 
ATOM   2520 O O     . ALA A 1 441 ? 14.144  67.531  -12.725 1.00 53.42  ? 543  ALA A O     1 
ATOM   2521 C CB    . ALA A 1 441 ? 10.945  66.355  -13.013 1.00 57.74  ? 543  ALA A CB    1 
ATOM   2522 N N     . LEU A 1 442 ? 13.259  67.178  -14.749 1.00 43.31  ? 544  LEU A N     1 
ATOM   2523 C CA    . LEU A 1 442 ? 14.572  66.964  -15.390 1.00 44.72  ? 544  LEU A CA    1 
ATOM   2524 C C     . LEU A 1 442 ? 15.718  67.618  -14.606 1.00 47.35  ? 544  LEU A C     1 
ATOM   2525 O O     . LEU A 1 442 ? 16.738  66.952  -14.281 1.00 45.22  ? 544  LEU A O     1 
ATOM   2526 C CB    . LEU A 1 442 ? 14.579  67.452  -16.821 1.00 39.59  ? 544  LEU A CB    1 
ATOM   2527 C CG    . LEU A 1 442 ? 14.048  66.368  -17.733 1.00 38.97  ? 544  LEU A CG    1 
ATOM   2528 C CD1   . LEU A 1 442 ? 13.806  66.904  -19.153 1.00 39.61  ? 544  LEU A CD1   1 
ATOM   2529 C CD2   . LEU A 1 442 ? 15.062  65.254  -17.802 1.00 41.63  ? 544  LEU A CD2   1 
ATOM   2530 N N     . GLU A 1 443 ? 15.530  68.899  -14.279 1.00 50.21  ? 545  GLU A N     1 
ATOM   2531 C CA    . GLU A 1 443 ? 16.487  69.641  -13.465 1.00 55.26  ? 545  GLU A CA    1 
ATOM   2532 C C     . GLU A 1 443 ? 16.659  68.954  -12.081 1.00 58.96  ? 545  GLU A C     1 
ATOM   2533 O O     . GLU A 1 443 ? 17.740  68.431  -11.780 1.00 61.75  ? 545  GLU A O     1 
ATOM   2534 C CB    . GLU A 1 443 ? 16.020  71.094  -13.288 1.00 62.82  ? 545  GLU A CB    1 
ATOM   2535 C CG    . GLU A 1 443 ? 16.135  71.909  -14.611 1.00 68.48  ? 545  GLU A CG    1 
ATOM   2536 C CD    . GLU A 1 443 ? 15.565  73.318  -14.472 1.00 73.58  ? 545  GLU A CD    1 
ATOM   2537 O OE1   . GLU A 1 443 ? 14.627  73.458  -13.653 1.00 75.37  ? 545  GLU A OE1   1 
ATOM   2538 O OE2   . GLU A 1 443 ? 16.026  74.262  -15.165 1.00 74.86  ? 545  GLU A OE2   1 
ATOM   2539 N N     . THR A 1 444 ? 15.602  68.934  -11.258 1.00 50.12  ? 546  THR A N     1 
ATOM   2540 C CA    . THR A 1 444 ? 15.682  68.344  -9.939  1.00 49.87  ? 546  THR A CA    1 
ATOM   2541 C C     . THR A 1 444 ? 16.275  66.941  -10.014 1.00 55.01  ? 546  THR A C     1 
ATOM   2542 O O     . THR A 1 444 ? 16.814  66.438  -9.017  1.00 57.87  ? 546  THR A O     1 
ATOM   2543 C CB    . THR A 1 444 ? 14.332  68.281  -9.280  1.00 49.91  ? 546  THR A CB    1 
ATOM   2544 O OG1   . THR A 1 444 ? 13.624  69.488  -9.554  1.00 49.16  ? 546  THR A OG1   1 
ATOM   2545 C CG2   . THR A 1 444 ? 14.494  68.185  -7.780  1.00 50.70  ? 546  THR A CG2   1 
ATOM   2546 N N     . VAL A 1 445 ? 16.182  66.271  -11.168 1.00 71.88  ? 547  VAL A N     1 
ATOM   2547 C CA    . VAL A 1 445 ? 16.799  64.946  -11.304 1.00 74.30  ? 547  VAL A CA    1 
ATOM   2548 C C     . VAL A 1 445 ? 18.314  65.171  -11.476 1.00 79.48  ? 547  VAL A C     1 
ATOM   2549 O O     . VAL A 1 445 ? 19.120  64.601  -10.736 1.00 80.04  ? 547  VAL A O     1 
ATOM   2550 C CB    . VAL A 1 445 ? 16.227  64.174  -12.500 1.00 73.83  ? 547  VAL A CB    1 
ATOM   2551 C CG1   . VAL A 1 445 ? 17.260  63.215  -13.089 1.00 70.87  ? 547  VAL A CG1   1 
ATOM   2552 C CG2   . VAL A 1 445 ? 15.000  63.427  -12.030 1.00 71.24  ? 547  VAL A CG2   1 
ATOM   2553 N N     . GLN A 1 446 ? 18.693  66.023  -12.432 1.00 77.85  ? 548  GLN A N     1 
ATOM   2554 C CA    . GLN A 1 446 ? 20.092  66.344  -12.674 1.00 79.12  ? 548  GLN A CA    1 
ATOM   2555 C C     . GLN A 1 446 ? 20.773  66.478  -11.319 1.00 81.35  ? 548  GLN A C     1 
ATOM   2556 O O     . GLN A 1 446 ? 21.556  65.640  -10.942 1.00 87.44  ? 548  GLN A O     1 
ATOM   2557 C CB    . GLN A 1 446 ? 20.180  67.654  -13.417 1.00 67.92  ? 548  GLN A CB    1 
ATOM   2558 C CG    . GLN A 1 446 ? 21.559  68.197  -13.567 1.00 69.43  ? 548  GLN A CG    1 
ATOM   2559 C CD    . GLN A 1 446 ? 22.381  67.371  -14.534 1.00 74.80  ? 548  GLN A CD    1 
ATOM   2560 O OE1   . GLN A 1 446 ? 22.327  66.124  -14.505 1.00 75.69  ? 548  GLN A OE1   1 
ATOM   2561 N NE2   . GLN A 1 446 ? 23.164  68.054  -15.402 1.00 81.84  ? 548  GLN A NE2   1 
ATOM   2562 N N     . ARG A 1 447 ? 20.438  67.517  -10.565 1.00 77.35  ? 549  ARG A N     1 
ATOM   2563 C CA    . ARG A 1 447 ? 20.999  67.765  -9.236  1.00 78.32  ? 549  ARG A CA    1 
ATOM   2564 C C     . ARG A 1 447 ? 21.027  66.637  -8.244  1.00 80.50  ? 549  ARG A C     1 
ATOM   2565 O O     . ARG A 1 447 ? 22.092  66.163  -7.869  1.00 83.70  ? 549  ARG A O     1 
ATOM   2566 C CB    . ARG A 1 447 ? 20.238  68.869  -8.518  1.00 84.90  ? 549  ARG A CB    1 
ATOM   2567 C CG    . ARG A 1 447 ? 20.304  70.227  -9.164  1.00 90.81  ? 549  ARG A CG    1 
ATOM   2568 C CD    . ARG A 1 447 ? 18.970  70.961  -9.080  1.00 87.00  ? 549  ARG A CD    1 
ATOM   2569 N NE    . ARG A 1 447 ? 18.968  72.176  -9.906  1.00 89.43  ? 549  ARG A NE    1 
ATOM   2570 C CZ    . ARG A 1 447 ? 19.046  72.209  -11.245 1.00 90.86  ? 549  ARG A CZ    1 
ATOM   2571 N NH1   . ARG A 1 447 ? 19.136  71.071  -11.949 1.00 83.02  ? 549  ARG A NH1   1 
ATOM   2572 N NH2   . ARG A 1 447 ? 19.027  73.391  -11.892 1.00 92.84  ? 549  ARG A NH2   1 
ATOM   2573 N N     . LEU A 1 448 ? 19.847  66.238  -7.787  1.00 73.20  ? 550  LEU A N     1 
ATOM   2574 C CA    . LEU A 1 448 ? 19.734  65.235  -6.727  1.00 75.58  ? 550  LEU A CA    1 
ATOM   2575 C C     . LEU A 1 448 ? 19.833  63.760  -7.132  1.00 76.28  ? 550  LEU A C     1 
ATOM   2576 O O     . LEU A 1 448 ? 19.447  62.876  -6.355  1.00 75.23  ? 550  LEU A O     1 
ATOM   2577 C CB    . LEU A 1 448 ? 18.445  65.477  -5.903  1.00 92.22  ? 550  LEU A CB    1 
ATOM   2578 C CG    . LEU A 1 448 ? 18.178  66.840  -5.228  1.00 91.64  ? 550  LEU A CG    1 
ATOM   2579 C CD1   . LEU A 1 448 ? 16.883  66.743  -4.448  1.00 92.02  ? 550  LEU A CD1   1 
ATOM   2580 C CD2   . LEU A 1 448 ? 19.331  67.224  -4.327  1.00 91.51  ? 550  LEU A CD2   1 
ATOM   2581 N N     . LEU A 1 449 ? 20.360  63.494  -8.328  1.00 76.45  ? 551  LEU A N     1 
ATOM   2582 C CA    . LEU A 1 449 ? 20.498  62.112  -8.764  1.00 76.28  ? 551  LEU A CA    1 
ATOM   2583 C C     . LEU A 1 449 ? 21.451  61.411  -7.803  1.00 83.38  ? 551  LEU A C     1 
ATOM   2584 O O     . LEU A 1 449 ? 21.029  60.500  -7.102  1.00 89.49  ? 551  LEU A O     1 
ATOM   2585 C CB    . LEU A 1 449 ? 21.030  61.997  -10.201 1.00 57.94  ? 551  LEU A CB    1 
ATOM   2586 C CG    . LEU A 1 449 ? 20.178  61.050  -11.013 1.00 55.49  ? 551  LEU A CG    1 
ATOM   2587 C CD1   . LEU A 1 449 ? 21.000  60.476  -12.129 1.00 54.70  ? 551  LEU A CD1   1 
ATOM   2588 C CD2   . LEU A 1 449 ? 19.581  60.015  -10.088 1.00 55.28  ? 551  LEU A CD2   1 
ATOM   2589 N N     . PRO A 1 450 ? 22.746  61.818  -7.753  1.00 108.26 ? 552  PRO A N     1 
ATOM   2590 C CA    . PRO A 1 450 ? 23.633  61.132  -6.806  1.00 112.17 ? 552  PRO A CA    1 
ATOM   2591 C C     . PRO A 1 450 ? 23.259  61.472  -5.348  1.00 109.16 ? 552  PRO A C     1 
ATOM   2592 O O     . PRO A 1 450 ? 23.160  60.580  -4.513  1.00 112.45 ? 552  PRO A O     1 
ATOM   2593 C CB    . PRO A 1 450 ? 25.032  61.618  -7.210  1.00 114.72 ? 552  PRO A CB    1 
ATOM   2594 C CG    . PRO A 1 450 ? 24.793  62.952  -7.834  1.00 111.22 ? 552  PRO A CG    1 
ATOM   2595 C CD    . PRO A 1 450 ? 23.499  62.779  -8.585  1.00 108.20 ? 552  PRO A CD    1 
ATOM   2596 N N     . VAL A 1 451 ? 23.073  62.756  -5.043  1.00 64.92  ? 553  VAL A N     1 
ATOM   2597 C CA    . VAL A 1 451 ? 22.652  63.200  -3.708  1.00 62.93  ? 553  VAL A CA    1 
ATOM   2598 C C     . VAL A 1 451 ? 21.715  62.148  -3.059  1.00 64.14  ? 553  VAL A C     1 
ATOM   2599 O O     . VAL A 1 451 ? 21.813  61.877  -1.851  1.00 65.76  ? 553  VAL A O     1 
ATOM   2600 C CB    . VAL A 1 451 ? 21.868  64.556  -3.790  1.00 65.89  ? 553  VAL A CB    1 
ATOM   2601 C CG1   . VAL A 1 451 ? 21.466  65.034  -2.406  1.00 64.66  ? 553  VAL A CG1   1 
ATOM   2602 C CG2   . VAL A 1 451 ? 22.691  65.589  -4.525  1.00 65.80  ? 553  VAL A CG2   1 
ATOM   2603 N N     . LEU A 1 452 ? 20.786  61.596  -3.848  1.00 120.82 ? 554  LEU A N     1 
ATOM   2604 C CA    . LEU A 1 452 ? 19.867  60.573  -3.343  1.00 118.74 ? 554  LEU A CA    1 
ATOM   2605 C C     . LEU A 1 452 ? 20.425  59.157  -3.579  1.00 122.83 ? 554  LEU A C     1 
ATOM   2606 O O     . LEU A 1 452 ? 20.146  58.238  -2.812  1.00 124.19 ? 554  LEU A O     1 
ATOM   2607 C CB    . LEU A 1 452 ? 18.481  60.721  -3.974  1.00 67.38  ? 554  LEU A CB    1 
ATOM   2608 C CG    . LEU A 1 452 ? 17.548  61.841  -3.505  1.00 60.32  ? 554  LEU A CG    1 
ATOM   2609 C CD1   . LEU A 1 452 ? 16.394  61.890  -4.480  1.00 54.12  ? 554  LEU A CD1   1 
ATOM   2610 C CD2   . LEU A 1 452 ? 17.025  61.619  -2.103  1.00 56.93  ? 554  LEU A CD2   1 
ATOM   2611 N N     . CYS A 1 453 ? 21.193  58.964  -4.648  1.00 83.14  ? 555  CYS A N     1 
ATOM   2612 C CA    . CYS A 1 453 ? 21.853  57.666  -4.884  1.00 88.81  ? 555  CYS A CA    1 
ATOM   2613 C C     . CYS A 1 453 ? 23.043  57.510  -3.889  1.00 95.35  ? 555  CYS A C     1 
ATOM   2614 O O     . CYS A 1 453 ? 23.020  56.672  -2.982  1.00 95.51  ? 555  CYS A O     1 
ATOM   2615 C CB    . CYS A 1 453 ? 22.414  57.598  -6.315  1.00 111.02 ? 555  CYS A CB    1 
ATOM   2616 S SG    . CYS A 1 453 ? 21.197  57.641  -7.638  1.00 114.24 ? 555  CYS A SG    1 
ATOM   2617 N N     . GLN A 1 454 ? 24.076  58.333  -4.088  1.00 122.12 ? 556  GLN A N     1 
ATOM   2618 C CA    . GLN A 1 454 ? 25.279  58.330  -3.272  1.00 123.16 ? 556  GLN A CA    1 
ATOM   2619 C C     . GLN A 1 454 ? 24.981  58.221  -1.794  1.00 125.24 ? 556  GLN A C     1 
ATOM   2620 O O     . GLN A 1 454 ? 25.586  57.417  -1.091  1.00 134.81 ? 556  GLN A O     1 
ATOM   2621 C CB    . GLN A 1 454 ? 26.118  59.593  -3.549  1.00 101.38 ? 556  GLN A CB    1 
ATOM   2622 C CG    . GLN A 1 454 ? 26.840  59.594  -4.908  1.00 102.77 ? 556  GLN A CG    1 
ATOM   2623 C CD    . GLN A 1 454 ? 28.081  60.512  -4.928  1.00 108.99 ? 556  GLN A CD    1 
ATOM   2624 O OE1   . GLN A 1 454 ? 28.743  60.724  -3.899  1.00 111.84 ? 556  GLN A OE1   1 
ATOM   2625 N NE2   . GLN A 1 454 ? 28.410  61.038  -6.112  1.00 107.83 ? 556  GLN A NE2   1 
ATOM   2626 N N     . THR A 1 455 ? 24.017  59.001  -1.337  1.00 87.57  ? 557  THR A N     1 
ATOM   2627 C CA    . THR A 1 455 ? 23.665  59.035  0.082   1.00 85.63  ? 557  THR A CA    1 
ATOM   2628 C C     . THR A 1 455 ? 22.558  58.128  0.608   1.00 83.83  ? 557  THR A C     1 
ATOM   2629 O O     . THR A 1 455 ? 22.840  57.133  1.272   1.00 82.43  ? 557  THR A O     1 
ATOM   2630 C CB    . THR A 1 455 ? 23.340  60.502  0.551   1.00 92.24  ? 557  THR A CB    1 
ATOM   2631 O OG1   . THR A 1 455 ? 24.566  61.243  0.668   1.00 92.26  ? 557  THR A OG1   1 
ATOM   2632 C CG2   . THR A 1 455 ? 22.632  60.518  1.901   1.00 91.67  ? 557  THR A CG2   1 
ATOM   2633 N N     . HIS A 1 456 ? 21.313  58.527  0.365   1.00 88.81  ? 558  HIS A N     1 
ATOM   2634 C CA    . HIS A 1 456 ? 20.083  57.821  0.795   1.00 93.43  ? 558  HIS A CA    1 
ATOM   2635 C C     . HIS A 1 456 ? 19.866  56.540  0.033   1.00 95.16  ? 558  HIS A C     1 
ATOM   2636 O O     . HIS A 1 456 ? 18.721  56.250  -0.299  1.00 91.58  ? 558  HIS A O     1 
ATOM   2637 C CB    . HIS A 1 456 ? 18.817  58.524  0.352   1.00 132.86 ? 558  HIS A CB    1 
ATOM   2638 C CG    . HIS A 1 456 ? 18.499  59.769  1.065   1.00 142.11 ? 558  HIS A CG    1 
ATOM   2639 N ND1   . HIS A 1 456 ? 17.990  59.780  2.349   1.00 145.32 ? 558  HIS A ND1   1 
ATOM   2640 C CD2   . HIS A 1 456 ? 18.524  61.056  0.652   1.00 148.83 ? 558  HIS A CD2   1 
ATOM   2641 C CE1   . HIS A 1 456 ? 17.714  61.022  2.683   1.00 148.15 ? 558  HIS A CE1   1 
ATOM   2642 N NE2   . HIS A 1 456 ? 18.028  61.822  1.670   1.00 148.06 ? 558  HIS A NE2   1 
ATOM   2643 N N     . GLY A 1 457 ? 20.934  55.875  -0.362  1.00 156.46 ? 559  GLY A N     1 
ATOM   2644 C CA    . GLY A 1 457 ? 20.851  54.624  -1.110  1.00 156.39 ? 559  GLY A CA    1 
ATOM   2645 C C     . GLY A 1 457 ? 19.892  54.156  -2.220  1.00 152.77 ? 559  GLY A C     1 
ATOM   2646 O O     . GLY A 1 457 ? 19.556  52.948  -2.249  1.00 159.20 ? 559  GLY A O     1 
ATOM   2647 N N     . LEU A 1 458 ? 19.511  55.052  -3.146  1.00 106.70 ? 560  LEU A N     1 
ATOM   2648 C CA    . LEU A 1 458 ? 18.615  54.755  -4.272  1.00 98.52  ? 560  LEU A CA    1 
ATOM   2649 C C     . LEU A 1 458 ? 19.406  54.551  -5.557  1.00 95.99  ? 560  LEU A C     1 
ATOM   2650 O O     . LEU A 1 458 ? 20.612  54.753  -5.617  1.00 97.42  ? 560  LEU A O     1 
ATOM   2651 C CB    . LEU A 1 458 ? 17.601  55.877  -4.471  1.00 77.88  ? 560  LEU A CB    1 
ATOM   2652 C CG    . LEU A 1 458 ? 16.713  56.174  -3.243  1.00 78.02  ? 560  LEU A CG    1 
ATOM   2653 C CD1   . LEU A 1 458 ? 16.050  57.561  -3.348  1.00 72.78  ? 560  LEU A CD1   1 
ATOM   2654 C CD2   . LEU A 1 458 ? 15.676  55.063  -3.080  1.00 75.07  ? 560  LEU A CD2   1 
ATOM   2655 N N     . THR A 1 459 ? 18.680  54.154  -6.587  1.00 86.31  ? 561  THR A N     1 
ATOM   2656 C CA    . THR A 1 459 ? 19.255  53.871  -7.885  1.00 81.69  ? 561  THR A CA    1 
ATOM   2657 C C     . THR A 1 459 ? 18.699  54.837  -8.904  1.00 80.55  ? 561  THR A C     1 
ATOM   2658 O O     . THR A 1 459 ? 17.604  55.373  -8.709  1.00 78.99  ? 561  THR A O     1 
ATOM   2659 C CB    . THR A 1 459 ? 18.862  52.450  -8.321  1.00 55.31  ? 561  THR A CB    1 
ATOM   2660 O OG1   . THR A 1 459 ? 18.700  52.406  -9.760  1.00 48.84  ? 561  THR A OG1   1 
ATOM   2661 C CG2   . THR A 1 459 ? 17.533  52.025  -7.598  1.00 49.17  ? 561  THR A CG2   1 
ATOM   2662 N N     . PRO A 1 460 ? 19.432  55.060  -10.005 1.00 110.10 ? 562  PRO A N     1 
ATOM   2663 C CA    . PRO A 1 460 ? 18.970  55.953  -11.078 1.00 108.33 ? 562  PRO A CA    1 
ATOM   2664 C C     . PRO A 1 460 ? 17.497  55.608  -11.461 1.00 105.22 ? 562  PRO A C     1 
ATOM   2665 O O     . PRO A 1 460 ? 16.647  56.487  -11.680 1.00 98.80  ? 562  PRO A O     1 
ATOM   2666 C CB    . PRO A 1 460 ? 19.925  55.640  -12.244 1.00 74.87  ? 562  PRO A CB    1 
ATOM   2667 C CG    . PRO A 1 460 ? 21.176  55.174  -11.607 1.00 76.64  ? 562  PRO A CG    1 
ATOM   2668 C CD    . PRO A 1 460 ? 20.820  54.624  -10.216 1.00 76.73  ? 562  PRO A CD    1 
ATOM   2669 N N     . ALA A 1 461 ? 17.215  54.311  -11.549 1.00 73.79  ? 563  ALA A N     1 
ATOM   2670 C CA    . ALA A 1 461 ? 15.884  53.828  -11.905 1.00 67.01  ? 563  ALA A CA    1 
ATOM   2671 C C     . ALA A 1 461 ? 14.881  54.330  -10.920 1.00 63.97  ? 563  ALA A C     1 
ATOM   2672 O O     . ALA A 1 461 ? 14.066  55.186  -11.254 1.00 65.32  ? 563  ALA A O     1 
ATOM   2673 C CB    . ALA A 1 461 ? 15.851  52.321  -11.946 1.00 80.19  ? 563  ALA A CB    1 
ATOM   2674 N N     . GLN A 1 462 ? 14.942  53.837  -9.696  1.00 50.60  ? 564  GLN A N     1 
ATOM   2675 C CA    . GLN A 1 462 ? 13.959  54.281  -8.689  1.00 54.42  ? 564  GLN A CA    1 
ATOM   2676 C C     . GLN A 1 462 ? 13.806  55.849  -8.599  1.00 55.08  ? 564  GLN A C     1 
ATOM   2677 O O     . GLN A 1 462 ? 12.744  56.386  -8.212  1.00 52.62  ? 564  GLN A O     1 
ATOM   2678 C CB    . GLN A 1 462 ? 14.315  53.694  -7.302  1.00 96.21  ? 564  GLN A CB    1 
ATOM   2679 C CG    . GLN A 1 462 ? 14.058  52.204  -7.109  1.00 103.03 ? 564  GLN A CG    1 
ATOM   2680 C CD    . GLN A 1 462 ? 14.034  51.807  -5.644  1.00 103.97 ? 564  GLN A CD    1 
ATOM   2681 O OE1   . GLN A 1 462 ? 14.937  52.162  -4.881  1.00 99.06  ? 564  GLN A OE1   1 
ATOM   2682 N NE2   . GLN A 1 462 ? 13.006  51.060  -5.244  1.00 107.03 ? 564  GLN A NE2   1 
ATOM   2683 N N     . VAL A 1 463 ? 14.862  56.580  -8.937  1.00 65.62  ? 565  VAL A N     1 
ATOM   2684 C CA    . VAL A 1 463 ? 14.739  58.035  -8.907  1.00 64.05  ? 565  VAL A CA    1 
ATOM   2685 C C     . VAL A 1 463 ? 14.033  58.503  -10.191 1.00 60.37  ? 565  VAL A C     1 
ATOM   2686 O O     . VAL A 1 463 ? 13.157  59.356  -10.134 1.00 54.23  ? 565  VAL A O     1 
ATOM   2687 C CB    . VAL A 1 463 ? 16.137  58.738  -8.723  1.00 99.07  ? 565  VAL A CB    1 
ATOM   2688 C CG1   . VAL A 1 463 ? 16.176  60.108  -9.420  1.00 98.72  ? 565  VAL A CG1   1 
ATOM   2689 C CG2   . VAL A 1 463 ? 16.418  58.915  -7.229  1.00 99.65  ? 565  VAL A CG2   1 
ATOM   2690 N N     . VAL A 1 464 ? 14.385  57.928  -11.343 1.00 71.73  ? 566  VAL A N     1 
ATOM   2691 C CA    . VAL A 1 464 ? 13.749  58.372  -12.566 1.00 71.16  ? 566  VAL A CA    1 
ATOM   2692 C C     . VAL A 1 464 ? 12.313  57.875  -12.617 1.00 67.81  ? 566  VAL A C     1 
ATOM   2693 O O     . VAL A 1 464 ? 11.559  58.133  -13.595 1.00 65.14  ? 566  VAL A O     1 
ATOM   2694 C CB    . VAL A 1 464 ? 14.541  57.988  -13.878 1.00 62.64  ? 566  VAL A CB    1 
ATOM   2695 C CG1   . VAL A 1 464 ? 15.905  58.691  -13.880 1.00 63.90  ? 566  VAL A CG1   1 
ATOM   2696 C CG2   . VAL A 1 464 ? 14.663  56.493  -14.045 1.00 60.19  ? 566  VAL A CG2   1 
ATOM   2697 N N     . ALA A 1 465 ? 11.924  57.181  -11.547 1.00 56.49  ? 567  ALA A N     1 
ATOM   2698 C CA    . ALA A 1 465 ? 10.555  56.700  -11.438 1.00 52.08  ? 567  ALA A CA    1 
ATOM   2699 C C     . ALA A 1 465 ? 9.832   57.478  -10.342 1.00 49.18  ? 567  ALA A C     1 
ATOM   2700 O O     . ALA A 1 465 ? 8.606   57.462  -10.254 1.00 47.40  ? 567  ALA A O     1 
ATOM   2701 C CB    . ALA A 1 465 ? 10.509  55.175  -11.260 1.00 32.79  ? 567  ALA A CB    1 
ATOM   2702 N N     . ILE A 1 466 ? 10.574  58.192  -9.508  1.00 64.12  ? 568  ILE A N     1 
ATOM   2703 C CA    . ILE A 1 466 ? 9.862   59.110  -8.609  1.00 66.43  ? 568  ILE A CA    1 
ATOM   2704 C C     . ILE A 1 466 ? 9.709   60.451  -9.408  1.00 62.95  ? 568  ILE A C     1 
ATOM   2705 O O     . ILE A 1 466 ? 8.827   61.265  -9.091  1.00 61.37  ? 568  ILE A O     1 
ATOM   2706 C CB    . ILE A 1 466 ? 10.604  59.428  -7.344  1.00 76.49  ? 568  ILE A CB    1 
ATOM   2707 C CG1   . ILE A 1 466 ? 11.023  58.140  -6.645  1.00 80.92  ? 568  ILE A CG1   1 
ATOM   2708 C CG2   . ILE A 1 466 ? 9.685   60.211  -6.430  1.00 79.11  ? 568  ILE A CG2   1 
ATOM   2709 C CD1   . ILE A 1 466 ? 12.019  58.343  -5.531  1.00 82.43  ? 568  ILE A CD1   1 
ATOM   2710 N N     . ALA A 1 467 ? 10.538  60.642  -10.456 1.00 50.11  ? 569  ALA A N     1 
ATOM   2711 C CA    . ALA A 1 467 ? 10.519  61.822  -11.342 1.00 46.94  ? 569  ALA A CA    1 
ATOM   2712 C C     . ALA A 1 467 ? 9.466   61.958  -12.455 1.00 46.08  ? 569  ALA A C     1 
ATOM   2713 O O     . ALA A 1 467 ? 9.066   63.090  -12.807 1.00 44.72  ? 569  ALA A O     1 
ATOM   2714 C CB    . ALA A 1 467 ? 11.809  61.878  -12.156 1.00 37.55  ? 569  ALA A CB    1 
ATOM   2715 N N     . SER A 1 468 ? 9.058   60.808  -13.015 1.00 64.66  ? 570  SER A N     1 
ATOM   2716 C CA    . SER A 1 468 ? 8.123   60.717  -14.128 1.00 61.57  ? 570  SER A CA    1 
ATOM   2717 C C     . SER A 1 468 ? 6.623   60.954  -13.804 1.00 58.63  ? 570  SER A C     1 
ATOM   2718 O O     . SER A 1 468 ? 5.750   60.442  -14.522 1.00 60.18  ? 570  SER A O     1 
ATOM   2719 C CB    . SER A 1 468 ? 8.331   59.376  -14.798 1.00 48.74  ? 570  SER A CB    1 
ATOM   2720 O OG    . SER A 1 468 ? 9.568   59.399  -15.537 1.00 51.83  ? 570  SER A OG    1 
ATOM   2721 N N     . HIS A 1 469 ? 6.282   61.726  -12.773 1.00 44.95  ? 571  HIS A N     1 
ATOM   2722 C CA    . HIS A 1 469 ? 4.865   62.064  -12.508 1.00 42.64  ? 571  HIS A CA    1 
ATOM   2723 C C     . HIS A 1 469 ? 4.618   63.634  -12.400 1.00 40.63  ? 571  HIS A C     1 
ATOM   2724 O O     . HIS A 1 469 ? 5.468   64.337  -11.966 1.00 39.17  ? 571  HIS A O     1 
ATOM   2725 C CB    . HIS A 1 469 ? 4.363   61.283  -11.311 1.00 47.97  ? 571  HIS A CB    1 
ATOM   2726 C CG    . HIS A 1 469 ? 4.781   59.856  -11.330 1.00 49.91  ? 571  HIS A CG    1 
ATOM   2727 N ND1   . HIS A 1 469 ? 4.029   58.860  -11.941 1.00 51.31  ? 571  HIS A ND1   1 
ATOM   2728 C CD2   . HIS A 1 469 ? 5.850   59.230  -10.777 1.00 51.86  ? 571  HIS A CD2   1 
ATOM   2729 C CE1   . HIS A 1 469 ? 4.612   57.690  -11.749 1.00 50.12  ? 571  HIS A CE1   1 
ATOM   2730 N NE2   . HIS A 1 469 ? 5.724   57.878  -11.044 1.00 50.94  ? 571  HIS A NE2   1 
ATOM   2731 N N     . ASP A 1 470 ? 3.483   64.180  -12.814 1.00 44.37  ? 572  ASP A N     1 
ATOM   2732 C CA    . ASP A 1 470 ? 3.323   65.617  -12.741 1.00 48.10  ? 572  ASP A CA    1 
ATOM   2733 C C     . ASP A 1 470 ? 4.039   66.310  -11.598 1.00 51.11  ? 572  ASP A C     1 
ATOM   2734 O O     . ASP A 1 470 ? 4.630   67.378  -11.824 1.00 55.55  ? 572  ASP A O     1 
ATOM   2735 C CB    . ASP A 1 470 ? 1.851   66.064  -12.684 1.00 56.64  ? 572  ASP A CB    1 
ATOM   2736 C CG    . ASP A 1 470 ? 1.156   66.081  -14.071 1.00 58.84  ? 572  ASP A CG    1 
ATOM   2737 O OD1   . ASP A 1 470 ? 1.895   65.978  -15.071 1.00 59.03  ? 572  ASP A OD1   1 
ATOM   2738 O OD2   . ASP A 1 470 ? -0.131  66.185  -14.179 1.00 58.21  ? 572  ASP A OD2   1 
ATOM   2739 N N     . GLY A 1 471 ? 4.035   65.768  -10.380 1.00 54.42  ? 573  GLY A N     1 
ATOM   2740 C CA    . GLY A 1 471 ? 4.691   66.526  -9.297  1.00 58.06  ? 573  GLY A CA    1 
ATOM   2741 C C     . GLY A 1 471 ? 6.115   66.131  -8.981  1.00 60.47  ? 573  GLY A C     1 
ATOM   2742 O O     . GLY A 1 471 ? 6.509   65.957  -7.828  1.00 62.66  ? 573  GLY A O     1 
ATOM   2743 N N     . GLY A 1 472 ? 6.902   66.054  -10.031 1.00 47.46  ? 574  GLY A N     1 
ATOM   2744 C CA    . GLY A 1 472 ? 8.275   65.566  -9.944  1.00 51.83  ? 574  GLY A CA    1 
ATOM   2745 C C     . GLY A 1 472 ? 9.229   66.183  -8.972  1.00 55.76  ? 574  GLY A C     1 
ATOM   2746 O O     . GLY A 1 472 ? 9.597   65.564  -7.980  1.00 57.06  ? 574  GLY A O     1 
ATOM   2747 N N     . LYS A 1 473 ? 9.693   67.372  -9.330  1.00 50.55  ? 575  LYS A N     1 
ATOM   2748 C CA    . LYS A 1 473 ? 10.551  68.202  -8.476  1.00 48.65  ? 575  LYS A CA    1 
ATOM   2749 C C     . LYS A 1 473 ? 10.095  67.959  -7.035  1.00 48.05  ? 575  LYS A C     1 
ATOM   2750 O O     . LYS A 1 473 ? 10.886  67.508  -6.217  1.00 46.75  ? 575  LYS A O     1 
ATOM   2751 C CB    . LYS A 1 473 ? 10.301  69.684  -8.807  1.00 43.05  ? 575  LYS A CB    1 
ATOM   2752 C CG    . LYS A 1 473 ? 11.145  70.675  -8.048  1.00 43.62  ? 575  LYS A CG    1 
ATOM   2753 C CD    . LYS A 1 473 ? 10.671  72.162  -8.169  1.00 45.17  ? 575  LYS A CD    1 
ATOM   2754 C CE    . LYS A 1 473 ? 11.882  73.114  -8.009  1.00 49.49  ? 575  LYS A CE    1 
ATOM   2755 N NZ    . LYS A 1 473 ? 11.618  74.579  -8.068  1.00 49.12  ? 575  LYS A NZ    1 
ATOM   2756 N N     . GLN A 1 474 ? 8.802   68.238  -6.775  1.00 54.65  ? 576  GLN A N     1 
ATOM   2757 C CA    . GLN A 1 474 ? 8.112   68.111  -5.466  1.00 55.40  ? 576  GLN A CA    1 
ATOM   2758 C C     . GLN A 1 474 ? 8.328   66.791  -4.791  1.00 56.82  ? 576  GLN A C     1 
ATOM   2759 O O     . GLN A 1 474 ? 8.814   66.740  -3.651  1.00 56.91  ? 576  GLN A O     1 
ATOM   2760 C CB    . GLN A 1 474 ? 6.565   68.316  -5.570  1.00 54.49  ? 576  GLN A CB    1 
ATOM   2761 C CG    . GLN A 1 474 ? 6.066   69.812  -5.742  1.00 47.83  ? 576  GLN A CG    1 
ATOM   2762 C CD    . GLN A 1 474 ? 7.145   70.718  -5.332  1.00 48.54  ? 576  GLN A CD    1 
ATOM   2763 O OE1   . GLN A 1 474 ? 8.072   70.983  -6.127  1.00 47.60  ? 576  GLN A OE1   1 
ATOM   2764 N NE2   . GLN A 1 474 ? 7.108   71.146  -4.045  1.00 49.95  ? 576  GLN A NE2   1 
ATOM   2765 N N     . ALA A 1 475 ? 7.936   65.725  -5.478  1.00 59.34  ? 577  ALA A N     1 
ATOM   2766 C CA    . ALA A 1 475 ? 8.117   64.408  -4.929  1.00 61.72  ? 577  ALA A CA    1 
ATOM   2767 C C     . ALA A 1 475 ? 9.618   64.135  -4.681  1.00 62.09  ? 577  ALA A C     1 
ATOM   2768 O O     . ALA A 1 475 ? 9.979   63.835  -3.569  1.00 65.70  ? 577  ALA A O     1 
ATOM   2769 C CB    . ALA A 1 475 ? 7.510   63.394  -5.834  1.00 67.00  ? 577  ALA A CB    1 
ATOM   2770 N N     . LEU A 1 476 ? 10.499  64.255  -5.664  1.00 65.07  ? 578  LEU A N     1 
ATOM   2771 C CA    . LEU A 1 476 ? 11.931  64.011  -5.405  1.00 67.77  ? 578  LEU A CA    1 
ATOM   2772 C C     . LEU A 1 476 ? 12.449  64.777  -4.175  1.00 72.85  ? 578  LEU A C     1 
ATOM   2773 O O     . LEU A 1 476 ? 13.069  64.197  -3.264  1.00 72.75  ? 578  LEU A O     1 
ATOM   2774 C CB    . LEU A 1 476 ? 12.771  64.431  -6.596  1.00 42.06  ? 578  LEU A CB    1 
ATOM   2775 C CG    . LEU A 1 476 ? 13.124  63.334  -7.551  1.00 40.90  ? 578  LEU A CG    1 
ATOM   2776 C CD1   . LEU A 1 476 ? 14.265  63.814  -8.438  1.00 42.18  ? 578  LEU A CD1   1 
ATOM   2777 C CD2   . LEU A 1 476 ? 13.535  62.110  -6.762  1.00 44.00  ? 578  LEU A CD2   1 
ATOM   2778 N N     . GLU A 1 477 ? 12.206  66.091  -4.173  1.00 85.83  ? 579  GLU A N     1 
ATOM   2779 C CA    . GLU A 1 477 ? 12.573  66.982  -3.074  1.00 92.71  ? 579  GLU A CA    1 
ATOM   2780 C C     . GLU A 1 477 ? 12.176  66.388  -1.733  1.00 98.84  ? 579  GLU A C     1 
ATOM   2781 O O     . GLU A 1 477 ? 13.045  66.040  -0.943  1.00 106.60 ? 579  GLU A O     1 
ATOM   2782 C CB    . GLU A 1 477 ? 11.854  68.316  -3.220  1.00 79.31  ? 579  GLU A CB    1 
ATOM   2783 C CG    . GLU A 1 477 ? 12.747  69.473  -3.643  1.00 80.88  ? 579  GLU A CG    1 
ATOM   2784 C CD    . GLU A 1 477 ? 12.168  70.832  -3.262  1.00 85.26  ? 579  GLU A CD    1 
ATOM   2785 O OE1   . GLU A 1 477 ? 12.015  71.686  -4.158  1.00 92.37  ? 579  GLU A OE1   1 
ATOM   2786 O OE2   . GLU A 1 477 ? 11.871  71.058  -2.066  1.00 86.63  ? 579  GLU A OE2   1 
ATOM   2787 N N     . THR A 1 478 ? 10.866  66.311  -1.469  1.00 73.88  ? 580  THR A N     1 
ATOM   2788 C CA    . THR A 1 478 ? 10.363  65.712  -0.235  1.00 75.57  ? 580  THR A CA    1 
ATOM   2789 C C     . THR A 1 478 ? 10.986  64.304  0.077   1.00 75.13  ? 580  THR A C     1 
ATOM   2790 O O     . THR A 1 478 ? 11.334  64.031  1.234   1.00 77.84  ? 580  THR A O     1 
ATOM   2791 C CB    . THR A 1 478 ? 8.819   65.612  -0.241  1.00 74.29  ? 580  THR A CB    1 
ATOM   2792 O OG1   . THR A 1 478 ? 8.268   66.508  -1.217  1.00 76.43  ? 580  THR A OG1   1 
ATOM   2793 C CG2   . THR A 1 478 ? 8.282   66.012  1.130   1.00 73.30  ? 580  THR A CG2   1 
ATOM   2794 N N     . VAL A 1 479 ? 11.157  63.422  -0.917  1.00 67.21  ? 581  VAL A N     1 
ATOM   2795 C CA    . VAL A 1 479 ? 11.765  62.112  -0.649  1.00 71.52  ? 581  VAL A CA    1 
ATOM   2796 C C     . VAL A 1 479 ? 13.079  62.372  0.053   1.00 73.67  ? 581  VAL A C     1 
ATOM   2797 O O     . VAL A 1 479 ? 13.409  61.711  1.021   1.00 71.79  ? 581  VAL A O     1 
ATOM   2798 C CB    . VAL A 1 479 ? 12.056  61.272  -1.948  1.00 70.58  ? 581  VAL A CB    1 
ATOM   2799 C CG1   . VAL A 1 479 ? 13.504  61.419  -2.406  1.00 68.42  ? 581  VAL A CG1   1 
ATOM   2800 C CG2   . VAL A 1 479 ? 11.791  59.812  -1.678  1.00 67.46  ? 581  VAL A CG2   1 
ATOM   2801 N N     . GLN A 1 480 ? 13.815  63.359  -0.438  1.00 79.24  ? 582  GLN A N     1 
ATOM   2802 C CA    . GLN A 1 480 ? 15.106  63.736  0.139   1.00 83.35  ? 582  GLN A CA    1 
ATOM   2803 C C     . GLN A 1 480 ? 14.942  64.281  1.563   1.00 81.93  ? 582  GLN A C     1 
ATOM   2804 O O     . GLN A 1 480 ? 15.717  63.951  2.455   1.00 83.94  ? 582  GLN A O     1 
ATOM   2805 C CB    . GLN A 1 480 ? 15.772  64.797  -0.748  1.00 94.25  ? 582  GLN A CB    1 
ATOM   2806 C CG    . GLN A 1 480 ? 17.259  64.762  -0.752  1.00 94.66  ? 582  GLN A CG    1 
ATOM   2807 C CD    . GLN A 1 480 ? 17.818  65.577  0.333   1.00 98.83  ? 582  GLN A CD    1 
ATOM   2808 O OE1   . GLN A 1 480 ? 18.157  66.747  0.125   1.00 104.38 ? 582  GLN A OE1   1 
ATOM   2809 N NE2   . GLN A 1 480 ? 17.916  64.993  1.520   1.00 99.57  ? 582  GLN A NE2   1 
ATOM   2810 N N     . GLN A 1 481 ? 13.899  65.071  1.779   1.00 72.38  ? 583  GLN A N     1 
ATOM   2811 C CA    . GLN A 1 481 ? 13.689  65.700  3.063   1.00 76.43  ? 583  GLN A CA    1 
ATOM   2812 C C     . GLN A 1 481 ? 12.840  64.923  4.047   1.00 75.75  ? 583  GLN A C     1 
ATOM   2813 O O     . GLN A 1 481 ? 12.469  65.455  5.110   1.00 74.28  ? 583  GLN A O     1 
ATOM   2814 C CB    . GLN A 1 481 ? 13.113  67.119  2.871   1.00 110.38 ? 583  GLN A CB    1 
ATOM   2815 C CG    . GLN A 1 481 ? 14.073  68.120  2.213   1.00 115.20 ? 583  GLN A CG    1 
ATOM   2816 C CD    . GLN A 1 481 ? 13.425  69.468  1.947   1.00 120.23 ? 583  GLN A CD    1 
ATOM   2817 O OE1   . GLN A 1 481 ? 12.787  70.041  2.830   1.00 122.65 ? 583  GLN A OE1   1 
ATOM   2818 N NE2   . GLN A 1 481 ? 13.598  69.990  0.725   1.00 118.47 ? 583  GLN A NE2   1 
ATOM   2819 N N     . LEU A 1 482 ? 12.522  63.672  3.715   1.00 99.19  ? 584  LEU A N     1 
ATOM   2820 C CA    . LEU A 1 482 ? 11.723  62.843  4.625   1.00 95.40  ? 584  LEU A CA    1 
ATOM   2821 C C     . LEU A 1 482 ? 12.100  61.340  4.698   1.00 95.29  ? 584  LEU A C     1 
ATOM   2822 O O     . LEU A 1 482 ? 11.663  60.639  5.610   1.00 93.81  ? 584  LEU A O     1 
ATOM   2823 C CB    . LEU A 1 482 ? 10.222  63.012  4.308   1.00 51.49  ? 584  LEU A CB    1 
ATOM   2824 C CG    . LEU A 1 482 ? 9.450   64.208  4.905   1.00 49.25  ? 584  LEU A CG    1 
ATOM   2825 C CD1   . LEU A 1 482 ? 7.966   64.277  4.412   1.00 46.94  ? 584  LEU A CD1   1 
ATOM   2826 C CD2   . LEU A 1 482 ? 9.436   64.090  6.379   1.00 54.14  ? 584  LEU A CD2   1 
ATOM   2827 N N     . LEU A 1 483 ? 12.920  60.855  3.767   1.00 90.73  ? 585  LEU A N     1 
ATOM   2828 C CA    . LEU A 1 483 ? 13.293  59.433  3.728   1.00 94.36  ? 585  LEU A CA    1 
ATOM   2829 C C     . LEU A 1 483 ? 13.854  58.845  5.018   1.00 99.55  ? 585  LEU A C     1 
ATOM   2830 O O     . LEU A 1 483 ? 13.285  57.876  5.523   1.00 101.47 ? 585  LEU A O     1 
ATOM   2831 C CB    . LEU A 1 483 ? 14.264  59.155  2.560   1.00 75.22  ? 585  LEU A CB    1 
ATOM   2832 C CG    . LEU A 1 483 ? 14.866  57.770  2.249   1.00 74.64  ? 585  LEU A CG    1 
ATOM   2833 C CD1   . LEU A 1 483 ? 15.390  57.777  0.838   1.00 74.91  ? 585  LEU A CD1   1 
ATOM   2834 C CD2   . LEU A 1 483 ? 16.022  57.414  3.211   1.00 77.45  ? 585  LEU A CD2   1 
ATOM   2835 N N     . PRO A 1 484 ? 14.961  59.410  5.570   1.00 126.06 ? 586  PRO A N     1 
ATOM   2836 C CA    . PRO A 1 484 ? 15.506  58.828  6.811   1.00 124.70 ? 586  PRO A CA    1 
ATOM   2837 C C     . PRO A 1 484 ? 14.668  59.178  8.033   1.00 125.06 ? 586  PRO A C     1 
ATOM   2838 O O     . PRO A 1 484 ? 14.713  58.475  9.047   1.00 127.56 ? 586  PRO A O     1 
ATOM   2839 C CB    . PRO A 1 484 ? 16.913  59.390  6.882   1.00 118.76 ? 586  PRO A CB    1 
ATOM   2840 C CG    . PRO A 1 484 ? 16.836  60.695  6.118   1.00 118.15 ? 586  PRO A CG    1 
ATOM   2841 C CD    . PRO A 1 484 ? 15.576  60.720  5.277   1.00 117.25 ? 586  PRO A CD    1 
ATOM   2842 N N     . VAL A 1 485 ? 13.916  60.279  7.907   1.00 76.82  ? 587  VAL A N     1 
ATOM   2843 C CA    . VAL A 1 485 ? 12.950  60.774  8.895   1.00 78.23  ? 587  VAL A CA    1 
ATOM   2844 C C     . VAL A 1 485 ? 11.777  59.763  9.034   1.00 78.17  ? 587  VAL A C     1 
ATOM   2845 O O     . VAL A 1 485 ? 11.282  59.516  10.118  1.00 78.51  ? 587  VAL A O     1 
ATOM   2846 C CB    . VAL A 1 485 ? 12.348  62.117  8.424   1.00 125.26 ? 587  VAL A CB    1 
ATOM   2847 C CG1   . VAL A 1 485 ? 11.642  62.810  9.573   1.00 129.77 ? 587  VAL A CG1   1 
ATOM   2848 C CG2   . VAL A 1 485 ? 13.429  62.988  7.837   1.00 127.32 ? 587  VAL A CG2   1 
ATOM   2849 N N     . LEU A 1 486 ? 11.308  59.220  7.911   1.00 85.79  ? 588  LEU A N     1 
ATOM   2850 C CA    . LEU A 1 486 ? 10.235  58.213  7.901   1.00 84.47  ? 588  LEU A CA    1 
ATOM   2851 C C     . LEU A 1 486 ? 10.825  56.884  8.369   1.00 87.12  ? 588  LEU A C     1 
ATOM   2852 O O     . LEU A 1 486 ? 10.189  56.166  9.112   1.00 85.52  ? 588  LEU A O     1 
ATOM   2853 C CB    . LEU A 1 486 ? 9.618   58.097  6.478   1.00 77.93  ? 588  LEU A CB    1 
ATOM   2854 C CG    . LEU A 1 486 ? 8.303   58.909  6.295   1.00 74.29  ? 588  LEU A CG    1 
ATOM   2855 C CD1   . LEU A 1 486 ? 8.250   59.676  4.981   1.00 66.39  ? 588  LEU A CD1   1 
ATOM   2856 C CD2   . LEU A 1 486 ? 7.130   57.967  6.426   1.00 76.26  ? 588  LEU A CD2   1 
ATOM   2857 N N     . CYS A 1 487 ? 12.050  56.587  7.930   1.00 138.02 ? 589  CYS A N     1 
ATOM   2858 C CA    . CYS A 1 487 ? 12.794  55.375  8.295   1.00 143.44 ? 589  CYS A CA    1 
ATOM   2859 C C     . CYS A 1 487 ? 13.120  55.289  9.799   1.00 146.50 ? 589  CYS A C     1 
ATOM   2860 O O     . CYS A 1 487 ? 13.347  54.189  10.319  1.00 149.84 ? 589  CYS A O     1 
ATOM   2861 C CB    . CYS A 1 487 ? 14.127  55.308  7.518   1.00 145.89 ? 589  CYS A CB    1 
ATOM   2862 S SG    . CYS A 1 487 ? 14.014  55.012  5.722   1.00 143.40 ? 589  CYS A SG    1 
ATOM   2863 N N     . GLN A 1 488 ? 13.154  56.436  10.484  1.00 84.47  ? 590  GLN A N     1 
ATOM   2864 C CA    . GLN A 1 488 ? 13.501  56.462  11.902  1.00 86.81  ? 590  GLN A CA    1 
ATOM   2865 C C     . GLN A 1 488 ? 12.362  56.820  12.851  1.00 85.51  ? 590  GLN A C     1 
ATOM   2866 O O     . GLN A 1 488 ? 12.317  56.362  13.984  1.00 87.80  ? 590  GLN A O     1 
ATOM   2867 C CB    . GLN A 1 488 ? 14.703  57.397  12.114  1.00 99.97  ? 590  GLN A CB    1 
ATOM   2868 C CG    . GLN A 1 488 ? 16.046  56.750  11.698  1.00 103.73 ? 590  GLN A CG    1 
ATOM   2869 C CD    . GLN A 1 488 ? 17.247  57.670  11.884  1.00 106.02 ? 590  GLN A CD    1 
ATOM   2870 O OE1   . GLN A 1 488 ? 17.255  58.555  12.754  1.00 107.93 ? 590  GLN A OE1   1 
ATOM   2871 N NE2   . GLN A 1 488 ? 18.279  57.449  11.077  1.00 109.28 ? 590  GLN A NE2   1 
ATOM   2872 N N     . ALA A 1 489 ? 11.438  57.643  12.383  1.00 129.16 ? 591  ALA A N     1 
ATOM   2873 C CA    . ALA A 1 489 ? 10.295  58.040  13.200  1.00 127.03 ? 591  ALA A CA    1 
ATOM   2874 C C     . ALA A 1 489 ? 9.391   56.860  13.457  1.00 124.67 ? 591  ALA A C     1 
ATOM   2875 O O     . ALA A 1 489 ? 8.616   56.843  14.397  1.00 123.16 ? 591  ALA A O     1 
ATOM   2876 C CB    . ALA A 1 489 ? 9.498   59.188  12.526  1.00 99.53  ? 591  ALA A CB    1 
ATOM   2877 N N     . HIS A 1 490 ? 9.478   55.851  12.603  1.00 115.78 ? 592  HIS A N     1 
ATOM   2878 C CA    . HIS A 1 490 ? 8.736   54.613  12.804  1.00 123.27 ? 592  HIS A CA    1 
ATOM   2879 C C     . HIS A 1 490 ? 9.760   53.765  12.092  1.00 124.51 ? 592  HIS A C     1 
ATOM   2880 O O     . HIS A 1 490 ? 10.914  54.170  11.952  1.00 120.43 ? 592  HIS A O     1 
ATOM   2881 C CB    . HIS A 1 490 ? 7.440   54.620  11.996  1.00 127.33 ? 592  HIS A CB    1 
ATOM   2882 C CG    . HIS A 1 490 ? 7.210   55.887  11.232  1.00 124.10 ? 592  HIS A CG    1 
ATOM   2883 N ND1   . HIS A 1 490 ? 6.189   56.763  11.533  1.00 124.60 ? 592  HIS A ND1   1 
ATOM   2884 C CD2   . HIS A 1 490 ? 7.870   56.426  10.180  1.00 122.51 ? 592  HIS A CD2   1 
ATOM   2885 C CE1   . HIS A 1 490 ? 6.230   57.786  10.699  1.00 127.34 ? 592  HIS A CE1   1 
ATOM   2886 N NE2   . HIS A 1 490 ? 7.241   57.606  9.868   1.00 125.47 ? 592  HIS A NE2   1 
ATOM   2887 N N     . GLY A 1 491 ? 9.346   52.603  11.605  1.00 197.51 ? 593  GLY A N     1 
ATOM   2888 C CA    . GLY A 1 491 ? 10.164  51.939  10.568  1.00 197.51 ? 593  GLY A CA    1 
ATOM   2889 C C     . GLY A 1 491 ? 9.761   51.252  9.300   1.00 194.84 ? 593  GLY A C     1 
ATOM   2890 O O     . GLY A 1 491 ? 9.455   50.010  9.295   1.00 197.51 ? 593  GLY A O     1 
ATOM   2891 N N     . LEU A 1 492 ? 9.569   52.160  8.350   1.00 99.72  ? 594  LEU A N     1 
ATOM   2892 C CA    . LEU A 1 492 ? 9.231   52.220  6.923   1.00 90.33  ? 594  LEU A CA    1 
ATOM   2893 C C     . LEU A 1 492 ? 10.607  52.036  6.218   1.00 87.43  ? 594  LEU A C     1 
ATOM   2894 O O     . LEU A 1 492 ? 11.548  52.771  6.485   1.00 91.85  ? 594  LEU A O     1 
ATOM   2895 C CB    . LEU A 1 492 ? 8.694   53.613  6.647   1.00 70.20  ? 594  LEU A CB    1 
ATOM   2896 C CG    . LEU A 1 492 ? 7.220   54.022  6.663   1.00 67.48  ? 594  LEU A CG    1 
ATOM   2897 C CD1   . LEU A 1 492 ? 6.688   54.052  5.256   1.00 63.73  ? 594  LEU A CD1   1 
ATOM   2898 C CD2   . LEU A 1 492 ? 6.429   53.064  7.547   1.00 67.49  ? 594  LEU A CD2   1 
ATOM   2899 N N     . THR A 1 493 ? 10.694  51.049  5.334   1.00 76.53  ? 595  THR A N     1 
ATOM   2900 C CA    . THR A 1 493 ? 11.890  50.694  4.620   1.00 72.76  ? 595  THR A CA    1 
ATOM   2901 C C     . THR A 1 493 ? 12.227  51.742  3.579   1.00 73.07  ? 595  THR A C     1 
ATOM   2902 O O     . THR A 1 493 ? 11.652  52.832  3.605   1.00 74.91  ? 595  THR A O     1 
ATOM   2903 C CB    . THR A 1 493 ? 11.624  49.359  3.894   1.00 91.67  ? 595  THR A CB    1 
ATOM   2904 O OG1   . THR A 1 493 ? 11.371  49.606  2.510   1.00 95.52  ? 595  THR A OG1   1 
ATOM   2905 C CG2   . THR A 1 493 ? 10.375  48.684  4.457   1.00 89.83  ? 595  THR A CG2   1 
ATOM   2906 N N     . PRO A 1 494 ? 13.231  51.475  2.714   1.00 88.84  ? 596  PRO A N     1 
ATOM   2907 C CA    . PRO A 1 494 ? 13.503  52.452  1.646   1.00 87.14  ? 596  PRO A CA    1 
ATOM   2908 C C     . PRO A 1 494 ? 12.574  52.102  0.408   1.00 83.32  ? 596  PRO A C     1 
ATOM   2909 O O     . PRO A 1 494 ? 11.601  52.850  0.131   1.00 79.43  ? 596  PRO A O     1 
ATOM   2910 C CB    . PRO A 1 494 ? 14.983  52.239  1.300   1.00 80.72  ? 596  PRO A CB    1 
ATOM   2911 C CG    . PRO A 1 494 ? 15.560  51.806  2.548   1.00 83.41  ? 596  PRO A CG    1 
ATOM   2912 C CD    . PRO A 1 494 ? 14.502  50.840  3.125   1.00 84.26  ? 596  PRO A CD    1 
ATOM   2913 N N     . ASP A 1 495 ? 12.856  50.976  -0.299  1.00 75.60  ? 597  ASP A N     1 
ATOM   2914 C CA    . ASP A 1 495 ? 12.078  50.554  -1.514  1.00 75.69  ? 597  ASP A CA    1 
ATOM   2915 C C     . ASP A 1 495 ? 10.603  50.971  -1.319  1.00 74.91  ? 597  ASP A C     1 
ATOM   2916 O O     . ASP A 1 495 ? 9.964   51.559  -2.193  1.00 75.83  ? 597  ASP A O     1 
ATOM   2917 C CB    . ASP A 1 495 ? 12.209  49.029  -1.753  1.00 80.30  ? 597  ASP A CB    1 
ATOM   2918 C CG    . ASP A 1 495 ? 13.673  48.577  -1.981  1.00 80.93  ? 597  ASP A CG    1 
ATOM   2919 O OD1   . ASP A 1 495 ? 14.225  48.770  -3.101  1.00 80.91  ? 597  ASP A OD1   1 
ATOM   2920 O OD2   . ASP A 1 495 ? 14.270  48.019  -1.022  1.00 78.19  ? 597  ASP A OD2   1 
ATOM   2921 N N     . GLN A 1 496 ? 10.106  50.645  -0.135  1.00 72.13  ? 598  GLN A N     1 
ATOM   2922 C CA    . GLN A 1 496 ? 8.807   50.993  0.377   1.00 71.00  ? 598  GLN A CA    1 
ATOM   2923 C C     . GLN A 1 496 ? 8.524   52.507  0.207   1.00 71.44  ? 598  GLN A C     1 
ATOM   2924 O O     . GLN A 1 496 ? 7.414   52.841  -0.204  1.00 68.66  ? 598  GLN A O     1 
ATOM   2925 C CB    . GLN A 1 496 ? 8.821   50.586  1.857   1.00 80.02  ? 598  GLN A CB    1 
ATOM   2926 C CG    . GLN A 1 496 ? 8.133   51.486  2.850   1.00 85.86  ? 598  GLN A CG    1 
ATOM   2927 C CD    . GLN A 1 496 ? 6.678   51.169  2.941   1.00 84.62  ? 598  GLN A CD    1 
ATOM   2928 O OE1   . GLN A 1 496 ? 6.247   50.393  3.813   1.00 79.46  ? 598  GLN A OE1   1 
ATOM   2929 N NE2   . GLN A 1 496 ? 5.895   51.744  2.014   1.00 80.87  ? 598  GLN A NE2   1 
ATOM   2930 N N     . VAL A 1 497 ? 9.481   53.406  0.532   1.00 74.80  ? 599  VAL A N     1 
ATOM   2931 C CA    . VAL A 1 497 ? 9.256   54.879  0.430   1.00 81.50  ? 599  VAL A CA    1 
ATOM   2932 C C     . VAL A 1 497 ? 9.286   55.368  -1.010  1.00 82.56  ? 599  VAL A C     1 
ATOM   2933 O O     . VAL A 1 497 ? 8.574   56.311  -1.388  1.00 82.65  ? 599  VAL A O     1 
ATOM   2934 C CB    . VAL A 1 497 ? 10.261  55.713  1.286   1.00 116.84 ? 599  VAL A CB    1 
ATOM   2935 C CG1   . VAL A 1 497 ? 10.169  57.203  0.940   1.00 113.57 ? 599  VAL A CG1   1 
ATOM   2936 C CG2   . VAL A 1 497 ? 9.931   55.532  2.764   1.00 125.69 ? 599  VAL A CG2   1 
ATOM   2937 N N     . VAL A 1 498 ? 10.134  54.738  -1.812  1.00 68.63  ? 600  VAL A N     1 
ATOM   2938 C CA    . VAL A 1 498 ? 10.156  55.024  -3.236  1.00 62.16  ? 600  VAL A CA    1 
ATOM   2939 C C     . VAL A 1 498 ? 8.709   54.735  -3.731  1.00 60.55  ? 600  VAL A C     1 
ATOM   2940 O O     . VAL A 1 498 ? 8.148   55.501  -4.483  1.00 61.41  ? 600  VAL A O     1 
ATOM   2941 C CB    . VAL A 1 498 ? 11.125  54.082  -3.966  1.00 61.35  ? 600  VAL A CB    1 
ATOM   2942 C CG1   . VAL A 1 498 ? 10.991  54.240  -5.481  1.00 60.23  ? 600  VAL A CG1   1 
ATOM   2943 C CG2   . VAL A 1 498 ? 12.531  54.353  -3.511  1.00 63.24  ? 600  VAL A CG2   1 
ATOM   2944 N N     . ALA A 1 499 ? 8.100   53.639  -3.281  1.00 90.75  ? 601  ALA A N     1 
ATOM   2945 C CA    . ALA A 1 499 ? 6.750   53.284  -3.716  1.00 90.98  ? 601  ALA A CA    1 
ATOM   2946 C C     . ALA A 1 499 ? 5.678   54.310  -3.380  1.00 92.43  ? 601  ALA A C     1 
ATOM   2947 O O     . ALA A 1 499 ? 4.603   54.321  -3.968  1.00 91.68  ? 601  ALA A O     1 
ATOM   2948 C CB    . ALA A 1 499 ? 6.352   51.927  -3.142  1.00 200.00 ? 601  ALA A CB    1 
ATOM   2949 N N     . ILE A 1 500 ? 5.962   55.191  -2.444  1.00 83.51  ? 602  ILE A N     1 
ATOM   2950 C CA    . ILE A 1 500 ? 4.957   56.160  -2.072  1.00 82.55  ? 602  ILE A CA    1 
ATOM   2951 C C     . ILE A 1 500 ? 5.207   57.466  -2.843  1.00 81.65  ? 602  ILE A C     1 
ATOM   2952 O O     . ILE A 1 500 ? 4.290   58.276  -3.036  1.00 82.45  ? 602  ILE A O     1 
ATOM   2953 C CB    . ILE A 1 500 ? 5.016   56.449  -0.572  1.00 104.85 ? 602  ILE A CB    1 
ATOM   2954 C CG1   . ILE A 1 500 ? 5.564   55.240  0.184   1.00 110.75 ? 602  ILE A CG1   1 
ATOM   2955 C CG2   . ILE A 1 500 ? 3.656   56.856  -0.096  1.00 99.40  ? 602  ILE A CG2   1 
ATOM   2956 C CD1   . ILE A 1 500 ? 5.806   55.466  1.668   1.00 118.12 ? 602  ILE A CD1   1 
ATOM   2957 N N     . ALA A 1 501 ? 6.450   57.660  -3.291  1.00 69.73  ? 603  ALA A N     1 
ATOM   2958 C CA    . ALA A 1 501 ? 6.852   58.866  -4.013  1.00 64.21  ? 603  ALA A CA    1 
ATOM   2959 C C     . ALA A 1 501 ? 6.501   58.818  -5.479  1.00 62.73  ? 603  ALA A C     1 
ATOM   2960 O O     . ALA A 1 501 ? 6.291   59.849  -6.117  1.00 62.54  ? 603  ALA A O     1 
ATOM   2961 C CB    . ALA A 1 501 ? 8.336   59.048  -3.878  1.00 53.80  ? 603  ALA A CB    1 
ATOM   2962 N N     . SER A 1 502 ? 6.416   57.601  -6.003  1.00 65.01  ? 604  SER A N     1 
ATOM   2963 C CA    . SER A 1 502 ? 6.173   57.395  -7.393  1.00 60.21  ? 604  SER A CA    1 
ATOM   2964 C C     . SER A 1 502 ? 4.778   57.482  -8.029  1.00 58.52  ? 604  SER A C     1 
ATOM   2965 O O     . SER A 1 502 ? 4.454   56.810  -9.007  1.00 63.56  ? 604  SER A O     1 
ATOM   2966 C CB    . SER A 1 502 ? 6.899   56.166  -7.752  1.00 41.86  ? 604  SER A CB    1 
ATOM   2967 O OG    . SER A 1 502 ? 8.228   56.381  -7.346  1.00 48.21  ? 604  SER A OG    1 
ATOM   2968 N N     . ASN A 1 503 ? 3.921   58.303  -7.455  1.00 49.63  ? 605  ASN A N     1 
ATOM   2969 C CA    . ASN A 1 503 ? 2.701   58.637  -8.155  1.00 48.15  ? 605  ASN A CA    1 
ATOM   2970 C C     . ASN A 1 503 ? 2.451   60.173  -7.997  1.00 46.37  ? 605  ASN A C     1 
ATOM   2971 O O     . ASN A 1 503 ? 3.272   60.908  -7.440  1.00 45.87  ? 605  ASN A O     1 
ATOM   2972 C CB    . ASN A 1 503 ? 1.501   57.803  -7.717  1.00 39.13  ? 605  ASN A CB    1 
ATOM   2973 C CG    . ASN A 1 503 ? 1.801   56.918  -6.533  1.00 41.25  ? 605  ASN A CG    1 
ATOM   2974 O OD1   . ASN A 1 503 ? 2.811   56.235  -6.511  1.00 41.65  ? 605  ASN A OD1   1 
ATOM   2975 N ND2   . ASN A 1 503 ? 0.901   56.916  -5.529  1.00 42.23  ? 605  ASN A ND2   1 
ATOM   2976 N N     . ILE A 1 504 ? 1.391   60.650  -8.603  1.00 42.06  ? 606  ILE A N     1 
ATOM   2977 C CA    . ILE A 1 504 ? 1.059   62.035  -8.515  1.00 45.67  ? 606  ILE A CA    1 
ATOM   2978 C C     . ILE A 1 504 ? 0.775   62.257  -7.012  1.00 49.42  ? 606  ILE A C     1 
ATOM   2979 O O     . ILE A 1 504 ? -0.033  61.523  -6.405  1.00 53.29  ? 606  ILE A O     1 
ATOM   2980 C CB    . ILE A 1 504 ? -0.276  62.340  -9.276  1.00 50.37  ? 606  ILE A CB    1 
ATOM   2981 C CG1   . ILE A 1 504 ? -0.251  61.761  -10.702 1.00 49.35  ? 606  ILE A CG1   1 
ATOM   2982 C CG2   . ILE A 1 504 ? -0.584  63.838  -9.227  1.00 48.10  ? 606  ILE A CG2   1 
ATOM   2983 C CD1   . ILE A 1 504 ? 0.449   62.608  -11.801 1.00 49.58  ? 606  ILE A CD1   1 
ATOM   2984 N N     . GLY A 1 505 ? 1.419   63.239  -6.377  1.00 38.64  ? 607  GLY A N     1 
ATOM   2985 C CA    . GLY A 1 505 ? 1.068   63.494  -4.988  1.00 40.46  ? 607  GLY A CA    1 
ATOM   2986 C C     . GLY A 1 505 ? 2.143   63.158  -4.002  1.00 44.14  ? 607  GLY A C     1 
ATOM   2987 O O     . GLY A 1 505 ? 1.942   63.378  -2.823  1.00 48.17  ? 607  GLY A O     1 
ATOM   2988 N N     . GLY A 1 506 ? 3.254   62.613  -4.487  1.00 43.89  ? 608  GLY A N     1 
ATOM   2989 C CA    . GLY A 1 506 ? 4.377   62.225  -3.651  1.00 50.51  ? 608  GLY A CA    1 
ATOM   2990 C C     . GLY A 1 506 ? 4.612   63.080  -2.403  1.00 57.80  ? 608  GLY A C     1 
ATOM   2991 O O     . GLY A 1 506 ? 4.969   62.562  -1.300  1.00 61.23  ? 608  GLY A O     1 
ATOM   2992 N N     . LYS A 1 507 ? 4.454   64.399  -2.574  1.00 76.79  ? 609  LYS A N     1 
ATOM   2993 C CA    . LYS A 1 507 ? 4.574   65.325  -1.461  1.00 76.15  ? 609  LYS A CA    1 
ATOM   2994 C C     . LYS A 1 507 ? 3.374   65.179  -0.486  1.00 74.93  ? 609  LYS A C     1 
ATOM   2995 O O     . LYS A 1 507 ? 3.549   64.767  0.673   1.00 74.34  ? 609  LYS A O     1 
ATOM   2996 C CB    . LYS A 1 507 ? 4.623   66.759  -1.987  1.00 84.66  ? 609  LYS A CB    1 
ATOM   2997 C CG    . LYS A 1 507 ? 4.206   67.875  -0.966  1.00 84.61  ? 609  LYS A CG    1 
ATOM   2998 C CD    . LYS A 1 507 ? 4.459   69.282  -1.527  1.00 83.98  ? 609  LYS A CD    1 
ATOM   2999 C CE    . LYS A 1 507 ? 3.636   70.354  -0.840  1.00 85.66  ? 609  LYS A CE    1 
ATOM   3000 N NZ    . LYS A 1 507 ? 3.995   70.587  0.618   1.00 90.84  ? 609  LYS A NZ    1 
ATOM   3001 N N     . GLN A 1 508 ? 2.170   65.526  -0.965  1.00 58.77  ? 610  GLN A N     1 
ATOM   3002 C CA    . GLN A 1 508 ? 0.966   65.498  -0.145  1.00 58.53  ? 610  GLN A CA    1 
ATOM   3003 C C     . GLN A 1 508 ? 0.798   64.161  0.556   1.00 63.25  ? 610  GLN A C     1 
ATOM   3004 O O     . GLN A 1 508 ? 0.333   64.108  1.686   1.00 67.08  ? 610  GLN A O     1 
ATOM   3005 C CB    . GLN A 1 508 ? -0.299  65.789  -0.969  1.00 54.15  ? 610  GLN A CB    1 
ATOM   3006 C CG    . GLN A 1 508 ? -0.353  67.093  -1.715  1.00 50.70  ? 610  GLN A CG    1 
ATOM   3007 C CD    . GLN A 1 508 ? 0.547   68.157  -1.179  1.00 50.77  ? 610  GLN A CD    1 
ATOM   3008 O OE1   . GLN A 1 508 ? 0.760   68.287  0.020   1.00 51.65  ? 610  GLN A OE1   1 
ATOM   3009 N NE2   . GLN A 1 508 ? 1.065   68.960  -2.076  1.00 51.75  ? 610  GLN A NE2   1 
ATOM   3010 N N     . ALA A 1 509 ? 1.169   63.086  -0.130  1.00 85.00  ? 611  ALA A N     1 
ATOM   3011 C CA    . ALA A 1 509 ? 1.057   61.761  0.432   1.00 91.55  ? 611  ALA A CA    1 
ATOM   3012 C C     . ALA A 1 509 ? 2.167   61.456  1.452   1.00 95.07  ? 611  ALA A C     1 
ATOM   3013 O O     . ALA A 1 509 ? 1.902   60.870  2.511   1.00 101.01 ? 611  ALA A O     1 
ATOM   3014 C CB    . ALA A 1 509 ? 1.020   60.723  -0.690  1.00 65.63  ? 611  ALA A CB    1 
ATOM   3015 N N     . LEU A 1 510 ? 3.404   61.825  1.157   1.00 81.53  ? 612  LEU A N     1 
ATOM   3016 C CA    . LEU A 1 510 ? 4.448   61.598  2.152   1.00 83.35  ? 612  LEU A CA    1 
ATOM   3017 C C     . LEU A 1 510 ? 4.194   62.552  3.337   1.00 85.14  ? 612  LEU A C     1 
ATOM   3018 O O     . LEU A 1 510 ? 4.601   62.290  4.471   1.00 83.72  ? 612  LEU A O     1 
ATOM   3019 C CB    . LEU A 1 510 ? 5.838   61.852  1.568   1.00 43.58  ? 612  LEU A CB    1 
ATOM   3020 C CG    . LEU A 1 510 ? 6.273   60.808  0.544   1.00 41.15  ? 612  LEU A CG    1 
ATOM   3021 C CD1   . LEU A 1 510 ? 7.734   61.066  0.144   1.00 42.73  ? 612  LEU A CD1   1 
ATOM   3022 C CD2   . LEU A 1 510 ? 6.110   59.436  1.127   1.00 36.88  ? 612  LEU A CD2   1 
ATOM   3023 N N     . ALA A 1 511 ? 3.481   63.639  3.063   1.00 108.34 ? 613  ALA A N     1 
ATOM   3024 C CA    . ALA A 1 511 ? 3.184   64.613  4.089   1.00 111.60 ? 613  ALA A CA    1 
ATOM   3025 C C     . ALA A 1 511 ? 1.915   64.253  4.858   1.00 111.72 ? 613  ALA A C     1 
ATOM   3026 O O     . ALA A 1 511 ? 1.724   64.749  5.978   1.00 123.38 ? 613  ALA A O     1 
ATOM   3027 C CB    . ALA A 1 511 ? 3.087   66.003  3.480   1.00 71.42  ? 613  ALA A CB    1 
ATOM   3028 N N     . THR A 1 512 ? 1.047   63.412  4.279   1.00 53.90  ? 614  THR A N     1 
ATOM   3029 C CA    . THR A 1 512 ? -0.148  62.988  5.045   1.00 52.83  ? 614  THR A CA    1 
ATOM   3030 C C     . THR A 1 512 ? 0.350   61.712  5.772   1.00 56.45  ? 614  THR A C     1 
ATOM   3031 O O     . THR A 1 512 ? -0.246  61.214  6.761   1.00 55.45  ? 614  THR A O     1 
ATOM   3032 C CB    . THR A 1 512 ? -1.348  62.633  4.164   1.00 49.48  ? 614  THR A CB    1 
ATOM   3033 O OG1   . THR A 1 512 ? -1.347  63.435  2.965   1.00 51.77  ? 614  THR A OG1   1 
ATOM   3034 C CG2   . THR A 1 512 ? -2.630  62.848  4.939   1.00 48.75  ? 614  THR A CG2   1 
ATOM   3035 N N     . VAL A 1 513 ? 1.463   61.189  5.274   1.00 62.25  ? 615  VAL A N     1 
ATOM   3036 C CA    . VAL A 1 513 ? 2.047   60.065  5.904   1.00 65.90  ? 615  VAL A CA    1 
ATOM   3037 C C     . VAL A 1 513 ? 2.524   60.545  7.278   1.00 73.54  ? 615  VAL A C     1 
ATOM   3038 O O     . VAL A 1 513 ? 1.923   60.143  8.309   1.00 74.46  ? 615  VAL A O     1 
ATOM   3039 C CB    . VAL A 1 513 ? 3.234   59.480  5.048   1.00 97.49  ? 615  VAL A CB    1 
ATOM   3040 C CG1   . VAL A 1 513 ? 4.549   59.359  5.866   1.00 94.56  ? 615  VAL A CG1   1 
ATOM   3041 C CG2   . VAL A 1 513 ? 2.825   58.106  4.511   1.00 97.89  ? 615  VAL A CG2   1 
ATOM   3042 N N     . GLN A 1 514 ? 3.562   61.408  7.305   1.00 110.49 ? 616  GLN A N     1 
ATOM   3043 C CA    . GLN A 1 514 ? 4.171   61.847  8.576   1.00 118.43 ? 616  GLN A CA    1 
ATOM   3044 C C     . GLN A 1 514 ? 3.165   62.396  9.556   1.00 115.22 ? 616  GLN A C     1 
ATOM   3045 O O     . GLN A 1 514 ? 3.348   62.306  10.766  1.00 116.19 ? 616  GLN A O     1 
ATOM   3046 C CB    . GLN A 1 514 ? 5.354   62.799  8.341   1.00 112.93 ? 616  GLN A CB    1 
ATOM   3047 C CG    . GLN A 1 514 ? 6.364   62.843  9.516   1.00 122.52 ? 616  GLN A CG    1 
ATOM   3048 C CD    . GLN A 1 514 ? 6.966   61.474  9.902   1.00 125.39 ? 616  GLN A CD    1 
ATOM   3049 O OE1   . GLN A 1 514 ? 6.279   60.454  9.893   1.00 122.06 ? 616  GLN A OE1   1 
ATOM   3050 N NE2   . GLN A 1 514 ? 8.249   61.469  10.268  1.00 125.71 ? 616  GLN A NE2   1 
ATOM   3051 N N     . ARG A 1 515 ? 2.092   62.952  9.019   1.00 145.07 ? 617  ARG A N     1 
ATOM   3052 C CA    . ARG A 1 515 ? 0.953   63.365  9.836   1.00 141.00 ? 617  ARG A CA    1 
ATOM   3053 C C     . ARG A 1 515 ? 0.303   62.151  10.466  1.00 138.03 ? 617  ARG A C     1 
ATOM   3054 O O     . ARG A 1 515 ? 0.496   61.858  11.655  1.00 141.03 ? 617  ARG A O     1 
ATOM   3055 C CB    . ARG A 1 515 ? -0.230  63.928  9.026   1.00 83.10  ? 617  ARG A CB    1 
ATOM   3056 C CG    . ARG A 1 515 ? -0.133  65.340  8.389   1.00 72.88  ? 617  ARG A CG    1 
ATOM   3057 C CD    . ARG A 1 515 ? -0.914  66.380  9.187   1.00 68.65  ? 617  ARG A CD    1 
ATOM   3058 N NE    . ARG A 1 515 ? -2.311  66.076  9.444   1.00 62.39  ? 617  ARG A NE    1 
ATOM   3059 C CZ    . ARG A 1 515 ? -3.315  66.191  8.558   1.00 58.06  ? 617  ARG A CZ    1 
ATOM   3060 N NH1   . ARG A 1 515 ? -3.101  66.600  7.275   1.00 54.07  ? 617  ARG A NH1   1 
ATOM   3061 N NH2   . ARG A 1 515 ? -4.572  65.940  8.984   1.00 56.45  ? 617  ARG A NH2   1 
ATOM   3062 N N     . LEU A 1 516 ? -0.430  61.415  9.647   1.00 81.00  ? 618  LEU A N     1 
ATOM   3063 C CA    . LEU A 1 516 ? -1.294  60.385  10.150  1.00 82.98  ? 618  LEU A CA    1 
ATOM   3064 C C     . LEU A 1 516 ? -0.792  58.996  10.510  1.00 84.69  ? 618  LEU A C     1 
ATOM   3065 O O     . LEU A 1 516 ? -1.520  58.205  11.097  1.00 86.63  ? 618  LEU A O     1 
ATOM   3066 C CB    . LEU A 1 516 ? -2.507  60.354  9.233   1.00 59.53  ? 618  LEU A CB    1 
ATOM   3067 C CG    . LEU A 1 516 ? -3.228  61.715  9.132   1.00 57.08  ? 618  LEU A CG    1 
ATOM   3068 C CD1   . LEU A 1 516 ? -3.968  61.864  7.779   1.00 55.36  ? 618  LEU A CD1   1 
ATOM   3069 C CD2   . LEU A 1 516 ? -4.249  61.839  10.305  1.00 57.97  ? 618  LEU A CD2   1 
ATOM   3070 N N     . LEU A 1 517 ? 0.468   58.741  10.210  1.00 69.69  ? 619  LEU A N     1 
ATOM   3071 C CA    . LEU A 1 517 ? 1.025   57.430  10.438  1.00 72.36  ? 619  LEU A CA    1 
ATOM   3072 C C     . LEU A 1 517 ? 0.811   56.843  11.826  1.00 74.74  ? 619  LEU A C     1 
ATOM   3073 O O     . LEU A 1 517 ? 0.286   55.721  11.945  1.00 71.93  ? 619  LEU A O     1 
ATOM   3074 C CB    . LEU A 1 517 ? 2.522   57.408  10.081  1.00 74.71  ? 619  LEU A CB    1 
ATOM   3075 C CG    . LEU A 1 517 ? 3.299   56.071  10.012  1.00 79.27  ? 619  LEU A CG    1 
ATOM   3076 C CD1   . LEU A 1 517 ? 3.427   55.484  11.431  1.00 83.52  ? 619  LEU A CD1   1 
ATOM   3077 C CD2   . LEU A 1 517 ? 2.638   55.063  9.041   1.00 74.34  ? 619  LEU A CD2   1 
ATOM   3078 N N     . PRO A 1 518 ? 1.230   57.561  12.892  1.00 95.11  ? 620  PRO A N     1 
ATOM   3079 C CA    . PRO A 1 518 ? 1.036   57.007  14.237  1.00 97.02  ? 620  PRO A CA    1 
ATOM   3080 C C     . PRO A 1 518 ? -0.428  57.072  14.664  1.00 100.65 ? 620  PRO A C     1 
ATOM   3081 O O     . PRO A 1 518 ? -0.932  56.183  15.352  1.00 101.88 ? 620  PRO A O     1 
ATOM   3082 C CB    . PRO A 1 518 ? 1.931   57.885  15.101  1.00 98.87  ? 620  PRO A CB    1 
ATOM   3083 C CG    . PRO A 1 518 ? 1.853   59.201  14.421  1.00 96.60  ? 620  PRO A CG    1 
ATOM   3084 C CD    . PRO A 1 518 ? 1.876   58.887  12.947  1.00 94.71  ? 620  PRO A CD    1 
ATOM   3085 N N     . VAL A 1 519 ? -1.106  58.129  14.233  1.00 113.48 ? 621  VAL A N     1 
ATOM   3086 C CA    . VAL A 1 519 ? -2.508  58.354  14.562  1.00 118.04 ? 621  VAL A CA    1 
ATOM   3087 C C     . VAL A 1 519 ? -3.379  57.177  14.148  1.00 121.34 ? 621  VAL A C     1 
ATOM   3088 O O     . VAL A 1 519 ? -4.588  57.168  14.405  1.00 123.83 ? 621  VAL A O     1 
ATOM   3089 C CB    . VAL A 1 519 ? -3.032  59.641  13.879  1.00 99.03  ? 621  VAL A CB    1 
ATOM   3090 C CG1   . VAL A 1 519 ? -4.258  60.166  14.611  1.00 103.08 ? 621  VAL A CG1   1 
ATOM   3091 C CG2   . VAL A 1 519 ? -1.928  60.716  13.866  1.00 100.36 ? 621  VAL A CG2   1 
ATOM   3092 N N     . LEU A 1 520 ? -2.754  56.164  13.551  1.00 132.08 ? 622  LEU A N     1 
ATOM   3093 C CA    . LEU A 1 520 ? -3.483  54.998  13.055  1.00 132.29 ? 622  LEU A CA    1 
ATOM   3094 C C     . LEU A 1 520 ? -2.964  53.644  13.557  1.00 132.26 ? 622  LEU A C     1 
ATOM   3095 O O     . LEU A 1 520 ? -3.631  52.625  13.373  1.00 135.51 ? 622  LEU A O     1 
ATOM   3096 C CB    . LEU A 1 520 ? -3.505  55.062  11.508  1.00 163.36 ? 622  LEU A CB    1 
ATOM   3097 C CG    . LEU A 1 520 ? -4.292  56.235  10.856  1.00 167.92 ? 622  LEU A CG    1 
ATOM   3098 C CD1   . LEU A 1 520 ? -3.715  56.611  9.497   1.00 169.18 ? 622  LEU A CD1   1 
ATOM   3099 C CD2   . LEU A 1 520 ? -5.763  55.863  10.703  1.00 171.94 ? 622  LEU A CD2   1 
ATOM   3100 N N     . CYS A 1 521 ? -1.806  53.634  14.218  1.00 135.59 ? 623  CYS A N     1 
ATOM   3101 C CA    . CYS A 1 521 ? -1.220  52.384  14.724  1.00 140.31 ? 623  CYS A CA    1 
ATOM   3102 C C     . CYS A 1 521 ? -1.604  52.052  16.166  1.00 141.30 ? 623  CYS A C     1 
ATOM   3103 O O     . CYS A 1 521 ? -2.275  51.046  16.420  1.00 137.94 ? 623  CYS A O     1 
ATOM   3104 C CB    . CYS A 1 521 ? 0.311   52.414  14.566  1.00 119.33 ? 623  CYS A CB    1 
ATOM   3105 S SG    . CYS A 1 521 ? 0.877   52.002  12.890  1.00 114.77 ? 623  CYS A SG    1 
ATOM   3106 N N     . GLN A 1 522 ? -1.170  52.891  17.100  1.00 142.83 ? 624  GLN A N     1 
ATOM   3107 C CA    . GLN A 1 522 ? -1.505  52.701  18.502  1.00 144.60 ? 624  GLN A CA    1 
ATOM   3108 C C     . GLN A 1 522 ? -2.941  53.191  18.734  1.00 146.60 ? 624  GLN A C     1 
ATOM   3109 O O     . GLN A 1 522 ? -3.667  52.660  19.574  1.00 149.91 ? 624  GLN A O     1 
ATOM   3110 C CB    . GLN A 1 522 ? -0.524  53.501  19.388  1.00 92.89  ? 624  GLN A CB    1 
ATOM   3111 C CG    . GLN A 1 522 ? -0.578  53.180  20.898  1.00 91.56  ? 624  GLN A CG    1 
ATOM   3112 C CD    . GLN A 1 522 ? 0.604   53.724  21.678  1.00 91.50  ? 624  GLN A CD    1 
ATOM   3113 O OE1   . GLN A 1 522 ? 1.377   54.540  21.177  1.00 93.49  ? 624  GLN A OE1   1 
ATOM   3114 N NE2   . GLN A 1 522 ? 0.742   53.279  22.919  1.00 91.94  ? 624  GLN A NE2   1 
ATOM   3115 N N     . ALA A 1 523 ? -3.358  54.174  17.941  1.00 105.46 ? 625  ALA A N     1 
ATOM   3116 C CA    . ALA A 1 523 ? -4.652  54.813  18.123  1.00 101.10 ? 625  ALA A CA    1 
ATOM   3117 C C     . ALA A 1 523 ? -5.793  54.459  17.174  1.00 101.87 ? 625  ALA A C     1 
ATOM   3118 O O     . ALA A 1 523 ? -6.942  54.848  17.432  1.00 100.32 ? 625  ALA A O     1 
ATOM   3119 C CB    . ALA A 1 523 ? -4.433  56.334  18.142  1.00 52.28  ? 625  ALA A CB    1 
ATOM   3120 N N     . HIS A 1 524 ? -5.488  53.739  16.090  1.00 154.38 ? 626  HIS A N     1 
ATOM   3121 C CA    . HIS A 1 524 ? -6.514  53.373  15.099  1.00 154.91 ? 626  HIS A CA    1 
ATOM   3122 C C     . HIS A 1 524 ? -6.390  51.969  14.506  1.00 151.64 ? 626  HIS A C     1 
ATOM   3123 O O     . HIS A 1 524 ? -6.991  51.661  13.490  1.00 148.61 ? 626  HIS A O     1 
ATOM   3124 C CB    . HIS A 1 524 ? -6.590  54.426  13.961  1.00 110.35 ? 626  HIS A CB    1 
ATOM   3125 C CG    . HIS A 1 524 ? -7.536  55.568  14.245  1.00 114.60 ? 626  HIS A CG    1 
ATOM   3126 N ND1   . HIS A 1 524 ? -7.150  56.901  14.205  1.00 114.45 ? 626  HIS A ND1   1 
ATOM   3127 C CD2   . HIS A 1 524 ? -8.859  55.582  14.540  1.00 116.87 ? 626  HIS A CD2   1 
ATOM   3128 C CE1   . HIS A 1 524 ? -8.194  57.667  14.459  1.00 116.40 ? 626  HIS A CE1   1 
ATOM   3129 N NE2   . HIS A 1 524 ? -9.251  56.893  14.666  1.00 120.52 ? 626  HIS A NE2   1 
ATOM   3130 N N     . GLY A 1 525 ? -5.603  51.125  15.155  1.00 140.31 ? 627  GLY A N     1 
ATOM   3131 C CA    . GLY A 1 525 ? -5.435  49.743  14.737  1.00 135.40 ? 627  GLY A CA    1 
ATOM   3132 C C     . GLY A 1 525 ? -5.086  49.297  13.322  1.00 129.23 ? 627  GLY A C     1 
ATOM   3133 O O     . GLY A 1 525 ? -5.509  48.209  12.914  1.00 128.04 ? 627  GLY A O     1 
ATOM   3134 N N     . LEU A 1 526 ? -4.308  50.096  12.585  1.00 92.24  ? 628  LEU A N     1 
ATOM   3135 C CA    . LEU A 1 526 ? -3.890  49.789  11.201  1.00 84.46  ? 628  LEU A CA    1 
ATOM   3136 C C     . LEU A 1 526 ? -2.399  49.649  11.383  1.00 83.93  ? 628  LEU A C     1 
ATOM   3137 O O     . LEU A 1 526 ? -1.806  50.313  12.203  1.00 84.55  ? 628  LEU A O     1 
ATOM   3138 C CB    . LEU A 1 526 ? -4.223  50.914  10.167  1.00 80.96  ? 628  LEU A CB    1 
ATOM   3139 C CG    . LEU A 1 526 ? -5.670  51.484  9.885   1.00 80.96  ? 628  LEU A CG    1 
ATOM   3140 C CD1   . LEU A 1 526 ? -5.814  51.886  8.432   1.00 78.53  ? 628  LEU A CD1   1 
ATOM   3141 C CD2   . LEU A 1 526 ? -6.745  50.502  10.174  1.00 81.72  ? 628  LEU A CD2   1 
ATOM   3142 N N     . THR A 1 527 ? -1.810  48.746  10.620  1.00 79.19  ? 629  THR A N     1 
ATOM   3143 C CA    . THR A 1 527 ? -0.376  48.458  10.719  1.00 81.71  ? 629  THR A CA    1 
ATOM   3144 C C     . THR A 1 527 ? 0.423   49.474  9.916   1.00 83.87  ? 629  THR A C     1 
ATOM   3145 O O     . THR A 1 527 ? -0.123  50.510  9.535   1.00 75.66  ? 629  THR A O     1 
ATOM   3146 C CB    . THR A 1 527 ? -0.028  47.064  10.107  1.00 139.49 ? 629  THR A CB    1 
ATOM   3147 O OG1   . THR A 1 527 ? 0.068   47.193  8.679   1.00 136.38 ? 629  THR A OG1   1 
ATOM   3148 C CG2   . THR A 1 527 ? -1.098  46.003  10.453  1.00 143.85 ? 629  THR A CG2   1 
ATOM   3149 N N     . PRO A 1 528 ? 1.736   49.217  9.710   1.00 135.20 ? 630  PRO A N     1 
ATOM   3150 C CA    . PRO A 1 528 ? 2.548   50.123  8.881   1.00 137.25 ? 630  PRO A CA    1 
ATOM   3151 C C     . PRO A 1 528 ? 2.151   49.853  7.408   1.00 139.08 ? 630  PRO A C     1 
ATOM   3152 O O     . PRO A 1 528 ? 1.673   50.738  6.693   1.00 131.69 ? 630  PRO A O     1 
ATOM   3153 C CB    . PRO A 1 528 ? 3.975   49.633  9.087   1.00 106.98 ? 630  PRO A CB    1 
ATOM   3154 C CG    . PRO A 1 528 ? 3.972   49.080  10.439  1.00 111.73 ? 630  PRO A CG    1 
ATOM   3155 C CD    . PRO A 1 528 ? 2.604   48.422  10.611  1.00 108.63 ? 630  PRO A CD    1 
ATOM   3156 N N     . ASP A 1 529 ? 2.392   48.617  6.962   1.00 112.75 ? 631  ASP A N     1 
ATOM   3157 C CA    . ASP A 1 529 ? 2.074   48.171  5.593   1.00 106.23 ? 631  ASP A CA    1 
ATOM   3158 C C     . ASP A 1 529 ? 0.618   48.570  5.284   1.00 102.60 ? 631  ASP A C     1 
ATOM   3159 O O     . ASP A 1 529 ? 0.371   49.264  4.316   1.00 98.25  ? 631  ASP A O     1 
ATOM   3160 C CB    . ASP A 1 529 ? 2.264   46.630  5.462   1.00 99.12  ? 631  ASP A CB    1 
ATOM   3161 C CG    . ASP A 1 529 ? 3.557   46.115  6.121   1.00 100.72 ? 631  ASP A CG    1 
ATOM   3162 O OD1   . ASP A 1 529 ? 3.949   44.965  5.855   1.00 101.20 ? 631  ASP A OD1   1 
ATOM   3163 O OD2   . ASP A 1 529 ? 4.176   46.844  6.917   1.00 101.16 ? 631  ASP A OD2   1 
ATOM   3164 N N     . GLN A 1 530 ? -0.324  48.136  6.127   1.00 85.63  ? 632  GLN A N     1 
ATOM   3165 C CA    . GLN A 1 530 ? -1.768  48.435  5.978   1.00 81.90  ? 632  GLN A CA    1 
ATOM   3166 C C     . GLN A 1 530 ? -2.061  49.918  5.611   1.00 81.52  ? 632  GLN A C     1 
ATOM   3167 O O     . GLN A 1 530 ? -3.148  50.226  5.150   1.00 75.59  ? 632  GLN A O     1 
ATOM   3168 C CB    . GLN A 1 530 ? -2.525  48.067  7.277   1.00 98.06  ? 632  GLN A CB    1 
ATOM   3169 C CG    . GLN A 1 530 ? -3.841  47.320  7.050   1.00 97.76  ? 632  GLN A CG    1 
ATOM   3170 C CD    . GLN A 1 530 ? -4.793  47.339  8.255   1.00 97.92  ? 632  GLN A CD    1 
ATOM   3171 O OE1   . GLN A 1 530 ? -4.372  47.607  9.391   1.00 98.02  ? 632  GLN A OE1   1 
ATOM   3172 N NE2   . GLN A 1 530 ? -6.086  47.042  8.008   1.00 91.13  ? 632  GLN A NE2   1 
ATOM   3173 N N     . VAL A 1 531 ? -1.083  50.814  5.804   1.00 115.34 ? 633  VAL A N     1 
ATOM   3174 C CA    . VAL A 1 531 ? -1.236  52.261  5.517   1.00 111.89 ? 633  VAL A CA    1 
ATOM   3175 C C     . VAL A 1 531 ? -0.314  52.788  4.391   1.00 110.52 ? 633  VAL A C     1 
ATOM   3176 O O     . VAL A 1 531 ? -0.764  53.603  3.570   1.00 110.26 ? 633  VAL A O     1 
ATOM   3177 C CB    . VAL A 1 531 ? -1.058  53.103  6.818   1.00 72.02  ? 633  VAL A CB    1 
ATOM   3178 C CG1   . VAL A 1 531 ? -0.537  54.496  6.496   1.00 70.56  ? 633  VAL A CG1   1 
ATOM   3179 C CG2   . VAL A 1 531 ? -2.384  53.175  7.570   1.00 66.74  ? 633  VAL A CG2   1 
ATOM   3180 N N     . VAL A 1 532 ? 0.966   52.380  4.377   1.00 71.18  ? 634  VAL A N     1 
ATOM   3181 C CA    . VAL A 1 532 ? 1.837   52.722  3.251   1.00 60.36  ? 634  VAL A CA    1 
ATOM   3182 C C     . VAL A 1 532 ? 1.052   52.281  1.983   1.00 61.48  ? 634  VAL A C     1 
ATOM   3183 O O     . VAL A 1 532 ? 1.102   52.952  0.971   1.00 63.06  ? 634  VAL A O     1 
ATOM   3184 C CB    . VAL A 1 532 ? 3.165   51.974  3.293   1.00 40.72  ? 634  VAL A CB    1 
ATOM   3185 C CG1   . VAL A 1 532 ? 3.614   51.923  4.674   1.00 44.04  ? 634  VAL A CG1   1 
ATOM   3186 C CG2   . VAL A 1 532 ? 3.059   50.567  2.775   1.00 39.36  ? 634  VAL A CG2   1 
ATOM   3187 N N     . ALA A 1 533 ? 0.326   51.158  2.049   1.00 79.25  ? 635  ALA A N     1 
ATOM   3188 C CA    . ALA A 1 533 ? -0.482  50.664  0.943   1.00 74.42  ? 635  ALA A CA    1 
ATOM   3189 C C     . ALA A 1 533 ? -1.663  51.596  0.693   1.00 75.30  ? 635  ALA A C     1 
ATOM   3190 O O     . ALA A 1 533 ? -2.610  51.237  -0.003  1.00 79.64  ? 635  ALA A O     1 
ATOM   3191 C CB    . ALA A 1 533 ? -0.979  49.286  1.253   1.00 46.70  ? 635  ALA A CB    1 
ATOM   3192 N N     . ILE A 1 534 ? -1.631  52.784  1.284   1.00 66.92  ? 636  ILE A N     1 
ATOM   3193 C CA    . ILE A 1 534 ? -2.716  53.751  1.071   1.00 69.13  ? 636  ILE A CA    1 
ATOM   3194 C C     . ILE A 1 534 ? -1.980  54.925  0.449   1.00 69.62  ? 636  ILE A C     1 
ATOM   3195 O O     . ILE A 1 534 ? -2.450  55.590  -0.463  1.00 70.81  ? 636  ILE A O     1 
ATOM   3196 C CB    . ILE A 1 534 ? -3.470  54.121  2.384   1.00 128.26 ? 636  ILE A CB    1 
ATOM   3197 C CG1   . ILE A 1 534 ? -3.902  52.828  3.116   1.00 129.06 ? 636  ILE A CG1   1 
ATOM   3198 C CG2   . ILE A 1 534 ? -4.698  54.993  2.029   1.00 126.96 ? 636  ILE A CG2   1 
ATOM   3199 C CD1   . ILE A 1 534 ? -4.855  53.031  4.294   1.00 128.36 ? 636  ILE A CD1   1 
ATOM   3200 N N     . ALA A 1 535 ? -0.801  55.165  0.977   1.00 68.98  ? 637  ALA A N     1 
ATOM   3201 C CA    . ALA A 1 535 ? 0.122   56.087  0.369   1.00 64.82  ? 637  ALA A CA    1 
ATOM   3202 C C     . ALA A 1 535 ? 0.487   55.512  -1.022  1.00 64.58  ? 637  ALA A C     1 
ATOM   3203 O O     . ALA A 1 535 ? 0.114   56.106  -2.048  1.00 58.87  ? 637  ALA A O     1 
ATOM   3204 C CB    . ALA A 1 535 ? 1.379   56.151  1.173   1.00 68.96  ? 637  ALA A CB    1 
ATOM   3205 N N     . SER A 1 536 ? 1.191   54.359  -1.046  1.00 80.91  ? 638  SER A N     1 
ATOM   3206 C CA    . SER A 1 536 ? 1.708   53.753  -2.292  1.00 83.80  ? 638  SER A CA    1 
ATOM   3207 C C     . SER A 1 536 ? 0.789   53.779  -3.563  1.00 80.38  ? 638  SER A C     1 
ATOM   3208 O O     . SER A 1 536 ? 1.233   54.051  -4.725  1.00 77.34  ? 638  SER A O     1 
ATOM   3209 C CB    . SER A 1 536 ? 2.613   52.508  -1.997  1.00 101.47 ? 638  SER A CB    1 
ATOM   3210 O OG    . SER A 1 536 ? 1.952   51.332  -1.585  1.00 104.32 ? 638  SER A OG    1 
ATOM   3211 N N     . ASN A 1 537 ? -0.498  53.583  -3.347  1.00 68.47  ? 639  ASN A N     1 
ATOM   3212 C CA    . ASN A 1 537 ? -1.410  53.785  -4.472  1.00 75.47  ? 639  ASN A CA    1 
ATOM   3213 C C     . ASN A 1 537 ? -1.778  55.263  -4.837  1.00 78.93  ? 639  ASN A C     1 
ATOM   3214 O O     . ASN A 1 537 ? -1.403  56.241  -4.130  1.00 77.58  ? 639  ASN A O     1 
ATOM   3215 C CB    . ASN A 1 537 ? -2.683  52.974  -4.233  1.00 88.13  ? 639  ASN A CB    1 
ATOM   3216 C CG    . ASN A 1 537 ? -3.603  52.986  -5.432  1.00 92.55  ? 639  ASN A CG    1 
ATOM   3217 O OD1   . ASN A 1 537 ? -4.239  53.987  -5.728  1.00 91.71  ? 639  ASN A OD1   1 
ATOM   3218 N ND2   . ASN A 1 537 ? -3.669  51.878  -6.133  1.00 93.94  ? 639  ASN A ND2   1 
ATOM   3219 N N     . GLY A 1 538 ? -2.489  55.413  -5.952  1.00 117.39 ? 640  GLY A N     1 
ATOM   3220 C CA    . GLY A 1 538 ? -2.902  56.727  -6.425  1.00 123.32 ? 640  GLY A CA    1 
ATOM   3221 C C     . GLY A 1 538 ? -3.566  57.648  -5.406  1.00 121.38 ? 640  GLY A C     1 
ATOM   3222 O O     . GLY A 1 538 ? -3.281  58.868  -5.411  1.00 114.75 ? 640  GLY A O     1 
ATOM   3223 N N     . GLY A 1 539 ? -4.424  57.047  -4.552  1.00 96.71  ? 641  GLY A N     1 
ATOM   3224 C CA    . GLY A 1 539 ? -5.202  57.718  -3.492  1.00 92.72  ? 641  GLY A CA    1 
ATOM   3225 C C     . GLY A 1 539 ? -4.530  58.875  -2.743  1.00 91.83  ? 641  GLY A C     1 
ATOM   3226 O O     . GLY A 1 539 ? -5.071  59.977  -2.713  1.00 96.65  ? 641  GLY A O     1 
ATOM   3227 N N     . GLY A 1 540 ? -3.426  58.574  -2.058  1.00 94.76  ? 642  GLY A N     1 
ATOM   3228 C CA    . GLY A 1 540 ? -2.614  59.561  -1.361  1.00 89.18  ? 642  GLY A CA    1 
ATOM   3229 C C     . GLY A 1 540 ? -3.035  60.144  -0.013  1.00 90.48  ? 642  GLY A C     1 
ATOM   3230 O O     . GLY A 1 540 ? -2.998  59.484  1.025   1.00 91.38  ? 642  GLY A O     1 
ATOM   3231 N N     . LYS A 1 541 ? -3.427  61.412  -0.070  1.00 59.28  ? 643  LYS A N     1 
ATOM   3232 C CA    . LYS A 1 541 ? -3.572  62.337  1.028   1.00 55.52  ? 643  LYS A CA    1 
ATOM   3233 C C     . LYS A 1 541 ? -5.053  62.206  1.236   1.00 53.22  ? 643  LYS A C     1 
ATOM   3234 O O     . LYS A 1 541 ? -5.504  61.623  2.171   1.00 50.68  ? 643  LYS A O     1 
ATOM   3235 C CB    . LYS A 1 541 ? -3.258  63.763  0.555   1.00 86.33  ? 643  LYS A CB    1 
ATOM   3236 C CG    . LYS A 1 541 ? -3.956  64.902  1.294   1.00 85.02  ? 643  LYS A CG    1 
ATOM   3237 C CD    . LYS A 1 541 ? -3.388  66.182  0.726   1.00 83.03  ? 643  LYS A CD    1 
ATOM   3238 C CE    . LYS A 1 541 ? -4.158  67.405  1.164   1.00 88.19  ? 643  LYS A CE    1 
ATOM   3239 N NZ    . LYS A 1 541 ? -3.427  68.648  0.789   1.00 88.77  ? 643  LYS A NZ    1 
ATOM   3240 N N     . GLN A 1 542 ? -5.829  62.734  0.316   1.00 50.04  ? 644  GLN A N     1 
ATOM   3241 C CA    . GLN A 1 542 ? -7.295  62.690  0.387   1.00 59.20  ? 644  GLN A CA    1 
ATOM   3242 C C     . GLN A 1 542 ? -7.848  61.340  0.834   1.00 55.14  ? 644  GLN A C     1 
ATOM   3243 O O     . GLN A 1 542 ? -8.946  61.295  1.370   1.00 50.46  ? 644  GLN A O     1 
ATOM   3244 C CB    . GLN A 1 542 ? -7.914  63.084  -0.987  1.00 105.24 ? 644  GLN A CB    1 
ATOM   3245 C CG    . GLN A 1 542 ? -7.843  64.589  -1.358  1.00 105.09 ? 644  GLN A CG    1 
ATOM   3246 C CD    . GLN A 1 542 ? -8.737  65.470  -0.493  1.00 114.32 ? 644  GLN A CD    1 
ATOM   3247 O OE1   . GLN A 1 542 ? -9.208  65.053  0.570   1.00 121.35 ? 644  GLN A OE1   1 
ATOM   3248 N NE2   . GLN A 1 542 ? -8.961  66.700  -0.939  1.00 116.93 ? 644  GLN A NE2   1 
ATOM   3249 N N     . ALA A 1 543 ? -7.104  60.254  0.605   1.00 90.39  ? 645  ALA A N     1 
ATOM   3250 C CA    . ALA A 1 543 ? -7.574  58.935  0.993   1.00 96.11  ? 645  ALA A CA    1 
ATOM   3251 C C     . ALA A 1 543 ? -7.130  58.562  2.428   1.00 100.37 ? 645  ALA A C     1 
ATOM   3252 O O     . ALA A 1 543 ? -7.919  57.932  3.146   1.00 106.55 ? 645  ALA A O     1 
ATOM   3253 C CB    . ALA A 1 543 ? -7.141  57.905  -0.028  1.00 200.00 ? 645  ALA A CB    1 
ATOM   3254 N N     . LEU A 1 544 ? -5.906  58.934  2.848   1.00 87.18  ? 646  LEU A N     1 
ATOM   3255 C CA    . LEU A 1 544 ? -5.448  58.712  4.256   1.00 84.90  ? 646  LEU A CA    1 
ATOM   3256 C C     . LEU A 1 544 ? -6.333  59.536  5.200   1.00 86.59  ? 646  LEU A C     1 
ATOM   3257 O O     . LEU A 1 544 ? -6.612  59.136  6.315   1.00 89.73  ? 646  LEU A O     1 
ATOM   3258 C CB    . LEU A 1 544 ? -4.018  59.212  4.493   1.00 56.08  ? 646  LEU A CB    1 
ATOM   3259 C CG    . LEU A 1 544 ? -2.834  58.362  4.017   1.00 50.73  ? 646  LEU A CG    1 
ATOM   3260 C CD1   . LEU A 1 544 ? -1.685  59.213  3.617   1.00 46.54  ? 646  LEU A CD1   1 
ATOM   3261 C CD2   . LEU A 1 544 ? -2.386  57.414  5.116   1.00 51.36  ? 646  LEU A CD2   1 
ATOM   3262 N N     . GLU A 1 545 ? -6.752  60.707  4.742   1.00 70.50  ? 647  GLU A N     1 
ATOM   3263 C CA    . GLU A 1 545 ? -7.579  61.587  5.531   1.00 73.80  ? 647  GLU A CA    1 
ATOM   3264 C C     . GLU A 1 545 ? -8.958  61.007  5.749   1.00 76.66  ? 647  GLU A C     1 
ATOM   3265 O O     . GLU A 1 545 ? -9.291  60.702  6.886   1.00 81.89  ? 647  GLU A O     1 
ATOM   3266 C CB    . GLU A 1 545 ? -7.613  62.983  4.886   1.00 80.19  ? 647  GLU A CB    1 
ATOM   3267 C CG    . GLU A 1 545 ? -6.248  63.643  4.996   1.00 80.89  ? 647  GLU A CG    1 
ATOM   3268 C CD    . GLU A 1 545 ? -6.222  65.069  4.509   1.00 82.77  ? 647  GLU A CD    1 
ATOM   3269 O OE1   . GLU A 1 545 ? -7.119  65.417  3.697   1.00 82.54  ? 647  GLU A OE1   1 
ATOM   3270 O OE2   . GLU A 1 545 ? -5.288  65.815  4.944   1.00 79.94  ? 647  GLU A OE2   1 
ATOM   3271 N N     . THR A 1 546 ? -9.738  60.847  4.679   1.00 76.09  ? 648  THR A N     1 
ATOM   3272 C CA    . THR A 1 546 ? -11.075 60.263  4.770   1.00 78.37  ? 648  THR A CA    1 
ATOM   3273 C C     . THR A 1 546 ? -11.048 58.995  5.633   1.00 76.44  ? 648  THR A C     1 
ATOM   3274 O O     . THR A 1 546 ? -12.069 58.601  6.188   1.00 79.13  ? 648  THR A O     1 
ATOM   3275 C CB    . THR A 1 546 ? -11.647 59.927  3.374   1.00 113.89 ? 648  THR A CB    1 
ATOM   3276 O OG1   . THR A 1 546 ? -12.130 61.134  2.775   1.00 120.04 ? 648  THR A OG1   1 
ATOM   3277 C CG2   . THR A 1 546 ? -12.784 58.912  3.467   1.00 116.04 ? 648  THR A CG2   1 
ATOM   3278 N N     . VAL A 1 547 ? -9.898  58.339  5.727   1.00 60.82  ? 649  VAL A N     1 
ATOM   3279 C CA    . VAL A 1 547 ? -9.800  57.200  6.591   1.00 62.48  ? 649  VAL A CA    1 
ATOM   3280 C C     . VAL A 1 547 ? -9.910  57.699  8.087   1.00 69.74  ? 649  VAL A C     1 
ATOM   3281 O O     . VAL A 1 547 ? -10.884 57.347  8.782   1.00 72.88  ? 649  VAL A O     1 
ATOM   3282 C CB    . VAL A 1 547 ? -8.481  56.390  6.299   1.00 67.20  ? 649  VAL A CB    1 
ATOM   3283 C CG1   . VAL A 1 547 ? -7.936  55.669  7.552   1.00 72.54  ? 649  VAL A CG1   1 
ATOM   3284 C CG2   . VAL A 1 547 ? -8.768  55.371  5.232   1.00 65.30  ? 649  VAL A CG2   1 
ATOM   3285 N N     . GLN A 1 548 ? -9.024  58.530  8.646   1.00 118.78 ? 650  GLN A N     1 
ATOM   3286 C CA    . GLN A 1 548 ? -9.285  58.816  10.046  1.00 122.16 ? 650  GLN A CA    1 
ATOM   3287 C C     . GLN A 1 548 ? -10.609 59.396  10.173  1.00 121.42 ? 650  GLN A C     1 
ATOM   3288 O O     . GLN A 1 548 ? -11.338 59.020  11.037  1.00 127.30 ? 650  GLN A O     1 
ATOM   3289 C CB    . GLN A 1 548 ? -8.402  59.841  10.665  1.00 117.13 ? 650  GLN A CB    1 
ATOM   3290 C CG    . GLN A 1 548 ? -9.173  61.100  11.037  1.00 117.68 ? 650  GLN A CG    1 
ATOM   3291 C CD    . GLN A 1 548 ? -8.371  61.976  11.955  1.00 117.91 ? 650  GLN A CD    1 
ATOM   3292 O OE1   . GLN A 1 548 ? -8.270  63.188  11.764  1.00 117.93 ? 650  GLN A OE1   1 
ATOM   3293 N NE2   . GLN A 1 548 ? -7.786  61.365  12.973  1.00 117.93 ? 650  GLN A NE2   1 
ATOM   3294 N N     . ARG A 1 549 ? -10.908 60.386  9.374   1.00 124.32 ? 651  ARG A N     1 
ATOM   3295 C CA    . ARG A 1 549 ? -12.208 60.959  9.523   1.00 126.20 ? 651  ARG A CA    1 
ATOM   3296 C C     . ARG A 1 549 ? -13.352 59.927  9.454   1.00 125.64 ? 651  ARG A C     1 
ATOM   3297 O O     . ARG A 1 549 ? -14.238 59.922  10.308  1.00 135.87 ? 651  ARG A O     1 
ATOM   3298 C CB    . ARG A 1 549 ? -12.376 62.081  8.483   1.00 95.32  ? 651  ARG A CB    1 
ATOM   3299 C CG    . ARG A 1 549 ? -13.801 62.291  7.881   1.00 92.83  ? 651  ARG A CG    1 
ATOM   3300 C CD    . ARG A 1 549 ? -13.693 62.996  6.530   1.00 89.14  ? 651  ARG A CD    1 
ATOM   3301 N NE    . ARG A 1 549 ? -14.885 62.796  5.708   1.00 89.26  ? 651  ARG A NE    1 
ATOM   3302 C CZ    . ARG A 1 549 ? -14.940 62.935  4.373   1.00 88.76  ? 651  ARG A CZ    1 
ATOM   3303 N NH1   . ARG A 1 549 ? -13.856 63.278  3.661   1.00 87.02  ? 651  ARG A NH1   1 
ATOM   3304 N NH2   . ARG A 1 549 ? -16.100 62.737  3.731   1.00 89.94  ? 651  ARG A NH2   1 
ATOM   3305 N N     . LEU A 1 550 ? -13.330 59.034  8.475   1.00 121.83 ? 652  LEU A N     1 
ATOM   3306 C CA    . LEU A 1 550 ? -14.459 58.112  8.301   1.00 123.00 ? 652  LEU A CA    1 
ATOM   3307 C C     . LEU A 1 550 ? -14.291 56.605  8.535   1.00 124.75 ? 652  LEU A C     1 
ATOM   3308 O O     . LEU A 1 550 ? -15.176 55.839  8.144   1.00 130.32 ? 652  LEU A O     1 
ATOM   3309 C CB    . LEU A 1 550 ? -15.085 58.334  6.913   1.00 75.02  ? 652  LEU A CB    1 
ATOM   3310 C CG    . LEU A 1 550 ? -16.132 59.462  6.837   1.00 79.60  ? 652  LEU A CG    1 
ATOM   3311 C CD1   . LEU A 1 550 ? -16.300 59.931  5.386   1.00 77.27  ? 652  LEU A CD1   1 
ATOM   3312 C CD2   . LEU A 1 550 ? -17.494 58.981  7.395   1.00 84.76  ? 652  LEU A CD2   1 
ATOM   3313 N N     . LEU A 1 551 ? -13.195 56.164  9.160   1.00 103.09 ? 653  LEU A N     1 
ATOM   3314 C CA    . LEU A 1 551 ? -13.031 54.724  9.393   1.00 102.02 ? 653  LEU A CA    1 
ATOM   3315 C C     . LEU A 1 551 ? -13.647 54.304  10.715  1.00 108.81 ? 653  LEU A C     1 
ATOM   3316 O O     . LEU A 1 551 ? -14.146 53.186  10.818  1.00 108.88 ? 653  LEU A O     1 
ATOM   3317 C CB    . LEU A 1 551 ? -11.551 54.246  9.308   1.00 53.01  ? 653  LEU A CB    1 
ATOM   3318 C CG    . LEU A 1 551 ? -10.618 54.053  10.492  1.00 49.85  ? 653  LEU A CG    1 
ATOM   3319 C CD1   . LEU A 1 551 ? -9.731  52.849  10.261  1.00 47.82  ? 653  LEU A CD1   1 
ATOM   3320 C CD2   . LEU A 1 551 ? -9.770  55.293  10.633  1.00 50.41  ? 653  LEU A CD2   1 
ATOM   3321 N N     . PRO A 1 552 ? -13.615 55.187  11.743  1.00 99.31  ? 654  PRO A N     1 
ATOM   3322 C CA    . PRO A 1 552 ? -14.230 54.795  13.011  1.00 100.07 ? 654  PRO A CA    1 
ATOM   3323 C C     . PRO A 1 552 ? -15.743 54.744  12.718  1.00 99.62  ? 654  PRO A C     1 
ATOM   3324 O O     . PRO A 1 552 ? -16.397 53.710  12.868  1.00 99.10  ? 654  PRO A O     1 
ATOM   3325 C CB    . PRO A 1 552 ? -13.880 55.958  13.946  1.00 85.61  ? 654  PRO A CB    1 
ATOM   3326 C CG    . PRO A 1 552 ? -12.687 56.583  13.353  1.00 81.34  ? 654  PRO A CG    1 
ATOM   3327 C CD    . PRO A 1 552 ? -12.916 56.480  11.880  1.00 80.51  ? 654  PRO A CD    1 
ATOM   3328 N N     . VAL A 1 553 ? -16.277 55.888  12.293  1.00 72.95  ? 655  VAL A N     1 
ATOM   3329 C CA    . VAL A 1 553 ? -17.699 56.043  11.939  1.00 81.24  ? 655  VAL A CA    1 
ATOM   3330 C C     . VAL A 1 553 ? -18.259 54.853  11.132  1.00 78.74  ? 655  VAL A C     1 
ATOM   3331 O O     . VAL A 1 553 ? -19.123 54.137  11.593  1.00 77.70  ? 655  VAL A O     1 
ATOM   3332 C CB    . VAL A 1 553 ? -17.921 57.364  11.106  1.00 112.03 ? 655  VAL A CB    1 
ATOM   3333 C CG1   . VAL A 1 553 ? -19.339 57.421  10.535  1.00 115.01 ? 655  VAL A CG1   1 
ATOM   3334 C CG2   . VAL A 1 553 ? -17.637 58.593  11.975  1.00 116.84 ? 655  VAL A CG2   1 
ATOM   3335 N N     . LEU A 1 554 ? -17.749 54.659  9.923   1.00 128.89 ? 656  LEU A N     1 
ATOM   3336 C CA    . LEU A 1 554 ? -18.182 53.604  8.997   1.00 127.62 ? 656  LEU A CA    1 
ATOM   3337 C C     . LEU A 1 554 ? -18.518 52.273  9.683   1.00 130.31 ? 656  LEU A C     1 
ATOM   3338 O O     . LEU A 1 554 ? -19.479 51.584  9.324   1.00 125.76 ? 656  LEU A O     1 
ATOM   3339 C CB    . LEU A 1 554 ? -17.080 53.416  7.908   1.00 98.72  ? 656  LEU A CB    1 
ATOM   3340 C CG    . LEU A 1 554 ? -17.421 53.404  6.383   1.00 92.92  ? 656  LEU A CG    1 
ATOM   3341 C CD1   . LEU A 1 554 ? -18.343 54.585  5.897   1.00 90.46  ? 656  LEU A CD1   1 
ATOM   3342 C CD2   . LEU A 1 554 ? -16.105 53.398  5.645   1.00 87.45  ? 656  LEU A CD2   1 
ATOM   3343 N N     . CYS A 1 555 ? -17.718 51.927  10.682  1.00 111.65 ? 657  CYS A N     1 
ATOM   3344 C CA    . CYS A 1 555 ? -17.917 50.686  11.423  1.00 116.31 ? 657  CYS A CA    1 
ATOM   3345 C C     . CYS A 1 555 ? -18.888 50.811  12.608  1.00 121.80 ? 657  CYS A C     1 
ATOM   3346 O O     . CYS A 1 555 ? -18.873 49.976  13.507  1.00 122.80 ? 657  CYS A O     1 
ATOM   3347 C CB    . CYS A 1 555 ? -16.568 50.153  11.918  1.00 110.73 ? 657  CYS A CB    1 
ATOM   3348 S SG    . CYS A 1 555 ? -15.283 50.143  10.665  1.00 95.91  ? 657  CYS A SG    1 
ATOM   3349 N N     . GLN A 1 556 ? -19.721 51.852  12.619  1.00 88.40  ? 658  GLN A N     1 
ATOM   3350 C CA    . GLN A 1 556 ? -20.719 52.036  13.684  1.00 88.31  ? 658  GLN A CA    1 
ATOM   3351 C C     . GLN A 1 556 ? -21.887 51.088  13.374  1.00 87.84  ? 658  GLN A C     1 
ATOM   3352 O O     . GLN A 1 556 ? -22.094 50.142  14.109  1.00 88.47  ? 658  GLN A O     1 
ATOM   3353 C CB    . GLN A 1 556 ? -21.173 53.513  13.779  1.00 128.68 ? 658  GLN A CB    1 
ATOM   3354 C CG    . GLN A 1 556 ? -20.574 54.255  15.004  1.00 131.06 ? 658  GLN A CG    1 
ATOM   3355 C CD    . GLN A 1 556 ? -20.484 55.785  14.848  1.00 128.22 ? 658  GLN A CD    1 
ATOM   3356 O OE1   . GLN A 1 556 ? -21.303 56.420  14.175  1.00 122.74 ? 658  GLN A OE1   1 
ATOM   3357 N NE2   . GLN A 1 556 ? -19.487 56.376  15.496  1.00 125.91 ? 658  GLN A NE2   1 
ATOM   3358 N N     . ALA A 1 557 ? -22.659 51.332  12.311  1.00 146.89 ? 659  ALA A N     1 
ATOM   3359 C CA    . ALA A 1 557 ? -23.721 50.393  11.921  1.00 146.46 ? 659  ALA A CA    1 
ATOM   3360 C C     . ALA A 1 557 ? -23.637 50.069  10.439  1.00 143.70 ? 659  ALA A C     1 
ATOM   3361 O O     . ALA A 1 557 ? -24.658 49.845  9.772   1.00 152.09 ? 659  ALA A O     1 
ATOM   3362 C CB    . ALA A 1 557 ? -25.118 50.886  12.286  1.00 69.15  ? 659  ALA A CB    1 
ATOM   3363 N N     . HIS A 1 558 ? -22.403 50.077  9.925   1.00 112.50 ? 660  HIS A N     1 
ATOM   3364 C CA    . HIS A 1 558 ? -22.134 49.640  8.555   1.00 103.28 ? 660  HIS A CA    1 
ATOM   3365 C C     . HIS A 1 558 ? -21.259 48.364  8.618   1.00 101.96 ? 660  HIS A C     1 
ATOM   3366 O O     . HIS A 1 558 ? -21.106 47.627  7.641   1.00 98.68  ? 660  HIS A O     1 
ATOM   3367 C CB    . HIS A 1 558 ? -21.439 50.724  7.734   1.00 94.12  ? 660  HIS A CB    1 
ATOM   3368 C CG    . HIS A 1 558 ? -22.372 51.755  7.182   1.00 89.57  ? 660  HIS A CG    1 
ATOM   3369 N ND1   . HIS A 1 558 ? -23.337 51.472  6.227   1.00 89.02  ? 660  HIS A ND1   1 
ATOM   3370 C CD2   . HIS A 1 558 ? -22.468 53.083  7.421   1.00 86.38  ? 660  HIS A CD2   1 
ATOM   3371 C CE1   . HIS A 1 558 ? -23.970 52.586  5.908   1.00 85.88  ? 660  HIS A CE1   1 
ATOM   3372 N NE2   . HIS A 1 558 ? -23.464 53.582  6.617   1.00 84.46  ? 660  HIS A NE2   1 
ATOM   3373 N N     . GLY A 1 559 ? -20.658 48.113  9.769   1.00 118.70 ? 661  GLY A N     1 
ATOM   3374 C CA    . GLY A 1 559 ? -19.863 46.904  9.930   1.00 117.42 ? 661  GLY A CA    1 
ATOM   3375 C C     . GLY A 1 559 ? -18.421 46.971  9.465   1.00 116.58 ? 661  GLY A C     1 
ATOM   3376 O O     . GLY A 1 559 ? -17.520 47.213  10.264  1.00 116.40 ? 661  GLY A O     1 
ATOM   3377 N N     . LEU A 1 560 ? -18.229 46.710  8.167   1.00 103.52 ? 662  LEU A N     1 
ATOM   3378 C CA    . LEU A 1 560 ? -16.950 46.744  7.413   1.00 101.37 ? 662  LEU A CA    1 
ATOM   3379 C C     . LEU A 1 560 ? -15.542 46.454  7.954   1.00 100.19 ? 662  LEU A C     1 
ATOM   3380 O O     . LEU A 1 560 ? -14.650 47.307  7.753   1.00 95.52  ? 662  LEU A O     1 
ATOM   3381 C CB    . LEU A 1 560 ? -16.847 48.091  6.684   1.00 77.94  ? 662  LEU A CB    1 
ATOM   3382 C CG    . LEU A 1 560 ? -17.463 48.299  5.288   1.00 77.21  ? 662  LEU A CG    1 
ATOM   3383 C CD1   . LEU A 1 560 ? -18.961 48.010  5.269   1.00 75.45  ? 662  LEU A CD1   1 
ATOM   3384 C CD2   . LEU A 1 560 ? -17.207 49.747  4.838   1.00 73.96  ? 662  LEU A CD2   1 
ATOM   3385 N N     . THR A 1 561 ? -15.302 45.247  8.491   1.00 110.21 ? 663  THR A N     1 
ATOM   3386 C CA    . THR A 1 561 ? -13.997 44.929  9.086   1.00 115.82 ? 663  THR A CA    1 
ATOM   3387 C C     . THR A 1 561 ? -12.884 45.691  8.372   1.00 118.17 ? 663  THR A C     1 
ATOM   3388 O O     . THR A 1 561 ? -12.869 45.773  7.156   1.00 124.77 ? 663  THR A O     1 
ATOM   3389 C CB    . THR A 1 561 ? -13.719 43.391  9.172   1.00 129.17 ? 663  THR A CB    1 
ATOM   3390 O OG1   . THR A 1 561 ? -12.342 43.195  9.510   1.00 130.32 ? 663  THR A OG1   1 
ATOM   3391 C CG2   . THR A 1 561 ? -14.065 42.646  7.894   1.00 128.37 ? 663  THR A CG2   1 
ATOM   3392 N N     . PRO A 1 562 ? -11.996 46.343  9.137   1.00 106.27 ? 664  PRO A N     1 
ATOM   3393 C CA    . PRO A 1 562 ? -10.885 47.147  8.609   1.00 102.35 ? 664  PRO A CA    1 
ATOM   3394 C C     . PRO A 1 562 ? -10.267 46.632  7.322   1.00 99.57  ? 664  PRO A C     1 
ATOM   3395 O O     . PRO A 1 562 ? -9.967  47.401  6.419   1.00 96.47  ? 664  PRO A O     1 
ATOM   3396 C CB    . PRO A 1 562 ? -9.901  47.208  9.786   1.00 98.70  ? 664  PRO A CB    1 
ATOM   3397 C CG    . PRO A 1 562 ? -10.810 47.264  10.946  1.00 101.17 ? 664  PRO A CG    1 
ATOM   3398 C CD    . PRO A 1 562 ? -12.033 46.406  10.606  1.00 103.39 ? 664  PRO A CD    1 
ATOM   3399 N N     . ASP A 1 563 ? -10.068 45.325  7.254   1.00 94.08  ? 665  ASP A N     1 
ATOM   3400 C CA    . ASP A 1 563 ? -9.551  44.698  6.061   1.00 91.28  ? 665  ASP A CA    1 
ATOM   3401 C C     . ASP A 1 563 ? -10.269 45.407  4.922   1.00 90.01  ? 665  ASP A C     1 
ATOM   3402 O O     . ASP A 1 563 ? -9.636  45.925  3.988   1.00 87.47  ? 665  ASP A O     1 
ATOM   3403 C CB    . ASP A 1 563 ? -9.940  43.211  6.045   1.00 173.68 ? 665  ASP A CB    1 
ATOM   3404 C CG    . ASP A 1 563 ? -9.513  42.468  7.306   1.00 181.32 ? 665  ASP A CG    1 
ATOM   3405 O OD1   . ASP A 1 563 ? -10.061 42.764  8.392   1.00 187.05 ? 665  ASP A OD1   1 
ATOM   3406 O OD2   . ASP A 1 563 ? -8.623  41.590  7.205   1.00 179.14 ? 665  ASP A OD2   1 
ATOM   3407 N N     . GLN A 1 564 ? -11.601 45.445  5.047   1.00 87.25  ? 666  GLN A N     1 
ATOM   3408 C CA    . GLN A 1 564 ? -12.503 46.040  4.055   1.00 87.39  ? 666  GLN A CA    1 
ATOM   3409 C C     . GLN A 1 564 ? -12.236 47.506  3.733   1.00 82.83  ? 666  GLN A C     1 
ATOM   3410 O O     . GLN A 1 564 ? -12.299 47.895  2.563   1.00 75.91  ? 666  GLN A O     1 
ATOM   3411 C CB    . GLN A 1 564 ? -13.974 45.868  4.490   1.00 92.86  ? 666  GLN A CB    1 
ATOM   3412 C CG    . GLN A 1 564 ? -14.500 44.413  4.485   1.00 94.61  ? 666  GLN A CG    1 
ATOM   3413 C CD    . GLN A 1 564 ? -15.929 44.293  5.006   1.00 98.93  ? 666  GLN A CD    1 
ATOM   3414 O OE1   . GLN A 1 564 ? -16.874 44.832  4.414   1.00 102.47 ? 666  GLN A OE1   1 
ATOM   3415 N NE2   . GLN A 1 564 ? -16.088 43.587  6.120   1.00 97.76  ? 666  GLN A NE2   1 
ATOM   3416 N N     . VAL A 1 565 ? -11.957 48.311  4.764   1.00 114.92 ? 667  VAL A N     1 
ATOM   3417 C CA    . VAL A 1 565 ? -11.670 49.742  4.603   1.00 110.33 ? 667  VAL A CA    1 
ATOM   3418 C C     . VAL A 1 565 ? -10.302 49.964  3.945   1.00 105.74 ? 667  VAL A C     1 
ATOM   3419 O O     . VAL A 1 565 ? -10.225 50.570  2.886   1.00 102.16 ? 667  VAL A O     1 
ATOM   3420 C CB    . VAL A 1 565 ? -11.701 50.492  5.971   1.00 101.14 ? 667  VAL A CB    1 
ATOM   3421 C CG1   . VAL A 1 565 ? -11.111 51.898  5.826   1.00 100.14 ? 667  VAL A CG1   1 
ATOM   3422 C CG2   . VAL A 1 565 ? -13.130 50.573  6.493   1.00 103.10 ? 667  VAL A CG2   1 
ATOM   3423 N N     . VAL A 1 566 ? -9.231  49.458  4.554   1.00 81.29  ? 668  VAL A N     1 
ATOM   3424 C CA    . VAL A 1 566 ? -7.888  49.640  4.007   1.00 76.57  ? 668  VAL A CA    1 
ATOM   3425 C C     . VAL A 1 566 ? -7.823  49.276  2.527   1.00 76.58  ? 668  VAL A C     1 
ATOM   3426 O O     . VAL A 1 566 ? -6.999  49.817  1.788   1.00 77.14  ? 668  VAL A O     1 
ATOM   3427 C CB    . VAL A 1 566 ? -6.795  48.850  4.815   1.00 64.04  ? 668  VAL A CB    1 
ATOM   3428 C CG1   . VAL A 1 566 ? -7.128  47.354  4.884   1.00 69.45  ? 668  VAL A CG1   1 
ATOM   3429 C CG2   . VAL A 1 566 ? -5.446  49.050  4.178   1.00 57.50  ? 668  VAL A CG2   1 
ATOM   3430 N N     . ALA A 1 567 ? -8.690  48.371  2.083   1.00 66.21  ? 669  ALA A N     1 
ATOM   3431 C CA    . ALA A 1 567 ? -8.708  48.017  0.668   1.00 61.70  ? 669  ALA A CA    1 
ATOM   3432 C C     . ALA A 1 567 ? -9.347  49.178  -0.064  1.00 62.31  ? 669  ALA A C     1 
ATOM   3433 O O     . ALA A 1 567 ? -8.836  49.670  -1.041  1.00 62.78  ? 669  ALA A O     1 
ATOM   3434 C CB    . ALA A 1 567 ? -9.511  46.738  0.438   1.00 73.60  ? 669  ALA A CB    1 
ATOM   3435 N N     . ILE A 1 568 ? -10.468 49.643  0.439   1.00 74.45  ? 670  ILE A N     1 
ATOM   3436 C CA    . ILE A 1 568 ? -11.185 50.725  -0.208  1.00 72.67  ? 670  ILE A CA    1 
ATOM   3437 C C     . ILE A 1 568 ? -10.346 51.984  -0.377  1.00 73.08  ? 670  ILE A C     1 
ATOM   3438 O O     . ILE A 1 568 ? -10.359 52.590  -1.426  1.00 76.57  ? 670  ILE A O     1 
ATOM   3439 C CB    . ILE A 1 568 ? -12.488 51.035  0.544   1.00 106.89 ? 670  ILE A CB    1 
ATOM   3440 C CG1   . ILE A 1 568 ? -13.455 49.837  0.393   1.00 108.46 ? 670  ILE A CG1   1 
ATOM   3441 C CG2   . ILE A 1 568 ? -13.126 52.296  -0.009  1.00 106.40 ? 670  ILE A CG2   1 
ATOM   3442 C CD1   . ILE A 1 568 ? -14.463 49.685  1.523   1.00 110.72 ? 670  ILE A CD1   1 
ATOM   3443 N N     . ALA A 1 569 ? -9.579  52.359  0.624   1.00 73.28  ? 671  ALA A N     1 
ATOM   3444 C CA    . ALA A 1 569 ? -8.759  53.557  0.523   1.00 73.35  ? 671  ALA A CA    1 
ATOM   3445 C C     . ALA A 1 569 ? -7.503  53.299  -0.310  1.00 75.17  ? 671  ALA A C     1 
ATOM   3446 O O     . ALA A 1 569 ? -6.562  54.141  -0.328  1.00 72.58  ? 671  ALA A O     1 
ATOM   3447 C CB    . ALA A 1 569 ? -8.333  54.041  1.949   1.00 62.45  ? 671  ALA A CB    1 
ATOM   3448 N N     . SER A 1 570 ? -7.465  52.170  -1.011  1.00 98.26  ? 672  SER A N     1 
ATOM   3449 C CA    . SER A 1 570 ? -6.261  51.846  -1.756  1.00 97.87  ? 672  SER A CA    1 
ATOM   3450 C C     . SER A 1 570 ? -6.231  51.940  -3.278  1.00 95.47  ? 672  SER A C     1 
ATOM   3451 O O     . SER A 1 570 ? -5.311  51.428  -3.900  1.00 98.12  ? 672  SER A O     1 
ATOM   3452 C CB    . SER A 1 570 ? -5.758  50.491  -1.290  1.00 81.35  ? 672  SER A CB    1 
ATOM   3453 O OG    . SER A 1 570 ? -5.183  50.611  0.001   1.00 82.30  ? 672  SER A OG    1 
ATOM   3454 N N     . ASN A 1 571 ? -7.224  52.590  -3.876  1.00 79.76  ? 673  ASN A N     1 
ATOM   3455 C CA    . ASN A 1 571 ? -7.241  52.806  -5.322  1.00 75.34  ? 673  ASN A CA    1 
ATOM   3456 C C     . ASN A 1 571 ? -7.175  54.299  -5.609  1.00 77.81  ? 673  ASN A C     1 
ATOM   3457 O O     . ASN A 1 571 ? -6.888  55.129  -4.719  1.00 81.62  ? 673  ASN A O     1 
ATOM   3458 C CB    . ASN A 1 571 ? -8.508  52.243  -5.963  1.00 94.19  ? 673  ASN A CB    1 
ATOM   3459 C CG    . ASN A 1 571 ? -8.583  50.760  -5.854  1.00 93.68  ? 673  ASN A CG    1 
ATOM   3460 O OD1   . ASN A 1 571 ? -8.378  50.038  -6.840  1.00 95.14  ? 673  ASN A OD1   1 
ATOM   3461 N ND2   . ASN A 1 571 ? -8.846  50.281  -4.650  1.00 92.95  ? 673  ASN A ND2   1 
ATOM   3462 N N     . GLY A 1 572 ? -7.464  54.631  -6.867  1.00 67.97  ? 674  GLY A N     1 
ATOM   3463 C CA    . GLY A 1 572 ? -7.415  55.996  -7.328  1.00 65.26  ? 674  GLY A CA    1 
ATOM   3464 C C     . GLY A 1 572 ? -8.607  56.739  -6.748  1.00 72.32  ? 674  GLY A C     1 
ATOM   3465 O O     . GLY A 1 572 ? -8.452  57.634  -5.874  1.00 68.72  ? 674  GLY A O     1 
ATOM   3466 N N     . GLY A 1 573 ? -9.800  56.374  -7.222  1.00 88.98  ? 675  GLY A N     1 
ATOM   3467 C CA    . GLY A 1 573 ? -11.009 57.008  -6.717  1.00 99.78  ? 675  GLY A CA    1 
ATOM   3468 C C     . GLY A 1 573 ? -11.227 56.702  -5.230  1.00 105.06 ? 675  GLY A C     1 
ATOM   3469 O O     . GLY A 1 573 ? -12.351 56.414  -4.791  1.00 102.06 ? 675  GLY A O     1 
ATOM   3470 N N     . GLY A 1 574 ? -10.142 56.835  -4.460  1.00 89.17  ? 676  GLY A N     1 
ATOM   3471 C CA    . GLY A 1 574 ? -10.093 56.505  -3.041  1.00 83.12  ? 676  GLY A CA    1 
ATOM   3472 C C     . GLY A 1 574 ? -11.099 57.208  -2.169  1.00 80.29  ? 676  GLY A C     1 
ATOM   3473 O O     . GLY A 1 574 ? -12.097 56.584  -1.721  1.00 76.76  ? 676  GLY A O     1 
ATOM   3474 N N     . LYS A 1 575 ? -10.809 58.484  -1.902  1.00 61.50  ? 677  LYS A N     1 
ATOM   3475 C CA    . LYS A 1 575 ? -11.658 59.332  -1.129  1.00 60.74  ? 677  LYS A CA    1 
ATOM   3476 C C     . LYS A 1 575 ? -13.059 59.165  -1.751  1.00 59.94  ? 677  LYS A C     1 
ATOM   3477 O O     . LYS A 1 575 ? -14.004 58.841  -1.060  1.00 62.34  ? 677  LYS A O     1 
ATOM   3478 C CB    . LYS A 1 575 ? -11.160 60.766  -1.245  1.00 83.46  ? 677  LYS A CB    1 
ATOM   3479 C CG    . LYS A 1 575 ? -12.048 61.850  -0.625  1.00 87.80  ? 677  LYS A CG    1 
ATOM   3480 C CD    . LYS A 1 575 ? -11.841 63.216  -1.330  1.00 88.60  ? 677  LYS A CD    1 
ATOM   3481 C CE    . LYS A 1 575 ? -12.393 64.427  -0.544  1.00 92.99  ? 677  LYS A CE    1 
ATOM   3482 N NZ    . LYS A 1 575 ? -13.894 64.576  -0.450  1.00 93.84  ? 677  LYS A NZ    1 
ATOM   3483 N N     . GLN A 1 576 ? -13.202 59.320  -3.058  1.00 56.19  ? 678  GLN A N     1 
ATOM   3484 C CA    . GLN A 1 576 ? -14.530 59.183  -3.708  1.00 61.84  ? 678  GLN A CA    1 
ATOM   3485 C C     . GLN A 1 576 ? -15.327 57.922  -3.342  1.00 65.06  ? 678  GLN A C     1 
ATOM   3486 O O     . GLN A 1 576 ? -16.550 57.989  -3.141  1.00 62.17  ? 678  GLN A O     1 
ATOM   3487 C CB    . GLN A 1 576 ? -14.376 59.260  -5.234  1.00 86.15  ? 678  GLN A CB    1 
ATOM   3488 C CG    . GLN A 1 576 ? -13.974 60.627  -5.744  1.00 85.06  ? 678  GLN A CG    1 
ATOM   3489 C CD    . GLN A 1 576 ? -15.069 61.653  -5.560  1.00 86.95  ? 678  GLN A CD    1 
ATOM   3490 O OE1   . GLN A 1 576 ? -16.260 61.322  -5.563  1.00 93.24  ? 678  GLN A OE1   1 
ATOM   3491 N NE2   . GLN A 1 576 ? -14.678 62.906  -5.423  1.00 80.96  ? 678  GLN A NE2   1 
ATOM   3492 N N     . ALA A 1 577 ? -14.634 56.781  -3.270  1.00 96.52  ? 679  ALA A N     1 
ATOM   3493 C CA    . ALA A 1 577 ? -15.262 55.504  -2.925  1.00 98.81  ? 679  ALA A CA    1 
ATOM   3494 C C     . ALA A 1 577 ? -15.783 55.497  -1.480  1.00 100.83 ? 679  ALA A C     1 
ATOM   3495 O O     . ALA A 1 577 ? -17.006 55.426  -1.269  1.00 105.01 ? 679  ALA A O     1 
ATOM   3496 C CB    . ALA A 1 577 ? -14.278 54.382  -3.114  1.00 128.21 ? 679  ALA A CB    1 
ATOM   3497 N N     . LEU A 1 578 ? -14.860 55.568  -0.502  1.00 87.42  ? 680  LEU A N     1 
ATOM   3498 C CA    . LEU A 1 578 ? -15.199 55.577  0.937   1.00 87.88  ? 680  LEU A CA    1 
ATOM   3499 C C     . LEU A 1 578 ? -16.458 56.455  1.163   1.00 90.58  ? 680  LEU A C     1 
ATOM   3500 O O     . LEU A 1 578 ? -17.436 56.019  1.755   1.00 92.05  ? 680  LEU A O     1 
ATOM   3501 C CB    . LEU A 1 578 ? -13.988 56.082  1.776   1.00 74.61  ? 680  LEU A CB    1 
ATOM   3502 C CG    . LEU A 1 578 ? -12.707 55.227  1.900   1.00 73.29  ? 680  LEU A CG    1 
ATOM   3503 C CD1   . LEU A 1 578 ? -11.528 56.086  2.329   1.00 68.03  ? 680  LEU A CD1   1 
ATOM   3504 C CD2   . LEU A 1 578 ? -12.911 54.060  2.882   1.00 72.02  ? 680  LEU A CD2   1 
ATOM   3505 N N     . GLU A 1 579 ? -16.436 57.696  0.693   1.00 82.87  ? 681  GLU A N     1 
ATOM   3506 C CA    . GLU A 1 579 ? -17.603 58.546  0.831   1.00 89.39  ? 681  GLU A CA    1 
ATOM   3507 C C     . GLU A 1 579 ? -18.783 57.830  0.201   1.00 88.21  ? 681  GLU A C     1 
ATOM   3508 O O     . GLU A 1 579 ? -19.706 57.450  0.903   1.00 93.46  ? 681  GLU A O     1 
ATOM   3509 C CB    . GLU A 1 579 ? -17.396 59.919  0.132   1.00 149.16 ? 681  GLU A CB    1 
ATOM   3510 N N     . THR A 1 580 ? -18.745 57.601  -1.111  1.00 77.27  ? 682  THR A N     1 
ATOM   3511 C CA    . THR A 1 580 ? -19.910 56.997  -1.783  1.00 78.11  ? 682  THR A CA    1 
ATOM   3512 C C     . THR A 1 580 ? -20.425 55.713  -1.138  1.00 75.21  ? 682  THR A C     1 
ATOM   3513 O O     . THR A 1 580 ? -21.543 55.292  -1.397  1.00 76.28  ? 682  THR A O     1 
ATOM   3514 C CB    . THR A 1 580 ? -19.673 56.842  -3.329  1.00 88.16  ? 682  THR A CB    1 
ATOM   3515 O OG1   . THR A 1 580 ? -19.273 58.118  -3.884  1.00 88.70  ? 682  THR A OG1   1 
ATOM   3516 C CG2   . THR A 1 580 ? -20.964 56.383  -4.030  1.00 87.71  ? 682  THR A CG2   1 
ATOM   3517 N N     . VAL A 1 581 ? -19.622 55.140  -0.253  1.00 89.00  ? 683  VAL A N     1 
ATOM   3518 C CA    . VAL A 1 581 ? -20.019 53.928  0.459   1.00 92.24  ? 683  VAL A CA    1 
ATOM   3519 C C     . VAL A 1 581 ? -20.912 54.335  1.669   1.00 94.34  ? 683  VAL A C     1 
ATOM   3520 O O     . VAL A 1 581 ? -21.991 53.731  1.909   1.00 95.68  ? 683  VAL A O     1 
ATOM   3521 C CB    . VAL A 1 581 ? -18.742 53.060  0.821   1.00 110.61 ? 683  VAL A CB    1 
ATOM   3522 C CG1   . VAL A 1 581 ? -18.702 52.670  2.308   1.00 112.28 ? 683  VAL A CG1   1 
ATOM   3523 C CG2   . VAL A 1 581 ? -18.736 51.821  -0.085  1.00 106.56 ? 683  VAL A CG2   1 
ATOM   3524 N N     . GLN A 1 582 ? -20.456 55.342  2.418   1.00 55.93  ? 684  GLN A N     1 
ATOM   3525 C CA    . GLN A 1 582 ? -21.245 55.931  3.485   1.00 58.54  ? 684  GLN A CA    1 
ATOM   3526 C C     . GLN A 1 582 ? -22.592 56.232  2.801   1.00 59.25  ? 684  GLN A C     1 
ATOM   3527 O O     . GLN A 1 582 ? -23.650 56.010  3.373   1.00 61.28  ? 684  GLN A O     1 
ATOM   3528 C CB    . GLN A 1 582 ? -20.595 57.250  3.912   1.00 103.22 ? 684  GLN A CB    1 
ATOM   3529 C CG    . GLN A 1 582 ? -21.527 58.497  4.009   1.00 108.04 ? 684  GLN A CG    1 
ATOM   3530 C CD    . GLN A 1 582 ? -21.068 59.707  3.151   1.00 107.55 ? 684  GLN A CD    1 
ATOM   3531 O OE1   . GLN A 1 582 ? -20.923 60.822  3.656   1.00 107.47 ? 684  GLN A OE1   1 
ATOM   3532 N NE2   . GLN A 1 582 ? -20.860 59.483  1.854   1.00 104.63 ? 684  GLN A NE2   1 
ATOM   3533 N N     . ARG A 1 583 ? -22.549 56.719  1.560   1.00 76.12  ? 685  ARG A N     1 
ATOM   3534 C CA    . ARG A 1 583 ? -23.769 57.111  0.834   1.00 79.63  ? 685  ARG A CA    1 
ATOM   3535 C C     . ARG A 1 583 ? -24.749 56.019  0.473   1.00 80.65  ? 685  ARG A C     1 
ATOM   3536 O O     . ARG A 1 583 ? -25.863 55.974  1.009   1.00 82.09  ? 685  ARG A O     1 
ATOM   3537 C CB    . ARG A 1 583 ? -23.440 57.897  -0.456  1.00 91.88  ? 685  ARG A CB    1 
ATOM   3538 C CG    . ARG A 1 583 ? -23.521 59.425  -0.348  1.00 90.03  ? 685  ARG A CG    1 
ATOM   3539 C CD    . ARG A 1 583 ? -24.220 60.084  -1.560  1.00 88.77  ? 685  ARG A CD    1 
ATOM   3540 N NE    . ARG A 1 583 ? -23.686 59.703  -2.874  1.00 91.68  ? 685  ARG A NE    1 
ATOM   3541 C CZ    . ARG A 1 583 ? -22.439 59.923  -3.305  1.00 89.88  ? 685  ARG A CZ    1 
ATOM   3542 N NH1   . ARG A 1 583 ? -21.554 60.529  -2.521  1.00 91.36  ? 685  ARG A NH1   1 
ATOM   3543 N NH2   . ARG A 1 583 ? -22.067 59.548  -4.530  1.00 84.59  ? 685  ARG A NH2   1 
ATOM   3544 N N     . LEU A 1 584 ? -24.332 55.122  -0.413  1.00 114.09 ? 686  LEU A N     1 
ATOM   3545 C CA    . LEU A 1 584 ? -25.240 54.101  -0.897  1.00 110.61 ? 686  LEU A CA    1 
ATOM   3546 C C     . LEU A 1 584 ? -25.177 52.653  -0.347  1.00 108.48 ? 686  LEU A C     1 
ATOM   3547 O O     . LEU A 1 584 ? -25.759 51.743  -0.949  1.00 109.14 ? 686  LEU A O     1 
ATOM   3548 C CB    . LEU A 1 584 ? -25.218 54.153  -2.436  1.00 92.32  ? 686  LEU A CB    1 
ATOM   3549 C CG    . LEU A 1 584 ? -26.167 55.158  -3.115  1.00 92.33  ? 686  LEU A CG    1 
ATOM   3550 C CD1   . LEU A 1 584 ? -25.979 56.569  -2.555  1.00 94.84  ? 686  LEU A CD1   1 
ATOM   3551 C CD2   . LEU A 1 584 ? -25.929 55.185  -4.609  1.00 92.11  ? 686  LEU A CD2   1 
ATOM   3552 N N     . LEU A 1 585 ? -24.492 52.446  0.784   1.00 59.15  ? 687  LEU A N     1 
ATOM   3553 C CA    . LEU A 1 585 ? -24.481 51.131  1.395   1.00 59.54  ? 687  LEU A CA    1 
ATOM   3554 C C     . LEU A 1 585 ? -25.946 50.722  1.676   1.00 60.64  ? 687  LEU A C     1 
ATOM   3555 O O     . LEU A 1 585 ? -26.339 49.623  1.285   1.00 53.87  ? 687  LEU A O     1 
ATOM   3556 C CB    . LEU A 1 585 ? -23.652 51.128  2.688   1.00 92.85  ? 687  LEU A CB    1 
ATOM   3557 C CG    . LEU A 1 585 ? -22.405 50.211  2.670   1.00 90.47  ? 687  LEU A CG    1 
ATOM   3558 C CD1   . LEU A 1 585 ? -21.493 50.489  3.879   1.00 89.29  ? 687  LEU A CD1   1 
ATOM   3559 C CD2   . LEU A 1 585 ? -22.816 48.759  2.655   1.00 85.97  ? 687  LEU A CD2   1 
ATOM   3560 N N     . PRO A 1 586 ? -26.768 51.588  2.351   1.00 112.46 ? 688  PRO A N     1 
ATOM   3561 C CA    . PRO A 1 586 ? -28.173 51.308  2.660   1.00 115.94 ? 688  PRO A CA    1 
ATOM   3562 C C     . PRO A 1 586 ? -29.051 51.222  1.420   1.00 116.60 ? 688  PRO A C     1 
ATOM   3563 O O     . PRO A 1 586 ? -29.825 50.290  1.310   1.00 119.21 ? 688  PRO A O     1 
ATOM   3564 C CB    . PRO A 1 586 ? -28.585 52.482  3.543   1.00 79.79  ? 688  PRO A CB    1 
ATOM   3565 C CG    . PRO A 1 586 ? -27.346 52.835  4.229   1.00 78.74  ? 688  PRO A CG    1 
ATOM   3566 C CD    . PRO A 1 586 ? -26.313 52.747  3.143   1.00 76.22  ? 688  PRO A CD    1 
ATOM   3567 N N     . VAL A 1 587 ? -28.958 52.186  0.499   1.00 94.88  ? 689  VAL A N     1 
ATOM   3568 C CA    . VAL A 1 587 ? -29.816 52.181  -0.726  1.00 95.53  ? 689  VAL A CA    1 
ATOM   3569 C C     . VAL A 1 587 ? -29.542 50.931  -1.575  1.00 96.79  ? 689  VAL A C     1 
ATOM   3570 O O     . VAL A 1 587 ? -30.120 50.754  -2.677  1.00 94.49  ? 689  VAL A O     1 
ATOM   3571 C CB    . VAL A 1 587 ? -29.577 53.446  -1.631  1.00 66.49  ? 689  VAL A CB    1 
ATOM   3572 C CG1   . VAL A 1 587 ? -30.605 53.530  -2.758  1.00 66.31  ? 689  VAL A CG1   1 
ATOM   3573 C CG2   . VAL A 1 587 ? -29.611 54.726  -0.778  1.00 62.42  ? 689  VAL A CG2   1 
ATOM   3574 N N     . LEU A 1 588 ? -28.669 50.060  -1.052  1.00 108.52 ? 690  LEU A N     1 
ATOM   3575 C CA    . LEU A 1 588 ? -28.279 48.810  -1.723  1.00 109.18 ? 690  LEU A CA    1 
ATOM   3576 C C     . LEU A 1 588 ? -28.821 47.561  -1.001  1.00 114.68 ? 690  LEU A C     1 
ATOM   3577 O O     . LEU A 1 588 ? -29.200 46.565  -1.641  1.00 114.25 ? 690  LEU A O     1 
ATOM   3578 C CB    . LEU A 1 588 ? -26.746 48.742  -1.832  1.00 78.60  ? 690  LEU A CB    1 
ATOM   3579 C CG    . LEU A 1 588 ? -26.030 49.417  -3.009  1.00 71.29  ? 690  LEU A CG    1 
ATOM   3580 C CD1   . LEU A 1 588 ? -24.599 49.699  -2.615  1.00 63.89  ? 690  LEU A CD1   1 
ATOM   3581 C CD2   . LEU A 1 588 ? -26.114 48.528  -4.260  1.00 73.74  ? 690  LEU A CD2   1 
ATOM   3582 N N     . CYS A 1 589 ? -28.827 47.607  0.331   1.00 140.33 ? 691  CYS A N     1 
ATOM   3583 C CA    . CYS A 1 589 ? -29.371 46.510  1.129   1.00 144.55 ? 691  CYS A CA    1 
ATOM   3584 C C     . CYS A 1 589 ? -30.850 46.847  1.385   1.00 146.64 ? 691  CYS A C     1 
ATOM   3585 O O     . CYS A 1 589 ? -31.708 45.964  1.387   1.00 141.24 ? 691  CYS A O     1 
ATOM   3586 C CB    . CYS A 1 589 ? -28.581 46.384  2.434   1.00 119.41 ? 691  CYS A CB    1 
ATOM   3587 S SG    . CYS A 1 589 ? -26.772 46.541  2.104   1.00 114.91 ? 691  CYS A SG    1 
ATOM   3588 N N     . GLN A 1 590 ? -31.138 48.136  1.564   1.00 129.26 ? 692  GLN A N     1 
ATOM   3589 C CA    . GLN A 1 590 ? -32.501 48.614  1.775   1.00 132.87 ? 692  GLN A CA    1 
ATOM   3590 C C     . GLN A 1 590 ? -33.299 48.582  0.445   1.00 133.75 ? 692  GLN A C     1 
ATOM   3591 O O     . GLN A 1 590 ? -34.509 48.853  0.425   1.00 133.87 ? 692  GLN A O     1 
ATOM   3592 C CB    . GLN A 1 590 ? -32.475 50.015  2.422   1.00 187.32 ? 692  GLN A CB    1 
ATOM   3593 C CG    . GLN A 1 590 ? -33.525 50.199  3.543   1.00 187.72 ? 692  GLN A CG    1 
ATOM   3594 C CD    . GLN A 1 590 ? -32.923 50.707  4.853   1.00 187.02 ? 692  GLN A CD    1 
ATOM   3595 O OE1   . GLN A 1 590 ? -33.020 51.887  5.174   1.00 183.84 ? 692  GLN A OE1   1 
ATOM   3596 N NE2   . GLN A 1 590 ? -32.289 49.813  5.602   1.00 185.28 ? 692  GLN A NE2   1 
ATOM   3597 N N     . ALA A 1 591 ? -32.625 48.166  -0.635  1.00 113.89 ? 693  ALA A N     1 
ATOM   3598 C CA    . ALA A 1 591 ? -33.236 48.047  -1.966  1.00 111.97 ? 693  ALA A CA    1 
ATOM   3599 C C     . ALA A 1 591 ? -32.880 46.778  -2.768  1.00 110.78 ? 693  ALA A C     1 
ATOM   3600 O O     . ALA A 1 591 ? -33.744 46.202  -3.421  1.00 114.08 ? 693  ALA A O     1 
ATOM   3601 C CB    . ALA A 1 591 ? -32.884 49.269  -2.788  1.00 98.49  ? 693  ALA A CB    1 
ATOM   3602 N N     . HIS A 1 592 ? -31.617 46.349  -2.720  1.00 131.89 ? 694  HIS A N     1 
ATOM   3603 C CA    . HIS A 1 592 ? -31.155 45.179  -3.485  1.00 131.12 ? 694  HIS A CA    1 
ATOM   3604 C C     . HIS A 1 592 ? -30.689 44.007  -2.622  1.00 128.95 ? 694  HIS A C     1 
ATOM   3605 O O     . HIS A 1 592 ? -30.211 42.986  -3.138  1.00 118.32 ? 694  HIS A O     1 
ATOM   3606 C CB    . HIS A 1 592 ? -30.018 45.578  -4.443  1.00 123.72 ? 694  HIS A CB    1 
ATOM   3607 C CG    . HIS A 1 592 ? -30.276 46.832  -5.218  1.00 124.29 ? 694  HIS A CG    1 
ATOM   3608 N ND1   . HIS A 1 592 ? -31.505 47.122  -5.784  1.00 122.90 ? 694  HIS A ND1   1 
ATOM   3609 C CD2   . HIS A 1 592 ? -29.467 47.872  -5.536  1.00 118.25 ? 694  HIS A CD2   1 
ATOM   3610 C CE1   . HIS A 1 592 ? -31.436 48.279  -6.408  1.00 118.77 ? 694  HIS A CE1   1 
ATOM   3611 N NE2   . HIS A 1 592 ? -30.208 48.760  -6.275  1.00 120.21 ? 694  HIS A NE2   1 
ATOM   3612 N N     . GLY A 1 593 ? -30.842 44.139  -1.311  1.00 200.00 ? 695  GLY A N     1 
ATOM   3613 C CA    . GLY A 1 593 ? -30.428 43.053  -0.443  1.00 200.00 ? 695  GLY A CA    1 
ATOM   3614 C C     . GLY A 1 593 ? -29.138 42.443  -0.952  1.00 200.00 ? 695  GLY A C     1 
ATOM   3615 O O     . GLY A 1 593 ? -28.970 41.240  -1.069  1.00 200.00 ? 695  GLY A O     1 
ATOM   3616 N N     . LEU A 1 594 ? -28.251 43.359  -1.279  1.00 90.72  ? 696  LEU A N     1 
ATOM   3617 C CA    . LEU A 1 594 ? -26.895 43.199  -1.746  1.00 79.19  ? 696  LEU A CA    1 
ATOM   3618 C C     . LEU A 1 594 ? -25.974 43.188  -0.458  1.00 77.13  ? 696  LEU A C     1 
ATOM   3619 O O     . LEU A 1 594 ? -25.866 44.223  0.245   1.00 72.38  ? 696  LEU A O     1 
ATOM   3620 C CB    . LEU A 1 594 ? -26.765 44.510  -2.412  1.00 61.73  ? 696  LEU A CB    1 
ATOM   3621 C CG    . LEU A 1 594 ? -26.001 44.941  -3.600  1.00 62.79  ? 696  LEU A CG    1 
ATOM   3622 C CD1   . LEU A 1 594 ? -24.547 44.749  -3.275  1.00 61.83  ? 696  LEU A CD1   1 
ATOM   3623 C CD2   . LEU A 1 594 ? -26.502 44.215  -4.853  1.00 61.67  ? 696  LEU A CD2   1 
ATOM   3624 N N     . THR A 1 595 ? -25.297 42.073  -0.148  1.00 101.34 ? 697  THR A N     1 
ATOM   3625 C CA    . THR A 1 595 ? -24.435 41.940  1.062   1.00 99.69  ? 697  THR A CA    1 
ATOM   3626 C C     . THR A 1 595 ? -23.443 43.046  1.228   1.00 101.79 ? 697  THR A C     1 
ATOM   3627 O O     . THR A 1 595 ? -23.333 43.905  0.399   1.00 102.94 ? 697  THR A O     1 
ATOM   3628 C CB    . THR A 1 595 ? -23.540 40.715  0.989   1.00 86.36  ? 697  THR A CB    1 
ATOM   3629 O OG1   . THR A 1 595 ? -22.947 40.694  -0.317  1.00 80.80  ? 697  THR A OG1   1 
ATOM   3630 C CG2   . THR A 1 595 ? -24.298 39.429  1.269   1.00 87.21  ? 697  THR A CG2   1 
ATOM   3631 N N     . GLN A 1 596 ? -22.692 42.978  2.307   1.00 98.91  ? 698  GLN A N     1 
ATOM   3632 C CA    . GLN A 1 596 ? -21.642 43.930  2.533   1.00 100.21 ? 698  GLN A CA    1 
ATOM   3633 C C     . GLN A 1 596 ? -20.432 43.497  1.680   1.00 102.99 ? 698  GLN A C     1 
ATOM   3634 O O     . GLN A 1 596 ? -19.985 44.215  0.770   1.00 101.64 ? 698  GLN A O     1 
ATOM   3635 C CB    . GLN A 1 596 ? -21.253 43.949  3.997   1.00 164.14 ? 698  GLN A CB    1 
ATOM   3636 C CG    . GLN A 1 596 ? -21.184 45.351  4.514   1.00 174.90 ? 698  GLN A CG    1 
ATOM   3637 C CD    . GLN A 1 596 ? -22.090 45.550  5.694   1.00 182.33 ? 698  GLN A CD    1 
ATOM   3638 O OE1   . GLN A 1 596 ? -21.641 45.520  6.843   1.00 190.22 ? 698  GLN A OE1   1 
ATOM   3639 N NE2   . GLN A 1 596 ? -23.384 45.736  5.428   1.00 181.41 ? 698  GLN A NE2   1 
ATOM   3640 N N     . VAL A 1 597 ? -19.883 42.328  1.985   1.00 128.23 ? 699  VAL A N     1 
ATOM   3641 C CA    . VAL A 1 597 ? -18.761 41.785  1.225   1.00 124.23 ? 699  VAL A CA    1 
ATOM   3642 C C     . VAL A 1 597 ? -18.981 42.103  -0.261  1.00 125.41 ? 699  VAL A C     1 
ATOM   3643 O O     . VAL A 1 597 ? -18.061 42.568  -0.945  1.00 130.07 ? 699  VAL A O     1 
ATOM   3644 C CB    . VAL A 1 597 ? -18.669 40.264  1.481   1.00 86.08  ? 699  VAL A CB    1 
ATOM   3645 C CG1   . VAL A 1 597 ? -17.871 39.551  0.374   1.00 81.10  ? 699  VAL A CG1   1 
ATOM   3646 C CG2   . VAL A 1 597 ? -18.032 40.032  2.859   1.00 86.50  ? 699  VAL A CG2   1 
ATOM   3647 N N     . GLN A 1 598 ? -20.221 41.900  -0.718  1.00 88.80  ? 700  GLN A N     1 
ATOM   3648 C CA    . GLN A 1 598 ? -20.593 42.141  -2.094  1.00 79.21  ? 700  GLN A CA    1 
ATOM   3649 C C     . GLN A 1 598 ? -20.248 43.542  -2.567  1.00 75.40  ? 700  GLN A C     1 
ATOM   3650 O O     . GLN A 1 598 ? -19.890 43.717  -3.744  1.00 68.31  ? 700  GLN A O     1 
ATOM   3651 C CB    . GLN A 1 598 ? -22.086 41.922  -2.268  1.00 76.46  ? 700  GLN A CB    1 
ATOM   3652 C CG    . GLN A 1 598 ? -22.452 41.132  -3.490  1.00 76.00  ? 700  GLN A CG    1 
ATOM   3653 C CD    . GLN A 1 598 ? -23.879 40.695  -3.468  1.00 76.96  ? 700  GLN A CD    1 
ATOM   3654 O OE1   . GLN A 1 598 ? -24.532 40.779  -2.426  1.00 80.32  ? 700  GLN A OE1   1 
ATOM   3655 N NE2   . GLN A 1 598 ? -24.391 40.216  -4.623  1.00 77.04  ? 700  GLN A NE2   1 
ATOM   3656 N N     . VAL A 1 599 ? -20.371 44.527  -1.660  1.00 82.17  ? 701  VAL A N     1 
ATOM   3657 C CA    . VAL A 1 599 ? -20.117 45.947  -1.979  1.00 79.82  ? 701  VAL A CA    1 
ATOM   3658 C C     . VAL A 1 599 ? -18.712 46.430  -1.678  1.00 75.12  ? 701  VAL A C     1 
ATOM   3659 O O     . VAL A 1 599 ? -18.146 47.138  -2.493  1.00 74.44  ? 701  VAL A O     1 
ATOM   3660 C CB    . VAL A 1 599 ? -21.157 46.888  -1.297  1.00 73.04  ? 701  VAL A CB    1 
ATOM   3661 C CG1   . VAL A 1 599 ? -20.523 48.222  -0.945  1.00 71.39  ? 701  VAL A CG1   1 
ATOM   3662 C CG2   . VAL A 1 599 ? -22.368 47.121  -2.250  1.00 74.19  ? 701  VAL A CG2   1 
ATOM   3663 N N     . VAL A 1 600 ? -18.147 46.071  -0.526  1.00 45.63  ? 702  VAL A N     1 
ATOM   3664 C CA    . VAL A 1 600 ? -16.787 46.476  -0.268  1.00 41.70  ? 702  VAL A CA    1 
ATOM   3665 C C     . VAL A 1 600 ? -15.968 46.070  -1.510  1.00 36.18  ? 702  VAL A C     1 
ATOM   3666 O O     . VAL A 1 600 ? -14.932 46.696  -1.775  1.00 29.07  ? 702  VAL A O     1 
ATOM   3667 C CB    . VAL A 1 600 ? -16.207 45.873  1.029   1.00 70.08  ? 702  VAL A CB    1 
ATOM   3668 C CG1   . VAL A 1 600 ? -16.119 44.320  0.934   1.00 74.98  ? 702  VAL A CG1   1 
ATOM   3669 C CG2   . VAL A 1 600 ? -14.825 46.464  1.278   1.00 72.21  ? 702  VAL A CG2   1 
ATOM   3670 N N     . ALA A 1 601 ? -16.429 45.061  -2.278  1.00 74.51  ? 703  ALA A N     1 
ATOM   3671 C CA    . ALA A 1 601 ? -15.758 44.633  -3.522  1.00 73.30  ? 703  ALA A CA    1 
ATOM   3672 C C     . ALA A 1 601 ? -16.132 45.542  -4.725  1.00 72.19  ? 703  ALA A C     1 
ATOM   3673 O O     . ALA A 1 601 ? -15.908 45.230  -5.862  1.00 73.89  ? 703  ALA A O     1 
ATOM   3674 C CB    . ALA A 1 601 ? -16.071 43.161  -3.832  1.00 100.50 ? 703  ALA A CB    1 
ATOM   3675 N N     . ILE A 1 602 ? -16.726 46.680  -4.480  1.00 65.93  ? 704  ILE A N     1 
ATOM   3676 C CA    . ILE A 1 602 ? -17.007 47.599  -5.589  1.00 66.79  ? 704  ILE A CA    1 
ATOM   3677 C C     . ILE A 1 602 ? -16.254 48.906  -5.247  1.00 66.61  ? 704  ILE A C     1 
ATOM   3678 O O     . ILE A 1 602 ? -15.639 49.548  -6.093  1.00 63.15  ? 704  ILE A O     1 
ATOM   3679 C CB    . ILE A 1 602 ? -18.526 47.828  -5.776  1.00 65.00  ? 704  ILE A CB    1 
ATOM   3680 C CG1   . ILE A 1 602 ? -19.105 46.629  -6.514  1.00 64.62  ? 704  ILE A CG1   1 
ATOM   3681 C CG2   . ILE A 1 602 ? -18.773 49.076  -6.531  1.00 62.76  ? 704  ILE A CG2   1 
ATOM   3682 C CD1   . ILE A 1 602 ? -20.558 46.744  -6.798  1.00 65.90  ? 704  ILE A CD1   1 
ATOM   3683 N N     . ALA A 1 603 ? -16.284 49.250  -3.972  1.00 74.88  ? 705  ALA A N     1 
ATOM   3684 C CA    . ALA A 1 603 ? -15.555 50.369  -3.429  1.00 77.38  ? 705  ALA A CA    1 
ATOM   3685 C C     . ALA A 1 603 ? -14.040 50.066  -3.469  1.00 76.70  ? 705  ALA A C     1 
ATOM   3686 O O     . ALA A 1 603 ? -13.246 50.872  -2.993  1.00 80.33  ? 705  ALA A O     1 
ATOM   3687 C CB    . ALA A 1 603 ? -16.004 50.599  -1.952  1.00 78.14  ? 705  ALA A CB    1 
ATOM   3688 N N     . SER A 1 604 ? -13.644 48.949  -4.074  1.00 79.42  ? 706  SER A N     1 
ATOM   3689 C CA    . SER A 1 604 ? -12.262 48.467  -4.081  1.00 78.09  ? 706  SER A CA    1 
ATOM   3690 C C     . SER A 1 604 ? -11.534 48.470  -5.448  1.00 74.75  ? 706  SER A C     1 
ATOM   3691 O O     . SER A 1 604 ? -10.590 47.652  -5.711  1.00 70.61  ? 706  SER A O     1 
ATOM   3692 C CB    . SER A 1 604 ? -12.371 47.083  -3.514  1.00 55.50  ? 706  SER A CB    1 
ATOM   3693 O OG    . SER A 1 604 ? -13.532 46.512  -4.109  1.00 54.47  ? 706  SER A OG    1 
ATOM   3694 N N     . ASN A 1 605 ? -11.955 49.414  -6.287  1.00 54.19  ? 707  ASN A N     1 
ATOM   3695 C CA    . ASN A 1 605 ? -11.506 49.526  -7.667  1.00 50.21  ? 707  ASN A CA    1 
ATOM   3696 C C     . ASN A 1 605 ? -11.307 50.980  -8.107  1.00 47.78  ? 707  ASN A C     1 
ATOM   3697 O O     . ASN A 1 605 ? -11.927 51.921  -7.641  1.00 48.59  ? 707  ASN A O     1 
ATOM   3698 C CB    . ASN A 1 605 ? -12.558 48.834  -8.523  1.00 51.15  ? 707  ASN A CB    1 
ATOM   3699 C CG    . ASN A 1 605 ? -12.436 47.349  -8.476  1.00 52.97  ? 707  ASN A CG    1 
ATOM   3700 O OD1   . ASN A 1 605 ? -12.965 46.732  -7.589  1.00 51.89  ? 707  ASN A OD1   1 
ATOM   3701 N ND2   . ASN A 1 605 ? -11.755 46.763  -9.435  1.00 56.89  ? 707  ASN A ND2   1 
ATOM   3702 N N     . ILE A 1 606 ? -10.407 51.135  -9.044  1.00 50.49  ? 708  ILE A N     1 
ATOM   3703 C CA    . ILE A 1 606 ? -9.976  52.424  -9.514  1.00 47.96  ? 708  ILE A CA    1 
ATOM   3704 C C     . ILE A 1 606 ? -11.129 52.991  -10.280 1.00 48.75  ? 708  ILE A C     1 
ATOM   3705 O O     . ILE A 1 606 ? -11.246 52.868  -11.514 1.00 47.67  ? 708  ILE A O     1 
ATOM   3706 C CB    . ILE A 1 606 ? -8.569  52.233  -10.297 1.00 41.70  ? 708  ILE A CB    1 
ATOM   3707 C CG1   . ILE A 1 606 ? -7.423  52.226  -9.270  1.00 40.57  ? 708  ILE A CG1   1 
ATOM   3708 C CG2   . ILE A 1 606 ? -8.407  53.149  -11.514 1.00 39.02  ? 708  ILE A CG2   1 
ATOM   3709 C CD1   . ILE A 1 606 ? -6.152  53.006  -9.708  1.00 38.21  ? 708  ILE A CD1   1 
ATOM   3710 N N     . GLY A 1 607 ? -12.015 53.583  -9.482  1.00 44.13  ? 709  GLY A N     1 
ATOM   3711 C CA    . GLY A 1 607 ? -13.225 54.212  -10.012 1.00 47.04  ? 709  GLY A CA    1 
ATOM   3712 C C     . GLY A 1 607 ? -14.420 53.757  -9.236  1.00 50.48  ? 709  GLY A C     1 
ATOM   3713 O O     . GLY A 1 607 ? -15.418 53.347  -9.802  1.00 50.43  ? 709  GLY A O     1 
ATOM   3714 N N     . GLY A 1 608 ? -14.266 53.790  -7.916  1.00 61.91  ? 710  GLY A N     1 
ATOM   3715 C CA    . GLY A 1 608 ? -15.334 53.386  -6.993  1.00 65.61  ? 710  GLY A CA    1 
ATOM   3716 C C     . GLY A 1 608 ? -16.685 54.067  -7.213  1.00 67.64  ? 710  GLY A C     1 
ATOM   3717 O O     . GLY A 1 608 ? -17.613 53.496  -7.819  1.00 66.08  ? 710  GLY A O     1 
ATOM   3718 N N     . LYS A 1 609 ? -16.788 55.306  -6.741  1.00 57.41  ? 711  LYS A N     1 
ATOM   3719 C CA    . LYS A 1 609 ? -18.024 56.081  -6.904  1.00 61.23  ? 711  LYS A CA    1 
ATOM   3720 C C     . LYS A 1 609 ? -18.673 55.845  -8.271  1.00 65.48  ? 711  LYS A C     1 
ATOM   3721 O O     . LYS A 1 609 ? -19.865 55.602  -8.373  1.00 70.17  ? 711  LYS A O     1 
ATOM   3722 C CB    . LYS A 1 609 ? -17.763 57.593  -6.712  1.00 80.28  ? 711  LYS A CB    1 
ATOM   3723 C CG    . LYS A 1 609 ? -18.420 58.503  -7.787  1.00 81.46  ? 711  LYS A CG    1 
ATOM   3724 C CD    . LYS A 1 609 ? -19.747 59.034  -7.354  1.00 81.89  ? 711  LYS A CD    1 
ATOM   3725 C CE    . LYS A 1 609 ? -20.650 59.268  -8.542  1.00 81.23  ? 711  LYS A CE    1 
ATOM   3726 N NZ    . LYS A 1 609 ? -22.119 59.199  -8.135  1.00 81.05  ? 711  LYS A NZ    1 
ATOM   3727 N N     . GLN A 1 610 ? -17.873 55.866  -9.322  1.00 92.93  ? 712  GLN A N     1 
ATOM   3728 C CA    . GLN A 1 610 ? -18.423 55.728  -10.654 1.00 94.38  ? 712  GLN A CA    1 
ATOM   3729 C C     . GLN A 1 610 ? -19.249 54.521  -10.849 1.00 92.54  ? 712  GLN A C     1 
ATOM   3730 O O     . GLN A 1 610 ? -20.088 54.489  -11.752 1.00 93.04  ? 712  GLN A O     1 
ATOM   3731 C CB    . GLN A 1 610 ? -17.328 55.815  -11.715 1.00 67.37  ? 712  GLN A CB    1 
ATOM   3732 C CG    . GLN A 1 610 ? -16.867 57.237  -11.903 1.00 61.27  ? 712  GLN A CG    1 
ATOM   3733 C CD    . GLN A 1 610 ? -17.970 58.206  -11.524 1.00 62.06  ? 712  GLN A CD    1 
ATOM   3734 O OE1   . GLN A 1 610 ? -19.023 58.247  -12.174 1.00 61.16  ? 712  GLN A OE1   1 
ATOM   3735 N NE2   . GLN A 1 610 ? -17.722 59.011  -10.477 1.00 62.87  ? 712  GLN A NE2   1 
ATOM   3736 N N     . ALA A 1 611 ? -19.049 53.557  -9.962  1.00 60.02  ? 713  ALA A N     1 
ATOM   3737 C CA    . ALA A 1 611 ? -19.798 52.316  -10.055 1.00 66.53  ? 713  ALA A CA    1 
ATOM   3738 C C     . ALA A 1 611 ? -21.007 52.233  -9.100  1.00 69.38  ? 713  ALA A C     1 
ATOM   3739 O O     . ALA A 1 611 ? -22.131 51.924  -9.551  1.00 72.13  ? 713  ALA A O     1 
ATOM   3740 C CB    . ALA A 1 611 ? -18.863 51.131  -9.846  1.00 200.00 ? 713  ALA A CB    1 
ATOM   3741 N N     . LEU A 1 612 ? -20.787 52.497  -7.807  1.00 70.82  ? 714  LEU A N     1 
ATOM   3742 C CA    . LEU A 1 612 ? -21.893 52.413  -6.860  1.00 69.86  ? 714  LEU A CA    1 
ATOM   3743 C C     . LEU A 1 612 ? -23.132 53.110  -7.486  1.00 70.12  ? 714  LEU A C     1 
ATOM   3744 O O     . LEU A 1 612 ? -24.168 52.465  -7.787  1.00 68.85  ? 714  LEU A O     1 
ATOM   3745 C CB    . LEU A 1 612 ? -21.506 53.030  -5.506  1.00 54.28  ? 714  LEU A CB    1 
ATOM   3746 C CG    . LEU A 1 612 ? -20.288 52.304  -4.923  1.00 55.72  ? 714  LEU A CG    1 
ATOM   3747 C CD1   . LEU A 1 612 ? -19.962 52.779  -3.493  1.00 57.45  ? 714  LEU A CD1   1 
ATOM   3748 C CD2   . LEU A 1 612 ? -20.572 50.813  -4.906  1.00 54.64  ? 714  LEU A CD2   1 
ATOM   3749 N N     . GLU A 1 613 ? -22.998 54.404  -7.740  1.00 71.00  ? 715  GLU A N     1 
ATOM   3750 C CA    . GLU A 1 613 ? -24.085 55.131  -8.306  1.00 72.43  ? 715  GLU A CA    1 
ATOM   3751 C C     . GLU A 1 613 ? -24.589 54.455  -9.573  1.00 73.96  ? 715  GLU A C     1 
ATOM   3752 O O     . GLU A 1 613 ? -25.798 54.300  -9.732  1.00 79.58  ? 715  GLU A O     1 
ATOM   3753 C CB    . GLU A 1 613 ? -23.647 56.585  -8.596  1.00 125.29 ? 715  GLU A CB    1 
ATOM   3754 N N     . THR A 1 614 ? -23.683 54.040  -10.463 1.00 56.15  ? 716  THR A N     1 
ATOM   3755 C CA    . THR A 1 614 ? -24.124 53.482  -11.736 1.00 61.48  ? 716  THR A CA    1 
ATOM   3756 C C     . THR A 1 614 ? -24.759 52.063  -11.621 1.00 64.85  ? 716  THR A C     1 
ATOM   3757 O O     . THR A 1 614 ? -25.332 51.514  -12.588 1.00 61.71  ? 716  THR A O     1 
ATOM   3758 C CB    . THR A 1 614 ? -22.998 53.638  -12.816 1.00 72.77  ? 716  THR A CB    1 
ATOM   3759 O OG1   . THR A 1 614 ? -23.097 54.961  -13.393 1.00 74.18  ? 716  THR A OG1   1 
ATOM   3760 C CG2   . THR A 1 614 ? -23.104 52.551  -13.929 1.00 74.76  ? 716  THR A CG2   1 
ATOM   3761 N N     . VAL A 1 615 ? -24.686 51.460  -10.431 1.00 92.86  ? 717  VAL A N     1 
ATOM   3762 C CA    . VAL A 1 615 ? -25.409 50.196  -10.259 1.00 97.18  ? 717  VAL A CA    1 
ATOM   3763 C C     . VAL A 1 615 ? -26.797 50.562  -9.698  1.00 94.63  ? 717  VAL A C     1 
ATOM   3764 O O     . VAL A 1 615 ? -27.806 49.979  -10.080 1.00 97.29  ? 717  VAL A O     1 
ATOM   3765 C CB    . VAL A 1 615 ? -24.681 49.116  -9.365  1.00 119.37 ? 717  VAL A CB    1 
ATOM   3766 C CG1   . VAL A 1 615 ? -23.497 48.540  -10.136 1.00 112.26 ? 717  VAL A CG1   1 
ATOM   3767 C CG2   . VAL A 1 615 ? -24.260 49.678  -8.023  1.00 122.60 ? 717  VAL A CG2   1 
ATOM   3768 N N     . GLN A 1 616 ? -26.860 51.542  -8.807  1.00 76.43  ? 718  GLN A N     1 
ATOM   3769 C CA    . GLN A 1 616 ? -28.156 51.984  -8.307  1.00 78.17  ? 718  GLN A CA    1 
ATOM   3770 C C     . GLN A 1 616 ? -29.123 52.094  -9.467  1.00 80.20  ? 718  GLN A C     1 
ATOM   3771 O O     . GLN A 1 616 ? -30.174 51.474  -9.418  1.00 79.14  ? 718  GLN A O     1 
ATOM   3772 C CB    . GLN A 1 616 ? -28.041 53.307  -7.528  1.00 78.27  ? 718  GLN A CB    1 
ATOM   3773 C CG    . GLN A 1 616 ? -27.786 53.029  -6.045  1.00 80.80  ? 718  GLN A CG    1 
ATOM   3774 C CD    . GLN A 1 616 ? -27.031 51.727  -5.821  1.00 80.39  ? 718  GLN A CD    1 
ATOM   3775 O OE1   . GLN A 1 616 ? -25.831 51.723  -5.557  1.00 78.26  ? 718  GLN A OE1   1 
ATOM   3776 N NE2   . GLN A 1 616 ? -27.736 50.604  -5.948  1.00 87.39  ? 718  GLN A NE2   1 
ATOM   3777 N N     . ARG A 1 617 ? -28.803 52.851  -10.518 1.00 112.27 ? 719  ARG A N     1 
ATOM   3778 C CA    . ARG A 1 617 ? -29.737 52.915  -11.639 1.00 116.90 ? 719  ARG A CA    1 
ATOM   3779 C C     . ARG A 1 617 ? -29.831 51.547  -12.284 1.00 121.09 ? 719  ARG A C     1 
ATOM   3780 O O     . ARG A 1 617 ? -30.868 50.860  -12.181 1.00 129.20 ? 719  ARG A O     1 
ATOM   3781 C CB    . ARG A 1 617 ? -29.315 53.872  -12.772 1.00 110.15 ? 719  ARG A CB    1 
ATOM   3782 C CG    . ARG A 1 617 ? -29.059 55.314  -12.432 1.00 113.05 ? 719  ARG A CG    1 
ATOM   3783 C CD    . ARG A 1 617 ? -27.562 55.539  -12.346 1.00 109.74 ? 719  ARG A CD    1 
ATOM   3784 N NE    . ARG A 1 617 ? -27.200 56.779  -11.660 1.00 110.51 ? 719  ARG A NE    1 
ATOM   3785 C CZ    . ARG A 1 617 ? -27.535 57.087  -10.403 1.00 116.18 ? 719  ARG A CZ    1 
ATOM   3786 N NH1   . ARG A 1 617 ? -28.264 56.255  -9.653  1.00 116.29 ? 719  ARG A NH1   1 
ATOM   3787 N NH2   . ARG A 1 617 ? -27.109 58.231  -9.881  1.00 121.47 ? 719  ARG A NH2   1 
ATOM   3788 N N     . LEU A 1 618 ? -28.711 51.142  -12.896 1.00 91.12  ? 720  LEU A N     1 
ATOM   3789 C CA    . LEU A 1 618 ? -28.686 49.957  -13.741 1.00 87.03  ? 720  LEU A CA    1 
ATOM   3790 C C     . LEU A 1 618 ? -28.811 48.539  -13.223 1.00 91.77  ? 720  LEU A C     1 
ATOM   3791 O O     . LEU A 1 618 ? -28.564 47.574  -13.970 1.00 92.64  ? 720  LEU A O     1 
ATOM   3792 C CB    . LEU A 1 618 ? -27.523 50.086  -14.733 1.00 70.64  ? 720  LEU A CB    1 
ATOM   3793 C CG    . LEU A 1 618 ? -27.617 51.277  -15.714 1.00 69.13  ? 720  LEU A CG    1 
ATOM   3794 C CD1   . LEU A 1 618 ? -26.253 51.560  -16.335 1.00 72.37  ? 720  LEU A CD1   1 
ATOM   3795 C CD2   . LEU A 1 618 ? -28.620 50.992  -16.813 1.00 67.84  ? 720  LEU A CD2   1 
ATOM   3796 N N     . LEU A 1 619 ? -29.220 48.415  -11.956 1.00 109.62 ? 721  LEU A N     1 
ATOM   3797 C CA    . LEU A 1 619 ? -29.472 47.100  -11.370 1.00 109.97 ? 721  LEU A CA    1 
ATOM   3798 C C     . LEU A 1 619 ? -30.939 46.751  -11.709 1.00 114.58 ? 721  LEU A C     1 
ATOM   3799 O O     . LEU A 1 619 ? -31.169 45.842  -12.495 1.00 114.59 ? 721  LEU A O     1 
ATOM   3800 C CB    . LEU A 1 619 ? -29.219 47.073  -9.836  1.00 89.12  ? 721  LEU A CB    1 
ATOM   3801 C CG    . LEU A 1 619 ? -29.306 45.663  -9.194  1.00 91.37  ? 721  LEU A CG    1 
ATOM   3802 C CD1   . LEU A 1 619 ? -28.211 45.439  -8.154  1.00 86.60  ? 721  LEU A CD1   1 
ATOM   3803 C CD2   . LEU A 1 619 ? -30.684 45.465  -8.560  1.00 94.27  ? 721  LEU A CD2   1 
ATOM   3804 N N     . PRO A 1 620 ? -31.940 47.480  -11.140 1.00 112.49 ? 722  PRO A N     1 
ATOM   3805 C CA    . PRO A 1 620 ? -33.356 47.207  -11.425 1.00 113.24 ? 722  PRO A CA    1 
ATOM   3806 C C     . PRO A 1 620 ? -33.623 46.977  -12.897 1.00 112.35 ? 722  PRO A C     1 
ATOM   3807 O O     . PRO A 1 620 ? -34.407 46.116  -13.264 1.00 116.64 ? 722  PRO A O     1 
ATOM   3808 C CB    . PRO A 1 620 ? -34.060 48.466  -10.942 1.00 130.06 ? 722  PRO A CB    1 
ATOM   3809 C CG    . PRO A 1 620 ? -33.272 48.852  -9.760  1.00 133.49 ? 722  PRO A CG    1 
ATOM   3810 C CD    . PRO A 1 620 ? -31.821 48.535  -10.113 1.00 133.88 ? 722  PRO A CD    1 
ATOM   3811 N N     . VAL A 1 621 ? -32.973 47.758  -13.743 1.00 90.13  ? 723  VAL A N     1 
ATOM   3812 C CA    . VAL A 1 621 ? -33.171 47.643  -15.191 1.00 92.17  ? 723  VAL A CA    1 
ATOM   3813 C C     . VAL A 1 621 ? -32.853 46.251  -15.724 1.00 89.67  ? 723  VAL A C     1 
ATOM   3814 O O     . VAL A 1 621 ? -33.612 45.671  -16.504 1.00 92.84  ? 723  VAL A O     1 
ATOM   3815 C CB    . VAL A 1 621 ? -32.278 48.668  -15.973 1.00 93.89  ? 723  VAL A CB    1 
ATOM   3816 C CG1   . VAL A 1 621 ? -32.384 48.435  -17.495 1.00 94.20  ? 723  VAL A CG1   1 
ATOM   3817 C CG2   . VAL A 1 621 ? -32.677 50.099  -15.625 1.00 89.19  ? 723  VAL A CG2   1 
ATOM   3818 N N     . LEU A 1 622 ? -31.724 45.720  -15.273 1.00 127.91 ? 724  LEU A N     1 
ATOM   3819 C CA    . LEU A 1 622 ? -31.238 44.439  -15.741 1.00 125.86 ? 724  LEU A CA    1 
ATOM   3820 C C     . LEU A 1 622 ? -31.980 43.204  -15.256 1.00 124.04 ? 724  LEU A C     1 
ATOM   3821 O O     . LEU A 1 622 ? -32.727 42.619  -16.019 1.00 127.90 ? 724  LEU A O     1 
ATOM   3822 C CB    . LEU A 1 622 ? -29.738 44.322  -15.431 1.00 156.83 ? 724  LEU A CB    1 
ATOM   3823 N N     . CYS A 1 623 ? -31.777 42.806  -14.001 1.00 84.75  ? 725  CYS A N     1 
ATOM   3824 C CA    . CYS A 1 623 ? -32.409 41.598  -13.475 1.00 88.04  ? 725  CYS A CA    1 
ATOM   3825 C C     . CYS A 1 623 ? -33.889 41.513  -13.845 1.00 91.49  ? 725  CYS A C     1 
ATOM   3826 O O     . CYS A 1 623 ? -34.351 40.424  -14.209 1.00 84.65  ? 725  CYS A O     1 
ATOM   3827 C CB    . CYS A 1 623 ? -32.176 41.433  -11.945 1.00 101.42 ? 725  CYS A CB    1 
ATOM   3828 S SG    . CYS A 1 623 ? -31.497 42.821  -10.998 1.00 100.05 ? 725  CYS A SG    1 
ATOM   3829 N N     . GLN A 1 624 ? -34.614 42.641  -13.780 1.00 197.92 ? 726  GLN A N     1 
ATOM   3830 C CA    . GLN A 1 624 ? -36.030 42.685  -14.169 1.00 199.96 ? 726  GLN A CA    1 
ATOM   3831 C C     . GLN A 1 624 ? -36.229 42.450  -15.669 1.00 199.96 ? 726  GLN A C     1 
ATOM   3832 O O     . GLN A 1 624 ? -36.731 41.391  -16.094 1.00 199.96 ? 726  GLN A O     1 
ATOM   3833 C CB    . GLN A 1 624 ? -36.680 44.035  -13.810 1.00 128.35 ? 726  GLN A CB    1 
ATOM   3834 C CG    . GLN A 1 624 ? -37.028 44.229  -12.335 1.00 125.81 ? 726  GLN A CG    1 
ATOM   3835 C CD    . GLN A 1 624 ? -37.633 45.607  -12.036 1.00 122.24 ? 726  GLN A CD    1 
ATOM   3836 O OE1   . GLN A 1 624 ? -38.047 46.335  -12.958 1.00 118.21 ? 726  GLN A OE1   1 
ATOM   3837 N NE2   . GLN A 1 624 ? -37.691 45.970  -10.742 1.00 120.12 ? 726  GLN A NE2   1 
ATOM   3838 N N     . ALA A 1 625 ? -35.795 43.396  -16.489 1.00 171.95 ? 727  ALA A N     1 
ATOM   3839 C CA    . ALA A 1 625 ? -36.085 43.248  -17.902 1.00 170.23 ? 727  ALA A CA    1 
ATOM   3840 C C     . ALA A 1 625 ? -35.175 42.350  -18.786 1.00 171.10 ? 727  ALA A C     1 
ATOM   3841 O O     . ALA A 1 625 ? -35.648 41.829  -19.771 1.00 166.60 ? 727  ALA A O     1 
ATOM   3842 C CB    . ALA A 1 625 ? -36.346 44.663  -18.506 1.00 110.08 ? 727  ALA A CB    1 
ATOM   3843 N N     . HIS A 1 626 ? -33.911 42.195  -18.406 1.00 200.00 ? 728  HIS A N     1 
ATOM   3844 C CA    . HIS A 1 626 ? -32.987 41.351  -19.152 1.00 200.00 ? 728  HIS A CA    1 
ATOM   3845 C C     . HIS A 1 626 ? -32.611 39.953  -18.674 1.00 200.00 ? 728  HIS A C     1 
ATOM   3846 O O     . HIS A 1 626 ? -33.055 38.952  -19.237 1.00 200.00 ? 728  HIS A O     1 
ATOM   3847 C CB    . HIS A 1 626 ? -31.636 42.049  -19.316 1.00 136.32 ? 728  HIS A CB    1 
ATOM   3848 C CG    . HIS A 1 626 ? -31.676 43.237  -20.226 1.00 134.93 ? 728  HIS A CG    1 
ATOM   3849 N ND1   . HIS A 1 626 ? -31.745 44.531  -19.758 1.00 137.15 ? 728  HIS A ND1   1 
ATOM   3850 C CD2   . HIS A 1 626 ? -31.657 43.326  -21.577 1.00 136.02 ? 728  HIS A CD2   1 
ATOM   3851 C CE1   . HIS A 1 626 ? -31.766 45.367  -20.781 1.00 134.97 ? 728  HIS A CE1   1 
ATOM   3852 N NE2   . HIS A 1 626 ? -31.714 44.661  -21.896 1.00 134.57 ? 728  HIS A NE2   1 
ATOM   3853 N N     . GLY A 1 627 ? -31.792 39.892  -17.630 1.00 199.99 ? 729  GLY A N     1 
ATOM   3854 C CA    . GLY A 1 627 ? -31.377 38.627  -17.054 1.00 199.99 ? 729  GLY A CA    1 
ATOM   3855 C C     . GLY A 1 627 ? -30.041 38.615  -16.339 1.00 199.99 ? 729  GLY A C     1 
ATOM   3856 O O     . GLY A 1 627 ? -29.021 38.235  -16.915 1.00 199.99 ? 729  GLY A O     1 
ATOM   3857 N N     . LEU A 1 628 ? -30.046 39.030  -15.077 1.00 106.45 ? 730  LEU A N     1 
ATOM   3858 C CA    . LEU A 1 628 ? -28.843 39.016  -14.268 1.00 96.87  ? 730  LEU A CA    1 
ATOM   3859 C C     . LEU A 1 628 ? -29.448 39.063  -12.878 1.00 94.87  ? 730  LEU A C     1 
ATOM   3860 O O     . LEU A 1 628 ? -30.612 39.435  -12.729 1.00 95.76  ? 730  LEU A O     1 
ATOM   3861 C CB    . LEU A 1 628 ? -27.937 40.208  -14.566 1.00 126.08 ? 730  LEU A CB    1 
ATOM   3862 C CG    . LEU A 1 628 ? -27.806 40.608  -16.037 1.00 124.65 ? 730  LEU A CG    1 
ATOM   3863 C CD1   . LEU A 1 628 ? -26.857 41.787  -16.191 1.00 120.94 ? 730  LEU A CD1   1 
ATOM   3864 C CD2   . LEU A 1 628 ? -27.342 39.427  -16.876 1.00 119.54 ? 730  LEU A CD2   1 
ATOM   3865 N N     . THR A 1 629 ? -28.695 38.673  -11.859 1.00 76.53  ? 731  THR A N     1 
ATOM   3866 C CA    . THR A 1 629 ? -29.332 38.477  -10.519 1.00 76.70  ? 731  THR A CA    1 
ATOM   3867 C C     . THR A 1 629 ? -28.596 39.665  -9.931  1.00 76.41  ? 731  THR A C     1 
ATOM   3868 O O     . THR A 1 629 ? -28.511 40.686  -10.625 1.00 74.94  ? 731  THR A O     1 
ATOM   3869 C CB    . THR A 1 629 ? -28.669 37.272  -9.660  1.00 88.87  ? 731  THR A CB    1 
ATOM   3870 O OG1   . THR A 1 629 ? -27.247 37.275  -9.861  1.00 88.91  ? 731  THR A OG1   1 
ATOM   3871 C CG2   . THR A 1 629 ? -29.160 35.904  -10.028 1.00 93.07  ? 731  THR A CG2   1 
ATOM   3872 N N     . PRO A 1 630 ? -28.454 39.652  -8.575  1.00 199.59 ? 732  PRO A N     1 
ATOM   3873 C CA    . PRO A 1 630 ? -27.500 40.663  -8.168  1.00 199.59 ? 732  PRO A CA    1 
ATOM   3874 C C     . PRO A 1 630 ? -26.022 40.243  -8.652  1.00 198.53 ? 732  PRO A C     1 
ATOM   3875 O O     . PRO A 1 630 ? -25.328 41.017  -9.291  1.00 199.59 ? 732  PRO A O     1 
ATOM   3876 C CB    . PRO A 1 630 ? -27.537 40.557  -6.668  1.00 90.19  ? 732  PRO A CB    1 
ATOM   3877 C CG    . PRO A 1 630 ? -28.944 40.618  -6.373  1.00 87.40  ? 732  PRO A CG    1 
ATOM   3878 C CD    . PRO A 1 630 ? -29.599 39.831  -7.615  1.00 95.65  ? 732  PRO A CD    1 
ATOM   3879 N N     . ALA A 1 631 ? -25.525 39.061  -8.278  1.00 96.62  ? 733  ALA A N     1 
ATOM   3880 C CA    . ALA A 1 631 ? -24.149 38.594  -8.613  1.00 92.38  ? 733  ALA A CA    1 
ATOM   3881 C C     . ALA A 1 631 ? -23.557 39.074  -9.915  1.00 88.81  ? 733  ALA A C     1 
ATOM   3882 O O     . ALA A 1 631 ? -22.440 39.627  -9.958  1.00 86.05  ? 733  ALA A O     1 
ATOM   3883 C CB    . ALA A 1 631 ? -24.149 37.146  -8.655  1.00 107.20 ? 733  ALA A CB    1 
ATOM   3884 N N     . GLN A 1 632 ? -24.302 38.776  -10.975 1.00 79.76  ? 734  GLN A N     1 
ATOM   3885 C CA    . GLN A 1 632 ? -23.975 39.163  -12.346 1.00 81.98  ? 734  GLN A CA    1 
ATOM   3886 C C     . GLN A 1 632 ? -23.878 40.665  -12.564 1.00 80.83  ? 734  GLN A C     1 
ATOM   3887 O O     . GLN A 1 632 ? -23.308 41.122  -13.560 1.00 79.90  ? 734  GLN A O     1 
ATOM   3888 C CB    . GLN A 1 632 ? -24.994 38.575  -13.302 1.00 107.70 ? 734  GLN A CB    1 
ATOM   3889 C CG    . GLN A 1 632 ? -24.596 37.232  -13.833 1.00 106.10 ? 734  GLN A CG    1 
ATOM   3890 C CD    . GLN A 1 632 ? -25.761 36.546  -14.428 1.00 107.88 ? 734  GLN A CD    1 
ATOM   3891 O OE1   . GLN A 1 632 ? -26.881 36.669  -13.902 1.00 111.69 ? 734  GLN A OE1   1 
ATOM   3892 N NE2   . GLN A 1 632 ? -25.534 35.808  -15.523 1.00 106.06 ? 734  GLN A NE2   1 
ATOM   3893 N N     . VAL A 1 633 ? -24.481 41.441  -11.671 1.00 66.01  ? 735  VAL A N     1 
ATOM   3894 C CA    . VAL A 1 633 ? -24.312 42.890  -11.759 1.00 63.81  ? 735  VAL A CA    1 
ATOM   3895 C C     . VAL A 1 633 ? -23.002 43.212  -11.003 1.00 59.03  ? 735  VAL A C     1 
ATOM   3896 O O     . VAL A 1 633 ? -22.090 43.822  -11.549 1.00 57.97  ? 735  VAL A O     1 
ATOM   3897 C CB    . VAL A 1 633 ? -25.463 43.685  -11.118 1.00 59.44  ? 735  VAL A CB    1 
ATOM   3898 C CG1   . VAL A 1 633 ? -25.072 45.153  -11.045 1.00 60.96  ? 735  VAL A CG1   1 
ATOM   3899 C CG2   . VAL A 1 633 ? -26.720 43.533  -11.964 1.00 62.41  ? 735  VAL A CG2   1 
ATOM   3900 N N     . VAL A 1 634 ? -22.886 42.768  -9.763  1.00 60.56  ? 736  VAL A N     1 
ATOM   3901 C CA    . VAL A 1 634 ? -21.686 43.055  -9.005  1.00 57.36  ? 736  VAL A CA    1 
ATOM   3902 C C     . VAL A 1 634 ? -20.406 42.473  -9.696  1.00 55.54  ? 736  VAL A C     1 
ATOM   3903 O O     . VAL A 1 634 ? -19.308 43.090  -9.679  1.00 49.53  ? 736  VAL A O     1 
ATOM   3904 C CB    . VAL A 1 634 ? -21.819 42.533  -7.540  1.00 46.10  ? 736  VAL A CB    1 
ATOM   3905 C CG1   . VAL A 1 634 ? -20.450 42.655  -6.800  1.00 42.72  ? 736  VAL A CG1   1 
ATOM   3906 C CG2   . VAL A 1 634 ? -22.899 43.358  -6.780  1.00 45.96  ? 736  VAL A CG2   1 
ATOM   3907 N N     . ALA A 1 635 ? -20.532 41.287  -10.297 1.00 64.79  ? 737  ALA A N     1 
ATOM   3908 C CA    . ALA A 1 635 ? -19.413 40.668  -10.999 1.00 62.60  ? 737  ALA A CA    1 
ATOM   3909 C C     . ALA A 1 635 ? -18.997 41.603  -12.161 1.00 64.63  ? 737  ALA A C     1 
ATOM   3910 O O     . ALA A 1 635 ? -17.805 41.948  -12.331 1.00 64.15  ? 737  ALA A O     1 
ATOM   3911 C CB    . ALA A 1 635 ? -19.834 39.362  -11.511 1.00 33.71  ? 737  ALA A CB    1 
ATOM   3912 N N     . ILE A 1 636 ? -19.975 42.010  -12.964 1.00 76.77  ? 738  ILE A N     1 
ATOM   3913 C CA    . ILE A 1 636 ? -19.728 42.940  -14.046 1.00 76.93  ? 738  ILE A CA    1 
ATOM   3914 C C     . ILE A 1 636 ? -19.210 44.257  -13.496 1.00 76.49  ? 738  ILE A C     1 
ATOM   3915 O O     . ILE A 1 636 ? -18.412 44.924  -14.129 1.00 79.19  ? 738  ILE A O     1 
ATOM   3916 C CB    . ILE A 1 636 ? -21.032 43.252  -14.789 1.00 62.75  ? 738  ILE A CB    1 
ATOM   3917 C CG1   . ILE A 1 636 ? -21.077 42.500  -16.116 1.00 63.68  ? 738  ILE A CG1   1 
ATOM   3918 C CG2   . ILE A 1 636 ? -21.174 44.748  -15.003 1.00 62.15  ? 738  ILE A CG2   1 
ATOM   3919 C CD1   . ILE A 1 636 ? -20.836 43.356  -17.365 1.00 62.00  ? 738  ILE A CD1   1 
ATOM   3920 N N     . ALA A 1 637 ? -19.636 44.612  -12.293 1.00 70.99  ? 739  ALA A N     1 
ATOM   3921 C CA    . ALA A 1 637 ? -19.319 45.932  -11.733 1.00 70.01  ? 739  ALA A CA    1 
ATOM   3922 C C     . ALA A 1 637 ? -18.065 46.172  -10.946 1.00 67.51  ? 739  ALA A C     1 
ATOM   3923 O O     . ALA A 1 637 ? -17.739 47.320  -10.672 1.00 68.51  ? 739  ALA A O     1 
ATOM   3924 C CB    . ALA A 1 637 ? -20.507 46.430  -10.912 1.00 104.62 ? 739  ALA A CB    1 
ATOM   3925 N N     . SER A 1 638 ? -17.377 45.106  -10.561 1.00 87.59  ? 740  SER A N     1 
ATOM   3926 C CA    . SER A 1 638 ? -16.137 45.233  -9.770  1.00 86.97  ? 740  SER A CA    1 
ATOM   3927 C C     . SER A 1 638 ? -14.692 45.388  -10.229 1.00 84.98  ? 740  SER A C     1 
ATOM   3928 O O     . SER A 1 638 ? -13.763 44.905  -9.579  1.00 83.52  ? 740  SER A O     1 
ATOM   3929 C CB    . SER A 1 638 ? -16.133 44.180  -8.694  1.00 51.90  ? 740  SER A CB    1 
ATOM   3930 O OG    . SER A 1 638 ? -17.177 44.414  -7.740  1.00 52.94  ? 740  SER A OG    1 
ATOM   3931 N N     . HIS A 1 639 ? -14.486 46.078  -11.345 1.00 77.09  ? 741  HIS A N     1 
ATOM   3932 C CA    . HIS A 1 639 ? -13.133 46.273  -11.862 1.00 76.14  ? 741  HIS A CA    1 
ATOM   3933 C C     . HIS A 1 639 ? -12.882 47.777  -11.927 1.00 75.45  ? 741  HIS A C     1 
ATOM   3934 O O     . HIS A 1 639 ? -13.814 48.574  -11.821 1.00 75.20  ? 741  HIS A O     1 
ATOM   3935 C CB    . HIS A 1 639 ? -12.887 45.367  -13.070 1.00 74.02  ? 741  HIS A CB    1 
ATOM   3936 C CG    . HIS A 1 639 ? -13.443 43.986  -12.913 1.00 74.32  ? 741  HIS A CG    1 
ATOM   3937 N ND1   . HIS A 1 639 ? -13.347 43.274  -11.737 1.00 74.70  ? 741  HIS A ND1   1 
ATOM   3938 C CD2   . HIS A 1 639 ? -14.102 43.185  -13.784 1.00 74.38  ? 741  HIS A CD2   1 
ATOM   3939 C CE1   . HIS A 1 639 ? -13.922 42.095  -11.890 1.00 74.63  ? 741  HIS A CE1   1 
ATOM   3940 N NE2   . HIS A 1 639 ? -14.388 42.016  -13.123 1.00 74.51  ? 741  HIS A NE2   1 
ATOM   3941 N N     . ASP A 1 640 ? -11.620 48.163  -12.106 1.00 65.61  ? 742  ASP A N     1 
ATOM   3942 C CA    . ASP A 1 640 ? -11.280 49.573  -12.241 1.00 65.71  ? 742  ASP A CA    1 
ATOM   3943 C C     . ASP A 1 640 ? -12.229 49.899  -13.381 1.00 66.00  ? 742  ASP A C     1 
ATOM   3944 O O     . ASP A 1 640 ? -12.282 49.178  -14.377 1.00 66.06  ? 742  ASP A O     1 
ATOM   3945 C CB    . ASP A 1 640 ? -9.804  49.629  -12.632 1.00 58.61  ? 742  ASP A CB    1 
ATOM   3946 C CG    . ASP A 1 640 ? -8.881  49.579  -11.431 1.00 58.83  ? 742  ASP A CG    1 
ATOM   3947 O OD1   . ASP A 1 640 ? -9.318  49.102  -10.362 1.00 58.90  ? 742  ASP A OD1   1 
ATOM   3948 O OD2   . ASP A 1 640 ? -7.717  50.016  -11.555 1.00 59.23  ? 742  ASP A OD2   1 
ATOM   3949 N N     . GLY A 1 641 ? -12.993 50.974  -13.228 1.00 45.66  ? 743  GLY A N     1 
ATOM   3950 C CA    . GLY A 1 641 ? -14.106 51.232  -14.147 1.00 45.89  ? 743  GLY A CA    1 
ATOM   3951 C C     . GLY A 1 641 ? -15.432 50.493  -14.294 1.00 46.49  ? 743  GLY A C     1 
ATOM   3952 O O     . GLY A 1 641 ? -15.814 50.128  -15.444 1.00 45.66  ? 743  GLY A O     1 
ATOM   3953 N N     . GLY A 1 642 ? -16.105 50.278  -13.140 1.00 79.10  ? 744  GLY A N     1 
ATOM   3954 C CA    . GLY A 1 642 ? -17.363 49.549  -13.123 1.00 83.57  ? 744  GLY A CA    1 
ATOM   3955 C C     . GLY A 1 642 ? -18.393 50.203  -13.988 1.00 83.64  ? 744  GLY A C     1 
ATOM   3956 O O     . GLY A 1 642 ? -19.096 49.558  -14.782 1.00 80.70  ? 744  GLY A O     1 
ATOM   3957 N N     . LYS A 1 643 ? -18.495 51.505  -13.810 1.00 39.04  ? 745  LYS A N     1 
ATOM   3958 C CA    . LYS A 1 643 ? -19.451 52.302  -14.581 1.00 40.97  ? 745  LYS A CA    1 
ATOM   3959 C C     . LYS A 1 643 ? -19.557 51.904  -16.074 1.00 39.60  ? 745  LYS A C     1 
ATOM   3960 O O     . LYS A 1 643 ? -20.579 51.388  -16.512 1.00 44.84  ? 745  LYS A O     1 
ATOM   3961 C CB    . LYS A 1 643 ? -18.995 53.754  -14.502 1.00 87.70  ? 745  LYS A CB    1 
ATOM   3962 C CG    . LYS A 1 643 ? -20.019 54.837  -14.533 1.00 93.01  ? 745  LYS A CG    1 
ATOM   3963 C CD    . LYS A 1 643 ? -20.061 55.601  -15.855 1.00 95.38  ? 745  LYS A CD    1 
ATOM   3964 C CE    . LYS A 1 643 ? -20.584 57.000  -15.602 1.00 98.62  ? 745  LYS A CE    1 
ATOM   3965 N NZ    . LYS A 1 643 ? -21.289 57.644  -16.741 1.00 97.04  ? 745  LYS A NZ    1 
ATOM   3966 N N     . GLN A 1 644 ? -18.478 52.088  -16.839 1.00 39.88  ? 746  GLN A N     1 
ATOM   3967 C CA    . GLN A 1 644 ? -18.591 51.874  -18.255 1.00 40.62  ? 746  GLN A CA    1 
ATOM   3968 C C     . GLN A 1 644 ? -19.210 50.517  -18.644 1.00 42.35  ? 746  GLN A C     1 
ATOM   3969 O O     . GLN A 1 644 ? -20.194 50.399  -19.448 1.00 41.24  ? 746  GLN A O     1 
ATOM   3970 C CB    . GLN A 1 644 ? -17.274 52.209  -18.963 1.00 55.99  ? 746  GLN A CB    1 
ATOM   3971 C CG    . GLN A 1 644 ? -17.279 53.639  -19.559 1.00 59.37  ? 746  GLN A CG    1 
ATOM   3972 C CD    . GLN A 1 644 ? -17.521 54.750  -18.494 1.00 64.34  ? 746  GLN A CD    1 
ATOM   3973 O OE1   . GLN A 1 644 ? -16.961 54.741  -17.393 1.00 66.21  ? 746  GLN A OE1   1 
ATOM   3974 N NE2   . GLN A 1 644 ? -18.342 55.722  -18.847 1.00 65.71  ? 746  GLN A NE2   1 
ATOM   3975 N N     . ALA A 1 645 ? -18.680 49.495  -18.005 1.00 64.91  ? 747  ALA A N     1 
ATOM   3976 C CA    . ALA A 1 645 ? -19.204 48.178  -18.202 1.00 67.17  ? 747  ALA A CA    1 
ATOM   3977 C C     . ALA A 1 645 ? -20.742 48.102  -18.157 1.00 69.30  ? 747  ALA A C     1 
ATOM   3978 O O     . ALA A 1 645 ? -21.366 47.738  -19.165 1.00 72.51  ? 747  ALA A O     1 
ATOM   3979 C CB    . ALA A 1 645 ? -18.626 47.274  -17.153 1.00 82.12  ? 747  ALA A CB    1 
ATOM   3980 N N     . LEU A 1 646 ? -21.341 48.431  -16.999 1.00 57.84  ? 748  LEU A N     1 
ATOM   3981 C CA    . LEU A 1 646 ? -22.825 48.330  -16.800 1.00 59.38  ? 748  LEU A CA    1 
ATOM   3982 C C     . LEU A 1 646 ? -23.640 49.071  -17.900 1.00 63.41  ? 748  LEU A C     1 
ATOM   3983 O O     . LEU A 1 646 ? -24.533 48.487  -18.576 1.00 60.11  ? 748  LEU A O     1 
ATOM   3984 C CB    . LEU A 1 646 ? -23.178 48.818  -15.391 1.00 37.55  ? 748  LEU A CB    1 
ATOM   3985 C CG    . LEU A 1 646 ? -22.418 48.048  -14.287 1.00 35.49  ? 748  LEU A CG    1 
ATOM   3986 C CD1   . LEU A 1 646 ? -21.835 49.047  -13.278 1.00 33.55  ? 748  LEU A CD1   1 
ATOM   3987 C CD2   . LEU A 1 646 ? -23.370 47.014  -13.567 1.00 35.04  ? 748  LEU A CD2   1 
ATOM   3988 N N     . GLU A 1 647 ? -23.270 50.340  -18.079 1.00 63.93  ? 749  GLU A N     1 
ATOM   3989 C CA    . GLU A 1 647 ? -23.802 51.229  -19.092 1.00 65.99  ? 749  GLU A CA    1 
ATOM   3990 C C     . GLU A 1 647 ? -23.769 50.605  -20.482 1.00 65.95  ? 749  GLU A C     1 
ATOM   3991 O O     . GLU A 1 647 ? -24.680 50.803  -21.280 1.00 68.49  ? 749  GLU A O     1 
ATOM   3992 C CB    . GLU A 1 647 ? -22.937 52.485  -19.179 1.00 121.15 ? 749  GLU A CB    1 
ATOM   3993 C CG    . GLU A 1 647 ? -23.507 53.724  -18.530 1.00 129.91 ? 749  GLU A CG    1 
ATOM   3994 C CD    . GLU A 1 647 ? -22.898 55.013  -19.074 1.00 132.10 ? 749  GLU A CD    1 
ATOM   3995 O OE1   . GLU A 1 647 ? -22.973 55.253  -20.302 1.00 135.62 ? 749  GLU A OE1   1 
ATOM   3996 O OE2   . GLU A 1 647 ? -22.351 55.786  -18.262 1.00 128.71 ? 749  GLU A OE2   1 
ATOM   3997 N N     . THR A 1 648 ? -22.696 49.890  -20.787 1.00 67.18  ? 750  THR A N     1 
ATOM   3998 C CA    . THR A 1 648 ? -22.520 49.350  -22.133 1.00 67.98  ? 750  THR A CA    1 
ATOM   3999 C C     . THR A 1 648 ? -23.259 48.045  -22.334 1.00 73.72  ? 750  THR A C     1 
ATOM   4000 O O     . THR A 1 648 ? -23.242 47.445  -23.431 1.00 74.23  ? 750  THR A O     1 
ATOM   4001 C CB    . THR A 1 648 ? -21.013 49.220  -22.463 1.00 67.66  ? 750  THR A CB    1 
ATOM   4002 O OG1   . THR A 1 648 ? -20.301 50.251  -21.762 1.00 63.29  ? 750  THR A OG1   1 
ATOM   4003 C CG2   . THR A 1 648 ? -20.783 49.388  -23.957 1.00 66.82  ? 750  THR A CG2   1 
ATOM   4004 N N     . VAL A 1 649 ? -23.902 47.618  -21.248 1.00 102.63 ? 751  VAL A N     1 
ATOM   4005 C CA    . VAL A 1 649 ? -24.743 46.448  -21.279 1.00 109.47 ? 751  VAL A CA    1 
ATOM   4006 C C     . VAL A 1 649 ? -26.150 47.036  -21.567 1.00 112.61 ? 751  VAL A C     1 
ATOM   4007 O O     . VAL A 1 649 ? -26.673 46.898  -22.688 1.00 112.35 ? 751  VAL A O     1 
ATOM   4008 C CB    . VAL A 1 649 ? -24.677 45.679  -19.939 1.00 160.35 ? 751  VAL A CB    1 
ATOM   4009 C CG1   . VAL A 1 649 ? -26.056 45.147  -19.544 1.00 167.78 ? 751  VAL A CG1   1 
ATOM   4010 C CG2   . VAL A 1 649 ? -23.677 44.527  -20.079 1.00 159.10 ? 751  VAL A CG2   1 
ATOM   4011 N N     . GLN A 1 650 ? -26.729 47.733  -20.580 1.00 93.91  ? 752  GLN A N     1 
ATOM   4012 C CA    . GLN A 1 650 ? -28.060 48.355  -20.710 1.00 94.37  ? 752  GLN A CA    1 
ATOM   4013 C C     . GLN A 1 650 ? -28.310 48.940  -22.103 1.00 98.13  ? 752  GLN A C     1 
ATOM   4014 O O     . GLN A 1 650 ? -29.461 48.969  -22.586 1.00 99.83  ? 752  GLN A O     1 
ATOM   4015 C CB    . GLN A 1 650 ? -28.227 49.428  -19.625 1.00 84.49  ? 752  GLN A CB    1 
ATOM   4016 C CG    . GLN A 1 650 ? -28.897 50.710  -20.086 1.00 92.20  ? 752  GLN A CG    1 
ATOM   4017 C CD    . GLN A 1 650 ? -27.927 51.886  -20.292 1.00 95.45  ? 752  GLN A CD    1 
ATOM   4018 O OE1   . GLN A 1 650 ? -27.532 52.546  -19.326 1.00 97.91  ? 752  GLN A OE1   1 
ATOM   4019 N NE2   . GLN A 1 650 ? -27.547 52.151  -21.554 1.00 94.11  ? 752  GLN A NE2   1 
ATOM   4020 N N     . ARG A 1 651 ? -27.219 49.397  -22.732 1.00 97.54  ? 753  ARG A N     1 
ATOM   4021 C CA    . ARG A 1 651 ? -27.250 49.970  -24.071 1.00 99.01  ? 753  ARG A CA    1 
ATOM   4022 C C     . ARG A 1 651 ? -27.110 48.828  -25.059 1.00 95.91  ? 753  ARG A C     1 
ATOM   4023 O O     . ARG A 1 651 ? -28.011 48.572  -25.876 1.00 100.21 ? 753  ARG A O     1 
ATOM   4024 C CB    . ARG A 1 651 ? -26.099 50.969  -24.249 1.00 132.35 ? 753  ARG A CB    1 
ATOM   4025 C CG    . ARG A 1 651 ? -26.126 51.806  -25.530 1.00 136.96 ? 753  ARG A CG    1 
ATOM   4026 C CD    . ARG A 1 651 ? -25.141 52.976  -25.460 1.00 135.16 ? 753  ARG A CD    1 
ATOM   4027 N NE    . ARG A 1 651 ? -24.018 52.713  -24.560 1.00 137.00 ? 753  ARG A NE    1 
ATOM   4028 C CZ    . ARG A 1 651 ? -23.892 53.218  -23.329 1.00 135.38 ? 753  ARG A CZ    1 
ATOM   4029 N NH1   . ARG A 1 651 ? -24.823 54.025  -22.832 1.00 134.17 ? 753  ARG A NH1   1 
ATOM   4030 N NH2   . ARG A 1 651 ? -22.823 52.919  -22.589 1.00 131.00 ? 753  ARG A NH2   1 
ATOM   4031 N N     . LEU A 1 652 ? -26.015 48.090  -24.936 1.00 76.99  ? 754  LEU A N     1 
ATOM   4032 C CA    . LEU A 1 652 ? -25.734 47.023  -25.902 1.00 79.07  ? 754  LEU A CA    1 
ATOM   4033 C C     . LEU A 1 652 ? -26.022 45.552  -25.553 1.00 79.24  ? 754  LEU A C     1 
ATOM   4034 O O     . LEU A 1 652 ? -25.811 44.652  -26.375 1.00 79.61  ? 754  LEU A O     1 
ATOM   4035 C CB    . LEU A 1 652 ? -24.285 47.188  -26.426 1.00 79.13  ? 754  LEU A CB    1 
ATOM   4036 C CG    . LEU A 1 652 ? -24.091 47.946  -27.766 1.00 77.62  ? 754  LEU A CG    1 
ATOM   4037 C CD1   . LEU A 1 652 ? -22.803 48.775  -27.760 1.00 74.45  ? 754  LEU A CD1   1 
ATOM   4038 C CD2   . LEU A 1 652 ? -24.100 46.945  -28.935 1.00 75.20  ? 754  LEU A CD2   1 
ATOM   4039 N N     . LEU A 1 653 ? -26.544 45.290  -24.359 1.00 104.11 ? 755  LEU A N     1 
ATOM   4040 C CA    . LEU A 1 653 ? -26.827 43.899  -23.969 1.00 108.98 ? 755  LEU A CA    1 
ATOM   4041 C C     . LEU A 1 653 ? -27.737 43.156  -24.956 1.00 116.89 ? 755  LEU A C     1 
ATOM   4042 O O     . LEU A 1 653 ? -27.287 42.178  -25.565 1.00 113.65 ? 755  LEU A O     1 
ATOM   4043 C CB    . LEU A 1 653 ? -27.462 43.802  -22.556 1.00 94.35  ? 755  LEU A CB    1 
ATOM   4044 C CG    . LEU A 1 653 ? -27.442 42.409  -21.845 1.00 94.90  ? 755  LEU A CG    1 
ATOM   4045 C CD1   . LEU A 1 653 ? -28.128 42.532  -20.475 1.00 94.49  ? 755  LEU A CD1   1 
ATOM   4046 C CD2   . LEU A 1 653 ? -28.116 41.265  -22.680 1.00 86.25  ? 755  LEU A CD2   1 
ATOM   4047 N N     . PRO A 1 654 ? -29.007 43.617  -25.137 1.00 148.01 ? 756  PRO A N     1 
ATOM   4048 C CA    . PRO A 1 654 ? -30.037 43.023  -26.016 1.00 150.66 ? 756  PRO A CA    1 
ATOM   4049 C C     . PRO A 1 654 ? -29.629 42.582  -27.403 1.00 151.27 ? 756  PRO A C     1 
ATOM   4050 O O     . PRO A 1 654 ? -29.844 41.454  -27.832 1.00 149.38 ? 756  PRO A O     1 
ATOM   4051 C CB    . PRO A 1 654 ? -31.069 44.131  -26.148 1.00 70.82  ? 756  PRO A CB    1 
ATOM   4052 C CG    . PRO A 1 654 ? -30.939 44.919  -24.947 1.00 64.47  ? 756  PRO A CG    1 
ATOM   4053 C CD    . PRO A 1 654 ? -29.477 44.934  -24.638 1.00 66.57  ? 756  PRO A CD    1 
ATOM   4054 N N     . VAL A 1 655 ? -29.206 43.605  -28.120 1.00 99.41  ? 757  VAL A N     1 
ATOM   4055 C CA    . VAL A 1 655 ? -28.637 43.585  -29.453 1.00 97.69  ? 757  VAL A CA    1 
ATOM   4056 C C     . VAL A 1 655 ? -27.659 42.395  -29.705 1.00 95.62  ? 757  VAL A C     1 
ATOM   4057 O O     . VAL A 1 655 ? -27.531 41.892  -30.839 1.00 91.89  ? 757  VAL A O     1 
ATOM   4058 C CB    . VAL A 1 655 ? -27.845 44.903  -29.562 1.00 133.92 ? 757  VAL A CB    1 
ATOM   4059 C CG1   . VAL A 1 655 ? -27.746 45.384  -30.982 1.00 132.95 ? 757  VAL A CG1   1 
ATOM   4060 C CG2   . VAL A 1 655 ? -28.501 45.959  -28.632 1.00 130.88 ? 757  VAL A CG2   1 
ATOM   4061 N N     . LEU A 1 656 ? -26.927 41.995  -28.665 1.00 117.71 ? 758  LEU A N     1 
ATOM   4062 C CA    . LEU A 1 656 ? -25.943 40.925  -28.800 1.00 123.04 ? 758  LEU A CA    1 
ATOM   4063 C C     . LEU A 1 656 ? -26.623 39.558  -28.828 1.00 128.02 ? 758  LEU A C     1 
ATOM   4064 O O     . LEU A 1 656 ? -26.005 38.545  -29.176 1.00 124.81 ? 758  LEU A O     1 
ATOM   4065 C CB    . LEU A 1 656 ? -24.896 41.016  -27.672 1.00 112.95 ? 758  LEU A CB    1 
ATOM   4066 C CG    . LEU A 1 656 ? -23.994 42.261  -27.652 1.00 108.97 ? 758  LEU A CG    1 
ATOM   4067 C CD1   . LEU A 1 656 ? -23.369 42.392  -26.284 1.00 104.22 ? 758  LEU A CD1   1 
ATOM   4068 C CD2   . LEU A 1 656 ? -22.928 42.172  -28.743 1.00 109.00 ? 758  LEU A CD2   1 
ATOM   4069 N N     . CYS A 1 657 ? -27.899 39.532  -28.451 1.00 144.24 ? 759  CYS A N     1 
ATOM   4070 C CA    . CYS A 1 657 ? -28.692 38.301  -28.498 1.00 144.88 ? 759  CYS A CA    1 
ATOM   4071 C C     . CYS A 1 657 ? -29.795 38.515  -29.561 1.00 147.43 ? 759  CYS A C     1 
ATOM   4072 O O     . CYS A 1 657 ? -30.228 37.574  -30.245 1.00 144.83 ? 759  CYS A O     1 
ATOM   4073 C CB    . CYS A 1 657 ? -29.315 38.026  -27.137 1.00 125.47 ? 759  CYS A CB    1 
ATOM   4074 S SG    . CYS A 1 657 ? -28.155 38.242  -25.799 1.00 121.34 ? 759  CYS A SG    1 
ATOM   4075 N N     . GLN A 1 658 ? -30.231 39.768  -29.698 1.00 163.68 ? 760  GLN A N     1 
ATOM   4076 C CA    . GLN A 1 658 ? -31.251 40.122  -30.673 1.00 163.71 ? 760  GLN A CA    1 
ATOM   4077 C C     . GLN A 1 658 ? -30.669 40.240  -32.085 1.00 165.63 ? 760  GLN A C     1 
ATOM   4078 O O     . GLN A 1 658 ? -31.393 40.395  -33.079 1.00 171.51 ? 760  GLN A O     1 
ATOM   4079 C CB    . GLN A 1 658 ? -31.987 41.384  -30.229 1.00 110.82 ? 760  GLN A CB    1 
ATOM   4080 C CG    . GLN A 1 658 ? -32.797 41.159  -28.952 1.00 109.94 ? 760  GLN A CG    1 
ATOM   4081 C CD    . GLN A 1 658 ? -33.856 40.077  -29.115 1.00 109.65 ? 760  GLN A CD    1 
ATOM   4082 O OE1   . GLN A 1 658 ? -34.063 39.267  -28.224 1.00 109.65 ? 760  GLN A OE1   1 
ATOM   4083 N NE2   . GLN A 1 658 ? -34.516 40.051  -30.260 1.00 109.68 ? 760  GLN A NE2   1 
ATOM   4084 N N     . ALA A 1 659 ? -29.354 40.161  -32.187 1.00 144.55 ? 761  ALA A N     1 
ATOM   4085 C CA    . ALA A 1 659 ? -28.769 40.163  -33.508 1.00 142.72 ? 761  ALA A CA    1 
ATOM   4086 C C     . ALA A 1 659 ? -27.601 39.152  -33.375 1.00 141.18 ? 761  ALA A C     1 
ATOM   4087 O O     . ALA A 1 659 ? -27.553 38.169  -34.082 1.00 137.91 ? 761  ALA A O     1 
ATOM   4088 C CB    . ALA A 1 659 ? -28.402 41.640  -33.968 1.00 86.48  ? 761  ALA A CB    1 
ATOM   4089 N N     . HIS A 1 660 ? -26.802 39.289  -32.322 1.00 184.20 ? 762  HIS A N     1 
ATOM   4090 C CA    . HIS A 1 660 ? -25.643 38.410  -32.112 1.00 184.20 ? 762  HIS A CA    1 
ATOM   4091 C C     . HIS A 1 660 ? -25.755 37.045  -31.293 1.00 184.20 ? 762  HIS A C     1 
ATOM   4092 O O     . HIS A 1 660 ? -24.758 36.314  -31.148 1.00 178.61 ? 762  HIS A O     1 
ATOM   4093 C CB    . HIS A 1 660 ? -24.560 39.295  -31.569 1.00 97.06  ? 762  HIS A CB    1 
ATOM   4094 N N     . GLY A 1 661 ? -26.949 36.694  -30.790 1.00 169.58 ? 763  GLY A N     1 
ATOM   4095 C CA    . GLY A 1 661 ? -27.176 35.452  -30.030 1.00 171.00 ? 763  GLY A CA    1 
ATOM   4096 C C     . GLY A 1 661 ? -26.085 34.904  -29.129 1.00 164.06 ? 763  GLY A C     1 
ATOM   4097 O O     . GLY A 1 661 ? -25.773 33.717  -29.158 1.00 164.34 ? 763  GLY A O     1 
ATOM   4098 N N     . LEU A 1 662 ? -25.522 35.786  -28.318 1.00 72.73  ? 764  LEU A N     1 
ATOM   4099 C CA    . LEU A 1 662 ? -24.459 35.460  -27.380 1.00 68.74  ? 764  LEU A CA    1 
ATOM   4100 C C     . LEU A 1 662 ? -25.315 35.171  -26.165 1.00 66.51  ? 764  LEU A C     1 
ATOM   4101 O O     . LEU A 1 662 ? -26.027 36.072  -25.728 1.00 66.07  ? 764  LEU A O     1 
ATOM   4102 C CB    . LEU A 1 662 ? -23.577 36.710  -27.133 1.00 115.86 ? 764  LEU A CB    1 
ATOM   4103 C CG    . LEU A 1 662 ? -22.550 37.240  -28.159 1.00 118.57 ? 764  LEU A CG    1 
ATOM   4104 C CD1   . LEU A 1 662 ? -21.993 38.594  -27.697 1.00 113.62 ? 764  LEU A CD1   1 
ATOM   4105 C CD2   . LEU A 1 662 ? -21.420 36.234  -28.356 1.00 118.42 ? 764  LEU A CD2   1 
ATOM   4106 N N     . THR A 1 663 ? -25.286 33.942  -25.645 1.00 101.88 ? 765  THR A N     1 
ATOM   4107 C CA    . THR A 1 663 ? -26.121 33.625  -24.480 1.00 105.18 ? 765  THR A CA    1 
ATOM   4108 C C     . THR A 1 663 ? -25.769 34.628  -23.374 1.00 102.92 ? 765  THR A C     1 
ATOM   4109 O O     . THR A 1 663 ? -24.669 34.581  -22.823 1.00 101.95 ? 765  THR A O     1 
ATOM   4110 C CB    . THR A 1 663 ? -25.956 32.126  -24.025 1.00 184.63 ? 765  THR A CB    1 
ATOM   4111 O OG1   . THR A 1 663 ? -24.664 31.913  -23.437 1.00 179.51 ? 765  THR A OG1   1 
ATOM   4112 C CG2   . THR A 1 663 ? -26.139 31.201  -25.235 1.00 184.74 ? 765  THR A CG2   1 
ATOM   4113 N N     . PRO A 1 664 ? -26.707 35.544  -23.043 1.00 105.09 ? 766  PRO A N     1 
ATOM   4114 C CA    . PRO A 1 664 ? -26.538 36.611  -22.043 1.00 104.76 ? 766  PRO A CA    1 
ATOM   4115 C C     . PRO A 1 664 ? -25.527 36.386  -20.960 1.00 103.06 ? 766  PRO A C     1 
ATOM   4116 O O     . PRO A 1 664 ? -24.839 37.322  -20.597 1.00 101.32 ? 766  PRO A O     1 
ATOM   4117 C CB    . PRO A 1 664 ? -27.935 36.832  -21.480 1.00 96.63  ? 766  PRO A CB    1 
ATOM   4118 C CG    . PRO A 1 664 ? -28.813 36.495  -22.629 1.00 103.07 ? 766  PRO A CG    1 
ATOM   4119 C CD    . PRO A 1 664 ? -28.138 35.370  -23.378 1.00 102.08 ? 766  PRO A CD    1 
ATOM   4120 N N     . ASP A 1 665 ? -25.449 35.151  -20.455 1.00 99.12  ? 767  ASP A N     1 
ATOM   4121 C CA    . ASP A 1 665 ? -24.477 34.760  -19.432 1.00 94.08  ? 767  ASP A CA    1 
ATOM   4122 C C     . ASP A 1 665 ? -23.067 34.810  -20.022 1.00 86.39  ? 767  ASP A C     1 
ATOM   4123 O O     . ASP A 1 665 ? -22.088 34.926  -19.277 1.00 86.41  ? 767  ASP A O     1 
ATOM   4124 C CB    . ASP A 1 665 ? -24.798 33.360  -18.906 1.00 200.00 ? 767  ASP A CB    1 
ATOM   4125 C CG    . ASP A 1 665 ? -26.070 33.336  -18.078 1.00 200.00 ? 767  ASP A CG    1 
ATOM   4126 O OD1   . ASP A 1 665 ? -26.344 34.347  -17.392 1.00 200.00 ? 767  ASP A OD1   1 
ATOM   4127 O OD2   . ASP A 1 665 ? -26.785 32.310  -18.102 1.00 200.00 ? 767  ASP A OD2   1 
ATOM   4128 N N     . GLN A 1 666 ? -22.977 34.718  -21.354 1.00 74.25  ? 768  GLN A N     1 
ATOM   4129 C CA    . GLN A 1 666 ? -21.701 34.855  -22.074 1.00 73.46  ? 768  GLN A CA    1 
ATOM   4130 C C     . GLN A 1 666 ? -21.387 36.367  -22.295 1.00 66.63  ? 768  GLN A C     1 
ATOM   4131 O O     . GLN A 1 666 ? -20.230 36.722  -22.558 1.00 58.79  ? 768  GLN A O     1 
ATOM   4132 C CB    . GLN A 1 666 ? -21.742 34.161  -23.440 1.00 132.43 ? 768  GLN A CB    1 
ATOM   4133 C CG    . GLN A 1 666 ? -21.665 32.656  -23.372 1.00 142.70 ? 768  GLN A CG    1 
ATOM   4134 C CD    . GLN A 1 666 ? -21.620 32.019  -24.749 1.00 149.70 ? 768  GLN A CD    1 
ATOM   4135 O OE1   . GLN A 1 666 ? -21.945 32.662  -25.757 1.00 146.88 ? 768  GLN A OE1   1 
ATOM   4136 N NE2   . GLN A 1 666 ? -21.232 30.744  -24.801 1.00 147.38 ? 768  GLN A NE2   1 
ATOM   4137 N N     . VAL A 1 667 ? -22.416 37.234  -22.224 1.00 82.51  ? 769  VAL A N     1 
ATOM   4138 C CA    . VAL A 1 667 ? -22.250 38.683  -22.374 1.00 78.50  ? 769  VAL A CA    1 
ATOM   4139 C C     . VAL A 1 667 ? -21.966 39.362  -21.033 1.00 76.06  ? 769  VAL A C     1 
ATOM   4140 O O     . VAL A 1 667 ? -21.298 40.370  -20.997 1.00 76.75  ? 769  VAL A O     1 
ATOM   4141 C CB    . VAL A 1 667 ? -23.442 39.305  -23.050 1.00 106.98 ? 769  VAL A CB    1 
ATOM   4142 C CG1   . VAL A 1 667 ? -23.493 40.814  -22.799 1.00 105.94 ? 769  VAL A CG1   1 
ATOM   4143 C CG2   . VAL A 1 667 ? -23.313 39.044  -24.542 1.00 110.65 ? 769  VAL A CG2   1 
ATOM   4144 N N     . VAL A 1 668 ? -22.468 38.829  -19.929 1.00 59.26  ? 770  VAL A N     1 
ATOM   4145 C CA    . VAL A 1 668 ? -22.107 39.338  -18.620 1.00 56.51  ? 770  VAL A CA    1 
ATOM   4146 C C     . VAL A 1 668 ? -20.644 38.808  -18.409 1.00 51.73  ? 770  VAL A C     1 
ATOM   4147 O O     . VAL A 1 668 ? -20.068 38.914  -17.315 1.00 49.42  ? 770  VAL A O     1 
ATOM   4148 C CB    . VAL A 1 668 ? -22.969 38.744  -17.457 1.00 87.62  ? 770  VAL A CB    1 
ATOM   4149 C CG1   . VAL A 1 668 ? -23.299 39.836  -16.448 1.00 87.36  ? 770  VAL A CG1   1 
ATOM   4150 C CG2   . VAL A 1 668 ? -24.238 38.090  -17.969 1.00 93.39  ? 770  VAL A CG2   1 
ATOM   4151 N N     . ALA A 1 669 ? -20.029 38.241  -19.441 1.00 66.86  ? 771  ALA A N     1 
ATOM   4152 C CA    . ALA A 1 669 ? -18.677 37.744  -19.307 1.00 65.04  ? 771  ALA A CA    1 
ATOM   4153 C C     . ALA A 1 669 ? -17.675 38.486  -20.206 1.00 62.65  ? 771  ALA A C     1 
ATOM   4154 O O     . ALA A 1 669 ? -16.482 38.598  -19.863 1.00 68.34  ? 771  ALA A O     1 
ATOM   4155 C CB    . ALA A 1 669 ? -18.636 36.233  -19.588 1.00 86.41  ? 771  ALA A CB    1 
ATOM   4156 N N     . ILE A 1 670 ? -18.097 38.986  -21.362 1.00 49.48  ? 772  ILE A N     1 
ATOM   4157 C CA    . ILE A 1 670 ? -17.125 39.717  -22.174 1.00 47.97  ? 772  ILE A CA    1 
ATOM   4158 C C     . ILE A 1 670 ? -17.112 41.134  -21.571 1.00 46.17  ? 772  ILE A C     1 
ATOM   4159 O O     . ILE A 1 670 ? -16.709 42.091  -22.210 1.00 48.42  ? 772  ILE A O     1 
ATOM   4160 C CB    . ILE A 1 670 ? -17.555 39.852  -23.657 1.00 61.92  ? 772  ILE A CB    1 
ATOM   4161 C CG1   . ILE A 1 670 ? -18.419 38.675  -24.091 1.00 63.55  ? 772  ILE A CG1   1 
ATOM   4162 C CG2   . ILE A 1 670 ? -16.316 39.931  -24.558 1.00 62.38  ? 772  ILE A CG2   1 
ATOM   4163 C CD1   . ILE A 1 670 ? -19.787 39.131  -24.551 1.00 67.56  ? 772  ILE A CD1   1 
ATOM   4164 N N     . ALA A 1 671 ? -17.476 41.263  -20.306 1.00 42.90  ? 773  ALA A N     1 
ATOM   4165 C CA    . ALA A 1 671 ? -17.653 42.560  -19.725 1.00 41.86  ? 773  ALA A CA    1 
ATOM   4166 C C     . ALA A 1 671 ? -17.346 42.642  -18.274 1.00 43.16  ? 773  ALA A C     1 
ATOM   4167 O O     . ALA A 1 671 ? -17.828 43.578  -17.645 1.00 44.62  ? 773  ALA A O     1 
ATOM   4168 C CB    . ALA A 1 671 ? -19.072 42.931  -19.920 1.00 32.11  ? 773  ALA A CB    1 
ATOM   4169 N N     . SER A 1 672 ? -16.623 41.681  -17.695 1.00 76.94  ? 774  SER A N     1 
ATOM   4170 C CA    . SER A 1 672 ? -16.280 41.850  -16.296 1.00 79.85  ? 774  SER A CA    1 
ATOM   4171 C C     . SER A 1 672 ? -14.786 41.698  -16.123 1.00 79.48  ? 774  SER A C     1 
ATOM   4172 O O     . SER A 1 672 ? -14.348 41.099  -15.156 1.00 87.83  ? 774  SER A O     1 
ATOM   4173 C CB    . SER A 1 672 ? -16.648 40.639  -15.480 1.00 62.93  ? 774  SER A CB    1 
ATOM   4174 O OG    . SER A 1 672 ? -17.971 40.876  -15.020 1.00 63.84  ? 774  SER A OG    1 
ATOM   4175 N N     . ASN A 1 673 ? -13.999 42.246  -17.026 1.00 62.60  ? 775  ASN A N     1 
ATOM   4176 C CA    . ASN A 1 673 ? -12.538 42.312  -16.833 1.00 63.15  ? 775  ASN A CA    1 
ATOM   4177 C C     . ASN A 1 673 ? -12.493 43.887  -17.042 1.00 60.82  ? 775  ASN A C     1 
ATOM   4178 O O     . ASN A 1 673 ? -13.346 44.471  -17.685 1.00 58.47  ? 775  ASN A O     1 
ATOM   4179 C CB    . ASN A 1 673 ? -11.881 41.596  -17.966 1.00 50.24  ? 775  ASN A CB    1 
ATOM   4180 C CG    . ASN A 1 673 ? -12.712 40.474  -18.384 1.00 50.86  ? 775  ASN A CG    1 
ATOM   4181 O OD1   . ASN A 1 673 ? -12.869 39.538  -17.638 1.00 55.59  ? 775  ASN A OD1   1 
ATOM   4182 N ND2   . ASN A 1 673 ? -13.333 40.581  -19.543 1.00 53.07  ? 775  ASN A ND2   1 
ATOM   4183 N N     . GLY A 1 674 ? -11.429 44.517  -16.564 1.00 67.55  ? 776  GLY A N     1 
ATOM   4184 C CA    . GLY A 1 674 ? -11.281 45.951  -16.574 1.00 68.00  ? 776  GLY A CA    1 
ATOM   4185 C C     . GLY A 1 674 ? -11.574 46.764  -17.790 1.00 70.25  ? 776  GLY A C     1 
ATOM   4186 O O     . GLY A 1 674 ? -12.007 47.906  -17.658 1.00 72.91  ? 776  GLY A O     1 
ATOM   4187 N N     . GLY A 1 675 ? -11.335 46.230  -18.973 1.00 89.00  ? 777  GLY A N     1 
ATOM   4188 C CA    . GLY A 1 675 ? -11.639 47.026  -20.160 1.00 91.45  ? 777  GLY A CA    1 
ATOM   4189 C C     . GLY A 1 675 ? -13.002 46.672  -20.748 1.00 92.18  ? 777  GLY A C     1 
ATOM   4190 O O     . GLY A 1 675 ? -13.150 46.576  -21.980 1.00 93.51  ? 777  GLY A O     1 
ATOM   4191 N N     . GLY A 1 676 ? -13.996 46.559  -19.854 1.00 59.67  ? 778  GLY A N     1 
ATOM   4192 C CA    . GLY A 1 676 ? -15.352 46.111  -20.158 1.00 57.85  ? 778  GLY A CA    1 
ATOM   4193 C C     . GLY A 1 676 ? -16.095 46.712  -21.306 1.00 58.17  ? 778  GLY A C     1 
ATOM   4194 O O     . GLY A 1 676 ? -16.307 46.059  -22.353 1.00 58.85  ? 778  GLY A O     1 
ATOM   4195 N N     . LYS A 1 677 ? -16.498 47.967  -21.098 1.00 46.90  ? 779  LYS A N     1 
ATOM   4196 C CA    . LYS A 1 677 ? -17.228 48.703  -22.118 1.00 46.59  ? 779  LYS A CA    1 
ATOM   4197 C C     . LYS A 1 677 ? -16.602 48.492  -23.464 1.00 46.37  ? 779  LYS A C     1 
ATOM   4198 O O     . LYS A 1 677 ? -17.303 48.320  -24.462 1.00 50.05  ? 779  LYS A O     1 
ATOM   4199 C CB    . LYS A 1 677 ? -17.257 50.211  -21.821 1.00 39.69  ? 779  LYS A CB    1 
ATOM   4200 C CG    . LYS A 1 677 ? -17.026 51.122  -23.063 1.00 41.22  ? 779  LYS A CG    1 
ATOM   4201 C CD    . LYS A 1 677 ? -17.474 52.565  -22.862 1.00 44.26  ? 779  LYS A CD    1 
ATOM   4202 C CE    . LYS A 1 677 ? -18.672 52.964  -23.865 1.00 50.12  ? 779  LYS A CE    1 
ATOM   4203 N NZ    . LYS A 1 677 ? -20.060 52.505  -23.508 1.00 50.63  ? 779  LYS A NZ    1 
ATOM   4204 N N     . GLN A 1 678 ? -15.274 48.472  -23.457 1.00 43.59  ? 780  GLN A N     1 
ATOM   4205 C CA    . GLN A 1 678 ? -14.472 48.430  -24.656 1.00 44.17  ? 780  GLN A CA    1 
ATOM   4206 C C     . GLN A 1 678 ? -14.443 47.140  -25.379 1.00 45.90  ? 780  GLN A C     1 
ATOM   4207 O O     . GLN A 1 678 ? -14.304 47.131  -26.588 1.00 46.41  ? 780  GLN A O     1 
ATOM   4208 C CB    . GLN A 1 678 ? -13.066 48.895  -24.315 1.00 48.71  ? 780  GLN A CB    1 
ATOM   4209 C CG    . GLN A 1 678 ? -12.568 50.087  -25.137 1.00 49.34  ? 780  GLN A CG    1 
ATOM   4210 C CD    . GLN A 1 678 ? -13.171 51.392  -24.759 1.00 50.27  ? 780  GLN A CD    1 
ATOM   4211 O OE1   . GLN A 1 678 ? -13.374 51.690  -23.547 1.00 48.50  ? 780  GLN A OE1   1 
ATOM   4212 N NE2   . GLN A 1 678 ? -13.419 52.227  -25.788 1.00 51.83  ? 780  GLN A NE2   1 
ATOM   4213 N N     . ALA A 1 679 ? -14.614 46.052  -24.656 1.00 58.49  ? 781  ALA A N     1 
ATOM   4214 C CA    . ALA A 1 679 ? -14.569 44.753  -25.285 1.00 61.30  ? 781  ALA A CA    1 
ATOM   4215 C C     . ALA A 1 679 ? -15.972 44.517  -25.839 1.00 66.66  ? 781  ALA A C     1 
ATOM   4216 O O     . ALA A 1 679 ? -16.090 44.071  -27.037 1.00 69.99  ? 781  ALA A O     1 
ATOM   4217 C CB    . ALA A 1 679 ? -14.180 43.687  -24.284 1.00 101.53 ? 781  ALA A CB    1 
ATOM   4218 N N     . LEU A 1 680 ? -17.025 44.809  -25.024 1.00 51.02  ? 782  LEU A N     1 
ATOM   4219 C CA    . LEU A 1 680 ? -18.439 44.672  -25.499 1.00 53.93  ? 782  LEU A CA    1 
ATOM   4220 C C     . LEU A 1 680 ? -18.574 45.293  -26.908 1.00 57.95  ? 782  LEU A C     1 
ATOM   4221 O O     . LEU A 1 680 ? -18.830 44.593  -27.920 1.00 56.37  ? 782  LEU A O     1 
ATOM   4222 C CB    . LEU A 1 680 ? -19.391 45.406  -24.566 1.00 51.02  ? 782  LEU A CB    1 
ATOM   4223 C CG    . LEU A 1 680 ? -19.763 44.656  -23.259 1.00 50.37  ? 782  LEU A CG    1 
ATOM   4224 C CD1   . LEU A 1 680 ? -20.400 45.615  -22.236 1.00 46.76  ? 782  LEU A CD1   1 
ATOM   4225 C CD2   . LEU A 1 680 ? -20.711 43.487  -23.563 1.00 48.07  ? 782  LEU A CD2   1 
ATOM   4226 N N     . GLU A 1 681 ? -18.376 46.621  -26.937 1.00 79.37  ? 783  GLU A N     1 
ATOM   4227 C CA    . GLU A 1 681 ? -18.390 47.411  -28.157 1.00 79.23  ? 783  GLU A CA    1 
ATOM   4228 C C     . GLU A 1 681 ? -17.574 46.772  -29.295 1.00 81.56  ? 783  GLU A C     1 
ATOM   4229 O O     . GLU A 1 681 ? -18.000 46.768  -30.454 1.00 83.72  ? 783  GLU A O     1 
ATOM   4230 C CB    . GLU A 1 681 ? -17.858 48.808  -27.867 1.00 60.75  ? 783  GLU A CB    1 
ATOM   4231 C CG    . GLU A 1 681 ? -18.801 49.636  -27.083 1.00 64.88  ? 783  GLU A CG    1 
ATOM   4232 C CD    . GLU A 1 681 ? -18.445 51.116  -27.079 1.00 66.82  ? 783  GLU A CD    1 
ATOM   4233 O OE1   . GLU A 1 681 ? -17.339 51.456  -26.658 1.00 66.83  ? 783  GLU A OE1   1 
ATOM   4234 O OE2   . GLU A 1 681 ? -19.281 51.942  -27.476 1.00 65.46  ? 783  GLU A OE2   1 
ATOM   4235 N N     . THR A 1 682 ? -16.414 46.226  -28.981 1.00 69.46  ? 784  THR A N     1 
ATOM   4236 C CA    . THR A 1 682 ? -15.608 45.675  -30.053 1.00 73.65  ? 784  THR A CA    1 
ATOM   4237 C C     . THR A 1 682 ? -16.048 44.296  -30.529 1.00 80.86  ? 784  THR A C     1 
ATOM   4238 O O     . THR A 1 682 ? -15.549 43.796  -31.553 1.00 81.21  ? 784  THR A O     1 
ATOM   4239 C CB    . THR A 1 682 ? -14.151 45.753  -29.698 1.00 58.72  ? 784  THR A CB    1 
ATOM   4240 O OG1   . THR A 1 682 ? -13.910 47.061  -29.126 1.00 52.58  ? 784  THR A OG1   1 
ATOM   4241 C CG2   . THR A 1 682 ? -13.328 45.577  -30.940 1.00 56.61  ? 784  THR A CG2   1 
ATOM   4242 N N     . VAL A 1 683 ? -16.988 43.689  -29.794 1.00 113.02 ? 785  VAL A N     1 
ATOM   4243 C CA    . VAL A 1 683 ? -17.603 42.439  -30.249 1.00 118.06 ? 785  VAL A CA    1 
ATOM   4244 C C     . VAL A 1 683 ? -18.719 42.935  -31.214 1.00 122.46 ? 785  VAL A C     1 
ATOM   4245 O O     . VAL A 1 683 ? -18.775 42.528  -32.372 1.00 123.92 ? 785  VAL A O     1 
ATOM   4246 C CB    . VAL A 1 683 ? -18.204 41.586  -29.080 1.00 77.51  ? 785  VAL A CB    1 
ATOM   4247 C CG1   . VAL A 1 683 ? -19.425 40.813  -29.570 1.00 81.27  ? 785  VAL A CG1   1 
ATOM   4248 C CG2   . VAL A 1 683 ? -17.181 40.598  -28.607 1.00 71.06  ? 785  VAL A CG2   1 
ATOM   4249 N N     . GLN A 1 684 ? -19.586 43.831  -30.735 1.00 107.57 ? 786  GLN A N     1 
ATOM   4250 C CA    . GLN A 1 684 ? -20.644 44.419  -31.559 1.00 107.91 ? 786  GLN A CA    1 
ATOM   4251 C C     . GLN A 1 684 ? -20.046 44.742  -32.926 1.00 108.56 ? 786  GLN A C     1 
ATOM   4252 O O     . GLN A 1 684 ? -20.462 44.240  -33.944 1.00 112.13 ? 786  GLN A O     1 
ATOM   4253 C CB    . GLN A 1 684 ? -21.159 45.696  -30.895 1.00 117.48 ? 786  GLN A CB    1 
ATOM   4254 C CG    . GLN A 1 684 ? -22.004 46.585  -31.787 1.00 131.32 ? 786  GLN A CG    1 
ATOM   4255 C CD    . GLN A 1 684 ? -23.233 45.865  -32.334 1.00 140.88 ? 786  GLN A CD    1 
ATOM   4256 O OE1   . GLN A 1 684 ? -23.840 45.029  -31.653 1.00 146.89 ? 786  GLN A OE1   1 
ATOM   4257 N NE2   . GLN A 1 684 ? -23.617 46.202  -33.562 1.00 145.35 ? 786  GLN A NE2   1 
ATOM   4258 N N     . ARG A 1 685 ? -19.031 45.575  -32.937 1.00 118.69 ? 787  ARG A N     1 
ATOM   4259 C CA    . ARG A 1 685 ? -18.391 45.940  -34.178 1.00 117.64 ? 787  ARG A CA    1 
ATOM   4260 C C     . ARG A 1 685 ? -17.891 44.775  -34.960 1.00 121.78 ? 787  ARG A C     1 
ATOM   4261 O O     . ARG A 1 685 ? -18.473 44.387  -35.967 1.00 126.38 ? 787  ARG A O     1 
ATOM   4262 C CB    . ARG A 1 685 ? -17.192 46.866  -33.916 1.00 88.76  ? 787  ARG A CB    1 
ATOM   4263 C CG    . ARG A 1 685 ? -16.373 47.279  -35.152 1.00 88.49  ? 787  ARG A CG    1 
ATOM   4264 C CD    . ARG A 1 685 ? -15.469 48.501  -34.848 1.00 84.68  ? 787  ARG A CD    1 
ATOM   4265 N NE    . ARG A 1 685 ? -14.292 48.166  -34.028 1.00 83.29  ? 787  ARG A NE    1 
ATOM   4266 C CZ    . ARG A 1 685 ? -13.682 49.012  -33.199 1.00 81.78  ? 787  ARG A CZ    1 
ATOM   4267 N NH1   . ARG A 1 685 ? -14.154 50.256  -33.087 1.00 88.08  ? 787  ARG A NH1   1 
ATOM   4268 N NH2   . ARG A 1 685 ? -12.621 48.628  -32.481 1.00 75.80  ? 787  ARG A NH2   1 
ATOM   4269 N N     . LEU A 1 686 ? -16.853 44.167  -34.407 1.00 101.64 ? 788  LEU A N     1 
ATOM   4270 C CA    . LEU A 1 686 ? -16.063 43.184  -35.114 1.00 100.21 ? 788  LEU A CA    1 
ATOM   4271 C C     . LEU A 1 686 ? -16.465 41.725  -35.378 1.00 99.19  ? 788  LEU A C     1 
ATOM   4272 O O     . LEU A 1 686 ? -16.023 41.162  -36.393 1.00 104.67 ? 788  LEU A O     1 
ATOM   4273 C CB    . LEU A 1 686 ? -14.628 43.287  -34.528 1.00 78.24  ? 788  LEU A CB    1 
ATOM   4274 C CG    . LEU A 1 686 ? -13.346 43.442  -35.398 1.00 83.93  ? 788  LEU A CG    1 
ATOM   4275 C CD1   . LEU A 1 686 ? -13.547 44.429  -36.545 1.00 86.55  ? 788  LEU A CD1   1 
ATOM   4276 C CD2   . LEU A 1 686 ? -12.181 43.888  -34.545 1.00 81.15  ? 788  LEU A CD2   1 
ATOM   4277 N N     . LEU A 1 687 ? -17.330 41.158  -34.535 1.00 118.76 ? 789  LEU A N     1 
ATOM   4278 C CA    . LEU A 1 687 ? -17.732 39.729  -34.609 1.00 119.60 ? 789  LEU A CA    1 
ATOM   4279 C C     . LEU A 1 687 ? -17.658 39.153  -36.039 1.00 120.88 ? 789  LEU A C     1 
ATOM   4280 O O     . LEU A 1 687 ? -17.033 38.088  -36.241 1.00 120.60 ? 789  LEU A O     1 
ATOM   4281 C CB    . LEU A 1 687 ? -19.101 39.482  -33.914 1.00 76.38  ? 789  LEU A CB    1 
ATOM   4282 C CG    . LEU A 1 687 ? -19.256 38.112  -33.239 1.00 74.68  ? 789  LEU A CG    1 
ATOM   4283 C CD1   . LEU A 1 687 ? -20.303 38.206  -32.104 1.00 72.44  ? 789  LEU A CD1   1 
ATOM   4284 C CD2   . LEU A 1 687 ? -19.623 37.058  -34.280 1.00 80.05  ? 789  LEU A CD2   1 
ATOM   4285 N N     . PRO A 1 688 ? -18.393 39.763  -36.999 1.00 101.98 ? 790  PRO A N     1 
ATOM   4286 C CA    . PRO A 1 688 ? -18.339 39.385  -38.412 1.00 101.22 ? 790  PRO A CA    1 
ATOM   4287 C C     . PRO A 1 688 ? -16.885 39.600  -38.891 1.00 96.01  ? 790  PRO A C     1 
ATOM   4288 O O     . PRO A 1 688 ? -15.952 38.842  -38.629 1.00 93.43  ? 790  PRO A O     1 
ATOM   4289 C CB    . PRO A 1 688 ? -19.208 40.441  -39.056 1.00 109.02 ? 790  PRO A CB    1 
ATOM   4290 C CG    . PRO A 1 688 ? -20.336 40.601  -38.065 1.00 111.32 ? 790  PRO A CG    1 
ATOM   4291 C CD    . PRO A 1 688 ? -19.809 40.095  -36.701 1.00 105.24 ? 790  PRO A CD    1 
ATOM   4292 N N     . GLY A 1 695 ? -14.653 33.794  -40.422 1.00 143.12 ? 797  GLY A N     1 
ATOM   4293 C CA    . GLY A 1 695 ? -14.200 32.538  -39.854 1.00 144.32 ? 797  GLY A CA    1 
ATOM   4294 C C     . GLY A 1 695 ? -13.824 32.357  -38.396 1.00 139.69 ? 797  GLY A C     1 
ATOM   4295 O O     . GLY A 1 695 ? -12.655 32.470  -38.028 1.00 139.76 ? 797  GLY A O     1 
ATOM   4296 N N     . LEU A 1 696 ? -14.821 32.076  -37.564 1.00 104.89 ? 798  LEU A N     1 
ATOM   4297 C CA    . LEU A 1 696 ? -14.594 31.877  -36.131 1.00 97.92  ? 798  LEU A CA    1 
ATOM   4298 C C     . LEU A 1 696 ? -15.971 31.694  -35.473 1.00 93.71  ? 798  LEU A C     1 
ATOM   4299 O O     . LEU A 1 696 ? -17.009 31.862  -36.111 1.00 90.92  ? 798  LEU A O     1 
ATOM   4300 C CB    . LEU A 1 696 ? -13.646 32.992  -35.697 1.00 152.00 ? 798  LEU A CB    1 
ATOM   4301 C CG    . LEU A 1 696 ? -13.184 33.260  -34.266 1.00 152.48 ? 798  LEU A CG    1 
ATOM   4302 C CD1   . LEU A 1 696 ? -12.340 32.128  -33.755 1.00 152.76 ? 798  LEU A CD1   1 
ATOM   4303 C CD2   . LEU A 1 696 ? -12.366 34.542  -34.227 1.00 153.38 ? 798  LEU A CD2   1 
ATOM   4304 N N     . THR A 1 697 ? -15.994 31.392  -34.181 1.00 65.11  ? 799  THR A N     1 
ATOM   4305 C CA    . THR A 1 697 ? -17.261 31.070  -33.487 1.00 66.70  ? 799  THR A CA    1 
ATOM   4306 C C     . THR A 1 697 ? -17.602 32.011  -32.348 1.00 66.48  ? 799  THR A C     1 
ATOM   4307 O O     . THR A 1 697 ? -16.954 33.022  -32.154 1.00 65.06  ? 799  THR A O     1 
ATOM   4308 C CB    . THR A 1 697 ? -17.398 29.633  -32.921 1.00 70.34  ? 799  THR A CB    1 
ATOM   4309 O OG1   . THR A 1 697 ? -17.040 29.622  -31.540 1.00 64.18  ? 799  THR A OG1   1 
ATOM   4310 C CG2   . THR A 1 697 ? -16.476 28.662  -33.674 1.00 70.76  ? 799  THR A CG2   1 
ATOM   4311 N N     . GLN A 1 698 ? -18.620 31.647  -31.572 1.00 105.16 ? 800  GLN A N     1 
ATOM   4312 C CA    . GLN A 1 698 ? -19.041 32.481  -30.450 1.00 114.13 ? 800  GLN A CA    1 
ATOM   4313 C C     . GLN A 1 698 ? -18.429 32.037  -29.125 1.00 109.57 ? 800  GLN A C     1 
ATOM   4314 O O     . GLN A 1 698 ? -18.018 32.874  -28.322 1.00 107.82 ? 800  GLN A O     1 
ATOM   4315 C CB    . GLN A 1 698 ? -20.578 32.583  -30.410 1.00 188.40 ? 800  GLN A CB    1 
ATOM   4316 C CG    . GLN A 1 698 ? -21.119 33.476  -31.552 1.00 188.40 ? 800  GLN A CG    1 
ATOM   4317 C CD    . GLN A 1 698 ? -22.481 34.082  -31.259 1.00 188.40 ? 800  GLN A CD    1 
ATOM   4318 O OE1   . GLN A 1 698 ? -22.889 34.206  -30.101 1.00 188.40 ? 800  GLN A OE1   1 
ATOM   4319 N NE2   . GLN A 1 698 ? -23.183 34.485  -32.312 1.00 188.40 ? 800  GLN A NE2   1 
ATOM   4320 N N     . GLU A 1 699 ? -18.378 30.728  -28.890 1.00 131.10 ? 801  GLU A N     1 
ATOM   4321 C CA    . GLU A 1 699 ? -17.672 30.187  -27.726 1.00 129.03 ? 801  GLU A CA    1 
ATOM   4322 C C     . GLU A 1 699 ? -16.234 30.782  -27.841 1.00 123.51 ? 801  GLU A C     1 
ATOM   4323 O O     . GLU A 1 699 ? -15.687 31.333  -26.873 1.00 117.29 ? 801  GLU A O     1 
ATOM   4324 C CB    . GLU A 1 699 ? -17.585 28.656  -27.824 1.00 139.84 ? 801  GLU A CB    1 
ATOM   4325 C CG    . GLU A 1 699 ? -18.267 27.878  -26.685 1.00 151.87 ? 801  GLU A CG    1 
ATOM   4326 C CD    . GLU A 1 699 ? -19.786 27.779  -26.824 1.00 156.38 ? 801  GLU A CD    1 
ATOM   4327 O OE1   . GLU A 1 699 ? -20.347 28.198  -27.860 1.00 158.64 ? 801  GLU A OE1   1 
ATOM   4328 O OE2   . GLU A 1 699 ? -20.422 27.265  -25.888 1.00 154.76 ? 801  GLU A OE2   1 
ATOM   4329 N N     . GLN A 1 700 ? -15.673 30.677  -29.055 1.00 70.73  ? 802  GLN A N     1 
ATOM   4330 C CA    . GLN A 1 700 ? -14.346 31.146  -29.414 1.00 61.48  ? 802  GLN A CA    1 
ATOM   4331 C C     . GLN A 1 700 ? -14.154 32.641  -29.393 1.00 59.77  ? 802  GLN A C     1 
ATOM   4332 O O     . GLN A 1 700 ? -13.033 33.100  -29.136 1.00 63.91  ? 802  GLN A O     1 
ATOM   4333 C CB    . GLN A 1 700 ? -13.980 30.692  -30.800 1.00 84.10  ? 802  GLN A CB    1 
ATOM   4334 C CG    . GLN A 1 700 ? -13.470 29.290  -30.924 1.00 84.45  ? 802  GLN A CG    1 
ATOM   4335 C CD    . GLN A 1 700 ? -13.006 29.008  -32.351 1.00 84.29  ? 802  GLN A CD    1 
ATOM   4336 O OE1   . GLN A 1 700 ? -13.804 28.606  -33.198 1.00 91.10  ? 802  GLN A OE1   1 
ATOM   4337 N NE2   . GLN A 1 700 ? -11.720 29.250  -32.631 1.00 81.00  ? 802  GLN A NE2   1 
ATOM   4338 N N     . VAL A 1 701 ? -15.195 33.415  -29.709 1.00 69.60  ? 803  VAL A N     1 
ATOM   4339 C CA    . VAL A 1 701 ? -15.026 34.872  -29.686 1.00 66.47  ? 803  VAL A CA    1 
ATOM   4340 C C     . VAL A 1 701 ? -15.295 35.448  -28.289 1.00 63.54  ? 803  VAL A C     1 
ATOM   4341 O O     . VAL A 1 701 ? -14.481 36.221  -27.788 1.00 63.74  ? 803  VAL A O     1 
ATOM   4342 C CB    . VAL A 1 701 ? -15.817 35.556  -30.822 1.00 80.75  ? 803  VAL A CB    1 
ATOM   4343 C CG1   . VAL A 1 701 ? -16.088 37.022  -30.508 1.00 81.87  ? 803  VAL A CG1   1 
ATOM   4344 C CG2   . VAL A 1 701 ? -14.966 35.510  -32.065 1.00 80.57  ? 803  VAL A CG2   1 
ATOM   4345 N N     . VAL A 1 702 ? -16.409 35.099  -27.649 1.00 63.66  ? 804  VAL A N     1 
ATOM   4346 C CA    . VAL A 1 702 ? -16.582 35.489  -26.243 1.00 65.48  ? 804  VAL A CA    1 
ATOM   4347 C C     . VAL A 1 702 ? -15.188 35.254  -25.550 1.00 62.80  ? 804  VAL A C     1 
ATOM   4348 O O     . VAL A 1 702 ? -14.674 36.130  -24.833 1.00 57.97  ? 804  VAL A O     1 
ATOM   4349 C CB    . VAL A 1 702 ? -17.663 34.598  -25.541 1.00 77.02  ? 804  VAL A CB    1 
ATOM   4350 C CG1   . VAL A 1 702 ? -17.451 34.551  -24.033 1.00 75.67  ? 804  VAL A CG1   1 
ATOM   4351 C CG2   . VAL A 1 702 ? -19.042 35.136  -25.847 1.00 78.45  ? 804  VAL A CG2   1 
ATOM   4352 N N     . ALA A 1 703 ? -14.578 34.088  -25.804 1.00 78.72  ? 805  ALA A N     1 
ATOM   4353 C CA    . ALA A 1 703 ? -13.267 33.791  -25.216 1.00 78.33  ? 805  ALA A CA    1 
ATOM   4354 C C     . ALA A 1 703 ? -12.210 34.870  -25.481 1.00 74.53  ? 805  ALA A C     1 
ATOM   4355 O O     . ALA A 1 703 ? -11.771 35.505  -24.553 1.00 77.11  ? 805  ALA A O     1 
ATOM   4356 C CB    . ALA A 1 703 ? -12.739 32.405  -25.677 1.00 54.34  ? 805  ALA A CB    1 
ATOM   4357 N N     . ILE A 1 704 ? -11.798 35.078  -26.725 1.00 49.82  ? 806  ILE A N     1 
ATOM   4358 C CA    . ILE A 1 704 ? -10.755 36.072  -27.019 1.00 46.74  ? 806  ILE A CA    1 
ATOM   4359 C C     . ILE A 1 704 ? -11.001 37.457  -26.447 1.00 48.04  ? 806  ILE A C     1 
ATOM   4360 O O     . ILE A 1 704 ? -10.092 38.171  -26.129 1.00 52.16  ? 806  ILE A O     1 
ATOM   4361 C CB    . ILE A 1 704 ? -10.545 36.270  -28.521 1.00 43.26  ? 806  ILE A CB    1 
ATOM   4362 C CG1   . ILE A 1 704 ? -9.670  35.163  -29.100 1.00 42.67  ? 806  ILE A CG1   1 
ATOM   4363 C CG2   . ILE A 1 704 ? -9.927  37.645  -28.779 1.00 40.68  ? 806  ILE A CG2   1 
ATOM   4364 C CD1   . ILE A 1 704 ? -9.549  35.202  -30.608 1.00 42.60  ? 806  ILE A CD1   1 
ATOM   4365 N N     . ALA A 1 705 ? -12.233 37.841  -26.261 1.00 55.06  ? 807  ALA A N     1 
ATOM   4366 C CA    . ALA A 1 705 ? -12.483 39.168  -25.768 1.00 54.35  ? 807  ALA A CA    1 
ATOM   4367 C C     . ALA A 1 705 ? -12.679 39.225  -24.261 1.00 51.56  ? 807  ALA A C     1 
ATOM   4368 O O     . ALA A 1 705 ? -12.764 40.271  -23.663 1.00 51.92  ? 807  ALA A O     1 
ATOM   4369 C CB    . ALA A 1 705 ? -13.723 39.720  -26.502 1.00 111.08 ? 807  ALA A CB    1 
ATOM   4370 N N     . SER A 1 706 ? -12.756 38.092  -23.631 1.00 46.02  ? 808  SER A N     1 
ATOM   4371 C CA    . SER A 1 706 ? -12.998 38.060  -22.208 1.00 49.58  ? 808  SER A CA    1 
ATOM   4372 C C     . SER A 1 706 ? -11.914 38.482  -21.231 1.00 51.50  ? 808  SER A C     1 
ATOM   4373 O O     . SER A 1 706 ? -12.173 38.509  -20.055 1.00 54.98  ? 808  SER A O     1 
ATOM   4374 C CB    . SER A 1 706 ? -13.249 36.646  -21.771 1.00 52.63  ? 808  SER A CB    1 
ATOM   4375 O OG    . SER A 1 706 ? -14.373 36.197  -22.493 1.00 56.59  ? 808  SER A OG    1 
ATOM   4376 N N     . ASN A 1 707 ? -10.721 38.836  -21.697 1.00 82.22  ? 809  ASN A N     1 
ATOM   4377 C CA    . ASN A 1 707 ? -9.635  39.263  -20.793 1.00 78.13  ? 809  ASN A CA    1 
ATOM   4378 C C     . ASN A 1 707 ? -9.369  40.741  -20.956 1.00 74.91  ? 809  ASN A C     1 
ATOM   4379 O O     . ASN A 1 707 ? -10.042 41.443  -21.677 1.00 77.05  ? 809  ASN A O     1 
ATOM   4380 C CB    . ASN A 1 707 ? -8.376  38.529  -21.068 1.00 58.62  ? 809  ASN A CB    1 
ATOM   4381 C CG    . ASN A 1 707 ? -8.665  37.121  -21.327 1.00 58.76  ? 809  ASN A CG    1 
ATOM   4382 O OD1   . ASN A 1 707 ? -9.180  36.420  -20.430 1.00 58.06  ? 809  ASN A OD1   1 
ATOM   4383 N ND2   . ASN A 1 707 ? -8.416  36.682  -22.571 1.00 58.98  ? 809  ASN A ND2   1 
ATOM   4384 N N     . ASN A 1 708 ? -8.371  41.215  -20.258 1.00 43.40  ? 810  ASN A N     1 
ATOM   4385 C CA    . ASN A 1 708 ? -8.018  42.609  -20.338 1.00 43.64  ? 810  ASN A CA    1 
ATOM   4386 C C     . ASN A 1 708 ? -7.692  43.035  -21.789 1.00 45.52  ? 810  ASN A C     1 
ATOM   4387 O O     . ASN A 1 708 ? -8.096  44.177  -22.238 1.00 41.81  ? 810  ASN A O     1 
ATOM   4388 C CB    . ASN A 1 708 ? -6.879  42.882  -19.370 1.00 49.82  ? 810  ASN A CB    1 
ATOM   4389 C CG    . ASN A 1 708 ? -7.375  42.981  -17.932 1.00 53.46  ? 810  ASN A CG    1 
ATOM   4390 O OD1   . ASN A 1 708 ? -8.560  42.745  -17.679 1.00 56.71  ? 810  ASN A OD1   1 
ATOM   4391 N ND2   . ASN A 1 708 ? -6.484  43.314  -16.983 1.00 52.34  ? 810  ASN A ND2   1 
ATOM   4392 N N     . GLY A 1 709 ? -6.978  42.156  -22.525 1.00 65.65  ? 811  GLY A N     1 
ATOM   4393 C CA    . GLY A 1 709 ? -6.763  42.388  -23.971 1.00 68.97  ? 811  GLY A CA    1 
ATOM   4394 C C     . GLY A 1 709 ? -8.070  42.878  -24.652 1.00 70.44  ? 811  GLY A C     1 
ATOM   4395 O O     . GLY A 1 709 ? -8.026  43.872  -25.374 1.00 69.25  ? 811  GLY A O     1 
ATOM   4396 N N     . GLY A 1 710 ? -9.210  42.192  -24.404 1.00 66.78  ? 812  GLY A N     1 
ATOM   4397 C CA    . GLY A 1 710 ? -10.532 42.567  -24.909 1.00 66.21  ? 812  GLY A CA    1 
ATOM   4398 C C     . GLY A 1 710 ? -10.567 43.106  -26.316 1.00 66.28  ? 812  GLY A C     1 
ATOM   4399 O O     . GLY A 1 710 ? -10.696 42.360  -27.281 1.00 65.92  ? 812  GLY A O     1 
ATOM   4400 N N     . LYS A 1 711 ? -10.428 44.426  -26.385 1.00 60.90  ? 813  LYS A N     1 
ATOM   4401 C CA    . LYS A 1 711 ? -10.414 45.226  -27.578 1.00 62.76  ? 813  LYS A CA    1 
ATOM   4402 C C     . LYS A 1 711 ? -9.181  45.003  -28.446 1.00 65.24  ? 813  LYS A C     1 
ATOM   4403 O O     . LYS A 1 711 ? -9.284  44.434  -29.540 1.00 70.09  ? 813  LYS A O     1 
ATOM   4404 C CB    . LYS A 1 711 ? -10.520 46.695  -27.185 1.00 69.81  ? 813  LYS A CB    1 
ATOM   4405 C CG    . LYS A 1 711 ? -10.849 47.646  -28.340 1.00 73.28  ? 813  LYS A CG    1 
ATOM   4406 C CD    . LYS A 1 711 ? -10.854 49.085  -27.837 1.00 73.43  ? 813  LYS A CD    1 
ATOM   4407 C CE    . LYS A 1 711 ? -11.554 50.035  -28.777 1.00 76.67  ? 813  LYS A CE    1 
ATOM   4408 N NZ    . LYS A 1 711 ? -12.252 51.177  -28.026 1.00 73.65  ? 813  LYS A NZ    1 
ATOM   4409 N N     . GLN A 1 712 ? -8.010  45.425  -27.981 1.00 66.40  ? 814  GLN A N     1 
ATOM   4410 C CA    . GLN A 1 712 ? -6.796  45.271  -28.811 1.00 67.15  ? 814  GLN A CA    1 
ATOM   4411 C C     . GLN A 1 712 ? -6.557  43.817  -29.177 1.00 65.75  ? 814  GLN A C     1 
ATOM   4412 O O     . GLN A 1 712 ? -5.652  43.487  -29.952 1.00 64.85  ? 814  GLN A O     1 
ATOM   4413 C CB    . GLN A 1 712 ? -5.526  45.836  -28.111 1.00 61.88  ? 814  GLN A CB    1 
ATOM   4414 C CG    . GLN A 1 712 ? -5.757  46.785  -26.963 1.00 63.16  ? 814  GLN A CG    1 
ATOM   4415 C CD    . GLN A 1 712 ? -6.009  48.193  -27.403 1.00 67.03  ? 814  GLN A CD    1 
ATOM   4416 O OE1   . GLN A 1 712 ? -5.476  48.627  -28.420 1.00 70.20  ? 814  GLN A OE1   1 
ATOM   4417 N NE2   . GLN A 1 712 ? -6.796  48.935  -26.627 1.00 66.46  ? 814  GLN A NE2   1 
ATOM   4418 N N     . ALA A 1 713 ? -7.380  42.958  -28.600 1.00 48.00  ? 815  ALA A N     1 
ATOM   4419 C CA    . ALA A 1 713 ? -7.281  41.517  -28.800 1.00 48.68  ? 815  ALA A CA    1 
ATOM   4420 C C     . ALA A 1 713 ? -7.776  41.206  -30.211 1.00 50.41  ? 815  ALA A C     1 
ATOM   4421 O O     . ALA A 1 713 ? -6.956  40.820  -31.104 1.00 50.61  ? 815  ALA A O     1 
ATOM   4422 C CB    . ALA A 1 713 ? -8.127  40.835  -27.775 1.00 59.45  ? 815  ALA A CB    1 
ATOM   4423 N N     . LEU A 1 714 ? -9.092  41.428  -30.405 1.00 32.03  ? 816  LEU A N     1 
ATOM   4424 C CA    . LEU A 1 714 ? -9.734  41.238  -31.667 1.00 34.76  ? 816  LEU A CA    1 
ATOM   4425 C C     . LEU A 1 714 ? -9.056  42.074  -32.767 1.00 39.95  ? 816  LEU A C     1 
ATOM   4426 O O     . LEU A 1 714 ? -8.598  41.536  -33.803 1.00 40.78  ? 816  LEU A O     1 
ATOM   4427 C CB    . LEU A 1 714 ? -11.185 41.649  -31.519 1.00 32.97  ? 816  LEU A CB    1 
ATOM   4428 C CG    . LEU A 1 714 ? -11.886 40.904  -30.377 1.00 33.04  ? 816  LEU A CG    1 
ATOM   4429 C CD1   . LEU A 1 714 ? -12.756 41.727  -29.594 1.00 31.96  ? 816  LEU A CD1   1 
ATOM   4430 C CD2   . LEU A 1 714 ? -12.689 39.751  -30.956 1.00 35.12  ? 816  LEU A CD2   1 
ATOM   4431 N N     . GLU A 1 715 ? -9.008  43.391  -32.551 1.00 50.62  ? 817  GLU A N     1 
ATOM   4432 C CA    . GLU A 1 715 ? -8.434  44.332  -33.510 1.00 58.27  ? 817  GLU A CA    1 
ATOM   4433 C C     . GLU A 1 715 ? -7.135  43.788  -34.087 1.00 60.62  ? 817  GLU A C     1 
ATOM   4434 O O     . GLU A 1 715 ? -6.962  43.773  -35.299 1.00 65.63  ? 817  GLU A O     1 
ATOM   4435 C CB    . GLU A 1 715 ? -8.231  45.722  -32.850 1.00 86.83  ? 817  GLU A CB    1 
ATOM   4436 C CG    . GLU A 1 715 ? -9.020  46.897  -33.483 1.00 89.33  ? 817  GLU A CG    1 
ATOM   4437 C CD    . GLU A 1 715 ? -8.665  47.114  -34.949 1.00 92.73  ? 817  GLU A CD    1 
ATOM   4438 O OE1   . GLU A 1 715 ? -7.461  46.962  -35.305 1.00 95.08  ? 817  GLU A OE1   1 
ATOM   4439 O OE2   . GLU A 1 715 ? -9.590  47.443  -35.737 1.00 93.89  ? 817  GLU A OE2   1 
ATOM   4440 N N     . THR A 1 716 ? -6.241  43.313  -33.231 1.00 84.11  ? 818  THR A N     1 
ATOM   4441 C CA    . THR A 1 716 ? -4.990  42.725  -33.694 1.00 84.97  ? 818  THR A CA    1 
ATOM   4442 C C     . THR A 1 716 ? -5.261  41.389  -34.380 1.00 87.96  ? 818  THR A C     1 
ATOM   4443 O O     . THR A 1 716 ? -4.576  41.031  -35.346 1.00 93.57  ? 818  THR A O     1 
ATOM   4444 C CB    . THR A 1 716 ? -4.020  42.476  -32.547 1.00 79.51  ? 818  THR A CB    1 
ATOM   4445 O OG1   . THR A 1 716 ? -3.766  43.713  -31.868 1.00 84.74  ? 818  THR A OG1   1 
ATOM   4446 C CG2   . THR A 1 716 ? -2.691  41.954  -33.071 1.00 75.43  ? 818  THR A CG2   1 
ATOM   4447 N N     . VAL A 1 717 ? -6.250  40.640  -33.894 1.00 71.43  ? 819  VAL A N     1 
ATOM   4448 C CA    . VAL A 1 717 ? -6.556  39.339  -34.517 1.00 74.49  ? 819  VAL A CA    1 
ATOM   4449 C C     . VAL A 1 717 ? -6.827  39.544  -35.988 1.00 75.05  ? 819  VAL A C     1 
ATOM   4450 O O     . VAL A 1 717 ? -6.117  38.984  -36.817 1.00 71.96  ? 819  VAL A O     1 
ATOM   4451 C CB    . VAL A 1 717 ? -7.738  38.623  -33.804 1.00 153.88 ? 819  VAL A CB    1 
ATOM   4452 C CG1   . VAL A 1 717 ? -8.626  37.879  -34.796 1.00 153.72 ? 819  VAL A CG1   1 
ATOM   4453 C CG2   . VAL A 1 717 ? -7.151  37.645  -32.756 1.00 155.33 ? 819  VAL A CG2   1 
ATOM   4454 N N     . GLN A 1 718 ? -7.843  40.345  -36.312 1.00 94.03  ? 820  GLN A N     1 
ATOM   4455 C CA    . GLN A 1 718 ? -8.121  40.682  -37.705 1.00 94.73  ? 820  GLN A CA    1 
ATOM   4456 C C     . GLN A 1 718 ? -6.793  41.071  -38.379 1.00 95.37  ? 820  GLN A C     1 
ATOM   4457 O O     . GLN A 1 718 ? -6.399  40.505  -39.389 1.00 98.15  ? 820  GLN A O     1 
ATOM   4458 C CB    . GLN A 1 718 ? -9.049  41.876  -37.768 1.00 89.42  ? 820  GLN A CB    1 
ATOM   4459 C CG    . GLN A 1 718 ? -8.750  42.842  -38.928 1.00 93.52  ? 820  GLN A CG    1 
ATOM   4460 C CD    . GLN A 1 718 ? -8.667  44.312  -38.471 1.00 95.58  ? 820  GLN A CD    1 
ATOM   4461 O OE1   . GLN A 1 718 ? -9.651  44.898  -37.945 1.00 94.22  ? 820  GLN A OE1   1 
ATOM   4462 N NE2   . GLN A 1 718 ? -7.490  44.912  -38.663 1.00 93.44  ? 820  GLN A NE2   1 
ATOM   4463 N N     . ARG A 1 719 ? -6.093  42.030  -37.778 1.00 80.97  ? 821  ARG A N     1 
ATOM   4464 C CA    . ARG A 1 719 ? -4.825  42.556  -38.307 1.00 79.85  ? 821  ARG A CA    1 
ATOM   4465 C C     . ARG A 1 719 ? -3.818  41.500  -38.697 1.00 80.96  ? 821  ARG A C     1 
ATOM   4466 O O     . ARG A 1 719 ? -3.144  41.644  -39.689 1.00 84.87  ? 821  ARG A O     1 
ATOM   4467 C CB    . ARG A 1 719 ? -4.181  43.496  -37.265 1.00 75.82  ? 821  ARG A CB    1 
ATOM   4468 C CG    . ARG A 1 719 ? -3.539  44.764  -37.768 1.00 77.40  ? 821  ARG A CG    1 
ATOM   4469 C CD    . ARG A 1 719 ? -3.623  45.841  -36.697 1.00 78.91  ? 821  ARG A CD    1 
ATOM   4470 N NE    . ARG A 1 719 ? -2.710  45.571  -35.588 1.00 85.97  ? 821  ARG A NE    1 
ATOM   4471 C CZ    . ARG A 1 719 ? -3.030  45.686  -34.292 1.00 85.89  ? 821  ARG A CZ    1 
ATOM   4472 N NH1   . ARG A 1 719 ? -4.255  46.070  -33.920 1.00 87.92  ? 821  ARG A NH1   1 
ATOM   4473 N NH2   . ARG A 1 719 ? -2.134  45.406  -33.347 1.00 78.02  ? 821  ARG A NH2   1 
ATOM   4474 N N     . LEU A 1 720 ? -3.767  40.420  -37.924 1.00 105.91 ? 822  LEU A N     1 
ATOM   4475 C CA    . LEU A 1 720 ? -2.762  39.371  -38.085 1.00 103.82 ? 822  LEU A CA    1 
ATOM   4476 C C     . LEU A 1 720 ? -3.186  37.940  -38.454 1.00 106.10 ? 822  LEU A C     1 
ATOM   4477 O O     . LEU A 1 720 ? -2.394  37.198  -39.043 1.00 108.41 ? 822  LEU A O     1 
ATOM   4478 C CB    . LEU A 1 720 ? -1.926  39.321  -36.798 1.00 64.17  ? 822  LEU A CB    1 
ATOM   4479 C CG    . LEU A 1 720 ? -0.834  40.357  -36.459 1.00 59.96  ? 822  LEU A CG    1 
ATOM   4480 C CD1   . LEU A 1 720 ? 0.360   40.246  -37.414 1.00 60.11  ? 822  LEU A CD1   1 
ATOM   4481 C CD2   . LEU A 1 720 ? -1.417  41.761  -36.539 1.00 60.73  ? 822  LEU A CD2   1 
ATOM   4482 N N     . LEU A 1 721 ? -4.399  37.549  -38.074 1.00 83.13  ? 823  LEU A N     1 
ATOM   4483 C CA    . LEU A 1 721 ? -4.945  36.234  -38.393 1.00 81.88  ? 823  LEU A CA    1 
ATOM   4484 C C     . LEU A 1 721 ? -4.467  35.920  -39.823 1.00 86.60  ? 823  LEU A C     1 
ATOM   4485 O O     . LEU A 1 721 ? -3.884  34.885  -40.035 1.00 89.08  ? 823  LEU A O     1 
ATOM   4486 C CB    . LEU A 1 721 ? -6.468  36.270  -38.315 1.00 66.13  ? 823  LEU A CB    1 
ATOM   4487 C CG    . LEU A 1 721 ? -7.263  35.066  -37.812 1.00 64.33  ? 823  LEU A CG    1 
ATOM   4488 C CD1   . LEU A 1 721 ? -6.849  33.851  -38.605 1.00 68.24  ? 823  LEU A CD1   1 
ATOM   4489 C CD2   . LEU A 1 721 ? -7.066  34.801  -36.304 1.00 64.57  ? 823  LEU A CD2   1 
ATOM   4490 N N     . PRO A 1 722 ? -4.717  36.805  -40.815 1.00 87.76  ? 824  PRO A N     1 
ATOM   4491 C CA    . PRO A 1 722 ? -4.260  36.611  -42.193 1.00 88.42  ? 824  PRO A CA    1 
ATOM   4492 C C     . PRO A 1 722 ? -2.750  36.365  -42.299 1.00 87.44  ? 824  PRO A C     1 
ATOM   4493 O O     . PRO A 1 722 ? -2.294  35.334  -42.745 1.00 88.44  ? 824  PRO A O     1 
ATOM   4494 C CB    . PRO A 1 722 ? -4.574  37.944  -42.836 1.00 154.59 ? 824  PRO A CB    1 
ATOM   4495 C CG    . PRO A 1 722 ? -5.849  38.322  -42.233 1.00 155.07 ? 824  PRO A CG    1 
ATOM   4496 C CD    . PRO A 1 722 ? -5.809  37.799  -40.794 1.00 153.23 ? 824  PRO A CD    1 
ATOM   4497 N N     . VAL A 1 723 ? -1.986  37.393  -41.981 1.00 88.98  ? 825  VAL A N     1 
ATOM   4498 C CA    . VAL A 1 723 ? -0.517  37.376  -41.984 1.00 92.69  ? 825  VAL A CA    1 
ATOM   4499 C C     . VAL A 1 723 ? 0.068   36.171  -41.227 1.00 92.42  ? 825  VAL A C     1 
ATOM   4500 O O     . VAL A 1 723 ? 1.170   35.701  -41.531 1.00 91.23  ? 825  VAL A O     1 
ATOM   4501 C CB    . VAL A 1 723 ? 0.036   38.653  -41.262 1.00 196.18 ? 825  VAL A CB    1 
ATOM   4502 C CG1   . VAL A 1 723 ? 1.519   38.889  -41.579 1.00 196.33 ? 825  VAL A CG1   1 
ATOM   4503 C CG2   . VAL A 1 723 ? -0.805  39.867  -41.617 1.00 199.92 ? 825  VAL A CG2   1 
ATOM   4504 N N     . LEU A 1 724 ? -0.655  35.695  -40.219 1.00 125.94 ? 826  LEU A N     1 
ATOM   4505 C CA    . LEU A 1 724 ? -0.160  34.596  -39.377 1.00 124.36 ? 826  LEU A CA    1 
ATOM   4506 C C     . LEU A 1 724 ? -0.274  33.175  -39.946 1.00 126.97 ? 826  LEU A C     1 
ATOM   4507 O O     . LEU A 1 724 ? 0.677   32.379  -39.842 1.00 130.51 ? 826  LEU A O     1 
ATOM   4508 C CB    . LEU A 1 724 ? -0.813  34.659  -37.970 1.00 67.67  ? 826  LEU A CB    1 
ATOM   4509 C CG    . LEU A 1 724 ? -0.268  35.704  -36.955 1.00 63.53  ? 826  LEU A CG    1 
ATOM   4510 C CD1   . LEU A 1 724 ? -1.160  35.755  -35.737 1.00 61.24  ? 826  LEU A CD1   1 
ATOM   4511 C CD2   . LEU A 1 724 ? 1.168   35.384  -36.515 1.00 60.10  ? 826  LEU A CD2   1 
ATOM   4512 N N     . CYS A 1 725 ? -1.415  32.854  -40.551 1.00 92.94  ? 827  CYS A N     1 
ATOM   4513 C CA    . CYS A 1 725 ? -1.616  31.542  -41.116 1.00 91.67  ? 827  CYS A CA    1 
ATOM   4514 C C     . CYS A 1 725 ? -0.739  31.303  -42.360 1.00 97.11  ? 827  CYS A C     1 
ATOM   4515 O O     . CYS A 1 725 ? -0.872  30.280  -43.061 1.00 100.63 ? 827  CYS A O     1 
ATOM   4516 C CB    . CYS A 1 725 ? -3.095  31.360  -41.384 1.00 120.82 ? 827  CYS A CB    1 
ATOM   4517 S SG    . CYS A 1 725 ? -4.042  31.600  -39.861 1.00 123.37 ? 827  CYS A SG    1 
ATOM   4518 N N     . GLN A 1 726 ? 0.233   32.204  -42.546 1.00 72.80  ? 828  GLN A N     1 
ATOM   4519 C CA    . GLN A 1 726 ? 1.151   32.203  -43.668 1.00 74.13  ? 828  GLN A CA    1 
ATOM   4520 C C     . GLN A 1 726 ? 2.616   32.108  -43.289 1.00 77.91  ? 828  GLN A C     1 
ATOM   4521 O O     . GLN A 1 726 ? 3.497   32.317  -44.125 1.00 81.96  ? 828  GLN A O     1 
ATOM   4522 C CB    . GLN A 1 726 ? 0.867   33.454  -44.491 1.00 69.78  ? 828  GLN A CB    1 
ATOM   4523 C CG    . GLN A 1 726 ? -0.593  33.527  -44.928 1.00 71.56  ? 828  GLN A CG    1 
ATOM   4524 C CD    . GLN A 1 726 ? -0.732  34.206  -46.241 1.00 74.03  ? 828  GLN A CD    1 
ATOM   4525 O OE1   . GLN A 1 726 ? 0.009   33.881  -47.173 1.00 85.10  ? 828  GLN A OE1   1 
ATOM   4526 N NE2   . GLN A 1 726 ? -1.674  35.150  -46.349 1.00 68.40  ? 828  GLN A NE2   1 
ATOM   4527 N N     . ALA A 1 727 ? 2.881   31.876  -42.007 1.00 139.72 ? 829  ALA A N     1 
ATOM   4528 C CA    . ALA A 1 727 ? 4.246   31.614  -41.556 1.00 145.01 ? 829  ALA A CA    1 
ATOM   4529 C C     . ALA A 1 727 ? 4.173   30.079  -41.343 1.00 145.07 ? 829  ALA A C     1 
ATOM   4530 O O     . ALA A 1 727 ? 3.112   29.464  -41.573 1.00 140.95 ? 829  ALA A O     1 
ATOM   4531 C CB    . ALA A 1 727 ? 4.584   32.362  -40.260 1.00 122.36 ? 829  ALA A CB    1 
ATOM   4532 N N     . HIS A 1 728 ? 5.277   29.441  -40.950 1.00 197.06 ? 830  HIS A N     1 
ATOM   4533 C CA    . HIS A 1 728 ? 5.257   27.977  -40.773 1.00 199.86 ? 830  HIS A CA    1 
ATOM   4534 C C     . HIS A 1 728 ? 4.413   27.707  -39.561 1.00 199.86 ? 830  HIS A C     1 
ATOM   4535 O O     . HIS A 1 728 ? 4.278   26.571  -39.094 1.00 199.86 ? 830  HIS A O     1 
ATOM   4536 C CB    . HIS A 1 728 ? 6.700   27.354  -40.622 1.00 112.69 ? 830  HIS A CB    1 
ATOM   4537 C CG    . HIS A 1 728 ? 7.643   28.096  -39.696 1.00 110.46 ? 830  HIS A CG    1 
ATOM   4538 N ND1   . HIS A 1 728 ? 8.335   29.233  -40.082 1.00 113.43 ? 830  HIS A ND1   1 
ATOM   4539 C CD2   . HIS A 1 728 ? 8.057   27.834  -38.424 1.00 106.73 ? 830  HIS A CD2   1 
ATOM   4540 C CE1   . HIS A 1 728 ? 9.122   29.624  -39.094 1.00 113.15 ? 830  HIS A CE1   1 
ATOM   4541 N NE2   . HIS A 1 728 ? 8.975   28.792  -38.072 1.00 106.38 ? 830  HIS A NE2   1 
ATOM   4542 N N     . GLY A 1 729 ? 3.776   28.775  -39.093 1.00 199.96 ? 831  GLY A N     1 
ATOM   4543 C CA    . GLY A 1 729 ? 3.061   28.787  -37.836 1.00 199.96 ? 831  GLY A CA    1 
ATOM   4544 C C     . GLY A 1 729 ? 1.756   28.130  -37.433 1.00 194.81 ? 831  GLY A C     1 
ATOM   4545 O O     . GLY A 1 729 ? 1.747   27.202  -36.625 1.00 199.96 ? 831  GLY A O     1 
ATOM   4546 N N     . LEU A 1 730 ? 0.647   28.631  -37.972 1.00 116.84 ? 832  LEU A N     1 
ATOM   4547 C CA    . LEU A 1 730 ? -0.587  28.632  -37.256 1.00 105.54 ? 832  LEU A CA    1 
ATOM   4548 C C     . LEU A 1 730 ? -1.707  28.021  -38.046 1.00 98.47  ? 832  LEU A C     1 
ATOM   4549 O O     . LEU A 1 730 ? -1.485  27.484  -39.106 1.00 98.75  ? 832  LEU A O     1 
ATOM   4550 C CB    . LEU A 1 730 ? -0.908  29.903  -36.438 1.00 109.94 ? 832  LEU A CB    1 
ATOM   4551 C CG    . LEU A 1 730 ? 0.182   30.066  -35.314 1.00 111.82 ? 832  LEU A CG    1 
ATOM   4552 C CD1   . LEU A 1 730 ? 1.376   30.945  -35.794 1.00 106.75 ? 832  LEU A CD1   1 
ATOM   4553 C CD2   . LEU A 1 730 ? -0.405  30.601  -33.985 1.00 118.68 ? 832  LEU A CD2   1 
ATOM   4554 N N     . THR A 1 731 ? -2.870  28.007  -37.425 1.00 56.13  ? 833  THR A N     1 
ATOM   4555 C CA    . THR A 1 731 ? -4.056  27.406  -37.992 1.00 61.93  ? 833  THR A CA    1 
ATOM   4556 C C     . THR A 1 731 ? -5.044  28.485  -37.606 1.00 67.11  ? 833  THR A C     1 
ATOM   4557 O O     . THR A 1 731 ? -4.652  29.646  -37.655 1.00 64.51  ? 833  THR A O     1 
ATOM   4558 C CB    . THR A 1 731 ? -4.486  26.117  -37.215 1.00 68.80  ? 833  THR A CB    1 
ATOM   4559 O OG1   . THR A 1 731 ? -4.954  26.491  -35.912 1.00 69.04  ? 833  THR A OG1   1 
ATOM   4560 C CG2   . THR A 1 731 ? -3.338  25.135  -37.072 1.00 68.44  ? 833  THR A CG2   1 
ATOM   4561 N N     . PRO A 1 732 ? -6.348  28.152  -37.508 1.00 200.00 ? 834  PRO A N     1 
ATOM   4562 C CA    . PRO A 1 732 ? -7.234  29.203  -36.997 1.00 200.00 ? 834  PRO A CA    1 
ATOM   4563 C C     . PRO A 1 732 ? -7.258  29.074  -35.449 1.00 200.00 ? 834  PRO A C     1 
ATOM   4564 O O     . PRO A 1 732 ? -7.315  30.068  -34.725 1.00 200.00 ? 834  PRO A O     1 
ATOM   4565 C CB    . PRO A 1 732 ? -8.606  28.792  -37.461 1.00 150.17 ? 834  PRO A CB    1 
ATOM   4566 C CG    . PRO A 1 732 ? -8.395  28.244  -38.748 1.00 152.32 ? 834  PRO A CG    1 
ATOM   4567 C CD    . PRO A 1 732 ? -7.028  27.516  -38.685 1.00 150.80 ? 834  PRO A CD    1 
ATOM   4568 N N     . ASP A 1 733 ? -7.378  27.819  -34.998 1.00 181.87 ? 835  ASP A N     1 
ATOM   4569 C CA    . ASP A 1 733 ? -7.368  27.366  -33.591 1.00 177.19 ? 835  ASP A CA    1 
ATOM   4570 C C     . ASP A 1 733 ? -6.196  27.994  -32.803 1.00 173.08 ? 835  ASP A C     1 
ATOM   4571 O O     . ASP A 1 733 ? -6.392  28.664  -31.786 1.00 171.86 ? 835  ASP A O     1 
ATOM   4572 C CB    . ASP A 1 733 ? -7.168  25.842  -33.556 1.00 127.24 ? 835  ASP A CB    1 
ATOM   4573 C CG    . ASP A 1 733 ? -8.384  25.058  -34.006 1.00 136.00 ? 835  ASP A CG    1 
ATOM   4574 O OD1   . ASP A 1 733 ? -9.082  25.523  -34.933 1.00 137.58 ? 835  ASP A OD1   1 
ATOM   4575 O OD2   . ASP A 1 733 ? -8.634  23.967  -33.435 1.00 139.74 ? 835  ASP A OD2   1 
ATOM   4576 N N     . GLN A 1 734 ? -4.980  27.774  -33.304 1.00 125.05 ? 836  GLN A N     1 
ATOM   4577 C CA    . GLN A 1 734 ? -3.765  28.210  -32.638 1.00 116.90 ? 836  GLN A CA    1 
ATOM   4578 C C     . GLN A 1 734 ? -3.714  29.679  -32.251 1.00 116.89 ? 836  GLN A C     1 
ATOM   4579 O O     . GLN A 1 734 ? -3.625  30.001  -31.056 1.00 117.26 ? 836  GLN A O     1 
ATOM   4580 C CB    . GLN A 1 734 ? -2.541  27.810  -33.470 1.00 115.63 ? 836  GLN A CB    1 
ATOM   4581 C CG    . GLN A 1 734 ? -2.411  26.295  -33.706 1.00 116.89 ? 836  GLN A CG    1 
ATOM   4582 C CD    . GLN A 1 734 ? -0.981  25.877  -34.057 1.00 116.65 ? 836  GLN A CD    1 
ATOM   4583 O OE1   . GLN A 1 734 ? -0.686  25.467  -35.187 1.00 118.65 ? 836  GLN A OE1   1 
ATOM   4584 N NE2   . GLN A 1 734 ? -0.081  25.990  -33.086 1.00 113.83 ? 836  GLN A NE2   1 
ATOM   4585 N N     . VAL A 1 735 ? -3.780  30.571  -33.238 1.00 104.62 ? 837  VAL A N     1 
ATOM   4586 C CA    . VAL A 1 735 ? -3.742  32.010  -32.966 1.00 98.20  ? 837  VAL A CA    1 
ATOM   4587 C C     . VAL A 1 735 ? -4.796  32.355  -31.913 1.00 96.19  ? 837  VAL A C     1 
ATOM   4588 O O     . VAL A 1 735 ? -4.532  33.081  -30.972 1.00 91.70  ? 837  VAL A O     1 
ATOM   4589 C CB    . VAL A 1 735 ? -3.994  32.812  -34.258 1.00 76.41  ? 837  VAL A CB    1 
ATOM   4590 C CG1   . VAL A 1 735 ? -4.447  34.240  -33.948 1.00 72.77  ? 837  VAL A CG1   1 
ATOM   4591 C CG2   . VAL A 1 735 ? -2.722  32.827  -35.087 1.00 77.34  ? 837  VAL A CG2   1 
ATOM   4592 N N     . VAL A 1 736 ? -5.994  31.827  -32.081 1.00 68.09  ? 838  VAL A N     1 
ATOM   4593 C CA    . VAL A 1 736 ? -7.052  32.064  -31.122 1.00 64.90  ? 838  VAL A CA    1 
ATOM   4594 C C     . VAL A 1 736 ? -6.568  31.794  -29.692 1.00 62.26  ? 838  VAL A C     1 
ATOM   4595 O O     . VAL A 1 736 ? -6.820  32.619  -28.804 1.00 57.00  ? 838  VAL A O     1 
ATOM   4596 C CB    . VAL A 1 736 ? -8.266  31.147  -31.434 1.00 85.33  ? 838  VAL A CB    1 
ATOM   4597 C CG1   . VAL A 1 736 ? -9.313  31.202  -30.332 1.00 85.03  ? 838  VAL A CG1   1 
ATOM   4598 C CG2   . VAL A 1 736 ? -8.875  31.566  -32.731 1.00 88.08  ? 838  VAL A CG2   1 
ATOM   4599 N N     . ALA A 1 737 ? -5.890  30.645  -29.485 1.00 100.37 ? 839  ALA A N     1 
ATOM   4600 C CA    . ALA A 1 737 ? -5.388  30.224  -28.169 1.00 96.41  ? 839  ALA A CA    1 
ATOM   4601 C C     . ALA A 1 737 ? -4.295  31.150  -27.700 1.00 94.95  ? 839  ALA A C     1 
ATOM   4602 O O     . ALA A 1 737 ? -4.173  31.393  -26.505 1.00 92.75  ? 839  ALA A O     1 
ATOM   4603 C CB    . ALA A 1 737 ? -4.893  28.778  -28.215 1.00 88.14  ? 839  ALA A CB    1 
ATOM   4604 N N     . ILE A 1 738 ? -3.500  31.648  -28.650 1.00 101.57 ? 840  ILE A N     1 
ATOM   4605 C CA    . ILE A 1 738 ? -2.459  32.645  -28.391 1.00 97.04  ? 840  ILE A CA    1 
ATOM   4606 C C     . ILE A 1 738 ? -3.162  33.885  -27.814 1.00 97.10  ? 840  ILE A C     1 
ATOM   4607 O O     . ILE A 1 738 ? -2.671  34.486  -26.876 1.00 105.19 ? 840  ILE A O     1 
ATOM   4608 C CB    . ILE A 1 738 ? -1.766  33.104  -29.703 1.00 41.96  ? 840  ILE A CB    1 
ATOM   4609 C CG1   . ILE A 1 738 ? -0.784  32.054  -30.206 1.00 40.75  ? 840  ILE A CG1   1 
ATOM   4610 C CG2   . ILE A 1 738 ? -1.088  34.440  -29.504 1.00 38.36  ? 840  ILE A CG2   1 
ATOM   4611 C CD1   . ILE A 1 738 ? 0.356   31.777  -29.220 1.00 37.88  ? 840  ILE A CD1   1 
ATOM   4612 N N     . ALA A 1 739 ? -4.325  34.243  -28.364 1.00 52.29  ? 841  ALA A N     1 
ATOM   4613 C CA    . ALA A 1 739 ? -5.062  35.440  -27.971 1.00 48.65  ? 841  ALA A CA    1 
ATOM   4614 C C     . ALA A 1 739 ? -6.097  35.390  -26.880 1.00 47.50  ? 841  ALA A C     1 
ATOM   4615 O O     . ALA A 1 739 ? -6.597  36.421  -26.478 1.00 48.01  ? 841  ALA A O     1 
ATOM   4616 C CB    . ALA A 1 739 ? -5.675  36.057  -29.222 1.00 87.73  ? 841  ALA A CB    1 
ATOM   4617 N N     . SER A 1 740 ? -6.433  34.216  -26.389 1.00 59.78  ? 842  SER A N     1 
ATOM   4618 C CA    . SER A 1 740 ? -7.445  34.112  -25.331 1.00 58.56  ? 842  SER A CA    1 
ATOM   4619 C C     . SER A 1 740 ? -6.858  34.450  -23.941 1.00 56.72  ? 842  SER A C     1 
ATOM   4620 O O     . SER A 1 740 ? -7.437  34.053  -22.898 1.00 55.28  ? 842  SER A O     1 
ATOM   4621 C CB    . SER A 1 740 ? -8.027  32.705  -25.306 1.00 72.41  ? 842  SER A CB    1 
ATOM   4622 O OG    . SER A 1 740 ? -8.746  32.459  -26.485 1.00 76.53  ? 842  SER A OG    1 
ATOM   4623 N N     . ASN A 1 741 ? -5.767  35.232  -23.944 1.00 63.54  ? 843  ASN A N     1 
ATOM   4624 C CA    . ASN A 1 741 ? -4.998  35.591  -22.745 1.00 61.96  ? 843  ASN A CA    1 
ATOM   4625 C C     . ASN A 1 741 ? -4.668  37.070  -22.620 1.00 60.86  ? 843  ASN A C     1 
ATOM   4626 O O     . ASN A 1 741 ? -4.473  37.756  -23.612 1.00 61.69  ? 843  ASN A O     1 
ATOM   4627 C CB    . ASN A 1 741 ? -3.676  34.877  -22.787 1.00 53.02  ? 843  ASN A CB    1 
ATOM   4628 C CG    . ASN A 1 741 ? -3.807  33.374  -22.661 1.00 52.73  ? 843  ASN A CG    1 
ATOM   4629 O OD1   . ASN A 1 741 ? -4.636  32.871  -21.879 1.00 48.97  ? 843  ASN A OD1   1 
ATOM   4630 N ND2   . ASN A 1 741 ? -2.948  32.642  -23.401 1.00 54.17  ? 843  ASN A ND2   1 
ATOM   4631 N N     . GLY A 1 742 ? -4.553  37.556  -21.393 1.00 41.76  ? 844  GLY A N     1 
ATOM   4632 C CA    . GLY A 1 742 ? -4.260  38.965  -21.184 1.00 38.73  ? 844  GLY A CA    1 
ATOM   4633 C C     . GLY A 1 742 ? -3.235  39.595  -22.105 1.00 38.10  ? 844  GLY A C     1 
ATOM   4634 O O     . GLY A 1 742 ? -3.565  40.490  -22.823 1.00 37.07  ? 844  GLY A O     1 
ATOM   4635 N N     . GLY A 1 743 ? -1.996  39.152  -22.153 1.00 48.23  ? 845  GLY A N     1 
ATOM   4636 C CA    . GLY A 1 743 ? -1.066  39.901  -23.010 1.00 50.70  ? 845  GLY A CA    1 
ATOM   4637 C C     . GLY A 1 743 ? -1.263  39.657  -24.487 1.00 49.65  ? 845  GLY A C     1 
ATOM   4638 O O     . GLY A 1 743 ? -0.316  39.543  -25.235 1.00 50.01  ? 845  GLY A O     1 
ATOM   4639 N N     . GLY A 1 744 ? -2.516  39.673  -24.907 1.00 38.03  ? 846  GLY A N     1 
ATOM   4640 C CA    . GLY A 1 744 ? -2.879  39.248  -26.259 1.00 39.00  ? 846  GLY A CA    1 
ATOM   4641 C C     . GLY A 1 744 ? -2.157  39.839  -27.436 1.00 39.65  ? 846  GLY A C     1 
ATOM   4642 O O     . GLY A 1 744 ? -1.302  39.236  -28.134 1.00 41.39  ? 846  GLY A O     1 
ATOM   4643 N N     . LYS A 1 745 ? -2.561  41.061  -27.687 1.00 36.60  ? 847  LYS A N     1 
ATOM   4644 C CA    . LYS A 1 745 ? -1.956  41.846  -28.715 1.00 38.44  ? 847  LYS A CA    1 
ATOM   4645 C C     . LYS A 1 745 ? -0.453  41.781  -28.533 1.00 40.02  ? 847  LYS A C     1 
ATOM   4646 O O     . LYS A 1 745 ? 0.284   41.691  -29.471 1.00 46.35  ? 847  LYS A O     1 
ATOM   4647 C CB    . LYS A 1 745 ? -2.428  43.268  -28.582 1.00 49.55  ? 847  LYS A CB    1 
ATOM   4648 C CG    . LYS A 1 745 ? -1.600  44.237  -29.291 1.00 52.21  ? 847  LYS A CG    1 
ATOM   4649 C CD    . LYS A 1 745 ? -2.433  45.435  -29.581 1.00 53.00  ? 847  LYS A CD    1 
ATOM   4650 C CE    . LYS A 1 745 ? -1.580  46.635  -29.741 1.00 52.96  ? 847  LYS A CE    1 
ATOM   4651 N NZ    . LYS A 1 745 ? -2.533  47.695  -29.339 1.00 56.97  ? 847  LYS A NZ    1 
ATOM   4652 N N     . GLN A 1 746 ? 0.020   41.857  -27.317 1.00 44.83  ? 848  GLN A N     1 
ATOM   4653 C CA    . GLN A 1 746 ? 1.459   41.753  -27.092 1.00 45.77  ? 848  GLN A CA    1 
ATOM   4654 C C     . GLN A 1 746 ? 2.019   40.380  -27.564 1.00 47.43  ? 848  GLN A C     1 
ATOM   4655 O O     . GLN A 1 746 ? 3.082   40.324  -28.162 1.00 48.64  ? 848  GLN A O     1 
ATOM   4656 C CB    . GLN A 1 746 ? 1.763   41.934  -25.581 1.00 52.03  ? 848  GLN A CB    1 
ATOM   4657 C CG    . GLN A 1 746 ? 2.024   43.338  -25.174 1.00 50.49  ? 848  GLN A CG    1 
ATOM   4658 C CD    . GLN A 1 746 ? 1.318   44.303  -26.075 1.00 50.84  ? 848  GLN A CD    1 
ATOM   4659 O OE1   . GLN A 1 746 ? 0.287   44.867  -25.709 1.00 48.63  ? 848  GLN A OE1   1 
ATOM   4660 N NE2   . GLN A 1 746 ? 1.856   44.478  -27.288 1.00 52.16  ? 848  GLN A NE2   1 
ATOM   4661 N N     . ALA A 1 747 ? 1.301   39.291  -27.278 1.00 46.44  ? 849  ALA A N     1 
ATOM   4662 C CA    . ALA A 1 747 ? 1.762   37.959  -27.586 1.00 48.75  ? 849  ALA A CA    1 
ATOM   4663 C C     . ALA A 1 747 ? 1.832   37.853  -29.058 1.00 54.47  ? 849  ALA A C     1 
ATOM   4664 O O     . ALA A 1 747 ? 2.940   37.613  -29.585 1.00 58.36  ? 849  ALA A O     1 
ATOM   4665 C CB    . ALA A 1 747 ? 0.818   36.937  -27.055 1.00 82.84  ? 849  ALA A CB    1 
ATOM   4666 N N     . LEU A 1 748 ? 0.672   38.062  -29.733 1.00 48.24  ? 850  LEU A N     1 
ATOM   4667 C CA    . LEU A 1 748 ? 0.590   37.976  -31.231 1.00 48.93  ? 850  LEU A CA    1 
ATOM   4668 C C     . LEU A 1 748 ? 1.738   38.727  -31.928 1.00 51.65  ? 850  LEU A C     1 
ATOM   4669 O O     . LEU A 1 748 ? 2.634   38.111  -32.512 1.00 52.67  ? 850  LEU A O     1 
ATOM   4670 C CB    . LEU A 1 748 ? -0.727  38.526  -31.730 1.00 31.82  ? 850  LEU A CB    1 
ATOM   4671 C CG    . LEU A 1 748 ? -1.976  37.746  -31.347 1.00 32.56  ? 850  LEU A CG    1 
ATOM   4672 C CD1   . LEU A 1 748 ? -3.168  38.614  -31.501 1.00 30.18  ? 850  LEU A CD1   1 
ATOM   4673 C CD2   . LEU A 1 748 ? -2.078  36.501  -32.238 1.00 32.53  ? 850  LEU A CD2   1 
ATOM   4674 N N     . GLU A 1 749 ? 1.738   40.054  -31.813 1.00 61.43  ? 851  GLU A N     1 
ATOM   4675 C CA    . GLU A 1 749 ? 2.793   40.872  -32.392 1.00 65.86  ? 851  GLU A CA    1 
ATOM   4676 C C     . GLU A 1 749 ? 4.205   40.462  -31.946 1.00 66.88  ? 851  GLU A C     1 
ATOM   4677 O O     . GLU A 1 749 ? 5.189   41.005  -32.448 1.00 69.20  ? 851  GLU A O     1 
ATOM   4678 C CB    . GLU A 1 749 ? 2.558   42.333  -32.074 1.00 66.94  ? 851  GLU A CB    1 
ATOM   4679 C CG    . GLU A 1 749 ? 1.166   42.832  -32.451 1.00 71.26  ? 851  GLU A CG    1 
ATOM   4680 C CD    . GLU A 1 749 ? 0.978   44.334  -32.170 1.00 73.45  ? 851  GLU A CD    1 
ATOM   4681 O OE1   . GLU A 1 749 ? 0.148   44.944  -32.877 1.00 81.42  ? 851  GLU A OE1   1 
ATOM   4682 O OE2   . GLU A 1 749 ? 1.645   44.892  -31.259 1.00 69.80  ? 851  GLU A OE2   1 
ATOM   4683 N N     . THR A 1 750 ? 4.329   39.517  -31.017 1.00 62.79  ? 852  THR A N     1 
ATOM   4684 C CA    . THR A 1 750 ? 5.658   39.076  -30.630 1.00 63.81  ? 852  THR A CA    1 
ATOM   4685 C C     . THR A 1 750 ? 5.910   37.694  -31.230 1.00 69.11  ? 852  THR A C     1 
ATOM   4686 O O     . THR A 1 750 ? 7.085   37.255  -31.337 1.00 71.27  ? 852  THR A O     1 
ATOM   4687 C CB    . THR A 1 750 ? 5.865   39.081  -29.100 1.00 59.59  ? 852  THR A CB    1 
ATOM   4688 O OG1   . THR A 1 750 ? 5.794   40.440  -28.621 1.00 61.78  ? 852  THR A OG1   1 
ATOM   4689 C CG2   . THR A 1 750 ? 7.246   38.502  -28.735 1.00 59.03  ? 852  THR A CG2   1 
ATOM   4690 N N     . VAL A 1 751 ? 4.825   37.008  -31.622 1.00 70.41  ? 853  VAL A N     1 
ATOM   4691 C CA    . VAL A 1 751 ? 4.981   35.724  -32.313 1.00 70.10  ? 853  VAL A CA    1 
ATOM   4692 C C     . VAL A 1 751 ? 5.349   36.249  -33.715 1.00 74.98  ? 853  VAL A C     1 
ATOM   4693 O O     . VAL A 1 751 ? 6.333   35.822  -34.342 1.00 78.59  ? 853  VAL A O     1 
ATOM   4694 C CB    . VAL A 1 751 ? 3.675   34.921  -32.533 1.00 90.77  ? 853  VAL A CB    1 
ATOM   4695 C CG1   . VAL A 1 751 ? 3.981   33.430  -32.526 1.00 90.99  ? 853  VAL A CG1   1 
ATOM   4696 C CG2   . VAL A 1 751 ? 2.635   35.264  -31.508 1.00 89.34  ? 853  VAL A CG2   1 
ATOM   4697 N N     . GLN A 1 752 ? 4.555   37.203  -34.207 1.00 83.04  ? 854  GLN A N     1 
ATOM   4698 C CA    . GLN A 1 752 ? 4.795   37.741  -35.537 1.00 85.54  ? 854  GLN A CA    1 
ATOM   4699 C C     . GLN A 1 752 ? 6.207   38.288  -35.666 1.00 84.40  ? 854  GLN A C     1 
ATOM   4700 O O     . GLN A 1 752 ? 6.953   37.865  -36.511 1.00 85.80  ? 854  GLN A O     1 
ATOM   4701 C CB    . GLN A 1 752 ? 3.768   38.810  -35.885 1.00 78.79  ? 854  GLN A CB    1 
ATOM   4702 C CG    . GLN A 1 752 ? 3.654   39.001  -37.353 1.00 84.05  ? 854  GLN A CG    1 
ATOM   4703 C CD    . GLN A 1 752 ? 3.758   40.440  -37.767 1.00 84.20  ? 854  GLN A CD    1 
ATOM   4704 O OE1   . GLN A 1 752 ? 4.141   41.298  -36.964 1.00 87.35  ? 854  GLN A OE1   1 
ATOM   4705 N NE2   . GLN A 1 752 ? 3.431   40.721  -39.035 1.00 85.55  ? 854  GLN A NE2   1 
ATOM   4706 N N     . ARG A 1 753 ? 6.594   39.197  -34.797 1.00 80.62  ? 855  ARG A N     1 
ATOM   4707 C CA    . ARG A 1 753 ? 7.920   39.756  -34.906 1.00 83.19  ? 855  ARG A CA    1 
ATOM   4708 C C     . ARG A 1 753 ? 9.050   38.769  -34.607 1.00 83.30  ? 855  ARG A C     1 
ATOM   4709 O O     . ARG A 1 753 ? 10.203  39.027  -34.929 1.00 84.57  ? 855  ARG A O     1 
ATOM   4710 C CB    . ARG A 1 753 ? 8.074   40.997  -34.006 1.00 69.54  ? 855  ARG A CB    1 
ATOM   4711 C CG    . ARG A 1 753 ? 8.430   42.306  -34.782 1.00 72.95  ? 855  ARG A CG    1 
ATOM   4712 C CD    . ARG A 1 753 ? 9.353   43.316  -33.999 1.00 72.53  ? 855  ARG A CD    1 
ATOM   4713 N NE    . ARG A 1 753 ? 9.241   43.206  -32.548 1.00 67.78  ? 855  ARG A NE    1 
ATOM   4714 C CZ    . ARG A 1 753 ? 10.030  42.455  -31.785 1.00 65.30  ? 855  ARG A CZ    1 
ATOM   4715 N NH1   . ARG A 1 753 ? 11.034  41.730  -32.329 1.00 62.32  ? 855  ARG A NH1   1 
ATOM   4716 N NH2   . ARG A 1 753 ? 9.792   42.438  -30.472 1.00 62.20  ? 855  ARG A NH2   1 
ATOM   4717 N N     . LEU A 1 754 ? 8.736   37.627  -34.024 1.00 92.68  ? 856  LEU A N     1 
ATOM   4718 C CA    . LEU A 1 754 ? 9.799   36.715  -33.677 1.00 94.68  ? 856  LEU A CA    1 
ATOM   4719 C C     . LEU A 1 754 ? 9.591   35.219  -33.956 1.00 101.13 ? 856  LEU A C     1 
ATOM   4720 O O     . LEU A 1 754 ? 10.433  34.415  -33.531 1.00 105.52 ? 856  LEU A O     1 
ATOM   4721 C CB    . LEU A 1 754 ? 10.160  36.927  -32.205 1.00 62.64  ? 856  LEU A CB    1 
ATOM   4722 C CG    . LEU A 1 754 ? 10.986  38.178  -31.828 1.00 62.69  ? 856  LEU A CG    1 
ATOM   4723 C CD1   . LEU A 1 754 ? 11.436  38.145  -30.327 1.00 60.07  ? 856  LEU A CD1   1 
ATOM   4724 C CD2   . LEU A 1 754 ? 12.217  38.259  -32.677 1.00 66.84  ? 856  LEU A CD2   1 
ATOM   4725 N N     . LEU A 1 755 ? 8.533   34.822  -34.674 1.00 101.93 ? 857  LEU A N     1 
ATOM   4726 C CA    . LEU A 1 755 ? 8.311   33.385  -34.923 1.00 105.41 ? 857  LEU A CA    1 
ATOM   4727 C C     . LEU A 1 755 ? 9.535   32.826  -35.684 1.00 113.27 ? 857  LEU A C     1 
ATOM   4728 O O     . LEU A 1 755 ? 10.160  31.866  -35.206 1.00 110.60 ? 857  LEU A O     1 
ATOM   4729 C CB    . LEU A 1 755 ? 6.945   33.128  -35.627 1.00 83.31  ? 857  LEU A CB    1 
ATOM   4730 C CG    . LEU A 1 755 ? 6.412   31.713  -35.931 1.00 81.56  ? 857  LEU A CG    1 
ATOM   4731 C CD1   . LEU A 1 755 ? 7.290   30.644  -35.313 1.00 80.66  ? 857  LEU A CD1   1 
ATOM   4732 C CD2   . LEU A 1 755 ? 4.963   31.567  -35.457 1.00 76.76  ? 857  LEU A CD2   1 
ATOM   4733 N N     . PRO A 1 756 ? 9.899   33.403  -36.858 1.00 121.15 ? 858  PRO A N     1 
ATOM   4734 C CA    . PRO A 1 756 ? 11.101  32.852  -37.506 1.00 125.47 ? 858  PRO A CA    1 
ATOM   4735 C C     . PRO A 1 756 ? 12.372  33.679  -37.243 1.00 124.13 ? 858  PRO A C     1 
ATOM   4736 O O     . PRO A 1 756 ? 12.832  34.389  -38.139 1.00 119.26 ? 858  PRO A O     1 
ATOM   4737 C CB    . PRO A 1 756 ? 10.782  32.865  -39.005 1.00 130.72 ? 858  PRO A CB    1 
ATOM   4738 C CG    . PRO A 1 756 ? 9.407   33.470  -39.137 1.00 127.33 ? 858  PRO A CG    1 
ATOM   4739 C CD    . PRO A 1 756 ? 9.066   34.132  -37.838 1.00 121.38 ? 858  PRO A CD    1 
ATOM   4740 N N     . VAL A 1 757 ? 12.924  33.581  -36.037 1.00 94.55  ? 859  VAL A N     1 
ATOM   4741 C CA    . VAL A 1 757 ? 14.159  34.278  -35.662 1.00 96.62  ? 859  VAL A CA    1 
ATOM   4742 C C     . VAL A 1 757 ? 15.056  33.356  -34.824 1.00 99.35  ? 859  VAL A C     1 
ATOM   4743 O O     . VAL A 1 757 ? 16.305  33.354  -34.966 1.00 107.67 ? 859  VAL A O     1 
ATOM   4744 C CB    . VAL A 1 757 ? 13.857  35.540  -34.844 1.00 124.82 ? 859  VAL A CB    1 
ATOM   4745 C CG1   . VAL A 1 757 ? 14.906  35.746  -33.737 1.00 123.27 ? 859  VAL A CG1   1 
ATOM   4746 C CG2   . VAL A 1 757 ? 13.835  36.735  -35.765 1.00 128.20 ? 859  VAL A CG2   1 
ATOM   4747 N N     . LEU A 1 758 ? 14.423  32.575  -33.947 1.00 102.14 ? 860  LEU A N     1 
ATOM   4748 C CA    . LEU A 1 758 ? 15.160  31.664  -33.088 1.00 100.75 ? 860  LEU A CA    1 
ATOM   4749 C C     . LEU A 1 758 ? 15.084  30.222  -33.609 1.00 106.85 ? 860  LEU A C     1 
ATOM   4750 O O     . LEU A 1 758 ? 15.826  29.360  -33.144 1.00 104.50 ? 860  LEU A O     1 
ATOM   4751 C CB    . LEU A 1 758 ? 14.695  31.819  -31.619 1.00 69.54  ? 860  LEU A CB    1 
ATOM   4752 C CG    . LEU A 1 758 ? 13.427  32.593  -31.143 1.00 56.94  ? 860  LEU A CG    1 
ATOM   4753 C CD1   . LEU A 1 758 ? 12.085  32.089  -31.749 1.00 52.48  ? 860  LEU A CD1   1 
ATOM   4754 C CD2   . LEU A 1 758 ? 13.405  32.457  -29.654 1.00 50.40  ? 860  LEU A CD2   1 
ATOM   4755 N N     . CYS A 1 759 ? 14.206  29.980  -34.589 1.00 200.00 ? 861  CYS A N     1 
ATOM   4756 C CA    . CYS A 1 759 ? 14.123  28.678  -35.271 1.00 200.00 ? 861  CYS A CA    1 
ATOM   4757 C C     . CYS A 1 759 ? 15.380  28.587  -36.161 1.00 200.00 ? 861  CYS A C     1 
ATOM   4758 O O     . CYS A 1 759 ? 15.542  27.654  -36.963 1.00 200.00 ? 861  CYS A O     1 
ATOM   4759 C CB    . CYS A 1 759 ? 12.891  28.606  -36.162 1.00 99.28  ? 861  CYS A CB    1 
ATOM   4760 S SG    . CYS A 1 759 ? 11.441  28.828  -35.244 1.00 84.62  ? 861  CYS A SG    1 
ATOM   4761 N N     . GLN A 1 760 ? 16.248  29.590  -36.023 1.00 129.29 ? 862  GLN A N     1 
ATOM   4762 C CA    . GLN A 1 760 ? 17.518  29.685  -36.742 1.00 129.69 ? 862  GLN A CA    1 
ATOM   4763 C C     . GLN A 1 760 ? 18.593  29.886  -35.649 1.00 126.31 ? 862  GLN A C     1 
ATOM   4764 O O     . GLN A 1 760 ? 19.717  30.320  -35.912 1.00 128.26 ? 862  GLN A O     1 
ATOM   4765 C CB    . GLN A 1 760 ? 17.458  30.846  -37.753 1.00 173.08 ? 862  GLN A CB    1 
ATOM   4766 C CG    . GLN A 1 760 ? 16.418  30.599  -38.863 1.00 173.08 ? 862  GLN A CG    1 
ATOM   4767 C CD    . GLN A 1 760 ? 15.396  31.720  -39.006 1.00 173.08 ? 862  GLN A CD    1 
ATOM   4768 O OE1   . GLN A 1 760 ? 14.562  31.942  -38.120 1.00 173.08 ? 862  GLN A OE1   1 
ATOM   4769 N NE2   . GLN A 1 760 ? 15.458  32.434  -40.129 1.00 173.08 ? 862  GLN A NE2   1 
ATOM   4770 N N     . ALA A 1 761 ? 18.200  29.538  -34.420 1.00 108.16 ? 863  ALA A N     1 
ATOM   4771 C CA    . ALA A 1 761 ? 19.025  29.603  -33.213 1.00 105.60 ? 863  ALA A CA    1 
ATOM   4772 C C     . ALA A 1 761 ? 18.702  28.349  -32.371 1.00 104.10 ? 863  ALA A C     1 
ATOM   4773 O O     . ALA A 1 761 ? 19.460  27.969  -31.464 1.00 105.64 ? 863  ALA A O     1 
ATOM   4774 C CB    . ALA A 1 761 ? 18.729  30.866  -32.433 1.00 69.09  ? 863  ALA A CB    1 
ATOM   4775 N N     . HIS A 1 762 ? 17.552  27.736  -32.670 1.00 105.24 ? 864  HIS A N     1 
ATOM   4776 C CA    . HIS A 1 762 ? 17.104  26.454  -32.080 1.00 101.04 ? 864  HIS A CA    1 
ATOM   4777 C C     . HIS A 1 762 ? 16.161  25.819  -33.070 1.00 93.68  ? 864  HIS A C     1 
ATOM   4778 O O     . HIS A 1 762 ? 16.136  26.213  -34.223 1.00 96.47  ? 864  HIS A O     1 
ATOM   4779 C CB    . HIS A 1 762 ? 16.429  26.580  -30.686 1.00 185.87 ? 864  HIS A CB    1 
ATOM   4780 C CG    . HIS A 1 762 ? 15.073  27.228  -30.670 1.00 194.13 ? 864  HIS A CG    1 
ATOM   4781 N ND1   . HIS A 1 762 ? 14.592  28.020  -31.700 1.00 192.69 ? 864  HIS A ND1   1 
ATOM   4782 C CD2   . HIS A 1 762 ? 14.118  27.260  -29.710 1.00 190.82 ? 864  HIS A CD2   1 
ATOM   4783 C CE1   . HIS A 1 762 ? 13.413  28.498  -31.365 1.00 186.86 ? 864  HIS A CE1   1 
ATOM   4784 N NE2   . HIS A 1 762 ? 13.097  28.054  -30.157 1.00 183.10 ? 864  HIS A NE2   1 
ATOM   4785 N N     . GLY A 1 763 ? 15.363  24.855  -32.670 1.00 128.52 ? 865  GLY A N     1 
ATOM   4786 C CA    . GLY A 1 763 ? 14.502  24.266  -33.673 1.00 125.30 ? 865  GLY A CA    1 
ATOM   4787 C C     . GLY A 1 763 ? 13.006  24.371  -33.580 1.00 117.53 ? 865  GLY A C     1 
ATOM   4788 O O     . GLY A 1 763 ? 12.270  23.720  -34.343 1.00 113.08 ? 865  GLY A O     1 
ATOM   4789 N N     . LEU A 1 764 ? 12.560  25.239  -32.692 1.00 89.83  ? 866  LEU A N     1 
ATOM   4790 C CA    . LEU A 1 764 ? 11.148  25.389  -32.423 1.00 86.95  ? 866  LEU A CA    1 
ATOM   4791 C C     . LEU A 1 764 ? 10.187  25.188  -33.553 1.00 82.93  ? 866  LEU A C     1 
ATOM   4792 O O     . LEU A 1 764 ? 10.170  25.952  -34.514 1.00 83.12  ? 866  LEU A O     1 
ATOM   4793 C CB    . LEU A 1 764 ? 10.892  26.748  -31.791 1.00 153.23 ? 866  LEU A CB    1 
ATOM   4794 C CG    . LEU A 1 764 ? 10.254  26.738  -30.396 1.00 153.39 ? 866  LEU A CG    1 
ATOM   4795 C CD1   . LEU A 1 764 ? 11.160  25.977  -29.460 1.00 156.88 ? 866  LEU A CD1   1 
ATOM   4796 C CD2   . LEU A 1 764 ? 10.003  28.142  -29.876 1.00 150.82 ? 866  LEU A CD2   1 
ATOM   4797 N N     . THR A 1 765 ? 9.463   24.082  -33.485 1.00 85.41  ? 867  THR A N     1 
ATOM   4798 C CA    . THR A 1 765 ? 8.388   23.909  -34.426 1.00 90.90  ? 867  THR A CA    1 
ATOM   4799 C C     . THR A 1 765 ? 7.546   25.152  -34.080 1.00 87.64  ? 867  THR A C     1 
ATOM   4800 O O     . THR A 1 765 ? 7.709   25.734  -33.019 1.00 83.68  ? 867  THR A O     1 
ATOM   4801 C CB    . THR A 1 765 ? 7.544   22.644  -34.092 1.00 177.16 ? 867  THR A CB    1 
ATOM   4802 O OG1   . THR A 1 765 ? 7.511   22.419  -32.664 1.00 178.21 ? 867  THR A OG1   1 
ATOM   4803 C CG2   . THR A 1 765 ? 8.132   21.445  -34.784 1.00 181.77 ? 867  THR A CG2   1 
ATOM   4804 N N     . PRO A 1 766 ? 6.657   25.578  -34.968 1.00 88.75  ? 868  PRO A N     1 
ATOM   4805 C CA    . PRO A 1 766 ? 5.865   26.736  -34.584 1.00 87.19  ? 868  PRO A CA    1 
ATOM   4806 C C     . PRO A 1 766 ? 5.027   26.320  -33.383 1.00 86.26  ? 868  PRO A C     1 
ATOM   4807 O O     . PRO A 1 766 ? 4.625   27.177  -32.588 1.00 90.55  ? 868  PRO A O     1 
ATOM   4808 C CB    . PRO A 1 766 ? 5.003   26.976  -35.804 1.00 99.38  ? 868  PRO A CB    1 
ATOM   4809 C CG    . PRO A 1 766 ? 4.797   25.586  -36.330 1.00 101.62 ? 868  PRO A CG    1 
ATOM   4810 C CD    . PRO A 1 766 ? 6.173   24.981  -36.216 1.00 104.23 ? 868  PRO A CD    1 
ATOM   4811 N N     . ALA A 1 767 ? 4.762   25.013  -33.266 1.00 87.23  ? 869  ALA A N     1 
ATOM   4812 C CA    . ALA A 1 767 ? 3.968   24.456  -32.154 1.00 84.74  ? 869  ALA A CA    1 
ATOM   4813 C C     . ALA A 1 767 ? 4.549   24.922  -30.824 1.00 81.47  ? 869  ALA A C     1 
ATOM   4814 O O     . ALA A 1 767 ? 3.868   25.582  -30.021 1.00 76.68  ? 869  ALA A O     1 
ATOM   4815 C CB    . ALA A 1 767 ? 3.971   22.947  -32.217 1.00 112.30 ? 869  ALA A CB    1 
ATOM   4816 N N     . GLN A 1 768 ? 5.823   24.594  -30.617 1.00 76.84  ? 870  GLN A N     1 
ATOM   4817 C CA    . GLN A 1 768 ? 6.553   24.982  -29.404 1.00 74.39  ? 870  GLN A CA    1 
ATOM   4818 C C     . GLN A 1 768 ? 6.435   26.491  -29.123 1.00 72.96  ? 870  GLN A C     1 
ATOM   4819 O O     . GLN A 1 768 ? 6.224   26.936  -28.011 1.00 76.11  ? 870  GLN A O     1 
ATOM   4820 C CB    . GLN A 1 768 ? 8.031   24.573  -29.526 1.00 57.03  ? 870  GLN A CB    1 
ATOM   4821 C CG    . GLN A 1 768 ? 8.228   23.096  -29.742 1.00 54.82  ? 870  GLN A CG    1 
ATOM   4822 C CD    . GLN A 1 768 ? 9.569   22.663  -29.221 1.00 55.05  ? 870  GLN A CD    1 
ATOM   4823 O OE1   . GLN A 1 768 ? 10.641  23.050  -29.760 1.00 51.71  ? 870  GLN A OE1   1 
ATOM   4824 N NE2   . GLN A 1 768 ? 9.537   21.863  -28.140 1.00 57.36  ? 870  GLN A NE2   1 
ATOM   4825 N N     . VAL A 1 769 ? 6.592   27.275  -30.156 1.00 73.29  ? 871  VAL A N     1 
ATOM   4826 C CA    . VAL A 1 769 ? 6.443   28.707  -30.061 1.00 71.22  ? 871  VAL A CA    1 
ATOM   4827 C C     . VAL A 1 769 ? 5.025   29.002  -29.553 1.00 69.31  ? 871  VAL A C     1 
ATOM   4828 O O     . VAL A 1 769 ? 4.846   29.682  -28.545 1.00 65.54  ? 871  VAL A O     1 
ATOM   4829 C CB    . VAL A 1 769 ? 6.626   29.340  -31.462 1.00 63.43  ? 871  VAL A CB    1 
ATOM   4830 C CG1   . VAL A 1 769 ? 5.576   30.415  -31.734 1.00 64.87  ? 871  VAL A CG1   1 
ATOM   4831 C CG2   . VAL A 1 769 ? 8.040   29.878  -31.593 1.00 65.82  ? 871  VAL A CG2   1 
ATOM   4832 N N     . VAL A 1 770 ? 4.014   28.477  -30.234 1.00 59.96  ? 872  VAL A N     1 
ATOM   4833 C CA    . VAL A 1 770 ? 2.639   28.778  -29.834 1.00 56.80  ? 872  VAL A CA    1 
ATOM   4834 C C     . VAL A 1 770 ? 2.375   28.436  -28.374 1.00 55.23  ? 872  VAL A C     1 
ATOM   4835 O O     . VAL A 1 770 ? 1.575   29.104  -27.740 1.00 52.56  ? 872  VAL A O     1 
ATOM   4836 C CB    . VAL A 1 770 ? 1.618   28.120  -30.827 1.00 43.12  ? 872  VAL A CB    1 
ATOM   4837 C CG1   . VAL A 1 770 ? 0.187   28.347  -30.401 1.00 41.91  ? 872  VAL A CG1   1 
ATOM   4838 C CG2   . VAL A 1 770 ? 1.816   28.748  -32.186 1.00 45.21  ? 872  VAL A CG2   1 
ATOM   4839 N N     . ALA A 1 771 ? 3.074   27.411  -27.864 1.00 76.98  ? 873  ALA A N     1 
ATOM   4840 C CA    . ALA A 1 771 ? 2.994   26.978  -26.463 1.00 73.28  ? 873  ALA A CA    1 
ATOM   4841 C C     . ALA A 1 771 ? 3.588   28.039  -25.555 1.00 70.38  ? 873  ALA A C     1 
ATOM   4842 O O     . ALA A 1 771 ? 3.151   28.270  -24.468 1.00 70.02  ? 873  ALA A O     1 
ATOM   4843 C CB    . ALA A 1 771 ? 3.765   25.686  -26.257 1.00 51.40  ? 873  ALA A CB    1 
ATOM   4844 N N     . ILE A 1 772 ? 4.622   28.693  -25.998 1.00 45.58  ? 874  ILE A N     1 
ATOM   4845 C CA    . ILE A 1 772 ? 5.264   29.696  -25.143 1.00 43.07  ? 874  ILE A CA    1 
ATOM   4846 C C     . ILE A 1 772 ? 4.422   30.930  -25.062 1.00 42.26  ? 874  ILE A C     1 
ATOM   4847 O O     . ILE A 1 772 ? 4.418   31.624  -24.056 1.00 41.26  ? 874  ILE A O     1 
ATOM   4848 C CB    . ILE A 1 772 ? 6.668   30.129  -25.703 1.00 45.13  ? 874  ILE A CB    1 
ATOM   4849 C CG1   . ILE A 1 772 ? 7.530   28.891  -26.019 1.00 47.27  ? 874  ILE A CG1   1 
ATOM   4850 C CG2   . ILE A 1 772 ? 7.341   30.971  -24.714 1.00 42.98  ? 874  ILE A CG2   1 
ATOM   4851 C CD1   . ILE A 1 772 ? 9.019   29.087  -25.978 1.00 48.79  ? 874  ILE A CD1   1 
ATOM   4852 N N     . ALA A 1 773 ? 3.702   31.190  -26.149 1.00 42.62  ? 875  ALA A N     1 
ATOM   4853 C CA    . ALA A 1 773 ? 2.901   32.368  -26.257 1.00 42.34  ? 875  ALA A CA    1 
ATOM   4854 C C     . ALA A 1 773 ? 1.399   32.199  -26.032 1.00 43.19  ? 875  ALA A C     1 
ATOM   4855 O O     . ALA A 1 773 ? 0.704   33.178  -25.854 1.00 43.18  ? 875  ALA A O     1 
ATOM   4856 C CB    . ALA A 1 773 ? 3.185   32.999  -27.576 1.00 33.81  ? 875  ALA A CB    1 
ATOM   4857 N N     . SER A 1 774 ? 0.876   30.980  -26.014 1.00 45.28  ? 876  SER A N     1 
ATOM   4858 C CA    . SER A 1 774 ? -0.562  30.751  -25.753 1.00 45.68  ? 876  SER A CA    1 
ATOM   4859 C C     . SER A 1 774 ? -0.847  30.936  -24.257 1.00 46.02  ? 876  SER A C     1 
ATOM   4860 O O     . SER A 1 774 ? -1.957  30.634  -23.753 1.00 47.48  ? 876  SER A O     1 
ATOM   4861 C CB    . SER A 1 774 ? -0.969  29.343  -26.160 1.00 50.27  ? 876  SER A CB    1 
ATOM   4862 O OG    . SER A 1 774 ? -0.872  28.451  -25.040 1.00 53.49  ? 876  SER A OG    1 
ATOM   4863 N N     . ASN A 1 775 ? 0.188   31.462  -23.587 1.00 73.94  ? 877  ASN A N     1 
ATOM   4864 C CA    . ASN A 1 775 ? 0.288   31.804  -22.148 1.00 70.92  ? 877  ASN A CA    1 
ATOM   4865 C C     . ASN A 1 775 ? 0.341   33.314  -21.783 1.00 69.36  ? 877  ASN A C     1 
ATOM   4866 O O     . ASN A 1 775 ? 0.848   34.149  -22.524 1.00 68.70  ? 877  ASN A O     1 
ATOM   4867 C CB    . ASN A 1 775 ? 1.550   31.175  -21.563 1.00 75.89  ? 877  ASN A CB    1 
ATOM   4868 C CG    . ASN A 1 775 ? 1.299   29.830  -21.042 1.00 76.45  ? 877  ASN A CG    1 
ATOM   4869 O OD1   . ASN A 1 775 ? 0.337   29.633  -20.296 1.00 76.45  ? 877  ASN A OD1   1 
ATOM   4870 N ND2   . ASN A 1 775 ? 2.137   28.868  -21.416 1.00 76.14  ? 877  ASN A ND2   1 
ATOM   4871 N N     . ILE A 1 776 ? -0.179  33.649  -20.615 1.00 48.08  ? 878  ILE A N     1 
ATOM   4872 C CA    . ILE A 1 776 ? -0.111  35.034  -20.149 1.00 45.77  ? 878  ILE A CA    1 
ATOM   4873 C C     . ILE A 1 776 ? 1.347   35.571  -20.091 1.00 47.69  ? 878  ILE A C     1 
ATOM   4874 O O     . ILE A 1 776 ? 2.247   35.024  -19.422 1.00 48.97  ? 878  ILE A O     1 
ATOM   4875 C CB    . ILE A 1 776 ? -0.581  35.179  -18.731 1.00 42.90  ? 878  ILE A CB    1 
ATOM   4876 C CG1   . ILE A 1 776 ? -2.055  35.344  -18.655 1.00 42.31  ? 878  ILE A CG1   1 
ATOM   4877 C CG2   . ILE A 1 776 ? 0.051   36.339  -18.139 1.00 42.35  ? 878  ILE A CG2   1 
ATOM   4878 C CD1   . ILE A 1 776 ? -2.540  35.986  -17.360 1.00 41.81  ? 878  ILE A CD1   1 
ATOM   4879 N N     . GLY A 1 777 ? 1.581   36.698  -20.721 1.00 49.06  ? 879  GLY A N     1 
ATOM   4880 C CA    . GLY A 1 777 ? 2.917   37.202  -20.653 1.00 49.49  ? 879  GLY A CA    1 
ATOM   4881 C C     . GLY A 1 777 ? 3.790   36.657  -21.755 1.00 50.65  ? 879  GLY A C     1 
ATOM   4882 O O     . GLY A 1 777 ? 5.000   36.557  -21.553 1.00 50.65  ? 879  GLY A O     1 
ATOM   4883 N N     . GLY A 1 778 ? 3.159   36.338  -22.897 1.00 43.27  ? 880  GLY A N     1 
ATOM   4884 C CA    . GLY A 1 778 ? 3.823   35.835  -24.095 1.00 44.02  ? 880  GLY A CA    1 
ATOM   4885 C C     . GLY A 1 778 ? 4.946   36.774  -24.407 1.00 46.17  ? 880  GLY A C     1 
ATOM   4886 O O     . GLY A 1 778 ? 6.123   36.433  -24.185 1.00 48.47  ? 880  GLY A O     1 
ATOM   4887 N N     . LYS A 1 779 ? 4.593   37.982  -24.854 1.00 41.45  ? 881  LYS A N     1 
ATOM   4888 C CA    . LYS A 1 779 ? 5.575   38.993  -25.220 1.00 40.80  ? 881  LYS A CA    1 
ATOM   4889 C C     . LYS A 1 779 ? 6.866   38.846  -24.435 1.00 40.15  ? 881  LYS A C     1 
ATOM   4890 O O     . LYS A 1 779 ? 7.900   38.812  -25.032 1.00 41.04  ? 881  LYS A O     1 
ATOM   4891 C CB    . LYS A 1 779 ? 4.974   40.375  -25.040 1.00 57.26  ? 881  LYS A CB    1 
ATOM   4892 C CG    . LYS A 1 779 ? 5.931   41.456  -25.440 1.00 61.75  ? 881  LYS A CG    1 
ATOM   4893 C CD    . LYS A 1 779 ? 5.250   42.786  -25.557 1.00 65.85  ? 881  LYS A CD    1 
ATOM   4894 C CE    . LYS A 1 779 ? 6.283   43.878  -25.518 1.00 70.98  ? 881  LYS A CE    1 
ATOM   4895 N NZ    . LYS A 1 779 ? 7.290   43.515  -24.465 1.00 76.40  ? 881  LYS A NZ    1 
ATOM   4896 N N     . GLN A 1 780 ? 6.794   38.710  -23.109 1.00 46.27  ? 882  GLN A N     1 
ATOM   4897 C CA    . GLN A 1 780 ? 7.964   38.550  -22.239 1.00 46.59  ? 882  GLN A CA    1 
ATOM   4898 C C     . GLN A 1 780 ? 8.591   37.111  -22.326 1.00 47.95  ? 882  GLN A C     1 
ATOM   4899 O O     . GLN A 1 780 ? 9.802   36.959  -22.211 1.00 49.92  ? 882  GLN A O     1 
ATOM   4900 C CB    . GLN A 1 780 ? 7.530   38.828  -20.808 1.00 45.43  ? 882  GLN A CB    1 
ATOM   4901 C CG    . GLN A 1 780 ? 6.529   39.937  -20.714 1.00 43.44  ? 882  GLN A CG    1 
ATOM   4902 C CD    . GLN A 1 780 ? 7.119   41.288  -21.064 1.00 43.49  ? 882  GLN A CD    1 
ATOM   4903 O OE1   . GLN A 1 780 ? 6.435   42.153  -21.612 1.00 42.27  ? 882  GLN A OE1   1 
ATOM   4904 N NE2   . GLN A 1 780 ? 8.376   41.481  -20.730 1.00 42.98  ? 882  GLN A NE2   1 
ATOM   4905 N N     . ALA A 1 781 ? 7.765   36.067  -22.457 1.00 43.49  ? 883  ALA A N     1 
ATOM   4906 C CA    . ALA A 1 781 ? 8.221   34.709  -22.610 1.00 45.79  ? 883  ALA A CA    1 
ATOM   4907 C C     . ALA A 1 781 ? 8.816   34.497  -24.019 1.00 49.16  ? 883  ALA A C     1 
ATOM   4908 O O     . ALA A 1 781 ? 9.817   33.779  -24.150 1.00 53.16  ? 883  ALA A O     1 
ATOM   4909 C CB    . ALA A 1 781 ? 7.108   33.764  -22.395 1.00 54.28  ? 883  ALA A CB    1 
ATOM   4910 N N     . LEU A 1 782 ? 8.270   35.068  -25.091 1.00 39.79  ? 884  LEU A N     1 
ATOM   4911 C CA    . LEU A 1 782 ? 8.949   34.877  -26.388 1.00 46.00  ? 884  LEU A CA    1 
ATOM   4912 C C     . LEU A 1 782 ? 10.260  35.674  -26.304 1.00 52.38  ? 884  LEU A C     1 
ATOM   4913 O O     . LEU A 1 782 ? 11.349  35.094  -26.391 1.00 59.51  ? 884  LEU A O     1 
ATOM   4914 C CB    . LEU A 1 782 ? 8.116   35.366  -27.581 1.00 71.56  ? 884  LEU A CB    1 
ATOM   4915 C CG    . LEU A 1 782 ? 6.706   34.763  -27.705 1.00 72.27  ? 884  LEU A CG    1 
ATOM   4916 C CD1   . LEU A 1 782 ? 5.979   35.206  -28.979 1.00 71.59  ? 884  LEU A CD1   1 
ATOM   4917 C CD2   . LEU A 1 782 ? 6.820   33.239  -27.695 1.00 74.56  ? 884  LEU A CD2   1 
ATOM   4918 N N     . GLU A 1 783 ? 10.178  36.987  -26.107 1.00 65.51  ? 885  GLU A N     1 
ATOM   4919 C CA    . GLU A 1 783 ? 11.387  37.807  -26.010 1.00 68.62  ? 885  GLU A CA    1 
ATOM   4920 C C     . GLU A 1 783 ? 12.467  37.161  -25.168 1.00 67.38  ? 885  GLU A C     1 
ATOM   4921 O O     . GLU A 1 783 ? 13.535  36.871  -25.675 1.00 73.56  ? 885  GLU A O     1 
ATOM   4922 C CB    . GLU A 1 783 ? 11.101  39.200  -25.437 1.00 99.80  ? 885  GLU A CB    1 
ATOM   4923 C CG    . GLU A 1 783 ? 10.743  40.261  -26.461 1.00 104.01 ? 885  GLU A CG    1 
ATOM   4924 C CD    . GLU A 1 783 ? 10.995  41.674  -25.938 1.00 107.01 ? 885  GLU A CD    1 
ATOM   4925 O OE1   . GLU A 1 783 ? 11.050  41.839  -24.693 1.00 107.65 ? 885  GLU A OE1   1 
ATOM   4926 O OE2   . GLU A 1 783 ? 11.132  42.612  -26.770 1.00 108.99 ? 885  GLU A OE2   1 
ATOM   4927 N N     . THR A 1 784 ? 12.205  36.908  -23.893 1.00 57.49  ? 886  THR A N     1 
ATOM   4928 C CA    . THR A 1 784 ? 13.261  36.315  -23.046 1.00 58.49  ? 886  THR A CA    1 
ATOM   4929 C C     . THR A 1 784 ? 13.784  35.001  -23.673 1.00 61.40  ? 886  THR A C     1 
ATOM   4930 O O     . THR A 1 784 ? 15.000  34.754  -23.760 1.00 62.40  ? 886  THR A O     1 
ATOM   4931 C CB    . THR A 1 784 ? 12.805  36.068  -21.562 1.00 54.37  ? 886  THR A CB    1 
ATOM   4932 O OG1   . THR A 1 784 ? 12.516  37.334  -20.911 1.00 56.89  ? 886  THR A OG1   1 
ATOM   4933 C CG2   . THR A 1 784 ? 13.919  35.344  -20.793 1.00 53.31  ? 886  THR A CG2   1 
ATOM   4934 N N     . VAL A 1 785 ? 12.875  34.170  -24.156 1.00 67.64  ? 887  VAL A N     1 
ATOM   4935 C CA    . VAL A 1 785 ? 13.336  32.963  -24.780 1.00 69.48  ? 887  VAL A CA    1 
ATOM   4936 C C     . VAL A 1 785 ? 14.378  33.319  -25.837 1.00 73.11  ? 887  VAL A C     1 
ATOM   4937 O O     . VAL A 1 785 ? 15.427  32.676  -25.918 1.00 74.87  ? 887  VAL A O     1 
ATOM   4938 C CB    . VAL A 1 785 ? 12.157  32.170  -25.332 1.00 59.63  ? 887  VAL A CB    1 
ATOM   4939 C CG1   . VAL A 1 785 ? 12.401  31.681  -26.736 1.00 65.04  ? 887  VAL A CG1   1 
ATOM   4940 C CG2   . VAL A 1 785 ? 11.934  30.993  -24.437 1.00 57.81  ? 887  VAL A CG2   1 
ATOM   4941 N N     . GLN A 1 786 ? 14.137  34.377  -26.606 1.00 73.32  ? 888  GLN A N     1 
ATOM   4942 C CA    . GLN A 1 786 ? 15.101  34.755  -27.643 1.00 74.86  ? 888  GLN A CA    1 
ATOM   4943 C C     . GLN A 1 786 ? 16.429  35.284  -27.115 1.00 76.33  ? 888  GLN A C     1 
ATOM   4944 O O     . GLN A 1 786 ? 17.477  34.853  -27.516 1.00 81.17  ? 888  GLN A O     1 
ATOM   4945 C CB    . GLN A 1 786 ? 14.477  35.743  -28.617 1.00 74.50  ? 888  GLN A CB    1 
ATOM   4946 C CG    . GLN A 1 786 ? 15.422  36.261  -29.699 1.00 80.86  ? 888  GLN A CG    1 
ATOM   4947 C CD    . GLN A 1 786 ? 16.026  37.609  -29.328 1.00 85.11  ? 888  GLN A CD    1 
ATOM   4948 O OE1   . GLN A 1 786 ? 17.171  37.872  -29.635 1.00 94.72  ? 888  GLN A OE1   1 
ATOM   4949 N NE2   . GLN A 1 786 ? 15.243  38.475  -28.680 1.00 81.78  ? 888  GLN A NE2   1 
ATOM   4950 N N     . ARG A 1 787 ? 16.391  36.179  -26.163 1.00 79.26  ? 889  ARG A N     1 
ATOM   4951 C CA    . ARG A 1 787 ? 17.614  36.773  -25.656 1.00 84.07  ? 889  ARG A CA    1 
ATOM   4952 C C     . ARG A 1 787 ? 18.429  35.928  -24.688 1.00 83.93  ? 889  ARG A C     1 
ATOM   4953 O O     . ARG A 1 787 ? 19.597  36.203  -24.423 1.00 88.39  ? 889  ARG A O     1 
ATOM   4954 C CB    . ARG A 1 787 ? 17.272  38.126  -25.002 1.00 74.81  ? 889  ARG A CB    1 
ATOM   4955 N N     . LEU A 1 788 ? 17.829  34.879  -24.178 1.00 75.25  ? 890  LEU A N     1 
ATOM   4956 C CA    . LEU A 1 788 ? 18.513  34.082  -23.165 1.00 79.76  ? 890  LEU A CA    1 
ATOM   4957 C C     . LEU A 1 788 ? 18.714  32.601  -23.558 1.00 83.99  ? 890  LEU A C     1 
ATOM   4958 O O     . LEU A 1 788 ? 19.262  31.817  -22.761 1.00 83.93  ? 890  LEU A O     1 
ATOM   4959 C CB    . LEU A 1 788 ? 17.699  34.167  -21.861 1.00 111.15 ? 890  LEU A CB    1 
ATOM   4960 C CG    . LEU A 1 788 ? 18.195  34.063  -20.398 1.00 115.74 ? 890  LEU A CG    1 
ATOM   4961 C CD1   . LEU A 1 788 ? 18.812  32.693  -20.110 1.00 115.63 ? 890  LEU A CD1   1 
ATOM   4962 C CD2   . LEU A 1 788 ? 19.196  35.181  -20.078 1.00 119.53 ? 890  LEU A CD2   1 
ATOM   4963 N N     . LEU A 1 789 ? 18.279  32.218  -24.769 1.00 128.82 ? 891  LEU A N     1 
ATOM   4964 C CA    . LEU A 1 789 ? 18.398  30.825  -25.218 1.00 128.94 ? 891  LEU A CA    1 
ATOM   4965 C C     . LEU A 1 789 ? 19.889  30.439  -25.367 1.00 134.95 ? 891  LEU A C     1 
ATOM   4966 O O     . LEU A 1 789 ? 20.326  29.420  -24.814 1.00 133.03 ? 891  LEU A O     1 
ATOM   4967 C CB    . LEU A 1 789 ? 17.596  30.607  -26.521 1.00 73.00  ? 891  LEU A CB    1 
ATOM   4968 C CG    . LEU A 1 789 ? 16.701  29.333  -26.546 1.00 71.96  ? 891  LEU A CG    1 
ATOM   4969 C CD1   . LEU A 1 789 ? 16.652  28.851  -28.004 1.00 72.50  ? 891  LEU A CD1   1 
ATOM   4970 C CD2   . LEU A 1 789 ? 17.211  28.198  -25.683 1.00 70.10  ? 891  LEU A CD2   1 
ATOM   4971 N N     . PRO A 1 790 ? 20.673  31.240  -26.135 1.00 138.25 ? 892  PRO A N     1 
ATOM   4972 C CA    . PRO A 1 790 ? 22.103  31.026  -26.330 1.00 136.34 ? 892  PRO A CA    1 
ATOM   4973 C C     . PRO A 1 790 ? 22.854  30.594  -25.067 1.00 138.87 ? 892  PRO A C     1 
ATOM   4974 O O     . PRO A 1 790 ? 23.412  29.500  -25.012 1.00 149.43 ? 892  PRO A O     1 
ATOM   4975 C CB    . PRO A 1 790 ? 22.576  32.402  -26.741 1.00 100.53 ? 892  PRO A CB    1 
ATOM   4976 C CG    . PRO A 1 790 ? 21.448  32.958  -27.551 1.00 100.69 ? 892  PRO A CG    1 
ATOM   4977 C CD    . PRO A 1 790 ? 20.193  32.161  -27.187 1.00 103.76 ? 892  PRO A CD    1 
ATOM   4978 N N     . VAL A 1 791 ? 22.898  31.479  -24.073 1.00 84.77  ? 893  VAL A N     1 
ATOM   4979 C CA    . VAL A 1 791 ? 23.621  31.227  -22.812 1.00 86.56  ? 893  VAL A CA    1 
ATOM   4980 C C     . VAL A 1 791 ? 23.421  29.851  -22.143 1.00 92.02  ? 893  VAL A C     1 
ATOM   4981 O O     . VAL A 1 791 ? 24.399  29.143  -21.869 1.00 98.17  ? 893  VAL A O     1 
ATOM   4982 C CB    . VAL A 1 791 ? 23.349  32.356  -21.768 1.00 89.00  ? 893  VAL A CB    1 
ATOM   4983 C CG1   . VAL A 1 791 ? 23.699  31.885  -20.357 1.00 88.78  ? 893  VAL A CG1   1 
ATOM   4984 C CG2   . VAL A 1 791 ? 24.164  33.592  -22.120 1.00 90.75  ? 893  VAL A CG2   1 
ATOM   4985 N N     . LEU A 1 792 ? 22.172  29.453  -21.914 1.00 98.09  ? 894  LEU A N     1 
ATOM   4986 C CA    . LEU A 1 792 ? 21.885  28.178  -21.256 1.00 99.70  ? 894  LEU A CA    1 
ATOM   4987 C C     . LEU A 1 792 ? 22.395  26.955  -22.005 1.00 107.78 ? 894  LEU A C     1 
ATOM   4988 O O     . LEU A 1 792 ? 23.261  26.232  -21.503 1.00 115.85 ? 894  LEU A O     1 
ATOM   4989 C CB    . LEU A 1 792 ? 20.389  28.020  -21.048 1.00 104.89 ? 894  LEU A CB    1 
ATOM   4990 C CG    . LEU A 1 792 ? 19.615  29.221  -20.518 1.00 99.82  ? 894  LEU A CG    1 
ATOM   4991 C CD1   . LEU A 1 792 ? 18.267  29.244  -21.227 1.00 97.57  ? 894  LEU A CD1   1 
ATOM   4992 C CD2   . LEU A 1 792 ? 19.455  29.149  -18.992 1.00 94.51  ? 894  LEU A CD2   1 
ATOM   4993 N N     . CYS A 1 793 ? 21.837  26.726  -23.195 1.00 134.25 ? 895  CYS A N     1 
ATOM   4994 C CA    . CYS A 1 793 ? 22.211  25.601  -24.060 1.00 132.23 ? 895  CYS A CA    1 
ATOM   4995 C C     . CYS A 1 793 ? 23.724  25.439  -24.264 1.00 137.22 ? 895  CYS A C     1 
ATOM   4996 O O     . CYS A 1 793 ? 24.242  24.316  -24.279 1.00 135.35 ? 895  CYS A O     1 
ATOM   4997 C CB    . CYS A 1 793 ? 21.576  25.779  -25.432 1.00 107.67 ? 895  CYS A CB    1 
ATOM   4998 S SG    . CYS A 1 793 ? 19.810  25.910  -25.378 1.00 101.06 ? 895  CYS A SG    1 
ATOM   4999 N N     . GLN A 1 794 ? 24.411  26.571  -24.439 1.00 123.47 ? 896  GLN A N     1 
ATOM   5000 C CA    . GLN A 1 794 ? 25.848  26.609  -24.691 1.00 125.58 ? 896  GLN A CA    1 
ATOM   5001 C C     . GLN A 1 794 ? 26.701  26.461  -23.450 1.00 126.26 ? 896  GLN A C     1 
ATOM   5002 O O     . GLN A 1 794 ? 27.607  25.644  -23.426 1.00 125.77 ? 896  GLN A O     1 
ATOM   5003 C CB    . GLN A 1 794 ? 26.221  27.897  -25.429 1.00 143.09 ? 896  GLN A CB    1 
ATOM   5004 C CG    . GLN A 1 794 ? 25.646  27.996  -26.843 1.00 147.99 ? 896  GLN A CG    1 
ATOM   5005 C CD    . GLN A 1 794 ? 26.358  29.040  -27.701 1.00 151.69 ? 896  GLN A CD    1 
ATOM   5006 O OE1   . GLN A 1 794 ? 27.496  28.844  -28.121 1.00 159.53 ? 896  GLN A OE1   1 
ATOM   5007 N NE2   . GLN A 1 794 ? 25.690  30.156  -27.953 1.00 150.70 ? 896  GLN A NE2   1 
ATOM   5008 N N     . ASP A 1 795 ? 26.423  27.252  -22.420 1.00 160.03 ? 897  ASP A N     1 
ATOM   5009 C CA    . ASP A 1 795 ? 27.179  27.162  -21.172 1.00 162.92 ? 897  ASP A CA    1 
ATOM   5010 C C     . ASP A 1 795 ? 26.661  26.047  -20.248 1.00 163.11 ? 897  ASP A C     1 
ATOM   5011 O O     . ASP A 1 795 ? 27.423  25.129  -19.903 1.00 171.61 ? 897  ASP A O     1 
ATOM   5012 C CB    . ASP A 1 795 ? 27.139  28.505  -20.425 1.00 137.74 ? 897  ASP A CB    1 
ATOM   5013 C CG    . ASP A 1 795 ? 27.917  28.480  -19.097 1.00 139.78 ? 897  ASP A CG    1 
ATOM   5014 O OD1   . ASP A 1 795 ? 27.634  27.613  -18.238 1.00 139.44 ? 897  ASP A OD1   1 
ATOM   5015 O OD2   . ASP A 1 795 ? 28.806  29.341  -18.914 1.00 144.67 ? 897  ASP A OD2   1 
ATOM   5016 N N     . HIS A 1 796 ? 25.374  26.125  -19.869 1.00 138.81 ? 898  HIS A N     1 
ATOM   5017 C CA    . HIS A 1 796 ? 24.775  25.156  -18.944 1.00 127.64 ? 898  HIS A CA    1 
ATOM   5018 C C     . HIS A 1 796 ? 24.272  23.873  -19.585 1.00 124.02 ? 898  HIS A C     1 
ATOM   5019 O O     . HIS A 1 796 ? 23.853  22.932  -18.893 1.00 122.72 ? 898  HIS A O     1 
ATOM   5020 C CB    . HIS A 1 796 ? 23.660  25.808  -18.120 1.00 139.01 ? 898  HIS A CB    1 
ATOM   5021 C CG    . HIS A 1 796 ? 24.025  27.151  -17.561 1.00 137.75 ? 898  HIS A CG    1 
ATOM   5022 N ND1   . HIS A 1 796 ? 23.794  28.331  -18.249 1.00 133.05 ? 898  HIS A ND1   1 
ATOM   5023 C CD2   . HIS A 1 796 ? 24.585  27.512  -16.379 1.00 136.00 ? 898  HIS A CD2   1 
ATOM   5024 C CE1   . HIS A 1 796 ? 24.189  29.347  -17.509 1.00 137.14 ? 898  HIS A CE1   1 
ATOM   5025 N NE2   . HIS A 1 796 ? 24.674  28.882  -16.366 1.00 137.38 ? 898  HIS A NE2   1 
ATOM   5026 N N     . GLY A 1 797 ? 24.297  23.826  -20.906 1.00 125.95 ? 899  GLY A N     1 
ATOM   5027 C CA    . GLY A 1 797 ? 23.915  22.601  -21.573 1.00 124.62 ? 899  GLY A CA    1 
ATOM   5028 C C     . GLY A 1 797 ? 22.443  22.292  -21.609 1.00 121.00 ? 899  GLY A C     1 
ATOM   5029 O O     . GLY A 1 797 ? 22.022  21.357  -22.304 1.00 124.00 ? 899  GLY A O     1 
ATOM   5030 N N     . LEU A 1 798 ? 21.669  23.043  -20.829 1.00 101.98 ? 900  LEU A N     1 
ATOM   5031 C CA    . LEU A 1 798 ? 20.214  22.913  -20.816 1.00 92.37  ? 900  LEU A CA    1 
ATOM   5032 C C     . LEU A 1 798 ? 19.852  22.712  -22.288 1.00 89.29  ? 900  LEU A C     1 
ATOM   5033 O O     . LEU A 1 798 ? 20.359  23.413  -23.180 1.00 91.40  ? 900  LEU A O     1 
ATOM   5034 C CB    . LEU A 1 798 ? 19.583  24.186  -20.247 1.00 106.88 ? 900  LEU A CB    1 
ATOM   5035 C CG    . LEU A 1 798 ? 19.445  24.260  -18.710 1.00 107.17 ? 900  LEU A CG    1 
ATOM   5036 C CD1   . LEU A 1 798 ? 18.440  25.368  -18.339 1.00 101.65 ? 900  LEU A CD1   1 
ATOM   5037 C CD2   . LEU A 1 798 ? 18.957  22.922  -18.139 1.00 104.21 ? 900  LEU A CD2   1 
ATOM   5038 N N     . THR A 1 799 ? 18.999  21.737  -22.545 1.00 72.02  ? 901  THR A N     1 
ATOM   5039 C CA    . THR A 1 799 ? 18.641  21.368  -23.911 1.00 74.74  ? 901  THR A CA    1 
ATOM   5040 C C     . THR A 1 799 ? 17.730  22.373  -24.489 1.00 73.34  ? 901  THR A C     1 
ATOM   5041 O O     . THR A 1 799 ? 17.640  23.479  -24.026 1.00 76.13  ? 901  THR A O     1 
ATOM   5042 C CB    . THR A 1 799 ? 17.831  20.040  -23.959 1.00 112.17 ? 901  THR A CB    1 
ATOM   5043 O OG1   . THR A 1 799 ? 17.897  19.390  -22.684 1.00 111.96 ? 901  THR A OG1   1 
ATOM   5044 C CG2   . THR A 1 799 ? 18.343  19.119  -25.061 1.00 113.36 ? 901  THR A CG2   1 
ATOM   5045 N N     . LEU A 1 800 ? 17.048  21.976  -25.539 1.00 113.28 ? 902  LEU A N     1 
ATOM   5046 C CA    . LEU A 1 800 ? 16.016  22.839  -26.049 1.00 115.85 ? 902  LEU A CA    1 
ATOM   5047 C C     . LEU A 1 800 ? 14.807  22.499  -25.118 1.00 112.31 ? 902  LEU A C     1 
ATOM   5048 O O     . LEU A 1 800 ? 14.408  23.293  -24.276 1.00 109.56 ? 902  LEU A O     1 
ATOM   5049 C CB    . LEU A 1 800 ? 15.676  22.480  -27.491 1.00 152.16 ? 902  LEU A CB    1 
ATOM   5050 C CG    . LEU A 1 800 ? 14.287  22.878  -27.992 1.00 157.55 ? 902  LEU A CG    1 
ATOM   5051 C CD1   . LEU A 1 800 ? 14.202  24.385  -28.104 1.00 157.40 ? 902  LEU A CD1   1 
ATOM   5052 C CD2   . LEU A 1 800 ? 14.016  22.202  -29.339 1.00 162.67 ? 902  LEU A CD2   1 
ATOM   5053 N N     . ALA A 1 801 ? 14.264  21.289  -25.239 1.00 103.62 ? 903  ALA A N     1 
ATOM   5054 C CA    . ALA A 1 801 ? 13.104  20.884  -24.470 1.00 101.35 ? 903  ALA A CA    1 
ATOM   5055 C C     . ALA A 1 801 ? 13.137  21.363  -23.044 1.00 98.52  ? 903  ALA A C     1 
ATOM   5056 O O     . ALA A 1 801 ? 12.127  21.804  -22.528 1.00 101.00 ? 903  ALA A O     1 
ATOM   5057 C CB    . ALA A 1 801 ? 12.927  19.365  -24.521 1.00 196.59 ? 903  ALA A CB    1 
ATOM   5058 N N     . GLN A 1 802 ? 14.277  21.284  -22.389 1.00 81.50  ? 904  GLN A N     1 
ATOM   5059 C CA    . GLN A 1 802 ? 14.322  21.774  -21.027 1.00 81.90  ? 904  GLN A CA    1 
ATOM   5060 C C     . GLN A 1 802 ? 13.949  23.266  -21.000 1.00 80.28  ? 904  GLN A C     1 
ATOM   5061 O O     . GLN A 1 802 ? 13.045  23.672  -20.291 1.00 81.30  ? 904  GLN A O     1 
ATOM   5062 C CB    . GLN A 1 802 ? 15.709  21.542  -20.429 1.00 73.78  ? 904  GLN A CB    1 
ATOM   5063 C CG    . GLN A 1 802 ? 16.000  20.102  -20.174 1.00 78.25  ? 904  GLN A CG    1 
ATOM   5064 C CD    . GLN A 1 802 ? 17.386  19.882  -19.662 1.00 78.87  ? 904  GLN A CD    1 
ATOM   5065 O OE1   . GLN A 1 802 ? 17.655  18.895  -19.015 1.00 83.28  ? 904  GLN A OE1   1 
ATOM   5066 N NE2   . GLN A 1 802 ? 18.280  20.783  -19.968 1.00 77.89  ? 904  GLN A NE2   1 
ATOM   5067 N N     . VAL A 1 803 ? 14.640  24.081  -21.777 1.00 75.26  ? 905  VAL A N     1 
ATOM   5068 C CA    . VAL A 1 803 ? 14.351  25.508  -21.826 1.00 70.96  ? 905  VAL A CA    1 
ATOM   5069 C C     . VAL A 1 803 ? 12.917  25.795  -22.263 1.00 68.31  ? 905  VAL A C     1 
ATOM   5070 O O     . VAL A 1 803 ? 12.343  26.816  -21.894 1.00 69.43  ? 905  VAL A O     1 
ATOM   5071 C CB    . VAL A 1 803 ? 15.301  26.228  -22.809 1.00 54.25  ? 905  VAL A CB    1 
ATOM   5072 C CG1   . VAL A 1 803 ? 14.659  27.539  -23.298 1.00 53.41  ? 905  VAL A CG1   1 
ATOM   5073 C CG2   . VAL A 1 803 ? 16.668  26.462  -22.140 1.00 51.24  ? 905  VAL A CG2   1 
ATOM   5074 N N     . VAL A 1 804 ? 12.331  24.907  -23.053 1.00 66.49  ? 906  VAL A N     1 
ATOM   5075 C CA    . VAL A 1 804 ? 10.958  25.164  -23.502 1.00 61.06  ? 906  VAL A CA    1 
ATOM   5076 C C     . VAL A 1 804 ? 9.935   24.743  -22.468 1.00 57.31  ? 906  VAL A C     1 
ATOM   5077 O O     . VAL A 1 804 ? 8.912   25.334  -22.359 1.00 53.35  ? 906  VAL A O     1 
ATOM   5078 C CB    . VAL A 1 804 ? 10.697  24.587  -24.940 1.00 47.51  ? 906  VAL A CB    1 
ATOM   5079 C CG1   . VAL A 1 804 ? 9.229   24.355  -25.209 1.00 43.03  ? 906  VAL A CG1   1 
ATOM   5080 C CG2   . VAL A 1 804 ? 11.286  25.624  -25.939 1.00 46.96  ? 906  VAL A CG2   1 
ATOM   5081 N N     . ALA A 1 805 ? 10.246  23.735  -21.677 1.00 71.36  ? 907  ALA A N     1 
ATOM   5082 C CA    . ALA A 1 805 ? 9.399   23.345  -20.544 1.00 68.40  ? 907  ALA A CA    1 
ATOM   5083 C C     . ALA A 1 805 ? 9.384   24.554  -19.550 1.00 68.63  ? 907  ALA A C     1 
ATOM   5084 O O     . ALA A 1 805 ? 8.385   24.846  -18.885 1.00 69.05  ? 907  ALA A O     1 
ATOM   5085 C CB    . ALA A 1 805 ? 10.036  22.144  -19.814 1.00 45.83  ? 907  ALA A CB    1 
ATOM   5086 N N     . ILE A 1 806 ? 10.527  25.220  -19.414 1.00 52.78  ? 908  ILE A N     1 
ATOM   5087 C CA    . ILE A 1 806 ? 10.676  26.326  -18.514 1.00 52.67  ? 908  ILE A CA    1 
ATOM   5088 C C     . ILE A 1 806 ? 9.813   27.489  -18.949 1.00 54.66  ? 908  ILE A C     1 
ATOM   5089 O O     . ILE A 1 806 ? 9.007   28.028  -18.160 1.00 56.39  ? 908  ILE A O     1 
ATOM   5090 C CB    . ILE A 1 806 ? 12.119  26.854  -18.559 1.00 39.49  ? 908  ILE A CB    1 
ATOM   5091 C CG1   . ILE A 1 806 ? 13.048  25.909  -17.828 1.00 45.79  ? 908  ILE A CG1   1 
ATOM   5092 C CG2   . ILE A 1 806 ? 12.215  28.261  -18.034 1.00 35.70  ? 908  ILE A CG2   1 
ATOM   5093 C CD1   . ILE A 1 806 ? 12.890  25.918  -16.283 1.00 53.14  ? 908  ILE A CD1   1 
ATOM   5094 N N     . ALA A 1 807 ? 10.008  27.884  -20.215 1.00 58.06  ? 909  ALA A N     1 
ATOM   5095 C CA    . ALA A 1 807 ? 9.428   29.088  -20.753 1.00 54.48  ? 909  ALA A CA    1 
ATOM   5096 C C     . ALA A 1 807 ? 7.986   29.107  -21.113 1.00 53.53  ? 909  ALA A C     1 
ATOM   5097 O O     . ALA A 1 807 ? 7.408   30.203  -21.357 1.00 54.47  ? 909  ALA A O     1 
ATOM   5098 C CB    . ALA A 1 807 ? 10.245  29.544  -21.923 1.00 47.20  ? 909  ALA A CB    1 
ATOM   5099 N N     . SER A 1 808 ? 7.389   27.925  -21.129 1.00 54.09  ? 910  SER A N     1 
ATOM   5100 C CA    . SER A 1 808 ? 6.008   27.851  -21.513 1.00 53.34  ? 910  SER A CA    1 
ATOM   5101 C C     . SER A 1 808 ? 4.961   27.689  -20.415 1.00 52.89  ? 910  SER A C     1 
ATOM   5102 O O     . SER A 1 808 ? 3.827   27.178  -20.650 1.00 54.77  ? 910  SER A O     1 
ATOM   5103 C CB    . SER A 1 808 ? 5.833   26.812  -22.627 1.00 46.67  ? 910  SER A CB    1 
ATOM   5104 O OG    . SER A 1 808 ? 6.704   25.777  -22.405 1.00 51.62  ? 910  SER A OG    1 
ATOM   5105 N N     . ASN A 1 809 ? 5.327   28.146  -19.226 1.00 61.25  ? 911  ASN A N     1 
ATOM   5106 C CA    . ASN A 1 809 ? 4.421   28.151  -18.103 1.00 58.82  ? 911  ASN A CA    1 
ATOM   5107 C C     . ASN A 1 809 ? 4.199   29.626  -17.883 1.00 56.91  ? 911  ASN A C     1 
ATOM   5108 O O     . ASN A 1 809 ? 4.784   30.452  -18.557 1.00 55.82  ? 911  ASN A O     1 
ATOM   5109 C CB    . ASN A 1 809 ? 5.065   27.575  -16.889 1.00 75.08  ? 911  ASN A CB    1 
ATOM   5110 C CG    . ASN A 1 809 ? 5.006   26.082  -16.872 1.00 79.83  ? 911  ASN A CG    1 
ATOM   5111 O OD1   . ASN A 1 809 ? 3.923   25.476  -16.883 1.00 83.79  ? 911  ASN A OD1   1 
ATOM   5112 N ND2   . ASN A 1 809 ? 6.186   25.456  -16.855 1.00 83.10  ? 911  ASN A ND2   1 
ATOM   5113 N N     . ILE A 1 810 ? 3.332   29.979  -16.963 1.00 42.35  ? 912  ILE A N     1 
ATOM   5114 C CA    . ILE A 1 810 ? 3.088   31.370  -16.720 1.00 41.22  ? 912  ILE A CA    1 
ATOM   5115 C C     . ILE A 1 810 ? 4.126   32.018  -15.851 1.00 44.99  ? 912  ILE A C     1 
ATOM   5116 O O     . ILE A 1 810 ? 4.085   31.883  -14.605 1.00 45.07  ? 912  ILE A O     1 
ATOM   5117 C CB    . ILE A 1 810 ? 1.825   31.567  -15.999 1.00 51.62  ? 912  ILE A CB    1 
ATOM   5118 C CG1   . ILE A 1 810 ? 0.684   31.361  -16.938 1.00 50.64  ? 912  ILE A CG1   1 
ATOM   5119 C CG2   . ILE A 1 810 ? 1.730   32.968  -15.564 1.00 53.38  ? 912  ILE A CG2   1 
ATOM   5120 C CD1   . ILE A 1 810 ? -0.497  31.938  -16.405 1.00 49.34  ? 912  ILE A CD1   1 
ATOM   5121 N N     . GLY A 1 811 ? 5.022   32.761  -16.489 1.00 64.06  ? 913  GLY A N     1 
ATOM   5122 C CA    . GLY A 1 811 ? 6.048   33.464  -15.751 1.00 63.77  ? 913  GLY A CA    1 
ATOM   5123 C C     . GLY A 1 811 ? 7.347   33.087  -16.392 1.00 62.82  ? 913  GLY A C     1 
ATOM   5124 O O     . GLY A 1 811 ? 8.371   32.974  -15.723 1.00 64.32  ? 913  GLY A O     1 
ATOM   5125 N N     . GLY A 1 812 ? 7.306   32.916  -17.705 1.00 32.41  ? 914  GLY A N     1 
ATOM   5126 C CA    . GLY A 1 812 ? 8.515   32.493  -18.385 1.00 32.34  ? 914  GLY A CA    1 
ATOM   5127 C C     . GLY A 1 812 ? 9.688   33.384  -18.094 1.00 33.28  ? 914  GLY A C     1 
ATOM   5128 O O     . GLY A 1 812 ? 10.738  32.958  -17.634 1.00 33.53  ? 914  GLY A O     1 
ATOM   5129 N N     . LYS A 1 813 ? 9.498   34.659  -18.351 1.00 41.24  ? 915  LYS A N     1 
ATOM   5130 C CA    . LYS A 1 813 ? 10.544  35.607  -18.121 1.00 42.15  ? 915  LYS A CA    1 
ATOM   5131 C C     . LYS A 1 813 ? 11.080  35.490  -16.722 1.00 44.13  ? 915  LYS A C     1 
ATOM   5132 O O     . LYS A 1 813 ? 12.284  35.458  -16.530 1.00 50.49  ? 915  LYS A O     1 
ATOM   5133 C CB    . LYS A 1 813 ? 10.032  36.997  -18.428 1.00 48.81  ? 915  LYS A CB    1 
ATOM   5134 C CG    . LYS A 1 813 ? 10.906  38.127  -17.949 1.00 50.96  ? 915  LYS A CG    1 
ATOM   5135 C CD    . LYS A 1 813 ? 10.006  39.272  -17.486 1.00 49.90  ? 915  LYS A CD    1 
ATOM   5136 C CE    . LYS A 1 813 ? 10.674  40.617  -17.562 1.00 49.32  ? 915  LYS A CE    1 
ATOM   5137 N NZ    . LYS A 1 813 ? 9.939   41.575  -16.670 1.00 48.90  ? 915  LYS A NZ    1 
ATOM   5138 N N     . GLN A 1 814 ? 10.218  35.388  -15.730 1.00 44.16  ? 916  GLN A N     1 
ATOM   5139 C CA    . GLN A 1 814 ? 10.747  35.253  -14.385 1.00 43.97  ? 916  GLN A CA    1 
ATOM   5140 C C     . GLN A 1 814 ? 11.419  33.909  -14.261 1.00 45.67  ? 916  GLN A C     1 
ATOM   5141 O O     . GLN A 1 814 ? 12.518  33.796  -13.694 1.00 46.01  ? 916  GLN A O     1 
ATOM   5142 C CB    . GLN A 1 814 ? 9.638   35.324  -13.342 1.00 40.74  ? 916  GLN A CB    1 
ATOM   5143 C CG    . GLN A 1 814 ? 8.769   36.577  -13.415 1.00 39.61  ? 916  GLN A CG    1 
ATOM   5144 C CD    . GLN A 1 814 ? 9.565   37.842  -13.684 1.00 38.95  ? 916  GLN A CD    1 
ATOM   5145 O OE1   . GLN A 1 814 ? 9.499   38.391  -14.777 1.00 37.22  ? 916  GLN A OE1   1 
ATOM   5146 N NE2   . GLN A 1 814 ? 10.327  38.300  -12.687 1.00 38.55  ? 916  GLN A NE2   1 
ATOM   5147 N N     . ALA A 1 815 ? 10.754  32.882  -14.798 1.00 66.51  ? 917  ALA A N     1 
ATOM   5148 C CA    . ALA A 1 815 ? 11.264  31.509  -14.713 1.00 70.79  ? 917  ALA A CA    1 
ATOM   5149 C C     . ALA A 1 815 ? 12.679  31.411  -15.206 1.00 74.53  ? 917  ALA A C     1 
ATOM   5150 O O     . ALA A 1 815 ? 13.559  30.933  -14.480 1.00 78.51  ? 917  ALA A O     1 
ATOM   5151 C CB    . ALA A 1 815 ? 10.390  30.583  -15.484 1.00 68.68  ? 917  ALA A CB    1 
ATOM   5152 N N     . LEU A 1 816 ? 12.891  31.892  -16.424 1.00 55.06  ? 918  LEU A N     1 
ATOM   5153 C CA    . LEU A 1 816 ? 14.201  31.886  -17.024 1.00 60.05  ? 918  LEU A CA    1 
ATOM   5154 C C     . LEU A 1 816 ? 15.199  32.851  -16.285 1.00 65.41  ? 918  LEU A C     1 
ATOM   5155 O O     . LEU A 1 816 ? 16.193  32.437  -15.645 1.00 70.37  ? 918  LEU A O     1 
ATOM   5156 C CB    . LEU A 1 816 ? 14.045  32.269  -18.500 1.00 61.02  ? 918  LEU A CB    1 
ATOM   5157 C CG    . LEU A 1 816 ? 13.304  31.260  -19.384 1.00 60.49  ? 918  LEU A CG    1 
ATOM   5158 C CD1   . LEU A 1 816 ? 12.672  31.986  -20.567 1.00 58.07  ? 918  LEU A CD1   1 
ATOM   5159 C CD2   . LEU A 1 816 ? 14.270  30.212  -19.877 1.00 62.73  ? 918  LEU A CD2   1 
ATOM   5160 N N     . GLU A 1 817 ? 14.924  34.140  -16.374 1.00 69.09  ? 919  GLU A N     1 
ATOM   5161 C CA    . GLU A 1 817 ? 15.799  35.101  -15.770 1.00 72.68  ? 919  GLU A CA    1 
ATOM   5162 C C     . GLU A 1 817 ? 16.104  34.789  -14.337 1.00 72.25  ? 919  GLU A C     1 
ATOM   5163 O O     . GLU A 1 817 ? 16.961  35.443  -13.757 1.00 78.40  ? 919  GLU A O     1 
ATOM   5164 C CB    . GLU A 1 817 ? 15.231  36.518  -15.911 1.00 83.82  ? 919  GLU A CB    1 
ATOM   5165 C CG    . GLU A 1 817 ? 15.186  36.995  -17.346 1.00 89.67  ? 919  GLU A CG    1 
ATOM   5166 C CD    . GLU A 1 817 ? 15.313  38.499  -17.442 1.00 95.31  ? 919  GLU A CD    1 
ATOM   5167 O OE1   . GLU A 1 817 ? 16.162  38.950  -18.246 1.00 100.37 ? 919  GLU A OE1   1 
ATOM   5168 O OE2   . GLU A 1 817 ? 14.579  39.223  -16.718 1.00 95.69  ? 919  GLU A OE2   1 
ATOM   5169 N N     . THR A 1 818 ? 15.392  33.846  -13.738 1.00 70.18  ? 920  THR A N     1 
ATOM   5170 C CA    . THR A 1 818 ? 15.756  33.471  -12.369 1.00 72.84  ? 920  THR A CA    1 
ATOM   5171 C C     . THR A 1 818 ? 16.499  32.138  -12.474 1.00 76.12  ? 920  THR A C     1 
ATOM   5172 O O     . THR A 1 818 ? 17.334  31.801  -11.635 1.00 84.98  ? 920  THR A O     1 
ATOM   5173 C CB    . THR A 1 818 ? 14.534  33.252  -11.357 1.00 72.83  ? 920  THR A CB    1 
ATOM   5174 O OG1   . THR A 1 818 ? 13.849  34.494  -11.085 1.00 69.81  ? 920  THR A OG1   1 
ATOM   5175 C CG2   . THR A 1 818 ? 15.072  32.668  -9.995  1.00 70.66  ? 920  THR A CG2   1 
ATOM   5176 N N     . VAL A 1 819 ? 16.212  31.372  -13.511 1.00 59.61  ? 921  VAL A N     1 
ATOM   5177 C CA    . VAL A 1 819 ? 16.859  30.096  -13.590 1.00 62.43  ? 921  VAL A CA    1 
ATOM   5178 C C     . VAL A 1 819 ? 18.304  30.386  -13.896 1.00 69.41  ? 921  VAL A C     1 
ATOM   5179 O O     . VAL A 1 819 ? 19.146  30.122  -13.061 1.00 72.56  ? 921  VAL A O     1 
ATOM   5180 C CB    . VAL A 1 819 ? 16.178  29.140  -14.657 1.00 51.19  ? 921  VAL A CB    1 
ATOM   5181 C CG1   . VAL A 1 819 ? 16.894  29.228  -16.021 1.00 54.18  ? 921  VAL A CG1   1 
ATOM   5182 C CG2   . VAL A 1 819 ? 16.156  27.698  -14.144 1.00 48.84  ? 921  VAL A CG2   1 
ATOM   5183 N N     . GLN A 1 820 ? 18.601  30.983  -15.051 1.00 68.58  ? 922  GLN A N     1 
ATOM   5184 C CA    . GLN A 1 820 ? 19.998  31.257  -15.425 1.00 71.67  ? 922  GLN A CA    1 
ATOM   5185 C C     . GLN A 1 820 ? 20.784  31.898  -14.265 1.00 74.21  ? 922  GLN A C     1 
ATOM   5186 O O     . GLN A 1 820 ? 21.827  31.405  -13.869 1.00 80.69  ? 922  GLN A O     1 
ATOM   5187 C CB    . GLN A 1 820 ? 20.011  32.110  -16.706 1.00 85.85  ? 922  GLN A CB    1 
ATOM   5188 C CG    . GLN A 1 820 ? 21.297  32.828  -16.965 1.00 89.74  ? 922  GLN A CG    1 
ATOM   5189 C CD    . GLN A 1 820 ? 21.207  34.277  -16.572 1.00 92.22  ? 922  GLN A CD    1 
ATOM   5190 O OE1   . GLN A 1 820 ? 20.461  34.648  -15.664 1.00 92.56  ? 922  GLN A OE1   1 
ATOM   5191 N NE2   . GLN A 1 820 ? 21.981  35.111  -17.249 1.00 99.77  ? 922  GLN A NE2   1 
ATOM   5192 N N     . ARG A 1 821 ? 20.236  32.967  -13.709 1.00 60.77  ? 923  ARG A N     1 
ATOM   5193 C CA    . ARG A 1 821 ? 20.803  33.669  -12.572 1.00 63.18  ? 923  ARG A CA    1 
ATOM   5194 C C     . ARG A 1 821 ? 21.215  32.748  -11.465 1.00 61.42  ? 923  ARG A C     1 
ATOM   5195 O O     . ARG A 1 821 ? 22.255  32.922  -10.895 1.00 70.21  ? 923  ARG A O     1 
ATOM   5196 C CB    . ARG A 1 821 ? 19.781  34.639  -11.954 1.00 123.64 ? 923  ARG A CB    1 
ATOM   5197 C CG    . ARG A 1 821 ? 20.086  36.132  -12.102 1.00 127.36 ? 923  ARG A CG    1 
ATOM   5198 C CD    . ARG A 1 821 ? 18.910  37.005  -11.683 1.00 126.86 ? 923  ARG A CD    1 
ATOM   5199 N NE    . ARG A 1 821 ? 19.023  38.364  -12.217 1.00 132.49 ? 923  ARG A NE    1 
ATOM   5200 C CZ    . ARG A 1 821 ? 18.610  38.747  -13.429 1.00 135.91 ? 923  ARG A CZ    1 
ATOM   5201 N NH1   . ARG A 1 821 ? 18.041  37.884  -14.263 1.00 143.33 ? 923  ARG A NH1   1 
ATOM   5202 N NH2   . ARG A 1 821 ? 18.766  40.005  -13.820 1.00 135.09 ? 923  ARG A NH2   1 
ATOM   5203 N N     . LEU A 1 822 ? 20.397  31.774  -11.147 1.00 75.09  ? 924  LEU A N     1 
ATOM   5204 C CA    . LEU A 1 822 ? 20.676  30.889  -10.029 1.00 78.78  ? 924  LEU A CA    1 
ATOM   5205 C C     . LEU A 1 822 ? 21.092  29.439  -10.359 1.00 88.65  ? 924  LEU A C     1 
ATOM   5206 O O     . LEU A 1 822 ? 21.229  28.584  -9.443  1.00 87.72  ? 924  LEU A O     1 
ATOM   5207 C CB    . LEU A 1 822 ? 19.440  30.843  -9.135  1.00 62.94  ? 924  LEU A CB    1 
ATOM   5208 C CG    . LEU A 1 822 ? 19.397  31.834  -7.981  1.00 61.14  ? 924  LEU A CG    1 
ATOM   5209 C CD1   . LEU A 1 822 ? 19.369  33.230  -8.525  1.00 65.89  ? 924  LEU A CD1   1 
ATOM   5210 C CD2   . LEU A 1 822 ? 18.173  31.567  -7.075  1.00 57.02  ? 924  LEU A CD2   1 
ATOM   5211 N N     . LEU A 1 823 ? 21.300  29.121  -11.640 1.00 155.04 ? 925  LEU A N     1 
ATOM   5212 C CA    . LEU A 1 823 ? 21.619  27.720  -11.950 1.00 153.63 ? 925  LEU A CA    1 
ATOM   5213 C C     . LEU A 1 823 ? 22.958  27.337  -11.378 1.00 160.84 ? 925  LEU A C     1 
ATOM   5214 O O     . LEU A 1 823 ? 22.981  26.598  -10.399 1.00 165.87 ? 925  LEU A O     1 
ATOM   5215 C CB    . LEU A 1 823 ? 21.530  27.374  -13.460 1.00 101.38 ? 925  LEU A CB    1 
ATOM   5216 C CG    . LEU A 1 823 ? 21.643  25.875  -13.840 1.00 95.75  ? 925  LEU A CG    1 
ATOM   5217 C CD1   . LEU A 1 823 ? 20.848  25.028  -12.883 1.00 91.02  ? 925  LEU A CD1   1 
ATOM   5218 C CD2   . LEU A 1 823 ? 21.133  25.607  -15.284 1.00 89.97  ? 925  LEU A CD2   1 
ATOM   5219 N N     . PRO A 1 824 ? 24.081  27.869  -11.927 1.00 123.31 ? 926  PRO A N     1 
ATOM   5220 C CA    . PRO A 1 824 ? 25.400  27.504  -11.388 1.00 117.95 ? 926  PRO A CA    1 
ATOM   5221 C C     . PRO A 1 824 ? 25.355  27.231  -9.908  1.00 113.00 ? 926  PRO A C     1 
ATOM   5222 O O     . PRO A 1 824 ? 25.607  26.116  -9.463  1.00 118.43 ? 926  PRO A O     1 
ATOM   5223 C CB    . PRO A 1 824 ? 26.262  28.726  -11.671 1.00 102.51 ? 926  PRO A CB    1 
ATOM   5224 C CG    . PRO A 1 824 ? 25.668  29.316  -12.907 1.00 105.71 ? 926  PRO A CG    1 
ATOM   5225 C CD    . PRO A 1 824 ? 24.196  28.949  -12.940 1.00 105.81 ? 926  PRO A CD    1 
ATOM   5226 N N     . VAL A 1 825 ? 24.990  28.272  -9.170  1.00 65.07  ? 927  VAL A N     1 
ATOM   5227 C CA    . VAL A 1 825 ? 24.921  28.265  -7.705  1.00 65.50  ? 927  VAL A CA    1 
ATOM   5228 C C     . VAL A 1 825 ? 24.250  27.040  -7.029  1.00 70.26  ? 927  VAL A C     1 
ATOM   5229 O O     . VAL A 1 825 ? 24.625  26.645  -5.910  1.00 74.69  ? 927  VAL A O     1 
ATOM   5230 C CB    . VAL A 1 825 ? 24.257  29.595  -7.154  1.00 59.59  ? 927  VAL A CB    1 
ATOM   5231 C CG1   . VAL A 1 825 ? 24.720  29.875  -5.730  1.00 56.57  ? 927  VAL A CG1   1 
ATOM   5232 C CG2   . VAL A 1 825 ? 24.607  30.804  -8.061  1.00 54.97  ? 927  VAL A CG2   1 
ATOM   5233 N N     . LEU A 1 826 ? 23.305  26.400  -7.698  1.00 113.43 ? 928  LEU A N     1 
ATOM   5234 C CA    . LEU A 1 826 ? 22.624  25.264  -7.079  1.00 119.49 ? 928  LEU A CA    1 
ATOM   5235 C C     . LEU A 1 826 ? 23.372  23.930  -7.163  1.00 121.62 ? 928  LEU A C     1 
ATOM   5236 O O     . LEU A 1 826 ? 23.591  23.273  -6.138  1.00 123.02 ? 928  LEU A O     1 
ATOM   5237 C CB    . LEU A 1 826 ? 21.222  25.127  -7.679  1.00 166.39 ? 928  LEU A CB    1 
ATOM   5238 N N     . CYS A 1 827 ? 23.733  23.533  -8.383  1.00 84.05  ? 929  CYS A N     1 
ATOM   5239 C CA    . CYS A 1 827 ? 24.453  22.294  -8.608  1.00 87.81  ? 929  CYS A CA    1 
ATOM   5240 C C     . CYS A 1 827 ? 25.624  22.277  -7.637  1.00 88.82  ? 929  CYS A C     1 
ATOM   5241 O O     . CYS A 1 827 ? 25.784  21.310  -6.883  1.00 88.45  ? 929  CYS A O     1 
ATOM   5242 C CB    . CYS A 1 827 ? 24.928  22.219  -10.056 1.00 160.61 ? 929  CYS A CB    1 
ATOM   5243 S SG    . CYS A 1 827 ? 23.569  22.177  -11.261 1.00 164.51 ? 929  CYS A SG    1 
ATOM   5244 N N     . GLN A 1 828 ? 26.429  23.345  -7.631  1.00 125.88 ? 930  GLN A N     1 
ATOM   5245 C CA    . GLN A 1 828 ? 27.543  23.437  -6.671  1.00 130.20 ? 930  GLN A CA    1 
ATOM   5246 C C     . GLN A 1 828 ? 27.171  24.325  -5.460  1.00 130.51 ? 930  GLN A C     1 
ATOM   5247 O O     . GLN A 1 828 ? 27.906  25.213  -5.054  1.00 130.20 ? 930  GLN A O     1 
ATOM   5248 C CB    . GLN A 1 828 ? 28.834  23.935  -7.356  1.00 99.23  ? 930  GLN A CB    1 
ATOM   5249 C CG    . GLN A 1 828 ? 28.711  24.284  -8.830  1.00 91.51  ? 930  GLN A CG    1 
ATOM   5250 C CD    . GLN A 1 828 ? 28.808  25.788  -9.078  1.00 86.20  ? 930  GLN A CD    1 
ATOM   5251 O OE1   . GLN A 1 828 ? 28.846  26.599  -8.123  1.00 84.73  ? 930  GLN A OE1   1 
ATOM   5252 N NE2   . GLN A 1 828 ? 28.847  26.176  -10.363 1.00 83.28  ? 930  GLN A NE2   1 
ATOM   5253 N N     . GLY A 1 831 ? 24.545  20.404  -3.282  1.00 138.47 ? 933  GLY A N     1 
ATOM   5254 C CA    . GLY A 1 831 ? 24.231  19.279  -4.142  1.00 129.66 ? 933  GLY A CA    1 
ATOM   5255 C C     . GLY A 1 831 ? 22.874  19.179  -4.808  1.00 122.05 ? 933  GLY A C     1 
ATOM   5256 O O     . GLY A 1 831 ? 22.103  18.233  -4.538  1.00 113.82 ? 933  GLY A O     1 
ATOM   5257 N N     . LEU A 1 832 ? 22.539  20.172  -5.629  1.00 137.89 ? 934  LEU A N     1 
ATOM   5258 C CA    . LEU A 1 832 ? 21.311  20.081  -6.416  1.00 127.48 ? 934  LEU A CA    1 
ATOM   5259 C C     . LEU A 1 832 ? 21.765  19.567  -7.778  1.00 123.29 ? 934  LEU A C     1 
ATOM   5260 O O     . LEU A 1 832 ? 22.957  19.611  -8.104  1.00 127.61 ? 934  LEU A O     1 
ATOM   5261 C CB    . LEU A 1 832 ? 20.584  21.438  -6.580  1.00 92.78  ? 934  LEU A CB    1 
ATOM   5262 C CG    . LEU A 1 832 ? 19.361  21.634  -5.644  1.00 89.22  ? 934  LEU A CG    1 
ATOM   5263 C CD1   . LEU A 1 832 ? 18.209  22.234  -6.443  1.00 88.03  ? 934  LEU A CD1   1 
ATOM   5264 C CD2   . LEU A 1 832 ? 18.897  20.287  -5.010  1.00 84.89  ? 934  LEU A CD2   1 
ATOM   5265 N N     . THR A 1 833 ? 20.830  19.038  -8.556  1.00 77.47  ? 935  THR A N     1 
ATOM   5266 C CA    . THR A 1 833 ? 21.163  18.557  -9.893  1.00 74.98  ? 935  THR A CA    1 
ATOM   5267 C C     . THR A 1 833 ? 20.501  19.406  -10.964 1.00 69.12  ? 935  THR A C     1 
ATOM   5268 O O     . THR A 1 833 ? 19.449  20.024  -10.691 1.00 69.18  ? 935  THR A O     1 
ATOM   5269 C CB    . THR A 1 833 ? 20.724  17.094  -10.103 1.00 98.24  ? 935  THR A CB    1 
ATOM   5270 O OG1   . THR A 1 833 ? 19.305  17.024  -10.219 1.00 92.43  ? 935  THR A OG1   1 
ATOM   5271 C CG2   . THR A 1 833 ? 21.181  16.217  -8.928  1.00 99.28  ? 935  THR A CG2   1 
ATOM   5272 N N     . GLN A 1 834 ? 21.070  19.409  -12.173 1.00 76.72  ? 936  GLN A N     1 
ATOM   5273 C CA    . GLN A 1 834 ? 20.518  20.214  -13.251 1.00 81.10  ? 936  GLN A CA    1 
ATOM   5274 C C     . GLN A 1 834 ? 19.004  20.060  -13.443 1.00 84.08  ? 936  GLN A C     1 
ATOM   5275 O O     . GLN A 1 834 ? 18.270  21.052  -13.358 1.00 83.93  ? 936  GLN A O     1 
ATOM   5276 C CB    . GLN A 1 834 ? 21.243  19.929  -14.563 1.00 81.92  ? 936  GLN A CB    1 
ATOM   5277 C CG    . GLN A 1 834 ? 22.176  21.064  -14.990 1.00 82.22  ? 936  GLN A CG    1 
ATOM   5278 C CD    . GLN A 1 834 ? 22.346  21.169  -16.522 1.00 83.83  ? 936  GLN A CD    1 
ATOM   5279 O OE1   . GLN A 1 834 ? 21.414  20.893  -17.282 1.00 88.24  ? 936  GLN A OE1   1 
ATOM   5280 N NE2   . GLN A 1 834 ? 23.537  21.579  -16.970 1.00 79.05  ? 936  GLN A NE2   1 
ATOM   5281 N N     . ASP A 1 835 ? 18.548  18.828  -13.676 1.00 131.52 ? 937  ASP A N     1 
ATOM   5282 C CA    . ASP A 1 835 ? 17.125  18.552  -13.890 1.00 132.97 ? 937  ASP A CA    1 
ATOM   5283 C C     . ASP A 1 835 ? 16.265  18.826  -12.657 1.00 131.80 ? 937  ASP A C     1 
ATOM   5284 O O     . ASP A 1 835 ? 15.081  19.134  -12.804 1.00 135.35 ? 937  ASP A O     1 
ATOM   5285 C CB    . ASP A 1 835 ? 16.908  17.105  -14.346 1.00 108.18 ? 937  ASP A CB    1 
ATOM   5286 C CG    . ASP A 1 835 ? 18.063  16.574  -15.180 1.00 111.90 ? 937  ASP A CG    1 
ATOM   5287 O OD1   . ASP A 1 835 ? 18.239  16.978  -16.338 1.00 115.85 ? 937  ASP A OD1   1 
ATOM   5288 O OD2   . ASP A 1 835 ? 18.814  15.742  -14.665 1.00 111.66 ? 937  ASP A OD2   1 
ATOM   5289 N N     . GLN A 1 836 ? 16.840  18.699  -11.456 1.00 104.72 ? 938  GLN A N     1 
ATOM   5290 C CA    . GLN A 1 836 ? 16.105  18.993  -10.214 1.00 97.40  ? 938  GLN A CA    1 
ATOM   5291 C C     . GLN A 1 836 ? 15.768  20.470  -10.218 1.00 89.93  ? 938  GLN A C     1 
ATOM   5292 O O     . GLN A 1 836 ? 14.678  20.854  -9.852  1.00 86.95  ? 938  GLN A O     1 
ATOM   5293 C CB    . GLN A 1 836 ? 16.923  18.689  -8.963  1.00 86.81  ? 938  GLN A CB    1 
ATOM   5294 C CG    . GLN A 1 836 ? 16.851  17.241  -8.518  1.00 85.38  ? 938  GLN A CG    1 
ATOM   5295 C CD    . GLN A 1 836 ? 17.770  16.942  -7.336  1.00 86.54  ? 938  GLN A CD    1 
ATOM   5296 O OE1   . GLN A 1 836 ? 18.934  17.394  -7.302  1.00 87.33  ? 938  GLN A OE1   1 
ATOM   5297 N NE2   . GLN A 1 836 ? 17.262  16.160  -6.366  1.00 84.46  ? 938  GLN A NE2   1 
ATOM   5298 N N     . VAL A 1 837 ? 16.710  21.305  -10.631 1.00 80.36  ? 939  VAL A N     1 
ATOM   5299 C CA    . VAL A 1 837 ? 16.456  22.745  -10.720 1.00 78.92  ? 939  VAL A CA    1 
ATOM   5300 C C     . VAL A 1 837 ? 15.410  23.017  -11.791 1.00 74.46  ? 939  VAL A C     1 
ATOM   5301 O O     . VAL A 1 837 ? 14.363  23.600  -11.497 1.00 71.04  ? 939  VAL A O     1 
ATOM   5302 C CB    . VAL A 1 837 ? 17.756  23.540  -11.070 1.00 72.49  ? 939  VAL A CB    1 
ATOM   5303 C CG1   . VAL A 1 837 ? 17.480  24.600  -12.124 1.00 68.73  ? 939  VAL A CG1   1 
ATOM   5304 C CG2   . VAL A 1 837 ? 18.306  24.181  -9.788  1.00 72.30  ? 939  VAL A CG2   1 
ATOM   5305 N N     . VAL A 1 838 ? 15.720  22.594  -13.021 1.00 76.17  ? 940  VAL A N     1 
ATOM   5306 C CA    . VAL A 1 838 ? 14.854  22.759  -14.175 1.00 73.68  ? 940  VAL A CA    1 
ATOM   5307 C C     . VAL A 1 838 ? 13.435  22.310  -13.857 1.00 72.11  ? 940  VAL A C     1 
ATOM   5308 O O     . VAL A 1 838 ? 12.493  23.022  -14.203 1.00 70.40  ? 940  VAL A O     1 
ATOM   5309 C CB    . VAL A 1 838 ? 15.429  22.036  -15.383 1.00 70.43  ? 940  VAL A CB    1 
ATOM   5310 C CG1   . VAL A 1 838 ? 14.318  21.650  -16.361 1.00 67.48  ? 940  VAL A CG1   1 
ATOM   5311 C CG2   . VAL A 1 838 ? 16.461  22.963  -16.049 1.00 72.27  ? 940  VAL A CG2   1 
ATOM   5312 N N     . ALA A 1 839 ? 13.293  21.160  -13.188 1.00 75.82  ? 941  ALA A N     1 
ATOM   5313 C CA    . ALA A 1 839 ? 12.001  20.628  -12.710 1.00 71.07  ? 941  ALA A CA    1 
ATOM   5314 C C     . ALA A 1 839 ? 11.247  21.608  -11.784 1.00 67.94  ? 941  ALA A C     1 
ATOM   5315 O O     . ALA A 1 839 ? 10.106  21.911  -12.022 1.00 68.85  ? 941  ALA A O     1 
ATOM   5316 C CB    . ALA A 1 839 ? 12.232  19.385  -11.940 1.00 76.18  ? 941  ALA A CB    1 
ATOM   5317 N N     . ILE A 1 840 ? 11.868  21.999  -10.673 1.00 59.06  ? 942  ILE A N     1 
ATOM   5318 C CA    . ILE A 1 840 ? 11.375  22.969  -9.689  1.00 56.35  ? 942  ILE A CA    1 
ATOM   5319 C C     . ILE A 1 840 ? 10.993  24.218  -10.446 1.00 53.81  ? 942  ILE A C     1 
ATOM   5320 O O     . ILE A 1 840 ? 10.041  24.883  -10.069 1.00 54.42  ? 942  ILE A O     1 
ATOM   5321 C CB    . ILE A 1 840 ? 12.524  23.324  -8.719  1.00 76.01  ? 942  ILE A CB    1 
ATOM   5322 C CG1   . ILE A 1 840 ? 12.821  22.133  -7.830  1.00 81.35  ? 942  ILE A CG1   1 
ATOM   5323 C CG2   . ILE A 1 840 ? 12.181  24.473  -7.863  1.00 79.06  ? 942  ILE A CG2   1 
ATOM   5324 C CD1   . ILE A 1 840 ? 14.092  22.281  -7.041  1.00 83.94  ? 942  ILE A CD1   1 
ATOM   5325 N N     . ALA A 1 841 ? 11.730  24.558  -11.504 1.00 44.74  ? 943  ALA A N     1 
ATOM   5326 C CA    . ALA A 1 841 ? 11.446  25.787  -12.295 1.00 43.87  ? 943  ALA A CA    1 
ATOM   5327 C C     . ALA A 1 841 ? 10.399  25.588  -13.385 1.00 42.15  ? 943  ALA A C     1 
ATOM   5328 O O     . ALA A 1 841 ? 9.802   26.530  -13.871 1.00 42.37  ? 943  ALA A O     1 
ATOM   5329 C CB    . ALA A 1 841 ? 12.745  26.314  -12.954 1.00 34.87  ? 943  ALA A CB    1 
ATOM   5330 N N     . SER A 1 842 ? 10.198  24.340  -13.780 1.00 52.38  ? 944  SER A N     1 
ATOM   5331 C CA    . SER A 1 842 ? 9.287   23.986  -14.865 1.00 49.93  ? 944  SER A CA    1 
ATOM   5332 C C     . SER A 1 842 ? 7.882   23.894  -14.413 1.00 47.40  ? 944  SER A C     1 
ATOM   5333 O O     . SER A 1 842 ? 7.105   23.077  -14.935 1.00 50.68  ? 944  SER A O     1 
ATOM   5334 C CB    . SER A 1 842 ? 9.718   22.660  -15.541 1.00 55.60  ? 944  SER A CB    1 
ATOM   5335 O OG    . SER A 1 842 ? 10.606  21.899  -14.718 1.00 56.43  ? 944  SER A OG    1 
ATOM   5336 N N     . ASN A 1 843 ? 7.563   24.692  -13.404 1.00 41.42  ? 945  ASN A N     1 
ATOM   5337 C CA    . ASN A 1 843 ? 6.182   24.771  -12.903 1.00 38.67  ? 945  ASN A CA    1 
ATOM   5338 C C     . ASN A 1 843 ? 5.731   26.246  -12.820 1.00 38.46  ? 945  ASN A C     1 
ATOM   5339 O O     . ASN A 1 843 ? 6.562   27.144  -12.834 1.00 39.60  ? 945  ASN A O     1 
ATOM   5340 C CB    . ASN A 1 843 ? 6.074   24.044  -11.572 1.00 41.21  ? 945  ASN A CB    1 
ATOM   5341 C CG    . ASN A 1 843 ? 5.480   22.632  -11.733 1.00 41.25  ? 945  ASN A CG    1 
ATOM   5342 O OD1   . ASN A 1 843 ? 5.382   22.103  -12.853 1.00 41.26  ? 945  ASN A OD1   1 
ATOM   5343 N ND2   . ASN A 1 843 ? 5.066   22.020  -10.607 1.00 41.19  ? 945  ASN A ND2   1 
ATOM   5344 N N     . ILE A 1 844 ? 4.439   26.532  -12.822 1.00 43.26  ? 946  ILE A N     1 
ATOM   5345 C CA    . ILE A 1 844 ? 4.053   27.948  -12.748 1.00 42.21  ? 946  ILE A CA    1 
ATOM   5346 C C     . ILE A 1 844 ? 4.688   28.536  -11.465 1.00 44.49  ? 946  ILE A C     1 
ATOM   5347 O O     . ILE A 1 844 ? 4.733   27.904  -10.364 1.00 45.58  ? 946  ILE A O     1 
ATOM   5348 C CB    . ILE A 1 844 ? 2.549   28.124  -12.602 1.00 30.89  ? 946  ILE A CB    1 
ATOM   5349 C CG1   . ILE A 1 844 ? 1.860   28.118  -13.913 1.00 30.33  ? 946  ILE A CG1   1 
ATOM   5350 C CG2   . ILE A 1 844 ? 2.236   29.447  -11.931 1.00 30.52  ? 946  ILE A CG2   1 
ATOM   5351 C CD1   . ILE A 1 844 ? 0.525   28.763  -13.758 1.00 29.89  ? 946  ILE A CD1   1 
ATOM   5352 N N     . GLY A 1 845 ? 5.151   29.765  -11.571 1.00 52.25  ? 947  GLY A N     1 
ATOM   5353 C CA    . GLY A 1 845 ? 5.769   30.355  -10.389 1.00 55.99  ? 947  GLY A CA    1 
ATOM   5354 C C     . GLY A 1 845 ? 7.026   29.642  -9.944  1.00 59.35  ? 947  GLY A C     1 
ATOM   5355 O O     . GLY A 1 845 ? 7.257   29.489  -8.737  1.00 57.45  ? 947  GLY A O     1 
ATOM   5356 N N     . GLY A 1 846 ? 7.799   29.179  -10.939 1.00 60.07  ? 948  GLY A N     1 
ATOM   5357 C CA    . GLY A 1 846 ? 9.053   28.493  -10.709 1.00 61.79  ? 948  GLY A CA    1 
ATOM   5358 C C     . GLY A 1 846 ? 9.986   29.495  -10.088 1.00 64.34  ? 948  GLY A C     1 
ATOM   5359 O O     . GLY A 1 846 ? 10.594  29.213  -9.083  1.00 67.00  ? 948  GLY A O     1 
ATOM   5360 N N     . LYS A 1 847 ? 10.093  30.680  -10.661 1.00 61.79  ? 949  LYS A N     1 
ATOM   5361 C CA    . LYS A 1 847 ? 10.967  31.694  -10.075 1.00 62.76  ? 949  LYS A CA    1 
ATOM   5362 C C     . LYS A 1 847 ? 10.880  31.653  -8.547  1.00 64.48  ? 949  LYS A C     1 
ATOM   5363 O O     . LYS A 1 847 ? 11.893  31.402  -7.906  1.00 73.45  ? 949  LYS A O     1 
ATOM   5364 C CB    . LYS A 1 847 ? 10.631  33.106  -10.601 1.00 59.26  ? 949  LYS A CB    1 
ATOM   5365 C CG    . LYS A 1 847 ? 11.303  34.213  -9.837  1.00 59.12  ? 949  LYS A CG    1 
ATOM   5366 C CD    . LYS A 1 847 ? 10.974  35.552  -10.439 1.00 59.11  ? 949  LYS A CD    1 
ATOM   5367 C CE    . LYS A 1 847 ? 10.679  36.622  -9.391  1.00 56.59  ? 949  LYS A CE    1 
ATOM   5368 N NZ    . LYS A 1 847 ? 11.869  36.820  -8.534  1.00 57.88  ? 949  LYS A NZ    1 
ATOM   5369 N N     . GLN A 1 848 ? 9.693   31.880  -7.966  1.00 52.58  ? 950  GLN A N     1 
ATOM   5370 C CA    . GLN A 1 848 ? 9.486   31.810  -6.511  1.00 51.18  ? 950  GLN A CA    1 
ATOM   5371 C C     . GLN A 1 848 ? 9.916   30.431  -5.943  1.00 50.05  ? 950  GLN A C     1 
ATOM   5372 O O     . GLN A 1 848 ? 10.672  30.405  -4.990  1.00 51.32  ? 950  GLN A O     1 
ATOM   5373 C CB    . GLN A 1 848 ? 8.013   32.042  -6.164  1.00 88.58  ? 950  GLN A CB    1 
ATOM   5374 C CG    . GLN A 1 848 ? 7.314   33.117  -6.940  1.00 89.98  ? 950  GLN A CG    1 
ATOM   5375 C CD    . GLN A 1 848 ? 7.906   34.529  -6.715  1.00 89.55  ? 950  GLN A CD    1 
ATOM   5376 O OE1   . GLN A 1 848 ? 8.297   34.889  -5.584  1.00 90.90  ? 950  GLN A OE1   1 
ATOM   5377 N NE2   . GLN A 1 848 ? 7.943   35.347  -7.800  1.00 87.47  ? 950  GLN A NE2   1 
ATOM   5378 N N     . ALA A 1 849 ? 9.433   29.314  -6.499  1.00 66.46  ? 951  ALA A N     1 
ATOM   5379 C CA    . ALA A 1 849 ? 9.833   27.995  -6.003  1.00 68.47  ? 951  ALA A CA    1 
ATOM   5380 C C     . ALA A 1 849 ? 11.376  27.856  -5.862  1.00 70.29  ? 951  ALA A C     1 
ATOM   5381 O O     . ALA A 1 849 ? 11.879  27.437  -4.791  1.00 73.61  ? 951  ALA A O     1 
ATOM   5382 C CB    . ALA A 1 849 ? 9.307   26.901  -6.910  1.00 59.49  ? 951  ALA A CB    1 
ATOM   5383 N N     . LEU A 1 850 ? 12.116  28.190  -6.923  1.00 40.84  ? 952  LEU A N     1 
ATOM   5384 C CA    . LEU A 1 850 ? 13.576  28.152  -6.929  1.00 42.12  ? 952  LEU A CA    1 
ATOM   5385 C C     . LEU A 1 850 ? 14.099  28.958  -5.737  1.00 48.87  ? 952  LEU A C     1 
ATOM   5386 O O     . LEU A 1 850 ? 14.826  28.416  -4.872  1.00 53.31  ? 952  LEU A O     1 
ATOM   5387 C CB    . LEU A 1 850 ? 14.111  28.791  -8.185  1.00 46.51  ? 952  LEU A CB    1 
ATOM   5388 C CG    . LEU A 1 850 ? 14.248  27.897  -9.423  1.00 46.13  ? 952  LEU A CG    1 
ATOM   5389 C CD1   . LEU A 1 850 ? 15.048  28.665  -10.532 1.00 45.62  ? 952  LEU A CD1   1 
ATOM   5390 C CD2   . LEU A 1 850 ? 14.974  26.597  -9.048  1.00 46.96  ? 952  LEU A CD2   1 
ATOM   5391 N N     . GLU A 1 851 ? 13.746  30.250  -5.673  1.00 58.81  ? 953  GLU A N     1 
ATOM   5392 C CA    . GLU A 1 851 ? 14.176  31.092  -4.561  1.00 63.71  ? 953  GLU A CA    1 
ATOM   5393 C C     . GLU A 1 851 ? 13.963  30.438  -3.172  1.00 66.95  ? 953  GLU A C     1 
ATOM   5394 O O     . GLU A 1 851 ? 14.926  30.062  -2.514  1.00 70.03  ? 953  GLU A O     1 
ATOM   5395 C CB    . GLU A 1 851 ? 13.470  32.416  -4.621  1.00 72.85  ? 953  GLU A CB    1 
ATOM   5396 C CG    . GLU A 1 851 ? 13.871  33.278  -5.798  1.00 76.19  ? 953  GLU A CG    1 
ATOM   5397 C CD    . GLU A 1 851 ? 13.508  34.753  -5.563  1.00 81.80  ? 953  GLU A CD    1 
ATOM   5398 O OE1   . GLU A 1 851 ? 12.749  35.057  -4.606  1.00 77.71  ? 953  GLU A OE1   1 
ATOM   5399 O OE2   . GLU A 1 851 ? 13.986  35.609  -6.336  1.00 88.50  ? 953  GLU A OE2   1 
ATOM   5400 N N     . THR A 1 852 ? 12.726  30.254  -2.728  1.00 78.67  ? 954  THR A N     1 
ATOM   5401 C CA    . THR A 1 852 ? 12.495  29.654  -1.405  1.00 83.00  ? 954  THR A CA    1 
ATOM   5402 C C     . THR A 1 852 ? 13.381  28.434  -1.108  1.00 85.31  ? 954  THR A C     1 
ATOM   5403 O O     . THR A 1 852 ? 13.618  28.134  0.065   1.00 89.03  ? 954  THR A O     1 
ATOM   5404 C CB    . THR A 1 852 ? 10.969  29.357  -1.174  1.00 94.77  ? 954  THR A CB    1 
ATOM   5405 O OG1   . THR A 1 852 ? 10.256  30.598  -1.124  1.00 95.73  ? 954  THR A OG1   1 
ATOM   5406 C CG2   . THR A 1 852 ? 10.730  28.661  0.144   1.00 92.45  ? 954  THR A CG2   1 
ATOM   5407 N N     . VAL A 1 853 ? 13.869  27.741  -2.149  1.00 83.10  ? 955  VAL A N     1 
ATOM   5408 C CA    . VAL A 1 853 ? 14.820  26.625  -1.955  1.00 84.89  ? 955  VAL A CA    1 
ATOM   5409 C C     . VAL A 1 853 ? 16.181  27.264  -1.646  1.00 88.14  ? 955  VAL A C     1 
ATOM   5410 O O     . VAL A 1 853 ? 16.680  27.129  -0.534  1.00 92.84  ? 955  VAL A O     1 
ATOM   5411 C CB    . VAL A 1 853 ? 14.997  25.745  -3.203  1.00 81.77  ? 955  VAL A CB    1 
ATOM   5412 C CG1   . VAL A 1 853 ? 16.189  24.804  -3.019  1.00 79.40  ? 955  VAL A CG1   1 
ATOM   5413 C CG2   . VAL A 1 853 ? 13.729  24.951  -3.440  1.00 80.89  ? 955  VAL A CG2   1 
ATOM   5414 N N     . GLN A 1 854 ? 16.785  27.948  -2.626  1.00 87.33  ? 956  GLN A N     1 
ATOM   5415 C CA    . GLN A 1 854 ? 18.069  28.657  -2.422  1.00 89.68  ? 956  GLN A CA    1 
ATOM   5416 C C     . GLN A 1 854 ? 18.121  29.173  -0.970  1.00 92.63  ? 956  GLN A C     1 
ATOM   5417 O O     . GLN A 1 854 ? 19.111  29.010  -0.282  1.00 93.05  ? 956  GLN A O     1 
ATOM   5418 C CB    . GLN A 1 854 ? 18.173  29.835  -3.426  1.00 80.73  ? 956  GLN A CB    1 
ATOM   5419 C CG    . GLN A 1 854 ? 18.878  31.112  -2.924  1.00 81.02  ? 956  GLN A CG    1 
ATOM   5420 C CD    . GLN A 1 854 ? 20.354  31.103  -3.216  1.00 86.43  ? 956  GLN A CD    1 
ATOM   5421 O OE1   . GLN A 1 854 ? 20.779  31.481  -4.314  1.00 89.49  ? 956  GLN A OE1   1 
ATOM   5422 N NE2   . GLN A 1 854 ? 21.153  30.649  -2.241  1.00 85.73  ? 956  GLN A NE2   1 
ATOM   5423 N N     . ARG A 1 855 ? 17.009  29.752  -0.522  1.00 138.51 ? 957  ARG A N     1 
ATOM   5424 C CA    . ARG A 1 855 ? 16.840  30.315  0.817   1.00 144.18 ? 957  ARG A CA    1 
ATOM   5425 C C     . ARG A 1 855 ? 16.683  29.344  1.975   1.00 142.82 ? 957  ARG A C     1 
ATOM   5426 O O     . ARG A 1 855 ? 17.544  29.294  2.851   1.00 148.09 ? 957  ARG A O     1 
ATOM   5427 C CB    . ARG A 1 855 ? 15.613  31.236  0.849   1.00 142.45 ? 957  ARG A CB    1 
ATOM   5428 C CG    . ARG A 1 855 ? 15.411  31.985  2.173   1.00 143.21 ? 957  ARG A CG    1 
ATOM   5429 C CD    . ARG A 1 855 ? 14.387  33.111  2.026   1.00 144.02 ? 957  ARG A CD    1 
ATOM   5430 N NE    . ARG A 1 855 ? 13.005  32.670  2.233   1.00 146.28 ? 957  ARG A NE    1 
ATOM   5431 C CZ    . ARG A 1 855 ? 12.027  32.766  1.328   1.00 145.40 ? 957  ARG A CZ    1 
ATOM   5432 N NH1   . ARG A 1 855 ? 12.267  33.288  0.130   1.00 140.58 ? 957  ARG A NH1   1 
ATOM   5433 N NH2   . ARG A 1 855 ? 10.799  32.345  1.628   1.00 141.06 ? 957  ARG A NH2   1 
ATOM   5434 N N     . LEU A 1 856 ? 15.551  28.629  2.004   1.00 84.82  ? 958  LEU A N     1 
ATOM   5435 C CA    . LEU A 1 856 ? 15.233  27.680  3.074   1.00 86.33  ? 958  LEU A CA    1 
ATOM   5436 C C     . LEU A 1 856 ? 15.818  26.289  2.803   1.00 87.36  ? 958  LEU A C     1 
ATOM   5437 O O     . LEU A 1 856 ? 15.328  25.245  3.270   1.00 81.62  ? 958  LEU A O     1 
ATOM   5438 C CB    . LEU A 1 856 ? 13.714  27.621  3.325   1.00 133.66 ? 958  LEU A CB    1 
ATOM   5439 C CG    . LEU A 1 856 ? 13.068  28.892  3.933   1.00 138.13 ? 958  LEU A CG    1 
ATOM   5440 C CD1   . LEU A 1 856 ? 11.553  28.865  3.722   1.00 136.81 ? 958  LEU A CD1   1 
ATOM   5441 C CD2   . LEU A 1 856 ? 13.399  29.028  5.429   1.00 141.21 ? 958  LEU A CD2   1 
ATOM   5442 N N     . LEU A 1 857 ? 16.907  26.309  2.034   1.00 97.87  ? 959  LEU A N     1 
ATOM   5443 C CA    . LEU A 1 857 ? 17.672  25.115  1.694   1.00 99.47  ? 959  LEU A CA    1 
ATOM   5444 C C     . LEU A 1 857 ? 18.234  24.451  2.969   1.00 105.09 ? 959  LEU A C     1 
ATOM   5445 O O     . LEU A 1 857 ? 17.799  23.362  3.338   1.00 100.42 ? 959  LEU A O     1 
ATOM   5446 C CB    . LEU A 1 857 ? 18.834  25.501  0.745   1.00 100.81 ? 959  LEU A CB    1 
ATOM   5447 C CG    . LEU A 1 857 ? 20.204  24.778  0.741   1.00 103.92 ? 959  LEU A CG    1 
ATOM   5448 C CD1   . LEU A 1 857 ? 20.123  23.533  -0.126  1.00 104.68 ? 959  LEU A CD1   1 
ATOM   5449 C CD2   . LEU A 1 857 ? 21.317  25.716  0.223   1.00 100.40 ? 959  LEU A CD2   1 
ATOM   5450 N N     . PRO A 1 858 ? 19.141  25.138  3.691   1.00 93.78  ? 960  PRO A N     1 
ATOM   5451 C CA    . PRO A 1 858 ? 19.722  24.502  4.868   1.00 96.92  ? 960  PRO A CA    1 
ATOM   5452 C C     . PRO A 1 858 ? 18.870  24.125  6.041   1.00 96.03  ? 960  PRO A C     1 
ATOM   5453 O O     . PRO A 1 858 ? 19.022  23.046  6.585   1.00 93.55  ? 960  PRO A O     1 
ATOM   5454 C CB    . PRO A 1 858 ? 20.815  25.484  5.291   1.00 104.53 ? 960  PRO A CB    1 
ATOM   5455 C CG    . PRO A 1 858 ? 20.213  26.801  4.999   1.00 100.16 ? 960  PRO A CG    1 
ATOM   5456 C CD    . PRO A 1 858 ? 19.435  26.591  3.697   1.00 96.85  ? 960  PRO A CD    1 
ATOM   5457 N N     . VAL A 1 859 ? 18.013  25.047  6.443   1.00 104.89 ? 961  VAL A N     1 
ATOM   5458 C CA    . VAL A 1 859 ? 17.133  24.899  7.587   1.00 105.87 ? 961  VAL A CA    1 
ATOM   5459 C C     . VAL A 1 859 ? 16.554  23.510  7.788   1.00 108.27 ? 961  VAL A C     1 
ATOM   5460 O O     . VAL A 1 859 ? 16.289  23.136  8.918   1.00 110.93 ? 961  VAL A O     1 
ATOM   5461 C CB    . VAL A 1 859 ? 15.965  25.902  7.480   1.00 147.15 ? 961  VAL A CB    1 
ATOM   5462 C CG1   . VAL A 1 859 ? 15.320  26.137  8.838   1.00 147.08 ? 961  VAL A CG1   1 
ATOM   5463 C CG2   . VAL A 1 859 ? 16.470  27.212  6.869   1.00 147.25 ? 961  VAL A CG2   1 
ATOM   5464 N N     . LEU A 1 860 ? 16.373  22.760  6.701   1.00 159.32 ? 962  LEU A N     1 
ATOM   5465 C CA    . LEU A 1 860 ? 15.784  21.424  6.756   1.00 156.15 ? 962  LEU A CA    1 
ATOM   5466 C C     . LEU A 1 860 ? 16.822  20.302  6.718   1.00 164.70 ? 962  LEU A C     1 
ATOM   5467 O O     . LEU A 1 860 ? 16.586  19.182  7.193   1.00 169.77 ? 962  LEU A O     1 
ATOM   5468 C CB    . LEU A 1 860 ? 14.763  21.277  5.615   1.00 99.76  ? 962  LEU A CB    1 
ATOM   5469 C CG    . LEU A 1 860 ? 13.546  22.243  5.485   1.00 89.14  ? 962  LEU A CG    1 
ATOM   5470 C CD1   . LEU A 1 860 ? 12.654  22.182  6.752   1.00 86.84  ? 962  LEU A CD1   1 
ATOM   5471 C CD2   . LEU A 1 860 ? 14.004  23.654  5.202   1.00 86.58  ? 962  LEU A CD2   1 
ATOM   5472 N N     . CYS A 1 861 ? 17.980  20.582  6.147   1.00 169.05 ? 963  CYS A N     1 
ATOM   5473 C CA    . CYS A 1 861 ? 18.989  19.549  6.193   1.00 168.30 ? 963  CYS A CA    1 
ATOM   5474 C C     . CYS A 1 861 ? 19.444  19.653  7.696   1.00 167.81 ? 963  CYS A C     1 
ATOM   5475 O O     . CYS A 1 861 ? 19.340  18.696  8.436   1.00 172.39 ? 963  CYS A O     1 
ATOM   5476 C CB    . CYS A 1 861 ? 20.007  19.704  5.015   1.00 142.85 ? 963  CYS A CB    1 
ATOM   5477 S SG    . CYS A 1 861 ? 19.292  18.754  3.497   1.00 141.21 ? 963  CYS A SG    1 
ATOM   5478 N N     . GLN A 1 862 ? 19.720  20.865  8.165   1.00 99.01  ? 964  GLN A N     1 
ATOM   5479 C CA    . GLN A 1 862 ? 20.156  21.160  9.544   1.00 102.47 ? 964  GLN A CA    1 
ATOM   5480 C C     . GLN A 1 862 ? 19.263  20.940  10.814  1.00 106.95 ? 964  GLN A C     1 
ATOM   5481 O O     . GLN A 1 862 ? 19.793  20.573  11.887  1.00 108.51 ? 964  GLN A O     1 
ATOM   5482 C CB    . GLN A 1 862 ? 20.612  22.622  9.515   1.00 97.63  ? 964  GLN A CB    1 
ATOM   5483 C CG    . GLN A 1 862 ? 21.038  23.057  8.099   1.00 100.12 ? 964  GLN A CG    1 
ATOM   5484 C CD    . GLN A 1 862 ? 22.531  23.014  7.848   1.00 103.31 ? 964  GLN A CD    1 
ATOM   5485 O OE1   . GLN A 1 862 ? 23.313  22.977  8.787   1.00 113.88 ? 964  GLN A OE1   1 
ATOM   5486 N NE2   . GLN A 1 862 ? 22.936  23.057  6.577   1.00 98.17  ? 964  GLN A NE2   1 
ATOM   5487 N N     . ASP A 1 863 ? 17.941  21.139  10.706  1.00 128.73 ? 965  ASP A N     1 
ATOM   5488 C CA    . ASP A 1 863 ? 17.045  21.061  11.889  1.00 145.90 ? 965  ASP A CA    1 
ATOM   5489 C C     . ASP A 1 863 ? 16.139  19.932  12.358  1.00 160.57 ? 965  ASP A C     1 
ATOM   5490 O O     . ASP A 1 863 ? 16.341  19.416  13.447  1.00 165.87 ? 965  ASP A O     1 
ATOM   5491 C CB    . ASP A 1 863 ? 16.175  22.311  11.954  1.00 199.97 ? 965  ASP A CB    1 
ATOM   5492 C CG    . ASP A 1 863 ? 15.307  22.351  13.179  1.00 199.97 ? 965  ASP A CG    1 
ATOM   5493 O OD1   . ASP A 1 863 ? 14.555  23.325  13.346  1.00 199.97 ? 965  ASP A OD1   1 
ATOM   5494 O OD2   . ASP A 1 863 ? 15.393  21.414  13.993  1.00 199.97 ? 965  ASP A OD2   1 
ATOM   5495 N N     . HIS A 1 864 ? 15.071  19.680  11.609  1.00 199.40 ? 966  HIS A N     1 
ATOM   5496 C CA    . HIS A 1 864 ? 14.129  18.609  11.902  1.00 199.40 ? 966  HIS A CA    1 
ATOM   5497 C C     . HIS A 1 864 ? 14.371  17.666  10.757  1.00 199.40 ? 966  HIS A C     1 
ATOM   5498 O O     . HIS A 1 864 ? 13.464  17.276  10.021  1.00 199.40 ? 966  HIS A O     1 
ATOM   5499 C CB    . HIS A 1 864 ? 12.693  19.124  11.881  1.00 200.00 ? 966  HIS A CB    1 
ATOM   5500 C CG    . HIS A 1 864 ? 12.240  19.703  13.185  1.00 200.00 ? 966  HIS A CG    1 
ATOM   5501 N ND1   . HIS A 1 864 ? 12.359  19.028  14.381  1.00 200.00 ? 966  HIS A ND1   1 
ATOM   5502 C CD2   . HIS A 1 864 ? 11.667  20.894  13.482  1.00 200.00 ? 966  HIS A CD2   1 
ATOM   5503 C CE1   . HIS A 1 864 ? 11.880  19.778  15.357  1.00 200.00 ? 966  HIS A CE1   1 
ATOM   5504 N NE2   . HIS A 1 864 ? 11.454  20.915  14.838  1.00 200.00 ? 966  HIS A NE2   1 
ATOM   5505 N N     . GLY A 1 865 ? 15.642  17.328  10.620  1.00 92.34  ? 967  GLY A N     1 
ATOM   5506 C CA    . GLY A 1 865 ? 16.224  16.849  9.387   1.00 76.10  ? 967  GLY A CA    1 
ATOM   5507 C C     . GLY A 1 865 ? 15.385  16.407  8.204   1.00 65.26  ? 967  GLY A C     1 
ATOM   5508 O O     . GLY A 1 865 ? 14.374  15.724  8.374   1.00 60.77  ? 967  GLY A O     1 
ATOM   5509 N N     . LEU A 1 866 ? 15.821  16.819  7.007   1.00 144.21 ? 968  LEU A N     1 
ATOM   5510 C CA    . LEU A 1 866 ? 15.208  16.448  5.723   1.00 139.97 ? 968  LEU A CA    1 
ATOM   5511 C C     . LEU A 1 866 ? 16.314  16.490  4.664   1.00 136.08 ? 968  LEU A C     1 
ATOM   5512 O O     . LEU A 1 866 ? 17.238  17.304  4.752   1.00 132.33 ? 968  LEU A O     1 
ATOM   5513 C CB    . LEU A 1 866 ? 14.056  17.394  5.319   1.00 115.10 ? 968  LEU A CB    1 
ATOM   5514 C CG    . LEU A 1 866 ? 12.608  17.104  5.786   1.00 116.08 ? 968  LEU A CG    1 
ATOM   5515 C CD1   . LEU A 1 866 ? 11.735  18.316  5.521   1.00 106.42 ? 968  LEU A CD1   1 
ATOM   5516 C CD2   . LEU A 1 866 ? 12.024  15.873  5.086   1.00 111.01 ? 968  LEU A CD2   1 
ATOM   5517 N N     . THR A 1 867 ? 16.207  15.609  3.671   1.00 123.95 ? 969  THR A N     1 
ATOM   5518 C CA    . THR A 1 867 ? 17.204  15.479  2.596   1.00 119.49 ? 969  THR A CA    1 
ATOM   5519 C C     . THR A 1 867 ? 16.893  16.320  1.373   1.00 114.45 ? 969  THR A C     1 
ATOM   5520 O O     . THR A 1 867 ? 15.731  16.475  1.001   1.00 112.37 ? 969  THR A O     1 
ATOM   5521 C CB    . THR A 1 867 ? 17.275  14.038  2.079   1.00 125.92 ? 969  THR A CB    1 
ATOM   5522 O OG1   . THR A 1 867 ? 15.977  13.661  1.594   1.00 123.54 ? 969  THR A OG1   1 
ATOM   5523 C CG2   . THR A 1 867 ? 17.727  13.071  3.184   1.00 126.89 ? 969  THR A CG2   1 
ATOM   5524 N N     . PRO A 1 868 ? 17.930  16.829  0.702   1.00 96.60  ? 970  PRO A N     1 
ATOM   5525 C CA    . PRO A 1 868 ? 17.769  17.658  -0.490  1.00 97.17  ? 970  PRO A CA    1 
ATOM   5526 C C     . PRO A 1 868 ? 16.653  17.227  -1.433  1.00 97.46  ? 970  PRO A C     1 
ATOM   5527 O O     . PRO A 1 868 ? 16.004  18.068  -2.076  1.00 97.71  ? 970  PRO A O     1 
ATOM   5528 C CB    . PRO A 1 868 ? 19.119  17.537  -1.189  1.00 89.13  ? 970  PRO A CB    1 
ATOM   5529 C CG    . PRO A 1 868 ? 20.049  17.433  -0.062  1.00 91.10  ? 970  PRO A CG    1 
ATOM   5530 C CD    . PRO A 1 868 ? 19.345  16.576  0.980   1.00 88.85  ? 970  PRO A CD    1 
ATOM   5531 N N     . ASP A 1 869 ? 16.411  15.925  -1.495  1.00 142.51 ? 971  ASP A N     1 
ATOM   5532 C CA    . ASP A 1 869 ? 15.463  15.394  -2.459  1.00 144.58 ? 971  ASP A CA    1 
ATOM   5533 C C     . ASP A 1 869 ? 14.004  15.442  -2.060  1.00 139.17 ? 971  ASP A C     1 
ATOM   5534 O O     . ASP A 1 869 ? 13.154  15.780  -2.879  1.00 135.25 ? 971  ASP A O     1 
ATOM   5535 C CB    . ASP A 1 869 ? 15.941  13.998  -2.893  1.00 200.00 ? 971  ASP A CB    1 
ATOM   5536 C CG    . ASP A 1 869 ? 17.400  14.024  -3.391  1.00 200.00 ? 971  ASP A CG    1 
ATOM   5537 O OD1   . ASP A 1 869 ? 17.838  15.093  -3.884  1.00 200.00 ? 971  ASP A OD1   1 
ATOM   5538 O OD2   . ASP A 1 869 ? 18.100  12.991  -3.294  1.00 200.00 ? 971  ASP A OD2   1 
ATOM   5539 N N     . GLN A 1 870 ? 13.716  15.119  -0.808  1.00 128.41 ? 972  GLN A N     1 
ATOM   5540 C CA    . GLN A 1 870 ? 12.357  15.223  -0.298  1.00 121.56 ? 972  GLN A CA    1 
ATOM   5541 C C     . GLN A 1 870 ? 11.994  16.697  -0.474  1.00 116.73 ? 972  GLN A C     1 
ATOM   5542 O O     . GLN A 1 870 ? 10.886  17.018  -0.874  1.00 120.12 ? 972  GLN A O     1 
ATOM   5543 C CB    . GLN A 1 870 ? 12.314  14.893  1.188   1.00 115.25 ? 972  GLN A CB    1 
ATOM   5544 C CG    . GLN A 1 870 ? 12.732  13.482  1.511   1.00 123.49 ? 972  GLN A CG    1 
ATOM   5545 C CD    . GLN A 1 870 ? 13.115  13.297  2.966   1.00 126.83 ? 972  GLN A CD    1 
ATOM   5546 O OE1   . GLN A 1 870 ? 14.138  13.817  3.433   1.00 128.70 ? 972  GLN A OE1   1 
ATOM   5547 N NE2   . GLN A 1 870 ? 12.290  12.557  3.696   1.00 126.33 ? 972  GLN A NE2   1 
ATOM   5548 N N     . VAL A 1 871 ? 12.941  17.582  -0.159  1.00 98.69  ? 973  VAL A N     1 
ATOM   5549 C CA    . VAL A 1 871 ? 12.771  19.032  -0.271  1.00 94.49  ? 973  VAL A CA    1 
ATOM   5550 C C     . VAL A 1 871 ? 12.460  19.425  -1.709  1.00 91.28  ? 973  VAL A C     1 
ATOM   5551 O O     . VAL A 1 871 ? 11.429  20.060  -1.991  1.00 90.01  ? 973  VAL A O     1 
ATOM   5552 C CB    . VAL A 1 871 ? 14.056  19.751  0.210   1.00 99.50  ? 973  VAL A CB    1 
ATOM   5553 C CG1   . VAL A 1 871 ? 14.119  21.193  -0.300  1.00 95.34  ? 973  VAL A CG1   1 
ATOM   5554 C CG2   . VAL A 1 871 ? 14.092  19.708  1.741   1.00 102.66 ? 973  VAL A CG2   1 
ATOM   5555 N N     . VAL A 1 872 ? 13.367  19.064  -2.611  1.00 91.99  ? 974  VAL A N     1 
ATOM   5556 C CA    . VAL A 1 872 ? 13.181  19.331  -4.026  1.00 88.98  ? 974  VAL A CA    1 
ATOM   5557 C C     . VAL A 1 872 ? 11.795  18.830  -4.450  1.00 84.74  ? 974  VAL A C     1 
ATOM   5558 O O     . VAL A 1 872 ? 11.132  19.452  -5.271  1.00 79.88  ? 974  VAL A O     1 
ATOM   5559 C CB    . VAL A 1 872 ? 14.305  18.617  -4.850  1.00 103.16 ? 974  VAL A CB    1 
ATOM   5560 C CG1   . VAL A 1 872 ? 13.788  18.196  -6.232  1.00 104.50 ? 974  VAL A CG1   1 
ATOM   5561 C CG2   . VAL A 1 872 ? 15.536  19.550  -4.985  1.00 103.03 ? 974  VAL A CG2   1 
ATOM   5562 N N     . ALA A 1 873 ? 11.375  17.712  -3.851  1.00 87.22  ? 975  ALA A N     1 
ATOM   5563 C CA    . ALA A 1 873 ? 10.107  17.052  -4.152  1.00 87.08  ? 975  ALA A CA    1 
ATOM   5564 C C     . ALA A 1 873 ? 8.890   17.808  -3.671  1.00 87.43  ? 975  ALA A C     1 
ATOM   5565 O O     . ALA A 1 873 ? 7.786   17.565  -4.141  1.00 90.66  ? 975  ALA A O     1 
ATOM   5566 C CB    . ALA A 1 873 ? 10.103  15.625  -3.585  1.00 130.41 ? 975  ALA A CB    1 
ATOM   5567 N N     . ILE A 1 874 ? 9.082   18.720  -2.726  1.00 103.29 ? 976  ILE A N     1 
ATOM   5568 C CA    . ILE A 1 874 ? 7.977   19.534  -2.221  1.00 98.20  ? 976  ILE A CA    1 
ATOM   5569 C C     . ILE A 1 874 ? 7.917   20.773  -3.125  1.00 94.47  ? 976  ILE A C     1 
ATOM   5570 O O     . ILE A 1 874 ? 6.866   21.235  -3.549  1.00 97.24  ? 976  ILE A O     1 
ATOM   5571 C CB    . ILE A 1 874 ? 8.237   20.037  -0.751  1.00 76.65  ? 976  ILE A CB    1 
ATOM   5572 C CG1   . ILE A 1 874 ? 8.437   18.867  0.210   1.00 75.48  ? 976  ILE A CG1   1 
ATOM   5573 C CG2   . ILE A 1 874 ? 7.062   20.879  -0.281  1.00 73.53  ? 976  ILE A CG2   1 
ATOM   5574 C CD1   . ILE A 1 874 ? 9.087   19.258  1.522   1.00 75.49  ? 976  ILE A CD1   1 
ATOM   5575 N N     . ALA A 1 875 ? 9.097   21.265  -3.432  1.00 53.09  ? 977  ALA A N     1 
ATOM   5576 C CA    . ALA A 1 875 ? 9.289   22.465  -4.162  1.00 49.46  ? 977  ALA A CA    1 
ATOM   5577 C C     . ALA A 1 875 ? 9.015   22.406  -5.618  1.00 50.20  ? 977  ALA A C     1 
ATOM   5578 O O     . ALA A 1 875 ? 9.155   23.411  -6.312  1.00 51.44  ? 977  ALA A O     1 
ATOM   5579 C CB    . ALA A 1 875 ? 10.697  22.914  -3.939  1.00 43.38  ? 977  ALA A CB    1 
ATOM   5580 N N     . SER A 1 876 ? 8.650   21.241  -6.130  1.00 74.59  ? 978  SER A N     1 
ATOM   5581 C CA    . SER A 1 876 ? 8.418   21.162  -7.559  1.00 72.16  ? 978  SER A CA    1 
ATOM   5582 C C     . SER A 1 876 ? 6.991   21.107  -7.960  1.00 70.24  ? 978  SER A C     1 
ATOM   5583 O O     . SER A 1 876 ? 6.678   21.026  -9.126  1.00 72.32  ? 978  SER A O     1 
ATOM   5584 C CB    . SER A 1 876 ? 9.175   20.024  -8.208  1.00 76.79  ? 978  SER A CB    1 
ATOM   5585 O OG    . SER A 1 876 ? 9.264   20.357  -9.578  1.00 77.05  ? 978  SER A OG    1 
ATOM   5586 N N     . ASN A 1 877 ? 6.111   21.111  -6.988  1.00 57.68  ? 979  ASN A N     1 
ATOM   5587 C CA    . ASN A 1 877 ? 4.680   21.212  -7.255  1.00 56.01  ? 979  ASN A CA    1 
ATOM   5588 C C     . ASN A 1 877 ? 4.444   22.704  -7.625  1.00 53.58  ? 979  ASN A C     1 
ATOM   5589 O O     . ASN A 1 877 ? 5.383   23.482  -7.693  1.00 56.57  ? 979  ASN A O     1 
ATOM   5590 C CB    . ASN A 1 877 ? 3.938   20.947  -5.956  1.00 77.76  ? 979  ASN A CB    1 
ATOM   5591 C CG    . ASN A 1 877 ? 3.208   19.664  -5.976  1.00 76.54  ? 979  ASN A CG    1 
ATOM   5592 O OD1   . ASN A 1 877 ? 3.726   18.698  -6.532  1.00 76.70  ? 979  ASN A OD1   1 
ATOM   5593 N ND2   . ASN A 1 877 ? 1.990   19.618  -5.370  1.00 75.86  ? 979  ASN A ND2   1 
ATOM   5594 N N     . ILE A 1 878 ? 3.193   23.097  -7.867  1.00 39.95  ? 980  ILE A N     1 
ATOM   5595 C CA    . ILE A 1 878 ? 2.831   24.521  -8.033  1.00 40.22  ? 980  ILE A CA    1 
ATOM   5596 C C     . ILE A 1 878 ? 2.835   24.967  -6.564  1.00 41.83  ? 980  ILE A C     1 
ATOM   5597 O O     . ILE A 1 878 ? 2.987   26.146  -6.291  1.00 38.94  ? 980  ILE A O     1 
ATOM   5598 C CB    . ILE A 1 878 ? 1.386   24.794  -8.597  1.00 54.31  ? 980  ILE A CB    1 
ATOM   5599 C CG1   . ILE A 1 878 ? 0.532   23.510  -8.579  1.00 55.29  ? 980  ILE A CG1   1 
ATOM   5600 C CG2   . ILE A 1 878 ? 1.474   25.430  -9.937  1.00 48.48  ? 980  ILE A CG2   1 
ATOM   5601 C CD1   . ILE A 1 878 ? -0.338  23.298  -7.258  1.00 54.90  ? 980  ILE A CD1   1 
ATOM   5602 N N     . GLY A 1 879 ? 2.622   24.035  -5.609  1.00 67.28  ? 981  GLY A N     1 
ATOM   5603 C CA    . GLY A 1 879 ? 2.733   24.363  -4.174  1.00 72.02  ? 981  GLY A CA    1 
ATOM   5604 C C     . GLY A 1 879 ? 3.950   25.292  -4.031  1.00 71.35  ? 981  GLY A C     1 
ATOM   5605 O O     . GLY A 1 879 ? 3.788   26.392  -3.570  1.00 66.02  ? 981  GLY A O     1 
ATOM   5606 N N     . GLY A 1 880 ? 5.139   24.833  -4.455  1.00 70.37  ? 982  GLY A N     1 
ATOM   5607 C CA    . GLY A 1 880 ? 6.378   25.600  -4.462  1.00 73.60  ? 982  GLY A CA    1 
ATOM   5608 C C     . GLY A 1 880 ? 6.903   26.352  -3.247  1.00 73.19  ? 982  GLY A C     1 
ATOM   5609 O O     . GLY A 1 880 ? 7.054   25.823  -2.136  1.00 71.70  ? 982  GLY A O     1 
ATOM   5610 N N     . LYS A 1 881 ? 7.249   27.600  -3.507  1.00 91.72  ? 983  LYS A N     1 
ATOM   5611 C CA    . LYS A 1 881 ? 7.734   28.514  -2.503  1.00 97.34  ? 983  LYS A CA    1 
ATOM   5612 C C     . LYS A 1 881 ? 6.764   28.626  -1.308  1.00 101.63 ? 983  LYS A C     1 
ATOM   5613 O O     . LYS A 1 881 ? 7.081   29.300  -0.326  1.00 109.24 ? 983  LYS A O     1 
ATOM   5614 C CB    . LYS A 1 881 ? 7.909   29.873  -3.180  1.00 66.52  ? 983  LYS A CB    1 
ATOM   5615 C CG    . LYS A 1 881 ? 7.956   31.106  -2.282  1.00 64.75  ? 983  LYS A CG    1 
ATOM   5616 C CD    . LYS A 1 881 ? 6.589   31.697  -1.965  1.00 63.12  ? 983  LYS A CD    1 
ATOM   5617 C CE    . LYS A 1 881 ? 6.752   33.153  -1.549  1.00 63.53  ? 983  LYS A CE    1 
ATOM   5618 N NZ    . LYS A 1 881 ? 7.370   33.992  -2.655  1.00 59.98  ? 983  LYS A NZ    1 
ATOM   5619 N N     . GLN A 1 882 ? 5.616   27.944  -1.367  1.00 78.36  ? 984  GLN A N     1 
ATOM   5620 C CA    . GLN A 1 882 ? 4.586   28.078  -0.333  1.00 77.32  ? 984  GLN A CA    1 
ATOM   5621 C C     . GLN A 1 882 ? 4.407   26.854  0.534   1.00 78.29  ? 984  GLN A C     1 
ATOM   5622 O O     . GLN A 1 882 ? 4.211   26.968  1.767   1.00 80.49  ? 984  GLN A O     1 
ATOM   5623 C CB    . GLN A 1 882 ? 3.247   28.436  -0.982  1.00 71.88  ? 984  GLN A CB    1 
ATOM   5624 C CG    . GLN A 1 882 ? 2.380   29.364  -0.175  1.00 77.11  ? 984  GLN A CG    1 
ATOM   5625 C CD    . GLN A 1 882 ? 2.566   30.795  -0.570  1.00 83.02  ? 984  GLN A CD    1 
ATOM   5626 O OE1   . GLN A 1 882 ? 3.588   31.147  -1.171  1.00 83.03  ? 984  GLN A OE1   1 
ATOM   5627 N NE2   . GLN A 1 882 ? 1.583   31.645  -0.237  1.00 88.53  ? 984  GLN A NE2   1 
ATOM   5628 N N     . ALA A 1 883 ? 4.452   25.687  -0.105  1.00 72.55  ? 985  ALA A N     1 
ATOM   5629 C CA    . ALA A 1 883 ? 4.310   24.465  0.632   1.00 68.63  ? 985  ALA A CA    1 
ATOM   5630 C C     . ALA A 1 883 ? 5.607   24.245  1.422   1.00 70.59  ? 985  ALA A C     1 
ATOM   5631 O O     . ALA A 1 883 ? 5.559   23.677  2.528   1.00 73.32  ? 985  ALA A O     1 
ATOM   5632 C CB    . ALA A 1 883 ? 4.045   23.361  -0.280  1.00 63.38  ? 985  ALA A CB    1 
ATOM   5633 N N     . LEU A 1 884 ? 6.749   24.694  0.890   1.00 58.16  ? 986  LEU A N     1 
ATOM   5634 C CA    . LEU A 1 884 ? 8.011   24.604  1.640   1.00 61.57  ? 986  LEU A CA    1 
ATOM   5635 C C     . LEU A 1 884 ? 7.909   25.479  2.932   1.00 66.93  ? 986  LEU A C     1 
ATOM   5636 O O     . LEU A 1 884 ? 8.093   24.981  4.067   1.00 71.00  ? 986  LEU A O     1 
ATOM   5637 C CB    . LEU A 1 884 ? 9.171   25.165  0.837   1.00 60.17  ? 986  LEU A CB    1 
ATOM   5638 C CG    . LEU A 1 884 ? 9.756   24.454  -0.347  1.00 57.80  ? 986  LEU A CG    1 
ATOM   5639 C CD1   . LEU A 1 884 ? 11.047  25.191  -0.756  1.00 55.55  ? 986  LEU A CD1   1 
ATOM   5640 C CD2   . LEU A 1 884 ? 10.027  22.974  0.023   1.00 55.09  ? 986  LEU A CD2   1 
ATOM   5641 N N     . GLU A 1 885 ? 7.629   26.785  2.749   1.00 74.56  ? 987  GLU A N     1 
ATOM   5642 C CA    . GLU A 1 885 ? 7.547   27.741  3.865   1.00 79.07  ? 987  GLU A CA    1 
ATOM   5643 C C     . GLU A 1 885 ? 6.706   27.220  4.988   1.00 82.90  ? 987  GLU A C     1 
ATOM   5644 O O     . GLU A 1 885 ? 7.189   27.139  6.107   1.00 84.87  ? 987  GLU A O     1 
ATOM   5645 C CB    . GLU A 1 885 ? 6.997   29.087  3.393   1.00 92.47  ? 987  GLU A CB    1 
ATOM   5646 C CG    . GLU A 1 885 ? 8.075   30.067  2.904   1.00 93.76  ? 987  GLU A CG    1 
ATOM   5647 C CD    . GLU A 1 885 ? 7.486   31.404  2.489   1.00 94.62  ? 987  GLU A CD    1 
ATOM   5648 O OE1   . GLU A 1 885 ? 8.301   32.349  2.312   1.00 96.38  ? 987  GLU A OE1   1 
ATOM   5649 O OE2   . GLU A 1 885 ? 6.229   31.484  2.344   1.00 89.22  ? 987  GLU A OE2   1 
ATOM   5650 N N     . THR A 1 886 ? 5.457   26.869  4.679   1.00 120.97 ? 988  THR A N     1 
ATOM   5651 C CA    . THR A 1 886 ? 4.546   26.299  5.670   1.00 129.93 ? 988  THR A CA    1 
ATOM   5652 C C     . THR A 1 886 ? 5.141   25.035  6.310   1.00 133.87 ? 988  THR A C     1 
ATOM   5653 O O     . THR A 1 886 ? 5.036   24.860  7.533   1.00 142.06 ? 988  THR A O     1 
ATOM   5654 C CB    . THR A 1 886 ? 3.166   25.956  5.052   1.00 107.58 ? 988  THR A CB    1 
ATOM   5655 O OG1   . THR A 1 886 ? 2.429   27.168  4.852   1.00 112.38 ? 988  THR A OG1   1 
ATOM   5656 C CG2   . THR A 1 886 ? 2.362   25.007  5.965   1.00 102.67 ? 988  THR A CG2   1 
ATOM   5657 N N     . VAL A 1 887 ? 5.793   24.179  5.510   1.00 109.01 ? 989  VAL A N     1 
ATOM   5658 C CA    . VAL A 1 887 ? 6.359   22.948  6.060   1.00 105.82 ? 989  VAL A CA    1 
ATOM   5659 C C     . VAL A 1 887 ? 7.428   23.145  7.121   1.00 109.15 ? 989  VAL A C     1 
ATOM   5660 O O     . VAL A 1 887 ? 7.591   22.276  7.972   1.00 114.43 ? 989  VAL A O     1 
ATOM   5661 C CB    . VAL A 1 887 ? 6.794   21.962  4.967   1.00 67.74  ? 989  VAL A CB    1 
ATOM   5662 C CG1   . VAL A 1 887 ? 8.292   21.650  5.042   1.00 67.79  ? 989  VAL A CG1   1 
ATOM   5663 C CG2   . VAL A 1 887 ? 5.965   20.697  5.125   1.00 66.06  ? 989  VAL A CG2   1 
ATOM   5664 N N     . GLN A 1 888 ? 8.153   24.262  7.103   1.00 81.63  ? 990  GLN A N     1 
ATOM   5665 C CA    . GLN A 1 888 ? 9.066   24.489  8.227   1.00 86.63  ? 990  GLN A CA    1 
ATOM   5666 C C     . GLN A 1 888 ? 8.147   24.973  9.400   1.00 83.98  ? 990  GLN A C     1 
ATOM   5667 O O     . GLN A 1 888 ? 8.143   24.384  10.476  1.00 87.84  ? 990  GLN A O     1 
ATOM   5668 C CB    . GLN A 1 888 ? 10.151  25.545  7.929   1.00 130.15 ? 990  GLN A CB    1 
ATOM   5669 C CG    . GLN A 1 888 ? 11.512  25.184  8.577   1.00 140.18 ? 990  GLN A CG    1 
ATOM   5670 C CD    . GLN A 1 888 ? 11.407  24.714  10.037  1.00 143.27 ? 990  GLN A CD    1 
ATOM   5671 O OE1   . GLN A 1 888 ? 10.904  25.433  10.900  1.00 153.02 ? 990  GLN A OE1   1 
ATOM   5672 N NE2   . GLN A 1 888 ? 11.890  23.510  10.309  1.00 135.47 ? 990  GLN A NE2   1 
ATOM   5673 N N     . ARG A 1 889 ? 7.367   26.028  9.168   1.00 82.43  ? 991  ARG A N     1 
ATOM   5674 C CA    . ARG A 1 889 ? 6.430   26.574  10.148  1.00 80.57  ? 991  ARG A CA    1 
ATOM   5675 C C     . ARG A 1 889 ? 5.586   25.511  10.850  1.00 81.97  ? 991  ARG A C     1 
ATOM   5676 O O     . ARG A 1 889 ? 4.975   25.793  11.886  1.00 82.40  ? 991  ARG A O     1 
ATOM   5677 C CB    . ARG A 1 889 ? 5.481   27.583  9.457   1.00 102.66 ? 991  ARG A CB    1 
ATOM   5678 C CG    . ARG A 1 889 ? 4.089   27.770  10.134  1.00 100.63 ? 991  ARG A CG    1 
ATOM   5679 C CD    . ARG A 1 889 ? 3.327   28.985  9.612   1.00 98.40  ? 991  ARG A CD    1 
ATOM   5680 N NE    . ARG A 1 889 ? 2.836   28.797  8.254   1.00 94.76  ? 991  ARG A NE    1 
ATOM   5681 C CZ    . ARG A 1 889 ? 2.910   29.706  7.291   1.00 91.29  ? 991  ARG A CZ    1 
ATOM   5682 N NH1   . ARG A 1 889 ? 3.458   30.879  7.514   1.00 88.34  ? 991  ARG A NH1   1 
ATOM   5683 N NH2   . ARG A 1 889 ? 2.423   29.437  6.095   1.00 90.81  ? 991  ARG A NH2   1 
ATOM   5684 N N     . LEU A 1 890 ? 5.536   24.294  10.313  1.00 94.73  ? 992  LEU A N     1 
ATOM   5685 C CA    . LEU A 1 890 ? 4.691   23.283  10.941  1.00 97.71  ? 992  LEU A CA    1 
ATOM   5686 C C     . LEU A 1 890 ? 5.343   21.909  11.230  1.00 104.35 ? 992  LEU A C     1 
ATOM   5687 O O     . LEU A 1 890 ? 4.709   20.979  11.774  1.00 102.07 ? 992  LEU A O     1 
ATOM   5688 C CB    . LEU A 1 890 ? 3.392   23.125  10.136  1.00 95.44  ? 992  LEU A CB    1 
ATOM   5689 C CG    . LEU A 1 890 ? 2.398   24.303  10.042  1.00 95.68  ? 992  LEU A CG    1 
ATOM   5690 C CD1   . LEU A 1 890 ? 1.186   23.796  9.281   1.00 99.72  ? 992  LEU A CD1   1 
ATOM   5691 C CD2   . LEU A 1 890 ? 1.957   24.840  11.406  1.00 97.69  ? 992  LEU A CD2   1 
ATOM   5692 N N     . LEU A 1 891 ? 6.606   21.766  10.867  1.00 95.20  ? 993  LEU A N     1 
ATOM   5693 C CA    . LEU A 1 891 ? 7.310   20.536  11.198  1.00 97.23  ? 993  LEU A CA    1 
ATOM   5694 C C     . LEU A 1 891 ? 7.135   20.459  12.752  1.00 96.64  ? 993  LEU A C     1 
ATOM   5695 O O     . LEU A 1 891 ? 6.654   19.467  13.274  1.00 91.94  ? 993  LEU A O     1 
ATOM   5696 C CB    . LEU A 1 891 ? 8.790   20.647  10.773  1.00 133.46 ? 993  LEU A CB    1 
ATOM   5697 C CG    . LEU A 1 891 ? 9.555   19.348  10.515  1.00 135.53 ? 993  LEU A CG    1 
ATOM   5698 C CD1   . LEU A 1 891 ? 8.925   18.585  9.359   1.00 128.70 ? 993  LEU A CD1   1 
ATOM   5699 C CD2   . LEU A 1 891 ? 10.968  19.642  10.168  1.00 136.54 ? 993  LEU A CD2   1 
ATOM   5700 N N     . PRO A 1 892 ? 7.530   21.518  13.500  1.00 106.85 ? 994  PRO A N     1 
ATOM   5701 C CA    . PRO A 1 892 ? 7.369   21.538  14.946  1.00 108.60 ? 994  PRO A CA    1 
ATOM   5702 C C     . PRO A 1 892 ? 6.061   20.934  15.462  1.00 109.26 ? 994  PRO A C     1 
ATOM   5703 O O     . PRO A 1 892 ? 6.071   19.920  16.147  1.00 117.67 ? 994  PRO A O     1 
ATOM   5704 C CB    . PRO A 1 892 ? 7.414   23.026  15.263  1.00 103.88 ? 994  PRO A CB    1 
ATOM   5705 C CG    . PRO A 1 892 ? 8.380   23.583  14.273  1.00 102.15 ? 994  PRO A CG    1 
ATOM   5706 C CD    . PRO A 1 892 ? 8.445   22.609  13.112  1.00 102.68 ? 994  PRO A CD    1 
ATOM   5707 N N     . VAL A 1 893 ? 4.941   21.563  15.127  1.00 131.03 ? 995  VAL A N     1 
ATOM   5708 C CA    . VAL A 1 893 ? 3.636   21.162  15.659  1.00 136.44 ? 995  VAL A CA    1 
ATOM   5709 C C     . VAL A 1 893 ? 3.063   19.792  15.299  1.00 139.52 ? 995  VAL A C     1 
ATOM   5710 O O     . VAL A 1 893 ? 2.592   19.053  16.185  1.00 139.74 ? 995  VAL A O     1 
ATOM   5711 C CB    . VAL A 1 893 ? 2.549   22.274  15.364  1.00 142.65 ? 995  VAL A CB    1 
ATOM   5712 C CG1   . VAL A 1 893 ? 1.174   21.865  15.921  1.00 144.92 ? 995  VAL A CG1   1 
ATOM   5713 C CG2   . VAL A 1 893 ? 2.975   23.605  15.980  1.00 143.21 ? 995  VAL A CG2   1 
ATOM   5714 N N     . LEU A 1 894 ? 3.117   19.445  14.016  1.00 157.95 ? 996  LEU A N     1 
ATOM   5715 C CA    . LEU A 1 894 ? 2.546   18.186  13.541  1.00 154.58 ? 996  LEU A CA    1 
ATOM   5716 C C     . LEU A 1 894 ? 3.263   16.906  13.974  1.00 158.80 ? 996  LEU A C     1 
ATOM   5717 O O     . LEU A 1 894 ? 2.619   15.879  14.182  1.00 162.96 ? 996  LEU A O     1 
ATOM   5718 C CB    . LEU A 1 894 ? 2.375   18.231  12.012  1.00 117.94 ? 996  LEU A CB    1 
ATOM   5719 C CG    . LEU A 1 894 ? 1.124   18.960  11.467  1.00 109.13 ? 996  LEU A CG    1 
ATOM   5720 C CD1   . LEU A 1 894 ? 1.228   19.100  9.960   1.00 103.55 ? 996  LEU A CD1   1 
ATOM   5721 C CD2   . LEU A 1 894 ? -0.144  18.221  11.840  1.00 105.86 ? 996  LEU A CD2   1 
ATOM   5722 N N     . CYS A 1 895 ? 4.587   16.968  14.102  1.00 112.71 ? 997  CYS A N     1 
ATOM   5723 C CA    . CYS A 1 895 ? 5.386   15.824  14.556  1.00 117.03 ? 997  CYS A CA    1 
ATOM   5724 C C     . CYS A 1 895 ? 5.417   15.764  16.092  1.00 118.45 ? 997  CYS A C     1 
ATOM   5725 O O     . CYS A 1 895 ? 5.396   14.677  16.677  1.00 111.16 ? 997  CYS A O     1 
ATOM   5726 C CB    . CYS A 1 895 ? 6.821   15.921  14.027  1.00 196.68 ? 997  CYS A CB    1 
ATOM   5727 S SG    . CYS A 1 895 ? 6.943   15.838  12.238  1.00 195.38 ? 997  CYS A SG    1 
ATOM   5728 N N     . GLN A 1 896 ? 5.476   16.933  16.735  1.00 195.09 ? 998  GLN A N     1 
ATOM   5729 C CA    . GLN A 1 896 ? 5.491   17.013  18.192  1.00 195.09 ? 998  GLN A CA    1 
ATOM   5730 C C     . GLN A 1 896 ? 4.079   17.154  18.796  1.00 195.09 ? 998  GLN A C     1 
ATOM   5731 O O     . GLN A 1 896 ? 3.587   16.217  19.422  1.00 195.09 ? 998  GLN A O     1 
ATOM   5732 C CB    . GLN A 1 896 ? 6.419   18.151  18.646  1.00 181.96 ? 998  GLN A CB    1 
ATOM   5733 C CG    . GLN A 1 896 ? 6.353   18.493  20.129  1.00 191.36 ? 998  GLN A CG    1 
ATOM   5734 C CD    . GLN A 1 896 ? 5.328   19.586  20.429  1.00 199.36 ? 998  GLN A CD    1 
ATOM   5735 O OE1   . GLN A 1 896 ? 5.018   20.417  19.565  1.00 199.75 ? 998  GLN A OE1   1 
ATOM   5736 N NE2   . GLN A 1 896 ? 4.818   19.607  21.662  1.00 199.75 ? 998  GLN A NE2   1 
ATOM   5737 N N     . ASP A 1 897 ? 3.421   18.294  18.589  1.00 149.42 ? 999  ASP A N     1 
ATOM   5738 C CA    . ASP A 1 897 ? 2.085   18.527  19.150  1.00 145.11 ? 999  ASP A CA    1 
ATOM   5739 C C     . ASP A 1 897 ? 1.053   17.484  18.782  1.00 139.06 ? 999  ASP A C     1 
ATOM   5740 O O     . ASP A 1 897 ? 0.369   16.925  19.646  1.00 135.78 ? 999  ASP A O     1 
ATOM   5741 C CB    . ASP A 1 897 ? 1.523   19.895  18.722  1.00 159.79 ? 999  ASP A CB    1 
ATOM   5742 C CG    . ASP A 1 897 ? 1.847   21.018  19.712  1.00 167.26 ? 999  ASP A CG    1 
ATOM   5743 O OD1   . ASP A 1 897 ? 2.209   20.718  20.870  1.00 178.28 ? 999  ASP A OD1   1 
ATOM   5744 O OD2   . ASP A 1 897 ? 1.721   22.208  19.335  1.00 162.28 ? 999  ASP A OD2   1 
ATOM   5745 N N     . HIS A 1 898 ? 0.964   17.217  17.488  1.00 111.82 ? 1000 HIS A N     1 
ATOM   5746 C CA    . HIS A 1 898 ? -0.043  16.315  16.945  1.00 113.08 ? 1000 HIS A CA    1 
ATOM   5747 C C     . HIS A 1 898 ? 0.377   14.832  16.904  1.00 111.84 ? 1000 HIS A C     1 
ATOM   5748 O O     . HIS A 1 898 ? -0.426  13.939  17.169  1.00 105.61 ? 1000 HIS A O     1 
ATOM   5749 C CB    . HIS A 1 898 ? -0.439  16.841  15.545  1.00 134.73 ? 1000 HIS A CB    1 
ATOM   5750 C CG    . HIS A 1 898 ? -1.884  17.221  15.403  1.00 136.23 ? 1000 HIS A CG    1 
ATOM   5751 N ND1   . HIS A 1 898 ? -2.730  17.385  16.487  1.00 135.69 ? 1000 HIS A ND1   1 
ATOM   5752 C CD2   . HIS A 1 898 ? -2.640  17.479  14.309  1.00 133.41 ? 1000 HIS A CD2   1 
ATOM   5753 C CE1   . HIS A 1 898 ? -3.930  17.717  16.057  1.00 134.13 ? 1000 HIS A CE1   1 
ATOM   5754 N NE2   . HIS A 1 898 ? -3.909  17.783  14.735  1.00 131.07 ? 1000 HIS A NE2   1 
ATOM   5755 N N     . GLY A 1 899 ? 1.640   14.587  16.567  1.00 145.69 ? 1001 GLY A N     1 
ATOM   5756 C CA    . GLY A 1 899 ? 2.165   13.232  16.483  1.00 141.32 ? 1001 GLY A CA    1 
ATOM   5757 C C     . GLY A 1 899 ? 2.245   12.691  15.061  1.00 139.33 ? 1001 GLY A C     1 
ATOM   5758 O O     . GLY A 1 899 ? 1.451   11.824  14.697  1.00 134.27 ? 1001 GLY A O     1 
ATOM   5759 N N     . LEU A 1 900 ? 3.217   13.171  14.278  1.00 163.98 ? 1002 LEU A N     1 
ATOM   5760 C CA    . LEU A 1 900 ? 3.359   12.764  12.883  1.00 159.65 ? 1002 LEU A CA    1 
ATOM   5761 C C     . LEU A 1 900 ? 4.799   12.458  12.479  1.00 158.47 ? 1002 LEU A C     1 
ATOM   5762 O O     . LEU A 1 900 ? 5.734   12.755  13.226  1.00 163.94 ? 1002 LEU A O     1 
ATOM   5763 C CB    . LEU A 1 900 ? 2.773   13.855  11.989  1.00 145.34 ? 1002 LEU A CB    1 
ATOM   5764 C CG    . LEU A 1 900 ? 1.804   13.384  10.909  1.00 143.16 ? 1002 LEU A CG    1 
ATOM   5765 C CD1   . LEU A 1 900 ? 0.591   12.748  11.561  1.00 142.49 ? 1002 LEU A CD1   1 
ATOM   5766 C CD2   . LEU A 1 900 ? 1.379   14.554  10.031  1.00 137.96 ? 1002 LEU A CD2   1 
ATOM   5767 N N     . THR A 1 901 ? 4.970   11.880  11.291  1.00 96.60  ? 1003 THR A N     1 
ATOM   5768 C CA    . THR A 1 901 ? 6.292   11.490  10.815  1.00 97.70  ? 1003 THR A CA    1 
ATOM   5769 C C     . THR A 1 901 ? 6.741   12.270  9.590   1.00 98.39  ? 1003 THR A C     1 
ATOM   5770 O O     . THR A 1 901 ? 5.970   12.413  8.641   1.00 100.39 ? 1003 THR A O     1 
ATOM   5771 C CB    . THR A 1 901 ? 6.330   9.970   10.485  1.00 99.23  ? 1003 THR A CB    1 
ATOM   5772 O OG1   . THR A 1 901 ? 5.697   9.706   9.217   1.00 99.85  ? 1003 THR A OG1   1 
ATOM   5773 C CG2   . THR A 1 901 ? 5.606   9.168   11.591  1.00 95.52  ? 1003 THR A CG2   1 
ATOM   5774 N N     . LEU A 1 902 ? 7.986   12.770  9.624   1.00 117.44 ? 1004 LEU A N     1 
ATOM   5775 C CA    . LEU A 1 902 ? 8.608   13.553  8.531   1.00 113.73 ? 1004 LEU A CA    1 
ATOM   5776 C C     . LEU A 1 902 ? 8.281   13.105  7.104   1.00 112.93 ? 1004 LEU A C     1 
ATOM   5777 O O     . LEU A 1 902 ? 8.311   13.925  6.174   1.00 110.56 ? 1004 LEU A O     1 
ATOM   5778 C CB    . LEU A 1 902 ? 10.128  13.546  8.680   1.00 102.10 ? 1004 LEU A CB    1 
ATOM   5779 C CG    . LEU A 1 902 ? 10.764  14.484  9.694   1.00 99.88  ? 1004 LEU A CG    1 
ATOM   5780 C CD1   . LEU A 1 902 ? 11.957  13.814  10.381  1.00 104.81 ? 1004 LEU A CD1   1 
ATOM   5781 C CD2   . LEU A 1 902 ? 11.199  15.744  8.978   1.00 102.40 ? 1004 LEU A CD2   1 
ATOM   5782 N N     . ASP A 1 903 ? 7.991   11.811  6.941   1.00 149.68 ? 1005 ASP A N     1 
ATOM   5783 C CA    . ASP A 1 903 ? 7.691   11.230  5.637   1.00 158.26 ? 1005 ASP A CA    1 
ATOM   5784 C C     . ASP A 1 903 ? 6.202   11.211  5.273   1.00 159.72 ? 1005 ASP A C     1 
ATOM   5785 O O     . ASP A 1 903 ? 5.833   10.833  4.145   1.00 156.49 ? 1005 ASP A O     1 
ATOM   5786 C CB    . ASP A 1 903 ? 8.319   9.839   5.534   1.00 199.71 ? 1005 ASP A CB    1 
ATOM   5787 C CG    . ASP A 1 903 ? 9.829   9.866   5.812   1.00 199.71 ? 1005 ASP A CG    1 
ATOM   5788 O OD1   . ASP A 1 903 ? 10.467  10.921  5.586   1.00 199.71 ? 1005 ASP A OD1   1 
ATOM   5789 O OD2   . ASP A 1 903 ? 10.381  8.829   6.245   1.00 199.71 ? 1005 ASP A OD2   1 
ATOM   5790 N N     . GLN A 1 904 ? 5.367   11.618  6.237   1.00 200.00 ? 1006 GLN A N     1 
ATOM   5791 C CA    . GLN A 1 904 ? 3.919   11.797  6.032   1.00 200.00 ? 1006 GLN A CA    1 
ATOM   5792 C C     . GLN A 1 904 ? 3.706   13.274  5.664   1.00 200.00 ? 1006 GLN A C     1 
ATOM   5793 O O     . GLN A 1 904 ? 2.943   13.594  4.748   1.00 200.00 ? 1006 GLN A O     1 
ATOM   5794 C CB    . GLN A 1 904 ? 3.112   11.514  7.296   1.00 115.38 ? 1006 GLN A CB    1 
ATOM   5795 C CG    . GLN A 1 904 ? 2.926   10.048  7.578   1.00 125.15 ? 1006 GLN A CG    1 
ATOM   5796 C CD    . GLN A 1 904 ? 2.336   9.801   8.955   1.00 130.27 ? 1006 GLN A CD    1 
ATOM   5797 O OE1   . GLN A 1 904 ? 2.788   10.384  9.942   1.00 134.85 ? 1006 GLN A OE1   1 
ATOM   5798 N NE2   . GLN A 1 904 ? 1.332   8.928   9.034   1.00 127.96 ? 1006 GLN A NE2   1 
ATOM   5799 N N     . VAL A 1 905 ? 4.376   14.169  6.395   1.00 124.44 ? 1007 VAL A N     1 
ATOM   5800 C CA    . VAL A 1 905 ? 4.295   15.605  6.141   1.00 109.84 ? 1007 VAL A CA    1 
ATOM   5801 C C     . VAL A 1 905 ? 4.787   15.918  4.699   1.00 103.25 ? 1007 VAL A C     1 
ATOM   5802 O O     . VAL A 1 905 ? 4.096   16.594  3.928   1.00 98.27  ? 1007 VAL A O     1 
ATOM   5803 C CB    . VAL A 1 905 ? 5.109   16.417  7.241   1.00 119.28 ? 1007 VAL A CB    1 
ATOM   5804 C CG1   . VAL A 1 905 ? 6.630   16.284  7.064   1.00 113.53 ? 1007 VAL A CG1   1 
ATOM   5805 C CG2   . VAL A 1 905 ? 4.667   17.881  7.215   1.00 120.83 ? 1007 VAL A CG2   1 
ATOM   5806 N N     . VAL A 1 906 ? 5.956   15.394  4.322   1.00 84.63  ? 1008 VAL A N     1 
ATOM   5807 C CA    . VAL A 1 906 ? 6.472   15.644  2.985   1.00 78.16  ? 1008 VAL A CA    1 
ATOM   5808 C C     . VAL A 1 906 ? 5.414   15.167  2.017   1.00 77.53  ? 1008 VAL A C     1 
ATOM   5809 O O     . VAL A 1 906 ? 5.056   15.899  1.106   1.00 77.40  ? 1008 VAL A O     1 
ATOM   5810 C CB    . VAL A 1 906 ? 7.933   14.981  2.731   1.00 47.82  ? 1008 VAL A CB    1 
ATOM   5811 C CG1   . VAL A 1 906 ? 7.870   13.479  2.626   1.00 51.21  ? 1008 VAL A CG1   1 
ATOM   5812 C CG2   . VAL A 1 906 ? 8.572   15.561  1.504   1.00 43.18  ? 1008 VAL A CG2   1 
ATOM   5813 N N     . ALA A 1 907 ? 4.859   13.985  2.270   1.00 94.85  ? 1009 ALA A N     1 
ATOM   5814 C CA    . ALA A 1 907 ? 3.852   13.421  1.382   1.00 96.33  ? 1009 ALA A CA    1 
ATOM   5815 C C     . ALA A 1 907 ? 2.493   14.157  1.360   1.00 96.55  ? 1009 ALA A C     1 
ATOM   5816 O O     . ALA A 1 907 ? 1.521   13.704  0.725   1.00 100.83 ? 1009 ALA A O     1 
ATOM   5817 C CB    . ALA A 1 907 ? 3.686   11.891  1.640   1.00 142.95 ? 1009 ALA A CB    1 
ATOM   5818 N N     . ILE A 1 908 ? 2.416   15.287  2.058   1.00 71.32  ? 1010 ILE A N     1 
ATOM   5819 C CA    . ILE A 1 908 ? 1.235   16.156  1.967   1.00 72.56  ? 1010 ILE A CA    1 
ATOM   5820 C C     . ILE A 1 908 ? 1.781   17.476  1.343   1.00 66.47  ? 1010 ILE A C     1 
ATOM   5821 O O     . ILE A 1 908 ? 1.259   17.998  0.341   1.00 58.43  ? 1010 ILE A O     1 
ATOM   5822 C CB    . ILE A 1 908 ? 0.565   16.362  3.318   1.00 135.60 ? 1010 ILE A CB    1 
ATOM   5823 C CG1   . ILE A 1 908 ? -0.028  15.013  3.751   1.00 134.33 ? 1010 ILE A CG1   1 
ATOM   5824 C CG2   . ILE A 1 908 ? -0.508  17.458  3.205   1.00 131.36 ? 1010 ILE A CG2   1 
ATOM   5825 C CD1   . ILE A 1 908 ? -0.280  14.887  5.248   1.00 134.83 ? 1010 ILE A CD1   1 
ATOM   5826 N N     . ALA A 1 909 ? 2.864   17.991  1.916   1.00 76.20  ? 1011 ALA A N     1 
ATOM   5827 C CA    . ALA A 1 909 ? 3.547   19.163  1.393   1.00 76.87  ? 1011 ALA A CA    1 
ATOM   5828 C C     . ALA A 1 909 ? 3.811   18.909  -0.093  1.00 79.04  ? 1011 ALA A C     1 
ATOM   5829 O O     . ALA A 1 909 ? 3.883   19.837  -0.892  1.00 77.90  ? 1011 ALA A O     1 
ATOM   5830 C CB    . ALA A 1 909 ? 4.866   19.335  2.132   1.00 25.92  ? 1011 ALA A CB    1 
ATOM   5831 N N     . SER A 1 910 ? 3.968   17.638  -0.447  1.00 78.97  ? 1012 SER A N     1 
ATOM   5832 C CA    . SER A 1 910 ? 4.245   17.256  -1.822  1.00 78.35  ? 1012 SER A CA    1 
ATOM   5833 C C     . SER A 1 910 ? 3.003   16.795  -2.608  1.00 80.09  ? 1012 SER A C     1 
ATOM   5834 O O     . SER A 1 910 ? 3.054   16.681  -3.827  1.00 75.75  ? 1012 SER A O     1 
ATOM   5835 C CB    . SER A 1 910 ? 5.355   16.211  -1.831  1.00 65.95  ? 1012 SER A CB    1 
ATOM   5836 O OG    . SER A 1 910 ? 6.209   16.424  -2.926  1.00 63.21  ? 1012 SER A OG    1 
ATOM   5837 N N     . ASN A 1 911 ? 1.902   16.518  -1.911  1.00 98.95  ? 1013 ASN A N     1 
ATOM   5838 C CA    . ASN A 1 911 ? 0.622   16.201  -2.575  1.00 105.35 ? 1013 ASN A CA    1 
ATOM   5839 C C     . ASN A 1 911 ? -0.263  17.479  -2.545  1.00 110.91 ? 1013 ASN A C     1 
ATOM   5840 O O     . ASN A 1 911 ? -0.432  18.143  -3.574  1.00 124.14 ? 1013 ASN A O     1 
ATOM   5841 C CB    . ASN A 1 911 ? -0.141  15.027  -1.892  1.00 92.86  ? 1013 ASN A CB    1 
ATOM   5842 C CG    . ASN A 1 911 ? -1.652  14.972  -2.270  1.00 90.56  ? 1013 ASN A CG    1 
ATOM   5843 O OD1   . ASN A 1 911 ? -2.173  15.821  -2.982  1.00 85.25  ? 1013 ASN A OD1   1 
ATOM   5844 N ND2   . ASN A 1 911 ? -2.337  13.971  -1.779  1.00 86.58  ? 1013 ASN A ND2   1 
ATOM   5845 N N     . GLY A 1 912 ? -0.827  17.824  -1.383  1.00 123.96 ? 1014 GLY A N     1 
ATOM   5846 C CA    . GLY A 1 912 ? -1.675  19.004  -1.297  1.00 125.32 ? 1014 GLY A CA    1 
ATOM   5847 C C     . GLY A 1 912 ? -1.008  20.240  -0.727  1.00 122.86 ? 1014 GLY A C     1 
ATOM   5848 O O     . GLY A 1 912 ? -1.660  21.262  -0.495  1.00 124.38 ? 1014 GLY A O     1 
ATOM   5849 N N     . GLY A 1 913 ? 0.289   20.140  -0.480  1.00 85.36  ? 1015 GLY A N     1 
ATOM   5850 C CA    . GLY A 1 913 ? 1.022   21.265  0.032   1.00 79.38  ? 1015 GLY A CA    1 
ATOM   5851 C C     . GLY A 1 913 ? 0.410   22.057  1.163   1.00 79.19  ? 1015 GLY A C     1 
ATOM   5852 O O     . GLY A 1 913 ? -0.226  21.482  2.055   1.00 78.05  ? 1015 GLY A O     1 
ATOM   5853 N N     . LYS A 1 914 ? 0.577   23.388  1.069   1.00 74.87  ? 1016 LYS A N     1 
ATOM   5854 C CA    . LYS A 1 914 ? 0.192   24.332  2.090   1.00 75.01  ? 1016 LYS A CA    1 
ATOM   5855 C C     . LYS A 1 914 ? -1.172  24.171  2.740   1.00 75.31  ? 1016 LYS A C     1 
ATOM   5856 O O     . LYS A 1 914 ? -1.266  23.843  3.923   1.00 77.27  ? 1016 LYS A O     1 
ATOM   5857 C CB    . LYS A 1 914 ? 0.423   25.756  1.565   1.00 91.18  ? 1016 LYS A CB    1 
ATOM   5858 C CG    . LYS A 1 914 ? -0.010  26.871  2.516   1.00 95.18  ? 1016 LYS A CG    1 
ATOM   5859 C CD    . LYS A 1 914 ? -0.007  28.236  1.818   1.00 99.75  ? 1016 LYS A CD    1 
ATOM   5860 C CE    . LYS A 1 914 ? -1.322  28.985  2.015   1.00 100.41 ? 1016 LYS A CE    1 
ATOM   5861 N NZ    . LYS A 1 914 ? -2.504  28.144  1.581   1.00 102.66 ? 1016 LYS A NZ    1 
ATOM   5862 N N     . GLN A 1 915 ? -2.234  24.374  1.989   1.00 85.22  ? 1017 GLN A N     1 
ATOM   5863 C CA    . GLN A 1 915 ? -3.547  24.282  2.602   1.00 94.53  ? 1017 GLN A CA    1 
ATOM   5864 C C     . GLN A 1 915 ? -3.809  22.867  3.101   1.00 94.95  ? 1017 GLN A C     1 
ATOM   5865 O O     . GLN A 1 915 ? -4.128  22.672  4.267   1.00 100.43 ? 1017 GLN A O     1 
ATOM   5866 C CB    . GLN A 1 915 ? -4.653  24.824  1.658   1.00 165.86 ? 1017 GLN A CB    1 
ATOM   5867 C CG    . GLN A 1 915 ? -4.774  24.191  0.290   1.00 176.93 ? 1017 GLN A CG    1 
ATOM   5868 C CD    . GLN A 1 915 ? -3.484  24.246  -0.516  1.00 182.31 ? 1017 GLN A CD    1 
ATOM   5869 O OE1   . GLN A 1 915 ? -2.532  24.943  -0.151  1.00 182.31 ? 1017 GLN A OE1   1 
ATOM   5870 N NE2   . GLN A 1 915 ? -3.450  23.513  -1.629  1.00 182.31 ? 1017 GLN A NE2   1 
ATOM   5871 N N     . ALA A 1 916 ? -3.628  21.873  2.247   1.00 95.57  ? 1018 ALA A N     1 
ATOM   5872 C CA    . ALA A 1 916 ? -3.816  20.502  2.675   1.00 91.53  ? 1018 ALA A CA    1 
ATOM   5873 C C     . ALA A 1 916 ? -3.002  20.284  3.955   1.00 93.36  ? 1018 ALA A C     1 
ATOM   5874 O O     . ALA A 1 916 ? -3.443  19.565  4.828   1.00 95.84  ? 1018 ALA A O     1 
ATOM   5875 C CB    . ALA A 1 916 ? -3.351  19.554  1.586   1.00 163.30 ? 1018 ALA A CB    1 
ATOM   5876 N N     . LEU A 1 917 ? -1.821  20.903  4.057   1.00 84.74  ? 1019 LEU A N     1 
ATOM   5877 C CA    . LEU A 1 917 ? -0.938  20.774  5.230   1.00 81.96  ? 1019 LEU A CA    1 
ATOM   5878 C C     . LEU A 1 917 ? -1.573  21.307  6.497   1.00 84.93  ? 1019 LEU A C     1 
ATOM   5879 O O     . LEU A 1 917 ? -1.810  20.552  7.433   1.00 90.80  ? 1019 LEU A O     1 
ATOM   5880 C CB    . LEU A 1 917 ? 0.368   21.534  5.029   1.00 57.72  ? 1019 LEU A CB    1 
ATOM   5881 C CG    . LEU A 1 917 ? 1.606   20.758  4.659   1.00 55.42  ? 1019 LEU A CG    1 
ATOM   5882 C CD1   . LEU A 1 917 ? 2.841   21.715  4.787   1.00 53.28  ? 1019 LEU A CD1   1 
ATOM   5883 C CD2   . LEU A 1 917 ? 1.758   19.554  5.591   1.00 56.80  ? 1019 LEU A CD2   1 
ATOM   5884 N N     . GLU A 1 918 ? -1.809  22.618  6.546   1.00 93.82  ? 1020 GLU A N     1 
ATOM   5885 C CA    . GLU A 1 918 ? -2.423  23.226  7.720   1.00 95.33  ? 1020 GLU A CA    1 
ATOM   5886 C C     . GLU A 1 918 ? -3.783  22.588  7.991   1.00 91.64  ? 1020 GLU A C     1 
ATOM   5887 O O     . GLU A 1 918 ? -4.012  22.102  9.103   1.00 94.49  ? 1020 GLU A O     1 
ATOM   5888 C CB    . GLU A 1 918 ? -2.578  24.741  7.545   1.00 143.96 ? 1020 GLU A CB    1 
ATOM   5889 C CG    . GLU A 1 918 ? -1.258  25.516  7.587   1.00 154.26 ? 1020 GLU A CG    1 
ATOM   5890 C CD    . GLU A 1 918 ? -1.367  26.883  8.283   1.00 162.71 ? 1020 GLU A CD    1 
ATOM   5891 O OE1   . GLU A 1 918 ? -1.871  26.931  9.431   1.00 168.45 ? 1020 GLU A OE1   1 
ATOM   5892 O OE2   . GLU A 1 918 ? -0.936  27.905  7.685   1.00 158.47 ? 1020 GLU A OE2   1 
ATOM   5893 N N     . THR A 1 919 ? -4.661  22.571  6.978   1.00 67.71  ? 1021 THR A N     1 
ATOM   5894 C CA    . THR A 1 919 ? -6.014  21.988  7.094   1.00 72.11  ? 1021 THR A CA    1 
ATOM   5895 C C     . THR A 1 919 ? -6.019  20.588  7.743   1.00 78.41  ? 1021 THR A C     1 
ATOM   5896 O O     . THR A 1 919 ? -6.971  20.234  8.444   1.00 79.42  ? 1021 THR A O     1 
ATOM   5897 C CB    . THR A 1 919 ? -6.715  21.905  5.722   1.00 116.22 ? 1021 THR A CB    1 
ATOM   5898 O OG1   . THR A 1 919 ? -6.624  23.175  5.076   1.00 122.52 ? 1021 THR A OG1   1 
ATOM   5899 C CG2   . THR A 1 919 ? -8.190  21.551  5.886   1.00 116.38 ? 1021 THR A CG2   1 
ATOM   5900 N N     . VAL A 1 920 ? -4.993  19.780  7.461   1.00 91.98  ? 1022 VAL A N     1 
ATOM   5901 C CA    . VAL A 1 920 ? -4.825  18.484  8.116   1.00 90.57  ? 1022 VAL A CA    1 
ATOM   5902 C C     . VAL A 1 920 ? -4.577  18.834  9.603   1.00 97.09  ? 1022 VAL A C     1 
ATOM   5903 O O     . VAL A 1 920 ? -5.392  18.485  10.464  1.00 102.51 ? 1022 VAL A O     1 
ATOM   5904 C CB    . VAL A 1 920 ? -3.590  17.719  7.550   1.00 70.14  ? 1022 VAL A CB    1 
ATOM   5905 C CG1   . VAL A 1 920 ? -3.006  16.773  8.594   1.00 66.10  ? 1022 VAL A CG1   1 
ATOM   5906 C CG2   . VAL A 1 920 ? -3.986  16.951  6.300   1.00 65.51  ? 1022 VAL A CG2   1 
ATOM   5907 N N     . GLN A 1 921 ? -3.476  19.546  9.884   1.00 128.99 ? 1023 GLN A N     1 
ATOM   5908 C CA    . GLN A 1 921 ? -3.093  19.943  11.252  1.00 133.46 ? 1023 GLN A CA    1 
ATOM   5909 C C     . GLN A 1 921 ? -4.266  20.513  12.051  1.00 134.03 ? 1023 GLN A C     1 
ATOM   5910 O O     . GLN A 1 921 ? -4.369  20.317  13.266  1.00 136.82 ? 1023 GLN A O     1 
ATOM   5911 C CB    . GLN A 1 921 ? -1.942  20.958  11.196  1.00 106.77 ? 1023 GLN A CB    1 
ATOM   5912 C CG    . GLN A 1 921 ? -1.515  21.522  12.534  1.00 109.70 ? 1023 GLN A CG    1 
ATOM   5913 C CD    . GLN A 1 921 ? -2.039  22.957  12.784  1.00 112.68 ? 1023 GLN A CD    1 
ATOM   5914 O OE1   . GLN A 1 921 ? -1.621  23.924  12.129  1.00 111.53 ? 1023 GLN A OE1   1 
ATOM   5915 N NE2   . GLN A 1 921 ? -2.959  23.089  13.737  1.00 116.00 ? 1023 GLN A NE2   1 
ATOM   5916 N N     . ARG A 1 922 ? -5.166  21.177  11.338  1.00 96.36  ? 1024 ARG A N     1 
ATOM   5917 C CA    . ARG A 1 922 ? -6.321  21.820  11.936  1.00 100.38 ? 1024 ARG A CA    1 
ATOM   5918 C C     . ARG A 1 922 ? -7.686  21.168  11.605  1.00 101.67 ? 1024 ARG A C     1 
ATOM   5919 O O     . ARG A 1 922 ? -8.709  21.855  11.445  1.00 105.66 ? 1024 ARG A O     1 
ATOM   5920 C CB    . ARG A 1 922 ? -6.319  23.315  11.549  1.00 154.99 ? 1024 ARG A CB    1 
ATOM   5921 C CG    . ARG A 1 922 ? -4.922  23.954  11.574  1.00 156.01 ? 1024 ARG A CG    1 
ATOM   5922 C CD    . ARG A 1 922 ? -4.955  25.420  11.994  1.00 159.16 ? 1024 ARG A CD    1 
ATOM   5923 N NE    . ARG A 1 922 ? -5.214  26.324  10.875  1.00 162.81 ? 1024 ARG A NE    1 
ATOM   5924 C CZ    . ARG A 1 922 ? -5.371  27.640  10.997  1.00 163.53 ? 1024 ARG A CZ    1 
ATOM   5925 N NH1   . ARG A 1 922 ? -5.303  28.211  12.194  1.00 158.88 ? 1024 ARG A NH1   1 
ATOM   5926 N NH2   . ARG A 1 922 ? -5.580  28.393  9.923   1.00 157.57 ? 1024 ARG A NH2   1 
ATOM   5927 N N     . LEU A 1 923 ? -7.695  19.846  11.473  1.00 114.45 ? 1025 LEU A N     1 
ATOM   5928 C CA    . LEU A 1 923 ? -8.947  19.123  11.254  1.00 117.75 ? 1025 LEU A CA    1 
ATOM   5929 C C     . LEU A 1 923 ? -8.834  17.727  11.922  1.00 118.41 ? 1025 LEU A C     1 
ATOM   5930 O O     . LEU A 1 923 ? -9.856  17.092  12.244  1.00 118.67 ? 1025 LEU A O     1 
ATOM   5931 C CB    . LEU A 1 923 ? -9.321  19.054  9.756   1.00 105.65 ? 1025 LEU A CB    1 
ATOM   5932 C CG    . LEU A 1 923 ? -10.762 18.646  9.363   1.00 107.22 ? 1025 LEU A CG    1 
ATOM   5933 C CD1   . LEU A 1 923 ? -11.762 19.789  9.596   1.00 108.53 ? 1025 LEU A CD1   1 
ATOM   5934 C CD2   . LEU A 1 923 ? -10.771 18.239  7.894   1.00 103.98 ? 1025 LEU A CD2   1 
ATOM   5935 N N     . LEU A 1 924 ? -7.598  17.273  12.164  1.00 78.58  ? 1026 LEU A N     1 
ATOM   5936 C CA    . LEU A 1 924 ? -7.356  16.022  12.879  1.00 76.15  ? 1026 LEU A CA    1 
ATOM   5937 C C     . LEU A 1 924 ? -8.200  15.938  14.175  1.00 77.12  ? 1026 LEU A C     1 
ATOM   5938 O O     . LEU A 1 924 ? -8.834  14.940  14.436  1.00 79.85  ? 1026 LEU A O     1 
ATOM   5939 C CB    . LEU A 1 924 ? -5.876  15.888  13.247  1.00 90.71  ? 1026 LEU A CB    1 
ATOM   5940 C CG    . LEU A 1 924 ? -5.142  14.734  12.562  1.00 92.72  ? 1026 LEU A CG    1 
ATOM   5941 C CD1   . LEU A 1 924 ? -4.858  15.071  11.085  1.00 87.56  ? 1026 LEU A CD1   1 
ATOM   5942 C CD2   . LEU A 1 924 ? -3.851  14.465  13.301  1.00 97.89  ? 1026 LEU A CD2   1 
ATOM   5943 N N     . PRO A 1 925 ? -8.193  16.983  15.021  1.00 104.05 ? 1027 PRO A N     1 
ATOM   5944 C CA    . PRO A 1 925 ? -9.021  16.843  16.228  1.00 109.11 ? 1027 PRO A CA    1 
ATOM   5945 C C     . PRO A 1 925 ? -10.447 16.356  15.938  1.00 109.12 ? 1027 PRO A C     1 
ATOM   5946 O O     . PRO A 1 925 ? -10.873 15.334  16.439  1.00 110.71 ? 1027 PRO A O     1 
ATOM   5947 C CB    . PRO A 1 925 ? -9.064  18.266  16.803  1.00 119.45 ? 1027 PRO A CB    1 
ATOM   5948 C CG    . PRO A 1 925 ? -7.799  18.895  16.338  1.00 115.34 ? 1027 PRO A CG    1 
ATOM   5949 C CD    . PRO A 1 925 ? -7.563  18.321  14.952  1.00 113.99 ? 1027 PRO A CD    1 
ATOM   5950 N N     . VAL A 1 926 ? -11.154 17.099  15.093  1.00 109.71 ? 1028 VAL A N     1 
ATOM   5951 C CA    . VAL A 1 926 ? -12.565 16.860  14.794  1.00 108.36 ? 1028 VAL A CA    1 
ATOM   5952 C C     . VAL A 1 926 ? -13.042 15.454  14.578  1.00 108.23 ? 1028 VAL A C     1 
ATOM   5953 O O     . VAL A 1 926 ? -13.905 14.965  15.315  1.00 112.22 ? 1028 VAL A O     1 
ATOM   5954 C CB    . VAL A 1 926 ? -13.076 17.751  13.595  1.00 79.02  ? 1028 VAL A CB    1 
ATOM   5955 C CG1   . VAL A 1 926 ? -14.342 17.183  13.016  1.00 72.36  ? 1028 VAL A CG1   1 
ATOM   5956 C CG2   . VAL A 1 926 ? -13.353 19.191  14.075  1.00 79.22  ? 1028 VAL A CG2   1 
ATOM   5957 N N     . LEU A 1 927 ? -12.478 14.801  13.577  1.00 103.37 ? 1029 LEU A N     1 
ATOM   5958 C CA    . LEU A 1 927 ? -12.921 13.465  13.237  1.00 103.48 ? 1029 LEU A CA    1 
ATOM   5959 C C     . LEU A 1 927 ? -12.827 12.472  14.412  1.00 111.39 ? 1029 LEU A C     1 
ATOM   5960 O O     . LEU A 1 927 ? -13.719 11.648  14.620  1.00 118.87 ? 1029 LEU A O     1 
ATOM   5961 C CB    . LEU A 1 927 ? -12.153 12.953  12.009  1.00 93.15  ? 1029 LEU A CB    1 
ATOM   5962 C CG    . LEU A 1 927 ? -11.908 13.890  10.819  1.00 91.77  ? 1029 LEU A CG    1 
ATOM   5963 C CD1   . LEU A 1 927 ? -11.230 13.080  9.719   1.00 94.32  ? 1029 LEU A CD1   1 
ATOM   5964 C CD2   . LEU A 1 927 ? -13.198 14.514  10.283  1.00 88.52  ? 1029 LEU A CD2   1 
ATOM   5965 N N     . CYS A 1 928 ? -11.757 12.569  15.190  1.00 114.59 ? 1030 CYS A N     1 
ATOM   5966 C CA    . CYS A 1 928 ? -11.543 11.695  16.342  1.00 114.63 ? 1030 CYS A CA    1 
ATOM   5967 C C     . CYS A 1 928 ? -12.452 12.058  17.530  1.00 117.65 ? 1030 CYS A C     1 
ATOM   5968 O O     . CYS A 1 928 ? -12.633 11.259  18.466  1.00 116.92 ? 1030 CYS A O     1 
ATOM   5969 C CB    . CYS A 1 928 ? -10.094 11.843  16.813  1.00 107.56 ? 1030 CYS A CB    1 
ATOM   5970 S SG    . CYS A 1 928 ? -8.858  11.944  15.499  1.00 106.40 ? 1030 CYS A SG    1 
ATOM   5971 N N     . GLN A 1 929 ? -13.049 13.247  17.452  1.00 126.37 ? 1031 GLN A N     1 
ATOM   5972 C CA    . GLN A 1 929 ? -13.802 13.836  18.554  1.00 132.25 ? 1031 GLN A CA    1 
ATOM   5973 C C     . GLN A 1 929 ? -15.345 13.756  18.646  1.00 135.65 ? 1031 GLN A C     1 
ATOM   5974 O O     . GLN A 1 929 ? -15.902 13.763  19.750  1.00 134.98 ? 1031 GLN A O     1 
ATOM   5975 C CB    . GLN A 1 929 ? -13.297 15.291  18.675  1.00 142.16 ? 1031 GLN A CB    1 
ATOM   5976 C CG    . GLN A 1 929 ? -13.761 16.097  19.885  1.00 143.13 ? 1031 GLN A CG    1 
ATOM   5977 C CD    . GLN A 1 929 ? -14.872 17.080  19.552  1.00 143.94 ? 1031 GLN A CD    1 
ATOM   5978 O OE1   . GLN A 1 929 ? -16.064 16.766  19.692  1.00 146.76 ? 1031 GLN A OE1   1 
ATOM   5979 N NE2   . GLN A 1 929 ? -14.487 18.274  19.091  1.00 142.79 ? 1031 GLN A NE2   1 
ATOM   5980 N N     . ASP A 1 930 ? -16.036 13.675  17.513  1.00 154.12 ? 1032 ASP A N     1 
ATOM   5981 C CA    . ASP A 1 930 ? -17.503 13.602  17.531  1.00 162.47 ? 1032 ASP A CA    1 
ATOM   5982 C C     . ASP A 1 930 ? -18.072 12.205  17.807  1.00 173.36 ? 1032 ASP A C     1 
ATOM   5983 O O     . ASP A 1 930 ? -18.712 11.978  18.847  1.00 180.41 ? 1032 ASP A O     1 
ATOM   5984 C CB    . ASP A 1 930 ? -18.092 14.169  16.219  1.00 161.19 ? 1032 ASP A CB    1 
ATOM   5985 C CG    . ASP A 1 930 ? -17.644 13.407  14.971  1.00 153.06 ? 1032 ASP A CG    1 
ATOM   5986 O OD1   . ASP A 1 930 ? -16.533 12.842  14.988  1.00 146.63 ? 1032 ASP A OD1   1 
ATOM   5987 O OD2   . ASP A 1 930 ? -18.402 13.398  13.962  1.00 145.73 ? 1032 ASP A OD2   1 
ATOM   5988 N N     . HIS A 1 931 ? -17.888 11.298  16.845  1.00 180.00 ? 1033 HIS A N     1 
ATOM   5989 C CA    . HIS A 1 931 ? -18.298 9.898   16.990  1.00 180.00 ? 1033 HIS A CA    1 
ATOM   5990 C C     . HIS A 1 931 ? -17.290 8.986   16.274  1.00 180.00 ? 1033 HIS A C     1 
ATOM   5991 O O     . HIS A 1 931 ? -17.400 8.711   15.074  1.00 180.00 ? 1033 HIS A O     1 
ATOM   5992 C CB    . HIS A 1 931 ? -19.720 9.641   16.449  1.00 200.00 ? 1033 HIS A CB    1 
ATOM   5993 C CG    . HIS A 1 931 ? -20.348 8.376   16.975  1.00 200.00 ? 1033 HIS A CG    1 
ATOM   5994 N ND1   . HIS A 1 931 ? -20.967 7.449   16.152  1.00 200.00 ? 1033 HIS A ND1   1 
ATOM   5995 C CD2   . HIS A 1 931 ? -20.475 7.889   18.234  1.00 200.00 ? 1033 HIS A CD2   1 
ATOM   5996 C CE1   . HIS A 1 931 ? -21.439 6.460   16.883  1.00 200.00 ? 1033 HIS A CE1   1 
ATOM   5997 N NE2   . HIS A 1 931 ? -21.155 6.697   18.155  1.00 200.00 ? 1033 HIS A NE2   1 
ATOM   5998 N N     . GLY A 1 932 ? -16.291 8.562   17.043  1.00 167.97 ? 1034 GLY A N     1 
ATOM   5999 C CA    . GLY A 1 932 ? -15.240 7.661   16.591  1.00 153.19 ? 1034 GLY A CA    1 
ATOM   6000 C C     . GLY A 1 932 ? -14.596 7.681   15.212  1.00 147.65 ? 1034 GLY A C     1 
ATOM   6001 O O     . GLY A 1 932 ? -15.243 7.344   14.208  1.00 141.24 ? 1034 GLY A O     1 
ATOM   6002 N N     . LEU A 1 933 ? -13.324 8.104   15.171  1.00 192.72 ? 1035 LEU A N     1 
ATOM   6003 C CA    . LEU A 1 933 ? -12.481 8.076   13.950  1.00 192.72 ? 1035 LEU A CA    1 
ATOM   6004 C C     . LEU A 1 933 ? -10.983 8.088   14.300  1.00 192.72 ? 1035 LEU A C     1 
ATOM   6005 O O     . LEU A 1 933 ? -10.598 8.421   15.426  1.00 192.72 ? 1035 LEU A O     1 
ATOM   6006 C CB    . LEU A 1 933 ? -12.826 9.196   12.961  1.00 128.28 ? 1035 LEU A CB    1 
ATOM   6007 C CG    . LEU A 1 933 ? -13.077 8.728   11.510  1.00 125.39 ? 1035 LEU A CG    1 
ATOM   6008 C CD1   . LEU A 1 933 ? -14.059 9.696   10.841  1.00 121.15 ? 1035 LEU A CD1   1 
ATOM   6009 C CD2   . LEU A 1 933 ? -11.762 8.622   10.709  1.00 123.01 ? 1035 LEU A CD2   1 
ATOM   6010 N N     . THR A 1 934 ? -10.139 7.735   13.329  1.00 99.91  ? 1036 THR A N     1 
ATOM   6011 C CA    . THR A 1 934 ? -8.692  7.585   13.569  1.00 98.67  ? 1036 THR A CA    1 
ATOM   6012 C C     . THR A 1 934 ? -7.736  8.354   12.653  1.00 102.08 ? 1036 THR A C     1 
ATOM   6013 O O     . THR A 1 934 ? -8.047  8.556   11.477  1.00 101.73 ? 1036 THR A O     1 
ATOM   6014 C CB    . THR A 1 934 ? -8.307  6.063   13.481  1.00 105.82 ? 1036 THR A CB    1 
ATOM   6015 O OG1   . THR A 1 934 ? -6.906  5.864   13.720  1.00 94.18  ? 1036 THR A OG1   1 
ATOM   6016 C CG2   . THR A 1 934 ? -8.637  5.513   12.079  1.00 106.18 ? 1036 THR A CG2   1 
ATOM   6017 N N     . PRO A 1 935 ? -6.595  8.772   13.191  1.00 152.77 ? 1037 PRO A N     1 
ATOM   6018 C CA    . PRO A 1 935 ? -5.603  9.520   12.411  1.00 152.32 ? 1037 PRO A CA    1 
ATOM   6019 C C     . PRO A 1 935 ? -4.867  8.623   11.421  1.00 156.46 ? 1037 PRO A C     1 
ATOM   6020 O O     . PRO A 1 935 ? -3.849  9.030   10.861  1.00 151.24 ? 1037 PRO A O     1 
ATOM   6021 C CB    . PRO A 1 935 ? -4.635  10.028  13.480  1.00 102.55 ? 1037 PRO A CB    1 
ATOM   6022 C CG    . PRO A 1 935 ? -4.734  9.027   14.575  1.00 102.63 ? 1037 PRO A CG    1 
ATOM   6023 C CD    . PRO A 1 935 ? -6.164  8.568   14.585  1.00 105.12 ? 1037 PRO A CD    1 
ATOM   6024 N N     . ASP A 1 936 ? -5.382  7.416   11.212  1.00 200.00 ? 1038 ASP A N     1 
ATOM   6025 C CA    . ASP A 1 936 ? -4.766  6.471   10.288  1.00 200.00 ? 1038 ASP A CA    1 
ATOM   6026 C C     . ASP A 1 936 ? -5.251  6.700   8.861   1.00 200.00 ? 1038 ASP A C     1 
ATOM   6027 O O     . ASP A 1 936 ? -4.470  6.631   7.911   1.00 200.00 ? 1038 ASP A O     1 
ATOM   6028 C CB    . ASP A 1 936 ? -5.060  5.032   10.719  1.00 185.82 ? 1038 ASP A CB    1 
ATOM   6029 C CG    . ASP A 1 936 ? -3.847  4.343   11.314  1.00 184.63 ? 1038 ASP A CG    1 
ATOM   6030 O OD1   . ASP A 1 936 ? -3.153  4.968   12.143  1.00 187.03 ? 1038 ASP A OD1   1 
ATOM   6031 O OD2   . ASP A 1 936 ? -3.588  3.176   10.952  1.00 175.30 ? 1038 ASP A OD2   1 
ATOM   6032 N N     . GLN A 1 937 ? -6.544  6.972   8.717   1.00 199.97 ? 1039 GLN A N     1 
ATOM   6033 C CA    . GLN A 1 937 ? -7.136  7.208   7.405   1.00 199.97 ? 1039 GLN A CA    1 
ATOM   6034 C C     . GLN A 1 937 ? -7.134  8.692   7.056   1.00 199.97 ? 1039 GLN A C     1 
ATOM   6035 O O     . GLN A 1 937 ? -7.481  9.078   5.940   1.00 199.97 ? 1039 GLN A O     1 
ATOM   6036 C CB    . GLN A 1 937 ? -8.563  6.658   7.355   1.00 200.00 ? 1039 GLN A CB    1 
ATOM   6037 C CG    . GLN A 1 937 ? -8.959  5.847   8.578   1.00 200.00 ? 1039 GLN A CG    1 
ATOM   6038 C CD    . GLN A 1 937 ? -10.421 5.446   8.563   1.00 200.00 ? 1039 GLN A CD    1 
ATOM   6039 O OE1   . GLN A 1 937 ? -10.985 5.074   9.592   1.00 200.00 ? 1039 GLN A OE1   1 
ATOM   6040 N NE2   . GLN A 1 937 ? -11.043 5.520   7.392   1.00 200.00 ? 1039 GLN A NE2   1 
ATOM   6041 N N     . VAL A 1 938 ? -6.740  9.521   8.018   1.00 200.00 ? 1040 VAL A N     1 
ATOM   6042 C CA    . VAL A 1 938 ? -6.692  10.964  7.814   1.00 200.00 ? 1040 VAL A CA    1 
ATOM   6043 C C     . VAL A 1 938 ? -5.307  11.411  7.358   1.00 198.92 ? 1040 VAL A C     1 
ATOM   6044 O O     . VAL A 1 938 ? -4.882  12.531  7.642   1.00 190.40 ? 1040 VAL A O     1 
ATOM   6045 C CB    . VAL A 1 938 ? -7.073  11.728  9.095   1.00 178.86 ? 1040 VAL A CB    1 
ATOM   6046 C CG1   . VAL A 1 938 ? -6.659  13.188  8.984   1.00 178.86 ? 1040 VAL A CG1   1 
ATOM   6047 C CG2   . VAL A 1 938 ? -8.566  11.609  9.360   1.00 178.86 ? 1040 VAL A CG2   1 
ATOM   6048 N N     . VAL A 1 939 ? -4.609  10.529  6.651   1.00 195.28 ? 1041 VAL A N     1 
ATOM   6049 C CA    . VAL A 1 939 ? -3.271  10.831  6.156   1.00 195.28 ? 1041 VAL A CA    1 
ATOM   6050 C C     . VAL A 1 939 ? -2.883  9.901   5.011   1.00 195.28 ? 1041 VAL A C     1 
ATOM   6051 O O     . VAL A 1 939 ? -2.814  8.684   5.184   1.00 195.28 ? 1041 VAL A O     1 
ATOM   6052 C CB    . VAL A 1 939 ? -2.255  10.740  7.284   1.00 116.00 ? 1041 VAL A CB    1 
ATOM   6053 N N     . ALA A 1 940 ? -2.632  10.482  3.843   1.00 167.98 ? 1042 ALA A N     1 
ATOM   6054 C CA    . ALA A 1 940 ? -2.723  11.927  3.670   1.00 167.98 ? 1042 ALA A CA    1 
ATOM   6055 C C     . ALA A 1 940 ? -4.156  12.414  3.854   1.00 167.98 ? 1042 ALA A C     1 
ATOM   6056 O O     . ALA A 1 940 ? -4.427  13.272  4.695   1.00 167.98 ? 1042 ALA A O     1 
ATOM   6057 C CB    . ALA A 1 940 ? -2.194  12.331  2.302   1.00 129.58 ? 1042 ALA A CB    1 
ATOM   6058 N N     . ILE A 1 941 ? -5.059  11.892  3.039   1.00 136.06 ? 1043 ILE A N     1 
ATOM   6059 C CA    . ILE A 1 941 ? -6.474  12.203  3.122   1.00 136.06 ? 1043 ILE A CA    1 
ATOM   6060 C C     . ILE A 1 941 ? -7.100  10.994  2.482   1.00 136.06 ? 1043 ILE A C     1 
ATOM   6061 O O     . ILE A 1 941 ? -7.974  11.081  1.620   1.00 136.06 ? 1043 ILE A O     1 
ATOM   6062 N N     . ALA A 1 942 ? -6.603  9.845   2.919   1.00 199.88 ? 1044 ALA A N     1 
ATOM   6063 C CA    . ALA A 1 942 ? -6.733  8.592   2.184   1.00 199.88 ? 1044 ALA A CA    1 
ATOM   6064 C C     . ALA A 1 942 ? -8.137  8.446   1.580   1.00 199.88 ? 1044 ALA A C     1 
ATOM   6065 O O     . ALA A 1 942 ? -9.139  8.748   2.298   1.00 199.88 ? 1044 ALA A O     1 
ATOM   6066 N N     . SER A 1 943 ? -8.232  7.931   0.345   1.00 200.00 ? 1045 SER A N     1 
ATOM   6067 C CA    . SER A 1 943 ? -9.437  7.933   -0.452  1.00 200.00 ? 1045 SER A CA    1 
ATOM   6068 C C     . SER A 1 943 ? -10.606 7.391   0.339   1.00 200.00 ? 1045 SER A C     1 
ATOM   6069 O O     . SER A 1 943 ? -10.398 6.639   1.192   1.00 200.00 ? 1045 SER A O     1 
ATOM   6070 C CB    . SER A 1 943 ? -9.184  7.169   -1.686  1.00 90.41  ? 1045 SER A CB    1 
ATOM   6071 O OG    . SER A 1 943 ? -8.150  7.822   -2.238  1.00 90.41  ? 1045 SER A OG    1 
ATOM   6072 N N     . ASN A 1 944 ? -11.812 7.854   0.165   1.00 130.86 ? 1046 ASN A N     1 
ATOM   6073 C CA    . ASN A 1 944 ? -12.703 7.349   1.076   1.00 130.86 ? 1046 ASN A CA    1 
ATOM   6074 C C     . ASN A 1 944 ? -11.954 7.878   2.215   1.00 130.86 ? 1046 ASN A C     1 
ATOM   6075 O O     . ASN A 1 944 ? -11.376 8.888   2.130   1.00 130.86 ? 1046 ASN A O     1 
ATOM   6076 C CB    . ASN A 1 944 ? -12.583 5.973   1.084   1.00 75.20  ? 1046 ASN A CB    1 
ATOM   6077 N N     . SER A 1 945 ? -11.847 7.212   3.320   1.00 151.59 ? 1047 SER A N     1 
ATOM   6078 C CA    . SER A 1 945 ? -12.292 5.916   3.650   1.00 151.59 ? 1047 SER A CA    1 
ATOM   6079 C C     . SER A 1 945 ? -13.245 5.927   4.790   1.00 151.59 ? 1047 SER A C     1 
ATOM   6080 O O     . SER A 1 945 ? -12.878 6.364   5.804   1.00 151.59 ? 1047 SER A O     1 
ATOM   6081 C CB    . SER A 1 945 ? -11.083 5.335   4.163   1.00 98.04  ? 1047 SER A CB    1 
ATOM   6082 N N     . GLY A 1 946 ? -14.439 5.357   4.609   1.00 159.19 ? 1048 GLY A N     1 
ATOM   6083 C CA    . GLY A 1 946 ? -15.521 5.439   5.583   1.00 159.19 ? 1048 GLY A CA    1 
ATOM   6084 C C     . GLY A 1 946 ? -15.726 4.383   6.667   1.00 159.19 ? 1048 GLY A C     1 
ATOM   6085 O O     . GLY A 1 946 ? -16.641 3.562   6.593   1.00 159.19 ? 1048 GLY A O     1 
ATOM   6086 O "O5'" . DT  B 2 1   ? -2.772  115.325 -22.856 1.00 186.42 ? -6   DT  B "O5'" 1 
ATOM   6087 C "C5'" . DT  B 2 1   ? -1.670  114.565 -23.347 1.00 186.11 ? -6   DT  B "C5'" 1 
ATOM   6088 C "C4'" . DT  B 2 1   ? -0.422  114.795 -22.528 1.00 187.00 ? -6   DT  B "C4'" 1 
ATOM   6089 O "O4'" . DT  B 2 1   ? -0.693  115.699 -21.426 1.00 181.38 ? -6   DT  B "O4'" 1 
ATOM   6090 C "C3'" . DT  B 2 1   ? 0.215   113.550 -21.912 1.00 189.42 ? -6   DT  B "C3'" 1 
ATOM   6091 O "O3'" . DT  B 2 1   ? 1.598   113.514 -22.305 1.00 199.91 ? -6   DT  B "O3'" 1 
ATOM   6092 C "C2'" . DT  B 2 1   ? 0.019   113.748 -20.416 1.00 182.65 ? -6   DT  B "C2'" 1 
ATOM   6093 C "C1'" . DT  B 2 1   ? -0.041  115.251 -20.252 1.00 168.84 ? -6   DT  B "C1'" 1 
ATOM   6094 N N1    . DT  B 2 1   ? -0.842  115.708 -19.090 1.00 95.96  ? -6   DT  B N1    1 
ATOM   6095 C C2    . DT  B 2 1   ? -0.206  115.995 -17.870 1.00 86.89  ? -6   DT  B C2    1 
ATOM   6096 O O2    . DT  B 2 1   ? 1.012   115.889 -17.692 1.00 81.83  ? -6   DT  B O2    1 
ATOM   6097 N N3    . DT  B 2 1   ? -1.060  116.410 -16.866 1.00 82.52  ? -6   DT  B N3    1 
ATOM   6098 C C4    . DT  B 2 1   ? -2.444  116.571 -16.952 1.00 82.75  ? -6   DT  B C4    1 
ATOM   6099 O O4    . DT  B 2 1   ? -3.094  116.957 -15.962 1.00 76.42  ? -6   DT  B O4    1 
ATOM   6100 C C5    . DT  B 2 1   ? -3.028  116.258 -18.255 1.00 84.07  ? -6   DT  B C5    1 
ATOM   6101 C C7    . DT  B 2 1   ? -4.503  116.420 -18.447 1.00 82.07  ? -6   DT  B C7    1 
ATOM   6102 C C6    . DT  B 2 1   ? -2.213  115.844 -19.236 1.00 89.91  ? -6   DT  B C6    1 
ATOM   6103 P P     . DA  B 2 2   ? 2.662   112.567 -21.540 1.00 165.64 ? -5   DA  B P     1 
ATOM   6104 O OP1   . DA  B 2 2   ? 3.866   112.499 -22.427 1.00 158.15 ? -5   DA  B OP1   1 
ATOM   6105 O OP2   . DA  B 2 2   ? 2.010   111.285 -21.093 1.00 152.71 ? -5   DA  B OP2   1 
ATOM   6106 O "O5'" . DA  B 2 2   ? 3.052   113.414 -20.243 1.00 149.40 ? -5   DA  B "O5'" 1 
ATOM   6107 C "C5'" . DA  B 2 2   ? 4.396   113.826 -20.014 1.00 137.22 ? -5   DA  B "C5'" 1 
ATOM   6108 C "C4'" . DA  B 2 2   ? 4.931   113.227 -18.730 1.00 126.13 ? -5   DA  B "C4'" 1 
ATOM   6109 O "O4'" . DA  B 2 2   ? 3.992   113.385 -17.639 1.00 117.24 ? -5   DA  B "O4'" 1 
ATOM   6110 C "C3'" . DA  B 2 2   ? 5.312   111.757 -18.722 1.00 123.40 ? -5   DA  B "C3'" 1 
ATOM   6111 O "O3'" . DA  B 2 2   ? 6.491   111.697 -17.901 1.00 130.51 ? -5   DA  B "O3'" 1 
ATOM   6112 C "C2'" . DA  B 2 2   ? 4.073   111.094 -18.134 1.00 114.08 ? -5   DA  B "C2'" 1 
ATOM   6113 C "C1'" . DA  B 2 2   ? 3.495   112.143 -17.189 1.00 102.72 ? -5   DA  B "C1'" 1 
ATOM   6114 N N9    . DA  B 2 2   ? 2.041   112.257 -17.235 1.00 81.72  ? -5   DA  B N9    1 
ATOM   6115 C C8    . DA  B 2 2   ? 1.241   112.067 -18.334 1.00 79.60  ? -5   DA  B C8    1 
ATOM   6116 N N7    . DA  B 2 2   ? -0.036  112.293 -18.109 1.00 74.60  ? -5   DA  B N7    1 
ATOM   6117 C C5    . DA  B 2 2   ? -0.081  112.646 -16.765 1.00 73.07  ? -5   DA  B C5    1 
ATOM   6118 C C6    . DA  B 2 2   ? -1.148  113.009 -15.899 1.00 70.32  ? -5   DA  B C6    1 
ATOM   6119 N N6    . DA  B 2 2   ? -2.438  113.088 -16.281 1.00 68.81  ? -5   DA  B N6    1 
ATOM   6120 N N1    . DA  B 2 2   ? -0.841  113.286 -14.599 1.00 70.11  ? -5   DA  B N1    1 
ATOM   6121 C C2    . DA  B 2 2   ? 0.429   113.200 -14.206 1.00 70.16  ? -5   DA  B C2    1 
ATOM   6122 N N3    . DA  B 2 2   ? 1.505   112.887 -14.918 1.00 74.35  ? -5   DA  B N3    1 
ATOM   6123 C C4    . DA  B 2 2   ? 1.188   112.615 -16.208 1.00 76.45  ? -5   DA  B C4    1 
ATOM   6124 P P     . DG  B 2 3   ? 7.097   110.284 -17.409 1.00 135.23 ? -4   DG  B P     1 
ATOM   6125 O OP1   . DG  B 2 3   ? 8.456   110.504 -16.857 1.00 128.82 ? -4   DG  B OP1   1 
ATOM   6126 O OP2   . DG  B 2 3   ? 6.911   109.238 -18.454 1.00 125.36 ? -4   DG  B OP2   1 
ATOM   6127 O "O5'" . DG  B 2 3   ? 6.154   109.881 -16.190 1.00 130.99 ? -4   DG  B "O5'" 1 
ATOM   6128 C "C5'" . DG  B 2 3   ? 5.856   110.781 -15.118 1.00 118.91 ? -4   DG  B "C5'" 1 
ATOM   6129 C "C4'" . DG  B 2 3   ? 5.103   110.025 -14.052 1.00 110.24 ? -4   DG  B "C4'" 1 
ATOM   6130 O "O4'" . DG  B 2 3   ? 3.680   110.256 -14.160 1.00 104.69 ? -4   DG  B "O4'" 1 
ATOM   6131 C "C3'" . DG  B 2 3   ? 5.294   108.517 -14.219 1.00 103.89 ? -4   DG  B "C3'" 1 
ATOM   6132 O "O3'" . DG  B 2 3   ? 5.261   107.852 -12.959 1.00 105.78 ? -4   DG  B "O3'" 1 
ATOM   6133 C "C2'" . DG  B 2 3   ? 4.042   108.113 -14.980 1.00 96.53  ? -4   DG  B "C2'" 1 
ATOM   6134 C "C1'" . DG  B 2 3   ? 3.033   109.013 -14.296 1.00 89.82  ? -4   DG  B "C1'" 1 
ATOM   6135 N N9    . DG  B 2 3   ? 1.746   109.244 -14.948 1.00 77.94  ? -4   DG  B N9    1 
ATOM   6136 C C8    . DG  B 2 3   ? 1.407   109.121 -16.288 1.00 73.80  ? -4   DG  B C8    1 
ATOM   6137 N N7    . DG  B 2 3   ? 0.138   109.381 -16.523 1.00 68.88  ? -4   DG  B N7    1 
ATOM   6138 C C5    . DG  B 2 3   ? -0.388  109.693 -15.273 1.00 68.95  ? -4   DG  B C5    1 
ATOM   6139 C C6    . DG  B 2 3   ? -1.713  110.022 -14.891 1.00 65.45  ? -4   DG  B C6    1 
ATOM   6140 O O6    . DG  B 2 3   ? -2.730  110.142 -15.607 1.00 60.82  ? -4   DG  B O6    1 
ATOM   6141 N N1    . DG  B 2 3   ? -1.800  110.228 -13.511 1.00 66.45  ? -4   DG  B N1    1 
ATOM   6142 C C2    . DG  B 2 3   ? -0.741  110.141 -12.611 1.00 68.64  ? -4   DG  B C2    1 
ATOM   6143 N N2    . DG  B 2 3   ? -1.028  110.370 -11.314 1.00 65.30  ? -4   DG  B N2    1 
ATOM   6144 N N3    . DG  B 2 3   ? 0.494   109.845 -12.962 1.00 71.01  ? -4   DG  B N3    1 
ATOM   6145 C C4    . DG  B 2 3   ? 0.597   109.627 -14.293 1.00 72.77  ? -4   DG  B C4    1 
ATOM   6146 P P     . DA  B 2 4   ? 6.402   108.126 -11.859 1.00 106.50 ? -3   DA  B P     1 
ATOM   6147 O OP1   . DA  B 2 4   ? 7.215   109.314 -12.277 1.00 109.51 ? -3   DA  B OP1   1 
ATOM   6148 O OP2   . DA  B 2 4   ? 7.079   106.842 -11.509 1.00 100.37 ? -3   DA  B OP2   1 
ATOM   6149 O "O5'" . DA  B 2 4   ? 5.539   108.501 -10.570 1.00 99.05  ? -3   DA  B "O5'" 1 
ATOM   6150 C "C5'" . DA  B 2 4   ? 4.952   107.460 -9.793  1.00 87.36  ? -3   DA  B "C5'" 1 
ATOM   6151 C "C4'" . DA  B 2 4   ? 3.843   107.995 -8.922  1.00 75.74  ? -3   DA  B "C4'" 1 
ATOM   6152 O "O4'" . DA  B 2 4   ? 2.708   108.375 -9.744  1.00 71.92  ? -3   DA  B "O4'" 1 
ATOM   6153 C "C3'" . DA  B 2 4   ? 3.332   106.935 -7.960  1.00 70.32  ? -3   DA  B "C3'" 1 
ATOM   6154 O "O3'" . DA  B 2 4   ? 2.985   107.595 -6.753  1.00 66.78  ? -3   DA  B "O3'" 1 
ATOM   6155 C "C2'" . DA  B 2 4   ? 2.158   106.323 -8.720  1.00 69.76  ? -3   DA  B "C2'" 1 
ATOM   6156 C "C1'" . DA  B 2 4   ? 1.604   107.511 -9.513  1.00 67.72  ? -3   DA  B "C1'" 1 
ATOM   6157 N N9    . DA  B 2 4   ? 1.012   107.194 -10.816 1.00 60.81  ? -3   DA  B N9    1 
ATOM   6158 C C8    . DA  B 2 4   ? 1.657   106.806 -11.962 1.00 61.59  ? -3   DA  B C8    1 
ATOM   6159 N N7    . DA  B 2 4   ? 0.857   106.630 -13.000 1.00 59.12  ? -3   DA  B N7    1 
ATOM   6160 C C5    . DA  B 2 4   ? -0.393  106.918 -12.505 1.00 57.07  ? -3   DA  B C5    1 
ATOM   6161 C C6    . DA  B 2 4   ? -1.652  106.947 -13.112 1.00 55.75  ? -3   DA  B C6    1 
ATOM   6162 N N6    . DA  B 2 4   ? -1.851  106.676 -14.383 1.00 56.73  ? -3   DA  B N6    1 
ATOM   6163 N N1    . DA  B 2 4   ? -2.720  107.283 -12.348 1.00 55.99  ? -3   DA  B N1    1 
ATOM   6164 C C2    . DA  B 2 4   ? -2.511  107.587 -11.036 1.00 57.07  ? -3   DA  B C2    1 
ATOM   6165 N N3    . DA  B 2 4   ? -1.349  107.601 -10.339 1.00 58.75  ? -3   DA  B N3    1 
ATOM   6166 C C4    . DA  B 2 4   ? -0.321  107.256 -11.148 1.00 58.98  ? -3   DA  B C4    1 
ATOM   6167 P P     . DT  B 2 5   ? 2.464   106.747 -5.512  1.00 71.94  ? -2   DT  B P     1 
ATOM   6168 O OP1   . DT  B 2 5   ? 3.303   107.060 -4.322  1.00 70.13  ? -2   DT  B OP1   1 
ATOM   6169 O OP2   . DT  B 2 5   ? 2.320   105.321 -5.965  1.00 77.31  ? -2   DT  B OP2   1 
ATOM   6170 O "O5'" . DT  B 2 5   ? 0.944   107.230 -5.288  1.00 68.91  ? -2   DT  B "O5'" 1 
ATOM   6171 C "C5'" . DT  B 2 5   ? 0.099   107.540 -6.425  1.00 64.75  ? -2   DT  B "C5'" 1 
ATOM   6172 C "C4'" . DT  B 2 5   ? -1.248  106.859 -6.331  1.00 59.17  ? -2   DT  B "C4'" 1 
ATOM   6173 O "O4'" . DT  B 2 5   ? -1.668  106.488 -7.664  1.00 55.31  ? -2   DT  B "O4'" 1 
ATOM   6174 C "C3'" . DT  B 2 5   ? -1.306  105.587 -5.501  1.00 57.17  ? -2   DT  B "C3'" 1 
ATOM   6175 O "O3'" . DT  B 2 5   ? -2.566  105.625 -4.778  1.00 54.64  ? -2   DT  B "O3'" 1 
ATOM   6176 C "C2'" . DT  B 2 5   ? -1.224  104.501 -6.562  1.00 56.36  ? -2   DT  B "C2'" 1 
ATOM   6177 C "C1'" . DT  B 2 5   ? -2.017  105.129 -7.697  1.00 54.43  ? -2   DT  B "C1'" 1 
ATOM   6178 N N1    . DT  B 2 5   ? -1.764  104.667 -9.064  1.00 51.86  ? -2   DT  B N1    1 
ATOM   6179 C C2    . DT  B 2 5   ? -2.822  104.680 -9.923  1.00 49.92  ? -2   DT  B C2    1 
ATOM   6180 O O2    . DT  B 2 5   ? -3.949  105.046 -9.594  1.00 49.70  ? -2   DT  B O2    1 
ATOM   6181 N N3    . DT  B 2 5   ? -2.513  104.289 -11.212 1.00 49.19  ? -2   DT  B N3    1 
ATOM   6182 C C4    . DT  B 2 5   ? -1.273  103.924 -11.716 1.00 48.03  ? -2   DT  B C4    1 
ATOM   6183 O O4    . DT  B 2 5   ? -1.130  103.653 -12.931 1.00 46.07  ? -2   DT  B O4    1 
ATOM   6184 C C5    . DT  B 2 5   ? -0.218  103.923 -10.748 1.00 49.46  ? -2   DT  B C5    1 
ATOM   6185 C C7    . DT  B 2 5   ? 1.162   103.536 -11.188 1.00 49.01  ? -2   DT  B C7    1 
ATOM   6186 C C6    . DT  B 2 5   ? -0.514  104.278 -9.484  1.00 52.57  ? -2   DT  B C6    1 
ATOM   6187 P P     . DA  B 2 6   ? -2.858  104.537 -3.629  1.00 59.50  ? -1   DA  B P     1 
ATOM   6188 O OP1   . DA  B 2 6   ? -3.855  105.062 -2.665  1.00 48.56  ? -1   DA  B OP1   1 
ATOM   6189 O OP2   . DA  B 2 6   ? -1.546  103.972 -3.137  1.00 50.87  ? -1   DA  B OP2   1 
ATOM   6190 O "O5'" . DA  B 2 6   ? -3.620  103.407 -4.448  1.00 59.14  ? -1   DA  B "O5'" 1 
ATOM   6191 C "C5'" . DA  B 2 6   ? -4.936  103.666 -4.879  1.00 53.49  ? -1   DA  B "C5'" 1 
ATOM   6192 C "C4'" . DA  B 2 6   ? -5.407  102.652 -5.883  1.00 48.86  ? -1   DA  B "C4'" 1 
ATOM   6193 O "O4'" . DA  B 2 6   ? -4.697  102.735 -7.139  1.00 47.65  ? -1   DA  B "O4'" 1 
ATOM   6194 C "C3'" . DA  B 2 6   ? -5.402  101.193 -5.454  1.00 47.82  ? -1   DA  B "C3'" 1 
ATOM   6195 O "O3'" . DA  B 2 6   ? -6.756  100.907 -5.254  1.00 46.60  ? -1   DA  B "O3'" 1 
ATOM   6196 C "C2'" . DA  B 2 6   ? -4.872  100.451 -6.678  1.00 47.14  ? -1   DA  B "C2'" 1 
ATOM   6197 C "C1'" . DA  B 2 6   ? -4.916  101.483 -7.802  1.00 48.07  ? -1   DA  B "C1'" 1 
ATOM   6198 N N9    . DA  B 2 6   ? -3.873  101.268 -8.819  1.00 38.32  ? -1   DA  B N9    1 
ATOM   6199 C C8    . DA  B 2 6   ? -2.536  101.080 -8.587  1.00 39.97  ? -1   DA  B C8    1 
ATOM   6200 N N7    . DA  B 2 6   ? -1.828  100.864 -9.682  1.00 39.53  ? -1   DA  B N7    1 
ATOM   6201 C C5    . DA  B 2 6   ? -2.762  100.919 -10.686 1.00 34.54  ? -1   DA  B C5    1 
ATOM   6202 C C6    . DA  B 2 6   ? -2.635  100.737 -12.031 1.00 32.27  ? -1   DA  B C6    1 
ATOM   6203 N N6    . DA  B 2 6   ? -1.458  100.469 -12.593 1.00 30.92  ? -1   DA  B N6    1 
ATOM   6204 N N1    . DA  B 2 6   ? -3.770  100.830 -12.803 1.00 34.27  ? -1   DA  B N1    1 
ATOM   6205 C C2    . DA  B 2 6   ? -4.946  101.114 -12.179 1.00 34.97  ? -1   DA  B C2    1 
ATOM   6206 N N3    . DA  B 2 6   ? -5.165  101.304 -10.869 1.00 34.59  ? -1   DA  B N3    1 
ATOM   6207 C C4    . DA  B 2 6   ? -4.023  101.177 -10.177 1.00 35.41  ? -1   DA  B C4    1 
ATOM   6208 P P     . DT  B 2 7   ? -7.214  99.482  -4.715  1.00 50.83  ? 0    DT  B P     1 
ATOM   6209 O OP1   . DT  B 2 7   ? -8.195  99.717  -3.573  1.00 54.87  ? 0    DT  B OP1   1 
ATOM   6210 O OP2   . DT  B 2 7   ? -6.007  98.586  -4.484  1.00 57.20  ? 0    DT  B OP2   1 
ATOM   6211 O "O5'" . DT  B 2 7   ? -7.991  98.992  -6.016  1.00 47.92  ? 0    DT  B "O5'" 1 
ATOM   6212 C "C5'" . DT  B 2 7   ? -7.422  99.309  -7.253  1.00 44.73  ? 0    DT  B "C5'" 1 
ATOM   6213 C "C4'" . DT  B 2 7   ? -8.333  98.961  -8.394  1.00 43.93  ? 0    DT  B "C4'" 1 
ATOM   6214 O "O4'" . DT  B 2 7   ? -7.495  99.113  -9.559  1.00 44.43  ? 0    DT  B "O4'" 1 
ATOM   6215 C "C3'" . DT  B 2 7   ? -8.808  97.515  -8.451  1.00 44.30  ? 0    DT  B "C3'" 1 
ATOM   6216 O "O3'" . DT  B 2 7   ? -9.982  97.556  -9.232  1.00 44.71  ? 0    DT  B "O3'" 1 
ATOM   6217 C "C2'" . DT  B 2 7   ? -7.702  96.807  -9.228  1.00 43.34  ? 0    DT  B "C2'" 1 
ATOM   6218 C "C1'" . DT  B 2 7   ? -7.295  97.861  -10.224 1.00 43.61  ? 0    DT  B "C1'" 1 
ATOM   6219 N N1    . DT  B 2 7   ? -5.897  97.784  -10.724 1.00 44.47  ? 0    DT  B N1    1 
ATOM   6220 C C2    . DT  B 2 7   ? -5.689  97.903  -12.088 1.00 44.02  ? 0    DT  B C2    1 
ATOM   6221 O O2    . DT  B 2 7   ? -6.630  98.062  -12.898 1.00 44.35  ? 0    DT  B O2    1 
ATOM   6222 N N3    . DT  B 2 7   ? -4.379  97.805  -12.480 1.00 42.62  ? 0    DT  B N3    1 
ATOM   6223 C C4    . DT  B 2 7   ? -3.289  97.563  -11.669 1.00 43.81  ? 0    DT  B C4    1 
ATOM   6224 O O4    . DT  B 2 7   ? -2.139  97.410  -12.167 1.00 43.58  ? 0    DT  B O4    1 
ATOM   6225 C C5    . DT  B 2 7   ? -3.592  97.472  -10.249 1.00 44.83  ? 0    DT  B C5    1 
ATOM   6226 C C7    . DT  B 2 7   ? -2.474  97.266  -9.271  1.00 45.76  ? 0    DT  B C7    1 
ATOM   6227 C C6    . DT  B 2 7   ? -4.864  97.587  -9.861  1.00 44.83  ? 0    DT  B C6    1 
ATOM   6228 P P     . DG  B 2 8   ? -11.008 96.340  -9.221  1.00 39.84  ? 1    DG  B P     1 
ATOM   6229 O OP1   . DG  B 2 8   ? -12.224 96.945  -8.665  1.00 52.70  ? 1    DG  B OP1   1 
ATOM   6230 O OP2   . DG  B 2 8   ? -10.395 95.163  -8.551  1.00 49.38  ? 1    DG  B OP2   1 
ATOM   6231 O "O5'" . DG  B 2 8   ? -11.241 96.089  -10.770 1.00 36.48  ? 1    DG  B "O5'" 1 
ATOM   6232 C "C5'" . DG  B 2 8   ? -10.090 95.895  -11.586 1.00 34.03  ? 1    DG  B "C5'" 1 
ATOM   6233 C "C4'" . DG  B 2 8   ? -10.449 95.646  -13.031 1.00 33.54  ? 1    DG  B "C4'" 1 
ATOM   6234 O "O4'" . DG  B 2 8   ? -9.211  95.903  -13.697 1.00 32.58  ? 1    DG  B "O4'" 1 
ATOM   6235 C "C3'" . DG  B 2 8   ? -10.814 94.212  -13.398 1.00 34.27  ? 1    DG  B "C3'" 1 
ATOM   6236 O "O3'" . DG  B 2 8   ? -11.612 94.153  -14.579 1.00 36.21  ? 1    DG  B "O3'" 1 
ATOM   6237 C "C2'" . DG  B 2 8   ? -9.480  93.554  -13.693 1.00 33.25  ? 1    DG  B "C2'" 1 
ATOM   6238 C "C1'" . DG  B 2 8   ? -8.657  94.708  -14.241 1.00 32.89  ? 1    DG  B "C1'" 1 
ATOM   6239 N N9    . DG  B 2 8   ? -7.283  94.635  -13.778 1.00 40.14  ? 1    DG  B N9    1 
ATOM   6240 C C8    . DG  B 2 8   ? -6.909  94.668  -12.461 1.00 40.80  ? 1    DG  B C8    1 
ATOM   6241 N N7    . DG  B 2 8   ? -5.632  94.515  -12.292 1.00 41.05  ? 1    DG  B N7    1 
ATOM   6242 C C5    . DG  B 2 8   ? -5.128  94.397  -13.592 1.00 40.40  ? 1    DG  B C5    1 
ATOM   6243 C C6    . DG  B 2 8   ? -3.773  94.205  -14.042 1.00 38.88  ? 1    DG  B C6    1 
ATOM   6244 O O6    . DG  B 2 8   ? -2.735  94.127  -13.361 1.00 38.97  ? 1    DG  B O6    1 
ATOM   6245 N N1    . DG  B 2 8   ? -3.703  94.110  -15.407 1.00 38.93  ? 1    DG  B N1    1 
ATOM   6246 C C2    . DG  B 2 8   ? -4.781  94.202  -16.248 1.00 40.23  ? 1    DG  B C2    1 
ATOM   6247 N N2    . DG  B 2 8   ? -4.467  94.075  -17.548 1.00 38.93  ? 1    DG  B N2    1 
ATOM   6248 N N3    . DG  B 2 8   ? -6.053  94.402  -15.857 1.00 40.12  ? 1    DG  B N3    1 
ATOM   6249 C C4    . DG  B 2 8   ? -6.139  94.480  -14.520 1.00 40.30  ? 1    DG  B C4    1 
ATOM   6250 P P     . DC  B 2 9   ? -12.091 92.693  -15.126 1.00 49.17  ? 2    DC  B P     1 
ATOM   6251 O OP1   . DC  B 2 9   ? -13.183 92.838  -16.102 1.00 44.53  ? 2    DC  B OP1   1 
ATOM   6252 O OP2   . DC  B 2 9   ? -12.326 91.891  -13.874 1.00 45.79  ? 2    DC  B OP2   1 
ATOM   6253 O "O5'" . DC  B 2 9   ? -10.836 92.200  -15.973 1.00 45.90  ? 2    DC  B "O5'" 1 
ATOM   6254 C "C5'" . DC  B 2 9   ? -10.570 92.905  -17.161 1.00 46.86  ? 2    DC  B "C5'" 1 
ATOM   6255 C "C4'" . DC  B 2 9   ? -9.624  92.164  -18.066 1.00 47.29  ? 2    DC  B "C4'" 1 
ATOM   6256 O "O4'" . DC  B 2 9   ? -8.263  92.241  -17.589 1.00 47.10  ? 2    DC  B "O4'" 1 
ATOM   6257 C "C3'" . DC  B 2 9   ? -9.888  90.700  -18.356 1.00 46.25  ? 2    DC  B "C3'" 1 
ATOM   6258 O "O3'" . DC  B 2 9   ? -9.944  90.637  -19.773 1.00 45.90  ? 2    DC  B "O3'" 1 
ATOM   6259 C "C2'" . DC  B 2 9   ? -8.694  89.985  -17.698 1.00 44.95  ? 2    DC  B "C2'" 1 
ATOM   6260 C "C1'" . DC  B 2 9   ? -7.589  91.017  -17.759 1.00 43.89  ? 2    DC  B "C1'" 1 
ATOM   6261 N N1    . DC  B 2 9   ? -6.563  90.972  -16.721 1.00 37.06  ? 2    DC  B N1    1 
ATOM   6262 C C2    . DC  B 2 9   ? -5.256  90.887  -17.080 1.00 37.59  ? 2    DC  B C2    1 
ATOM   6263 O O2    . DC  B 2 9   ? -5.001  90.800  -18.282 1.00 39.29  ? 2    DC  B O2    1 
ATOM   6264 N N3    . DC  B 2 9   ? -4.290  90.889  -16.103 1.00 36.48  ? 2    DC  B N3    1 
ATOM   6265 C C4    . DC  B 2 9   ? -4.660  90.941  -14.808 1.00 34.94  ? 2    DC  B C4    1 
ATOM   6266 N N4    . DC  B 2 9   ? -3.756  90.888  -13.865 1.00 35.43  ? 2    DC  B N4    1 
ATOM   6267 C C5    . DC  B 2 9   ? -5.990  91.037  -14.428 1.00 35.46  ? 2    DC  B C5    1 
ATOM   6268 C C6    . DC  B 2 9   ? -6.908  91.043  -15.406 1.00 37.42  ? 2    DC  B C6    1 
ATOM   6269 P P     . DA  B 2 10  ? -10.091 89.255  -20.487 1.00 35.79  ? 3    DA  B P     1 
ATOM   6270 O OP1   . DA  B 2 10  ? -10.478 89.557  -21.880 1.00 46.73  ? 3    DA  B OP1   1 
ATOM   6271 O OP2   . DA  B 2 10  ? -10.926 88.349  -19.645 1.00 44.99  ? 3    DA  B OP2   1 
ATOM   6272 O "O5'" . DA  B 2 10  ? -8.601  88.719  -20.654 1.00 35.05  ? 3    DA  B "O5'" 1 
ATOM   6273 C "C5'" . DA  B 2 10  ? -7.822  89.182  -21.742 1.00 36.70  ? 3    DA  B "C5'" 1 
ATOM   6274 C "C4'" . DA  B 2 10  ? -6.504  88.442  -21.843 1.00 37.84  ? 3    DA  B "C4'" 1 
ATOM   6275 O "O4'" . DA  B 2 10  ? -5.638  88.620  -20.678 1.00 38.26  ? 3    DA  B "O4'" 1 
ATOM   6276 C "C3'" . DA  B 2 10  ? -6.479  86.947  -22.170 1.00 37.60  ? 3    DA  B "C3'" 1 
ATOM   6277 O "O3'" . DA  B 2 10  ? -5.476  86.779  -23.176 1.00 39.15  ? 3    DA  B "O3'" 1 
ATOM   6278 C "C2'" . DA  B 2 10  ? -5.972  86.316  -20.883 1.00 35.49  ? 3    DA  B "C2'" 1 
ATOM   6279 C "C1'" . DA  B 2 10  ? -4.982  87.380  -20.414 1.00 34.98  ? 3    DA  B "C1'" 1 
ATOM   6280 N N9    . DA  B 2 10  ? -4.617  87.385  -19.001 1.00 41.94  ? 3    DA  B N9    1 
ATOM   6281 C C8    . DA  B 2 10  ? -5.458  87.458  -17.951 1.00 41.08  ? 3    DA  B C8    1 
ATOM   6282 N N7    . DA  B 2 10  ? -4.860  87.502  -16.784 1.00 40.26  ? 3    DA  B N7    1 
ATOM   6283 C C5    . DA  B 2 10  ? -3.532  87.464  -17.097 1.00 41.16  ? 3    DA  B C5    1 
ATOM   6284 C C6    . DA  B 2 10  ? -2.401  87.500  -16.302 1.00 42.23  ? 3    DA  B C6    1 
ATOM   6285 N N6    . DA  B 2 10  ? -2.447  87.571  -14.963 1.00 43.84  ? 3    DA  B N6    1 
ATOM   6286 N N1    . DA  B 2 10  ? -1.197  87.450  -16.926 1.00 42.19  ? 3    DA  B N1    1 
ATOM   6287 C C2    . DA  B 2 10  ? -1.171  87.348  -18.274 1.00 41.95  ? 3    DA  B C2    1 
ATOM   6288 N N3    . DA  B 2 10  ? -2.188  87.302  -19.135 1.00 42.68  ? 3    DA  B N3    1 
ATOM   6289 C C4    . DA  B 2 10  ? -3.356  87.369  -18.467 1.00 42.19  ? 3    DA  B C4    1 
ATOM   6290 P P     . DT  B 2 11  ? -5.408  85.419  -24.001 1.00 50.69  ? 4    DT  B P     1 
ATOM   6291 O OP1   . DT  B 2 11  ? -5.559  85.729  -25.426 1.00 52.61  ? 4    DT  B OP1   1 
ATOM   6292 O OP2   . DT  B 2 11  ? -6.324  84.422  -23.355 1.00 50.02  ? 4    DT  B OP2   1 
ATOM   6293 O "O5'" . DT  B 2 11  ? -3.926  84.897  -23.826 1.00 49.18  ? 4    DT  B "O5'" 1 
ATOM   6294 C "C5'" . DT  B 2 11  ? -2.832  85.729  -23.541 1.00 42.14  ? 4    DT  B "C5'" 1 
ATOM   6295 C "C4'" . DT  B 2 11  ? -1.803  84.907  -22.797 1.00 39.77  ? 4    DT  B "C4'" 1 
ATOM   6296 O "O4'" . DT  B 2 11  ? -1.979  85.005  -21.360 1.00 38.90  ? 4    DT  B "O4'" 1 
ATOM   6297 C "C3'" . DT  B 2 11  ? -1.769  83.404  -23.098 1.00 38.55  ? 4    DT  B "C3'" 1 
ATOM   6298 O "O3'" . DT  B 2 11  ? -0.526  83.184  -23.733 1.00 39.64  ? 4    DT  B "O3'" 1 
ATOM   6299 C "C2'" . DT  B 2 11  ? -1.976  82.701  -21.746 1.00 37.52  ? 4    DT  B "C2'" 1 
ATOM   6300 C "C1'" . DT  B 2 11  ? -1.606  83.770  -20.726 1.00 36.17  ? 4    DT  B "C1'" 1 
ATOM   6301 N N1    . DT  B 2 11  ? -2.230  83.756  -19.376 1.00 35.29  ? 4    DT  B N1    1 
ATOM   6302 C C2    . DT  B 2 11  ? -1.418  84.100  -18.348 1.00 36.16  ? 4    DT  B C2    1 
ATOM   6303 O O2    . DT  B 2 11  ? -0.232  84.342  -18.525 1.00 39.01  ? 4    DT  B O2    1 
ATOM   6304 N N3    . DT  B 2 11  ? -2.022  84.183  -17.123 1.00 34.03  ? 4    DT  B N3    1 
ATOM   6305 C C4    . DT  B 2 11  ? -3.339  83.934  -16.856 1.00 34.47  ? 4    DT  B C4    1 
ATOM   6306 O O4    . DT  B 2 11  ? -3.759  84.018  -15.715 1.00 36.97  ? 4    DT  B O4    1 
ATOM   6307 C C5    . DT  B 2 11  ? -4.142  83.566  -17.982 1.00 34.03  ? 4    DT  B C5    1 
ATOM   6308 C C7    . DT  B 2 11  ? -5.597  83.311  -17.770 1.00 33.95  ? 4    DT  B C7    1 
ATOM   6309 C C6    . DT  B 2 11  ? -3.550  83.479  -19.172 1.00 35.06  ? 4    DT  B C6    1 
ATOM   6310 P P     . DC  B 2 12  ? -0.047  81.731  -24.013 1.00 40.11  ? 5    DC  B P     1 
ATOM   6311 O OP1   . DC  B 2 12  ? 0.953   81.748  -25.075 1.00 39.93  ? 5    DC  B OP1   1 
ATOM   6312 O OP2   . DC  B 2 12  ? -1.278  80.817  -24.072 1.00 39.06  ? 5    DC  B OP2   1 
ATOM   6313 O "O5'" . DC  B 2 12  ? 0.762   81.447  -22.678 1.00 39.98  ? 5    DC  B "O5'" 1 
ATOM   6314 C "C5'" . DC  B 2 12  ? 1.850   82.295  -22.267 1.00 39.90  ? 5    DC  B "C5'" 1 
ATOM   6315 C "C4'" . DC  B 2 12  ? 2.607   81.640  -21.125 1.00 39.35  ? 5    DC  B "C4'" 1 
ATOM   6316 O "O4'" . DC  B 2 12  ? 1.838   81.757  -19.893 1.00 40.06  ? 5    DC  B "O4'" 1 
ATOM   6317 C "C3'" . DC  B 2 12  ? 2.893   80.138  -21.302 1.00 37.47  ? 5    DC  B "C3'" 1 
ATOM   6318 O "O3'" . DC  B 2 12  ? 4.246   79.850  -21.032 1.00 36.56  ? 5    DC  B "O3'" 1 
ATOM   6319 C "C2'" . DC  B 2 12  ? 1.949   79.452  -20.337 1.00 35.39  ? 5    DC  B "C2'" 1 
ATOM   6320 C "C1'" . DC  B 2 12  ? 1.738   80.481  -19.248 1.00 36.02  ? 5    DC  B "C1'" 1 
ATOM   6321 N N1    . DC  B 2 12  ? 0.442   80.433  -18.542 1.00 34.20  ? 5    DC  B N1    1 
ATOM   6322 C C2    . DC  B 2 12  ? 0.409   80.630  -17.156 1.00 34.43  ? 5    DC  B C2    1 
ATOM   6323 O O2    . DC  B 2 12  ? 1.477   80.833  -16.548 1.00 37.06  ? 5    DC  B O2    1 
ATOM   6324 N N3    . DC  B 2 12  ? -0.770  80.586  -16.514 1.00 32.52  ? 5    DC  B N3    1 
ATOM   6325 C C4    . DC  B 2 12  ? -1.874  80.332  -17.201 1.00 33.08  ? 5    DC  B C4    1 
ATOM   6326 N N4    . DC  B 2 12  ? -3.014  80.193  -16.527 1.00 33.47  ? 5    DC  B N4    1 
ATOM   6327 C C5    . DC  B 2 12  ? -1.873  80.163  -18.597 1.00 33.78  ? 5    DC  B C5    1 
ATOM   6328 C C6    . DC  B 2 12  ? -0.707  80.208  -19.222 1.00 34.18  ? 5    DC  B C6    1 
ATOM   6329 P P     . DT  B 2 13  ? 4.758   78.339  -21.126 1.00 34.51  ? 6    DT  B P     1 
ATOM   6330 O OP1   . DT  B 2 13  ? 6.160   78.340  -21.671 1.00 47.89  ? 6    DT  B OP1   1 
ATOM   6331 O OP2   . DT  B 2 13  ? 3.734   77.421  -21.756 1.00 44.66  ? 6    DT  B OP2   1 
ATOM   6332 O "O5'" . DT  B 2 13  ? 4.875   77.926  -19.593 1.00 32.58  ? 6    DT  B "O5'" 1 
ATOM   6333 C "C5'" . DT  B 2 13  ? 5.831   78.532  -18.769 1.00 32.01  ? 6    DT  B "C5'" 1 
ATOM   6334 C "C4'" . DT  B 2 13  ? 5.723   78.001  -17.376 1.00 31.39  ? 6    DT  B "C4'" 1 
ATOM   6335 O "O4'" . DT  B 2 13  ? 4.392   78.296  -16.846 1.00 31.85  ? 6    DT  B "O4'" 1 
ATOM   6336 C "C3'" . DT  B 2 13  ? 5.904   76.487  -17.254 1.00 31.21  ? 6    DT  B "C3'" 1 
ATOM   6337 O "O3'" . DT  B 2 13  ? 6.726   76.244  -16.123 1.00 31.40  ? 6    DT  B "O3'" 1 
ATOM   6338 C "C2'" . DT  B 2 13  ? 4.515   75.971  -16.895 1.00 30.54  ? 6    DT  B "C2'" 1 
ATOM   6339 C "C1'" . DT  B 2 13  ? 3.934   77.149  -16.141 1.00 31.32  ? 6    DT  B "C1'" 1 
ATOM   6340 N N1    . DT  B 2 13  ? 2.494   77.209  -16.044 1.00 44.23  ? 6    DT  B N1    1 
ATOM   6341 C C2    . DT  B 2 13  ? 1.931   77.672  -14.861 1.00 46.21  ? 6    DT  B C2    1 
ATOM   6342 O O2    . DT  B 2 13  ? 2.582   78.067  -13.897 1.00 46.56  ? 6    DT  B O2    1 
ATOM   6343 N N3    . DT  B 2 13  ? 0.550   77.661  -14.843 1.00 46.20  ? 6    DT  B N3    1 
ATOM   6344 C C4    . DT  B 2 13  ? -0.292  77.248  -15.879 1.00 44.63  ? 6    DT  B C4    1 
ATOM   6345 O O4    . DT  B 2 13  ? -1.518  77.260  -15.752 1.00 43.46  ? 6    DT  B O4    1 
ATOM   6346 C C5    . DT  B 2 13  ? 0.373   76.822  -17.071 1.00 44.91  ? 6    DT  B C5    1 
ATOM   6347 C C7    . DT  B 2 13  ? -0.482  76.423  -18.231 1.00 46.01  ? 6    DT  B C7    1 
ATOM   6348 C C6    . DT  B 2 13  ? 1.718   76.811  -17.094 1.00 45.28  ? 6    DT  B C6    1 
ATOM   6349 P P     . DC  B 2 14  ? 7.373   74.830  -15.919 1.00 32.18  ? 7    DC  B P     1 
ATOM   6350 O OP1   . DC  B 2 14  ? 8.859   74.944  -15.901 1.00 39.05  ? 7    DC  B OP1   1 
ATOM   6351 O OP2   . DC  B 2 14  ? 6.692   74.002  -16.958 1.00 36.23  ? 7    DC  B OP2   1 
ATOM   6352 O "O5'" . DC  B 2 14  ? 6.933   74.326  -14.469 1.00 31.11  ? 7    DC  B "O5'" 1 
ATOM   6353 C "C5'" . DC  B 2 14  ? 6.605   75.183  -13.424 1.00 29.26  ? 7    DC  B "C5'" 1 
ATOM   6354 C "C4'" . DC  B 2 14  ? 5.532   74.552  -12.552 1.00 28.78  ? 7    DC  B "C4'" 1 
ATOM   6355 O "O4'" . DC  B 2 14  ? 4.208   74.687  -13.131 1.00 28.45  ? 7    DC  B "O4'" 1 
ATOM   6356 C "C3'" . DC  B 2 14  ? 5.637   73.076  -12.165 1.00 29.68  ? 7    DC  B "C3'" 1 
ATOM   6357 O "O3'" . DC  B 2 14  ? 5.775   72.936  -10.755 1.00 32.36  ? 7    DC  B "O3'" 1 
ATOM   6358 C "C2'" . DC  B 2 14  ? 4.262   72.502  -12.531 1.00 28.91  ? 7    DC  B "C2'" 1 
ATOM   6359 C "C1'" . DC  B 2 14  ? 3.366   73.688  -12.601 1.00 27.52  ? 7    DC  B "C1'" 1 
ATOM   6360 N N1    . DC  B 2 14  ? 2.196   73.587  -13.476 1.00 31.62  ? 7    DC  B N1    1 
ATOM   6361 C C2    . DC  B 2 14  ? 0.904   73.804  -12.928 1.00 33.51  ? 7    DC  B C2    1 
ATOM   6362 O O2    . DC  B 2 14  ? 0.793   73.986  -11.707 1.00 35.31  ? 7    DC  B O2    1 
ATOM   6363 N N3    . DC  B 2 14  ? -0.172  73.810  -13.731 1.00 32.75  ? 7    DC  B N3    1 
ATOM   6364 C C4    . DC  B 2 14  ? -0.013  73.575  -15.042 1.00 34.02  ? 7    DC  B C4    1 
ATOM   6365 N N4    . DC  B 2 14  ? -1.121  73.483  -15.843 1.00 34.54  ? 7    DC  B N4    1 
ATOM   6366 C C5    . DC  B 2 14  ? 1.292   73.362  -15.624 1.00 35.11  ? 7    DC  B C5    1 
ATOM   6367 C C6    . DC  B 2 14  ? 2.346   73.350  -14.802 1.00 33.14  ? 7    DC  B C6    1 
ATOM   6368 P P     . DC  B 2 15  ? 6.424   71.608  -10.163 1.00 47.59  ? 8    DC  B P     1 
ATOM   6369 O OP1   . DC  B 2 15  ? 7.755   71.942  -9.573  1.00 41.70  ? 8    DC  B OP1   1 
ATOM   6370 O OP2   . DC  B 2 15  ? 6.337   70.513  -11.179 1.00 38.27  ? 8    DC  B OP2   1 
ATOM   6371 O "O5'" . DC  B 2 15  ? 5.393   71.274  -9.003  1.00 47.97  ? 8    DC  B "O5'" 1 
ATOM   6372 C "C5'" . DC  B 2 15  ? 4.554   72.277  -8.480  1.00 49.16  ? 8    DC  B "C5'" 1 
ATOM   6373 C "C4'" . DC  B 2 15  ? 3.213   71.685  -8.116  1.00 49.39  ? 8    DC  B "C4'" 1 
ATOM   6374 O "O4'" . DC  B 2 15  ? 2.231   71.986  -9.138  1.00 47.79  ? 8    DC  B "O4'" 1 
ATOM   6375 C "C3'" . DC  B 2 15  ? 3.121   70.178  -7.843  1.00 48.63  ? 8    DC  B "C3'" 1 
ATOM   6376 O "O3'" . DC  B 2 15  ? 2.163   69.992  -6.811  1.00 51.43  ? 8    DC  B "O3'" 1 
ATOM   6377 C "C2'" . DC  B 2 15  ? 2.398   69.692  -9.076  1.00 46.62  ? 8    DC  B "C2'" 1 
ATOM   6378 C "C1'" . DC  B 2 15  ? 1.413   70.849  -9.250  1.00 44.22  ? 8    DC  B "C1'" 1 
ATOM   6379 N N1    . DC  B 2 15  ? 0.659   70.948  -10.515 1.00 32.50  ? 8    DC  B N1    1 
ATOM   6380 C C2    . DC  B 2 15  ? -0.673  71.258  -10.448 1.00 32.28  ? 8    DC  B C2    1 
ATOM   6381 O O2    . DC  B 2 15  ? -1.166  71.466  -9.323  1.00 30.46  ? 8    DC  B O2    1 
ATOM   6382 N N3    . DC  B 2 15  ? -1.396  71.310  -11.609 1.00 31.40  ? 8    DC  B N3    1 
ATOM   6383 C C4    . DC  B 2 15  ? -0.789  71.038  -12.790 1.00 30.75  ? 8    DC  B C4    1 
ATOM   6384 N N4    . DC  B 2 15  ? -1.467  71.063  -13.878 1.00 31.46  ? 8    DC  B N4    1 
ATOM   6385 C C5    . DC  B 2 15  ? 0.562   70.731  -12.883 1.00 30.24  ? 8    DC  B C5    1 
ATOM   6386 C C6    . DC  B 2 15  ? 1.260   70.712  -11.733 1.00 31.01  ? 8    DC  B C6    1 
ATOM   6387 P P     . DC  B 2 16  ? 2.326   68.798  -5.736  1.00 53.60  ? 9    DC  B P     1 
ATOM   6388 O OP1   . DC  B 2 16  ? 2.619   69.513  -4.463  1.00 47.35  ? 9    DC  B OP1   1 
ATOM   6389 O OP2   . DC  B 2 16  ? 3.296   67.747  -6.210  1.00 44.71  ? 9    DC  B OP2   1 
ATOM   6390 O "O5'" . DC  B 2 16  ? 0.856   68.192  -5.658  1.00 50.45  ? 9    DC  B "O5'" 1 
ATOM   6391 C "C5'" . DC  B 2 16  ? -0.176  69.001  -5.177  1.00 49.42  ? 9    DC  B "C5'" 1 
ATOM   6392 C "C4'" . DC  B 2 16  ? -1.508  68.487  -5.638  1.00 48.80  ? 9    DC  B "C4'" 1 
ATOM   6393 O "O4'" . DC  B 2 16  ? -1.732  68.906  -7.002  1.00 49.07  ? 9    DC  B "O4'" 1 
ATOM   6394 C "C3'" . DC  B 2 16  ? -1.727  66.977  -5.622  1.00 48.26  ? 9    DC  B "C3'" 1 
ATOM   6395 O "O3'" . DC  B 2 16  ? -2.105  66.624  -4.288  1.00 50.18  ? 9    DC  B "O3'" 1 
ATOM   6396 C "C2'" . DC  B 2 16  ? -2.714  66.771  -6.770  1.00 46.92  ? 9    DC  B "C2'" 1 
ATOM   6397 C "C1'" . DC  B 2 16  ? -2.777  68.117  -7.534  1.00 44.85  ? 9    DC  B "C1'" 1 
ATOM   6398 N N1    . DC  B 2 16  ? -2.573  68.010  -8.999  1.00 35.53  ? 9    DC  B N1    1 
ATOM   6399 C C2    . DC  B 2 16  ? -3.727  68.167  -9.835  1.00 35.55  ? 9    DC  B C2    1 
ATOM   6400 O O2    . DC  B 2 16  ? -4.806  68.420  -9.313  1.00 35.14  ? 9    DC  B O2    1 
ATOM   6401 N N3    . DC  B 2 16  ? -3.603  68.032  -11.182 1.00 36.52  ? 9    DC  B N3    1 
ATOM   6402 C C4    . DC  B 2 16  ? -2.378  67.760  -11.717 1.00 35.91  ? 9    DC  B C4    1 
ATOM   6403 N N4    . DC  B 2 16  ? -2.300  67.615  -13.046 1.00 34.63  ? 9    DC  B N4    1 
ATOM   6404 C C5    . DC  B 2 16  ? -1.186  67.617  -10.898 1.00 33.44  ? 9    DC  B C5    1 
ATOM   6405 C C6    . DC  B 2 16  ? -1.330  67.745  -9.563  1.00 34.36  ? 9    DC  B C6    1 
ATOM   6406 P P     . DC  B 2 17  ? -3.273  65.561  -3.924  1.00 43.93  ? 10   DC  B P     1 
ATOM   6407 O OP1   . DC  B 2 17  ? -4.012  66.336  -2.837  1.00 48.41  ? 10   DC  B OP1   1 
ATOM   6408 O OP2   . DC  B 2 17  ? -2.638  64.226  -3.588  1.00 49.78  ? 10   DC  B OP2   1 
ATOM   6409 O "O5'" . DC  B 2 17  ? -4.347  65.401  -5.109  1.00 39.40  ? 10   DC  B "O5'" 1 
ATOM   6410 C "C5'" . DC  B 2 17  ? -5.562  66.110  -4.988  1.00 41.82  ? 10   DC  B "C5'" 1 
ATOM   6411 C "C4'" . DC  B 2 17  ? -6.628  65.563  -5.893  1.00 43.21  ? 10   DC  B "C4'" 1 
ATOM   6412 O "O4'" . DC  B 2 17  ? -6.301  65.781  -7.285  1.00 43.01  ? 10   DC  B "O4'" 1 
ATOM   6413 C "C3'" . DC  B 2 17  ? -7.009  64.088  -5.751  1.00 47.81  ? 10   DC  B "C3'" 1 
ATOM   6414 O "O3'" . DC  B 2 17  ? -8.428  64.056  -5.525  1.00 54.57  ? 10   DC  B "O3'" 1 
ATOM   6415 C "C2'" . DC  B 2 17  ? -6.639  63.500  -7.121  1.00 46.30  ? 10   DC  B "C2'" 1 
ATOM   6416 C "C1'" . DC  B 2 17  ? -6.775  64.698  -8.036  1.00 44.34  ? 10   DC  B "C1'" 1 
ATOM   6417 N N1    . DC  B 2 17  ? -6.052  64.681  -9.296  1.00 47.00  ? 10   DC  B N1    1 
ATOM   6418 C C2    . DC  B 2 17  ? -6.814  64.734  -10.456 1.00 48.23  ? 10   DC  B C2    1 
ATOM   6419 O O2    . DC  B 2 17  ? -8.026  64.828  -10.335 1.00 49.56  ? 10   DC  B O2    1 
ATOM   6420 N N3    . DC  B 2 17  ? -6.209  64.699  -11.679 1.00 47.53  ? 10   DC  B N3    1 
ATOM   6421 C C4    . DC  B 2 17  ? -4.867  64.645  -11.746 1.00 46.07  ? 10   DC  B C4    1 
ATOM   6422 N N4    . DC  B 2 17  ? -4.330  64.637  -12.958 1.00 44.64  ? 10   DC  B N4    1 
ATOM   6423 C C5    . DC  B 2 17  ? -4.039  64.605  -10.559 1.00 44.38  ? 10   DC  B C5    1 
ATOM   6424 C C6    . DC  B 2 17  ? -4.683  64.620  -9.364  1.00 45.95  ? 10   DC  B C6    1 
ATOM   6425 P P     . DC  B 2 18  ? -9.169  62.717  -5.010  1.00 65.46  ? 11   DC  B P     1 
ATOM   6426 O OP1   . DC  B 2 18  ? -10.387 63.257  -4.353  1.00 65.60  ? 11   DC  B OP1   1 
ATOM   6427 O OP2   . DC  B 2 18  ? -8.250  61.790  -4.239  1.00 63.66  ? 11   DC  B OP2   1 
ATOM   6428 O "O5'" . DC  B 2 18  ? -9.718  62.049  -6.346  1.00 60.58  ? 11   DC  B "O5'" 1 
ATOM   6429 C "C5'" . DC  B 2 18  ? -11.016 62.388  -6.787  1.00 60.36  ? 11   DC  B "C5'" 1 
ATOM   6430 C "C4'" . DC  B 2 18  ? -11.255 61.940  -8.206  1.00 59.09  ? 11   DC  B "C4'" 1 
ATOM   6431 O "O4'" . DC  B 2 18  ? -10.084 62.200  -9.008  1.00 57.25  ? 11   DC  B "O4'" 1 
ATOM   6432 C "C3'" . DC  B 2 18  ? -11.626 60.472  -8.420  1.00 57.39  ? 11   DC  B "C3'" 1 
ATOM   6433 O "O3'" . DC  B 2 18  ? -13.018 60.499  -8.617  1.00 58.65  ? 11   DC  B "O3'" 1 
ATOM   6434 C "C2'" . DC  B 2 18  ? -10.822 60.056  -9.652  1.00 56.14  ? 11   DC  B "C2'" 1 
ATOM   6435 C "C1'" . DC  B 2 18  ? -10.101 61.338  -10.126 1.00 52.44  ? 11   DC  B "C1'" 1 
ATOM   6436 N N1    . DC  B 2 18  ? -8.699  61.149  -10.544 1.00 43.68  ? 11   DC  B N1    1 
ATOM   6437 C C2    . DC  B 2 18  ? -8.390  61.048  -11.952 1.00 42.66  ? 11   DC  B C2    1 
ATOM   6438 O O2    . DC  B 2 18  ? -9.313  61.137  -12.798 1.00 41.21  ? 11   DC  B O2    1 
ATOM   6439 N N3    . DC  B 2 18  ? -7.097  60.859  -12.325 1.00 41.10  ? 11   DC  B N3    1 
ATOM   6440 C C4    . DC  B 2 18  ? -6.122  60.764  -11.366 1.00 40.82  ? 11   DC  B C4    1 
ATOM   6441 N N4    . DC  B 2 18  ? -4.836  60.556  -11.730 1.00 38.15  ? 11   DC  B N4    1 
ATOM   6442 C C5    . DC  B 2 18  ? -6.414  60.869  -9.970  1.00 42.71  ? 11   DC  B C5    1 
ATOM   6443 C C6    . DC  B 2 18  ? -7.704  61.065  -9.607  1.00 44.41  ? 11   DC  B C6    1 
ATOM   6444 P P     . DT  B 2 19  ? -13.787 59.207  -9.071  1.00 57.81  ? 12   DT  B P     1 
ATOM   6445 O OP1   . DT  B 2 19  ? -15.265 59.475  -9.284  1.00 59.02  ? 12   DT  B OP1   1 
ATOM   6446 O OP2   . DT  B 2 19  ? -13.336 58.062  -8.219  1.00 64.18  ? 12   DT  B OP2   1 
ATOM   6447 O "O5'" . DT  B 2 19  ? -13.155 58.974  -10.466 1.00 52.03  ? 12   DT  B "O5'" 1 
ATOM   6448 C "C5'" . DT  B 2 19  ? -13.920 59.143  -11.582 1.00 50.50  ? 12   DT  B "C5'" 1 
ATOM   6449 C "C4'" . DT  B 2 19  ? -13.193 58.517  -12.740 1.00 50.04  ? 12   DT  B "C4'" 1 
ATOM   6450 O "O4'" . DT  B 2 19  ? -11.750 58.632  -12.589 1.00 47.41  ? 12   DT  B "O4'" 1 
ATOM   6451 C "C3'" . DT  B 2 19  ? -13.452 57.038  -12.973 1.00 49.51  ? 12   DT  B "C3'" 1 
ATOM   6452 O "O3'" . DT  B 2 19  ? -14.329 57.056  -14.044 1.00 51.35  ? 12   DT  B "O3'" 1 
ATOM   6453 C "C2'" . DT  B 2 19  ? -12.089 56.476  -13.371 1.00 46.18  ? 12   DT  B "C2'" 1 
ATOM   6454 C "C1'" . DT  B 2 19  ? -11.232 57.738  -13.525 1.00 43.24  ? 12   DT  B "C1'" 1 
ATOM   6455 N N1    . DT  B 2 19  ? -9.778  57.661  -13.306 1.00 37.24  ? 12   DT  B N1    1 
ATOM   6456 C C2    . DT  B 2 19  ? -8.995  57.593  -14.462 1.00 35.38  ? 12   DT  B C2    1 
ATOM   6457 O O2    . DT  B 2 19  ? -9.470  57.579  -15.599 1.00 34.95  ? 12   DT  B O2    1 
ATOM   6458 N N3    . DT  B 2 19  ? -7.655  57.534  -14.226 1.00 32.84  ? 12   DT  B N3    1 
ATOM   6459 C C4    . DT  B 2 19  ? -7.035  57.484  -12.969 1.00 31.94  ? 12   DT  B C4    1 
ATOM   6460 O O4    . DT  B 2 19  ? -5.793  57.334  -12.868 1.00 30.49  ? 12   DT  B O4    1 
ATOM   6461 C C5    . DT  B 2 19  ? -7.918  57.572  -11.822 1.00 32.50  ? 12   DT  B C5    1 
ATOM   6462 C C7    . DT  B 2 19  ? -7.314  57.533  -10.461 1.00 32.61  ? 12   DT  B C7    1 
ATOM   6463 C C6    . DT  B 2 19  ? -9.225  57.668  -12.036 1.00 34.13  ? 12   DT  B C6    1 
ATOM   6464 P P     . DA  B 2 20  ? -14.811 55.710  -14.636 1.00 49.49  ? 13   DA  B P     1 
ATOM   6465 O OP1   . DA  B 2 20  ? -16.066 55.924  -15.445 1.00 60.57  ? 13   DA  B OP1   1 
ATOM   6466 O OP2   . DA  B 2 20  ? -14.758 54.734  -13.508 1.00 58.78  ? 13   DA  B OP2   1 
ATOM   6467 O "O5'" . DA  B 2 20  ? -13.687 55.386  -15.676 1.00 46.00  ? 13   DA  B "O5'" 1 
ATOM   6468 C "C5'" . DA  B 2 20  ? -13.877 55.686  -17.027 1.00 42.14  ? 13   DA  B "C5'" 1 
ATOM   6469 C "C4'" . DA  B 2 20  ? -12.704 55.130  -17.786 1.00 38.33  ? 13   DA  B "C4'" 1 
ATOM   6470 O "O4'" . DA  B 2 20  ? -11.500 55.264  -16.974 1.00 33.51  ? 13   DA  B "O4'" 1 
ATOM   6471 C "C3'" . DA  B 2 20  ? -12.792 53.636  -18.104 1.00 37.53  ? 13   DA  B "C3'" 1 
ATOM   6472 O "O3'" . DA  B 2 20  ? -12.626 53.447  -19.504 1.00 37.97  ? 13   DA  B "O3'" 1 
ATOM   6473 C "C2'" . DA  B 2 20  ? -11.596 53.033  -17.376 1.00 34.73  ? 13   DA  B "C2'" 1 
ATOM   6474 C "C1'" . DA  B 2 20  ? -10.667 54.205  -17.310 1.00 31.15  ? 13   DA  B "C1'" 1 
ATOM   6475 N N9    . DA  B 2 20  ? -9.625  54.167  -16.309 1.00 35.71  ? 13   DA  B N9    1 
ATOM   6476 C C8    . DA  B 2 20  ? -9.751  54.139  -14.958 1.00 36.43  ? 13   DA  B C8    1 
ATOM   6477 N N7    . DA  B 2 20  ? -8.605  54.183  -14.319 1.00 34.90  ? 13   DA  B N7    1 
ATOM   6478 C C5    . DA  B 2 20  ? -7.665  54.210  -15.330 1.00 32.58  ? 13   DA  B C5    1 
ATOM   6479 C C6    . DA  B 2 20  ? -6.263  54.198  -15.308 1.00 30.69  ? 13   DA  B C6    1 
ATOM   6480 N N6    . DA  B 2 20  ? -5.547  54.197  -14.233 1.00 29.76  ? 13   DA  B N6    1 
ATOM   6481 N N1    . DA  B 2 20  ? -5.617  54.182  -16.472 1.00 30.76  ? 13   DA  B N1    1 
ATOM   6482 C C2    . DA  B 2 20  ? -6.375  54.232  -17.607 1.00 31.90  ? 13   DA  B C2    1 
ATOM   6483 N N3    . DA  B 2 20  ? -7.698  54.276  -17.752 1.00 32.56  ? 13   DA  B N3    1 
ATOM   6484 C C4    . DA  B 2 20  ? -8.281  54.222  -16.561 1.00 33.65  ? 13   DA  B C4    1 
ATOM   6485 P P     . DC  B 2 21  ? -13.178 52.129  -20.132 1.00 50.40  ? 14   DC  B P     1 
ATOM   6486 O OP1   . DC  B 2 21  ? -14.201 52.521  -21.113 1.00 42.12  ? 14   DC  B OP1   1 
ATOM   6487 O OP2   . DC  B 2 21  ? -13.499 51.293  -18.967 1.00 39.28  ? 14   DC  B OP2   1 
ATOM   6488 O "O5'" . DC  B 2 21  ? -12.005 51.474  -20.948 1.00 50.42  ? 14   DC  B "O5'" 1 
ATOM   6489 C "C5'" . DC  B 2 21  ? -11.056 52.292  -21.538 1.00 48.51  ? 14   DC  B "C5'" 1 
ATOM   6490 C "C4'" . DC  B 2 21  ? -9.665  51.719  -21.358 1.00 46.71  ? 14   DC  B "C4'" 1 
ATOM   6491 O "O4'" . DC  B 2 21  ? -9.179  51.809  -19.999 1.00 43.89  ? 14   DC  B "O4'" 1 
ATOM   6492 C "C3'" . DC  B 2 21  ? -9.499  50.244  -21.687 1.00 46.06  ? 14   DC  B "C3'" 1 
ATOM   6493 O "O3'" . DC  B 2 21  ? -9.001  50.055  -23.012 1.00 47.14  ? 14   DC  B "O3'" 1 
ATOM   6494 C "C2'" . DC  B 2 21  ? -8.498  49.735  -20.625 1.00 42.81  ? 14   DC  B "C2'" 1 
ATOM   6495 C "C1'" . DC  B 2 21  ? -8.052  50.980  -19.945 1.00 40.12  ? 14   DC  B "C1'" 1 
ATOM   6496 N N1    . DC  B 2 21  ? -7.613  50.909  -18.563 1.00 25.07  ? 14   DC  B N1    1 
ATOM   6497 C C2    . DC  B 2 21  ? -6.279  51.019  -18.325 1.00 23.83  ? 14   DC  B C2    1 
ATOM   6498 O O2    . DC  B 2 21  ? -5.524  51.181  -19.332 1.00 24.18  ? 14   DC  B O2    1 
ATOM   6499 N N3    . DC  B 2 21  ? -5.797  50.984  -17.025 1.00 22.15  ? 14   DC  B N3    1 
ATOM   6500 C C4    . DC  B 2 21  ? -6.642  50.845  -16.020 1.00 22.50  ? 14   DC  B C4    1 
ATOM   6501 N N4    . DC  B 2 21  ? -6.131  50.705  -14.796 1.00 22.05  ? 14   DC  B N4    1 
ATOM   6502 C C5    . DC  B 2 21  ? -8.052  50.799  -16.246 1.00 24.15  ? 14   DC  B C5    1 
ATOM   6503 C C6    . DC  B 2 21  ? -8.479  50.801  -17.533 1.00 25.41  ? 14   DC  B C6    1 
ATOM   6504 P P     . DT  B 2 22  ? -8.331  48.633  -23.362 1.00 49.51  ? 15   DT  B P     1 
ATOM   6505 O OP1   . DT  B 2 22  ? -8.090  48.539  -24.807 1.00 44.36  ? 15   DT  B OP1   1 
ATOM   6506 O OP2   . DT  B 2 22  ? -9.075  47.561  -22.686 1.00 43.91  ? 15   DT  B OP2   1 
ATOM   6507 O "O5'" . DT  B 2 22  ? -6.923  48.800  -22.650 1.00 44.70  ? 15   DT  B "O5'" 1 
ATOM   6508 C "C5'" . DT  B 2 22  ? -5.773  48.798  -23.406 1.00 41.79  ? 15   DT  B "C5'" 1 
ATOM   6509 C "C4'" . DT  B 2 22  ? -4.642  48.249  -22.586 1.00 39.14  ? 15   DT  B "C4'" 1 
ATOM   6510 O "O4'" . DT  B 2 22  ? -4.798  48.444  -21.152 1.00 36.70  ? 15   DT  B "O4'" 1 
ATOM   6511 C "C3'" . DT  B 2 22  ? -4.404  46.744  -22.814 1.00 38.68  ? 15   DT  B "C3'" 1 
ATOM   6512 O "O3'" . DT  B 2 22  ? -3.129  46.602  -23.473 1.00 38.44  ? 15   DT  B "O3'" 1 
ATOM   6513 C "C2'" . DT  B 2 22  ? -4.428  46.134  -21.418 1.00 36.77  ? 15   DT  B "C2'" 1 
ATOM   6514 C "C1'" . DT  B 2 22  ? -4.109  47.340  -20.558 1.00 35.65  ? 15   DT  B "C1'" 1 
ATOM   6515 N N1    . DT  B 2 22  ? -4.427  47.260  -19.137 1.00 29.22  ? 15   DT  B N1    1 
ATOM   6516 C C2    . DT  B 2 22  ? -3.377  47.328  -18.258 1.00 28.85  ? 15   DT  B C2    1 
ATOM   6517 O O2    . DT  B 2 22  ? -2.202  47.422  -18.600 1.00 27.93  ? 15   DT  B O2    1 
ATOM   6518 N N3    . DT  B 2 22  ? -3.754  47.270  -16.932 1.00 28.68  ? 15   DT  B N3    1 
ATOM   6519 C C4    . DT  B 2 22  ? -5.039  47.150  -16.422 1.00 29.48  ? 15   DT  B C4    1 
ATOM   6520 O O4    . DT  B 2 22  ? -5.219  47.141  -15.204 1.00 29.92  ? 15   DT  B O4    1 
ATOM   6521 C C5    . DT  B 2 22  ? -6.085  47.075  -17.408 1.00 30.10  ? 15   DT  B C5    1 
ATOM   6522 C C7    . DT  B 2 22  ? -7.510  46.989  -16.947 1.00 31.31  ? 15   DT  B C7    1 
ATOM   6523 C C6    . DT  B 2 22  ? -5.728  47.122  -18.698 1.00 30.03  ? 15   DT  B C6    1 
ATOM   6524 P P     . DG  B 2 23  ? -2.640  45.161  -23.914 1.00 35.56  ? 16   DG  B P     1 
ATOM   6525 O OP1   . DG  B 2 23  ? -2.336  45.218  -25.387 1.00 34.84  ? 16   DG  B OP1   1 
ATOM   6526 O OP2   . DG  B 2 23  ? -3.577  44.136  -23.360 1.00 34.40  ? 16   DG  B OP2   1 
ATOM   6527 O "O5'" . DG  B 2 23  ? -1.234  44.942  -23.184 1.00 33.13  ? 16   DG  B "O5'" 1 
ATOM   6528 C "C5'" . DG  B 2 23  ? -0.798  45.759  -22.167 1.00 31.03  ? 16   DG  B "C5'" 1 
ATOM   6529 C "C4'" . DG  B 2 23  ? -0.124  44.919  -21.121 1.00 30.55  ? 16   DG  B "C4'" 1 
ATOM   6530 O "O4'" . DG  B 2 23  ? -0.911  45.038  -19.916 1.00 30.49  ? 16   DG  B "O4'" 1 
ATOM   6531 C "C3'" . DG  B 2 23  ? 0.095   43.416  -21.347 1.00 30.66  ? 16   DG  B "C3'" 1 
ATOM   6532 O "O3'" . DG  B 2 23  ? 1.505   43.258  -21.278 1.00 30.71  ? 16   DG  B "O3'" 1 
ATOM   6533 C "C2'" . DG  B 2 23  ? -0.642  42.746  -20.174 1.00 30.41  ? 16   DG  B "C2'" 1 
ATOM   6534 C "C1'" . DG  B 2 23  ? -0.748  43.865  -19.153 1.00 30.02  ? 16   DG  B "C1'" 1 
ATOM   6535 N N9    . DG  B 2 23  ? -1.812  43.848  -18.174 1.00 28.28  ? 16   DG  B N9    1 
ATOM   6536 C C8    . DG  B 2 23  ? -3.139  43.916  -18.402 1.00 28.70  ? 16   DG  B C8    1 
ATOM   6537 N N7    . DG  B 2 23  ? -3.835  43.856  -17.311 1.00 29.37  ? 16   DG  B N7    1 
ATOM   6538 C C5    . DG  B 2 23  ? -2.882  43.762  -16.310 1.00 28.77  ? 16   DG  B C5    1 
ATOM   6539 C C6    . DG  B 2 23  ? -3.028  43.701  -14.871 1.00 29.24  ? 16   DG  B C6    1 
ATOM   6540 O O6    . DG  B 2 23  ? -4.065  43.716  -14.169 1.00 30.77  ? 16   DG  B O6    1 
ATOM   6541 N N1    . DG  B 2 23  ? -1.801  43.625  -14.248 1.00 30.46  ? 16   DG  B N1    1 
ATOM   6542 C C2    . DG  B 2 23  ? -0.590  43.618  -14.912 1.00 30.67  ? 16   DG  B C2    1 
ATOM   6543 N N2    . DG  B 2 23  ? 0.522   43.496  -14.092 1.00 30.89  ? 16   DG  B N2    1 
ATOM   6544 N N3    . DG  B 2 23  ? -0.462  43.715  -16.237 1.00 28.79  ? 16   DG  B N3    1 
ATOM   6545 C C4    . DG  B 2 23  ? -1.635  43.771  -16.848 1.00 27.97  ? 16   DG  B C4    1 
ATOM   6546 P P     . DT  B 2 24  ? 2.233   41.819  -21.438 1.00 28.31  ? 17   DT  B P     1 
ATOM   6547 O OP1   . DT  B 2 24  ? 3.113   41.979  -22.647 1.00 37.61  ? 17   DT  B OP1   1 
ATOM   6548 O OP2   . DT  B 2 24  ? 1.302   40.583  -21.306 1.00 36.80  ? 17   DT  B OP2   1 
ATOM   6549 O "O5'" . DT  B 2 24  ? 3.137   41.795  -20.146 1.00 26.88  ? 17   DT  B "O5'" 1 
ATOM   6550 C "C5'" . DT  B 2 24  ? 2.429   41.710  -18.941 1.00 25.94  ? 17   DT  B "C5'" 1 
ATOM   6551 C "C4'" . DT  B 2 24  ? 3.331   41.398  -17.793 1.00 25.74  ? 17   DT  B "C4'" 1 
ATOM   6552 O "O4'" . DT  B 2 24  ? 2.515   41.555  -16.647 1.00 25.78  ? 17   DT  B "O4'" 1 
ATOM   6553 C "C3'" . DT  B 2 24  ? 3.823   39.976  -17.737 1.00 26.12  ? 17   DT  B "C3'" 1 
ATOM   6554 O "O3'" . DT  B 2 24  ? 5.015   39.906  -16.956 1.00 26.78  ? 17   DT  B "O3'" 1 
ATOM   6555 C "C2'" . DT  B 2 24  ? 2.719   39.260  -17.010 1.00 26.22  ? 17   DT  B "C2'" 1 
ATOM   6556 C "C1'" . DT  B 2 24  ? 2.214   40.324  -16.061 1.00 27.96  ? 17   DT  B "C1'" 1 
ATOM   6557 N N1    . DT  B 2 24  ? 0.727   40.259  -15.796 1.00 39.39  ? 17   DT  B N1    1 
ATOM   6558 C C2    . DT  B 2 24  ? 0.254   40.237  -14.484 1.00 40.59  ? 17   DT  B C2    1 
ATOM   6559 O O2    . DT  B 2 24  ? 0.956   40.265  -13.503 1.00 40.57  ? 17   DT  B O2    1 
ATOM   6560 N N3    . DT  B 2 24  ? -1.103  40.154  -14.381 1.00 42.23  ? 17   DT  B N3    1 
ATOM   6561 C C4    . DT  B 2 24  ? -2.031  40.068  -15.424 1.00 42.20  ? 17   DT  B C4    1 
ATOM   6562 O O4    . DT  B 2 24  ? -3.201  39.967  -15.183 1.00 41.82  ? 17   DT  B O4    1 
ATOM   6563 C C5    . DT  B 2 24  ? -1.483  40.086  -16.749 1.00 42.35  ? 17   DT  B C5    1 
ATOM   6564 C C7    . DT  B 2 24  ? -2.391  39.967  -17.921 1.00 42.26  ? 17   DT  B C7    1 
ATOM   6565 C C6    . DT  B 2 24  ? -0.159  40.192  -16.871 1.00 41.04  ? 17   DT  B C6    1 
ATOM   6566 P P     . DA  B 2 25  ? 5.672   38.472  -16.662 1.00 38.12  ? 18   DA  B P     1 
ATOM   6567 O OP1   . DA  B 2 25  ? 7.116   38.683  -16.426 1.00 37.29  ? 18   DA  B OP1   1 
ATOM   6568 O OP2   . DA  B 2 25  ? 5.214   37.493  -17.696 1.00 36.25  ? 18   DA  B OP2   1 
ATOM   6569 O "O5'" . DA  B 2 25  ? 4.994   38.066  -15.302 1.00 37.28  ? 18   DA  B "O5'" 1 
ATOM   6570 C "C5'" . DA  B 2 25  ? 5.591   38.482  -14.127 1.00 38.48  ? 18   DA  B "C5'" 1 
ATOM   6571 C "C4'" . DA  B 2 25  ? 4.908   37.814  -12.967 1.00 40.81  ? 18   DA  B "C4'" 1 
ATOM   6572 O "O4'" . DA  B 2 25  ? 3.477   38.063  -12.947 1.00 42.61  ? 18   DA  B "O4'" 1 
ATOM   6573 C "C3'" . DA  B 2 25  ? 5.115   36.317  -12.788 1.00 41.17  ? 18   DA  B "C3'" 1 
ATOM   6574 O "O3'" . DA  B 2 25  ? 5.706   36.361  -11.534 1.00 42.50  ? 18   DA  B "O3'" 1 
ATOM   6575 C "C2'" . DA  B 2 25  ? 3.699   35.753  -12.707 1.00 43.14  ? 18   DA  B "C2'" 1 
ATOM   6576 C "C1'" . DA  B 2 25  ? 2.813   36.965  -12.354 1.00 43.34  ? 18   DA  B "C1'" 1 
ATOM   6577 N N9    . DA  B 2 25  ? 1.441   36.961  -12.903 1.00 43.23  ? 18   DA  B N9    1 
ATOM   6578 C C8    . DA  B 2 25  ? 1.049   36.982  -14.267 1.00 43.06  ? 18   DA  B C8    1 
ATOM   6579 N N7    . DA  B 2 25  ? -0.249  36.974  -14.443 1.00 44.00  ? 18   DA  B N7    1 
ATOM   6580 C C5    . DA  B 2 25  ? -0.751  36.953  -13.130 1.00 45.09  ? 18   DA  B C5    1 
ATOM   6581 C C6    . DA  B 2 25  ? -2.047  36.914  -12.624 1.00 44.02  ? 18   DA  B C6    1 
ATOM   6582 N N6    . DA  B 2 25  ? -3.125  36.918  -13.382 1.00 44.79  ? 18   DA  B N6    1 
ATOM   6583 N N1    . DA  B 2 25  ? -2.198  36.880  -11.296 1.00 44.66  ? 18   DA  B N1    1 
ATOM   6584 C C2    . DA  B 2 25  ? -1.117  36.890  -10.526 1.00 44.08  ? 18   DA  B C2    1 
ATOM   6585 N N3    . DA  B 2 25  ? 0.134   36.924  -10.860 1.00 43.75  ? 18   DA  B N3    1 
ATOM   6586 C C4    . DA  B 2 25  ? 0.271   36.952  -12.186 1.00 44.57  ? 18   DA  B C4    1 
ATOM   6587 P P     . DC  B 2 26  ? 6.283   35.075  -10.875 1.00 33.39  ? 19   DC  B P     1 
ATOM   6588 O OP1   . DC  B 2 26  ? 7.723   35.384  -10.546 1.00 35.63  ? 19   DC  B OP1   1 
ATOM   6589 O OP2   . DC  B 2 26  ? 5.923   33.879  -11.743 1.00 36.48  ? 19   DC  B OP2   1 
ATOM   6590 O "O5'" . DC  B 2 26  ? 5.315   34.957  -9.597  1.00 34.29  ? 19   DC  B "O5'" 1 
ATOM   6591 C "C5'" . DC  B 2 26  ? 3.937   34.799  -9.775  1.00 33.91  ? 19   DC  B "C5'" 1 
ATOM   6592 C "C4'" . DC  B 2 26  ? 3.278   34.443  -8.474  1.00 37.18  ? 19   DC  B "C4'" 1 
ATOM   6593 O "O4'" . DC  B 2 26  ? 1.870   34.636  -8.679  1.00 38.97  ? 19   DC  B "O4'" 1 
ATOM   6594 C "C3'" . DC  B 2 26  ? 3.411   32.971  -8.041  1.00 39.82  ? 19   DC  B "C3'" 1 
ATOM   6595 O "O3'" . DC  B 2 26  ? 3.033   32.961  -6.674  1.00 46.77  ? 19   DC  B "O3'" 1 
ATOM   6596 C "C2'" . DC  B 2 26  ? 2.257   32.313  -8.787  1.00 38.87  ? 19   DC  B "C2'" 1 
ATOM   6597 C "C1'" . DC  B 2 26  ? 1.190   33.397  -8.682  1.00 39.43  ? 19   DC  B "C1'" 1 
ATOM   6598 N N1    . DC  B 2 26  ? 0.225   33.413  -9.777  1.00 42.28  ? 19   DC  B N1    1 
ATOM   6599 C C2    . DC  B 2 26  ? -1.129  33.517  -9.462  1.00 45.51  ? 19   DC  B C2    1 
ATOM   6600 O O2    . DC  B 2 26  ? -1.453  33.624  -8.254  1.00 49.90  ? 19   DC  B O2    1 
ATOM   6601 N N3    . DC  B 2 26  ? -2.059  33.489  -10.467 1.00 45.00  ? 19   DC  B N3    1 
ATOM   6602 C C4    . DC  B 2 26  ? -1.657  33.379  -11.733 1.00 43.47  ? 19   DC  B C4    1 
ATOM   6603 N N4    . DC  B 2 26  ? -2.582  33.371  -12.705 1.00 43.36  ? 19   DC  B N4    1 
ATOM   6604 C C5    . DC  B 2 26  ? -0.281  33.277  -12.071 1.00 42.71  ? 19   DC  B C5    1 
ATOM   6605 C C6    . DC  B 2 26  ? 0.617   33.301  -11.074 1.00 41.52  ? 19   DC  B C6    1 
ATOM   6606 P P     . DA  B 2 27  ? 3.530   31.835  -5.664  1.00 53.96  ? 20   DA  B P     1 
ATOM   6607 O OP1   . DA  B 2 27  ? 4.064   32.619  -4.501  1.00 51.94  ? 20   DA  B OP1   1 
ATOM   6608 O OP2   . DA  B 2 27  ? 4.375   30.829  -6.298  1.00 49.59  ? 20   DA  B OP2   1 
ATOM   6609 O "O5'" . DA  B 2 27  ? 2.157   31.146  -5.243  1.00 57.89  ? 20   DA  B "O5'" 1 
ATOM   6610 C "C5'" . DA  B 2 27  ? 1.116   31.885  -4.613  1.00 59.02  ? 20   DA  B "C5'" 1 
ATOM   6611 C "C4'" . DA  B 2 27  ? -0.188  31.128  -4.693  1.00 60.66  ? 20   DA  B "C4'" 1 
ATOM   6612 O "O4'" . DA  B 2 27  ? -0.760  31.335  -6.003  1.00 59.64  ? 20   DA  B "O4'" 1 
ATOM   6613 C "C3'" . DA  B 2 27  ? -0.140  29.602  -4.463  1.00 63.49  ? 20   DA  B "C3'" 1 
ATOM   6614 O "O3'" . DA  B 2 27  ? -0.924  29.212  -3.330  1.00 72.83  ? 20   DA  B "O3'" 1 
ATOM   6615 C "C2'" . DA  B 2 27  ? -0.734  28.998  -5.727  1.00 59.69  ? 20   DA  B "C2'" 1 
ATOM   6616 C "C1'" . DA  B 2 27  ? -1.518  30.165  -6.321  1.00 55.94  ? 20   DA  B "C1'" 1 
ATOM   6617 N N9    . DA  B 2 27  ? -1.713  30.101  -7.777  1.00 44.89  ? 20   DA  B N9    1 
ATOM   6618 C C8    . DA  B 2 27  ? -0.754  29.911  -8.744  1.00 40.69  ? 20   DA  B C8    1 
ATOM   6619 N N7    . DA  B 2 27  ? -1.221  29.935  -9.967  1.00 38.87  ? 20   DA  B N7    1 
ATOM   6620 C C5    . DA  B 2 27  ? -2.587  30.133  -9.798  1.00 41.69  ? 20   DA  B C5    1 
ATOM   6621 C C6    . DA  B 2 27  ? -3.648  30.229  -10.716 1.00 41.17  ? 20   DA  B C6    1 
ATOM   6622 N N6    . DA  B 2 27  ? -3.487  30.069  -12.051 1.00 37.68  ? 20   DA  B N6    1 
ATOM   6623 N N1    . DA  B 2 27  ? -4.896  30.472  -10.213 1.00 42.19  ? 20   DA  B N1    1 
ATOM   6624 C C2    . DA  B 2 27  ? -5.057  30.561  -8.877  1.00 42.69  ? 20   DA  B C2    1 
ATOM   6625 N N3    . DA  B 2 27  ? -4.146  30.447  -7.913  1.00 43.30  ? 20   DA  B N3    1 
ATOM   6626 C C4    . DA  B 2 27  ? -2.911  30.238  -8.449  1.00 43.96  ? 20   DA  B C4    1 
ATOM   6627 P P     . DC  B 2 28  ? -0.910  27.681  -2.830  1.00 88.18  ? 21   DC  B P     1 
ATOM   6628 O OP1   . DC  B 2 28  ? -0.963  27.711  -1.330  1.00 76.98  ? 21   DC  B OP1   1 
ATOM   6629 O OP2   . DC  B 2 28  ? 0.150   26.863  -3.529  1.00 72.63  ? 21   DC  B OP2   1 
ATOM   6630 O "O5'" . DC  B 2 28  ? -2.311  27.156  -3.342  1.00 87.91  ? 21   DC  B "O5'" 1 
ATOM   6631 C "C5'" . DC  B 2 28  ? -3.465  27.845  -2.997  1.00 90.03  ? 21   DC  B "C5'" 1 
ATOM   6632 C "C4'" . DC  B 2 28  ? -4.611  27.395  -3.861  1.00 95.21  ? 21   DC  B "C4'" 1 
ATOM   6633 O "O4'" . DC  B 2 28  ? -4.399  27.744  -5.245  1.00 93.97  ? 21   DC  B "O4'" 1 
ATOM   6634 C "C3'" . DC  B 2 28  ? -4.951  25.907  -3.847  1.00 97.82  ? 21   DC  B "C3'" 1 
ATOM   6635 O "O3'" . DC  B 2 28  ? -6.144  25.799  -3.083  1.00 107.81 ? 21   DC  B "O3'" 1 
ATOM   6636 C "C2'" . DC  B 2 28  ? -5.158  25.563  -5.320  1.00 91.08  ? 21   DC  B "C2'" 1 
ATOM   6637 C "C1'" . DC  B 2 28  ? -5.258  26.924  -5.992  1.00 86.66  ? 21   DC  B "C1'" 1 
ATOM   6638 N N1    . DC  B 2 28  ? -4.847  26.979  -7.399  1.00 67.15  ? 21   DC  B N1    1 
ATOM   6639 C C2    . DC  B 2 28  ? -5.830  27.240  -8.377  1.00 68.11  ? 21   DC  B C2    1 
ATOM   6640 O O2    . DC  B 2 28  ? -7.021  27.414  -8.021  1.00 69.59  ? 21   DC  B O2    1 
ATOM   6641 N N3    . DC  B 2 28  ? -5.463  27.291  -9.684  1.00 64.81  ? 21   DC  B N3    1 
ATOM   6642 C C4    . DC  B 2 28  ? -4.179  27.081  -10.034 1.00 61.45  ? 21   DC  B C4    1 
ATOM   6643 N N4    . DC  B 2 28  ? -3.842  27.134  -11.353 1.00 59.02  ? 21   DC  B N4    1 
ATOM   6644 C C5    . DC  B 2 28  ? -3.172  26.809  -9.058  1.00 60.82  ? 21   DC  B C5    1 
ATOM   6645 C C6    . DC  B 2 28  ? -3.549  26.778  -7.762  1.00 63.27  ? 21   DC  B C6    1 
ATOM   6646 P P     . DC  B 2 29  ? -6.813  24.381  -2.811  1.00 95.83  ? 22   DC  B P     1 
ATOM   6647 O OP1   . DC  B 2 29  ? -7.673  24.582  -1.592  1.00 102.85 ? 22   DC  B OP1   1 
ATOM   6648 O OP2   . DC  B 2 29  ? -5.772  23.323  -2.802  1.00 108.63 ? 22   DC  B OP2   1 
ATOM   6649 O "O5'" . DC  B 2 29  ? -7.668  24.128  -4.128  1.00 87.23  ? 22   DC  B "O5'" 1 
ATOM   6650 C "C5'" . DC  B 2 29  ? -8.619  25.067  -4.570  1.00 83.43  ? 22   DC  B "C5'" 1 
ATOM   6651 C "C4'" . DC  B 2 29  ? -9.396  24.458  -5.705  1.00 86.48  ? 22   DC  B "C4'" 1 
ATOM   6652 O "O4'" . DC  B 2 29  ? -8.767  24.732  -6.987  1.00 81.97  ? 22   DC  B "O4'" 1 
ATOM   6653 C "C3'" . DC  B 2 29  ? -9.478  22.938  -5.585  1.00 90.09  ? 22   DC  B "C3'" 1 
ATOM   6654 O "O3'" . DC  B 2 29  ? -10.726 22.517  -6.144  1.00 98.06  ? 22   DC  B "O3'" 1 
ATOM   6655 C "C2'" . DC  B 2 29  ? -8.348  22.500  -6.498  1.00 85.97  ? 22   DC  B "C2'" 1 
ATOM   6656 C "C1'" . DC  B 2 29  ? -8.481  23.505  -7.630  1.00 79.21  ? 22   DC  B "C1'" 1 
ATOM   6657 N N1    . DC  B 2 29  ? -7.273  23.671  -8.455  1.00 74.26  ? 22   DC  B N1    1 
ATOM   6658 C C2    . DC  B 2 29  ? -7.431  24.001  -9.810  1.00 69.32  ? 22   DC  B C2    1 
ATOM   6659 O O2    . DC  B 2 29  ? -8.590  24.162  -10.258 1.00 72.12  ? 22   DC  B O2    1 
ATOM   6660 N N3    . DC  B 2 29  ? -6.316  24.135  -10.594 1.00 64.67  ? 22   DC  B N3    1 
ATOM   6661 C C4    . DC  B 2 29  ? -5.087  23.957  -10.055 1.00 65.52  ? 22   DC  B C4    1 
ATOM   6662 N N4    . DC  B 2 29  ? -3.995  24.106  -10.846 1.00 64.23  ? 22   DC  B N4    1 
ATOM   6663 C C5    . DC  B 2 29  ? -4.911  23.619  -8.680  1.00 68.45  ? 22   DC  B C5    1 
ATOM   6664 C C6    . DC  B 2 29  ? -6.019  23.491  -7.923  1.00 73.14  ? 22   DC  B C6    1 
ATOM   6665 P P     . DA  B 2 30  ? -11.402 21.120  -5.721  1.00 108.68 ? 23   DA  B P     1 
ATOM   6666 O OP1   . DA  B 2 30  ? -11.594 21.207  -4.251  1.00 87.48  ? 23   DA  B OP1   1 
ATOM   6667 O OP2   . DA  B 2 30  ? -10.685 19.962  -6.319  1.00 82.44  ? 23   DA  B OP2   1 
ATOM   6668 O "O5'" . DA  B 2 30  ? -12.778 21.221  -6.503  1.00 111.39 ? 23   DA  B "O5'" 1 
ATOM   6669 C "C5'" . DA  B 2 30  ? -12.897 22.120  -7.600  1.00 110.89 ? 23   DA  B "C5'" 1 
ATOM   6670 C "C4'" . DA  B 2 30  ? -12.577 21.403  -8.885  1.00 108.26 ? 23   DA  B "C4'" 1 
ATOM   6671 O "O4'" . DA  B 2 30  ? -11.252 21.715  -9.389  1.00 103.07 ? 23   DA  B "O4'" 1 
ATOM   6672 C "C3'" . DA  B 2 30  ? -12.665 19.874  -8.805  1.00 109.93 ? 23   DA  B "C3'" 1 
ATOM   6673 O "O3'" . DA  B 2 30  ? -13.480 19.405  -9.877  1.00 117.60 ? 23   DA  B "O3'" 1 
ATOM   6674 C "C2'" . DA  B 2 30  ? -11.248 19.427  -9.095  1.00 104.97 ? 23   DA  B "C2'" 1 
ATOM   6675 C "C1'" . DA  B 2 30  ? -10.787 20.531  -10.014 1.00 98.77  ? 23   DA  B "C1'" 1 
ATOM   6676 N N9    . DA  B 2 30  ? -9.333  20.590  -10.187 1.00 68.29  ? 23   DA  B N9    1 
ATOM   6677 C C8    . DA  B 2 30  ? -8.370  20.517  -9.210  1.00 65.07  ? 23   DA  B C8    1 
ATOM   6678 N N7    . DA  B 2 30  ? -7.142  20.537  -9.685  1.00 56.81  ? 23   DA  B N7    1 
ATOM   6679 C C5    . DA  B 2 30  ? -7.308  20.626  -11.060 1.00 52.47  ? 23   DA  B C5    1 
ATOM   6680 C C6    . DA  B 2 30  ? -6.390  20.669  -12.111 1.00 48.72  ? 23   DA  B C6    1 
ATOM   6681 N N6    . DA  B 2 30  ? -5.073  20.615  -11.913 1.00 50.28  ? 23   DA  B N6    1 
ATOM   6682 N N1    . DA  B 2 30  ? -6.866  20.760  -13.382 1.00 46.65  ? 23   DA  B N1    1 
ATOM   6683 C C2    . DA  B 2 30  ? -8.194  20.798  -13.556 1.00 49.71  ? 23   DA  B C2    1 
ATOM   6684 N N3    . DA  B 2 30  ? -9.166  20.759  -12.635 1.00 53.45  ? 23   DA  B N3    1 
ATOM   6685 C C4    . DA  B 2 30  ? -8.647  20.670  -11.391 1.00 57.77  ? 23   DA  B C4    1 
ATOM   6686 P P     . DC  B 2 31  ? -14.068 17.902  -9.866  1.00 106.66 ? 24   DC  B P     1 
ATOM   6687 O OP1   . DC  B 2 31  ? -15.133 17.880  -8.811  1.00 99.69  ? 24   DC  B OP1   1 
ATOM   6688 O OP2   . DC  B 2 31  ? -12.964 16.891  -9.830  1.00 94.19  ? 24   DC  B OP2   1 
ATOM   6689 O "O5'" . DC  B 2 31  ? -14.745 17.810  -11.300 1.00 103.58 ? 24   DC  B "O5'" 1 
ATOM   6690 C "C5'" . DC  B 2 31  ? -14.476 18.802  -12.270 1.00 103.90 ? 24   DC  B "C5'" 1 
ATOM   6691 C "C4'" . DC  B 2 31  ? -13.683 18.214  -13.406 1.00 102.65 ? 24   DC  B "C4'" 1 
ATOM   6692 O "O4'" . DC  B 2 31  ? -12.267 18.487  -13.265 1.00 98.63  ? 24   DC  B "O4'" 1 
ATOM   6693 C "C3'" . DC  B 2 31  ? -13.830 16.699  -13.555 1.00 109.65 ? 24   DC  B "C3'" 1 
ATOM   6694 O "O3'" . DC  B 2 31  ? -14.409 16.375  -14.819 1.00 121.95 ? 24   DC  B "O3'" 1 
ATOM   6695 C "C2'" . DC  B 2 31  ? -12.406 16.169  -13.466 1.00 105.15 ? 24   DC  B "C2'" 1 
ATOM   6696 C "C1'" . DC  B 2 31  ? -11.554 17.385  -13.796 1.00 97.30  ? 24   DC  B "C1'" 1 
ATOM   6697 N N1    . DC  B 2 31  ? -10.234 17.324  -13.146 1.00 82.04  ? 24   DC  B N1    1 
ATOM   6698 C C2    . DC  B 2 31  ? -9.068  17.466  -13.949 1.00 74.18  ? 24   DC  B C2    1 
ATOM   6699 O O2    . DC  B 2 31  ? -9.198  17.651  -15.189 1.00 68.87  ? 24   DC  B O2    1 
ATOM   6700 N N3    . DC  B 2 31  ? -7.849  17.390  -13.349 1.00 71.53  ? 24   DC  B N3    1 
ATOM   6701 C C4    . DC  B 2 31  ? -7.766  17.169  -12.012 1.00 73.68  ? 24   DC  B C4    1 
ATOM   6702 N N4    . DC  B 2 31  ? -6.522  17.088  -11.441 1.00 68.61  ? 24   DC  B N4    1 
ATOM   6703 C C5    . DC  B 2 31  ? -8.942  17.018  -11.190 1.00 75.66  ? 24   DC  B C5    1 
ATOM   6704 C C6    . DC  B 2 31  ? -10.132 17.109  -11.790 1.00 80.37  ? 24   DC  B C6    1 
ATOM   6705 P P     . DC  B 2 32  ? -14.360 14.863  -15.344 1.00 170.17 ? 25   DC  B P     1 
ATOM   6706 O OP1   . DC  B 2 32  ? -15.287 14.744  -16.497 1.00 138.62 ? 25   DC  B OP1   1 
ATOM   6707 O OP2   . DC  B 2 32  ? -14.546 13.976  -14.168 1.00 136.77 ? 25   DC  B OP2   1 
ATOM   6708 O "O5'" . DC  B 2 32  ? -12.876 14.737  -15.906 1.00 162.19 ? 25   DC  B "O5'" 1 
ATOM   6709 C "C5'" . DC  B 2 32  ? -12.466 15.546  -17.002 1.00 157.65 ? 25   DC  B "C5'" 1 
ATOM   6710 C "C4'" . DC  B 2 32  ? -11.601 14.747  -17.944 1.00 153.48 ? 25   DC  B "C4'" 1 
ATOM   6711 O "O4'" . DC  B 2 32  ? -10.218 14.835  -17.544 1.00 145.13 ? 25   DC  B "O4'" 1 
ATOM   6712 C "C3'" . DC  B 2 32  ? -11.930 13.260  -18.018 1.00 152.08 ? 25   DC  B "C3'" 1 
ATOM   6713 O "O3'" . DC  B 2 32  ? -11.692 12.803  -19.349 1.00 157.93 ? 25   DC  B "O3'" 1 
ATOM   6714 C "C2'" . DC  B 2 32  ? -10.947 12.647  -17.042 1.00 145.01 ? 25   DC  B "C2'" 1 
ATOM   6715 C "C1'" . DC  B 2 32  ? -9.729  13.556  -17.180 1.00 136.76 ? 25   DC  B "C1'" 1 
ATOM   6716 N N1    . DC  B 2 32  ? -8.954  13.713  -15.938 1.00 91.21  ? 25   DC  B N1    1 
ATOM   6717 C C2    . DC  B 2 32  ? -7.589  14.029  -16.032 1.00 81.76  ? 25   DC  B C2    1 
ATOM   6718 O O2    . DC  B 2 32  ? -7.092  14.210  -17.162 1.00 70.45  ? 25   DC  B O2    1 
ATOM   6719 N N3    . DC  B 2 32  ? -6.857  14.138  -14.895 1.00 84.59  ? 25   DC  B N3    1 
ATOM   6720 C C4    . DC  B 2 32  ? -7.449  13.966  -13.702 1.00 88.35  ? 25   DC  B C4    1 
ATOM   6721 N N4    . DC  B 2 32  ? -6.699  14.090  -12.597 1.00 85.97  ? 25   DC  B N4    1 
ATOM   6722 C C5    . DC  B 2 32  ? -8.842  13.661  -13.585 1.00 87.89  ? 25   DC  B C5    1 
ATOM   6723 C C6    . DC  B 2 32  ? -9.547  13.545  -14.716 1.00 91.27  ? 25   DC  B C6    1 
ATOM   6724 P P     . DA  B 2 33  ? -11.671 11.226  -19.669 1.00 142.69 ? 26   DA  B P     1 
ATOM   6725 O OP1   . DA  B 2 33  ? -12.329 11.070  -20.996 1.00 163.10 ? 26   DA  B OP1   1 
ATOM   6726 O OP2   . DA  B 2 33  ? -12.185 10.454  -18.502 1.00 155.46 ? 26   DA  B OP2   1 
ATOM   6727 O "O5'" . DA  B 2 33  ? -10.124 10.895  -19.863 1.00 136.11 ? 26   DA  B "O5'" 1 
ATOM   6728 C "C5'" . DA  B 2 33  ? -9.527  10.921  -21.158 1.00 127.34 ? 26   DA  B "C5'" 1 
ATOM   6729 C "C4'" . DA  B 2 33  ? -8.054  11.228  -21.043 1.00 121.57 ? 26   DA  B "C4'" 1 
ATOM   6730 O "O4'" . DA  B 2 33  ? -7.756  11.661  -19.698 1.00 115.40 ? 26   DA  B "O4'" 1 
ATOM   6731 C "C3'" . DA  B 2 33  ? -7.106  10.066  -21.338 1.00 125.53 ? 26   DA  B "C3'" 1 
ATOM   6732 O "O3'" . DA  B 2 33  ? -6.088  10.514  -22.240 1.00 135.67 ? 26   DA  B "O3'" 1 
ATOM   6733 C "C2'" . DA  B 2 33  ? -6.514  9.711   -19.982 1.00 121.37 ? 26   DA  B "C2'" 1 
ATOM   6734 C "C1'" . DA  B 2 33  ? -6.593  11.015  -19.215 1.00 113.50 ? 26   DA  B "C1'" 1 
ATOM   6735 N N9    . DA  B 2 33  ? -6.748  10.865  -17.767 1.00 127.56 ? 26   DA  B N9    1 
ATOM   6736 C C8    . DA  B 2 33  ? -7.893  10.533  -17.072 1.00 127.85 ? 26   DA  B C8    1 
ATOM   6737 N N7    . DA  B 2 33  ? -7.731  10.486  -15.767 1.00 125.78 ? 26   DA  B N7    1 
ATOM   6738 C C5    . DA  B 2 33  ? -6.390  10.803  -15.587 1.00 123.65 ? 26   DA  B C5    1 
ATOM   6739 C C6    . DA  B 2 33  ? -5.590  10.918  -14.430 1.00 121.27 ? 26   DA  B C6    1 
ATOM   6740 N N6    . DA  B 2 33  ? -6.041  10.713  -13.193 1.00 122.27 ? 26   DA  B N6    1 
ATOM   6741 N N1    . DA  B 2 33  ? -4.293  11.255  -14.594 1.00 118.56 ? 26   DA  B N1    1 
ATOM   6742 C C2    . DA  B 2 33  ? -3.835  11.456  -15.842 1.00 117.94 ? 26   DA  B C2    1 
ATOM   6743 N N3    . DA  B 2 33  ? -4.485  11.370  -17.013 1.00 119.02 ? 26   DA  B N3    1 
ATOM   6744 C C4    . DA  B 2 33  ? -5.772  11.038  -16.812 1.00 123.38 ? 26   DA  B C4    1 
ATOM   6745 P P     . DA  B 2 34  ? -5.325  9.457   -23.184 1.00 152.27 ? 27   DA  B P     1 
ATOM   6746 O OP1   . DA  B 2 34  ? -4.634  10.232  -24.261 1.00 123.03 ? 27   DA  B OP1   1 
ATOM   6747 O OP2   . DA  B 2 34  ? -6.289  8.378   -23.558 1.00 120.03 ? 27   DA  B OP2   1 
ATOM   6748 O "O5'" . DA  B 2 34  ? -4.225  8.866   -22.197 1.00 141.02 ? 27   DA  B "O5'" 1 
ATOM   6749 C "C5'" . DA  B 2 34  ? -3.014  8.308   -22.688 1.00 133.98 ? 27   DA  B "C5'" 1 
ATOM   6750 C "C4'" . DA  B 2 34  ? -1.868  8.749   -21.813 1.00 129.81 ? 27   DA  B "C4'" 1 
ATOM   6751 O "O4'" . DA  B 2 34  ? -2.392  9.164   -20.529 1.00 128.98 ? 27   DA  B "O4'" 1 
ATOM   6752 C "C3'" . DA  B 2 34  ? -0.824  7.668   -21.527 1.00 131.18 ? 27   DA  B "C3'" 1 
ATOM   6753 O "O3'" . DA  B 2 34  ? 0.508   8.217   -21.586 1.00 131.79 ? 27   DA  B "O3'" 1 
ATOM   6754 C "C2'" . DA  B 2 34  ? -1.170  7.210   -20.119 1.00 128.26 ? 27   DA  B "C2'" 1 
ATOM   6755 C "C1'" . DA  B 2 34  ? -1.669  8.502   -19.502 1.00 125.23 ? 27   DA  B "C1'" 1 
ATOM   6756 N N9    . DA  B 2 34  ? -2.555  8.352   -18.350 1.00 91.51  ? 27   DA  B N9    1 
ATOM   6757 C C8    . DA  B 2 34  ? -3.896  8.061   -18.354 1.00 88.80  ? 27   DA  B C8    1 
ATOM   6758 N N7    . DA  B 2 34  ? -4.423  7.993   -17.157 1.00 86.90  ? 27   DA  B N7    1 
ATOM   6759 C C5    . DA  B 2 34  ? -3.355  8.269   -16.304 1.00 86.96  ? 27   DA  B C5    1 
ATOM   6760 C C6    . DA  B 2 34  ? -3.257  8.367   -14.897 1.00 84.76  ? 27   DA  B C6    1 
ATOM   6761 N N6    . DA  B 2 34  ? -4.297  8.196   -14.073 1.00 84.83  ? 27   DA  B N6    1 
ATOM   6762 N N1    . DA  B 2 34  ? -2.047  8.652   -14.367 1.00 82.96  ? 27   DA  B N1    1 
ATOM   6763 C C2    . DA  B 2 34  ? -1.016  8.823   -15.191 1.00 84.68  ? 27   DA  B C2    1 
ATOM   6764 N N3    . DA  B 2 34  ? -0.982  8.763   -16.521 1.00 85.37  ? 27   DA  B N3    1 
ATOM   6765 C C4    . DA  B 2 34  ? -2.199  8.483   -17.025 1.00 87.23  ? 27   DA  B C4    1 
ATOM   6766 P P     . DA  B 2 35  ? 1.793   7.235   -21.445 1.00 120.07 ? 28   DA  B P     1 
ATOM   6767 O OP1   . DA  B 2 35  ? 3.042   7.897   -21.930 1.00 119.76 ? 28   DA  B OP1   1 
ATOM   6768 O OP2   . DA  B 2 35  ? 1.421   5.889   -22.004 1.00 128.33 ? 28   DA  B OP2   1 
ATOM   6769 O "O5'" . DA  B 2 35  ? 1.941   7.072   -19.875 1.00 113.32 ? 28   DA  B "O5'" 1 
ATOM   6770 C "C5'" . DA  B 2 35  ? 2.776   7.940   -19.154 1.00 105.41 ? 28   DA  B "C5'" 1 
ATOM   6771 C "C4'" . DA  B 2 35  ? 2.925   7.443   -17.742 1.00 103.62 ? 28   DA  B "C4'" 1 
ATOM   6772 O "O4'" . DA  B 2 35  ? 1.607   7.245   -17.191 1.00 99.62  ? 28   DA  B "O4'" 1 
ATOM   6773 C "C3'" . DA  B 2 35  ? 3.643   6.105   -17.609 1.00 108.56 ? 28   DA  B "C3'" 1 
ATOM   6774 O "O3'" . DA  B 2 35  ? 4.601   6.207   -16.559 1.00 117.52 ? 28   DA  B "O3'" 1 
ATOM   6775 C "C2'" . DA  B 2 35  ? 2.536   5.118   -17.276 1.00 105.30 ? 28   DA  B "C2'" 1 
ATOM   6776 C "C1'" . DA  B 2 35  ? 1.543   5.992   -16.541 1.00 97.36  ? 28   DA  B "C1'" 1 
ATOM   6777 N N9    . DA  B 2 35  ? 0.148   5.541   -16.573 1.00 96.44  ? 28   DA  B N9    1 
ATOM   6778 C C8    . DA  B 2 35  ? -0.614  5.139   -17.655 1.00 97.61  ? 28   DA  B C8    1 
ATOM   6779 N N7    . DA  B 2 35  ? -1.844  4.802   -17.342 1.00 93.76  ? 28   DA  B N7    1 
ATOM   6780 C C5    . DA  B 2 35  ? -1.900  5.005   -15.966 1.00 89.89  ? 28   DA  B C5    1 
ATOM   6781 C C6    . DA  B 2 35  ? -2.940  4.851   -15.028 1.00 89.48  ? 28   DA  B C6    1 
ATOM   6782 N N6    . DA  B 2 35  ? -4.184  4.445   -15.352 1.00 92.72  ? 28   DA  B N6    1 
ATOM   6783 N N1    . DA  B 2 35  ? -2.656  5.130   -13.729 1.00 86.31  ? 28   DA  B N1    1 
ATOM   6784 C C2    . DA  B 2 35  ? -1.415  5.526   -13.407 1.00 87.04  ? 28   DA  B C2    1 
ATOM   6785 N N3    . DA  B 2 35  ? -0.361  5.717   -14.199 1.00 87.07  ? 28   DA  B N3    1 
ATOM   6786 C C4    . DA  B 2 35  ? -0.677  5.444   -15.480 1.00 90.73  ? 28   DA  B C4    1 
ATOM   6787 P P     . DA  B 2 36  ? 6.114   5.752   -16.811 1.00 179.78 ? 29   DA  B P     1 
ATOM   6788 O OP1   . DA  B 2 36  ? 6.992   6.908   -16.520 1.00 131.60 ? 29   DA  B OP1   1 
ATOM   6789 O OP2   . DA  B 2 36  ? 6.177   5.092   -18.134 1.00 137.37 ? 29   DA  B OP2   1 
ATOM   6790 O "O5'" . DA  B 2 36  ? 6.343   4.632   -15.691 1.00 177.88 ? 29   DA  B "O5'" 1 
ATOM   6791 C "C5'" . DA  B 2 36  ? 5.323   3.679   -15.418 1.00 177.08 ? 29   DA  B "C5'" 1 
ATOM   6792 C "C4'" . DA  B 2 36  ? 4.717   3.916   -14.046 1.00 171.24 ? 29   DA  B "C4'" 1 
ATOM   6793 O "O4'" . DA  B 2 36  ? 3.273   4.001   -14.166 1.00 168.90 ? 29   DA  B "O4'" 1 
ATOM   6794 C "C3'" . DA  B 2 36  ? 4.982   2.814   -13.029 1.00 171.46 ? 29   DA  B "C3'" 1 
ATOM   6795 O "O3'" . DA  B 2 36  ? 5.035   3.367   -11.720 1.00 168.32 ? 29   DA  B "O3'" 1 
ATOM   6796 C "C2'" . DA  B 2 36  ? 3.766   1.912   -13.204 1.00 170.82 ? 29   DA  B "C2'" 1 
ATOM   6797 C "C1'" . DA  B 2 36  ? 2.668   2.939   -13.455 1.00 161.97 ? 29   DA  B "C1'" 1 
ATOM   6798 N N9    . DA  B 2 36  ? 1.557   2.424   -14.251 1.00 109.93 ? 29   DA  B N9    1 
ATOM   6799 C C8    . DA  B 2 36  ? 1.581   2.082   -15.574 1.00 105.63 ? 29   DA  B C8    1 
ATOM   6800 N N7    . DA  B 2 36  ? 0.429   1.646   -16.029 1.00 104.73 ? 29   DA  B N7    1 
ATOM   6801 C C5    . DA  B 2 36  ? -0.407  1.706   -14.926 1.00 100.12 ? 29   DA  B C5    1 
ATOM   6802 C C6    . DA  B 2 36  ? -1.766  1.380   -14.747 1.00 94.61  ? 29   DA  B C6    1 
ATOM   6803 N N6    . DA  B 2 36  ? -2.545  0.908   -15.726 1.00 93.64  ? 29   DA  B N6    1 
ATOM   6804 N N1    . DA  B 2 36  ? -2.295  1.558   -13.519 1.00 89.24  ? 29   DA  B N1    1 
ATOM   6805 C C2    . DA  B 2 36  ? -1.512  2.030   -12.542 1.00 91.33  ? 29   DA  B C2    1 
ATOM   6806 N N3    . DA  B 2 36  ? -0.225  2.371   -12.590 1.00 94.89  ? 29   DA  B N3    1 
ATOM   6807 C C4    . DA  B 2 36  ? 0.272   2.184   -13.822 1.00 101.96 ? 29   DA  B C4    1 
ATOM   6808 P P     . DG  B 2 37  ? 6.034   2.757   -10.629 1.00 114.38 ? 30   DG  B P     1 
ATOM   6809 O OP1   . DG  B 2 37  ? 6.309   3.810   -9.611  1.00 116.58 ? 30   DG  B OP1   1 
ATOM   6810 O OP2   . DG  B 2 37  ? 7.182   2.124   -11.342 1.00 107.47 ? 30   DG  B OP2   1 
ATOM   6811 O "O5'" . DG  B 2 37  ? 5.155   1.631   -9.915  1.00 110.01 ? 30   DG  B "O5'" 1 
ATOM   6812 C "C5'" . DG  B 2 37  ? 5.606   0.968   -8.733  1.00 107.91 ? 30   DG  B "C5'" 1 
ATOM   6813 C "C4'" . DG  B 2 37  ? 4.438   0.781   -7.800  1.00 113.67 ? 30   DG  B "C4'" 1 
ATOM   6814 O "O4'" . DG  B 2 37  ? 3.211   0.917   -8.549  1.00 109.10 ? 30   DG  B "O4'" 1 
ATOM   6815 C "C3'" . DG  B 2 37  ? 4.333   -0.559  -7.087  1.00 123.26 ? 30   DG  B "C3'" 1 
ATOM   6816 O "O3'" . DG  B 2 37  ? 3.584   -0.302  -5.892  1.00 142.46 ? 30   DG  B "O3'" 1 
ATOM   6817 C "C2'" . DG  B 2 37  ? 3.484   -1.364  -8.062  1.00 115.16 ? 30   DG  B "C2'" 1 
ATOM   6818 C "C1'" . DG  B 2 37  ? 2.502   -0.315  -8.578  1.00 106.96 ? 30   DG  B "C1'" 1 
ATOM   6819 N N9    . DG  B 2 37  ? 2.026   -0.498  -9.949  1.00 96.96  ? 30   DG  B N9    1 
ATOM   6820 C C8    . DG  B 2 37  ? 2.765   -0.379  -11.111 1.00 94.17  ? 30   DG  B C8    1 
ATOM   6821 N N7    . DG  B 2 37  ? 2.059   -0.562  -12.196 1.00 88.44  ? 30   DG  B N7    1 
ATOM   6822 C C5    . DG  B 2 37  ? 0.774   -0.828  -11.730 1.00 87.97  ? 30   DG  B C5    1 
ATOM   6823 C C6    . DG  B 2 37  ? -0.424  -1.132  -12.445 1.00 84.92  ? 30   DG  B C6    1 
ATOM   6824 O O6    . DG  B 2 37  ? -0.577  -1.211  -13.664 1.00 78.42  ? 30   DG  B O6    1 
ATOM   6825 N N1    . DG  B 2 37  ? -1.502  -1.357  -11.581 1.00 85.26  ? 30   DG  B N1    1 
ATOM   6826 C C2    . DG  B 2 37  ? -1.434  -1.298  -10.194 1.00 90.71  ? 30   DG  B C2    1 
ATOM   6827 N N2    . DG  B 2 37  ? -2.562  -1.555  -9.507  1.00 83.69  ? 30   DG  B N2    1 
ATOM   6828 N N3    . DG  B 2 37  ? -0.321  -1.011  -9.517  1.00 97.18  ? 30   DG  B N3    1 
ATOM   6829 C C4    . DG  B 2 37  ? 0.737   -0.795  -10.342 1.00 93.93  ? 30   DG  B C4    1 
ATOM   6830 P P     . DT  B 2 38  ? 3.939   -1.028  -4.498  1.00 179.20 ? 31   DT  B P     1 
ATOM   6831 O OP1   . DT  B 2 38  ? 3.475   -0.094  -3.425  1.00 163.56 ? 31   DT  B OP1   1 
ATOM   6832 O OP2   . DT  B 2 38  ? 5.351   -1.505  -4.498  1.00 159.62 ? 31   DT  B OP2   1 
ATOM   6833 O "O5'" . DT  B 2 38  ? 2.964   -2.285  -4.493  1.00 168.27 ? 31   DT  B "O5'" 1 
ATOM   6834 C "C5'" . DT  B 2 38  ? 1.585   -2.115  -4.803  1.00 163.16 ? 31   DT  B "C5'" 1 
ATOM   6835 C "C4'" . DT  B 2 38  ? 1.009   -3.379  -5.397  1.00 155.96 ? 31   DT  B "C4'" 1 
ATOM   6836 O "O4'" . DT  B 2 38  ? 0.650   -3.190  -6.781  1.00 149.99 ? 31   DT  B "O4'" 1 
ATOM   6837 C "C3'" . DT  B 2 38  ? 1.903   -4.614  -5.384  1.00 155.72 ? 31   DT  B "C3'" 1 
ATOM   6838 O "O3'" . DT  B 2 38  ? 1.921   -5.328  -4.178  1.00 158.32 ? 31   DT  B "O3'" 1 
ATOM   6839 C "C2'" . DT  B 2 38  ? 1.452   -5.410  -6.597  1.00 150.77 ? 31   DT  B "C2'" 1 
ATOM   6840 C "C1'" . DT  B 2 38  ? 0.502   -4.484  -7.357  1.00 145.76 ? 31   DT  B "C1'" 1 
ATOM   6841 N N1    . DT  B 2 38  ? 0.860   -4.410  -8.794  1.00 117.57 ? 31   DT  B N1    1 
ATOM   6842 C C2    . DT  B 2 38  ? -0.121  -4.715  -9.722  1.00 113.51 ? 31   DT  B C2    1 
ATOM   6843 O O2    . DT  B 2 38  ? -1.268  -5.018  -9.415  1.00 112.88 ? 31   DT  B O2    1 
ATOM   6844 N N3    . DT  B 2 38  ? 0.291   -4.653  -11.034 1.00 109.67 ? 31   DT  B N3    1 
ATOM   6845 C C4    . DT  B 2 38  ? 1.554   -4.310  -11.510 1.00 109.41 ? 31   DT  B C4    1 
ATOM   6846 O O4    . DT  B 2 38  ? 1.774   -4.282  -12.742 1.00 99.51  ? 31   DT  B O4    1 
ATOM   6847 C C5    . DT  B 2 38  ? 2.534   -3.998  -10.472 1.00 110.92 ? 31   DT  B C5    1 
ATOM   6848 C C7    . DT  B 2 38  ? 3.923   -3.623  -10.875 1.00 107.78 ? 31   DT  B C7    1 
ATOM   6849 C C6    . DT  B 2 38  ? 2.143   -4.062  -9.190  1.00 113.33 ? 31   DT  B C6    1 
ATOM   6850 O "O5'" . DT  C 3 1   ? -10.411 0.396   -7.161  1.00 169.33 ? 1    DT  C "O5'" 1 
ATOM   6851 C "C5'" . DT  C 3 1   ? -9.628  0.166   -8.330  1.00 164.09 ? 1    DT  C "C5'" 1 
ATOM   6852 C "C4'" . DT  C 3 1   ? -8.194  -0.089  -7.934  1.00 162.60 ? 1    DT  C "C4'" 1 
ATOM   6853 O "O4'" . DT  C 3 1   ? -7.436  -0.439  -9.116  1.00 156.96 ? 1    DT  C "O4'" 1 
ATOM   6854 C "C3'" . DT  C 3 1   ? -7.474  1.098   -7.280  1.00 167.60 ? 1    DT  C "C3'" 1 
ATOM   6855 O "O3'" . DT  C 3 1   ? -7.132  0.808   -5.916  1.00 177.40 ? 1    DT  C "O3'" 1 
ATOM   6856 C "C2'" . DT  C 3 1   ? -6.226  1.327   -8.130  1.00 159.11 ? 1    DT  C "C2'" 1 
ATOM   6857 C "C1'" . DT  C 3 1   ? -6.127  0.121   -9.061  1.00 148.43 ? 1    DT  C "C1'" 1 
ATOM   6858 N N1    . DT  C 3 1   ? -5.716  0.470   -10.460 1.00 75.68  ? 1    DT  C N1    1 
ATOM   6859 C C2    . DT  C 3 1   ? -4.420  0.921   -10.711 1.00 64.09  ? 1    DT  C C2    1 
ATOM   6860 O O2    . DT  C 3 1   ? -3.573  1.082   -9.833  1.00 62.44  ? 1    DT  C O2    1 
ATOM   6861 N N3    . DT  C 3 1   ? -4.159  1.197   -12.035 1.00 52.61  ? 1    DT  C N3    1 
ATOM   6862 C C4    . DT  C 3 1   ? -5.048  1.107   -13.098 1.00 51.10  ? 1    DT  C C4    1 
ATOM   6863 O O4    . DT  C 3 1   ? -4.705  1.456   -14.224 1.00 42.71  ? 1    DT  C O4    1 
ATOM   6864 C C5    . DT  C 3 1   ? -6.373  0.616   -12.771 1.00 58.37  ? 1    DT  C C5    1 
ATOM   6865 C C7    . DT  C 3 1   ? -7.381  0.433   -13.869 1.00 57.50  ? 1    DT  C C7    1 
ATOM   6866 C C6    . DT  C 3 1   ? -6.637  0.336   -11.489 1.00 67.65  ? 1    DT  C C6    1 
ATOM   6867 P P     . DT  C 3 2   ? -6.981  2.012   -4.837  1.00 185.00 ? 2    DT  C P     1 
ATOM   6868 O OP1   . DT  C 3 2   ? -6.593  1.396   -3.527  1.00 145.62 ? 2    DT  C OP1   1 
ATOM   6869 O OP2   . DT  C 3 2   ? -8.208  2.876   -4.901  1.00 142.37 ? 2    DT  C OP2   1 
ATOM   6870 O "O5'" . DT  C 3 2   ? -5.728  2.843   -5.377  1.00 168.02 ? 2    DT  C "O5'" 1 
ATOM   6871 C "C5'" . DT  C 3 2   ? -4.721  3.319   -4.490  1.00 160.66 ? 2    DT  C "C5'" 1 
ATOM   6872 C "C4'" . DT  C 3 2   ? -3.396  3.412   -5.207  1.00 155.89 ? 2    DT  C "C4'" 1 
ATOM   6873 O "O4'" . DT  C 3 2   ? -3.557  3.160   -6.624  1.00 146.19 ? 2    DT  C "O4'" 1 
ATOM   6874 C "C3'" . DT  C 3 2   ? -2.675  4.764   -5.086  1.00 159.01 ? 2    DT  C "C3'" 1 
ATOM   6875 O "O3'" . DT  C 3 2   ? -1.297  4.581   -4.729  1.00 166.71 ? 2    DT  C "O3'" 1 
ATOM   6876 C "C2'" . DT  C 3 2   ? -2.741  5.325   -6.495  1.00 147.55 ? 2    DT  C "C2'" 1 
ATOM   6877 C "C1'" . DT  C 3 2   ? -2.715  4.056   -7.322  1.00 136.45 ? 2    DT  C "C1'" 1 
ATOM   6878 N N1    . DT  C 3 2   ? -3.233  4.211   -8.693  1.00 83.35  ? 2    DT  C N1    1 
ATOM   6879 C C2    . DT  C 3 2   ? -2.311  4.504   -9.701  1.00 75.61  ? 2    DT  C C2    1 
ATOM   6880 O O2    . DT  C 3 2   ? -1.090  4.606   -9.493  1.00 73.33  ? 2    DT  C O2    1 
ATOM   6881 N N3    . DT  C 3 2   ? -2.878  4.669   -10.969 1.00 68.75  ? 2    DT  C N3    1 
ATOM   6882 C C4    . DT  C 3 2   ? -4.230  4.551   -11.310 1.00 68.85  ? 2    DT  C C4    1 
ATOM   6883 O O4    . DT  C 3 2   ? -4.599  4.704   -12.483 1.00 58.48  ? 2    DT  C O4    1 
ATOM   6884 C C5    . DT  C 3 2   ? -5.125  4.234   -10.207 1.00 74.17  ? 2    DT  C C5    1 
ATOM   6885 C C7    . DT  C 3 2   ? -6.586  4.091   -10.495 1.00 73.63  ? 2    DT  C C7    1 
ATOM   6886 C C6    . DT  C 3 2   ? -4.593  4.083   -8.971  1.00 78.80  ? 2    DT  C C6    1 
ATOM   6887 P P     . DT  C 3 3   ? -0.428  5.819   -4.156  1.00 172.79 ? 3    DT  C P     1 
ATOM   6888 O OP1   . DT  C 3 3   ? 0.764   5.213   -3.490  1.00 136.85 ? 3    DT  C OP1   1 
ATOM   6889 O OP2   . DT  C 3 3   ? -1.328  6.710   -3.369  1.00 137.60 ? 3    DT  C OP2   1 
ATOM   6890 O "O5'" . DT  C 3 3   ? 0.075   6.630   -5.447  1.00 170.18 ? 3    DT  C "O5'" 1 
ATOM   6891 C "C5'" . DT  C 3 3   ? 0.395   5.962   -6.678  1.00 167.80 ? 3    DT  C "C5'" 1 
ATOM   6892 C "C4'" . DT  C 3 3   ? 1.406   6.745   -7.495  1.00 164.04 ? 3    DT  C "C4'" 1 
ATOM   6893 O "O4'" . DT  C 3 3   ? 0.934   6.864   -8.853  1.00 156.71 ? 3    DT  C "O4'" 1 
ATOM   6894 C "C3'" . DT  C 3 3   ? 1.753   8.168   -7.070  1.00 164.61 ? 3    DT  C "C3'" 1 
ATOM   6895 O "O3'" . DT  C 3 3   ? 3.049   8.429   -7.623  1.00 169.46 ? 3    DT  C "O3'" 1 
ATOM   6896 C "C2'" . DT  C 3 3   ? 0.717   8.976   -7.821  1.00 153.50 ? 3    DT  C "C2'" 1 
ATOM   6897 C "C1'" . DT  C 3 3   ? 0.606   8.214   -9.139  1.00 148.18 ? 3    DT  C "C1'" 1 
ATOM   6898 N N1    . DT  C 3 3   ? -0.746  8.212   -9.719  1.00 105.70 ? 3    DT  C N1    1 
ATOM   6899 C C2    . DT  C 3 3   ? -0.873  8.356   -11.076 1.00 102.86 ? 3    DT  C C2    1 
ATOM   6900 O O2    . DT  C 3 3   ? 0.093   8.473   -11.824 1.00 110.35 ? 3    DT  C O2    1 
ATOM   6901 N N3    . DT  C 3 3   ? -2.181  8.363   -11.530 1.00 92.93  ? 3    DT  C N3    1 
ATOM   6902 C C4    . DT  C 3 3   ? -3.334  8.243   -10.767 1.00 89.58  ? 3    DT  C C4    1 
ATOM   6903 O O4    . DT  C 3 3   ? -4.456  8.290   -11.296 1.00 82.80  ? 3    DT  C O4    1 
ATOM   6904 C C5    . DT  C 3 3   ? -3.114  8.079   -9.361  1.00 94.71  ? 3    DT  C C5    1 
ATOM   6905 C C7    . DT  C 3 3   ? -4.302  7.924   -8.468  1.00 100.34 ? 3    DT  C C7    1 
ATOM   6906 C C6    . DT  C 3 3   ? -1.852  8.073   -8.909  1.00 100.82 ? 3    DT  C C6    1 
ATOM   6907 P P     . DT  C 3 4   ? 4.075   9.446   -6.914  1.00 149.75 ? 4    DT  C P     1 
ATOM   6908 O OP1   . DT  C 3 4   ? 5.346   8.698   -6.704  1.00 146.88 ? 4    DT  C OP1   1 
ATOM   6909 O OP2   . DT  C 3 4   ? 3.423   10.118  -5.756  1.00 142.00 ? 4    DT  C OP2   1 
ATOM   6910 O "O5'" . DT  C 3 4   ? 4.338   10.519  -8.064  1.00 142.53 ? 4    DT  C "O5'" 1 
ATOM   6911 C "C5'" . DT  C 3 4   ? 3.235   11.175  -8.688  1.00 143.09 ? 4    DT  C "C5'" 1 
ATOM   6912 C "C4'" . DT  C 3 4   ? 3.351   11.107  -10.194 1.00 141.10 ? 4    DT  C "C4'" 1 
ATOM   6913 O "O4'" . DT  C 3 4   ? 2.090   10.650  -10.756 1.00 137.62 ? 4    DT  C "O4'" 1 
ATOM   6914 C "C3'" . DT  C 3 4   ? 3.656   12.445  -10.873 1.00 140.79 ? 4    DT  C "C3'" 1 
ATOM   6915 O "O3'" . DT  C 3 4   ? 4.564   12.251  -11.968 1.00 142.35 ? 4    DT  C "O3'" 1 
ATOM   6916 C "C2'" . DT  C 3 4   ? 2.287   12.905  -11.356 1.00 138.12 ? 4    DT  C "C2'" 1 
ATOM   6917 C "C1'" . DT  C 3 4   ? 1.610   11.591  -11.707 1.00 132.08 ? 4    DT  C "C1'" 1 
ATOM   6918 N N1    . DT  C 3 4   ? 0.140   11.601  -11.634 1.00 116.80 ? 4    DT  C N1    1 
ATOM   6919 C C2    . DT  C 3 4   ? -0.572  11.481  -12.808 1.00 113.72 ? 4    DT  C C2    1 
ATOM   6920 O O2    . DT  C 3 4   ? -0.045  11.387  -13.902 1.00 111.77 ? 4    DT  C O2    1 
ATOM   6921 N N3    . DT  C 3 4   ? -1.943  11.475  -12.652 1.00 114.31 ? 4    DT  C N3    1 
ATOM   6922 C C4    . DT  C 3 4   ? -2.658  11.577  -11.461 1.00 115.11 ? 4    DT  C C4    1 
ATOM   6923 O O4    . DT  C 3 4   ? -3.896  11.546  -11.471 1.00 117.39 ? 4    DT  C O4    1 
ATOM   6924 C C5    . DT  C 3 4   ? -1.846  11.709  -10.268 1.00 113.59 ? 4    DT  C C5    1 
ATOM   6925 C C7    . DT  C 3 4   ? -2.533  11.817  -8.936  1.00 107.61 ? 4    DT  C C7    1 
ATOM   6926 C C6    . DT  C 3 4   ? -0.503  11.717  -10.416 1.00 116.08 ? 4    DT  C C6    1 
ATOM   6927 P P     . DG  C 3 5   ? 5.408   13.495  -12.553 1.00 140.52 ? 5    DG  C P     1 
ATOM   6928 O OP1   . DG  C 3 5   ? 6.484   12.921  -13.409 1.00 127.13 ? 5    DG  C OP1   1 
ATOM   6929 O OP2   . DG  C 3 5   ? 5.768   14.392  -11.429 1.00 134.01 ? 5    DG  C OP2   1 
ATOM   6930 O "O5'" . DG  C 3 5   ? 4.382   14.276  -13.491 1.00 140.94 ? 5    DG  C "O5'" 1 
ATOM   6931 C "C5'" . DG  C 3 5   ? 4.521   14.214  -14.901 1.00 138.27 ? 5    DG  C "C5'" 1 
ATOM   6932 C "C4'" . DG  C 3 5   ? 3.255   14.641  -15.610 1.00 132.82 ? 5    DG  C "C4'" 1 
ATOM   6933 O "O4'" . DG  C 3 5   ? 2.065   14.182  -14.920 1.00 130.68 ? 5    DG  C "O4'" 1 
ATOM   6934 C "C3'" . DG  C 3 5   ? 3.056   16.139  -15.855 1.00 131.91 ? 5    DG  C "C3'" 1 
ATOM   6935 O "O3'" . DG  C 3 5   ? 3.448   16.426  -17.208 1.00 126.32 ? 5    DG  C "O3'" 1 
ATOM   6936 C "C2'" . DG  C 3 5   ? 1.561   16.359  -15.617 1.00 131.45 ? 5    DG  C "C2'" 1 
ATOM   6937 C "C1'" . DG  C 3 5   ? 0.968   14.972  -15.350 1.00 127.12 ? 5    DG  C "C1'" 1 
ATOM   6938 N N9    . DG  C 3 5   ? -0.042  14.975  -14.288 1.00 106.19 ? 5    DG  C N9    1 
ATOM   6939 C C8    . DG  C 3 5   ? 0.190   15.035  -12.931 1.00 102.85 ? 5    DG  C C8    1 
ATOM   6940 N N7    . DG  C 3 5   ? -0.906  15.020  -12.220 1.00 101.13 ? 5    DG  C N7    1 
ATOM   6941 C C5    . DG  C 3 5   ? -1.928  14.944  -13.163 1.00 96.37  ? 5    DG  C C5    1 
ATOM   6942 C C6    . DG  C 3 5   ? -3.341  14.878  -12.986 1.00 91.33  ? 5    DG  C C6    1 
ATOM   6943 O O6    . DG  C 3 5   ? -3.980  14.890  -11.918 1.00 94.44  ? 5    DG  C O6    1 
ATOM   6944 N N1    . DG  C 3 5   ? -4.013  14.795  -14.205 1.00 83.28  ? 5    DG  C N1    1 
ATOM   6945 C C2    . DG  C 3 5   ? -3.405  14.788  -15.422 1.00 88.87  ? 5    DG  C C2    1 
ATOM   6946 N N2    . DG  C 3 5   ? -4.224  14.709  -16.459 1.00 90.48  ? 5    DG  C N2    1 
ATOM   6947 N N3    . DG  C 3 5   ? -2.088  14.855  -15.611 1.00 95.52  ? 5    DG  C N3    1 
ATOM   6948 C C4    . DG  C 3 5   ? -1.415  14.924  -14.444 1.00 98.37  ? 5    DG  C C4    1 
ATOM   6949 P P     . DG  C 3 6   ? 3.308   17.920  -17.834 1.00 132.37 ? 6    DG  C P     1 
ATOM   6950 O OP1   . DG  C 3 6   ? 4.668   18.344  -18.286 1.00 115.27 ? 6    DG  C OP1   1 
ATOM   6951 O OP2   . DG  C 3 6   ? 2.524   18.841  -16.952 1.00 111.85 ? 6    DG  C OP2   1 
ATOM   6952 O "O5'" . DG  C 3 6   ? 2.455   17.639  -19.152 1.00 129.17 ? 6    DG  C "O5'" 1 
ATOM   6953 C "C5'" . DG  C 3 6   ? 1.523   16.551  -19.198 1.00 126.01 ? 6    DG  C "C5'" 1 
ATOM   6954 C "C4'" . DG  C 3 6   ? 0.142   17.074  -19.513 1.00 119.43 ? 6    DG  C "C4'" 1 
ATOM   6955 O "O4'" . DG  C 3 6   ? -0.788  16.849  -18.417 1.00 120.75 ? 6    DG  C "O4'" 1 
ATOM   6956 C "C3'" . DG  C 3 6   ? 0.143   18.572  -19.765 1.00 118.83 ? 6    DG  C "C3'" 1 
ATOM   6957 O "O3'" . DG  C 3 6   ? -0.540  18.862  -20.953 1.00 119.58 ? 6    DG  C "O3'" 1 
ATOM   6958 C "C2'" . DG  C 3 6   ? -0.603  19.164  -18.577 1.00 117.50 ? 6    DG  C "C2'" 1 
ATOM   6959 C "C1'" . DG  C 3 6   ? -1.526  18.039  -18.166 1.00 116.19 ? 6    DG  C "C1'" 1 
ATOM   6960 N N9    . DG  C 3 6   ? -1.911  18.054  -16.755 1.00 90.18  ? 6    DG  C N9    1 
ATOM   6961 C C8    . DG  C 3 6   ? -1.084  18.151  -15.651 1.00 85.12  ? 6    DG  C C8    1 
ATOM   6962 N N7    . DG  C 3 6   ? -1.727  18.133  -14.515 1.00 80.37  ? 6    DG  C N7    1 
ATOM   6963 C C5    . DG  C 3 6   ? -3.055  18.016  -14.887 1.00 80.09  ? 6    DG  C C5    1 
ATOM   6964 C C6    . DG  C 3 6   ? -4.233  17.955  -14.082 1.00 79.74  ? 6    DG  C C6    1 
ATOM   6965 O O6    . DG  C 3 6   ? -4.321  18.010  -12.840 1.00 77.16  ? 6    DG  C O6    1 
ATOM   6966 N N1    . DG  C 3 6   ? -5.396  17.836  -14.869 1.00 81.17  ? 6    DG  C N1    1 
ATOM   6967 C C2    . DG  C 3 6   ? -5.412  17.809  -16.255 1.00 81.36  ? 6    DG  C C2    1 
ATOM   6968 N N2    . DG  C 3 6   ? -6.624  17.723  -16.814 1.00 79.76  ? 6    DG  C N2    1 
ATOM   6969 N N3    . DG  C 3 6   ? -4.309  17.871  -17.022 1.00 81.89  ? 6    DG  C N3    1 
ATOM   6970 C C4    . DG  C 3 6   ? -3.181  17.970  -16.273 1.00 83.09  ? 6    DG  C C4    1 
ATOM   6971 P P     . DT  C 3 7   ? -0.702  20.381  -21.362 1.00 155.58 ? 7    DT  C P     1 
ATOM   6972 O OP1   . DT  C 3 7   ? -0.712  20.485  -22.841 1.00 89.01  ? 7    DT  C OP1   1 
ATOM   6973 O OP2   . DT  C 3 7   ? 0.353   21.069  -20.592 1.00 87.86  ? 7    DT  C OP2   1 
ATOM   6974 O "O5'" . DT  C 3 7   ? -2.149  20.734  -20.790 1.00 159.36 ? 7    DT  C "O5'" 1 
ATOM   6975 C "C5'" . DT  C 3 7   ? -3.239  19.825  -20.990 1.00 159.34 ? 7    DT  C "C5'" 1 
ATOM   6976 C "C4'" . DT  C 3 7   ? -4.561  20.562  -21.023 1.00 162.83 ? 7    DT  C "C4'" 1 
ATOM   6977 O "O4'" . DT  C 3 7   ? -5.170  20.537  -19.724 1.00 162.38 ? 7    DT  C "O4'" 1 
ATOM   6978 C "C3'" . DT  C 3 7   ? -4.540  22.035  -21.428 1.00 160.38 ? 7    DT  C "C3'" 1 
ATOM   6979 O "O3'" . DT  C 3 7   ? -5.853  22.364  -21.906 1.00 165.39 ? 7    DT  C "O3'" 1 
ATOM   6980 C "C2'" . DT  C 3 7   ? -4.324  22.709  -20.091 1.00 153.21 ? 7    DT  C "C2'" 1 
ATOM   6981 C "C1'" . DT  C 3 7   ? -5.191  21.844  -19.181 1.00 147.83 ? 7    DT  C "C1'" 1 
ATOM   6982 N N1    . DT  C 3 7   ? -4.730  21.717  -17.798 1.00 67.42  ? 7    DT  C N1    1 
ATOM   6983 C C2    . DT  C 3 7   ? -5.702  21.572  -16.828 1.00 63.71  ? 7    DT  C C2    1 
ATOM   6984 O O2    . DT  C 3 7   ? -6.907  21.557  -17.093 1.00 67.40  ? 7    DT  C O2    1 
ATOM   6985 N N3    . DT  C 3 7   ? -5.217  21.440  -15.533 1.00 58.87  ? 7    DT  C N3    1 
ATOM   6986 C C4    . DT  C 3 7   ? -3.887  21.455  -15.134 1.00 59.70  ? 7    DT  C C4    1 
ATOM   6987 O O4    . DT  C 3 7   ? -3.606  21.358  -13.946 1.00 62.63  ? 7    DT  C O4    1 
ATOM   6988 C C5    . DT  C 3 7   ? -2.907  21.595  -16.211 1.00 59.53  ? 7    DT  C C5    1 
ATOM   6989 C C7    . DT  C 3 7   ? -1.442  21.582  -15.862 1.00 53.87  ? 7    DT  C C7    1 
ATOM   6990 C C6    . DT  C 3 7   ? -3.380  21.723  -17.476 1.00 62.63  ? 7    DT  C C6    1 
ATOM   6991 P P     . DG  C 3 8   ? -6.136  23.778  -22.610 1.00 137.93 ? 8    DG  C P     1 
ATOM   6992 O OP1   . DG  C 3 8   ? -6.507  23.514  -24.029 1.00 108.04 ? 8    DG  C OP1   1 
ATOM   6993 O OP2   . DG  C 3 8   ? -5.003  24.693  -22.304 1.00 104.50 ? 8    DG  C OP2   1 
ATOM   6994 O "O5'" . DG  C 3 8   ? -7.431  24.364  -21.882 1.00 131.47 ? 8    DG  C "O5'" 1 
ATOM   6995 C "C5'" . DG  C 3 8   ? -8.461  23.532  -21.392 1.00 127.99 ? 8    DG  C "C5'" 1 
ATOM   6996 C "C4'" . DG  C 3 8   ? -9.139  24.212  -20.231 1.00 123.71 ? 8    DG  C "C4'" 1 
ATOM   6997 O "O4'" . DG  C 3 8   ? -8.457  23.897  -18.996 1.00 124.43 ? 8    DG  C "O4'" 1 
ATOM   6998 C "C3'" . DG  C 3 8   ? -9.232  25.741  -20.296 1.00 122.62 ? 8    DG  C "C3'" 1 
ATOM   6999 O "O3'" . DG  C 3 8   ? -10.513 26.094  -19.789 1.00 125.64 ? 8    DG  C "O3'" 1 
ATOM   7000 C "C2'" . DG  C 3 8   ? -8.184  26.197  -19.289 1.00 115.25 ? 8    DG  C "C2'" 1 
ATOM   7001 C "C1'" . DG  C 3 8   ? -8.289  25.092  -18.245 1.00 113.35 ? 8    DG  C "C1'" 1 
ATOM   7002 N N9    . DG  C 3 8   ? -7.139  24.908  -17.359 1.00 71.36  ? 8    DG  C N9    1 
ATOM   7003 C C8    . DG  C 3 8   ? -5.818  24.898  -17.710 1.00 68.55  ? 8    DG  C C8    1 
ATOM   7004 N N7    . DG  C 3 8   ? -5.021  24.717  -16.694 1.00 62.95  ? 8    DG  C N7    1 
ATOM   7005 C C5    . DG  C 3 8   ? -5.868  24.599  -15.611 1.00 61.35  ? 8    DG  C C5    1 
ATOM   7006 C C6    . DG  C 3 8   ? -5.562  24.408  -14.232 1.00 57.71  ? 8    DG  C C6    1 
ATOM   7007 O O6    . DG  C 3 8   ? -4.451  24.277  -13.708 1.00 52.73  ? 8    DG  C O6    1 
ATOM   7008 N N1    . DG  C 3 8   ? -6.711  24.370  -13.449 1.00 60.13  ? 8    DG  C N1    1 
ATOM   7009 C C2    . DG  C 3 8   ? -8.008  24.489  -13.947 1.00 62.62  ? 8    DG  C C2    1 
ATOM   7010 N N2    . DG  C 3 8   ? -9.022  24.412  -13.024 1.00 62.20  ? 8    DG  C N2    1 
ATOM   7011 N N3    . DG  C 3 8   ? -8.296  24.665  -15.254 1.00 62.49  ? 8    DG  C N3    1 
ATOM   7012 C C4    . DG  C 3 8   ? -7.181  24.711  -16.009 1.00 64.10  ? 8    DG  C C4    1 
ATOM   7013 P P     . DG  C 3 9   ? -11.219 27.474  -20.211 1.00 112.94 ? 9    DG  C P     1 
ATOM   7014 O OP1   . DG  C 3 9   ? -11.799 27.280  -21.583 1.00 113.91 ? 9    DG  C OP1   1 
ATOM   7015 O OP2   . DG  C 3 9   ? -10.288 28.613  -19.965 1.00 113.61 ? 9    DG  C OP2   1 
ATOM   7016 O "O5'" . DG  C 3 9   ? -12.385 27.529  -19.131 1.00 103.51 ? 9    DG  C "O5'" 1 
ATOM   7017 C "C5'" . DG  C 3 9   ? -12.517 26.479  -18.191 1.00 102.04 ? 9    DG  C "C5'" 1 
ATOM   7018 C "C4'" . DG  C 3 9   ? -12.418 27.028  -16.789 1.00 97.41  ? 9    DG  C "C4'" 1 
ATOM   7019 O "O4'" . DG  C 3 9   ? -11.156 26.715  -16.147 1.00 99.05  ? 9    DG  C "O4'" 1 
ATOM   7020 C "C3'" . DG  C 3 9   ? -12.611 28.535  -16.644 1.00 92.14  ? 9    DG  C "C3'" 1 
ATOM   7021 O "O3'" . DG  C 3 9   ? -13.454 28.756  -15.530 1.00 95.22  ? 9    DG  C "O3'" 1 
ATOM   7022 C "C2'" . DG  C 3 9   ? -11.235 29.030  -16.242 1.00 91.87  ? 9    DG  C "C2'" 1 
ATOM   7023 C "C1'" . DG  C 3 9   ? -10.738 27.860  -15.412 1.00 89.73  ? 9    DG  C "C1'" 1 
ATOM   7024 N N9    . DG  C 3 9   ? -9.286  27.801  -15.266 1.00 81.23  ? 9    DG  C N9    1 
ATOM   7025 C C8    . DG  C 3 9   ? -8.375  27.792  -16.284 1.00 78.40  ? 9    DG  C C8    1 
ATOM   7026 N N7    . DG  C 3 9   ? -7.145  27.744  -15.866 1.00 74.49  ? 9    DG  C N7    1 
ATOM   7027 C C5    . DG  C 3 9   ? -7.246  27.706  -14.484 1.00 70.73  ? 9    DG  C C5    1 
ATOM   7028 C C6    . DG  C 3 9   ? -6.233  27.636  -13.497 1.00 66.07  ? 9    DG  C C6    1 
ATOM   7029 O O6    . DG  C 3 9   ? -4.993  27.579  -13.647 1.00 62.56  ? 9    DG  C O6    1 
ATOM   7030 N N1    . DG  C 3 9   ? -6.775  27.636  -12.221 1.00 67.05  ? 9    DG  C N1    1 
ATOM   7031 C C2    . DG  C 3 9   ? -8.117  27.691  -11.920 1.00 72.20  ? 9    DG  C C2    1 
ATOM   7032 N N2    . DG  C 3 9   ? -8.422  27.713  -10.592 1.00 69.66  ? 9    DG  C N2    1 
ATOM   7033 N N3    . DG  C 3 9   ? -9.076  27.733  -12.839 1.00 76.26  ? 9    DG  C N3    1 
ATOM   7034 C C4    . DG  C 3 9   ? -8.564  27.744  -14.092 1.00 74.78  ? 9    DG  C C4    1 
ATOM   7035 P P     . DT  C 3 10  ? -14.008 30.225  -15.244 1.00 99.83  ? 10   DT  C P     1 
ATOM   7036 O OP1   . DT  C 3 10  ? -15.414 30.241  -15.751 1.00 114.56 ? 10   DT  C OP1   1 
ATOM   7037 O OP2   . DT  C 3 10  ? -13.031 31.259  -15.700 1.00 99.27  ? 10   DT  C OP2   1 
ATOM   7038 O "O5'" . DT  C 3 10  ? -14.053 30.317  -13.666 1.00 91.69  ? 10   DT  C "O5'" 1 
ATOM   7039 C "C5'" . DT  C 3 10  ? -13.139 29.562  -12.898 1.00 88.33  ? 10   DT  C "C5'" 1 
ATOM   7040 C "C4'" . DT  C 3 10  ? -12.938 30.224  -11.560 1.00 83.14  ? 10   DT  C "C4'" 1 
ATOM   7041 O "O4'" . DT  C 3 10  ? -11.545 30.083  -11.197 1.00 79.61  ? 10   DT  C "O4'" 1 
ATOM   7042 C "C3'" . DT  C 3 10  ? -13.222 31.718  -11.565 1.00 80.01  ? 10   DT  C "C3'" 1 
ATOM   7043 O "O3'" . DT  C 3 10  ? -13.654 32.108  -10.247 1.00 86.31  ? 10   DT  C "O3'" 1 
ATOM   7044 C "C2'" . DT  C 3 10  ? -11.868 32.274  -11.928 1.00 76.17  ? 10   DT  C "C2'" 1 
ATOM   7045 C "C1'" . DT  C 3 10  ? -10.947 31.354  -11.154 1.00 74.64  ? 10   DT  C "C1'" 1 
ATOM   7046 N N1    . DT  C 3 10  ? -9.579  31.219  -11.672 1.00 75.12  ? 10   DT  C N1    1 
ATOM   7047 C C2    . DT  C 3 10  ? -8.559  31.261  -10.746 1.00 71.07  ? 10   DT  C C2    1 
ATOM   7048 O O2    . DT  C 3 10  ? -8.750  31.395  -9.541  1.00 72.69  ? 10   DT  C O2    1 
ATOM   7049 N N3    . DT  C 3 10  ? -7.299  31.131  -11.283 1.00 63.56  ? 10   DT  C N3    1 
ATOM   7050 C C4    . DT  C 3 10  ? -6.975  30.942  -12.617 1.00 59.53  ? 10   DT  C C4    1 
ATOM   7051 O O4    . DT  C 3 10  ? -5.805  30.797  -12.953 1.00 54.86  ? 10   DT  C O4    1 
ATOM   7052 C C5    . DT  C 3 10  ? -8.087  30.913  -13.524 1.00 60.83  ? 10   DT  C C5    1 
ATOM   7053 C C7    . DT  C 3 10  ? -7.802  30.722  -14.981 1.00 60.42  ? 10   DT  C C7    1 
ATOM   7054 C C6    . DT  C 3 10  ? -9.324  31.056  -13.019 1.00 67.69  ? 10   DT  C C6    1 
ATOM   7055 P P     . DG  C 3 11  ? -13.703 33.670  -9.815  1.00 112.43 ? 11   DG  C P     1 
ATOM   7056 O OP1   . DG  C 3 11  ? -14.859 33.927  -8.938  1.00 96.15  ? 11   DG  C OP1   1 
ATOM   7057 O OP2   . DG  C 3 11  ? -13.493 34.527  -10.998 1.00 88.44  ? 11   DG  C OP2   1 
ATOM   7058 O "O5'" . DG  C 3 11  ? -12.449 33.816  -8.854  1.00 110.95 ? 11   DG  C "O5'" 1 
ATOM   7059 C "C5'" . DG  C 3 11  ? -12.247 32.922  -7.757  1.00 110.26 ? 11   DG  C "C5'" 1 
ATOM   7060 C "C4'" . DG  C 3 11  ? -11.113 33.445  -6.912  1.00 104.81 ? 11   DG  C "C4'" 1 
ATOM   7061 O "O4'" . DG  C 3 11  ? -9.872  33.254  -7.643  1.00 100.13 ? 11   DG  C "O4'" 1 
ATOM   7062 C "C3'" . DG  C 3 11  ? -11.261 34.956  -6.736  1.00 103.68 ? 11   DG  C "C3'" 1 
ATOM   7063 O "O3'" . DG  C 3 11  ? -10.862 35.467  -5.450  1.00 107.19 ? 11   DG  C "O3'" 1 
ATOM   7064 C "C2'" . DG  C 3 11  ? -10.355 35.523  -7.813  1.00 99.67  ? 11   DG  C "C2'" 1 
ATOM   7065 C "C1'" . DG  C 3 11  ? -9.244  34.501  -7.868  1.00 93.94  ? 11   DG  C "C1'" 1 
ATOM   7066 N N9    . DG  C 3 11  ? -8.570  34.452  -9.162  1.00 66.31  ? 11   DG  C N9    1 
ATOM   7067 C C8    . DG  C 3 11  ? -9.139  34.616  -10.402 1.00 63.22  ? 11   DG  C C8    1 
ATOM   7068 N N7    . DG  C 3 11  ? -8.274  34.535  -11.381 1.00 60.17  ? 11   DG  C N7    1 
ATOM   7069 C C5    . DG  C 3 11  ? -7.059  34.290  -10.750 1.00 57.63  ? 11   DG  C C5    1 
ATOM   7070 C C6    . DG  C 3 11  ? -5.759  34.096  -11.292 1.00 51.69  ? 11   DG  C C6    1 
ATOM   7071 O O6    . DG  C 3 11  ? -5.408  34.122  -12.483 1.00 45.93  ? 11   DG  C O6    1 
ATOM   7072 N N1    . DG  C 3 11  ? -4.811  33.869  -10.299 1.00 52.84  ? 11   DG  C N1    1 
ATOM   7073 C C2    . DG  C 3 11  ? -5.066  33.844  -8.958  1.00 58.53  ? 11   DG  C C2    1 
ATOM   7074 N N2    . DG  C 3 11  ? -4.029  33.579  -8.162  1.00 54.55  ? 11   DG  C N2    1 
ATOM   7075 N N3    . DG  C 3 11  ? -6.267  34.047  -8.428  1.00 62.61  ? 11   DG  C N3    1 
ATOM   7076 C C4    . DG  C 3 11  ? -7.218  34.249  -9.382  1.00 62.57  ? 11   DG  C C4    1 
ATOM   7077 P P     . DT  C 3 12  ? -11.000 37.063  -5.170  1.00 91.78  ? 12   DT  C P     1 
ATOM   7078 O OP1   . DT  C 3 12  ? -12.021 37.261  -4.095  1.00 92.37  ? 12   DT  C OP1   1 
ATOM   7079 O OP2   . DT  C 3 12  ? -11.156 37.759  -6.475  1.00 78.96  ? 12   DT  C OP2   1 
ATOM   7080 O "O5'" . DT  C 3 12  ? -9.562  37.469  -4.623  1.00 86.99  ? 12   DT  C "O5'" 1 
ATOM   7081 C "C5'" . DT  C 3 12  ? -8.538  36.505  -4.561  1.00 81.16  ? 12   DT  C "C5'" 1 
ATOM   7082 C "C4'" . DT  C 3 12  ? -7.259  37.092  -5.088  1.00 76.83  ? 12   DT  C "C4'" 1 
ATOM   7083 O "O4'" . DT  C 3 12  ? -7.009  36.761  -6.477  1.00 74.83  ? 12   DT  C "O4'" 1 
ATOM   7084 C "C3'" . DT  C 3 12  ? -7.112  38.609  -4.977  1.00 72.88  ? 12   DT  C "C3'" 1 
ATOM   7085 O "O3'" . DT  C 3 12  ? -5.962  38.908  -4.187  1.00 79.87  ? 12   DT  C "O3'" 1 
ATOM   7086 C "C2'" . DT  C 3 12  ? -6.773  39.030  -6.398  1.00 66.47  ? 12   DT  C "C2'" 1 
ATOM   7087 C "C1'" . DT  C 3 12  ? -6.173  37.768  -6.969  1.00 63.36  ? 12   DT  C "C1'" 1 
ATOM   7088 N N1    . DT  C 3 12  ? -6.083  37.655  -8.429  1.00 51.88  ? 12   DT  C N1    1 
ATOM   7089 C C2    . DT  C 3 12  ? -4.814  37.429  -8.934  1.00 46.75  ? 12   DT  C C2    1 
ATOM   7090 O O2    . DT  C 3 12  ? -3.837  37.301  -8.221  1.00 47.87  ? 12   DT  C O2    1 
ATOM   7091 N N3    . DT  C 3 12  ? -4.721  37.371  -10.302 1.00 42.49  ? 12   DT  C N3    1 
ATOM   7092 C C4    . DT  C 3 12  ? -5.760  37.527  -11.201 1.00 44.42  ? 12   DT  C C4    1 
ATOM   7093 O O4    . DT  C 3 12  ? -5.549  37.508  -12.417 1.00 43.41  ? 12   DT  C O4    1 
ATOM   7094 C C5    . DT  C 3 12  ? -7.078  37.730  -10.610 1.00 48.45  ? 12   DT  C C5    1 
ATOM   7095 C C7    . DT  C 3 12  ? -8.242  37.868  -11.553 1.00 46.61  ? 12   DT  C C7    1 
ATOM   7096 C C6    . DT  C 3 12  ? -7.177  37.783  -9.257  1.00 50.80  ? 12   DT  C C6    1 
ATOM   7097 P P     . DA  C 3 13  ? -5.979  40.157  -3.163  1.00 97.60  ? 13   DA  C P     1 
ATOM   7098 O OP1   . DA  C 3 13  ? -6.584  39.827  -1.826  1.00 105.28 ? 13   DA  C OP1   1 
ATOM   7099 O OP2   . DA  C 3 13  ? -6.481  41.324  -3.910  1.00 103.92 ? 13   DA  C OP2   1 
ATOM   7100 O "O5'" . DA  C 3 13  ? -4.450  40.446  -2.922  1.00 93.65  ? 13   DA  C "O5'" 1 
ATOM   7101 C "C5'" . DA  C 3 13  ? -3.935  41.655  -3.393  1.00 91.31  ? 13   DA  C "C5'" 1 
ATOM   7102 C "C4'" . DA  C 3 13  ? -2.919  41.388  -4.471  1.00 86.52  ? 13   DA  C "C4'" 1 
ATOM   7103 O "O4'" . DA  C 3 13  ? -3.443  40.577  -5.571  1.00 79.61  ? 13   DA  C "O4'" 1 
ATOM   7104 C "C3'" . DA  C 3 13  ? -2.403  42.636  -5.157  1.00 85.81  ? 13   DA  C "C3'" 1 
ATOM   7105 O "O3'" . DA  C 3 13  ? -1.477  43.369  -4.340  1.00 91.29  ? 13   DA  C "O3'" 1 
ATOM   7106 C "C2'" . DA  C 3 13  ? -1.849  42.075  -6.466  1.00 78.80  ? 13   DA  C "C2'" 1 
ATOM   7107 C "C1'" . DA  C 3 13  ? -2.561  40.734  -6.681  1.00 70.18  ? 13   DA  C "C1'" 1 
ATOM   7108 N N9    . DA  C 3 13  ? -3.354  40.819  -7.910  1.00 65.12  ? 13   DA  C N9    1 
ATOM   7109 C C8    . DA  C 3 13  ? -4.682  41.185  -8.102  1.00 64.70  ? 13   DA  C C8    1 
ATOM   7110 N N7    . DA  C 3 13  ? -5.062  41.161  -9.368  1.00 62.07  ? 13   DA  C N7    1 
ATOM   7111 C C5    . DA  C 3 13  ? -3.903  40.766  -10.049 1.00 59.07  ? 13   DA  C C5    1 
ATOM   7112 C C6    . DA  C 3 13  ? -3.627  40.570  -11.413 1.00 53.65  ? 13   DA  C C6    1 
ATOM   7113 N N6    . DA  C 3 13  ? -4.513  40.751  -12.373 1.00 50.45  ? 13   DA  C N6    1 
ATOM   7114 N N1    . DA  C 3 13  ? -2.397  40.190  -11.746 1.00 52.31  ? 13   DA  C N1    1 
ATOM   7115 C C2    . DA  C 3 13  ? -1.501  40.032  -10.776 1.00 53.94  ? 13   DA  C C2    1 
ATOM   7116 N N3    . DA  C 3 13  ? -1.621  40.204  -9.464  1.00 56.91  ? 13   DA  C N3    1 
ATOM   7117 C C4    . DA  C 3 13  ? -2.855  40.567  -9.160  1.00 59.84  ? 13   DA  C C4    1 
ATOM   7118 P P     . DC  C 3 14  ? -0.187  42.654  -3.736  1.00 130.90 ? 14   DC  C P     1 
ATOM   7119 O OP1   . DC  C 3 14  ? -0.302  41.163  -3.753  1.00 88.73  ? 14   DC  C OP1   1 
ATOM   7120 O OP2   . DC  C 3 14  ? 0.108   43.351  -2.471  1.00 95.50  ? 14   DC  C OP2   1 
ATOM   7121 O "O5'" . DC  C 3 14  ? 0.921   43.016  -4.810  1.00 127.74 ? 14   DC  C "O5'" 1 
ATOM   7122 C "C5'" . DC  C 3 14  ? 1.398   42.018  -5.711  1.00 117.02 ? 14   DC  C "C5'" 1 
ATOM   7123 C "C4'" . DC  C 3 14  ? 1.891   42.656  -6.988  1.00 107.09 ? 14   DC  C "C4'" 1 
ATOM   7124 O "O4'" . DC  C 3 14  ? 0.988   42.469  -8.100  1.00 98.17  ? 14   DC  C "O4'" 1 
ATOM   7125 C "C3'" . DC  C 3 14  ? 2.179   44.150  -6.902  1.00 103.59 ? 14   DC  C "C3'" 1 
ATOM   7126 O "O3'" . DC  C 3 14  ? 3.564   44.277  -7.223  1.00 106.05 ? 14   DC  C "O3'" 1 
ATOM   7127 C "C2'" . DC  C 3 14  ? 1.185   44.774  -7.867  1.00 99.03  ? 14   DC  C "C2'" 1 
ATOM   7128 C "C1'" . DC  C 3 14  ? 0.911   43.663  -8.852  1.00 94.59  ? 14   DC  C "C1'" 1 
ATOM   7129 N N1    . DC  C 3 14  ? -0.417  43.735  -9.481  1.00 52.50  ? 14   DC  C N1    1 
ATOM   7130 C C2    . DC  C 3 14  ? -0.609  43.173  -10.792 1.00 48.50  ? 14   DC  C C2    1 
ATOM   7131 O O2    . DC  C 3 14  ? 0.332   42.627  -11.388 1.00 47.21  ? 14   DC  C O2    1 
ATOM   7132 N N3    . DC  C 3 14  ? -1.806  43.254  -11.373 1.00 45.50  ? 14   DC  C N3    1 
ATOM   7133 C C4    . DC  C 3 14  ? -2.801  43.867  -10.738 1.00 45.33  ? 14   DC  C C4    1 
ATOM   7134 N N4    . DC  C 3 14  ? -3.970  43.987  -11.402 1.00 43.46  ? 14   DC  C N4    1 
ATOM   7135 C C5    . DC  C 3 14  ? -2.643  44.414  -9.410  1.00 46.18  ? 14   DC  C C5    1 
ATOM   7136 C C6    . DC  C 3 14  ? -1.442  44.330  -8.839  1.00 46.98  ? 14   DC  C C6    1 
ATOM   7137 P P     . DA  C 3 15  ? 4.140   45.537  -8.017  1.00 89.59  ? 15   DA  C P     1 
ATOM   7138 O OP1   . DA  C 3 15  ? 5.606   45.236  -8.032  1.00 72.64  ? 15   DA  C OP1   1 
ATOM   7139 O OP2   . DA  C 3 15  ? 3.654   46.837  -7.432  1.00 73.27  ? 15   DA  C OP2   1 
ATOM   7140 O "O5'" . DA  C 3 15  ? 3.515   45.342  -9.472  1.00 83.05  ? 15   DA  C "O5'" 1 
ATOM   7141 C "C5'" . DA  C 3 15  ? 4.081   44.440  -10.385 1.00 79.51  ? 15   DA  C "C5'" 1 
ATOM   7142 C "C4'" . DA  C 3 15  ? 4.328   45.148  -11.694 1.00 76.98  ? 15   DA  C "C4'" 1 
ATOM   7143 O "O4'" . DA  C 3 15  ? 3.109   45.165  -12.452 1.00 73.25  ? 15   DA  C "O4'" 1 
ATOM   7144 C "C3'" . DA  C 3 15  ? 4.771   46.607  -11.617 1.00 73.51  ? 15   DA  C "C3'" 1 
ATOM   7145 O "O3'" . DA  C 3 15  ? 5.384   46.883  -12.869 1.00 73.96  ? 15   DA  C "O3'" 1 
ATOM   7146 C "C2'" . DA  C 3 15  ? 3.451   47.326  -11.590 1.00 69.41  ? 15   DA  C "C2'" 1 
ATOM   7147 C "C1'" . DA  C 3 15  ? 2.654   46.497  -12.585 1.00 67.37  ? 15   DA  C "C1'" 1 
ATOM   7148 N N9    . DA  C 3 15  ? 1.217   46.475  -12.333 1.00 44.96  ? 15   DA  C N9    1 
ATOM   7149 C C8    . DA  C 3 15  ? 0.572   46.280  -11.130 1.00 44.94  ? 15   DA  C C8    1 
ATOM   7150 N N7    . DA  C 3 15  ? -0.742  46.369  -11.215 1.00 44.19  ? 15   DA  C N7    1 
ATOM   7151 C C5    . DA  C 3 15  ? -0.965  46.602  -12.574 1.00 40.97  ? 15   DA  C C5    1 
ATOM   7152 C C6    . DA  C 3 15  ? -2.127  46.733  -13.317 1.00 37.08  ? 15   DA  C C6    1 
ATOM   7153 N N6    . DA  C 3 15  ? -3.346  46.644  -12.755 1.00 37.80  ? 15   DA  C N6    1 
ATOM   7154 N N1    . DA  C 3 15  ? -2.006  46.938  -14.654 1.00 34.68  ? 15   DA  C N1    1 
ATOM   7155 C C2    . DA  C 3 15  ? -0.811  46.978  -15.173 1.00 35.14  ? 15   DA  C C2    1 
ATOM   7156 N N3    . DA  C 3 15  ? 0.354   46.850  -14.587 1.00 37.20  ? 15   DA  C N3    1 
ATOM   7157 C C4    . DA  C 3 15  ? 0.219   46.664  -13.267 1.00 41.05  ? 15   DA  C C4    1 
ATOM   7158 P P     . DG  C 3 16  ? 5.993   48.334  -13.194 1.00 56.05  ? 16   DG  C P     1 
ATOM   7159 O OP1   . DG  C 3 16  ? 7.377   48.090  -13.728 1.00 58.51  ? 16   DG  C OP1   1 
ATOM   7160 O OP2   . DG  C 3 16  ? 5.800   49.249  -12.032 1.00 62.32  ? 16   DG  C OP2   1 
ATOM   7161 O "O5'" . DG  C 3 16  ? 5.068   48.801  -14.395 1.00 52.83  ? 16   DG  C "O5'" 1 
ATOM   7162 C "C5'" . DG  C 3 16  ? 5.140   48.127  -15.646 1.00 50.22  ? 16   DG  C "C5'" 1 
ATOM   7163 C "C4'" . DG  C 3 16  ? 4.187   48.735  -16.650 1.00 49.03  ? 16   DG  C "C4'" 1 
ATOM   7164 O "O4'" . DG  C 3 16  ? 2.799   48.582  -16.215 1.00 46.28  ? 16   DG  C "O4'" 1 
ATOM   7165 C "C3'" . DG  C 3 16  ? 4.382   50.220  -16.979 1.00 48.95  ? 16   DG  C "C3'" 1 
ATOM   7166 O "O3'" . DG  C 3 16  ? 4.549   50.311  -18.387 1.00 53.77  ? 16   DG  C "O3'" 1 
ATOM   7167 C "C2'" . DG  C 3 16  ? 3.093   50.895  -16.501 1.00 43.64  ? 16   DG  C "C2'" 1 
ATOM   7168 C "C1'" . DG  C 3 16  ? 2.072   49.756  -16.577 1.00 39.78  ? 16   DG  C "C1'" 1 
ATOM   7169 N N9    . DG  C 3 16  ? 0.893   49.889  -15.718 1.00 37.22  ? 16   DG  C N9    1 
ATOM   7170 C C8    . DG  C 3 16  ? 0.852   49.896  -14.365 1.00 35.97  ? 16   DG  C C8    1 
ATOM   7171 N N7    . DG  C 3 16  ? -0.352  50.048  -13.897 1.00 34.62  ? 16   DG  C N7    1 
ATOM   7172 C C5    . DG  C 3 16  ? -1.148  50.153  -15.019 1.00 33.71  ? 16   DG  C C5    1 
ATOM   7173 C C6    . DG  C 3 16  ? -2.549  50.316  -15.156 1.00 32.82  ? 16   DG  C C6    1 
ATOM   7174 O O6    . DG  C 3 16  ? -3.386  50.372  -14.332 1.00 32.50  ? 16   DG  C O6    1 
ATOM   7175 N N1    . DG  C 3 16  ? -2.944  50.390  -16.457 1.00 34.24  ? 16   DG  C N1    1 
ATOM   7176 C C2    . DG  C 3 16  ? -2.110  50.290  -17.528 1.00 34.23  ? 16   DG  C C2    1 
ATOM   7177 N N2    . DG  C 3 16  ? -2.661  50.348  -18.772 1.00 33.52  ? 16   DG  C N2    1 
ATOM   7178 N N3    . DG  C 3 16  ? -0.810  50.120  -17.414 1.00 35.78  ? 16   DG  C N3    1 
ATOM   7179 C C4    . DG  C 3 16  ? -0.400  50.058  -16.139 1.00 35.57  ? 16   DG  C C4    1 
ATOM   7180 P P     . DT  C 3 17  ? 4.529   51.742  -19.112 1.00 81.60  ? 17   DT  C P     1 
ATOM   7181 O OP1   . DT  C 3 17  ? 5.232   51.601  -20.417 1.00 64.48  ? 17   DT  C OP1   1 
ATOM   7182 O OP2   . DT  C 3 17  ? 4.904   52.859  -18.173 1.00 63.72  ? 17   DT  C OP2   1 
ATOM   7183 O "O5'" . DT  C 3 17  ? 2.999   51.980  -19.425 1.00 78.63  ? 17   DT  C "O5'" 1 
ATOM   7184 C "C5'" . DT  C 3 17  ? 2.409   51.414  -20.554 1.00 74.63  ? 17   DT  C "C5'" 1 
ATOM   7185 C "C4'" . DT  C 3 17  ? 1.148   52.161  -20.867 1.00 69.29  ? 17   DT  C "C4'" 1 
ATOM   7186 O "O4'" . DT  C 3 17  ? 0.254   52.129  -19.734 1.00 65.50  ? 17   DT  C "O4'" 1 
ATOM   7187 C "C3'" . DT  C 3 17  ? 1.337   53.636  -21.198 1.00 69.87  ? 17   DT  C "C3'" 1 
ATOM   7188 O "O3'" . DT  C 3 17  ? 0.790   53.774  -22.524 1.00 76.84  ? 17   DT  C "O3'" 1 
ATOM   7189 C "C2'" . DT  C 3 17  ? 0.597   54.369  -20.074 1.00 62.88  ? 17   DT  C "C2'" 1 
ATOM   7190 C "C1'" . DT  C 3 17  ? -0.428  53.361  -19.649 1.00 58.31  ? 17   DT  C "C1'" 1 
ATOM   7191 N N1    . DT  C 3 17  ? -1.000  53.466  -18.297 1.00 33.67  ? 17   DT  C N1    1 
ATOM   7192 C C2    . DT  C 3 17  ? -2.363  53.742  -18.176 1.00 32.61  ? 17   DT  C C2    1 
ATOM   7193 O O2    . DT  C 3 17  ? -3.084  53.941  -19.143 1.00 34.01  ? 17   DT  C O2    1 
ATOM   7194 N N3    . DT  C 3 17  ? -2.860  53.783  -16.883 1.00 30.54  ? 17   DT  C N3    1 
ATOM   7195 C C4    . DT  C 3 17  ? -2.138  53.587  -15.727 1.00 30.24  ? 17   DT  C C4    1 
ATOM   7196 O O4    . DT  C 3 17  ? -2.697  53.648  -14.634 1.00 28.38  ? 17   DT  C O4    1 
ATOM   7197 C C5    . DT  C 3 17  ? -0.698  53.309  -15.926 1.00 30.27  ? 17   DT  C C5    1 
ATOM   7198 C C7    . DT  C 3 17  ? 0.182   53.084  -14.725 1.00 28.20  ? 17   DT  C C7    1 
ATOM   7199 C C6    . DT  C 3 17  ? -0.220  53.270  -17.192 1.00 31.06  ? 17   DT  C C6    1 
ATOM   7200 P P     . DA  C 3 18  ? 0.429   55.202  -23.112 1.00 79.37  ? 18   DA  C P     1 
ATOM   7201 O OP1   . DA  C 3 18  ? 0.201   55.042  -24.573 1.00 65.97  ? 18   DA  C OP1   1 
ATOM   7202 O OP2   . DA  C 3 18  ? 1.435   56.184  -22.588 1.00 61.94  ? 18   DA  C OP2   1 
ATOM   7203 O "O5'" . DA  C 3 18  ? -0.967  55.476  -22.389 1.00 79.43  ? 18   DA  C "O5'" 1 
ATOM   7204 C "C5'" . DA  C 3 18  ? -2.214  55.055  -22.965 1.00 74.06  ? 18   DA  C "C5'" 1 
ATOM   7205 C "C4'" . DA  C 3 18  ? -3.299  56.046  -22.613 1.00 68.48  ? 18   DA  C "C4'" 1 
ATOM   7206 O "O4'" . DA  C 3 18  ? -3.683  55.919  -21.207 1.00 63.74  ? 18   DA  C "O4'" 1 
ATOM   7207 C "C3'" . DA  C 3 18  ? -2.800  57.485  -22.802 1.00 70.37  ? 18   DA  C "C3'" 1 
ATOM   7208 O "O3'" . DA  C 3 18  ? -3.663  58.288  -23.608 1.00 78.84  ? 18   DA  C "O3'" 1 
ATOM   7209 C "C2'" . DA  C 3 18  ? -2.735  58.045  -21.395 1.00 64.41  ? 18   DA  C "C2'" 1 
ATOM   7210 C "C1'" . DA  C 3 18  ? -3.762  57.215  -20.634 1.00 60.11  ? 18   DA  C "C1'" 1 
ATOM   7211 N N9    . DA  C 3 18  ? -3.411  57.150  -19.220 1.00 39.48  ? 18   DA  C N9    1 
ATOM   7212 C C8    . DA  C 3 18  ? -2.147  57.036  -18.686 1.00 37.41  ? 18   DA  C C8    1 
ATOM   7213 N N7    . DA  C 3 18  ? -2.121  57.085  -17.372 1.00 35.38  ? 18   DA  C N7    1 
ATOM   7214 C C5    . DA  C 3 18  ? -3.461  57.222  -17.027 1.00 33.38  ? 18   DA  C C5    1 
ATOM   7215 C C6    . DA  C 3 18  ? -4.094  57.320  -15.794 1.00 29.88  ? 18   DA  C C6    1 
ATOM   7216 N N6    . DA  C 3 18  ? -3.407  57.278  -14.634 1.00 30.02  ? 18   DA  C N6    1 
ATOM   7217 N N1    . DA  C 3 18  ? -5.435  57.474  -15.783 1.00 28.18  ? 18   DA  C N1    1 
ATOM   7218 C C2    . DA  C 3 18  ? -6.066  57.518  -16.929 1.00 31.04  ? 18   DA  C C2    1 
ATOM   7219 N N3    . DA  C 3 18  ? -5.581  57.420  -18.172 1.00 34.23  ? 18   DA  C N3    1 
ATOM   7220 C C4    . DA  C 3 18  ? -4.256  57.268  -18.151 1.00 35.73  ? 18   DA  C C4    1 
ATOM   7221 P P     . DG  C 3 19  ? -3.183  59.762  -24.092 1.00 93.18  ? 19   DG  C P     1 
ATOM   7222 O OP1   . DG  C 3 19  ? -2.967  59.678  -25.557 1.00 86.12  ? 19   DG  C OP1   1 
ATOM   7223 O OP2   . DG  C 3 19  ? -2.071  60.266  -23.241 1.00 82.44  ? 19   DG  C OP2   1 
ATOM   7224 O "O5'" . DG  C 3 19  ? -4.477  60.650  -23.807 1.00 92.15  ? 19   DG  C "O5'" 1 
ATOM   7225 C "C5'" . DG  C 3 19  ? -5.722  60.020  -23.538 1.00 91.54  ? 19   DG  C "C5'" 1 
ATOM   7226 C "C4'" . DG  C 3 19  ? -6.417  60.660  -22.359 1.00 85.06  ? 19   DG  C "C4'" 1 
ATOM   7227 O "O4'" . DG  C 3 19  ? -5.949  60.204  -21.058 1.00 82.51  ? 19   DG  C "O4'" 1 
ATOM   7228 C "C3'" . DG  C 3 19  ? -6.475  62.189  -22.319 1.00 82.87  ? 19   DG  C "C3'" 1 
ATOM   7229 O "O3'" . DG  C 3 19  ? -7.872  62.523  -22.317 1.00 87.60  ? 19   DG  C "O3'" 1 
ATOM   7230 C "C2'" . DG  C 3 19  ? -5.851  62.523  -20.970 1.00 79.95  ? 19   DG  C "C2'" 1 
ATOM   7231 C "C1'" . DG  C 3 19  ? -6.160  61.263  -20.155 1.00 78.03  ? 19   DG  C "C1'" 1 
ATOM   7232 N N9    . DG  C 3 19  ? -5.361  61.058  -18.939 1.00 60.49  ? 19   DG  C N9    1 
ATOM   7233 C C8    . DG  C 3 19  ? -3.985  60.945  -18.823 1.00 58.71  ? 19   DG  C C8    1 
ATOM   7234 N N7    . DG  C 3 19  ? -3.574  60.852  -17.583 1.00 54.22  ? 19   DG  C N7    1 
ATOM   7235 C C5    . DG  C 3 19  ? -4.745  60.887  -16.836 1.00 49.82  ? 19   DG  C C5    1 
ATOM   7236 C C6    . DG  C 3 19  ? -4.920  60.817  -15.455 1.00 47.15  ? 19   DG  C C6    1 
ATOM   7237 O O6    . DG  C 3 19  ? -4.059  60.711  -14.582 1.00 46.43  ? 19   DG  C O6    1 
ATOM   7238 N N1    . DG  C 3 19  ? -6.252  60.879  -15.101 1.00 47.46  ? 19   DG  C N1    1 
ATOM   7239 C C2    . DG  C 3 19  ? -7.295  61.007  -15.987 1.00 50.65  ? 19   DG  C C2    1 
ATOM   7240 N N2    . DG  C 3 19  ? -8.529  61.032  -15.429 1.00 50.20  ? 19   DG  C N2    1 
ATOM   7241 N N3    . DG  C 3 19  ? -7.149  61.087  -17.312 1.00 51.56  ? 19   DG  C N3    1 
ATOM   7242 C C4    . DG  C 3 19  ? -5.852  61.009  -17.657 1.00 52.84  ? 19   DG  C C4    1 
ATOM   7243 P P     . DG  C 3 20  ? -8.391  64.006  -22.681 1.00 74.76  ? 20   DG  C P     1 
ATOM   7244 O OP1   . DG  C 3 20  ? -8.887  63.837  -24.063 1.00 69.43  ? 20   DG  C OP1   1 
ATOM   7245 O OP2   . DG  C 3 20  ? -7.352  65.038  -22.356 1.00 67.44  ? 20   DG  C OP2   1 
ATOM   7246 O "O5'" . DG  C 3 20  ? -9.598  64.213  -21.651 1.00 70.46  ? 20   DG  C "O5'" 1 
ATOM   7247 C "C5'" . DG  C 3 20  ? -10.434 63.109  -21.284 1.00 72.70  ? 20   DG  C "C5'" 1 
ATOM   7248 C "C4'" . DG  C 3 20  ? -11.219 63.391  -20.015 1.00 72.05  ? 20   DG  C "C4'" 1 
ATOM   7249 O "O4'" . DG  C 3 20  ? -10.585 62.717  -18.916 1.00 66.48  ? 20   DG  C "O4'" 1 
ATOM   7250 C "C3'" . DG  C 3 20  ? -11.330 64.829  -19.546 1.00 73.57  ? 20   DG  C "C3'" 1 
ATOM   7251 O "O3'" . DG  C 3 20  ? -12.518 65.512  -19.962 1.00 81.42  ? 20   DG  C "O3'" 1 
ATOM   7252 C "C2'" . DG  C 3 20  ? -11.357 64.713  -18.032 1.00 67.88  ? 20   DG  C "C2'" 1 
ATOM   7253 C "C1'" . DG  C 3 20  ? -10.525 63.521  -17.761 1.00 63.06  ? 20   DG  C "C1'" 1 
ATOM   7254 N N9    . DG  C 3 20  ? -9.122  63.894  -17.572 1.00 51.38  ? 20   DG  C N9    1 
ATOM   7255 C C8    . DG  C 3 20  ? -8.164  64.083  -18.540 1.00 49.76  ? 20   DG  C C8    1 
ATOM   7256 N N7    . DG  C 3 20  ? -6.976  64.331  -18.041 1.00 46.44  ? 20   DG  C N7    1 
ATOM   7257 C C5    . DG  C 3 20  ? -7.177  64.314  -16.673 1.00 42.71  ? 20   DG  C C5    1 
ATOM   7258 C C6    . DG  C 3 20  ? -6.262  64.520  -15.628 1.00 40.15  ? 20   DG  C C6    1 
ATOM   7259 O O6    . DG  C 3 20  ? -5.068  64.797  -15.712 1.00 42.73  ? 20   DG  C O6    1 
ATOM   7260 N N1    . DG  C 3 20  ? -6.861  64.419  -14.384 1.00 40.82  ? 20   DG  C N1    1 
ATOM   7261 C C2    . DG  C 3 20  ? -8.210  64.202  -14.199 1.00 44.43  ? 20   DG  C C2    1 
ATOM   7262 N N2    . DG  C 3 20  ? -8.659  64.199  -12.905 1.00 41.79  ? 20   DG  C N2    1 
ATOM   7263 N N3    . DG  C 3 20  ? -9.076  64.022  -15.189 1.00 43.58  ? 20   DG  C N3    1 
ATOM   7264 C C4    . DG  C 3 20  ? -8.493  64.079  -16.376 1.00 45.00  ? 20   DG  C C4    1 
ATOM   7265 P P     . DG  C 3 21  ? -12.576 67.131  -19.823 1.00 90.64  ? 21   DG  C P     1 
ATOM   7266 O OP1   . DG  C 3 21  ? -13.872 67.521  -20.453 1.00 82.11  ? 21   DG  C OP1   1 
ATOM   7267 O OP2   . DG  C 3 21  ? -11.295 67.827  -20.257 1.00 72.45  ? 21   DG  C OP2   1 
ATOM   7268 O "O5'" . DG  C 3 21  ? -12.612 67.335  -18.246 1.00 81.62  ? 21   DG  C "O5'" 1 
ATOM   7269 C "C5'" . DG  C 3 21  ? -11.608 68.111  -17.619 1.00 69.94  ? 21   DG  C "C5'" 1 
ATOM   7270 C "C4'" . DG  C 3 21  ? -12.037 68.434  -16.215 1.00 65.59  ? 21   DG  C "C4'" 1 
ATOM   7271 O "O4'" . DG  C 3 21  ? -11.564 67.364  -15.387 1.00 63.34  ? 21   DG  C "O4'" 1 
ATOM   7272 C "C3'" . DG  C 3 21  ? -11.403 69.693  -15.623 1.00 68.07  ? 21   DG  C "C3'" 1 
ATOM   7273 O "O3'" . DG  C 3 21  ? -12.231 70.839  -15.898 1.00 75.38  ? 21   DG  C "O3'" 1 
ATOM   7274 C "C2'" . DG  C 3 21  ? -11.113 69.323  -14.179 1.00 63.36  ? 21   DG  C "C2'" 1 
ATOM   7275 C "C1'" . DG  C 3 21  ? -10.760 67.860  -14.312 1.00 58.78  ? 21   DG  C "C1'" 1 
ATOM   7276 N N9    . DG  C 3 21  ? -9.348  67.748  -14.713 1.00 41.68  ? 21   DG  C N9    1 
ATOM   7277 C C8    . DG  C 3 21  ? -8.852  67.590  -15.988 1.00 40.61  ? 21   DG  C C8    1 
ATOM   7278 N N7    . DG  C 3 21  ? -7.547  67.551  -16.023 1.00 36.43  ? 21   DG  C N7    1 
ATOM   7279 C C5    . DG  C 3 21  ? -7.158  67.693  -14.699 1.00 34.88  ? 21   DG  C C5    1 
ATOM   7280 C C6    . DG  C 3 21  ? -5.861  67.725  -14.136 1.00 34.88  ? 21   DG  C C6    1 
ATOM   7281 O O6    . DG  C 3 21  ? -4.731  67.596  -14.734 1.00 34.79  ? 21   DG  C O6    1 
ATOM   7282 N N1    . DG  C 3 21  ? -5.918  67.925  -12.750 1.00 34.66  ? 21   DG  C N1    1 
ATOM   7283 C C2    . DG  C 3 21  ? -7.077  68.056  -12.029 1.00 38.36  ? 21   DG  C C2    1 
ATOM   7284 N N2    . DG  C 3 21  ? -6.914  68.240  -10.689 1.00 40.83  ? 21   DG  C N2    1 
ATOM   7285 N N3    . DG  C 3 21  ? -8.293  68.006  -12.557 1.00 38.47  ? 21   DG  C N3    1 
ATOM   7286 C C4    . DG  C 3 21  ? -8.253  67.822  -13.879 1.00 37.21  ? 21   DG  C C4    1 
ATOM   7287 P P     . DG  C 3 22  ? -12.550 71.957  -14.799 1.00 69.95  ? 22   DG  C P     1 
ATOM   7288 O OP1   . DG  C 3 22  ? -13.986 71.694  -14.449 1.00 78.69  ? 22   DG  C OP1   1 
ATOM   7289 O OP2   . DG  C 3 22  ? -12.168 73.242  -15.459 1.00 78.06  ? 22   DG  C OP2   1 
ATOM   7290 O "O5'" . DG  C 3 22  ? -11.650 71.681  -13.514 1.00 62.95  ? 22   DG  C "O5'" 1 
ATOM   7291 C "C5'" . DG  C 3 22  ? -12.276 71.230  -12.309 1.00 64.24  ? 22   DG  C "C5'" 1 
ATOM   7292 C "C4'" . DG  C 3 22  ? -11.379 71.484  -11.123 1.00 64.00  ? 22   DG  C "C4'" 1 
ATOM   7293 O "O4'" . DG  C 3 22  ? -10.077 70.897  -11.358 1.00 61.32  ? 22   DG  C "O4'" 1 
ATOM   7294 C "C3'" . DG  C 3 22  ? -11.120 72.969  -10.918 1.00 64.66  ? 22   DG  C "C3'" 1 
ATOM   7295 O "O3'" . DG  C 3 22  ? -10.876 73.279  -9.564  1.00 68.73  ? 22   DG  C "O3'" 1 
ATOM   7296 C "C2'" . DG  C 3 22  ? -9.807  73.187  -11.617 1.00 59.99  ? 22   DG  C "C2'" 1 
ATOM   7297 C "C1'" . DG  C 3 22  ? -9.085  71.911  -11.284 1.00 55.35  ? 22   DG  C "C1'" 1 
ATOM   7298 N N9    . DG  C 3 22  ? -8.067  71.633  -12.283 1.00 50.52  ? 22   DG  C N9    1 
ATOM   7299 C C8    . DG  C 3 22  ? -8.248  71.428  -13.642 1.00 48.48  ? 22   DG  C C8    1 
ATOM   7300 N N7    . DG  C 3 22  ? -7.134  71.184  -14.278 1.00 45.52  ? 22   DG  C N7    1 
ATOM   7301 C C5    . DG  C 3 22  ? -6.169  71.259  -13.280 1.00 45.42  ? 22   DG  C C5    1 
ATOM   7302 C C6    . DG  C 3 22  ? -4.748  71.106  -13.366 1.00 44.84  ? 22   DG  C C6    1 
ATOM   7303 O O6    . DG  C 3 22  ? -4.071  70.924  -14.409 1.00 43.45  ? 22   DG  C O6    1 
ATOM   7304 N N1    . DG  C 3 22  ? -4.123  71.230  -12.087 1.00 44.42  ? 22   DG  C N1    1 
ATOM   7305 C C2    . DG  C 3 22  ? -4.804  71.516  -10.912 1.00 45.38  ? 22   DG  C C2    1 
ATOM   7306 N N2    . DG  C 3 22  ? -4.041  71.628  -9.820  1.00 46.01  ? 22   DG  C N2    1 
ATOM   7307 N N3    . DG  C 3 22  ? -6.144  71.684  -10.841 1.00 45.47  ? 22   DG  C N3    1 
ATOM   7308 C C4    . DG  C 3 22  ? -6.743  71.538  -12.046 1.00 46.32  ? 22   DG  C C4    1 
ATOM   7309 P P     . DG  C 3 23  ? -11.010 74.801  -9.106  1.00 78.67  ? 23   DG  C P     1 
ATOM   7310 O OP1   . DG  C 3 23  ? -12.436 75.049  -8.881  1.00 64.22  ? 23   DG  C OP1   1 
ATOM   7311 O OP2   . DG  C 3 23  ? -10.289 75.571  -10.164 1.00 62.82  ? 23   DG  C OP2   1 
ATOM   7312 O "O5'" . DG  C 3 23  ? -10.226 74.851  -7.713  1.00 74.96  ? 23   DG  C "O5'" 1 
ATOM   7313 C "C5'" . DG  C 3 23  ? -9.212  73.862  -7.397  1.00 74.46  ? 23   DG  C "C5'" 1 
ATOM   7314 C "C4'" . DG  C 3 23  ? -7.829  74.484  -7.364  1.00 71.20  ? 23   DG  C "C4'" 1 
ATOM   7315 O "O4'" . DG  C 3 23  ? -7.035  74.123  -8.516  1.00 70.46  ? 23   DG  C "O4'" 1 
ATOM   7316 C "C3'" . DG  C 3 23  ? -7.823  76.003  -7.382  1.00 72.71  ? 23   DG  C "C3'" 1 
ATOM   7317 O "O3'" . DG  C 3 23  ? -6.788  76.480  -6.520  1.00 75.33  ? 23   DG  C "O3'" 1 
ATOM   7318 C "C2'" . DG  C 3 23  ? -7.467  76.340  -8.826  1.00 66.52  ? 23   DG  C "C2'" 1 
ATOM   7319 C "C1'" . DG  C 3 23  ? -6.438  75.284  -9.042  1.00 62.98  ? 23   DG  C "C1'" 1 
ATOM   7320 N N9    . DG  C 3 23  ? -6.041  75.035  -10.417 1.00 43.50  ? 23   DG  C N9    1 
ATOM   7321 C C8    . DG  C 3 23  ? -6.810  75.064  -11.572 1.00 45.28  ? 23   DG  C C8    1 
ATOM   7322 N N7    . DG  C 3 23  ? -6.113  74.846  -12.665 1.00 42.02  ? 23   DG  C N7    1 
ATOM   7323 C C5    . DG  C 3 23  ? -4.819  74.659  -12.195 1.00 38.52  ? 23   DG  C C5    1 
ATOM   7324 C C6    . DG  C 3 23  ? -3.629  74.389  -12.904 1.00 35.71  ? 23   DG  C C6    1 
ATOM   7325 O O6    . DG  C 3 23  ? -3.496  74.251  -14.130 1.00 34.64  ? 23   DG  C O6    1 
ATOM   7326 N N1    . DG  C 3 23  ? -2.527  74.253  -12.044 1.00 34.75  ? 23   DG  C N1    1 
ATOM   7327 C C2    . DG  C 3 23  ? -2.596  74.367  -10.671 1.00 35.93  ? 23   DG  C C2    1 
ATOM   7328 N N2    . DG  C 3 23  ? -1.480  74.218  -10.011 1.00 32.25  ? 23   DG  C N2    1 
ATOM   7329 N N3    . DG  C 3 23  ? -3.712  74.622  -9.996  1.00 38.55  ? 23   DG  C N3    1 
ATOM   7330 C C4    . DG  C 3 23  ? -4.774  74.755  -10.814 1.00 39.68  ? 23   DG  C C4    1 
ATOM   7331 P P     . DA  C 3 24  ? -6.917  77.966  -5.934  1.00 69.71  ? 24   DA  C P     1 
ATOM   7332 O OP1   . DA  C 3 24  ? -8.096  77.916  -4.993  1.00 67.75  ? 24   DA  C OP1   1 
ATOM   7333 O OP2   . DA  C 3 24  ? -6.956  78.875  -7.155  1.00 63.46  ? 24   DA  C OP2   1 
ATOM   7334 O "O5'" . DA  C 3 24  ? -5.554  78.246  -5.147  1.00 67.19  ? 24   DA  C "O5'" 1 
ATOM   7335 C "C5'" . DA  C 3 24  ? -4.610  77.219  -4.865  1.00 60.47  ? 24   DA  C "C5'" 1 
ATOM   7336 C "C4'" . DA  C 3 24  ? -3.262  77.583  -5.437  1.00 55.71  ? 24   DA  C "C4'" 1 
ATOM   7337 O "O4'" . DA  C 3 24  ? -3.280  77.269  -6.850  1.00 50.35  ? 24   DA  C "O4'" 1 
ATOM   7338 C "C3'" . DA  C 3 24  ? -2.870  79.072  -5.346  1.00 54.80  ? 24   DA  C "C3'" 1 
ATOM   7339 O "O3'" . DA  C 3 24  ? -1.629  79.294  -4.678  1.00 58.03  ? 24   DA  C "O3'" 1 
ATOM   7340 C "C2'" . DA  C 3 24  ? -2.699  79.529  -6.794  1.00 49.23  ? 24   DA  C "C2'" 1 
ATOM   7341 C "C1'" . DA  C 3 24  ? -2.466  78.234  -7.527  1.00 46.74  ? 24   DA  C "C1'" 1 
ATOM   7342 N N9    . DA  C 3 24  ? -2.854  78.289  -8.930  1.00 42.07  ? 24   DA  C N9    1 
ATOM   7343 C C8    . DA  C 3 24  ? -4.108  78.381  -9.460  1.00 42.34  ? 24   DA  C C8    1 
ATOM   7344 N N7    . DA  C 3 24  ? -4.130  78.395  -10.765 1.00 40.31  ? 24   DA  C N7    1 
ATOM   7345 C C5    . DA  C 3 24  ? -2.799  78.310  -11.116 1.00 37.95  ? 24   DA  C C5    1 
ATOM   7346 C C6    . DA  C 3 24  ? -2.177  78.276  -12.339 1.00 37.57  ? 24   DA  C C6    1 
ATOM   7347 N N6    . DA  C 3 24  ? -2.832  78.353  -13.504 1.00 37.99  ? 24   DA  C N6    1 
ATOM   7348 N N1    . DA  C 3 24  ? -0.837  78.165  -12.355 1.00 38.90  ? 24   DA  C N1    1 
ATOM   7349 C C2    . DA  C 3 24  ? -0.186  78.090  -11.183 1.00 39.01  ? 24   DA  C C2    1 
ATOM   7350 N N3    . DA  C 3 24  ? -0.671  78.120  -9.947  1.00 38.48  ? 24   DA  C N3    1 
ATOM   7351 C C4    . DA  C 3 24  ? -2.004  78.240  -9.993  1.00 39.31  ? 24   DA  C C4    1 
ATOM   7352 P P     . DG  C 3 25  ? -1.253  80.769  -4.191  1.00 76.87  ? 25   DG  C P     1 
ATOM   7353 O OP1   . DG  C 3 25  ? -1.092  80.729  -2.738  1.00 66.20  ? 25   DG  C OP1   1 
ATOM   7354 O OP2   . DG  C 3 25  ? -2.165  81.763  -4.776  1.00 57.21  ? 25   DG  C OP2   1 
ATOM   7355 O "O5'" . DG  C 3 25  ? 0.184   81.084  -4.815  1.00 75.63  ? 25   DG  C "O5'" 1 
ATOM   7356 C "C5'" . DG  C 3 25  ? 0.973   80.131  -5.548  1.00 71.59  ? 25   DG  C "C5'" 1 
ATOM   7357 C "C4'" . DG  C 3 25  ? 1.776   80.820  -6.650  1.00 69.84  ? 25   DG  C "C4'" 1 
ATOM   7358 O "O4'" . DG  C 3 25  ? 1.289   80.527  -7.990  1.00 66.52  ? 25   DG  C "O4'" 1 
ATOM   7359 C "C3'" . DG  C 3 25  ? 1.951   82.351  -6.606  1.00 71.87  ? 25   DG  C "C3'" 1 
ATOM   7360 O "O3'" . DG  C 3 25  ? 3.306   82.686  -6.965  1.00 76.41  ? 25   DG  C "O3'" 1 
ATOM   7361 C "C2'" . DG  C 3 25  ? 1.036   82.815  -7.713  1.00 64.63  ? 25   DG  C "C2'" 1 
ATOM   7362 C "C1'" . DG  C 3 25  ? 1.256   81.720  -8.740  1.00 62.18  ? 25   DG  C "C1'" 1 
ATOM   7363 N N9    . DG  C 3 25  ? 0.142   81.652  -9.659  1.00 38.13  ? 25   DG  C N9    1 
ATOM   7364 C C8    . DG  C 3 25  ? -1.139  81.811  -9.299  1.00 38.13  ? 25   DG  C C8    1 
ATOM   7365 N N7    . DG  C 3 25  ? -1.947  81.773  -10.314 1.00 37.93  ? 25   DG  C N7    1 
ATOM   7366 C C5    . DG  C 3 25  ? -1.128  81.573  -11.407 1.00 36.01  ? 25   DG  C C5    1 
ATOM   7367 C C6    . DG  C 3 25  ? -1.464  81.424  -12.779 1.00 36.36  ? 25   DG  C C6    1 
ATOM   7368 O O6    . DG  C 3 25  ? -2.567  81.408  -13.295 1.00 38.02  ? 25   DG  C O6    1 
ATOM   7369 N N1    . DG  C 3 25  ? -0.367  81.250  -13.563 1.00 37.18  ? 25   DG  C N1    1 
ATOM   7370 C C2    . DG  C 3 25  ? 0.890   81.200  -13.085 1.00 42.16  ? 25   DG  C C2    1 
ATOM   7371 N N2    . DG  C 3 25  ? 1.859   81.026  -14.022 1.00 42.92  ? 25   DG  C N2    1 
ATOM   7372 N N3    . DG  C 3 25  ? 1.208   81.305  -11.782 1.00 42.54  ? 25   DG  C N3    1 
ATOM   7373 C C4    . DG  C 3 25  ? 0.150   81.488  -11.021 1.00 37.08  ? 25   DG  C C4    1 
ATOM   7374 P P     . DA  C 3 26  ? 3.883   84.183  -6.757  1.00 65.77  ? 26   DA  C P     1 
ATOM   7375 O OP1   . DA  C 3 26  ? 5.167   84.004  -6.024  1.00 64.60  ? 26   DA  C OP1   1 
ATOM   7376 O OP2   . DA  C 3 26  ? 2.867   85.178  -6.292  1.00 59.91  ? 26   DA  C OP2   1 
ATOM   7377 O "O5'" . DA  C 3 26  ? 4.359   84.514  -8.244  1.00 58.10  ? 26   DA  C "O5'" 1 
ATOM   7378 C "C5'" . DA  C 3 26  ? 5.233   83.628  -8.915  1.00 55.52  ? 26   DA  C "C5'" 1 
ATOM   7379 C "C4'" . DA  C 3 26  ? 5.391   84.061  -10.338 1.00 51.57  ? 26   DA  C "C4'" 1 
ATOM   7380 O "O4'" . DA  C 3 26  ? 4.164   83.786  -11.042 1.00 46.93  ? 26   DA  C "O4'" 1 
ATOM   7381 C "C3'" . DA  C 3 26  ? 5.644   85.551  -10.435 1.00 53.49  ? 26   DA  C "C3'" 1 
ATOM   7382 O "O3'" . DA  C 3 26  ? 6.877   85.745  -11.116 1.00 60.61  ? 26   DA  C "O3'" 1 
ATOM   7383 C "C2'" . DA  C 3 26  ? 4.450   86.078  -11.208 1.00 49.74  ? 26   DA  C "C2'" 1 
ATOM   7384 C "C1'" . DA  C 3 26  ? 3.826   84.851  -11.859 1.00 46.03  ? 26   DA  C "C1'" 1 
ATOM   7385 N N9    . DA  C 3 26  ? 2.367   84.886  -11.928 1.00 37.81  ? 26   DA  C N9    1 
ATOM   7386 C C8    . DA  C 3 26  ? 1.549   85.040  -10.877 1.00 37.37  ? 26   DA  C C8    1 
ATOM   7387 N N7    . DA  C 3 26  ? 0.273   85.011  -11.214 1.00 39.53  ? 26   DA  C N7    1 
ATOM   7388 C C5    . DA  C 3 26  ? 0.274   84.797  -12.588 1.00 36.58  ? 26   DA  C C5    1 
ATOM   7389 C C6    . DA  C 3 26  ? -0.773  84.654  -13.539 1.00 35.91  ? 26   DA  C C6    1 
ATOM   7390 N N6    . DA  C 3 26  ? -2.079  84.717  -13.231 1.00 33.99  ? 26   DA  C N6    1 
ATOM   7391 N N1    . DA  C 3 26  ? -0.444  84.478  -14.821 1.00 34.67  ? 26   DA  C N1    1 
ATOM   7392 C C2    . DA  C 3 26  ? 0.821   84.508  -15.120 1.00 35.39  ? 26   DA  C C2    1 
ATOM   7393 N N3    . DA  C 3 26  ? 1.884   84.657  -14.324 1.00 37.32  ? 26   DA  C N3    1 
ATOM   7394 C C4    . DA  C 3 26  ? 1.538   84.767  -13.046 1.00 36.58  ? 26   DA  C C4    1 
ATOM   7395 P P     . DT  C 3 27  ? 7.514   87.207  -11.241 1.00 68.24  ? 27   DT  C P     1 
ATOM   7396 O OP1   . DT  C 3 27  ? 8.996   87.071  -11.367 1.00 60.78  ? 27   DT  C OP1   1 
ATOM   7397 O OP2   . DT  C 3 27  ? 6.928   88.119  -10.232 1.00 59.57  ? 27   DT  C OP2   1 
ATOM   7398 O "O5'" . DT  C 3 27  ? 6.998   87.576  -12.686 1.00 64.13  ? 27   DT  C "O5'" 1 
ATOM   7399 C "C5'" . DT  C 3 27  ? 7.262   86.699  -13.756 1.00 65.41  ? 27   DT  C "C5'" 1 
ATOM   7400 C "C4'" . DT  C 3 27  ? 6.489   87.172  -14.945 1.00 63.77  ? 27   DT  C "C4'" 1 
ATOM   7401 O "O4'" . DT  C 3 27  ? 5.084   86.980  -14.654 1.00 63.27  ? 27   DT  C "O4'" 1 
ATOM   7402 C "C3'" . DT  C 3 27  ? 6.655   88.677  -15.103 1.00 69.01  ? 27   DT  C "C3'" 1 
ATOM   7403 O "O3'" . DT  C 3 27  ? 7.325   88.952  -16.336 1.00 76.40  ? 27   DT  C "O3'" 1 
ATOM   7404 C "C2'" . DT  C 3 27  ? 5.236   89.249  -15.033 1.00 65.26  ? 27   DT  C "C2'" 1 
ATOM   7405 C "C1'" . DT  C 3 27  ? 4.365   88.048  -15.236 1.00 62.86  ? 27   DT  C "C1'" 1 
ATOM   7406 N N1    . DT  C 3 27  ? 3.024   88.114  -14.613 1.00 51.80  ? 27   DT  C N1    1 
ATOM   7407 C C2    . DT  C 3 27  ? 1.964   87.909  -15.435 1.00 50.83  ? 27   DT  C C2    1 
ATOM   7408 O O2    . DT  C 3 27  ? 2.097   87.665  -16.595 1.00 54.01  ? 27   DT  C O2    1 
ATOM   7409 N N3    . DT  C 3 27  ? 0.753   87.985  -14.857 1.00 46.64  ? 27   DT  C N3    1 
ATOM   7410 C C4    . DT  C 3 27  ? 0.476   88.218  -13.523 1.00 47.41  ? 27   DT  C C4    1 
ATOM   7411 O O4    . DT  C 3 27  ? -0.714  88.229  -13.108 1.00 46.93  ? 27   DT  C O4    1 
ATOM   7412 C C5    . DT  C 3 27  ? 1.640   88.431  -12.679 1.00 48.86  ? 27   DT  C C5    1 
ATOM   7413 C C7    . DT  C 3 27  ? 1.442   88.702  -11.217 1.00 44.16  ? 27   DT  C C7    1 
ATOM   7414 C C6    . DT  C 3 27  ? 2.848   88.371  -13.267 1.00 50.98  ? 27   DT  C C6    1 
ATOM   7415 P P     . DG  C 3 28  ? 7.622   90.473  -16.770 1.00 83.52  ? 28   DG  C P     1 
ATOM   7416 O OP1   . DG  C 3 28  ? 9.091   90.684  -16.586 1.00 69.18  ? 28   DG  C OP1   1 
ATOM   7417 O OP2   . DG  C 3 28  ? 6.638   91.363  -16.027 1.00 67.12  ? 28   DG  C OP2   1 
ATOM   7418 O "O5'" . DG  C 3 28  ? 7.216   90.433  -18.301 1.00 77.76  ? 28   DG  C "O5'" 1 
ATOM   7419 C "C5'" . DG  C 3 28  ? 6.168   89.572  -18.720 1.00 74.67  ? 28   DG  C "C5'" 1 
ATOM   7420 C "C4'" . DG  C 3 28  ? 5.077   90.349  -19.416 1.00 74.85  ? 28   DG  C "C4'" 1 
ATOM   7421 O "O4'" . DG  C 3 28  ? 3.829   90.216  -18.718 1.00 76.05  ? 28   DG  C "O4'" 1 
ATOM   7422 C "C3'" . DG  C 3 28  ? 5.282   91.849  -19.485 1.00 79.85  ? 28   DG  C "C3'" 1 
ATOM   7423 O "O3'" . DG  C 3 28  ? 4.621   92.341  -20.638 1.00 85.05  ? 28   DG  C "O3'" 1 
ATOM   7424 C "C2'" . DG  C 3 28  ? 4.463   92.381  -18.332 1.00 74.90  ? 28   DG  C "C2'" 1 
ATOM   7425 C "C1'" . DG  C 3 28  ? 3.273   91.497  -18.493 1.00 73.06  ? 28   DG  C "C1'" 1 
ATOM   7426 N N9    . DG  C 3 28  ? 2.461   91.425  -17.292 1.00 56.34  ? 28   DG  C N9    1 
ATOM   7427 C C8    . DG  C 3 28  ? 2.901   91.633  -16.000 1.00 59.08  ? 28   DG  C C8    1 
ATOM   7428 N N7    . DG  C 3 28  ? 1.945   91.514  -15.108 1.00 57.50  ? 28   DG  C N7    1 
ATOM   7429 C C5    . DG  C 3 28  ? 0.805   91.224  -15.854 1.00 53.22  ? 28   DG  C C5    1 
ATOM   7430 C C6    . DG  C 3 28  ? -0.529  91.023  -15.427 1.00 49.84  ? 28   DG  C C6    1 
ATOM   7431 O O6    . DG  C 3 28  ? -0.960  91.093  -14.268 1.00 48.35  ? 28   DG  C O6    1 
ATOM   7432 N N1    . DG  C 3 28  ? -1.386  90.739  -16.510 1.00 47.16  ? 28   DG  C N1    1 
ATOM   7433 C C2    . DG  C 3 28  ? -0.982  90.679  -17.833 1.00 47.95  ? 28   DG  C C2    1 
ATOM   7434 N N2    . DG  C 3 28  ? -1.912  90.411  -18.725 1.00 46.68  ? 28   DG  C N2    1 
ATOM   7435 N N3    . DG  C 3 28  ? 0.266   90.878  -18.240 1.00 50.00  ? 28   DG  C N3    1 
ATOM   7436 C C4    . DG  C 3 28  ? 1.102   91.149  -17.207 1.00 53.14  ? 28   DG  C C4    1 
ATOM   7437 P P     . DC  C 3 29  ? 5.131   93.711  -21.267 1.00 83.89  ? 29   DC  C P     1 
ATOM   7438 O OP1   . DC  C 3 29  ? 6.035   93.248  -22.359 1.00 73.67  ? 29   DC  C OP1   1 
ATOM   7439 O OP2   . DC  C 3 29  ? 5.658   94.555  -20.152 1.00 70.73  ? 29   DC  C OP2   1 
ATOM   7440 O "O5'" . DC  C 3 29  ? 3.813   94.366  -21.815 1.00 80.09  ? 29   DC  C "O5'" 1 
ATOM   7441 C "C5'" . DC  C 3 29  ? 2.926   93.600  -22.560 1.00 77.53  ? 29   DC  C "C5'" 1 
ATOM   7442 C "C4'" . DC  C 3 29  ? 1.522   94.078  -22.306 1.00 75.26  ? 29   DC  C "C4'" 1 
ATOM   7443 O "O4'" . DC  C 3 29  ? 1.175   93.752  -20.947 1.00 71.56  ? 29   DC  C "O4'" 1 
ATOM   7444 C "C3'" . DC  C 3 29  ? 1.229   95.581  -22.470 1.00 76.46  ? 29   DC  C "C3'" 1 
ATOM   7445 O "O3'" . DC  C 3 29  ? 0.412   95.722  -23.659 1.00 84.67  ? 29   DC  C "O3'" 1 
ATOM   7446 C "C2'" . DC  C 3 29  ? 0.645   96.011  -21.131 1.00 72.60  ? 29   DC  C "C2'" 1 
ATOM   7447 C "C1'" . DC  C 3 29  ? 0.202   94.684  -20.525 1.00 67.71  ? 29   DC  C "C1'" 1 
ATOM   7448 N N1    . DC  C 3 29  ? 0.052   94.581  -19.058 1.00 46.36  ? 29   DC  C N1    1 
ATOM   7449 C C2    . DC  C 3 29  ? -1.195  94.206  -18.543 1.00 43.50  ? 29   DC  C C2    1 
ATOM   7450 O O2    . DC  C 3 29  ? -2.158  94.006  -19.319 1.00 43.07  ? 29   DC  C O2    1 
ATOM   7451 N N3    . DC  C 3 29  ? -1.322  94.082  -17.207 1.00 41.47  ? 29   DC  C N3    1 
ATOM   7452 C C4    . DC  C 3 29  ? -0.268  94.340  -16.398 1.00 39.30  ? 29   DC  C C4    1 
ATOM   7453 N N4    . DC  C 3 29  ? -0.398  94.234  -15.075 1.00 36.91  ? 29   DC  C N4    1 
ATOM   7454 C C5    . DC  C 3 29  ? 0.970   94.727  -16.899 1.00 42.23  ? 29   DC  C C5    1 
ATOM   7455 C C6    . DC  C 3 29  ? 1.097   94.837  -18.220 1.00 44.26  ? 29   DC  C C6    1 
ATOM   7456 P P     . DA  C 3 30  ? -1.024  96.473  -23.687 1.00 98.19  ? 30   DA  C P     1 
ATOM   7457 O OP1   . DA  C 3 30  ? -1.590  95.901  -24.950 1.00 86.69  ? 30   DA  C OP1   1 
ATOM   7458 O OP2   . DA  C 3 30  ? -0.873  97.928  -23.539 1.00 82.29  ? 30   DA  C OP2   1 
ATOM   7459 O "O5'" . DA  C 3 30  ? -1.939  95.902  -22.515 1.00 91.32  ? 30   DA  C "O5'" 1 
ATOM   7460 C "C5'" . DA  C 3 30  ? -3.137  95.180  -22.815 1.00 89.53  ? 30   DA  C "C5'" 1 
ATOM   7461 C "C4'" . DA  C 3 30  ? -4.323  95.837  -22.154 1.00 87.02  ? 30   DA  C "C4'" 1 
ATOM   7462 O "O4'" . DA  C 3 30  ? -4.138  95.864  -20.721 1.00 80.71  ? 30   DA  C "O4'" 1 
ATOM   7463 C "C3'" . DA  C 3 30  ? -4.663  97.266  -22.578 1.00 88.00  ? 30   DA  C "C3'" 1 
ATOM   7464 O "O3'" . DA  C 3 30  ? -6.068  97.251  -22.885 1.00 93.59  ? 30   DA  C "O3'" 1 
ATOM   7465 C "C2'" . DA  C 3 30  ? -4.299  98.100  -21.356 1.00 79.80  ? 30   DA  C "C2'" 1 
ATOM   7466 C "C1'" . DA  C 3 30  ? -4.451  97.133  -20.187 1.00 70.51  ? 30   DA  C "C1'" 1 
ATOM   7467 N N9    . DA  C 3 30  ? -3.518  97.340  -19.072 1.00 47.65  ? 30   DA  C N9    1 
ATOM   7468 C C8    . DA  C 3 30  ? -2.141  97.526  -19.132 1.00 44.14  ? 30   DA  C C8    1 
ATOM   7469 N N7    . DA  C 3 30  ? -1.567  97.683  -17.961 1.00 38.90  ? 30   DA  C N7    1 
ATOM   7470 C C5    . DA  C 3 30  ? -2.627  97.585  -17.065 1.00 38.30  ? 30   DA  C C5    1 
ATOM   7471 C C6    . DA  C 3 30  ? -2.677  97.624  -15.665 1.00 36.80  ? 30   DA  C C6    1 
ATOM   7472 N N6    . DA  C 3 30  ? -1.577  97.789  -14.879 1.00 34.50  ? 30   DA  C N6    1 
ATOM   7473 N N1    . DA  C 3 30  ? -3.900  97.458  -15.068 1.00 36.07  ? 30   DA  C N1    1 
ATOM   7474 C C2    . DA  C 3 30  ? -4.980  97.250  -15.839 1.00 37.17  ? 30   DA  C C2    1 
ATOM   7475 N N3    . DA  C 3 30  ? -5.062  97.195  -17.176 1.00 39.46  ? 30   DA  C N3    1 
ATOM   7476 C C4    . DA  C 3 30  ? -3.835  97.369  -17.733 1.00 41.40  ? 30   DA  C C4    1 
ATOM   7477 P P     . DT  C 3 31  ? -6.871  98.598  -23.212 1.00 84.93  ? 31   DT  C P     1 
ATOM   7478 O OP1   . DT  C 3 31  ? -8.230  98.140  -23.670 1.00 88.46  ? 31   DT  C OP1   1 
ATOM   7479 O OP2   . DT  C 3 31  ? -6.065  99.542  -24.067 1.00 85.92  ? 31   DT  C OP2   1 
ATOM   7480 O "O5'" . DT  C 3 31  ? -7.064  99.253  -21.793 1.00 81.09  ? 31   DT  C "O5'" 1 
ATOM   7481 C "C5'" . DT  C 3 31  ? -8.229  99.968  -21.519 1.00 78.89  ? 31   DT  C "C5'" 1 
ATOM   7482 C "C4'" . DT  C 3 31  ? -8.427  100.075 -20.033 1.00 75.03  ? 31   DT  C "C4'" 1 
ATOM   7483 O "O4'" . DT  C 3 31  ? -7.202  99.851  -19.293 1.00 70.46  ? 31   DT  C "O4'" 1 
ATOM   7484 C "C3'" . DT  C 3 31  ? -8.948  101.437 -19.588 1.00 78.49  ? 31   DT  C "C3'" 1 
ATOM   7485 O "O3'" . DT  C 3 31  ? -10.395 101.352 -19.564 1.00 85.29  ? 31   DT  C "O3'" 1 
ATOM   7486 C "C2'" . DT  C 3 31  ? -8.171  101.722 -18.294 1.00 69.08  ? 31   DT  C "C2'" 1 
ATOM   7487 C "C1'" . DT  C 3 31  ? -7.353  100.455 -18.024 1.00 60.72  ? 31   DT  C "C1'" 1 
ATOM   7488 N N1    . DT  C 3 31  ? -5.989  100.641 -17.406 1.00 52.05  ? 31   DT  C N1    1 
ATOM   7489 C C2    . DT  C 3 31  ? -5.924  100.557 -16.013 1.00 47.76  ? 31   DT  C C2    1 
ATOM   7490 O O2    . DT  C 3 31  ? -6.907  100.312 -15.331 1.00 51.07  ? 31   DT  C O2    1 
ATOM   7491 N N3    . DT  C 3 31  ? -4.677  100.732 -15.465 1.00 41.08  ? 31   DT  C N3    1 
ATOM   7492 C C4    . DT  C 3 31  ? -3.500  100.926 -16.166 1.00 42.40  ? 31   DT  C C4    1 
ATOM   7493 O O4    . DT  C 3 31  ? -2.433  101.027 -15.552 1.00 40.15  ? 31   DT  C O4    1 
ATOM   7494 C C5    . DT  C 3 31  ? -3.628  101.010 -17.632 1.00 45.35  ? 31   DT  C C5    1 
ATOM   7495 C C7    . DT  C 3 31  ? -2.400  101.277 -18.457 1.00 44.67  ? 31   DT  C C7    1 
ATOM   7496 C C6    . DT  C 3 31  ? -4.847  100.872 -18.167 1.00 47.78  ? 31   DT  C C6    1 
ATOM   7497 P P     . DA  C 3 32  ? -11.287 102.390 -18.731 1.00 98.77  ? 32   DA  C P     1 
ATOM   7498 O OP1   . DA  C 3 32  ? -12.670 102.190 -19.183 1.00 88.14  ? 32   DA  C OP1   1 
ATOM   7499 O OP2   . DA  C 3 32  ? -10.673 103.757 -18.792 1.00 78.51  ? 32   DA  C OP2   1 
ATOM   7500 O "O5'" . DA  C 3 32  ? -11.137 101.804 -17.270 1.00 94.42  ? 32   DA  C "O5'" 1 
ATOM   7501 C "C5'" . DA  C 3 32  ? -12.018 102.116 -16.239 1.00 93.33  ? 32   DA  C "C5'" 1 
ATOM   7502 C "C4'" . DA  C 3 32  ? -11.315 102.965 -15.205 1.00 91.77  ? 32   DA  C "C4'" 1 
ATOM   7503 O "O4'" . DA  C 3 32  ? -9.866  102.783 -15.164 1.00 83.52  ? 32   DA  C "O4'" 1 
ATOM   7504 C "C3'" . DA  C 3 32  ? -11.541 104.471 -15.340 1.00 95.67  ? 32   DA  C "C3'" 1 
ATOM   7505 O "O3'" . DA  C 3 32  ? -12.176 104.925 -14.140 1.00 105.67 ? 32   DA  C "O3'" 1 
ATOM   7506 C "C2'" . DA  C 3 32  ? -10.126 105.041 -15.426 1.00 87.43  ? 32   DA  C "C2'" 1 
ATOM   7507 C "C1'" . DA  C 3 32  ? -9.311  104.000 -14.693 1.00 78.76  ? 32   DA  C "C1'" 1 
ATOM   7508 N N9    . DA  C 3 32  ? -7.881  104.031 -15.005 1.00 53.25  ? 32   DA  C N9    1 
ATOM   7509 C C8    . DA  C 3 32  ? -7.264  103.921 -16.216 1.00 49.46  ? 32   DA  C C8    1 
ATOM   7510 N N7    . DA  C 3 32  ? -5.947  103.995 -16.155 1.00 47.25  ? 32   DA  C N7    1 
ATOM   7511 C C5    . DA  C 3 32  ? -5.691  104.172 -14.803 1.00 47.15  ? 32   DA  C C5    1 
ATOM   7512 C C6    . DA  C 3 32  ? -4.474  104.346 -14.066 1.00 43.51  ? 32   DA  C C6    1 
ATOM   7513 N N6    . DA  C 3 32  ? -3.257  104.309 -14.627 1.00 39.12  ? 32   DA  C N6    1 
ATOM   7514 N N1    . DA  C 3 32  ? -4.567  104.548 -12.728 1.00 41.63  ? 32   DA  C N1    1 
ATOM   7515 C C2    . DA  C 3 32  ? -5.785  104.532 -12.175 1.00 44.88  ? 32   DA  C C2    1 
ATOM   7516 N N3    . DA  C 3 32  ? -7.003  104.363 -12.763 1.00 53.49  ? 32   DA  C N3    1 
ATOM   7517 C C4    . DA  C 3 32  ? -6.876  104.199 -14.088 1.00 51.36  ? 32   DA  C C4    1 
ATOM   7518 P P     . DT  C 3 33  ? -13.381 106.005 -14.195 1.00 103.55 ? 33   DT  C P     1 
ATOM   7519 O OP1   . DT  C 3 33  ? -14.207 105.708 -12.988 1.00 87.92  ? 33   DT  C OP1   1 
ATOM   7520 O OP2   . DT  C 3 33  ? -14.022 106.030 -15.534 1.00 85.23  ? 33   DT  C OP2   1 
ATOM   7521 O "O5'" . DT  C 3 33  ? -12.649 107.412 -13.992 1.00 98.45  ? 33   DT  C "O5'" 1 
ATOM   7522 C "C5'" . DT  C 3 33  ? -11.241 107.467 -13.754 1.00 94.37  ? 33   DT  C "C5'" 1 
ATOM   7523 C "C4'" . DT  C 3 33  ? -10.954 107.675 -12.284 1.00 93.40  ? 33   DT  C "C4'" 1 
ATOM   7524 O "O4'" . DT  C 3 33  ? -9.627  107.179 -12.020 1.00 90.20  ? 33   DT  C "O4'" 1 
ATOM   7525 C "C3'" . DT  C 3 33  ? -10.932 109.134 -11.830 1.00 94.90  ? 33   DT  C "C3'" 1 
ATOM   7526 O "O3'" . DT  C 3 33  ? -11.223 109.213 -10.411 1.00 103.70 ? 33   DT  C "O3'" 1 
ATOM   7527 C "C2'" . DT  C 3 33  ? -9.507  109.541 -12.157 1.00 83.65  ? 33   DT  C "C2'" 1 
ATOM   7528 C "C1'" . DT  C 3 33  ? -8.731  108.264 -11.842 1.00 80.01  ? 33   DT  C "C1'" 1 
ATOM   7529 N N1    . DT  C 3 33  ? -7.589  108.013 -12.707 1.00 49.09  ? 33   DT  C N1    1 
ATOM   7530 C C2    . DT  C 3 33  ? -6.337  107.914 -12.151 1.00 43.87  ? 33   DT  C C2    1 
ATOM   7531 O O2    . DT  C 3 33  ? -6.112  108.017 -10.965 1.00 45.11  ? 33   DT  C O2    1 
ATOM   7532 N N3    . DT  C 3 33  ? -5.342  107.698 -13.030 1.00 39.13  ? 33   DT  C N3    1 
ATOM   7533 C C4    . DT  C 3 33  ? -5.440  107.580 -14.393 1.00 41.72  ? 33   DT  C C4    1 
ATOM   7534 O O4    . DT  C 3 33  ? -4.401  107.397 -15.091 1.00 39.96  ? 33   DT  C O4    1 
ATOM   7535 C C5    . DT  C 3 33  ? -6.788  107.679 -14.919 1.00 46.60  ? 33   DT  C C5    1 
ATOM   7536 C C7    . DT  C 3 33  ? -7.004  107.545 -16.393 1.00 46.99  ? 33   DT  C C7    1 
ATOM   7537 C C6    . DT  C 3 33  ? -7.785  107.884 -14.052 1.00 49.62  ? 33   DT  C C6    1 
ATOM   7538 P P     . DC  C 3 34  ? -11.170 110.640 -9.649  1.00 112.08 ? 34   DC  C P     1 
ATOM   7539 O OP1   . DC  C 3 34  ? -12.027 110.560 -8.434  1.00 99.54  ? 34   DC  C OP1   1 
ATOM   7540 O OP2   . DC  C 3 34  ? -11.408 111.704 -10.663 1.00 100.06 ? 34   DC  C OP2   1 
ATOM   7541 O "O5'" . DC  C 3 34  ? -9.654  110.776 -9.161  1.00 106.94 ? 34   DC  C "O5'" 1 
ATOM   7542 C "C5'" . DC  C 3 34  ? -9.122  109.897 -8.173  1.00 103.07 ? 34   DC  C "C5'" 1 
ATOM   7543 C "C4'" . DC  C 3 34  ? -7.718  110.311 -7.818  1.00 96.39  ? 34   DC  C "C4'" 1 
ATOM   7544 O "O4'" . DC  C 3 34  ? -6.846  110.052 -8.942  1.00 89.96  ? 34   DC  C "O4'" 1 
ATOM   7545 C "C3'" . DC  C 3 34  ? -7.551  111.785 -7.473  1.00 101.98 ? 34   DC  C "C3'" 1 
ATOM   7546 O "O3'" . DC  C 3 34  ? -6.731  111.872 -6.309  1.00 112.74 ? 34   DC  C "O3'" 1 
ATOM   7547 C "C2'" . DC  C 3 34  ? -6.893  112.377 -8.715  1.00 92.37  ? 34   DC  C "C2'" 1 
ATOM   7548 C "C1'" . DC  C 3 34  ? -6.094  111.210 -9.272  1.00 83.48  ? 34   DC  C "C1'" 1 
ATOM   7549 N N1    . DC  C 3 34  ? -5.897  111.209 -10.737 1.00 63.87  ? 34   DC  C N1    1 
ATOM   7550 C C2    . DC  C 3 34  ? -4.609  111.085 -11.245 1.00 58.56  ? 34   DC  C C2    1 
ATOM   7551 O O2    . DC  C 3 34  ? -3.671  110.979 -10.453 1.00 59.23  ? 34   DC  C O2    1 
ATOM   7552 N N3    . DC  C 3 34  ? -4.408  111.071 -12.583 1.00 54.84  ? 34   DC  C N3    1 
ATOM   7553 C C4    . DC  C 3 34  ? -5.441  111.150 -13.403 1.00 54.80  ? 34   DC  C C4    1 
ATOM   7554 N N4    . DC  C 3 34  ? -5.187  111.077 -14.714 1.00 53.80  ? 34   DC  C N4    1 
ATOM   7555 C C5    . DC  C 3 34  ? -6.782  111.291 -12.918 1.00 59.39  ? 34   DC  C C5    1 
ATOM   7556 C C6    . DC  C 3 34  ? -6.959  111.319 -11.587 1.00 63.65  ? 34   DC  C C6    1 
ATOM   7557 P P     . DT  C 3 35  ? -6.337  113.305 -5.695  1.00 138.77 ? 35   DT  C P     1 
ATOM   7558 O OP1   . DT  C 3 35  ? -6.771  113.323 -4.266  1.00 104.09 ? 35   DT  C OP1   1 
ATOM   7559 O OP2   . DT  C 3 35  ? -6.755  114.421 -6.605  1.00 91.60  ? 35   DT  C OP2   1 
ATOM   7560 O "O5'" . DT  C 3 35  ? -4.747  113.252 -5.715  1.00 132.81 ? 35   DT  C "O5'" 1 
ATOM   7561 C "C5'" . DT  C 3 35  ? -4.059  112.075 -6.112  1.00 129.70 ? 35   DT  C "C5'" 1 
ATOM   7562 C "C4'" . DT  C 3 35  ? -2.664  112.434 -6.554  1.00 127.15 ? 35   DT  C "C4'" 1 
ATOM   7563 O "O4'" . DT  C 3 35  ? -2.554  112.416 -7.990  1.00 119.96 ? 35   DT  C "O4'" 1 
ATOM   7564 C "C3'" . DT  C 3 35  ? -2.146  113.802 -6.092  1.00 129.59 ? 35   DT  C "C3'" 1 
ATOM   7565 O "O3'" . DT  C 3 35  ? -0.783  113.564 -5.704  1.00 142.71 ? 35   DT  C "O3'" 1 
ATOM   7566 C "C2'" . DT  C 3 35  ? -2.295  114.652 -7.348  1.00 121.59 ? 35   DT  C "C2'" 1 
ATOM   7567 C "C1'" . DT  C 3 35  ? -1.958  113.628 -8.414  1.00 109.24 ? 35   DT  C "C1'" 1 
ATOM   7568 N N1    . DT  C 3 35  ? -2.344  113.850 -9.823  1.00 57.60  ? 35   DT  C N1    1 
ATOM   7569 C C2    . DT  C 3 35  ? -1.310  113.628 -10.744 1.00 52.63  ? 35   DT  C C2    1 
ATOM   7570 O O2    . DT  C 3 35  ? -0.171  113.365 -10.393 1.00 54.37  ? 35   DT  C O2    1 
ATOM   7571 N N3    . DT  C 3 35  ? -1.652  113.741 -12.083 1.00 49.30  ? 35   DT  C N3    1 
ATOM   7572 C C4    . DT  C 3 35  ? -2.919  114.071 -12.593 1.00 51.33  ? 35   DT  C C4    1 
ATOM   7573 O O4    . DT  C 3 35  ? -3.109  114.124 -13.849 1.00 48.82  ? 35   DT  C O4    1 
ATOM   7574 C C5    . DT  C 3 35  ? -3.966  114.330 -11.551 1.00 50.38  ? 35   DT  C C5    1 
ATOM   7575 C C7    . DT  C 3 35  ? -5.335  114.695 -12.020 1.00 47.19  ? 35   DT  C C7    1 
ATOM   7576 C C6    . DT  C 3 35  ? -3.626  114.213 -10.239 1.00 50.93  ? 35   DT  C C6    1 
ATOM   7577 P P     . DA  C 3 36  ? 0.138   114.722 -5.070  1.00 160.95 ? 36   DA  C P     1 
ATOM   7578 O OP1   . DA  C 3 36  ? 0.933   114.095 -3.972  1.00 110.78 ? 36   DA  C OP1   1 
ATOM   7579 O OP2   . DA  C 3 36  ? -0.697  115.914 -4.775  1.00 116.48 ? 36   DA  C OP2   1 
ATOM   7580 O "O5'" . DA  C 3 36  ? 1.131   115.086 -6.270  1.00 156.45 ? 36   DA  C "O5'" 1 
ATOM   7581 C "C5'" . DA  C 3 36  ? 1.715   114.062 -7.081  1.00 151.98 ? 36   DA  C "C5'" 1 
ATOM   7582 C "C4'" . DA  C 3 36  ? 2.593   114.683 -8.141  1.00 149.09 ? 36   DA  C "C4'" 1 
ATOM   7583 O "O4'" . DA  C 3 36  ? 1.874   114.891 -9.378  1.00 143.86 ? 36   DA  C "O4'" 1 
ATOM   7584 C "C3'" . DA  C 3 36  ? 3.184   116.037 -7.736  1.00 146.31 ? 36   DA  C "C3'" 1 
ATOM   7585 O "O3'" . DA  C 3 36  ? 4.527   116.117 -8.215  1.00 154.22 ? 36   DA  C "O3'" 1 
ATOM   7586 C "C2'" . DA  C 3 36  ? 2.301   117.024 -8.468  1.00 136.23 ? 36   DA  C "C2'" 1 
ATOM   7587 C "C1'" . DA  C 3 36  ? 1.953   116.260 -9.743  1.00 127.62 ? 36   DA  C "C1'" 1 
ATOM   7588 N N9    . DA  C 3 36  ? 0.674   116.635 -10.335 1.00 64.10  ? 36   DA  C N9    1 
ATOM   7589 C C8    . DA  C 3 36  ? -0.431  117.154 -9.689  1.00 57.05  ? 36   DA  C C8    1 
ATOM   7590 N N7    . DA  C 3 36  ? -1.445  117.417 -10.486 1.00 52.58  ? 36   DA  C N7    1 
ATOM   7591 C C5    . DA  C 3 36  ? -0.986  117.031 -11.736 1.00 57.95  ? 36   DA  C C5    1 
ATOM   7592 C C6    . DA  C 3 36  ? -1.603  117.037 -13.025 1.00 59.18  ? 36   DA  C C6    1 
ATOM   7593 N N6    . DA  C 3 36  ? -2.879  117.432 -13.231 1.00 58.86  ? 36   DA  C N6    1 
ATOM   7594 N N1    . DA  C 3 36  ? -0.847  116.596 -14.093 1.00 58.54  ? 36   DA  C N1    1 
ATOM   7595 C C2    . DA  C 3 36  ? 0.428   116.154 -13.847 1.00 57.65  ? 36   DA  C C2    1 
ATOM   7596 N N3    . DA  C 3 36  ? 1.089   116.087 -12.670 1.00 57.07  ? 36   DA  C N3    1 
ATOM   7597 C C4    . DA  C 3 36  ? 0.328   116.547 -11.655 1.00 59.70  ? 36   DA  C C4    1 
ATOM   7598 P P     . DA  C 3 37  ? 5.656   116.839 -7.335  1.00 141.71 ? 37   DA  C P     1 
ATOM   7599 O OP1   . DA  C 3 37  ? 6.312   115.842 -6.457  1.00 118.83 ? 37   DA  C OP1   1 
ATOM   7600 O OP2   . DA  C 3 37  ? 5.025   118.035 -6.733  1.00 122.95 ? 37   DA  C OP2   1 
ATOM   7601 O "O5'" . DA  C 3 37  ? 6.724   117.279 -8.440  1.00 146.24 ? 37   DA  C "O5'" 1 
ATOM   7602 C "C5'" . DA  C 3 37  ? 7.393   116.302 -9.242  1.00 144.92 ? 37   DA  C "C5'" 1 
ATOM   7603 C "C4'" . DA  C 3 37  ? 7.404   116.714 -10.699 1.00 143.14 ? 37   DA  C "C4'" 1 
ATOM   7604 O "O4'" . DA  C 3 37  ? 6.051   116.845 -11.210 1.00 138.24 ? 37   DA  C "O4'" 1 
ATOM   7605 C "C3'" . DA  C 3 37  ? 8.111   118.028 -11.052 1.00 145.32 ? 37   DA  C "C3'" 1 
ATOM   7606 O "O3'" . DA  C 3 37  ? 8.875   117.817 -12.252 1.00 151.78 ? 37   DA  C "O3'" 1 
ATOM   7607 C "C2'" . DA  C 3 37  ? 6.952   118.980 -11.320 1.00 137.40 ? 37   DA  C "C2'" 1 
ATOM   7608 C "C1'" . DA  C 3 37  ? 5.969   118.038 -11.977 1.00 126.24 ? 37   DA  C "C1'" 1 
ATOM   7609 N N9    . DA  C 3 37  ? 4.576   118.475 -12.004 1.00 85.91  ? 37   DA  C N9    1 
ATOM   7610 C C8    . DA  C 3 37  ? 3.767   118.817 -10.941 1.00 82.58  ? 37   DA  C C8    1 
ATOM   7611 N N7    . DA  C 3 37  ? 2.546   119.161 -11.287 1.00 76.64  ? 37   DA  C N7    1 
ATOM   7612 C C5    . DA  C 3 37  ? 2.548   119.040 -12.675 1.00 75.79  ? 37   DA  C C5    1 
ATOM   7613 C C6    . DA  C 3 37  ? 1.541   119.268 -13.654 1.00 73.32  ? 37   DA  C C6    1 
ATOM   7614 N N6    . DA  C 3 37  ? 0.284   119.672 -13.350 1.00 63.67  ? 37   DA  C N6    1 
ATOM   7615 N N1    . DA  C 3 37  ? 1.877   119.060 -14.965 1.00 73.73  ? 37   DA  C N1    1 
ATOM   7616 C C2    . DA  C 3 37  ? 3.137   118.643 -15.256 1.00 74.62  ? 37   DA  C C2    1 
ATOM   7617 N N3    . DA  C 3 37  ? 4.166   118.395 -14.419 1.00 74.60  ? 37   DA  C N3    1 
ATOM   7618 C C4    . DA  C 3 37  ? 3.799   118.617 -13.132 1.00 76.97  ? 37   DA  C C4    1 
ATOM   7619 P P     . DC  C 3 38  ? 9.757   119.007 -12.858 1.00 182.58 ? 38   DC  C P     1 
ATOM   7620 O OP1   . DC  C 3 38  ? 11.079  118.978 -12.193 1.00 154.82 ? 38   DC  C OP1   1 
ATOM   7621 O OP2   . DC  C 3 38  ? 8.941   120.241 -12.826 1.00 141.82 ? 38   DC  C OP2   1 
ATOM   7622 O "O5'" . DC  C 3 38  ? 9.937   118.575 -14.388 1.00 182.58 ? 38   DC  C "O5'" 1 
ATOM   7623 C "C5'" . DC  C 3 38  ? 8.867   117.939 -15.078 1.00 182.58 ? 38   DC  C "C5'" 1 
ATOM   7624 C "C4'" . DC  C 3 38  ? 8.394   118.791 -16.242 1.00 180.07 ? 38   DC  C "C4'" 1 
ATOM   7625 O "O4'" . DC  C 3 38  ? 6.945   118.852 -16.236 1.00 169.35 ? 38   DC  C "O4'" 1 
ATOM   7626 C "C3'" . DC  C 3 38  ? 8.864   120.239 -16.208 1.00 180.57 ? 38   DC  C "C3'" 1 
ATOM   7627 O "O3'" . DC  C 3 38  ? 10.095  120.368 -16.907 1.00 182.58 ? 38   DC  C "O3'" 1 
ATOM   7628 C "C2'" . DC  C 3 38  ? 7.733   120.963 -16.930 1.00 174.27 ? 38   DC  C "C2'" 1 
ATOM   7629 C "C1'" . DC  C 3 38  ? 6.515   120.184 -16.445 1.00 162.29 ? 38   DC  C "C1'" 1 
ATOM   7630 N N1    . DC  C 3 38  ? 5.950   120.701 -15.167 1.00 101.39 ? 38   DC  C N1    1 
ATOM   7631 C C2    . DC  C 3 38  ? 4.740   121.403 -15.178 1.00 89.15  ? 38   DC  C C2    1 
ATOM   7632 O O2    . DC  C 3 38  ? 4.157   121.583 -16.254 1.00 89.30  ? 38   DC  C O2    1 
ATOM   7633 N N3    . DC  C 3 38  ? 4.240   121.867 -14.006 1.00 75.22  ? 38   DC  C N3    1 
ATOM   7634 C C4    . DC  C 3 38  ? 4.899   121.652 -12.866 1.00 72.51  ? 38   DC  C C4    1 
ATOM   7635 N N4    . DC  C 3 38  ? 4.367   122.129 -11.736 1.00 66.84  ? 38   DC  C N4    1 
ATOM   7636 C C5    . DC  C 3 38  ? 6.134   120.939 -12.835 1.00 78.65  ? 38   DC  C C5    1 
ATOM   7637 C C6    . DC  C 3 38  ? 6.617   120.487 -13.997 1.00 91.38  ? 38   DC  C C6    1 
HETATM 7638 O O     . HOH D 4 .   ? -4.723  81.601  1.870   1.00 49.20  ? 1    HOH A O     1 
HETATM 7639 O O     . HOH D 4 .   ? -9.604  24.356  10.659  1.00 36.79  ? 3    HOH A O     1 
HETATM 7640 O O     . HOH D 4 .   ? 1.021   26.365  -22.080 1.00 54.61  ? 4    HOH A O     1 
HETATM 7641 O O     . HOH D 4 .   ? 10.276  77.790  -28.143 1.00 49.55  ? 5    HOH A O     1 
HETATM 7642 O O     . HOH D 4 .   ? 30.299  26.084  -22.915 1.00 50.88  ? 6    HOH A O     1 
HETATM 7643 O O     . HOH D 4 .   ? -3.592  96.058  -6.316  1.00 45.28  ? 8    HOH A O     1 
HETATM 7644 O O     . HOH D 4 .   ? 6.923   13.545  -3.411  1.00 42.11  ? 10   HOH A O     1 
HETATM 7645 O O     . HOH D 4 .   ? -10.201 30.027  -26.063 1.00 42.32  ? 11   HOH A O     1 
HETATM 7646 O O     . HOH D 4 .   ? 1.668   61.813  -27.479 1.00 52.38  ? 12   HOH A O     1 
HETATM 7647 O O     . HOH D 4 .   ? -24.904 56.267  -14.773 1.00 48.76  ? 13   HOH A O     1 
HETATM 7648 O O     . HOH D 4 .   ? 13.130  71.812  4.804   1.00 37.61  ? 15   HOH A O     1 
HETATM 7649 O O     . HOH D 4 .   ? -1.743  27.744  -22.116 1.00 45.23  ? 17   HOH A O     1 
HETATM 7650 O O     . HOH D 4 .   ? -5.643  51.401  -28.312 1.00 49.70  ? 18   HOH A O     1 
HETATM 7651 O O     . HOH D 4 .   ? 4.669   33.802  -19.851 1.00 38.29  ? 19   HOH A O     1 
HETATM 7652 O O     . HOH D 4 .   ? 1.562   25.065  -19.512 1.00 51.68  ? 20   HOH A O     1 
HETATM 7653 O O     . HOH D 4 .   ? -0.254  44.675  -36.385 1.00 51.55  ? 21   HOH A O     1 
HETATM 7654 O O     . HOH D 4 .   ? -10.683 79.464  -7.692  1.00 36.49  ? 22   HOH A O     1 
HETATM 7655 O O     . HOH D 4 .   ? 12.006  6.751   6.453   1.00 36.49  ? 23   HOH A O     1 
HETATM 7656 O O     . HOH D 4 .   ? -12.825 101.552 3.544   1.00 36.49  ? 25   HOH A O     1 
HETATM 7657 O O     . HOH D 4 .   ? -3.026  11.702  -1.759  1.00 36.49  ? 27   HOH A O     1 
HETATM 7658 O O     . HOH D 4 .   ? 7.051   63.505  -40.268 1.00 36.49  ? 28   HOH A O     1 
HETATM 7659 O O     . HOH D 4 .   ? -25.714 46.883  -35.398 1.00 36.49  ? 29   HOH A O     1 
HETATM 7660 O O     . HOH D 4 .   ? -12.200 62.518  -32.711 1.00 36.49  ? 30   HOH A O     1 
HETATM 7661 O O     . HOH D 4 .   ? 7.799   56.166  -30.036 1.00 36.49  ? 32   HOH A O     1 
HETATM 7662 O O     . HOH D 4 .   ? 14.027  44.035  -26.116 1.00 36.49  ? 33   HOH A O     1 
HETATM 7663 O O     . HOH D 4 .   ? 4.782   21.869  -15.651 1.00 36.49  ? 34   HOH A O     1 
HETATM 7664 O O     . HOH D 4 .   ? 10.975  87.340  17.034  1.00 36.49  ? 35   HOH A O     1 
HETATM 7665 O O     . HOH D 4 .   ? -14.064 96.052  12.885  1.00 36.49  ? 36   HOH A O     1 
HETATM 7666 O O     . HOH D 4 .   ? -27.716 55.391  -17.867 1.00 36.49  ? 38   HOH A O     1 
HETATM 7667 O O     . HOH D 4 .   ? -2.624  55.696  -9.298  1.00 36.49  ? 39   HOH A O     1 
HETATM 7668 O O     . HOH D 4 .   ? 6.962   19.831  -30.931 1.00 36.49  ? 41   HOH A O     1 
HETATM 7669 O O     . HOH D 4 .   ? -13.960 38.671  -35.187 1.00 36.49  ? 42   HOH A O     1 
HETATM 7670 O O     . HOH D 4 .   ? -1.875  9.257   11.823  1.00 36.49  ? 45   HOH A O     1 
HETATM 7671 O O     . HOH D 4 .   ? 19.978  11.155  -3.779  1.00 36.49  ? 46   HOH A O     1 
HETATM 7672 O O     . HOH D 4 .   ? -20.002 75.139  -3.993  1.00 36.49  ? 47   HOH A O     1 
HETATM 7673 O O     . HOH D 4 .   ? -31.974 89.474  2.236   1.00 36.49  ? 48   HOH A O     1 
HETATM 7674 O O     . HOH D 4 .   ? 6.099   66.852  -31.036 1.00 36.49  ? 50   HOH A O     1 
HETATM 7675 O O     . HOH D 4 .   ? -25.767 48.673  6.929   1.00 36.49  ? 51   HOH A O     1 
HETATM 7676 O O     . HOH D 4 .   ? 28.565  62.680  -25.458 1.00 36.49  ? 52   HOH A O     1 
HETATM 7677 O O     . HOH D 4 .   ? -12.963 55.007  -26.435 1.00 36.49  ? 54   HOH A O     1 
HETATM 7678 O O     . HOH D 4 .   ? -30.022 56.522  -8.111  1.00 36.49  ? 55   HOH A O     1 
HETATM 7679 O O     . HOH D 4 .   ? -21.190 33.958  -16.569 1.00 36.49  ? 56   HOH A O     1 
HETATM 7680 O O     . HOH D 4 .   ? -6.966  2.946   14.727  1.00 36.49  ? 57   HOH A O     1 
HETATM 7681 O O     . HOH D 4 .   ? -3.506  78.357  -42.731 1.00 36.49  ? 59   HOH A O     1 
HETATM 7682 O O     . HOH D 4 .   ? 16.919  41.457  -14.006 1.00 36.49  ? 60   HOH A O     1 
HETATM 7683 O O     . HOH D 4 .   ? -0.723  87.425  16.095  1.00 36.49  ? 61   HOH A O     1 
HETATM 7684 O O     . HOH D 4 .   ? 2.993   96.390  -10.098 1.00 36.49  ? 62   HOH A O     1 
HETATM 7685 O O     . HOH D 4 .   ? 8.432   41.752  -28.292 1.00 36.49  ? 63   HOH A O     1 
HETATM 7686 O O     . HOH D 4 .   ? -0.466  39.108  -20.205 1.00 36.49  ? 64   HOH A O     1 
HETATM 7687 O O     . HOH D 4 .   ? 19.885  68.508  -28.981 1.00 36.49  ? 66   HOH A O     1 
HETATM 7688 O O     . HOH D 4 .   ? 23.123  62.703  -27.504 1.00 36.49  ? 67   HOH A O     1 
HETATM 7689 O O     . HOH D 4 .   ? -31.587 53.918  5.749   1.00 36.49  ? 68   HOH A O     1 
HETATM 7690 O O     . HOH D 4 .   ? -4.998  30.429  -22.833 1.00 36.49  ? 69   HOH A O     1 
HETATM 7691 O O     . HOH D 4 .   ? 21.966  33.394  -5.748  1.00 36.49  ? 70   HOH A O     1 
HETATM 7692 O O     . HOH D 4 .   ? -13.084 87.712  -12.499 1.00 36.49  ? 71   HOH A O     1 
HETATM 7693 O O     . HOH D 4 .   ? -15.080 57.927  2.607   1.00 36.49  ? 73   HOH A O     1 
HETATM 7694 O O     . HOH D 4 .   ? -25.352 42.366  -31.938 1.00 36.49  ? 75   HOH A O     1 
HETATM 7695 O O     . HOH D 4 .   ? 19.889  36.669  -30.268 1.00 36.49  ? 76   HOH A O     1 
HETATM 7696 O O     . HOH D 4 .   ? 5.092   19.295  -11.072 1.00 36.49  ? 78   HOH A O     1 
HETATM 7697 O O     . HOH D 4 .   ? 8.304   64.993  -14.243 1.00 36.49  ? 80   HOH A O     1 
HETATM 7698 O O     . HOH D 4 .   ? -21.932 52.499  -25.335 1.00 36.49  ? 81   HOH A O     1 
HETATM 7699 O O     . HOH D 4 .   ? -15.716 9.933   19.867  1.00 36.49  ? 82   HOH A O     1 
HETATM 7700 O O     . HOH D 4 .   ? 4.236   31.421  -21.307 1.00 36.49  ? 83   HOH A O     1 
HETATM 7701 O O     . HOH D 4 .   ? 11.259  88.961  -7.449  1.00 36.49  ? 84   HOH A O     1 
HETATM 7702 O O     . HOH D 4 .   ? -11.639 54.465  13.906  1.00 36.49  ? 85   HOH A O     1 
HETATM 7703 O O     . HOH D 4 .   ? 3.761   57.727  13.312  1.00 36.49  ? 87   HOH A O     1 
HETATM 7704 O O     . HOH D 4 .   ? 7.302   101.667 -4.256  1.00 36.49  ? 88   HOH A O     1 
HETATM 7705 O O     . HOH D 4 .   ? -8.092  88.523  16.802  1.00 36.49  ? 91   HOH A O     1 
HETATM 7706 O O     . HOH D 4 .   ? -16.096 98.556  -2.357  1.00 36.49  ? 92   HOH A O     1 
HETATM 7707 O O     . HOH D 4 .   ? -18.414 82.388  11.032  1.00 36.49  ? 93   HOH A O     1 
HETATM 7708 O O     . HOH D 4 .   ? 17.897  89.077  -3.354  1.00 36.49  ? 94   HOH A O     1 
HETATM 7709 O O     . HOH D 4 .   ? 19.231  73.952  -17.969 1.00 55.31  ? 95   HOH A O     1 
HETATM 7710 O O     . HOH D 4 .   ? 8.675   50.281  -5.364  1.00 50.22  ? 97   HOH A O     1 
HETATM 7711 O O     . HOH D 4 .   ? -33.854 38.747  -26.065 1.00 34.08  ? 98   HOH A O     1 
HETATM 7712 O O     . HOH D 4 .   ? 9.754   12.638  1.661   1.00 34.48  ? 101  HOH A O     1 
HETATM 7713 O O     . HOH D 4 .   ? 7.133   67.233  -12.848 1.00 34.48  ? 102  HOH A O     1 
HETATM 7714 O O     . HOH D 4 .   ? -0.790  58.760  -4.657  1.00 34.48  ? 1150 HOH A O     1 
HETATM 7715 O O     . HOH D 4 .   ? -9.031  89.864  -5.053  1.00 34.48  ? 1151 HOH A O     1 
HETATM 7716 O O     . HOH D 4 .   ? 15.021  72.008  -0.159  1.00 34.48  ? 1152 HOH A O     1 
HETATM 7717 O O     . HOH D 4 .   ? -0.197  62.805  -3.196  1.00 34.48  ? 1153 HOH A O     1 
HETATM 7718 O O     . HOH D 4 .   ? 15.762  31.902  -6.150  1.00 34.48  ? 1154 HOH A O     1 
HETATM 7719 O O     . HOH D 4 .   ? -8.785  46.190  -7.290  1.00 34.48  ? 1155 HOH A O     1 
HETATM 7720 O O     . HOH D 4 .   ? -24.378 52.008  -27.420 1.00 34.48  ? 1156 HOH A O     1 
HETATM 7721 O O     . HOH D 4 .   ? -30.967 91.236  -23.005 1.00 36.22  ? 1157 HOH A O     1 
HETATM 7722 O O     . HOH D 4 .   ? -2.554  69.411  -17.443 1.00 36.22  ? 1158 HOH A O     1 
HETATM 7723 O O     . HOH D 4 .   ? 18.179  75.785  -8.903  1.00 36.22  ? 1159 HOH A O     1 
HETATM 7724 O O     . HOH D 4 .   ? -3.857  66.808  -20.541 1.00 36.22  ? 1160 HOH A O     1 
HETATM 7725 O O     . HOH D 4 .   ? -36.469 43.621  -2.888  1.00 36.22  ? 1161 HOH A O     1 
HETATM 7726 O O     . HOH D 4 .   ? -18.668 76.333  -10.010 1.00 36.22  ? 1162 HOH A O     1 
HETATM 7727 O O     . HOH D 4 .   ? -8.360  74.664  -16.546 1.00 36.22  ? 1163 HOH A O     1 
HETATM 7728 O O     . HOH D 4 .   ? -31.238 48.676  -20.836 1.00 36.22  ? 1164 HOH A O     1 
HETATM 7729 O O     . HOH D 4 .   ? -26.930 46.994  4.777   1.00 36.22  ? 1165 HOH A O     1 
HETATM 7730 O O     . HOH D 4 .   ? 6.692   90.262  13.191  1.00 36.22  ? 1166 HOH A O     1 
HETATM 7731 O O     . HOH D 4 .   ? 14.871  93.796  12.880  1.00 36.22  ? 1167 HOH A O     1 
HETATM 7732 O O     . HOH D 4 .   ? 11.283  29.214  -37.724 1.00 36.22  ? 1168 HOH A O     1 
HETATM 7733 O O     . HOH D 4 .   ? 1.673   21.514  -3.798  1.00 36.22  ? 1169 HOH A O     1 
HETATM 7734 O O     . HOH D 4 .   ? 6.821   43.170  3.881   1.00 36.22  ? 1170 HOH A O     1 
HETATM 7735 O O     . HOH D 4 .   ? 3.847   64.994  -46.517 1.00 36.22  ? 1171 HOH A O     1 
HETATM 7736 O O     . HOH D 4 .   ? 18.436  88.395  3.215   1.00 36.22  ? 1172 HOH A O     1 
HETATM 7737 O O     . HOH D 4 .   ? -4.727  88.576  11.668  1.00 36.22  ? 1173 HOH A O     1 
HETATM 7738 O O     . HOH D 4 .   ? 27.921  101.478 -11.849 1.00 36.22  ? 1174 HOH A O     1 
HETATM 7739 O O     . HOH D 4 .   ? -20.043 56.155  5.834   1.00 36.22  ? 1175 HOH A O     1 
HETATM 7740 O O     . HOH D 4 .   ? 3.090   34.761  -16.571 1.00 36.22  ? 1176 HOH A O     1 
HETATM 7741 O O     . HOH D 4 .   ? 2.676   60.562  -29.343 1.00 36.22  ? 1177 HOH A O     1 
HETATM 7742 O O     . HOH D 4 .   ? -1.938  66.533  -15.590 1.00 36.22  ? 1178 HOH A O     1 
HETATM 7743 O O     . HOH D 4 .   ? -13.829 78.014  -12.677 1.00 36.22  ? 1179 HOH A O     1 
HETATM 7744 O O     . HOH D 4 .   ? 26.096  59.206  -7.353  1.00 36.22  ? 1180 HOH A O     1 
HETATM 7745 O O     . HOH D 4 .   ? 18.970  34.182  -35.585 1.00 36.22  ? 1181 HOH A O     1 
HETATM 7746 O O     . HOH D 4 .   ? -5.853  82.702  -6.385  1.00 36.22  ? 1182 HOH A O     1 
HETATM 7747 O O     . HOH D 4 .   ? 5.059   41.720  6.966   1.00 36.22  ? 1183 HOH A O     1 
HETATM 7748 O O     . HOH D 4 .   ? -18.086 28.024  -36.600 1.00 36.22  ? 1184 HOH A O     1 
HETATM 7749 O O     . HOH D 4 .   ? 6.980   57.069  -17.358 1.00 36.22  ? 1185 HOH A O     1 
HETATM 7750 O O     . HOH D 4 .   ? -18.757 25.290  -38.002 1.00 36.22  ? 1186 HOH A O     1 
HETATM 7751 O O     . HOH D 4 .   ? 10.786  93.387  13.624  1.00 35.60  ? 1187 HOH A O     1 
HETATM 7752 O O     . HOH D 4 .   ? -15.708 49.114  -18.259 1.00 35.60  ? 1188 HOH A O     1 
HETATM 7753 O O     . HOH D 4 .   ? -28.053 49.512  5.332   1.00 35.18  ? 1189 HOH A O     1 
HETATM 7754 O O     . HOH D 4 .   ? -6.860  48.254  -13.002 1.00 35.18  ? 1190 HOH A O     1 
HETATM 7755 O O     . HOH D 4 .   ? 14.034  96.544  -3.906  1.00 35.18  ? 1191 HOH A O     1 
HETATM 7756 O O     . HOH D 4 .   ? -1.910  65.709  -22.073 1.00 35.18  ? 1192 HOH A O     1 
HETATM 7757 O O     . HOH D 4 .   ? -4.578  70.635  -18.659 1.00 35.18  ? 1193 HOH A O     1 
HETATM 7758 O O     . HOH D 4 .   ? -1.003  67.247  -18.209 1.00 35.18  ? 1194 HOH A O     1 
HETATM 7759 O O     . HOH D 4 .   ? -6.204  75.602  -17.592 1.00 35.18  ? 1195 HOH A O     1 
HETATM 7760 O O     . HOH D 4 .   ? -10.027 40.196  -16.035 1.00 35.60  ? 1196 HOH A O     1 
HETATM 7761 O O     . HOH D 4 .   ? -12.518 78.289  -10.490 1.00 35.60  ? 1197 HOH A O     1 
HETATM 7762 O O     . HOH D 4 .   ? -30.840 91.762  -12.200 1.00 35.60  ? 1198 HOH A O     1 
HETATM 7763 O O     . HOH D 4 .   ? -10.563 75.725  -15.370 1.00 35.60  ? 1199 HOH A O     1 
HETATM 7764 O O     . HOH D 4 .   ? 1.271   66.119  -9.148  1.00 35.60  ? 1200 HOH A O     1 
HETATM 7765 O O     . HOH D 4 .   ? -19.458 86.285  6.332   1.00 35.60  ? 1201 HOH A O     1 
HETATM 7766 O O     . HOH D 4 .   ? 7.524   28.287  -14.802 1.00 35.60  ? 1202 HOH A O     1 
HETATM 7767 O O     . HOH D 4 .   ? 7.792   35.422  -19.706 1.00 35.60  ? 1203 HOH A O     1 
HETATM 7768 O O     . HOH D 4 .   ? 20.659  74.977  -8.683  1.00 35.60  ? 1204 HOH A O     1 
HETATM 7769 O O     . HOH D 4 .   ? -21.682 76.126  -7.887  1.00 35.60  ? 1205 HOH A O     1 
HETATM 7770 O O     . HOH D 4 .   ? 7.184   71.368  -17.689 1.00 35.60  ? 1206 HOH A O     1 
HETATM 7771 O O     . HOH D 4 .   ? 0.881   28.266  -17.259 1.00 35.60  ? 1207 HOH A O     1 
HETATM 7772 O O     . HOH D 4 .   ? 2.008   95.862  -3.669  1.00 35.60  ? 1208 HOH A O     1 
HETATM 7773 O O     . HOH D 4 .   ? -17.323 71.109  -35.800 1.00 35.60  ? 1209 HOH A O     1 
HETATM 7774 O O     . HOH D 4 .   ? 0.045   36.954  -23.045 1.00 35.60  ? 1210 HOH A O     1 
HETATM 7775 O O     . HOH D 4 .   ? -5.137  58.819  12.460  1.00 35.60  ? 1211 HOH A O     1 
HETATM 7776 O O     . HOH D 4 .   ? -0.814  71.299  -19.382 1.00 35.60  ? 1212 HOH A O     1 
HETATM 7777 O O     . HOH D 4 .   ? 18.075  54.358  -14.429 1.00 35.60  ? 1213 HOH A O     1 
HETATM 7778 O O     . HOH D 4 .   ? 16.378  35.209  -39.548 1.00 35.60  ? 1214 HOH A O     1 
HETATM 7779 O O     . HOH D 4 .   ? -25.563 84.401  -20.670 1.00 35.60  ? 1215 HOH A O     1 
HETATM 7780 O O     . HOH D 4 .   ? -9.329  45.711  -12.686 1.00 35.60  ? 1216 HOH A O     1 
HETATM 7781 O O     . HOH D 4 .   ? -15.039 81.118  3.522   1.00 35.60  ? 1217 HOH A O     1 
HETATM 7782 O O     . HOH D 4 .   ? -4.994  67.179  -23.282 1.00 35.60  ? 1218 HOH A O     1 
HETATM 7783 O O     . HOH D 4 .   ? -6.691  39.875  -23.778 1.00 35.60  ? 1219 HOH A O     1 
HETATM 7784 O O     . HOH D 4 .   ? -1.100  67.275  -24.649 1.00 35.60  ? 1220 HOH A O     1 
HETATM 7785 O O     . HOH D 4 .   ? 0.776   74.451  -47.060 1.00 35.60  ? 1221 HOH A O     1 
HETATM 7786 O O     . HOH D 4 .   ? 32.753  29.813  -20.910 1.00 34.26  ? 1222 HOH A O     1 
HETATM 7787 O O     . HOH D 4 .   ? 34.129  27.436  -25.268 1.00 34.26  ? 1223 HOH A O     1 
HETATM 7788 O O     . HOH D 4 .   ? -5.819  68.505  -20.466 1.00 34.26  ? 1224 HOH A O     1 
HETATM 7789 O O     . HOH D 4 .   ? -6.797  53.591  -24.083 1.00 34.26  ? 1225 HOH A O     1 
HETATM 7790 O O     . HOH D 4 .   ? -4.485  52.189  -25.375 1.00 34.26  ? 1226 HOH A O     1 
HETATM 7791 O O     . HOH D 4 .   ? -1.771  51.739  -25.606 1.00 34.26  ? 1227 HOH A O     1 
HETATM 7792 O O     . HOH D 4 .   ? -33.164 90.835  -11.182 1.00 47.75  ? 1228 HOH A O     1 
HETATM 7793 O O     . HOH D 4 .   ? -19.406 73.944  -1.147  1.00 48.15  ? 1229 HOH A O     1 
HETATM 7794 O O     . HOH D 4 .   ? 10.023  56.241  -16.265 1.00 48.03  ? 1230 HOH A O     1 
HETATM 7795 O O     . HOH D 4 .   ? 16.852  35.293  -32.472 1.00 31.77  ? 1231 HOH A O     1 
HETATM 7796 O O     . HOH D 4 .   ? -5.421  64.769  -20.772 1.00 34.48  ? 1232 HOH A O     1 
HETATM 7797 O O     . HOH E 4 .   ? 4.486   78.229  -11.767 1.00 49.31  ? 32   HOH B O     1 
HETATM 7798 O O     . HOH E 4 .   ? 0.789   99.493  -11.309 1.00 43.54  ? 33   HOH B O     1 
HETATM 7799 O O     . HOH E 4 .   ? 0.395   96.331  -11.568 1.00 45.68  ? 34   HOH B O     1 
HETATM 7800 O O     . HOH E 4 .   ? -3.013  10.404  -26.824 1.00 49.07  ? 35   HOH B O     1 
HETATM 7801 O O     . HOH E 4 .   ? 5.490   7.041   -19.426 1.00 36.49  ? 65   HOH B O     1 
HETATM 7802 O O     . HOH E 4 .   ? 3.957   112.512 -14.441 1.00 36.49  ? 72   HOH B O     1 
HETATM 7803 O O     . HOH E 4 .   ? -12.404 86.155  -19.502 1.00 36.49  ? 79   HOH B O     1 
HETATM 7804 O O     . HOH E 4 .   ? -11.048 21.750  -13.894 1.00 36.49  ? 89   HOH B O     1 
HETATM 7805 O O     . HOH E 4 .   ? -2.243  72.195  -17.530 1.00 34.48  ? 99   HOH B O     1 
HETATM 7806 O O     . HOH E 4 .   ? 8.168   7.094   -19.328 1.00 34.48  ? 100  HOH B O     1 
HETATM 7807 O O     . HOH E 4 .   ? -6.122  26.376  0.092   1.00 36.22  ? 129  HOH B O     1 
HETATM 7808 O O     . HOH E 4 .   ? -11.166 57.966  -17.476 1.00 36.22  ? 140  HOH B O     1 
HETATM 7809 O O     . HOH E 4 .   ? -8.571  94.491  -19.282 1.00 36.22  ? 151  HOH B O     1 
HETATM 7810 O O     . HOH E 4 .   ? -3.344  76.541  -17.559 1.00 35.60  ? 165  HOH B O     1 
HETATM 7811 O O     . HOH E 4 .   ? 2.128   112.318 -12.531 1.00 35.60  ? 170  HOH B O     1 
HETATM 7812 O O     . HOH E 4 .   ? -1.812  24.527  -10.754 1.00 35.60  ? 178  HOH B O     1 
HETATM 7813 O O     . HOH E 4 .   ? -7.105  95.612  -17.518 1.00 35.60  ? 183  HOH B O     1 
HETATM 7814 O O     . HOH E 4 .   ? -9.914  20.132  -16.407 1.00 35.60  ? 185  HOH B O     1 
HETATM 7815 O O     . HOH E 4 .   ? 3.162   12.677  -31.131 1.00 34.26  ? 205  HOH B O     1 
HETATM 7816 O O     . HOH E 4 .   ? 2.822   12.980  -27.333 1.00 34.26  ? 206  HOH B O     1 
HETATM 7817 O O     . HOH E 4 .   ? -6.752  12.920  -28.486 1.00 34.26  ? 207  HOH B O     1 
HETATM 7818 O O     . HOH E 4 .   ? -3.250  14.452  -25.600 1.00 34.26  ? 208  HOH B O     1 
HETATM 7819 O O     . HOH E 4 .   ? -13.817 22.057  -12.369 1.00 53.44  ? 215  HOH B O     1 
HETATM 7820 O O     . HOH F 4 .   ? -8.826  68.757  -20.575 1.00 49.67  ? 39   HOH C O     1 
HETATM 7821 O O     . HOH F 4 .   ? 5.891   94.556  -16.490 1.00 36.49  ? 40   HOH C O     1 
HETATM 7822 O O     . HOH F 4 .   ? 10.844  116.132 -16.246 1.00 36.49  ? 41   HOH C O     1 
HETATM 7823 O O     . HOH F 4 .   ? -13.114 75.664  -5.692  1.00 36.49  ? 42   HOH C O     1 
HETATM 7824 O O     . HOH F 4 .   ? 4.125   113.174 -7.297  1.00 36.49  ? 43   HOH C O     1 
HETATM 7825 O O     . HOH F 4 .   ? 3.041   92.659  -13.497 1.00 36.49  ? 44   HOH C O     1 
HETATM 7826 O O     . HOH F 4 .   ? 3.557   114.418 -2.518  1.00 36.49  ? 45   HOH C O     1 
HETATM 7827 O O     . HOH F 4 .   ? -15.124 104.388 -11.241 1.00 36.49  ? 46   HOH C O     1 
HETATM 7828 O O     . HOH F 4 .   ? 4.079   44.343  -14.601 1.00 36.49  ? 49   HOH C O     1 
HETATM 7829 O O     . HOH F 4 .   ? -9.796  105.402 -20.120 1.00 36.49  ? 53   HOH C O     1 
HETATM 7830 O O     . HOH F 4 .   ? 1.070   99.674  -25.608 1.00 36.49  ? 58   HOH C O     1 
HETATM 7831 O O     . HOH F 4 .   ? 1.806   85.257  -4.262  1.00 36.49  ? 74   HOH C O     1 
HETATM 7832 O O     . HOH F 4 .   ? -6.130  110.550 -2.853  1.00 36.49  ? 77   HOH C O     1 
HETATM 7833 O O     . HOH F 4 .   ? -4.473  48.589  -10.016 1.00 36.49  ? 86   HOH C O     1 
HETATM 7834 O O     . HOH F 4 .   ? -11.557 101.266 -22.212 1.00 36.49  ? 90   HOH C O     1 
HETATM 7835 O O     . HOH F 4 .   ? 5.793   96.585  -14.222 1.00 54.68  ? 96   HOH C O     1 
HETATM 7836 O O     . HOH F 4 .   ? -6.515  75.446  -14.787 1.00 34.48  ? 104  HOH C O     1 
HETATM 7837 O O     . HOH F 4 .   ? -6.609  45.478  -12.291 1.00 34.48  ? 105  HOH C O     1 
HETATM 7838 O O     . HOH F 4 .   ? -3.772  66.593  -17.359 1.00 34.48  ? 111  HOH C O     1 
HETATM 7839 O O     . HOH F 4 .   ? 1.130   47.945  -7.169  1.00 53.55  ? 114  HOH C O     1 
HETATM 7840 O O     . HOH F 4 .   ? -1.826  51.781  -10.552 1.00 36.22  ? 116  HOH C O     1 
HETATM 7841 O O     . HOH F 4 .   ? -7.343  45.718  -9.787  1.00 36.22  ? 127  HOH C O     1 
HETATM 7842 O O     . HOH F 4 .   ? -4.295  73.644  -17.108 1.00 36.22  ? 128  HOH C O     1 
HETATM 7843 O O     . HOH F 4 .   ? 3.254   115.256 -11.741 1.00 36.22  ? 133  HOH C O     1 
HETATM 7844 O O     . HOH F 4 .   ? 4.680   96.491  -16.809 1.00 36.22  ? 146  HOH C O     1 
HETATM 7845 O O     . HOH F 4 .   ? -0.880  56.524  -12.362 1.00 35.18  ? 162  HOH C O     1 
HETATM 7846 O O     . HOH F 4 .   ? -10.750 76.669  -12.824 1.00 35.18  ? 164  HOH C O     1 
HETATM 7847 O O     . HOH F 4 .   ? -4.716  46.416  -9.571  1.00 35.60  ? 167  HOH C O     1 
HETATM 7848 O O     . HOH F 4 .   ? -3.872  64.375  -18.075 1.00 35.60  ? 179  HOH C O     1 
HETATM 7849 O O     . HOH F 4 .   ? -2.961  82.533  -7.218  1.00 35.60  ? 181  HOH C O     1 
HETATM 7850 O O     . HOH F 4 .   ? -7.177  38.597  -13.695 1.00 35.60  ? 189  HOH C O     1 
HETATM 7851 O O     . HOH F 4 .   ? 5.582   99.842  -17.881 1.00 34.26  ? 202  HOH C O     1 
HETATM 7852 O O     . HOH F 4 .   ? 8.024   95.734  -17.747 1.00 34.26  ? 203  HOH C O     1 
HETATM 7853 O O     . HOH F 4 .   ? -1.352  53.826  -12.024 1.00 31.50  ? 217  HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    MET 1    103  ?    ?   ?   A . n 
A 1 2    ALA 2    104  ?    ?   ?   A . n 
A 1 3    SER 3    105  ?    ?   ?   A . n 
A 1 4    SER 4    106  ?    ?   ?   A . n 
A 1 5    HIS 5    107  ?    ?   ?   A . n 
A 1 6    HIS 6    108  ?    ?   ?   A . n 
A 1 7    HIS 7    109  ?    ?   ?   A . n 
A 1 8    HIS 8    110  ?    ?   ?   A . n 
A 1 9    HIS 9    111  ?    ?   ?   A . n 
A 1 10   HIS 10   112  ?    ?   ?   A . n 
A 1 11   SER 11   113  ?    ?   ?   A . n 
A 1 12   SER 12   114  ?    ?   ?   A . n 
A 1 13   GLY 13   115  ?    ?   ?   A . n 
A 1 14   LEU 14   116  ?    ?   ?   A . n 
A 1 15   VAL 15   117  ?    ?   ?   A . n 
A 1 16   PRO 16   118  ?    ?   ?   A . n 
A 1 17   ARG 17   119  ?    ?   ?   A . n 
A 1 18   GLY 18   120  ?    ?   ?   A . n 
A 1 19   SER 19   121  ?    ?   ?   A . n 
A 1 20   SER 20   122  ?    ?   ?   A . n 
A 1 21   GLY 21   123  ?    ?   ?   A . n 
A 1 22   SER 22   124  ?    ?   ?   A . n 
A 1 23   SER 23   125  ?    ?   ?   A . n 
A 1 24   MET 24   126  ?    ?   ?   A . n 
A 1 25   ALA 25   127  ?    ?   ?   A . n 
A 1 26   ALA 26   128  ?    ?   ?   A . n 
A 1 27   ARG 27   129  ?    ?   ?   A . n 
A 1 28   PRO 28   130  ?    ?   ?   A . n 
A 1 29   PRO 29   131  ?    ?   ?   A . n 
A 1 30   ARG 30   132  ?    ?   ?   A . n 
A 1 31   ALA 31   133  ?    ?   ?   A . n 
A 1 32   LYS 32   134  ?    ?   ?   A . n 
A 1 33   PRO 33   135  ?    ?   ?   A . n 
A 1 34   ALA 34   136  ?    ?   ?   A . n 
A 1 35   PRO 35   137  ?    ?   ?   A . n 
A 1 36   ARG 36   138  ?    ?   ?   A . n 
A 1 37   ARG 37   139  ?    ?   ?   A . n 
A 1 38   ARG 38   140  ?    ?   ?   A . n 
A 1 39   ALA 39   141  ?    ?   ?   A . n 
A 1 40   ALA 40   142  ?    ?   ?   A . n 
A 1 41   GLN 41   143  ?    ?   ?   A . n 
A 1 42   PRO 42   144  ?    ?   ?   A . n 
A 1 43   SER 43   145  ?    ?   ?   A . n 
A 1 44   ASP 44   146  ?    ?   ?   A . n 
A 1 45   ALA 45   147  ?    ?   ?   A . n 
A 1 46   SER 46   148  ?    ?   ?   A . n 
A 1 47   PRO 47   149  ?    ?   ?   A . n 
A 1 48   ALA 48   150  ?    ?   ?   A . n 
A 1 49   ALA 49   151  ?    ?   ?   A . n 
A 1 50   GLN 50   152  ?    ?   ?   A . n 
A 1 51   VAL 51   153  ?    ?   ?   A . n 
A 1 52   ASP 52   154  ?    ?   ?   A . n 
A 1 53   LEU 53   155  ?    ?   ?   A . n 
A 1 54   ARG 54   156  ?    ?   ?   A . n 
A 1 55   THR 55   157  ?    ?   ?   A . n 
A 1 56   LEU 56   158  ?    ?   ?   A . n 
A 1 57   GLY 57   159  ?    ?   ?   A . n 
A 1 58   TYR 58   160  ?    ?   ?   A . n 
A 1 59   SER 59   161  ?    ?   ?   A . n 
A 1 60   GLN 60   162  ?    ?   ?   A . n 
A 1 61   GLN 61   163  ?    ?   ?   A . n 
A 1 62   GLN 62   164  ?    ?   ?   A . n 
A 1 63   GLN 63   165  ?    ?   ?   A . n 
A 1 64   GLU 64   166  ?    ?   ?   A . n 
A 1 65   LYS 65   167  ?    ?   ?   A . n 
A 1 66   ILE 66   168  ?    ?   ?   A . n 
A 1 67   LYS 67   169  169  LYS LYS A . n 
A 1 68   PRO 68   170  170  PRO PRO A . n 
A 1 69   LYS 69   171  171  LYS LYS A . n 
A 1 70   VAL 70   172  172  VAL VAL A . n 
A 1 71   ARG 71   173  173  ARG ARG A . n 
A 1 72   SER 72   174  ?    ?   ?   A . n 
A 1 73   THR 73   175  ?    ?   ?   A . n 
A 1 74   VAL 74   176  ?    ?   ?   A . n 
A 1 75   ALA 75   177  ?    ?   ?   A . n 
A 1 76   GLN 76   178  ?    ?   ?   A . n 
A 1 77   HIS 77   179  ?    ?   ?   A . n 
A 1 78   HIS 78   180  ?    ?   ?   A . n 
A 1 79   GLU 79   181  181  GLU GLU A . n 
A 1 80   ALA 80   182  ?    ?   ?   A . n 
A 1 81   LEU 81   183  183  LEU LEU A . n 
A 1 82   VAL 82   184  184  VAL VAL A . n 
A 1 83   GLY 83   185  ?    ?   ?   A . n 
A 1 84   HIS 84   186  ?    ?   ?   A . n 
A 1 85   GLY 85   187  ?    ?   ?   A . n 
A 1 86   PHE 86   188  ?    ?   ?   A . n 
A 1 87   THR 87   189  ?    ?   ?   A . n 
A 1 88   HIS 88   190  ?    ?   ?   A . n 
A 1 89   ALA 89   191  191  ALA ALA A . n 
A 1 90   HIS 90   192  192  HIS HIS A . n 
A 1 91   ILE 91   193  193  ILE ILE A . n 
A 1 92   VAL 92   194  194  VAL VAL A . n 
A 1 93   ALA 93   195  195  ALA ALA A . n 
A 1 94   LEU 94   196  196  LEU LEU A . n 
A 1 95   SER 95   197  197  SER SER A . n 
A 1 96   GLN 96   198  198  GLN GLN A . n 
A 1 97   HIS 97   199  199  HIS HIS A . n 
A 1 98   PRO 98   200  200  PRO PRO A . n 
A 1 99   ALA 99   201  201  ALA ALA A . n 
A 1 100  ALA 100  202  202  ALA ALA A . n 
A 1 101  LEU 101  203  203  LEU LEU A . n 
A 1 102  GLY 102  204  204  GLY GLY A . n 
A 1 103  THR 103  205  205  THR THR A . n 
A 1 104  VAL 104  206  206  VAL VAL A . n 
A 1 105  ALA 105  207  207  ALA ALA A . n 
A 1 106  VAL 106  208  208  VAL VAL A . n 
A 1 107  THR 107  209  209  THR THR A . n 
A 1 108  TYR 108  210  210  TYR TYR A . n 
A 1 109  GLN 109  211  211  GLN GLN A . n 
A 1 110  HIS 110  212  212  HIS HIS A . n 
A 1 111  ILE 111  213  213  ILE ILE A . n 
A 1 112  ILE 112  214  214  ILE ILE A . n 
A 1 113  THR 113  215  215  THR THR A . n 
A 1 114  ALA 114  216  216  ALA ALA A . n 
A 1 115  LEU 115  217  217  LEU LEU A . n 
A 1 116  PRO 116  218  ?    ?   ?   A . n 
A 1 117  GLU 117  219  ?    ?   ?   A . n 
A 1 118  ALA 118  220  220  ALA ALA A . n 
A 1 119  THR 119  221  221  THR THR A . n 
A 1 120  HIS 120  222  222  HIS HIS A . n 
A 1 121  GLU 121  223  223  GLU GLU A . n 
A 1 122  ASP 122  224  224  ASP ASP A . n 
A 1 123  ILE 123  225  225  ILE ILE A . n 
A 1 124  VAL 124  226  226  VAL VAL A . n 
A 1 125  GLY 125  227  227  GLY GLY A . n 
A 1 126  VAL 126  228  228  VAL VAL A . n 
A 1 127  GLY 127  229  229  GLY GLY A . n 
A 1 128  LYS 128  230  230  LYS LYS A . n 
A 1 129  GLN 129  231  231  GLN GLN A . n 
A 1 130  TRP 130  232  232  TRP TRP A . n 
A 1 131  SER 131  233  233  SER SER A . n 
A 1 132  GLY 132  234  234  GLY GLY A . n 
A 1 133  ALA 133  235  235  ALA ALA A . n 
A 1 134  ARG 134  236  236  ARG ARG A . n 
A 1 135  ALA 135  237  237  ALA ALA A . n 
A 1 136  LEU 136  238  238  LEU LEU A . n 
A 1 137  GLU 137  239  239  GLU GLU A . n 
A 1 138  ALA 138  240  240  ALA ALA A . n 
A 1 139  LEU 139  241  241  LEU LEU A . n 
A 1 140  LEU 140  242  242  LEU LEU A . n 
A 1 141  THR 141  243  243  THR THR A . n 
A 1 142  ASP 142  244  244  ASP ASP A . n 
A 1 143  ALA 143  245  245  ALA ALA A . n 
A 1 144  GLY 144  246  246  GLY GLY A . n 
A 1 145  GLU 145  247  247  GLU GLU A . n 
A 1 146  LEU 146  248  248  LEU LEU A . n 
A 1 147  ARG 147  249  249  ARG ARG A . n 
A 1 148  GLY 148  250  250  GLY GLY A . n 
A 1 149  PRO 149  251  251  PRO PRO A . n 
A 1 150  PRO 150  252  252  PRO PRO A . n 
A 1 151  LEU 151  253  253  LEU LEU A . n 
A 1 152  GLN 152  254  254  GLN GLN A . n 
A 1 153  LEU 153  255  255  LEU LEU A . n 
A 1 154  ASP 154  256  256  ASP ASP A . n 
A 1 155  THR 155  257  257  THR THR A . n 
A 1 156  GLY 156  258  258  GLY GLY A . n 
A 1 157  GLN 157  259  259  GLN GLN A . n 
A 1 158  LEU 158  260  260  LEU LEU A . n 
A 1 159  VAL 159  261  261  VAL VAL A . n 
A 1 160  LYS 160  262  262  LYS LYS A . n 
A 1 161  ILE 161  263  263  ILE ILE A . n 
A 1 162  ALA 162  264  264  ALA ALA A . n 
A 1 163  LYS 163  265  265  LYS LYS A . n 
A 1 164  ARG 164  266  266  ARG ARG A . n 
A 1 165  GLY 165  267  267  GLY GLY A . n 
A 1 166  GLY 166  268  268  GLY GLY A . n 
A 1 167  VAL 167  269  269  VAL VAL A . n 
A 1 168  THR 168  270  270  THR THR A . n 
A 1 169  ALA 169  271  271  ALA ALA A . n 
A 1 170  MET 170  272  272  MET MET A . n 
A 1 171  GLU 171  273  273  GLU GLU A . n 
A 1 172  ALA 172  274  274  ALA ALA A . n 
A 1 173  VAL 173  275  275  VAL VAL A . n 
A 1 174  HIS 174  276  276  HIS HIS A . n 
A 1 175  ALA 175  277  277  ALA ALA A . n 
A 1 176  SER 176  278  278  SER SER A . n 
A 1 177  ARG 177  279  279  ARG ARG A . n 
A 1 178  ASN 178  280  280  ASN ASN A . n 
A 1 179  ALA 179  281  281  ALA ALA A . n 
A 1 180  LEU 180  282  282  LEU LEU A . n 
A 1 181  THR 181  283  283  THR THR A . n 
A 1 182  GLY 182  284  ?    ?   ?   A . n 
A 1 183  ALA 183  285  ?    ?   ?   A . n 
A 1 184  PRO 184  286  286  PRO PRO A . n 
A 1 185  LEU 185  287  287  LEU LEU A . n 
A 1 186  ASN 186  288  288  ASN ASN A . n 
A 1 187  LEU 187  289  289  LEU LEU A . n 
A 1 188  THR 188  290  290  THR THR A . n 
A 1 189  PRO 189  291  291  PRO PRO A . n 
A 1 190  ALA 190  292  292  ALA ALA A . n 
A 1 191  GLN 191  293  293  GLN GLN A . n 
A 1 192  VAL 192  294  294  VAL VAL A . n 
A 1 193  VAL 193  295  295  VAL VAL A . n 
A 1 194  ALA 194  296  296  ALA ALA A . n 
A 1 195  ILE 195  297  297  ILE ILE A . n 
A 1 196  ALA 196  298  298  ALA ALA A . n 
A 1 197  SER 197  299  299  SER SER A . n 
A 1 198  ASN 198  300  300  ASN ASN A . n 
A 1 199  ASN 199  301  301  ASN ASN A . n 
A 1 200  GLY 200  302  302  GLY GLY A . n 
A 1 201  GLY 201  303  303  GLY GLY A . n 
A 1 202  LYS 202  304  304  LYS LYS A . n 
A 1 203  GLN 203  305  305  GLN GLN A . n 
A 1 204  ALA 204  306  306  ALA ALA A . n 
A 1 205  LEU 205  307  307  LEU LEU A . n 
A 1 206  GLU 206  308  308  GLU GLU A . n 
A 1 207  THR 207  309  309  THR THR A . n 
A 1 208  VAL 208  310  310  VAL VAL A . n 
A 1 209  GLN 209  311  311  GLN GLN A . n 
A 1 210  ARG 210  312  312  ARG ARG A . n 
A 1 211  LEU 211  313  313  LEU LEU A . n 
A 1 212  LEU 212  314  314  LEU LEU A . n 
A 1 213  PRO 213  315  315  PRO PRO A . n 
A 1 214  VAL 214  316  316  VAL VAL A . n 
A 1 215  LEU 215  317  317  LEU LEU A . n 
A 1 216  CYS 216  318  318  CYS CYS A . n 
A 1 217  GLN 217  319  319  GLN GLN A . n 
A 1 218  ALA 218  320  320  ALA ALA A . n 
A 1 219  HIS 219  321  321  HIS HIS A . n 
A 1 220  GLY 220  322  322  GLY GLY A . n 
A 1 221  LEU 221  323  323  LEU LEU A . n 
A 1 222  THR 222  324  324  THR THR A . n 
A 1 223  PRO 223  325  325  PRO PRO A . n 
A 1 224  ALA 224  326  326  ALA ALA A . n 
A 1 225  GLN 225  327  327  GLN GLN A . n 
A 1 226  VAL 226  328  328  VAL VAL A . n 
A 1 227  VAL 227  329  329  VAL VAL A . n 
A 1 228  ALA 228  330  330  ALA ALA A . n 
A 1 229  ILE 229  331  331  ILE ILE A . n 
A 1 230  ALA 230  332  332  ALA ALA A . n 
A 1 231  SER 231  333  333  SER SER A . n 
A 1 232  HIS 232  334  334  HIS HIS A . n 
A 1 233  ASP 233  335  335  ASP ASP A . n 
A 1 234  GLY 234  336  336  GLY GLY A . n 
A 1 235  GLY 235  337  337  GLY GLY A . n 
A 1 236  LYS 236  338  338  LYS LYS A . n 
A 1 237  GLN 237  339  339  GLN GLN A . n 
A 1 238  ALA 238  340  340  ALA ALA A . n 
A 1 239  LEU 239  341  341  LEU LEU A . n 
A 1 240  GLU 240  342  342  GLU GLU A . n 
A 1 241  THR 241  343  343  THR THR A . n 
A 1 242  MET 242  344  344  MET MET A . n 
A 1 243  GLN 243  345  345  GLN GLN A . n 
A 1 244  ARG 244  346  346  ARG ARG A . n 
A 1 245  LEU 245  347  347  LEU LEU A . n 
A 1 246  LEU 246  348  348  LEU LEU A . n 
A 1 247  PRO 247  349  349  PRO PRO A . n 
A 1 248  VAL 248  350  350  VAL VAL A . n 
A 1 249  LEU 249  351  351  LEU LEU A . n 
A 1 250  CYS 250  352  352  CYS CYS A . n 
A 1 251  GLN 251  353  353  GLN GLN A . n 
A 1 252  ALA 252  354  354  ALA ALA A . n 
A 1 253  HIS 253  355  355  HIS HIS A . n 
A 1 254  GLY 254  356  356  GLY GLY A . n 
A 1 255  LEU 255  357  357  LEU LEU A . n 
A 1 256  PRO 256  358  358  PRO PRO A . n 
A 1 257  PRO 257  359  359  PRO PRO A . n 
A 1 258  ASP 258  360  360  ASP ASP A . n 
A 1 259  GLN 259  361  361  GLN GLN A . n 
A 1 260  VAL 260  362  362  VAL VAL A . n 
A 1 261  VAL 261  363  363  VAL VAL A . n 
A 1 262  ALA 262  364  364  ALA ALA A . n 
A 1 263  ILE 263  365  365  ILE ILE A . n 
A 1 264  ALA 264  366  366  ALA ALA A . n 
A 1 265  SER 265  367  367  SER SER A . n 
A 1 266  ASN 266  368  368  ASN ASN A . n 
A 1 267  ILE 267  369  369  ILE ILE A . n 
A 1 268  GLY 268  370  370  GLY GLY A . n 
A 1 269  GLY 269  371  371  GLY GLY A . n 
A 1 270  LYS 270  372  372  LYS LYS A . n 
A 1 271  GLN 271  373  373  GLN GLN A . n 
A 1 272  ALA 272  374  374  ALA ALA A . n 
A 1 273  LEU 273  375  375  LEU LEU A . n 
A 1 274  GLU 274  376  376  GLU GLU A . n 
A 1 275  THR 275  377  377  THR THR A . n 
A 1 276  VAL 276  378  378  VAL VAL A . n 
A 1 277  GLN 277  379  379  GLN GLN A . n 
A 1 278  ARG 278  380  380  ARG ARG A . n 
A 1 279  LEU 279  381  381  LEU LEU A . n 
A 1 280  LEU 280  382  382  LEU LEU A . n 
A 1 281  PRO 281  383  383  PRO PRO A . n 
A 1 282  VAL 282  384  384  VAL VAL A . n 
A 1 283  LEU 283  385  385  LEU LEU A . n 
A 1 284  CYS 284  386  386  CYS CYS A . n 
A 1 285  GLN 285  387  387  GLN GLN A . n 
A 1 286  ALA 286  388  388  ALA ALA A . n 
A 1 287  HIS 287  389  389  HIS HIS A . n 
A 1 288  GLY 288  390  390  GLY GLY A . n 
A 1 289  LEU 289  391  391  LEU LEU A . n 
A 1 290  THR 290  392  392  THR THR A . n 
A 1 291  PRO 291  393  393  PRO PRO A . n 
A 1 292  ASP 292  394  394  ASP ASP A . n 
A 1 293  GLN 293  395  395  GLN GLN A . n 
A 1 294  VAL 294  396  396  VAL VAL A . n 
A 1 295  VAL 295  397  397  VAL VAL A . n 
A 1 296  ALA 296  398  398  ALA ALA A . n 
A 1 297  ILE 297  399  399  ILE ILE A . n 
A 1 298  ALA 298  400  400  ALA ALA A . n 
A 1 299  SER 299  401  401  SER SER A . n 
A 1 300  HIS 300  402  402  HIS HIS A . n 
A 1 301  GLY 301  403  403  GLY GLY A . n 
A 1 302  GLY 302  404  404  GLY GLY A . n 
A 1 303  GLY 303  405  405  GLY GLY A . n 
A 1 304  LYS 304  406  406  LYS LYS A . n 
A 1 305  GLN 305  407  407  GLN GLN A . n 
A 1 306  ALA 306  408  408  ALA ALA A . n 
A 1 307  LEU 307  409  409  LEU LEU A . n 
A 1 308  GLU 308  410  410  GLU GLU A . n 
A 1 309  THR 309  411  411  THR THR A . n 
A 1 310  VAL 310  412  412  VAL VAL A . n 
A 1 311  GLN 311  413  413  GLN GLN A . n 
A 1 312  ARG 312  414  414  ARG ARG A . n 
A 1 313  LEU 313  415  415  LEU LEU A . n 
A 1 314  LEU 314  416  416  LEU LEU A . n 
A 1 315  PRO 315  417  417  PRO PRO A . n 
A 1 316  VAL 316  418  418  VAL VAL A . n 
A 1 317  LEU 317  419  419  LEU LEU A . n 
A 1 318  CYS 318  420  420  CYS CYS A . n 
A 1 319  GLN 319  421  421  GLN GLN A . n 
A 1 320  ALA 320  422  422  ALA ALA A . n 
A 1 321  HIS 321  423  423  HIS HIS A . n 
A 1 322  GLY 322  424  424  GLY GLY A . n 
A 1 323  LEU 323  425  425  LEU LEU A . n 
A 1 324  THR 324  426  426  THR THR A . n 
A 1 325  PRO 325  427  427  PRO PRO A . n 
A 1 326  ASP 326  428  428  ASP ASP A . n 
A 1 327  GLN 327  429  429  GLN GLN A . n 
A 1 328  VAL 328  430  430  VAL VAL A . n 
A 1 329  VAL 329  431  431  VAL VAL A . n 
A 1 330  ALA 330  432  432  ALA ALA A . n 
A 1 331  ILE 331  433  433  ILE ILE A . n 
A 1 332  ALA 332  434  434  ALA ALA A . n 
A 1 333  SER 333  435  435  SER SER A . n 
A 1 334  HIS 334  436  436  HIS HIS A . n 
A 1 335  ASP 335  437  437  ASP ASP A . n 
A 1 336  GLY 336  438  438  GLY GLY A . n 
A 1 337  GLY 337  439  439  GLY GLY A . n 
A 1 338  LYS 338  440  440  LYS LYS A . n 
A 1 339  GLN 339  441  441  GLN GLN A . n 
A 1 340  ALA 340  442  442  ALA ALA A . n 
A 1 341  LEU 341  443  443  LEU LEU A . n 
A 1 342  GLU 342  444  444  GLU GLU A . n 
A 1 343  THR 343  445  445  THR THR A . n 
A 1 344  VAL 344  446  446  VAL VAL A . n 
A 1 345  GLN 345  447  447  GLN GLN A . n 
A 1 346  ARG 346  448  448  ARG ARG A . n 
A 1 347  LEU 347  449  449  LEU LEU A . n 
A 1 348  LEU 348  450  450  LEU LEU A . n 
A 1 349  PRO 349  451  451  PRO PRO A . n 
A 1 350  VAL 350  452  452  VAL VAL A . n 
A 1 351  LEU 351  453  453  LEU LEU A . n 
A 1 352  CYS 352  454  454  CYS CYS A . n 
A 1 353  GLN 353  455  455  GLN GLN A . n 
A 1 354  ALA 354  456  456  ALA ALA A . n 
A 1 355  HIS 355  457  457  HIS HIS A . n 
A 1 356  GLY 356  458  458  GLY GLY A . n 
A 1 357  LEU 357  459  459  LEU LEU A . n 
A 1 358  THR 358  460  460  THR THR A . n 
A 1 359  PRO 359  461  461  PRO PRO A . n 
A 1 360  ASP 360  462  462  ASP ASP A . n 
A 1 361  GLN 361  463  463  GLN GLN A . n 
A 1 362  VAL 362  464  464  VAL VAL A . n 
A 1 363  VAL 363  465  465  VAL VAL A . n 
A 1 364  ALA 364  466  466  ALA ALA A . n 
A 1 365  ILE 365  467  467  ILE ILE A . n 
A 1 366  ALA 366  468  468  ALA ALA A . n 
A 1 367  SER 367  469  469  SER SER A . n 
A 1 368  ASN 368  470  470  ASN ASN A . n 
A 1 369  GLY 369  471  471  GLY GLY A . n 
A 1 370  GLY 370  472  472  GLY GLY A . n 
A 1 371  GLY 371  473  473  GLY GLY A . n 
A 1 372  LYS 372  474  474  LYS LYS A . n 
A 1 373  GLN 373  475  475  GLN GLN A . n 
A 1 374  ALA 374  476  476  ALA ALA A . n 
A 1 375  LEU 375  477  477  LEU LEU A . n 
A 1 376  GLU 376  478  478  GLU GLU A . n 
A 1 377  THR 377  479  479  THR THR A . n 
A 1 378  VAL 378  480  480  VAL VAL A . n 
A 1 379  GLN 379  481  481  GLN GLN A . n 
A 1 380  ARG 380  482  482  ARG ARG A . n 
A 1 381  LEU 381  483  483  LEU LEU A . n 
A 1 382  LEU 382  484  484  LEU LEU A . n 
A 1 383  PRO 383  485  485  PRO PRO A . n 
A 1 384  VAL 384  486  486  VAL VAL A . n 
A 1 385  LEU 385  487  487  LEU LEU A . n 
A 1 386  CYS 386  488  488  CYS CYS A . n 
A 1 387  GLN 387  489  489  GLN GLN A . n 
A 1 388  ALA 388  490  490  ALA ALA A . n 
A 1 389  HIS 389  491  491  HIS HIS A . n 
A 1 390  GLY 390  492  492  GLY GLY A . n 
A 1 391  LEU 391  493  493  LEU LEU A . n 
A 1 392  THR 392  494  494  THR THR A . n 
A 1 393  PRO 393  495  495  PRO PRO A . n 
A 1 394  ASP 394  496  496  ASP ASP A . n 
A 1 395  GLN 395  497  497  GLN GLN A . n 
A 1 396  VAL 396  498  498  VAL VAL A . n 
A 1 397  VAL 397  499  499  VAL VAL A . n 
A 1 398  ALA 398  500  500  ALA ALA A . n 
A 1 399  ILE 399  501  501  ILE ILE A . n 
A 1 400  ALA 400  502  502  ALA ALA A . n 
A 1 401  SER 401  503  503  SER SER A . n 
A 1 402  ASN 402  504  504  ASN ASN A . n 
A 1 403  GLY 403  505  505  GLY GLY A . n 
A 1 404  GLY 404  506  506  GLY GLY A . n 
A 1 405  LYS 405  507  507  LYS LYS A . n 
A 1 406  GLN 406  508  508  GLN GLN A . n 
A 1 407  ALA 407  509  509  ALA ALA A . n 
A 1 408  LEU 408  510  510  LEU LEU A . n 
A 1 409  GLU 409  511  511  GLU GLU A . n 
A 1 410  THR 410  512  512  THR THR A . n 
A 1 411  VAL 411  513  513  VAL VAL A . n 
A 1 412  GLN 412  514  514  GLN GLN A . n 
A 1 413  ARG 413  515  515  ARG ARG A . n 
A 1 414  LEU 414  516  516  LEU LEU A . n 
A 1 415  LEU 415  517  517  LEU LEU A . n 
A 1 416  PRO 416  518  518  PRO PRO A . n 
A 1 417  VAL 417  519  519  VAL VAL A . n 
A 1 418  LEU 418  520  520  LEU LEU A . n 
A 1 419  CYS 419  521  521  CYS CYS A . n 
A 1 420  GLN 420  522  522  GLN GLN A . n 
A 1 421  ALA 421  523  523  ALA ALA A . n 
A 1 422  HIS 422  524  524  HIS HIS A . n 
A 1 423  GLY 423  525  525  GLY GLY A . n 
A 1 424  LEU 424  526  526  LEU LEU A . n 
A 1 425  THR 425  527  527  THR THR A . n 
A 1 426  PRO 426  528  528  PRO PRO A . n 
A 1 427  ASP 427  529  529  ASP ASP A . n 
A 1 428  GLN 428  530  530  GLN GLN A . n 
A 1 429  VAL 429  531  531  VAL VAL A . n 
A 1 430  VAL 430  532  532  VAL VAL A . n 
A 1 431  ALA 431  533  533  ALA ALA A . n 
A 1 432  ILE 432  534  534  ILE ILE A . n 
A 1 433  ALA 433  535  535  ALA ALA A . n 
A 1 434  SER 434  536  536  SER SER A . n 
A 1 435  HIS 435  537  537  HIS HIS A . n 
A 1 436  ASP 436  538  538  ASP ASP A . n 
A 1 437  GLY 437  539  539  GLY GLY A . n 
A 1 438  GLY 438  540  540  GLY GLY A . n 
A 1 439  LYS 439  541  541  LYS LYS A . n 
A 1 440  GLN 440  542  542  GLN GLN A . n 
A 1 441  ALA 441  543  543  ALA ALA A . n 
A 1 442  LEU 442  544  544  LEU LEU A . n 
A 1 443  GLU 443  545  545  GLU GLU A . n 
A 1 444  THR 444  546  546  THR THR A . n 
A 1 445  VAL 445  547  547  VAL VAL A . n 
A 1 446  GLN 446  548  548  GLN GLN A . n 
A 1 447  ARG 447  549  549  ARG ARG A . n 
A 1 448  LEU 448  550  550  LEU LEU A . n 
A 1 449  LEU 449  551  551  LEU LEU A . n 
A 1 450  PRO 450  552  552  PRO PRO A . n 
A 1 451  VAL 451  553  553  VAL VAL A . n 
A 1 452  LEU 452  554  554  LEU LEU A . n 
A 1 453  CYS 453  555  555  CYS CYS A . n 
A 1 454  GLN 454  556  556  GLN GLN A . n 
A 1 455  THR 455  557  557  THR THR A . n 
A 1 456  HIS 456  558  558  HIS HIS A . n 
A 1 457  GLY 457  559  559  GLY GLY A . n 
A 1 458  LEU 458  560  560  LEU LEU A . n 
A 1 459  THR 459  561  561  THR THR A . n 
A 1 460  PRO 460  562  562  PRO PRO A . n 
A 1 461  ALA 461  563  563  ALA ALA A . n 
A 1 462  GLN 462  564  564  GLN GLN A . n 
A 1 463  VAL 463  565  565  VAL VAL A . n 
A 1 464  VAL 464  566  566  VAL VAL A . n 
A 1 465  ALA 465  567  567  ALA ALA A . n 
A 1 466  ILE 466  568  568  ILE ILE A . n 
A 1 467  ALA 467  569  569  ALA ALA A . n 
A 1 468  SER 468  570  570  SER SER A . n 
A 1 469  HIS 469  571  571  HIS HIS A . n 
A 1 470  ASP 470  572  572  ASP ASP A . n 
A 1 471  GLY 471  573  573  GLY GLY A . n 
A 1 472  GLY 472  574  574  GLY GLY A . n 
A 1 473  LYS 473  575  575  LYS LYS A . n 
A 1 474  GLN 474  576  576  GLN GLN A . n 
A 1 475  ALA 475  577  577  ALA ALA A . n 
A 1 476  LEU 476  578  578  LEU LEU A . n 
A 1 477  GLU 477  579  579  GLU GLU A . n 
A 1 478  THR 478  580  580  THR THR A . n 
A 1 479  VAL 479  581  581  VAL VAL A . n 
A 1 480  GLN 480  582  582  GLN GLN A . n 
A 1 481  GLN 481  583  583  GLN GLN A . n 
A 1 482  LEU 482  584  584  LEU LEU A . n 
A 1 483  LEU 483  585  585  LEU LEU A . n 
A 1 484  PRO 484  586  586  PRO PRO A . n 
A 1 485  VAL 485  587  587  VAL VAL A . n 
A 1 486  LEU 486  588  588  LEU LEU A . n 
A 1 487  CYS 487  589  589  CYS CYS A . n 
A 1 488  GLN 488  590  590  GLN GLN A . n 
A 1 489  ALA 489  591  591  ALA ALA A . n 
A 1 490  HIS 490  592  592  HIS HIS A . n 
A 1 491  GLY 491  593  593  GLY GLY A . n 
A 1 492  LEU 492  594  594  LEU LEU A . n 
A 1 493  THR 493  595  595  THR THR A . n 
A 1 494  PRO 494  596  596  PRO PRO A . n 
A 1 495  ASP 495  597  597  ASP ASP A . n 
A 1 496  GLN 496  598  598  GLN GLN A . n 
A 1 497  VAL 497  599  599  VAL VAL A . n 
A 1 498  VAL 498  600  600  VAL VAL A . n 
A 1 499  ALA 499  601  601  ALA ALA A . n 
A 1 500  ILE 500  602  602  ILE ILE A . n 
A 1 501  ALA 501  603  603  ALA ALA A . n 
A 1 502  SER 502  604  604  SER SER A . n 
A 1 503  ASN 503  605  605  ASN ASN A . n 
A 1 504  ILE 504  606  606  ILE ILE A . n 
A 1 505  GLY 505  607  607  GLY GLY A . n 
A 1 506  GLY 506  608  608  GLY GLY A . n 
A 1 507  LYS 507  609  609  LYS LYS A . n 
A 1 508  GLN 508  610  610  GLN GLN A . n 
A 1 509  ALA 509  611  611  ALA ALA A . n 
A 1 510  LEU 510  612  612  LEU LEU A . n 
A 1 511  ALA 511  613  613  ALA ALA A . n 
A 1 512  THR 512  614  614  THR THR A . n 
A 1 513  VAL 513  615  615  VAL VAL A . n 
A 1 514  GLN 514  616  616  GLN GLN A . n 
A 1 515  ARG 515  617  617  ARG ARG A . n 
A 1 516  LEU 516  618  618  LEU LEU A . n 
A 1 517  LEU 517  619  619  LEU LEU A . n 
A 1 518  PRO 518  620  620  PRO PRO A . n 
A 1 519  VAL 519  621  621  VAL VAL A . n 
A 1 520  LEU 520  622  622  LEU LEU A . n 
A 1 521  CYS 521  623  623  CYS CYS A . n 
A 1 522  GLN 522  624  624  GLN GLN A . n 
A 1 523  ALA 523  625  625  ALA ALA A . n 
A 1 524  HIS 524  626  626  HIS HIS A . n 
A 1 525  GLY 525  627  627  GLY GLY A . n 
A 1 526  LEU 526  628  628  LEU LEU A . n 
A 1 527  THR 527  629  629  THR THR A . n 
A 1 528  PRO 528  630  630  PRO PRO A . n 
A 1 529  ASP 529  631  631  ASP ASP A . n 
A 1 530  GLN 530  632  632  GLN GLN A . n 
A 1 531  VAL 531  633  633  VAL VAL A . n 
A 1 532  VAL 532  634  634  VAL VAL A . n 
A 1 533  ALA 533  635  635  ALA ALA A . n 
A 1 534  ILE 534  636  636  ILE ILE A . n 
A 1 535  ALA 535  637  637  ALA ALA A . n 
A 1 536  SER 536  638  638  SER SER A . n 
A 1 537  ASN 537  639  639  ASN ASN A . n 
A 1 538  GLY 538  640  640  GLY GLY A . n 
A 1 539  GLY 539  641  641  GLY GLY A . n 
A 1 540  GLY 540  642  642  GLY GLY A . n 
A 1 541  LYS 541  643  643  LYS LYS A . n 
A 1 542  GLN 542  644  644  GLN GLN A . n 
A 1 543  ALA 543  645  645  ALA ALA A . n 
A 1 544  LEU 544  646  646  LEU LEU A . n 
A 1 545  GLU 545  647  647  GLU GLU A . n 
A 1 546  THR 546  648  648  THR THR A . n 
A 1 547  VAL 547  649  649  VAL VAL A . n 
A 1 548  GLN 548  650  650  GLN GLN A . n 
A 1 549  ARG 549  651  651  ARG ARG A . n 
A 1 550  LEU 550  652  652  LEU LEU A . n 
A 1 551  LEU 551  653  653  LEU LEU A . n 
A 1 552  PRO 552  654  654  PRO PRO A . n 
A 1 553  VAL 553  655  655  VAL VAL A . n 
A 1 554  LEU 554  656  656  LEU LEU A . n 
A 1 555  CYS 555  657  657  CYS CYS A . n 
A 1 556  GLN 556  658  658  GLN GLN A . n 
A 1 557  ALA 557  659  659  ALA ALA A . n 
A 1 558  HIS 558  660  660  HIS HIS A . n 
A 1 559  GLY 559  661  661  GLY GLY A . n 
A 1 560  LEU 560  662  662  LEU LEU A . n 
A 1 561  THR 561  663  663  THR THR A . n 
A 1 562  PRO 562  664  664  PRO PRO A . n 
A 1 563  ASP 563  665  665  ASP ASP A . n 
A 1 564  GLN 564  666  666  GLN GLN A . n 
A 1 565  VAL 565  667  667  VAL VAL A . n 
A 1 566  VAL 566  668  668  VAL VAL A . n 
A 1 567  ALA 567  669  669  ALA ALA A . n 
A 1 568  ILE 568  670  670  ILE ILE A . n 
A 1 569  ALA 569  671  671  ALA ALA A . n 
A 1 570  SER 570  672  672  SER SER A . n 
A 1 571  ASN 571  673  673  ASN ASN A . n 
A 1 572  GLY 572  674  674  GLY GLY A . n 
A 1 573  GLY 573  675  675  GLY GLY A . n 
A 1 574  GLY 574  676  676  GLY GLY A . n 
A 1 575  LYS 575  677  677  LYS LYS A . n 
A 1 576  GLN 576  678  678  GLN GLN A . n 
A 1 577  ALA 577  679  679  ALA ALA A . n 
A 1 578  LEU 578  680  680  LEU LEU A . n 
A 1 579  GLU 579  681  681  GLU GLU A . n 
A 1 580  THR 580  682  682  THR THR A . n 
A 1 581  VAL 581  683  683  VAL VAL A . n 
A 1 582  GLN 582  684  684  GLN GLN A . n 
A 1 583  ARG 583  685  685  ARG ARG A . n 
A 1 584  LEU 584  686  686  LEU LEU A . n 
A 1 585  LEU 585  687  687  LEU LEU A . n 
A 1 586  PRO 586  688  688  PRO PRO A . n 
A 1 587  VAL 587  689  689  VAL VAL A . n 
A 1 588  LEU 588  690  690  LEU LEU A . n 
A 1 589  CYS 589  691  691  CYS CYS A . n 
A 1 590  GLN 590  692  692  GLN GLN A . n 
A 1 591  ALA 591  693  693  ALA ALA A . n 
A 1 592  HIS 592  694  694  HIS HIS A . n 
A 1 593  GLY 593  695  695  GLY GLY A . n 
A 1 594  LEU 594  696  696  LEU LEU A . n 
A 1 595  THR 595  697  697  THR THR A . n 
A 1 596  GLN 596  698  698  GLN GLN A . n 
A 1 597  VAL 597  699  699  VAL VAL A . n 
A 1 598  GLN 598  700  700  GLN GLN A . n 
A 1 599  VAL 599  701  701  VAL VAL A . n 
A 1 600  VAL 600  702  702  VAL VAL A . n 
A 1 601  ALA 601  703  703  ALA ALA A . n 
A 1 602  ILE 602  704  704  ILE ILE A . n 
A 1 603  ALA 603  705  705  ALA ALA A . n 
A 1 604  SER 604  706  706  SER SER A . n 
A 1 605  ASN 605  707  707  ASN ASN A . n 
A 1 606  ILE 606  708  708  ILE ILE A . n 
A 1 607  GLY 607  709  709  GLY GLY A . n 
A 1 608  GLY 608  710  710  GLY GLY A . n 
A 1 609  LYS 609  711  711  LYS LYS A . n 
A 1 610  GLN 610  712  712  GLN GLN A . n 
A 1 611  ALA 611  713  713  ALA ALA A . n 
A 1 612  LEU 612  714  714  LEU LEU A . n 
A 1 613  GLU 613  715  715  GLU GLU A . n 
A 1 614  THR 614  716  716  THR THR A . n 
A 1 615  VAL 615  717  717  VAL VAL A . n 
A 1 616  GLN 616  718  718  GLN GLN A . n 
A 1 617  ARG 617  719  719  ARG ARG A . n 
A 1 618  LEU 618  720  720  LEU LEU A . n 
A 1 619  LEU 619  721  721  LEU LEU A . n 
A 1 620  PRO 620  722  722  PRO PRO A . n 
A 1 621  VAL 621  723  723  VAL VAL A . n 
A 1 622  LEU 622  724  724  LEU LEU A . n 
A 1 623  CYS 623  725  725  CYS CYS A . n 
A 1 624  GLN 624  726  726  GLN GLN A . n 
A 1 625  ALA 625  727  727  ALA ALA A . n 
A 1 626  HIS 626  728  728  HIS HIS A . n 
A 1 627  GLY 627  729  729  GLY GLY A . n 
A 1 628  LEU 628  730  730  LEU LEU A . n 
A 1 629  THR 629  731  731  THR THR A . n 
A 1 630  PRO 630  732  732  PRO PRO A . n 
A 1 631  ALA 631  733  733  ALA ALA A . n 
A 1 632  GLN 632  734  734  GLN GLN A . n 
A 1 633  VAL 633  735  735  VAL VAL A . n 
A 1 634  VAL 634  736  736  VAL VAL A . n 
A 1 635  ALA 635  737  737  ALA ALA A . n 
A 1 636  ILE 636  738  738  ILE ILE A . n 
A 1 637  ALA 637  739  739  ALA ALA A . n 
A 1 638  SER 638  740  740  SER SER A . n 
A 1 639  HIS 639  741  741  HIS HIS A . n 
A 1 640  ASP 640  742  742  ASP ASP A . n 
A 1 641  GLY 641  743  743  GLY GLY A . n 
A 1 642  GLY 642  744  744  GLY GLY A . n 
A 1 643  LYS 643  745  745  LYS LYS A . n 
A 1 644  GLN 644  746  746  GLN GLN A . n 
A 1 645  ALA 645  747  747  ALA ALA A . n 
A 1 646  LEU 646  748  748  LEU LEU A . n 
A 1 647  GLU 647  749  749  GLU GLU A . n 
A 1 648  THR 648  750  750  THR THR A . n 
A 1 649  VAL 649  751  751  VAL VAL A . n 
A 1 650  GLN 650  752  752  GLN GLN A . n 
A 1 651  ARG 651  753  753  ARG ARG A . n 
A 1 652  LEU 652  754  754  LEU LEU A . n 
A 1 653  LEU 653  755  755  LEU LEU A . n 
A 1 654  PRO 654  756  756  PRO PRO A . n 
A 1 655  VAL 655  757  757  VAL VAL A . n 
A 1 656  LEU 656  758  758  LEU LEU A . n 
A 1 657  CYS 657  759  759  CYS CYS A . n 
A 1 658  GLN 658  760  760  GLN GLN A . n 
A 1 659  ALA 659  761  761  ALA ALA A . n 
A 1 660  HIS 660  762  762  HIS HIS A . n 
A 1 661  GLY 661  763  763  GLY GLY A . n 
A 1 662  LEU 662  764  764  LEU LEU A . n 
A 1 663  THR 663  765  765  THR THR A . n 
A 1 664  PRO 664  766  766  PRO PRO A . n 
A 1 665  ASP 665  767  767  ASP ASP A . n 
A 1 666  GLN 666  768  768  GLN GLN A . n 
A 1 667  VAL 667  769  769  VAL VAL A . n 
A 1 668  VAL 668  770  770  VAL VAL A . n 
A 1 669  ALA 669  771  771  ALA ALA A . n 
A 1 670  ILE 670  772  772  ILE ILE A . n 
A 1 671  ALA 671  773  773  ALA ALA A . n 
A 1 672  SER 672  774  774  SER SER A . n 
A 1 673  ASN 673  775  775  ASN ASN A . n 
A 1 674  GLY 674  776  776  GLY GLY A . n 
A 1 675  GLY 675  777  777  GLY GLY A . n 
A 1 676  GLY 676  778  778  GLY GLY A . n 
A 1 677  LYS 677  779  779  LYS LYS A . n 
A 1 678  GLN 678  780  780  GLN GLN A . n 
A 1 679  ALA 679  781  781  ALA ALA A . n 
A 1 680  LEU 680  782  782  LEU LEU A . n 
A 1 681  GLU 681  783  783  GLU GLU A . n 
A 1 682  THR 682  784  784  THR THR A . n 
A 1 683  VAL 683  785  785  VAL VAL A . n 
A 1 684  GLN 684  786  786  GLN GLN A . n 
A 1 685  ARG 685  787  787  ARG ARG A . n 
A 1 686  LEU 686  788  788  LEU LEU A . n 
A 1 687  LEU 687  789  789  LEU LEU A . n 
A 1 688  PRO 688  790  790  PRO PRO A . n 
A 1 689  VAL 689  791  ?    ?   ?   A . n 
A 1 690  LEU 690  792  ?    ?   ?   A . n 
A 1 691  CYS 691  793  ?    ?   ?   A . n 
A 1 692  GLN 692  794  ?    ?   ?   A . n 
A 1 693  ALA 693  795  ?    ?   ?   A . n 
A 1 694  HIS 694  796  ?    ?   ?   A . n 
A 1 695  GLY 695  797  797  GLY GLY A . n 
A 1 696  LEU 696  798  798  LEU LEU A . n 
A 1 697  THR 697  799  799  THR THR A . n 
A 1 698  GLN 698  800  800  GLN GLN A . n 
A 1 699  GLU 699  801  801  GLU GLU A . n 
A 1 700  GLN 700  802  802  GLN GLN A . n 
A 1 701  VAL 701  803  803  VAL VAL A . n 
A 1 702  VAL 702  804  804  VAL VAL A . n 
A 1 703  ALA 703  805  805  ALA ALA A . n 
A 1 704  ILE 704  806  806  ILE ILE A . n 
A 1 705  ALA 705  807  807  ALA ALA A . n 
A 1 706  SER 706  808  808  SER SER A . n 
A 1 707  ASN 707  809  809  ASN ASN A . n 
A 1 708  ASN 708  810  810  ASN ASN A . n 
A 1 709  GLY 709  811  811  GLY GLY A . n 
A 1 710  GLY 710  812  812  GLY GLY A . n 
A 1 711  LYS 711  813  813  LYS LYS A . n 
A 1 712  GLN 712  814  814  GLN GLN A . n 
A 1 713  ALA 713  815  815  ALA ALA A . n 
A 1 714  LEU 714  816  816  LEU LEU A . n 
A 1 715  GLU 715  817  817  GLU GLU A . n 
A 1 716  THR 716  818  818  THR THR A . n 
A 1 717  VAL 717  819  819  VAL VAL A . n 
A 1 718  GLN 718  820  820  GLN GLN A . n 
A 1 719  ARG 719  821  821  ARG ARG A . n 
A 1 720  LEU 720  822  822  LEU LEU A . n 
A 1 721  LEU 721  823  823  LEU LEU A . n 
A 1 722  PRO 722  824  824  PRO PRO A . n 
A 1 723  VAL 723  825  825  VAL VAL A . n 
A 1 724  LEU 724  826  826  LEU LEU A . n 
A 1 725  CYS 725  827  827  CYS CYS A . n 
A 1 726  GLN 726  828  828  GLN GLN A . n 
A 1 727  ALA 727  829  829  ALA ALA A . n 
A 1 728  HIS 728  830  830  HIS HIS A . n 
A 1 729  GLY 729  831  831  GLY GLY A . n 
A 1 730  LEU 730  832  832  LEU LEU A . n 
A 1 731  THR 731  833  833  THR THR A . n 
A 1 732  PRO 732  834  834  PRO PRO A . n 
A 1 733  ASP 733  835  835  ASP ASP A . n 
A 1 734  GLN 734  836  836  GLN GLN A . n 
A 1 735  VAL 735  837  837  VAL VAL A . n 
A 1 736  VAL 736  838  838  VAL VAL A . n 
A 1 737  ALA 737  839  839  ALA ALA A . n 
A 1 738  ILE 738  840  840  ILE ILE A . n 
A 1 739  ALA 739  841  841  ALA ALA A . n 
A 1 740  SER 740  842  842  SER SER A . n 
A 1 741  ASN 741  843  843  ASN ASN A . n 
A 1 742  GLY 742  844  844  GLY GLY A . n 
A 1 743  GLY 743  845  845  GLY GLY A . n 
A 1 744  GLY 744  846  846  GLY GLY A . n 
A 1 745  LYS 745  847  847  LYS LYS A . n 
A 1 746  GLN 746  848  848  GLN GLN A . n 
A 1 747  ALA 747  849  849  ALA ALA A . n 
A 1 748  LEU 748  850  850  LEU LEU A . n 
A 1 749  GLU 749  851  851  GLU GLU A . n 
A 1 750  THR 750  852  852  THR THR A . n 
A 1 751  VAL 751  853  853  VAL VAL A . n 
A 1 752  GLN 752  854  854  GLN GLN A . n 
A 1 753  ARG 753  855  855  ARG ARG A . n 
A 1 754  LEU 754  856  856  LEU LEU A . n 
A 1 755  LEU 755  857  857  LEU LEU A . n 
A 1 756  PRO 756  858  858  PRO PRO A . n 
A 1 757  VAL 757  859  859  VAL VAL A . n 
A 1 758  LEU 758  860  860  LEU LEU A . n 
A 1 759  CYS 759  861  861  CYS CYS A . n 
A 1 760  GLN 760  862  862  GLN GLN A . n 
A 1 761  ALA 761  863  863  ALA ALA A . n 
A 1 762  HIS 762  864  864  HIS HIS A . n 
A 1 763  GLY 763  865  865  GLY GLY A . n 
A 1 764  LEU 764  866  866  LEU LEU A . n 
A 1 765  THR 765  867  867  THR THR A . n 
A 1 766  PRO 766  868  868  PRO PRO A . n 
A 1 767  ALA 767  869  869  ALA ALA A . n 
A 1 768  GLN 768  870  870  GLN GLN A . n 
A 1 769  VAL 769  871  871  VAL VAL A . n 
A 1 770  VAL 770  872  872  VAL VAL A . n 
A 1 771  ALA 771  873  873  ALA ALA A . n 
A 1 772  ILE 772  874  874  ILE ILE A . n 
A 1 773  ALA 773  875  875  ALA ALA A . n 
A 1 774  SER 774  876  876  SER SER A . n 
A 1 775  ASN 775  877  877  ASN ASN A . n 
A 1 776  ILE 776  878  878  ILE ILE A . n 
A 1 777  GLY 777  879  879  GLY GLY A . n 
A 1 778  GLY 778  880  880  GLY GLY A . n 
A 1 779  LYS 779  881  881  LYS LYS A . n 
A 1 780  GLN 780  882  882  GLN GLN A . n 
A 1 781  ALA 781  883  883  ALA ALA A . n 
A 1 782  LEU 782  884  884  LEU LEU A . n 
A 1 783  GLU 783  885  885  GLU GLU A . n 
A 1 784  THR 784  886  886  THR THR A . n 
A 1 785  VAL 785  887  887  VAL VAL A . n 
A 1 786  GLN 786  888  888  GLN GLN A . n 
A 1 787  ARG 787  889  889  ARG ARG A . n 
A 1 788  LEU 788  890  890  LEU LEU A . n 
A 1 789  LEU 789  891  891  LEU LEU A . n 
A 1 790  PRO 790  892  892  PRO PRO A . n 
A 1 791  VAL 791  893  893  VAL VAL A . n 
A 1 792  LEU 792  894  894  LEU LEU A . n 
A 1 793  CYS 793  895  895  CYS CYS A . n 
A 1 794  GLN 794  896  896  GLN GLN A . n 
A 1 795  ASP 795  897  897  ASP ASP A . n 
A 1 796  HIS 796  898  898  HIS HIS A . n 
A 1 797  GLY 797  899  899  GLY GLY A . n 
A 1 798  LEU 798  900  900  LEU LEU A . n 
A 1 799  THR 799  901  901  THR THR A . n 
A 1 800  LEU 800  902  902  LEU LEU A . n 
A 1 801  ALA 801  903  903  ALA ALA A . n 
A 1 802  GLN 802  904  904  GLN GLN A . n 
A 1 803  VAL 803  905  905  VAL VAL A . n 
A 1 804  VAL 804  906  906  VAL VAL A . n 
A 1 805  ALA 805  907  907  ALA ALA A . n 
A 1 806  ILE 806  908  908  ILE ILE A . n 
A 1 807  ALA 807  909  909  ALA ALA A . n 
A 1 808  SER 808  910  910  SER SER A . n 
A 1 809  ASN 809  911  911  ASN ASN A . n 
A 1 810  ILE 810  912  912  ILE ILE A . n 
A 1 811  GLY 811  913  913  GLY GLY A . n 
A 1 812  GLY 812  914  914  GLY GLY A . n 
A 1 813  LYS 813  915  915  LYS LYS A . n 
A 1 814  GLN 814  916  916  GLN GLN A . n 
A 1 815  ALA 815  917  917  ALA ALA A . n 
A 1 816  LEU 816  918  918  LEU LEU A . n 
A 1 817  GLU 817  919  919  GLU GLU A . n 
A 1 818  THR 818  920  920  THR THR A . n 
A 1 819  VAL 819  921  921  VAL VAL A . n 
A 1 820  GLN 820  922  922  GLN GLN A . n 
A 1 821  ARG 821  923  923  ARG ARG A . n 
A 1 822  LEU 822  924  924  LEU LEU A . n 
A 1 823  LEU 823  925  925  LEU LEU A . n 
A 1 824  PRO 824  926  926  PRO PRO A . n 
A 1 825  VAL 825  927  927  VAL VAL A . n 
A 1 826  LEU 826  928  928  LEU LEU A . n 
A 1 827  CYS 827  929  929  CYS CYS A . n 
A 1 828  GLN 828  930  930  GLN GLN A . n 
A 1 829  ALA 829  931  ?    ?   ?   A . n 
A 1 830  HIS 830  932  ?    ?   ?   A . n 
A 1 831  GLY 831  933  933  GLY GLY A . n 
A 1 832  LEU 832  934  934  LEU LEU A . n 
A 1 833  THR 833  935  935  THR THR A . n 
A 1 834  GLN 834  936  936  GLN GLN A . n 
A 1 835  ASP 835  937  937  ASP ASP A . n 
A 1 836  GLN 836  938  938  GLN GLN A . n 
A 1 837  VAL 837  939  939  VAL VAL A . n 
A 1 838  VAL 838  940  940  VAL VAL A . n 
A 1 839  ALA 839  941  941  ALA ALA A . n 
A 1 840  ILE 840  942  942  ILE ILE A . n 
A 1 841  ALA 841  943  943  ALA ALA A . n 
A 1 842  SER 842  944  944  SER SER A . n 
A 1 843  ASN 843  945  945  ASN ASN A . n 
A 1 844  ILE 844  946  946  ILE ILE A . n 
A 1 845  GLY 845  947  947  GLY GLY A . n 
A 1 846  GLY 846  948  948  GLY GLY A . n 
A 1 847  LYS 847  949  949  LYS LYS A . n 
A 1 848  GLN 848  950  950  GLN GLN A . n 
A 1 849  ALA 849  951  951  ALA ALA A . n 
A 1 850  LEU 850  952  952  LEU LEU A . n 
A 1 851  GLU 851  953  953  GLU GLU A . n 
A 1 852  THR 852  954  954  THR THR A . n 
A 1 853  VAL 853  955  955  VAL VAL A . n 
A 1 854  GLN 854  956  956  GLN GLN A . n 
A 1 855  ARG 855  957  957  ARG ARG A . n 
A 1 856  LEU 856  958  958  LEU LEU A . n 
A 1 857  LEU 857  959  959  LEU LEU A . n 
A 1 858  PRO 858  960  960  PRO PRO A . n 
A 1 859  VAL 859  961  961  VAL VAL A . n 
A 1 860  LEU 860  962  962  LEU LEU A . n 
A 1 861  CYS 861  963  963  CYS CYS A . n 
A 1 862  GLN 862  964  964  GLN GLN A . n 
A 1 863  ASP 863  965  965  ASP ASP A . n 
A 1 864  HIS 864  966  966  HIS HIS A . n 
A 1 865  GLY 865  967  967  GLY GLY A . n 
A 1 866  LEU 866  968  968  LEU LEU A . n 
A 1 867  THR 867  969  969  THR THR A . n 
A 1 868  PRO 868  970  970  PRO PRO A . n 
A 1 869  ASP 869  971  971  ASP ASP A . n 
A 1 870  GLN 870  972  972  GLN GLN A . n 
A 1 871  VAL 871  973  973  VAL VAL A . n 
A 1 872  VAL 872  974  974  VAL VAL A . n 
A 1 873  ALA 873  975  975  ALA ALA A . n 
A 1 874  ILE 874  976  976  ILE ILE A . n 
A 1 875  ALA 875  977  977  ALA ALA A . n 
A 1 876  SER 876  978  978  SER SER A . n 
A 1 877  ASN 877  979  979  ASN ASN A . n 
A 1 878  ILE 878  980  980  ILE ILE A . n 
A 1 879  GLY 879  981  981  GLY GLY A . n 
A 1 880  GLY 880  982  982  GLY GLY A . n 
A 1 881  LYS 881  983  983  LYS LYS A . n 
A 1 882  GLN 882  984  984  GLN GLN A . n 
A 1 883  ALA 883  985  985  ALA ALA A . n 
A 1 884  LEU 884  986  986  LEU LEU A . n 
A 1 885  GLU 885  987  987  GLU GLU A . n 
A 1 886  THR 886  988  988  THR THR A . n 
A 1 887  VAL 887  989  989  VAL VAL A . n 
A 1 888  GLN 888  990  990  GLN GLN A . n 
A 1 889  ARG 889  991  991  ARG ARG A . n 
A 1 890  LEU 890  992  992  LEU LEU A . n 
A 1 891  LEU 891  993  993  LEU LEU A . n 
A 1 892  PRO 892  994  994  PRO PRO A . n 
A 1 893  VAL 893  995  995  VAL VAL A . n 
A 1 894  LEU 894  996  996  LEU LEU A . n 
A 1 895  CYS 895  997  997  CYS CYS A . n 
A 1 896  GLN 896  998  998  GLN GLN A . n 
A 1 897  ASP 897  999  999  ASP ASP A . n 
A 1 898  HIS 898  1000 1000 HIS HIS A . n 
A 1 899  GLY 899  1001 1001 GLY GLY A . n 
A 1 900  LEU 900  1002 1002 LEU LEU A . n 
A 1 901  THR 901  1003 1003 THR THR A . n 
A 1 902  LEU 902  1004 1004 LEU LEU A . n 
A 1 903  ASP 903  1005 1005 ASP ASP A . n 
A 1 904  GLN 904  1006 1006 GLN GLN A . n 
A 1 905  VAL 905  1007 1007 VAL VAL A . n 
A 1 906  VAL 906  1008 1008 VAL VAL A . n 
A 1 907  ALA 907  1009 1009 ALA ALA A . n 
A 1 908  ILE 908  1010 1010 ILE ILE A . n 
A 1 909  ALA 909  1011 1011 ALA ALA A . n 
A 1 910  SER 910  1012 1012 SER SER A . n 
A 1 911  ASN 911  1013 1013 ASN ASN A . n 
A 1 912  GLY 912  1014 1014 GLY GLY A . n 
A 1 913  GLY 913  1015 1015 GLY GLY A . n 
A 1 914  LYS 914  1016 1016 LYS LYS A . n 
A 1 915  GLN 915  1017 1017 GLN GLN A . n 
A 1 916  ALA 916  1018 1018 ALA ALA A . n 
A 1 917  LEU 917  1019 1019 LEU LEU A . n 
A 1 918  GLU 918  1020 1020 GLU GLU A . n 
A 1 919  THR 919  1021 1021 THR THR A . n 
A 1 920  VAL 920  1022 1022 VAL VAL A . n 
A 1 921  GLN 921  1023 1023 GLN GLN A . n 
A 1 922  ARG 922  1024 1024 ARG ARG A . n 
A 1 923  LEU 923  1025 1025 LEU LEU A . n 
A 1 924  LEU 924  1026 1026 LEU LEU A . n 
A 1 925  PRO 925  1027 1027 PRO PRO A . n 
A 1 926  VAL 926  1028 1028 VAL VAL A . n 
A 1 927  LEU 927  1029 1029 LEU LEU A . n 
A 1 928  CYS 928  1030 1030 CYS CYS A . n 
A 1 929  GLN 929  1031 1031 GLN GLN A . n 
A 1 930  ASP 930  1032 1032 ASP ASP A . n 
A 1 931  HIS 931  1033 1033 HIS HIS A . n 
A 1 932  GLY 932  1034 1034 GLY GLY A . n 
A 1 933  LEU 933  1035 1035 LEU LEU A . n 
A 1 934  THR 934  1036 1036 THR THR A . n 
A 1 935  PRO 935  1037 1037 PRO PRO A . n 
A 1 936  ASP 936  1038 1038 ASP ASP A . n 
A 1 937  GLN 937  1039 1039 GLN GLN A . n 
A 1 938  VAL 938  1040 1040 VAL VAL A . n 
A 1 939  VAL 939  1041 1041 VAL VAL A . n 
A 1 940  ALA 940  1042 1042 ALA ALA A . n 
A 1 941  ILE 941  1043 1043 ILE ILE A . n 
A 1 942  ALA 942  1044 1044 ALA ALA A . n 
A 1 943  SER 943  1045 1045 SER SER A . n 
A 1 944  ASN 944  1046 1046 ASN ASN A . n 
A 1 945  SER 945  1047 1047 SER SER A . n 
A 1 946  GLY 946  1048 1048 GLY GLY A . n 
A 1 947  GLY 947  1049 ?    ?   ?   A . n 
A 1 948  LYS 948  1050 ?    ?   ?   A . n 
A 1 949  GLN 949  1051 ?    ?   ?   A . n 
A 1 950  ALA 950  1052 ?    ?   ?   A . n 
A 1 951  LEU 951  1053 ?    ?   ?   A . n 
A 1 952  GLU 952  1054 ?    ?   ?   A . n 
A 1 953  THR 953  1055 ?    ?   ?   A . n 
A 1 954  VAL 954  1056 ?    ?   ?   A . n 
A 1 955  GLN 955  1057 ?    ?   ?   A . n 
A 1 956  ARG 956  1058 ?    ?   ?   A . n 
A 1 957  LEU 957  1059 ?    ?   ?   A . n 
A 1 958  LEU 958  1060 ?    ?   ?   A . n 
A 1 959  PRO 959  1061 ?    ?   ?   A . n 
A 1 960  VAL 960  1062 ?    ?   ?   A . n 
A 1 961  LEU 961  1063 ?    ?   ?   A . n 
A 1 962  CYS 962  1064 ?    ?   ?   A . n 
A 1 963  GLN 963  1065 ?    ?   ?   A . n 
A 1 964  ASP 964  1066 ?    ?   ?   A . n 
A 1 965  HIS 965  1067 ?    ?   ?   A . n 
A 1 966  GLY 966  1068 ?    ?   ?   A . n 
A 1 967  LEU 967  1069 ?    ?   ?   A . n 
A 1 968  THR 968  1070 ?    ?   ?   A . n 
A 1 969  PRO 969  1071 ?    ?   ?   A . n 
A 1 970  ASN 970  1072 ?    ?   ?   A . n 
A 1 971  GLN 971  1073 ?    ?   ?   A . n 
A 1 972  VAL 972  1074 ?    ?   ?   A . n 
A 1 973  VAL 973  1075 ?    ?   ?   A . n 
A 1 974  ALA 974  1076 ?    ?   ?   A . n 
A 1 975  ILE 975  1077 ?    ?   ?   A . n 
A 1 976  ALA 976  1078 ?    ?   ?   A . n 
A 1 977  SER 977  1079 ?    ?   ?   A . n 
A 1 978  ASN 978  1080 ?    ?   ?   A . n 
A 1 979  GLY 979  1081 ?    ?   ?   A . n 
A 1 980  GLY 980  1082 ?    ?   ?   A . n 
A 1 981  LYS 981  1083 ?    ?   ?   A . n 
A 1 982  GLN 982  1084 ?    ?   ?   A . n 
A 1 983  ALA 983  1085 ?    ?   ?   A . n 
A 1 984  LEU 984  1086 ?    ?   ?   A . n 
A 1 985  GLU 985  1087 ?    ?   ?   A . n 
A 1 986  SER 986  1088 ?    ?   ?   A . n 
A 1 987  ILE 987  1089 ?    ?   ?   A . n 
A 1 988  VAL 988  1090 ?    ?   ?   A . n 
A 1 989  ALA 989  1091 ?    ?   ?   A . n 
A 1 990  GLN 990  1092 ?    ?   ?   A . n 
A 1 991  LEU 991  1093 ?    ?   ?   A . n 
A 1 992  SER 992  1094 ?    ?   ?   A . n 
A 1 993  ARG 993  1095 ?    ?   ?   A . n 
A 1 994  PRO 994  1096 ?    ?   ?   A . n 
A 1 995  ASP 995  1097 ?    ?   ?   A . n 
A 1 996  PRO 996  1098 ?    ?   ?   A . n 
A 1 997  ALA 997  1099 ?    ?   ?   A . n 
A 1 998  LEU 998  1100 ?    ?   ?   A . n 
A 1 999  ALA 999  1101 ?    ?   ?   A . n 
A 1 1000 ALA 1000 1102 ?    ?   ?   A . n 
A 1 1001 LEU 1001 1103 ?    ?   ?   A . n 
A 1 1002 THR 1002 1104 ?    ?   ?   A . n 
A 1 1003 ASN 1003 1105 ?    ?   ?   A . n 
A 1 1004 ASP 1004 1106 ?    ?   ?   A . n 
A 1 1005 HIS 1005 1107 ?    ?   ?   A . n 
A 1 1006 LEU 1006 1108 ?    ?   ?   A . n 
A 1 1007 VAL 1007 1109 ?    ?   ?   A . n 
A 1 1008 ALA 1008 1110 ?    ?   ?   A . n 
A 1 1009 LEU 1009 1111 ?    ?   ?   A . n 
A 1 1010 ALA 1010 1112 ?    ?   ?   A . n 
A 1 1011 CYS 1011 1113 ?    ?   ?   A . n 
A 1 1012 LEU 1012 1114 ?    ?   ?   A . n 
A 1 1013 GLY 1013 1115 ?    ?   ?   A . n 
A 1 1014 GLY 1014 1116 ?    ?   ?   A . n 
A 1 1015 ARG 1015 1117 ?    ?   ?   A . n 
A 1 1016 PRO 1016 1118 ?    ?   ?   A . n 
A 1 1017 ALA 1017 1119 ?    ?   ?   A . n 
A 1 1018 MET 1018 1120 ?    ?   ?   A . n 
A 1 1019 ASP 1019 1121 ?    ?   ?   A . n 
A 1 1020 ALA 1020 1122 ?    ?   ?   A . n 
A 1 1021 VAL 1021 1123 ?    ?   ?   A . n 
A 1 1022 LYS 1022 1124 ?    ?   ?   A . n 
A 1 1023 LYS 1023 1125 ?    ?   ?   A . n 
A 1 1024 GLY 1024 1126 ?    ?   ?   A . n 
A 1 1025 LEU 1025 1127 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1128 ?    ?   ?   A . n 
A 1 1027 HIS 1027 1129 ?    ?   ?   A . n 
A 1 1028 ALA 1028 1130 ?    ?   ?   A . n 
A 1 1029 PRO 1029 1131 ?    ?   ?   A . n 
A 1 1030 GLU 1030 1132 ?    ?   ?   A . n 
A 1 1031 LEU 1031 1133 ?    ?   ?   A . n 
A 1 1032 ILE 1032 1134 ?    ?   ?   A . n 
A 1 1033 ARG 1033 1135 ?    ?   ?   A . n 
A 1 1034 ARG 1034 1136 ?    ?   ?   A . n 
A 1 1035 VAL 1035 1137 ?    ?   ?   A . n 
A 1 1036 ASN 1036 1138 ?    ?   ?   A . n 
A 1 1037 ARG 1037 1139 ?    ?   ?   A . n 
A 1 1038 ARG 1038 1140 ?    ?   ?   A . n 
A 1 1039 ILE 1039 1141 ?    ?   ?   A . n 
A 1 1040 GLY 1040 1142 ?    ?   ?   A . n 
A 1 1041 GLU 1041 1143 ?    ?   ?   A . n 
A 1 1042 ARG 1042 1144 ?    ?   ?   A . n 
A 1 1043 THR 1043 1145 ?    ?   ?   A . n 
A 1 1044 SER 1044 1146 ?    ?   ?   A . n 
A 1 1045 HIS 1045 1147 ?    ?   ?   A . n 
A 1 1046 ARG 1046 1148 ?    ?   ?   A . n 
A 1 1047 VAL 1047 1149 ?    ?   ?   A . n 
B 2 1    DT  1    -6   -6   DT  DT  B . n 
B 2 2    DA  2    -5   -5   DA  DA  B . n 
B 2 3    DG  3    -4   -4   DG  DG  B . n 
B 2 4    DA  4    -3   -3   DA  DA  B . n 
B 2 5    DT  5    -2   -2   DT  DT  B . n 
B 2 6    DA  6    -1   -1   DA  DA  B . n 
B 2 7    DT  7    0    0    DT  DT  B . n 
B 2 8    DG  8    1    1    DG  DG  B . n 
B 2 9    DC  9    2    2    DC  DC  B . n 
B 2 10   DA  10   3    3    DA  DA  B . n 
B 2 11   DT  11   4    4    DT  DT  B . n 
B 2 12   DC  12   5    5    DC  DC  B . n 
B 2 13   DT  13   6    6    DT  DT  B . n 
B 2 14   DC  14   7    7    DC  DC  B . n 
B 2 15   DC  15   8    8    DC  DC  B . n 
B 2 16   DC  16   9    9    DC  DC  B . n 
B 2 17   DC  17   10   10   DC  DC  B . n 
B 2 18   DC  18   11   11   DC  DC  B . n 
B 2 19   DT  19   12   12   DT  DT  B . n 
B 2 20   DA  20   13   13   DA  DA  B . n 
B 2 21   DC  21   14   14   DC  DC  B . n 
B 2 22   DT  22   15   15   DT  DT  B . n 
B 2 23   DG  23   16   16   DG  DG  B . n 
B 2 24   DT  24   17   17   DT  DT  B . n 
B 2 25   DA  25   18   18   DA  DA  B . n 
B 2 26   DC  26   19   19   DC  DC  B . n 
B 2 27   DA  27   20   20   DA  DA  B . n 
B 2 28   DC  28   21   21   DC  DC  B . n 
B 2 29   DC  29   22   22   DC  DC  B . n 
B 2 30   DA  30   23   23   DA  DA  B . n 
B 2 31   DC  31   24   24   DC  DC  B . n 
B 2 32   DC  32   25   25   DC  DC  B . n 
B 2 33   DA  33   26   26   DA  DA  B . n 
B 2 34   DA  34   27   27   DA  DA  B . n 
B 2 35   DA  35   28   28   DA  DA  B . n 
B 2 36   DA  36   29   29   DA  DA  B . n 
B 2 37   DG  37   30   30   DG  DG  B . n 
B 2 38   DT  38   31   31   DT  DT  B . n 
C 3 1    DT  1    1    1    DT  DT  C . n 
C 3 2    DT  2    2    2    DT  DT  C . n 
C 3 3    DT  3    3    3    DT  DT  C . n 
C 3 4    DT  4    4    4    DT  DT  C . n 
C 3 5    DG  5    5    5    DG  DG  C . n 
C 3 6    DG  6    6    6    DG  DG  C . n 
C 3 7    DT  7    7    7    DT  DT  C . n 
C 3 8    DG  8    8    8    DG  DG  C . n 
C 3 9    DG  9    9    9    DG  DG  C . n 
C 3 10   DT  10   10   10   DT  DT  C . n 
C 3 11   DG  11   11   11   DG  DG  C . n 
C 3 12   DT  12   12   12   DT  DT  C . n 
C 3 13   DA  13   13   13   DA  DA  C . n 
C 3 14   DC  14   14   14   DC  DC  C . n 
C 3 15   DA  15   15   15   DA  DA  C . n 
C 3 16   DG  16   16   16   DG  DG  C . n 
C 3 17   DT  17   17   17   DT  DT  C . n 
C 3 18   DA  18   18   18   DA  DA  C . n 
C 3 19   DG  19   19   19   DG  DG  C . n 
C 3 20   DG  20   20   20   DG  DG  C . n 
C 3 21   DG  21   21   21   DG  DG  C . n 
C 3 22   DG  22   22   22   DG  DG  C . n 
C 3 23   DG  23   23   23   DG  DG  C . n 
C 3 24   DA  24   24   24   DA  DA  C . n 
C 3 25   DG  25   25   25   DG  DG  C . n 
C 3 26   DA  26   26   26   DA  DA  C . n 
C 3 27   DT  27   27   27   DT  DT  C . n 
C 3 28   DG  28   28   28   DG  DG  C . n 
C 3 29   DC  29   29   29   DC  DC  C . n 
C 3 30   DA  30   30   30   DA  DA  C . n 
C 3 31   DT  31   31   31   DT  DT  C . n 
C 3 32   DA  32   32   32   DA  DA  C . n 
C 3 33   DT  33   33   33   DT  DT  C . n 
C 3 34   DC  34   34   34   DC  DC  C . n 
C 3 35   DT  35   35   35   DT  DT  C . n 
C 3 36   DA  36   36   36   DA  DA  C . n 
C 3 37   DA  37   37   37   DA  DA  C . n 
C 3 38   DC  38   38   38   DC  DC  C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9650  ? 
1 MORE         -93   ? 
1 'SSA (A^2)'  46280 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-04 
2 'Structure model' 1 1 2012-01-25 
3 'Structure model' 1 2 2012-02-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 REFMAC      .       ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
2 PDB_EXTRACT 3.10    'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 ADSC        Quantum ?               ?       ?                    ?                        'data collection' ? ?          ? 
4 HKL-2000    .       ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
5 SCALEPACK   .       ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
6 PHASES      .       ?               ?       ?                    ?                        phasing           ? ?          ? 
7 CNS         .       ?               ?       ?                    ?                        refinement        ? ?          ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CA  A LYS 169 ? ? CB  A LYS 169 ? ? 1.212 1.535 -0.323 0.022 N 
2  1 CA  A PRO 170 ? ? CB  A PRO 170 ? ? 1.342 1.531 -0.189 0.020 N 
3  1 CA  A PRO 170 ? ? C   A PRO 170 ? ? 1.391 1.524 -0.133 0.020 N 
4  1 CA  A LYS 171 ? ? CB  A LYS 171 ? ? 1.333 1.535 -0.202 0.022 N 
5  1 C   A LYS 171 ? ? O   A LYS 171 ? ? 1.103 1.229 -0.126 0.019 N 
6  1 C   A VAL 172 ? ? O   A VAL 172 ? ? 1.079 1.229 -0.150 0.019 N 
7  1 CA  A ALA 191 ? ? CB  A ALA 191 ? ? 1.202 1.520 -0.318 0.021 N 
8  1 CA  A ALA 191 ? ? C   A ALA 191 ? ? 1.345 1.525 -0.180 0.026 N 
9  1 C   A ALA 191 ? ? O   A ALA 191 ? ? 1.054 1.229 -0.175 0.019 N 
10 1 CA  A ILE 193 ? ? CB  A ILE 193 ? ? 1.351 1.544 -0.193 0.023 N 
11 1 CA  A PRO 200 ? ? C   A PRO 200 ? ? 1.350 1.524 -0.174 0.020 N 
12 1 C   A PRO 200 ? ? O   A PRO 200 ? ? 1.054 1.228 -0.174 0.020 N 
13 1 N   A ALA 201 ? ? CA  A ALA 201 ? ? 1.304 1.459 -0.155 0.020 N 
14 1 CA  A ALA 201 ? ? C   A ALA 201 ? ? 1.297 1.525 -0.228 0.026 N 
15 1 CA  A ALA 202 ? ? CB  A ALA 202 ? ? 1.343 1.520 -0.177 0.021 N 
16 1 CA  A ALA 207 ? ? CB  A ALA 207 ? ? 1.358 1.520 -0.162 0.021 N 
17 1 CB  A TYR 210 ? ? CG  A TYR 210 ? ? 1.394 1.512 -0.118 0.015 N 
18 1 CG  A TYR 210 ? ? CD2 A TYR 210 ? ? 1.296 1.387 -0.091 0.013 N 
19 1 CG  A TYR 210 ? ? CD1 A TYR 210 ? ? 1.262 1.387 -0.125 0.013 N 
20 1 CD1 A TYR 210 ? ? CE1 A TYR 210 ? ? 1.274 1.389 -0.115 0.015 N 
21 1 CE1 A TYR 210 ? ? CZ  A TYR 210 ? ? 1.294 1.381 -0.087 0.013 N 
22 1 CZ  A TYR 210 ? ? CE2 A TYR 210 ? ? 1.240 1.381 -0.141 0.013 N 
23 1 CE2 A TYR 210 ? ? CD2 A TYR 210 ? ? 1.261 1.389 -0.128 0.015 N 
24 1 CA  A HIS 212 ? ? CB  A HIS 212 ? ? 1.305 1.535 -0.230 0.022 N 
25 1 CA  A ILE 214 ? ? C   A ILE 214 ? ? 1.306 1.525 -0.219 0.026 N 
26 1 C   A ILE 214 ? ? O   A ILE 214 ? ? 1.083 1.229 -0.146 0.019 N 
27 1 CA  A ALA 216 ? ? CB  A ALA 216 ? ? 1.327 1.520 -0.193 0.021 N 
28 1 CB  A CYS 963 ? ? SG  A CYS 963 ? ? 1.928 1.818 0.110  0.017 N 
29 1 C6  C DG  16  ? ? O6  C DG  16  ? ? 1.176 1.237 -0.061 0.009 N 
30 1 C4  C DT  35  ? ? C5  C DT  35  ? ? 1.500 1.445 0.055  0.009 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N     A LYS 171  ? ? CA    A LYS 171  ? ? C  A LYS 171  ? ? 91.58  111.00 -19.42 2.70 N 
2  1 N     A SER 197  ? ? CA    A SER 197  ? ? C  A SER 197  ? ? 94.05  111.00 -16.95 2.70 N 
3  1 C     A HIS 199  ? ? N     A PRO 200  ? ? CD A PRO 200  ? ? 110.22 128.40 -18.18 2.10 Y 
4  1 N     A PRO 200  ? ? CA    A PRO 200  ? ? CB A PRO 200  ? ? 95.36  103.30 -7.94  1.20 N 
5  1 CB    A ALA 201  ? ? CA    A ALA 201  ? ? C  A ALA 201  ? ? 124.34 110.10 14.24  1.50 N 
6  1 N     A ALA 201  ? ? CA    A ALA 201  ? ? CB A ALA 201  ? ? 120.02 110.10 9.92   1.40 N 
7  1 C     A ALA 201  ? ? N     A ALA 202  ? ? CA A ALA 202  ? ? 136.90 121.70 15.20  2.50 Y 
8  1 N     A ALA 202  ? ? CA    A ALA 202  ? ? CB A ALA 202  ? ? 98.33  110.10 -11.77 1.40 N 
9  1 N     A ALA 202  ? ? CA    A ALA 202  ? ? C  A ALA 202  ? ? 93.60  111.00 -17.40 2.70 N 
10 1 N     A THR 205  ? ? CA    A THR 205  ? ? C  A THR 205  ? ? 128.97 111.00 17.97  2.70 N 
11 1 N     A VAL 206  ? ? CA    A VAL 206  ? ? CB A VAL 206  ? ? 97.13  111.50 -14.37 2.20 N 
12 1 N     A VAL 206  ? ? CA    A VAL 206  ? ? C  A VAL 206  ? ? 128.91 111.00 17.91  2.70 N 
13 1 N     A THR 209  ? ? CA    A THR 209  ? ? CB A THR 209  ? ? 124.28 110.30 13.98  1.90 N 
14 1 N     A TYR 210  ? ? CA    A TYR 210  ? ? CB A TYR 210  ? ? 98.35  110.60 -12.25 1.80 N 
15 1 CA    A TYR 210  ? ? CB    A TYR 210  ? ? CG A TYR 210  ? ? 101.23 113.40 -12.17 1.90 N 
16 1 N     A ILE 214  ? ? CA    A ILE 214  ? ? CB A ILE 214  ? ? 94.88  110.80 -15.92 2.30 N 
17 1 N     A ILE 214  ? ? CA    A ILE 214  ? ? C  A ILE 214  ? ? 128.66 111.00 17.66  2.70 N 
18 1 CB    A ALA 216  ? ? CA    A ALA 216  ? ? C  A ALA 216  ? ? 99.23  110.10 -10.87 1.50 N 
19 1 N     A ALA 216  ? ? CA    A ALA 216  ? ? C  A ALA 216  ? ? 129.74 111.00 18.74  2.70 N 
20 1 N     A LEU 253  ? ? CA    A LEU 253  ? ? C  A LEU 253  ? ? 92.79  111.00 -18.21 2.70 N 
21 1 N     A LEU 287  ? ? CA    A LEU 287  ? ? CB A LEU 287  ? ? 122.75 110.40 12.35  2.00 N 
22 1 C     A ASN 288  ? ? N     A LEU 289  ? ? CA A LEU 289  ? ? 140.35 121.70 18.65  2.50 Y 
23 1 N     A LEU 289  ? ? CA    A LEU 289  ? ? CB A LEU 289  ? ? 95.78  110.40 -14.62 2.00 N 
24 1 N     A GLY 390  ? ? CA    A GLY 390  ? ? C  A GLY 390  ? ? 128.64 113.10 15.54  2.50 N 
25 1 CB    A HIS 558  ? ? CA    A HIS 558  ? ? C  A HIS 558  ? ? 97.26  110.40 -13.14 2.00 N 
26 1 N     A GLY 559  ? ? CA    A GLY 559  ? ? C  A GLY 559  ? ? 131.70 113.10 18.60  2.50 N 
27 1 CB    A ALA 569  ? ? CA    A ALA 569  ? ? C  A ALA 569  ? ? 100.92 110.10 -9.18  1.50 N 
28 1 N     A HIS 592  ? ? CA    A HIS 592  ? ? C  A HIS 592  ? ? 93.83  111.00 -17.17 2.70 N 
29 1 N     A GLY 593  ? ? CA    A GLY 593  ? ? C  A GLY 593  ? ? 130.63 113.10 17.53  2.50 N 
30 1 C     A GLY 593  ? ? N     A LEU 594  ? ? CA A LEU 594  ? ? 139.18 121.70 17.48  2.50 Y 
31 1 N     A LEU 662  ? ? CA    A LEU 662  ? ? C  A LEU 662  ? ? 127.32 111.00 16.32  2.70 N 
32 1 N     A LEU 696  ? ? CA    A LEU 696  ? ? CB A LEU 696  ? ? 97.49  110.40 -12.91 2.00 N 
33 1 CA    A LEU 696  ? ? CB    A LEU 696  ? ? CG A LEU 696  ? ? 131.89 115.30 16.59  2.30 N 
34 1 N     A THR 731  ? ? CA    A THR 731  ? ? C  A THR 731  ? ? 92.18  111.00 -18.82 2.70 N 
35 1 C     A THR 731  ? ? N     A PRO 732  ? ? CA A PRO 732  ? ? 109.96 119.30 -9.34  1.50 Y 
36 1 N     A SER 740  ? ? CA    A SER 740  ? ? C  A SER 740  ? ? 130.07 111.00 19.07  2.70 N 
37 1 N     A GLY 743  ? ? CA    A GLY 743  ? ? C  A GLY 743  ? ? 129.43 113.10 16.33  2.50 N 
38 1 CB    A SER 774  ? ? CA    A SER 774  ? ? C  A SER 774  ? ? 95.66  110.10 -14.44 1.90 N 
39 1 N     A ASN 775  ? ? CA    A ASN 775  ? ? C  A ASN 775  ? ? 93.16  111.00 -17.84 2.70 N 
40 1 N     A GLY 831  ? ? CA    A GLY 831  ? ? C  A GLY 831  ? ? 130.79 113.10 17.69  2.50 N 
41 1 CB    A CYS 963  ? ? CA    A CYS 963  ? ? C  A CYS 963  ? ? 121.63 111.50 10.13  1.20 N 
42 1 N     A ASP 965  ? ? CA    A ASP 965  ? ? C  A ASP 965  ? ? 130.04 111.00 19.04  2.70 N 
43 1 N     A ASN 1046 ? ? CA    A ASN 1046 ? ? C  A ASN 1046 ? ? 92.95  111.00 -18.05 2.70 N 
44 1 N     A SER 1047 ? ? CA    A SER 1047 ? ? CB A SER 1047 ? ? 100.94 110.50 -9.56  1.50 N 
45 1 "O4'" B DA  23   ? ? "C1'" B DA  23   ? ? N9 B DA  23   ? ? 110.12 108.30 1.82   0.30 N 
46 1 "O4'" C DG  19   ? ? "C1'" C DG  19   ? ? N9 C DG  19   ? ? 110.15 108.30 1.85   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 VAL A 172  ? ? -76.84  -163.60 
2   1 LEU A 196  ? ? -104.40 -85.76  
3   1 HIS A 199  ? ? -133.85 -51.31  
4   1 VAL A 208  ? ? 36.16   50.96   
5   1 TYR A 210  ? ? -124.55 -67.11  
6   1 ILE A 213  ? ? 44.69   72.80   
7   1 THR A 221  ? ? -47.48  172.77  
8   1 ASP A 224  ? ? -79.77  -71.17  
9   1 GLU A 247  ? ? -82.11  35.38   
10  1 LEU A 248  ? ? -137.06 -52.29  
11  1 ARG A 249  ? ? -82.25  30.56   
12  1 PRO A 252  ? ? -61.79  88.88   
13  1 ASP A 256  ? ? -76.25  -161.14 
14  1 THR A 257  ? ? -104.47 -86.16  
15  1 VAL A 275  ? ? -95.89  -61.63  
16  1 ALA A 277  ? ? -107.48 -72.56  
17  1 SER A 278  ? ? -68.51  5.36    
18  1 LEU A 287  ? ? -156.82 -16.39  
19  1 ASN A 288  ? ? 57.10   -152.41 
20  1 VAL A 295  ? ? -38.79  -32.83  
21  1 SER A 299  ? ? -73.05  45.36   
22  1 ASN A 300  ? ? -149.49 -159.57 
23  1 GLN A 319  ? ? -90.44  -72.45  
24  1 LEU A 323  ? ? -120.11 -158.89 
25  1 VAL A 329  ? ? -64.66  3.55    
26  1 THR A 343  ? ? -68.95  0.89    
27  1 ALA A 354  ? ? -142.24 -10.11  
28  1 SER A 367  ? ? -66.62  60.88   
29  1 VAL A 384  ? ? -61.45  0.46    
30  1 ALA A 388  ? ? -145.89 -3.04   
31  1 HIS A 389  ? ? -146.95 -21.60  
32  1 SER A 401  ? ? -79.74  38.91   
33  1 ARG A 414  ? ? -56.21  -70.79  
34  1 VAL A 418  ? ? -29.48  -51.96  
35  1 CYS A 420  ? ? -46.02  -16.92  
36  1 GLN A 421  ? ? -85.22  -76.41  
37  1 THR A 426  ? ? -64.55  -177.99 
38  1 VAL A 452  ? ? -41.72  -18.97  
39  1 LEU A 453  ? ? -78.11  -73.59  
40  1 HIS A 457  ? ? -175.38 118.44  
41  1 ALA A 476  ? ? -68.79  -72.90  
42  1 ALA A 500  ? ? -39.95  -38.61  
43  1 LEU A 520  ? ? -104.97 -71.98  
44  1 ALA A 523  ? ? -149.48 -51.98  
45  1 PRO A 528  ? ? -58.23  -0.65   
46  1 SER A 536  ? ? -112.30 58.09   
47  1 LEU A 544  ? ? -24.93  -50.31  
48  1 THR A 557  ? ? -92.92  -78.01  
49  1 HIS A 558  ? ? -70.83  32.19   
50  1 SER A 570  ? ? -75.81  27.40   
51  1 LEU A 584  ? ? -142.73 -12.81  
52  1 HIS A 592  ? ? -150.89 -157.67 
53  1 PRO A 596  ? ? -87.38  -70.58  
54  1 ARG A 617  ? ? -65.17  -75.24  
55  1 VAL A 621  ? ? -56.16  -0.93   
56  1 CYS A 623  ? ? -92.73  -64.93  
57  1 HIS A 626  ? ? -141.50 15.83   
58  1 GLN A 632  ? ? -43.88  -16.77  
59  1 ALA A 635  ? ? -68.24  13.12   
60  1 LYS A 643  ? ? -98.16  -71.32  
61  1 LEU A 656  ? ? -37.90  -39.07  
62  1 LEU A 662  ? ? 30.10   59.30   
63  1 THR A 663  ? ? -31.27  131.66  
64  1 ASN A 673  ? ? -116.51 -166.63 
65  1 VAL A 689  ? ? -61.71  3.43    
66  1 ALA A 693  ? ? -136.99 -40.44  
67  1 THR A 697  ? ? -50.85  178.16  
68  1 ALA A 705  ? ? -68.84  5.93    
69  1 LEU A 724  ? ? -73.00  -75.23  
70  1 HIS A 728  ? ? -102.35 -73.47  
71  1 THR A 731  ? ? -111.82 -157.01 
72  1 SER A 740  ? ? -88.82  33.81   
73  1 VAL A 751  ? ? -93.22  -70.65  
74  1 GLN A 752  ? ? -37.60  -31.07  
75  1 ALA A 761  ? ? -141.90 -47.79  
76  1 PRO A 766  ? ? -24.77  -39.26  
77  1 ALA A 773  ? ? -148.91 17.40   
78  1 LEU A 789  ? ? -28.43  -57.99  
79  1 LEU A 798  ? ? 175.21  174.79  
80  1 GLN A 814  ? ? -57.94  -5.98   
81  1 CYS A 827  ? ? -69.39  12.97   
82  1 THR A 833  ? ? -137.50 -156.71 
83  1 SER A 842  ? ? -79.56  24.05   
84  1 GLU A 851  ? ? -54.60  -5.79   
85  1 VAL A 859  ? ? -138.95 -38.74  
86  1 ALA A 863  ? ? -140.79 -18.70  
87  1 LEU A 866  ? ? -33.35  108.76  
88  1 LYS A 881  ? ? -28.83  -48.77  
89  1 THR A 901  ? ? -74.70  -161.44 
90  1 LEU A 925  ? ? -66.55  -70.02  
91  1 SER A 944  ? ? -82.91  30.34   
92  1 VAL A 961  ? ? -37.61  -29.31  
93  1 ASP A 965  ? ? -100.23 -69.43  
94  1 HIS A 966  ? ? -112.03 53.51   
95  1 PRO A 970  ? ? -38.56  -32.35  
96  1 LYS A 983  ? ? -54.11  -2.84   
97  1 ARG A 991  ? ? -45.89  -15.65  
98  1 GLN A 998  ? ? -91.72  -68.77  
99  1 LEU A 1004 ? ? -37.88  -27.96  
100 1 ALA A 1009 ? ? -68.55  5.59    
101 1 ASN A 1013 ? ? -100.50 -74.45  
102 1 LEU A 1025 ? ? -147.81 -20.50  
103 1 VAL A 1041 ? ? -160.51 118.77  
104 1 ILE A 1043 ? ? -155.98 46.57   
105 1 ASN A 1046 ? ? 59.46   -142.50 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS A 169 ? ? PRO A 170 ? ? -149.50 
2 1 THR A 209 ? ? TYR A 210 ? ? -145.04 
3 1 GLN A 211 ? ? HIS A 212 ? ? 123.57  
4 1 THR A 215 ? ? ALA A 216 ? ? -148.36 
5 1 PRO A 286 ? ? LEU A 287 ? ? 54.59   
6 1 GLY A 831 ? ? LEU A 832 ? ? -147.65 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 PRO A 200 ? ? 13.56 
2 1 PRO A 286 ? ? 20.83 
3 1 THR A 731 ? ? 10.46 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 169  ? CG  ? A LYS 67  CG  
2   1 Y 1 A LYS 169  ? CD  ? A LYS 67  CD  
3   1 Y 1 A LYS 169  ? CE  ? A LYS 67  CE  
4   1 Y 1 A LYS 169  ? NZ  ? A LYS 67  NZ  
5   1 Y 1 A PRO 170  ? CG  ? A PRO 68  CG  
6   1 Y 1 A PRO 170  ? CD  ? A PRO 68  CD  
7   1 Y 1 A LYS 171  ? CG  ? A LYS 69  CG  
8   1 Y 1 A LYS 171  ? CD  ? A LYS 69  CD  
9   1 Y 1 A LYS 171  ? CE  ? A LYS 69  CE  
10  1 Y 1 A LYS 171  ? NZ  ? A LYS 69  NZ  
11  1 Y 1 A VAL 172  ? CB  ? A VAL 70  CB  
12  1 Y 1 A VAL 172  ? CG1 ? A VAL 70  CG1 
13  1 Y 1 A VAL 172  ? CG2 ? A VAL 70  CG2 
14  1 Y 1 A ARG 173  ? CG  ? A ARG 71  CG  
15  1 Y 1 A ARG 173  ? CD  ? A ARG 71  CD  
16  1 Y 1 A ARG 173  ? NE  ? A ARG 71  NE  
17  1 Y 1 A ARG 173  ? CZ  ? A ARG 71  CZ  
18  1 Y 1 A ARG 173  ? NH1 ? A ARG 71  NH1 
19  1 Y 1 A ARG 173  ? NH2 ? A ARG 71  NH2 
20  1 Y 1 A GLU 181  ? CG  ? A GLU 79  CG  
21  1 Y 1 A GLU 181  ? CD  ? A GLU 79  CD  
22  1 Y 1 A GLU 181  ? OE1 ? A GLU 79  OE1 
23  1 Y 1 A GLU 181  ? OE2 ? A GLU 79  OE2 
24  1 Y 1 A LEU 183  ? CG  ? A LEU 81  CG  
25  1 Y 1 A LEU 183  ? CD1 ? A LEU 81  CD1 
26  1 Y 1 A LEU 183  ? CD2 ? A LEU 81  CD2 
27  1 Y 1 A VAL 184  ? CG1 ? A VAL 82  CG1 
28  1 Y 1 A VAL 184  ? CG2 ? A VAL 82  CG2 
29  1 Y 1 A HIS 192  ? CG  ? A HIS 90  CG  
30  1 Y 1 A HIS 192  ? ND1 ? A HIS 90  ND1 
31  1 Y 1 A HIS 192  ? CD2 ? A HIS 90  CD2 
32  1 Y 1 A HIS 192  ? CE1 ? A HIS 90  CE1 
33  1 Y 1 A HIS 192  ? NE2 ? A HIS 90  NE2 
34  1 Y 1 A ILE 193  ? CG1 ? A ILE 91  CG1 
35  1 Y 1 A ILE 193  ? CG2 ? A ILE 91  CG2 
36  1 Y 1 A ILE 193  ? CD1 ? A ILE 91  CD1 
37  1 Y 1 A VAL 194  ? CB  ? A VAL 92  CB  
38  1 Y 1 A VAL 194  ? CG1 ? A VAL 92  CG1 
39  1 Y 1 A VAL 194  ? CG2 ? A VAL 92  CG2 
40  1 Y 1 A LEU 196  ? CB  ? A LEU 94  CB  
41  1 Y 1 A LEU 196  ? CG  ? A LEU 94  CG  
42  1 Y 1 A LEU 196  ? CD1 ? A LEU 94  CD1 
43  1 Y 1 A LEU 196  ? CD2 ? A LEU 94  CD2 
44  1 Y 1 A SER 197  ? OG  ? A SER 95  OG  
45  1 Y 1 A GLN 198  ? CG  ? A GLN 96  CG  
46  1 Y 1 A GLN 198  ? CD  ? A GLN 96  CD  
47  1 Y 1 A GLN 198  ? OE1 ? A GLN 96  OE1 
48  1 Y 1 A GLN 198  ? NE2 ? A GLN 96  NE2 
49  1 Y 1 A THR 205  ? CB  ? A THR 103 CB  
50  1 Y 1 A THR 205  ? OG1 ? A THR 103 OG1 
51  1 Y 1 A THR 205  ? CG2 ? A THR 103 CG2 
52  1 Y 1 A VAL 206  ? CG1 ? A VAL 104 CG1 
53  1 Y 1 A VAL 206  ? CG2 ? A VAL 104 CG2 
54  1 Y 1 A GLN 211  ? CG  ? A GLN 109 CG  
55  1 Y 1 A GLN 211  ? CD  ? A GLN 109 CD  
56  1 Y 1 A GLN 211  ? OE1 ? A GLN 109 OE1 
57  1 Y 1 A GLN 211  ? NE2 ? A GLN 109 NE2 
58  1 Y 1 A HIS 212  ? CG  ? A HIS 110 CG  
59  1 Y 1 A HIS 212  ? ND1 ? A HIS 110 ND1 
60  1 Y 1 A HIS 212  ? CD2 ? A HIS 110 CD2 
61  1 Y 1 A HIS 212  ? CE1 ? A HIS 110 CE1 
62  1 Y 1 A HIS 212  ? NE2 ? A HIS 110 NE2 
63  1 Y 1 A ILE 213  ? CG1 ? A ILE 111 CG1 
64  1 Y 1 A ILE 213  ? CG2 ? A ILE 111 CG2 
65  1 Y 1 A ILE 213  ? CD1 ? A ILE 111 CD1 
66  1 Y 1 A GLU 223  ? CG  ? A GLU 121 CG  
67  1 Y 1 A GLU 223  ? CD  ? A GLU 121 CD  
68  1 Y 1 A GLU 223  ? OE1 ? A GLU 121 OE1 
69  1 Y 1 A GLU 223  ? OE2 ? A GLU 121 OE2 
70  1 Y 1 A LEU 287  ? CG  ? A LEU 185 CG  
71  1 Y 1 A LEU 287  ? CD1 ? A LEU 185 CD1 
72  1 Y 1 A LEU 287  ? CD2 ? A LEU 185 CD2 
73  1 Y 1 A GLU 681  ? CG  ? A GLU 579 CG  
74  1 Y 1 A GLU 681  ? CD  ? A GLU 579 CD  
75  1 Y 1 A GLU 681  ? OE1 ? A GLU 579 OE1 
76  1 Y 1 A GLU 681  ? OE2 ? A GLU 579 OE2 
77  1 Y 1 A GLU 715  ? CG  ? A GLU 613 CG  
78  1 Y 1 A GLU 715  ? CD  ? A GLU 613 CD  
79  1 Y 1 A GLU 715  ? OE1 ? A GLU 613 OE1 
80  1 Y 1 A GLU 715  ? OE2 ? A GLU 613 OE2 
81  1 Y 1 A LEU 724  ? CG  ? A LEU 622 CG  
82  1 Y 1 A LEU 724  ? CD1 ? A LEU 622 CD1 
83  1 Y 1 A LEU 724  ? CD2 ? A LEU 622 CD2 
84  1 Y 1 A HIS 762  ? CG  ? A HIS 660 CG  
85  1 Y 1 A HIS 762  ? ND1 ? A HIS 660 ND1 
86  1 Y 1 A HIS 762  ? CD2 ? A HIS 660 CD2 
87  1 Y 1 A HIS 762  ? CE1 ? A HIS 660 CE1 
88  1 Y 1 A HIS 762  ? NE2 ? A HIS 660 NE2 
89  1 Y 1 A ARG 889  ? CG  ? A ARG 787 CG  
90  1 Y 1 A ARG 889  ? CD  ? A ARG 787 CD  
91  1 Y 1 A ARG 889  ? NE  ? A ARG 787 NE  
92  1 Y 1 A ARG 889  ? CZ  ? A ARG 787 CZ  
93  1 Y 1 A ARG 889  ? NH1 ? A ARG 787 NH1 
94  1 Y 1 A ARG 889  ? NH2 ? A ARG 787 NH2 
95  1 Y 1 A LEU 928  ? CG  ? A LEU 826 CG  
96  1 Y 1 A LEU 928  ? CD1 ? A LEU 826 CD1 
97  1 Y 1 A LEU 928  ? CD2 ? A LEU 826 CD2 
98  1 Y 1 A VAL 1041 ? CG1 ? A VAL 939 CG1 
99  1 Y 1 A VAL 1041 ? CG2 ? A VAL 939 CG2 
100 1 Y 1 A ILE 1043 ? CB  ? A ILE 941 CB  
101 1 Y 1 A ILE 1043 ? CG1 ? A ILE 941 CG1 
102 1 Y 1 A ILE 1043 ? CG2 ? A ILE 941 CG2 
103 1 Y 1 A ILE 1043 ? CD1 ? A ILE 941 CD1 
104 1 Y 1 A ALA 1044 ? CB  ? A ALA 942 CB  
105 1 Y 1 A ASN 1046 ? CG  ? A ASN 944 CG  
106 1 Y 1 A ASN 1046 ? OD1 ? A ASN 944 OD1 
107 1 Y 1 A ASN 1046 ? ND2 ? A ASN 944 ND2 
108 1 Y 1 A SER 1047 ? OG  ? A SER 945 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 103  ? A MET 1    
2   1 Y 1 A ALA 104  ? A ALA 2    
3   1 Y 1 A SER 105  ? A SER 3    
4   1 Y 1 A SER 106  ? A SER 4    
5   1 Y 1 A HIS 107  ? A HIS 5    
6   1 Y 1 A HIS 108  ? A HIS 6    
7   1 Y 1 A HIS 109  ? A HIS 7    
8   1 Y 1 A HIS 110  ? A HIS 8    
9   1 Y 1 A HIS 111  ? A HIS 9    
10  1 Y 1 A HIS 112  ? A HIS 10   
11  1 Y 1 A SER 113  ? A SER 11   
12  1 Y 1 A SER 114  ? A SER 12   
13  1 Y 1 A GLY 115  ? A GLY 13   
14  1 Y 1 A LEU 116  ? A LEU 14   
15  1 Y 1 A VAL 117  ? A VAL 15   
16  1 Y 1 A PRO 118  ? A PRO 16   
17  1 Y 1 A ARG 119  ? A ARG 17   
18  1 Y 1 A GLY 120  ? A GLY 18   
19  1 Y 1 A SER 121  ? A SER 19   
20  1 Y 1 A SER 122  ? A SER 20   
21  1 Y 1 A GLY 123  ? A GLY 21   
22  1 Y 1 A SER 124  ? A SER 22   
23  1 Y 1 A SER 125  ? A SER 23   
24  1 Y 1 A MET 126  ? A MET 24   
25  1 Y 1 A ALA 127  ? A ALA 25   
26  1 Y 1 A ALA 128  ? A ALA 26   
27  1 Y 1 A ARG 129  ? A ARG 27   
28  1 Y 1 A PRO 130  ? A PRO 28   
29  1 Y 1 A PRO 131  ? A PRO 29   
30  1 Y 1 A ARG 132  ? A ARG 30   
31  1 Y 1 A ALA 133  ? A ALA 31   
32  1 Y 1 A LYS 134  ? A LYS 32   
33  1 Y 1 A PRO 135  ? A PRO 33   
34  1 Y 1 A ALA 136  ? A ALA 34   
35  1 Y 1 A PRO 137  ? A PRO 35   
36  1 Y 1 A ARG 138  ? A ARG 36   
37  1 Y 1 A ARG 139  ? A ARG 37   
38  1 Y 1 A ARG 140  ? A ARG 38   
39  1 Y 1 A ALA 141  ? A ALA 39   
40  1 Y 1 A ALA 142  ? A ALA 40   
41  1 Y 1 A GLN 143  ? A GLN 41   
42  1 Y 1 A PRO 144  ? A PRO 42   
43  1 Y 1 A SER 145  ? A SER 43   
44  1 Y 1 A ASP 146  ? A ASP 44   
45  1 Y 1 A ALA 147  ? A ALA 45   
46  1 Y 1 A SER 148  ? A SER 46   
47  1 Y 1 A PRO 149  ? A PRO 47   
48  1 Y 1 A ALA 150  ? A ALA 48   
49  1 Y 1 A ALA 151  ? A ALA 49   
50  1 Y 1 A GLN 152  ? A GLN 50   
51  1 Y 1 A VAL 153  ? A VAL 51   
52  1 Y 1 A ASP 154  ? A ASP 52   
53  1 Y 1 A LEU 155  ? A LEU 53   
54  1 Y 1 A ARG 156  ? A ARG 54   
55  1 Y 1 A THR 157  ? A THR 55   
56  1 Y 1 A LEU 158  ? A LEU 56   
57  1 Y 1 A GLY 159  ? A GLY 57   
58  1 Y 1 A TYR 160  ? A TYR 58   
59  1 Y 1 A SER 161  ? A SER 59   
60  1 Y 1 A GLN 162  ? A GLN 60   
61  1 Y 1 A GLN 163  ? A GLN 61   
62  1 Y 1 A GLN 164  ? A GLN 62   
63  1 Y 1 A GLN 165  ? A GLN 63   
64  1 Y 1 A GLU 166  ? A GLU 64   
65  1 Y 1 A LYS 167  ? A LYS 65   
66  1 Y 1 A ILE 168  ? A ILE 66   
67  1 Y 1 A SER 174  ? A SER 72   
68  1 Y 1 A THR 175  ? A THR 73   
69  1 Y 1 A VAL 176  ? A VAL 74   
70  1 Y 1 A ALA 177  ? A ALA 75   
71  1 Y 1 A GLN 178  ? A GLN 76   
72  1 Y 1 A HIS 179  ? A HIS 77   
73  1 Y 1 A HIS 180  ? A HIS 78   
74  1 Y 1 A ALA 182  ? A ALA 80   
75  1 Y 1 A GLY 185  ? A GLY 83   
76  1 Y 1 A HIS 186  ? A HIS 84   
77  1 Y 1 A GLY 187  ? A GLY 85   
78  1 Y 1 A PHE 188  ? A PHE 86   
79  1 Y 1 A THR 189  ? A THR 87   
80  1 Y 1 A HIS 190  ? A HIS 88   
81  1 Y 1 A PRO 218  ? A PRO 116  
82  1 Y 1 A GLU 219  ? A GLU 117  
83  1 Y 1 A GLY 284  ? A GLY 182  
84  1 Y 1 A ALA 285  ? A ALA 183  
85  1 Y 1 A VAL 791  ? A VAL 689  
86  1 Y 1 A LEU 792  ? A LEU 690  
87  1 Y 1 A CYS 793  ? A CYS 691  
88  1 Y 1 A GLN 794  ? A GLN 692  
89  1 Y 1 A ALA 795  ? A ALA 693  
90  1 Y 1 A HIS 796  ? A HIS 694  
91  1 Y 1 A ALA 931  ? A ALA 829  
92  1 Y 1 A HIS 932  ? A HIS 830  
93  1 Y 1 A GLY 1049 ? A GLY 947  
94  1 Y 1 A LYS 1050 ? A LYS 948  
95  1 Y 1 A GLN 1051 ? A GLN 949  
96  1 Y 1 A ALA 1052 ? A ALA 950  
97  1 Y 1 A LEU 1053 ? A LEU 951  
98  1 Y 1 A GLU 1054 ? A GLU 952  
99  1 Y 1 A THR 1055 ? A THR 953  
100 1 Y 1 A VAL 1056 ? A VAL 954  
101 1 Y 1 A GLN 1057 ? A GLN 955  
102 1 Y 1 A ARG 1058 ? A ARG 956  
103 1 Y 1 A LEU 1059 ? A LEU 957  
104 1 Y 1 A LEU 1060 ? A LEU 958  
105 1 Y 1 A PRO 1061 ? A PRO 959  
106 1 Y 1 A VAL 1062 ? A VAL 960  
107 1 Y 1 A LEU 1063 ? A LEU 961  
108 1 Y 1 A CYS 1064 ? A CYS 962  
109 1 Y 1 A GLN 1065 ? A GLN 963  
110 1 Y 1 A ASP 1066 ? A ASP 964  
111 1 Y 1 A HIS 1067 ? A HIS 965  
112 1 Y 1 A GLY 1068 ? A GLY 966  
113 1 Y 1 A LEU 1069 ? A LEU 967  
114 1 Y 1 A THR 1070 ? A THR 968  
115 1 Y 1 A PRO 1071 ? A PRO 969  
116 1 Y 1 A ASN 1072 ? A ASN 970  
117 1 Y 1 A GLN 1073 ? A GLN 971  
118 1 Y 1 A VAL 1074 ? A VAL 972  
119 1 Y 1 A VAL 1075 ? A VAL 973  
120 1 Y 1 A ALA 1076 ? A ALA 974  
121 1 Y 1 A ILE 1077 ? A ILE 975  
122 1 Y 1 A ALA 1078 ? A ALA 976  
123 1 Y 1 A SER 1079 ? A SER 977  
124 1 Y 1 A ASN 1080 ? A ASN 978  
125 1 Y 1 A GLY 1081 ? A GLY 979  
126 1 Y 1 A GLY 1082 ? A GLY 980  
127 1 Y 1 A LYS 1083 ? A LYS 981  
128 1 Y 1 A GLN 1084 ? A GLN 982  
129 1 Y 1 A ALA 1085 ? A ALA 983  
130 1 Y 1 A LEU 1086 ? A LEU 984  
131 1 Y 1 A GLU 1087 ? A GLU 985  
132 1 Y 1 A SER 1088 ? A SER 986  
133 1 Y 1 A ILE 1089 ? A ILE 987  
134 1 Y 1 A VAL 1090 ? A VAL 988  
135 1 Y 1 A ALA 1091 ? A ALA 989  
136 1 Y 1 A GLN 1092 ? A GLN 990  
137 1 Y 1 A LEU 1093 ? A LEU 991  
138 1 Y 1 A SER 1094 ? A SER 992  
139 1 Y 1 A ARG 1095 ? A ARG 993  
140 1 Y 1 A PRO 1096 ? A PRO 994  
141 1 Y 1 A ASP 1097 ? A ASP 995  
142 1 Y 1 A PRO 1098 ? A PRO 996  
143 1 Y 1 A ALA 1099 ? A ALA 997  
144 1 Y 1 A LEU 1100 ? A LEU 998  
145 1 Y 1 A ALA 1101 ? A ALA 999  
146 1 Y 1 A ALA 1102 ? A ALA 1000 
147 1 Y 1 A LEU 1103 ? A LEU 1001 
148 1 Y 1 A THR 1104 ? A THR 1002 
149 1 Y 1 A ASN 1105 ? A ASN 1003 
150 1 Y 1 A ASP 1106 ? A ASP 1004 
151 1 Y 1 A HIS 1107 ? A HIS 1005 
152 1 Y 1 A LEU 1108 ? A LEU 1006 
153 1 Y 1 A VAL 1109 ? A VAL 1007 
154 1 Y 1 A ALA 1110 ? A ALA 1008 
155 1 Y 1 A LEU 1111 ? A LEU 1009 
156 1 Y 1 A ALA 1112 ? A ALA 1010 
157 1 Y 1 A CYS 1113 ? A CYS 1011 
158 1 Y 1 A LEU 1114 ? A LEU 1012 
159 1 Y 1 A GLY 1115 ? A GLY 1013 
160 1 Y 1 A GLY 1116 ? A GLY 1014 
161 1 Y 1 A ARG 1117 ? A ARG 1015 
162 1 Y 1 A PRO 1118 ? A PRO 1016 
163 1 Y 1 A ALA 1119 ? A ALA 1017 
164 1 Y 1 A MET 1120 ? A MET 1018 
165 1 Y 1 A ASP 1121 ? A ASP 1019 
166 1 Y 1 A ALA 1122 ? A ALA 1020 
167 1 Y 1 A VAL 1123 ? A VAL 1021 
168 1 Y 1 A LYS 1124 ? A LYS 1022 
169 1 Y 1 A LYS 1125 ? A LYS 1023 
170 1 Y 1 A GLY 1126 ? A GLY 1024 
171 1 Y 1 A LEU 1127 ? A LEU 1025 
172 1 Y 1 A PRO 1128 ? A PRO 1026 
173 1 Y 1 A HIS 1129 ? A HIS 1027 
174 1 Y 1 A ALA 1130 ? A ALA 1028 
175 1 Y 1 A PRO 1131 ? A PRO 1029 
176 1 Y 1 A GLU 1132 ? A GLU 1030 
177 1 Y 1 A LEU 1133 ? A LEU 1031 
178 1 Y 1 A ILE 1134 ? A ILE 1032 
179 1 Y 1 A ARG 1135 ? A ARG 1033 
180 1 Y 1 A ARG 1136 ? A ARG 1034 
181 1 Y 1 A VAL 1137 ? A VAL 1035 
182 1 Y 1 A ASN 1138 ? A ASN 1036 
183 1 Y 1 A ARG 1139 ? A ARG 1037 
184 1 Y 1 A ARG 1140 ? A ARG 1038 
185 1 Y 1 A ILE 1141 ? A ILE 1039 
186 1 Y 1 A GLY 1142 ? A GLY 1040 
187 1 Y 1 A GLU 1143 ? A GLU 1041 
188 1 Y 1 A ARG 1144 ? A ARG 1042 
189 1 Y 1 A THR 1145 ? A THR 1043 
190 1 Y 1 A SER 1146 ? A SER 1044 
191 1 Y 1 A HIS 1147 ? A HIS 1045 
192 1 Y 1 A ARG 1148 ? A ARG 1046 
193 1 Y 1 A VAL 1149 ? A VAL 1047 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3UGM 'double helix'        
3UGM 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 1  1_555 C DA 36 1_555 -0.915 -0.188 -0.495 10.853  -10.354 -3.083 1  B_DT-6:DA36_C B -6 ? C 36 ? 20 1 
1 B DA 2  1_555 C DT 35 1_555 1.400  -0.406 0.250  7.049   -15.095 -2.001 2  B_DA-5:DT35_C B -5 ? C 35 ? 20 1 
1 B DG 3  1_555 C DC 34 1_555 -0.160 -0.170 0.512  9.801   -3.702  -2.145 3  B_DG-4:DC34_C B -4 ? C 34 ? 19 1 
1 B DA 4  1_555 C DT 33 1_555 0.462  -0.233 0.254  -1.582  -8.220  -3.018 4  B_DA-3:DT33_C B -3 ? C 33 ? 20 1 
1 B DT 5  1_555 C DA 32 1_555 0.110  -0.402 0.370  6.594   -15.000 1.755  5  B_DT-2:DA32_C B -2 ? C 32 ? 20 1 
1 B DA 6  1_555 C DT 31 1_555 0.814  -0.126 -0.028 -6.935  -19.175 2.124  6  B_DA-1:DT31_C B -1 ? C 31 ? 20 1 
1 B DT 7  1_555 C DA 30 1_555 -0.117 -0.298 -0.324 4.109   -17.055 1.899  7  B_DT0:DA30_C  B 0  ? C 30 ? 20 1 
1 B DG 8  1_555 C DC 29 1_555 0.604  0.011  -0.502 -22.819 -6.902  -2.994 8  B_DG1:DC29_C  B 1  ? C 29 ? 19 1 
1 B DC 9  1_555 C DG 28 1_555 -0.224 -0.092 -0.081 -13.669 -4.586  -5.456 9  B_DC2:DG28_C  B 2  ? C 28 ? 19 1 
1 B DA 10 1_555 C DT 27 1_555 -0.510 -0.320 0.186  -6.267  -4.952  -9.492 10 B_DA3:DT27_C  B 3  ? C 27 ? 20 1 
1 B DT 11 1_555 C DA 26 1_555 -0.257 -0.076 -0.266 8.312   -7.914  4.709  11 B_DT4:DA26_C  B 4  ? C 26 ? 20 1 
1 B DC 12 1_555 C DG 25 1_555 0.481  0.061  0.418  0.279   -12.024 8.036  12 B_DC5:DG25_C  B 5  ? C 25 ? 19 1 
1 B DT 13 1_555 C DA 24 1_555 -0.100 -0.104 -0.110 14.621  -16.468 -7.267 13 B_DT6:DA24_C  B 6  ? C 24 ? 20 1 
1 B DC 14 1_555 C DG 23 1_555 0.697  -0.197 -0.004 -2.715  -5.156  0.793  14 B_DC7:DG23_C  B 7  ? C 23 ? 19 1 
1 B DC 15 1_555 C DG 22 1_555 -0.568 -0.291 -0.557 6.738   3.031   -6.988 15 B_DC8:DG22_C  B 8  ? C 22 ? 19 1 
1 B DC 16 1_555 C DG 21 1_555 0.065  -0.132 -0.277 8.545   -3.613  3.838  16 B_DC9:DG21_C  B 9  ? C 21 ? 19 1 
1 B DC 17 1_555 C DG 20 1_555 -0.873 -0.228 -0.193 7.653   -11.010 1.182  17 B_DC10:DG20_C B 10 ? C 20 ? 19 1 
1 B DC 18 1_555 C DG 19 1_555 -0.071 -0.083 0.206  -6.974  -1.297  -0.838 18 B_DC11:DG19_C B 11 ? C 19 ? 19 1 
1 B DT 19 1_555 C DA 18 1_555 -0.978 -0.282 0.138  2.121   1.322   2.593  19 B_DT12:DA18_C B 12 ? C 18 ? 20 1 
1 B DA 20 1_555 C DT 17 1_555 0.178  -0.087 -0.033 11.148  3.518   0.035  20 B_DA13:DT17_C B 13 ? C 17 ? 20 1 
1 B DC 21 1_555 C DG 16 1_555 0.001  -0.096 -0.597 10.039  -5.938  -2.018 21 B_DC14:DG16_C B 14 ? C 16 ? 19 1 
1 B DT 22 1_555 C DA 15 1_555 -0.685 -0.055 -0.352 10.510  0.316   2.476  22 B_DT15:DA15_C B 15 ? C 15 ? 20 1 
1 B DG 23 1_555 C DC 14 1_555 -0.204 -0.136 -1.045 -24.683 -18.838 2.552  23 B_DG16:DC14_C B 16 ? C 14 ? 19 1 
1 B DT 24 1_555 C DA 13 1_555 -0.339 0.025  0.125  -12.727 -15.564 3.159  24 B_DT17:DA13_C B 17 ? C 13 ? 20 1 
1 B DA 25 1_555 C DT 12 1_555 -0.008 -0.271 0.176  -9.612  -2.735  -4.545 25 B_DA18:DT12_C B 18 ? C 12 ? 20 1 
1 B DC 26 1_555 C DG 11 1_555 -0.439 -0.167 0.237  -5.658  -7.803  2.892  26 B_DC19:DG11_C B 19 ? C 11 ? 19 1 
1 B DA 27 1_555 C DT 10 1_555 0.899  -0.347 0.584  6.186   0.764   -6.934 27 B_DA20:DT10_C B 20 ? C 10 ? 20 1 
1 B DC 28 1_555 C DG 9  1_555 -0.728 -0.180 -0.003 7.470   -4.826  -6.620 28 B_DC21:DG9_C  B 21 ? C 9  ? 19 1 
1 B DC 29 1_555 C DG 8  1_555 0.174  -0.135 -0.403 5.715   -0.117  -1.245 29 B_DC22:DG8_C  B 22 ? C 8  ? 19 1 
1 B DA 30 1_555 C DT 7  1_555 0.325  -0.229 0.423  -3.787  -0.993  -8.542 30 B_DA23:DT7_C  B 23 ? C 7  ? 20 1 
1 B DC 31 1_555 C DG 6  1_555 0.054  -0.135 0.322  0.877   -11.333 -6.700 31 B_DC24:DG6_C  B 24 ? C 6  ? 19 1 
1 B DC 32 1_555 C DG 5  1_555 -0.756 -0.027 0.193  9.311   -4.922  -3.223 32 B_DC25:DG5_C  B 25 ? C 5  ? 19 1 
1 B DA 33 1_555 C DT 4  1_555 0.894  0.039  0.022  1.983   -15.930 -8.182 33 B_DA26:DT4_C  B 26 ? C 4  ? 20 1 
1 B DA 34 1_555 C DT 3  1_555 -0.417 -0.244 0.076  11.535  -7.373  -4.386 34 B_DA27:DT3_C  B 27 ? C 3  ? 20 1 
1 B DA 35 1_555 C DT 2  1_555 1.751  -0.484 -0.045 9.618   -18.021 -0.135 35 B_DA28:DT2_C  B 28 ? C 2  ? 20 1 
1 B DA 36 1_555 C DT 1  1_555 1.215  -0.667 0.438  9.466   -20.834 -1.922 36 B_DA29:DT1_C  B 29 ? C 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 1  1_555 C DA 36 1_555 B DA 2  1_555 C DT 35 1_555 -0.706 0.561  3.388 -7.098 -1.514 55.368 0.690  0.326  3.433 -1.622  
7.602   55.804 1  BB_DT-6DA-5:DT35DA36_CC B -6 ? C 36 ? B -5 ? C 35 ? 
1 B DA 2  1_555 C DT 35 1_555 B DG 3  1_555 C DC 34 1_555 0.592  -0.941 3.043 -2.986 0.116  19.803 -2.755 -2.975 2.917 0.334   
8.618   20.025 2  BB_DA-5DG-4:DC34DT35_CC B -5 ? C 35 ? B -4 ? C 34 ? 
1 B DG 3  1_555 C DC 34 1_555 B DA 4  1_555 C DT 33 1_555 -0.639 -0.014 3.469 -0.973 -5.967 45.212 0.538  0.734  3.456 -7.721  
1.259   45.593 3  BB_DG-4DA-3:DT33DC34_CC B -4 ? C 34 ? B -3 ? C 33 ? 
1 B DA 4  1_555 C DT 33 1_555 B DT 5  1_555 C DA 32 1_555 0.323  -0.815 2.937 -2.661 1.155  30.629 -1.736 -1.072 2.868 2.179   
5.022   30.763 4  BB_DA-3DT-2:DA32DT33_CC B -3 ? C 33 ? B -2 ? C 32 ? 
1 B DT 5  1_555 C DA 32 1_555 B DA 6  1_555 C DT 31 1_555 0.664  -0.394 3.612 6.642  7.423  36.642 -1.661 -0.076 3.532 11.547  
-10.333 37.927 5  BB_DT-2DA-1:DT31DA32_CC B -2 ? C 32 ? B -1 ? C 31 ? 
1 B DA 6  1_555 C DT 31 1_555 B DT 7  1_555 C DA 30 1_555 0.096  -1.258 2.947 2.885  1.275  23.393 -3.455 0.627  2.866 3.125   
-7.073  23.602 6  BB_DA-1DT0:DA30DT31_CC  B -1 ? C 31 ? B 0  ? C 30 ? 
1 B DT 7  1_555 C DA 30 1_555 B DG 8  1_555 C DC 29 1_555 -0.265 -0.830 4.010 0.920  3.691  43.181 -1.561 0.468  3.924 5.004   
-1.247  43.340 7  BB_DT0DG1:DC29DA30_CC   B 0  ? C 30 ? B 1  ? C 29 ? 
1 B DG 8  1_555 C DC 29 1_555 B DC 9  1_555 C DG 28 1_555 -0.301 -0.907 3.081 -1.650 3.785  26.637 -2.842 0.255  2.939 8.152   
3.553   26.949 8  BB_DG1DC2:DG28DC29_CC   B 1  ? C 29 ? B 2  ? C 28 ? 
1 B DC 9  1_555 C DG 28 1_555 B DA 10 1_555 C DT 27 1_555 -0.489 -0.531 3.140 -2.764 3.908  31.556 -1.645 0.409  3.084 7.135   
5.046   31.908 9  BB_DC2DA3:DT27DG28_CC   B 2  ? C 28 ? B 3  ? C 27 ? 
1 B DA 10 1_555 C DT 27 1_555 B DT 11 1_555 C DA 26 1_555 0.607  -0.299 3.079 5.396  -3.291 29.872 0.061  -0.119 3.151 -6.295  
-10.323 30.518 10 BB_DA3DT4:DA26DT27_CC   B 3  ? C 27 ? B 4  ? C 26 ? 
1 B DT 11 1_555 C DA 26 1_555 B DC 12 1_555 C DG 25 1_555 0.368  -0.079 3.652 -2.593 5.510  38.107 -0.877 -0.914 3.575 8.373   
3.941   38.572 11 BB_DT4DC5:DG25DA26_CC   B 4  ? C 26 ? B 5  ? C 25 ? 
1 B DC 12 1_555 C DG 25 1_555 B DT 13 1_555 C DA 24 1_555 -0.548 -0.514 2.895 3.660  1.735  30.545 -1.262 1.654  2.779 3.275   
-6.909  30.806 12 BB_DC5DT6:DA24DG25_CC   B 5  ? C 25 ? B 6  ? C 24 ? 
1 B DT 13 1_555 C DA 24 1_555 B DC 14 1_555 C DG 23 1_555 1.096  -0.403 4.201 3.066  6.407  37.809 -1.638 -1.174 4.153 9.782   
-4.681  38.447 13 BB_DT6DC7:DG23DA24_CC   B 6  ? C 24 ? B 7  ? C 23 ? 
1 B DC 14 1_555 C DG 23 1_555 B DC 15 1_555 C DG 22 1_555 -0.352 -0.807 2.928 1.085  -1.091 23.690 -1.639 1.177  2.942 -2.654  
-2.639  23.739 14 BB_DC7DC8:DG22DG23_CC   B 7  ? C 23 ? B 8  ? C 22 ? 
1 B DC 15 1_555 C DG 22 1_555 B DC 16 1_555 C DG 21 1_555 0.459  -1.314 3.470 -2.322 3.068  33.108 -2.822 -1.202 3.300 5.361   
4.057   33.324 15 BB_DC8DC9:DG21DG22_CC   B 8  ? C 22 ? B 9  ? C 21 ? 
1 B DC 16 1_555 C DG 21 1_555 B DC 17 1_555 C DG 20 1_555 -0.315 -1.827 3.283 -1.939 11.103 23.028 -6.907 0.224  2.199 25.913  
4.525   25.605 16 BB_DC9DC10:DG20DG21_CC  B 9  ? C 21 ? B 10 ? C 20 ? 
1 B DC 17 1_555 C DG 20 1_555 B DC 18 1_555 C DG 19 1_555 0.606  -0.235 3.968 1.538  -9.814 47.728 0.635  -0.591 3.957 -11.978 
-1.877  48.691 17 BB_DC10DC11:DG19DG20_CC B 10 ? C 20 ? B 11 ? C 19 ? 
1 B DC 18 1_555 C DG 19 1_555 B DT 19 1_555 C DA 18 1_555 -0.004 -1.273 3.224 -1.052 1.712  19.651 -4.503 -0.477 3.098 4.999   
3.072   19.753 18 BB_DC11DT12:DA18DG19_CC B 11 ? C 19 ? B 12 ? C 18 ? 
1 B DT 19 1_555 C DA 18 1_555 B DA 20 1_555 C DT 17 1_555 -0.156 -1.020 3.164 1.085  -3.029 37.358 -1.199 0.381  3.228 -4.719  
-1.690  37.491 19 BB_DT12DA13:DT17DA18_CC B 12 ? C 18 ? B 13 ? C 17 ? 
1 B DA 20 1_555 C DT 17 1_555 B DC 21 1_555 C DG 16 1_555 0.049  -1.513 3.331 3.997  0.046  29.978 -2.910 0.732  3.307 0.088   
-7.684  30.238 20 BB_DA13DC14:DG16DT17_CC B 13 ? C 17 ? B 14 ? C 16 ? 
1 B DC 21 1_555 C DG 16 1_555 B DT 22 1_555 C DA 15 1_555 0.628  -1.713 3.551 0.792  -4.558 27.761 -2.315 -1.082 3.794 -9.418  
-1.636  28.136 21 BB_DC14DT15:DA15DG16_CC B 14 ? C 16 ? B 15 ? C 15 ? 
1 B DT 22 1_555 C DA 15 1_555 B DG 23 1_555 C DC 14 1_555 0.237  -1.092 4.109 9.060  16.120 33.585 -4.109 1.010  3.235 25.629  
-14.404 38.210 22 BB_DT15DG16:DC14DA15_CC B 15 ? C 15 ? B 16 ? C 14 ? 
1 B DG 23 1_555 C DC 14 1_555 B DT 24 1_555 C DA 13 1_555 -0.420 -0.624 3.029 -7.705 -1.929 35.884 -0.741 -0.328 3.079 -3.085  
12.320  36.724 23 BB_DG16DT17:DA13DC14_CC B 16 ? C 14 ? B 17 ? C 13 ? 
1 B DT 24 1_555 C DA 13 1_555 B DA 25 1_555 C DT 12 1_555 -0.476 -0.541 3.222 -3.174 0.545  33.307 -1.029 0.307  3.244 0.948   
5.522   33.458 24 BB_DT17DA18:DT12DA13_CC B 17 ? C 13 ? B 18 ? C 12 ? 
1 B DA 25 1_555 C DT 12 1_555 B DC 26 1_555 C DG 11 1_555 -0.341 -1.320 3.365 2.422  0.535  24.102 -3.319 1.595  3.285 1.277   
-5.781  24.228 25 BB_DA18DC19:DG11DT12_CC B 18 ? C 12 ? B 19 ? C 11 ? 
1 B DC 26 1_555 C DG 11 1_555 B DA 27 1_555 C DT 10 1_555 -0.206 -0.389 3.012 -1.224 -3.849 38.501 -0.149 0.172  3.041 -5.817  
1.851   38.705 26 BB_DC19DA20:DT10DG11_CC B 19 ? C 11 ? B 20 ? C 10 ? 
1 B DA 27 1_555 C DT 10 1_555 B DC 28 1_555 C DG 9  1_555 0.446  -1.464 3.233 5.456  5.424  23.744 -4.938 0.525  2.863 12.760  
-12.835 24.942 27 BB_DA20DC21:DG9DT10_CC  B 20 ? C 10 ? B 21 ? C 9  ? 
1 B DC 28 1_555 C DG 9  1_555 B DC 29 1_555 C DG 8  1_555 0.622  -0.400 3.241 6.054  5.657  35.607 -1.418 -0.157 3.202 9.099   
-9.739  36.528 28 BB_DC21DC22:DG8DG9_CC   B 21 ? C 9  ? B 22 ? C 8  ? 
1 B DC 29 1_555 C DG 8  1_555 B DA 30 1_555 C DT 7  1_555 -0.257 -0.114 3.543 -4.321 4.516  31.170 -1.107 -0.391 3.495 8.301   
7.941   31.775 29 BB_DC22DA23:DT7DG8_CC   B 22 ? C 8  ? B 23 ? C 7  ? 
1 B DA 30 1_555 C DT 7  1_555 B DC 31 1_555 C DG 6  1_555 0.100  -0.534 3.330 0.817  2.168  33.591 -1.280 -0.038 3.292 3.745   
-1.412  33.669 30 BB_DA23DC24:DG6DT7_CC   B 23 ? C 7  ? B 24 ? C 6  ? 
1 B DC 31 1_555 C DG 6  1_555 B DC 32 1_555 C DG 5  1_555 0.268  -0.708 3.050 4.335  4.540  28.511 -2.318 0.339  2.912 9.079   
-8.670  29.180 31 BB_DC24DC25:DG5DG6_CC   B 24 ? C 6  ? B 25 ? C 5  ? 
1 B DC 32 1_555 C DG 5  1_555 B DA 33 1_555 C DT 4  1_555 -0.187 -0.132 3.527 0.310  0.888  41.383 -0.289 0.300  3.522 1.257   
-0.438  41.393 32 BB_DC25DA26:DT4DG5_CC   B 25 ? C 5  ? B 26 ? C 4  ? 
1 B DA 33 1_555 C DT 4  1_555 B DA 34 1_555 C DT 3  1_555 -0.624 -0.725 2.777 -2.645 -1.059 28.519 -1.260 0.746  2.847 -2.142  
5.352   28.658 33 BB_DA26DA27:DT3DT4_CC   B 26 ? C 4  ? B 27 ? C 3  ? 
1 B DA 34 1_555 C DT 3  1_555 B DA 35 1_555 C DT 2  1_555 0.360  -0.530 3.517 0.020  -4.983 50.108 -0.237 -0.421 3.552 -5.867  
-0.024  50.340 34 BB_DA27DA28:DT2DT3_CC   B 27 ? C 3  ? B 28 ? C 2  ? 
1 B DA 35 1_555 C DT 2  1_555 B DA 36 1_555 C DT 1  1_555 0.592  -0.491 3.312 -1.360 -5.803 35.436 0.051  -1.158 3.324 -9.452  
2.215   35.918 35 BB_DA28DA29:DT1DT2_CC   B 28 ? C 2  ? B 29 ? C 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   1    1   HOH HOH A . 
D 4 HOH 2   3    3   HOH HOH A . 
D 4 HOH 3   4    4   HOH HOH A . 
D 4 HOH 4   5    5   HOH HOH A . 
D 4 HOH 5   6    6   HOH HOH A . 
D 4 HOH 6   8    8   HOH HOH A . 
D 4 HOH 7   10   10  HOH HOH A . 
D 4 HOH 8   11   11  HOH HOH A . 
D 4 HOH 9   12   12  HOH HOH A . 
D 4 HOH 10  13   13  HOH HOH A . 
D 4 HOH 11  15   15  HOH HOH A . 
D 4 HOH 12  17   17  HOH HOH A . 
D 4 HOH 13  18   18  HOH HOH A . 
D 4 HOH 14  19   19  HOH HOH A . 
D 4 HOH 15  20   20  HOH HOH A . 
D 4 HOH 16  21   21  HOH HOH A . 
D 4 HOH 17  22   22  HOH HOH A . 
D 4 HOH 18  23   23  HOH HOH A . 
D 4 HOH 19  25   25  HOH HOH A . 
D 4 HOH 20  27   27  HOH HOH A . 
D 4 HOH 21  28   28  HOH HOH A . 
D 4 HOH 22  29   29  HOH HOH A . 
D 4 HOH 23  30   30  HOH HOH A . 
D 4 HOH 24  32   32  HOH HOH A . 
D 4 HOH 25  33   33  HOH HOH A . 
D 4 HOH 26  34   34  HOH HOH A . 
D 4 HOH 27  35   35  HOH HOH A . 
D 4 HOH 28  36   36  HOH HOH A . 
D 4 HOH 29  38   38  HOH HOH A . 
D 4 HOH 30  39   39  HOH HOH A . 
D 4 HOH 31  41   41  HOH HOH A . 
D 4 HOH 32  42   42  HOH HOH A . 
D 4 HOH 33  45   45  HOH HOH A . 
D 4 HOH 34  46   46  HOH HOH A . 
D 4 HOH 35  47   47  HOH HOH A . 
D 4 HOH 36  48   48  HOH HOH A . 
D 4 HOH 37  50   50  HOH HOH A . 
D 4 HOH 38  51   51  HOH HOH A . 
D 4 HOH 39  52   52  HOH HOH A . 
D 4 HOH 40  54   54  HOH HOH A . 
D 4 HOH 41  55   55  HOH HOH A . 
D 4 HOH 42  56   56  HOH HOH A . 
D 4 HOH 43  57   57  HOH HOH A . 
D 4 HOH 44  59   59  HOH HOH A . 
D 4 HOH 45  60   60  HOH HOH A . 
D 4 HOH 46  61   61  HOH HOH A . 
D 4 HOH 47  62   62  HOH HOH A . 
D 4 HOH 48  63   63  HOH HOH A . 
D 4 HOH 49  64   64  HOH HOH A . 
D 4 HOH 50  66   66  HOH HOH A . 
D 4 HOH 51  67   67  HOH HOH A . 
D 4 HOH 52  68   68  HOH HOH A . 
D 4 HOH 53  69   69  HOH HOH A . 
D 4 HOH 54  70   70  HOH HOH A . 
D 4 HOH 55  71   71  HOH HOH A . 
D 4 HOH 56  73   73  HOH HOH A . 
D 4 HOH 57  75   75  HOH HOH A . 
D 4 HOH 58  76   76  HOH HOH A . 
D 4 HOH 59  78   78  HOH HOH A . 
D 4 HOH 60  80   80  HOH HOH A . 
D 4 HOH 61  81   81  HOH HOH A . 
D 4 HOH 62  82   82  HOH HOH A . 
D 4 HOH 63  83   83  HOH HOH A . 
D 4 HOH 64  84   84  HOH HOH A . 
D 4 HOH 65  85   85  HOH HOH A . 
D 4 HOH 66  87   87  HOH HOH A . 
D 4 HOH 67  88   88  HOH HOH A . 
D 4 HOH 68  91   91  HOH HOH A . 
D 4 HOH 69  92   92  HOH HOH A . 
D 4 HOH 70  93   93  HOH HOH A . 
D 4 HOH 71  94   94  HOH HOH A . 
D 4 HOH 72  95   95  HOH HOH A . 
D 4 HOH 73  97   97  HOH HOH A . 
D 4 HOH 74  98   98  HOH HOH A . 
D 4 HOH 75  101  101 HOH HOH A . 
D 4 HOH 76  102  102 HOH HOH A . 
D 4 HOH 77  1150 103 HOH HOH A . 
D 4 HOH 78  1151 106 HOH HOH A . 
D 4 HOH 79  1152 107 HOH HOH A . 
D 4 HOH 80  1153 108 HOH HOH A . 
D 4 HOH 81  1154 109 HOH HOH A . 
D 4 HOH 82  1155 110 HOH HOH A . 
D 4 HOH 83  1156 112 HOH HOH A . 
D 4 HOH 84  1157 115 HOH HOH A . 
D 4 HOH 85  1158 117 HOH HOH A . 
D 4 HOH 86  1159 118 HOH HOH A . 
D 4 HOH 87  1160 119 HOH HOH A . 
D 4 HOH 88  1161 120 HOH HOH A . 
D 4 HOH 89  1162 121 HOH HOH A . 
D 4 HOH 90  1163 122 HOH HOH A . 
D 4 HOH 91  1164 123 HOH HOH A . 
D 4 HOH 92  1165 124 HOH HOH A . 
D 4 HOH 93  1166 125 HOH HOH A . 
D 4 HOH 94  1167 126 HOH HOH A . 
D 4 HOH 95  1168 130 HOH HOH A . 
D 4 HOH 96  1169 131 HOH HOH A . 
D 4 HOH 97  1170 132 HOH HOH A . 
D 4 HOH 98  1171 134 HOH HOH A . 
D 4 HOH 99  1172 135 HOH HOH A . 
D 4 HOH 100 1173 136 HOH HOH A . 
D 4 HOH 101 1174 137 HOH HOH A . 
D 4 HOH 102 1175 138 HOH HOH A . 
D 4 HOH 103 1176 139 HOH HOH A . 
D 4 HOH 104 1177 141 HOH HOH A . 
D 4 HOH 105 1178 142 HOH HOH A . 
D 4 HOH 106 1179 143 HOH HOH A . 
D 4 HOH 107 1180 144 HOH HOH A . 
D 4 HOH 108 1181 145 HOH HOH A . 
D 4 HOH 109 1182 147 HOH HOH A . 
D 4 HOH 110 1183 148 HOH HOH A . 
D 4 HOH 111 1184 150 HOH HOH A . 
D 4 HOH 112 1185 152 HOH HOH A . 
D 4 HOH 113 1186 153 HOH HOH A . 
D 4 HOH 114 1187 154 HOH HOH A . 
D 4 HOH 115 1188 155 HOH HOH A . 
D 4 HOH 116 1189 156 HOH HOH A . 
D 4 HOH 117 1190 157 HOH HOH A . 
D 4 HOH 118 1191 158 HOH HOH A . 
D 4 HOH 119 1192 159 HOH HOH A . 
D 4 HOH 120 1193 160 HOH HOH A . 
D 4 HOH 121 1194 161 HOH HOH A . 
D 4 HOH 122 1195 163 HOH HOH A . 
D 4 HOH 123 1196 166 HOH HOH A . 
D 4 HOH 124 1197 168 HOH HOH A . 
D 4 HOH 125 1198 169 HOH HOH A . 
D 4 HOH 126 1199 171 HOH HOH A . 
D 4 HOH 127 1200 172 HOH HOH A . 
D 4 HOH 128 1201 173 HOH HOH A . 
D 4 HOH 129 1202 174 HOH HOH A . 
D 4 HOH 130 1203 175 HOH HOH A . 
D 4 HOH 131 1204 176 HOH HOH A . 
D 4 HOH 132 1205 177 HOH HOH A . 
D 4 HOH 133 1206 180 HOH HOH A . 
D 4 HOH 134 1207 182 HOH HOH A . 
D 4 HOH 135 1208 184 HOH HOH A . 
D 4 HOH 136 1209 186 HOH HOH A . 
D 4 HOH 137 1210 187 HOH HOH A . 
D 4 HOH 138 1211 188 HOH HOH A . 
D 4 HOH 139 1212 190 HOH HOH A . 
D 4 HOH 140 1213 191 HOH HOH A . 
D 4 HOH 141 1214 192 HOH HOH A . 
D 4 HOH 142 1215 193 HOH HOH A . 
D 4 HOH 143 1216 194 HOH HOH A . 
D 4 HOH 144 1217 195 HOH HOH A . 
D 4 HOH 145 1218 196 HOH HOH A . 
D 4 HOH 146 1219 197 HOH HOH A . 
D 4 HOH 147 1220 198 HOH HOH A . 
D 4 HOH 148 1221 199 HOH HOH A . 
D 4 HOH 149 1222 200 HOH HOH A . 
D 4 HOH 150 1223 201 HOH HOH A . 
D 4 HOH 151 1224 204 HOH HOH A . 
D 4 HOH 152 1225 209 HOH HOH A . 
D 4 HOH 153 1226 210 HOH HOH A . 
D 4 HOH 154 1227 211 HOH HOH A . 
D 4 HOH 155 1228 212 HOH HOH A . 
D 4 HOH 156 1229 213 HOH HOH A . 
D 4 HOH 157 1230 214 HOH HOH A . 
D 4 HOH 158 1231 216 HOH HOH A . 
D 4 HOH 159 1232 113 HOH HOH A . 
E 4 HOH 1   32   2   HOH HOH B . 
E 4 HOH 2   33   7   HOH HOH B . 
E 4 HOH 3   34   9   HOH HOH B . 
E 4 HOH 4   35   16  HOH HOH B . 
E 4 HOH 5   65   65  HOH HOH B . 
E 4 HOH 6   72   72  HOH HOH B . 
E 4 HOH 7   79   79  HOH HOH B . 
E 4 HOH 8   89   89  HOH HOH B . 
E 4 HOH 9   99   99  HOH HOH B . 
E 4 HOH 10  100  100 HOH HOH B . 
E 4 HOH 11  129  129 HOH HOH B . 
E 4 HOH 12  140  140 HOH HOH B . 
E 4 HOH 13  151  151 HOH HOH B . 
E 4 HOH 14  165  165 HOH HOH B . 
E 4 HOH 15  170  170 HOH HOH B . 
E 4 HOH 16  178  178 HOH HOH B . 
E 4 HOH 17  183  183 HOH HOH B . 
E 4 HOH 18  185  185 HOH HOH B . 
E 4 HOH 19  205  205 HOH HOH B . 
E 4 HOH 20  206  206 HOH HOH B . 
E 4 HOH 21  207  207 HOH HOH B . 
E 4 HOH 22  208  208 HOH HOH B . 
E 4 HOH 23  215  215 HOH HOH B . 
F 4 HOH 1   39   14  HOH HOH C . 
F 4 HOH 2   40   40  HOH HOH C . 
F 4 HOH 3   41   24  HOH HOH C . 
F 4 HOH 4   42   26  HOH HOH C . 
F 4 HOH 5   43   43  HOH HOH C . 
F 4 HOH 6   44   44  HOH HOH C . 
F 4 HOH 7   45   31  HOH HOH C . 
F 4 HOH 8   46   37  HOH HOH C . 
F 4 HOH 9   49   49  HOH HOH C . 
F 4 HOH 10  53   53  HOH HOH C . 
F 4 HOH 11  58   58  HOH HOH C . 
F 4 HOH 12  74   74  HOH HOH C . 
F 4 HOH 13  77   77  HOH HOH C . 
F 4 HOH 14  86   86  HOH HOH C . 
F 4 HOH 15  90   90  HOH HOH C . 
F 4 HOH 16  96   96  HOH HOH C . 
F 4 HOH 17  104  104 HOH HOH C . 
F 4 HOH 18  105  105 HOH HOH C . 
F 4 HOH 19  111  111 HOH HOH C . 
F 4 HOH 20  114  114 HOH HOH C . 
F 4 HOH 21  116  116 HOH HOH C . 
F 4 HOH 22  127  127 HOH HOH C . 
F 4 HOH 23  128  128 HOH HOH C . 
F 4 HOH 24  133  133 HOH HOH C . 
F 4 HOH 25  146  146 HOH HOH C . 
F 4 HOH 26  162  162 HOH HOH C . 
F 4 HOH 27  164  164 HOH HOH C . 
F 4 HOH 28  167  167 HOH HOH C . 
F 4 HOH 29  179  179 HOH HOH C . 
F 4 HOH 30  181  181 HOH HOH C . 
F 4 HOH 31  189  189 HOH HOH C . 
F 4 HOH 32  202  202 HOH HOH C . 
F 4 HOH 33  203  203 HOH HOH C . 
F 4 HOH 34  217  217 HOH HOH C . 
#