data_3UGV
# 
_entry.id   3UGV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UGV         
RCSB  RCSB068738   
WWPDB D_1000068738 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          EFI-501650 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3UGV 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-03 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vetting, M.W.'                    1  
'Toro, R.'                         2  
'Bhosle, R.'                       3  
'Wasserman, S.R.'                  4  
'Morisco, L.L.'                    5  
'Hillerich, B.'                    6  
'Washington, E.'                   7  
'Scott Glenn, A.'                  8  
'Chowdhury, S.'                    9  
'Evans, B.'                        10 
'Hammonds, J.'                     11 
'Zencheck, W.D.'                   12 
'Imker, H.J.'                      13 
'Gerlt, J.A.'                      14 
'Almo, S.C.'                       15 
'Enzyme Function Initiative (EFI)' 16 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of an enolase from alpha pretobacterium bal199 (EFI TARGET EFI-501650) with bound MG' 
_citation.journal_abbrev            'to be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vetting, M.W.'                    1  
primary 'Toro, R.'                         2  
primary 'Bhosle, R.'                       3  
primary 'Wasserman, S.R.'                  4  
primary 'Morisco, L.L.'                    5  
primary 'Hillerich, B.'                    6  
primary 'Washington, E.'                   7  
primary 'Scott Glenn, A.'                  8  
primary 'Chowdhury, S.'                    9  
primary 'Evans, B.'                        10 
primary 'Hammonds, J.'                     11 
primary 'Zencheck, W.D.'                   12 
primary 'Imker, H.J.'                      13 
primary 'Gerlt, J.A.'                      14 
primary 'Almo, S.C.'                       15 
primary 'Enzyme Function Initiative (EFI)' 16 
# 
_cell.length_a           152.711 
_cell.length_b           152.984 
_cell.length_c           173.535 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3UGV 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              32 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3UGV 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Enolase           42937.938 8   ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'   24.305    16  ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION'    35.453    3   ? ? ? ? 
4 non-polymer syn 'NICKEL (II) ION' 58.693    2   ? ? ? ? 
5 water       nat water             18.015    866 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMMAQTLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVP
KAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKA
YNSNGLWLKSPAEVAAEAVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTR
QIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAW
GIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLVE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMMAQTLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVP
KAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKA
YNSNGLWLKSPAEVAAEAVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTR
QIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAW
GIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLVE
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         EFI-501650 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  MET n 
1 25  ALA n 
1 26  GLN n 
1 27  THR n 
1 28  LEU n 
1 29  THR n 
1 30  PHE n 
1 31  ARG n 
1 32  LYS n 
1 33  LEU n 
1 34  THR n 
1 35  ALA n 
1 36  ARG n 
1 37  PRO n 
1 38  VAL n 
1 39  LEU n 
1 40  LEU n 
1 41  LYS n 
1 42  LEU n 
1 43  GLN n 
1 44  ARG n 
1 45  PRO n 
1 46  VAL n 
1 47  THR n 
1 48  ALA n 
1 49  ARG n 
1 50  ILE n 
1 51  ALA n 
1 52  THR n 
1 53  ILE n 
1 54  PRO n 
1 55  ASP n 
1 56  TRP n 
1 57  PRO n 
1 58  LEU n 
1 59  ILE n 
1 60  LEU n 
1 61  ILE n 
1 62  ASP n 
1 63  ILE n 
1 64  GLU n 
1 65  THR n 
1 66  GLU n 
1 67  GLU n 
1 68  GLY n 
1 69  VAL n 
1 70  PRO n 
1 71  GLY n 
1 72  ARG n 
1 73  ALA n 
1 74  TYR n 
1 75  LEU n 
1 76  GLU n 
1 77  PRO n 
1 78  TYR n 
1 79  VAL n 
1 80  PRO n 
1 81  LYS n 
1 82  ALA n 
1 83  MET n 
1 84  LYS n 
1 85  TYR n 
1 86  LEU n 
1 87  VAL n 
1 88  PRO n 
1 89  ALA n 
1 90  LEU n 
1 91  HIS n 
1 92  ASP n 
1 93  MET n 
1 94  SER n 
1 95  ASP n 
1 96  MET n 
1 97  LEU n 
1 98  ALA n 
1 99  GLY n 
1 100 GLN n 
1 101 PRO n 
1 102 LEU n 
1 103 ALA n 
1 104 PRO n 
1 105 ALA n 
1 106 GLU n 
1 107 ILE n 
1 108 TYR n 
1 109 ASP n 
1 110 LYS n 
1 111 THR n 
1 112 ARG n 
1 113 LYS n 
1 114 SER n 
1 115 LEU n 
1 116 HIS n 
1 117 PHE n 
1 118 VAL n 
1 119 GLY n 
1 120 TYR n 
1 121 ALA n 
1 122 GLY n 
1 123 LEU n 
1 124 SER n 
1 125 MET n 
1 126 ILE n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 GLY n 
1 131 VAL n 
1 132 ASP n 
1 133 MET n 
1 134 ALA n 
1 135 VAL n 
1 136 TRP n 
1 137 ASP n 
1 138 ALA n 
1 139 LEU n 
1 140 ALA n 
1 141 ARG n 
1 142 ALA n 
1 143 ALA n 
1 144 ASN n 
1 145 MET n 
1 146 PRO n 
1 147 LEU n 
1 148 CYS n 
1 149 THR n 
1 150 LEU n 
1 151 LEU n 
1 152 GLY n 
1 153 GLY n 
1 154 THR n 
1 155 PRO n 
1 156 GLY n 
1 157 SER n 
1 158 VAL n 
1 159 LYS n 
1 160 ALA n 
1 161 TYR n 
1 162 ASN n 
1 163 SER n 
1 164 ASN n 
1 165 GLY n 
1 166 LEU n 
1 167 TRP n 
1 168 LEU n 
1 169 LYS n 
1 170 SER n 
1 171 PRO n 
1 172 ALA n 
1 173 GLU n 
1 174 VAL n 
1 175 ALA n 
1 176 ALA n 
1 177 GLU n 
1 178 ALA n 
1 179 VAL n 
1 180 GLU n 
1 181 LEU n 
1 182 LYS n 
1 183 ALA n 
1 184 GLU n 
1 185 GLY n 
1 186 GLN n 
1 187 GLY n 
1 188 THR n 
1 189 GLY n 
1 190 PHE n 
1 191 LYS n 
1 192 GLY n 
1 193 LEU n 
1 194 LYS n 
1 195 LEU n 
1 196 ARG n 
1 197 MET n 
1 198 GLY n 
1 199 ARG n 
1 200 ASP n 
1 201 ASP n 
1 202 PRO n 
1 203 ALA n 
1 204 VAL n 
1 205 ASP n 
1 206 ILE n 
1 207 GLU n 
1 208 THR n 
1 209 ALA n 
1 210 GLU n 
1 211 ALA n 
1 212 VAL n 
1 213 TRP n 
1 214 ASP n 
1 215 ALA n 
1 216 VAL n 
1 217 GLY n 
1 218 ARG n 
1 219 ASP n 
1 220 THR n 
1 221 ALA n 
1 222 LEU n 
1 223 MET n 
1 224 VAL n 
1 225 ASP n 
1 226 PHE n 
1 227 ASN n 
1 228 GLN n 
1 229 GLY n 
1 230 LEU n 
1 231 ASP n 
1 232 MET n 
1 233 ALA n 
1 234 GLU n 
1 235 ALA n 
1 236 MET n 
1 237 HIS n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 GLN n 
1 242 ILE n 
1 243 ASP n 
1 244 ASP n 
1 245 LEU n 
1 246 GLY n 
1 247 LEU n 
1 248 GLU n 
1 249 TRP n 
1 250 ILE n 
1 251 GLU n 
1 252 GLU n 
1 253 PRO n 
1 254 VAL n 
1 255 VAL n 
1 256 TYR n 
1 257 ASP n 
1 258 ASN n 
1 259 PHE n 
1 260 ASP n 
1 261 GLY n 
1 262 TYR n 
1 263 ALA n 
1 264 GLN n 
1 265 LEU n 
1 266 ARG n 
1 267 HIS n 
1 268 ASP n 
1 269 LEU n 
1 270 LYS n 
1 271 THR n 
1 272 PRO n 
1 273 LEU n 
1 274 MET n 
1 275 ILE n 
1 276 GLY n 
1 277 GLU n 
1 278 ASN n 
1 279 PHE n 
1 280 TYR n 
1 281 GLY n 
1 282 PRO n 
1 283 ARG n 
1 284 GLU n 
1 285 MET n 
1 286 HIS n 
1 287 GLN n 
1 288 ALA n 
1 289 LEU n 
1 290 GLN n 
1 291 ALA n 
1 292 GLY n 
1 293 ALA n 
1 294 CYS n 
1 295 ASP n 
1 296 LEU n 
1 297 VAL n 
1 298 MET n 
1 299 PRO n 
1 300 ASP n 
1 301 PHE n 
1 302 MET n 
1 303 ARG n 
1 304 ILE n 
1 305 GLY n 
1 306 GLY n 
1 307 VAL n 
1 308 SER n 
1 309 GLY n 
1 310 TRP n 
1 311 MET n 
1 312 ARG n 
1 313 ALA n 
1 314 ALA n 
1 315 GLY n 
1 316 VAL n 
1 317 ALA n 
1 318 GLY n 
1 319 ALA n 
1 320 TRP n 
1 321 GLY n 
1 322 ILE n 
1 323 PRO n 
1 324 MET n 
1 325 SER n 
1 326 THR n 
1 327 HIS n 
1 328 LEU n 
1 329 TYR n 
1 330 PRO n 
1 331 GLU n 
1 332 VAL n 
1 333 GLY n 
1 334 ALA n 
1 335 HIS n 
1 336 VAL n 
1 337 MET n 
1 338 ARG n 
1 339 VAL n 
1 340 THR n 
1 341 GLU n 
1 342 THR n 
1 343 ALA n 
1 344 HIS n 
1 345 TRP n 
1 346 LEU n 
1 347 GLU n 
1 348 TRP n 
1 349 GLN n 
1 350 SER n 
1 351 TRP n 
1 352 ALA n 
1 353 ASP n 
1 354 PRO n 
1 355 ILE n 
1 356 LEU n 
1 357 GLN n 
1 358 GLU n 
1 359 PRO n 
1 360 TYR n 
1 361 ALA n 
1 362 LEU n 
1 363 SER n 
1 364 ASP n 
1 365 GLY n 
1 366 ASP n 
1 367 LEU n 
1 368 ILE n 
1 369 VAL n 
1 370 PRO n 
1 371 ASP n 
1 372 LYS n 
1 373 PRO n 
1 374 GLY n 
1 375 LEU n 
1 376 GLY n 
1 377 LEU n 
1 378 ASP n 
1 379 TRP n 
1 380 ASP n 
1 381 GLU n 
1 382 ASP n 
1 383 VAL n 
1 384 VAL n 
1 385 ALA n 
1 386 ALA n 
1 387 ASN n 
1 388 LEU n 
1 389 VAL n 
1 390 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BAL199_22462 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'alpha proteobacterium BAL199' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     331869 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A8TYI5_9PROT 
_struct_ref.pdbx_db_accession          A8TYI5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAQTLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLA
PAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAEAVELKA
EGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTRQIDDLGLEWIEEPVVYDNFDGYA
QLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETA
HWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLVE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UGV A 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
2 1 3UGV B 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
3 1 3UGV C 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
4 1 3UGV D 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
5 1 3UGV E 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
6 1 3UGV F 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
7 1 3UGV G 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
8 1 3UGV H 24 ? 390 ? A8TYI5 1 ? 367 ? 1 367 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UGV MET A 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 1   
1 3UGV HIS A 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 2   
1 3UGV HIS A 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 3   
1 3UGV HIS A 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 4   
1 3UGV HIS A 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 5   
1 3UGV HIS A 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 6   
1 3UGV HIS A 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 7   
1 3UGV SER A 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 8   
1 3UGV SER A 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 9   
1 3UGV GLY A 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 10  
1 3UGV VAL A 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 11  
1 3UGV ASP A 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 12  
1 3UGV LEU A 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 13  
1 3UGV GLY A 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  14  
1 3UGV THR A 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  15  
1 3UGV GLU A 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  16  
1 3UGV ASN A 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  17  
1 3UGV LEU A 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  18  
1 3UGV TYR A 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  19  
1 3UGV PHE A 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  20  
1 3UGV GLN A 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  21  
1 3UGV SER A 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  22  
1 3UGV MET A 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   23  
2 3UGV MET B 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 24  
2 3UGV HIS B 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 25  
2 3UGV HIS B 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 26  
2 3UGV HIS B 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 27  
2 3UGV HIS B 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 28  
2 3UGV HIS B 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 29  
2 3UGV HIS B 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 30  
2 3UGV SER B 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 31  
2 3UGV SER B 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 32  
2 3UGV GLY B 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 33  
2 3UGV VAL B 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 34  
2 3UGV ASP B 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 35  
2 3UGV LEU B 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 36  
2 3UGV GLY B 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  37  
2 3UGV THR B 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  38  
2 3UGV GLU B 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  39  
2 3UGV ASN B 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  40  
2 3UGV LEU B 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  41  
2 3UGV TYR B 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  42  
2 3UGV PHE B 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  43  
2 3UGV GLN B 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  44  
2 3UGV SER B 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  45  
2 3UGV MET B 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   46  
3 3UGV MET C 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 47  
3 3UGV HIS C 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 48  
3 3UGV HIS C 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 49  
3 3UGV HIS C 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 50  
3 3UGV HIS C 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 51  
3 3UGV HIS C 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 52  
3 3UGV HIS C 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 53  
3 3UGV SER C 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 54  
3 3UGV SER C 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 55  
3 3UGV GLY C 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 56  
3 3UGV VAL C 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 57  
3 3UGV ASP C 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 58  
3 3UGV LEU C 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 59  
3 3UGV GLY C 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  60  
3 3UGV THR C 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  61  
3 3UGV GLU C 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  62  
3 3UGV ASN C 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  63  
3 3UGV LEU C 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  64  
3 3UGV TYR C 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  65  
3 3UGV PHE C 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  66  
3 3UGV GLN C 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  67  
3 3UGV SER C 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  68  
3 3UGV MET C 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   69  
4 3UGV MET D 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 70  
4 3UGV HIS D 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 71  
4 3UGV HIS D 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 72  
4 3UGV HIS D 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 73  
4 3UGV HIS D 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 74  
4 3UGV HIS D 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 75  
4 3UGV HIS D 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 76  
4 3UGV SER D 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 77  
4 3UGV SER D 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 78  
4 3UGV GLY D 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 79  
4 3UGV VAL D 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 80  
4 3UGV ASP D 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 81  
4 3UGV LEU D 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 82  
4 3UGV GLY D 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  83  
4 3UGV THR D 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  84  
4 3UGV GLU D 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  85  
4 3UGV ASN D 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  86  
4 3UGV LEU D 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  87  
4 3UGV TYR D 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  88  
4 3UGV PHE D 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  89  
4 3UGV GLN D 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  90  
4 3UGV SER D 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  91  
4 3UGV MET D 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   92  
5 3UGV MET E 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 93  
5 3UGV HIS E 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 94  
5 3UGV HIS E 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 95  
5 3UGV HIS E 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 96  
5 3UGV HIS E 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 97  
5 3UGV HIS E 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 98  
5 3UGV HIS E 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 99  
5 3UGV SER E 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 100 
5 3UGV SER E 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 101 
5 3UGV GLY E 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 102 
5 3UGV VAL E 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 103 
5 3UGV ASP E 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 104 
5 3UGV LEU E 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 105 
5 3UGV GLY E 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  106 
5 3UGV THR E 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  107 
5 3UGV GLU E 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  108 
5 3UGV ASN E 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  109 
5 3UGV LEU E 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  110 
5 3UGV TYR E 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  111 
5 3UGV PHE E 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  112 
5 3UGV GLN E 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  113 
5 3UGV SER E 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  114 
5 3UGV MET E 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   115 
6 3UGV MET F 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 116 
6 3UGV HIS F 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 117 
6 3UGV HIS F 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 118 
6 3UGV HIS F 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 119 
6 3UGV HIS F 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 120 
6 3UGV HIS F 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 121 
6 3UGV HIS F 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 122 
6 3UGV SER F 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 123 
6 3UGV SER F 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 124 
6 3UGV GLY F 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 125 
6 3UGV VAL F 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 126 
6 3UGV ASP F 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 127 
6 3UGV LEU F 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 128 
6 3UGV GLY F 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  129 
6 3UGV THR F 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  130 
6 3UGV GLU F 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  131 
6 3UGV ASN F 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  132 
6 3UGV LEU F 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  133 
6 3UGV TYR F 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  134 
6 3UGV PHE F 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  135 
6 3UGV GLN F 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  136 
6 3UGV SER F 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  137 
6 3UGV MET F 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   138 
7 3UGV MET G 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 139 
7 3UGV HIS G 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 140 
7 3UGV HIS G 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 141 
7 3UGV HIS G 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 142 
7 3UGV HIS G 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 143 
7 3UGV HIS G 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 144 
7 3UGV HIS G 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 145 
7 3UGV SER G 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 146 
7 3UGV SER G 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 147 
7 3UGV GLY G 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 148 
7 3UGV VAL G 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 149 
7 3UGV ASP G 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 150 
7 3UGV LEU G 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 151 
7 3UGV GLY G 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  152 
7 3UGV THR G 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  153 
7 3UGV GLU G 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  154 
7 3UGV ASN G 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  155 
7 3UGV LEU G 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  156 
7 3UGV TYR G 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  157 
7 3UGV PHE G 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  158 
7 3UGV GLN G 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  159 
7 3UGV SER G 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  160 
7 3UGV MET G 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   161 
8 3UGV MET H 1  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -22 162 
8 3UGV HIS H 2  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -21 163 
8 3UGV HIS H 3  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -20 164 
8 3UGV HIS H 4  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -19 165 
8 3UGV HIS H 5  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -18 166 
8 3UGV HIS H 6  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -17 167 
8 3UGV HIS H 7  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -16 168 
8 3UGV SER H 8  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -15 169 
8 3UGV SER H 9  ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -14 170 
8 3UGV GLY H 10 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -13 171 
8 3UGV VAL H 11 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -12 172 
8 3UGV ASP H 12 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -11 173 
8 3UGV LEU H 13 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -10 174 
8 3UGV GLY H 14 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -9  175 
8 3UGV THR H 15 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -8  176 
8 3UGV GLU H 16 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -7  177 
8 3UGV ASN H 17 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -6  178 
8 3UGV LEU H 18 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -5  179 
8 3UGV TYR H 19 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -4  180 
8 3UGV PHE H 20 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -3  181 
8 3UGV GLN H 21 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -2  182 
8 3UGV SER H 22 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' -1  183 
8 3UGV MET H 23 ? UNP A8TYI5 ? ? 'EXPRESSION TAG' 0   184 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'    ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'   ? 'Mg 2'           24.305  
NI  non-polymer         . 'NICKEL (II) ION' ? 'Ni 2'           58.693  
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3UGV 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
;Protein (10 mM Hepes, pH 7.8, 150 mM NaCl, 10% glycerol, 5 mM DTT, 5 mM MgCl2); Reservoir (200 mM MgAcetate, 100 mM NaCac pH 6.5, 30% MPD); Cryoprotection (Reservoir), VAPOR DIFFUSION, SITTING DROP, temperature 298K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2011-07-27 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.entry_id                     3UGV 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             173.535 
_reflns.number_all                   175465 
_reflns.number_obs                   175465 
_reflns.pdbx_netI_over_sigmaI        11.900 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_redundancy              4.300 
_reflns.percent_possible_obs         97.700 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.B_iso_Wilson_estimate        29.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.300 2.420   ? 92528 ? 0.481 1.600  0.481 ? 3.700 ? 25126 96.600 1  1 
2.420 2.570   ? 92390 ? 0.355 2.100  0.355 ? 3.900 ? 23794 96.700 2  1 
2.570 2.750   ? 93576 ? 0.255 3.000  0.255 ? 4.200 ? 22488 97.200 3  1 
2.750 2.970   ? 92595 ? 0.164 4.700  0.164 ? 4.400 ? 21170 97.900 4  1 
2.970 3.250   ? 88715 ? 0.108 7.100  0.108 ? 4.500 ? 19555 98.100 5  1 
3.250 3.640   ? 81502 ? 0.071 10.400 0.071 ? 4.600 ? 17756 98.300 6  1 
3.640 4.200   ? 71893 ? 0.049 14.000 0.049 ? 4.600 ? 15762 98.500 7  1 
4.200 5.140   ? 61063 ? 0.039 17.200 0.039 ? 4.600 ? 13415 98.700 8  1 
5.140 7.270   ? 47699 ? 0.036 18.700 0.036 ? 4.500 ? 10513 98.900 9  1 
7.270 152.984 ? 24837 ? 0.024 25.300 0.024 ? 4.200 ? 5886  97.500 10 1 
# 
_refine.entry_id                                 3UGV 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             114.6420 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    92.1900 
_refine.ls_number_reflns_obs                     166037 
_refine.ls_number_reflns_all                     166037 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.1628 
_refine.ls_R_factor_obs                          0.1628 
_refine.ls_R_factor_R_work                       0.1605 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2077 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9700 
_refine.ls_number_reflns_R_free                  8248 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               36.7372 
_refine.solvent_model_param_bsol                 34.0860 
_refine.solvent_model_param_ksol                 0.3480 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.7403 
_refine.aniso_B[2][2]                            1.8742 
_refine.aniso_B[3][3]                            -2.6145 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.0000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.7200 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1MDR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8616 
_refine.B_iso_max                                159.430 
_refine.B_iso_min                                5.700 
_refine.pdbx_overall_phase_error                 20.9700 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.390 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        22354 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             866 
_refine_hist.number_atoms_total               23241 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        114.6420 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           23048 0.012  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          31539 1.054  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     3443  0.070  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      4065  0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 8334  13.667 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.3000 2.3261   30 81.0000 4578 . 0.2496 0.3190 . 244 . 4822 . . 'X-RAY DIFFRACTION' 
2.3261 2.3535   30 82.0000 4632 . 0.2500 0.3238 . 241 . 4873 . . 'X-RAY DIFFRACTION' 
2.3535 2.3822   30 83.0000 4697 . 0.2426 0.3103 . 247 . 4944 . . 'X-RAY DIFFRACTION' 
2.3822 2.4124   30 85.0000 4803 . 0.2238 0.3055 . 251 . 5054 . . 'X-RAY DIFFRACTION' 
2.4124 2.4441   30 85.0000 4795 . 0.2258 0.2945 . 244 . 5039 . . 'X-RAY DIFFRACTION' 
2.4441 2.4776   30 85.0000 4863 . 0.2182 0.2850 . 248 . 5111 . . 'X-RAY DIFFRACTION' 
2.4776 2.5130   30 88.0000 5000 . 0.2153 0.2604 . 234 . 5234 . . 'X-RAY DIFFRACTION' 
2.5130 2.5505   30 87.0000 4918 . 0.2086 0.2811 . 250 . 5168 . . 'X-RAY DIFFRACTION' 
2.5505 2.5904   30 89.0000 5073 . 0.2000 0.2752 . 269 . 5342 . . 'X-RAY DIFFRACTION' 
2.5904 2.6328   30 89.0000 5069 . 0.2010 0.2691 . 240 . 5309 . . 'X-RAY DIFFRACTION' 
2.6328 2.6782   30 90.0000 5081 . 0.1946 0.2614 . 239 . 5320 . . 'X-RAY DIFFRACTION' 
2.6782 2.7269   30 91.0000 5175 . 0.1972 0.2727 . 270 . 5445 . . 'X-RAY DIFFRACTION' 
2.7269 2.7794   30 92.0000 5227 . 0.1860 0.2564 . 271 . 5498 . . 'X-RAY DIFFRACTION' 
2.7794 2.8361   30 93.0000 5257 . 0.1808 0.2530 . 282 . 5539 . . 'X-RAY DIFFRACTION' 
2.8361 2.8978   30 93.0000 5328 . 0.1815 0.2298 . 244 . 5572 . . 'X-RAY DIFFRACTION' 
2.8978 2.9652   30 95.0000 5383 . 0.1773 0.2489 . 300 . 5683 . . 'X-RAY DIFFRACTION' 
2.9652 3.0394   30 95.0000 5405 . 0.1740 0.2110 . 276 . 5681 . . 'X-RAY DIFFRACTION' 
3.0394 3.1216   30 96.0000 5430 . 0.1744 0.2402 . 294 . 5724 . . 'X-RAY DIFFRACTION' 
3.1216 3.2134   30 96.0000 5497 . 0.1707 0.2132 . 271 . 5768 . . 'X-RAY DIFFRACTION' 
3.2134 3.3172   30 96.0000 5488 . 0.1637 0.2196 . 278 . 5766 . . 'X-RAY DIFFRACTION' 
3.3172 3.4357   30 97.0000 5475 . 0.1630 0.1940 . 300 . 5775 . . 'X-RAY DIFFRACTION' 
3.4357 3.5733   30 98.0000 5544 . 0.1562 0.1929 . 314 . 5858 . . 'X-RAY DIFFRACTION' 
3.5733 3.7359   30 98.0000 5581 . 0.1421 0.1907 . 320 . 5901 . . 'X-RAY DIFFRACTION' 
3.7359 3.9329   30 98.0000 5597 . 0.1317 0.1583 . 280 . 5877 . . 'X-RAY DIFFRACTION' 
3.9329 4.1793   30 98.0000 5599 . 0.1235 0.1571 . 301 . 5900 . . 'X-RAY DIFFRACTION' 
4.1793 4.5020   30 98.0000 5677 . 0.1177 0.1630 . 286 . 5963 . . 'X-RAY DIFFRACTION' 
4.5020 4.9551   30 98.0000 5631 . 0.1109 0.1532 . 306 . 5937 . . 'X-RAY DIFFRACTION' 
4.9551 5.6721   30 98.0000 5696 . 0.1307 0.1766 . 311 . 6007 . . 'X-RAY DIFFRACTION' 
5.6721 7.1461   30 98.0000 5709 . 0.1369 0.1877 . 328 . 6037 . . 'X-RAY DIFFRACTION' 
7.1461 114.7848 30 92.0000 5581 . 0.1514 0.1648 . 309 . 5890 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UGV 
_struct.title                     
'Crystal structure of an enolase from alpha pretobacterium bal199 (EFI TARGET EFI-501650) with bound MG' 
_struct.pdbx_descriptor           Enolase 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UGV 
_struct_keywords.text            'Enolase, enzyme function initiative, EFI, LYASE, Structural Genomics' 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 4 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   VAL A 79  ? LYS A 81  ? VAL A 56  LYS A 58  5 ? 3  
HELX_P HELX_P2   2   ALA A 82  ? ALA A 98  ? ALA A 59  ALA A 75  1 ? 17 
HELX_P HELX_P3   3   ALA A 103 ? LEU A 115 ? ALA A 80  LEU A 92  1 ? 13 
HELX_P HELX_P4   4   HIS A 116 ? GLY A 119 ? HIS A 93  GLY A 96  5 ? 4  
HELX_P HELX_P5   5   GLY A 122 ? ALA A 143 ? GLY A 99  ALA A 120 1 ? 22 
HELX_P HELX_P6   6   PRO A 146 ? LEU A 151 ? PRO A 123 LEU A 128 1 ? 6  
HELX_P HELX_P7   7   SER A 170 ? GLU A 184 ? SER A 147 GLU A 161 1 ? 15 
HELX_P HELX_P8   8   ASP A 201 ? GLY A 217 ? ASP A 178 GLY A 194 1 ? 17 
HELX_P HELX_P9   9   ASP A 231 ? ASP A 243 ? ASP A 208 ASP A 220 1 ? 13 
HELX_P HELX_P10  10  ASN A 258 ? LEU A 269 ? ASN A 235 LEU A 246 1 ? 12 
HELX_P HELX_P11  11  GLY A 281 ? ALA A 291 ? GLY A 258 ALA A 268 1 ? 11 
HELX_P HELX_P12  12  ASP A 300 ? GLY A 305 ? ASP A 277 GLY A 282 1 ? 6  
HELX_P HELX_P13  13  GLY A 305 ? GLY A 321 ? GLY A 282 GLY A 298 1 ? 17 
HELX_P HELX_P14  14  TYR A 329 ? ARG A 338 ? TYR A 306 ARG A 315 1 ? 10 
HELX_P HELX_P15  15  ALA A 352 ? LEU A 356 ? ALA A 329 LEU A 333 5 ? 5  
HELX_P HELX_P16  16  ASP A 380 ? ALA A 386 ? ASP A 357 ALA A 363 1 ? 7  
HELX_P HELX_P17  17  VAL B 79  ? LYS B 81  ? VAL B 56  LYS B 58  5 ? 3  
HELX_P HELX_P18  18  ALA B 82  ? ALA B 98  ? ALA B 59  ALA B 75  1 ? 17 
HELX_P HELX_P19  19  ALA B 103 ? LEU B 115 ? ALA B 80  LEU B 92  1 ? 13 
HELX_P HELX_P20  20  HIS B 116 ? GLY B 119 ? HIS B 93  GLY B 96  5 ? 4  
HELX_P HELX_P21  21  GLY B 122 ? ALA B 143 ? GLY B 99  ALA B 120 1 ? 22 
HELX_P HELX_P22  22  PRO B 146 ? LEU B 151 ? PRO B 123 LEU B 128 1 ? 6  
HELX_P HELX_P23  23  SER B 170 ? GLU B 184 ? SER B 147 GLU B 161 1 ? 15 
HELX_P HELX_P24  24  ASP B 201 ? GLY B 217 ? ASP B 178 GLY B 194 1 ? 17 
HELX_P HELX_P25  25  ASP B 231 ? ILE B 242 ? ASP B 208 ILE B 219 1 ? 12 
HELX_P HELX_P26  26  ASN B 258 ? LEU B 269 ? ASN B 235 LEU B 246 1 ? 12 
HELX_P HELX_P27  27  GLY B 281 ? ALA B 291 ? GLY B 258 ALA B 268 1 ? 11 
HELX_P HELX_P28  28  GLY B 305 ? GLY B 321 ? GLY B 282 GLY B 298 1 ? 17 
HELX_P HELX_P29  29  TYR B 329 ? ARG B 338 ? TYR B 306 ARG B 315 1 ? 10 
HELX_P HELX_P30  30  ALA B 352 ? LEU B 356 ? ALA B 329 LEU B 333 5 ? 5  
HELX_P HELX_P31  31  ASP B 380 ? LEU B 388 ? ASP B 357 LEU B 365 1 ? 9  
HELX_P HELX_P32  32  VAL C 79  ? LYS C 81  ? VAL C 56  LYS C 58  5 ? 3  
HELX_P HELX_P33  33  ALA C 82  ? ALA C 98  ? ALA C 59  ALA C 75  1 ? 17 
HELX_P HELX_P34  34  ALA C 103 ? HIS C 116 ? ALA C 80  HIS C 93  1 ? 14 
HELX_P HELX_P35  35  PHE C 117 ? GLY C 119 ? PHE C 94  GLY C 96  5 ? 3  
HELX_P HELX_P36  36  GLY C 122 ? ALA C 143 ? GLY C 99  ALA C 120 1 ? 22 
HELX_P HELX_P37  37  PRO C 146 ? LEU C 151 ? PRO C 123 LEU C 128 1 ? 6  
HELX_P HELX_P38  38  SER C 170 ? GLY C 185 ? SER C 147 GLY C 162 1 ? 16 
HELX_P HELX_P39  39  ASP C 201 ? GLY C 217 ? ASP C 178 GLY C 194 1 ? 17 
HELX_P HELX_P40  40  ASP C 231 ? ILE C 242 ? ASP C 208 ILE C 219 1 ? 12 
HELX_P HELX_P41  41  ASN C 258 ? LEU C 269 ? ASN C 235 LEU C 246 1 ? 12 
HELX_P HELX_P42  42  GLY C 281 ? ALA C 291 ? GLY C 258 ALA C 268 1 ? 11 
HELX_P HELX_P43  43  GLY C 305 ? GLY C 321 ? GLY C 282 GLY C 298 1 ? 17 
HELX_P HELX_P44  44  TYR C 329 ? ARG C 338 ? TYR C 306 ARG C 315 1 ? 10 
HELX_P HELX_P45  45  ALA C 352 ? LEU C 356 ? ALA C 329 LEU C 333 5 ? 5  
HELX_P HELX_P46  46  ASP C 380 ? LEU C 388 ? ASP C 357 LEU C 365 1 ? 9  
HELX_P HELX_P47  47  VAL D 79  ? LYS D 81  ? VAL D 56  LYS D 58  5 ? 3  
HELX_P HELX_P48  48  ALA D 82  ? ALA D 98  ? ALA D 59  ALA D 75  1 ? 17 
HELX_P HELX_P49  49  ALA D 103 ? LEU D 115 ? ALA D 80  LEU D 92  1 ? 13 
HELX_P HELX_P50  50  HIS D 116 ? GLY D 119 ? HIS D 93  GLY D 96  5 ? 4  
HELX_P HELX_P51  51  GLY D 122 ? ALA D 143 ? GLY D 99  ALA D 120 1 ? 22 
HELX_P HELX_P52  52  PRO D 146 ? LEU D 151 ? PRO D 123 LEU D 128 1 ? 6  
HELX_P HELX_P53  53  SER D 170 ? GLY D 185 ? SER D 147 GLY D 162 1 ? 16 
HELX_P HELX_P54  54  ASP D 201 ? GLY D 217 ? ASP D 178 GLY D 194 1 ? 17 
HELX_P HELX_P55  55  ASP D 231 ? ASP D 243 ? ASP D 208 ASP D 220 1 ? 13 
HELX_P HELX_P56  56  ASN D 258 ? LEU D 269 ? ASN D 235 LEU D 246 1 ? 12 
HELX_P HELX_P57  57  GLY D 281 ? ALA D 291 ? GLY D 258 ALA D 268 1 ? 11 
HELX_P HELX_P58  58  ASP D 300 ? GLY D 305 ? ASP D 277 GLY D 282 1 ? 6  
HELX_P HELX_P59  59  GLY D 305 ? GLY D 321 ? GLY D 282 GLY D 298 1 ? 17 
HELX_P HELX_P60  60  TYR D 329 ? ARG D 338 ? TYR D 306 ARG D 315 1 ? 10 
HELX_P HELX_P61  61  ALA D 352 ? LEU D 356 ? ALA D 329 LEU D 333 5 ? 5  
HELX_P HELX_P62  62  ASP D 380 ? LEU D 388 ? ASP D 357 LEU D 365 1 ? 9  
HELX_P HELX_P63  63  VAL E 79  ? LYS E 81  ? VAL E 56  LYS E 58  5 ? 3  
HELX_P HELX_P64  64  ALA E 82  ? ALA E 98  ? ALA E 59  ALA E 75  1 ? 17 
HELX_P HELX_P65  65  ALA E 103 ? LEU E 115 ? ALA E 80  LEU E 92  1 ? 13 
HELX_P HELX_P66  66  HIS E 116 ? GLY E 119 ? HIS E 93  GLY E 96  5 ? 4  
HELX_P HELX_P67  67  GLY E 122 ? ALA E 142 ? GLY E 99  ALA E 119 1 ? 21 
HELX_P HELX_P68  68  PRO E 146 ? LEU E 151 ? PRO E 123 LEU E 128 1 ? 6  
HELX_P HELX_P69  69  SER E 170 ? GLU E 184 ? SER E 147 GLU E 161 1 ? 15 
HELX_P HELX_P70  70  ASP E 201 ? GLY E 217 ? ASP E 178 GLY E 194 1 ? 17 
HELX_P HELX_P71  71  ASP E 231 ? ILE E 242 ? ASP E 208 ILE E 219 1 ? 12 
HELX_P HELX_P72  72  ASN E 258 ? LEU E 269 ? ASN E 235 LEU E 246 1 ? 12 
HELX_P HELX_P73  73  GLY E 281 ? ALA E 291 ? GLY E 258 ALA E 268 1 ? 11 
HELX_P HELX_P74  74  ASP E 300 ? GLY E 305 ? ASP E 277 GLY E 282 1 ? 6  
HELX_P HELX_P75  75  GLY E 305 ? GLY E 321 ? GLY E 282 GLY E 298 1 ? 17 
HELX_P HELX_P76  76  TYR E 329 ? ARG E 338 ? TYR E 306 ARG E 315 1 ? 10 
HELX_P HELX_P77  77  ALA E 352 ? LEU E 356 ? ALA E 329 LEU E 333 5 ? 5  
HELX_P HELX_P78  78  ASP E 380 ? LEU E 388 ? ASP E 357 LEU E 365 1 ? 9  
HELX_P HELX_P79  79  VAL F 79  ? LYS F 81  ? VAL F 56  LYS F 58  5 ? 3  
HELX_P HELX_P80  80  ALA F 82  ? ALA F 98  ? ALA F 59  ALA F 75  1 ? 17 
HELX_P HELX_P81  81  ALA F 103 ? LEU F 115 ? ALA F 80  LEU F 92  1 ? 13 
HELX_P HELX_P82  82  HIS F 116 ? GLY F 119 ? HIS F 93  GLY F 96  5 ? 4  
HELX_P HELX_P83  83  GLY F 122 ? ALA F 143 ? GLY F 99  ALA F 120 1 ? 22 
HELX_P HELX_P84  84  PRO F 146 ? LEU F 151 ? PRO F 123 LEU F 128 1 ? 6  
HELX_P HELX_P85  85  SER F 170 ? GLU F 184 ? SER F 147 GLU F 161 1 ? 15 
HELX_P HELX_P86  86  ASP F 201 ? GLY F 217 ? ASP F 178 GLY F 194 1 ? 17 
HELX_P HELX_P87  87  ASP F 231 ? ASP F 243 ? ASP F 208 ASP F 220 1 ? 13 
HELX_P HELX_P88  88  ASN F 258 ? LEU F 269 ? ASN F 235 LEU F 246 1 ? 12 
HELX_P HELX_P89  89  GLY F 281 ? ALA F 291 ? GLY F 258 ALA F 268 1 ? 11 
HELX_P HELX_P90  90  ASP F 300 ? GLY F 305 ? ASP F 277 GLY F 282 1 ? 6  
HELX_P HELX_P91  91  GLY F 305 ? GLY F 321 ? GLY F 282 GLY F 298 1 ? 17 
HELX_P HELX_P92  92  TYR F 329 ? ARG F 338 ? TYR F 306 ARG F 315 1 ? 10 
HELX_P HELX_P93  93  ALA F 352 ? LEU F 356 ? ALA F 329 LEU F 333 5 ? 5  
HELX_P HELX_P94  94  ASP F 380 ? LEU F 388 ? ASP F 357 LEU F 365 1 ? 9  
HELX_P HELX_P95  95  VAL G 79  ? LYS G 81  ? VAL G 56  LYS G 58  5 ? 3  
HELX_P HELX_P96  96  ALA G 82  ? ALA G 98  ? ALA G 59  ALA G 75  1 ? 17 
HELX_P HELX_P97  97  ALA G 103 ? LEU G 115 ? ALA G 80  LEU G 92  1 ? 13 
HELX_P HELX_P98  98  HIS G 116 ? GLY G 119 ? HIS G 93  GLY G 96  5 ? 4  
HELX_P HELX_P99  99  GLY G 122 ? ALA G 143 ? GLY G 99  ALA G 120 1 ? 22 
HELX_P HELX_P100 100 PRO G 146 ? LEU G 151 ? PRO G 123 LEU G 128 1 ? 6  
HELX_P HELX_P101 101 SER G 170 ? GLU G 184 ? SER G 147 GLU G 161 1 ? 15 
HELX_P HELX_P102 102 ASP G 201 ? GLY G 217 ? ASP G 178 GLY G 194 1 ? 17 
HELX_P HELX_P103 103 ASP G 231 ? ASP G 243 ? ASP G 208 ASP G 220 1 ? 13 
HELX_P HELX_P104 104 ASN G 258 ? LEU G 269 ? ASN G 235 LEU G 246 1 ? 12 
HELX_P HELX_P105 105 GLY G 281 ? ALA G 291 ? GLY G 258 ALA G 268 1 ? 11 
HELX_P HELX_P106 106 ASP G 300 ? GLY G 305 ? ASP G 277 GLY G 282 1 ? 6  
HELX_P HELX_P107 107 GLY G 305 ? GLY G 321 ? GLY G 282 GLY G 298 1 ? 17 
HELX_P HELX_P108 108 TYR G 329 ? ARG G 338 ? TYR G 306 ARG G 315 1 ? 10 
HELX_P HELX_P109 109 ALA G 352 ? LEU G 356 ? ALA G 329 LEU G 333 5 ? 5  
HELX_P HELX_P110 110 ASP G 380 ? LEU G 388 ? ASP G 357 LEU G 365 1 ? 9  
HELX_P HELX_P111 111 VAL H 79  ? LYS H 81  ? VAL H 56  LYS H 58  5 ? 3  
HELX_P HELX_P112 112 ALA H 82  ? ALA H 98  ? ALA H 59  ALA H 75  1 ? 17 
HELX_P HELX_P113 113 ALA H 103 ? LEU H 115 ? ALA H 80  LEU H 92  1 ? 13 
HELX_P HELX_P114 114 HIS H 116 ? GLY H 119 ? HIS H 93  GLY H 96  5 ? 4  
HELX_P HELX_P115 115 GLY H 122 ? ALA H 143 ? GLY H 99  ALA H 120 1 ? 22 
HELX_P HELX_P116 116 PRO H 146 ? LEU H 151 ? PRO H 123 LEU H 128 1 ? 6  
HELX_P HELX_P117 117 SER H 170 ? GLU H 184 ? SER H 147 GLU H 161 1 ? 15 
HELX_P HELX_P118 118 ASP H 201 ? GLY H 217 ? ASP H 178 GLY H 194 1 ? 17 
HELX_P HELX_P119 119 ASP H 231 ? ASP H 243 ? ASP H 208 ASP H 220 1 ? 13 
HELX_P HELX_P120 120 ASN H 258 ? LEU H 269 ? ASN H 235 LEU H 246 1 ? 12 
HELX_P HELX_P121 121 GLY H 281 ? ALA H 291 ? GLY H 258 ALA H 268 1 ? 11 
HELX_P HELX_P122 122 GLY H 305 ? GLY H 321 ? GLY H 282 GLY H 298 1 ? 17 
HELX_P HELX_P123 123 TYR H 329 ? ARG H 338 ? TYR H 306 ARG H 315 1 ? 10 
HELX_P HELX_P124 124 ALA H 352 ? LEU H 356 ? ALA H 329 LEU H 333 5 ? 5  
HELX_P HELX_P125 125 ASP H 380 ? LEU H 388 ? ASP H 357 LEU H 365 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? F  GLU 251 OE2 ? ? ? 1_555 W  MG  . MG ? ? F GLU 228 F MG  500 1_555 ? ? ? ? ? ? ? 1.928 ? 
metalc2   metalc ? ? C  GLU 251 OE2 ? ? ? 1_555 P  MG  . MG ? ? C GLU 228 C MG  500 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc3   metalc ? ? F  ASP 225 OD2 ? ? ? 1_555 W  MG  . MG ? ? F ASP 202 F MG  500 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc4   metalc ? ? D  GLU 251 OE2 ? ? ? 1_555 R  MG  . MG ? ? D GLU 228 D MG  500 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc5   metalc ? ? C  ARG 266 O   ? ? ? 1_555 Q  MG  . MG ? ? C ARG 243 C MG  501 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc6   metalc ? ? B  LEU 269 O   ? ? ? 1_555 N  MG  . MG ? ? B LEU 246 B MG  501 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc7   metalc ? ? H  ARG 266 O   ? ? ? 1_555 CA MG  . MG ? ? H ARG 243 H MG  501 1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc8   metalc ? ? B  GLU 277 OE1 ? ? ? 1_555 M  MG  . MG ? ? B GLU 254 B MG  500 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc9   metalc ? ? F  LEU 269 O   ? ? ? 1_555 X  MG  . MG ? ? F LEU 246 F MG  501 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc10  metalc ? ? B  ARG 266 O   ? ? ? 1_555 N  MG  . MG ? ? B ARG 243 B MG  501 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc11  metalc ? ? D  LEU 269 O   ? ? ? 1_555 S  MG  . MG ? ? D LEU 246 D MG  501 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc12  metalc ? ? A  ARG 266 O   ? ? ? 1_555 J  MG  . MG ? ? A ARG 243 A MG  501 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc13  metalc ? ? G  GLU 251 OE2 ? ? ? 1_555 Z  MG  . MG ? ? G GLU 228 G MG  500 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc14  metalc ? ? A  GLU 251 OE2 ? ? ? 1_555 I  MG  . MG ? ? A GLU 228 A MG  500 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc15  metalc ? ? H  LEU 269 O   ? ? ? 1_555 CA MG  . MG ? ? H LEU 246 H MG  501 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc16  metalc ? ? A  LEU 269 O   ? ? ? 1_555 J  MG  . MG ? ? A LEU 246 A MG  501 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc17  metalc ? ? B  GLU 251 OE2 ? ? ? 1_555 M  MG  . MG ? ? B GLU 228 B MG  500 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc18  metalc ? ? G  ASP 225 OD2 ? ? ? 1_555 Z  MG  . MG ? ? G ASP 202 G MG  500 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc19  metalc ? ? D  ARG 266 O   ? ? ? 1_555 S  MG  . MG ? ? D ARG 243 D MG  501 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc20  metalc ? ? C  LEU 269 O   ? ? ? 1_555 Q  MG  . MG ? ? C LEU 246 C MG  501 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc21  metalc ? ? E  GLU 251 OE2 ? ? ? 1_555 U  MG  . MG ? ? E GLU 228 E MG  500 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc22  metalc ? ? E  LEU 269 O   ? ? ? 1_555 V  MG  . MG ? ? E LEU 246 E MG  501 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc23  metalc ? ? F  ARG 266 O   ? ? ? 1_555 X  MG  . MG ? ? F ARG 243 F MG  501 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc24  metalc ? ? D  ASP 225 OD2 ? ? ? 1_555 R  MG  . MG ? ? D ASP 202 D MG  500 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc25  metalc ? ? E  ASP 225 OD2 ? ? ? 1_555 U  MG  . MG ? ? E ASP 202 E MG  500 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc26  metalc ? ? E  GLU 277 OE1 ? ? ? 1_555 U  MG  . MG ? ? E GLU 254 E MG  500 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc27  metalc ? ? G  LEU 269 O   ? ? ? 1_555 AA MG  . MG ? ? G LEU 246 G MG  501 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc28  metalc ? ? G  ARG 266 O   ? ? ? 1_555 AA MG  . MG ? ? G ARG 243 G MG  501 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc29  metalc ? ? H  GLU 251 OE2 ? ? ? 1_555 BA MG  . MG ? ? H GLU 228 H MG  500 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc30  metalc ? ? H  ASP 225 OD2 ? ? ? 1_555 BA MG  . MG ? ? H ASP 202 H MG  500 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc31  metalc ? ? G  GLU 277 OE1 ? ? ? 1_555 Z  MG  . MG ? ? G GLU 254 G MG  500 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc32  metalc ? ? C  ASP 225 OD2 ? ? ? 1_555 P  MG  . MG ? ? C ASP 202 C MG  500 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc33  metalc ? ? D  GLU 277 OE1 ? ? ? 1_555 R  MG  . MG ? ? D GLU 254 D MG  500 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc34  metalc ? ? C  GLU 277 OE1 ? ? ? 1_555 P  MG  . MG ? ? C GLU 254 C MG  500 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc35  metalc ? ? B  ASP 225 OD2 ? ? ? 1_555 M  MG  . MG ? ? B ASP 202 B MG  500 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc36  metalc ? ? A  GLU 277 OE1 ? ? ? 1_555 I  MG  . MG ? ? A GLU 254 A MG  500 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc37  metalc ? ? F  GLU 277 OE1 ? ? ? 1_555 W  MG  . MG ? ? F GLU 254 F MG  500 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc38  metalc ? ? E  ARG 266 O   ? ? ? 1_555 V  MG  . MG ? ? E ARG 243 E MG  501 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc39  metalc ? ? H  HIS 267 NE2 ? ? ? 1_555 Y  NI  . NI ? ? H HIS 244 F NI  368 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc40  metalc ? ? H  GLU 277 OE1 ? ? ? 1_555 BA MG  . MG ? ? H GLU 254 H MG  500 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc41  metalc ? ? A  ASP 225 OD2 ? ? ? 1_555 I  MG  . MG ? ? A ASP 202 A MG  500 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc42  metalc ? ? A  HIS 267 NE2 ? ? ? 1_555 L  NI  . NI ? ? A HIS 244 A NI  369 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc43  metalc ? ? C  HIS 267 NE2 ? ? ? 1_555 L  NI  . NI ? ? C HIS 244 A NI  369 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc44  metalc ? ? G  HIS 267 NE2 ? ? ? 1_555 Y  NI  . NI ? ? G HIS 244 F NI  368 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc45  metalc ? ? D  HIS 267 NE2 ? ? ? 1_555 L  NI  . NI ? ? D HIS 244 A NI  369 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc46  metalc ? ? E  HIS 267 NE2 ? ? ? 1_555 Y  NI  . NI ? ? E HIS 244 F NI  368 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc47  metalc ? ? F  HIS 267 NE2 ? ? ? 1_555 Y  NI  . NI ? ? F HIS 244 F NI  368 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc48  metalc ? ? B  HIS 267 NE2 ? ? ? 1_555 L  NI  . NI ? ? B HIS 244 A NI  369 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc49  metalc ? ? J  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? A MG  501 A HOH 375 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc50  metalc ? ? J  MG  .   MG  ? ? ? 1_555 GA HOH . O  ? ? A MG  501 D HOH 371 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc51  metalc ? ? M  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? B MG  500 B HOH 866 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc52  metalc ? ? AA MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? G MG  501 F HOH 369 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc53  metalc ? ? N  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? B MG  501 B HOH 381 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc54  metalc ? ? J  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? A MG  501 A HOH 382 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc55  metalc ? ? N  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? B MG  501 B HOH 369 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc56  metalc ? ? V  MG  .   MG  ? ? ? 1_555 HA HOH . O  ? ? E MG  501 E HOH 370 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc57  metalc ? ? V  MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? E MG  501 H HOH 446 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc58  metalc ? ? BA MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? H MG  500 H HOH 403 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc59  metalc ? ? CA MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? H MG  501 H HOH 372 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc60  metalc ? ? U  MG  .   MG  ? ? ? 1_555 HA HOH . O  ? ? E MG  500 E HOH 836 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc61  metalc ? ? J  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? A MG  501 A HOH 370 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc62  metalc ? ? S  MG  .   MG  ? ? ? 1_555 GA HOH . O  ? ? D MG  501 D HOH 372 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc63  metalc ? ? N  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? B MG  501 B HOH 370 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc64  metalc ? ? X  MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? F MG  501 F HOH 379 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc65  metalc ? ? CA MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? H MG  501 H HOH 385 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc66  metalc ? ? BA MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? H MG  500 H HOH 846 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc67  metalc ? ? X  MG  .   MG  ? ? ? 1_555 HA HOH . O  ? ? F MG  501 E HOH 369 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc68  metalc ? ? M  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? B MG  500 B HOH 486 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc69  metalc ? ? P  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? C MG  500 C HOH 707 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc70  metalc ? ? V  MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? E MG  501 H HOH 370 1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc71  metalc ? ? Q  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? C MG  501 B HOH 380 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc72  metalc ? ? P  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? C MG  500 C HOH 782 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc73  metalc ? ? X  MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? F MG  501 F HOH 372 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc74  metalc ? ? AA MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? G MG  501 G HOH 368 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc75  metalc ? ? CA MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? H MG  501 G HOH 373 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc76  metalc ? ? V  MG  .   MG  ? ? ? 1_555 HA HOH . O  ? ? E MG  501 E HOH 371 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc77  metalc ? ? Z  MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? G MG  500 G HOH 429 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc78  metalc ? ? CA MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? H MG  501 H HOH 368 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc79  metalc ? ? Z  MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? G MG  500 G HOH 438 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc80  metalc ? ? R  MG  .   MG  ? ? ? 1_555 GA HOH . O  ? ? D MG  500 D HOH 381 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc81  metalc ? ? X  MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? F MG  501 F HOH 370 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc82  metalc ? ? W  MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? F MG  500 F HOH 418 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc83  metalc ? ? S  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? D MG  501 C HOH 369 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc84  metalc ? ? M  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? B MG  500 B HOH 407 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc85  metalc ? ? Q  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? C MG  501 C HOH 378 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc86  metalc ? ? I  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? A MG  500 A HOH 411 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc87  metalc ? ? AA MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? G MG  501 G HOH 381 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc88  metalc ? ? W  MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? F MG  500 F HOH 407 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc89  metalc ? ? U  MG  .   MG  ? ? ? 1_555 HA HOH . O  ? ? E MG  500 E HOH 726 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc90  metalc ? ? BA MG  .   MG  ? ? ? 1_555 KA HOH . O  ? ? H MG  500 H HOH 423 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc91  metalc ? ? S  MG  .   MG  ? ? ? 1_555 GA HOH . O  ? ? D MG  501 D HOH 369 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc92  metalc ? ? S  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? D MG  501 C HOH 368 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc93  metalc ? ? I  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? A MG  500 A HOH 429 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc94  metalc ? ? P  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? C MG  500 C HOH 667 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc95  metalc ? ? Q  MG  .   MG  ? ? ? 1_555 FA HOH . O  ? ? C MG  501 C HOH 370 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc96  metalc ? ? Q  MG  .   MG  ? ? ? 1_555 EA HOH . O  ? ? C MG  501 B HOH 373 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc97  metalc ? ? W  MG  .   MG  ? ? ? 1_555 IA HOH . O  ? ? F MG  500 F HOH 419 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc98  metalc ? ? U  MG  .   MG  ? ? ? 1_555 HA HOH . O  ? ? E MG  500 E HOH 386 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc99  metalc ? ? AA MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? G MG  501 G HOH 370 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc100 metalc ? ? R  MG  .   MG  ? ? ? 1_555 GA HOH . O  ? ? D MG  500 D HOH 415 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc101 metalc ? ? N  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? B MG  501 A HOH 374 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc102 metalc ? ? Z  MG  .   MG  ? ? ? 1_555 JA HOH . O  ? ? G MG  500 G HOH 409 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc103 metalc ? ? R  MG  .   MG  ? ? ? 1_555 GA HOH . O  ? ? D MG  500 D HOH 401 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc104 metalc ? ? I  MG  .   MG  ? ? ? 1_555 DA HOH . O  ? ? A MG  500 A HOH 394 1_555 ? ? ? ? ? ? ? 2.192 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 5 ? 
D ? 3 ? 
E ? 4 ? 
F ? 5 ? 
G ? 3 ? 
H ? 4 ? 
I ? 5 ? 
J ? 3 ? 
K ? 4 ? 
L ? 5 ? 
M ? 3 ? 
N ? 4 ? 
O ? 5 ? 
P ? 3 ? 
Q ? 4 ? 
R ? 5 ? 
S ? 3 ? 
T ? 4 ? 
U ? 5 ? 
V ? 3 ? 
W ? 4 ? 
X ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? parallel      
O 3 4 ? parallel      
O 4 5 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? parallel      
R 2 3 ? parallel      
R 3 4 ? parallel      
R 4 5 ? parallel      
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
T 1 2 ? parallel      
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? parallel      
U 2 3 ? parallel      
U 3 4 ? parallel      
U 4 5 ? parallel      
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
W 1 2 ? parallel      
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? parallel      
X 2 3 ? parallel      
X 3 4 ? parallel      
X 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 30  ? THR A 47  ? PHE A 7   THR A 24  
A 2 THR A 52  ? THR A 65  ? THR A 29  THR A 42  
A 3 GLY A 71  ? LEU A 75  ? GLY A 48  LEU A 52  
B 1 LEU A 346 ? TRP A 348 ? LEU A 323 TRP A 325 
B 2 SER A 157 ? ASN A 162 ? SER A 134 ASN A 139 
B 3 ASP A 366 ? ILE A 368 ? ASP A 343 ILE A 345 
B 4 LEU A 362 ? SER A 363 ? LEU A 339 SER A 340 
C 1 GLY A 192 ? ARG A 196 ? GLY A 169 ARG A 173 
C 2 ALA A 221 ? ASP A 225 ? ALA A 198 ASP A 202 
C 3 TRP A 249 ? GLU A 251 ? TRP A 226 GLU A 228 
C 4 LEU A 273 ? ILE A 275 ? LEU A 250 ILE A 252 
C 5 LEU A 296 ? VAL A 297 ? LEU A 273 VAL A 274 
D 1 PHE B 30  ? THR B 47  ? PHE B 7   THR B 24  
D 2 THR B 52  ? THR B 65  ? THR B 29  THR B 42  
D 3 PRO B 70  ? LEU B 75  ? PRO B 47  LEU B 52  
E 1 LEU B 346 ? TRP B 348 ? LEU B 323 TRP B 325 
E 2 SER B 157 ? ASN B 162 ? SER B 134 ASN B 139 
E 3 ASP B 366 ? ILE B 368 ? ASP B 343 ILE B 345 
E 4 ALA B 361 ? SER B 363 ? ALA B 338 SER B 340 
F 1 GLY B 192 ? ARG B 196 ? GLY B 169 ARG B 173 
F 2 ALA B 221 ? ASP B 225 ? ALA B 198 ASP B 202 
F 3 TRP B 249 ? GLU B 251 ? TRP B 226 GLU B 228 
F 4 LEU B 273 ? ILE B 275 ? LEU B 250 ILE B 252 
F 5 LEU B 296 ? VAL B 297 ? LEU B 273 VAL B 274 
G 1 PHE C 30  ? THR C 47  ? PHE C 7   THR C 24  
G 2 THR C 52  ? THR C 65  ? THR C 29  THR C 42  
G 3 GLY C 71  ? LEU C 75  ? GLY C 48  LEU C 52  
H 1 LEU C 346 ? TRP C 348 ? LEU C 323 TRP C 325 
H 2 SER C 157 ? ASN C 162 ? SER C 134 ASN C 139 
H 3 ASP C 366 ? ILE C 368 ? ASP C 343 ILE C 345 
H 4 ALA C 361 ? SER C 363 ? ALA C 338 SER C 340 
I 1 GLY C 192 ? ARG C 196 ? GLY C 169 ARG C 173 
I 2 ALA C 221 ? ASP C 225 ? ALA C 198 ASP C 202 
I 3 TRP C 249 ? GLU C 251 ? TRP C 226 GLU C 228 
I 4 LEU C 273 ? ILE C 275 ? LEU C 250 ILE C 252 
I 5 LEU C 296 ? VAL C 297 ? LEU C 273 VAL C 274 
J 1 PHE D 30  ? THR D 47  ? PHE D 7   THR D 24  
J 2 THR D 52  ? THR D 65  ? THR D 29  THR D 42  
J 3 GLY D 71  ? LEU D 75  ? GLY D 48  LEU D 52  
K 1 LEU D 346 ? TRP D 348 ? LEU D 323 TRP D 325 
K 2 SER D 157 ? ASN D 162 ? SER D 134 ASN D 139 
K 3 ASP D 366 ? ILE D 368 ? ASP D 343 ILE D 345 
K 4 LEU D 362 ? SER D 363 ? LEU D 339 SER D 340 
L 1 GLY D 192 ? ARG D 196 ? GLY D 169 ARG D 173 
L 2 ALA D 221 ? ASP D 225 ? ALA D 198 ASP D 202 
L 3 TRP D 249 ? GLU D 251 ? TRP D 226 GLU D 228 
L 4 LEU D 273 ? ILE D 275 ? LEU D 250 ILE D 252 
L 5 LEU D 296 ? VAL D 297 ? LEU D 273 VAL D 274 
M 1 PHE E 30  ? THR E 47  ? PHE E 7   THR E 24  
M 2 THR E 52  ? THR E 65  ? THR E 29  THR E 42  
M 3 PRO E 70  ? LEU E 75  ? PRO E 47  LEU E 52  
N 1 LEU E 346 ? TRP E 348 ? LEU E 323 TRP E 325 
N 2 SER E 157 ? ASN E 162 ? SER E 134 ASN E 139 
N 3 ASP E 366 ? ILE E 368 ? ASP E 343 ILE E 345 
N 4 LEU E 362 ? SER E 363 ? LEU E 339 SER E 340 
O 1 GLY E 192 ? ARG E 196 ? GLY E 169 ARG E 173 
O 2 ALA E 221 ? ASP E 225 ? ALA E 198 ASP E 202 
O 3 TRP E 249 ? GLU E 251 ? TRP E 226 GLU E 228 
O 4 LEU E 273 ? ILE E 275 ? LEU E 250 ILE E 252 
O 5 LEU E 296 ? VAL E 297 ? LEU E 273 VAL E 274 
P 1 PHE F 30  ? THR F 47  ? PHE F 7   THR F 24  
P 2 THR F 52  ? THR F 65  ? THR F 29  THR F 42  
P 3 GLY F 71  ? LEU F 75  ? GLY F 48  LEU F 52  
Q 1 LEU F 346 ? TRP F 348 ? LEU F 323 TRP F 325 
Q 2 SER F 157 ? ASN F 162 ? SER F 134 ASN F 139 
Q 3 ASP F 366 ? ILE F 368 ? ASP F 343 ILE F 345 
Q 4 ALA F 361 ? SER F 363 ? ALA F 338 SER F 340 
R 1 GLY F 192 ? ARG F 196 ? GLY F 169 ARG F 173 
R 2 ALA F 221 ? ASP F 225 ? ALA F 198 ASP F 202 
R 3 TRP F 249 ? GLU F 251 ? TRP F 226 GLU F 228 
R 4 LEU F 273 ? ILE F 275 ? LEU F 250 ILE F 252 
R 5 LEU F 296 ? VAL F 297 ? LEU F 273 VAL F 274 
S 1 PHE G 30  ? THR G 47  ? PHE G 7   THR G 24  
S 2 THR G 52  ? THR G 65  ? THR G 29  THR G 42  
S 3 GLY G 71  ? LEU G 75  ? GLY G 48  LEU G 52  
T 1 LEU G 346 ? TRP G 348 ? LEU G 323 TRP G 325 
T 2 SER G 157 ? ASN G 162 ? SER G 134 ASN G 139 
T 3 ASP G 366 ? ILE G 368 ? ASP G 343 ILE G 345 
T 4 ALA G 361 ? SER G 363 ? ALA G 338 SER G 340 
U 1 GLY G 192 ? ARG G 196 ? GLY G 169 ARG G 173 
U 2 ALA G 221 ? ASP G 225 ? ALA G 198 ASP G 202 
U 3 TRP G 249 ? GLU G 251 ? TRP G 226 GLU G 228 
U 4 LEU G 273 ? ILE G 275 ? LEU G 250 ILE G 252 
U 5 LEU G 296 ? VAL G 297 ? LEU G 273 VAL G 274 
V 1 PHE H 30  ? THR H 47  ? PHE H 7   THR H 24  
V 2 THR H 52  ? THR H 65  ? THR H 29  THR H 42  
V 3 PRO H 70  ? LEU H 75  ? PRO H 47  LEU H 52  
W 1 LEU H 346 ? TRP H 348 ? LEU H 323 TRP H 325 
W 2 SER H 157 ? ASN H 162 ? SER H 134 ASN H 139 
W 3 ASP H 366 ? ILE H 368 ? ASP H 343 ILE H 345 
W 4 ALA H 361 ? SER H 363 ? ALA H 338 SER H 340 
X 1 GLY H 192 ? ARG H 196 ? GLY H 169 ARG H 173 
X 2 ALA H 221 ? ASP H 225 ? ALA H 198 ASP H 202 
X 3 TRP H 249 ? GLU H 251 ? TRP H 226 GLU H 228 
X 4 LEU H 273 ? ILE H 275 ? LEU H 250 ILE H 252 
X 5 LEU H 296 ? VAL H 297 ? LEU H 273 VAL H 274 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 34  ? N THR A 11  O ASP A 62  ? O ASP A 39  
A 2 3 N ILE A 63  ? N ILE A 40  O GLY A 71  ? O GLY A 48  
B 1 2 O TRP A 348 ? O TRP A 325 N TYR A 161 ? N TYR A 138 
B 2 3 N VAL A 158 ? N VAL A 135 O LEU A 367 ? O LEU A 344 
B 3 4 O ASP A 366 ? O ASP A 343 N SER A 363 ? N SER A 340 
C 1 2 N LEU A 195 ? N LEU A 172 O MET A 223 ? O MET A 200 
C 2 3 N VAL A 224 ? N VAL A 201 O GLU A 251 ? O GLU A 228 
C 3 4 N ILE A 250 ? N ILE A 227 O MET A 274 ? O MET A 251 
C 4 5 O LEU A 273 ? O LEU A 250 N LEU A 296 ? N LEU A 273 
D 1 2 N LEU B 42  ? N LEU B 19  O PRO B 54  ? O PRO B 31  
D 2 3 N ILE B 63  ? N ILE B 40  O GLY B 71  ? O GLY B 48  
E 1 2 O TRP B 348 ? O TRP B 325 N TYR B 161 ? N TYR B 138 
E 2 3 N VAL B 158 ? N VAL B 135 O LEU B 367 ? O LEU B 344 
E 3 4 O ILE B 368 ? O ILE B 345 N ALA B 361 ? N ALA B 338 
F 1 2 N LEU B 193 ? N LEU B 170 O ALA B 221 ? O ALA B 198 
F 2 3 N VAL B 224 ? N VAL B 201 O GLU B 251 ? O GLU B 228 
F 3 4 N ILE B 250 ? N ILE B 227 O MET B 274 ? O MET B 251 
F 4 5 O LEU B 273 ? O LEU B 250 N LEU B 296 ? N LEU B 273 
G 1 2 N LEU C 42  ? N LEU C 19  O PRO C 54  ? O PRO C 31  
G 2 3 N ILE C 63  ? N ILE C 40  O GLY C 71  ? O GLY C 48  
H 1 2 O TRP C 348 ? O TRP C 325 N TYR C 161 ? N TYR C 138 
H 2 3 N VAL C 158 ? N VAL C 135 O LEU C 367 ? O LEU C 344 
H 3 4 O ILE C 368 ? O ILE C 345 N ALA C 361 ? N ALA C 338 
I 1 2 N LEU C 193 ? N LEU C 170 O ALA C 221 ? O ALA C 198 
I 2 3 N VAL C 224 ? N VAL C 201 O GLU C 251 ? O GLU C 228 
I 3 4 N ILE C 250 ? N ILE C 227 O MET C 274 ? O MET C 251 
I 4 5 O LEU C 273 ? O LEU C 250 N LEU C 296 ? N LEU C 273 
J 1 2 N VAL D 46  ? N VAL D 23  O ILE D 53  ? O ILE D 30  
J 2 3 N ILE D 63  ? N ILE D 40  O GLY D 71  ? O GLY D 48  
K 1 2 O TRP D 348 ? O TRP D 325 N TYR D 161 ? N TYR D 138 
K 2 3 N VAL D 158 ? N VAL D 135 O LEU D 367 ? O LEU D 344 
K 3 4 O ASP D 366 ? O ASP D 343 N SER D 363 ? N SER D 340 
L 1 2 N LEU D 195 ? N LEU D 172 O MET D 223 ? O MET D 200 
L 2 3 N VAL D 224 ? N VAL D 201 O GLU D 251 ? O GLU D 228 
L 3 4 N ILE D 250 ? N ILE D 227 O MET D 274 ? O MET D 251 
L 4 5 O LEU D 273 ? O LEU D 250 N LEU D 296 ? N LEU D 273 
M 1 2 N ARG E 31  ? N ARG E 8   O GLU E 64  ? O GLU E 41  
M 2 3 N ILE E 63  ? N ILE E 40  O GLY E 71  ? O GLY E 48  
N 1 2 O TRP E 348 ? O TRP E 325 N TYR E 161 ? N TYR E 138 
N 2 3 N VAL E 158 ? N VAL E 135 O LEU E 367 ? O LEU E 344 
N 3 4 O ASP E 366 ? O ASP E 343 N SER E 363 ? N SER E 340 
O 1 2 N LEU E 193 ? N LEU E 170 O MET E 223 ? O MET E 200 
O 2 3 N VAL E 224 ? N VAL E 201 O GLU E 251 ? O GLU E 228 
O 3 4 N ILE E 250 ? N ILE E 227 O MET E 274 ? O MET E 251 
O 4 5 N ILE E 275 ? N ILE E 252 O LEU E 296 ? O LEU E 273 
P 1 2 N LEU F 42  ? N LEU F 19  O PRO F 54  ? O PRO F 31  
P 2 3 N ILE F 63  ? N ILE F 40  O GLY F 71  ? O GLY F 48  
Q 1 2 O TRP F 348 ? O TRP F 325 N TYR F 161 ? N TYR F 138 
Q 2 3 N VAL F 158 ? N VAL F 135 O LEU F 367 ? O LEU F 344 
Q 3 4 O ILE F 368 ? O ILE F 345 N ALA F 361 ? N ALA F 338 
R 1 2 N LEU F 195 ? N LEU F 172 O MET F 223 ? O MET F 200 
R 2 3 N VAL F 224 ? N VAL F 201 O GLU F 251 ? O GLU F 228 
R 3 4 N ILE F 250 ? N ILE F 227 O MET F 274 ? O MET F 251 
R 4 5 O LEU F 273 ? O LEU F 250 N LEU F 296 ? N LEU F 273 
S 1 2 N ARG G 36  ? N ARG G 13  O LEU G 60  ? O LEU G 37  
S 2 3 N ILE G 63  ? N ILE G 40  O GLY G 71  ? O GLY G 48  
T 1 2 O TRP G 348 ? O TRP G 325 N TYR G 161 ? N TYR G 138 
T 2 3 N VAL G 158 ? N VAL G 135 O LEU G 367 ? O LEU G 344 
T 3 4 O ILE G 368 ? O ILE G 345 N ALA G 361 ? N ALA G 338 
U 1 2 N LEU G 195 ? N LEU G 172 O MET G 223 ? O MET G 200 
U 2 3 N VAL G 224 ? N VAL G 201 O GLU G 251 ? O GLU G 228 
U 3 4 N ILE G 250 ? N ILE G 227 O MET G 274 ? O MET G 251 
U 4 5 O LEU G 273 ? O LEU G 250 N LEU G 296 ? N LEU G 273 
V 1 2 N LEU H 40  ? N LEU H 17  O TRP H 56  ? O TRP H 33  
V 2 3 N ILE H 61  ? N ILE H 38  O ALA H 73  ? O ALA H 50  
W 1 2 O TRP H 348 ? O TRP H 325 N TYR H 161 ? N TYR H 138 
W 2 3 N VAL H 158 ? N VAL H 135 O LEU H 367 ? O LEU H 344 
W 3 4 O ILE H 368 ? O ILE H 345 N ALA H 361 ? N ALA H 338 
X 1 2 N LEU H 195 ? N LEU H 172 O MET H 223 ? O MET H 200 
X 2 3 N VAL H 224 ? N VAL H 201 O GLU H 251 ? O GLU H 228 
X 3 4 N ILE H 250 ? N ILE H 227 O MET H 274 ? O MET H 251 
X 4 5 O LEU H 273 ? O LEU H 250 N LEU H 296 ? N LEU H 273 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 500' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 501' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 368' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 369' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 500' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 501' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 368' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG C 500' 
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG C 501' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG D 500' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG D 501' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 368' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG E 500' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG E 501' 
BC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG F 500' 
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG F 501' 
BC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI F 368' 
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG G 500' 
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG G 501' 
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG H 500' 
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG H 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7 LYS A  194 ? LYS A 171 . ? 1_555 ? 
2   AC1 7 ASP A  225 ? ASP A 202 . ? 1_555 ? 
3   AC1 7 GLU A  251 ? GLU A 228 . ? 1_555 ? 
4   AC1 7 GLU A  277 ? GLU A 254 . ? 1_555 ? 
5   AC1 7 HOH DA .   ? HOH A 394 . ? 1_555 ? 
6   AC1 7 HOH DA .   ? HOH A 411 . ? 1_555 ? 
7   AC1 7 HOH DA .   ? HOH A 429 . ? 1_555 ? 
8   AC2 6 ARG A  266 ? ARG A 243 . ? 1_555 ? 
9   AC2 6 LEU A  269 ? LEU A 246 . ? 1_555 ? 
10  AC2 6 HOH DA .   ? HOH A 370 . ? 1_555 ? 
11  AC2 6 HOH DA .   ? HOH A 375 . ? 1_555 ? 
12  AC2 6 HOH DA .   ? HOH A 382 . ? 1_555 ? 
13  AC2 6 HOH GA .   ? HOH D 371 . ? 1_555 ? 
14  AC3 4 HIS A  286 ? HIS A 263 . ? 1_555 ? 
15  AC3 4 TRP A  320 ? TRP A 297 . ? 1_555 ? 
16  AC3 4 HIS G  286 ? HIS G 263 . ? 1_555 ? 
17  AC3 4 TRP G  320 ? TRP G 297 . ? 1_555 ? 
18  AC4 4 HIS A  267 ? HIS A 244 . ? 1_555 ? 
19  AC4 4 HIS B  267 ? HIS B 244 . ? 1_555 ? 
20  AC4 4 HIS C  267 ? HIS C 244 . ? 1_555 ? 
21  AC4 4 HIS D  267 ? HIS D 244 . ? 1_555 ? 
22  AC5 6 ASP B  225 ? ASP B 202 . ? 1_555 ? 
23  AC5 6 GLU B  251 ? GLU B 228 . ? 1_555 ? 
24  AC5 6 GLU B  277 ? GLU B 254 . ? 1_555 ? 
25  AC5 6 HOH EA .   ? HOH B 407 . ? 1_555 ? 
26  AC5 6 HOH EA .   ? HOH B 486 . ? 1_555 ? 
27  AC5 6 HOH EA .   ? HOH B 866 . ? 1_555 ? 
28  AC6 6 HOH DA .   ? HOH A 374 . ? 1_555 ? 
29  AC6 6 ARG B  266 ? ARG B 243 . ? 1_555 ? 
30  AC6 6 LEU B  269 ? LEU B 246 . ? 1_555 ? 
31  AC6 6 HOH EA .   ? HOH B 369 . ? 1_555 ? 
32  AC6 6 HOH EA .   ? HOH B 370 . ? 1_555 ? 
33  AC6 6 HOH EA .   ? HOH B 381 . ? 1_555 ? 
34  AC7 4 HIS B  286 ? HIS B 263 . ? 1_555 ? 
35  AC7 4 TRP B  320 ? TRP B 297 . ? 1_555 ? 
36  AC7 4 HIS F  286 ? HIS F 263 . ? 1_555 ? 
37  AC7 4 TRP F  320 ? TRP F 297 . ? 1_555 ? 
38  AC8 6 ASP C  225 ? ASP C 202 . ? 1_555 ? 
39  AC8 6 GLU C  251 ? GLU C 228 . ? 1_555 ? 
40  AC8 6 GLU C  277 ? GLU C 254 . ? 1_555 ? 
41  AC8 6 HOH FA .   ? HOH C 667 . ? 1_555 ? 
42  AC8 6 HOH FA .   ? HOH C 707 . ? 1_555 ? 
43  AC8 6 HOH FA .   ? HOH C 782 . ? 1_555 ? 
44  AC9 6 HOH EA .   ? HOH B 373 . ? 1_555 ? 
45  AC9 6 HOH EA .   ? HOH B 380 . ? 1_555 ? 
46  AC9 6 ARG C  266 ? ARG C 243 . ? 1_555 ? 
47  AC9 6 LEU C  269 ? LEU C 246 . ? 1_555 ? 
48  AC9 6 HOH FA .   ? HOH C 370 . ? 1_555 ? 
49  AC9 6 HOH FA .   ? HOH C 378 . ? 1_555 ? 
50  BC1 6 ASP D  225 ? ASP D 202 . ? 1_555 ? 
51  BC1 6 GLU D  251 ? GLU D 228 . ? 1_555 ? 
52  BC1 6 GLU D  277 ? GLU D 254 . ? 1_555 ? 
53  BC1 6 HOH GA .   ? HOH D 381 . ? 1_555 ? 
54  BC1 6 HOH GA .   ? HOH D 401 . ? 1_555 ? 
55  BC1 6 HOH GA .   ? HOH D 415 . ? 1_555 ? 
56  BC2 6 HOH FA .   ? HOH C 368 . ? 1_555 ? 
57  BC2 6 HOH FA .   ? HOH C 369 . ? 1_555 ? 
58  BC2 6 ARG D  266 ? ARG D 243 . ? 1_555 ? 
59  BC2 6 LEU D  269 ? LEU D 246 . ? 1_555 ? 
60  BC2 6 HOH GA .   ? HOH D 369 . ? 1_555 ? 
61  BC2 6 HOH GA .   ? HOH D 372 . ? 1_555 ? 
62  BC3 4 HIS D  286 ? HIS D 263 . ? 1_555 ? 
63  BC3 4 TRP D  320 ? TRP D 297 . ? 1_555 ? 
64  BC3 4 HIS H  286 ? HIS H 263 . ? 1_555 ? 
65  BC3 4 TRP H  320 ? TRP H 297 . ? 1_555 ? 
66  BC4 6 ASP E  225 ? ASP E 202 . ? 1_555 ? 
67  BC4 6 GLU E  251 ? GLU E 228 . ? 1_555 ? 
68  BC4 6 GLU E  277 ? GLU E 254 . ? 1_555 ? 
69  BC4 6 HOH HA .   ? HOH E 386 . ? 1_555 ? 
70  BC4 6 HOH HA .   ? HOH E 726 . ? 1_555 ? 
71  BC4 6 HOH HA .   ? HOH E 836 . ? 1_555 ? 
72  BC5 6 ARG E  266 ? ARG E 243 . ? 1_555 ? 
73  BC5 6 LEU E  269 ? LEU E 246 . ? 1_555 ? 
74  BC5 6 HOH HA .   ? HOH E 370 . ? 1_555 ? 
75  BC5 6 HOH HA .   ? HOH E 371 . ? 1_555 ? 
76  BC5 6 HOH KA .   ? HOH H 370 . ? 1_555 ? 
77  BC5 6 HOH KA .   ? HOH H 446 . ? 1_555 ? 
78  BC6 6 ASP F  225 ? ASP F 202 . ? 1_555 ? 
79  BC6 6 GLU F  251 ? GLU F 228 . ? 1_555 ? 
80  BC6 6 GLU F  277 ? GLU F 254 . ? 1_555 ? 
81  BC6 6 HOH IA .   ? HOH F 407 . ? 1_555 ? 
82  BC6 6 HOH IA .   ? HOH F 418 . ? 1_555 ? 
83  BC6 6 HOH IA .   ? HOH F 419 . ? 1_555 ? 
84  BC7 6 HOH HA .   ? HOH E 369 . ? 1_555 ? 
85  BC7 6 ARG F  266 ? ARG F 243 . ? 1_555 ? 
86  BC7 6 LEU F  269 ? LEU F 246 . ? 1_555 ? 
87  BC7 6 HOH IA .   ? HOH F 370 . ? 1_555 ? 
88  BC7 6 HOH IA .   ? HOH F 372 . ? 1_555 ? 
89  BC7 6 HOH IA .   ? HOH F 379 . ? 1_555 ? 
90  BC8 4 HIS E  267 ? HIS E 244 . ? 1_555 ? 
91  BC8 4 HIS F  267 ? HIS F 244 . ? 1_555 ? 
92  BC8 4 HIS G  267 ? HIS G 244 . ? 1_555 ? 
93  BC8 4 HIS H  267 ? HIS H 244 . ? 1_555 ? 
94  BC9 6 ASP G  225 ? ASP G 202 . ? 1_555 ? 
95  BC9 6 GLU G  251 ? GLU G 228 . ? 1_555 ? 
96  BC9 6 GLU G  277 ? GLU G 254 . ? 1_555 ? 
97  BC9 6 HOH JA .   ? HOH G 409 . ? 1_555 ? 
98  BC9 6 HOH JA .   ? HOH G 429 . ? 1_555 ? 
99  BC9 6 HOH JA .   ? HOH G 438 . ? 1_555 ? 
100 CC1 6 HOH IA .   ? HOH F 369 . ? 1_555 ? 
101 CC1 6 ARG G  266 ? ARG G 243 . ? 1_555 ? 
102 CC1 6 LEU G  269 ? LEU G 246 . ? 1_555 ? 
103 CC1 6 HOH JA .   ? HOH G 368 . ? 1_555 ? 
104 CC1 6 HOH JA .   ? HOH G 370 . ? 1_555 ? 
105 CC1 6 HOH JA .   ? HOH G 381 . ? 1_555 ? 
106 CC2 6 ASP H  225 ? ASP H 202 . ? 1_555 ? 
107 CC2 6 GLU H  251 ? GLU H 228 . ? 1_555 ? 
108 CC2 6 GLU H  277 ? GLU H 254 . ? 1_555 ? 
109 CC2 6 HOH KA .   ? HOH H 403 . ? 1_555 ? 
110 CC2 6 HOH KA .   ? HOH H 423 . ? 1_555 ? 
111 CC2 6 HOH KA .   ? HOH H 846 . ? 1_555 ? 
112 CC3 6 HOH JA .   ? HOH G 373 . ? 1_555 ? 
113 CC3 6 ARG H  266 ? ARG H 243 . ? 1_555 ? 
114 CC3 6 LEU H  269 ? LEU H 246 . ? 1_555 ? 
115 CC3 6 HOH KA .   ? HOH H 368 . ? 1_555 ? 
116 CC3 6 HOH KA .   ? HOH H 372 . ? 1_555 ? 
117 CC3 6 HOH KA .   ? HOH H 385 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3UGV 
_atom_sites.fract_transf_matrix[1][1]   0.006548 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005763 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
NI 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . THR A  1 27  ? 105.629 123.067 125.328 1.00 52.29  ? 4   THR A N   1 
ATOM   2     C  CA  . THR A  1 27  ? 104.813 121.951 125.822 1.00 65.08  ? 4   THR A CA  1 
ATOM   3     C  C   . THR A  1 27  ? 103.538 121.687 125.002 1.00 60.74  ? 4   THR A C   1 
ATOM   4     O  O   . THR A  1 27  ? 103.095 122.536 124.221 1.00 62.32  ? 4   THR A O   1 
ATOM   5     C  CB  . THR A  1 27  ? 104.406 122.150 127.293 1.00 74.00  ? 4   THR A CB  1 
ATOM   6     O  OG1 . THR A  1 27  ? 103.337 123.105 127.376 1.00 67.70  ? 4   THR A OG1 1 
ATOM   7     C  CG2 . THR A  1 27  ? 105.600 122.625 128.112 1.00 80.97  ? 4   THR A CG2 1 
ATOM   8     N  N   . LEU A  1 28  ? 102.951 120.505 125.201 1.00 45.34  ? 5   LEU A N   1 
ATOM   9     C  CA  . LEU A  1 28  ? 101.798 120.056 124.419 1.00 35.60  ? 5   LEU A CA  1 
ATOM   10    C  C   . LEU A  1 28  ? 100.871 119.197 125.286 1.00 35.88  ? 5   LEU A C   1 
ATOM   11    O  O   . LEU A  1 28  ? 101.256 118.108 125.720 1.00 30.29  ? 5   LEU A O   1 
ATOM   12    C  CB  . LEU A  1 28  ? 102.272 119.263 123.201 1.00 28.19  ? 5   LEU A CB  1 
ATOM   13    C  CG  . LEU A  1 28  ? 101.338 119.170 121.998 1.00 35.48  ? 5   LEU A CG  1 
ATOM   14    C  CD1 . LEU A  1 28  ? 100.832 120.551 121.601 1.00 31.83  ? 5   LEU A CD1 1 
ATOM   15    C  CD2 . LEU A  1 28  ? 102.061 118.512 120.836 1.00 31.67  ? 5   LEU A CD2 1 
ATOM   16    N  N   . THR A  1 29  ? 99.659  119.693 125.535 1.00 28.40  ? 6   THR A N   1 
ATOM   17    C  CA  . THR A  1 29  ? 98.745  119.075 126.511 1.00 35.56  ? 6   THR A CA  1 
ATOM   18    C  C   . THR A  1 29  ? 97.420  118.612 125.893 1.00 28.24  ? 6   THR A C   1 
ATOM   19    O  O   . THR A  1 29  ? 96.755  119.377 125.207 1.00 31.18  ? 6   THR A O   1 
ATOM   20    C  CB  . THR A  1 29  ? 98.427  120.049 127.663 1.00 34.02  ? 6   THR A CB  1 
ATOM   21    O  OG1 . THR A  1 29  ? 99.623  120.729 128.052 1.00 46.34  ? 6   THR A OG1 1 
ATOM   22    C  CG2 . THR A  1 29  ? 97.883  119.301 128.854 1.00 26.74  ? 6   THR A CG2 1 
ATOM   23    N  N   . PHE A  1 30  ? 97.050  117.356 126.135 1.00 30.66  ? 7   PHE A N   1 
ATOM   24    C  CA  . PHE A  1 30  ? 95.806  116.793 125.605 1.00 31.74  ? 7   PHE A CA  1 
ATOM   25    C  C   . PHE A  1 30  ? 94.587  117.508 126.179 1.00 36.36  ? 7   PHE A C   1 
ATOM   26    O  O   . PHE A  1 30  ? 94.439  117.603 127.399 1.00 40.35  ? 7   PHE A O   1 
ATOM   27    C  CB  . PHE A  1 30  ? 95.727  115.299 125.932 1.00 33.65  ? 7   PHE A CB  1 
ATOM   28    C  CG  . PHE A  1 30  ? 94.538  114.595 125.319 1.00 35.27  ? 7   PHE A CG  1 
ATOM   29    C  CD1 . PHE A  1 30  ? 93.280  114.697 125.893 1.00 37.91  ? 7   PHE A CD1 1 
ATOM   30    C  CD2 . PHE A  1 30  ? 94.686  113.806 124.186 1.00 36.50  ? 7   PHE A CD2 1 
ATOM   31    C  CE1 . PHE A  1 30  ? 92.187  114.043 125.338 1.00 35.37  ? 7   PHE A CE1 1 
ATOM   32    C  CE2 . PHE A  1 30  ? 93.597  113.145 123.628 1.00 36.94  ? 7   PHE A CE2 1 
ATOM   33    C  CZ  . PHE A  1 30  ? 92.343  113.267 124.210 1.00 33.85  ? 7   PHE A CZ  1 
ATOM   34    N  N   . ARG A  1 31  ? 93.709  118.001 125.306 1.00 34.19  ? 8   ARG A N   1 
ATOM   35    C  CA  . ARG A  1 31  ? 92.487  118.669 125.760 1.00 31.35  ? 8   ARG A CA  1 
ATOM   36    C  C   . ARG A  1 31  ? 91.238  117.791 125.654 1.00 34.58  ? 8   ARG A C   1 
ATOM   37    O  O   . ARG A  1 31  ? 90.602  117.484 126.659 1.00 45.51  ? 8   ARG A O   1 
ATOM   38    C  CB  . ARG A  1 31  ? 92.270  120.000 125.038 1.00 36.91  ? 8   ARG A CB  1 
ATOM   39    C  CG  . ARG A  1 31  ? 91.145  120.843 125.650 1.00 40.47  ? 8   ARG A CG  1 
ATOM   40    C  CD  . ARG A  1 31  ? 91.180  122.284 125.160 1.00 42.54  ? 8   ARG A CD  1 
ATOM   41    N  NE  . ARG A  1 31  ? 90.571  123.171 126.143 1.00 65.30  ? 8   ARG A NE  1 
ATOM   42    C  CZ  . ARG A  1 31  ? 90.092  124.381 125.870 1.00 76.21  ? 8   ARG A CZ  1 
ATOM   43    N  NH1 . ARG A  1 31  ? 89.544  125.114 126.837 1.00 71.22  ? 8   ARG A NH1 1 
ATOM   44    N  NH2 . ARG A  1 31  ? 90.148  124.851 124.629 1.00 76.14  ? 8   ARG A NH2 1 
ATOM   45    N  N   . LYS A  1 32  ? 90.883  117.399 124.438 1.00 39.21  ? 9   LYS A N   1 
ATOM   46    C  CA  . LYS A  1 32  ? 89.786  116.460 124.236 1.00 42.43  ? 9   LYS A CA  1 
ATOM   47    C  C   . LYS A  1 32  ? 89.859  115.859 122.846 1.00 39.80  ? 9   LYS A C   1 
ATOM   48    O  O   . LYS A  1 32  ? 90.519  116.391 121.954 1.00 34.97  ? 9   LYS A O   1 
ATOM   49    C  CB  . LYS A  1 32  ? 88.423  117.134 124.406 1.00 42.32  ? 9   LYS A CB  1 
ATOM   50    C  CG  . LYS A  1 32  ? 88.031  118.008 123.229 1.00 43.58  ? 9   LYS A CG  1 
ATOM   51    C  CD  . LYS A  1 32  ? 86.582  118.485 123.336 1.00 55.24  ? 9   LYS A CD  1 
ATOM   52    C  CE  . LYS A  1 32  ? 85.621  117.301 123.376 1.00 62.86  ? 9   LYS A CE  1 
ATOM   53    N  NZ  . LYS A  1 32  ? 84.264  117.656 122.877 1.00 66.32  ? 9   LYS A NZ  1 
ATOM   54    N  N   . LEU A  1 33  ? 89.149  114.753 122.674 1.00 36.76  ? 10  LEU A N   1 
ATOM   55    C  CA  . LEU A  1 33  ? 89.075  114.077 121.397 1.00 36.05  ? 10  LEU A CA  1 
ATOM   56    C  C   . LEU A  1 33  ? 87.607  113.934 120.990 1.00 38.46  ? 10  LEU A C   1 
ATOM   57    O  O   . LEU A  1 33  ? 86.767  113.504 121.782 1.00 44.50  ? 10  LEU A O   1 
ATOM   58    C  CB  . LEU A  1 33  ? 89.777  112.709 121.499 1.00 36.33  ? 10  LEU A CB  1 
ATOM   59    C  CG  . LEU A  1 33  ? 89.838  111.796 120.274 1.00 38.62  ? 10  LEU A CG  1 
ATOM   60    C  CD1 . LEU A  1 33  ? 90.970  110.793 120.422 1.00 35.53  ? 10  LEU A CD1 1 
ATOM   61    C  CD2 . LEU A  1 33  ? 88.509  111.082 120.060 1.00 37.14  ? 10  LEU A CD2 1 
ATOM   62    N  N   . THR A  1 34  ? 87.302  114.313 119.755 1.00 41.34  ? 11  THR A N   1 
ATOM   63    C  CA  . THR A  1 34  ? 85.958  114.165 119.211 1.00 43.05  ? 11  THR A CA  1 
ATOM   64    C  C   . THR A  1 34  ? 85.952  113.109 118.122 1.00 42.35  ? 11  THR A C   1 
ATOM   65    O  O   . THR A  1 34  ? 86.756  113.171 117.195 1.00 42.68  ? 11  THR A O   1 
ATOM   66    C  CB  . THR A  1 34  ? 85.467  115.471 118.585 1.00 44.45  ? 11  THR A CB  1 
ATOM   67    O  OG1 . THR A  1 34  ? 85.430  116.490 119.586 1.00 49.22  ? 11  THR A OG1 1 
ATOM   68    C  CG2 . THR A  1 34  ? 84.078  115.286 117.991 1.00 43.44  ? 11  THR A CG2 1 
ATOM   69    N  N   . ALA A  1 35  ? 85.045  112.143 118.236 1.00 34.05  ? 12  ALA A N   1 
ATOM   70    C  CA  . ALA A  1 35  ? 84.934  111.073 117.252 1.00 30.00  ? 12  ALA A CA  1 
ATOM   71    C  C   . ALA A  1 35  ? 83.563  111.062 116.571 1.00 32.28  ? 12  ALA A C   1 
ATOM   72    O  O   . ALA A  1 35  ? 82.550  110.818 117.223 1.00 37.10  ? 12  ALA A O   1 
ATOM   73    C  CB  . ALA A  1 35  ? 85.205  109.732 117.912 1.00 37.32  ? 12  ALA A CB  1 
ATOM   74    N  N   . ARG A  1 36  ? 83.549  111.310 115.261 1.00 30.99  ? 13  ARG A N   1 
ATOM   75    C  CA  . ARG A  1 36  ? 82.312  111.384 114.471 1.00 33.27  ? 13  ARG A CA  1 
ATOM   76    C  C   . ARG A  1 36  ? 82.196  110.252 113.453 1.00 38.72  ? 13  ARG A C   1 
ATOM   77    O  O   . ARG A  1 36  ? 83.037  110.138 112.569 1.00 43.38  ? 13  ARG A O   1 
ATOM   78    C  CB  . ARG A  1 36  ? 82.254  112.721 113.724 1.00 31.93  ? 13  ARG A CB  1 
ATOM   79    C  CG  . ARG A  1 36  ? 82.207  113.931 114.640 1.00 31.32  ? 13  ARG A CG  1 
ATOM   80    C  CD  . ARG A  1 36  ? 82.133  115.202 113.842 1.00 29.84  ? 13  ARG A CD  1 
ATOM   81    N  NE  . ARG A  1 36  ? 83.372  115.433 113.124 1.00 37.54  ? 13  ARG A NE  1 
ATOM   82    C  CZ  . ARG A  1 36  ? 83.481  116.232 112.073 1.00 44.84  ? 13  ARG A CZ  1 
ATOM   83    N  NH1 . ARG A  1 36  ? 82.409  116.863 111.606 1.00 42.69  ? 13  ARG A NH1 1 
ATOM   84    N  NH2 . ARG A  1 36  ? 84.659  116.388 111.481 1.00 40.56  ? 13  ARG A NH2 1 
ATOM   85    N  N   . PRO A  1 37  ? 81.139  109.424 113.564 1.00 39.10  ? 14  PRO A N   1 
ATOM   86    C  CA  . PRO A  1 37  ? 80.904  108.289 112.657 1.00 27.17  ? 14  PRO A CA  1 
ATOM   87    C  C   . PRO A  1 37  ? 80.196  108.694 111.360 1.00 38.32  ? 14  PRO A C   1 
ATOM   88    O  O   . PRO A  1 37  ? 79.200  109.412 111.396 1.00 43.77  ? 14  PRO A O   1 
ATOM   89    C  CB  . PRO A  1 37  ? 79.972  107.387 113.474 1.00 25.50  ? 14  PRO A CB  1 
ATOM   90    C  CG  . PRO A  1 37  ? 79.142  108.376 114.292 1.00 23.70  ? 14  PRO A CG  1 
ATOM   91    C  CD  . PRO A  1 37  ? 80.091  109.532 114.604 1.00 36.84  ? 14  PRO A CD  1 
ATOM   92    N  N   . VAL A  1 38  ? 80.701  108.228 110.224 1.00 36.53  ? 15  VAL A N   1 
ATOM   93    C  CA  . VAL A  1 38  ? 80.063  108.496 108.951 1.00 36.97  ? 15  VAL A CA  1 
ATOM   94    C  C   . VAL A  1 38  ? 79.958  107.197 108.173 1.00 45.33  ? 15  VAL A C   1 
ATOM   95    O  O   . VAL A  1 38  ? 80.720  106.254 108.423 1.00 39.56  ? 15  VAL A O   1 
ATOM   96    C  CB  . VAL A  1 38  ? 80.833  109.551 108.136 1.00 38.75  ? 15  VAL A CB  1 
ATOM   97    C  CG1 . VAL A  1 38  ? 82.067  109.959 108.861 1.00 43.26  ? 15  VAL A CG1 1 
ATOM   98    C  CG2 . VAL A  1 38  ? 81.194  109.017 106.765 1.00 37.20  ? 15  VAL A CG2 1 
ATOM   99    N  N   . LEU A  1 39  ? 79.000  107.139 107.248 1.00 47.34  ? 16  LEU A N   1 
ATOM   100   C  CA  . LEU A  1 39  ? 78.808  105.955 106.413 1.00 47.54  ? 16  LEU A CA  1 
ATOM   101   C  C   . LEU A  1 39  ? 78.835  106.352 104.945 1.00 42.98  ? 16  LEU A C   1 
ATOM   102   O  O   . LEU A  1 39  ? 78.061  107.200 104.517 1.00 46.30  ? 16  LEU A O   1 
ATOM   103   C  CB  . LEU A  1 39  ? 77.498  105.250 106.768 1.00 45.29  ? 16  LEU A CB  1 
ATOM   104   C  CG  . LEU A  1 39  ? 77.269  103.851 106.193 1.00 45.22  ? 16  LEU A CG  1 
ATOM   105   C  CD1 . LEU A  1 39  ? 78.418  102.907 106.531 1.00 42.22  ? 16  LEU A CD1 1 
ATOM   106   C  CD2 . LEU A  1 39  ? 75.953  103.279 106.697 1.00 40.23  ? 16  LEU A CD2 1 
ATOM   107   N  N   . LEU A  1 40  ? 79.742  105.747 104.183 1.00 33.40  ? 17  LEU A N   1 
ATOM   108   C  CA  . LEU A  1 40  ? 79.985  106.155 102.805 1.00 31.60  ? 17  LEU A CA  1 
ATOM   109   C  C   . LEU A  1 40  ? 79.546  105.085 101.809 1.00 43.26  ? 17  LEU A C   1 
ATOM   110   O  O   . LEU A  1 40  ? 79.677  103.891 102.076 1.00 45.72  ? 17  LEU A O   1 
ATOM   111   C  CB  . LEU A  1 40  ? 81.466  106.465 102.605 1.00 36.39  ? 17  LEU A CB  1 
ATOM   112   C  CG  . LEU A  1 40  ? 81.840  107.929 102.405 1.00 44.98  ? 17  LEU A CG  1 
ATOM   113   C  CD1 . LEU A  1 40  ? 81.049  108.814 103.337 1.00 40.48  ? 17  LEU A CD1 1 
ATOM   114   C  CD2 . LEU A  1 40  ? 83.333  108.136 102.593 1.00 45.43  ? 17  LEU A CD2 1 
ATOM   115   N  N   . LYS A  1 41  ? 79.020  105.518 100.664 1.00 45.44  ? 18  LYS A N   1 
ATOM   116   C  CA  . LYS A  1 41  ? 78.613  104.593 99.608  1.00 47.76  ? 18  LYS A CA  1 
ATOM   117   C  C   . LYS A  1 41  ? 79.786  104.334 98.673  1.00 47.02  ? 18  LYS A C   1 
ATOM   118   O  O   . LYS A  1 41  ? 80.262  105.251 98.002  1.00 51.80  ? 18  LYS A O   1 
ATOM   119   C  CB  . LYS A  1 41  ? 77.435  105.159 98.810  1.00 52.80  ? 18  LYS A CB  1 
ATOM   120   C  CG  . LYS A  1 41  ? 76.410  104.115 98.371  1.00 56.32  ? 18  LYS A CG  1 
ATOM   121   C  CD  . LYS A  1 41  ? 75.459  103.796 99.523  1.00 63.02  ? 18  LYS A CD  1 
ATOM   122   C  CE  . LYS A  1 41  ? 74.603  102.567 99.255  1.00 64.83  ? 18  LYS A CE  1 
ATOM   123   N  NZ  . LYS A  1 41  ? 73.775  102.224 100.450 1.00 67.97  ? 18  LYS A NZ  1 
ATOM   124   N  N   . LEU A  1 42  ? 80.256  103.091 98.634  1.00 39.36  ? 19  LEU A N   1 
ATOM   125   C  CA  . LEU A  1 42  ? 81.403  102.744 97.799  1.00 44.15  ? 19  LEU A CA  1 
ATOM   126   C  C   . LEU A  1 42  ? 81.106  102.949 96.309  1.00 53.66  ? 19  LEU A C   1 
ATOM   127   O  O   . LEU A  1 42  ? 79.998  102.663 95.835  1.00 55.72  ? 19  LEU A O   1 
ATOM   128   C  CB  . LEU A  1 42  ? 81.858  101.295 98.059  1.00 38.60  ? 19  LEU A CB  1 
ATOM   129   C  CG  . LEU A  1 42  ? 82.391  100.982 99.465  1.00 41.02  ? 19  LEU A CG  1 
ATOM   130   C  CD1 . LEU A  1 42  ? 82.349  99.480  99.772  1.00 41.29  ? 19  LEU A CD1 1 
ATOM   131   C  CD2 . LEU A  1 42  ? 83.801  101.552 99.671  1.00 34.48  ? 19  LEU A CD2 1 
ATOM   132   N  N   . GLN A  1 43  ? 82.111  103.449 95.591  1.00 52.62  ? 20  GLN A N   1 
ATOM   133   C  CA  . GLN A  1 43  ? 82.080  103.586 94.136  1.00 49.49  ? 20  GLN A CA  1 
ATOM   134   C  C   . GLN A  1 43  ? 81.932  102.219 93.475  1.00 50.12  ? 20  GLN A C   1 
ATOM   135   O  O   . GLN A  1 43  ? 81.171  102.049 92.513  1.00 45.91  ? 20  GLN A O   1 
ATOM   136   C  CB  . GLN A  1 43  ? 83.369  104.263 93.649  1.00 50.59  ? 20  GLN A CB  1 
ATOM   137   C  CG  . GLN A  1 43  ? 83.501  104.365 92.130  1.00 57.94  ? 20  GLN A CG  1 
ATOM   138   C  CD  . GLN A  1 43  ? 84.814  104.999 91.686  1.00 63.97  ? 20  GLN A CD  1 
ATOM   139   O  OE1 . GLN A  1 43  ? 85.589  105.507 92.504  1.00 64.16  ? 20  GLN A OE1 1 
ATOM   140   N  NE2 . GLN A  1 43  ? 85.070  104.967 90.382  1.00 63.51  ? 20  GLN A NE2 1 
ATOM   141   N  N   . ARG A  1 44  ? 82.682  101.254 93.996  1.00 54.22  ? 21  ARG A N   1 
ATOM   142   C  CA  . ARG A  1 44  ? 82.598  99.865  93.563  1.00 54.08  ? 21  ARG A CA  1 
ATOM   143   C  C   . ARG A  1 44  ? 82.363  98.978  94.786  1.00 60.51  ? 21  ARG A C   1 
ATOM   144   O  O   . ARG A  1 44  ? 83.286  98.744  95.568  1.00 57.81  ? 21  ARG A O   1 
ATOM   145   C  CB  . ARG A  1 44  ? 83.894  99.443  92.872  1.00 46.81  ? 21  ARG A CB  1 
ATOM   146   C  CG  . ARG A  1 44  ? 84.332  100.343 91.741  1.00 44.62  ? 21  ARG A CG  1 
ATOM   147   C  CD  . ARG A  1 44  ? 85.731  99.954  91.286  1.00 45.00  ? 21  ARG A CD  1 
ATOM   148   N  NE  . ARG A  1 44  ? 86.086  100.545 89.999  1.00 50.24  ? 21  ARG A NE  1 
ATOM   149   C  CZ  . ARG A  1 44  ? 86.858  101.618 89.851  1.00 56.34  ? 21  ARG A CZ  1 
ATOM   150   N  NH1 . ARG A  1 44  ? 87.366  102.230 90.913  1.00 52.10  ? 21  ARG A NH1 1 
ATOM   151   N  NH2 . ARG A  1 44  ? 87.126  102.076 88.636  1.00 63.99  ? 21  ARG A NH2 1 
ATOM   152   N  N   . PRO A  1 45  ? 81.127  98.476  94.952  1.00 64.01  ? 22  PRO A N   1 
ATOM   153   C  CA  . PRO A  1 45  ? 80.772  97.667  96.125  1.00 56.31  ? 22  PRO A CA  1 
ATOM   154   C  C   . PRO A  1 45  ? 81.571  96.367  96.223  1.00 58.64  ? 22  PRO A C   1 
ATOM   155   O  O   . PRO A  1 45  ? 81.967  95.789  95.206  1.00 60.05  ? 22  PRO A O   1 
ATOM   156   C  CB  . PRO A  1 45  ? 79.285  97.361  95.904  1.00 50.72  ? 22  PRO A CB  1 
ATOM   157   C  CG  . PRO A  1 45  ? 79.091  97.476  94.441  1.00 59.97  ? 22  PRO A CG  1 
ATOM   158   C  CD  . PRO A  1 45  ? 80.012  98.575  93.994  1.00 65.39  ? 22  PRO A CD  1 
ATOM   159   N  N   . VAL A  1 46  ? 81.806  95.927  97.455  1.00 54.73  ? 23  VAL A N   1 
ATOM   160   C  CA  . VAL A  1 46  ? 82.451  94.649  97.716  1.00 52.27  ? 23  VAL A CA  1 
ATOM   161   C  C   . VAL A  1 46  ? 81.553  93.493  97.291  1.00 60.10  ? 23  VAL A C   1 
ATOM   162   O  O   . VAL A  1 46  ? 80.509  93.253  97.888  1.00 67.30  ? 23  VAL A O   1 
ATOM   163   C  CB  . VAL A  1 46  ? 82.778  94.484  99.215  1.00 47.23  ? 23  VAL A CB  1 
ATOM   164   C  CG1 . VAL A  1 46  ? 83.163  93.053  99.513  1.00 51.82  ? 23  VAL A CG1 1 
ATOM   165   C  CG2 . VAL A  1 46  ? 83.886  95.446  99.638  1.00 48.55  ? 23  VAL A CG2 1 
ATOM   166   N  N   . THR A  1 47  ? 81.956  92.775  96.254  1.00 62.11  ? 24  THR A N   1 
ATOM   167   C  CA  . THR A  1 47  ? 81.208  91.600  95.842  1.00 63.21  ? 24  THR A CA  1 
ATOM   168   C  C   . THR A  1 47  ? 81.930  90.339  96.305  1.00 69.99  ? 24  THR A C   1 
ATOM   169   O  O   . THR A  1 47  ? 82.810  89.824  95.609  1.00 66.70  ? 24  THR A O   1 
ATOM   170   C  CB  . THR A  1 47  ? 80.995  91.552  94.313  1.00 55.71  ? 24  THR A CB  1 
ATOM   171   O  OG1 . THR A  1 47  ? 80.400  92.777  93.874  1.00 59.39  ? 24  THR A OG1 1 
ATOM   172   C  CG2 . THR A  1 47  ? 80.083  90.399  93.938  1.00 49.22  ? 24  THR A CG2 1 
ATOM   173   N  N   . ALA A  1 48  ? 81.565  89.863  97.493  1.00 78.46  ? 25  ALA A N   1 
ATOM   174   C  CA  . ALA A  1 48  ? 82.035  88.575  97.990  1.00 84.97  ? 25  ALA A CA  1 
ATOM   175   C  C   . ALA A  1 48  ? 81.036  87.493  97.592  1.00 91.96  ? 25  ALA A C   1 
ATOM   176   O  O   . ALA A  1 48  ? 80.016  87.784  96.963  1.00 91.35  ? 25  ALA A O   1 
ATOM   177   C  CB  . ALA A  1 48  ? 82.216  88.612  99.504  1.00 84.71  ? 25  ALA A CB  1 
ATOM   178   N  N   . ARG A  1 49  ? 81.326  86.249  97.957  1.00 101.17 ? 26  ARG A N   1 
ATOM   179   C  CA  . ARG A  1 49  ? 80.463  85.126  97.596  1.00 109.25 ? 26  ARG A CA  1 
ATOM   180   C  C   . ARG A  1 49  ? 79.249  85.072  98.521  1.00 116.95 ? 26  ARG A C   1 
ATOM   181   O  O   . ARG A  1 49  ? 78.129  84.781  98.087  1.00 111.28 ? 26  ARG A O   1 
ATOM   182   C  CB  . ARG A  1 49  ? 81.244  83.813  97.681  1.00 106.46 ? 26  ARG A CB  1 
ATOM   183   C  CG  . ARG A  1 49  ? 80.701  82.697  96.808  1.00 104.39 ? 26  ARG A CG  1 
ATOM   184   C  CD  . ARG A  1 49  ? 81.398  81.378  97.114  1.00 103.95 ? 26  ARG A CD  1 
ATOM   185   N  NE  . ARG A  1 49  ? 80.635  80.549  98.047  1.00 104.72 ? 26  ARG A NE  1 
ATOM   186   C  CZ  . ARG A  1 49  ? 80.788  80.564  99.368  1.00 103.36 ? 26  ARG A CZ  1 
ATOM   187   N  NH1 . ARG A  1 49  ? 80.046  79.772  100.134 1.00 96.83  ? 26  ARG A NH1 1 
ATOM   188   N  NH2 . ARG A  1 49  ? 81.682  81.371  99.925  1.00 105.94 ? 26  ARG A NH2 1 
ATOM   189   N  N   . ILE A  1 50  ? 79.493  85.364  99.797  1.00 126.10 ? 27  ILE A N   1 
ATOM   190   C  CA  . ILE A  1 50  ? 78.465  85.343  100.836 1.00 128.56 ? 27  ILE A CA  1 
ATOM   191   C  C   . ILE A  1 50  ? 77.400  86.430  100.632 1.00 126.50 ? 27  ILE A C   1 
ATOM   192   O  O   . ILE A  1 50  ? 76.204  86.169  100.776 1.00 125.60 ? 27  ILE A O   1 
ATOM   193   C  CB  . ILE A  1 50  ? 79.102  85.460  102.254 1.00 94.32  ? 27  ILE A CB  1 
ATOM   194   C  CG1 . ILE A  1 50  ? 78.026  85.451  103.347 1.00 98.03  ? 27  ILE A CG1 1 
ATOM   195   C  CG2 . ILE A  1 50  ? 79.994  86.697  102.353 1.00 88.20  ? 27  ILE A CG2 1 
ATOM   196   C  CD1 . ILE A  1 50  ? 77.347  84.105  103.542 1.00 97.31  ? 27  ILE A CD1 1 
ATOM   197   N  N   . ALA A  1 51  ? 77.841  87.640  100.290 1.00 121.07 ? 28  ALA A N   1 
ATOM   198   C  CA  . ALA A  1 51  ? 76.936  88.765  100.071 1.00 111.27 ? 28  ALA A CA  1 
ATOM   199   C  C   . ALA A  1 51  ? 77.644  89.941  99.399  1.00 100.23 ? 28  ALA A C   1 
ATOM   200   O  O   . ALA A  1 51  ? 78.863  89.935  99.235  1.00 95.42  ? 28  ALA A O   1 
ATOM   201   C  CB  . ALA A  1 51  ? 76.312  89.210  101.390 1.00 111.49 ? 28  ALA A CB  1 
ATOM   202   N  N   . THR A  1 52  ? 76.864  90.947  99.011  1.00 95.82  ? 29  THR A N   1 
ATOM   203   C  CA  . THR A  1 52  ? 77.405  92.191  98.467  1.00 87.42  ? 29  THR A CA  1 
ATOM   204   C  C   . THR A  1 52  ? 77.334  93.287  99.539  1.00 77.63  ? 29  THR A C   1 
ATOM   205   O  O   . THR A  1 52  ? 76.307  93.453  100.198 1.00 85.20  ? 29  THR A O   1 
ATOM   206   C  CB  . THR A  1 52  ? 76.645  92.631  97.180  1.00 77.46  ? 29  THR A CB  1 
ATOM   207   O  OG1 . THR A  1 52  ? 76.814  91.646  96.152  1.00 76.98  ? 29  THR A OG1 1 
ATOM   208   C  CG2 . THR A  1 52  ? 77.164  93.961  96.665  1.00 76.55  ? 29  THR A CG2 1 
ATOM   209   N  N   . ILE A  1 53  ? 78.431  94.020  99.723  1.00 64.86  ? 30  ILE A N   1 
ATOM   210   C  CA  . ILE A  1 53  ? 78.502  95.092  100.721 1.00 59.14  ? 30  ILE A CA  1 
ATOM   211   C  C   . ILE A  1 53  ? 78.715  96.466  100.070 1.00 54.41  ? 30  ILE A C   1 
ATOM   212   O  O   . ILE A  1 53  ? 79.776  96.751  99.514  1.00 45.66  ? 30  ILE A O   1 
ATOM   213   C  CB  . ILE A  1 53  ? 79.617  94.841  101.760 1.00 62.51  ? 30  ILE A CB  1 
ATOM   214   C  CG1 . ILE A  1 53  ? 79.440  93.474  102.420 1.00 67.09  ? 30  ILE A CG1 1 
ATOM   215   C  CG2 . ILE A  1 53  ? 79.638  95.949  102.804 1.00 64.66  ? 30  ILE A CG2 1 
ATOM   216   C  CD1 . ILE A  1 53  ? 79.958  92.320  101.580 1.00 72.15  ? 30  ILE A CD1 1 
ATOM   217   N  N   . PRO A  1 54  ? 77.691  97.325  100.126 1.00 55.72  ? 31  PRO A N   1 
ATOM   218   C  CA  . PRO A  1 54  ? 77.831  98.608  99.431  1.00 53.30  ? 31  PRO A CA  1 
ATOM   219   C  C   . PRO A  1 54  ? 78.336  99.756  100.311 1.00 52.37  ? 31  PRO A C   1 
ATOM   220   O  O   . PRO A  1 54  ? 78.638  100.817 99.755  1.00 49.20  ? 31  PRO A O   1 
ATOM   221   C  CB  . PRO A  1 54  ? 76.405  98.890  98.961  1.00 53.54  ? 31  PRO A CB  1 
ATOM   222   C  CG  . PRO A  1 54  ? 75.533  98.235  100.016 1.00 40.31  ? 31  PRO A CG  1 
ATOM   223   C  CD  . PRO A  1 54  ? 76.295  97.044  100.523 1.00 43.92  ? 31  PRO A CD  1 
ATOM   224   N  N   . ASP A  1 55  ? 78.444  99.543  101.627 1.00 50.05  ? 32  ASP A N   1 
ATOM   225   C  CA  . ASP A  1 55  ? 78.708  100.632 102.579 1.00 48.74  ? 32  ASP A CA  1 
ATOM   226   C  C   . ASP A  1 55  ? 80.064  100.557 103.282 1.00 47.74  ? 32  ASP A C   1 
ATOM   227   O  O   . ASP A  1 55  ? 80.552  99.477  103.608 1.00 46.62  ? 32  ASP A O   1 
ATOM   228   C  CB  . ASP A  1 55  ? 77.604  100.697 103.634 1.00 61.40  ? 32  ASP A CB  1 
ATOM   229   C  CG  . ASP A  1 55  ? 76.247  100.991 103.036 1.00 76.12  ? 32  ASP A CG  1 
ATOM   230   O  OD1 . ASP A  1 55  ? 76.177  101.819 102.101 1.00 73.57  ? 32  ASP A OD1 1 
ATOM   231   O  OD2 . ASP A  1 55  ? 75.252  100.388 103.496 1.00 83.29  ? 32  ASP A OD2 1 
ATOM   232   N  N   . TRP A  1 56  ? 80.646  101.726 103.536 1.00 40.40  ? 33  TRP A N   1 
ATOM   233   C  CA  . TRP A  1 56  ? 81.969  101.830 104.134 1.00 34.14  ? 33  TRP A CA  1 
ATOM   234   C  C   . TRP A  1 56  ? 81.995  102.826 105.278 1.00 33.07  ? 33  TRP A C   1 
ATOM   235   O  O   . TRP A  1 56  ? 82.015  104.031 105.044 1.00 30.92  ? 33  TRP A O   1 
ATOM   236   C  CB  . TRP A  1 56  ? 82.985  102.269 103.082 1.00 35.18  ? 33  TRP A CB  1 
ATOM   237   C  CG  . TRP A  1 56  ? 84.405  102.087 103.523 1.00 37.99  ? 33  TRP A CG  1 
ATOM   238   C  CD1 . TRP A  1 56  ? 85.361  103.050 103.613 1.00 38.63  ? 33  TRP A CD1 1 
ATOM   239   C  CD2 . TRP A  1 56  ? 85.026  100.861 103.937 1.00 31.78  ? 33  TRP A CD2 1 
ATOM   240   N  NE1 . TRP A  1 56  ? 86.544  102.499 104.046 1.00 43.03  ? 33  TRP A NE1 1 
ATOM   241   C  CE2 . TRP A  1 56  ? 86.365  101.157 104.250 1.00 34.46  ? 33  TRP A CE2 1 
ATOM   242   C  CE3 . TRP A  1 56  ? 84.579  99.541  104.061 1.00 32.49  ? 33  TRP A CE3 1 
ATOM   243   C  CZ2 . TRP A  1 56  ? 87.260  100.190 104.697 1.00 29.08  ? 33  TRP A CZ2 1 
ATOM   244   C  CZ3 . TRP A  1 56  ? 85.470  98.578  104.502 1.00 32.63  ? 33  TRP A CZ3 1 
ATOM   245   C  CH2 . TRP A  1 56  ? 86.794  98.909  104.820 1.00 30.99  ? 33  TRP A CH2 1 
ATOM   246   N  N   . PRO A  1 57  ? 82.017  102.327 106.524 1.00 29.19  ? 34  PRO A N   1 
ATOM   247   C  CA  . PRO A  1 57  ? 82.023  103.194 107.712 1.00 27.15  ? 34  PRO A CA  1 
ATOM   248   C  C   . PRO A  1 57  ? 83.399  103.799 107.983 1.00 35.13  ? 34  PRO A C   1 
ATOM   249   O  O   . PRO A  1 57  ? 84.419  103.180 107.667 1.00 32.01  ? 34  PRO A O   1 
ATOM   250   C  CB  . PRO A  1 57  ? 81.666  102.234 108.835 1.00 22.46  ? 34  PRO A CB  1 
ATOM   251   C  CG  . PRO A  1 57  ? 82.204  100.914 108.365 1.00 26.66  ? 34  PRO A CG  1 
ATOM   252   C  CD  . PRO A  1 57  ? 82.053  100.899 106.873 1.00 20.08  ? 34  PRO A CD  1 
ATOM   253   N  N   . LEU A  1 58  ? 83.407  104.996 108.564 1.00 32.14  ? 35  LEU A N   1 
ATOM   254   C  CA  . LEU A  1 58  ? 84.628  105.705 108.921 1.00 30.54  ? 35  LEU A CA  1 
ATOM   255   C  C   . LEU A  1 58  ? 84.379  106.459 110.216 1.00 36.54  ? 35  LEU A C   1 
ATOM   256   O  O   . LEU A  1 58  ? 83.347  107.099 110.366 1.00 48.61  ? 35  LEU A O   1 
ATOM   257   C  CB  . LEU A  1 58  ? 85.001  106.709 107.835 1.00 29.47  ? 35  LEU A CB  1 
ATOM   258   C  CG  . LEU A  1 58  ? 85.418  106.190 106.460 1.00 35.19  ? 35  LEU A CG  1 
ATOM   259   C  CD1 . LEU A  1 58  ? 85.410  107.310 105.456 1.00 38.04  ? 35  LEU A CD1 1 
ATOM   260   C  CD2 . LEU A  1 58  ? 86.794  105.600 106.531 1.00 32.11  ? 35  LEU A CD2 1 
ATOM   261   N  N   . ILE A  1 59  ? 85.308  106.383 111.160 1.00 27.16  ? 36  ILE A N   1 
ATOM   262   C  CA  . ILE A  1 59  ? 85.253  107.268 112.316 1.00 26.84  ? 36  ILE A CA  1 
ATOM   263   C  C   . ILE A  1 59  ? 86.271  108.393 112.159 1.00 33.59  ? 36  ILE A C   1 
ATOM   264   O  O   . ILE A  1 59  ? 87.473  108.151 112.124 1.00 37.66  ? 36  ILE A O   1 
ATOM   265   C  CB  . ILE A  1 59  ? 85.511  106.523 113.632 1.00 25.88  ? 36  ILE A CB  1 
ATOM   266   C  CG1 . ILE A  1 59  ? 84.444  105.457 113.840 1.00 26.82  ? 36  ILE A CG1 1 
ATOM   267   C  CG2 . ILE A  1 59  ? 85.540  107.500 114.816 1.00 22.19  ? 36  ILE A CG2 1 
ATOM   268   C  CD1 . ILE A  1 59  ? 84.723  104.543 115.010 1.00 39.54  ? 36  ILE A CD1 1 
ATOM   269   N  N   . LEU A  1 60  ? 85.780  109.622 112.056 1.00 37.46  ? 37  LEU A N   1 
ATOM   270   C  CA  . LEU A  1 60  ? 86.638  110.793 111.963 1.00 39.05  ? 37  LEU A CA  1 
ATOM   271   C  C   . LEU A  1 60  ? 87.015  111.269 113.363 1.00 44.04  ? 37  LEU A C   1 
ATOM   272   O  O   . LEU A  1 60  ? 86.157  111.411 114.232 1.00 44.82  ? 37  LEU A O   1 
ATOM   273   C  CB  . LEU A  1 60  ? 85.948  111.907 111.172 1.00 31.89  ? 37  LEU A CB  1 
ATOM   274   C  CG  . LEU A  1 60  ? 86.040  111.785 109.647 1.00 44.15  ? 37  LEU A CG  1 
ATOM   275   C  CD1 . LEU A  1 60  ? 85.593  110.418 109.156 1.00 41.46  ? 37  LEU A CD1 1 
ATOM   276   C  CD2 . LEU A  1 60  ? 85.239  112.882 108.963 1.00 48.26  ? 37  LEU A CD2 1 
ATOM   277   N  N   . ILE A  1 61  ? 88.305  111.516 113.566 1.00 39.92  ? 38  ILE A N   1 
ATOM   278   C  CA  . ILE A  1 61  ? 88.846  111.798 114.885 1.00 32.03  ? 38  ILE A CA  1 
ATOM   279   C  C   . ILE A  1 61  ? 89.583  113.133 114.903 1.00 34.30  ? 38  ILE A C   1 
ATOM   280   O  O   . ILE A  1 61  ? 90.534  113.336 114.150 1.00 33.90  ? 38  ILE A O   1 
ATOM   281   C  CB  . ILE A  1 61  ? 89.821  110.694 115.314 1.00 31.08  ? 38  ILE A CB  1 
ATOM   282   C  CG1 . ILE A  1 61  ? 89.110  109.347 115.371 1.00 31.51  ? 38  ILE A CG1 1 
ATOM   283   C  CG2 . ILE A  1 61  ? 90.475  111.012 116.664 1.00 24.60  ? 38  ILE A CG2 1 
ATOM   284   C  CD1 . ILE A  1 61  ? 90.039  108.216 115.748 1.00 31.52  ? 38  ILE A CD1 1 
ATOM   285   N  N   . ASP A  1 62  ? 89.133  114.039 115.767 1.00 34.72  ? 39  ASP A N   1 
ATOM   286   C  CA  . ASP A  1 62  ? 89.774  115.338 115.949 1.00 36.07  ? 39  ASP A CA  1 
ATOM   287   C  C   . ASP A  1 62  ? 90.254  115.492 117.384 1.00 38.50  ? 39  ASP A C   1 
ATOM   288   O  O   . ASP A  1 62  ? 89.491  115.327 118.334 1.00 38.71  ? 39  ASP A O   1 
ATOM   289   C  CB  . ASP A  1 62  ? 88.814  116.488 115.619 1.00 32.50  ? 39  ASP A CB  1 
ATOM   290   C  CG  . ASP A  1 62  ? 88.484  116.574 114.141 1.00 40.79  ? 39  ASP A CG  1 
ATOM   291   O  OD1 . ASP A  1 62  ? 89.148  117.368 113.441 1.00 50.83  ? 39  ASP A OD1 1 
ATOM   292   O  OD2 . ASP A  1 62  ? 87.557  115.863 113.685 1.00 35.72  ? 39  ASP A OD2 1 
ATOM   293   N  N   . ILE A  1 63  ? 91.525  115.830 117.532 1.00 41.05  ? 40  ILE A N   1 
ATOM   294   C  CA  . ILE A  1 63  ? 92.083  116.088 118.839 1.00 36.01  ? 40  ILE A CA  1 
ATOM   295   C  C   . ILE A  1 63  ? 92.320  117.581 119.024 1.00 38.68  ? 40  ILE A C   1 
ATOM   296   O  O   . ILE A  1 63  ? 92.713  118.273 118.090 1.00 33.52  ? 40  ILE A O   1 
ATOM   297   C  CB  . ILE A  1 63  ? 93.389  115.324 119.020 1.00 29.47  ? 40  ILE A CB  1 
ATOM   298   C  CG1 . ILE A  1 63  ? 93.086  113.829 119.066 1.00 35.91  ? 40  ILE A CG1 1 
ATOM   299   C  CG2 . ILE A  1 63  ? 94.095  115.758 120.292 1.00 25.59  ? 40  ILE A CG2 1 
ATOM   300   C  CD1 . ILE A  1 63  ? 94.239  112.991 119.536 1.00 41.31  ? 40  ILE A CD1 1 
ATOM   301   N  N   . GLU A  1 64  ? 92.043  118.075 120.227 1.00 32.52  ? 41  GLU A N   1 
ATOM   302   C  CA  . GLU A  1 64  ? 92.407  119.433 120.593 1.00 38.28  ? 41  GLU A CA  1 
ATOM   303   C  C   . GLU A  1 64  ? 93.446  119.352 121.699 1.00 35.13  ? 41  GLU A C   1 
ATOM   304   O  O   . GLU A  1 64  ? 93.405  118.439 122.528 1.00 37.16  ? 41  GLU A O   1 
ATOM   305   C  CB  . GLU A  1 64  ? 91.193  120.222 121.102 1.00 45.49  ? 41  GLU A CB  1 
ATOM   306   C  CG  . GLU A  1 64  ? 90.029  120.372 120.128 1.00 49.04  ? 41  GLU A CG  1 
ATOM   307   C  CD  . GLU A  1 64  ? 88.934  121.315 120.658 1.00 59.60  ? 41  GLU A CD  1 
ATOM   308   O  OE1 . GLU A  1 64  ? 89.277  122.352 121.277 1.00 68.61  ? 41  GLU A OE1 1 
ATOM   309   O  OE2 . GLU A  1 64  ? 87.733  121.022 120.456 1.00 50.11  ? 41  GLU A OE2 1 
ATOM   310   N  N   . THR A  1 65  ? 94.387  120.290 121.688 1.00 27.99  ? 42  THR A N   1 
ATOM   311   C  CA  . THR A  1 65  ? 95.338  120.477 122.778 1.00 34.99  ? 42  THR A CA  1 
ATOM   312   C  C   . THR A  1 65  ? 95.109  121.848 123.421 1.00 39.04  ? 42  THR A C   1 
ATOM   313   O  O   . THR A  1 65  ? 94.570  122.760 122.787 1.00 38.91  ? 42  THR A O   1 
ATOM   314   C  CB  . THR A  1 65  ? 96.792  120.421 122.261 1.00 36.08  ? 42  THR A CB  1 
ATOM   315   O  OG1 . THR A  1 65  ? 96.908  121.238 121.094 1.00 31.58  ? 42  THR A OG1 1 
ATOM   316   C  CG2 . THR A  1 65  ? 97.196  118.994 121.914 1.00 30.56  ? 42  THR A CG2 1 
ATOM   317   N  N   . GLU A  1 66  ? 95.518  122.003 124.675 1.00 37.79  ? 43  GLU A N   1 
ATOM   318   C  CA  . GLU A  1 66  ? 95.386  123.294 125.343 1.00 42.95  ? 43  GLU A CA  1 
ATOM   319   C  C   . GLU A  1 66  ? 96.111  124.386 124.554 1.00 41.84  ? 43  GLU A C   1 
ATOM   320   O  O   . GLU A  1 66  ? 95.776  125.562 124.652 1.00 51.94  ? 43  GLU A O   1 
ATOM   321   C  CB  . GLU A  1 66  ? 95.920  123.242 126.783 1.00 49.32  ? 43  GLU A CB  1 
ATOM   322   C  CG  . GLU A  1 66  ? 95.394  122.093 127.644 1.00 54.31  ? 43  GLU A CG  1 
ATOM   323   C  CD  . GLU A  1 66  ? 93.893  122.161 127.892 1.00 77.67  ? 43  GLU A CD  1 
ATOM   324   O  OE1 . GLU A  1 66  ? 93.262  123.173 127.512 1.00 85.37  ? 43  GLU A OE1 1 
ATOM   325   O  OE2 . GLU A  1 66  ? 93.341  121.197 128.473 1.00 86.05  ? 43  GLU A OE2 1 
ATOM   326   N  N   . GLU A  1 67  ? 97.090  123.993 123.750 1.00 29.62  ? 44  GLU A N   1 
ATOM   327   C  CA  . GLU A  1 67  ? 97.925  124.968 123.069 1.00 24.07  ? 44  GLU A CA  1 
ATOM   328   C  C   . GLU A  1 67  ? 97.428  125.266 121.662 1.00 33.57  ? 44  GLU A C   1 
ATOM   329   O  O   . GLU A  1 67  ? 98.071  125.994 120.913 1.00 41.51  ? 44  GLU A O   1 
ATOM   330   C  CB  . GLU A  1 67  ? 99.382  124.504 123.043 1.00 28.24  ? 44  GLU A CB  1 
ATOM   331   C  CG  . GLU A  1 67  ? 100.011 124.325 124.426 1.00 34.51  ? 44  GLU A CG  1 
ATOM   332   C  CD  . GLU A  1 67  ? 99.656  122.991 125.085 1.00 41.66  ? 44  GLU A CD  1 
ATOM   333   O  OE1 . GLU A  1 67  ? 98.979  122.158 124.444 1.00 36.63  ? 44  GLU A OE1 1 
ATOM   334   O  OE2 . GLU A  1 67  ? 100.065 122.769 126.246 1.00 45.93  ? 44  GLU A OE2 1 
ATOM   335   N  N   . GLY A  1 68  ? 96.290  124.691 121.295 1.00 32.48  ? 45  GLY A N   1 
ATOM   336   C  CA  . GLY A  1 68  ? 95.672  125.021 120.025 1.00 38.14  ? 45  GLY A CA  1 
ATOM   337   C  C   . GLY A  1 68  ? 96.217  124.304 118.800 1.00 46.31  ? 45  GLY A C   1 
ATOM   338   O  O   . GLY A  1 68  ? 95.988  124.742 117.668 1.00 43.27  ? 45  GLY A O   1 
ATOM   339   N  N   . VAL A  1 69  ? 96.935  123.207 119.011 1.00 46.38  ? 46  VAL A N   1 
ATOM   340   C  CA  . VAL A  1 69  ? 97.383  122.375 117.898 1.00 34.74  ? 46  VAL A CA  1 
ATOM   341   C  C   . VAL A  1 69  ? 96.378  121.253 117.690 1.00 31.84  ? 46  VAL A C   1 
ATOM   342   O  O   . VAL A  1 69  ? 96.084  120.507 118.618 1.00 39.83  ? 46  VAL A O   1 
ATOM   343   C  CB  . VAL A  1 69  ? 98.779  121.797 118.170 1.00 36.25  ? 46  VAL A CB  1 
ATOM   344   C  CG1 . VAL A  1 69  ? 99.279  121.009 116.979 1.00 36.61  ? 46  VAL A CG1 1 
ATOM   345   C  CG2 . VAL A  1 69  ? 99.745  122.920 118.495 1.00 35.46  ? 46  VAL A CG2 1 
ATOM   346   N  N   . PRO A  1 70  ? 95.821  121.139 116.476 1.00 34.22  ? 47  PRO A N   1 
ATOM   347   C  CA  . PRO A  1 70  ? 94.826  120.083 116.245 1.00 32.76  ? 47  PRO A CA  1 
ATOM   348   C  C   . PRO A  1 70  ? 95.480  118.742 115.878 1.00 36.38  ? 47  PRO A C   1 
ATOM   349   O  O   . PRO A  1 70  ? 96.676  118.688 115.601 1.00 34.99  ? 47  PRO A O   1 
ATOM   350   C  CB  . PRO A  1 70  ? 94.034  120.625 115.056 1.00 22.28  ? 47  PRO A CB  1 
ATOM   351   C  CG  . PRO A  1 70  ? 95.083  121.364 114.243 1.00 24.25  ? 47  PRO A CG  1 
ATOM   352   C  CD  . PRO A  1 70  ? 96.076  121.936 115.261 1.00 29.66  ? 47  PRO A CD  1 
ATOM   353   N  N   . GLY A  1 71  ? 94.698  117.668 115.897 1.00 39.35  ? 48  GLY A N   1 
ATOM   354   C  CA  . GLY A  1 71  ? 95.165  116.373 115.435 1.00 29.80  ? 48  GLY A CA  1 
ATOM   355   C  C   . GLY A  1 71  ? 94.048  115.695 114.672 1.00 35.12  ? 48  GLY A C   1 
ATOM   356   O  O   . GLY A  1 71  ? 92.913  115.652 115.157 1.00 38.46  ? 48  GLY A O   1 
ATOM   357   N  N   . ARG A  1 72  ? 94.348  115.180 113.479 1.00 32.08  ? 49  ARG A N   1 
ATOM   358   C  CA  . ARG A  1 72  ? 93.309  114.597 112.623 1.00 34.12  ? 49  ARG A CA  1 
ATOM   359   C  C   . ARG A  1 72  ? 93.691  113.270 111.982 1.00 34.61  ? 49  ARG A C   1 
ATOM   360   O  O   . ARG A  1 72  ? 94.680  113.183 111.273 1.00 33.27  ? 49  ARG A O   1 
ATOM   361   C  CB  . ARG A  1 72  ? 92.909  115.575 111.518 1.00 28.82  ? 49  ARG A CB  1 
ATOM   362   C  CG  . ARG A  1 72  ? 92.042  116.714 112.000 1.00 40.93  ? 49  ARG A CG  1 
ATOM   363   C  CD  . ARG A  1 72  ? 91.428  117.491 110.841 1.00 34.38  ? 49  ARG A CD  1 
ATOM   364   N  NE  . ARG A  1 72  ? 92.411  118.341 110.187 1.00 29.91  ? 49  ARG A NE  1 
ATOM   365   C  CZ  . ARG A  1 72  ? 92.787  119.514 110.674 1.00 36.49  ? 49  ARG A CZ  1 
ATOM   366   N  NH1 . ARG A  1 72  ? 92.261  119.948 111.814 1.00 36.63  ? 49  ARG A NH1 1 
ATOM   367   N  NH2 . ARG A  1 72  ? 93.686  120.248 110.036 1.00 40.17  ? 49  ARG A NH2 1 
ATOM   368   N  N   . ALA A  1 73  ? 92.868  112.251 112.202 1.00 26.65  ? 50  ALA A N   1 
ATOM   369   C  CA  . ALA A  1 73  ? 93.043  110.961 111.555 1.00 28.58  ? 50  ALA A CA  1 
ATOM   370   C  C   . ALA A  1 73  ? 91.702  110.238 111.527 1.00 29.99  ? 50  ALA A C   1 
ATOM   371   O  O   . ALA A  1 73  ? 90.718  110.731 112.078 1.00 28.77  ? 50  ALA A O   1 
ATOM   372   C  CB  . ALA A  1 73  ? 94.082  110.125 112.303 1.00 31.66  ? 50  ALA A CB  1 
ATOM   373   N  N   . TYR A  1 74  ? 91.660  109.061 110.912 1.00 22.39  ? 51  TYR A N   1 
ATOM   374   C  CA  . TYR A  1 74  ? 90.412  108.317 110.844 1.00 25.70  ? 51  TYR A CA  1 
ATOM   375   C  C   . TYR A  1 74  ? 90.581  106.808 111.005 1.00 27.31  ? 51  TYR A C   1 
ATOM   376   O  O   . TYR A  1 74  ? 91.663  106.252 110.802 1.00 26.59  ? 51  TYR A O   1 
ATOM   377   C  CB  . TYR A  1 74  ? 89.665  108.632 109.540 1.00 29.85  ? 51  TYR A CB  1 
ATOM   378   C  CG  . TYR A  1 74  ? 90.391  108.188 108.297 1.00 29.49  ? 51  TYR A CG  1 
ATOM   379   C  CD1 . TYR A  1 74  ? 90.312  106.878 107.856 1.00 33.61  ? 51  TYR A CD1 1 
ATOM   380   C  CD2 . TYR A  1 74  ? 91.169  109.072 107.571 1.00 33.90  ? 51  TYR A CD2 1 
ATOM   381   C  CE1 . TYR A  1 74  ? 90.978  106.463 106.721 1.00 26.60  ? 51  TYR A CE1 1 
ATOM   382   C  CE2 . TYR A  1 74  ? 91.849  108.659 106.436 1.00 24.62  ? 51  TYR A CE2 1 
ATOM   383   C  CZ  . TYR A  1 74  ? 91.748  107.358 106.018 1.00 25.42  ? 51  TYR A CZ  1 
ATOM   384   O  OH  . TYR A  1 74  ? 92.414  106.946 104.885 1.00 25.66  ? 51  TYR A OH  1 
ATOM   385   N  N   . LEU A  1 75  ? 89.484  106.152 111.367 1.00 27.53  ? 52  LEU A N   1 
ATOM   386   C  CA  . LEU A  1 75  ? 89.444  104.705 111.470 1.00 23.33  ? 52  LEU A CA  1 
ATOM   387   C  C   . LEU A  1 75  ? 88.531  104.136 110.391 1.00 26.52  ? 52  LEU A C   1 
ATOM   388   O  O   . LEU A  1 75  ? 87.573  104.783 109.970 1.00 31.96  ? 52  LEU A O   1 
ATOM   389   C  CB  . LEU A  1 75  ? 88.919  104.299 112.844 1.00 30.43  ? 52  LEU A CB  1 
ATOM   390   C  CG  . LEU A  1 75  ? 89.829  104.485 114.052 1.00 27.86  ? 52  LEU A CG  1 
ATOM   391   C  CD1 . LEU A  1 75  ? 89.037  104.256 115.325 1.00 23.02  ? 52  LEU A CD1 1 
ATOM   392   C  CD2 . LEU A  1 75  ? 91.002  103.516 113.967 1.00 25.53  ? 52  LEU A CD2 1 
ATOM   393   N  N   . GLU A  1 76  ? 88.828  102.920 109.953 1.00 29.90  ? 53  GLU A N   1 
ATOM   394   C  CA  . GLU A  1 76  ? 87.983  102.199 109.009 1.00 36.22  ? 53  GLU A CA  1 
ATOM   395   C  C   . GLU A  1 76  ? 87.638  100.858 109.622 1.00 26.20  ? 53  GLU A C   1 
ATOM   396   O  O   . GLU A  1 76  ? 88.304  99.864  109.356 1.00 26.61  ? 53  GLU A O   1 
ATOM   397   C  CB  . GLU A  1 76  ? 88.719  101.992 107.689 1.00 38.02  ? 53  GLU A CB  1 
ATOM   398   C  CG  . GLU A  1 76  ? 89.167  103.289 107.062 1.00 35.03  ? 53  GLU A CG  1 
ATOM   399   C  CD  . GLU A  1 76  ? 89.972  103.080 105.810 1.00 32.20  ? 53  GLU A CD  1 
ATOM   400   O  OE1 . GLU A  1 76  ? 89.367  102.995 104.732 1.00 43.47  ? 53  GLU A OE1 1 
ATOM   401   O  OE2 . GLU A  1 76  ? 91.214  103.011 105.899 1.00 33.45  ? 53  GLU A OE2 1 
ATOM   402   N  N   . PRO A  1 77  ? 86.600  100.830 110.465 1.00 28.16  ? 54  PRO A N   1 
ATOM   403   C  CA  . PRO A  1 77  ? 86.318  99.637  111.271 1.00 26.73  ? 54  PRO A CA  1 
ATOM   404   C  C   . PRO A  1 77  ? 85.494  98.570  110.556 1.00 38.87  ? 54  PRO A C   1 
ATOM   405   O  O   . PRO A  1 77  ? 85.156  97.581  111.213 1.00 41.51  ? 54  PRO A O   1 
ATOM   406   C  CB  . PRO A  1 77  ? 85.556  100.203 112.469 1.00 33.22  ? 54  PRO A CB  1 
ATOM   407   C  CG  . PRO A  1 77  ? 84.863  101.418 111.914 1.00 33.22  ? 54  PRO A CG  1 
ATOM   408   C  CD  . PRO A  1 77  ? 85.763  101.981 110.845 1.00 28.21  ? 54  PRO A CD  1 
ATOM   409   N  N   . TYR A  1 78  ? 85.203  98.753  109.261 1.00 30.50  ? 55  TYR A N   1 
ATOM   410   C  CA  . TYR A  1 78  ? 84.495  97.746  108.450 1.00 31.17  ? 55  TYR A CA  1 
ATOM   411   C  C   . TYR A  1 78  ? 83.008  97.596  108.803 1.00 40.41  ? 55  TYR A C   1 
ATOM   412   O  O   . TYR A  1 78  ? 82.138  97.693  107.939 1.00 44.11  ? 55  TYR A O   1 
ATOM   413   C  CB  . TYR A  1 78  ? 85.130  96.371  108.610 1.00 29.95  ? 55  TYR A CB  1 
ATOM   414   C  CG  . TYR A  1 78  ? 86.407  96.111  107.850 1.00 36.47  ? 55  TYR A CG  1 
ATOM   415   C  CD1 . TYR A  1 78  ? 86.368  95.525  106.593 1.00 45.39  ? 55  TYR A CD1 1 
ATOM   416   C  CD2 . TYR A  1 78  ? 87.655  96.393  108.408 1.00 41.42  ? 55  TYR A CD2 1 
ATOM   417   C  CE1 . TYR A  1 78  ? 87.529  95.245  105.887 1.00 49.60  ? 55  TYR A CE1 1 
ATOM   418   C  CE2 . TYR A  1 78  ? 88.840  96.119  107.701 1.00 46.96  ? 55  TYR A CE2 1 
ATOM   419   C  CZ  . TYR A  1 78  ? 88.760  95.540  106.440 1.00 52.31  ? 55  TYR A CZ  1 
ATOM   420   O  OH  . TYR A  1 78  ? 89.891  95.251  105.704 1.00 57.31  ? 55  TYR A OH  1 
ATOM   421   N  N   . VAL A  1 79  ? 82.739  97.325  110.077 1.00 38.51  ? 56  VAL A N   1 
ATOM   422   C  CA  . VAL A  1 79  ? 81.398  97.012  110.558 1.00 37.35  ? 56  VAL A CA  1 
ATOM   423   C  C   . VAL A  1 79  ? 80.708  98.270  111.079 1.00 43.21  ? 56  VAL A C   1 
ATOM   424   O  O   . VAL A  1 79  ? 81.060  98.770  112.147 1.00 46.23  ? 56  VAL A O   1 
ATOM   425   C  CB  . VAL A  1 79  ? 81.458  95.973  111.710 1.00 35.48  ? 56  VAL A CB  1 
ATOM   426   C  CG1 . VAL A  1 79  ? 80.063  95.531  112.104 1.00 37.22  ? 56  VAL A CG1 1 
ATOM   427   C  CG2 . VAL A  1 79  ? 82.292  94.760  111.322 1.00 27.34  ? 56  VAL A CG2 1 
ATOM   428   N  N   . PRO A  1 80  ? 79.715  98.786  110.334 1.00 39.79  ? 57  PRO A N   1 
ATOM   429   C  CA  . PRO A  1 80  ? 79.017  100.009 110.741 1.00 32.83  ? 57  PRO A CA  1 
ATOM   430   C  C   . PRO A  1 80  ? 78.480  99.944  112.165 1.00 36.63  ? 57  PRO A C   1 
ATOM   431   O  O   . PRO A  1 80  ? 78.663  100.898 112.916 1.00 41.23  ? 57  PRO A O   1 
ATOM   432   C  CB  . PRO A  1 80  ? 77.870  100.092 109.745 1.00 30.29  ? 57  PRO A CB  1 
ATOM   433   C  CG  . PRO A  1 80  ? 78.391  99.408  108.535 1.00 28.54  ? 57  PRO A CG  1 
ATOM   434   C  CD  . PRO A  1 80  ? 79.188  98.260  109.064 1.00 36.40  ? 57  PRO A CD  1 
ATOM   435   N  N   . LYS A  1 81  ? 77.845  98.835  112.531 1.00 38.75  ? 58  LYS A N   1 
ATOM   436   C  CA  . LYS A  1 81  ? 77.336  98.659  113.890 1.00 39.61  ? 58  LYS A CA  1 
ATOM   437   C  C   . LYS A  1 81  ? 78.400  98.886  114.979 1.00 44.51  ? 58  LYS A C   1 
ATOM   438   O  O   . LYS A  1 81  ? 78.118  99.484  116.019 1.00 42.19  ? 58  LYS A O   1 
ATOM   439   C  CB  . LYS A  1 81  ? 76.724  97.266  114.054 1.00 46.87  ? 58  LYS A CB  1 
ATOM   440   C  CG  . LYS A  1 81  ? 75.437  97.047  113.265 1.00 58.46  ? 58  LYS A CG  1 
ATOM   441   C  CD  . LYS A  1 81  ? 74.237  96.817  114.201 1.00 68.43  ? 58  LYS A CD  1 
ATOM   442   C  CE  . LYS A  1 81  ? 72.949  96.476  113.439 1.00 67.76  ? 58  LYS A CE  1 
ATOM   443   N  NZ  . LYS A  1 81  ? 73.079  95.245  112.595 1.00 65.28  ? 58  LYS A NZ  1 
ATOM   444   N  N   . ALA A  1 82  ? 79.620  98.407  114.751 1.00 37.96  ? 59  ALA A N   1 
ATOM   445   C  CA  . ALA A  1 82  ? 80.651  98.517  115.773 1.00 36.52  ? 59  ALA A CA  1 
ATOM   446   C  C   . ALA A  1 82  ? 81.031  99.970  116.083 1.00 33.67  ? 59  ALA A C   1 
ATOM   447   O  O   . ALA A  1 82  ? 81.625  100.246 117.118 1.00 32.86  ? 59  ALA A O   1 
ATOM   448   C  CB  . ALA A  1 82  ? 81.882  97.678  115.420 1.00 33.61  ? 59  ALA A CB  1 
ATOM   449   N  N   . MET A  1 83  ? 80.671  100.906 115.213 1.00 33.83  ? 60  MET A N   1 
ATOM   450   C  CA  . MET A  1 83  ? 80.938  102.310 115.520 1.00 32.94  ? 60  MET A CA  1 
ATOM   451   C  C   . MET A  1 83  ? 80.226  102.731 116.800 1.00 41.57  ? 60  MET A C   1 
ATOM   452   O  O   . MET A  1 83  ? 80.632  103.681 117.470 1.00 42.49  ? 60  MET A O   1 
ATOM   453   C  CB  . MET A  1 83  ? 80.521  103.213 114.373 1.00 22.95  ? 60  MET A CB  1 
ATOM   454   C  CG  . MET A  1 83  ? 81.272  102.932 113.101 1.00 33.27  ? 60  MET A CG  1 
ATOM   455   S  SD  . MET A  1 83  ? 81.212  104.337 111.998 1.00 36.24  ? 60  MET A SD  1 
ATOM   456   C  CE  . MET A  1 83  ? 79.550  104.156 111.339 1.00 38.59  ? 60  MET A CE  1 
ATOM   457   N  N   . LYS A  1 84  ? 79.165  102.008 117.137 1.00 36.46  ? 61  LYS A N   1 
ATOM   458   C  CA  . LYS A  1 84  ? 78.393  102.294 118.337 1.00 44.92  ? 61  LYS A CA  1 
ATOM   459   C  C   . LYS A  1 84  ? 79.108  101.813 119.602 1.00 49.77  ? 61  LYS A C   1 
ATOM   460   O  O   . LYS A  1 84  ? 78.736  102.184 120.716 1.00 56.90  ? 61  LYS A O   1 
ATOM   461   C  CB  . LYS A  1 84  ? 76.995  101.673 118.235 1.00 45.93  ? 61  LYS A CB  1 
ATOM   462   C  CG  . LYS A  1 84  ? 76.009  102.531 117.465 1.00 56.69  ? 61  LYS A CG  1 
ATOM   463   C  CD  . LYS A  1 84  ? 74.694  101.801 117.181 1.00 71.25  ? 61  LYS A CD  1 
ATOM   464   C  CE  . LYS A  1 84  ? 74.600  100.446 117.882 1.00 73.40  ? 61  LYS A CE  1 
ATOM   465   N  NZ  . LYS A  1 84  ? 75.158  99.343  117.039 1.00 71.44  ? 61  LYS A NZ  1 
ATOM   466   N  N   . TYR A  1 85  ? 80.126  100.977 119.439 1.00 40.79  ? 62  TYR A N   1 
ATOM   467   C  CA  . TYR A  1 85  ? 80.919  100.581 120.590 1.00 38.88  ? 62  TYR A CA  1 
ATOM   468   C  C   . TYR A  1 85  ? 82.194  101.415 120.651 1.00 38.42  ? 62  TYR A C   1 
ATOM   469   O  O   . TYR A  1 85  ? 82.699  101.692 121.735 1.00 44.32  ? 62  TYR A O   1 
ATOM   470   C  CB  . TYR A  1 85  ? 81.269  99.093  120.555 1.00 38.24  ? 62  TYR A CB  1 
ATOM   471   C  CG  . TYR A  1 85  ? 80.237  98.180  119.918 1.00 39.14  ? 62  TYR A CG  1 
ATOM   472   C  CD1 . TYR A  1 85  ? 78.864  98.450  119.993 1.00 35.61  ? 62  TYR A CD1 1 
ATOM   473   C  CD2 . TYR A  1 85  ? 80.648  97.028  119.241 1.00 40.50  ? 62  TYR A CD2 1 
ATOM   474   C  CE1 . TYR A  1 85  ? 77.929  97.596  119.390 1.00 32.00  ? 62  TYR A CE1 1 
ATOM   475   C  CE2 . TYR A  1 85  ? 79.741  96.176  118.642 1.00 42.35  ? 62  TYR A CE2 1 
ATOM   476   C  CZ  . TYR A  1 85  ? 78.382  96.455  118.717 1.00 45.32  ? 62  TYR A CZ  1 
ATOM   477   O  OH  . TYR A  1 85  ? 77.507  95.569  118.110 1.00 45.85  ? 62  TYR A OH  1 
ATOM   478   N  N   . LEU A  1 86  ? 82.702  101.817 119.485 1.00 39.10  ? 63  LEU A N   1 
ATOM   479   C  CA  . LEU A  1 86  ? 84.012  102.476 119.379 1.00 37.93  ? 63  LEU A CA  1 
ATOM   480   C  C   . LEU A  1 86  ? 83.961  103.952 119.740 1.00 38.05  ? 63  LEU A C   1 
ATOM   481   O  O   . LEU A  1 86  ? 84.845  104.448 120.434 1.00 40.95  ? 63  LEU A O   1 
ATOM   482   C  CB  . LEU A  1 86  ? 84.626  102.298 117.974 1.00 30.81  ? 63  LEU A CB  1 
ATOM   483   C  CG  . LEU A  1 86  ? 85.158  100.888 117.681 1.00 31.57  ? 63  LEU A CG  1 
ATOM   484   C  CD1 . LEU A  1 86  ? 85.500  100.676 116.205 1.00 23.60  ? 63  LEU A CD1 1 
ATOM   485   C  CD2 . LEU A  1 86  ? 86.357  100.571 118.571 1.00 31.45  ? 63  LEU A CD2 1 
ATOM   486   N  N   . VAL A  1 87  ? 82.942  104.658 119.258 1.00 39.64  ? 64  VAL A N   1 
ATOM   487   C  CA  . VAL A  1 87  ? 82.798  106.073 119.590 1.00 45.49  ? 64  VAL A CA  1 
ATOM   488   C  C   . VAL A  1 87  ? 82.664  106.303 121.110 1.00 50.03  ? 64  VAL A C   1 
ATOM   489   O  O   . VAL A  1 87  ? 83.310  107.185 121.667 1.00 55.06  ? 64  VAL A O   1 
ATOM   490   C  CB  . VAL A  1 87  ? 81.623  106.721 118.855 1.00 38.75  ? 64  VAL A CB  1 
ATOM   491   C  CG1 . VAL A  1 87  ? 81.516  108.172 119.261 1.00 35.12  ? 64  VAL A CG1 1 
ATOM   492   C  CG2 . VAL A  1 87  ? 81.807  106.591 117.358 1.00 29.84  ? 64  VAL A CG2 1 
ATOM   493   N  N   . PRO A  1 88  ? 81.824  105.509 121.786 1.00 47.10  ? 65  PRO A N   1 
ATOM   494   C  CA  . PRO A  1 88  ? 81.824  105.603 123.248 1.00 47.26  ? 65  PRO A CA  1 
ATOM   495   C  C   . PRO A  1 88  ? 83.192  105.283 123.850 1.00 44.78  ? 65  PRO A C   1 
ATOM   496   O  O   . PRO A  1 88  ? 83.614  105.981 124.769 1.00 41.53  ? 65  PRO A O   1 
ATOM   497   C  CB  . PRO A  1 88  ? 80.804  104.538 123.664 1.00 47.46  ? 65  PRO A CB  1 
ATOM   498   C  CG  . PRO A  1 88  ? 79.877  104.456 122.497 1.00 50.35  ? 65  PRO A CG  1 
ATOM   499   C  CD  . PRO A  1 88  ? 80.750  104.632 121.290 1.00 50.68  ? 65  PRO A CD  1 
ATOM   500   N  N   . ALA A  1 89  ? 83.868  104.248 123.350 1.00 36.68  ? 66  ALA A N   1 
ATOM   501   C  CA  . ALA A  1 89  ? 85.181  103.884 123.875 1.00 34.72  ? 66  ALA A CA  1 
ATOM   502   C  C   . ALA A  1 89  ? 86.204  104.998 123.647 1.00 36.95  ? 66  ALA A C   1 
ATOM   503   O  O   . ALA A  1 89  ? 87.141  105.164 124.438 1.00 37.42  ? 66  ALA A O   1 
ATOM   504   C  CB  . ALA A  1 89  ? 85.664  102.582 123.271 1.00 31.24  ? 66  ALA A CB  1 
ATOM   505   N  N   . LEU A  1 90  ? 86.016  105.766 122.577 1.00 32.64  ? 67  LEU A N   1 
ATOM   506   C  CA  . LEU A  1 90  ? 86.933  106.854 122.268 1.00 33.09  ? 67  LEU A CA  1 
ATOM   507   C  C   . LEU A  1 90  ? 86.695  108.006 123.210 1.00 36.49  ? 67  LEU A C   1 
ATOM   508   O  O   . LEU A  1 90  ? 87.634  108.556 123.780 1.00 44.79  ? 67  LEU A O   1 
ATOM   509   C  CB  . LEU A  1 90  ? 86.815  107.296 120.808 1.00 22.53  ? 67  LEU A CB  1 
ATOM   510   C  CG  . LEU A  1 90  ? 87.393  106.281 119.810 1.00 32.82  ? 67  LEU A CG  1 
ATOM   511   C  CD1 . LEU A  1 90  ? 86.850  106.465 118.392 1.00 35.43  ? 67  LEU A CD1 1 
ATOM   512   C  CD2 . LEU A  1 90  ? 88.909  106.366 119.804 1.00 28.19  ? 67  LEU A CD2 1 
ATOM   513   N  N   . HIS A  1 91  ? 85.434  108.354 123.407 1.00 37.51  ? 68  HIS A N   1 
ATOM   514   C  CA  . HIS A  1 91  ? 85.105  109.438 124.328 1.00 34.28  ? 68  HIS A CA  1 
ATOM   515   C  C   . HIS A  1 91  ? 85.469  109.108 125.774 1.00 33.01  ? 68  HIS A C   1 
ATOM   516   O  O   . HIS A  1 91  ? 85.776  110.006 126.547 1.00 33.53  ? 68  HIS A O   1 
ATOM   517   C  CB  . HIS A  1 91  ? 83.648  109.866 124.167 1.00 45.35  ? 68  HIS A CB  1 
ATOM   518   C  CG  . HIS A  1 91  ? 83.365  110.508 122.840 1.00 54.91  ? 68  HIS A CG  1 
ATOM   519   N  ND1 . HIS A  1 91  ? 82.209  110.274 122.126 1.00 60.04  ? 68  HIS A ND1 1 
ATOM   520   C  CD2 . HIS A  1 91  ? 84.100  111.365 122.092 1.00 54.83  ? 68  HIS A CD2 1 
ATOM   521   C  CE1 . HIS A  1 91  ? 82.240  110.967 121.000 1.00 58.00  ? 68  HIS A CE1 1 
ATOM   522   N  NE2 . HIS A  1 91  ? 83.376  111.639 120.955 1.00 57.36  ? 68  HIS A NE2 1 
ATOM   523   N  N   . ASP A  1 92  ? 85.483  107.826 126.130 1.00 33.26  ? 69  ASP A N   1 
ATOM   524   C  CA  . ASP A  1 92  ? 85.970  107.420 127.452 1.00 41.07  ? 69  ASP A CA  1 
ATOM   525   C  C   . ASP A  1 92  ? 87.473  107.646 127.562 1.00 37.31  ? 69  ASP A C   1 
ATOM   526   O  O   . ASP A  1 92  ? 87.974  108.034 128.615 1.00 43.61  ? 69  ASP A O   1 
ATOM   527   C  CB  . ASP A  1 92  ? 85.650  105.946 127.761 1.00 44.12  ? 69  ASP A CB  1 
ATOM   528   C  CG  . ASP A  1 92  ? 84.208  105.733 128.205 1.00 54.49  ? 69  ASP A CG  1 
ATOM   529   O  OD1 . ASP A  1 92  ? 83.568  106.709 128.662 1.00 58.77  ? 69  ASP A OD1 1 
ATOM   530   O  OD2 . ASP A  1 92  ? 83.715  104.584 128.104 1.00 50.61  ? 69  ASP A OD2 1 
ATOM   531   N  N   . MET A  1 93  ? 88.190  107.376 126.478 1.00 32.39  ? 70  MET A N   1 
ATOM   532   C  CA  . MET A  1 93  ? 89.629  107.611 126.451 1.00 29.11  ? 70  MET A CA  1 
ATOM   533   C  C   . MET A  1 93  ? 89.915  109.110 126.537 1.00 27.18  ? 70  MET A C   1 
ATOM   534   O  O   . MET A  1 93  ? 90.820  109.529 127.252 1.00 29.08  ? 70  MET A O   1 
ATOM   535   C  CB  . MET A  1 93  ? 90.275  106.984 125.213 1.00 22.38  ? 70  MET A CB  1 
ATOM   536   C  CG  . MET A  1 93  ? 90.333  105.453 125.275 1.00 26.71  ? 70  MET A CG  1 
ATOM   537   S  SD  . MET A  1 93  ? 91.145  104.657 123.865 1.00 34.28  ? 70  MET A SD  1 
ATOM   538   C  CE  . MET A  1 93  ? 90.979  102.929 124.309 1.00 59.97  ? 70  MET A CE  1 
ATOM   539   N  N   . SER A  1 94  ? 89.119  109.911 125.837 1.00 25.86  ? 71  SER A N   1 
ATOM   540   C  CA  . SER A  1 94  ? 89.260  111.364 125.900 1.00 29.34  ? 71  SER A CA  1 
ATOM   541   C  C   . SER A  1 94  ? 89.106  111.880 127.331 1.00 38.47  ? 71  SER A C   1 
ATOM   542   O  O   . SER A  1 94  ? 89.895  112.708 127.786 1.00 40.91  ? 71  SER A O   1 
ATOM   543   C  CB  . SER A  1 94  ? 88.250  112.050 124.983 1.00 29.63  ? 71  SER A CB  1 
ATOM   544   O  OG  . SER A  1 94  ? 88.321  113.461 125.120 1.00 34.42  ? 71  SER A OG  1 
ATOM   545   N  N   . ASP A  1 95  ? 88.101  111.382 128.045 1.00 36.71  ? 72  ASP A N   1 
ATOM   546   C  CA  . ASP A  1 95  ? 87.869  111.804 129.426 1.00 35.42  ? 72  ASP A CA  1 
ATOM   547   C  C   . ASP A  1 95  ? 89.049  111.397 130.295 1.00 32.37  ? 72  ASP A C   1 
ATOM   548   O  O   . ASP A  1 95  ? 89.476  112.133 131.183 1.00 37.58  ? 72  ASP A O   1 
ATOM   549   C  CB  . ASP A  1 95  ? 86.572  111.191 129.980 1.00 46.99  ? 72  ASP A CB  1 
ATOM   550   C  CG  . ASP A  1 95  ? 85.314  111.759 129.319 1.00 53.09  ? 72  ASP A CG  1 
ATOM   551   O  OD1 . ASP A  1 95  ? 85.376  112.898 128.795 1.00 55.26  ? 72  ASP A OD1 1 
ATOM   552   O  OD2 . ASP A  1 95  ? 84.263  111.068 129.329 1.00 49.22  ? 72  ASP A OD2 1 
ATOM   553   N  N   . MET A  1 96  ? 89.586  110.216 130.024 1.00 30.38  ? 73  MET A N   1 
ATOM   554   C  CA  . MET A  1 96  ? 90.693  109.705 130.809 1.00 29.33  ? 73  MET A CA  1 
ATOM   555   C  C   . MET A  1 96  ? 91.977  110.520 130.614 1.00 38.50  ? 73  MET A C   1 
ATOM   556   O  O   . MET A  1 96  ? 92.735  110.730 131.563 1.00 47.08  ? 73  MET A O   1 
ATOM   557   C  CB  . MET A  1 96  ? 90.938  108.241 130.480 1.00 33.18  ? 73  MET A CB  1 
ATOM   558   C  CG  . MET A  1 96  ? 92.154  107.668 131.188 1.00 45.47  ? 73  MET A CG  1 
ATOM   559   S  SD  . MET A  1 96  ? 92.724  106.102 130.505 1.00 77.81  ? 73  MET A SD  1 
ATOM   560   C  CE  . MET A  1 96  ? 93.050  106.523 128.800 1.00 38.64  ? 73  MET A CE  1 
ATOM   561   N  N   . LEU A  1 97  ? 92.198  110.991 129.390 1.00 33.57  ? 74  LEU A N   1 
ATOM   562   C  CA  . LEU A  1 97  ? 93.470  111.593 128.998 1.00 29.83  ? 74  LEU A CA  1 
ATOM   563   C  C   . LEU A  1 97  ? 93.485  113.110 129.143 1.00 31.18  ? 74  LEU A C   1 
ATOM   564   O  O   . LEU A  1 97  ? 94.536  113.740 129.036 1.00 31.46  ? 74  LEU A O   1 
ATOM   565   C  CB  . LEU A  1 97  ? 93.805  111.225 127.545 1.00 29.64  ? 74  LEU A CB  1 
ATOM   566   C  CG  . LEU A  1 97  ? 94.012  109.748 127.213 1.00 27.17  ? 74  LEU A CG  1 
ATOM   567   C  CD1 . LEU A  1 97  ? 94.009  109.523 125.696 1.00 24.98  ? 74  LEU A CD1 1 
ATOM   568   C  CD2 . LEU A  1 97  ? 95.290  109.176 127.852 1.00 22.44  ? 74  LEU A CD2 1 
ATOM   569   N  N   . ALA A  1 98  ? 92.319  113.701 129.373 1.00 32.52  ? 75  ALA A N   1 
ATOM   570   C  CA  . ALA A  1 98  ? 92.220  115.154 129.497 1.00 34.69  ? 75  ALA A CA  1 
ATOM   571   C  C   . ALA A  1 98  ? 93.227  115.753 130.491 1.00 36.41  ? 75  ALA A C   1 
ATOM   572   O  O   . ALA A  1 98  ? 93.318  115.320 131.642 1.00 34.17  ? 75  ALA A O   1 
ATOM   573   C  CB  . ALA A  1 98  ? 90.790  115.562 129.866 1.00 37.23  ? 75  ALA A CB  1 
ATOM   574   N  N   . GLY A  1 99  ? 93.986  116.745 130.032 1.00 37.50  ? 76  GLY A N   1 
ATOM   575   C  CA  . GLY A  1 99  ? 94.920  117.458 130.887 1.00 25.04  ? 76  GLY A CA  1 
ATOM   576   C  C   . GLY A  1 99  ? 96.297  116.830 131.013 1.00 32.23  ? 76  GLY A C   1 
ATOM   577   O  O   . GLY A  1 99  ? 97.155  117.326 131.744 1.00 38.37  ? 76  GLY A O   1 
ATOM   578   N  N   . GLN A  1 100 ? 96.519  115.732 130.305 1.00 29.54  ? 77  GLN A N   1 
ATOM   579   C  CA  . GLN A  1 100 ? 97.812  115.062 130.368 1.00 34.41  ? 77  GLN A CA  1 
ATOM   580   C  C   . GLN A  1 100 ? 98.613  115.334 129.097 1.00 35.66  ? 77  GLN A C   1 
ATOM   581   O  O   . GLN A  1 100 ? 98.036  115.722 128.067 1.00 29.58  ? 77  GLN A O   1 
ATOM   582   C  CB  . GLN A  1 100 ? 97.623  113.563 130.584 1.00 40.42  ? 77  GLN A CB  1 
ATOM   583   C  CG  . GLN A  1 100 ? 97.211  113.205 131.995 1.00 44.37  ? 77  GLN A CG  1 
ATOM   584   C  CD  . GLN A  1 100 ? 96.390  111.941 132.040 1.00 59.57  ? 77  GLN A CD  1 
ATOM   585   O  OE1 . GLN A  1 100 ? 96.915  110.834 131.897 1.00 58.56  ? 77  GLN A OE1 1 
ATOM   586   N  NE2 . GLN A  1 100 ? 95.083  112.097 132.226 1.00 71.26  ? 77  GLN A NE2 1 
ATOM   587   N  N   . PRO A  1 101 ? 99.947  115.158 129.169 1.00 28.88  ? 78  PRO A N   1 
ATOM   588   C  CA  . PRO A  1 101 ? 100.823 115.464 128.035 1.00 25.95  ? 78  PRO A CA  1 
ATOM   589   C  C   . PRO A  1 101 ? 100.399 114.712 126.780 1.00 26.93  ? 78  PRO A C   1 
ATOM   590   O  O   . PRO A  1 101 ? 100.070 113.530 126.840 1.00 24.30  ? 78  PRO A O   1 
ATOM   591   C  CB  . PRO A  1 101 ? 102.190 114.965 128.513 1.00 22.12  ? 78  PRO A CB  1 
ATOM   592   C  CG  . PRO A  1 101 ? 102.118 115.103 129.996 1.00 26.66  ? 78  PRO A CG  1 
ATOM   593   C  CD  . PRO A  1 101 ? 100.716 114.706 130.343 1.00 27.99  ? 78  PRO A CD  1 
ATOM   594   N  N   . LEU A  1 102 ? 100.382 115.408 125.654 1.00 28.50  ? 79  LEU A N   1 
ATOM   595   C  CA  . LEU A  1 102 ? 100.102 114.772 124.385 1.00 29.46  ? 79  LEU A CA  1 
ATOM   596   C  C   . LEU A  1 102 ? 101.385 114.113 123.899 1.00 28.93  ? 79  LEU A C   1 
ATOM   597   O  O   . LEU A  1 102 ? 102.135 114.681 123.114 1.00 35.75  ? 79  LEU A O   1 
ATOM   598   C  CB  . LEU A  1 102 ? 99.606  115.795 123.377 1.00 32.39  ? 79  LEU A CB  1 
ATOM   599   C  CG  . LEU A  1 102 ? 99.150  115.142 122.080 1.00 39.87  ? 79  LEU A CG  1 
ATOM   600   C  CD1 . LEU A  1 102 ? 97.672  114.862 122.160 1.00 32.51  ? 79  LEU A CD1 1 
ATOM   601   C  CD2 . LEU A  1 102 ? 99.461  116.044 120.902 1.00 46.16  ? 79  LEU A CD2 1 
ATOM   602   N  N   . ALA A  1 103 ? 101.636 112.912 124.397 1.00 24.81  ? 80  ALA A N   1 
ATOM   603   C  CA  . ALA A  1 103 ? 102.838 112.166 124.071 1.00 27.72  ? 80  ALA A CA  1 
ATOM   604   C  C   . ALA A  1 103 ? 102.431 110.767 123.647 1.00 25.47  ? 80  ALA A C   1 
ATOM   605   O  O   . ALA A  1 103 ? 102.141 109.914 124.483 1.00 30.94  ? 80  ALA A O   1 
ATOM   606   C  CB  . ALA A  1 103 ? 103.752 112.107 125.278 1.00 13.36  ? 80  ALA A CB  1 
ATOM   607   N  N   . PRO A  1 104 ? 102.414 110.527 122.338 1.00 28.38  ? 81  PRO A N   1 
ATOM   608   C  CA  . PRO A  1 104 ? 101.945 109.285 121.715 1.00 32.58  ? 81  PRO A CA  1 
ATOM   609   C  C   . PRO A  1 104 ? 102.343 108.001 122.465 1.00 30.32  ? 81  PRO A C   1 
ATOM   610   O  O   . PRO A  1 104 ? 101.467 107.173 122.699 1.00 27.27  ? 81  PRO A O   1 
ATOM   611   C  CB  . PRO A  1 104 ? 102.593 109.335 120.333 1.00 29.18  ? 81  PRO A CB  1 
ATOM   612   C  CG  . PRO A  1 104 ? 102.680 110.767 120.037 1.00 29.14  ? 81  PRO A CG  1 
ATOM   613   C  CD  . PRO A  1 104 ? 102.968 111.461 121.349 1.00 26.27  ? 81  PRO A CD  1 
ATOM   614   N  N   . ALA A  1 105 ? 103.613 107.841 122.832 1.00 25.18  ? 82  ALA A N   1 
ATOM   615   C  CA  . ALA A  1 105 ? 104.056 106.616 123.518 1.00 29.28  ? 82  ALA A CA  1 
ATOM   616   C  C   . ALA A  1 105 ? 103.494 106.469 124.921 1.00 30.59  ? 82  ALA A C   1 
ATOM   617   O  O   . ALA A  1 105 ? 103.141 105.372 125.326 1.00 40.90  ? 82  ALA A O   1 
ATOM   618   C  CB  . ALA A  1 105 ? 105.582 106.499 123.553 1.00 21.38  ? 82  ALA A CB  1 
ATOM   619   N  N   . GLU A  1 106 ? 103.425 107.562 125.668 1.00 27.66  ? 83  GLU A N   1 
ATOM   620   C  CA  . GLU A  1 106 ? 102.795 107.527 126.982 1.00 25.43  ? 83  GLU A CA  1 
ATOM   621   C  C   . GLU A  1 106 ? 101.306 107.235 126.836 1.00 32.00  ? 83  GLU A C   1 
ATOM   622   O  O   . GLU A  1 106 ? 100.739 106.399 127.537 1.00 30.68  ? 83  GLU A O   1 
ATOM   623   C  CB  . GLU A  1 106 ? 102.988 108.861 127.702 1.00 26.17  ? 83  GLU A CB  1 
ATOM   624   C  CG  . GLU A  1 106 ? 104.422 109.138 128.124 1.00 29.70  ? 83  GLU A CG  1 
ATOM   625   C  CD  . GLU A  1 106 ? 104.546 110.377 128.990 1.00 46.36  ? 83  GLU A CD  1 
ATOM   626   O  OE1 . GLU A  1 106 ? 103.508 111.018 129.289 1.00 53.33  ? 83  GLU A OE1 1 
ATOM   627   O  OE2 . GLU A  1 106 ? 105.688 110.712 129.371 1.00 51.54  ? 83  GLU A OE2 1 
ATOM   628   N  N   . ILE A  1 107 ? 100.670 107.938 125.913 1.00 26.72  ? 84  ILE A N   1 
ATOM   629   C  CA  . ILE A  1 107 ? 99.249  107.778 125.732 1.00 27.57  ? 84  ILE A CA  1 
ATOM   630   C  C   . ILE A  1 107 ? 98.939  106.362 125.271 1.00 33.76  ? 84  ILE A C   1 
ATOM   631   O  O   . ILE A  1 107 ? 97.994  105.746 125.750 1.00 33.33  ? 84  ILE A O   1 
ATOM   632   C  CB  . ILE A  1 107 ? 98.685  108.844 124.773 1.00 25.61  ? 84  ILE A CB  1 
ATOM   633   C  CG1 . ILE A  1 107 ? 98.607  110.188 125.508 1.00 19.80  ? 84  ILE A CG1 1 
ATOM   634   C  CG2 . ILE A  1 107 ? 97.321  108.425 124.250 1.00 19.72  ? 84  ILE A CG2 1 
ATOM   635   C  CD1 . ILE A  1 107 ? 98.131  111.327 124.654 1.00 26.26  ? 84  ILE A CD1 1 
ATOM   636   N  N   . TYR A  1 108 ? 99.766  105.838 124.371 1.00 34.14  ? 85  TYR A N   1 
ATOM   637   C  CA  . TYR A  1 108 ? 99.623  104.470 123.896 1.00 33.53  ? 85  TYR A CA  1 
ATOM   638   C  C   . TYR A  1 108 ? 99.613  103.464 125.048 1.00 36.58  ? 85  TYR A C   1 
ATOM   639   O  O   . TYR A  1 108 ? 98.833  102.512 125.041 1.00 33.00  ? 85  TYR A O   1 
ATOM   640   C  CB  . TYR A  1 108 ? 100.758 104.137 122.943 1.00 28.33  ? 85  TYR A CB  1 
ATOM   641   C  CG  . TYR A  1 108 ? 100.657 102.775 122.300 1.00 36.17  ? 85  TYR A CG  1 
ATOM   642   C  CD1 . TYR A  1 108 ? 99.750  102.537 121.281 1.00 44.94  ? 85  TYR A CD1 1 
ATOM   643   C  CD2 . TYR A  1 108 ? 101.493 101.735 122.684 1.00 42.86  ? 85  TYR A CD2 1 
ATOM   644   C  CE1 . TYR A  1 108 ? 99.668  101.297 120.668 1.00 58.89  ? 85  TYR A CE1 1 
ATOM   645   C  CE2 . TYR A  1 108 ? 101.421 100.485 122.073 1.00 46.43  ? 85  TYR A CE2 1 
ATOM   646   C  CZ  . TYR A  1 108 ? 100.504 100.273 121.065 1.00 56.80  ? 85  TYR A CZ  1 
ATOM   647   O  OH  . TYR A  1 108 ? 100.409 99.041  120.449 1.00 64.61  ? 85  TYR A OH  1 
ATOM   648   N  N   . ASP A  1 109 ? 100.483 103.679 126.032 1.00 37.92  ? 86  ASP A N   1 
ATOM   649   C  CA  . ASP A  1 109 ? 100.547 102.818 127.215 1.00 41.91  ? 86  ASP A CA  1 
ATOM   650   C  C   . ASP A  1 109 ? 99.312  102.947 128.127 1.00 42.53  ? 86  ASP A C   1 
ATOM   651   O  O   . ASP A  1 109 ? 98.783  101.942 128.587 1.00 40.18  ? 86  ASP A O   1 
ATOM   652   C  CB  . ASP A  1 109 ? 101.824 103.082 128.007 1.00 47.43  ? 86  ASP A CB  1 
ATOM   653   C  CG  . ASP A  1 109 ? 102.049 102.055 129.101 1.00 63.19  ? 86  ASP A CG  1 
ATOM   654   O  OD1 . ASP A  1 109 ? 102.451 100.921 128.770 1.00 68.59  ? 86  ASP A OD1 1 
ATOM   655   O  OD2 . ASP A  1 109 ? 101.825 102.378 130.289 1.00 67.36  ? 86  ASP A OD2 1 
ATOM   656   N  N   . LYS A  1 110 ? 98.846  104.174 128.365 1.00 38.94  ? 87  LYS A N   1 
ATOM   657   C  CA  . LYS A  1 110 ? 97.643  104.403 129.177 1.00 38.54  ? 87  LYS A CA  1 
ATOM   658   C  C   . LYS A  1 110 ? 96.352  103.819 128.579 1.00 40.54  ? 87  LYS A C   1 
ATOM   659   O  O   . LYS A  1 110 ? 95.538  103.231 129.297 1.00 46.44  ? 87  LYS A O   1 
ATOM   660   C  CB  . LYS A  1 110 ? 97.431  105.898 129.433 1.00 30.28  ? 87  LYS A CB  1 
ATOM   661   C  CG  . LYS A  1 110 ? 98.529  106.578 130.218 1.00 37.67  ? 87  LYS A CG  1 
ATOM   662   C  CD  . LYS A  1 110 ? 98.366  108.088 130.135 1.00 46.76  ? 87  LYS A CD  1 
ATOM   663   C  CE  . LYS A  1 110 ? 99.522  108.805 130.799 1.00 55.06  ? 87  LYS A CE  1 
ATOM   664   N  NZ  . LYS A  1 110 ? 99.280  110.273 130.837 1.00 59.69  ? 87  LYS A NZ  1 
ATOM   665   N  N   . THR A  1 111 ? 96.148  104.009 127.279 1.00 32.85  ? 88  THR A N   1 
ATOM   666   C  CA  . THR A  1 111 ? 94.917  103.543 126.630 1.00 33.63  ? 88  THR A CA  1 
ATOM   667   C  C   . THR A  1 111 ? 94.798  102.017 126.688 1.00 32.82  ? 88  THR A C   1 
ATOM   668   O  O   . THR A  1 111 ? 93.727  101.484 126.958 1.00 33.36  ? 88  THR A O   1 
ATOM   669   C  CB  . THR A  1 111 ? 94.779  104.040 125.159 1.00 36.38  ? 88  THR A CB  1 
ATOM   670   O  OG1 . THR A  1 111 ? 95.982  103.764 124.427 1.00 35.86  ? 88  THR A OG1 1 
ATOM   671   C  CG2 . THR A  1 111 ? 94.490  105.546 125.108 1.00 33.88  ? 88  THR A CG2 1 
ATOM   672   N  N   . ARG A  1 112 ? 95.909  101.330 126.449 1.00 27.46  ? 89  ARG A N   1 
ATOM   673   C  CA  . ARG A  1 112 ? 95.958  99.875  126.497 1.00 38.62  ? 89  ARG A CA  1 
ATOM   674   C  C   . ARG A  1 112 ? 95.730  99.328  127.906 1.00 40.99  ? 89  ARG A C   1 
ATOM   675   O  O   . ARG A  1 112 ? 94.928  98.405  128.095 1.00 33.42  ? 89  ARG A O   1 
ATOM   676   C  CB  . ARG A  1 112 ? 97.289  99.359  125.931 1.00 42.51  ? 89  ARG A CB  1 
ATOM   677   C  CG  . ARG A  1 112 ? 97.452  99.644  124.436 1.00 62.01  ? 89  ARG A CG  1 
ATOM   678   C  CD  . ARG A  1 112 ? 98.453  98.702  123.763 1.00 72.81  ? 89  ARG A CD  1 
ATOM   679   N  NE  . ARG A  1 112 ? 97.828  97.461  123.302 1.00 75.10  ? 89  ARG A NE  1 
ATOM   680   C  CZ  . ARG A  1 112 ? 98.504  96.394  122.884 1.00 81.73  ? 89  ARG A CZ  1 
ATOM   681   N  NH1 . ARG A  1 112 ? 99.832  96.411  122.870 1.00 87.94  ? 89  ARG A NH1 1 
ATOM   682   N  NH2 . ARG A  1 112 ? 97.859  95.305  122.482 1.00 79.57  ? 89  ARG A NH2 1 
ATOM   683   N  N   . LYS A  1 113 ? 96.435  99.890  128.887 1.00 40.69  ? 90  LYS A N   1 
ATOM   684   C  CA  . LYS A  1 113 ? 96.292  99.450  130.273 1.00 39.31  ? 90  LYS A CA  1 
ATOM   685   C  C   . LYS A  1 113 ? 94.860  99.638  130.745 1.00 36.56  ? 90  LYS A C   1 
ATOM   686   O  O   . LYS A  1 113 ? 94.292  98.747  131.379 1.00 35.28  ? 90  LYS A O   1 
ATOM   687   C  CB  . LYS A  1 113 ? 97.246  100.202 131.201 1.00 45.73  ? 90  LYS A CB  1 
ATOM   688   C  CG  . LYS A  1 113 ? 98.716  99.970  130.884 1.00 64.88  ? 90  LYS A CG  1 
ATOM   689   C  CD  . LYS A  1 113 ? 99.139  98.535  131.141 1.00 76.64  ? 90  LYS A CD  1 
ATOM   690   C  CE  . LYS A  1 113 ? 100.211 98.476  132.231 1.00 83.08  ? 90  LYS A CE  1 
ATOM   691   N  NZ  . LYS A  1 113 ? 101.405 99.322  131.912 1.00 82.54  ? 90  LYS A NZ  1 
ATOM   692   N  N   . SER A  1 114 ? 94.278  100.794 130.423 1.00 36.31  ? 91  SER A N   1 
ATOM   693   C  CA  . SER A  1 114 ? 92.900  101.091 130.801 1.00 40.93  ? 91  SER A CA  1 
ATOM   694   C  C   . SER A  1 114 ? 91.938  99.950  130.428 1.00 45.27  ? 91  SER A C   1 
ATOM   695   O  O   . SER A  1 114 ? 90.957  99.703  131.133 1.00 39.93  ? 91  SER A O   1 
ATOM   696   C  CB  . SER A  1 114 ? 92.436  102.426 130.192 1.00 37.11  ? 91  SER A CB  1 
ATOM   697   O  OG  . SER A  1 114 ? 91.831  102.269 128.914 1.00 37.98  ? 91  SER A OG  1 
ATOM   698   N  N   . LEU A  1 115 ? 92.233  99.243  129.336 1.00 41.30  ? 92  LEU A N   1 
ATOM   699   C  CA  . LEU A  1 115 ? 91.335  98.191  128.851 1.00 34.22  ? 92  LEU A CA  1 
ATOM   700   C  C   . LEU A  1 115 ? 91.934  96.772  128.858 1.00 32.86  ? 92  LEU A C   1 
ATOM   701   O  O   . LEU A  1 115 ? 91.349  95.862  128.271 1.00 38.50  ? 92  LEU A O   1 
ATOM   702   C  CB  . LEU A  1 115 ? 90.803  98.533  127.443 1.00 29.35  ? 92  LEU A CB  1 
ATOM   703   C  CG  . LEU A  1 115 ? 89.829  99.706  127.251 1.00 33.41  ? 92  LEU A CG  1 
ATOM   704   C  CD1 . LEU A  1 115 ? 89.274  99.754  125.817 1.00 30.66  ? 92  LEU A CD1 1 
ATOM   705   C  CD2 . LEU A  1 115 ? 88.685  99.621  128.238 1.00 33.39  ? 92  LEU A CD2 1 
ATOM   706   N  N   . HIS A  1 116 ? 93.076  96.565  129.517 1.00 29.99  ? 93  HIS A N   1 
ATOM   707   C  CA  . HIS A  1 116 ? 93.705  95.234  129.505 1.00 35.84  ? 93  HIS A CA  1 
ATOM   708   C  C   . HIS A  1 116 ? 92.736  94.110  129.942 1.00 41.01  ? 93  HIS A C   1 
ATOM   709   O  O   . HIS A  1 116 ? 92.720  93.031  129.346 1.00 36.34  ? 93  HIS A O   1 
ATOM   710   C  CB  . HIS A  1 116 ? 95.020  95.208  130.306 1.00 37.37  ? 93  HIS A CB  1 
ATOM   711   C  CG  . HIS A  1 116 ? 94.838  95.068  131.785 1.00 52.96  ? 93  HIS A CG  1 
ATOM   712   N  ND1 . HIS A  1 116 ? 94.553  96.138  132.607 1.00 62.66  ? 93  HIS A ND1 1 
ATOM   713   C  CD2 . HIS A  1 116 ? 94.912  93.984  132.594 1.00 53.20  ? 93  HIS A CD2 1 
ATOM   714   C  CE1 . HIS A  1 116 ? 94.450  95.718  133.856 1.00 58.68  ? 93  HIS A CE1 1 
ATOM   715   N  NE2 . HIS A  1 116 ? 94.664  94.415  133.876 1.00 54.29  ? 93  HIS A NE2 1 
ATOM   716   N  N   . PHE A  1 117 ? 91.917  94.385  130.959 1.00 36.87  ? 94  PHE A N   1 
ATOM   717   C  CA  . PHE A  1 117 ? 90.917  93.437  131.459 1.00 36.46  ? 94  PHE A CA  1 
ATOM   718   C  C   . PHE A  1 117 ? 89.926  92.914  130.408 1.00 40.60  ? 94  PHE A C   1 
ATOM   719   O  O   . PHE A  1 117 ? 89.365  91.831  130.574 1.00 40.36  ? 94  PHE A O   1 
ATOM   720   C  CB  . PHE A  1 117 ? 90.132  94.065  132.615 1.00 42.19  ? 94  PHE A CB  1 
ATOM   721   C  CG  . PHE A  1 117 ? 90.831  93.977  133.938 1.00 47.87  ? 94  PHE A CG  1 
ATOM   722   C  CD1 . PHE A  1 117 ? 91.413  92.786  134.349 1.00 43.23  ? 94  PHE A CD1 1 
ATOM   723   C  CD2 . PHE A  1 117 ? 90.909  95.082  134.774 1.00 51.60  ? 94  PHE A CD2 1 
ATOM   724   C  CE1 . PHE A  1 117 ? 92.062  92.692  135.577 1.00 44.19  ? 94  PHE A CE1 1 
ATOM   725   C  CE2 . PHE A  1 117 ? 91.559  94.997  135.997 1.00 55.28  ? 94  PHE A CE2 1 
ATOM   726   C  CZ  . PHE A  1 117 ? 92.138  93.795  136.400 1.00 47.93  ? 94  PHE A CZ  1 
ATOM   727   N  N   . VAL A  1 118 ? 89.675  93.684  129.352 1.00 31.72  ? 95  VAL A N   1 
ATOM   728   C  CA  . VAL A  1 118 ? 88.814  93.197  128.276 1.00 33.96  ? 95  VAL A CA  1 
ATOM   729   C  C   . VAL A  1 118 ? 89.605  92.950  126.979 1.00 37.36  ? 95  VAL A C   1 
ATOM   730   O  O   . VAL A  1 118 ? 89.035  92.912  125.886 1.00 40.65  ? 95  VAL A O   1 
ATOM   731   C  CB  . VAL A  1 118 ? 87.575  94.117  128.024 1.00 43.15  ? 95  VAL A CB  1 
ATOM   732   C  CG1 . VAL A  1 118 ? 86.610  94.069  129.217 1.00 36.42  ? 95  VAL A CG1 1 
ATOM   733   C  CG2 . VAL A  1 118 ? 88.009  95.551  127.725 1.00 37.90  ? 95  VAL A CG2 1 
ATOM   734   N  N   . GLY A  1 119 ? 90.918  92.778  127.114 1.00 30.74  ? 96  GLY A N   1 
ATOM   735   C  CA  . GLY A  1 119 ? 91.751  92.341  126.005 1.00 40.18  ? 96  GLY A CA  1 
ATOM   736   C  C   . GLY A  1 119 ? 92.633  93.408  125.384 1.00 39.34  ? 96  GLY A C   1 
ATOM   737   O  O   . GLY A  1 119 ? 92.217  94.551  125.207 1.00 39.71  ? 96  GLY A O   1 
ATOM   738   N  N   . TYR A  1 120 ? 93.867  93.032  125.068 1.00 37.15  ? 97  TYR A N   1 
ATOM   739   C  CA  . TYR A  1 120 ? 94.774  93.907  124.326 1.00 41.62  ? 97  TYR A CA  1 
ATOM   740   C  C   . TYR A  1 120 ? 94.464  93.847  122.822 1.00 43.43  ? 97  TYR A C   1 
ATOM   741   O  O   . TYR A  1 120 ? 94.641  94.832  122.109 1.00 46.55  ? 97  TYR A O   1 
ATOM   742   C  CB  . TYR A  1 120 ? 96.241  93.536  124.588 1.00 35.18  ? 97  TYR A CB  1 
ATOM   743   C  CG  . TYR A  1 120 ? 96.774  93.924  125.960 1.00 37.28  ? 97  TYR A CG  1 
ATOM   744   C  CD1 . TYR A  1 120 ? 96.619  95.209  126.464 1.00 45.10  ? 97  TYR A CD1 1 
ATOM   745   C  CD2 . TYR A  1 120 ? 97.441  92.996  126.748 1.00 32.98  ? 97  TYR A CD2 1 
ATOM   746   C  CE1 . TYR A  1 120 ? 97.129  95.553  127.726 1.00 49.06  ? 97  TYR A CE1 1 
ATOM   747   C  CE2 . TYR A  1 120 ? 97.948  93.327  127.996 1.00 33.56  ? 97  TYR A CE2 1 
ATOM   748   C  CZ  . TYR A  1 120 ? 97.790  94.597  128.485 1.00 40.93  ? 97  TYR A CZ  1 
ATOM   749   O  OH  . TYR A  1 120 ? 98.297  94.895  129.737 1.00 40.06  ? 97  TYR A OH  1 
ATOM   750   N  N   . ALA A  1 121 ? 94.001  92.684  122.361 1.00 36.34  ? 98  ALA A N   1 
ATOM   751   C  CA  . ALA A  1 121 ? 93.535  92.489  120.985 1.00 34.91  ? 98  ALA A CA  1 
ATOM   752   C  C   . ALA A  1 121 ? 92.080  92.962  120.811 1.00 38.66  ? 98  ALA A C   1 
ATOM   753   O  O   . ALA A  1 121 ? 91.367  93.183  121.792 1.00 43.87  ? 98  ALA A O   1 
ATOM   754   C  CB  . ALA A  1 121 ? 93.672  91.002  120.594 1.00 27.99  ? 98  ALA A CB  1 
ATOM   755   N  N   . GLY A  1 122 ? 91.639  93.131  119.570 1.00 37.83  ? 99  GLY A N   1 
ATOM   756   C  CA  . GLY A  1 122 ? 90.242  93.457  119.305 1.00 38.14  ? 99  GLY A CA  1 
ATOM   757   C  C   . GLY A  1 122 ? 89.834  94.921  119.386 1.00 37.87  ? 99  GLY A C   1 
ATOM   758   O  O   . GLY A  1 122 ? 90.593  95.814  119.016 1.00 45.58  ? 99  GLY A O   1 
ATOM   759   N  N   . LEU A  1 123 ? 88.618  95.169  119.861 1.00 36.88  ? 100 LEU A N   1 
ATOM   760   C  CA  . LEU A  1 123 ? 88.081  96.530  119.930 1.00 36.98  ? 100 LEU A CA  1 
ATOM   761   C  C   . LEU A  1 123 ? 88.911  97.466  120.811 1.00 38.35  ? 100 LEU A C   1 
ATOM   762   O  O   . LEU A  1 123 ? 89.030  98.655  120.513 1.00 46.39  ? 100 LEU A O   1 
ATOM   763   C  CB  . LEU A  1 123 ? 86.598  96.527  120.354 1.00 41.33  ? 100 LEU A CB  1 
ATOM   764   C  CG  . LEU A  1 123 ? 85.617  95.970  119.299 1.00 41.86  ? 100 LEU A CG  1 
ATOM   765   C  CD1 . LEU A  1 123 ? 84.415  95.276  119.938 1.00 27.79  ? 100 LEU A CD1 1 
ATOM   766   C  CD2 . LEU A  1 123 ? 85.161  97.042  118.303 1.00 38.94  ? 100 LEU A CD2 1 
ATOM   767   N  N   . SER A  1 124 ? 89.486  96.935  121.886 1.00 37.59  ? 101 SER A N   1 
ATOM   768   C  CA  . SER A  1 124 ? 90.406  97.714  122.720 1.00 43.41  ? 101 SER A CA  1 
ATOM   769   C  C   . SER A  1 124 ? 91.524  98.335  121.887 1.00 27.82  ? 101 SER A C   1 
ATOM   770   O  O   . SER A  1 124 ? 91.730  99.543  121.912 1.00 33.22  ? 101 SER A O   1 
ATOM   771   C  CB  . SER A  1 124 ? 91.035  96.835  123.803 1.00 38.01  ? 101 SER A CB  1 
ATOM   772   O  OG  . SER A  1 124 ? 90.039  96.119  124.494 1.00 38.57  ? 101 SER A OG  1 
ATOM   773   N  N   . MET A  1 125 ? 92.248  97.491  121.160 1.00 30.25  ? 102 MET A N   1 
ATOM   774   C  CA  . MET A  1 125 ? 93.319  97.960  120.289 1.00 35.05  ? 102 MET A CA  1 
ATOM   775   C  C   . MET A  1 125 ? 92.803  98.958  119.247 1.00 34.90  ? 102 MET A C   1 
ATOM   776   O  O   . MET A  1 125 ? 93.463  99.959  118.959 1.00 37.86  ? 102 MET A O   1 
ATOM   777   C  CB  . MET A  1 125 ? 94.018  96.793  119.586 1.00 29.90  ? 102 MET A CB  1 
ATOM   778   C  CG  . MET A  1 125 ? 95.194  97.215  118.685 1.00 30.54  ? 102 MET A CG  1 
ATOM   779   S  SD  . MET A  1 125 ? 96.642  97.860  119.588 1.00 41.60  ? 102 MET A SD  1 
ATOM   780   C  CE  . MET A  1 125 ? 96.190  99.563  119.905 1.00 142.05 ? 102 MET A CE  1 
ATOM   781   N  N   . ILE A  1 126 ? 91.625  98.688  118.690 1.00 29.95  ? 103 ILE A N   1 
ATOM   782   C  CA  . ILE A  1 126 ? 91.111  99.516  117.611 1.00 27.14  ? 103 ILE A CA  1 
ATOM   783   C  C   . ILE A  1 126 ? 90.907  100.955 118.060 1.00 28.76  ? 103 ILE A C   1 
ATOM   784   O  O   . ILE A  1 126 ? 91.303  101.880 117.357 1.00 28.16  ? 103 ILE A O   1 
ATOM   785   C  CB  . ILE A  1 126 ? 89.847  98.922  116.984 1.00 30.22  ? 103 ILE A CB  1 
ATOM   786   C  CG1 . ILE A  1 126 ? 90.224  97.685  116.167 1.00 26.30  ? 103 ILE A CG1 1 
ATOM   787   C  CG2 . ILE A  1 126 ? 89.173  99.930  116.073 1.00 30.19  ? 103 ILE A CG2 1 
ATOM   788   C  CD1 . ILE A  1 126 ? 89.046  96.830  115.802 1.00 32.35  ? 103 ILE A CD1 1 
ATOM   789   N  N   . ALA A  1 127 ? 90.337  101.152 119.243 1.00 25.10  ? 104 ALA A N   1 
ATOM   790   C  CA  . ALA A  1 127 ? 90.129  102.519 119.740 1.00 29.46  ? 104 ALA A CA  1 
ATOM   791   C  C   . ALA A  1 127 ? 91.456  103.198 120.087 1.00 34.94  ? 104 ALA A C   1 
ATOM   792   O  O   . ALA A  1 127 ? 91.669  104.374 119.776 1.00 36.21  ? 104 ALA A O   1 
ATOM   793   C  CB  . ALA A  1 127 ? 89.195  102.523 120.951 1.00 30.02  ? 104 ALA A CB  1 
ATOM   794   N  N   . ALA A  1 128 ? 92.345  102.441 120.726 1.00 29.67  ? 105 ALA A N   1 
ATOM   795   C  CA  . ALA A  1 128 ? 93.670  102.928 121.093 1.00 33.16  ? 105 ALA A CA  1 
ATOM   796   C  C   . ALA A  1 128 ? 94.504  103.363 119.881 1.00 33.68  ? 105 ALA A C   1 
ATOM   797   O  O   . ALA A  1 128 ? 95.330  104.276 119.992 1.00 23.51  ? 105 ALA A O   1 
ATOM   798   C  CB  . ALA A  1 128 ? 94.429  101.858 121.896 1.00 23.15  ? 105 ALA A CB  1 
ATOM   799   N  N   . SER A  1 129 ? 94.307  102.695 118.744 1.00 25.43  ? 106 SER A N   1 
ATOM   800   C  CA  . SER A  1 129 ? 95.075  102.994 117.534 1.00 26.49  ? 106 SER A CA  1 
ATOM   801   C  C   . SER A  1 129 ? 94.597  104.284 116.902 1.00 23.86  ? 106 SER A C   1 
ATOM   802   O  O   . SER A  1 129 ? 95.383  105.072 116.380 1.00 24.64  ? 106 SER A O   1 
ATOM   803   C  CB  . SER A  1 129 ? 94.929  101.872 116.518 1.00 24.72  ? 106 SER A CB  1 
ATOM   804   O  OG  . SER A  1 129 ? 95.581  100.728 116.975 1.00 21.55  ? 106 SER A OG  1 
ATOM   805   N  N   . GLY A  1 130 ? 93.291  104.483 116.949 1.00 22.77  ? 107 GLY A N   1 
ATOM   806   C  CA  . GLY A  1 130 ? 92.695  105.697 116.435 1.00 26.36  ? 107 GLY A CA  1 
ATOM   807   C  C   . GLY A  1 130 ? 93.217  106.894 117.197 1.00 30.14  ? 107 GLY A C   1 
ATOM   808   O  O   . GLY A  1 130 ? 93.550  107.919 116.593 1.00 20.33  ? 107 GLY A O   1 
ATOM   809   N  N   . VAL A  1 131 ? 93.282  106.772 118.524 1.00 31.34  ? 108 VAL A N   1 
ATOM   810   C  CA  . VAL A  1 131 ? 93.826  107.842 119.351 1.00 26.77  ? 108 VAL A CA  1 
ATOM   811   C  C   . VAL A  1 131 ? 95.278  108.070 118.942 1.00 32.90  ? 108 VAL A C   1 
ATOM   812   O  O   . VAL A  1 131 ? 95.722  109.210 118.776 1.00 24.82  ? 108 VAL A O   1 
ATOM   813   C  CB  . VAL A  1 131 ? 93.782  107.493 120.858 1.00 25.07  ? 108 VAL A CB  1 
ATOM   814   C  CG1 . VAL A  1 131 ? 94.510  108.551 121.672 1.00 19.30  ? 108 VAL A CG1 1 
ATOM   815   C  CG2 . VAL A  1 131 ? 92.353  107.349 121.333 1.00 18.48  ? 108 VAL A CG2 1 
ATOM   816   N  N   . ASP A  1 132 ? 96.007  106.970 118.753 1.00 30.40  ? 109 ASP A N   1 
ATOM   817   C  CA  . ASP A  1 132 ? 97.434  107.037 118.472 1.00 21.86  ? 109 ASP A CA  1 
ATOM   818   C  C   . ASP A  1 132 ? 97.749  107.786 117.171 1.00 20.32  ? 109 ASP A C   1 
ATOM   819   O  O   . ASP A  1 132 ? 98.605  108.652 117.158 1.00 27.10  ? 109 ASP A O   1 
ATOM   820   C  CB  . ASP A  1 132 ? 98.042  105.636 118.457 1.00 22.45  ? 109 ASP A CB  1 
ATOM   821   C  CG  . ASP A  1 132 ? 99.543  105.655 118.309 1.00 28.72  ? 109 ASP A CG  1 
ATOM   822   O  OD1 . ASP A  1 132 ? 100.241 105.833 119.331 1.00 32.78  ? 109 ASP A OD1 1 
ATOM   823   O  OD2 . ASP A  1 132 ? 100.031 105.469 117.177 1.00 30.37  ? 109 ASP A OD2 1 
ATOM   824   N  N   . MET A  1 133 ? 97.060  107.465 116.082 1.00 19.43  ? 110 MET A N   1 
ATOM   825   C  CA  . MET A  1 133 ? 97.337  108.128 114.812 1.00 25.16  ? 110 MET A CA  1 
ATOM   826   C  C   . MET A  1 133 ? 97.051  109.624 114.900 1.00 27.05  ? 110 MET A C   1 
ATOM   827   O  O   . MET A  1 133 ? 97.774  110.442 114.343 1.00 26.71  ? 110 MET A O   1 
ATOM   828   C  CB  . MET A  1 133 ? 96.507  107.508 113.689 1.00 22.79  ? 110 MET A CB  1 
ATOM   829   C  CG  . MET A  1 133 ? 96.821  106.064 113.432 1.00 21.01  ? 110 MET A CG  1 
ATOM   830   S  SD  . MET A  1 133 ? 95.878  105.359 112.063 1.00 32.76  ? 110 MET A SD  1 
ATOM   831   C  CE  . MET A  1 133 ? 94.480  104.693 112.951 1.00 22.87  ? 110 MET A CE  1 
ATOM   832   N  N   . ALA A  1 134 ? 95.992  109.983 115.608 1.00 24.16  ? 111 ALA A N   1 
ATOM   833   C  CA  . ALA A  1 134 ? 95.585  111.379 115.694 1.00 23.78  ? 111 ALA A CA  1 
ATOM   834   C  C   . ALA A  1 134 ? 96.556  112.142 116.584 1.00 29.37  ? 111 ALA A C   1 
ATOM   835   O  O   . ALA A  1 134 ? 96.847  113.313 116.351 1.00 29.62  ? 111 ALA A O   1 
ATOM   836   C  CB  . ALA A  1 134 ? 94.160  111.486 116.233 1.00 17.23  ? 111 ALA A CB  1 
ATOM   837   N  N   . VAL A  1 135 ? 97.056  111.469 117.610 1.00 25.29  ? 112 VAL A N   1 
ATOM   838   C  CA  . VAL A  1 135 ? 98.031  112.078 118.505 1.00 28.06  ? 112 VAL A CA  1 
ATOM   839   C  C   . VAL A  1 135 ? 99.373  112.298 117.786 1.00 25.32  ? 112 VAL A C   1 
ATOM   840   O  O   . VAL A  1 135 ? 99.977  113.348 117.931 1.00 24.22  ? 112 VAL A O   1 
ATOM   841   C  CB  . VAL A  1 135 ? 98.218  111.238 119.796 1.00 38.54  ? 112 VAL A CB  1 
ATOM   842   C  CG1 . VAL A  1 135 ? 99.425  111.719 120.557 1.00 48.80  ? 112 VAL A CG1 1 
ATOM   843   C  CG2 . VAL A  1 135 ? 96.977  111.329 120.669 1.00 36.51  ? 112 VAL A CG2 1 
ATOM   844   N  N   . TRP A  1 136 ? 99.830  111.311 117.008 1.00 26.33  ? 113 TRP A N   1 
ATOM   845   C  CA  . TRP A  1 136 ? 101.051 111.474 116.212 1.00 26.37  ? 113 TRP A CA  1 
ATOM   846   C  C   . TRP A  1 136 ? 100.915 112.625 115.209 1.00 24.55  ? 113 TRP A C   1 
ATOM   847   O  O   . TRP A  1 136 ? 101.843 113.402 115.032 1.00 28.13  ? 113 TRP A O   1 
ATOM   848   C  CB  . TRP A  1 136 ? 101.458 110.165 115.495 1.00 21.68  ? 113 TRP A CB  1 
ATOM   849   C  CG  . TRP A  1 136 ? 102.306 109.251 116.349 1.00 23.28  ? 113 TRP A CG  1 
ATOM   850   C  CD1 . TRP A  1 136 ? 101.904 108.111 116.985 1.00 25.65  ? 113 TRP A CD1 1 
ATOM   851   C  CD2 . TRP A  1 136 ? 103.687 109.434 116.694 1.00 16.44  ? 113 TRP A CD2 1 
ATOM   852   N  NE1 . TRP A  1 136 ? 102.952 107.570 117.699 1.00 22.72  ? 113 TRP A NE1 1 
ATOM   853   C  CE2 . TRP A  1 136 ? 104.057 108.363 117.529 1.00 20.24  ? 113 TRP A CE2 1 
ATOM   854   C  CE3 . TRP A  1 136 ? 104.655 110.389 116.353 1.00 19.70  ? 113 TRP A CE3 1 
ATOM   855   C  CZ2 . TRP A  1 136 ? 105.355 108.212 118.024 1.00 28.08  ? 113 TRP A CZ2 1 
ATOM   856   C  CZ3 . TRP A  1 136 ? 105.945 110.245 116.861 1.00 22.22  ? 113 TRP A CZ3 1 
ATOM   857   C  CH2 . TRP A  1 136 ? 106.279 109.167 117.688 1.00 22.51  ? 113 TRP A CH2 1 
ATOM   858   N  N   . ASP A  1 137 ? 99.756  112.726 114.561 1.00 23.25  ? 114 ASP A N   1 
ATOM   859   C  CA  . ASP A  1 137 ? 99.465  113.829 113.634 1.00 31.03  ? 114 ASP A CA  1 
ATOM   860   C  C   . ASP A  1 137 ? 99.614  115.193 114.318 1.00 23.64  ? 114 ASP A C   1 
ATOM   861   O  O   . ASP A  1 137 ? 100.262 116.093 113.783 1.00 25.32  ? 114 ASP A O   1 
ATOM   862   C  CB  . ASP A  1 137 ? 98.054  113.675 113.028 1.00 29.64  ? 114 ASP A CB  1 
ATOM   863   C  CG  . ASP A  1 137 ? 97.667  114.844 112.121 1.00 37.90  ? 114 ASP A CG  1 
ATOM   864   O  OD1 . ASP A  1 137 ? 98.243  114.962 111.026 1.00 37.96  ? 114 ASP A OD1 1 
ATOM   865   O  OD2 . ASP A  1 137 ? 96.784  115.650 112.495 1.00 44.71  ? 114 ASP A OD2 1 
ATOM   866   N  N   . ALA A  1 138 ? 99.033  115.324 115.512 1.00 22.36  ? 115 ALA A N   1 
ATOM   867   C  CA  . ALA A  1 138 ? 99.158  116.539 116.335 1.00 22.35  ? 115 ALA A CA  1 
ATOM   868   C  C   . ALA A  1 138 ? 100.590 116.882 116.774 1.00 30.49  ? 115 ALA A C   1 
ATOM   869   O  O   . ALA A  1 138 ? 100.981 118.050 116.785 1.00 30.50  ? 115 ALA A O   1 
ATOM   870   C  CB  . ALA A  1 138 ? 98.253  116.450 117.552 1.00 25.73  ? 115 ALA A CB  1 
ATOM   871   N  N   . LEU A  1 139 ? 101.371 115.878 117.157 1.00 32.48  ? 116 LEU A N   1 
ATOM   872   C  CA  . LEU A  1 139 ? 102.744 116.143 117.570 1.00 27.14  ? 116 LEU A CA  1 
ATOM   873   C  C   . LEU A  1 139 ? 103.552 116.617 116.355 1.00 25.92  ? 116 LEU A C   1 
ATOM   874   O  O   . LEU A  1 139 ? 104.345 117.548 116.450 1.00 21.68  ? 116 LEU A O   1 
ATOM   875   C  CB  . LEU A  1 139 ? 103.375 114.898 118.200 1.00 26.58  ? 116 LEU A CB  1 
ATOM   876   C  CG  . LEU A  1 139 ? 104.824 115.007 118.670 1.00 24.85  ? 116 LEU A CG  1 
ATOM   877   C  CD1 . LEU A  1 139 ? 104.912 115.943 119.850 1.00 18.34  ? 116 LEU A CD1 1 
ATOM   878   C  CD2 . LEU A  1 139 ? 105.394 113.633 119.037 1.00 23.55  ? 116 LEU A CD2 1 
ATOM   879   N  N   . ALA A  1 140 ? 103.338 115.978 115.211 1.00 19.13  ? 117 ALA A N   1 
ATOM   880   C  CA  . ALA A  1 140 ? 103.980 116.405 113.971 1.00 22.23  ? 117 ALA A CA  1 
ATOM   881   C  C   . ALA A  1 140 ? 103.619 117.847 113.568 1.00 26.79  ? 117 ALA A C   1 
ATOM   882   O  O   . ALA A  1 140 ? 104.480 118.595 113.106 1.00 30.47  ? 117 ALA A O   1 
ATOM   883   C  CB  . ALA A  1 140 ? 103.642 115.446 112.849 1.00 19.49  ? 117 ALA A CB  1 
ATOM   884   N  N   . ARG A  1 141 ? 102.353 118.230 113.729 1.00 21.42  ? 118 ARG A N   1 
ATOM   885   C  CA  . ARG A  1 141 ? 101.925 119.590 113.401 1.00 23.61  ? 118 ARG A CA  1 
ATOM   886   C  C   . ARG A  1 141 ? 102.547 120.553 114.391 1.00 29.86  ? 118 ARG A C   1 
ATOM   887   O  O   . ARG A  1 141 ? 102.906 121.671 114.048 1.00 27.69  ? 118 ARG A O   1 
ATOM   888   C  CB  . ARG A  1 141 ? 100.399 119.740 113.460 1.00 20.01  ? 118 ARG A CB  1 
ATOM   889   C  CG  . ARG A  1 141 ? 99.621  118.945 112.406 1.00 28.54  ? 118 ARG A CG  1 
ATOM   890   C  CD  . ARG A  1 141 ? 98.115  119.208 112.532 1.00 31.54  ? 118 ARG A CD  1 
ATOM   891   N  NE  . ARG A  1 141 ? 97.354  118.499 111.519 1.00 32.48  ? 118 ARG A NE  1 
ATOM   892   C  CZ  . ARG A  1 141 ? 97.148  118.965 110.293 1.00 41.88  ? 118 ARG A CZ  1 
ATOM   893   N  NH1 . ARG A  1 141 ? 97.651  120.144 109.942 1.00 38.66  ? 118 ARG A NH1 1 
ATOM   894   N  NH2 . ARG A  1 141 ? 96.449  118.251 109.418 1.00 35.79  ? 118 ARG A NH2 1 
ATOM   895   N  N   . ALA A  1 142 ? 102.672 120.110 115.632 1.00 33.12  ? 119 ALA A N   1 
ATOM   896   C  CA  . ALA A  1 142 ? 103.276 120.945 116.645 1.00 22.18  ? 119 ALA A CA  1 
ATOM   897   C  C   . ALA A  1 142 ? 104.748 121.201 116.324 1.00 31.29  ? 119 ALA A C   1 
ATOM   898   O  O   . ALA A  1 142 ? 105.288 122.246 116.665 1.00 25.52  ? 119 ALA A O   1 
ATOM   899   C  CB  . ALA A  1 142 ? 103.111 120.315 118.004 1.00 20.09  ? 119 ALA A CB  1 
ATOM   900   N  N   . ALA A  1 143 ? 105.399 120.243 115.670 1.00 28.12  ? 120 ALA A N   1 
ATOM   901   C  CA  . ALA A  1 143 ? 106.784 120.412 115.248 1.00 23.14  ? 120 ALA A CA  1 
ATOM   902   C  C   . ALA A  1 143 ? 106.811 121.068 113.887 1.00 31.35  ? 120 ALA A C   1 
ATOM   903   O  O   . ALA A  1 143 ? 107.872 121.291 113.317 1.00 35.08  ? 120 ALA A O   1 
ATOM   904   C  CB  . ALA A  1 143 ? 107.481 119.071 115.174 1.00 23.64  ? 120 ALA A CB  1 
ATOM   905   N  N   . ASN A  1 144 ? 105.632 121.364 113.358 1.00 35.41  ? 121 ASN A N   1 
ATOM   906   C  CA  . ASN A  1 144 ? 105.530 121.897 112.006 1.00 44.19  ? 121 ASN A CA  1 
ATOM   907   C  C   . ASN A  1 144 ? 106.243 120.999 110.992 1.00 37.72  ? 121 ASN A C   1 
ATOM   908   O  O   . ASN A  1 144 ? 106.921 121.490 110.092 1.00 34.61  ? 121 ASN A O   1 
ATOM   909   C  CB  . ASN A  1 144 ? 106.102 123.316 111.935 1.00 43.18  ? 121 ASN A CB  1 
ATOM   910   C  CG  . ASN A  1 144 ? 105.687 124.048 110.670 1.00 50.49  ? 121 ASN A CG  1 
ATOM   911   O  OD1 . ASN A  1 144 ? 104.593 123.835 110.141 1.00 53.62  ? 121 ASN A OD1 1 
ATOM   912   N  ND2 . ASN A  1 144 ? 106.563 124.911 110.176 1.00 54.16  ? 121 ASN A ND2 1 
ATOM   913   N  N   . MET A  1 145 ? 106.088 119.687 111.145 1.00 31.50  ? 122 MET A N   1 
ATOM   914   C  CA  . MET A  1 145 ? 106.740 118.732 110.251 1.00 29.06  ? 122 MET A CA  1 
ATOM   915   C  C   . MET A  1 145 ? 105.725 117.770 109.681 1.00 26.97  ? 122 MET A C   1 
ATOM   916   O  O   . MET A  1 145 ? 104.766 117.401 110.369 1.00 22.98  ? 122 MET A O   1 
ATOM   917   C  CB  . MET A  1 145 ? 107.815 117.934 110.997 1.00 27.48  ? 122 MET A CB  1 
ATOM   918   C  CG  . MET A  1 145 ? 109.096 118.710 111.290 1.00 30.00  ? 122 MET A CG  1 
ATOM   919   S  SD  . MET A  1 145 ? 110.202 117.824 112.400 1.00 33.76  ? 122 MET A SD  1 
ATOM   920   C  CE  . MET A  1 145 ? 111.459 119.081 112.650 1.00 31.33  ? 122 MET A CE  1 
ATOM   921   N  N   . PRO A  1 146 ? 105.923 117.357 108.418 1.00 25.96  ? 123 PRO A N   1 
ATOM   922   C  CA  . PRO A  1 146 ? 105.169 116.186 107.955 1.00 26.47  ? 123 PRO A CA  1 
ATOM   923   C  C   . PRO A  1 146 ? 105.474 115.032 108.915 1.00 26.50  ? 123 PRO A C   1 
ATOM   924   O  O   . PRO A  1 146 ? 106.561 115.022 109.496 1.00 23.69  ? 123 PRO A O   1 
ATOM   925   C  CB  . PRO A  1 146 ? 105.769 115.909 106.574 1.00 24.58  ? 123 PRO A CB  1 
ATOM   926   C  CG  . PRO A  1 146 ? 106.275 117.270 106.117 1.00 26.05  ? 123 PRO A CG  1 
ATOM   927   C  CD  . PRO A  1 146 ? 106.796 117.920 107.371 1.00 19.19  ? 123 PRO A CD  1 
ATOM   928   N  N   . LEU A  1 147 ? 104.539 114.102 109.095 1.00 19.13  ? 124 LEU A N   1 
ATOM   929   C  CA  . LEU A  1 147 ? 104.738 112.979 110.006 1.00 23.28  ? 124 LEU A CA  1 
ATOM   930   C  C   . LEU A  1 147 ? 106.037 112.211 109.689 1.00 29.00  ? 124 LEU A C   1 
ATOM   931   O  O   . LEU A  1 147 ? 106.855 111.964 110.578 1.00 29.55  ? 124 LEU A O   1 
ATOM   932   C  CB  . LEU A  1 147 ? 103.532 112.033 109.981 1.00 17.51  ? 124 LEU A CB  1 
ATOM   933   C  CG  . LEU A  1 147 ? 103.684 110.801 110.884 1.00 23.42  ? 124 LEU A CG  1 
ATOM   934   C  CD1 . LEU A  1 147 ? 103.898 111.208 112.325 1.00 19.56  ? 124 LEU A CD1 1 
ATOM   935   C  CD2 . LEU A  1 147 ? 102.463 109.905 110.791 1.00 24.89  ? 124 LEU A CD2 1 
ATOM   936   N  N   . CYS A  1 148 ? 106.233 111.869 108.418 1.00 26.05  ? 125 CYS A N   1 
ATOM   937   C  CA  . CYS A  1 148 ? 107.403 111.102 108.008 1.00 22.51  ? 125 CYS A CA  1 
ATOM   938   C  C   . CYS A  1 148 ? 108.708 111.837 108.347 1.00 27.13  ? 125 CYS A C   1 
ATOM   939   O  O   . CYS A  1 148 ? 109.723 111.213 108.626 1.00 24.56  ? 125 CYS A O   1 
ATOM   940   C  CB  . CYS A  1 148 ? 107.332 110.771 106.513 1.00 25.08  ? 125 CYS A CB  1 
ATOM   941   S  SG  . CYS A  1 148 ? 107.311 112.216 105.431 1.00 26.53  ? 125 CYS A SG  1 
ATOM   942   N  N   . THR A  1 149 ? 108.672 113.165 108.331 1.00 29.70  ? 126 THR A N   1 
ATOM   943   C  CA  . THR A  1 149 ? 109.838 113.956 108.704 1.00 21.23  ? 126 THR A CA  1 
ATOM   944   C  C   . THR A  1 149 ? 110.032 113.915 110.219 1.00 23.97  ? 126 THR A C   1 
ATOM   945   O  O   . THR A  1 149 ? 111.149 113.849 110.712 1.00 24.37  ? 126 THR A O   1 
ATOM   946   C  CB  . THR A  1 149 ? 109.705 115.412 108.231 1.00 22.25  ? 126 THR A CB  1 
ATOM   947   O  OG1 . THR A  1 149 ? 109.575 115.435 106.809 1.00 30.00  ? 126 THR A OG1 1 
ATOM   948   C  CG2 . THR A  1 149 ? 110.914 116.208 108.628 1.00 24.83  ? 126 THR A CG2 1 
ATOM   949   N  N   . LEU A  1 150 ? 108.941 113.941 110.967 1.00 21.30  ? 127 LEU A N   1 
ATOM   950   C  CA  . LEU A  1 150 ? 109.072 113.822 112.400 1.00 15.81  ? 127 LEU A CA  1 
ATOM   951   C  C   . LEU A  1 150 ? 109.700 112.475 112.747 1.00 16.77  ? 127 LEU A C   1 
ATOM   952   O  O   . LEU A  1 150 ? 110.443 112.370 113.704 1.00 20.79  ? 127 LEU A O   1 
ATOM   953   C  CB  . LEU A  1 150 ? 107.710 113.941 113.084 1.00 13.37  ? 127 LEU A CB  1 
ATOM   954   C  CG  . LEU A  1 150 ? 107.835 113.883 114.609 1.00 18.10  ? 127 LEU A CG  1 
ATOM   955   C  CD1 . LEU A  1 150 ? 107.978 115.297 115.098 1.00 24.29  ? 127 LEU A CD1 1 
ATOM   956   C  CD2 . LEU A  1 150 ? 106.628 113.236 115.255 1.00 21.62  ? 127 LEU A CD2 1 
ATOM   957   N  N   . LEU A  1 151 ? 109.375 111.437 111.985 1.00 17.18  ? 128 LEU A N   1 
ATOM   958   C  CA  . LEU A  1 151 ? 109.840 110.081 112.309 1.00 22.46  ? 128 LEU A CA  1 
ATOM   959   C  C   . LEU A  1 151 ? 111.233 109.818 111.738 1.00 25.26  ? 128 LEU A C   1 
ATOM   960   O  O   . LEU A  1 151 ? 111.769 108.715 111.863 1.00 27.03  ? 128 LEU A O   1 
ATOM   961   C  CB  . LEU A  1 151 ? 108.860 109.013 111.790 1.00 20.65  ? 128 LEU A CB  1 
ATOM   962   C  CG  . LEU A  1 151 ? 107.401 109.074 112.240 1.00 17.69  ? 128 LEU A CG  1 
ATOM   963   C  CD1 . LEU A  1 151 ? 106.545 108.073 111.450 1.00 17.82  ? 128 LEU A CD1 1 
ATOM   964   C  CD2 . LEU A  1 151 ? 107.277 108.844 113.754 1.00 12.54  ? 128 LEU A CD2 1 
ATOM   965   N  N   . GLY A  1 152 ? 111.808 110.835 111.101 1.00 21.43  ? 129 GLY A N   1 
ATOM   966   C  CA  . GLY A  1 152 ? 113.180 110.769 110.655 1.00 19.36  ? 129 GLY A CA  1 
ATOM   967   C  C   . GLY A  1 152 ? 113.412 110.546 109.172 1.00 22.18  ? 129 GLY A C   1 
ATOM   968   O  O   . GLY A  1 152 ? 114.542 110.286 108.764 1.00 30.85  ? 129 GLY A O   1 
ATOM   969   N  N   . GLY A  1 153 ? 112.370 110.644 108.359 1.00 19.72  ? 130 GLY A N   1 
ATOM   970   C  CA  . GLY A  1 153 ? 112.547 110.579 106.913 1.00 18.64  ? 130 GLY A CA  1 
ATOM   971   C  C   . GLY A  1 153 ? 112.209 111.905 106.251 1.00 20.50  ? 130 GLY A C   1 
ATOM   972   O  O   . GLY A  1 153 ? 112.358 112.950 106.868 1.00 27.67  ? 130 GLY A O   1 
ATOM   973   N  N   . THR A  1 154 ? 111.758 111.856 104.998 1.00 19.78  ? 131 THR A N   1 
ATOM   974   C  CA  . THR A  1 154 ? 111.304 113.037 104.245 1.00 20.98  ? 131 THR A CA  1 
ATOM   975   C  C   . THR A  1 154 ? 110.094 112.660 103.389 1.00 21.61  ? 131 THR A C   1 
ATOM   976   O  O   . THR A  1 154 ? 109.845 111.487 103.153 1.00 26.24  ? 131 THR A O   1 
ATOM   977   C  CB  . THR A  1 154 ? 112.383 113.559 103.245 1.00 27.33  ? 131 THR A CB  1 
ATOM   978   O  OG1 . THR A  1 154 ? 112.651 112.554 102.255 1.00 30.45  ? 131 THR A OG1 1 
ATOM   979   C  CG2 . THR A  1 154 ? 113.661 113.908 103.945 1.00 16.03  ? 131 THR A CG2 1 
ATOM   980   N  N   . PRO A  1 155 ? 109.345 113.659 102.907 1.00 28.69  ? 132 PRO A N   1 
ATOM   981   C  CA  . PRO A  1 155 ? 108.271 113.402 101.945 1.00 25.03  ? 132 PRO A CA  1 
ATOM   982   C  C   . PRO A  1 155 ? 108.826 112.897 100.627 1.00 29.37  ? 132 PRO A C   1 
ATOM   983   O  O   . PRO A  1 155 ? 109.918 113.290 100.218 1.00 29.99  ? 132 PRO A O   1 
ATOM   984   C  CB  . PRO A  1 155 ? 107.656 114.785 101.733 1.00 21.80  ? 132 PRO A CB  1 
ATOM   985   C  CG  . PRO A  1 155 ? 107.979 115.525 102.991 1.00 32.00  ? 132 PRO A CG  1 
ATOM   986   C  CD  . PRO A  1 155 ? 109.353 115.062 103.353 1.00 32.98  ? 132 PRO A CD  1 
ATOM   987   N  N   . GLY A  1 156 ? 108.063 112.037 99.963  1.00 28.65  ? 133 GLY A N   1 
ATOM   988   C  CA  . GLY A  1 156 ? 108.479 111.469 98.697  1.00 23.94  ? 133 GLY A CA  1 
ATOM   989   C  C   . GLY A  1 156 ? 107.465 110.452 98.222  1.00 25.08  ? 133 GLY A C   1 
ATOM   990   O  O   . GLY A  1 156 ? 106.382 110.330 98.796  1.00 24.92  ? 133 GLY A O   1 
ATOM   991   N  N   . SER A  1 157 ? 107.846 109.709 97.190  1.00 23.19  ? 134 SER A N   1 
ATOM   992   C  CA  . SER A  1 157 ? 107.014 108.700 96.560  1.00 26.69  ? 134 SER A CA  1 
ATOM   993   C  C   . SER A  1 157 ? 107.038 107.368 97.295  1.00 32.69  ? 134 SER A C   1 
ATOM   994   O  O   . SER A  1 157 ? 108.025 107.024 97.952  1.00 31.31  ? 134 SER A O   1 
ATOM   995   C  CB  . SER A  1 157 ? 107.519 108.468 95.138  1.00 32.81  ? 134 SER A CB  1 
ATOM   996   O  OG  . SER A  1 157 ? 107.110 109.529 94.298  1.00 49.95  ? 134 SER A OG  1 
ATOM   997   N  N   . VAL A  1 158 ? 105.955 106.610 97.156  1.00 28.20  ? 135 VAL A N   1 
ATOM   998   C  CA  . VAL A  1 158 ? 105.879 105.262 97.713  1.00 23.98  ? 135 VAL A CA  1 
ATOM   999   C  C   . VAL A  1 158 ? 105.149 104.368 96.728  1.00 23.51  ? 135 VAL A C   1 
ATOM   1000  O  O   . VAL A  1 158 ? 103.989 104.608 96.433  1.00 20.25  ? 135 VAL A O   1 
ATOM   1001  C  CB  . VAL A  1 158 ? 105.113 105.220 99.078  1.00 20.39  ? 135 VAL A CB  1 
ATOM   1002  C  CG1 . VAL A  1 158 ? 105.028 103.796 99.586  1.00 17.90  ? 135 VAL A CG1 1 
ATOM   1003  C  CG2 . VAL A  1 158 ? 105.801 106.111 100.141 1.00 15.43  ? 135 VAL A CG2 1 
ATOM   1004  N  N   . LYS A  1 159 ? 105.820 103.335 96.225  1.00 21.13  ? 136 LYS A N   1 
ATOM   1005  C  CA  . LYS A  1 159 ? 105.191 102.428 95.262  1.00 23.28  ? 136 LYS A CA  1 
ATOM   1006  C  C   . LYS A  1 159 ? 103.943 101.758 95.819  1.00 28.07  ? 136 LYS A C   1 
ATOM   1007  O  O   . LYS A  1 159 ? 103.950 101.253 96.947  1.00 26.54  ? 136 LYS A O   1 
ATOM   1008  C  CB  . LYS A  1 159 ? 106.185 101.366 94.776  1.00 25.07  ? 136 LYS A CB  1 
ATOM   1009  C  CG  . LYS A  1 159 ? 105.614 100.449 93.718  1.00 22.95  ? 136 LYS A CG  1 
ATOM   1010  C  CD  . LYS A  1 159 ? 106.659 99.454  93.230  1.00 29.60  ? 136 LYS A CD  1 
ATOM   1011  C  CE  . LYS A  1 159 ? 106.962 98.411  94.295  1.00 28.33  ? 136 LYS A CE  1 
ATOM   1012  N  NZ  . LYS A  1 159 ? 108.069 97.525  93.859  1.00 40.04  ? 136 LYS A NZ  1 
ATOM   1013  N  N   . ALA A  1 160 ? 102.870 101.742 95.029  1.00 25.64  ? 137 ALA A N   1 
ATOM   1014  C  CA  . ALA A  1 160 ? 101.585 101.255 95.528  1.00 16.47  ? 137 ALA A CA  1 
ATOM   1015  C  C   . ALA A  1 160 ? 100.858 100.290 94.578  1.00 22.39  ? 137 ALA A C   1 
ATOM   1016  O  O   . ALA A  1 160 ? 101.159 100.218 93.387  1.00 25.91  ? 137 ALA A O   1 
ATOM   1017  C  CB  . ALA A  1 160 ? 100.689 102.434 95.894  1.00 13.24  ? 137 ALA A CB  1 
ATOM   1018  N  N   . TYR A  1 161 ? 99.911  99.533  95.123  1.00 18.43  ? 138 TYR A N   1 
ATOM   1019  C  CA  . TYR A  1 161 ? 99.053  98.693  94.305  1.00 20.26  ? 138 TYR A CA  1 
ATOM   1020  C  C   . TYR A  1 161 ? 97.611  99.075  94.576  1.00 27.05  ? 138 TYR A C   1 
ATOM   1021  O  O   . TYR A  1 161 ? 97.311  99.641  95.632  1.00 26.73  ? 138 TYR A O   1 
ATOM   1022  C  CB  . TYR A  1 161 ? 99.319  97.189  94.491  1.00 16.00  ? 138 TYR A CB  1 
ATOM   1023  C  CG  . TYR A  1 161 ? 98.910  96.615  95.822  1.00 21.88  ? 138 TYR A CG  1 
ATOM   1024  C  CD1 . TYR A  1 161 ? 97.717  95.921  95.954  1.00 25.01  ? 138 TYR A CD1 1 
ATOM   1025  C  CD2 . TYR A  1 161 ? 99.733  96.732  96.950  1.00 21.11  ? 138 TYR A CD2 1 
ATOM   1026  C  CE1 . TYR A  1 161 ? 97.333  95.366  97.180  1.00 25.20  ? 138 TYR A CE1 1 
ATOM   1027  C  CE2 . TYR A  1 161 ? 99.355  96.176  98.198  1.00 15.28  ? 138 TYR A CE2 1 
ATOM   1028  C  CZ  . TYR A  1 161 ? 98.150  95.500  98.299  1.00 18.85  ? 138 TYR A CZ  1 
ATOM   1029  O  OH  . TYR A  1 161 ? 97.741  94.948  99.496  1.00 23.10  ? 138 TYR A OH  1 
ATOM   1030  N  N   . ASN A  1 162 ? 96.739  98.811  93.598  1.00 31.56  ? 139 ASN A N   1 
ATOM   1031  C  CA  . ASN A  1 162 ? 95.350  99.268  93.646  1.00 29.63  ? 139 ASN A CA  1 
ATOM   1032  C  C   . ASN A  1 162 ? 94.450  98.185  94.179  1.00 30.65  ? 139 ASN A C   1 
ATOM   1033  O  O   . ASN A  1 162 ? 94.278  97.147  93.524  1.00 21.01  ? 139 ASN A O   1 
ATOM   1034  C  CB  . ASN A  1 162 ? 94.858  99.652  92.246  1.00 25.10  ? 139 ASN A CB  1 
ATOM   1035  C  CG  . ASN A  1 162 ? 93.625  100.559 92.283  1.00 29.57  ? 139 ASN A CG  1 
ATOM   1036  O  OD1 . ASN A  1 162 ? 92.854  100.555 93.245  1.00 32.31  ? 139 ASN A OD1 1 
ATOM   1037  N  ND2 . ASN A  1 162 ? 93.449  101.350 91.237  1.00 21.76  ? 139 ASN A ND2 1 
ATOM   1038  N  N   . SER A  1 163 ? 93.864  98.409  95.352  1.00 26.77  ? 140 SER A N   1 
ATOM   1039  C  CA  . SER A  1 163 ? 92.895  97.438  95.847  1.00 28.18  ? 140 SER A CA  1 
ATOM   1040  C  C   . SER A  1 163 ? 91.459  97.954  95.801  1.00 34.78  ? 140 SER A C   1 
ATOM   1041  O  O   . SER A  1 163 ? 90.602  97.476  96.549  1.00 38.96  ? 140 SER A O   1 
ATOM   1042  C  CB  . SER A  1 163 ? 93.262  96.903  97.241  1.00 22.88  ? 140 SER A CB  1 
ATOM   1043  O  OG  . SER A  1 163 ? 93.116  97.896  98.231  1.00 33.22  ? 140 SER A OG  1 
ATOM   1044  N  N   . ASN A  1 164 ? 91.185  98.895  94.897  1.00 32.22  ? 141 ASN A N   1 
ATOM   1045  C  CA  . ASN A  1 164 ? 89.828  99.444  94.774  1.00 30.90  ? 141 ASN A CA  1 
ATOM   1046  C  C   . ASN A  1 164 ? 88.737  98.431  94.428  1.00 34.31  ? 141 ASN A C   1 
ATOM   1047  O  O   . ASN A  1 164 ? 87.567  98.655  94.741  1.00 46.25  ? 141 ASN A O   1 
ATOM   1048  C  CB  . ASN A  1 164 ? 89.770  100.630 93.808  1.00 24.42  ? 141 ASN A CB  1 
ATOM   1049  C  CG  . ASN A  1 164 ? 89.859  101.958 94.523  1.00 31.48  ? 141 ASN A CG  1 
ATOM   1050  O  OD1 . ASN A  1 164 ? 89.630  102.035 95.733  1.00 39.39  ? 141 ASN A OD1 1 
ATOM   1051  N  ND2 . ASN A  1 164 ? 90.195  103.015 93.788  1.00 22.99  ? 141 ASN A ND2 1 
ATOM   1052  N  N   . GLY A  1 165 ? 89.102  97.319  93.797  1.00 26.87  ? 142 GLY A N   1 
ATOM   1053  C  CA  . GLY A  1 165 ? 88.084  96.357  93.398  1.00 28.76  ? 142 GLY A CA  1 
ATOM   1054  C  C   . GLY A  1 165 ? 88.556  94.978  92.978  1.00 35.54  ? 142 GLY A C   1 
ATOM   1055  O  O   . GLY A  1 165 ? 89.317  94.300  93.676  1.00 42.78  ? 142 GLY A O   1 
ATOM   1056  N  N   . LEU A  1 166 ? 88.086  94.558  91.818  1.00 29.70  ? 143 LEU A N   1 
ATOM   1057  C  CA  . LEU A  1 166 ? 88.363  93.223  91.305  1.00 30.95  ? 143 LEU A CA  1 
ATOM   1058  C  C   . LEU A  1 166 ? 87.792  92.168  92.248  1.00 38.99  ? 143 LEU A C   1 
ATOM   1059  O  O   . LEU A  1 166 ? 88.456  91.177  92.603  1.00 31.32  ? 143 LEU A O   1 
ATOM   1060  C  CB  . LEU A  1 166 ? 89.853  93.020  91.040  1.00 23.01  ? 143 LEU A CB  1 
ATOM   1061  C  CG  . LEU A  1 166 ? 90.511  94.034  90.094  1.00 31.33  ? 143 LEU A CG  1 
ATOM   1062  C  CD1 . LEU A  1 166 ? 91.950  93.619  89.743  1.00 24.85  ? 143 LEU A CD1 1 
ATOM   1063  C  CD2 . LEU A  1 166 ? 89.695  94.208  88.835  1.00 28.14  ? 143 LEU A CD2 1 
ATOM   1064  N  N   . TRP A  1 167 ? 86.542  92.408  92.642  1.00 36.55  ? 144 TRP A N   1 
ATOM   1065  C  CA  . TRP A  1 167 ? 85.763  91.481  93.459  1.00 36.74  ? 144 TRP A CA  1 
ATOM   1066  C  C   . TRP A  1 167 ? 85.248  90.310  92.628  1.00 37.19  ? 144 TRP A C   1 
ATOM   1067  O  O   . TRP A  1 167 ? 85.592  90.189  91.445  1.00 29.94  ? 144 TRP A O   1 
ATOM   1068  C  CB  . TRP A  1 167 ? 84.624  92.233  94.147  1.00 31.15  ? 144 TRP A CB  1 
ATOM   1069  C  CG  . TRP A  1 167 ? 85.169  93.230  95.093  1.00 35.43  ? 144 TRP A CG  1 
ATOM   1070  C  CD1 . TRP A  1 167 ? 85.250  94.585  94.918  1.00 40.48  ? 144 TRP A CD1 1 
ATOM   1071  C  CD2 . TRP A  1 167 ? 85.773  92.949  96.366  1.00 32.40  ? 144 TRP A CD2 1 
ATOM   1072  N  NE1 . TRP A  1 167 ? 85.850  95.166  96.019  1.00 43.28  ? 144 TRP A NE1 1 
ATOM   1073  C  CE2 . TRP A  1 167 ? 86.173  94.183  96.921  1.00 37.06  ? 144 TRP A CE2 1 
ATOM   1074  C  CE3 . TRP A  1 167 ? 85.991  91.773  97.096  1.00 24.33  ? 144 TRP A CE3 1 
ATOM   1075  C  CZ2 . TRP A  1 167 ? 86.793  94.273  98.172  1.00 44.17  ? 144 TRP A CZ2 1 
ATOM   1076  C  CZ3 . TRP A  1 167 ? 86.606  91.864  98.338  1.00 34.23  ? 144 TRP A CZ3 1 
ATOM   1077  C  CH2 . TRP A  1 167 ? 87.005  93.104  98.859  1.00 37.48  ? 144 TRP A CH2 1 
ATOM   1078  N  N   . LEU A  1 168 ? 84.448  89.439  93.244  1.00 41.39  ? 145 LEU A N   1 
ATOM   1079  C  CA  . LEU A  1 168 ? 84.092  88.168  92.609  1.00 41.00  ? 145 LEU A CA  1 
ATOM   1080  C  C   . LEU A  1 168 ? 82.987  88.301  91.563  1.00 44.83  ? 145 LEU A C   1 
ATOM   1081  O  O   . LEU A  1 168 ? 81.957  87.645  91.653  1.00 47.84  ? 145 LEU A O   1 
ATOM   1082  C  CB  . LEU A  1 168 ? 83.692  87.135  93.656  1.00 33.93  ? 145 LEU A CB  1 
ATOM   1083  C  CG  . LEU A  1 168 ? 84.664  86.916  94.811  1.00 39.82  ? 145 LEU A CG  1 
ATOM   1084  C  CD1 . LEU A  1 168 ? 84.088  85.907  95.782  1.00 34.39  ? 145 LEU A CD1 1 
ATOM   1085  C  CD2 . LEU A  1 168 ? 86.013  86.450  94.312  1.00 37.28  ? 145 LEU A CD2 1 
ATOM   1086  N  N   . LYS A  1 169 ? 83.213  89.158  90.576  1.00 45.41  ? 146 LYS A N   1 
ATOM   1087  C  CA  . LYS A  1 169 ? 82.325  89.277  89.433  1.00 37.98  ? 146 LYS A CA  1 
ATOM   1088  C  C   . LYS A  1 169 ? 82.821  88.330  88.342  1.00 44.13  ? 146 LYS A C   1 
ATOM   1089  O  O   . LYS A  1 169 ? 83.708  87.513  88.591  1.00 43.00  ? 146 LYS A O   1 
ATOM   1090  C  CB  . LYS A  1 169 ? 82.283  90.731  88.944  1.00 34.99  ? 146 LYS A CB  1 
ATOM   1091  C  CG  . LYS A  1 169 ? 81.511  91.668  89.887  1.00 37.14  ? 146 LYS A CG  1 
ATOM   1092  C  CD  . LYS A  1 169 ? 81.243  93.042  89.274  1.00 46.29  ? 146 LYS A CD  1 
ATOM   1093  C  CE  . LYS A  1 169 ? 82.540  93.772  88.928  1.00 57.25  ? 146 LYS A CE  1 
ATOM   1094  N  NZ  . LYS A  1 169 ? 82.442  95.241  89.201  1.00 62.38  ? 146 LYS A NZ  1 
ATOM   1095  N  N   . SER A  1 170 ? 82.259  88.431  87.140  1.00 40.42  ? 147 SER A N   1 
ATOM   1096  C  CA  . SER A  1 170 ? 82.684  87.568  86.040  1.00 41.21  ? 147 SER A CA  1 
ATOM   1097  C  C   . SER A  1 170 ? 84.061  87.972  85.515  1.00 38.73  ? 147 SER A C   1 
ATOM   1098  O  O   . SER A  1 170 ? 84.500  89.110  85.704  1.00 40.10  ? 147 SER A O   1 
ATOM   1099  C  CB  . SER A  1 170 ? 81.661  87.580  84.892  1.00 50.73  ? 147 SER A CB  1 
ATOM   1100  O  OG  . SER A  1 170 ? 81.809  88.731  84.071  1.00 50.42  ? 147 SER A OG  1 
ATOM   1101  N  N   . PRO A  1 171 ? 84.751  87.032  84.856  1.00 30.57  ? 148 PRO A N   1 
ATOM   1102  C  CA  . PRO A  1 171 ? 86.085  87.303  84.318  1.00 31.47  ? 148 PRO A CA  1 
ATOM   1103  C  C   . PRO A  1 171 ? 86.125  88.516  83.401  1.00 41.70  ? 148 PRO A C   1 
ATOM   1104  O  O   . PRO A  1 171 ? 87.059  89.316  83.499  1.00 44.18  ? 148 PRO A O   1 
ATOM   1105  C  CB  . PRO A  1 171 ? 86.401  86.026  83.538  1.00 30.07  ? 148 PRO A CB  1 
ATOM   1106  C  CG  . PRO A  1 171 ? 85.706  84.965  84.316  1.00 34.32  ? 148 PRO A CG  1 
ATOM   1107  C  CD  . PRO A  1 171 ? 84.412  85.599  84.787  1.00 29.68  ? 148 PRO A CD  1 
ATOM   1108  N  N   . ALA A  1 172 ? 85.132  88.654  82.525  1.00 41.33  ? 149 ALA A N   1 
ATOM   1109  C  CA  . ALA A  1 172 ? 85.116  89.763  81.583  1.00 39.27  ? 149 ALA A CA  1 
ATOM   1110  C  C   . ALA A  1 172 ? 84.855  91.101  82.281  1.00 34.40  ? 149 ALA A C   1 
ATOM   1111  O  O   . ALA A  1 172 ? 85.408  92.123  81.892  1.00 41.41  ? 149 ALA A O   1 
ATOM   1112  C  CB  . ALA A  1 172 ? 84.095  89.517  80.496  1.00 45.13  ? 149 ALA A CB  1 
ATOM   1113  N  N   . GLU A  1 173 ? 84.014  91.091  83.310  1.00 30.58  ? 150 GLU A N   1 
ATOM   1114  C  CA  . GLU A  1 173 ? 83.778  92.292  84.102  1.00 41.20  ? 150 GLU A CA  1 
ATOM   1115  C  C   . GLU A  1 173 ? 85.036  92.694  84.884  1.00 47.92  ? 150 GLU A C   1 
ATOM   1116  O  O   . GLU A  1 173 ? 85.474  93.846  84.831  1.00 50.14  ? 150 GLU A O   1 
ATOM   1117  C  CB  . GLU A  1 173 ? 82.595  92.090  85.049  1.00 45.08  ? 150 GLU A CB  1 
ATOM   1118  C  CG  . GLU A  1 173 ? 81.296  91.717  84.352  1.00 51.06  ? 150 GLU A CG  1 
ATOM   1119  C  CD  . GLU A  1 173 ? 80.103  91.663  85.296  1.00 65.94  ? 150 GLU A CD  1 
ATOM   1120  O  OE1 . GLU A  1 173 ? 80.240  91.129  86.417  1.00 72.20  ? 150 GLU A OE1 1 
ATOM   1121  O  OE2 . GLU A  1 173 ? 79.019  92.159  84.915  1.00 74.70  ? 150 GLU A OE2 1 
ATOM   1122  N  N   . VAL A  1 174 ? 85.623  91.733  85.592  1.00 43.54  ? 151 VAL A N   1 
ATOM   1123  C  CA  . VAL A  1 174 ? 86.846  91.976  86.352  1.00 34.32  ? 151 VAL A CA  1 
ATOM   1124  C  C   . VAL A  1 174 ? 87.986  92.463  85.461  1.00 36.43  ? 151 VAL A C   1 
ATOM   1125  O  O   . VAL A  1 174 ? 88.680  93.434  85.807  1.00 29.50  ? 151 VAL A O   1 
ATOM   1126  C  CB  . VAL A  1 174 ? 87.303  90.731  87.104  1.00 30.35  ? 151 VAL A CB  1 
ATOM   1127  C  CG1 . VAL A  1 174 ? 88.577  91.035  87.863  1.00 27.86  ? 151 VAL A CG1 1 
ATOM   1128  C  CG2 . VAL A  1 174 ? 86.199  90.252  88.039  1.00 30.27  ? 151 VAL A CG2 1 
ATOM   1129  N  N   . ALA A  1 175 ? 88.170  91.804  84.314  1.00 29.07  ? 152 ALA A N   1 
ATOM   1130  C  CA  . ALA A  1 175 ? 89.171  92.248  83.336  1.00 29.45  ? 152 ALA A CA  1 
ATOM   1131  C  C   . ALA A  1 175 ? 88.963  93.696  82.887  1.00 31.32  ? 152 ALA A C   1 
ATOM   1132  O  O   . ALA A  1 175 ? 89.921  94.440  82.723  1.00 34.42  ? 152 ALA A O   1 
ATOM   1133  C  CB  . ALA A  1 175 ? 89.207  91.325  82.136  1.00 28.04  ? 152 ALA A CB  1 
ATOM   1134  N  N   . ALA A  1 176 ? 87.715  94.107  82.695  1.00 31.66  ? 153 ALA A N   1 
ATOM   1135  C  CA  . ALA A  1 176 ? 87.462  95.464  82.225  1.00 31.04  ? 153 ALA A CA  1 
ATOM   1136  C  C   . ALA A  1 176 ? 87.755  96.437  83.350  1.00 40.37  ? 153 ALA A C   1 
ATOM   1137  O  O   . ALA A  1 176 ? 88.353  97.493  83.138  1.00 44.05  ? 153 ALA A O   1 
ATOM   1138  C  CB  . ALA A  1 176 ? 86.030  95.609  81.748  1.00 30.69  ? 153 ALA A CB  1 
ATOM   1139  N  N   . GLU A  1 177 ? 87.340  96.069  84.558  1.00 42.71  ? 154 GLU A N   1 
ATOM   1140  C  CA  . GLU A  1 177 ? 87.632  96.890  85.729  1.00 43.67  ? 154 GLU A CA  1 
ATOM   1141  C  C   . GLU A  1 177 ? 89.146  97.048  85.920  1.00 37.32  ? 154 GLU A C   1 
ATOM   1142  O  O   . GLU A  1 177 ? 89.637  98.133  86.235  1.00 33.16  ? 154 GLU A O   1 
ATOM   1143  C  CB  . GLU A  1 177 ? 86.986  96.298  86.982  1.00 39.40  ? 154 GLU A CB  1 
ATOM   1144  C  CG  . GLU A  1 177 ? 86.874  97.283  88.133  1.00 40.32  ? 154 GLU A CG  1 
ATOM   1145  C  CD  . GLU A  1 177 ? 86.005  96.752  89.263  1.00 55.89  ? 154 GLU A CD  1 
ATOM   1146  O  OE1 . GLU A  1 177 ? 84.785  97.054  89.275  1.00 59.72  ? 154 GLU A OE1 1 
ATOM   1147  O  OE2 . GLU A  1 177 ? 86.541  96.027  90.135  1.00 51.88  ? 154 GLU A OE2 1 
ATOM   1148  N  N   . ALA A  1 178 ? 89.881  95.962  85.708  1.00 34.26  ? 155 ALA A N   1 
ATOM   1149  C  CA  . ALA A  1 178 ? 91.332  95.986  85.839  1.00 29.77  ? 155 ALA A CA  1 
ATOM   1150  C  C   . ALA A  1 178 ? 91.992  97.096  85.000  1.00 32.03  ? 155 ALA A C   1 
ATOM   1151  O  O   . ALA A  1 178 ? 92.898  97.782  85.477  1.00 33.10  ? 155 ALA A O   1 
ATOM   1152  C  CB  . ALA A  1 178 ? 91.912  94.621  85.499  1.00 27.23  ? 155 ALA A CB  1 
ATOM   1153  N  N   . VAL A  1 179 ? 91.539  97.276  83.760  1.00 30.43  ? 156 VAL A N   1 
ATOM   1154  C  CA  . VAL A  1 179 ? 92.019  98.384  82.931  1.00 30.33  ? 156 VAL A CA  1 
ATOM   1155  C  C   . VAL A  1 179 ? 91.791  99.754  83.598  1.00 33.78  ? 156 VAL A C   1 
ATOM   1156  O  O   . VAL A  1 179 ? 92.675  100.624 83.581  1.00 33.28  ? 156 VAL A O   1 
ATOM   1157  C  CB  . VAL A  1 179 ? 91.381  98.368  81.516  1.00 41.26  ? 156 VAL A CB  1 
ATOM   1158  C  CG1 . VAL A  1 179 ? 91.831  99.594  80.695  1.00 27.42  ? 156 VAL A CG1 1 
ATOM   1159  C  CG2 . VAL A  1 179 ? 91.731  97.073  80.792  1.00 34.73  ? 156 VAL A CG2 1 
ATOM   1160  N  N   . GLU A  1 180 ? 90.615  99.947  84.187  1.00 33.37  ? 157 GLU A N   1 
ATOM   1161  C  CA  . GLU A  1 180 ? 90.325  101.194 84.888  1.00 35.58  ? 157 GLU A CA  1 
ATOM   1162  C  C   . GLU A  1 180 ? 91.231  101.365 86.107  1.00 35.53  ? 157 GLU A C   1 
ATOM   1163  O  O   . GLU A  1 180 ? 91.813  102.428 86.318  1.00 38.81  ? 157 GLU A O   1 
ATOM   1164  C  CB  . GLU A  1 180 ? 88.862  101.243 85.333  1.00 43.71  ? 157 GLU A CB  1 
ATOM   1165  C  CG  . GLU A  1 180 ? 87.838  101.286 84.216  1.00 59.58  ? 157 GLU A CG  1 
ATOM   1166  C  CD  . GLU A  1 180 ? 86.410  101.079 84.725  1.00 68.91  ? 157 GLU A CD  1 
ATOM   1167  O  OE1 . GLU A  1 180 ? 86.208  100.969 85.963  1.00 63.11  ? 157 GLU A OE1 1 
ATOM   1168  O  OE2 . GLU A  1 180 ? 85.492  101.018 83.879  1.00 71.39  ? 157 GLU A OE2 1 
ATOM   1169  N  N   . LEU A  1 181 ? 91.339  100.311 86.912  1.00 34.50  ? 158 LEU A N   1 
ATOM   1170  C  CA  . LEU A  1 181 ? 92.107  100.366 88.146  1.00 31.97  ? 158 LEU A CA  1 
ATOM   1171  C  C   . LEU A  1 181 ? 93.561  100.697 87.867  1.00 26.59  ? 158 LEU A C   1 
ATOM   1172  O  O   . LEU A  1 181 ? 94.169  101.509 88.559  1.00 27.86  ? 158 LEU A O   1 
ATOM   1173  C  CB  . LEU A  1 181 ? 91.999  99.048  88.899  1.00 32.96  ? 158 LEU A CB  1 
ATOM   1174  C  CG  . LEU A  1 181 ? 90.580  98.634  89.283  1.00 29.77  ? 158 LEU A CG  1 
ATOM   1175  C  CD1 . LEU A  1 181 ? 90.636  97.403  90.158  1.00 26.63  ? 158 LEU A CD1 1 
ATOM   1176  C  CD2 . LEU A  1 181 ? 89.880  99.771  90.008  1.00 27.85  ? 158 LEU A CD2 1 
ATOM   1177  N  N   . LYS A  1 182 ? 94.118  100.079 86.836  1.00 25.40  ? 159 LYS A N   1 
ATOM   1178  C  CA  . LYS A  1 182 ? 95.480  100.405 86.443  1.00 22.09  ? 159 LYS A CA  1 
ATOM   1179  C  C   . LYS A  1 182 ? 95.631  101.896 86.189  1.00 28.98  ? 159 LYS A C   1 
ATOM   1180  O  O   . LYS A  1 182 ? 96.492  102.544 86.777  1.00 35.80  ? 159 LYS A O   1 
ATOM   1181  C  CB  . LYS A  1 182 ? 95.906  99.621  85.200  1.00 25.66  ? 159 LYS A CB  1 
ATOM   1182  C  CG  . LYS A  1 182 ? 97.413  99.617  85.021  1.00 34.56  ? 159 LYS A CG  1 
ATOM   1183  C  CD  . LYS A  1 182 ? 97.858  98.710  83.892  1.00 29.57  ? 159 LYS A CD  1 
ATOM   1184  C  CE  . LYS A  1 182 ? 99.309  98.994  83.509  1.00 34.55  ? 159 LYS A CE  1 
ATOM   1185  N  NZ  . LYS A  1 182 ? 100.302 98.525  84.532  1.00 52.07  ? 159 LYS A NZ  1 
ATOM   1186  N  N   . ALA A  1 183 ? 94.778  102.442 85.322  1.00 25.51  ? 160 ALA A N   1 
ATOM   1187  C  CA  . ALA A  1 183 ? 94.888  103.844 84.927  1.00 24.76  ? 160 ALA A CA  1 
ATOM   1188  C  C   . ALA A  1 183 ? 94.665  104.780 86.096  1.00 28.48  ? 160 ALA A C   1 
ATOM   1189  O  O   . ALA A  1 183 ? 95.109  105.920 86.066  1.00 28.55  ? 160 ALA A O   1 
ATOM   1190  C  CB  . ALA A  1 183 ? 93.919  104.170 83.782  1.00 29.64  ? 160 ALA A CB  1 
ATOM   1191  N  N   . GLU A  1 184 ? 93.972  104.305 87.127  1.00 32.19  ? 161 GLU A N   1 
ATOM   1192  C  CA  . GLU A  1 184 ? 93.792  105.127 88.315  1.00 36.74  ? 161 GLU A CA  1 
ATOM   1193  C  C   . GLU A  1 184 ? 95.149  105.550 88.881  1.00 38.56  ? 161 GLU A C   1 
ATOM   1194  O  O   . GLU A  1 184 ? 95.239  106.516 89.632  1.00 39.49  ? 161 GLU A O   1 
ATOM   1195  C  CB  . GLU A  1 184 ? 92.934  104.417 89.372  1.00 33.26  ? 161 GLU A CB  1 
ATOM   1196  C  CG  . GLU A  1 184 ? 91.432  104.681 89.212  1.00 33.40  ? 161 GLU A CG  1 
ATOM   1197  C  CD  . GLU A  1 184 ? 90.567  104.017 90.287  1.00 46.12  ? 161 GLU A CD  1 
ATOM   1198  O  OE1 . GLU A  1 184 ? 91.007  103.002 90.861  1.00 38.62  ? 161 GLU A OE1 1 
ATOM   1199  O  OE2 . GLU A  1 184 ? 89.438  104.507 90.553  1.00 56.61  ? 161 GLU A OE2 1 
ATOM   1200  N  N   . GLY A  1 185 ? 96.204  104.837 88.497  1.00 34.54  ? 162 GLY A N   1 
ATOM   1201  C  CA  . GLY A  1 185 ? 97.551  105.141 88.965  1.00 32.91  ? 162 GLY A CA  1 
ATOM   1202  C  C   . GLY A  1 185 ? 98.220  106.363 88.346  1.00 29.83  ? 162 GLY A C   1 
ATOM   1203  O  O   . GLY A  1 185 ? 99.202  106.870 88.884  1.00 36.98  ? 162 GLY A O   1 
ATOM   1204  N  N   . GLN A  1 186 ? 97.696  106.841 87.222  1.00 28.14  ? 163 GLN A N   1 
ATOM   1205  C  CA  . GLN A  1 186 ? 98.269  108.003 86.527  1.00 35.00  ? 163 GLN A CA  1 
ATOM   1206  C  C   . GLN A  1 186 ? 99.544  107.635 85.777  1.00 35.62  ? 163 GLN A C   1 
ATOM   1207  O  O   . GLN A  1 186 ? 100.251 106.701 86.161  1.00 30.98  ? 163 GLN A O   1 
ATOM   1208  C  CB  . GLN A  1 186 ? 98.539  109.168 87.493  1.00 33.30  ? 163 GLN A CB  1 
ATOM   1209  C  CG  . GLN A  1 186 ? 97.295  109.681 88.228  1.00 40.38  ? 163 GLN A CG  1 
ATOM   1210  C  CD  . GLN A  1 186 ? 96.110  109.987 87.294  1.00 50.20  ? 163 GLN A CD  1 
ATOM   1211  O  OE1 . GLN A  1 186 ? 96.223  110.793 86.363  1.00 62.45  ? 163 GLN A OE1 1 
ATOM   1212  N  NE2 . GLN A  1 186 ? 94.972  109.341 87.548  1.00 33.02  ? 163 GLN A NE2 1 
ATOM   1213  N  N   . GLY A  1 187 ? 99.840  108.368 84.707  1.00 32.23  ? 164 GLY A N   1 
ATOM   1214  C  CA  . GLY A  1 187 ? 101.014 108.075 83.900  1.00 25.22  ? 164 GLY A CA  1 
ATOM   1215  C  C   . GLY A  1 187 ? 101.029 106.630 83.421  1.00 38.22  ? 164 GLY A C   1 
ATOM   1216  O  O   . GLY A  1 187 ? 100.065 106.155 82.802  1.00 29.99  ? 164 GLY A O   1 
ATOM   1217  N  N   . THR A  1 188 ? 102.117 105.919 83.721  1.00 41.47  ? 165 THR A N   1 
ATOM   1218  C  CA  . THR A  1 188 ? 102.272 104.520 83.309  1.00 36.79  ? 165 THR A CA  1 
ATOM   1219  C  C   . THR A  1 188 ? 101.348 103.552 84.058  1.00 31.18  ? 165 THR A C   1 
ATOM   1220  O  O   . THR A  1 188 ? 101.238 102.385 83.690  1.00 34.95  ? 165 THR A O   1 
ATOM   1221  C  CB  . THR A  1 188 ? 103.732 104.050 83.447  1.00 40.86  ? 165 THR A CB  1 
ATOM   1222  O  OG1 . THR A  1 188 ? 104.226 104.401 84.745  1.00 37.85  ? 165 THR A OG1 1 
ATOM   1223  C  CG2 . THR A  1 188 ? 104.609 104.719 82.383  1.00 43.78  ? 165 THR A CG2 1 
ATOM   1224  N  N   . GLY A  1 189 ? 100.683 104.047 85.101  1.00 27.32  ? 166 GLY A N   1 
ATOM   1225  C  CA  . GLY A  1 189 ? 99.710  103.263 85.844  1.00 28.04  ? 166 GLY A CA  1 
ATOM   1226  C  C   . GLY A  1 189 ? 100.231 102.584 87.104  1.00 27.30  ? 166 GLY A C   1 
ATOM   1227  O  O   . GLY A  1 189 ? 101.422 102.632 87.389  1.00 27.56  ? 166 GLY A O   1 
ATOM   1228  N  N   . PHE A  1 190 ? 99.326  101.968 87.867  1.00 29.70  ? 167 PHE A N   1 
ATOM   1229  C  CA  . PHE A  1 190 ? 99.718  101.089 88.969  1.00 32.74  ? 167 PHE A CA  1 
ATOM   1230  C  C   . PHE A  1 190 ? 100.516 99.879  88.447  1.00 30.37  ? 167 PHE A C   1 
ATOM   1231  O  O   . PHE A  1 190 ? 100.175 99.302  87.414  1.00 27.70  ? 167 PHE A O   1 
ATOM   1232  C  CB  . PHE A  1 190 ? 98.480  100.621 89.744  1.00 26.62  ? 167 PHE A CB  1 
ATOM   1233  C  CG  . PHE A  1 190 ? 97.953  101.642 90.711  1.00 29.19  ? 167 PHE A CG  1 
ATOM   1234  C  CD1 . PHE A  1 190 ? 98.719  102.048 91.787  1.00 22.85  ? 167 PHE A CD1 1 
ATOM   1235  C  CD2 . PHE A  1 190 ? 96.686  102.192 90.554  1.00 23.47  ? 167 PHE A CD2 1 
ATOM   1236  C  CE1 . PHE A  1 190 ? 98.243  103.000 92.682  1.00 28.97  ? 167 PHE A CE1 1 
ATOM   1237  C  CE2 . PHE A  1 190 ? 96.206  103.143 91.458  1.00 23.95  ? 167 PHE A CE2 1 
ATOM   1238  C  CZ  . PHE A  1 190 ? 96.986  103.545 92.519  1.00 21.79  ? 167 PHE A CZ  1 
ATOM   1239  N  N   . LYS A  1 191 ? 101.578 99.494  89.149  1.00 22.68  ? 168 LYS A N   1 
ATOM   1240  C  CA  . LYS A  1 191 ? 102.358 98.331  88.726  1.00 22.27  ? 168 LYS A CA  1 
ATOM   1241  C  C   . LYS A  1 191 ? 101.781 97.042  89.328  1.00 29.81  ? 168 LYS A C   1 
ATOM   1242  O  O   . LYS A  1 191 ? 102.259 95.937  89.048  1.00 31.06  ? 168 LYS A O   1 
ATOM   1243  C  CB  . LYS A  1 191 ? 103.837 98.495  89.102  1.00 30.74  ? 168 LYS A CB  1 
ATOM   1244  C  CG  . LYS A  1 191 ? 104.543 99.661  88.403  1.00 28.58  ? 168 LYS A CG  1 
ATOM   1245  C  CD  . LYS A  1 191 ? 105.877 99.968  89.072  1.00 38.00  ? 168 LYS A CD  1 
ATOM   1246  C  CE  . LYS A  1 191 ? 106.723 100.946 88.259  1.00 42.95  ? 168 LYS A CE  1 
ATOM   1247  N  NZ  . LYS A  1 191 ? 106.095 102.300 88.116  1.00 42.55  ? 168 LYS A NZ  1 
ATOM   1248  N  N   . GLY A  1 192 ? 100.744 97.191  90.152  1.00 25.13  ? 169 GLY A N   1 
ATOM   1249  C  CA  . GLY A  1 192 ? 100.088 96.048  90.751  1.00 20.18  ? 169 GLY A CA  1 
ATOM   1250  C  C   . GLY A  1 192 ? 98.632  96.282  91.108  1.00 29.99  ? 169 GLY A C   1 
ATOM   1251  O  O   . GLY A  1 192 ? 98.196  97.402  91.382  1.00 28.22  ? 169 GLY A O   1 
ATOM   1252  N  N   . LEU A  1 193 ? 97.880  95.192  91.112  1.00 26.87  ? 170 LEU A N   1 
ATOM   1253  C  CA  . LEU A  1 193 ? 96.463  95.218  91.388  1.00 19.07  ? 170 LEU A CA  1 
ATOM   1254  C  C   . LEU A  1 193 ? 96.158  94.081  92.336  1.00 24.11  ? 170 LEU A C   1 
ATOM   1255  O  O   . LEU A  1 193 ? 96.714  92.985  92.211  1.00 23.88  ? 170 LEU A O   1 
ATOM   1256  C  CB  . LEU A  1 193 ? 95.685  94.961  90.090  1.00 24.66  ? 170 LEU A CB  1 
ATOM   1257  C  CG  . LEU A  1 193 ? 95.870  95.942  88.940  1.00 26.96  ? 170 LEU A CG  1 
ATOM   1258  C  CD1 . LEU A  1 193 ? 95.235  95.403  87.645  1.00 24.00  ? 170 LEU A CD1 1 
ATOM   1259  C  CD2 . LEU A  1 193 ? 95.299  97.297  89.332  1.00 16.19  ? 170 LEU A CD2 1 
ATOM   1260  N  N   . LYS A  1 194 ? 95.261  94.324  93.274  1.00 20.62  ? 171 LYS A N   1 
ATOM   1261  C  CA  . LYS A  1 194 ? 94.768  93.245  94.095  1.00 17.51  ? 171 LYS A CA  1 
ATOM   1262  C  C   . LYS A  1 194 ? 93.564  92.591  93.414  1.00 25.59  ? 171 LYS A C   1 
ATOM   1263  O  O   . LYS A  1 194 ? 92.605  93.270  93.003  1.00 27.28  ? 171 LYS A O   1 
ATOM   1264  C  CB  . LYS A  1 194 ? 94.418  93.737  95.495  1.00 23.11  ? 171 LYS A CB  1 
ATOM   1265  C  CG  . LYS A  1 194 ? 93.849  92.642  96.402  1.00 24.55  ? 171 LYS A CG  1 
ATOM   1266  C  CD  . LYS A  1 194 ? 93.944  93.038  97.847  1.00 27.47  ? 171 LYS A CD  1 
ATOM   1267  C  CE  . LYS A  1 194 ? 95.310  92.659  98.404  1.00 30.06  ? 171 LYS A CE  1 
ATOM   1268  N  NZ  . LYS A  1 194 ? 95.459  93.044  99.843  1.00 26.07  ? 171 LYS A NZ  1 
ATOM   1269  N  N   . LEU A  1 195 ? 93.649  91.269  93.281  1.00 27.41  ? 172 LEU A N   1 
ATOM   1270  C  CA  . LEU A  1 195 ? 92.616  90.433  92.672  1.00 21.46  ? 172 LEU A CA  1 
ATOM   1271  C  C   . LEU A  1 195 ? 92.013  89.503  93.733  1.00 25.20  ? 172 LEU A C   1 
ATOM   1272  O  O   . LEU A  1 195 ? 92.730  88.704  94.352  1.00 18.46  ? 172 LEU A O   1 
ATOM   1273  C  CB  . LEU A  1 195 ? 93.239  89.586  91.546  1.00 26.03  ? 172 LEU A CB  1 
ATOM   1274  C  CG  . LEU A  1 195 ? 92.278  88.657  90.807  1.00 27.24  ? 172 LEU A CG  1 
ATOM   1275  C  CD1 . LEU A  1 195 ? 91.257  89.476  90.024  1.00 30.22  ? 172 LEU A CD1 1 
ATOM   1276  C  CD2 . LEU A  1 195 ? 93.010  87.724  89.888  1.00 27.27  ? 172 LEU A CD2 1 
ATOM   1277  N  N   . ARG A  1 196 ? 90.707  89.603  93.963  1.00 22.71  ? 173 ARG A N   1 
ATOM   1278  C  CA  . ARG A  1 196 ? 90.085  88.724  94.940  1.00 26.16  ? 173 ARG A CA  1 
ATOM   1279  C  C   . ARG A  1 196 ? 89.748  87.374  94.337  1.00 33.21  ? 173 ARG A C   1 
ATOM   1280  O  O   . ARG A  1 196 ? 89.508  87.265  93.136  1.00 38.00  ? 173 ARG A O   1 
ATOM   1281  C  CB  . ARG A  1 196 ? 88.870  89.370  95.590  1.00 29.72  ? 173 ARG A CB  1 
ATOM   1282  C  CG  . ARG A  1 196 ? 89.221  90.350  96.711  1.00 23.22  ? 173 ARG A CG  1 
ATOM   1283  C  CD  . ARG A  1 196 ? 89.693  91.720  96.211  1.00 25.71  ? 173 ARG A CD  1 
ATOM   1284  N  NE  . ARG A  1 196 ? 90.018  92.585  97.349  1.00 32.83  ? 173 ARG A NE  1 
ATOM   1285  C  CZ  . ARG A  1 196 ? 90.183  93.905  97.306  1.00 30.96  ? 173 ARG A CZ  1 
ATOM   1286  N  NH1 . ARG A  1 196 ? 90.068  94.579  96.171  1.00 31.23  ? 173 ARG A NH1 1 
ATOM   1287  N  NH2 . ARG A  1 196 ? 90.465  94.558  98.419  1.00 31.94  ? 173 ARG A NH2 1 
ATOM   1288  N  N   . MET A  1 197 ? 89.772  86.343  95.177  1.00 27.86  ? 174 MET A N   1 
ATOM   1289  C  CA  . MET A  1 197 ? 89.465  84.977  94.753  1.00 25.12  ? 174 MET A CA  1 
ATOM   1290  C  C   . MET A  1 197 ? 88.660  84.242  95.824  1.00 33.24  ? 174 MET A C   1 
ATOM   1291  O  O   . MET A  1 197 ? 88.541  84.704  96.966  1.00 37.78  ? 174 MET A O   1 
ATOM   1292  C  CB  . MET A  1 197 ? 90.749  84.197  94.439  1.00 29.51  ? 174 MET A CB  1 
ATOM   1293  C  CG  . MET A  1 197 ? 91.417  84.554  93.113  1.00 25.56  ? 174 MET A CG  1 
ATOM   1294  S  SD  . MET A  1 197 ? 92.745  83.388  92.692  1.00 36.43  ? 174 MET A SD  1 
ATOM   1295  C  CE  . MET A  1 197 ? 93.276  84.038  91.103  1.00 43.57  ? 174 MET A CE  1 
ATOM   1296  N  N   . GLY A  1 198 ? 88.109  83.095  95.452  1.00 33.18  ? 175 GLY A N   1 
ATOM   1297  C  CA  . GLY A  1 198 ? 87.227  82.354  96.333  1.00 27.81  ? 175 GLY A CA  1 
ATOM   1298  C  C   . GLY A  1 198 ? 85.872  82.079  95.712  1.00 35.24  ? 175 GLY A C   1 
ATOM   1299  O  O   . GLY A  1 198 ? 84.882  81.928  96.427  1.00 40.69  ? 175 GLY A O   1 
ATOM   1300  N  N   . ARG A  1 199 ? 85.826  82.025  94.381  1.00 38.80  ? 176 ARG A N   1 
ATOM   1301  C  CA  . ARG A  1 199 ? 84.602  81.676  93.662  1.00 39.85  ? 176 ARG A CA  1 
ATOM   1302  C  C   . ARG A  1 199 ? 84.227  80.225  93.922  1.00 45.96  ? 176 ARG A C   1 
ATOM   1303  O  O   . ARG A  1 199 ? 85.100  79.396  94.182  1.00 37.75  ? 176 ARG A O   1 
ATOM   1304  C  CB  . ARG A  1 199 ? 84.767  81.910  92.156  1.00 29.50  ? 176 ARG A CB  1 
ATOM   1305  C  CG  . ARG A  1 199 ? 84.802  83.378  91.787  1.00 31.60  ? 176 ARG A CG  1 
ATOM   1306  C  CD  . ARG A  1 199 ? 85.339  83.622  90.383  1.00 32.23  ? 176 ARG A CD  1 
ATOM   1307  N  NE  . ARG A  1 199 ? 85.424  85.052  90.081  1.00 30.93  ? 176 ARG A NE  1 
ATOM   1308  C  CZ  . ARG A  1 199 ? 86.483  85.815  90.336  1.00 37.68  ? 176 ARG A CZ  1 
ATOM   1309  N  NH1 . ARG A  1 199 ? 87.569  85.302  90.907  1.00 37.83  ? 176 ARG A NH1 1 
ATOM   1310  N  NH2 . ARG A  1 199 ? 86.463  87.097  90.016  1.00 40.39  ? 176 ARG A NH2 1 
ATOM   1311  N  N   . ASP A  1 200 ? 82.932  79.920  93.848  1.00 53.65  ? 177 ASP A N   1 
ATOM   1312  C  CA  . ASP A  1 200 ? 82.462  78.550  94.044  1.00 48.46  ? 177 ASP A CA  1 
ATOM   1313  C  C   . ASP A  1 200 ? 83.299  77.584  93.219  1.00 44.42  ? 177 ASP A C   1 
ATOM   1314  O  O   . ASP A  1 200 ? 83.597  76.484  93.665  1.00 46.86  ? 177 ASP A O   1 
ATOM   1315  C  CB  . ASP A  1 200 ? 80.980  78.407  93.678  1.00 58.98  ? 177 ASP A CB  1 
ATOM   1316  C  CG  . ASP A  1 200 ? 80.047  79.047  94.705  1.00 71.99  ? 177 ASP A CG  1 
ATOM   1317  O  OD1 . ASP A  1 200 ? 80.337  78.964  95.915  1.00 75.39  ? 177 ASP A OD1 1 
ATOM   1318  O  OD2 . ASP A  1 200 ? 79.013  79.629  94.302  1.00 77.47  ? 177 ASP A OD2 1 
ATOM   1319  N  N   . ASP A  1 201 ? 83.684  78.009  92.019  1.00 46.08  ? 178 ASP A N   1 
ATOM   1320  C  CA  . ASP A  1 201 ? 84.460  77.173  91.099  1.00 41.61  ? 178 ASP A CA  1 
ATOM   1321  C  C   . ASP A  1 201 ? 85.876  77.730  90.910  1.00 39.44  ? 178 ASP A C   1 
ATOM   1322  O  O   . ASP A  1 201 ? 86.047  78.827  90.392  1.00 38.41  ? 178 ASP A O   1 
ATOM   1323  C  CB  . ASP A  1 201 ? 83.737  77.088  89.748  1.00 40.99  ? 178 ASP A CB  1 
ATOM   1324  C  CG  . ASP A  1 201 ? 84.487  76.250  88.718  1.00 50.58  ? 178 ASP A CG  1 
ATOM   1325  O  OD1 . ASP A  1 201 ? 85.624  75.797  88.980  1.00 55.15  ? 178 ASP A OD1 1 
ATOM   1326  O  OD2 . ASP A  1 201 ? 83.930  76.053  87.623  1.00 60.05  ? 178 ASP A OD2 1 
ATOM   1327  N  N   . PRO A  1 202 ? 86.895  76.968  91.332  1.00 43.85  ? 179 PRO A N   1 
ATOM   1328  C  CA  . PRO A  1 202 ? 88.295  77.408  91.264  1.00 47.58  ? 179 PRO A CA  1 
ATOM   1329  C  C   . PRO A  1 202 ? 88.746  77.809  89.858  1.00 45.30  ? 179 PRO A C   1 
ATOM   1330  O  O   . PRO A  1 202 ? 89.475  78.791  89.702  1.00 50.39  ? 179 PRO A O   1 
ATOM   1331  C  CB  . PRO A  1 202 ? 89.071  76.172  91.734  1.00 48.45  ? 179 PRO A CB  1 
ATOM   1332  C  CG  . PRO A  1 202 ? 88.117  75.444  92.604  1.00 43.79  ? 179 PRO A CG  1 
ATOM   1333  C  CD  . PRO A  1 202 ? 86.761  75.651  91.979  1.00 42.30  ? 179 PRO A CD  1 
ATOM   1334  N  N   . ALA A  1 203 ? 88.321  77.059  88.849  1.00 41.78  ? 180 ALA A N   1 
ATOM   1335  C  CA  . ALA A  1 203 ? 88.711  77.348  87.469  1.00 38.06  ? 180 ALA A CA  1 
ATOM   1336  C  C   . ALA A  1 203 ? 88.332  78.760  87.017  1.00 33.32  ? 180 ALA A C   1 
ATOM   1337  O  O   . ALA A  1 203 ? 88.979  79.333  86.144  1.00 37.42  ? 180 ALA A O   1 
ATOM   1338  C  CB  . ALA A  1 203 ? 88.116  76.311  86.522  1.00 39.55  ? 180 ALA A CB  1 
ATOM   1339  N  N   . VAL A  1 204 ? 87.280  79.327  87.592  1.00 28.94  ? 181 VAL A N   1 
ATOM   1340  C  CA  . VAL A  1 204 ? 86.913  80.688  87.213  1.00 36.56  ? 181 VAL A CA  1 
ATOM   1341  C  C   . VAL A  1 204 ? 87.897  81.706  87.815  1.00 43.60  ? 181 VAL A C   1 
ATOM   1342  O  O   . VAL A  1 204 ? 88.247  82.695  87.156  1.00 44.77  ? 181 VAL A O   1 
ATOM   1343  C  CB  . VAL A  1 204 ? 85.446  81.032  87.574  1.00 33.77  ? 181 VAL A CB  1 
ATOM   1344  C  CG1 . VAL A  1 204 ? 85.076  82.406  87.040  1.00 32.16  ? 181 VAL A CG1 1 
ATOM   1345  C  CG2 . VAL A  1 204 ? 84.507  79.992  86.999  1.00 30.41  ? 181 VAL A CG2 1 
ATOM   1346  N  N   . ASP A  1 205 ? 88.344  81.460  89.052  1.00 24.36  ? 182 ASP A N   1 
ATOM   1347  C  CA  . ASP A  1 205 ? 89.401  82.282  89.666  1.00 29.99  ? 182 ASP A CA  1 
ATOM   1348  C  C   . ASP A  1 205 ? 90.639  82.373  88.761  1.00 31.07  ? 182 ASP A C   1 
ATOM   1349  O  O   . ASP A  1 205 ? 91.116  83.463  88.452  1.00 34.06  ? 182 ASP A O   1 
ATOM   1350  C  CB  . ASP A  1 205 ? 89.803  81.745  91.055  1.00 32.16  ? 182 ASP A CB  1 
ATOM   1351  C  CG  . ASP A  1 205 ? 88.768  82.053  92.142  1.00 39.87  ? 182 ASP A CG  1 
ATOM   1352  O  OD1 . ASP A  1 205 ? 87.988  83.027  91.993  1.00 34.30  ? 182 ASP A OD1 1 
ATOM   1353  O  OD2 . ASP A  1 205 ? 88.742  81.312  93.155  1.00 38.96  ? 182 ASP A OD2 1 
ATOM   1354  N  N   . ILE A  1 206 ? 91.153  81.222  88.338  1.00 24.48  ? 183 ILE A N   1 
ATOM   1355  C  CA  . ILE A  1 206 ? 92.247  81.188  87.378  1.00 30.09  ? 183 ILE A CA  1 
ATOM   1356  C  C   . ILE A  1 206 ? 91.878  81.917  86.082  1.00 35.72  ? 183 ILE A C   1 
ATOM   1357  O  O   . ILE A  1 206 ? 92.610  82.789  85.607  1.00 37.69  ? 183 ILE A O   1 
ATOM   1358  C  CB  . ILE A  1 206 ? 92.626  79.753  87.014  1.00 33.24  ? 183 ILE A CB  1 
ATOM   1359  C  CG1 . ILE A  1 206 ? 93.162  79.020  88.244  1.00 43.70  ? 183 ILE A CG1 1 
ATOM   1360  C  CG2 . ILE A  1 206 ? 93.637  79.749  85.871  1.00 27.79  ? 183 ILE A CG2 1 
ATOM   1361  C  CD1 . ILE A  1 206 ? 93.585  77.601  87.952  1.00 46.25  ? 183 ILE A CD1 1 
ATOM   1362  N  N   . GLU A  1 207 ? 90.743  81.541  85.512  1.00 34.58  ? 184 GLU A N   1 
ATOM   1363  C  CA  . GLU A  1 207 ? 90.233  82.207  84.323  1.00 43.56  ? 184 GLU A CA  1 
ATOM   1364  C  C   . GLU A  1 207 ? 90.223  83.725  84.519  1.00 36.10  ? 184 GLU A C   1 
ATOM   1365  O  O   . GLU A  1 207 ? 90.652  84.478  83.645  1.00 35.71  ? 184 GLU A O   1 
ATOM   1366  C  CB  . GLU A  1 207 ? 88.827  81.694  84.016  1.00 55.95  ? 184 GLU A CB  1 
ATOM   1367  C  CG  . GLU A  1 207 ? 88.294  82.056  82.642  1.00 72.57  ? 184 GLU A CG  1 
ATOM   1368  C  CD  . GLU A  1 207 ? 86.853  81.593  82.437  1.00 82.89  ? 184 GLU A CD  1 
ATOM   1369  O  OE1 . GLU A  1 207 ? 86.399  80.686  83.178  1.00 79.66  ? 184 GLU A OE1 1 
ATOM   1370  O  OE2 . GLU A  1 207 ? 86.174  82.146  81.541  1.00 86.66  ? 184 GLU A OE2 1 
ATOM   1371  N  N   . THR A  1 208 ? 89.731  84.180  85.669  1.00 34.09  ? 185 THR A N   1 
ATOM   1372  C  CA  . THR A  1 208 ? 89.703  85.615  85.951  1.00 26.72  ? 185 THR A CA  1 
ATOM   1373  C  C   . THR A  1 208 ? 91.121  86.200  85.968  1.00 33.96  ? 185 THR A C   1 
ATOM   1374  O  O   . THR A  1 208 ? 91.363  87.283  85.432  1.00 40.68  ? 185 THR A O   1 
ATOM   1375  C  CB  . THR A  1 208 ? 88.991  85.924  87.281  1.00 27.58  ? 185 THR A CB  1 
ATOM   1376  O  OG1 . THR A  1 208 ? 87.650  85.418  87.240  1.00 36.70  ? 185 THR A OG1 1 
ATOM   1377  C  CG2 . THR A  1 208 ? 88.943  87.415  87.519  1.00 32.09  ? 185 THR A CG2 1 
ATOM   1378  N  N   . ALA A  1 209 ? 92.060  85.482  86.580  1.00 34.21  ? 186 ALA A N   1 
ATOM   1379  C  CA  . ALA A  1 209 ? 93.445  85.944  86.629  1.00 35.92  ? 186 ALA A CA  1 
ATOM   1380  C  C   . ALA A  1 209 ? 94.002  86.042  85.216  1.00 36.71  ? 186 ALA A C   1 
ATOM   1381  O  O   . ALA A  1 209 ? 94.606  87.052  84.849  1.00 37.05  ? 186 ALA A O   1 
ATOM   1382  C  CB  . ALA A  1 209 ? 94.296  85.011  87.461  1.00 32.72  ? 186 ALA A CB  1 
ATOM   1383  N  N   . GLU A  1 210 ? 93.797  84.988  84.427  1.00 26.68  ? 187 GLU A N   1 
ATOM   1384  C  CA  . GLU A  1 210 ? 94.276  84.967  83.046  1.00 33.98  ? 187 GLU A CA  1 
ATOM   1385  C  C   . GLU A  1 210 ? 93.673  86.089  82.199  1.00 30.73  ? 187 GLU A C   1 
ATOM   1386  O  O   . GLU A  1 210 ? 94.374  86.711  81.406  1.00 31.83  ? 187 GLU A O   1 
ATOM   1387  C  CB  . GLU A  1 210 ? 94.037  83.606  82.391  1.00 42.72  ? 187 GLU A CB  1 
ATOM   1388  C  CG  . GLU A  1 210 ? 94.940  82.504  82.934  1.00 50.72  ? 187 GLU A CG  1 
ATOM   1389  C  CD  . GLU A  1 210 ? 96.410  82.782  82.685  1.00 61.81  ? 187 GLU A CD  1 
ATOM   1390  O  OE1 . GLU A  1 210 ? 96.714  83.616  81.803  1.00 68.14  ? 187 GLU A OE1 1 
ATOM   1391  O  OE2 . GLU A  1 210 ? 97.261  82.166  83.365  1.00 64.54  ? 187 GLU A OE2 1 
ATOM   1392  N  N   . ALA A  1 211 ? 92.386  86.358  82.395  1.00 29.00  ? 188 ALA A N   1 
ATOM   1393  C  CA  . ALA A  1 211 ? 91.708  87.439  81.686  1.00 35.40  ? 188 ALA A CA  1 
ATOM   1394  C  C   . ALA A  1 211 ? 92.288  88.798  82.042  1.00 39.87  ? 188 ALA A C   1 
ATOM   1395  O  O   . ALA A  1 211 ? 92.503  89.622  81.157  1.00 41.47  ? 188 ALA A O   1 
ATOM   1396  C  CB  . ALA A  1 211 ? 90.178  87.414  81.949  1.00 20.84  ? 188 ALA A CB  1 
ATOM   1397  N  N   . VAL A  1 212 ? 92.533  89.040  83.331  1.00 41.27  ? 189 VAL A N   1 
ATOM   1398  C  CA  . VAL A  1 212 ? 93.089  90.327  83.752  1.00 28.61  ? 189 VAL A CA  1 
ATOM   1399  C  C   . VAL A  1 212 ? 94.445  90.613  83.104  1.00 22.64  ? 189 VAL A C   1 
ATOM   1400  O  O   . VAL A  1 212 ? 94.672  91.715  82.598  1.00 24.23  ? 189 VAL A O   1 
ATOM   1401  C  CB  . VAL A  1 212 ? 93.191  90.468  85.285  1.00 31.93  ? 189 VAL A CB  1 
ATOM   1402  C  CG1 . VAL A  1 212 ? 93.974  91.735  85.651  1.00 26.19  ? 189 VAL A CG1 1 
ATOM   1403  C  CG2 . VAL A  1 212 ? 91.810  90.511  85.908  1.00 31.62  ? 189 VAL A CG2 1 
ATOM   1404  N  N   . TRP A  1 213 ? 95.338  89.624  83.111  1.00 22.74  ? 190 TRP A N   1 
ATOM   1405  C  CA  . TRP A  1 213 ? 96.656  89.784  82.483  1.00 31.65  ? 190 TRP A CA  1 
ATOM   1406  C  C   . TRP A  1 213 ? 96.554  90.036  80.968  1.00 39.49  ? 190 TRP A C   1 
ATOM   1407  O  O   . TRP A  1 213 ? 97.379  90.759  80.396  1.00 39.11  ? 190 TRP A O   1 
ATOM   1408  C  CB  . TRP A  1 213 ? 97.566  88.574  82.762  1.00 21.79  ? 190 TRP A CB  1 
ATOM   1409  C  CG  . TRP A  1 213 ? 98.390  88.677  84.047  1.00 28.42  ? 190 TRP A CG  1 
ATOM   1410  C  CD1 . TRP A  1 213 ? 98.956  89.799  84.565  1.00 33.16  ? 190 TRP A CD1 1 
ATOM   1411  C  CD2 . TRP A  1 213 ? 98.721  87.609  84.956  1.00 21.43  ? 190 TRP A CD2 1 
ATOM   1412  N  NE1 . TRP A  1 213 ? 99.628  89.501  85.727  1.00 35.37  ? 190 TRP A NE1 1 
ATOM   1413  C  CE2 . TRP A  1 213 ? 99.495  88.164  85.989  1.00 28.57  ? 190 TRP A CE2 1 
ATOM   1414  C  CE3 . TRP A  1 213 ? 98.429  86.239  84.994  1.00 26.07  ? 190 TRP A CE3 1 
ATOM   1415  C  CZ2 . TRP A  1 213 ? 99.984  87.401  87.053  1.00 31.21  ? 190 TRP A CZ2 1 
ATOM   1416  C  CZ3 . TRP A  1 213 ? 98.918  85.480  86.052  1.00 29.03  ? 190 TRP A CZ3 1 
ATOM   1417  C  CH2 . TRP A  1 213 ? 99.682  86.062  87.066  1.00 31.79  ? 190 TRP A CH2 1 
ATOM   1418  N  N   . ASP A  1 214 ? 95.555  89.433  80.322  1.00 39.45  ? 191 ASP A N   1 
ATOM   1419  C  CA  . ASP A  1 214 ? 95.334  89.668  78.895  1.00 40.06  ? 191 ASP A CA  1 
ATOM   1420  C  C   . ASP A  1 214 ? 94.932  91.124  78.647  1.00 41.12  ? 191 ASP A C   1 
ATOM   1421  O  O   . ASP A  1 214 ? 95.362  91.733  77.674  1.00 46.32  ? 191 ASP A O   1 
ATOM   1422  C  CB  . ASP A  1 214 ? 94.290  88.703  78.312  1.00 43.11  ? 191 ASP A CB  1 
ATOM   1423  C  CG  . ASP A  1 214 ? 94.790  87.258  78.245  1.00 56.20  ? 191 ASP A CG  1 
ATOM   1424  O  OD1 . ASP A  1 214 ? 96.022  87.046  78.289  1.00 65.19  ? 191 ASP A OD1 1 
ATOM   1425  O  OD2 . ASP A  1 214 ? 93.951  86.331  78.148  1.00 54.10  ? 191 ASP A OD2 1 
ATOM   1426  N  N   . ALA A  1 215 ? 94.128  91.690  79.541  1.00 32.01  ? 192 ALA A N   1 
ATOM   1427  C  CA  . ALA A  1 215 ? 93.702  93.077  79.387  1.00 28.88  ? 192 ALA A CA  1 
ATOM   1428  C  C   . ALA A  1 215 ? 94.776  94.114  79.737  1.00 43.24  ? 192 ALA A C   1 
ATOM   1429  O  O   . ALA A  1 215 ? 94.845  95.168  79.096  1.00 43.51  ? 192 ALA A O   1 
ATOM   1430  C  CB  . ALA A  1 215 ? 92.427  93.342  80.178  1.00 26.08  ? 192 ALA A CB  1 
ATOM   1431  N  N   . VAL A  1 216 ? 95.602  93.843  80.749  1.00 39.89  ? 193 VAL A N   1 
ATOM   1432  C  CA  . VAL A  1 216 ? 96.550  94.868  81.210  1.00 35.99  ? 193 VAL A CA  1 
ATOM   1433  C  C   . VAL A  1 216 ? 98.015  94.554  80.948  1.00 37.77  ? 193 VAL A C   1 
ATOM   1434  O  O   . VAL A  1 216 ? 98.863  95.421  81.126  1.00 42.57  ? 193 VAL A O   1 
ATOM   1435  C  CB  . VAL A  1 216 ? 96.398  95.223  82.726  1.00 36.83  ? 193 VAL A CB  1 
ATOM   1436  C  CG1 . VAL A  1 216 ? 94.984  95.681  83.036  1.00 30.80  ? 193 VAL A CG1 1 
ATOM   1437  C  CG2 . VAL A  1 216 ? 96.818  94.043  83.626  1.00 29.17  ? 193 VAL A CG2 1 
ATOM   1438  N  N   . GLY A  1 217 ? 98.318  93.325  80.538  1.00 29.49  ? 194 GLY A N   1 
ATOM   1439  C  CA  . GLY A  1 217 ? 99.697  92.943  80.289  1.00 28.34  ? 194 GLY A CA  1 
ATOM   1440  C  C   . GLY A  1 217 ? 100.323 92.228  81.476  1.00 36.45  ? 194 GLY A C   1 
ATOM   1441  O  O   . GLY A  1 217 ? 100.009 92.525  82.628  1.00 30.51  ? 194 GLY A O   1 
ATOM   1442  N  N   . ARG A  1 218 ? 101.227 91.296  81.188  1.00 37.54  ? 195 ARG A N   1 
ATOM   1443  C  CA  . ARG A  1 218 ? 101.761 90.393  82.202  1.00 39.51  ? 195 ARG A CA  1 
ATOM   1444  C  C   . ARG A  1 218 ? 102.814 91.014  83.106  1.00 36.93  ? 195 ARG A C   1 
ATOM   1445  O  O   . ARG A  1 218 ? 103.175 90.447  84.131  1.00 43.24  ? 195 ARG A O   1 
ATOM   1446  C  CB  . ARG A  1 218 ? 102.292 89.116  81.552  1.00 40.60  ? 195 ARG A CB  1 
ATOM   1447  C  CG  . ARG A  1 218 ? 101.225 88.411  80.747  1.00 48.60  ? 195 ARG A CG  1 
ATOM   1448  C  CD  . ARG A  1 218 ? 101.554 86.962  80.507  1.00 59.50  ? 195 ARG A CD  1 
ATOM   1449  N  NE  . ARG A  1 218 ? 100.928 86.096  81.497  1.00 65.63  ? 195 ARG A NE  1 
ATOM   1450  C  CZ  . ARG A  1 218 ? 99.663  85.694  81.437  1.00 59.89  ? 195 ARG A CZ  1 
ATOM   1451  N  NH1 . ARG A  1 218 ? 98.877  86.094  80.441  1.00 52.66  ? 195 ARG A NH1 1 
ATOM   1452  N  NH2 . ARG A  1 218 ? 99.186  84.894  82.376  1.00 53.16  ? 195 ARG A NH2 1 
ATOM   1453  N  N   . ASP A  1 219 ? 103.294 92.189  82.735  1.00 34.25  ? 196 ASP A N   1 
ATOM   1454  C  CA  . ASP A  1 219 ? 104.239 92.902  83.576  1.00 34.98  ? 196 ASP A CA  1 
ATOM   1455  C  C   . ASP A  1 219 ? 103.544 93.438  84.842  1.00 40.20  ? 196 ASP A C   1 
ATOM   1456  O  O   . ASP A  1 219 ? 104.208 93.897  85.785  1.00 39.97  ? 196 ASP A O   1 
ATOM   1457  C  CB  . ASP A  1 219 ? 104.938 94.015  82.781  1.00 39.91  ? 196 ASP A CB  1 
ATOM   1458  C  CG  . ASP A  1 219 ? 103.969 94.838  81.952  1.00 68.78  ? 196 ASP A CG  1 
ATOM   1459  O  OD1 . ASP A  1 219 ? 103.383 94.295  80.985  1.00 73.54  ? 196 ASP A OD1 1 
ATOM   1460  O  OD2 . ASP A  1 219 ? 103.798 96.035  82.263  1.00 81.42  ? 196 ASP A OD2 1 
ATOM   1461  N  N   . THR A  1 220 ? 102.212 93.359  84.869  1.00 28.95  ? 197 THR A N   1 
ATOM   1462  C  CA  . THR A  1 220 ? 101.453 93.878  86.000  1.00 29.24  ? 197 THR A CA  1 
ATOM   1463  C  C   . THR A  1 220 ? 101.447 92.839  87.111  1.00 31.64  ? 197 THR A C   1 
ATOM   1464  O  O   . THR A  1 220 ? 101.155 91.670  86.862  1.00 33.57  ? 197 THR A O   1 
ATOM   1465  C  CB  . THR A  1 220 ? 100.016 94.299  85.599  1.00 30.34  ? 197 THR A CB  1 
ATOM   1466  O  OG1 . THR A  1 220 ? 100.092 95.372  84.658  1.00 43.44  ? 197 THR A OG1 1 
ATOM   1467  C  CG2 . THR A  1 220 ? 99.210  94.796  86.807  1.00 25.62  ? 197 THR A CG2 1 
ATOM   1468  N  N   . ALA A  1 221 ? 101.815 93.260  88.321  1.00 23.95  ? 198 ALA A N   1 
ATOM   1469  C  CA  . ALA A  1 221 ? 101.755 92.377  89.482  1.00 24.07  ? 198 ALA A CA  1 
ATOM   1470  C  C   . ALA A  1 221 ? 100.319 92.165  89.953  1.00 27.54  ? 198 ALA A C   1 
ATOM   1471  O  O   . ALA A  1 221 ? 99.557  93.121  90.089  1.00 30.88  ? 198 ALA A O   1 
ATOM   1472  C  CB  . ALA A  1 221 ? 102.598 92.923  90.610  1.00 20.89  ? 198 ALA A CB  1 
ATOM   1473  N  N   . LEU A  1 222 ? 99.969  90.906  90.203  1.00 28.02  ? 199 LEU A N   1 
ATOM   1474  C  CA  . LEU A  1 222 ? 98.673  90.549  90.766  1.00 31.52  ? 199 LEU A CA  1 
ATOM   1475  C  C   . LEU A  1 222 ? 98.827  89.978  92.178  1.00 32.83  ? 199 LEU A C   1 
ATOM   1476  O  O   . LEU A  1 222 ? 99.444  88.924  92.374  1.00 20.96  ? 199 LEU A O   1 
ATOM   1477  C  CB  . LEU A  1 222 ? 97.962  89.510  89.881  1.00 27.59  ? 199 LEU A CB  1 
ATOM   1478  C  CG  . LEU A  1 222 ? 97.562  89.924  88.469  1.00 29.85  ? 199 LEU A CG  1 
ATOM   1479  C  CD1 . LEU A  1 222 ? 96.637  88.872  87.825  1.00 23.76  ? 199 LEU A CD1 1 
ATOM   1480  C  CD2 . LEU A  1 222 ? 96.891  91.283  88.521  1.00 16.68  ? 199 LEU A CD2 1 
ATOM   1481  N  N   . MET A  1 223 ? 98.260  90.677  93.154  1.00 29.61  ? 200 MET A N   1 
ATOM   1482  C  CA  . MET A  1 223 ? 98.195  90.192  94.516  1.00 23.66  ? 200 MET A CA  1 
ATOM   1483  C  C   . MET A  1 223 ? 96.820  89.572  94.714  1.00 25.34  ? 200 MET A C   1 
ATOM   1484  O  O   . MET A  1 223 ? 95.805  90.270  94.651  1.00 33.50  ? 200 MET A O   1 
ATOM   1485  C  CB  . MET A  1 223 ? 98.377  91.335  95.519  1.00 22.50  ? 200 MET A CB  1 
ATOM   1486  C  CG  . MET A  1 223 ? 99.722  92.030  95.495  1.00 19.47  ? 200 MET A CG  1 
ATOM   1487  S  SD  . MET A  1 223 ? 100.018 92.886  93.930  1.00 24.33  ? 200 MET A SD  1 
ATOM   1488  C  CE  . MET A  1 223 ? 101.199 94.128  94.481  1.00 20.73  ? 200 MET A CE  1 
ATOM   1489  N  N   . VAL A  1 224 ? 96.786  88.264  94.945  1.00 12.19  ? 201 VAL A N   1 
ATOM   1490  C  CA  . VAL A  1 224 ? 95.535  87.555  95.139  1.00 21.91  ? 201 VAL A CA  1 
ATOM   1491  C  C   . VAL A  1 224 ? 95.140  87.471  96.625  1.00 29.03  ? 201 VAL A C   1 
ATOM   1492  O  O   . VAL A  1 224 ? 95.982  87.217  97.492  1.00 27.73  ? 201 VAL A O   1 
ATOM   1493  C  CB  . VAL A  1 224 ? 95.628  86.150  94.541  1.00 31.44  ? 201 VAL A CB  1 
ATOM   1494  C  CG1 . VAL A  1 224 ? 94.570  85.249  95.140  1.00 33.38  ? 201 VAL A CG1 1 
ATOM   1495  C  CG2 . VAL A  1 224 ? 95.509  86.226  93.033  1.00 30.71  ? 201 VAL A CG2 1 
ATOM   1496  N  N   . ASP A  1 225 ? 93.861  87.684  96.915  1.00 26.09  ? 202 ASP A N   1 
ATOM   1497  C  CA  . ASP A  1 225 ? 93.388  87.668  98.294  1.00 23.69  ? 202 ASP A CA  1 
ATOM   1498  C  C   . ASP A  1 225 ? 92.150  86.791  98.463  1.00 24.43  ? 202 ASP A C   1 
ATOM   1499  O  O   . ASP A  1 225 ? 91.132  87.028  97.813  1.00 23.97  ? 202 ASP A O   1 
ATOM   1500  C  CB  . ASP A  1 225 ? 93.084  89.090  98.764  1.00 23.37  ? 202 ASP A CB  1 
ATOM   1501  C  CG  . ASP A  1 225 ? 92.886  89.175  100.260 1.00 28.31  ? 202 ASP A CG  1 
ATOM   1502  O  OD1 . ASP A  1 225 ? 92.748  88.111  100.907 1.00 26.70  ? 202 ASP A OD1 1 
ATOM   1503  O  OD2 . ASP A  1 225 ? 92.867  90.305  100.789 1.00 26.82  ? 202 ASP A OD2 1 
ATOM   1504  N  N   . PHE A  1 226 ? 92.242  85.790  99.344  1.00 23.88  ? 203 PHE A N   1 
ATOM   1505  C  CA  . PHE A  1 226 ? 91.143  84.854  99.594  1.00 18.42  ? 203 PHE A CA  1 
ATOM   1506  C  C   . PHE A  1 226 ? 90.256  85.284  100.764 1.00 22.49  ? 203 PHE A C   1 
ATOM   1507  O  O   . PHE A  1 226 ? 89.208  84.698  101.000 1.00 21.36  ? 203 PHE A O   1 
ATOM   1508  C  CB  . PHE A  1 226 ? 91.663  83.437  99.857  1.00 19.43  ? 203 PHE A CB  1 
ATOM   1509  C  CG  . PHE A  1 226 ? 92.052  82.683  98.617  1.00 23.36  ? 203 PHE A CG  1 
ATOM   1510  C  CD1 . PHE A  1 226 ? 91.089  82.081  97.825  1.00 23.10  ? 203 PHE A CD1 1 
ATOM   1511  C  CD2 . PHE A  1 226 ? 93.382  82.564  98.254  1.00 28.99  ? 203 PHE A CD2 1 
ATOM   1512  C  CE1 . PHE A  1 226 ? 91.443  81.391  96.687  1.00 27.84  ? 203 PHE A CE1 1 
ATOM   1513  C  CE2 . PHE A  1 226 ? 93.747  81.870  97.114  1.00 32.34  ? 203 PHE A CE2 1 
ATOM   1514  C  CZ  . PHE A  1 226 ? 92.778  81.285  96.329  1.00 30.34  ? 203 PHE A CZ  1 
ATOM   1515  N  N   . ASN A  1 227 ? 90.688  86.296  101.504 1.00 29.64  ? 204 ASN A N   1 
ATOM   1516  C  CA  . ASN A  1 227 ? 89.918  86.806  102.638 1.00 30.08  ? 204 ASN A CA  1 
ATOM   1517  C  C   . ASN A  1 227 ? 89.474  85.732  103.633 1.00 26.63  ? 204 ASN A C   1 
ATOM   1518  O  O   . ASN A  1 227 ? 88.348  85.762  104.116 1.00 24.25  ? 204 ASN A O   1 
ATOM   1519  C  CB  . ASN A  1 227 ? 88.705  87.619  102.147 1.00 29.95  ? 204 ASN A CB  1 
ATOM   1520  C  CG  . ASN A  1 227 ? 89.091  89.016  101.660 1.00 37.61  ? 204 ASN A CG  1 
ATOM   1521  O  OD1 . ASN A  1 227 ? 89.356  89.912  102.459 1.00 47.87  ? 204 ASN A OD1 1 
ATOM   1522  N  ND2 . ASN A  1 227 ? 89.108  89.206  100.351 1.00 36.55  ? 204 ASN A ND2 1 
ATOM   1523  N  N   . GLN A  1 228 ? 90.349  84.775  103.928 1.00 25.24  ? 205 GLN A N   1 
ATOM   1524  C  CA  . GLN A  1 228 ? 90.053  83.765  104.943 1.00 22.14  ? 205 GLN A CA  1 
ATOM   1525  C  C   . GLN A  1 228 ? 88.899  82.867  104.516 1.00 28.83  ? 205 GLN A C   1 
ATOM   1526  O  O   . GLN A  1 228 ? 88.330  82.142  105.331 1.00 23.86  ? 205 GLN A O   1 
ATOM   1527  C  CB  . GLN A  1 228 ? 89.701  84.435  106.283 1.00 20.06  ? 205 GLN A CB  1 
ATOM   1528  C  CG  . GLN A  1 228 ? 90.782  85.364  106.797 1.00 22.34  ? 205 GLN A CG  1 
ATOM   1529  C  CD  . GLN A  1 228 ? 90.473  85.977  108.157 1.00 29.27  ? 205 GLN A CD  1 
ATOM   1530  O  OE1 . GLN A  1 228 ? 90.505  85.299  109.189 1.00 28.35  ? 205 GLN A OE1 1 
ATOM   1531  N  NE2 . GLN A  1 228 ? 90.194  87.276  108.163 1.00 19.15  ? 205 GLN A NE2 1 
ATOM   1532  N  N   . GLY A  1 229 ? 88.552  82.897  103.235 1.00 26.93  ? 206 GLY A N   1 
ATOM   1533  C  CA  . GLY A  1 229 ? 87.385  82.154  102.775 1.00 21.70  ? 206 GLY A CA  1 
ATOM   1534  C  C   . GLY A  1 229 ? 87.472  80.636  102.801 1.00 26.51  ? 206 GLY A C   1 
ATOM   1535  O  O   . GLY A  1 229 ? 86.455  79.953  102.713 1.00 32.72  ? 206 GLY A O   1 
ATOM   1536  N  N   . LEU A  1 230 ? 88.678  80.097  102.912 1.00 25.70  ? 207 LEU A N   1 
ATOM   1537  C  CA  . LEU A  1 230 ? 88.862  78.664  102.753 1.00 16.12  ? 207 LEU A CA  1 
ATOM   1538  C  C   . LEU A  1 230 ? 89.157  77.973  104.070 1.00 25.74  ? 207 LEU A C   1 
ATOM   1539  O  O   . LEU A  1 230 ? 89.720  78.577  104.976 1.00 34.03  ? 207 LEU A O   1 
ATOM   1540  C  CB  . LEU A  1 230 ? 90.016  78.395  101.786 1.00 20.76  ? 207 LEU A CB  1 
ATOM   1541  C  CG  . LEU A  1 230 ? 90.011  79.188  100.490 1.00 25.46  ? 207 LEU A CG  1 
ATOM   1542  C  CD1 . LEU A  1 230 ? 91.250  78.835  99.688  1.00 23.51  ? 207 LEU A CD1 1 
ATOM   1543  C  CD2 . LEU A  1 230 ? 88.742  78.882  99.701  1.00 25.91  ? 207 LEU A CD2 1 
ATOM   1544  N  N   . ASP A  1 231 ? 88.774  76.702  104.170 1.00 27.57  ? 208 ASP A N   1 
ATOM   1545  C  CA  . ASP A  1 231 ? 89.241  75.853  105.257 1.00 22.62  ? 208 ASP A CA  1 
ATOM   1546  C  C   . ASP A  1 231 ? 90.539  75.220  104.778 1.00 23.73  ? 208 ASP A C   1 
ATOM   1547  O  O   . ASP A  1 231 ? 90.906  75.385  103.618 1.00 29.98  ? 208 ASP A O   1 
ATOM   1548  C  CB  . ASP A  1 231 ? 88.193  74.810  105.671 1.00 35.06  ? 208 ASP A CB  1 
ATOM   1549  C  CG  . ASP A  1 231 ? 87.970  73.714  104.618 1.00 46.80  ? 208 ASP A CG  1 
ATOM   1550  O  OD1 . ASP A  1 231 ? 88.942  73.269  103.965 1.00 44.46  ? 208 ASP A OD1 1 
ATOM   1551  O  OD2 . ASP A  1 231 ? 86.803  73.281  104.466 1.00 51.85  ? 208 ASP A OD2 1 
ATOM   1552  N  N   . MET A  1 232 ? 91.253  74.524  105.657 1.00 22.16  ? 209 MET A N   1 
ATOM   1553  C  CA  . MET A  1 232 ? 92.593  74.074  105.309 1.00 20.61  ? 209 MET A CA  1 
ATOM   1554  C  C   . MET A  1 232 ? 92.643  73.164  104.085 1.00 27.29  ? 209 MET A C   1 
ATOM   1555  O  O   . MET A  1 232 ? 93.583  73.236  103.295 1.00 33.22  ? 209 MET A O   1 
ATOM   1556  C  CB  . MET A  1 232 ? 93.287  73.411  106.508 1.00 20.41  ? 209 MET A CB  1 
ATOM   1557  C  CG  . MET A  1 232 ? 94.229  74.366  107.240 1.00 30.99  ? 209 MET A CG  1 
ATOM   1558  S  SD  . MET A  1 232 ? 95.532  75.073  106.180 1.00 28.18  ? 209 MET A SD  1 
ATOM   1559  C  CE  . MET A  1 232 ? 96.695  73.714  106.123 1.00 24.74  ? 209 MET A CE  1 
ATOM   1560  N  N   . ALA A  1 233 ? 91.646  72.296  103.939 1.00 30.78  ? 210 ALA A N   1 
ATOM   1561  C  CA  . ALA A  1 233 ? 91.603  71.355  102.811 1.00 26.67  ? 210 ALA A CA  1 
ATOM   1562  C  C   . ALA A  1 233 ? 91.418  72.081  101.490 1.00 22.56  ? 210 ALA A C   1 
ATOM   1563  O  O   . ALA A  1 233 ? 92.135  71.823  100.536 1.00 27.79  ? 210 ALA A O   1 
ATOM   1564  C  CB  . ALA A  1 233 ? 90.495  70.333  103.008 1.00 29.07  ? 210 ALA A CB  1 
ATOM   1565  N  N   . GLU A  1 234 ? 90.448  72.986  101.451 1.00 16.10  ? 211 GLU A N   1 
ATOM   1566  C  CA  . GLU A  1 234 ? 90.249  73.869  100.313 1.00 22.98  ? 211 GLU A CA  1 
ATOM   1567  C  C   . GLU A  1 234 ? 91.501  74.709  100.026 1.00 27.62  ? 211 GLU A C   1 
ATOM   1568  O  O   . GLU A  1 234 ? 91.881  74.900  98.872  1.00 30.50  ? 211 GLU A O   1 
ATOM   1569  C  CB  . GLU A  1 234 ? 89.042  74.786  100.560 1.00 27.90  ? 211 GLU A CB  1 
ATOM   1570  C  CG  . GLU A  1 234 ? 87.693  74.071  100.604 1.00 39.83  ? 211 GLU A CG  1 
ATOM   1571  C  CD  . GLU A  1 234 ? 86.590  74.936  101.215 1.00 57.02  ? 211 GLU A CD  1 
ATOM   1572  O  OE1 . GLU A  1 234 ? 86.892  75.713  102.150 1.00 55.81  ? 211 GLU A OE1 1 
ATOM   1573  O  OE2 . GLU A  1 234 ? 85.423  74.843  100.762 1.00 65.09  ? 211 GLU A OE2 1 
ATOM   1574  N  N   . ALA A  1 235 ? 92.134  75.211  101.081 1.00 21.89  ? 212 ALA A N   1 
ATOM   1575  C  CA  . ALA A  1 235 ? 93.327  76.031  100.939 1.00 19.04  ? 212 ALA A CA  1 
ATOM   1576  C  C   . ALA A  1 235 ? 94.454  75.267  100.256 1.00 27.87  ? 212 ALA A C   1 
ATOM   1577  O  O   . ALA A  1 235 ? 95.167  75.823  99.417  1.00 25.78  ? 212 ALA A O   1 
ATOM   1578  C  CB  . ALA A  1 235 ? 93.794  76.522  102.301 1.00 17.36  ? 212 ALA A CB  1 
ATOM   1579  N  N   . MET A  1 236 ? 94.623  74.002  100.633 1.00 22.78  ? 213 MET A N   1 
ATOM   1580  C  CA  . MET A  1 236 ? 95.689  73.170  100.068 1.00 23.04  ? 213 MET A CA  1 
ATOM   1581  C  C   . MET A  1 236 ? 95.491  72.913  98.580  1.00 30.15  ? 213 MET A C   1 
ATOM   1582  O  O   . MET A  1 236 ? 96.412  73.112  97.790  1.00 37.00  ? 213 MET A O   1 
ATOM   1583  C  CB  . MET A  1 236 ? 95.800  71.839  100.820 1.00 22.10  ? 213 MET A CB  1 
ATOM   1584  C  CG  . MET A  1 236 ? 96.427  71.967  102.206 1.00 24.03  ? 213 MET A CG  1 
ATOM   1585  S  SD  . MET A  1 236 ? 96.396  70.435  103.182 1.00 37.50  ? 213 MET A SD  1 
ATOM   1586  C  CE  . MET A  1 236 ? 97.718  69.512  102.378 1.00 41.58  ? 213 MET A CE  1 
ATOM   1587  N  N   . HIS A  1 237 ? 94.291  72.473  98.200  1.00 30.38  ? 214 HIS A N   1 
ATOM   1588  C  CA  . HIS A  1 237 ? 93.985  72.223  96.789  1.00 29.96  ? 214 HIS A CA  1 
ATOM   1589  C  C   . HIS A  1 237 ? 94.059  73.505  95.966  1.00 26.04  ? 214 HIS A C   1 
ATOM   1590  O  O   . HIS A  1 237 ? 94.679  73.535  94.916  1.00 26.99  ? 214 HIS A O   1 
ATOM   1591  C  CB  . HIS A  1 237 ? 92.608  71.572  96.611  1.00 24.22  ? 214 HIS A CB  1 
ATOM   1592  C  CG  . HIS A  1 237 ? 92.523  70.180  97.156  1.00 33.90  ? 214 HIS A CG  1 
ATOM   1593  N  ND1 . HIS A  1 237 ? 91.788  69.865  98.279  1.00 34.32  ? 214 HIS A ND1 1 
ATOM   1594  C  CD2 . HIS A  1 237 ? 93.089  69.022  96.737  1.00 33.32  ? 214 HIS A CD2 1 
ATOM   1595  C  CE1 . HIS A  1 237 ? 91.916  68.576  98.538  1.00 33.41  ? 214 HIS A CE1 1 
ATOM   1596  N  NE2 . HIS A  1 237 ? 92.702  68.042  97.619  1.00 36.45  ? 214 HIS A NE2 1 
ATOM   1597  N  N   . ARG A  1 238 ? 93.421  74.559  96.460  1.00 22.95  ? 215 ARG A N   1 
ATOM   1598  C  CA  . ARG A  1 238 ? 93.300  75.788  95.707  1.00 29.10  ? 215 ARG A CA  1 
ATOM   1599  C  C   . ARG A  1 238 ? 94.585  76.628  95.592  1.00 31.30  ? 215 ARG A C   1 
ATOM   1600  O  O   . ARG A  1 238 ? 94.865  77.199  94.543  1.00 27.42  ? 215 ARG A O   1 
ATOM   1601  C  CB  . ARG A  1 238 ? 92.185  76.631  96.291  1.00 28.58  ? 215 ARG A CB  1 
ATOM   1602  C  CG  . ARG A  1 238 ? 90.790  76.119  96.011  1.00 31.77  ? 215 ARG A CG  1 
ATOM   1603  C  CD  . ARG A  1 238 ? 89.834  77.094  96.647  1.00 39.72  ? 215 ARG A CD  1 
ATOM   1604  N  NE  . ARG A  1 238 ? 88.432  76.812  96.397  1.00 45.44  ? 215 ARG A NE  1 
ATOM   1605  C  CZ  . ARG A  1 238 ? 87.626  77.627  95.733  1.00 45.47  ? 215 ARG A CZ  1 
ATOM   1606  N  NH1 . ARG A  1 238 ? 88.101  78.765  95.237  1.00 33.32  ? 215 ARG A NH1 1 
ATOM   1607  N  NH2 . ARG A  1 238 ? 86.352  77.299  95.564  1.00 48.70  ? 215 ARG A NH2 1 
ATOM   1608  N  N   . THR A  1 239 ? 95.366  76.728  96.658  1.00 26.11  ? 216 THR A N   1 
ATOM   1609  C  CA  . THR A  1 239 ? 96.570  77.526  96.549  1.00 20.70  ? 216 THR A CA  1 
ATOM   1610  C  C   . THR A  1 239 ? 97.558  76.763  95.668  1.00 21.34  ? 216 THR A C   1 
ATOM   1611  O  O   . THR A  1 239 ? 98.370  77.355  94.970  1.00 18.89  ? 216 THR A O   1 
ATOM   1612  C  CB  . THR A  1 239 ? 97.172  77.921  97.941  1.00 27.00  ? 216 THR A CB  1 
ATOM   1613  O  OG1 . THR A  1 239 ? 97.524  76.747  98.681  1.00 20.58  ? 216 THR A OG1 1 
ATOM   1614  C  CG2 . THR A  1 239 ? 96.172  78.732  98.747  1.00 30.32  ? 216 THR A CG2 1 
ATOM   1615  N  N   . ARG A  1 240 ? 97.468  75.440  95.680  1.00 21.48  ? 217 ARG A N   1 
ATOM   1616  C  CA  . ARG A  1 240 ? 98.371  74.649  94.858  1.00 26.12  ? 217 ARG A CA  1 
ATOM   1617  C  C   . ARG A  1 240 ? 98.079  74.872  93.385  1.00 32.49  ? 217 ARG A C   1 
ATOM   1618  O  O   . ARG A  1 240 ? 99.006  74.980  92.581  1.00 34.84  ? 217 ARG A O   1 
ATOM   1619  C  CB  . ARG A  1 240 ? 98.270  73.168  95.203  1.00 30.01  ? 217 ARG A CB  1 
ATOM   1620  C  CG  . ARG A  1 240 ? 99.106  72.260  94.320  1.00 21.23  ? 217 ARG A CG  1 
ATOM   1621  C  CD  . ARG A  1 240 ? 98.742  70.784  94.567  1.00 21.22  ? 217 ARG A CD  1 
ATOM   1622  N  NE  . ARG A  1 240 ? 99.613  69.893  93.797  1.00 27.93  ? 217 ARG A NE  1 
ATOM   1623  C  CZ  . ARG A  1 240 ? 99.611  68.566  93.879  1.00 28.59  ? 217 ARG A CZ  1 
ATOM   1624  N  NH1 . ARG A  1 240 ? 98.772  67.933  94.706  1.00 21.48  ? 217 ARG A NH1 1 
ATOM   1625  N  NH2 . ARG A  1 240 ? 100.463 67.869  93.135  1.00 25.63  ? 217 ARG A NH2 1 
ATOM   1626  N  N   . GLN A  1 241 ? 96.796  74.969  93.035  1.00 23.77  ? 218 GLN A N   1 
ATOM   1627  C  CA  . GLN A  1 241 ? 96.405  75.219  91.643  1.00 28.33  ? 218 GLN A CA  1 
ATOM   1628  C  C   . GLN A  1 241 ? 96.957  76.513  91.072  1.00 30.53  ? 218 GLN A C   1 
ATOM   1629  O  O   . GLN A  1 241 ? 97.157  76.617  89.860  1.00 36.30  ? 218 GLN A O   1 
ATOM   1630  C  CB  . GLN A  1 241 ? 94.894  75.287  91.489  1.00 31.47  ? 218 GLN A CB  1 
ATOM   1631  C  CG  . GLN A  1 241 ? 94.166  73.984  91.595  1.00 44.45  ? 218 GLN A CG  1 
ATOM   1632  C  CD  . GLN A  1 241 ? 92.681  74.176  91.347  1.00 58.34  ? 218 GLN A CD  1 
ATOM   1633  O  OE1 . GLN A  1 241 ? 92.275  74.638  90.277  1.00 63.66  ? 218 GLN A OE1 1 
ATOM   1634  N  NE2 . GLN A  1 241 ? 91.866  73.847  92.341  1.00 57.00  ? 218 GLN A NE2 1 
ATOM   1635  N  N   . ILE A  1 242 ? 97.154  77.514  91.926  1.00 27.66  ? 219 ILE A N   1 
ATOM   1636  C  CA  . ILE A  1 242 ? 97.587  78.829  91.445  1.00 29.54  ? 219 ILE A CA  1 
ATOM   1637  C  C   . ILE A  1 242 ? 99.049  79.152  91.740  1.00 23.23  ? 219 ILE A C   1 
ATOM   1638  O  O   . ILE A  1 242 ? 99.516  80.249  91.431  1.00 27.29  ? 219 ILE A O   1 
ATOM   1639  C  CB  . ILE A  1 242 ? 96.695  79.961  91.991  1.00 34.98  ? 219 ILE A CB  1 
ATOM   1640  C  CG1 . ILE A  1 242 ? 96.720  79.969  93.521  1.00 36.44  ? 219 ILE A CG1 1 
ATOM   1641  C  CG2 . ILE A  1 242 ? 95.260  79.804  91.486  1.00 24.21  ? 219 ILE A CG2 1 
ATOM   1642  C  CD1 . ILE A  1 242 ? 96.009  81.155  94.120  1.00 34.17  ? 219 ILE A CD1 1 
ATOM   1643  N  N   . ASP A  1 243 ? 99.771  78.192  92.318  1.00 27.57  ? 220 ASP A N   1 
ATOM   1644  C  CA  . ASP A  1 243 ? 101.163 78.399  92.718  1.00 27.33  ? 220 ASP A CA  1 
ATOM   1645  C  C   . ASP A  1 243 ? 102.114 78.637  91.542  1.00 33.90  ? 220 ASP A C   1 
ATOM   1646  O  O   . ASP A  1 243 ? 103.178 79.234  91.717  1.00 28.84  ? 220 ASP A O   1 
ATOM   1647  C  CB  . ASP A  1 243 ? 101.670 77.220  93.554  1.00 22.33  ? 220 ASP A CB  1 
ATOM   1648  C  CG  . ASP A  1 243 ? 102.931 77.563  94.349  1.00 34.29  ? 220 ASP A CG  1 
ATOM   1649  O  OD1 . ASP A  1 243 ? 103.042 78.728  94.786  1.00 34.37  ? 220 ASP A OD1 1 
ATOM   1650  O  OD2 . ASP A  1 243 ? 103.814 76.680  94.531  1.00 30.26  ? 220 ASP A OD2 1 
ATOM   1651  N  N   . ASP A  1 244 ? 101.741 78.163  90.352  1.00 31.64  ? 221 ASP A N   1 
ATOM   1652  C  CA  . ASP A  1 244 ? 102.579 78.343  89.162  1.00 33.13  ? 221 ASP A CA  1 
ATOM   1653  C  C   . ASP A  1 244 ? 102.048 79.388  88.176  1.00 33.55  ? 221 ASP A C   1 
ATOM   1654  O  O   . ASP A  1 244 ? 102.509 79.461  87.044  1.00 36.36  ? 221 ASP A O   1 
ATOM   1655  C  CB  . ASP A  1 244 ? 102.802 77.008  88.453  1.00 37.62  ? 221 ASP A CB  1 
ATOM   1656  C  CG  . ASP A  1 244 ? 103.655 76.045  89.277  1.00 55.98  ? 221 ASP A CG  1 
ATOM   1657  O  OD1 . ASP A  1 244 ? 104.719 76.469  89.784  1.00 63.07  ? 221 ASP A OD1 1 
ATOM   1658  O  OD2 . ASP A  1 244 ? 103.259 74.866  89.423  1.00 54.56  ? 221 ASP A OD2 1 
ATOM   1659  N  N   . LEU A  1 245 ? 101.085 80.191  88.616  1.00 26.80  ? 222 LEU A N   1 
ATOM   1660  C  CA  . LEU A  1 245 ? 100.533 81.267  87.803  1.00 26.15  ? 222 LEU A CA  1 
ATOM   1661  C  C   . LEU A  1 245 ? 101.417 82.501  87.667  1.00 28.97  ? 222 LEU A C   1 
ATOM   1662  O  O   . LEU A  1 245 ? 101.233 83.279  86.741  1.00 33.56  ? 222 LEU A O   1 
ATOM   1663  C  CB  . LEU A  1 245 ? 99.214  81.740  88.391  1.00 24.95  ? 222 LEU A CB  1 
ATOM   1664  C  CG  . LEU A  1 245 ? 97.942  80.963  88.125  1.00 35.35  ? 222 LEU A CG  1 
ATOM   1665  C  CD1 . LEU A  1 245 ? 96.791  81.889  88.463  1.00 34.67  ? 222 LEU A CD1 1 
ATOM   1666  C  CD2 . LEU A  1 245 ? 97.901  80.546  86.666  1.00 43.73  ? 222 LEU A CD2 1 
ATOM   1667  N  N   . GLY A  1 246 ? 102.334 82.710  88.613  1.00 31.85  ? 223 GLY A N   1 
ATOM   1668  C  CA  . GLY A  1 246 ? 103.142 83.925  88.645  1.00 26.05  ? 223 GLY A CA  1 
ATOM   1669  C  C   . GLY A  1 246 ? 102.534 85.088  89.433  1.00 29.52  ? 223 GLY A C   1 
ATOM   1670  O  O   . GLY A  1 246 ? 102.741 86.253  89.093  1.00 23.30  ? 223 GLY A O   1 
ATOM   1671  N  N   . LEU A  1 247 ? 101.768 84.784  90.478  1.00 24.67  ? 224 LEU A N   1 
ATOM   1672  C  CA  . LEU A  1 247 ? 101.201 85.837  91.326  1.00 22.39  ? 224 LEU A CA  1 
ATOM   1673  C  C   . LEU A  1 247 ? 102.284 86.533  92.152  1.00 15.98  ? 224 LEU A C   1 
ATOM   1674  O  O   . LEU A  1 247 ? 103.296 85.929  92.505  1.00 21.85  ? 224 LEU A O   1 
ATOM   1675  C  CB  . LEU A  1 247 ? 100.143 85.233  92.249  1.00 14.54  ? 224 LEU A CB  1 
ATOM   1676  C  CG  . LEU A  1 247 ? 99.115  84.434  91.447  1.00 19.61  ? 224 LEU A CG  1 
ATOM   1677  C  CD1 . LEU A  1 247 ? 98.201  83.630  92.342  1.00 20.11  ? 224 LEU A CD1 1 
ATOM   1678  C  CD2 . LEU A  1 247 ? 98.318  85.379  90.555  1.00 17.30  ? 224 LEU A CD2 1 
ATOM   1679  N  N   . GLU A  1 248 ? 102.080 87.805  92.455  1.00 24.18  ? 225 GLU A N   1 
ATOM   1680  C  CA  . GLU A  1 248 ? 102.989 88.535  93.326  1.00 17.28  ? 225 GLU A CA  1 
ATOM   1681  C  C   . GLU A  1 248 ? 102.933 87.896  94.717  1.00 23.50  ? 225 GLU A C   1 
ATOM   1682  O  O   . GLU A  1 248 ? 103.950 87.701  95.358  1.00 29.18  ? 225 GLU A O   1 
ATOM   1683  C  CB  . GLU A  1 248 ? 102.593 90.009  93.390  1.00 18.47  ? 225 GLU A CB  1 
ATOM   1684  C  CG  . GLU A  1 248 ? 103.449 90.881  94.317  1.00 17.16  ? 225 GLU A CG  1 
ATOM   1685  C  CD  . GLU A  1 248 ? 104.855 91.106  93.796  1.00 25.07  ? 225 GLU A CD  1 
ATOM   1686  O  OE1 . GLU A  1 248 ? 105.093 90.828  92.603  1.00 30.96  ? 225 GLU A OE1 1 
ATOM   1687  O  OE2 . GLU A  1 248 ? 105.730 91.566  94.581  1.00 31.52  ? 225 GLU A OE2 1 
ATOM   1688  N  N   . TRP A  1 249 ? 101.735 87.557  95.178  1.00 25.26  ? 226 TRP A N   1 
ATOM   1689  C  CA  . TRP A  1 249 ? 101.596 86.831  96.438  1.00 17.62  ? 226 TRP A CA  1 
ATOM   1690  C  C   . TRP A  1 249 ? 100.190 86.258  96.641  1.00 21.43  ? 226 TRP A C   1 
ATOM   1691  O  O   . TRP A  1 249 ? 99.244  86.628  95.947  1.00 24.72  ? 226 TRP A O   1 
ATOM   1692  C  CB  . TRP A  1 249 ? 102.008 87.706  97.625  1.00 13.09  ? 226 TRP A CB  1 
ATOM   1693  C  CG  . TRP A  1 249 ? 101.006 88.737  98.026  1.00 18.62  ? 226 TRP A CG  1 
ATOM   1694  C  CD1 . TRP A  1 249 ? 99.697  88.530  98.348  1.00 17.88  ? 226 TRP A CD1 1 
ATOM   1695  C  CD2 . TRP A  1 249 ? 101.242 90.139  98.185  1.00 15.75  ? 226 TRP A CD2 1 
ATOM   1696  N  NE1 . TRP A  1 249 ? 99.097  89.723  98.692  1.00 22.74  ? 226 TRP A NE1 1 
ATOM   1697  C  CE2 . TRP A  1 249 ? 100.029 90.723  98.609  1.00 18.24  ? 226 TRP A CE2 1 
ATOM   1698  C  CE3 . TRP A  1 249 ? 102.370 90.960  98.025  1.00 16.36  ? 226 TRP A CE3 1 
ATOM   1699  C  CZ2 . TRP A  1 249 ? 99.904  92.089  98.861  1.00 20.66  ? 226 TRP A CZ2 1 
ATOM   1700  C  CZ3 . TRP A  1 249 ? 102.245 92.313  98.276  1.00 17.67  ? 226 TRP A CZ3 1 
ATOM   1701  C  CH2 . TRP A  1 249 ? 101.016 92.865  98.690  1.00 22.72  ? 226 TRP A CH2 1 
ATOM   1702  N  N   . ILE A  1 250 ? 100.076 85.330  97.580  1.00 21.85  ? 227 ILE A N   1 
ATOM   1703  C  CA  . ILE A  1 250 ? 98.795  84.756  97.958  1.00 21.19  ? 227 ILE A CA  1 
ATOM   1704  C  C   . ILE A  1 250 ? 98.481  85.162  99.405  1.00 22.83  ? 227 ILE A C   1 
ATOM   1705  O  O   . ILE A  1 250 ? 99.249  84.872  100.328 1.00 24.11  ? 227 ILE A O   1 
ATOM   1706  C  CB  . ILE A  1 250 ? 98.818  83.222  97.799  1.00 24.28  ? 227 ILE A CB  1 
ATOM   1707  C  CG1 . ILE A  1 250 ? 98.959  82.851  96.317  1.00 20.53  ? 227 ILE A CG1 1 
ATOM   1708  C  CG2 . ILE A  1 250 ? 97.567  82.595  98.389  1.00 16.31  ? 227 ILE A CG2 1 
ATOM   1709  C  CD1 . ILE A  1 250 ? 99.454  81.421  96.081  1.00 14.32  ? 227 ILE A CD1 1 
ATOM   1710  N  N   . GLU A  1 251 ? 97.355  85.847  99.590  1.00 17.70  ? 228 GLU A N   1 
ATOM   1711  C  CA  . GLU A  1 251 ? 97.014  86.470  100.866 1.00 20.33  ? 228 GLU A CA  1 
ATOM   1712  C  C   . GLU A  1 251 ? 95.877  85.758  101.633 1.00 22.47  ? 228 GLU A C   1 
ATOM   1713  O  O   . GLU A  1 251 ? 94.871  85.352  101.038 1.00 25.47  ? 228 GLU A O   1 
ATOM   1714  C  CB  . GLU A  1 251 ? 96.656  87.934  100.610 1.00 18.05  ? 228 GLU A CB  1 
ATOM   1715  C  CG  . GLU A  1 251 ? 96.373  88.782  101.837 1.00 17.04  ? 228 GLU A CG  1 
ATOM   1716  C  CD  . GLU A  1 251 ? 96.079  90.230  101.463 1.00 28.23  ? 228 GLU A CD  1 
ATOM   1717  O  OE1 . GLU A  1 251 ? 96.708  90.746  100.505 1.00 23.52  ? 228 GLU A OE1 1 
ATOM   1718  O  OE2 . GLU A  1 251 ? 95.212  90.844  102.115 1.00 35.43  ? 228 GLU A OE2 1 
ATOM   1719  N  N   . GLU A  1 252 ? 96.066  85.626  102.952 1.00 33.62  ? 229 GLU A N   1 
ATOM   1720  C  CA  . GLU A  1 252 ? 95.119  85.013  103.924 1.00 27.20  ? 229 GLU A CA  1 
ATOM   1721  C  C   . GLU A  1 252 ? 94.138  84.002  103.369 1.00 23.86  ? 229 GLU A C   1 
ATOM   1722  O  O   . GLU A  1 252 ? 92.950  84.285  103.298 1.00 27.87  ? 229 GLU A O   1 
ATOM   1723  C  CB  . GLU A  1 252 ? 94.313  86.090  104.673 1.00 27.05  ? 229 GLU A CB  1 
ATOM   1724  C  CG  . GLU A  1 252 ? 95.150  87.058  105.511 1.00 32.31  ? 229 GLU A CG  1 
ATOM   1725  C  CD  . GLU A  1 252 ? 94.308  87.871  106.488 1.00 45.10  ? 229 GLU A CD  1 
ATOM   1726  O  OE1 . GLU A  1 252 ? 93.334  88.534  106.055 1.00 55.68  ? 229 GLU A OE1 1 
ATOM   1727  O  OE2 . GLU A  1 252 ? 94.622  87.840  107.699 1.00 34.78  ? 229 GLU A OE2 1 
ATOM   1728  N  N   . PRO A  1 253 ? 94.619  82.821  102.968 1.00 30.28  ? 230 PRO A N   1 
ATOM   1729  C  CA  . PRO A  1 253 ? 93.635  81.853  102.477 1.00 28.43  ? 230 PRO A CA  1 
ATOM   1730  C  C   . PRO A  1 253 ? 92.755  81.254  103.584 1.00 25.45  ? 230 PRO A C   1 
ATOM   1731  O  O   . PRO A  1 253 ? 91.642  80.859  103.271 1.00 30.99  ? 230 PRO A O   1 
ATOM   1732  C  CB  . PRO A  1 253 ? 94.506  80.773  101.827 1.00 28.08  ? 230 PRO A CB  1 
ATOM   1733  C  CG  . PRO A  1 253 ? 95.845  80.924  102.460 1.00 26.23  ? 230 PRO A CG  1 
ATOM   1734  C  CD  . PRO A  1 253 ? 96.002  82.381  102.723 1.00 23.61  ? 230 PRO A CD  1 
ATOM   1735  N  N   . VAL A  1 254 ? 93.233  81.161  104.827 1.00 23.31  ? 231 VAL A N   1 
ATOM   1736  C  CA  . VAL A  1 254 ? 92.418  80.578  105.901 1.00 21.90  ? 231 VAL A CA  1 
ATOM   1737  C  C   . VAL A  1 254 ? 92.238  81.545  107.063 1.00 25.43  ? 231 VAL A C   1 
ATOM   1738  O  O   . VAL A  1 254 ? 92.762  82.646  107.041 1.00 23.78  ? 231 VAL A O   1 
ATOM   1739  C  CB  . VAL A  1 254 ? 92.969  79.229  106.433 1.00 24.03  ? 231 VAL A CB  1 
ATOM   1740  C  CG1 . VAL A  1 254 ? 93.127  78.218  105.297 1.00 26.69  ? 231 VAL A CG1 1 
ATOM   1741  C  CG2 . VAL A  1 254 ? 94.285  79.425  107.221 1.00 16.03  ? 231 VAL A CG2 1 
ATOM   1742  N  N   . VAL A  1 255 ? 91.482  81.133  108.072 1.00 25.94  ? 232 VAL A N   1 
ATOM   1743  C  CA  . VAL A  1 255 ? 91.219  82.006  109.206 1.00 25.82  ? 232 VAL A CA  1 
ATOM   1744  C  C   . VAL A  1 255 ? 92.532  82.535  109.820 1.00 20.82  ? 232 VAL A C   1 
ATOM   1745  O  O   . VAL A  1 255 ? 93.515  81.808  109.993 1.00 27.23  ? 232 VAL A O   1 
ATOM   1746  C  CB  . VAL A  1 255 ? 90.304  81.321  110.259 1.00 28.24  ? 232 VAL A CB  1 
ATOM   1747  C  CG1 . VAL A  1 255 ? 90.978  80.100  110.840 1.00 20.07  ? 232 VAL A CG1 1 
ATOM   1748  C  CG2 . VAL A  1 255 ? 89.954  82.289  111.347 1.00 35.27  ? 232 VAL A CG2 1 
ATOM   1749  N  N   . TYR A  1 256 ? 92.549  83.819  110.125 1.00 19.26  ? 233 TYR A N   1 
ATOM   1750  C  CA  . TYR A  1 256 ? 93.805  84.511  110.380 1.00 25.58  ? 233 TYR A CA  1 
ATOM   1751  C  C   . TYR A  1 256 ? 94.648  83.998  111.552 1.00 30.10  ? 233 TYR A C   1 
ATOM   1752  O  O   . TYR A  1 256 ? 95.857  84.233  111.575 1.00 24.21  ? 233 TYR A O   1 
ATOM   1753  C  CB  . TYR A  1 256 ? 93.582  86.017  110.503 1.00 29.08  ? 233 TYR A CB  1 
ATOM   1754  C  CG  . TYR A  1 256 ? 92.954  86.489  111.802 1.00 29.47  ? 233 TYR A CG  1 
ATOM   1755  C  CD1 . TYR A  1 256 ? 93.662  86.436  113.011 1.00 25.48  ? 233 TYR A CD1 1 
ATOM   1756  C  CD2 . TYR A  1 256 ? 91.677  87.032  111.816 1.00 20.09  ? 233 TYR A CD2 1 
ATOM   1757  C  CE1 . TYR A  1 256 ? 93.098  86.895  114.204 1.00 22.85  ? 233 TYR A CE1 1 
ATOM   1758  C  CE2 . TYR A  1 256 ? 91.109  87.493  113.001 1.00 29.62  ? 233 TYR A CE2 1 
ATOM   1759  C  CZ  . TYR A  1 256 ? 91.825  87.421  114.194 1.00 28.82  ? 233 TYR A CZ  1 
ATOM   1760  O  OH  . TYR A  1 256 ? 91.259  87.884  115.371 1.00 37.64  ? 233 TYR A OH  1 
ATOM   1761  N  N   . ASP A  1 257 ? 94.043  83.315  112.524 1.00 23.30  ? 234 ASP A N   1 
ATOM   1762  C  CA  . ASP A  1 257 ? 94.846  82.855  113.659 1.00 29.06  ? 234 ASP A CA  1 
ATOM   1763  C  C   . ASP A  1 257 ? 95.310  81.401  113.578 1.00 28.64  ? 234 ASP A C   1 
ATOM   1764  O  O   . ASP A  1 257 ? 95.799  80.852  114.561 1.00 28.96  ? 234 ASP A O   1 
ATOM   1765  C  CB  . ASP A  1 257 ? 94.192  83.177  115.011 1.00 21.94  ? 234 ASP A CB  1 
ATOM   1766  C  CG  . ASP A  1 257 ? 92.904  82.416  115.246 1.00 35.10  ? 234 ASP A CG  1 
ATOM   1767  O  OD1 . ASP A  1 257 ? 92.314  81.888  114.281 1.00 36.29  ? 234 ASP A OD1 1 
ATOM   1768  O  OD2 . ASP A  1 257 ? 92.470  82.364  116.414 1.00 48.35  ? 234 ASP A OD2 1 
ATOM   1769  N  N   . ASN A  1 258 ? 95.189  80.794  112.397 1.00 28.56  ? 235 ASN A N   1 
ATOM   1770  C  CA  . ASN A  1 258 ? 95.613  79.403  112.202 1.00 20.72  ? 235 ASN A CA  1 
ATOM   1771  C  C   . ASN A  1 258 ? 97.076  79.322  111.802 1.00 27.39  ? 235 ASN A C   1 
ATOM   1772  O  O   . ASN A  1 258 ? 97.389  79.108  110.635 1.00 25.23  ? 235 ASN A O   1 
ATOM   1773  C  CB  . ASN A  1 258 ? 94.740  78.706  111.142 1.00 27.23  ? 235 ASN A CB  1 
ATOM   1774  C  CG  . ASN A  1 258 ? 95.032  77.215  111.024 1.00 21.32  ? 235 ASN A CG  1 
ATOM   1775  O  OD1 . ASN A  1 258 ? 95.873  76.672  111.747 1.00 24.70  ? 235 ASN A OD1 1 
ATOM   1776  N  ND2 . ASN A  1 258 ? 94.324  76.545  110.131 1.00 17.28  ? 235 ASN A ND2 1 
ATOM   1777  N  N   . PHE A  1 259 ? 97.977  79.508  112.762 1.00 23.80  ? 236 PHE A N   1 
ATOM   1778  C  CA  . PHE A  1 259 ? 99.395  79.569  112.435 1.00 20.03  ? 236 PHE A CA  1 
ATOM   1779  C  C   . PHE A  1 259 ? 99.934  78.199  112.057 1.00 19.70  ? 236 PHE A C   1 
ATOM   1780  O  O   . PHE A  1 259 ? 100.862 78.092  111.262 1.00 24.50  ? 236 PHE A O   1 
ATOM   1781  C  CB  . PHE A  1 259 ? 100.209 80.159  113.591 1.00 21.01  ? 236 PHE A CB  1 
ATOM   1782  C  CG  . PHE A  1 259 ? 99.929  81.595  113.845 1.00 24.86  ? 236 PHE A CG  1 
ATOM   1783  C  CD1 . PHE A  1 259 ? 99.362  82.382  112.861 1.00 27.95  ? 236 PHE A CD1 1 
ATOM   1784  C  CD2 . PHE A  1 259 ? 100.232 82.168  115.062 1.00 32.50  ? 236 PHE A CD2 1 
ATOM   1785  C  CE1 . PHE A  1 259 ? 99.095  83.709  113.095 1.00 25.28  ? 236 PHE A CE1 1 
ATOM   1786  C  CE2 . PHE A  1 259 ? 99.966  83.495  115.294 1.00 33.26  ? 236 PHE A CE2 1 
ATOM   1787  C  CZ  . PHE A  1 259 ? 99.393  84.262  114.315 1.00 25.71  ? 236 PHE A CZ  1 
ATOM   1788  N  N   . ASP A  1 260 ? 99.356  77.153  112.631 1.00 17.73  ? 237 ASP A N   1 
ATOM   1789  C  CA  . ASP A  1 260 ? 99.728  75.799  112.252 1.00 26.01  ? 237 ASP A CA  1 
ATOM   1790  C  C   . ASP A  1 260 ? 99.484  75.587  110.762 1.00 25.76  ? 237 ASP A C   1 
ATOM   1791  O  O   . ASP A  1 260 ? 100.336 75.048  110.058 1.00 27.80  ? 237 ASP A O   1 
ATOM   1792  C  CB  . ASP A  1 260 ? 98.948  74.772  113.070 1.00 39.19  ? 237 ASP A CB  1 
ATOM   1793  C  CG  . ASP A  1 260 ? 99.346  74.766  114.544 1.00 46.96  ? 237 ASP A CG  1 
ATOM   1794  O  OD1 . ASP A  1 260 ? 100.560 74.629  114.849 1.00 39.81  ? 237 ASP A OD1 1 
ATOM   1795  O  OD2 . ASP A  1 260 ? 98.433  74.898  115.394 1.00 46.06  ? 237 ASP A OD2 1 
ATOM   1796  N  N   . GLY A  1 261 ? 98.323  76.024  110.285 1.00 21.79  ? 238 GLY A N   1 
ATOM   1797  C  CA  . GLY A  1 261 ? 97.968  75.903  108.879 1.00 21.26  ? 238 GLY A CA  1 
ATOM   1798  C  C   . GLY A  1 261 ? 98.815  76.760  107.953 1.00 21.48  ? 238 GLY A C   1 
ATOM   1799  O  O   . GLY A  1 261 ? 99.311  76.291  106.926 1.00 24.84  ? 238 GLY A O   1 
ATOM   1800  N  N   . TYR A  1 262 ? 98.992  78.020  108.323 1.00 18.64  ? 239 TYR A N   1 
ATOM   1801  C  CA  . TYR A  1 262 ? 99.821  78.930  107.551 1.00 18.48  ? 239 TYR A CA  1 
ATOM   1802  C  C   . TYR A  1 262 ? 101.225 78.371  107.345 1.00 25.06  ? 239 TYR A C   1 
ATOM   1803  O  O   . TYR A  1 262 ? 101.749 78.397  106.234 1.00 28.05  ? 239 TYR A O   1 
ATOM   1804  C  CB  . TYR A  1 262 ? 99.865  80.307  108.209 1.00 14.87  ? 239 TYR A CB  1 
ATOM   1805  C  CG  . TYR A  1 262 ? 98.666  81.145  107.871 1.00 22.52  ? 239 TYR A CG  1 
ATOM   1806  C  CD1 . TYR A  1 262 ? 98.266  81.295  106.560 1.00 19.44  ? 239 TYR A CD1 1 
ATOM   1807  C  CD2 . TYR A  1 262 ? 97.919  81.772  108.862 1.00 31.86  ? 239 TYR A CD2 1 
ATOM   1808  C  CE1 . TYR A  1 262 ? 97.142  82.043  106.229 1.00 24.10  ? 239 TYR A CE1 1 
ATOM   1809  C  CE2 . TYR A  1 262 ? 96.804  82.535  108.543 1.00 29.41  ? 239 TYR A CE2 1 
ATOM   1810  C  CZ  . TYR A  1 262 ? 96.423  82.664  107.216 1.00 31.57  ? 239 TYR A CZ  1 
ATOM   1811  O  OH  . TYR A  1 262 ? 95.318  83.412  106.863 1.00 38.68  ? 239 TYR A OH  1 
ATOM   1812  N  N   . ALA A  1 263 ? 101.829 77.840  108.400 1.00 18.30  ? 240 ALA A N   1 
ATOM   1813  C  CA  . ALA A  1 263 ? 103.165 77.292  108.264 1.00 15.86  ? 240 ALA A CA  1 
ATOM   1814  C  C   . ALA A  1 263 ? 103.212 76.185  107.218 1.00 21.39  ? 240 ALA A C   1 
ATOM   1815  O  O   . ALA A  1 263 ? 104.118 76.166  106.380 1.00 24.88  ? 240 ALA A O   1 
ATOM   1816  C  CB  . ALA A  1 263 ? 103.723 76.804  109.617 1.00 20.72  ? 240 ALA A CB  1 
ATOM   1817  N  N   . GLN A  1 264 ? 102.259 75.254  107.266 1.00 18.16  ? 241 GLN A N   1 
ATOM   1818  C  CA  . GLN A  1 264 ? 102.192 74.197  106.243 1.00 17.51  ? 241 GLN A CA  1 
ATOM   1819  C  C   . GLN A  1 264 ? 102.061 74.775  104.831 1.00 23.08  ? 241 GLN A C   1 
ATOM   1820  O  O   . GLN A  1 264 ? 102.704 74.298  103.895 1.00 24.99  ? 241 GLN A O   1 
ATOM   1821  C  CB  . GLN A  1 264 ? 101.012 73.254  106.490 1.00 22.55  ? 241 GLN A CB  1 
ATOM   1822  C  CG  . GLN A  1 264 ? 101.160 72.392  107.730 1.00 46.12  ? 241 GLN A CG  1 
ATOM   1823  C  CD  . GLN A  1 264 ? 102.366 71.487  107.658 1.00 59.92  ? 241 GLN A CD  1 
ATOM   1824  O  OE1 . GLN A  1 264 ? 102.565 70.773  106.668 1.00 72.20  ? 241 GLN A OE1 1 
ATOM   1825  N  NE2 . GLN A  1 264 ? 103.193 71.521  108.701 1.00 54.72  ? 241 GLN A NE2 1 
ATOM   1826  N  N   . LEU A  1 265 ? 101.220 75.794  104.675 1.00 14.94  ? 242 LEU A N   1 
ATOM   1827  C  CA  . LEU A  1 265 ? 100.970 76.365  103.350 1.00 15.40  ? 242 LEU A CA  1 
ATOM   1828  C  C   . LEU A  1 265 ? 102.213 77.076  102.829 1.00 25.87  ? 242 LEU A C   1 
ATOM   1829  O  O   . LEU A  1 265 ? 102.661 76.847  101.700 1.00 29.52  ? 242 LEU A O   1 
ATOM   1830  C  CB  . LEU A  1 265 ? 99.793  77.338  103.401 1.00 15.62  ? 242 LEU A CB  1 
ATOM   1831  C  CG  . LEU A  1 265 ? 98.451  76.667  103.639 1.00 19.33  ? 242 LEU A CG  1 
ATOM   1832  C  CD1 . LEU A  1 265 ? 97.426  77.714  103.911 1.00 14.44  ? 242 LEU A CD1 1 
ATOM   1833  C  CD2 . LEU A  1 265 ? 98.054  75.820  102.424 1.00 15.03  ? 242 LEU A CD2 1 
ATOM   1834  N  N   . ARG A  1 266 ? 102.762 77.945  103.666 1.00 21.96  ? 243 ARG A N   1 
ATOM   1835  C  CA  . ARG A  1 266 ? 104.023 78.625  103.376 1.00 24.52  ? 243 ARG A CA  1 
ATOM   1836  C  C   . ARG A  1 266 ? 105.082 77.657  102.841 1.00 26.05  ? 243 ARG A C   1 
ATOM   1837  O  O   . ARG A  1 266 ? 105.778 77.955  101.867 1.00 16.35  ? 243 ARG A O   1 
ATOM   1838  C  CB  . ARG A  1 266 ? 104.540 79.285  104.653 1.00 24.20  ? 243 ARG A CB  1 
ATOM   1839  C  CG  . ARG A  1 266 ? 105.691 80.239  104.456 1.00 26.63  ? 243 ARG A CG  1 
ATOM   1840  C  CD  . ARG A  1 266 ? 106.714 80.058  105.566 1.00 28.29  ? 243 ARG A CD  1 
ATOM   1841  N  NE  . ARG A  1 266 ? 107.632 81.174  105.612 1.00 39.38  ? 243 ARG A NE  1 
ATOM   1842  C  CZ  . ARG A  1 266 ? 108.675 81.239  106.421 1.00 48.02  ? 243 ARG A CZ  1 
ATOM   1843  N  NH1 . ARG A  1 266 ? 108.922 80.228  107.240 1.00 38.51  ? 243 ARG A NH1 1 
ATOM   1844  N  NH2 . ARG A  1 266 ? 109.471 82.307  106.398 1.00 56.63  ? 243 ARG A NH2 1 
ATOM   1845  N  N   . HIS A  1 267 ? 105.194 76.494  103.483 1.00 23.38  ? 244 HIS A N   1 
ATOM   1846  C  CA  . HIS A  1 267 ? 106.182 75.491  103.101 1.00 24.70  ? 244 HIS A CA  1 
ATOM   1847  C  C   . HIS A  1 267 ? 105.883 74.856  101.727 1.00 22.77  ? 244 HIS A C   1 
ATOM   1848  O  O   . HIS A  1 267 ? 106.760 74.782  100.870 1.00 27.66  ? 244 HIS A O   1 
ATOM   1849  C  CB  . HIS A  1 267 ? 106.295 74.411  104.192 1.00 32.01  ? 244 HIS A CB  1 
ATOM   1850  C  CG  . HIS A  1 267 ? 107.171 73.255  103.810 1.00 48.51  ? 244 HIS A CG  1 
ATOM   1851  N  ND1 . HIS A  1 267 ? 106.704 72.169  103.099 1.00 56.16  ? 244 HIS A ND1 1 
ATOM   1852  C  CD2 . HIS A  1 267 ? 108.487 73.022  104.032 1.00 50.23  ? 244 HIS A CD2 1 
ATOM   1853  C  CE1 . HIS A  1 267 ? 107.693 71.315  102.901 1.00 51.78  ? 244 HIS A CE1 1 
ATOM   1854  N  NE2 . HIS A  1 267 ? 108.787 71.809  103.456 1.00 49.43  ? 244 HIS A NE2 1 
ATOM   1855  N  N   . ASP A  1 268 ? 104.650 74.398  101.530 1.00 19.67  ? 245 ASP A N   1 
ATOM   1856  C  CA  . ASP A  1 268 ? 104.207 73.812  100.255 1.00 21.10  ? 245 ASP A CA  1 
ATOM   1857  C  C   . ASP A  1 268 ? 104.226 74.808  99.105  1.00 23.44  ? 245 ASP A C   1 
ATOM   1858  O  O   . ASP A  1 268 ? 104.549 74.450  97.989  1.00 29.97  ? 245 ASP A O   1 
ATOM   1859  C  CB  . ASP A  1 268 ? 102.785 73.252  100.378 1.00 16.93  ? 245 ASP A CB  1 
ATOM   1860  C  CG  . ASP A  1 268 ? 102.735 71.947  101.160 1.00 36.97  ? 245 ASP A CG  1 
ATOM   1861  O  OD1 . ASP A  1 268 ? 103.816 71.326  101.324 1.00 32.92  ? 245 ASP A OD1 1 
ATOM   1862  O  OD2 . ASP A  1 268 ? 101.613 71.546  101.586 1.00 36.35  ? 245 ASP A OD2 1 
ATOM   1863  N  N   . LEU A  1 269 ? 103.858 76.054  99.380  1.00 26.54  ? 246 LEU A N   1 
ATOM   1864  C  CA  . LEU A  1 269 ? 103.811 77.070  98.340  1.00 28.49  ? 246 LEU A CA  1 
ATOM   1865  C  C   . LEU A  1 269 ? 105.196 77.634  98.027  1.00 31.51  ? 246 LEU A C   1 
ATOM   1866  O  O   . LEU A  1 269 ? 106.008 77.867  98.927  1.00 27.32  ? 246 LEU A O   1 
ATOM   1867  C  CB  . LEU A  1 269 ? 102.893 78.211  98.753  1.00 18.36  ? 246 LEU A CB  1 
ATOM   1868  C  CG  . LEU A  1 269 ? 101.416 77.866  98.779  1.00 26.69  ? 246 LEU A CG  1 
ATOM   1869  C  CD1 . LEU A  1 269 ? 100.703 79.010  99.424  1.00 16.31  ? 246 LEU A CD1 1 
ATOM   1870  C  CD2 . LEU A  1 269 ? 100.904 77.611  97.347  1.00 25.05  ? 246 LEU A CD2 1 
ATOM   1871  N  N   . LYS A  1 270 ? 105.443 77.859  96.741  1.00 22.65  ? 247 LYS A N   1 
ATOM   1872  C  CA  . LYS A  1 270 ? 106.667 78.488  96.285  1.00 21.36  ? 247 LYS A CA  1 
ATOM   1873  C  C   . LYS A  1 270 ? 106.423 79.987  96.268  1.00 22.93  ? 247 LYS A C   1 
ATOM   1874  O  O   . LYS A  1 270 ? 107.271 80.775  96.669  1.00 25.81  ? 247 LYS A O   1 
ATOM   1875  C  CB  . LYS A  1 270 ? 107.013 77.984  94.884  1.00 29.77  ? 247 LYS A CB  1 
ATOM   1876  C  CG  . LYS A  1 270 ? 108.422 77.448  94.740  1.00 46.55  ? 247 LYS A CG  1 
ATOM   1877  C  CD  . LYS A  1 270 ? 108.611 76.108  95.430  1.00 58.02  ? 247 LYS A CD  1 
ATOM   1878  C  CE  . LYS A  1 270 ? 110.040 75.583  95.243  1.00 60.86  ? 247 LYS A CE  1 
ATOM   1879  N  NZ  . LYS A  1 270 ? 110.417 75.478  93.796  1.00 61.41  ? 247 LYS A NZ  1 
ATOM   1880  N  N   . THR A  1 271 ? 105.235 80.369  95.814  1.00 15.91  ? 248 THR A N   1 
ATOM   1881  C  CA  . THR A  1 271 ? 104.815 81.764  95.771  1.00 19.07  ? 248 THR A CA  1 
ATOM   1882  C  C   . THR A  1 271 ? 104.765 82.342  97.176  1.00 23.02  ? 248 THR A C   1 
ATOM   1883  O  O   . THR A  1 271 ? 104.436 81.644  98.121  1.00 19.80  ? 248 THR A O   1 
ATOM   1884  C  CB  . THR A  1 271 ? 103.414 81.858  95.136  1.00 23.31  ? 248 THR A CB  1 
ATOM   1885  O  OG1 . THR A  1 271 ? 103.480 81.420  93.780  1.00 19.49  ? 248 THR A OG1 1 
ATOM   1886  C  CG2 . THR A  1 271 ? 102.863 83.262  95.196  1.00 26.56  ? 248 THR A CG2 1 
ATOM   1887  N  N   . PRO A  1 272 ? 105.111 83.621  97.326  1.00 22.19  ? 249 PRO A N   1 
ATOM   1888  C  CA  . PRO A  1 272 ? 105.089 84.208  98.671  1.00 24.69  ? 249 PRO A CA  1 
ATOM   1889  C  C   . PRO A  1 272 ? 103.700 84.160  99.315  1.00 26.40  ? 249 PRO A C   1 
ATOM   1890  O  O   . PRO A  1 272 ? 102.717 84.505  98.664  1.00 25.26  ? 249 PRO A O   1 
ATOM   1891  C  CB  . PRO A  1 272 ? 105.521 85.655  98.417  1.00 19.26  ? 249 PRO A CB  1 
ATOM   1892  C  CG  . PRO A  1 272 ? 106.411 85.558  97.212  1.00 14.43  ? 249 PRO A CG  1 
ATOM   1893  C  CD  . PRO A  1 272 ? 105.804 84.481  96.353  1.00 19.51  ? 249 PRO A CD  1 
ATOM   1894  N  N   . LEU A  1 273 ? 103.635 83.708  100.568 1.00 22.59  ? 250 LEU A N   1 
ATOM   1895  C  CA  . LEU A  1 273 ? 102.399 83.711  101.361 1.00 19.79  ? 250 LEU A CA  1 
ATOM   1896  C  C   . LEU A  1 273 ? 102.371 84.963  102.230 1.00 18.80  ? 250 LEU A C   1 
ATOM   1897  O  O   . LEU A  1 273 ? 103.311 85.215  102.996 1.00 17.44  ? 250 LEU A O   1 
ATOM   1898  C  CB  . LEU A  1 273 ? 102.290 82.450  102.239 1.00 13.23  ? 250 LEU A CB  1 
ATOM   1899  C  CG  . LEU A  1 273 ? 101.026 82.278  103.095 1.00 22.04  ? 250 LEU A CG  1 
ATOM   1900  C  CD1 . LEU A  1 273 ? 99.818  82.106  102.232 1.00 23.11  ? 250 LEU A CD1 1 
ATOM   1901  C  CD2 . LEU A  1 273 ? 101.143 81.081  104.007 1.00 21.22  ? 250 LEU A CD2 1 
ATOM   1902  N  N   . MET A  1 274 ? 101.292 85.736  102.093 1.00 17.08  ? 251 MET A N   1 
ATOM   1903  C  CA  . MET A  1 274 ? 101.120 87.022  102.761 1.00 14.12  ? 251 MET A CA  1 
ATOM   1904  C  C   . MET A  1 274 ? 100.032 86.996  103.854 1.00 21.70  ? 251 MET A C   1 
ATOM   1905  O  O   . MET A  1 274 ? 98.908  86.515  103.626 1.00 17.47  ? 251 MET A O   1 
ATOM   1906  C  CB  . MET A  1 274 ? 100.751 88.082  101.723 1.00 19.90  ? 251 MET A CB  1 
ATOM   1907  C  CG  . MET A  1 274 ? 100.220 89.371  102.321 1.00 18.46  ? 251 MET A CG  1 
ATOM   1908  S  SD  . MET A  1 274 ? 101.504 90.361  103.145 1.00 23.05  ? 251 MET A SD  1 
ATOM   1909  C  CE  . MET A  1 274 ? 102.154 91.277  101.725 1.00 14.85  ? 251 MET A CE  1 
ATOM   1910  N  N   . ILE A  1 275 ? 100.369 87.505  105.036 1.00 17.19  ? 252 ILE A N   1 
ATOM   1911  C  CA  . ILE A  1 275 ? 99.388  87.725  106.091 1.00 15.93  ? 252 ILE A CA  1 
ATOM   1912  C  C   . ILE A  1 275 ? 99.726  88.979  106.879 1.00 18.88  ? 252 ILE A C   1 
ATOM   1913  O  O   . ILE A  1 275 ? 100.696 89.662  106.576 1.00 19.07  ? 252 ILE A O   1 
ATOM   1914  C  CB  . ILE A  1 275 ? 99.298  86.547  107.068 1.00 15.74  ? 252 ILE A CB  1 
ATOM   1915  C  CG1 . ILE A  1 275 ? 100.522 86.484  107.975 1.00 16.50  ? 252 ILE A CG1 1 
ATOM   1916  C  CG2 . ILE A  1 275 ? 99.111  85.224  106.329 1.00 21.52  ? 252 ILE A CG2 1 
ATOM   1917  C  CD1 . ILE A  1 275 ? 100.382 85.385  109.033 1.00 10.66  ? 252 ILE A CD1 1 
ATOM   1918  N  N   . GLY A  1 276 ? 98.926  89.285  107.896 1.00 19.79  ? 253 GLY A N   1 
ATOM   1919  C  CA  . GLY A  1 276 ? 99.266  90.364  108.805 1.00 16.69  ? 253 GLY A CA  1 
ATOM   1920  C  C   . GLY A  1 276 ? 98.185  91.402  109.067 1.00 21.04  ? 253 GLY A C   1 
ATOM   1921  O  O   . GLY A  1 276 ? 98.207  92.088  110.093 1.00 23.28  ? 253 GLY A O   1 
ATOM   1922  N  N   . GLU A  1 277 ? 97.226  91.533  108.161 1.00 23.70  ? 254 GLU A N   1 
ATOM   1923  C  CA  . GLU A  1 277 ? 96.204  92.546  108.380 1.00 22.61  ? 254 GLU A CA  1 
ATOM   1924  C  C   . GLU A  1 277 ? 95.454  92.304  109.686 1.00 22.14  ? 254 GLU A C   1 
ATOM   1925  O  O   . GLU A  1 277 ? 94.889  93.233  110.256 1.00 20.03  ? 254 GLU A O   1 
ATOM   1926  C  CB  . GLU A  1 277 ? 95.251  92.678  107.196 1.00 20.15  ? 254 GLU A CB  1 
ATOM   1927  C  CG  . GLU A  1 277 ? 94.527  91.419  106.813 1.00 29.34  ? 254 GLU A CG  1 
ATOM   1928  C  CD  . GLU A  1 277 ? 93.662  91.620  105.577 1.00 39.52  ? 254 GLU A CD  1 
ATOM   1929  O  OE1 . GLU A  1 277 ? 94.164  91.416  104.443 1.00 43.00  ? 254 GLU A OE1 1 
ATOM   1930  O  OE2 . GLU A  1 277 ? 92.478  91.985  105.739 1.00 32.01  ? 254 GLU A OE2 1 
ATOM   1931  N  N   . ASN A  1 278 ? 95.474  91.069  110.180 1.00 16.99  ? 255 ASN A N   1 
ATOM   1932  C  CA  . ASN A  1 278 ? 94.835  90.781  111.455 1.00 14.69  ? 255 ASN A CA  1 
ATOM   1933  C  C   . ASN A  1 278 ? 95.768  90.639  112.667 1.00 23.93  ? 255 ASN A C   1 
ATOM   1934  O  O   . ASN A  1 278 ? 95.351  90.123  113.711 1.00 23.40  ? 255 ASN A O   1 
ATOM   1935  C  CB  . ASN A  1 278 ? 93.891  89.591  111.318 1.00 19.81  ? 255 ASN A CB  1 
ATOM   1936  C  CG  . ASN A  1 278 ? 92.660  89.948  110.501 1.00 23.10  ? 255 ASN A CG  1 
ATOM   1937  O  OD1 . ASN A  1 278 ? 91.781  90.659  110.984 1.00 32.52  ? 255 ASN A OD1 1 
ATOM   1938  N  ND2 . ASN A  1 278 ? 92.616  89.504  109.252 1.00 14.24  ? 255 ASN A ND2 1 
ATOM   1939  N  N   . PHE A  1 279 ? 97.011  91.105  112.535 1.00 15.55  ? 256 PHE A N   1 
ATOM   1940  C  CA  . PHE A  1 279 ? 97.942  91.133  113.677 1.00 20.84  ? 256 PHE A CA  1 
ATOM   1941  C  C   . PHE A  1 279 ? 97.493  92.193  114.669 1.00 25.55  ? 256 PHE A C   1 
ATOM   1942  O  O   . PHE A  1 279 ? 97.346  93.366  114.323 1.00 22.35  ? 256 PHE A O   1 
ATOM   1943  C  CB  . PHE A  1 279 ? 99.377  91.453  113.238 1.00 12.82  ? 256 PHE A CB  1 
ATOM   1944  C  CG  . PHE A  1 279 ? 100.066 90.337  112.514 1.00 18.35  ? 256 PHE A CG  1 
ATOM   1945  C  CD1 . PHE A  1 279 ? 99.580  89.028  112.583 1.00 21.67  ? 256 PHE A CD1 1 
ATOM   1946  C  CD2 . PHE A  1 279 ? 101.212 90.590  111.768 1.00 23.22  ? 256 PHE A CD2 1 
ATOM   1947  C  CE1 . PHE A  1 279 ? 100.223 87.992  111.904 1.00 18.66  ? 256 PHE A CE1 1 
ATOM   1948  C  CE2 . PHE A  1 279 ? 101.865 89.565  111.088 1.00 25.94  ? 256 PHE A CE2 1 
ATOM   1949  C  CZ  . PHE A  1 279 ? 101.375 88.268  111.151 1.00 26.18  ? 256 PHE A CZ  1 
ATOM   1950  N  N   . TYR A  1 280 ? 97.250  91.788  115.904 1.00 29.52  ? 257 TYR A N   1 
ATOM   1951  C  CA  . TYR A  1 280 ? 96.976  92.766  116.946 1.00 26.17  ? 257 TYR A CA  1 
ATOM   1952  C  C   . TYR A  1 280 ? 98.233  93.091  117.761 1.00 22.40  ? 257 TYR A C   1 
ATOM   1953  O  O   . TYR A  1 280 ? 98.412  92.589  118.859 1.00 32.22  ? 257 TYR A O   1 
ATOM   1954  C  CB  . TYR A  1 280 ? 95.809  92.306  117.830 1.00 28.02  ? 257 TYR A CB  1 
ATOM   1955  C  CG  . TYR A  1 280 ? 94.471  92.450  117.129 1.00 32.73  ? 257 TYR A CG  1 
ATOM   1956  C  CD1 . TYR A  1 280 ? 93.815  93.672  117.105 1.00 27.04  ? 257 TYR A CD1 1 
ATOM   1957  C  CD2 . TYR A  1 280 ? 93.877  91.371  116.468 1.00 24.13  ? 257 TYR A CD2 1 
ATOM   1958  C  CE1 . TYR A  1 280 ? 92.595  93.819  116.457 1.00 30.32  ? 257 TYR A CE1 1 
ATOM   1959  C  CE2 . TYR A  1 280 ? 92.663  91.512  115.818 1.00 20.48  ? 257 TYR A CE2 1 
ATOM   1960  C  CZ  . TYR A  1 280 ? 92.026  92.741  115.816 1.00 30.73  ? 257 TYR A CZ  1 
ATOM   1961  O  OH  . TYR A  1 280 ? 90.817  92.903  115.173 1.00 34.58  ? 257 TYR A OH  1 
ATOM   1962  N  N   . GLY A  1 281 ? 99.102  93.928  117.193 1.00 23.62  ? 258 GLY A N   1 
ATOM   1963  C  CA  . GLY A  1 281 ? 100.314 94.392  117.850 1.00 21.01  ? 258 GLY A CA  1 
ATOM   1964  C  C   . GLY A  1 281 ? 101.583 93.692  117.392 1.00 23.89  ? 258 GLY A C   1 
ATOM   1965  O  O   . GLY A  1 281 ? 101.527 92.589  116.856 1.00 25.46  ? 258 GLY A O   1 
ATOM   1966  N  N   . PRO A  1 282 ? 102.739 94.325  117.628 1.00 23.98  ? 259 PRO A N   1 
ATOM   1967  C  CA  . PRO A  1 282 ? 104.060 93.803  117.241 1.00 26.15  ? 259 PRO A CA  1 
ATOM   1968  C  C   . PRO A  1 282 ? 104.344 92.404  117.804 1.00 21.22  ? 259 PRO A C   1 
ATOM   1969  O  O   . PRO A  1 282 ? 104.951 91.574  117.124 1.00 26.01  ? 259 PRO A O   1 
ATOM   1970  C  CB  . PRO A  1 282 ? 105.043 94.820  117.848 1.00 17.21  ? 259 PRO A CB  1 
ATOM   1971  C  CG  . PRO A  1 282 ? 104.222 96.039  118.139 1.00 22.00  ? 259 PRO A CG  1 
ATOM   1972  C  CD  . PRO A  1 282 ? 102.831 95.573  118.405 1.00 23.15  ? 259 PRO A CD  1 
ATOM   1973  N  N   . ARG A  1 283 ? 103.916 92.139  119.031 1.00 19.40  ? 260 ARG A N   1 
ATOM   1974  C  CA  . ARG A  1 283 ? 104.155 90.820  119.630 1.00 24.74  ? 260 ARG A CA  1 
ATOM   1975  C  C   . ARG A  1 283 ? 103.498 89.691  118.819 1.00 29.54  ? 260 ARG A C   1 
ATOM   1976  O  O   . ARG A  1 283 ? 104.069 88.600  118.636 1.00 23.61  ? 260 ARG A O   1 
ATOM   1977  C  CB  . ARG A  1 283 ? 103.674 90.796  121.076 1.00 17.69  ? 260 ARG A CB  1 
ATOM   1978  C  CG  . ARG A  1 283 ? 103.820 89.438  121.748 1.00 19.49  ? 260 ARG A CG  1 
ATOM   1979  C  CD  . ARG A  1 283 ? 103.793 89.605  123.252 1.00 19.54  ? 260 ARG A CD  1 
ATOM   1980  N  NE  . ARG A  1 283 ? 105.069 90.095  123.759 1.00 20.96  ? 260 ARG A NE  1 
ATOM   1981  C  CZ  . ARG A  1 283 ? 105.254 90.638  124.961 1.00 24.16  ? 260 ARG A CZ  1 
ATOM   1982  N  NH1 . ARG A  1 283 ? 104.228 90.789  125.792 1.00 20.71  ? 260 ARG A NH1 1 
ATOM   1983  N  NH2 . ARG A  1 283 ? 106.472 91.045  125.327 1.00 20.76  ? 260 ARG A NH2 1 
ATOM   1984  N  N   . GLU A  1 284 ? 102.298 89.963  118.320 1.00 22.93  ? 261 GLU A N   1 
ATOM   1985  C  CA  . GLU A  1 284 ? 101.582 88.972  117.532 1.00 21.92  ? 261 GLU A CA  1 
ATOM   1986  C  C   . GLU A  1 284 ? 102.323 88.751  116.212 1.00 18.23  ? 261 GLU A C   1 
ATOM   1987  O  O   . GLU A  1 284 ? 102.442 87.622  115.749 1.00 18.18  ? 261 GLU A O   1 
ATOM   1988  C  CB  . GLU A  1 284 ? 100.139 89.405  117.298 1.00 28.33  ? 261 GLU A CB  1 
ATOM   1989  C  CG  . GLU A  1 284 ? 99.141  88.263  117.157 1.00 50.31  ? 261 GLU A CG  1 
ATOM   1990  C  CD  . GLU A  1 284 ? 97.707  88.714  117.459 1.00 64.40  ? 261 GLU A CD  1 
ATOM   1991  O  OE1 . GLU A  1 284 ? 96.890  88.811  116.510 1.00 62.02  ? 261 GLU A OE1 1 
ATOM   1992  O  OE2 . GLU A  1 284 ? 97.404  88.981  118.650 1.00 64.09  ? 261 GLU A OE2 1 
ATOM   1993  N  N   . MET A  1 285 ? 102.858 89.819  115.629 1.00 20.50  ? 262 MET A N   1 
ATOM   1994  C  CA  . MET A  1 285 ? 103.708 89.655  114.457 1.00 22.90  ? 262 MET A CA  1 
ATOM   1995  C  C   . MET A  1 285 ? 104.886 88.748  114.801 1.00 24.15  ? 262 MET A C   1 
ATOM   1996  O  O   . MET A  1 285 ? 105.161 87.761  114.102 1.00 27.32  ? 262 MET A O   1 
ATOM   1997  C  CB  . MET A  1 285 ? 104.229 90.994  113.920 1.00 18.41  ? 262 MET A CB  1 
ATOM   1998  C  CG  . MET A  1 285 ? 105.169 90.787  112.699 1.00 29.34  ? 262 MET A CG  1 
ATOM   1999  S  SD  . MET A  1 285 ? 105.944 92.260  111.998 1.00 28.70  ? 262 MET A SD  1 
ATOM   2000  C  CE  . MET A  1 285 ? 104.499 93.018  111.303 1.00 5.70   ? 262 MET A CE  1 
ATOM   2001  N  N   . HIS A  1 286 ? 105.582 89.095  115.879 1.00 16.66  ? 263 HIS A N   1 
ATOM   2002  C  CA  . HIS A  1 286 ? 106.726 88.313  116.352 1.00 13.31  ? 263 HIS A CA  1 
ATOM   2003  C  C   . HIS A  1 286 ? 106.358 86.825  116.558 1.00 17.72  ? 263 HIS A C   1 
ATOM   2004  O  O   . HIS A  1 286 ? 107.106 85.937  116.154 1.00 19.99  ? 263 HIS A O   1 
ATOM   2005  C  CB  . HIS A  1 286 ? 107.311 88.975  117.616 1.00 16.70  ? 263 HIS A CB  1 
ATOM   2006  C  CG  . HIS A  1 286 ? 107.969 88.022  118.566 1.00 18.15  ? 263 HIS A CG  1 
ATOM   2007  N  ND1 . HIS A  1 286 ? 109.271 87.593  118.413 1.00 21.45  ? 263 HIS A ND1 1 
ATOM   2008  C  CD2 . HIS A  1 286 ? 107.508 87.429  119.694 1.00 19.80  ? 263 HIS A CD2 1 
ATOM   2009  C  CE1 . HIS A  1 286 ? 109.579 86.768  119.398 1.00 26.94  ? 263 HIS A CE1 1 
ATOM   2010  N  NE2 . HIS A  1 286 ? 108.527 86.655  120.191 1.00 22.05  ? 263 HIS A NE2 1 
ATOM   2011  N  N   . GLN A  1 287 ? 105.195 86.549  117.146 1.00 18.27  ? 264 GLN A N   1 
ATOM   2012  C  CA  . GLN A  1 287 ? 104.736 85.157  117.281 1.00 23.16  ? 264 GLN A CA  1 
ATOM   2013  C  C   . GLN A  1 287 ? 104.430 84.461  115.952 1.00 20.51  ? 264 GLN A C   1 
ATOM   2014  O  O   . GLN A  1 287 ? 104.701 83.271  115.802 1.00 21.93  ? 264 GLN A O   1 
ATOM   2015  C  CB  . GLN A  1 287 ? 103.524 85.054  118.206 1.00 19.36  ? 264 GLN A CB  1 
ATOM   2016  C  CG  . GLN A  1 287 ? 103.783 85.582  119.601 1.00 27.24  ? 264 GLN A CG  1 
ATOM   2017  C  CD  . GLN A  1 287 ? 102.505 85.771  120.415 1.00 42.68  ? 264 GLN A CD  1 
ATOM   2018  O  OE1 . GLN A  1 287 ? 101.399 85.951  119.864 1.00 35.81  ? 264 GLN A OE1 1 
ATOM   2019  N  NE2 . GLN A  1 287 ? 102.653 85.733  121.742 1.00 40.27  ? 264 GLN A NE2 1 
ATOM   2020  N  N   . ALA A  1 288 ? 103.862 85.192  114.995 1.00 13.21  ? 265 ALA A N   1 
ATOM   2021  C  CA  . ALA A  1 288 ? 103.634 84.625  113.659 1.00 17.74  ? 265 ALA A CA  1 
ATOM   2022  C  C   . ALA A  1 288 ? 104.954 84.208  112.999 1.00 18.50  ? 265 ALA A C   1 
ATOM   2023  O  O   . ALA A  1 288 ? 105.046 83.133  112.408 1.00 20.76  ? 265 ALA A O   1 
ATOM   2024  C  CB  . ALA A  1 288 ? 102.871 85.612  112.767 1.00 11.12  ? 265 ALA A CB  1 
ATOM   2025  N  N   . LEU A  1 289 ? 105.976 85.056  113.121 1.00 14.93  ? 266 LEU A N   1 
ATOM   2026  C  CA  . LEU A  1 289 ? 107.274 84.802  112.494 1.00 15.20  ? 266 LEU A CA  1 
ATOM   2027  C  C   . LEU A  1 289 ? 108.038 83.637  113.143 1.00 20.01  ? 266 LEU A C   1 
ATOM   2028  O  O   . LEU A  1 289 ? 108.703 82.861  112.462 1.00 27.12  ? 266 LEU A O   1 
ATOM   2029  C  CB  . LEU A  1 289 ? 108.127 86.080  112.486 1.00 14.37  ? 266 LEU A CB  1 
ATOM   2030  C  CG  . LEU A  1 289 ? 107.558 87.250  111.679 1.00 24.32  ? 266 LEU A CG  1 
ATOM   2031  C  CD1 . LEU A  1 289 ? 108.454 88.479  111.762 1.00 19.93  ? 266 LEU A CD1 1 
ATOM   2032  C  CD2 . LEU A  1 289 ? 107.389 86.839  110.215 1.00 24.88  ? 266 LEU A CD2 1 
ATOM   2033  N  N   . GLN A  1 290 ? 107.953 83.526  114.462 1.00 21.63  ? 267 GLN A N   1 
ATOM   2034  C  CA  . GLN A  1 290 ? 108.558 82.403  115.171 1.00 20.30  ? 267 GLN A CA  1 
ATOM   2035  C  C   . GLN A  1 290 ? 107.914 81.103  114.730 1.00 22.96  ? 267 GLN A C   1 
ATOM   2036  O  O   . GLN A  1 290 ? 108.551 80.064  114.723 1.00 28.42  ? 267 GLN A O   1 
ATOM   2037  C  CB  . GLN A  1 290 ? 108.368 82.542  116.680 1.00 19.45  ? 267 GLN A CB  1 
ATOM   2038  C  CG  . GLN A  1 290 ? 109.293 83.533  117.372 1.00 21.81  ? 267 GLN A CG  1 
ATOM   2039  C  CD  . GLN A  1 290 ? 108.965 83.662  118.847 1.00 37.33  ? 267 GLN A CD  1 
ATOM   2040  O  OE1 . GLN A  1 290 ? 107.823 83.950  119.218 1.00 37.46  ? 267 GLN A OE1 1 
ATOM   2041  N  NE2 . GLN A  1 290 ? 109.959 83.426  119.700 1.00 37.39  ? 267 GLN A NE2 1 
ATOM   2042  N  N   . ALA A  1 291 ? 106.639 81.172  114.377 1.00 16.83  ? 268 ALA A N   1 
ATOM   2043  C  CA  . ALA A  1 291 ? 105.898 80.006  113.926 1.00 17.33  ? 268 ALA A CA  1 
ATOM   2044  C  C   . ALA A  1 291 ? 106.121 79.702  112.428 1.00 24.70  ? 268 ALA A C   1 
ATOM   2045  O  O   . ALA A  1 291 ? 105.639 78.694  111.915 1.00 28.57  ? 268 ALA A O   1 
ATOM   2046  C  CB  . ALA A  1 291 ? 104.421 80.210  114.214 1.00 13.29  ? 268 ALA A CB  1 
ATOM   2047  N  N   . GLY A  1 292 ? 106.857 80.565  111.734 1.00 20.42  ? 269 GLY A N   1 
ATOM   2048  C  CA  . GLY A  1 292 ? 107.141 80.340  110.328 1.00 14.41  ? 269 GLY A CA  1 
ATOM   2049  C  C   . GLY A  1 292 ? 105.867 80.416  109.489 1.00 23.68  ? 269 GLY A C   1 
ATOM   2050  O  O   . GLY A  1 292 ? 105.668 79.637  108.558 1.00 27.89  ? 269 GLY A O   1 
ATOM   2051  N  N   . ALA A  1 293 ? 105.005 81.372  109.816 1.00 19.48  ? 270 ALA A N   1 
ATOM   2052  C  CA  . ALA A  1 293 ? 103.662 81.403  109.257 1.00 22.67  ? 270 ALA A CA  1 
ATOM   2053  C  C   . ALA A  1 293 ? 103.526 82.175  107.955 1.00 26.97  ? 270 ALA A C   1 
ATOM   2054  O  O   . ALA A  1 293 ? 102.471 82.117  107.318 1.00 24.50  ? 270 ALA A O   1 
ATOM   2055  C  CB  . ALA A  1 293 ? 102.670 81.945  110.285 1.00 16.06  ? 270 ALA A CB  1 
ATOM   2056  N  N   . CYS A  1 294 ? 104.566 82.896  107.550 1.00 24.49  ? 271 CYS A N   1 
ATOM   2057  C  CA  . CYS A  1 294 ? 104.443 83.771  106.381 1.00 21.17  ? 271 CYS A CA  1 
ATOM   2058  C  C   . CYS A  1 294 ? 105.778 84.215  105.797 1.00 23.81  ? 271 CYS A C   1 
ATOM   2059  O  O   . CYS A  1 294 ? 106.803 84.205  106.476 1.00 24.24  ? 271 CYS A O   1 
ATOM   2060  C  CB  . CYS A  1 294 ? 103.644 85.018  106.757 1.00 17.17  ? 271 CYS A CB  1 
ATOM   2061  S  SG  . CYS A  1 294 ? 104.447 85.930  108.087 1.00 33.75  ? 271 CYS A SG  1 
ATOM   2062  N  N   . ASP A  1 295 ? 105.730 84.619  104.528 1.00 23.41  ? 272 ASP A N   1 
ATOM   2063  C  CA  . ASP A  1 295 ? 106.878 85.158  103.815 1.00 23.38  ? 272 ASP A CA  1 
ATOM   2064  C  C   . ASP A  1 295 ? 106.840 86.681  103.808 1.00 25.21  ? 272 ASP A C   1 
ATOM   2065  O  O   . ASP A  1 295 ? 107.871 87.319  103.634 1.00 19.22  ? 272 ASP A O   1 
ATOM   2066  C  CB  . ASP A  1 295 ? 106.875 84.679  102.355 1.00 19.87  ? 272 ASP A CB  1 
ATOM   2067  C  CG  . ASP A  1 295 ? 106.790 83.171  102.235 1.00 30.16  ? 272 ASP A CG  1 
ATOM   2068  O  OD1 . ASP A  1 295 ? 105.779 82.681  101.686 1.00 27.68  ? 272 ASP A OD1 1 
ATOM   2069  O  OD2 . ASP A  1 295 ? 107.738 82.475  102.675 1.00 24.53  ? 272 ASP A OD2 1 
ATOM   2070  N  N   . LEU A  1 296 ? 105.642 87.249  103.944 1.00 17.12  ? 273 LEU A N   1 
ATOM   2071  C  CA  . LEU A  1 296 ? 105.448 88.687  103.849 1.00 14.58  ? 273 LEU A CA  1 
ATOM   2072  C  C   . LEU A  1 296 ? 104.431 89.109  104.899 1.00 17.12  ? 273 LEU A C   1 
ATOM   2073  O  O   . LEU A  1 296 ? 103.636 88.298  105.370 1.00 13.19  ? 273 LEU A O   1 
ATOM   2074  C  CB  . LEU A  1 296 ? 104.918 89.051  102.456 1.00 12.97  ? 273 LEU A CB  1 
ATOM   2075  C  CG  . LEU A  1 296 ? 105.665 88.505  101.229 1.00 18.07  ? 273 LEU A CG  1 
ATOM   2076  C  CD1 . LEU A  1 296 ? 104.968 88.875  99.937  1.00 20.66  ? 273 LEU A CD1 1 
ATOM   2077  C  CD2 . LEU A  1 296 ? 107.077 89.036  101.199 1.00 17.00  ? 273 LEU A CD2 1 
ATOM   2078  N  N   . VAL A  1 297 ? 104.446 90.374  105.276 1.00 14.27  ? 274 VAL A N   1 
ATOM   2079  C  CA  . VAL A  1 297 ? 103.479 90.849  106.259 1.00 15.21  ? 274 VAL A CA  1 
ATOM   2080  C  C   . VAL A  1 297 ? 102.929 92.181  105.827 1.00 15.58  ? 274 VAL A C   1 
ATOM   2081  O  O   . VAL A  1 297 ? 103.611 92.952  105.136 1.00 16.11  ? 274 VAL A O   1 
ATOM   2082  C  CB  . VAL A  1 297 ? 104.077 90.948  107.686 1.00 23.60  ? 274 VAL A CB  1 
ATOM   2083  C  CG1 . VAL A  1 297 ? 104.373 89.556  108.230 1.00 11.64  ? 274 VAL A CG1 1 
ATOM   2084  C  CG2 . VAL A  1 297 ? 105.328 91.799  107.689 1.00 16.11  ? 274 VAL A CG2 1 
ATOM   2085  N  N   . MET A  1 298 ? 101.682 92.439  106.206 1.00 17.46  ? 275 MET A N   1 
ATOM   2086  C  CA  . MET A  1 298 ? 101.057 93.731  105.943 1.00 15.95  ? 275 MET A CA  1 
ATOM   2087  C  C   . MET A  1 298 ? 100.171 94.152  107.125 1.00 18.07  ? 275 MET A C   1 
ATOM   2088  O  O   . MET A  1 298 ? 98.964  93.903  107.122 1.00 17.68  ? 275 MET A O   1 
ATOM   2089  C  CB  . MET A  1 298 ? 100.255 93.691  104.618 1.00 15.17  ? 275 MET A CB  1 
ATOM   2090  C  CG  . MET A  1 298 ? 99.275  92.510  104.512 1.00 18.40  ? 275 MET A CG  1 
ATOM   2091  S  SD  . MET A  1 298 ? 98.347  92.355  102.932 1.00 25.08  ? 275 MET A SD  1 
ATOM   2092  C  CE  . MET A  1 298 ? 97.127  93.660  103.102 1.00 21.64  ? 275 MET A CE  1 
ATOM   2093  N  N   . PRO A  1 299 ? 100.769 94.785  108.147 1.00 19.97  ? 276 PRO A N   1 
ATOM   2094  C  CA  . PRO A  1 299 ? 99.953  95.250  109.275 1.00 21.46  ? 276 PRO A CA  1 
ATOM   2095  C  C   . PRO A  1 299 ? 98.863  96.248  108.900 1.00 23.11  ? 276 PRO A C   1 
ATOM   2096  O  O   . PRO A  1 299 ? 98.999  97.028  107.954 1.00 24.69  ? 276 PRO A O   1 
ATOM   2097  C  CB  . PRO A  1 299 ? 100.978 95.895  110.197 1.00 19.91  ? 276 PRO A CB  1 
ATOM   2098  C  CG  . PRO A  1 299 ? 102.213 95.106  109.944 1.00 20.35  ? 276 PRO A CG  1 
ATOM   2099  C  CD  . PRO A  1 299 ? 102.205 94.855  108.460 1.00 21.30  ? 276 PRO A CD  1 
ATOM   2100  N  N   . ASP A  1 300 ? 97.760  96.186  109.641 1.00 22.96  ? 277 ASP A N   1 
ATOM   2101  C  CA  . ASP A  1 300 ? 96.665  97.137  109.500 1.00 22.07  ? 277 ASP A CA  1 
ATOM   2102  C  C   . ASP A  1 300 ? 96.826  98.137  110.622 1.00 19.86  ? 277 ASP A C   1 
ATOM   2103  O  O   . ASP A  1 300 ? 97.072  97.737  111.763 1.00 19.37  ? 277 ASP A O   1 
ATOM   2104  C  CB  . ASP A  1 300 ? 95.318  96.426  109.662 1.00 23.02  ? 277 ASP A CB  1 
ATOM   2105  C  CG  . ASP A  1 300 ? 94.143  97.393  109.683 1.00 28.00  ? 277 ASP A CG  1 
ATOM   2106  O  OD1 . ASP A  1 300 ? 93.949  98.101  110.696 1.00 32.45  ? 277 ASP A OD1 1 
ATOM   2107  O  OD2 . ASP A  1 300 ? 93.408  97.440  108.676 1.00 31.87  ? 277 ASP A OD2 1 
ATOM   2108  N  N   . PHE A  1 301 ? 96.665  99.424  110.321 1.00 22.03  ? 278 PHE A N   1 
ATOM   2109  C  CA  . PHE A  1 301 ? 96.951  100.468 111.312 1.00 25.24  ? 278 PHE A CA  1 
ATOM   2110  C  C   . PHE A  1 301 ? 96.071  100.504 112.569 1.00 29.74  ? 278 PHE A C   1 
ATOM   2111  O  O   . PHE A  1 301 ? 96.537  100.911 113.637 1.00 29.42  ? 278 PHE A O   1 
ATOM   2112  C  CB  . PHE A  1 301 ? 97.034  101.827 110.639 1.00 19.74  ? 278 PHE A CB  1 
ATOM   2113  C  CG  . PHE A  1 301 ? 98.259  101.980 109.855 1.00 20.55  ? 278 PHE A CG  1 
ATOM   2114  C  CD1 . PHE A  1 301 ? 99.457  102.276 110.493 1.00 16.91  ? 278 PHE A CD1 1 
ATOM   2115  C  CD2 . PHE A  1 301 ? 98.255  101.737 108.489 1.00 22.10  ? 278 PHE A CD2 1 
ATOM   2116  C  CE1 . PHE A  1 301 ? 100.624 102.363 109.776 1.00 18.19  ? 278 PHE A CE1 1 
ATOM   2117  C  CE2 . PHE A  1 301 ? 99.419  101.822 107.759 1.00 21.23  ? 278 PHE A CE2 1 
ATOM   2118  C  CZ  . PHE A  1 301 ? 100.616 102.139 108.410 1.00 19.46  ? 278 PHE A CZ  1 
ATOM   2119  N  N   . MET A  1 302 ? 94.816  100.081 112.445 1.00 25.69  ? 279 MET A N   1 
ATOM   2120  C  CA  . MET A  1 302 ? 93.914  100.077 113.584 1.00 30.64  ? 279 MET A CA  1 
ATOM   2121  C  C   . MET A  1 302 ? 94.104  98.828  114.429 1.00 29.29  ? 279 MET A C   1 
ATOM   2122  O  O   . MET A  1 302 ? 93.771  98.823  115.611 1.00 28.16  ? 279 MET A O   1 
ATOM   2123  C  CB  . MET A  1 302 ? 92.445  100.212 113.163 1.00 30.02  ? 279 MET A CB  1 
ATOM   2124  C  CG  . MET A  1 302 ? 91.806  98.929  112.662 1.00 35.49  ? 279 MET A CG  1 
ATOM   2125  S  SD  . MET A  1 302 ? 89.988  98.982  112.655 1.00 39.73  ? 279 MET A SD  1 
ATOM   2126  C  CE  . MET A  1 302 ? 89.576  97.393  111.919 1.00 26.87  ? 279 MET A CE  1 
ATOM   2127  N  N   . ARG A  1 303 ? 94.640  97.768  113.839 1.00 22.66  ? 280 ARG A N   1 
ATOM   2128  C  CA  . ARG A  1 303 ? 94.870  96.563  114.620 1.00 24.15  ? 280 ARG A CA  1 
ATOM   2129  C  C   . ARG A  1 303 ? 96.295  96.491  115.203 1.00 28.68  ? 280 ARG A C   1 
ATOM   2130  O  O   . ARG A  1 303 ? 96.485  95.975  116.304 1.00 23.42  ? 280 ARG A O   1 
ATOM   2131  C  CB  . ARG A  1 303 ? 94.543  95.315  113.803 1.00 23.89  ? 280 ARG A CB  1 
ATOM   2132  C  CG  . ARG A  1 303 ? 93.185  95.352  113.138 1.00 23.19  ? 280 ARG A CG  1 
ATOM   2133  C  CD  . ARG A  1 303 ? 92.798  93.990  112.607 1.00 20.44  ? 280 ARG A CD  1 
ATOM   2134  N  NE  . ARG A  1 303 ? 91.498  93.987  111.926 1.00 31.90  ? 280 ARG A NE  1 
ATOM   2135  C  CZ  . ARG A  1 303 ? 91.326  94.102  110.610 1.00 32.47  ? 280 ARG A CZ  1 
ATOM   2136  N  NH1 . ARG A  1 303 ? 92.364  94.241  109.797 1.00 34.46  ? 280 ARG A NH1 1 
ATOM   2137  N  NH2 . ARG A  1 303 ? 90.106  94.068  110.102 1.00 28.72  ? 280 ARG A NH2 1 
ATOM   2138  N  N   . ILE A  1 304 ? 97.281  97.014  114.470 1.00 22.97  ? 281 ILE A N   1 
ATOM   2139  C  CA  . ILE A  1 304 ? 98.691  96.894  114.857 1.00 14.81  ? 281 ILE A CA  1 
ATOM   2140  C  C   . ILE A  1 304 ? 99.061  97.841  115.988 1.00 20.90  ? 281 ILE A C   1 
ATOM   2141  O  O   . ILE A  1 304 ? 100.092 97.660  116.630 1.00 27.67  ? 281 ILE A O   1 
ATOM   2142  C  CB  . ILE A  1 304 ? 99.657  97.173  113.666 1.00 23.69  ? 281 ILE A CB  1 
ATOM   2143  C  CG1 . ILE A  1 304 ? 101.040 96.574  113.923 1.00 15.80  ? 281 ILE A CG1 1 
ATOM   2144  C  CG2 . ILE A  1 304 ? 99.790  98.653  113.412 1.00 16.05  ? 281 ILE A CG2 1 
ATOM   2145  C  CD1 . ILE A  1 304 ? 101.099 95.074  113.684 1.00 18.20  ? 281 ILE A CD1 1 
ATOM   2146  N  N   . GLY A  1 305 ? 98.226  98.846  116.235 1.00 17.96  ? 282 GLY A N   1 
ATOM   2147  C  CA  . GLY A  1 305 ? 98.524  99.833  117.269 1.00 16.45  ? 282 GLY A CA  1 
ATOM   2148  C  C   . GLY A  1 305 ? 98.946  101.177 116.693 1.00 19.45  ? 282 GLY A C   1 
ATOM   2149  O  O   . GLY A  1 305 ? 99.771  101.864 117.268 1.00 22.32  ? 282 GLY A O   1 
ATOM   2150  N  N   . GLY A  1 306 ? 98.379  101.548 115.548 1.00 16.36  ? 283 GLY A N   1 
ATOM   2151  C  CA  . GLY A  1 306 ? 98.630  102.853 114.961 1.00 13.73  ? 283 GLY A CA  1 
ATOM   2152  C  C   . GLY A  1 306 ? 100.059 103.052 114.481 1.00 20.84  ? 283 GLY A C   1 
ATOM   2153  O  O   . GLY A  1 306 ? 100.746 102.104 114.089 1.00 21.66  ? 283 GLY A O   1 
ATOM   2154  N  N   . VAL A  1 307 ? 100.513 104.300 114.512 1.00 20.85  ? 284 VAL A N   1 
ATOM   2155  C  CA  . VAL A  1 307 ? 101.881 104.618 114.147 1.00 15.56  ? 284 VAL A CA  1 
ATOM   2156  C  C   . VAL A  1 307 ? 102.863 103.949 115.121 1.00 25.89  ? 284 VAL A C   1 
ATOM   2157  O  O   . VAL A  1 307 ? 103.856 103.355 114.690 1.00 19.57  ? 284 VAL A O   1 
ATOM   2158  C  CB  . VAL A  1 307 ? 102.083 106.131 114.091 1.00 21.38  ? 284 VAL A CB  1 
ATOM   2159  C  CG1 . VAL A  1 307 ? 103.579 106.499 113.949 1.00 20.01  ? 284 VAL A CG1 1 
ATOM   2160  C  CG2 . VAL A  1 307 ? 101.248 106.707 112.946 1.00 12.40  ? 284 VAL A CG2 1 
ATOM   2161  N  N   . SER A  1 308 ? 102.561 103.997 116.419 1.00 15.47  ? 285 SER A N   1 
ATOM   2162  C  CA  . SER A  1 308 ? 103.466 103.439 117.432 1.00 18.35  ? 285 SER A CA  1 
ATOM   2163  C  C   . SER A  1 308 ? 103.669 101.948 117.223 1.00 19.79  ? 285 SER A C   1 
ATOM   2164  O  O   . SER A  1 308 ? 104.786 101.459 117.264 1.00 24.83  ? 285 SER A O   1 
ATOM   2165  C  CB  . SER A  1 308 ? 102.937 103.687 118.855 1.00 22.12  ? 285 SER A CB  1 
ATOM   2166  O  OG  . SER A  1 308 ? 102.920 105.071 119.159 1.00 26.04  ? 285 SER A OG  1 
ATOM   2167  N  N   . GLY A  1 309 ? 102.572 101.227 117.031 1.00 21.18  ? 286 GLY A N   1 
ATOM   2168  C  CA  . GLY A  1 309 ? 102.623 99.795  116.807 1.00 6.86   ? 286 GLY A CA  1 
ATOM   2169  C  C   . GLY A  1 309 ? 103.371 99.497  115.532 1.00 16.69  ? 286 GLY A C   1 
ATOM   2170  O  O   . GLY A  1 309 ? 104.217 98.590  115.485 1.00 19.49  ? 286 GLY A O   1 
ATOM   2171  N  N   . TRP A  1 310 ? 103.069 100.264 114.488 1.00 15.63  ? 287 TRP A N   1 
ATOM   2172  C  CA  . TRP A  1 310 ? 103.755 100.071 113.220 1.00 15.37  ? 287 TRP A CA  1 
ATOM   2173  C  C   . TRP A  1 310 ? 105.262 100.181 113.395 1.00 15.51  ? 287 TRP A C   1 
ATOM   2174  O  O   . TRP A  1 310 ? 106.008 99.300  112.976 1.00 23.43  ? 287 TRP A O   1 
ATOM   2175  C  CB  . TRP A  1 310 ? 103.272 101.063 112.154 1.00 15.27  ? 287 TRP A CB  1 
ATOM   2176  C  CG  . TRP A  1 310 ? 104.027 100.911 110.895 1.00 23.38  ? 287 TRP A CG  1 
ATOM   2177  C  CD1 . TRP A  1 310 ? 105.261 101.455 110.591 1.00 13.79  ? 287 TRP A CD1 1 
ATOM   2178  C  CD2 . TRP A  1 310 ? 103.635 100.140 109.752 1.00 17.73  ? 287 TRP A CD2 1 
ATOM   2179  N  NE1 . TRP A  1 310 ? 105.636 101.071 109.326 1.00 20.96  ? 287 TRP A NE1 1 
ATOM   2180  C  CE2 . TRP A  1 310 ? 104.658 100.267 108.792 1.00 20.04  ? 287 TRP A CE2 1 
ATOM   2181  C  CE3 . TRP A  1 310 ? 102.518 99.364  109.447 1.00 15.51  ? 287 TRP A CE3 1 
ATOM   2182  C  CZ2 . TRP A  1 310 ? 104.585 99.652  107.546 1.00 18.00  ? 287 TRP A CZ2 1 
ATOM   2183  C  CZ3 . TRP A  1 310 ? 102.455 98.749  108.215 1.00 6.20   ? 287 TRP A CZ3 1 
ATOM   2184  C  CH2 . TRP A  1 310 ? 103.478 98.899  107.278 1.00 16.31  ? 287 TRP A CH2 1 
ATOM   2185  N  N   . MET A  1 311 ? 105.712 101.267 114.011 1.00 15.22  ? 288 MET A N   1 
ATOM   2186  C  CA  . MET A  1 311 ? 107.140 101.509 114.143 1.00 18.56  ? 288 MET A CA  1 
ATOM   2187  C  C   . MET A  1 311 ? 107.827 100.368 114.904 1.00 19.91  ? 288 MET A C   1 
ATOM   2188  O  O   . MET A  1 311 ? 108.931 99.953  114.556 1.00 23.74  ? 288 MET A O   1 
ATOM   2189  C  CB  . MET A  1 311 ? 107.436 102.883 114.787 1.00 15.61  ? 288 MET A CB  1 
ATOM   2190  C  CG  . MET A  1 311 ? 107.072 104.107 113.898 1.00 18.17  ? 288 MET A CG  1 
ATOM   2191  S  SD  . MET A  1 311 ? 107.586 104.010 112.150 1.00 27.07  ? 288 MET A SD  1 
ATOM   2192  C  CE  . MET A  1 311 ? 109.389 104.119 112.258 1.00 18.18  ? 288 MET A CE  1 
ATOM   2193  N  N   . ARG A  1 312 ? 107.160 99.828  115.912 1.00 15.55  ? 289 ARG A N   1 
ATOM   2194  C  CA  . ARG A  1 312 ? 107.738 98.719  116.653 1.00 21.34  ? 289 ARG A CA  1 
ATOM   2195  C  C   . ARG A  1 312 ? 107.744 97.469  115.784 1.00 20.44  ? 289 ARG A C   1 
ATOM   2196  O  O   . ARG A  1 312 ? 108.691 96.698  115.814 1.00 20.76  ? 289 ARG A O   1 
ATOM   2197  C  CB  . ARG A  1 312 ? 106.990 98.488  117.971 1.00 17.33  ? 289 ARG A CB  1 
ATOM   2198  C  CG  . ARG A  1 312 ? 107.273 99.580  118.989 1.00 21.22  ? 289 ARG A CG  1 
ATOM   2199  C  CD  . ARG A  1 312 ? 106.331 99.531  120.187 1.00 22.71  ? 289 ARG A CD  1 
ATOM   2200  N  NE  . ARG A  1 312 ? 106.428 100.773 120.943 1.00 35.12  ? 289 ARG A NE  1 
ATOM   2201  C  CZ  . ARG A  1 312 ? 105.656 101.094 121.976 1.00 44.60  ? 289 ARG A CZ  1 
ATOM   2202  N  NH1 . ARG A  1 312 ? 104.723 100.251 122.391 1.00 47.77  ? 289 ARG A NH1 1 
ATOM   2203  N  NH2 . ARG A  1 312 ? 105.821 102.261 122.594 1.00 40.45  ? 289 ARG A NH2 1 
ATOM   2204  N  N   . ALA A  1 313 ? 106.678 97.291  115.009 1.00 15.97  ? 290 ALA A N   1 
ATOM   2205  C  CA  . ALA A  1 313 ? 106.552 96.172  114.099 1.00 15.34  ? 290 ALA A CA  1 
ATOM   2206  C  C   . ALA A  1 313 ? 107.579 96.292  112.968 1.00 18.42  ? 290 ALA A C   1 
ATOM   2207  O  O   . ALA A  1 313 ? 108.098 95.288  112.490 1.00 18.68  ? 290 ALA A O   1 
ATOM   2208  C  CB  . ALA A  1 313 ? 105.133 96.111  113.529 1.00 21.52  ? 290 ALA A CB  1 
ATOM   2209  N  N   . ALA A  1 314 ? 107.869 97.513  112.534 1.00 13.72  ? 291 ALA A N   1 
ATOM   2210  C  CA  . ALA A  1 314 ? 108.893 97.699  111.501 1.00 22.43  ? 291 ALA A CA  1 
ATOM   2211  C  C   . ALA A  1 314 ? 110.254 97.230  112.031 1.00 27.65  ? 291 ALA A C   1 
ATOM   2212  O  O   . ALA A  1 314 ? 111.078 96.703  111.279 1.00 23.66  ? 291 ALA A O   1 
ATOM   2213  C  CB  . ALA A  1 314 ? 108.962 99.169  111.037 1.00 12.10  ? 291 ALA A CB  1 
ATOM   2214  N  N   . GLY A  1 315 ? 110.474 97.424  113.332 1.00 19.00  ? 292 GLY A N   1 
ATOM   2215  C  CA  . GLY A  1 315 ? 111.692 96.979  113.985 1.00 14.78  ? 292 GLY A CA  1 
ATOM   2216  C  C   . GLY A  1 315 ? 111.819 95.465  113.960 1.00 21.46  ? 292 GLY A C   1 
ATOM   2217  O  O   . GLY A  1 315 ? 112.872 94.920  113.630 1.00 20.67  ? 292 GLY A O   1 
ATOM   2218  N  N   . VAL A  1 316 ? 110.732 94.783  114.302 1.00 16.32  ? 293 VAL A N   1 
ATOM   2219  C  CA  . VAL A  1 316 ? 110.708 93.337  114.266 1.00 14.69  ? 293 VAL A CA  1 
ATOM   2220  C  C   . VAL A  1 316 ? 110.916 92.813  112.851 1.00 19.18  ? 293 VAL A C   1 
ATOM   2221  O  O   . VAL A  1 316 ? 111.738 91.941  112.628 1.00 22.38  ? 293 VAL A O   1 
ATOM   2222  C  CB  . VAL A  1 316 ? 109.369 92.808  114.750 1.00 19.18  ? 293 VAL A CB  1 
ATOM   2223  C  CG1 . VAL A  1 316 ? 109.398 91.313  114.742 1.00 15.22  ? 293 VAL A CG1 1 
ATOM   2224  C  CG2 . VAL A  1 316 ? 109.057 93.332  116.147 1.00 24.48  ? 293 VAL A CG2 1 
ATOM   2225  N  N   . ALA A  1 317 ? 110.127 93.319  111.909 1.00 17.98  ? 294 ALA A N   1 
ATOM   2226  C  CA  . ALA A  1 317 ? 110.214 92.915  110.511 1.00 19.74  ? 294 ALA A CA  1 
ATOM   2227  C  C   . ALA A  1 317 ? 111.609 93.210  109.990 1.00 18.56  ? 294 ALA A C   1 
ATOM   2228  O  O   . ALA A  1 317 ? 112.183 92.397  109.280 1.00 17.96  ? 294 ALA A O   1 
ATOM   2229  C  CB  . ALA A  1 317 ? 109.188 93.666  109.676 1.00 19.68  ? 294 ALA A CB  1 
ATOM   2230  N  N   . GLY A  1 318 ? 112.139 94.382  110.345 1.00 19.72  ? 295 GLY A N   1 
ATOM   2231  C  CA  . GLY A  1 318 ? 113.498 94.770  109.991 1.00 11.93  ? 295 GLY A CA  1 
ATOM   2232  C  C   . GLY A  1 318 ? 114.539 93.724  110.362 1.00 18.77  ? 295 GLY A C   1 
ATOM   2233  O  O   . GLY A  1 318 ? 115.374 93.344  109.535 1.00 27.04  ? 295 GLY A O   1 
ATOM   2234  N  N   . ALA A  1 319 ? 114.470 93.235  111.599 1.00 21.06  ? 296 ALA A N   1 
ATOM   2235  C  CA  . ALA A  1 319 ? 115.439 92.273  112.103 1.00 17.65  ? 296 ALA A CA  1 
ATOM   2236  C  C   . ALA A  1 319 ? 115.352 90.927  111.382 1.00 22.90  ? 296 ALA A C   1 
ATOM   2237  O  O   . ALA A  1 319 ? 116.380 90.309  111.103 1.00 22.07  ? 296 ALA A O   1 
ATOM   2238  C  CB  . ALA A  1 319 ? 115.266 92.091  113.602 1.00 15.15  ? 296 ALA A CB  1 
ATOM   2239  N  N   . TRP A  1 320 ? 114.129 90.462  111.119 1.00 18.04  ? 297 TRP A N   1 
ATOM   2240  C  CA  . TRP A  1 320 ? 113.901 89.207  110.408 1.00 19.56  ? 297 TRP A CA  1 
ATOM   2241  C  C   . TRP A  1 320 ? 114.180 89.397  108.918 1.00 21.90  ? 297 TRP A C   1 
ATOM   2242  O  O   . TRP A  1 320 ? 114.394 88.439  108.186 1.00 23.22  ? 297 TRP A O   1 
ATOM   2243  C  CB  . TRP A  1 320 ? 112.452 88.740  110.557 1.00 14.13  ? 297 TRP A CB  1 
ATOM   2244  C  CG  . TRP A  1 320 ? 112.111 87.998  111.831 1.00 14.65  ? 297 TRP A CG  1 
ATOM   2245  C  CD1 . TRP A  1 320 ? 111.723 88.547  113.025 1.00 11.68  ? 297 TRP A CD1 1 
ATOM   2246  C  CD2 . TRP A  1 320 ? 112.096 86.576  112.026 1.00 17.03  ? 297 TRP A CD2 1 
ATOM   2247  N  NE1 . TRP A  1 320 ? 111.472 87.560  113.939 1.00 13.97  ? 297 TRP A NE1 1 
ATOM   2248  C  CE2 . TRP A  1 320 ? 111.705 86.341  113.356 1.00 17.62  ? 297 TRP A CE2 1 
ATOM   2249  C  CE3 . TRP A  1 320 ? 112.394 85.481  111.208 1.00 21.48  ? 297 TRP A CE3 1 
ATOM   2250  C  CZ2 . TRP A  1 320 ? 111.591 85.050  113.890 1.00 19.48  ? 297 TRP A CZ2 1 
ATOM   2251  C  CZ3 . TRP A  1 320 ? 112.274 84.206  111.734 1.00 26.18  ? 297 TRP A CZ3 1 
ATOM   2252  C  CH2 . TRP A  1 320 ? 111.875 84.002  113.069 1.00 16.19  ? 297 TRP A CH2 1 
ATOM   2253  N  N   . GLY A  1 321 ? 114.152 90.641  108.469 1.00 17.97  ? 298 GLY A N   1 
ATOM   2254  C  CA  . GLY A  1 321 ? 114.373 90.944  107.071 1.00 16.00  ? 298 GLY A CA  1 
ATOM   2255  C  C   . GLY A  1 321 ? 113.189 90.615  106.182 1.00 18.07  ? 298 GLY A C   1 
ATOM   2256  O  O   . GLY A  1 321 ? 113.349 90.334  104.998 1.00 21.01  ? 298 GLY A O   1 
ATOM   2257  N  N   . ILE A  1 322 ? 111.998 90.642  106.759 1.00 15.87  ? 299 ILE A N   1 
ATOM   2258  C  CA  . ILE A  1 322 ? 110.807 90.276  106.027 1.00 16.78  ? 299 ILE A CA  1 
ATOM   2259  C  C   . ILE A  1 322 ? 110.172 91.522  105.417 1.00 18.43  ? 299 ILE A C   1 
ATOM   2260  O  O   . ILE A  1 322 ? 109.967 92.514  106.113 1.00 19.67  ? 299 ILE A O   1 
ATOM   2261  C  CB  . ILE A  1 322 ? 109.812 89.468  106.920 1.00 20.08  ? 299 ILE A CB  1 
ATOM   2262  C  CG1 . ILE A  1 322 ? 108.511 89.238  106.185 1.00 26.36  ? 299 ILE A CG1 1 
ATOM   2263  C  CG2 . ILE A  1 322 ? 109.498 90.194  108.182 1.00 25.24  ? 299 ILE A CG2 1 
ATOM   2264  C  CD1 . ILE A  1 322 ? 107.570 88.316  106.936 1.00 40.17  ? 299 ILE A CD1 1 
ATOM   2265  N  N   . PRO A  1 323 ? 109.889 91.482  104.096 1.00 12.86  ? 300 PRO A N   1 
ATOM   2266  C  CA  . PRO A  1 323 ? 109.323 92.650  103.406 1.00 16.40  ? 300 PRO A CA  1 
ATOM   2267  C  C   . PRO A  1 323 ? 107.934 93.011  103.985 1.00 24.48  ? 300 PRO A C   1 
ATOM   2268  O  O   . PRO A  1 323 ? 107.092 92.132  104.240 1.00 18.47  ? 300 PRO A O   1 
ATOM   2269  C  CB  . PRO A  1 323 ? 109.226 92.191  101.942 1.00 16.58  ? 300 PRO A CB  1 
ATOM   2270  C  CG  . PRO A  1 323 ? 110.168 91.002  101.838 1.00 22.51  ? 300 PRO A CG  1 
ATOM   2271  C  CD  . PRO A  1 323 ? 110.052 90.333  103.190 1.00 15.99  ? 300 PRO A CD  1 
ATOM   2272  N  N   . MET A  1 324 ? 107.709 94.302  104.199 1.00 14.55  ? 301 MET A N   1 
ATOM   2273  C  CA  . MET A  1 324 ? 106.557 94.746  104.973 1.00 16.31  ? 301 MET A CA  1 
ATOM   2274  C  C   . MET A  1 324 ? 105.695 95.674  104.153 1.00 18.68  ? 301 MET A C   1 
ATOM   2275  O  O   . MET A  1 324 ? 106.173 96.680  103.622 1.00 15.10  ? 301 MET A O   1 
ATOM   2276  C  CB  . MET A  1 324 ? 107.028 95.464  106.230 1.00 16.97  ? 301 MET A CB  1 
ATOM   2277  C  CG  . MET A  1 324 ? 105.928 95.882  107.187 1.00 15.61  ? 301 MET A CG  1 
ATOM   2278  S  SD  . MET A  1 324 ? 106.723 96.375  108.741 1.00 29.12  ? 301 MET A SD  1 
ATOM   2279  C  CE  . MET A  1 324 ? 105.326 96.915  109.729 1.00 15.15  ? 301 MET A CE  1 
ATOM   2280  N  N   . SER A  1 325 ? 104.420 95.331  104.033 1.00 13.95  ? 302 SER A N   1 
ATOM   2281  C  CA  . SER A  1 325 ? 103.489 96.191  103.303 1.00 20.05  ? 302 SER A CA  1 
ATOM   2282  C  C   . SER A  1 325 ? 102.435 96.768  104.245 1.00 24.56  ? 302 SER A C   1 
ATOM   2283  O  O   . SER A  1 325 ? 102.411 96.446  105.439 1.00 27.41  ? 302 SER A O   1 
ATOM   2284  C  CB  . SER A  1 325 ? 102.835 95.420  102.148 1.00 21.13  ? 302 SER A CB  1 
ATOM   2285  O  OG  . SER A  1 325 ? 103.798 95.014  101.183 1.00 20.42  ? 302 SER A OG  1 
ATOM   2286  N  N   . THR A  1 326 ? 101.562 97.607  103.695 1.00 22.77  ? 303 THR A N   1 
ATOM   2287  C  CA  . THR A  1 326 ? 100.476 98.218  104.454 1.00 22.01  ? 303 THR A CA  1 
ATOM   2288  C  C   . THR A  1 326 ? 99.100  97.604  104.175 1.00 27.72  ? 303 THR A C   1 
ATOM   2289  O  O   . THR A  1 326 ? 98.901  96.822  103.228 1.00 18.25  ? 303 THR A O   1 
ATOM   2290  C  CB  . THR A  1 326 ? 100.356 99.701  104.134 1.00 15.00  ? 303 THR A CB  1 
ATOM   2291  O  OG1 . THR A  1 326 ? 100.019 99.848  102.754 1.00 19.78  ? 303 THR A OG1 1 
ATOM   2292  C  CG2 . THR A  1 326 ? 101.677 100.430 104.426 1.00 17.21  ? 303 THR A CG2 1 
ATOM   2293  N  N   . HIS A  1 327 ? 98.146  97.975  105.017 1.00 21.28  ? 304 HIS A N   1 
ATOM   2294  C  CA  . HIS A  1 327 ? 96.760  97.607  104.800 1.00 16.06  ? 304 HIS A CA  1 
ATOM   2295  C  C   . HIS A  1 327 ? 95.854  98.750  105.241 1.00 24.60  ? 304 HIS A C   1 
ATOM   2296  O  O   . HIS A  1 327 ? 95.902  99.183  106.395 1.00 22.71  ? 304 HIS A O   1 
ATOM   2297  C  CB  . HIS A  1 327 ? 96.408  96.336  105.548 1.00 17.16  ? 304 HIS A CB  1 
ATOM   2298  C  CG  . HIS A  1 327 ? 94.970  95.954  105.417 1.00 27.11  ? 304 HIS A CG  1 
ATOM   2299  N  ND1 . HIS A  1 327 ? 94.013  96.344  106.327 1.00 27.36  ? 304 HIS A ND1 1 
ATOM   2300  C  CD2 . HIS A  1 327 ? 94.321  95.237  104.468 1.00 27.77  ? 304 HIS A CD2 1 
ATOM   2301  C  CE1 . HIS A  1 327 ? 92.840  95.859  105.959 1.00 30.20  ? 304 HIS A CE1 1 
ATOM   2302  N  NE2 . HIS A  1 327 ? 92.999  95.187  104.832 1.00 28.22  ? 304 HIS A NE2 1 
ATOM   2303  N  N   . LEU A  1 328 ? 95.057  99.244  104.294 1.00 31.24  ? 305 LEU A N   1 
ATOM   2304  C  CA  . LEU A  1 328 ? 94.211  100.424 104.474 1.00 24.98  ? 305 LEU A CA  1 
ATOM   2305  C  C   . LEU A  1 328 ? 95.015  101.675 104.889 1.00 24.80  ? 305 LEU A C   1 
ATOM   2306  O  O   . LEU A  1 328 ? 96.249  101.662 104.863 1.00 24.02  ? 305 LEU A O   1 
ATOM   2307  C  CB  . LEU A  1 328 ? 93.055  100.118 105.432 1.00 23.26  ? 305 LEU A CB  1 
ATOM   2308  C  CG  . LEU A  1 328 ? 92.086  99.059  104.902 1.00 24.32  ? 305 LEU A CG  1 
ATOM   2309  C  CD1 . LEU A  1 328 ? 91.048  98.693  105.951 1.00 20.55  ? 305 LEU A CD1 1 
ATOM   2310  C  CD2 . LEU A  1 328 ? 91.409  99.521  103.594 1.00 21.94  ? 305 LEU A CD2 1 
ATOM   2311  N  N   . TYR A  1 329 ? 94.310  102.757 105.216 1.00 22.67  ? 306 TYR A N   1 
ATOM   2312  C  CA  . TYR A  1 329 ? 94.929  104.001 105.679 1.00 22.22  ? 306 TYR A CA  1 
ATOM   2313  C  C   . TYR A  1 329 ? 96.096  104.472 104.812 1.00 28.38  ? 306 TYR A C   1 
ATOM   2314  O  O   . TYR A  1 329 ? 97.184  104.655 105.321 1.00 26.41  ? 306 TYR A O   1 
ATOM   2315  C  CB  . TYR A  1 329 ? 95.416  103.822 107.117 1.00 14.80  ? 306 TYR A CB  1 
ATOM   2316  C  CG  . TYR A  1 329 ? 94.377  103.187 108.002 1.00 27.24  ? 306 TYR A CG  1 
ATOM   2317  C  CD1 . TYR A  1 329 ? 93.521  103.966 108.762 1.00 29.47  ? 306 TYR A CD1 1 
ATOM   2318  C  CD2 . TYR A  1 329 ? 94.239  101.807 108.065 1.00 31.42  ? 306 TYR A CD2 1 
ATOM   2319  C  CE1 . TYR A  1 329 ? 92.557  103.390 109.568 1.00 28.04  ? 306 TYR A CE1 1 
ATOM   2320  C  CE2 . TYR A  1 329 ? 93.278  101.221 108.867 1.00 33.91  ? 306 TYR A CE2 1 
ATOM   2321  C  CZ  . TYR A  1 329 ? 92.435  102.024 109.616 1.00 31.80  ? 306 TYR A CZ  1 
ATOM   2322  O  OH  . TYR A  1 329 ? 91.475  101.457 110.422 1.00 27.31  ? 306 TYR A OH  1 
ATOM   2323  N  N   . PRO A  1 330 ? 95.868  104.674 103.503 1.00 27.57  ? 307 PRO A N   1 
ATOM   2324  C  CA  . PRO A  1 330 ? 96.930  105.049 102.562 1.00 23.21  ? 307 PRO A CA  1 
ATOM   2325  C  C   . PRO A  1 330 ? 97.752  106.288 102.977 1.00 25.48  ? 307 PRO A C   1 
ATOM   2326  O  O   . PRO A  1 330 ? 98.934  106.373 102.646 1.00 23.13  ? 307 PRO A O   1 
ATOM   2327  C  CB  . PRO A  1 330 ? 96.165  105.337 101.267 1.00 30.23  ? 307 PRO A CB  1 
ATOM   2328  C  CG  . PRO A  1 330 ? 94.933  104.574 101.377 1.00 34.75  ? 307 PRO A CG  1 
ATOM   2329  C  CD  . PRO A  1 330 ? 94.570  104.532 102.832 1.00 31.04  ? 307 PRO A CD  1 
ATOM   2330  N  N   . GLU A  1 331 ? 97.150  107.242 103.673 1.00 25.41  ? 308 GLU A N   1 
ATOM   2331  C  CA  . GLU A  1 331 ? 97.884  108.451 104.030 1.00 26.86  ? 308 GLU A CA  1 
ATOM   2332  C  C   . GLU A  1 331 ? 98.885  108.174 105.157 1.00 26.55  ? 308 GLU A C   1 
ATOM   2333  O  O   . GLU A  1 331 ? 100.034 108.589 105.081 1.00 27.82  ? 308 GLU A O   1 
ATOM   2334  C  CB  . GLU A  1 331 ? 96.924  109.580 104.423 1.00 29.18  ? 308 GLU A CB  1 
ATOM   2335  C  CG  . GLU A  1 331 ? 95.933  109.961 103.338 1.00 28.44  ? 308 GLU A CG  1 
ATOM   2336  C  CD  . GLU A  1 331 ? 94.742  109.030 103.287 1.00 42.85  ? 308 GLU A CD  1 
ATOM   2337  O  OE1 . GLU A  1 331 ? 94.500  108.309 104.288 1.00 41.84  ? 308 GLU A OE1 1 
ATOM   2338  O  OE2 . GLU A  1 331 ? 94.039  109.031 102.249 1.00 41.27  ? 308 GLU A OE2 1 
ATOM   2339  N  N   . VAL A  1 332 ? 98.449  107.474 106.203 1.00 28.95  ? 309 VAL A N   1 
ATOM   2340  C  CA  . VAL A  1 332 ? 99.343  107.148 107.311 1.00 25.27  ? 309 VAL A CA  1 
ATOM   2341  C  C   . VAL A  1 332 ? 100.375 106.168 106.806 1.00 21.94  ? 309 VAL A C   1 
ATOM   2342  O  O   . VAL A  1 332 ? 101.541 106.238 107.178 1.00 17.72  ? 309 VAL A O   1 
ATOM   2343  C  CB  . VAL A  1 332 ? 98.608  106.507 108.512 1.00 24.43  ? 309 VAL A CB  1 
ATOM   2344  C  CG1 . VAL A  1 332 ? 99.607  106.078 109.577 1.00 20.12  ? 309 VAL A CG1 1 
ATOM   2345  C  CG2 . VAL A  1 332 ? 97.631  107.485 109.112 1.00 34.44  ? 309 VAL A CG2 1 
ATOM   2346  N  N   . GLY A  1 333 ? 99.927  105.251 105.955 1.00 15.22  ? 310 GLY A N   1 
ATOM   2347  C  CA  . GLY A  1 333 ? 100.785 104.217 105.418 1.00 17.20  ? 310 GLY A CA  1 
ATOM   2348  C  C   . GLY A  1 333 ? 101.945 104.807 104.635 1.00 22.32  ? 310 GLY A C   1 
ATOM   2349  O  O   . GLY A  1 333 ? 103.090 104.421 104.833 1.00 27.59  ? 310 GLY A O   1 
ATOM   2350  N  N   . ALA A  1 334 ? 101.656 105.751 103.748 1.00 20.21  ? 311 ALA A N   1 
ATOM   2351  C  CA  . ALA A  1 334 ? 102.706 106.330 102.924 1.00 17.55  ? 311 ALA A CA  1 
ATOM   2352  C  C   . ALA A  1 334 ? 103.730 107.019 103.822 1.00 14.86  ? 311 ALA A C   1 
ATOM   2353  O  O   . ALA A  1 334 ? 104.921 106.976 103.549 1.00 20.91  ? 311 ALA A O   1 
ATOM   2354  C  CB  . ALA A  1 334 ? 102.116 107.324 101.911 1.00 17.16  ? 311 ALA A CB  1 
ATOM   2355  N  N   . HIS A  1 335 ? 103.260 107.655 104.892 1.00 20.09  ? 312 HIS A N   1 
ATOM   2356  C  CA  . HIS A  1 335 ? 104.159 108.354 105.805 1.00 18.01  ? 312 HIS A CA  1 
ATOM   2357  C  C   . HIS A  1 335 ? 105.123 107.397 106.480 1.00 23.49  ? 312 HIS A C   1 
ATOM   2358  O  O   . HIS A  1 335 ? 106.318 107.645 106.492 1.00 29.68  ? 312 HIS A O   1 
ATOM   2359  C  CB  . HIS A  1 335 ? 103.394 109.168 106.849 1.00 16.84  ? 312 HIS A CB  1 
ATOM   2360  C  CG  . HIS A  1 335 ? 103.066 110.557 106.399 1.00 26.31  ? 312 HIS A CG  1 
ATOM   2361  N  ND1 . HIS A  1 335 ? 103.898 111.633 106.642 1.00 20.21  ? 312 HIS A ND1 1 
ATOM   2362  C  CD2 . HIS A  1 335 ? 102.011 111.043 105.697 1.00 24.10  ? 312 HIS A CD2 1 
ATOM   2363  C  CE1 . HIS A  1 335 ? 103.366 112.722 106.110 1.00 25.43  ? 312 HIS A CE1 1 
ATOM   2364  N  NE2 . HIS A  1 335 ? 102.220 112.393 105.536 1.00 25.36  ? 312 HIS A NE2 1 
ATOM   2365  N  N   . VAL A  1 336 ? 104.626 106.288 107.012 1.00 21.30  ? 313 VAL A N   1 
ATOM   2366  C  CA  . VAL A  1 336 ? 105.519 105.403 107.740 1.00 26.15  ? 313 VAL A CA  1 
ATOM   2367  C  C   . VAL A  1 336 ? 106.369 104.557 106.799 1.00 24.71  ? 313 VAL A C   1 
ATOM   2368  O  O   . VAL A  1 336 ? 107.513 104.226 107.135 1.00 19.28  ? 313 VAL A O   1 
ATOM   2369  C  CB  . VAL A  1 336 ? 104.784 104.525 108.758 1.00 26.36  ? 313 VAL A CB  1 
ATOM   2370  C  CG1 . VAL A  1 336 ? 104.047 105.404 109.764 1.00 24.43  ? 313 VAL A CG1 1 
ATOM   2371  C  CG2 . VAL A  1 336 ? 103.829 103.593 108.048 1.00 22.92  ? 313 VAL A CG2 1 
ATOM   2372  N  N   . MET A  1 337 ? 105.832 104.228 105.622 1.00 13.01  ? 314 MET A N   1 
ATOM   2373  C  CA  . MET A  1 337 ? 106.615 103.484 104.632 1.00 21.88  ? 314 MET A CA  1 
ATOM   2374  C  C   . MET A  1 337 ? 107.882 104.218 104.233 1.00 25.42  ? 314 MET A C   1 
ATOM   2375  O  O   . MET A  1 337 ? 108.870 103.591 103.878 1.00 26.82  ? 314 MET A O   1 
ATOM   2376  C  CB  . MET A  1 337 ? 105.790 103.172 103.395 1.00 18.88  ? 314 MET A CB  1 
ATOM   2377  C  CG  . MET A  1 337 ? 104.717 102.158 103.689 1.00 26.34  ? 314 MET A CG  1 
ATOM   2378  S  SD  . MET A  1 337 ? 105.339 100.471 103.733 1.00 28.70  ? 314 MET A SD  1 
ATOM   2379  C  CE  . MET A  1 337 ? 105.475 100.187 101.967 1.00 28.31  ? 314 MET A CE  1 
ATOM   2380  N  N   . ARG A  1 338 ? 107.844 105.545 104.296 1.00 26.81  ? 315 ARG A N   1 
ATOM   2381  C  CA  . ARG A  1 338 ? 109.012 106.368 104.013 1.00 23.04  ? 315 ARG A CA  1 
ATOM   2382  C  C   . ARG A  1 338 ? 110.103 106.152 105.057 1.00 26.51  ? 315 ARG A C   1 
ATOM   2383  O  O   . ARG A  1 338 ? 111.254 106.473 104.813 1.00 23.53  ? 315 ARG A O   1 
ATOM   2384  C  CB  . ARG A  1 338 ? 108.639 107.857 103.949 1.00 20.20  ? 315 ARG A CB  1 
ATOM   2385  C  CG  . ARG A  1 338 ? 107.686 108.223 102.811 1.00 25.71  ? 315 ARG A CG  1 
ATOM   2386  C  CD  . ARG A  1 338 ? 108.405 108.260 101.467 1.00 25.12  ? 315 ARG A CD  1 
ATOM   2387  N  NE  . ARG A  1 338 ? 109.600 109.092 101.547 1.00 32.74  ? 315 ARG A NE  1 
ATOM   2388  C  CZ  . ARG A  1 338 ? 110.522 109.174 100.594 1.00 34.07  ? 315 ARG A CZ  1 
ATOM   2389  N  NH1 . ARG A  1 338 ? 110.381 108.478 99.471  1.00 25.81  ? 315 ARG A NH1 1 
ATOM   2390  N  NH2 . ARG A  1 338 ? 111.579 109.957 100.768 1.00 25.21  ? 315 ARG A NH2 1 
ATOM   2391  N  N   . VAL A  1 339 ? 109.765 105.608 106.219 1.00 16.74  ? 316 VAL A N   1 
ATOM   2392  C  CA  . VAL A  1 339 ? 110.836 105.317 107.176 1.00 15.87  ? 316 VAL A CA  1 
ATOM   2393  C  C   . VAL A  1 339 ? 110.896 103.849 107.596 1.00 20.20  ? 316 VAL A C   1 
ATOM   2394  O  O   . VAL A  1 339 ? 111.479 103.523 108.624 1.00 30.38  ? 316 VAL A O   1 
ATOM   2395  C  CB  . VAL A  1 339 ? 110.760 106.208 108.442 1.00 21.97  ? 316 VAL A CB  1 
ATOM   2396  C  CG1 . VAL A  1 339 ? 110.896 107.669 108.074 1.00 27.91  ? 316 VAL A CG1 1 
ATOM   2397  C  CG2 . VAL A  1 339 ? 109.460 105.965 109.195 1.00 8.08   ? 316 VAL A CG2 1 
ATOM   2398  N  N   . THR A  1 340 ? 110.286 102.972 106.802 1.00 24.72  ? 317 THR A N   1 
ATOM   2399  C  CA  . THR A  1 340 ? 110.228 101.542 107.103 1.00 16.40  ? 317 THR A CA  1 
ATOM   2400  C  C   . THR A  1 340 ? 111.321 100.801 106.318 1.00 24.44  ? 317 THR A C   1 
ATOM   2401  O  O   . THR A  1 340 ? 111.373 100.857 105.083 1.00 22.92  ? 317 THR A O   1 
ATOM   2402  C  CB  . THR A  1 340 ? 108.837 100.952 106.802 1.00 15.13  ? 317 THR A CB  1 
ATOM   2403  O  OG1 . THR A  1 340 ? 107.858 101.635 107.591 1.00 20.07  ? 317 THR A OG1 1 
ATOM   2404  C  CG2 . THR A  1 340 ? 108.784 99.458  107.131 1.00 7.80   ? 317 THR A CG2 1 
ATOM   2405  N  N   . GLU A  1 341 ? 112.191 100.119 107.055 1.00 24.31  ? 318 GLU A N   1 
ATOM   2406  C  CA  . GLU A  1 341 ? 113.431 99.571  106.510 1.00 24.89  ? 318 GLU A CA  1 
ATOM   2407  C  C   . GLU A  1 341 ? 113.142 98.597  105.375 1.00 27.68  ? 318 GLU A C   1 
ATOM   2408  O  O   . GLU A  1 341 ? 113.795 98.634  104.334 1.00 24.40  ? 318 GLU A O   1 
ATOM   2409  C  CB  . GLU A  1 341 ? 114.224 98.878  107.624 1.00 27.73  ? 318 GLU A CB  1 
ATOM   2410  C  CG  . GLU A  1 341 ? 115.615 98.379  107.226 1.00 44.72  ? 318 GLU A CG  1 
ATOM   2411  C  CD  . GLU A  1 341 ? 116.270 97.516  108.317 1.00 59.57  ? 318 GLU A CD  1 
ATOM   2412  O  OE1 . GLU A  1 341 ? 116.024 97.784  109.514 1.00 57.10  ? 318 GLU A OE1 1 
ATOM   2413  O  OE2 . GLU A  1 341 ? 117.022 96.564  107.977 1.00 60.23  ? 318 GLU A OE2 1 
ATOM   2414  N  N   . THR A  1 342 ? 112.147 97.740  105.582 1.00 18.45  ? 319 THR A N   1 
ATOM   2415  C  CA  . THR A  1 342 ? 111.804 96.724  104.612 1.00 12.00  ? 319 THR A CA  1 
ATOM   2416  C  C   . THR A  1 342 ? 110.519 97.032  103.838 1.00 15.20  ? 319 THR A C   1 
ATOM   2417  O  O   . THR A  1 342 ? 109.893 96.128  103.301 1.00 16.23  ? 319 THR A O   1 
ATOM   2418  C  CB  . THR A  1 342 ? 111.686 95.347  105.273 1.00 19.99  ? 319 THR A CB  1 
ATOM   2419  O  OG1 . THR A  1 342 ? 110.691 95.408  106.294 1.00 19.02  ? 319 THR A OG1 1 
ATOM   2420  C  CG2 . THR A  1 342 ? 113.034 94.936  105.889 1.00 10.59  ? 319 THR A CG2 1 
ATOM   2421  N  N   . ALA A  1 343 ? 110.134 98.305  103.778 1.00 11.82  ? 320 ALA A N   1 
ATOM   2422  C  CA  . ALA A  1 343 ? 108.984 98.695  102.970 1.00 15.09  ? 320 ALA A CA  1 
ATOM   2423  C  C   . ALA A  1 343 ? 108.916 97.884  101.658 1.00 25.29  ? 320 ALA A C   1 
ATOM   2424  O  O   . ALA A  1 343 ? 109.894 97.771  100.923 1.00 17.41  ? 320 ALA A O   1 
ATOM   2425  C  CB  . ALA A  1 343 ? 109.022 100.173 102.683 1.00 11.05  ? 320 ALA A CB  1 
ATOM   2426  N  N   . HIS A  1 344 ? 107.753 97.304  101.385 1.00 20.02  ? 321 HIS A N   1 
ATOM   2427  C  CA  . HIS A  1 344 ? 107.557 96.494  100.189 1.00 22.47  ? 321 HIS A CA  1 
ATOM   2428  C  C   . HIS A  1 344 ? 106.501 97.193  99.313  1.00 25.16  ? 321 HIS A C   1 
ATOM   2429  O  O   . HIS A  1 344 ? 106.874 97.974  98.451  1.00 23.40  ? 321 HIS A O   1 
ATOM   2430  C  CB  . HIS A  1 344 ? 107.171 95.056  100.581 1.00 20.48  ? 321 HIS A CB  1 
ATOM   2431  C  CG  . HIS A  1 344 ? 107.174 94.085  99.440  1.00 22.79  ? 321 HIS A CG  1 
ATOM   2432  N  ND1 . HIS A  1 344 ? 106.432 92.920  99.455  1.00 18.17  ? 321 HIS A ND1 1 
ATOM   2433  C  CD2 . HIS A  1 344 ? 107.816 94.106  98.245  1.00 20.36  ? 321 HIS A CD2 1 
ATOM   2434  C  CE1 . HIS A  1 344 ? 106.625 92.263  98.326  1.00 21.31  ? 321 HIS A CE1 1 
ATOM   2435  N  NE2 . HIS A  1 344 ? 107.453 92.965  97.571  1.00 24.91  ? 321 HIS A NE2 1 
ATOM   2436  N  N   . TRP A  1 345 ? 105.201 96.955  99.546  1.00 22.35  ? 322 TRP A N   1 
ATOM   2437  C  CA  . TRP A  1 345 ? 104.144 97.672  98.795  1.00 19.20  ? 322 TRP A CA  1 
ATOM   2438  C  C   . TRP A  1 345 ? 103.206 98.484  99.675  1.00 16.98  ? 322 TRP A C   1 
ATOM   2439  O  O   . TRP A  1 345 ? 102.910 98.092  100.798 1.00 24.50  ? 322 TRP A O   1 
ATOM   2440  C  CB  . TRP A  1 345 ? 103.255 96.708  98.019  1.00 14.85  ? 322 TRP A CB  1 
ATOM   2441  C  CG  . TRP A  1 345 ? 103.894 95.996  96.887  1.00 15.16  ? 322 TRP A CG  1 
ATOM   2442  C  CD1 . TRP A  1 345 ? 104.643 94.863  96.959  1.00 14.84  ? 322 TRP A CD1 1 
ATOM   2443  C  CD2 . TRP A  1 345 ? 103.790 96.322  95.500  1.00 15.53  ? 322 TRP A CD2 1 
ATOM   2444  N  NE1 . TRP A  1 345 ? 105.022 94.463  95.702  1.00 19.23  ? 322 TRP A NE1 1 
ATOM   2445  C  CE2 . TRP A  1 345 ? 104.516 95.346  94.788  1.00 20.37  ? 322 TRP A CE2 1 
ATOM   2446  C  CE3 . TRP A  1 345 ? 103.151 97.339  94.790  1.00 15.17  ? 322 TRP A CE3 1 
ATOM   2447  C  CZ2 . TRP A  1 345 ? 104.639 95.367  93.401  1.00 19.98  ? 322 TRP A CZ2 1 
ATOM   2448  C  CZ3 . TRP A  1 345 ? 103.266 97.353  93.418  1.00 22.14  ? 322 TRP A CZ3 1 
ATOM   2449  C  CH2 . TRP A  1 345 ? 104.005 96.369  92.736  1.00 16.68  ? 322 TRP A CH2 1 
ATOM   2450  N  N   . LEU A  1 346 ? 102.720 99.602  99.146  1.00 9.99   ? 323 LEU A N   1 
ATOM   2451  C  CA  . LEU A  1 346 ? 101.662 100.367 99.796  1.00 16.71  ? 323 LEU A CA  1 
ATOM   2452  C  C   . LEU A  1 346 ? 100.320 100.023 99.169  1.00 26.88  ? 323 LEU A C   1 
ATOM   2453  O  O   . LEU A  1 346 ? 100.150 100.146 97.957  1.00 32.10  ? 323 LEU A O   1 
ATOM   2454  C  CB  . LEU A  1 346 ? 101.909 101.867 99.681  1.00 16.86  ? 323 LEU A CB  1 
ATOM   2455  C  CG  . LEU A  1 346 ? 100.788 102.620 100.395 1.00 20.50  ? 323 LEU A CG  1 
ATOM   2456  C  CD1 . LEU A  1 346 ? 101.308 103.730 101.245 1.00 19.72  ? 323 LEU A CD1 1 
ATOM   2457  C  CD2 . LEU A  1 346 ? 99.800  103.150 99.389  1.00 22.68  ? 323 LEU A CD2 1 
ATOM   2458  N  N   . GLU A  1 347 ? 99.372  99.584  99.985  1.00 19.99  ? 324 GLU A N   1 
ATOM   2459  C  CA  . GLU A  1 347 ? 98.063  99.217  99.465  1.00 20.12  ? 324 GLU A CA  1 
ATOM   2460  C  C   . GLU A  1 347 ? 97.213  100.450 99.306  1.00 23.57  ? 324 GLU A C   1 
ATOM   2461  O  O   . GLU A  1 347 ? 96.913  101.135 100.285 1.00 23.85  ? 324 GLU A O   1 
ATOM   2462  C  CB  . GLU A  1 347 ? 97.350  98.234  100.392 1.00 28.85  ? 324 GLU A CB  1 
ATOM   2463  C  CG  . GLU A  1 347 ? 96.037  97.754  99.797  1.00 31.99  ? 324 GLU A CG  1 
ATOM   2464  C  CD  . GLU A  1 347 ? 95.121  97.086  100.792 1.00 39.04  ? 324 GLU A CD  1 
ATOM   2465  O  OE1 . GLU A  1 347 ? 94.921  95.868  100.661 1.00 32.19  ? 324 GLU A OE1 1 
ATOM   2466  O  OE2 . GLU A  1 347 ? 94.575  97.780  101.679 1.00 49.28  ? 324 GLU A OE2 1 
ATOM   2467  N  N   . TRP A  1 348 ? 96.822  100.741 98.071  1.00 26.14  ? 325 TRP A N   1 
ATOM   2468  C  CA  . TRP A  1 348 ? 96.054  101.958 97.815  1.00 23.82  ? 325 TRP A CA  1 
ATOM   2469  C  C   . TRP A  1 348 ? 94.591  101.694 97.464  1.00 22.03  ? 325 TRP A C   1 
ATOM   2470  O  O   . TRP A  1 348 ? 94.249  100.718 96.781  1.00 24.05  ? 325 TRP A O   1 
ATOM   2471  C  CB  . TRP A  1 348 ? 96.712  102.800 96.713  1.00 20.43  ? 325 TRP A CB  1 
ATOM   2472  C  CG  . TRP A  1 348 ? 95.983  104.077 96.432  1.00 25.85  ? 325 TRP A CG  1 
ATOM   2473  C  CD1 . TRP A  1 348 ? 96.208  105.298 97.008  1.00 32.24  ? 325 TRP A CD1 1 
ATOM   2474  C  CD2 . TRP A  1 348 ? 94.903  104.261 95.507  1.00 27.08  ? 325 TRP A CD2 1 
ATOM   2475  N  NE1 . TRP A  1 348 ? 95.339  106.230 96.489  1.00 34.09  ? 325 TRP A NE1 1 
ATOM   2476  C  CE2 . TRP A  1 348 ? 94.529  105.621 95.567  1.00 31.06  ? 325 TRP A CE2 1 
ATOM   2477  C  CE3 . TRP A  1 348 ? 94.220  103.409 94.628  1.00 28.74  ? 325 TRP A CE3 1 
ATOM   2478  C  CZ2 . TRP A  1 348 ? 93.500  106.148 94.785  1.00 34.64  ? 325 TRP A CZ2 1 
ATOM   2479  C  CZ3 . TRP A  1 348 ? 93.198  103.933 93.855  1.00 27.87  ? 325 TRP A CZ3 1 
ATOM   2480  C  CH2 . TRP A  1 348 ? 92.844  105.290 93.942  1.00 25.86  ? 325 TRP A CH2 1 
ATOM   2481  N  N   . GLN A  1 349 ? 93.729  102.577 97.942  1.00 18.72  ? 326 GLN A N   1 
ATOM   2482  C  CA  . GLN A  1 349 ? 92.310  102.517 97.595  1.00 25.14  ? 326 GLN A CA  1 
ATOM   2483  C  C   . GLN A  1 349 ? 91.717  103.888 97.885  1.00 25.65  ? 326 GLN A C   1 
ATOM   2484  O  O   . GLN A  1 349 ? 92.264  104.632 98.697  1.00 28.53  ? 326 GLN A O   1 
ATOM   2485  C  CB  . GLN A  1 349 ? 91.593  101.403 98.370  1.00 29.29  ? 326 GLN A CB  1 
ATOM   2486  C  CG  . GLN A  1 349 ? 90.877  101.865 99.618  1.00 44.41  ? 326 GLN A CG  1 
ATOM   2487  C  CD  . GLN A  1 349 ? 91.802  101.990 100.796 1.00 54.21  ? 326 GLN A CD  1 
ATOM   2488  O  OE1 . GLN A  1 349 ? 92.851  101.342 100.840 1.00 60.53  ? 326 GLN A OE1 1 
ATOM   2489  N  NE2 . GLN A  1 349 ? 91.428  102.834 101.763 1.00 56.20  ? 326 GLN A NE2 1 
ATOM   2490  N  N   . SER A  1 350 ? 90.632  104.251 97.204  1.00 33.69  ? 327 SER A N   1 
ATOM   2491  C  CA  . SER A  1 350 ? 90.041  105.586 97.389  1.00 22.59  ? 327 SER A CA  1 
ATOM   2492  C  C   . SER A  1 350 ? 88.732  105.598 98.188  1.00 27.79  ? 327 SER A C   1 
ATOM   2493  O  O   . SER A  1 350 ? 87.986  106.571 98.146  1.00 31.06  ? 327 SER A O   1 
ATOM   2494  C  CB  . SER A  1 350 ? 89.845  106.300 96.040  1.00 26.35  ? 327 SER A CB  1 
ATOM   2495  O  OG  . SER A  1 350 ? 89.238  105.455 95.072  1.00 26.73  ? 327 SER A OG  1 
ATOM   2496  N  N   . TRP A  1 351 ? 88.464  104.528 98.923  1.00 32.66  ? 328 TRP A N   1 
ATOM   2497  C  CA  . TRP A  1 351 ? 87.224  104.416 99.689  1.00 28.16  ? 328 TRP A CA  1 
ATOM   2498  C  C   . TRP A  1 351 ? 87.016  105.541 100.687 1.00 30.79  ? 328 TRP A C   1 
ATOM   2499  O  O   . TRP A  1 351 ? 85.882  105.900 100.979 1.00 37.93  ? 328 TRP A O   1 
ATOM   2500  C  CB  . TRP A  1 351 ? 87.165  103.079 100.415 1.00 32.50  ? 328 TRP A CB  1 
ATOM   2501  C  CG  . TRP A  1 351 ? 87.331  101.938 99.495  1.00 34.28  ? 328 TRP A CG  1 
ATOM   2502  C  CD1 . TRP A  1 351 ? 87.339  101.987 98.131  1.00 34.23  ? 328 TRP A CD1 1 
ATOM   2503  C  CD2 . TRP A  1 351 ? 87.532  100.567 99.852  1.00 34.18  ? 328 TRP A CD2 1 
ATOM   2504  N  NE1 . TRP A  1 351 ? 87.521  100.723 97.614  1.00 34.46  ? 328 TRP A NE1 1 
ATOM   2505  C  CE2 . TRP A  1 351 ? 87.644  99.834  98.650  1.00 34.86  ? 328 TRP A CE2 1 
ATOM   2506  C  CE3 . TRP A  1 351 ? 87.631  99.887  101.069 1.00 37.65  ? 328 TRP A CE3 1 
ATOM   2507  C  CZ2 . TRP A  1 351 ? 87.839  98.453  98.633  1.00 36.67  ? 328 TRP A CZ2 1 
ATOM   2508  C  CZ3 . TRP A  1 351 ? 87.827  98.515  101.049 1.00 42.29  ? 328 TRP A CZ3 1 
ATOM   2509  C  CH2 . TRP A  1 351 ? 87.926  97.813  99.840  1.00 45.58  ? 328 TRP A CH2 1 
ATOM   2510  N  N   . ALA A  1 352 ? 88.098  106.100 101.218 1.00 30.85  ? 329 ALA A N   1 
ATOM   2511  C  CA  . ALA A  1 352 ? 87.962  107.146 102.228 1.00 35.52  ? 329 ALA A CA  1 
ATOM   2512  C  C   . ALA A  1 352 ? 88.067  108.548 101.637 1.00 34.27  ? 329 ALA A C   1 
ATOM   2513  O  O   . ALA A  1 352 ? 87.830  109.541 102.327 1.00 36.83  ? 329 ALA A O   1 
ATOM   2514  C  CB  . ALA A  1 352 ? 88.982  106.952 103.337 1.00 40.74  ? 329 ALA A CB  1 
ATOM   2515  N  N   . ASP A  1 353 ? 88.406  108.615 100.353 1.00 31.05  ? 330 ASP A N   1 
ATOM   2516  C  CA  . ASP A  1 353 ? 88.651  109.884 99.656  1.00 42.78  ? 330 ASP A CA  1 
ATOM   2517  C  C   . ASP A  1 353 ? 87.603  111.000 99.831  1.00 44.41  ? 330 ASP A C   1 
ATOM   2518  O  O   . ASP A  1 353 ? 87.968  112.174 99.946  1.00 40.67  ? 330 ASP A O   1 
ATOM   2519  C  CB  . ASP A  1 353 ? 88.879  109.628 98.160  1.00 49.26  ? 330 ASP A CB  1 
ATOM   2520  C  CG  . ASP A  1 353 ? 90.346  109.415 97.815  1.00 61.45  ? 330 ASP A CG  1 
ATOM   2521  O  OD1 . ASP A  1 353 ? 91.177  109.230 98.741  1.00 62.16  ? 330 ASP A OD1 1 
ATOM   2522  O  OD2 . ASP A  1 353 ? 90.665  109.434 96.604  1.00 64.44  ? 330 ASP A OD2 1 
ATOM   2523  N  N   . PRO A  1 354 ? 86.301  110.648 99.816  1.00 41.31  ? 331 PRO A N   1 
ATOM   2524  C  CA  . PRO A  1 354 ? 85.289  111.712 99.876  1.00 32.85  ? 331 PRO A CA  1 
ATOM   2525  C  C   . PRO A  1 354 ? 85.347  112.582 101.129 1.00 39.16  ? 331 PRO A C   1 
ATOM   2526  O  O   . PRO A  1 354 ? 84.967  113.746 101.026 1.00 49.05  ? 331 PRO A O   1 
ATOM   2527  C  CB  . PRO A  1 354 ? 83.973  110.944 99.813  1.00 36.02  ? 331 PRO A CB  1 
ATOM   2528  C  CG  . PRO A  1 354 ? 84.324  109.705 99.012  1.00 37.13  ? 331 PRO A CG  1 
ATOM   2529  C  CD  . PRO A  1 354 ? 85.704  109.338 99.491  1.00 35.22  ? 331 PRO A CD  1 
ATOM   2530  N  N   . ILE A  1 355 ? 85.828  112.070 102.262 1.00 32.63  ? 332 ILE A N   1 
ATOM   2531  C  CA  . ILE A  1 355 ? 85.869  112.887 103.482 1.00 30.81  ? 332 ILE A CA  1 
ATOM   2532  C  C   . ILE A  1 355 ? 87.083  113.815 103.547 1.00 36.63  ? 332 ILE A C   1 
ATOM   2533  O  O   . ILE A  1 355 ? 87.242  114.582 104.512 1.00 31.18  ? 332 ILE A O   1 
ATOM   2534  C  CB  . ILE A  1 355 ? 85.870  112.035 104.741 1.00 37.91  ? 332 ILE A CB  1 
ATOM   2535  C  CG1 . ILE A  1 355 ? 87.209  111.302 104.870 1.00 48.28  ? 332 ILE A CG1 1 
ATOM   2536  C  CG2 . ILE A  1 355 ? 84.699  111.082 104.717 1.00 34.79  ? 332 ILE A CG2 1 
ATOM   2537  C  CD1 . ILE A  1 355 ? 87.345  110.481 106.131 1.00 57.44  ? 332 ILE A CD1 1 
ATOM   2538  N  N   . LEU A  1 356 ? 87.930  113.754 102.519 1.00 32.75  ? 333 LEU A N   1 
ATOM   2539  C  CA  . LEU A  1 356 ? 89.153  114.555 102.489 1.00 37.60  ? 333 LEU A CA  1 
ATOM   2540  C  C   . LEU A  1 356 ? 89.063  115.645 101.443 1.00 44.53  ? 333 LEU A C   1 
ATOM   2541  O  O   . LEU A  1 356 ? 88.637  115.397 100.313 1.00 47.82  ? 333 LEU A O   1 
ATOM   2542  C  CB  . LEU A  1 356 ? 90.380  113.684 102.167 1.00 33.53  ? 333 LEU A CB  1 
ATOM   2543  C  CG  . LEU A  1 356 ? 90.736  112.495 103.064 1.00 30.47  ? 333 LEU A CG  1 
ATOM   2544  C  CD1 . LEU A  1 356 ? 92.013  111.877 102.566 1.00 37.42  ? 333 LEU A CD1 1 
ATOM   2545  C  CD2 . LEU A  1 356 ? 90.895  112.937 104.498 1.00 30.82  ? 333 LEU A CD2 1 
ATOM   2546  N  N   . GLN A  1 357 ? 89.495  116.846 101.808 1.00 40.91  ? 334 GLN A N   1 
ATOM   2547  C  CA  . GLN A  1 357 ? 89.577  117.923 100.835 1.00 42.08  ? 334 GLN A CA  1 
ATOM   2548  C  C   . GLN A  1 357 ? 90.558  117.558 99.734  1.00 41.71  ? 334 GLN A C   1 
ATOM   2549  O  O   . GLN A  1 357 ? 90.237  117.679 98.551  1.00 49.61  ? 334 GLN A O   1 
ATOM   2550  C  CB  . GLN A  1 357 ? 89.965  119.240 101.502 1.00 40.73  ? 334 GLN A CB  1 
ATOM   2551  C  CG  . GLN A  1 357 ? 88.958  119.706 102.535 1.00 36.15  ? 334 GLN A CG  1 
ATOM   2552  C  CD  . GLN A  1 357 ? 89.339  121.036 103.121 1.00 51.19  ? 334 GLN A CD  1 
ATOM   2553  O  OE1 . GLN A  1 357 ? 90.115  121.789 102.525 1.00 52.56  ? 334 GLN A OE1 1 
ATOM   2554  N  NE2 . GLN A  1 357 ? 88.813  121.335 104.302 1.00 60.83  ? 334 GLN A NE2 1 
ATOM   2555  N  N   . GLU A  1 358 ? 91.752  117.102 100.107 1.00 37.21  ? 335 GLU A N   1 
ATOM   2556  C  CA  . GLU A  1 358 ? 92.683  116.605 99.089  1.00 43.81  ? 335 GLU A CA  1 
ATOM   2557  C  C   . GLU A  1 358 ? 93.459  115.333 99.444  1.00 44.76  ? 335 GLU A C   1 
ATOM   2558  O  O   . GLU A  1 358 ? 94.435  115.374 100.205 1.00 40.02  ? 335 GLU A O   1 
ATOM   2559  C  CB  . GLU A  1 358 ? 93.629  117.703 98.582  1.00 49.51  ? 335 GLU A CB  1 
ATOM   2560  C  CG  . GLU A  1 358 ? 94.293  118.533 99.640  1.00 62.55  ? 335 GLU A CG  1 
ATOM   2561  C  CD  . GLU A  1 358 ? 95.287  119.512 99.042  1.00 81.28  ? 335 GLU A CD  1 
ATOM   2562  O  OE1 . GLU A  1 358 ? 95.592  119.374 97.833  1.00 81.33  ? 335 GLU A OE1 1 
ATOM   2563  O  OE2 . GLU A  1 358 ? 95.760  120.412 99.776  1.00 88.84  ? 335 GLU A OE2 1 
ATOM   2564  N  N   . PRO A  1 359 ? 93.016  114.194 98.883  1.00 41.79  ? 336 PRO A N   1 
ATOM   2565  C  CA  . PRO A  1 359 ? 93.778  112.950 98.973  1.00 44.51  ? 336 PRO A CA  1 
ATOM   2566  C  C   . PRO A  1 359 ? 95.151  113.149 98.358  1.00 39.37  ? 336 PRO A C   1 
ATOM   2567  O  O   . PRO A  1 359 ? 95.357  114.108 97.608  1.00 30.91  ? 336 PRO A O   1 
ATOM   2568  C  CB  . PRO A  1 359 ? 92.947  111.951 98.153  1.00 44.15  ? 336 PRO A CB  1 
ATOM   2569  C  CG  . PRO A  1 359 ? 91.997  112.764 97.372  1.00 52.30  ? 336 PRO A CG  1 
ATOM   2570  C  CD  . PRO A  1 359 ? 91.746  114.009 98.165  1.00 48.34  ? 336 PRO A CD  1 
ATOM   2571  N  N   . TYR A  1 360 ? 96.090  112.275 98.705  1.00 33.12  ? 337 TYR A N   1 
ATOM   2572  C  CA  . TYR A  1 360 ? 97.441  112.395 98.198  1.00 29.77  ? 337 TYR A CA  1 
ATOM   2573  C  C   . TYR A  1 360 ? 97.430  112.144 96.683  1.00 36.95  ? 337 TYR A C   1 
ATOM   2574  O  O   . TYR A  1 360 ? 96.620  111.359 96.180  1.00 24.04  ? 337 TYR A O   1 
ATOM   2575  C  CB  . TYR A  1 360 ? 98.358  111.401 98.900  1.00 31.39  ? 337 TYR A CB  1 
ATOM   2576  C  CG  . TYR A  1 360 ? 98.581  111.654 100.383 1.00 24.53  ? 337 TYR A CG  1 
ATOM   2577  C  CD1 . TYR A  1 360 ? 97.922  112.675 101.054 1.00 23.66  ? 337 TYR A CD1 1 
ATOM   2578  C  CD2 . TYR A  1 360 ? 99.476  110.868 101.105 1.00 19.96  ? 337 TYR A CD2 1 
ATOM   2579  C  CE1 . TYR A  1 360 ? 98.149  112.901 102.409 1.00 25.69  ? 337 TYR A CE1 1 
ATOM   2580  C  CE2 . TYR A  1 360 ? 99.709  111.083 102.446 1.00 17.07  ? 337 TYR A CE2 1 
ATOM   2581  C  CZ  . TYR A  1 360 ? 99.045  112.091 103.096 1.00 22.92  ? 337 TYR A CZ  1 
ATOM   2582  O  OH  . TYR A  1 360 ? 99.279  112.273 104.433 1.00 22.66  ? 337 TYR A OH  1 
ATOM   2583  N  N   . ALA A  1 361 ? 98.320  112.821 95.961  1.00 32.12  ? 338 ALA A N   1 
ATOM   2584  C  CA  . ALA A  1 361 ? 98.408  112.676 94.511  1.00 28.34  ? 338 ALA A CA  1 
ATOM   2585  C  C   . ALA A  1 361 ? 99.030  111.340 94.134  1.00 36.83  ? 338 ALA A C   1 
ATOM   2586  O  O   . ALA A  1 361 ? 99.837  110.801 94.881  1.00 37.28  ? 338 ALA A O   1 
ATOM   2587  C  CB  . ALA A  1 361 ? 99.249  113.805 93.924  1.00 21.24  ? 338 ALA A CB  1 
ATOM   2588  N  N   . LEU A  1 362 ? 98.673  110.828 92.959  1.00 35.09  ? 339 LEU A N   1 
ATOM   2589  C  CA  . LEU A  1 362 ? 99.305  109.639 92.400  1.00 28.66  ? 339 LEU A CA  1 
ATOM   2590  C  C   . LEU A  1 362 ? 100.189 110.002 91.197  1.00 39.08  ? 339 LEU A C   1 
ATOM   2591  O  O   . LEU A  1 362 ? 99.858  110.887 90.408  1.00 44.13  ? 339 LEU A O   1 
ATOM   2592  C  CB  . LEU A  1 362 ? 98.234  108.624 91.981  1.00 28.84  ? 339 LEU A CB  1 
ATOM   2593  C  CG  . LEU A  1 362 ? 97.624  107.788 93.110  1.00 32.60  ? 339 LEU A CG  1 
ATOM   2594  C  CD1 . LEU A  1 362 ? 96.145  107.520 92.898  1.00 36.07  ? 339 LEU A CD1 1 
ATOM   2595  C  CD2 . LEU A  1 362 ? 98.374  106.491 93.255  1.00 31.83  ? 339 LEU A CD2 1 
ATOM   2596  N  N   . SER A  1 363 ? 101.315 109.317 91.063  1.00 38.93  ? 340 SER A N   1 
ATOM   2597  C  CA  . SER A  1 363 ? 102.185 109.485 89.903  1.00 37.65  ? 340 SER A CA  1 
ATOM   2598  C  C   . SER A  1 363 ? 102.839 108.155 89.505  1.00 36.24  ? 340 SER A C   1 
ATOM   2599  O  O   . SER A  1 363 ? 103.662 107.594 90.244  1.00 35.56  ? 340 SER A O   1 
ATOM   2600  C  CB  . SER A  1 363 ? 103.246 110.558 90.169  1.00 37.74  ? 340 SER A CB  1 
ATOM   2601  O  OG  . SER A  1 363 ? 104.256 110.552 89.170  1.00 40.64  ? 340 SER A OG  1 
ATOM   2602  N  N   . ASP A  1 364 ? 102.443 107.643 88.344  1.00 33.09  ? 341 ASP A N   1 
ATOM   2603  C  CA  . ASP A  1 364 ? 102.992 106.398 87.821  1.00 29.33  ? 341 ASP A CA  1 
ATOM   2604  C  C   . ASP A  1 364 ? 102.796 105.243 88.814  1.00 35.51  ? 341 ASP A C   1 
ATOM   2605  O  O   . ASP A  1 364 ? 103.629 104.338 88.907  1.00 25.79  ? 341 ASP A O   1 
ATOM   2606  C  CB  . ASP A  1 364 ? 104.479 106.571 87.480  1.00 39.38  ? 341 ASP A CB  1 
ATOM   2607  C  CG  . ASP A  1 364 ? 104.710 107.368 86.191  1.00 48.83  ? 341 ASP A CG  1 
ATOM   2608  O  OD1 . ASP A  1 364 ? 103.868 107.302 85.267  1.00 49.16  ? 341 ASP A OD1 1 
ATOM   2609  O  OD2 . ASP A  1 364 ? 105.754 108.049 86.097  1.00 49.70  ? 341 ASP A OD2 1 
ATOM   2610  N  N   . GLY A  1 365 ? 101.687 105.277 89.552  1.00 28.00  ? 342 GLY A N   1 
ATOM   2611  C  CA  . GLY A  1 365 ? 101.381 104.225 90.502  1.00 28.27  ? 342 GLY A CA  1 
ATOM   2612  C  C   . GLY A  1 365 ? 102.035 104.443 91.855  1.00 29.08  ? 342 GLY A C   1 
ATOM   2613  O  O   . GLY A  1 365 ? 101.927 103.595 92.742  1.00 32.43  ? 342 GLY A O   1 
ATOM   2614  N  N   . ASP A  1 366 ? 102.718 105.571 92.019  1.00 28.24  ? 343 ASP A N   1 
ATOM   2615  C  CA  . ASP A  1 366 ? 103.374 105.870 93.289  1.00 31.56  ? 343 ASP A CA  1 
ATOM   2616  C  C   . ASP A  1 366 ? 102.538 106.884 94.031  1.00 32.96  ? 343 ASP A C   1 
ATOM   2617  O  O   . ASP A  1 366 ? 102.123 107.878 93.444  1.00 31.26  ? 343 ASP A O   1 
ATOM   2618  C  CB  . ASP A  1 366 ? 104.779 106.450 93.078  1.00 33.60  ? 343 ASP A CB  1 
ATOM   2619  C  CG  . ASP A  1 366 ? 105.788 105.411 92.594  1.00 50.73  ? 343 ASP A CG  1 
ATOM   2620  O  OD1 . ASP A  1 366 ? 105.572 104.212 92.858  1.00 51.41  ? 343 ASP A OD1 1 
ATOM   2621  O  OD2 . ASP A  1 366 ? 106.801 105.795 91.952  1.00 55.91  ? 343 ASP A OD2 1 
ATOM   2622  N  N   . LEU A  1 367 ? 102.274 106.633 95.313  1.00 29.20  ? 344 LEU A N   1 
ATOM   2623  C  CA  . LEU A  1 367 ? 101.573 107.616 96.126  1.00 27.30  ? 344 LEU A CA  1 
ATOM   2624  C  C   . LEU A  1 367 ? 102.594 108.644 96.584  1.00 28.43  ? 344 LEU A C   1 
ATOM   2625  O  O   . LEU A  1 367 ? 103.717 108.280 96.959  1.00 28.03  ? 344 LEU A O   1 
ATOM   2626  C  CB  . LEU A  1 367 ? 100.881 106.965 97.329  1.00 18.68  ? 344 LEU A CB  1 
ATOM   2627  C  CG  . LEU A  1 367 ? 99.795  107.817 98.000  1.00 25.49  ? 344 LEU A CG  1 
ATOM   2628  C  CD1 . LEU A  1 367 ? 98.706  108.225 96.999  1.00 23.38  ? 344 LEU A CD1 1 
ATOM   2629  C  CD2 . LEU A  1 367 ? 99.185  107.098 99.194  1.00 19.76  ? 344 LEU A CD2 1 
ATOM   2630  N  N   . ILE A  1 368 ? 102.215 109.922 96.536  1.00 29.64  ? 345 ILE A N   1 
ATOM   2631  C  CA  . ILE A  1 368 ? 103.116 111.021 96.893  1.00 32.28  ? 345 ILE A CA  1 
ATOM   2632  C  C   . ILE A  1 368 ? 102.817 111.601 98.269  1.00 29.32  ? 345 ILE A C   1 
ATOM   2633  O  O   . ILE A  1 368 ? 101.777 112.195 98.464  1.00 33.77  ? 345 ILE A O   1 
ATOM   2634  C  CB  . ILE A  1 368 ? 102.980 112.199 95.921  1.00 30.86  ? 345 ILE A CB  1 
ATOM   2635  C  CG1 . ILE A  1 368 ? 103.143 111.737 94.474  1.00 30.17  ? 345 ILE A CG1 1 
ATOM   2636  C  CG2 . ILE A  1 368 ? 103.983 113.277 96.288  1.00 31.86  ? 345 ILE A CG2 1 
ATOM   2637  C  CD1 . ILE A  1 368 ? 104.336 110.857 94.271  1.00 41.10  ? 345 ILE A CD1 1 
ATOM   2638  N  N   . VAL A  1 369 ? 103.725 111.453 99.221  1.00 28.81  ? 346 VAL A N   1 
ATOM   2639  C  CA  . VAL A  1 369 ? 103.554 112.146 100.490 1.00 23.85  ? 346 VAL A CA  1 
ATOM   2640  C  C   . VAL A  1 369 ? 103.761 113.648 100.293 1.00 31.78  ? 346 VAL A C   1 
ATOM   2641  O  O   . VAL A  1 369 ? 104.848 114.092 99.924  1.00 32.57  ? 346 VAL A O   1 
ATOM   2642  C  CB  . VAL A  1 369 ? 104.541 111.645 101.556 1.00 29.03  ? 346 VAL A CB  1 
ATOM   2643  C  CG1 . VAL A  1 369 ? 104.289 112.347 102.890 1.00 32.74  ? 346 VAL A CG1 1 
ATOM   2644  C  CG2 . VAL A  1 369 ? 104.441 110.145 101.716 1.00 23.07  ? 346 VAL A CG2 1 
ATOM   2645  N  N   . PRO A  1 370 ? 102.714 114.444 100.553 1.00 32.44  ? 347 PRO A N   1 
ATOM   2646  C  CA  . PRO A  1 370 ? 102.819 115.888 100.370 1.00 26.21  ? 347 PRO A CA  1 
ATOM   2647  C  C   . PRO A  1 370 ? 103.582 116.551 101.504 1.00 33.94  ? 347 PRO A C   1 
ATOM   2648  O  O   . PRO A  1 370 ? 103.620 116.051 102.631 1.00 29.43  ? 347 PRO A O   1 
ATOM   2649  C  CB  . PRO A  1 370 ? 101.364 116.336 100.401 1.00 22.24  ? 347 PRO A CB  1 
ATOM   2650  C  CG  . PRO A  1 370 ? 100.723 115.372 101.348 1.00 23.19  ? 347 PRO A CG  1 
ATOM   2651  C  CD  . PRO A  1 370 ? 101.391 114.053 101.073 1.00 32.43  ? 347 PRO A CD  1 
ATOM   2652  N  N   . ASP A  1 371 ? 104.180 117.691 101.188 1.00 38.01  ? 348 ASP A N   1 
ATOM   2653  C  CA  . ASP A  1 371 ? 104.957 118.457 102.142 1.00 35.48  ? 348 ASP A CA  1 
ATOM   2654  C  C   . ASP A  1 371 ? 104.049 119.343 103.006 1.00 34.39  ? 348 ASP A C   1 
ATOM   2655  O  O   . ASP A  1 371 ? 104.082 120.565 102.903 1.00 38.25  ? 348 ASP A O   1 
ATOM   2656  C  CB  . ASP A  1 371 ? 105.972 119.305 101.388 1.00 45.19  ? 348 ASP A CB  1 
ATOM   2657  C  CG  . ASP A  1 371 ? 107.105 119.769 102.265 1.00 64.65  ? 348 ASP A CG  1 
ATOM   2658  O  OD1 . ASP A  1 371 ? 106.945 119.745 103.504 1.00 68.00  ? 348 ASP A OD1 1 
ATOM   2659  O  OD2 . ASP A  1 371 ? 108.155 120.160 101.713 1.00 75.11  ? 348 ASP A OD2 1 
ATOM   2660  N  N   . LYS A  1 372 ? 103.227 118.704 103.835 1.00 32.32  ? 349 LYS A N   1 
ATOM   2661  C  CA  . LYS A  1 372 ? 102.340 119.386 104.774 1.00 34.04  ? 349 LYS A CA  1 
ATOM   2662  C  C   . LYS A  1 372 ? 102.545 118.777 106.155 1.00 36.77  ? 349 LYS A C   1 
ATOM   2663  O  O   . LYS A  1 372 ? 102.955 117.627 106.257 1.00 36.71  ? 349 LYS A O   1 
ATOM   2664  C  CB  . LYS A  1 372 ? 100.884 119.193 104.357 1.00 31.82  ? 349 LYS A CB  1 
ATOM   2665  C  CG  . LYS A  1 372 ? 100.622 119.525 102.913 1.00 35.71  ? 349 LYS A CG  1 
ATOM   2666  C  CD  . LYS A  1 372 ? 99.159  119.685 102.652 1.00 34.73  ? 349 LYS A CD  1 
ATOM   2667  C  CE  . LYS A  1 372 ? 98.475  118.357 102.469 1.00 45.46  ? 349 LYS A CE  1 
ATOM   2668  N  NZ  . LYS A  1 372 ? 97.039  118.596 102.115 1.00 54.58  ? 349 LYS A NZ  1 
ATOM   2669  N  N   . PRO A  1 373 ? 102.264 119.547 107.220 1.00 36.11  ? 350 PRO A N   1 
ATOM   2670  C  CA  . PRO A  1 373 ? 102.472 119.094 108.602 1.00 33.21  ? 350 PRO A CA  1 
ATOM   2671  C  C   . PRO A  1 373 ? 101.568 117.926 108.984 1.00 31.75  ? 350 PRO A C   1 
ATOM   2672  O  O   . PRO A  1 373 ? 100.415 117.885 108.565 1.00 33.60  ? 350 PRO A O   1 
ATOM   2673  C  CB  . PRO A  1 373 ? 102.119 120.333 109.437 1.00 39.86  ? 350 PRO A CB  1 
ATOM   2674  C  CG  . PRO A  1 373 ? 102.304 121.482 108.507 1.00 40.13  ? 350 PRO A CG  1 
ATOM   2675  C  CD  . PRO A  1 373 ? 101.843 120.956 107.168 1.00 39.29  ? 350 PRO A CD  1 
ATOM   2676  N  N   . GLY A  1 374 ? 102.091 116.981 109.766 1.00 29.26  ? 351 GLY A N   1 
ATOM   2677  C  CA  . GLY A  1 374 ? 101.298 115.840 110.196 1.00 28.84  ? 351 GLY A CA  1 
ATOM   2678  C  C   . GLY A  1 374 ? 100.921 114.979 109.011 1.00 23.31  ? 351 GLY A C   1 
ATOM   2679  O  O   . GLY A  1 374 ? 101.738 114.786 108.114 1.00 26.15  ? 351 GLY A O   1 
ATOM   2680  N  N   . LEU A  1 375 ? 99.693  114.465 109.005 1.00 23.71  ? 352 LEU A N   1 
ATOM   2681  C  CA  . LEU A  1 375 ? 99.182  113.682 107.882 1.00 30.59  ? 352 LEU A CA  1 
ATOM   2682  C  C   . LEU A  1 375 ? 98.648  114.580 106.769 1.00 33.82  ? 352 LEU A C   1 
ATOM   2683  O  O   . LEU A  1 375 ? 98.397  114.120 105.655 1.00 30.11  ? 352 LEU A O   1 
ATOM   2684  C  CB  . LEU A  1 375 ? 98.095  112.708 108.331 1.00 19.83  ? 352 LEU A CB  1 
ATOM   2685  C  CG  . LEU A  1 375 ? 98.512  111.637 109.341 1.00 22.16  ? 352 LEU A CG  1 
ATOM   2686  C  CD1 . LEU A  1 375 ? 97.280  111.011 110.021 1.00 17.81  ? 352 LEU A CD1 1 
ATOM   2687  C  CD2 . LEU A  1 375 ? 99.364  110.559 108.687 1.00 25.17  ? 352 LEU A CD2 1 
ATOM   2688  N  N   . GLY A  1 376 ? 98.486  115.864 107.073 1.00 33.48  ? 353 GLY A N   1 
ATOM   2689  C  CA  . GLY A  1 376 ? 98.018  116.828 106.093 1.00 36.57  ? 353 GLY A CA  1 
ATOM   2690  C  C   . GLY A  1 376 ? 96.576  116.604 105.677 1.00 37.04  ? 353 GLY A C   1 
ATOM   2691  O  O   . GLY A  1 376 ? 96.196  116.900 104.553 1.00 41.34  ? 353 GLY A O   1 
ATOM   2692  N  N   . LEU A  1 377 ? 95.771  116.064 106.584 1.00 32.25  ? 354 LEU A N   1 
ATOM   2693  C  CA  . LEU A  1 377 ? 94.376  115.793 106.291 1.00 32.97  ? 354 LEU A CA  1 
ATOM   2694  C  C   . LEU A  1 377 ? 93.514  116.986 106.691 1.00 40.50  ? 354 LEU A C   1 
ATOM   2695  O  O   . LEU A  1 377 ? 93.684  117.542 107.780 1.00 38.03  ? 354 LEU A O   1 
ATOM   2696  C  CB  . LEU A  1 377 ? 93.896  114.569 107.075 1.00 30.38  ? 354 LEU A CB  1 
ATOM   2697  C  CG  . LEU A  1 377 ? 94.525  113.187 106.891 1.00 30.08  ? 354 LEU A CG  1 
ATOM   2698  C  CD1 . LEU A  1 377 ? 93.955  112.239 107.918 1.00 26.31  ? 354 LEU A CD1 1 
ATOM   2699  C  CD2 . LEU A  1 377 ? 94.271  112.670 105.515 1.00 32.18  ? 354 LEU A CD2 1 
ATOM   2700  N  N   . ASP A  1 378 ? 92.577  117.364 105.823 1.00 42.48  ? 355 ASP A N   1 
ATOM   2701  C  CA  . ASP A  1 378 ? 91.541  118.334 106.178 1.00 37.74  ? 355 ASP A CA  1 
ATOM   2702  C  C   . ASP A  1 378 ? 90.181  117.800 105.761 1.00 39.65  ? 355 ASP A C   1 
ATOM   2703  O  O   . ASP A  1 378 ? 89.997  117.407 104.606 1.00 39.64  ? 355 ASP A O   1 
ATOM   2704  C  CB  . ASP A  1 378 ? 91.802  119.679 105.512 1.00 41.46  ? 355 ASP A CB  1 
ATOM   2705  C  CG  . ASP A  1 378 ? 93.115  120.295 105.945 1.00 52.69  ? 355 ASP A CG  1 
ATOM   2706  O  OD1 . ASP A  1 378 ? 94.091  120.207 105.164 1.00 50.41  ? 355 ASP A OD1 1 
ATOM   2707  O  OD2 . ASP A  1 378 ? 93.169  120.866 107.062 1.00 53.69  ? 355 ASP A OD2 1 
ATOM   2708  N  N   . TRP A  1 379 ? 89.236  117.778 106.702 1.00 38.50  ? 356 TRP A N   1 
ATOM   2709  C  CA  . TRP A  1 379 ? 87.913  117.203 106.457 1.00 41.15  ? 356 TRP A CA  1 
ATOM   2710  C  C   . TRP A  1 379 ? 87.088  118.006 105.439 1.00 44.13  ? 356 TRP A C   1 
ATOM   2711  O  O   . TRP A  1 379 ? 87.010  119.233 105.525 1.00 45.36  ? 356 TRP A O   1 
ATOM   2712  C  CB  . TRP A  1 379 ? 87.110  117.123 107.758 1.00 36.60  ? 356 TRP A CB  1 
ATOM   2713  C  CG  . TRP A  1 379 ? 87.717  116.331 108.859 1.00 39.46  ? 356 TRP A CG  1 
ATOM   2714  C  CD1 . TRP A  1 379 ? 87.687  116.640 110.182 1.00 37.15  ? 356 TRP A CD1 1 
ATOM   2715  C  CD2 . TRP A  1 379 ? 88.421  115.084 108.755 1.00 42.40  ? 356 TRP A CD2 1 
ATOM   2716  N  NE1 . TRP A  1 379 ? 88.328  115.674 110.911 1.00 36.34  ? 356 TRP A NE1 1 
ATOM   2717  C  CE2 . TRP A  1 379 ? 88.792  114.707 110.060 1.00 35.81  ? 356 TRP A CE2 1 
ATOM   2718  C  CE3 . TRP A  1 379 ? 88.785  114.257 107.684 1.00 45.39  ? 356 TRP A CE3 1 
ATOM   2719  C  CZ2 . TRP A  1 379 ? 89.513  113.540 110.329 1.00 34.20  ? 356 TRP A CZ2 1 
ATOM   2720  C  CZ3 . TRP A  1 379 ? 89.496  113.098 107.952 1.00 37.20  ? 356 TRP A CZ3 1 
ATOM   2721  C  CH2 . TRP A  1 379 ? 89.853  112.752 109.265 1.00 33.49  ? 356 TRP A CH2 1 
ATOM   2722  N  N   . ASP A  1 380 ? 86.473  117.310 104.486 1.00 33.29  ? 357 ASP A N   1 
ATOM   2723  C  CA  . ASP A  1 380 ? 85.439  117.910 103.640 1.00 45.20  ? 357 ASP A CA  1 
ATOM   2724  C  C   . ASP A  1 380 ? 84.113  117.868 104.405 1.00 47.61  ? 357 ASP A C   1 
ATOM   2725  O  O   . ASP A  1 380 ? 83.387  116.865 104.354 1.00 41.87  ? 357 ASP A O   1 
ATOM   2726  C  CB  . ASP A  1 380 ? 85.316  117.140 102.321 1.00 49.96  ? 357 ASP A CB  1 
ATOM   2727  C  CG  . ASP A  1 380 ? 84.314  117.766 101.356 1.00 51.29  ? 357 ASP A CG  1 
ATOM   2728  O  OD1 . ASP A  1 380 ? 83.245  118.225 101.808 1.00 56.42  ? 357 ASP A OD1 1 
ATOM   2729  O  OD2 . ASP A  1 380 ? 84.595  117.787 100.139 1.00 49.98  ? 357 ASP A OD2 1 
ATOM   2730  N  N   . GLU A  1 381 ? 83.802  118.947 105.123 1.00 46.24  ? 358 GLU A N   1 
ATOM   2731  C  CA  . GLU A  1 381 ? 82.686  118.912 106.069 1.00 51.76  ? 358 GLU A CA  1 
ATOM   2732  C  C   . GLU A  1 381 ? 81.305  118.785 105.420 1.00 52.30  ? 358 GLU A C   1 
ATOM   2733  O  O   . GLU A  1 381 ? 80.367  118.284 106.047 1.00 52.87  ? 358 GLU A O   1 
ATOM   2734  C  CB  . GLU A  1 381 ? 82.733  120.094 107.038 1.00 47.86  ? 358 GLU A CB  1 
ATOM   2735  C  CG  . GLU A  1 381 ? 83.881  120.033 108.039 1.00 41.72  ? 358 GLU A CG  1 
ATOM   2736  C  CD  . GLU A  1 381 ? 83.703  118.970 109.125 1.00 47.14  ? 358 GLU A CD  1 
ATOM   2737  O  OE1 . GLU A  1 381 ? 82.682  118.248 109.125 1.00 46.37  ? 358 GLU A OE1 1 
ATOM   2738  O  OE2 . GLU A  1 381 ? 84.600  118.862 109.994 1.00 51.40  ? 358 GLU A OE2 1 
ATOM   2739  N  N   . ASP A  1 382 ? 81.180  119.216 104.167 1.00 48.90  ? 359 ASP A N   1 
ATOM   2740  C  CA  . ASP A  1 382 ? 79.937  119.003 103.426 1.00 51.11  ? 359 ASP A CA  1 
ATOM   2741  C  C   . ASP A  1 382 ? 79.628  117.511 103.300 1.00 51.34  ? 359 ASP A C   1 
ATOM   2742  O  O   . ASP A  1 382 ? 78.542  117.058 103.679 1.00 50.24  ? 359 ASP A O   1 
ATOM   2743  C  CB  . ASP A  1 382 ? 79.993  119.657 102.042 1.00 50.99  ? 359 ASP A CB  1 
ATOM   2744  C  CG  . ASP A  1 382 ? 80.027  121.174 102.115 1.00 64.17  ? 359 ASP A CG  1 
ATOM   2745  O  OD1 . ASP A  1 382 ? 79.622  121.739 103.158 1.00 66.61  ? 359 ASP A OD1 1 
ATOM   2746  O  OD2 . ASP A  1 382 ? 80.455  121.803 101.124 1.00 71.17  ? 359 ASP A OD2 1 
ATOM   2747  N  N   . VAL A  1 383 ? 80.589  116.747 102.787 1.00 45.11  ? 360 VAL A N   1 
ATOM   2748  C  CA  . VAL A  1 383 ? 80.392  115.311 102.624 1.00 42.66  ? 360 VAL A CA  1 
ATOM   2749  C  C   . VAL A  1 383 ? 80.213  114.613 103.967 1.00 42.59  ? 360 VAL A C   1 
ATOM   2750  O  O   . VAL A  1 383 ? 79.440  113.654 104.073 1.00 50.00  ? 360 VAL A O   1 
ATOM   2751  C  CB  . VAL A  1 383 ? 81.535  114.654 101.857 1.00 43.91  ? 360 VAL A CB  1 
ATOM   2752  C  CG1 . VAL A  1 383 ? 81.244  113.180 101.669 1.00 47.63  ? 360 VAL A CG1 1 
ATOM   2753  C  CG2 . VAL A  1 383 ? 81.717  115.333 100.516 1.00 35.35  ? 360 VAL A CG2 1 
ATOM   2754  N  N   . VAL A  1 384 ? 80.908  115.101 104.993 1.00 31.03  ? 361 VAL A N   1 
ATOM   2755  C  CA  . VAL A  1 384 ? 80.730  114.572 106.344 1.00 41.83  ? 361 VAL A CA  1 
ATOM   2756  C  C   . VAL A  1 384 ? 79.277  114.719 106.800 1.00 51.03  ? 361 VAL A C   1 
ATOM   2757  O  O   . VAL A  1 384 ? 78.629  113.739 107.189 1.00 41.91  ? 361 VAL A O   1 
ATOM   2758  C  CB  . VAL A  1 384 ? 81.642  115.287 107.373 1.00 44.15  ? 361 VAL A CB  1 
ATOM   2759  C  CG1 . VAL A  1 384 ? 81.213  114.948 108.799 1.00 29.20  ? 361 VAL A CG1 1 
ATOM   2760  C  CG2 . VAL A  1 384 ? 83.093  114.922 107.143 1.00 48.96  ? 361 VAL A CG2 1 
ATOM   2761  N  N   . ALA A  1 385 ? 78.775  115.953 106.754 1.00 56.20  ? 362 ALA A N   1 
ATOM   2762  C  CA  . ALA A  1 385 ? 77.407  116.246 107.174 1.00 52.22  ? 362 ALA A CA  1 
ATOM   2763  C  C   . ALA A  1 385 ? 76.406  115.447 106.347 1.00 47.80  ? 362 ALA A C   1 
ATOM   2764  O  O   . ALA A  1 385 ? 75.420  114.942 106.875 1.00 38.76  ? 362 ALA A O   1 
ATOM   2765  C  CB  . ALA A  1 385 ? 77.118  117.738 107.056 1.00 45.00  ? 362 ALA A CB  1 
ATOM   2766  N  N   . ALA A  1 386 ? 76.677  115.339 105.049 1.00 43.84  ? 363 ALA A N   1 
ATOM   2767  C  CA  . ALA A  1 386 ? 75.803  114.627 104.130 1.00 39.69  ? 363 ALA A CA  1 
ATOM   2768  C  C   . ALA A  1 386 ? 75.825  113.134 104.399 1.00 50.53  ? 363 ALA A C   1 
ATOM   2769  O  O   . ALA A  1 386 ? 75.075  112.371 103.789 1.00 54.35  ? 363 ALA A O   1 
ATOM   2770  C  CB  . ALA A  1 386 ? 76.223  114.904 102.687 1.00 34.98  ? 363 ALA A CB  1 
ATOM   2771  N  N   . ASN A  1 387 ? 76.698  112.709 105.305 1.00 50.92  ? 364 ASN A N   1 
ATOM   2772  C  CA  . ASN A  1 387 ? 76.900  111.285 105.502 1.00 41.56  ? 364 ASN A CA  1 
ATOM   2773  C  C   . ASN A  1 387 ? 77.004  110.856 106.956 1.00 42.17  ? 364 ASN A C   1 
ATOM   2774  O  O   . ASN A  1 387 ? 77.279  109.688 107.237 1.00 43.24  ? 364 ASN A O   1 
ATOM   2775  C  CB  . ASN A  1 387 ? 78.122  110.808 104.727 1.00 34.21  ? 364 ASN A CB  1 
ATOM   2776  C  CG  . ASN A  1 387 ? 77.861  110.678 103.236 1.00 39.63  ? 364 ASN A CG  1 
ATOM   2777  O  OD1 . ASN A  1 387 ? 77.291  109.683 102.778 1.00 38.33  ? 364 ASN A OD1 1 
ATOM   2778  N  ND2 . ASN A  1 387 ? 78.307  111.671 102.466 1.00 37.88  ? 364 ASN A ND2 1 
ATOM   2779  N  N   . LEU A  1 388 ? 76.770  111.789 107.874 1.00 40.01  ? 365 LEU A N   1 
ATOM   2780  C  CA  . LEU A  1 388 ? 76.842  111.485 109.306 1.00 41.20  ? 365 LEU A CA  1 
ATOM   2781  C  C   . LEU A  1 388 ? 75.787  110.468 109.757 1.00 50.94  ? 365 LEU A C   1 
ATOM   2782  O  O   . LEU A  1 388 ? 74.756  110.301 109.111 1.00 58.96  ? 365 LEU A O   1 
ATOM   2783  C  CB  . LEU A  1 388 ? 76.711  112.758 110.131 1.00 35.36  ? 365 LEU A CB  1 
ATOM   2784  C  CG  . LEU A  1 388 ? 77.360  112.644 111.504 1.00 42.91  ? 365 LEU A CG  1 
ATOM   2785  C  CD1 . LEU A  1 388 ? 78.783  113.129 111.392 1.00 38.18  ? 365 LEU A CD1 1 
ATOM   2786  C  CD2 . LEU A  1 388 ? 76.594  113.446 112.548 1.00 48.37  ? 365 LEU A CD2 1 
ATOM   2787  N  N   . VAL A  1 389 ? 76.049  109.802 110.877 1.00 46.73  ? 366 VAL A N   1 
ATOM   2788  C  CA  . VAL A  1 389 ? 75.155  108.769 111.385 1.00 46.55  ? 366 VAL A CA  1 
ATOM   2789  C  C   . VAL A  1 389 ? 74.551  109.182 112.725 1.00 49.67  ? 366 VAL A C   1 
ATOM   2790  O  O   . VAL A  1 389 ? 75.268  109.631 113.622 1.00 51.05  ? 366 VAL A O   1 
ATOM   2791  C  CB  . VAL A  1 389 ? 75.895  107.422 111.555 1.00 47.97  ? 366 VAL A CB  1 
ATOM   2792  C  CG1 . VAL A  1 389 ? 75.064  106.445 112.372 1.00 49.82  ? 366 VAL A CG1 1 
ATOM   2793  C  CG2 . VAL A  1 389 ? 76.249  106.828 110.205 1.00 48.07  ? 366 VAL A CG2 1 
ATOM   2794  N  N   . THR B  1 27  ? 65.589  62.566  136.897 1.00 65.90  ? 4   THR B N   1 
ATOM   2795  C  CA  . THR B  1 27  ? 66.653  61.591  137.149 1.00 69.40  ? 4   THR B CA  1 
ATOM   2796  C  C   . THR B  1 27  ? 66.728  60.483  136.085 1.00 69.57  ? 4   THR B C   1 
ATOM   2797  O  O   . THR B  1 27  ? 65.718  60.102  135.486 1.00 69.10  ? 4   THR B O   1 
ATOM   2798  C  CB  . THR B  1 27  ? 66.517  60.940  138.550 1.00 88.57  ? 4   THR B CB  1 
ATOM   2799  O  OG1 . THR B  1 27  ? 65.562  59.871  138.505 1.00 80.94  ? 4   THR B OG1 1 
ATOM   2800  C  CG2 . THR B  1 27  ? 66.089  61.975  139.587 1.00 93.70  ? 4   THR B CG2 1 
ATOM   2801  N  N   . LEU B  1 28  ? 67.933  59.962  135.866 1.00 61.41  ? 5   LEU B N   1 
ATOM   2802  C  CA  . LEU B  1 28  ? 68.150  58.919  134.871 1.00 49.44  ? 5   LEU B CA  1 
ATOM   2803  C  C   . LEU B  1 28  ? 69.141  57.885  135.404 1.00 49.37  ? 5   LEU B C   1 
ATOM   2804  O  O   . LEU B  1 28  ? 70.254  58.231  135.814 1.00 48.93  ? 5   LEU B O   1 
ATOM   2805  C  CB  . LEU B  1 28  ? 68.668  59.537  133.573 1.00 42.28  ? 5   LEU B CB  1 
ATOM   2806  C  CG  . LEU B  1 28  ? 68.382  58.738  132.307 1.00 46.62  ? 5   LEU B CG  1 
ATOM   2807  C  CD1 . LEU B  1 28  ? 66.887  58.592  132.103 1.00 49.22  ? 5   LEU B CD1 1 
ATOM   2808  C  CD2 . LEU B  1 28  ? 69.004  59.405  131.099 1.00 46.06  ? 5   LEU B CD2 1 
ATOM   2809  N  N   . THR B  1 29  ? 68.741  56.615  135.395 1.00 42.37  ? 6   THR B N   1 
ATOM   2810  C  CA  . THR B  1 29  ? 69.544  55.560  136.011 1.00 39.74  ? 6   THR B CA  1 
ATOM   2811  C  C   . THR B  1 29  ? 69.763  54.381  135.078 1.00 42.40  ? 6   THR B C   1 
ATOM   2812  O  O   . THR B  1 29  ? 68.806  53.801  134.563 1.00 39.99  ? 6   THR B O   1 
ATOM   2813  C  CB  . THR B  1 29  ? 68.878  55.010  137.296 1.00 43.77  ? 6   THR B CB  1 
ATOM   2814  O  OG1 . THR B  1 29  ? 68.394  56.092  138.104 1.00 44.87  ? 6   THR B OG1 1 
ATOM   2815  C  CG2 . THR B  1 29  ? 69.871  54.152  138.100 1.00 36.81  ? 6   THR B CG2 1 
ATOM   2816  N  N   . PHE B  1 30  ? 71.027  54.016  134.886 1.00 43.44  ? 7   PHE B N   1 
ATOM   2817  C  CA  . PHE B  1 30  ? 71.392  52.832  134.111 1.00 43.45  ? 7   PHE B CA  1 
ATOM   2818  C  C   . PHE B  1 30  ? 70.839  51.569  134.758 1.00 48.59  ? 7   PHE B C   1 
ATOM   2819  O  O   . PHE B  1 30  ? 71.135  51.271  135.920 1.00 51.30  ? 7   PHE B O   1 
ATOM   2820  C  CB  . PHE B  1 30  ? 72.914  52.725  134.024 1.00 39.15  ? 7   PHE B CB  1 
ATOM   2821  C  CG  . PHE B  1 30  ? 73.406  51.592  133.155 1.00 50.77  ? 7   PHE B CG  1 
ATOM   2822  C  CD1 . PHE B  1 30  ? 73.601  50.326  133.684 1.00 52.97  ? 7   PHE B CD1 1 
ATOM   2823  C  CD2 . PHE B  1 30  ? 73.711  51.806  131.819 1.00 57.09  ? 7   PHE B CD2 1 
ATOM   2824  C  CE1 . PHE B  1 30  ? 74.071  49.292  132.893 1.00 54.85  ? 7   PHE B CE1 1 
ATOM   2825  C  CE2 . PHE B  1 30  ? 74.184  50.777  131.022 1.00 59.83  ? 7   PHE B CE2 1 
ATOM   2826  C  CZ  . PHE B  1 30  ? 74.363  49.519  131.558 1.00 59.71  ? 7   PHE B CZ  1 
ATOM   2827  N  N   . ARG B  1 31  ? 70.041  50.822  134.007 1.00 54.01  ? 8   ARG B N   1 
ATOM   2828  C  CA  . ARG B  1 31  ? 69.549  49.538  134.493 1.00 53.47  ? 8   ARG B CA  1 
ATOM   2829  C  C   . ARG B  1 31  ? 70.345  48.372  133.905 1.00 50.20  ? 8   ARG B C   1 
ATOM   2830  O  O   . ARG B  1 31  ? 70.893  47.555  134.641 1.00 50.37  ? 8   ARG B O   1 
ATOM   2831  C  CB  . ARG B  1 31  ? 68.055  49.365  134.212 1.00 54.48  ? 8   ARG B CB  1 
ATOM   2832  C  CG  . ARG B  1 31  ? 67.553  47.980  134.576 1.00 57.78  ? 8   ARG B CG  1 
ATOM   2833  C  CD  . ARG B  1 31  ? 66.053  47.825  134.396 1.00 60.01  ? 8   ARG B CD  1 
ATOM   2834  N  NE  . ARG B  1 31  ? 65.625  46.468  134.743 1.00 69.94  ? 8   ARG B NE  1 
ATOM   2835  C  CZ  . ARG B  1 31  ? 65.343  46.061  135.982 1.00 69.19  ? 8   ARG B CZ  1 
ATOM   2836  N  NH1 . ARG B  1 31  ? 65.437  46.904  137.003 1.00 66.89  ? 8   ARG B NH1 1 
ATOM   2837  N  NH2 . ARG B  1 31  ? 64.964  44.811  136.203 1.00 65.27  ? 8   ARG B NH2 1 
ATOM   2838  N  N   . LYS B  1 32  ? 70.418  48.291  132.581 1.00 46.88  ? 9   LYS B N   1 
ATOM   2839  C  CA  . LYS B  1 32  ? 71.166  47.202  131.959 1.00 46.91  ? 9   LYS B CA  1 
ATOM   2840  C  C   . LYS B  1 32  ? 71.415  47.383  130.467 1.00 49.24  ? 9   LYS B C   1 
ATOM   2841  O  O   . LYS B  1 32  ? 70.709  48.129  129.775 1.00 49.23  ? 9   LYS B O   1 
ATOM   2842  C  CB  . LYS B  1 32  ? 70.459  45.863  132.185 1.00 49.78  ? 9   LYS B CB  1 
ATOM   2843  C  CG  . LYS B  1 32  ? 69.348  45.553  131.178 1.00 49.73  ? 9   LYS B CG  1 
ATOM   2844  C  CD  . LYS B  1 32  ? 69.014  44.051  131.183 1.00 53.01  ? 9   LYS B CD  1 
ATOM   2845  C  CE  . LYS B  1 32  ? 67.806  43.710  130.316 1.00 49.36  ? 9   LYS B CE  1 
ATOM   2846  N  NZ  . LYS B  1 32  ? 67.595  42.233  130.252 1.00 49.30  ? 9   LYS B NZ  1 
ATOM   2847  N  N   . LEU B  1 33  ? 72.412  46.657  129.977 1.00 48.69  ? 10  LEU B N   1 
ATOM   2848  C  CA  . LEU B  1 33  ? 72.791  46.712  128.578 1.00 48.17  ? 10  LEU B CA  1 
ATOM   2849  C  C   . LEU B  1 33  ? 72.765  45.325  127.960 1.00 49.16  ? 10  LEU B C   1 
ATOM   2850  O  O   . LEU B  1 33  ? 73.317  44.378  128.520 1.00 57.41  ? 10  LEU B O   1 
ATOM   2851  C  CB  . LEU B  1 33  ? 74.187  47.322  128.454 1.00 45.50  ? 10  LEU B CB  1 
ATOM   2852  C  CG  . LEU B  1 33  ? 74.796  47.499  127.068 1.00 42.63  ? 10  LEU B CG  1 
ATOM   2853  C  CD1 . LEU B  1 33  ? 75.760  48.687  127.070 1.00 38.07  ? 10  LEU B CD1 1 
ATOM   2854  C  CD2 . LEU B  1 33  ? 75.486  46.213  126.625 1.00 32.14  ? 10  LEU B CD2 1 
ATOM   2855  N  N   . THR B  1 34  ? 72.126  45.207  126.802 1.00 42.77  ? 11  THR B N   1 
ATOM   2856  C  CA  . THR B  1 34  ? 72.099  43.949  126.073 1.00 48.33  ? 11  THR B CA  1 
ATOM   2857  C  C   . THR B  1 34  ? 72.844  44.112  124.759 1.00 45.27  ? 11  THR B C   1 
ATOM   2858  O  O   . THR B  1 34  ? 72.644  45.097  124.051 1.00 50.84  ? 11  THR B O   1 
ATOM   2859  C  CB  . THR B  1 34  ? 70.659  43.509  125.754 1.00 55.14  ? 11  THR B CB  1 
ATOM   2860  O  OG1 . THR B  1 34  ? 69.835  43.672  126.915 1.00 60.59  ? 11  THR B OG1 1 
ATOM   2861  C  CG2 . THR B  1 34  ? 70.633  42.049  125.287 1.00 48.78  ? 11  THR B CG2 1 
ATOM   2862  N  N   . ALA B  1 35  ? 73.690  43.138  124.435 1.00 46.06  ? 12  ALA B N   1 
ATOM   2863  C  CA  . ALA B  1 35  ? 74.497  43.185  123.217 1.00 46.23  ? 12  ALA B CA  1 
ATOM   2864  C  C   . ALA B  1 35  ? 74.262  41.965  122.328 1.00 46.95  ? 12  ALA B C   1 
ATOM   2865  O  O   . ALA B  1 35  ? 74.666  40.856  122.668 1.00 52.17  ? 12  ALA B O   1 
ATOM   2866  C  CB  . ALA B  1 35  ? 75.987  43.318  123.569 1.00 36.25  ? 12  ALA B CB  1 
ATOM   2867  N  N   . ARG B  1 36  ? 73.620  42.177  121.183 1.00 44.43  ? 13  ARG B N   1 
ATOM   2868  C  CA  . ARG B  1 36  ? 73.309  41.085  120.264 1.00 43.86  ? 13  ARG B CA  1 
ATOM   2869  C  C   . ARG B  1 36  ? 74.185  41.113  119.019 1.00 46.03  ? 13  ARG B C   1 
ATOM   2870  O  O   . ARG B  1 36  ? 74.161  42.088  118.265 1.00 46.13  ? 13  ARG B O   1 
ATOM   2871  C  CB  . ARG B  1 36  ? 71.835  41.140  119.842 1.00 43.09  ? 13  ARG B CB  1 
ATOM   2872  C  CG  . ARG B  1 36  ? 70.849  40.863  120.964 1.00 44.97  ? 13  ARG B CG  1 
ATOM   2873  C  CD  . ARG B  1 36  ? 69.426  40.981  120.466 1.00 47.59  ? 13  ARG B CD  1 
ATOM   2874  N  NE  . ARG B  1 36  ? 69.038  42.370  120.253 1.00 46.21  ? 13  ARG B NE  1 
ATOM   2875  C  CZ  . ARG B  1 36  ? 68.069  42.766  119.434 1.00 47.50  ? 13  ARG B CZ  1 
ATOM   2876  N  NH1 . ARG B  1 36  ? 67.371  41.885  118.724 1.00 47.06  ? 13  ARG B NH1 1 
ATOM   2877  N  NH2 . ARG B  1 36  ? 67.798  44.053  119.322 1.00 48.39  ? 13  ARG B NH2 1 
ATOM   2878  N  N   . PRO B  1 37  ? 74.948  40.033  118.790 1.00 42.42  ? 14  PRO B N   1 
ATOM   2879  C  CA  . PRO B  1 37  ? 75.794  39.920  117.595 1.00 38.02  ? 14  PRO B CA  1 
ATOM   2880  C  C   . PRO B  1 37  ? 74.984  39.538  116.356 1.00 43.53  ? 14  PRO B C   1 
ATOM   2881  O  O   . PRO B  1 37  ? 74.064  38.737  116.414 1.00 52.79  ? 14  PRO B O   1 
ATOM   2882  C  CB  . PRO B  1 37  ? 76.760  38.794  117.956 1.00 32.60  ? 14  PRO B CB  1 
ATOM   2883  C  CG  . PRO B  1 37  ? 75.957  37.908  118.860 1.00 41.03  ? 14  PRO B CG  1 
ATOM   2884  C  CD  . PRO B  1 37  ? 75.035  38.833  119.644 1.00 41.79  ? 14  PRO B CD  1 
ATOM   2885  N  N   . VAL B  1 38  ? 75.356  40.118  115.232 1.00 38.78  ? 15  VAL B N   1 
ATOM   2886  C  CA  . VAL B  1 38  ? 74.635  39.972  113.989 1.00 38.81  ? 15  VAL B CA  1 
ATOM   2887  C  C   . VAL B  1 38  ? 75.671  39.934  112.862 1.00 48.99  ? 15  VAL B C   1 
ATOM   2888  O  O   . VAL B  1 38  ? 76.723  40.567  112.960 1.00 51.74  ? 15  VAL B O   1 
ATOM   2889  C  CB  . VAL B  1 38  ? 73.694  41.171  113.806 1.00 40.08  ? 15  VAL B CB  1 
ATOM   2890  C  CG1 . VAL B  1 38  ? 73.116  41.201  112.418 1.00 41.03  ? 15  VAL B CG1 1 
ATOM   2891  C  CG2 . VAL B  1 38  ? 72.599  41.142  114.864 1.00 48.53  ? 15  VAL B CG2 1 
ATOM   2892  N  N   . LEU B  1 39  ? 75.396  39.182  111.803 1.00 46.76  ? 16  LEU B N   1 
ATOM   2893  C  CA  . LEU B  1 39  ? 76.327  39.101  110.687 1.00 46.00  ? 16  LEU B CA  1 
ATOM   2894  C  C   . LEU B  1 39  ? 75.588  39.280  109.362 1.00 51.42  ? 16  LEU B C   1 
ATOM   2895  O  O   . LEU B  1 39  ? 74.664  38.539  109.048 1.00 53.61  ? 16  LEU B O   1 
ATOM   2896  C  CB  . LEU B  1 39  ? 77.099  37.780  110.727 1.00 46.62  ? 16  LEU B CB  1 
ATOM   2897  C  CG  . LEU B  1 39  ? 78.349  37.714  109.846 1.00 55.82  ? 16  LEU B CG  1 
ATOM   2898  C  CD1 . LEU B  1 39  ? 79.307  36.598  110.275 1.00 47.19  ? 16  LEU B CD1 1 
ATOM   2899  C  CD2 . LEU B  1 39  ? 77.945  37.559  108.392 1.00 65.40  ? 16  LEU B CD2 1 
ATOM   2900  N  N   . LEU B  1 40  ? 75.996  40.272  108.583 1.00 50.57  ? 17  LEU B N   1 
ATOM   2901  C  CA  . LEU B  1 40  ? 75.285  40.600  107.356 1.00 56.20  ? 17  LEU B CA  1 
ATOM   2902  C  C   . LEU B  1 40  ? 76.037  40.162  106.107 1.00 59.57  ? 17  LEU B C   1 
ATOM   2903  O  O   . LEU B  1 40  ? 77.245  39.925  106.143 1.00 62.04  ? 17  LEU B O   1 
ATOM   2904  C  CB  . LEU B  1 40  ? 75.007  42.100  107.294 1.00 58.33  ? 17  LEU B CB  1 
ATOM   2905  C  CG  . LEU B  1 40  ? 73.631  42.553  107.768 1.00 59.18  ? 17  LEU B CG  1 
ATOM   2906  C  CD1 . LEU B  1 40  ? 73.187  41.758  108.979 1.00 59.16  ? 17  LEU B CD1 1 
ATOM   2907  C  CD2 . LEU B  1 40  ? 73.656  44.038  108.063 1.00 55.98  ? 17  LEU B CD2 1 
ATOM   2908  N  N   . LYS B  1 41  ? 75.307  40.055  105.001 1.00 60.61  ? 18  LYS B N   1 
ATOM   2909  C  CA  . LYS B  1 41  ? 75.903  39.723  103.717 1.00 59.47  ? 18  LYS B CA  1 
ATOM   2910  C  C   . LYS B  1 41  ? 76.014  41.007  102.934 1.00 48.88  ? 18  LYS B C   1 
ATOM   2911  O  O   . LYS B  1 41  ? 75.001  41.639  102.642 1.00 51.67  ? 18  LYS B O   1 
ATOM   2912  C  CB  . LYS B  1 41  ? 75.029  38.729  102.948 1.00 68.62  ? 18  LYS B CB  1 
ATOM   2913  C  CG  . LYS B  1 41  ? 75.816  37.749  102.075 1.00 76.76  ? 18  LYS B CG  1 
ATOM   2914  C  CD  . LYS B  1 41  ? 76.691  36.836  102.937 1.00 80.22  ? 18  LYS B CD  1 
ATOM   2915  C  CE  . LYS B  1 41  ? 77.342  35.730  102.121 1.00 77.48  ? 18  LYS B CE  1 
ATOM   2916  N  NZ  . LYS B  1 41  ? 78.186  34.848  102.975 1.00 75.12  ? 18  LYS B NZ  1 
ATOM   2917  N  N   . LEU B  1 42  ? 77.241  41.404  102.612 1.00 40.83  ? 19  LEU B N   1 
ATOM   2918  C  CA  . LEU B  1 42  ? 77.469  42.662  101.898 1.00 46.39  ? 19  LEU B CA  1 
ATOM   2919  C  C   . LEU B  1 42  ? 76.910  42.636  100.483 1.00 47.38  ? 19  LEU B C   1 
ATOM   2920  O  O   . LEU B  1 42  ? 77.184  41.716  99.712  1.00 46.28  ? 19  LEU B O   1 
ATOM   2921  C  CB  . LEU B  1 42  ? 78.962  43.018  101.847 1.00 44.20  ? 19  LEU B CB  1 
ATOM   2922  C  CG  . LEU B  1 42  ? 79.615  43.546  103.124 1.00 41.18  ? 19  LEU B CG  1 
ATOM   2923  C  CD1 . LEU B  1 42  ? 81.077  43.868  102.878 1.00 44.92  ? 19  LEU B CD1 1 
ATOM   2924  C  CD2 . LEU B  1 42  ? 78.867  44.765  103.634 1.00 33.52  ? 19  LEU B CD2 1 
ATOM   2925  N  N   . GLN B  1 43  ? 76.136  43.666  100.154 1.00 52.44  ? 20  GLN B N   1 
ATOM   2926  C  CA  . GLN B  1 43  ? 75.647  43.876  98.801  1.00 55.79  ? 20  GLN B CA  1 
ATOM   2927  C  C   . GLN B  1 43  ? 76.810  43.932  97.813  1.00 59.46  ? 20  GLN B C   1 
ATOM   2928  O  O   . GLN B  1 43  ? 76.717  43.402  96.710  1.00 63.15  ? 20  GLN B O   1 
ATOM   2929  C  CB  . GLN B  1 43  ? 74.835  45.168  98.735  1.00 60.73  ? 20  GLN B CB  1 
ATOM   2930  C  CG  . GLN B  1 43  ? 74.263  45.470  97.362  1.00 67.61  ? 20  GLN B CG  1 
ATOM   2931  C  CD  . GLN B  1 43  ? 73.731  46.887  97.255  1.00 70.94  ? 20  GLN B CD  1 
ATOM   2932  O  OE1 . GLN B  1 43  ? 73.372  47.511  98.259  1.00 68.99  ? 20  GLN B OE1 1 
ATOM   2933  N  NE2 . GLN B  1 43  ? 73.689  47.408  96.031  1.00 69.30  ? 20  GLN B NE2 1 
ATOM   2934  N  N   . ARG B  1 44  ? 77.901  44.582  98.213  1.00 57.50  ? 21  ARG B N   1 
ATOM   2935  C  CA  . ARG B  1 44  ? 79.128  44.616  97.411  1.00 61.14  ? 21  ARG B CA  1 
ATOM   2936  C  C   . ARG B  1 44  ? 80.303  44.108  98.237  1.00 69.01  ? 21  ARG B C   1 
ATOM   2937  O  O   . ARG B  1 44  ? 80.796  44.815  99.116  1.00 76.51  ? 21  ARG B O   1 
ATOM   2938  C  CB  . ARG B  1 44  ? 79.425  46.031  96.911  1.00 51.96  ? 21  ARG B CB  1 
ATOM   2939  C  CG  . ARG B  1 44  ? 78.361  46.608  95.995  1.00 49.77  ? 21  ARG B CG  1 
ATOM   2940  C  CD  . ARG B  1 44  ? 78.740  48.006  95.564  1.00 48.86  ? 21  ARG B CD  1 
ATOM   2941  N  NE  . ARG B  1 44  ? 77.784  48.583  94.628  1.00 48.24  ? 21  ARG B NE  1 
ATOM   2942  C  CZ  . ARG B  1 44  ? 76.627  49.124  94.990  1.00 55.41  ? 21  ARG B CZ  1 
ATOM   2943  N  NH1 . ARG B  1 44  ? 76.281  49.145  96.272  1.00 61.40  ? 21  ARG B NH1 1 
ATOM   2944  N  NH2 . ARG B  1 44  ? 75.816  49.636  94.072  1.00 54.16  ? 21  ARG B NH2 1 
ATOM   2945  N  N   . PRO B  1 45  ? 80.765  42.882  97.950  1.00 68.09  ? 22  PRO B N   1 
ATOM   2946  C  CA  . PRO B  1 45  ? 81.778  42.259  98.804  1.00 67.15  ? 22  PRO B CA  1 
ATOM   2947  C  C   . PRO B  1 45  ? 83.089  43.042  98.789  1.00 67.59  ? 22  PRO B C   1 
ATOM   2948  O  O   . PRO B  1 45  ? 83.436  43.663  97.780  1.00 69.03  ? 22  PRO B O   1 
ATOM   2949  C  CB  . PRO B  1 45  ? 81.968  40.878  98.168  1.00 65.49  ? 22  PRO B CB  1 
ATOM   2950  C  CG  . PRO B  1 45  ? 81.593  41.071  96.737  1.00 66.14  ? 22  PRO B CG  1 
ATOM   2951  C  CD  . PRO B  1 45  ? 80.482  42.081  96.745  1.00 69.56  ? 22  PRO B CD  1 
ATOM   2952  N  N   . VAL B  1 46  ? 83.799  43.020  99.911  1.00 60.36  ? 23  VAL B N   1 
ATOM   2953  C  CA  . VAL B  1 46  ? 85.107  43.651  99.995  1.00 58.73  ? 23  VAL B CA  1 
ATOM   2954  C  C   . VAL B  1 46  ? 86.110  42.862  99.160  1.00 57.88  ? 23  VAL B C   1 
ATOM   2955  O  O   . VAL B  1 46  ? 86.418  41.711  99.462  1.00 59.94  ? 23  VAL B O   1 
ATOM   2956  C  CB  . VAL B  1 46  ? 85.602  43.763  101.456 1.00 52.41  ? 23  VAL B CB  1 
ATOM   2957  C  CG1 . VAL B  1 46  ? 86.995  44.367  101.497 1.00 48.42  ? 23  VAL B CG1 1 
ATOM   2958  C  CG2 . VAL B  1 46  ? 84.638  44.597  102.282 1.00 55.66  ? 23  VAL B CG2 1 
ATOM   2959  N  N   . THR B  1 47  ? 86.608  43.492  98.103  1.00 60.09  ? 24  THR B N   1 
ATOM   2960  C  CA  . THR B  1 47  ? 87.563  42.867  97.195  1.00 59.24  ? 24  THR B CA  1 
ATOM   2961  C  C   . THR B  1 47  ? 88.957  43.467  97.399  1.00 65.21  ? 24  THR B C   1 
ATOM   2962  O  O   . THR B  1 47  ? 89.321  44.461  96.763  1.00 58.57  ? 24  THR B O   1 
ATOM   2963  C  CB  . THR B  1 47  ? 87.113  43.051  95.724  1.00 51.83  ? 24  THR B CB  1 
ATOM   2964  O  OG1 . THR B  1 47  ? 85.702  42.809  95.620  1.00 48.43  ? 24  THR B OG1 1 
ATOM   2965  C  CG2 . THR B  1 47  ? 87.873  42.110  94.782  1.00 42.78  ? 24  THR B CG2 1 
ATOM   2966  N  N   . ALA B  1 48  ? 89.730  42.871  98.301  1.00 76.76  ? 25  ALA B N   1 
ATOM   2967  C  CA  . ALA B  1 48  ? 91.086  43.345  98.565  1.00 86.88  ? 25  ALA B CA  1 
ATOM   2968  C  C   . ALA B  1 48  ? 92.107  42.423  97.907  1.00 95.89  ? 25  ALA B C   1 
ATOM   2969  O  O   . ALA B  1 48  ? 91.750  41.356  97.407  1.00 95.20  ? 25  ALA B O   1 
ATOM   2970  C  CB  . ALA B  1 48  ? 91.339  43.454  100.060 1.00 85.41  ? 25  ALA B CB  1 
ATOM   2971  N  N   . ARG B  1 49  ? 93.373  42.839  97.912  1.00 106.17 ? 26  ARG B N   1 
ATOM   2972  C  CA  . ARG B  1 49  ? 94.442  42.099  97.237  1.00 115.45 ? 26  ARG B CA  1 
ATOM   2973  C  C   . ARG B  1 49  ? 94.582  40.655  97.734  1.00 123.55 ? 26  ARG B C   1 
ATOM   2974  O  O   . ARG B  1 49  ? 94.781  39.728  96.938  1.00 116.21 ? 26  ARG B O   1 
ATOM   2975  C  CB  . ARG B  1 49  ? 95.778  42.837  97.375  1.00 113.24 ? 26  ARG B CB  1 
ATOM   2976  C  CG  . ARG B  1 49  ? 96.937  42.116  96.717  1.00 112.25 ? 26  ARG B CG  1 
ATOM   2977  C  CD  . ARG B  1 49  ? 98.274  42.706  97.121  1.00 114.62 ? 26  ARG B CD  1 
ATOM   2978  N  NE  . ARG B  1 49  ? 99.364  41.782  96.818  1.00 119.08 ? 26  ARG B NE  1 
ATOM   2979  C  CZ  . ARG B  1 49  ? 99.856  40.894  97.679  1.00 119.09 ? 26  ARG B CZ  1 
ATOM   2980  N  NH1 . ARG B  1 49  ? 100.845 40.088  97.313  1.00 116.83 ? 26  ARG B NH1 1 
ATOM   2981  N  NH2 . ARG B  1 49  ? 99.361  40.813  98.908  1.00 118.23 ? 26  ARG B NH2 1 
ATOM   2982  N  N   . ILE B  1 50  ? 94.485  40.471  99.049  1.00 132.46 ? 27  ILE B N   1 
ATOM   2983  C  CA  . ILE B  1 50  ? 94.524  39.136  99.640  1.00 134.50 ? 27  ILE B CA  1 
ATOM   2984  C  C   . ILE B  1 50  ? 93.314  38.296  99.197  1.00 131.88 ? 27  ILE B C   1 
ATOM   2985  O  O   . ILE B  1 50  ? 93.393  37.556  98.212  1.00 131.02 ? 27  ILE B O   1 
ATOM   2986  C  CB  . ILE B  1 50  ? 94.644  39.182  101.196 1.00 98.80  ? 27  ILE B CB  1 
ATOM   2987  C  CG1 . ILE B  1 50  ? 93.543  40.052  101.810 1.00 100.21 ? 27  ILE B CG1 1 
ATOM   2988  C  CG2 . ILE B  1 50  ? 96.011  39.705  101.616 1.00 92.66  ? 27  ILE B CG2 1 
ATOM   2989  C  CD1 . ILE B  1 50  ? 92.839  39.407  102.990 1.00 97.81  ? 27  ILE B CD1 1 
ATOM   2990  N  N   . ALA B  1 51  ? 92.198  38.426  99.911  1.00 125.50 ? 28  ALA B N   1 
ATOM   2991  C  CA  . ALA B  1 51  ? 90.994  37.660  99.606  1.00 116.21 ? 28  ALA B CA  1 
ATOM   2992  C  C   . ALA B  1 51  ? 89.745  38.538  99.555  1.00 106.57 ? 28  ALA B C   1 
ATOM   2993  O  O   . ALA B  1 51  ? 89.818  39.756  99.726  1.00 103.74 ? 28  ALA B O   1 
ATOM   2994  C  CB  . ALA B  1 51  ? 90.809  36.536  100.622 1.00 115.04 ? 28  ALA B CB  1 
ATOM   2995  N  N   . THR B  1 52  ? 88.602  37.903  99.309  1.00 98.03  ? 29  THR B N   1 
ATOM   2996  C  CA  . THR B  1 52  ? 87.311  38.584  99.301  1.00 88.56  ? 29  THR B CA  1 
ATOM   2997  C  C   . THR B  1 52  ? 86.614  38.396  100.646 1.00 86.32  ? 29  THR B C   1 
ATOM   2998  O  O   . THR B  1 52  ? 86.599  37.294  101.197 1.00 88.55  ? 29  THR B O   1 
ATOM   2999  C  CB  . THR B  1 52  ? 86.389  38.047  98.178  1.00 82.40  ? 29  THR B CB  1 
ATOM   3000  O  OG1 . THR B  1 52  ? 86.980  38.300  96.898  1.00 80.58  ? 29  THR B OG1 1 
ATOM   3001  C  CG2 . THR B  1 52  ? 85.017  38.712  98.237  1.00 79.91  ? 29  THR B CG2 1 
ATOM   3002  N  N   . ILE B  1 53  ? 86.046  39.476  101.177 1.00 80.98  ? 30  ILE B N   1 
ATOM   3003  C  CA  . ILE B  1 53  ? 85.293  39.411  102.426 1.00 78.81  ? 30  ILE B CA  1 
ATOM   3004  C  C   . ILE B  1 53  ? 83.846  39.845  102.178 1.00 77.18  ? 30  ILE B C   1 
ATOM   3005  O  O   . ILE B  1 53  ? 83.562  41.039  102.059 1.00 79.79  ? 30  ILE B O   1 
ATOM   3006  C  CB  . ILE B  1 53  ? 85.920  40.310  103.528 1.00 62.34  ? 30  ILE B CB  1 
ATOM   3007  C  CG1 . ILE B  1 53  ? 87.458  40.285  103.460 1.00 63.21  ? 30  ILE B CG1 1 
ATOM   3008  C  CG2 . ILE B  1 53  ? 85.383  39.931  104.912 1.00 53.17  ? 30  ILE B CG2 1 
ATOM   3009  C  CD1 . ILE B  1 53  ? 88.093  38.903  103.609 1.00 63.78  ? 30  ILE B CD1 1 
ATOM   3010  N  N   . PRO B  1 54  ? 82.924  38.873  102.091 1.00 68.48  ? 31  PRO B N   1 
ATOM   3011  C  CA  . PRO B  1 54  ? 81.518  39.172  101.800 1.00 61.80  ? 31  PRO B CA  1 
ATOM   3012  C  C   . PRO B  1 54  ? 80.700  39.471  103.052 1.00 55.35  ? 31  PRO B C   1 
ATOM   3013  O  O   . PRO B  1 54  ? 79.571  39.949  102.930 1.00 58.13  ? 31  PRO B O   1 
ATOM   3014  C  CB  . PRO B  1 54  ? 81.023  37.873  101.175 1.00 63.64  ? 31  PRO B CB  1 
ATOM   3015  C  CG  . PRO B  1 54  ? 81.817  36.821  101.882 1.00 66.85  ? 31  PRO B CG  1 
ATOM   3016  C  CD  . PRO B  1 54  ? 83.177  37.423  102.162 1.00 65.32  ? 31  PRO B CD  1 
ATOM   3017  N  N   . ASP B  1 55  ? 81.262  39.196  104.228 1.00 47.97  ? 32  ASP B N   1 
ATOM   3018  C  CA  . ASP B  1 55  ? 80.519  39.300  105.488 1.00 62.21  ? 32  ASP B CA  1 
ATOM   3019  C  C   . ASP B  1 55  ? 80.872  40.541  106.300 1.00 59.00  ? 32  ASP B C   1 
ATOM   3020  O  O   . ASP B  1 55  ? 82.014  41.007  106.274 1.00 56.49  ? 32  ASP B O   1 
ATOM   3021  C  CB  . ASP B  1 55  ? 80.739  38.052  106.351 1.00 71.69  ? 32  ASP B CB  1 
ATOM   3022  C  CG  . ASP B  1 55  ? 79.922  36.864  105.879 1.00 85.03  ? 32  ASP B CG  1 
ATOM   3023  O  OD1 . ASP B  1 55  ? 78.833  37.074  105.297 1.00 87.38  ? 32  ASP B OD1 1 
ATOM   3024  O  OD2 . ASP B  1 55  ? 80.369  35.718  106.098 1.00 89.62  ? 32  ASP B OD2 1 
ATOM   3025  N  N   . TRP B  1 56  ? 79.892  41.044  107.047 1.00 46.47  ? 33  TRP B N   1 
ATOM   3026  C  CA  . TRP B  1 56  ? 80.044  42.287  107.788 1.00 38.39  ? 33  TRP B CA  1 
ATOM   3027  C  C   . TRP B  1 56  ? 79.332  42.226  109.134 1.00 44.61  ? 33  TRP B C   1 
ATOM   3028  O  O   . TRP B  1 56  ? 78.118  42.374  109.193 1.00 45.91  ? 33  TRP B O   1 
ATOM   3029  C  CB  . TRP B  1 56  ? 79.501  43.454  106.955 1.00 37.70  ? 33  TRP B CB  1 
ATOM   3030  C  CG  . TRP B  1 56  ? 79.708  44.783  107.588 1.00 43.36  ? 33  TRP B CG  1 
ATOM   3031  C  CD1 . TRP B  1 56  ? 78.749  45.602  108.110 1.00 46.15  ? 33  TRP B CD1 1 
ATOM   3032  C  CD2 . TRP B  1 56  ? 80.959  45.450  107.788 1.00 40.60  ? 33  TRP B CD2 1 
ATOM   3033  N  NE1 . TRP B  1 56  ? 79.326  46.744  108.609 1.00 44.74  ? 33  TRP B NE1 1 
ATOM   3034  C  CE2 . TRP B  1 56  ? 80.681  46.673  108.427 1.00 41.57  ? 33  TRP B CE2 1 
ATOM   3035  C  CE3 . TRP B  1 56  ? 82.286  45.136  107.477 1.00 45.40  ? 33  TRP B CE3 1 
ATOM   3036  C  CZ2 . TRP B  1 56  ? 81.679  47.576  108.768 1.00 42.46  ? 33  TRP B CZ2 1 
ATOM   3037  C  CZ3 . TRP B  1 56  ? 83.278  46.038  107.813 1.00 43.63  ? 33  TRP B CZ3 1 
ATOM   3038  C  CH2 . TRP B  1 56  ? 82.971  47.240  108.454 1.00 43.56  ? 33  TRP B CH2 1 
ATOM   3039  N  N   . PRO B  1 57  ? 80.087  42.013  110.225 1.00 42.40  ? 34  PRO B N   1 
ATOM   3040  C  CA  . PRO B  1 57  ? 79.504  41.850  111.568 1.00 39.70  ? 34  PRO B CA  1 
ATOM   3041  C  C   . PRO B  1 57  ? 79.069  43.167  112.218 1.00 40.42  ? 34  PRO B C   1 
ATOM   3042  O  O   . PRO B  1 57  ? 79.750  44.176  112.057 1.00 46.40  ? 34  PRO B O   1 
ATOM   3043  C  CB  . PRO B  1 57  ? 80.656  41.241  112.375 1.00 39.05  ? 34  PRO B CB  1 
ATOM   3044  C  CG  . PRO B  1 57  ? 81.893  41.779  111.707 1.00 38.85  ? 34  PRO B CG  1 
ATOM   3045  C  CD  . PRO B  1 57  ? 81.554  41.862  110.233 1.00 35.16  ? 34  PRO B CD  1 
ATOM   3046  N  N   . LEU B  1 58  ? 77.949  43.141  112.939 1.00 36.28  ? 35  LEU B N   1 
ATOM   3047  C  CA  . LEU B  1 58  ? 77.512  44.258  113.772 1.00 38.79  ? 35  LEU B CA  1 
ATOM   3048  C  C   . LEU B  1 58  ? 77.213  43.766  115.177 1.00 48.25  ? 35  LEU B C   1 
ATOM   3049  O  O   . LEU B  1 58  ? 76.813  42.619  115.369 1.00 56.41  ? 35  LEU B O   1 
ATOM   3050  C  CB  . LEU B  1 58  ? 76.236  44.889  113.226 1.00 30.82  ? 35  LEU B CB  1 
ATOM   3051  C  CG  . LEU B  1 58  ? 76.176  45.383  111.787 1.00 40.14  ? 35  LEU B CG  1 
ATOM   3052  C  CD1 . LEU B  1 58  ? 74.746  45.386  111.325 1.00 42.99  ? 35  LEU B CD1 1 
ATOM   3053  C  CD2 . LEU B  1 58  ? 76.761  46.772  111.675 1.00 43.10  ? 35  LEU B CD2 1 
ATOM   3054  N  N   . ILE B  1 59  ? 77.396  44.634  116.163 1.00 37.95  ? 36  ILE B N   1 
ATOM   3055  C  CA  . ILE B  1 59  ? 76.853  44.378  117.488 1.00 34.24  ? 36  ILE B CA  1 
ATOM   3056  C  C   . ILE B  1 59  ? 75.768  45.407  117.762 1.00 42.37  ? 36  ILE B C   1 
ATOM   3057  O  O   . ILE B  1 59  ? 76.009  46.612  117.699 1.00 40.91  ? 36  ILE B O   1 
ATOM   3058  C  CB  . ILE B  1 59  ? 77.924  44.440  118.600 1.00 35.13  ? 36  ILE B CB  1 
ATOM   3059  C  CG1 . ILE B  1 59  ? 78.959  43.326  118.412 1.00 33.76  ? 36  ILE B CG1 1 
ATOM   3060  C  CG2 . ILE B  1 59  ? 77.267  44.343  119.982 1.00 38.40  ? 36  ILE B CG2 1 
ATOM   3061  C  CD1 . ILE B  1 59  ? 80.078  43.347  119.432 1.00 37.14  ? 36  ILE B CD1 1 
ATOM   3062  N  N   . LEU B  1 60  ? 74.562  44.929  118.042 1.00 47.91  ? 37  LEU B N   1 
ATOM   3063  C  CA  . LEU B  1 60  ? 73.457  45.821  118.341 1.00 43.08  ? 37  LEU B CA  1 
ATOM   3064  C  C   . LEU B  1 60  ? 73.345  45.964  119.847 1.00 50.23  ? 37  LEU B C   1 
ATOM   3065  O  O   . LEU B  1 60  ? 73.259  44.973  120.580 1.00 58.04  ? 37  LEU B O   1 
ATOM   3066  C  CB  . LEU B  1 60  ? 72.154  45.314  117.721 1.00 42.06  ? 37  LEU B CB  1 
ATOM   3067  C  CG  . LEU B  1 60  ? 71.965  45.607  116.227 1.00 47.76  ? 37  LEU B CG  1 
ATOM   3068  C  CD1 . LEU B  1 60  ? 73.214  45.293  115.407 1.00 53.91  ? 37  LEU B CD1 1 
ATOM   3069  C  CD2 . LEU B  1 60  ? 70.774  44.847  115.680 1.00 40.92  ? 37  LEU B CD2 1 
ATOM   3070  N  N   . ILE B  1 61  ? 73.358  47.212  120.298 1.00 48.48  ? 38  ILE B N   1 
ATOM   3071  C  CA  . ILE B  1 61  ? 73.413  47.530  121.717 1.00 49.65  ? 38  ILE B CA  1 
ATOM   3072  C  C   . ILE B  1 61  ? 72.121  48.209  122.157 1.00 47.15  ? 38  ILE B C   1 
ATOM   3073  O  O   . ILE B  1 61  ? 71.702  49.212  121.572 1.00 50.47  ? 38  ILE B O   1 
ATOM   3074  C  CB  . ILE B  1 61  ? 74.614  48.457  122.023 1.00 41.63  ? 38  ILE B CB  1 
ATOM   3075  C  CG1 . ILE B  1 61  ? 75.928  47.735  121.738 1.00 41.76  ? 38  ILE B CG1 1 
ATOM   3076  C  CG2 . ILE B  1 61  ? 74.568  48.950  123.449 1.00 34.68  ? 38  ILE B CG2 1 
ATOM   3077  C  CD1 . ILE B  1 61  ? 77.125  48.653  121.753 1.00 39.11  ? 38  ILE B CD1 1 
ATOM   3078  N  N   . ASP B  1 62  ? 71.494  47.653  123.188 1.00 44.15  ? 39  ASP B N   1 
ATOM   3079  C  CA  . ASP B  1 62  ? 70.251  48.198  123.715 1.00 42.66  ? 39  ASP B CA  1 
ATOM   3080  C  C   . ASP B  1 62  ? 70.427  48.493  125.191 1.00 44.29  ? 39  ASP B C   1 
ATOM   3081  O  O   . ASP B  1 62  ? 70.811  47.612  125.963 1.00 46.84  ? 39  ASP B O   1 
ATOM   3082  C  CB  . ASP B  1 62  ? 69.107  47.201  123.534 1.00 45.01  ? 39  ASP B CB  1 
ATOM   3083  C  CG  . ASP B  1 62  ? 68.858  46.849  122.079 1.00 52.55  ? 39  ASP B CG  1 
ATOM   3084  O  OD1 . ASP B  1 62  ? 67.982  47.502  121.467 1.00 48.55  ? 39  ASP B OD1 1 
ATOM   3085  O  OD2 . ASP B  1 62  ? 69.533  45.921  121.560 1.00 52.08  ? 39  ASP B OD2 1 
ATOM   3086  N  N   . ILE B  1 63  ? 70.155  49.732  125.584 1.00 40.94  ? 40  ILE B N   1 
ATOM   3087  C  CA  . ILE B  1 63  ? 70.245  50.114  126.989 1.00 39.94  ? 40  ILE B CA  1 
ATOM   3088  C  C   . ILE B  1 63  ? 68.872  50.385  127.601 1.00 38.30  ? 40  ILE B C   1 
ATOM   3089  O  O   . ILE B  1 63  ? 68.011  51.016  126.974 1.00 40.51  ? 40  ILE B O   1 
ATOM   3090  C  CB  . ILE B  1 63  ? 71.137  51.357  127.177 1.00 41.19  ? 40  ILE B CB  1 
ATOM   3091  C  CG1 . ILE B  1 63  ? 72.608  50.980  126.964 1.00 40.68  ? 40  ILE B CG1 1 
ATOM   3092  C  CG2 . ILE B  1 63  ? 70.927  51.971  128.571 1.00 29.63  ? 40  ILE B CG2 1 
ATOM   3093  C  CD1 . ILE B  1 63  ? 73.594  52.041  127.424 1.00 39.03  ? 40  ILE B CD1 1 
ATOM   3094  N  N   . GLU B  1 64  ? 68.672  49.904  128.826 1.00 38.15  ? 41  GLU B N   1 
ATOM   3095  C  CA  . GLU B  1 64  ? 67.455  50.206  129.583 1.00 47.18  ? 41  GLU B CA  1 
ATOM   3096  C  C   . GLU B  1 64  ? 67.788  51.044  130.806 1.00 39.69  ? 41  GLU B C   1 
ATOM   3097  O  O   . GLU B  1 64  ? 68.787  50.785  131.481 1.00 35.58  ? 41  GLU B O   1 
ATOM   3098  C  CB  . GLU B  1 64  ? 66.783  48.921  130.062 1.00 54.27  ? 41  GLU B CB  1 
ATOM   3099  C  CG  . GLU B  1 64  ? 66.506  47.901  128.984 1.00 68.20  ? 41  GLU B CG  1 
ATOM   3100  C  CD  . GLU B  1 64  ? 65.853  46.648  129.542 1.00 74.14  ? 41  GLU B CD  1 
ATOM   3101  O  OE1 . GLU B  1 64  ? 65.260  46.725  130.643 1.00 73.92  ? 41  GLU B OE1 1 
ATOM   3102  O  OE2 . GLU B  1 64  ? 65.941  45.590  128.882 1.00 76.27  ? 41  GLU B OE2 1 
ATOM   3103  N  N   . THR B  1 65  ? 66.956  52.038  131.101 1.00 40.95  ? 42  THR B N   1 
ATOM   3104  C  CA  . THR B  1 65  ? 67.093  52.790  132.348 1.00 44.89  ? 42  THR B CA  1 
ATOM   3105  C  C   . THR B  1 65  ? 65.926  52.479  133.283 1.00 51.59  ? 42  THR B C   1 
ATOM   3106  O  O   . THR B  1 65  ? 64.865  52.040  132.832 1.00 47.01  ? 42  THR B O   1 
ATOM   3107  C  CB  . THR B  1 65  ? 67.156  54.316  132.119 1.00 49.67  ? 42  THR B CB  1 
ATOM   3108  O  OG1 . THR B  1 65  ? 65.957  54.758  131.471 1.00 52.59  ? 42  THR B OG1 1 
ATOM   3109  C  CG2 . THR B  1 65  ? 68.379  54.697  131.276 1.00 46.46  ? 42  THR B CG2 1 
ATOM   3110  N  N   . GLU B  1 66  ? 66.126  52.697  134.581 1.00 50.41  ? 43  GLU B N   1 
ATOM   3111  C  CA  . GLU B  1 66  ? 65.069  52.470  135.562 1.00 48.13  ? 43  GLU B CA  1 
ATOM   3112  C  C   . GLU B  1 66  ? 63.859  53.342  135.256 1.00 55.66  ? 43  GLU B C   1 
ATOM   3113  O  O   . GLU B  1 66  ? 62.735  53.001  135.621 1.00 65.66  ? 43  GLU B O   1 
ATOM   3114  C  CB  . GLU B  1 66  ? 65.558  52.738  136.993 1.00 46.98  ? 43  GLU B CB  1 
ATOM   3115  C  CG  . GLU B  1 66  ? 66.667  51.805  137.486 1.00 63.63  ? 43  GLU B CG  1 
ATOM   3116  C  CD  . GLU B  1 66  ? 66.270  50.326  137.499 1.00 80.04  ? 43  GLU B CD  1 
ATOM   3117  O  OE1 . GLU B  1 66  ? 65.162  49.987  137.024 1.00 87.36  ? 43  GLU B OE1 1 
ATOM   3118  O  OE2 . GLU B  1 66  ? 67.076  49.499  137.988 1.00 79.33  ? 43  GLU B OE2 1 
ATOM   3119  N  N   . GLU B  1 67  ? 64.094  54.461  134.576 1.00 50.91  ? 44  GLU B N   1 
ATOM   3120  C  CA  . GLU B  1 67  ? 63.037  55.423  134.277 1.00 50.67  ? 44  GLU B CA  1 
ATOM   3121  C  C   . GLU B  1 67  ? 62.313  55.087  132.977 1.00 53.26  ? 44  GLU B C   1 
ATOM   3122  O  O   . GLU B  1 67  ? 61.389  55.789  132.570 1.00 63.20  ? 44  GLU B O   1 
ATOM   3123  C  CB  . GLU B  1 67  ? 63.600  56.848  134.209 1.00 58.66  ? 44  GLU B CB  1 
ATOM   3124  C  CG  . GLU B  1 67  ? 64.073  57.420  135.550 1.00 68.75  ? 44  GLU B CG  1 
ATOM   3125  C  CD  . GLU B  1 67  ? 65.383  56.814  136.050 1.00 69.08  ? 44  GLU B CD  1 
ATOM   3126  O  OE1 . GLU B  1 67  ? 66.099  56.186  135.243 1.00 69.38  ? 44  GLU B OE1 1 
ATOM   3127  O  OE2 . GLU B  1 67  ? 65.695  56.970  137.255 1.00 64.06  ? 44  GLU B OE2 1 
ATOM   3128  N  N   . GLY B  1 68  ? 62.740  54.021  132.317 1.00 49.40  ? 45  GLY B N   1 
ATOM   3129  C  CA  . GLY B  1 68  ? 62.068  53.573  131.112 1.00 53.25  ? 45  GLY B CA  1 
ATOM   3130  C  C   . GLY B  1 68  ? 62.420  54.346  129.856 1.00 54.66  ? 45  GLY B C   1 
ATOM   3131  O  O   . GLY B  1 68  ? 61.615  54.430  128.923 1.00 55.42  ? 45  GLY B O   1 
ATOM   3132  N  N   . VAL B  1 69  ? 63.620  54.917  129.830 1.00 50.67  ? 46  VAL B N   1 
ATOM   3133  C  CA  . VAL B  1 69  ? 64.145  55.534  128.619 1.00 44.93  ? 46  VAL B CA  1 
ATOM   3134  C  C   . VAL B  1 69  ? 65.139  54.574  127.969 1.00 45.89  ? 46  VAL B C   1 
ATOM   3135  O  O   . VAL B  1 69  ? 66.082  54.118  128.621 1.00 42.55  ? 46  VAL B O   1 
ATOM   3136  C  CB  . VAL B  1 69  ? 64.833  56.876  128.908 1.00 48.78  ? 46  VAL B CB  1 
ATOM   3137  C  CG1 . VAL B  1 69  ? 65.390  57.476  127.623 1.00 49.24  ? 46  VAL B CG1 1 
ATOM   3138  C  CG2 . VAL B  1 69  ? 63.863  57.845  129.571 1.00 43.92  ? 46  VAL B CG2 1 
ATOM   3139  N  N   . PRO B  1 70  ? 64.925  54.257  126.681 1.00 42.98  ? 47  PRO B N   1 
ATOM   3140  C  CA  . PRO B  1 70  ? 65.740  53.268  125.971 1.00 42.86  ? 47  PRO B CA  1 
ATOM   3141  C  C   . PRO B  1 70  ? 67.018  53.879  125.368 1.00 41.88  ? 47  PRO B C   1 
ATOM   3142  O  O   . PRO B  1 70  ? 67.123  55.092  125.173 1.00 34.65  ? 47  PRO B O   1 
ATOM   3143  C  CB  . PRO B  1 70  ? 64.804  52.815  124.849 1.00 33.38  ? 47  PRO B CB  1 
ATOM   3144  C  CG  . PRO B  1 70  ? 64.033  54.080  124.507 1.00 35.88  ? 47  PRO B CG  1 
ATOM   3145  C  CD  . PRO B  1 70  ? 63.905  54.863  125.802 1.00 42.08  ? 47  PRO B CD  1 
ATOM   3146  N  N   . GLY B  1 71  ? 67.986  53.027  125.063 1.00 43.43  ? 48  GLY B N   1 
ATOM   3147  C  CA  . GLY B  1 71  ? 69.208  53.477  124.422 1.00 43.03  ? 48  GLY B CA  1 
ATOM   3148  C  C   . GLY B  1 71  ? 69.594  52.503  123.333 1.00 46.80  ? 48  GLY B C   1 
ATOM   3149  O  O   . GLY B  1 71  ? 69.641  51.293  123.571 1.00 45.20  ? 48  GLY B O   1 
ATOM   3150  N  N   . ARG B  1 72  ? 69.861  53.027  122.139 1.00 42.76  ? 49  ARG B N   1 
ATOM   3151  C  CA  . ARG B  1 72  ? 70.155  52.186  120.988 1.00 40.14  ? 49  ARG B CA  1 
ATOM   3152  C  C   . ARG B  1 72  ? 71.263  52.733  120.085 1.00 41.70  ? 49  ARG B C   1 
ATOM   3153  O  O   . ARG B  1 72  ? 71.139  53.808  119.503 1.00 41.69  ? 49  ARG B O   1 
ATOM   3154  C  CB  . ARG B  1 72  ? 68.889  51.955  120.163 1.00 41.11  ? 49  ARG B CB  1 
ATOM   3155  C  CG  . ARG B  1 72  ? 67.954  50.917  120.757 1.00 49.57  ? 49  ARG B CG  1 
ATOM   3156  C  CD  . ARG B  1 72  ? 66.833  50.540  119.788 1.00 43.10  ? 49  ARG B CD  1 
ATOM   3157  N  NE  . ARG B  1 72  ? 65.909  51.642  119.526 1.00 40.43  ? 49  ARG B NE  1 
ATOM   3158  C  CZ  . ARG B  1 72  ? 64.977  52.044  120.384 1.00 42.75  ? 49  ARG B CZ  1 
ATOM   3159  N  NH1 . ARG B  1 72  ? 64.867  51.438  121.561 1.00 45.30  ? 49  ARG B NH1 1 
ATOM   3160  N  NH2 . ARG B  1 72  ? 64.157  53.046  120.072 1.00 42.65  ? 49  ARG B NH2 1 
ATOM   3161  N  N   . ALA B  1 73  ? 72.335  51.959  119.964 1.00 37.57  ? 50  ALA B N   1 
ATOM   3162  C  CA  . ALA B  1 73  ? 73.416  52.256  119.042 1.00 39.01  ? 50  ALA B CA  1 
ATOM   3163  C  C   . ALA B  1 73  ? 74.042  50.922  118.662 1.00 40.57  ? 50  ALA B C   1 
ATOM   3164  O  O   . ALA B  1 73  ? 73.747  49.897  119.292 1.00 32.78  ? 50  ALA B O   1 
ATOM   3165  C  CB  . ALA B  1 73  ? 74.440  53.169  119.705 1.00 36.90  ? 50  ALA B CB  1 
ATOM   3166  N  N   . TYR B  1 74  ? 74.902  50.922  117.646 1.00 37.92  ? 51  TYR B N   1 
ATOM   3167  C  CA  . TYR B  1 74  ? 75.576  49.689  117.238 1.00 36.25  ? 51  TYR B CA  1 
ATOM   3168  C  C   . TYR B  1 74  ? 77.082  49.848  117.017 1.00 33.84  ? 51  TYR B C   1 
ATOM   3169  O  O   . TYR B  1 74  ? 77.553  50.917  116.659 1.00 44.34  ? 51  TYR B O   1 
ATOM   3170  C  CB  . TYR B  1 74  ? 74.931  49.138  115.966 1.00 32.44  ? 51  TYR B CB  1 
ATOM   3171  C  CG  . TYR B  1 74  ? 75.123  50.026  114.768 1.00 29.83  ? 51  TYR B CG  1 
ATOM   3172  C  CD1 . TYR B  1 74  ? 76.215  49.863  113.933 1.00 37.18  ? 51  TYR B CD1 1 
ATOM   3173  C  CD2 . TYR B  1 74  ? 74.227  51.048  114.484 1.00 34.20  ? 51  TYR B CD2 1 
ATOM   3174  C  CE1 . TYR B  1 74  ? 76.409  50.690  112.829 1.00 33.89  ? 51  TYR B CE1 1 
ATOM   3175  C  CE2 . TYR B  1 74  ? 74.411  51.882  113.382 1.00 34.69  ? 51  TYR B CE2 1 
ATOM   3176  C  CZ  . TYR B  1 74  ? 75.504  51.694  112.557 1.00 37.33  ? 51  TYR B CZ  1 
ATOM   3177  O  OH  . TYR B  1 74  ? 75.699  52.509  111.456 1.00 37.70  ? 51  TYR B OH  1 
ATOM   3178  N  N   . LEU B  1 75  ? 77.823  48.765  117.221 1.00 38.71  ? 52  LEU B N   1 
ATOM   3179  C  CA  . LEU B  1 75  ? 79.239  48.685  116.870 1.00 33.60  ? 52  LEU B CA  1 
ATOM   3180  C  C   . LEU B  1 75  ? 79.450  47.962  115.538 1.00 37.35  ? 52  LEU B C   1 
ATOM   3181  O  O   . LEU B  1 75  ? 78.637  47.139  115.144 1.00 45.94  ? 52  LEU B O   1 
ATOM   3182  C  CB  . LEU B  1 75  ? 79.993  47.922  117.958 1.00 31.12  ? 52  LEU B CB  1 
ATOM   3183  C  CG  . LEU B  1 75  ? 80.273  48.634  119.279 1.00 32.92  ? 52  LEU B CG  1 
ATOM   3184  C  CD1 . LEU B  1 75  ? 80.994  47.683  120.224 1.00 28.00  ? 52  LEU B CD1 1 
ATOM   3185  C  CD2 . LEU B  1 75  ? 81.108  49.914  119.045 1.00 33.65  ? 52  LEU B CD2 1 
ATOM   3186  N  N   . GLU B  1 76  ? 80.552  48.262  114.856 1.00 42.83  ? 53  GLU B N   1 
ATOM   3187  C  CA  . GLU B  1 76  ? 80.938  47.558  113.631 1.00 33.58  ? 53  GLU B CA  1 
ATOM   3188  C  C   . GLU B  1 76  ? 82.397  47.104  113.724 1.00 41.65  ? 53  GLU B C   1 
ATOM   3189  O  O   . GLU B  1 76  ? 83.293  47.778  113.228 1.00 44.14  ? 53  GLU B O   1 
ATOM   3190  C  CB  . GLU B  1 76  ? 80.785  48.464  112.412 1.00 37.49  ? 53  GLU B CB  1 
ATOM   3191  C  CG  . GLU B  1 76  ? 79.412  49.074  112.218 1.00 48.96  ? 53  GLU B CG  1 
ATOM   3192  C  CD  . GLU B  1 76  ? 79.319  49.908  110.941 1.00 56.77  ? 53  GLU B CD  1 
ATOM   3193  O  OE1 . GLU B  1 76  ? 79.072  49.328  109.864 1.00 60.99  ? 53  GLU B OE1 1 
ATOM   3194  O  OE2 . GLU B  1 76  ? 79.493  51.144  111.010 1.00 58.82  ? 53  GLU B OE2 1 
ATOM   3195  N  N   . PRO B  1 77  ? 82.643  45.951  114.354 1.00 44.52  ? 54  PRO B N   1 
ATOM   3196  C  CA  . PRO B  1 77  ? 84.015  45.571  114.706 1.00 40.74  ? 54  PRO B CA  1 
ATOM   3197  C  C   . PRO B  1 77  ? 84.819  44.844  113.622 1.00 42.91  ? 54  PRO B C   1 
ATOM   3198  O  O   . PRO B  1 77  ? 85.915  44.379  113.950 1.00 36.79  ? 54  PRO B O   1 
ATOM   3199  C  CB  . PRO B  1 77  ? 83.806  44.645  115.907 1.00 40.83  ? 54  PRO B CB  1 
ATOM   3200  C  CG  . PRO B  1 77  ? 82.503  43.967  115.606 1.00 38.12  ? 54  PRO B CG  1 
ATOM   3201  C  CD  . PRO B  1 77  ? 81.652  44.989  114.874 1.00 44.08  ? 54  PRO B CD  1 
ATOM   3202  N  N   . TYR B  1 78  ? 84.306  44.735  112.392 1.00 38.70  ? 55  TYR B N   1 
ATOM   3203  C  CA  . TYR B  1 78  ? 85.080  44.161  111.281 1.00 29.03  ? 55  TYR B CA  1 
ATOM   3204  C  C   . TYR B  1 78  ? 85.289  42.646  111.382 1.00 45.44  ? 55  TYR B C   1 
ATOM   3205  O  O   . TYR B  1 78  ? 84.948  41.907  110.463 1.00 51.66  ? 55  TYR B O   1 
ATOM   3206  C  CB  . TYR B  1 78  ? 86.473  44.791  111.211 1.00 36.62  ? 55  TYR B CB  1 
ATOM   3207  C  CG  . TYR B  1 78  ? 86.585  46.131  110.523 1.00 44.13  ? 55  TYR B CG  1 
ATOM   3208  C  CD1 . TYR B  1 78  ? 86.961  46.217  109.186 1.00 44.48  ? 55  TYR B CD1 1 
ATOM   3209  C  CD2 . TYR B  1 78  ? 86.361  47.317  111.220 1.00 48.91  ? 55  TYR B CD2 1 
ATOM   3210  C  CE1 . TYR B  1 78  ? 87.087  47.444  108.558 1.00 46.87  ? 55  TYR B CE1 1 
ATOM   3211  C  CE2 . TYR B  1 78  ? 86.486  48.552  110.597 1.00 48.57  ? 55  TYR B CE2 1 
ATOM   3212  C  CZ  . TYR B  1 78  ? 86.850  48.609  109.270 1.00 43.89  ? 55  TYR B CZ  1 
ATOM   3213  O  OH  . TYR B  1 78  ? 86.964  49.828  108.643 1.00 47.19  ? 55  TYR B OH  1 
ATOM   3214  N  N   . VAL B  1 79  ? 85.897  42.196  112.481 1.00 47.24  ? 56  VAL B N   1 
ATOM   3215  C  CA  . VAL B  1 79  ? 86.278  40.792  112.647 1.00 47.81  ? 56  VAL B CA  1 
ATOM   3216  C  C   . VAL B  1 79  ? 85.190  39.996  113.357 1.00 47.49  ? 56  VAL B C   1 
ATOM   3217  O  O   . VAL B  1 79  ? 85.034  40.123  114.572 1.00 46.81  ? 56  VAL B O   1 
ATOM   3218  C  CB  . VAL B  1 79  ? 87.568  40.651  113.488 1.00 55.45  ? 56  VAL B CB  1 
ATOM   3219  C  CG1 . VAL B  1 79  ? 87.926  39.175  113.668 1.00 54.23  ? 56  VAL B CG1 1 
ATOM   3220  C  CG2 . VAL B  1 79  ? 88.731  41.435  112.868 1.00 50.41  ? 56  VAL B CG2 1 
ATOM   3221  N  N   . PRO B  1 80  ? 84.453  39.151  112.610 1.00 49.45  ? 57  PRO B N   1 
ATOM   3222  C  CA  . PRO B  1 80  ? 83.275  38.468  113.162 1.00 47.84  ? 57  PRO B CA  1 
ATOM   3223  C  C   . PRO B  1 80  ? 83.597  37.755  114.469 1.00 42.18  ? 57  PRO B C   1 
ATOM   3224  O  O   . PRO B  1 80  ? 82.868  37.906  115.455 1.00 42.90  ? 57  PRO B O   1 
ATOM   3225  C  CB  . PRO B  1 80  ? 82.909  37.460  112.065 1.00 41.58  ? 57  PRO B CB  1 
ATOM   3226  C  CG  . PRO B  1 80  ? 83.432  38.069  110.820 1.00 47.75  ? 57  PRO B CG  1 
ATOM   3227  C  CD  . PRO B  1 80  ? 84.718  38.739  111.222 1.00 49.74  ? 57  PRO B CD  1 
ATOM   3228  N  N   . LYS B  1 81  ? 84.685  36.994  114.478 1.00 40.03  ? 58  LYS B N   1 
ATOM   3229  C  CA  . LYS B  1 81  ? 85.105  36.309  115.696 1.00 48.21  ? 58  LYS B CA  1 
ATOM   3230  C  C   . LYS B  1 81  ? 85.147  37.261  116.902 1.00 48.91  ? 58  LYS B C   1 
ATOM   3231  O  O   . LYS B  1 81  ? 84.749  36.886  118.001 1.00 54.32  ? 58  LYS B O   1 
ATOM   3232  C  CB  . LYS B  1 81  ? 86.476  35.649  115.501 1.00 57.97  ? 58  LYS B CB  1 
ATOM   3233  C  CG  . LYS B  1 81  ? 86.501  34.545  114.455 1.00 71.60  ? 58  LYS B CG  1 
ATOM   3234  C  CD  . LYS B  1 81  ? 86.873  33.203  115.078 1.00 77.61  ? 58  LYS B CD  1 
ATOM   3235  C  CE  . LYS B  1 81  ? 86.734  32.055  114.085 1.00 81.18  ? 58  LYS B CE  1 
ATOM   3236  N  NZ  . LYS B  1 81  ? 86.897  30.732  114.758 1.00 82.83  ? 58  LYS B NZ  1 
ATOM   3237  N  N   . ALA B  1 82  ? 85.620  38.490  116.690 1.00 40.67  ? 59  ALA B N   1 
ATOM   3238  C  CA  . ALA B  1 82  ? 85.857  39.417  117.792 1.00 39.85  ? 59  ALA B CA  1 
ATOM   3239  C  C   . ALA B  1 82  ? 84.612  39.643  118.639 1.00 44.14  ? 59  ALA B C   1 
ATOM   3240  O  O   . ALA B  1 82  ? 84.711  40.032  119.803 1.00 45.86  ? 59  ALA B O   1 
ATOM   3241  C  CB  . ALA B  1 82  ? 86.399  40.746  117.281 1.00 32.62  ? 59  ALA B CB  1 
ATOM   3242  N  N   . MET B  1 83  ? 83.443  39.394  118.059 1.00 43.57  ? 60  MET B N   1 
ATOM   3243  C  CA  . MET B  1 83  ? 82.196  39.548  118.797 1.00 45.46  ? 60  MET B CA  1 
ATOM   3244  C  C   . MET B  1 83  ? 82.121  38.601  120.000 1.00 48.63  ? 60  MET B C   1 
ATOM   3245  O  O   . MET B  1 83  ? 81.337  38.825  120.921 1.00 50.51  ? 60  MET B O   1 
ATOM   3246  C  CB  . MET B  1 83  ? 81.002  39.358  117.868 1.00 45.80  ? 60  MET B CB  1 
ATOM   3247  C  CG  . MET B  1 83  ? 81.004  40.344  116.709 1.00 50.10  ? 60  MET B CG  1 
ATOM   3248  S  SD  . MET B  1 83  ? 79.417  40.485  115.867 1.00 54.11  ? 60  MET B SD  1 
ATOM   3249  C  CE  . MET B  1 83  ? 79.367  38.918  114.994 1.00 45.04  ? 60  MET B CE  1 
ATOM   3250  N  N   . LYS B  1 84  ? 82.954  37.560  119.992 1.00 44.68  ? 61  LYS B N   1 
ATOM   3251  C  CA  . LYS B  1 84  ? 83.045  36.630  121.120 1.00 53.07  ? 61  LYS B CA  1 
ATOM   3252  C  C   . LYS B  1 84  ? 83.814  37.233  122.273 1.00 51.31  ? 61  LYS B C   1 
ATOM   3253  O  O   . LYS B  1 84  ? 83.697  36.776  123.403 1.00 51.53  ? 61  LYS B O   1 
ATOM   3254  C  CB  . LYS B  1 84  ? 83.717  35.318  120.714 1.00 55.23  ? 61  LYS B CB  1 
ATOM   3255  C  CG  . LYS B  1 84  ? 82.772  34.311  120.081 1.00 64.86  ? 61  LYS B CG  1 
ATOM   3256  C  CD  . LYS B  1 84  ? 83.526  33.095  119.584 1.00 70.23  ? 61  LYS B CD  1 
ATOM   3257  C  CE  . LYS B  1 84  ? 84.588  33.495  118.578 1.00 70.99  ? 61  LYS B CE  1 
ATOM   3258  N  NZ  . LYS B  1 84  ? 85.175  32.311  117.903 1.00 76.69  ? 61  LYS B NZ  1 
ATOM   3259  N  N   . TYR B  1 85  ? 84.623  38.246  121.986 1.00 51.58  ? 62  TYR B N   1 
ATOM   3260  C  CA  . TYR B  1 85  ? 85.356  38.921  123.043 1.00 53.87  ? 62  TYR B CA  1 
ATOM   3261  C  C   . TYR B  1 85  ? 84.563  40.128  123.505 1.00 50.59  ? 62  TYR B C   1 
ATOM   3262  O  O   . TYR B  1 85  ? 84.548  40.456  124.690 1.00 52.73  ? 62  TYR B O   1 
ATOM   3263  C  CB  . TYR B  1 85  ? 86.727  39.380  122.560 1.00 58.18  ? 62  TYR B CB  1 
ATOM   3264  C  CG  . TYR B  1 85  ? 87.418  38.448  121.598 1.00 59.36  ? 62  TYR B CG  1 
ATOM   3265  C  CD1 . TYR B  1 85  ? 87.201  37.072  121.634 1.00 55.64  ? 62  TYR B CD1 1 
ATOM   3266  C  CD2 . TYR B  1 85  ? 88.295  38.952  120.649 1.00 63.55  ? 62  TYR B CD2 1 
ATOM   3267  C  CE1 . TYR B  1 85  ? 87.846  36.228  120.741 1.00 58.55  ? 62  TYR B CE1 1 
ATOM   3268  C  CE2 . TYR B  1 85  ? 88.942  38.125  119.760 1.00 65.98  ? 62  TYR B CE2 1 
ATOM   3269  C  CZ  . TYR B  1 85  ? 88.720  36.767  119.803 1.00 62.61  ? 62  TYR B CZ  1 
ATOM   3270  O  OH  . TYR B  1 85  ? 89.384  35.970  118.897 1.00 55.67  ? 62  TYR B OH  1 
ATOM   3271  N  N   . LEU B  1 86  ? 83.890  40.777  122.562 1.00 48.56  ? 63  LEU B N   1 
ATOM   3272  C  CA  . LEU B  1 86  ? 83.237  42.052  122.831 1.00 50.22  ? 63  LEU B CA  1 
ATOM   3273  C  C   . LEU B  1 86  ? 81.922  41.916  123.581 1.00 51.73  ? 63  LEU B C   1 
ATOM   3274  O  O   . LEU B  1 86  ? 81.681  42.645  124.542 1.00 51.14  ? 63  LEU B O   1 
ATOM   3275  C  CB  . LEU B  1 86  ? 83.017  42.831  121.534 1.00 49.37  ? 63  LEU B CB  1 
ATOM   3276  C  CG  . LEU B  1 86  ? 84.280  43.405  120.898 1.00 48.34  ? 63  LEU B CG  1 
ATOM   3277  C  CD1 . LEU B  1 86  ? 83.928  44.175  119.631 1.00 42.20  ? 63  LEU B CD1 1 
ATOM   3278  C  CD2 . LEU B  1 86  ? 85.023  44.291  121.896 1.00 50.30  ? 63  LEU B CD2 1 
ATOM   3279  N  N   . VAL B  1 87  ? 81.068  40.998  123.137 1.00 54.79  ? 64  VAL B N   1 
ATOM   3280  C  CA  . VAL B  1 87  ? 79.765  40.822  123.774 1.00 51.81  ? 64  VAL B CA  1 
ATOM   3281  C  C   . VAL B  1 87  ? 79.914  40.520  125.274 1.00 45.89  ? 64  VAL B C   1 
ATOM   3282  O  O   . VAL B  1 87  ? 79.320  41.201  126.105 1.00 42.14  ? 64  VAL B O   1 
ATOM   3283  C  CB  . VAL B  1 87  ? 78.889  39.771  123.042 1.00 47.09  ? 64  VAL B CB  1 
ATOM   3284  C  CG1 . VAL B  1 87  ? 77.702  39.362  123.905 1.00 47.01  ? 64  VAL B CG1 1 
ATOM   3285  C  CG2 . VAL B  1 87  ? 78.408  40.322  121.707 1.00 45.09  ? 64  VAL B CG2 1 
ATOM   3286  N  N   . PRO B  1 88  ? 80.727  39.514  125.624 1.00 46.72  ? 65  PRO B N   1 
ATOM   3287  C  CA  . PRO B  1 88  ? 81.033  39.299  127.044 1.00 49.81  ? 65  PRO B CA  1 
ATOM   3288  C  C   . PRO B  1 88  ? 81.529  40.574  127.726 1.00 54.56  ? 65  PRO B C   1 
ATOM   3289  O  O   . PRO B  1 88  ? 81.016  40.930  128.785 1.00 59.16  ? 65  PRO B O   1 
ATOM   3290  C  CB  . PRO B  1 88  ? 82.153  38.255  127.007 1.00 44.91  ? 65  PRO B CB  1 
ATOM   3291  C  CG  . PRO B  1 88  ? 81.882  37.482  125.751 1.00 47.99  ? 65  PRO B CG  1 
ATOM   3292  C  CD  . PRO B  1 88  ? 81.315  38.472  124.762 1.00 46.12  ? 65  PRO B CD  1 
ATOM   3293  N  N   . ALA B  1 89  ? 82.508  41.252  127.132 1.00 49.71  ? 66  ALA B N   1 
ATOM   3294  C  CA  . ALA B  1 89  ? 83.052  42.470  127.738 1.00 45.19  ? 66  ALA B CA  1 
ATOM   3295  C  C   . ALA B  1 89  ? 81.969  43.520  127.953 1.00 44.27  ? 66  ALA B C   1 
ATOM   3296  O  O   . ALA B  1 89  ? 81.935  44.189  128.985 1.00 48.05  ? 66  ALA B O   1 
ATOM   3297  C  CB  . ALA B  1 89  ? 84.178  43.036  126.896 1.00 42.92  ? 66  ALA B CB  1 
ATOM   3298  N  N   . LEU B  1 90  ? 81.088  43.665  126.970 1.00 42.32  ? 67  LEU B N   1 
ATOM   3299  C  CA  . LEU B  1 90  ? 79.984  44.605  127.074 1.00 41.49  ? 67  LEU B CA  1 
ATOM   3300  C  C   . LEU B  1 90  ? 79.076  44.248  128.249 1.00 50.04  ? 67  LEU B C   1 
ATOM   3301  O  O   . LEU B  1 90  ? 78.682  45.117  129.029 1.00 50.65  ? 67  LEU B O   1 
ATOM   3302  C  CB  . LEU B  1 90  ? 79.182  44.631  125.771 1.00 37.68  ? 67  LEU B CB  1 
ATOM   3303  C  CG  . LEU B  1 90  ? 79.842  45.397  124.620 1.00 35.09  ? 67  LEU B CG  1 
ATOM   3304  C  CD1 . LEU B  1 90  ? 79.099  45.207  123.322 1.00 39.40  ? 67  LEU B CD1 1 
ATOM   3305  C  CD2 . LEU B  1 90  ? 79.921  46.870  124.943 1.00 34.18  ? 67  LEU B CD2 1 
ATOM   3306  N  N   . HIS B  1 91  ? 78.748  42.968  128.382 1.00 40.97  ? 68  HIS B N   1 
ATOM   3307  C  CA  . HIS B  1 91  ? 77.827  42.552  129.435 1.00 48.65  ? 68  HIS B CA  1 
ATOM   3308  C  C   . HIS B  1 91  ? 78.412  42.784  130.828 1.00 46.83  ? 68  HIS B C   1 
ATOM   3309  O  O   . HIS B  1 91  ? 77.695  43.164  131.757 1.00 42.34  ? 68  HIS B O   1 
ATOM   3310  C  CB  . HIS B  1 91  ? 77.386  41.095  129.239 1.00 53.24  ? 68  HIS B CB  1 
ATOM   3311  C  CG  . HIS B  1 91  ? 76.418  40.908  128.109 1.00 59.44  ? 68  HIS B CG  1 
ATOM   3312  N  ND1 . HIS B  1 91  ? 76.325  39.733  127.392 1.00 60.41  ? 68  HIS B ND1 1 
ATOM   3313  C  CD2 . HIS B  1 91  ? 75.503  41.751  127.572 1.00 58.54  ? 68  HIS B CD2 1 
ATOM   3314  C  CE1 . HIS B  1 91  ? 75.394  39.863  126.461 1.00 63.66  ? 68  HIS B CE1 1 
ATOM   3315  N  NE2 . HIS B  1 91  ? 74.881  41.078  126.548 1.00 59.90  ? 68  HIS B NE2 1 
ATOM   3316  N  N   . ASP B  1 92  ? 79.717  42.576  130.968 1.00 38.32  ? 69  ASP B N   1 
ATOM   3317  C  CA  . ASP B  1 92  ? 80.380  42.817  132.245 1.00 49.61  ? 69  ASP B CA  1 
ATOM   3318  C  C   . ASP B  1 92  ? 80.360  44.305  132.620 1.00 48.12  ? 69  ASP B C   1 
ATOM   3319  O  O   . ASP B  1 92  ? 80.316  44.655  133.802 1.00 46.98  ? 69  ASP B O   1 
ATOM   3320  C  CB  . ASP B  1 92  ? 81.813  42.275  132.234 1.00 56.25  ? 69  ASP B CB  1 
ATOM   3321  C  CG  . ASP B  1 92  ? 81.868  40.760  132.083 1.00 64.60  ? 69  ASP B CG  1 
ATOM   3322  O  OD1 . ASP B  1 92  ? 80.803  40.105  132.134 1.00 69.70  ? 69  ASP B OD1 1 
ATOM   3323  O  OD2 . ASP B  1 92  ? 82.983  40.222  131.922 1.00 66.35  ? 69  ASP B OD2 1 
ATOM   3324  N  N   . MET B  1 93  ? 80.389  45.175  131.614 1.00 39.55  ? 70  MET B N   1 
ATOM   3325  C  CA  . MET B  1 93  ? 80.248  46.608  131.849 1.00 40.72  ? 70  MET B CA  1 
ATOM   3326  C  C   . MET B  1 93  ? 78.828  46.906  132.329 1.00 45.15  ? 70  MET B C   1 
ATOM   3327  O  O   . MET B  1 93  ? 78.622  47.777  133.176 1.00 51.69  ? 70  MET B O   1 
ATOM   3328  C  CB  . MET B  1 93  ? 80.584  47.429  130.590 1.00 31.64  ? 70  MET B CB  1 
ATOM   3329  C  CG  . MET B  1 93  ? 82.066  47.509  130.276 1.00 35.52  ? 70  MET B CG  1 
ATOM   3330  S  SD  . MET B  1 93  ? 82.417  48.385  128.732 1.00 46.49  ? 70  MET B SD  1 
ATOM   3331  C  CE  . MET B  1 93  ? 84.186  48.161  128.626 1.00 50.75  ? 70  MET B CE  1 
ATOM   3332  N  N   . SER B  1 94  ? 77.853  46.179  131.789 1.00 39.75  ? 71  SER B N   1 
ATOM   3333  C  CA  . SER B  1 94  ? 76.467  46.310  132.243 1.00 41.85  ? 71  SER B CA  1 
ATOM   3334  C  C   . SER B  1 94  ? 76.366  45.920  133.715 1.00 49.92  ? 71  SER B C   1 
ATOM   3335  O  O   . SER B  1 94  ? 75.715  46.603  134.512 1.00 46.78  ? 71  SER B O   1 
ATOM   3336  C  CB  . SER B  1 94  ? 75.529  45.445  131.402 1.00 35.29  ? 71  SER B CB  1 
ATOM   3337  O  OG  . SER B  1 94  ? 74.173  45.631  131.777 1.00 37.25  ? 71  SER B OG  1 
ATOM   3338  N  N   . ASP B  1 95  ? 77.024  44.822  134.075 1.00 55.31  ? 72  ASP B N   1 
ATOM   3339  C  CA  . ASP B  1 95  ? 77.022  44.367  135.460 1.00 60.05  ? 72  ASP B CA  1 
ATOM   3340  C  C   . ASP B  1 95  ? 77.666  45.415  136.349 1.00 56.84  ? 72  ASP B C   1 
ATOM   3341  O  O   . ASP B  1 95  ? 77.180  45.710  137.447 1.00 53.18  ? 72  ASP B O   1 
ATOM   3342  C  CB  . ASP B  1 95  ? 77.759  43.031  135.607 1.00 64.94  ? 72  ASP B CB  1 
ATOM   3343  C  CG  . ASP B  1 95  ? 76.958  41.853  135.067 1.00 65.17  ? 72  ASP B CG  1 
ATOM   3344  O  OD1 . ASP B  1 95  ? 75.738  42.017  134.834 1.00 53.91  ? 72  ASP B OD1 1 
ATOM   3345  O  OD2 . ASP B  1 95  ? 77.551  40.765  134.883 1.00 68.85  ? 72  ASP B OD2 1 
ATOM   3346  N  N   . MET B  1 96  ? 78.764  45.979  135.861 1.00 53.12  ? 73  MET B N   1 
ATOM   3347  C  CA  . MET B  1 96  ? 79.510  46.961  136.626 1.00 49.54  ? 73  MET B CA  1 
ATOM   3348  C  C   . MET B  1 96  ? 78.704  48.241  136.821 1.00 44.49  ? 73  MET B C   1 
ATOM   3349  O  O   . MET B  1 96  ? 78.793  48.880  137.866 1.00 43.01  ? 73  MET B O   1 
ATOM   3350  C  CB  . MET B  1 96  ? 80.835  47.274  135.938 1.00 60.17  ? 73  MET B CB  1 
ATOM   3351  C  CG  . MET B  1 96  ? 81.643  48.344  136.647 1.00 69.26  ? 73  MET B CG  1 
ATOM   3352  S  SD  . MET B  1 96  ? 82.895  49.072  135.590 1.00 87.96  ? 73  MET B SD  1 
ATOM   3353  C  CE  . MET B  1 96  ? 81.881  49.685  134.250 1.00 72.59  ? 73  MET B CE  1 
ATOM   3354  N  N   . LEU B  1 97  ? 77.903  48.594  135.820 1.00 47.12  ? 74  LEU B N   1 
ATOM   3355  C  CA  . LEU B  1 97  ? 77.221  49.884  135.792 1.00 46.38  ? 74  LEU B CA  1 
ATOM   3356  C  C   . LEU B  1 97  ? 75.824  49.876  136.409 1.00 43.29  ? 74  LEU B C   1 
ATOM   3357  O  O   . LEU B  1 97  ? 75.242  50.936  136.637 1.00 43.73  ? 74  LEU B O   1 
ATOM   3358  C  CB  . LEU B  1 97  ? 77.137  50.408  134.357 1.00 42.41  ? 74  LEU B CB  1 
ATOM   3359  C  CG  . LEU B  1 97  ? 78.465  50.775  133.701 1.00 44.78  ? 74  LEU B CG  1 
ATOM   3360  C  CD1 . LEU B  1 97  ? 78.273  51.002  132.205 1.00 41.56  ? 74  LEU B CD1 1 
ATOM   3361  C  CD2 . LEU B  1 97  ? 79.093  51.990  134.379 1.00 45.47  ? 74  LEU B CD2 1 
ATOM   3362  N  N   . ALA B  1 98  ? 75.281  48.692  136.668 1.00 38.83  ? 75  ALA B N   1 
ATOM   3363  C  CA  . ALA B  1 98  ? 73.918  48.583  137.183 1.00 34.70  ? 75  ALA B CA  1 
ATOM   3364  C  C   . ALA B  1 98  ? 73.681  49.479  138.396 1.00 34.20  ? 75  ALA B C   1 
ATOM   3365  O  O   . ALA B  1 98  ? 74.455  49.457  139.360 1.00 37.21  ? 75  ALA B O   1 
ATOM   3366  C  CB  . ALA B  1 98  ? 73.597  47.136  137.520 1.00 36.50  ? 75  ALA B CB  1 
ATOM   3367  N  N   . GLY B  1 99  ? 72.621  50.280  138.333 1.00 37.80  ? 76  GLY B N   1 
ATOM   3368  C  CA  . GLY B  1 99  ? 72.217  51.112  139.455 1.00 37.46  ? 76  GLY B CA  1 
ATOM   3369  C  C   . GLY B  1 99  ? 72.874  52.481  139.488 1.00 46.17  ? 76  GLY B C   1 
ATOM   3370  O  O   . GLY B  1 99  ? 72.560  53.303  140.340 1.00 56.57  ? 76  GLY B O   1 
ATOM   3371  N  N   . GLN B  1 100 ? 73.789  52.731  138.559 1.00 43.24  ? 77  GLN B N   1 
ATOM   3372  C  CA  . GLN B  1 100 ? 74.507  54.002  138.523 1.00 47.03  ? 77  GLN B CA  1 
ATOM   3373  C  C   . GLN B  1 100 ? 73.842  54.991  137.570 1.00 47.32  ? 77  GLN B C   1 
ATOM   3374  O  O   . GLN B  1 100 ? 73.164  54.585  136.625 1.00 44.31  ? 77  GLN B O   1 
ATOM   3375  C  CB  . GLN B  1 100 ? 75.975  53.789  138.137 1.00 39.38  ? 77  GLN B CB  1 
ATOM   3376  C  CG  . GLN B  1 100 ? 76.888  53.527  139.324 1.00 53.75  ? 77  GLN B CG  1 
ATOM   3377  C  CD  . GLN B  1 100 ? 77.896  52.433  139.041 1.00 65.35  ? 77  GLN B CD  1 
ATOM   3378  O  OE1 . GLN B  1 100 ? 78.954  52.675  138.459 1.00 65.29  ? 77  GLN B OE1 1 
ATOM   3379  N  NE2 . GLN B  1 100 ? 77.564  51.212  139.442 1.00 73.39  ? 77  GLN B NE2 1 
ATOM   3380  N  N   . PRO B  1 101 ? 74.033  56.297  137.826 1.00 44.57  ? 78  PRO B N   1 
ATOM   3381  C  CA  . PRO B  1 101 ? 73.441  57.361  137.009 1.00 39.92  ? 78  PRO B CA  1 
ATOM   3382  C  C   . PRO B  1 101 ? 73.854  57.208  135.560 1.00 40.75  ? 78  PRO B C   1 
ATOM   3383  O  O   . PRO B  1 101 ? 75.013  56.929  135.281 1.00 32.65  ? 78  PRO B O   1 
ATOM   3384  C  CB  . PRO B  1 101 ? 74.067  58.629  137.585 1.00 34.08  ? 78  PRO B CB  1 
ATOM   3385  C  CG  . PRO B  1 101 ? 74.435  58.260  138.993 1.00 37.34  ? 78  PRO B CG  1 
ATOM   3386  C  CD  . PRO B  1 101 ? 74.885  56.837  138.902 1.00 38.51  ? 78  PRO B CD  1 
ATOM   3387  N  N   . LEU B  1 102 ? 72.907  57.367  134.649 1.00 41.68  ? 79  LEU B N   1 
ATOM   3388  C  CA  . LEU B  1 102 ? 73.219  57.256  133.244 1.00 30.81  ? 79  LEU B CA  1 
ATOM   3389  C  C   . LEU B  1 102 ? 73.805  58.577  132.769 1.00 36.24  ? 79  LEU B C   1 
ATOM   3390  O  O   . LEU B  1 102 ? 73.095  59.422  132.229 1.00 46.19  ? 79  LEU B O   1 
ATOM   3391  C  CB  . LEU B  1 102 ? 71.972  56.925  132.435 1.00 35.11  ? 79  LEU B CB  1 
ATOM   3392  C  CG  . LEU B  1 102 ? 72.364  56.623  130.993 1.00 38.26  ? 79  LEU B CG  1 
ATOM   3393  C  CD1 . LEU B  1 102 ? 72.135  55.161  130.720 1.00 33.39  ? 79  LEU B CD1 1 
ATOM   3394  C  CD2 . LEU B  1 102 ? 71.605  57.493  130.028 1.00 45.59  ? 79  LEU B CD2 1 
ATOM   3395  N  N   . ALA B  1 103 ? 75.102  58.745  132.996 1.00 38.36  ? 80  ALA B N   1 
ATOM   3396  C  CA  . ALA B  1 103 ? 75.829  59.966  132.657 1.00 35.28  ? 80  ALA B CA  1 
ATOM   3397  C  C   . ALA B  1 103 ? 77.038  59.567  131.821 1.00 37.59  ? 80  ALA B C   1 
ATOM   3398  O  O   . ALA B  1 103 ? 78.016  59.051  132.360 1.00 39.56  ? 80  ALA B O   1 
ATOM   3399  C  CB  . ALA B  1 103 ? 76.286  60.673  133.933 1.00 24.47  ? 80  ALA B CB  1 
ATOM   3400  N  N   . PRO B  1 104 ? 76.971  59.800  130.501 1.00 39.35  ? 81  PRO B N   1 
ATOM   3401  C  CA  . PRO B  1 104 ? 77.989  59.336  129.547 1.00 35.88  ? 81  PRO B CA  1 
ATOM   3402  C  C   . PRO B  1 104 ? 79.430  59.633  129.985 1.00 38.21  ? 81  PRO B C   1 
ATOM   3403  O  O   . PRO B  1 104 ? 80.279  58.744  129.919 1.00 40.88  ? 81  PRO B O   1 
ATOM   3404  C  CB  . PRO B  1 104 ? 77.650  60.108  128.273 1.00 30.86  ? 81  PRO B CB  1 
ATOM   3405  C  CG  . PRO B  1 104 ? 76.205  60.427  128.401 1.00 40.85  ? 81  PRO B CG  1 
ATOM   3406  C  CD  . PRO B  1 104 ? 75.920  60.603  129.854 1.00 36.20  ? 81  PRO B CD  1 
ATOM   3407  N  N   . ALA B  1 105 ? 79.698  60.858  130.427 1.00 30.52  ? 82  ALA B N   1 
ATOM   3408  C  CA  . ALA B  1 105 ? 81.053  61.246  130.805 1.00 29.86  ? 82  ALA B CA  1 
ATOM   3409  C  C   . ALA B  1 105 ? 81.542  60.437  131.992 1.00 32.89  ? 82  ALA B C   1 
ATOM   3410  O  O   . ALA B  1 105 ? 82.639  59.878  131.960 1.00 32.63  ? 82  ALA B O   1 
ATOM   3411  C  CB  . ALA B  1 105 ? 81.130  62.746  131.104 1.00 27.21  ? 82  ALA B CB  1 
ATOM   3412  N  N   . GLU B  1 106 ? 80.726  60.384  133.041 1.00 37.88  ? 83  GLU B N   1 
ATOM   3413  C  CA  . GLU B  1 106 ? 81.005  59.533  134.197 1.00 42.12  ? 83  GLU B CA  1 
ATOM   3414  C  C   . GLU B  1 106 ? 81.186  58.077  133.781 1.00 38.94  ? 83  GLU B C   1 
ATOM   3415  O  O   . GLU B  1 106 ? 82.157  57.432  134.172 1.00 36.05  ? 83  GLU B O   1 
ATOM   3416  C  CB  . GLU B  1 106 ? 79.890  59.637  135.241 1.00 46.58  ? 83  GLU B CB  1 
ATOM   3417  C  CG  . GLU B  1 106 ? 79.800  60.988  135.923 1.00 52.69  ? 83  GLU B CG  1 
ATOM   3418  C  CD  . GLU B  1 106 ? 78.904  60.970  137.155 1.00 71.98  ? 83  GLU B CD  1 
ATOM   3419  O  OE1 . GLU B  1 106 ? 78.611  59.867  137.682 1.00 78.65  ? 83  GLU B OE1 1 
ATOM   3420  O  OE2 . GLU B  1 106 ? 78.493  62.064  137.597 1.00 75.39  ? 83  GLU B OE2 1 
ATOM   3421  N  N   . ILE B  1 107 ? 80.254  57.562  132.983 1.00 36.35  ? 84  ILE B N   1 
ATOM   3422  C  CA  . ILE B  1 107 ? 80.337  56.178  132.518 1.00 34.90  ? 84  ILE B CA  1 
ATOM   3423  C  C   . ILE B  1 107 ? 81.623  55.908  131.727 1.00 38.25  ? 84  ILE B C   1 
ATOM   3424  O  O   . ILE B  1 107 ? 82.320  54.920  131.971 1.00 40.49  ? 84  ILE B O   1 
ATOM   3425  C  CB  . ILE B  1 107 ? 79.094  55.787  131.690 1.00 35.63  ? 84  ILE B CB  1 
ATOM   3426  C  CG1 . ILE B  1 107 ? 77.879  55.624  132.603 1.00 39.03  ? 84  ILE B CG1 1 
ATOM   3427  C  CG2 . ILE B  1 107 ? 79.332  54.495  130.918 1.00 33.26  ? 84  ILE B CG2 1 
ATOM   3428  C  CD1 . ILE B  1 107 ? 76.583  55.387  131.845 1.00 37.51  ? 84  ILE B CD1 1 
ATOM   3429  N  N   . TYR B  1 108 ? 81.936  56.799  130.789 1.00 35.41  ? 85  TYR B N   1 
ATOM   3430  C  CA  . TYR B  1 108 ? 83.126  56.672  129.955 1.00 30.96  ? 85  TYR B CA  1 
ATOM   3431  C  C   . TYR B  1 108 ? 84.388  56.512  130.804 1.00 34.86  ? 85  TYR B C   1 
ATOM   3432  O  O   . TYR B  1 108 ? 85.277  55.726  130.470 1.00 33.72  ? 85  TYR B O   1 
ATOM   3433  C  CB  . TYR B  1 108 ? 83.229  57.896  129.043 1.00 41.17  ? 85  TYR B CB  1 
ATOM   3434  C  CG  . TYR B  1 108 ? 84.417  57.948  128.101 1.00 43.77  ? 85  TYR B CG  1 
ATOM   3435  C  CD1 . TYR B  1 108 ? 84.472  57.150  126.965 1.00 47.00  ? 85  TYR B CD1 1 
ATOM   3436  C  CD2 . TYR B  1 108 ? 85.458  58.840  128.324 1.00 49.42  ? 85  TYR B CD2 1 
ATOM   3437  C  CE1 . TYR B  1 108 ? 85.548  57.218  126.093 1.00 55.74  ? 85  TYR B CE1 1 
ATOM   3438  C  CE2 . TYR B  1 108 ? 86.537  58.917  127.456 1.00 55.43  ? 85  TYR B CE2 1 
ATOM   3439  C  CZ  . TYR B  1 108 ? 86.579  58.106  126.344 1.00 59.59  ? 85  TYR B CZ  1 
ATOM   3440  O  OH  . TYR B  1 108 ? 87.658  58.187  125.487 1.00 62.48  ? 85  TYR B OH  1 
ATOM   3441  N  N   . ASP B  1 109 ? 84.468  57.267  131.898 1.00 35.73  ? 86  ASP B N   1 
ATOM   3442  C  CA  . ASP B  1 109 ? 85.577  57.132  132.837 1.00 39.45  ? 86  ASP B CA  1 
ATOM   3443  C  C   . ASP B  1 109 ? 85.608  55.753  133.505 1.00 45.13  ? 86  ASP B C   1 
ATOM   3444  O  O   . ASP B  1 109 ? 86.647  55.095  133.543 1.00 45.89  ? 86  ASP B O   1 
ATOM   3445  C  CB  . ASP B  1 109 ? 85.518  58.219  133.902 1.00 52.64  ? 86  ASP B CB  1 
ATOM   3446  C  CG  . ASP B  1 109 ? 86.701  58.161  134.857 1.00 69.57  ? 86  ASP B CG  1 
ATOM   3447  O  OD1 . ASP B  1 109 ? 87.804  58.613  134.459 1.00 71.84  ? 86  ASP B OD1 1 
ATOM   3448  O  OD2 . ASP B  1 109 ? 86.527  57.667  136.001 1.00 69.42  ? 86  ASP B OD2 1 
ATOM   3449  N  N   . LYS B  1 110 ? 84.466  55.306  134.019 1.00 45.22  ? 87  LYS B N   1 
ATOM   3450  C  CA  . LYS B  1 110 ? 84.405  54.018  134.712 1.00 46.85  ? 87  LYS B CA  1 
ATOM   3451  C  C   . LYS B  1 110 ? 84.676  52.824  133.792 1.00 45.50  ? 87  LYS B C   1 
ATOM   3452  O  O   . LYS B  1 110 ? 85.366  51.888  134.190 1.00 49.10  ? 87  LYS B O   1 
ATOM   3453  C  CB  . LYS B  1 110 ? 83.060  53.838  135.425 1.00 46.27  ? 87  LYS B CB  1 
ATOM   3454  C  CG  . LYS B  1 110 ? 82.741  54.914  136.449 1.00 45.32  ? 87  LYS B CG  1 
ATOM   3455  C  CD  . LYS B  1 110 ? 81.245  54.958  136.697 1.00 49.61  ? 87  LYS B CD  1 
ATOM   3456  C  CE  . LYS B  1 110 ? 80.873  55.891  137.839 1.00 58.04  ? 87  LYS B CE  1 
ATOM   3457  N  NZ  . LYS B  1 110 ? 79.397  55.894  138.049 1.00 61.36  ? 87  LYS B NZ  1 
ATOM   3458  N  N   . THR B  1 111 ? 84.134  52.846  132.573 1.00 43.67  ? 88  THR B N   1 
ATOM   3459  C  CA  . THR B  1 111 ? 84.322  51.715  131.658 1.00 46.11  ? 88  THR B CA  1 
ATOM   3460  C  C   . THR B  1 111 ? 85.775  51.565  131.235 1.00 41.58  ? 88  THR B C   1 
ATOM   3461  O  O   . THR B  1 111 ? 86.254  50.453  131.036 1.00 44.51  ? 88  THR B O   1 
ATOM   3462  C  CB  . THR B  1 111 ? 83.462  51.808  130.385 1.00 42.69  ? 88  THR B CB  1 
ATOM   3463  O  OG1 . THR B  1 111 ? 83.600  53.107  129.805 1.00 51.93  ? 88  THR B OG1 1 
ATOM   3464  C  CG2 . THR B  1 111 ? 82.015  51.549  130.701 1.00 39.57  ? 88  THR B CG2 1 
ATOM   3465  N  N   . ARG B  1 112 ? 86.476  52.685  131.104 1.00 37.36  ? 89  ARG B N   1 
ATOM   3466  C  CA  . ARG B  1 112 ? 87.879  52.647  130.712 1.00 36.53  ? 89  ARG B CA  1 
ATOM   3467  C  C   . ARG B  1 112 ? 88.809  52.345  131.891 1.00 40.81  ? 89  ARG B C   1 
ATOM   3468  O  O   . ARG B  1 112 ? 89.754  51.574  131.739 1.00 41.45  ? 89  ARG B O   1 
ATOM   3469  C  CB  . ARG B  1 112 ? 88.264  53.940  130.000 1.00 43.49  ? 89  ARG B CB  1 
ATOM   3470  C  CG  . ARG B  1 112 ? 87.619  54.051  128.630 1.00 50.38  ? 89  ARG B CG  1 
ATOM   3471  C  CD  . ARG B  1 112 ? 87.934  55.374  127.963 1.00 66.88  ? 89  ARG B CD  1 
ATOM   3472  N  NE  . ARG B  1 112 ? 89.011  55.274  126.981 1.00 72.59  ? 89  ARG B NE  1 
ATOM   3473  C  CZ  . ARG B  1 112 ? 90.178  55.900  127.088 1.00 73.32  ? 89  ARG B CZ  1 
ATOM   3474  N  NH1 . ARG B  1 112 ? 90.421  56.670  128.142 1.00 72.91  ? 89  ARG B NH1 1 
ATOM   3475  N  NH2 . ARG B  1 112 ? 91.096  55.760  126.137 1.00 73.72  ? 89  ARG B NH2 1 
ATOM   3476  N  N   . LYS B  1 113 ? 88.540  52.934  133.062 1.00 36.15  ? 90  LYS B N   1 
ATOM   3477  C  CA  . LYS B  1 113 ? 89.297  52.590  134.266 1.00 42.45  ? 90  LYS B CA  1 
ATOM   3478  C  C   . LYS B  1 113 ? 89.232  51.090  134.531 1.00 43.72  ? 90  LYS B C   1 
ATOM   3479  O  O   . LYS B  1 113 ? 90.239  50.468  134.866 1.00 45.50  ? 90  LYS B O   1 
ATOM   3480  C  CB  . LYS B  1 113 ? 88.778  53.332  135.500 1.00 52.27  ? 90  LYS B CB  1 
ATOM   3481  C  CG  . LYS B  1 113 ? 88.942  54.842  135.468 1.00 67.35  ? 90  LYS B CG  1 
ATOM   3482  C  CD  . LYS B  1 113 ? 90.382  55.281  135.225 1.00 74.08  ? 90  LYS B CD  1 
ATOM   3483  C  CE  . LYS B  1 113 ? 90.493  56.802  135.312 1.00 78.09  ? 90  LYS B CE  1 
ATOM   3484  N  NZ  . LYS B  1 113 ? 91.861  57.299  135.000 1.00 80.09  ? 90  LYS B NZ  1 
ATOM   3485  N  N   . SER B  1 114 ? 88.040  50.517  134.380 1.00 44.02  ? 91  SER B N   1 
ATOM   3486  C  CA  . SER B  1 114 ? 87.825  49.098  134.668 1.00 46.79  ? 91  SER B CA  1 
ATOM   3487  C  C   . SER B  1 114 ? 88.761  48.172  133.876 1.00 46.89  ? 91  SER B C   1 
ATOM   3488  O  O   . SER B  1 114 ? 89.174  47.125  134.377 1.00 44.64  ? 91  SER B O   1 
ATOM   3489  C  CB  . SER B  1 114 ? 86.350  48.702  134.474 1.00 43.68  ? 91  SER B CB  1 
ATOM   3490  O  OG  . SER B  1 114 ? 86.007  48.530  133.107 1.00 40.32  ? 91  SER B OG  1 
ATOM   3491  N  N   . LEU B  1 115 ? 89.120  48.568  132.658 1.00 40.68  ? 92  LEU B N   1 
ATOM   3492  C  CA  . LEU B  1 115 ? 89.971  47.718  131.834 1.00 40.45  ? 92  LEU B CA  1 
ATOM   3493  C  C   . LEU B  1 115 ? 91.399  48.251  131.622 1.00 47.58  ? 92  LEU B C   1 
ATOM   3494  O  O   . LEU B  1 115 ? 92.128  47.749  130.763 1.00 43.69  ? 92  LEU B O   1 
ATOM   3495  C  CB  . LEU B  1 115 ? 89.291  47.419  130.484 1.00 40.49  ? 92  LEU B CB  1 
ATOM   3496  C  CG  . LEU B  1 115 ? 87.942  46.668  130.501 1.00 43.01  ? 92  LEU B CG  1 
ATOM   3497  C  CD1 . LEU B  1 115 ? 87.452  46.361  129.080 1.00 38.35  ? 92  LEU B CD1 1 
ATOM   3498  C  CD2 . LEU B  1 115 ? 87.990  45.386  131.348 1.00 33.68  ? 92  LEU B CD2 1 
ATOM   3499  N  N   . HIS B  1 116 ? 91.813  49.246  132.402 1.00 40.73  ? 93  HIS B N   1 
ATOM   3500  C  CA  . HIS B  1 116 ? 93.097  49.891  132.138 1.00 36.51  ? 93  HIS B CA  1 
ATOM   3501  C  C   . HIS B  1 116 ? 94.296  48.933  132.184 1.00 42.41  ? 93  HIS B C   1 
ATOM   3502  O  O   . HIS B  1 116 ? 95.308  49.163  131.521 1.00 44.25  ? 93  HIS B O   1 
ATOM   3503  C  CB  . HIS B  1 116 ? 93.308  51.120  133.034 1.00 38.48  ? 93  HIS B CB  1 
ATOM   3504  C  CG  . HIS B  1 116 ? 93.880  50.809  134.380 1.00 39.85  ? 93  HIS B CG  1 
ATOM   3505  N  ND1 . HIS B  1 116 ? 93.099  50.447  135.457 1.00 48.74  ? 93  HIS B ND1 1 
ATOM   3506  C  CD2 . HIS B  1 116 ? 95.156  50.827  134.830 1.00 47.25  ? 93  HIS B CD2 1 
ATOM   3507  C  CE1 . HIS B  1 116 ? 93.872  50.242  136.509 1.00 51.58  ? 93  HIS B CE1 1 
ATOM   3508  N  NE2 . HIS B  1 116 ? 95.125  50.467  136.156 1.00 49.20  ? 93  HIS B NE2 1 
ATOM   3509  N  N   . PHE B  1 117 ? 94.178  47.846  132.940 1.00 44.78  ? 94  PHE B N   1 
ATOM   3510  C  CA  . PHE B  1 117 ? 95.260  46.860  133.014 1.00 43.03  ? 94  PHE B CA  1 
ATOM   3511  C  C   . PHE B  1 117 ? 95.476  46.069  131.719 1.00 40.15  ? 94  PHE B C   1 
ATOM   3512  O  O   . PHE B  1 117 ? 96.558  45.544  131.471 1.00 39.94  ? 94  PHE B O   1 
ATOM   3513  C  CB  . PHE B  1 117 ? 95.031  45.900  134.177 1.00 45.10  ? 94  PHE B CB  1 
ATOM   3514  C  CG  . PHE B  1 117 ? 95.374  46.486  135.507 1.00 50.70  ? 94  PHE B CG  1 
ATOM   3515  C  CD1 . PHE B  1 117 ? 96.670  46.910  135.771 1.00 37.91  ? 94  PHE B CD1 1 
ATOM   3516  C  CD2 . PHE B  1 117 ? 94.408  46.614  136.493 1.00 51.18  ? 94  PHE B CD2 1 
ATOM   3517  C  CE1 . PHE B  1 117 ? 97.003  47.453  136.995 1.00 47.27  ? 94  PHE B CE1 1 
ATOM   3518  C  CE2 . PHE B  1 117 ? 94.732  47.154  137.725 1.00 55.13  ? 94  PHE B CE2 1 
ATOM   3519  C  CZ  . PHE B  1 117 ? 96.033  47.578  137.980 1.00 50.45  ? 94  PHE B CZ  1 
ATOM   3520  N  N   . VAL B  1 118 ? 94.435  45.962  130.908 1.00 42.43  ? 95  VAL B N   1 
ATOM   3521  C  CA  . VAL B  1 118 ? 94.560  45.303  129.616 1.00 38.63  ? 95  VAL B CA  1 
ATOM   3522  C  C   . VAL B  1 118 ? 94.424  46.327  128.475 1.00 41.63  ? 95  VAL B C   1 
ATOM   3523  O  O   . VAL B  1 118 ? 93.964  46.007  127.378 1.00 37.93  ? 95  VAL B O   1 
ATOM   3524  C  CB  . VAL B  1 118 ? 93.579  44.118  129.484 1.00 38.80  ? 95  VAL B CB  1 
ATOM   3525  C  CG1 . VAL B  1 118 ? 93.834  43.111  130.604 1.00 43.87  ? 95  VAL B CG1 1 
ATOM   3526  C  CG2 . VAL B  1 118 ? 92.134  44.589  129.525 1.00 34.23  ? 95  VAL B CG2 1 
ATOM   3527  N  N   . GLY B  1 119 ? 94.832  47.563  128.768 1.00 39.60  ? 96  GLY B N   1 
ATOM   3528  C  CA  . GLY B  1 119 ? 95.016  48.596  127.764 1.00 41.71  ? 96  GLY B CA  1 
ATOM   3529  C  C   . GLY B  1 119 ? 93.882  49.596  127.630 1.00 37.28  ? 96  GLY B C   1 
ATOM   3530  O  O   . GLY B  1 119 ? 92.709  49.236  127.696 1.00 33.24  ? 96  GLY B O   1 
ATOM   3531  N  N   . TYR B  1 120 ? 94.230  50.863  127.442 1.00 37.29  ? 97  TYR B N   1 
ATOM   3532  C  CA  . TYR B  1 120 ? 93.235  51.850  127.028 1.00 41.93  ? 97  TYR B CA  1 
ATOM   3533  C  C   . TYR B  1 120 ? 92.924  51.699  125.534 1.00 34.69  ? 97  TYR B C   1 
ATOM   3534  O  O   . TYR B  1 120 ? 91.784  51.866  125.117 1.00 41.88  ? 97  TYR B O   1 
ATOM   3535  C  CB  . TYR B  1 120 ? 93.698  53.279  127.326 1.00 38.41  ? 97  TYR B CB  1 
ATOM   3536  C  CG  . TYR B  1 120 ? 93.716  53.627  128.783 1.00 38.65  ? 97  TYR B CG  1 
ATOM   3537  C  CD1 . TYR B  1 120 ? 92.560  53.568  129.547 1.00 37.61  ? 97  TYR B CD1 1 
ATOM   3538  C  CD2 . TYR B  1 120 ? 94.893  54.028  129.403 1.00 39.81  ? 97  TYR B CD2 1 
ATOM   3539  C  CE1 . TYR B  1 120 ? 92.584  53.895  130.901 1.00 37.69  ? 97  TYR B CE1 1 
ATOM   3540  C  CE2 . TYR B  1 120 ? 94.922  54.357  130.749 1.00 34.87  ? 97  TYR B CE2 1 
ATOM   3541  C  CZ  . TYR B  1 120 ? 93.770  54.293  131.490 1.00 32.53  ? 97  TYR B CZ  1 
ATOM   3542  O  OH  . TYR B  1 120 ? 93.815  54.622  132.825 1.00 42.68  ? 97  TYR B OH  1 
ATOM   3543  N  N   . ALA B  1 121 ? 93.949  51.390  124.739 1.00 32.77  ? 98  ALA B N   1 
ATOM   3544  C  CA  . ALA B  1 121 ? 93.787  51.141  123.308 1.00 41.06  ? 98  ALA B CA  1 
ATOM   3545  C  C   . ALA B  1 121 ? 93.190  49.754  123.026 1.00 44.29  ? 98  ALA B C   1 
ATOM   3546  O  O   . ALA B  1 121 ? 93.230  48.862  123.873 1.00 50.17  ? 98  ALA B O   1 
ATOM   3547  C  CB  . ALA B  1 121 ? 95.127  51.295  122.587 1.00 36.73  ? 98  ALA B CB  1 
ATOM   3548  N  N   . GLY B  1 122 ? 92.637  49.575  121.833 1.00 43.12  ? 99  GLY B N   1 
ATOM   3549  C  CA  . GLY B  1 122 ? 92.177  48.264  121.412 1.00 46.86  ? 99  GLY B CA  1 
ATOM   3550  C  C   . GLY B  1 122 ? 90.782  47.860  121.863 1.00 47.75  ? 99  GLY B C   1 
ATOM   3551  O  O   . GLY B  1 122 ? 89.892  48.705  121.980 1.00 43.18  ? 99  GLY B O   1 
ATOM   3552  N  N   . LEU B  1 123 ? 90.597  46.562  122.114 1.00 44.94  ? 100 LEU B N   1 
ATOM   3553  C  CA  . LEU B  1 123 ? 89.268  45.999  122.386 1.00 46.61  ? 100 LEU B CA  1 
ATOM   3554  C  C   . LEU B  1 123 ? 88.559  46.661  123.565 1.00 48.65  ? 100 LEU B C   1 
ATOM   3555  O  O   . LEU B  1 123 ? 87.327  46.785  123.574 1.00 48.88  ? 100 LEU B O   1 
ATOM   3556  C  CB  . LEU B  1 123 ? 89.338  44.475  122.571 1.00 40.83  ? 100 LEU B CB  1 
ATOM   3557  C  CG  . LEU B  1 123 ? 89.530  43.731  121.245 1.00 44.62  ? 100 LEU B CG  1 
ATOM   3558  C  CD1 . LEU B  1 123 ? 90.154  42.361  121.447 1.00 41.89  ? 100 LEU B CD1 1 
ATOM   3559  C  CD2 . LEU B  1 123 ? 88.210  43.635  120.480 1.00 43.23  ? 100 LEU B CD2 1 
ATOM   3560  N  N   . SER B  1 124 ? 89.342  47.094  124.546 1.00 43.90  ? 101 SER B N   1 
ATOM   3561  C  CA  . SER B  1 124 ? 88.802  47.792  125.707 1.00 48.96  ? 101 SER B CA  1 
ATOM   3562  C  C   . SER B  1 124 ? 88.123  49.096  125.279 1.00 41.24  ? 101 SER B C   1 
ATOM   3563  O  O   . SER B  1 124 ? 87.012  49.414  125.700 1.00 33.97  ? 101 SER B O   1 
ATOM   3564  C  CB  . SER B  1 124 ? 89.936  48.074  126.687 1.00 48.22  ? 101 SER B CB  1 
ATOM   3565  O  OG  . SER B  1 124 ? 91.054  47.267  126.356 1.00 55.58  ? 101 SER B OG  1 
ATOM   3566  N  N   . MET B  1 125 ? 88.806  49.849  124.431 1.00 34.96  ? 102 MET B N   1 
ATOM   3567  C  CA  . MET B  1 125 ? 88.248  51.077  123.889 1.00 36.13  ? 102 MET B CA  1 
ATOM   3568  C  C   . MET B  1 125 ? 86.975  50.790  123.077 1.00 36.66  ? 102 MET B C   1 
ATOM   3569  O  O   . MET B  1 125 ? 85.996  51.543  123.137 1.00 36.93  ? 102 MET B O   1 
ATOM   3570  C  CB  . MET B  1 125 ? 89.297  51.777  123.022 1.00 28.28  ? 102 MET B CB  1 
ATOM   3571  C  CG  . MET B  1 125 ? 88.835  53.072  122.364 1.00 34.63  ? 102 MET B CG  1 
ATOM   3572  S  SD  . MET B  1 125 ? 88.885  54.500  123.455 1.00 49.29  ? 102 MET B SD  1 
ATOM   3573  C  CE  . MET B  1 125 ? 87.245  54.407  124.102 1.00 25.47  ? 102 MET B CE  1 
ATOM   3574  N  N   . ILE B  1 126 ? 86.985  49.696  122.325 1.00 31.15  ? 103 ILE B N   1 
ATOM   3575  C  CA  . ILE B  1 126 ? 85.867  49.377  121.440 1.00 33.11  ? 103 ILE B CA  1 
ATOM   3576  C  C   . ILE B  1 126 ? 84.600  49.072  122.229 1.00 36.86  ? 103 ILE B C   1 
ATOM   3577  O  O   . ILE B  1 126 ? 83.492  49.420  121.814 1.00 36.64  ? 103 ILE B O   1 
ATOM   3578  C  CB  . ILE B  1 126 ? 86.217  48.220  120.515 1.00 32.63  ? 103 ILE B CB  1 
ATOM   3579  C  CG1 . ILE B  1 126 ? 87.327  48.661  119.565 1.00 29.58  ? 103 ILE B CG1 1 
ATOM   3580  C  CG2 . ILE B  1 126 ? 84.992  47.777  119.745 1.00 28.99  ? 103 ILE B CG2 1 
ATOM   3581  C  CD1 . ILE B  1 126 ? 87.981  47.542  118.835 1.00 32.65  ? 103 ILE B CD1 1 
ATOM   3582  N  N   . ALA B  1 127 ? 84.779  48.451  123.390 1.00 36.16  ? 104 ALA B N   1 
ATOM   3583  C  CA  . ALA B  1 127 ? 83.667  48.115  124.273 1.00 33.43  ? 104 ALA B CA  1 
ATOM   3584  C  C   . ALA B  1 127 ? 83.076  49.364  124.926 1.00 36.14  ? 104 ALA B C   1 
ATOM   3585  O  O   . ALA B  1 127 ? 81.856  49.557  124.942 1.00 34.90  ? 104 ALA B O   1 
ATOM   3586  C  CB  . ALA B  1 127 ? 84.131  47.135  125.323 1.00 30.66  ? 104 ALA B CB  1 
ATOM   3587  N  N   . ALA B  1 128 ? 83.947  50.220  125.450 1.00 35.97  ? 105 ALA B N   1 
ATOM   3588  C  CA  . ALA B  1 128 ? 83.503  51.464  126.077 1.00 31.20  ? 105 ALA B CA  1 
ATOM   3589  C  C   . ALA B  1 128 ? 82.852  52.445  125.083 1.00 33.96  ? 105 ALA B C   1 
ATOM   3590  O  O   . ALA B  1 128 ? 81.928  53.182  125.432 1.00 31.90  ? 105 ALA B O   1 
ATOM   3591  C  CB  . ALA B  1 128 ? 84.654  52.120  126.821 1.00 23.74  ? 105 ALA B CB  1 
ATOM   3592  N  N   . SER B  1 129 ? 83.324  52.453  123.843 1.00 37.01  ? 106 SER B N   1 
ATOM   3593  C  CA  . SER B  1 129 ? 82.712  53.301  122.818 1.00 37.95  ? 106 SER B CA  1 
ATOM   3594  C  C   . SER B  1 129 ? 81.288  52.856  122.507 1.00 35.96  ? 106 SER B C   1 
ATOM   3595  O  O   . SER B  1 129 ? 80.366  53.680  122.407 1.00 35.12  ? 106 SER B O   1 
ATOM   3596  C  CB  . SER B  1 129 ? 83.549  53.285  121.542 1.00 32.47  ? 106 SER B CB  1 
ATOM   3597  O  OG  . SER B  1 129 ? 84.764  53.952  121.773 1.00 29.81  ? 106 SER B OG  1 
ATOM   3598  N  N   . GLY B  1 130 ? 81.109  51.548  122.359 1.00 34.37  ? 107 GLY B N   1 
ATOM   3599  C  CA  . GLY B  1 130 ? 79.783  51.007  122.123 1.00 36.30  ? 107 GLY B CA  1 
ATOM   3600  C  C   . GLY B  1 130 ? 78.836  51.447  123.220 1.00 35.38  ? 107 GLY B C   1 
ATOM   3601  O  O   . GLY B  1 130 ? 77.704  51.869  122.957 1.00 29.21  ? 107 GLY B O   1 
ATOM   3602  N  N   . VAL B  1 131 ? 79.299  51.352  124.463 1.00 32.36  ? 108 VAL B N   1 
ATOM   3603  C  CA  . VAL B  1 131 ? 78.474  51.753  125.597 1.00 31.94  ? 108 VAL B CA  1 
ATOM   3604  C  C   . VAL B  1 131 ? 78.214  53.259  125.530 1.00 37.27  ? 108 VAL B C   1 
ATOM   3605  O  O   . VAL B  1 131 ? 77.087  53.717  125.734 1.00 37.24  ? 108 VAL B O   1 
ATOM   3606  C  CB  . VAL B  1 131 ? 79.136  51.370  126.940 1.00 35.07  ? 108 VAL B CB  1 
ATOM   3607  C  CG1 . VAL B  1 131 ? 78.436  52.034  128.104 1.00 34.74  ? 108 VAL B CG1 1 
ATOM   3608  C  CG2 . VAL B  1 131 ? 79.150  49.867  127.109 1.00 42.56  ? 108 VAL B CG2 1 
ATOM   3609  N  N   . ASP B  1 132 ? 79.267  54.020  125.234 1.00 35.88  ? 109 ASP B N   1 
ATOM   3610  C  CA  . ASP B  1 132 ? 79.183  55.476  125.153 1.00 33.38  ? 109 ASP B CA  1 
ATOM   3611  C  C   . ASP B  1 132 ? 78.121  55.920  124.146 1.00 34.88  ? 109 ASP B C   1 
ATOM   3612  O  O   . ASP B  1 132 ? 77.240  56.729  124.465 1.00 34.24  ? 109 ASP B O   1 
ATOM   3613  C  CB  . ASP B  1 132 ? 80.552  56.063  124.775 1.00 35.53  ? 109 ASP B CB  1 
ATOM   3614  C  CG  . ASP B  1 132 ? 80.563  57.586  124.767 1.00 37.72  ? 109 ASP B CG  1 
ATOM   3615  O  OD1 . ASP B  1 132 ? 80.706  58.200  125.851 1.00 35.21  ? 109 ASP B OD1 1 
ATOM   3616  O  OD2 . ASP B  1 132 ? 80.446  58.169  123.669 1.00 35.16  ? 109 ASP B OD2 1 
ATOM   3617  N  N   . MET B  1 133 ? 78.202  55.403  122.927 1.00 28.79  ? 110 MET B N   1 
ATOM   3618  C  CA  . MET B  1 133 ? 77.235  55.802  121.914 1.00 36.94  ? 110 MET B CA  1 
ATOM   3619  C  C   . MET B  1 133 ? 75.786  55.536  122.375 1.00 43.71  ? 110 MET B C   1 
ATOM   3620  O  O   . MET B  1 133 ? 74.927  56.423  122.294 1.00 38.44  ? 110 MET B O   1 
ATOM   3621  C  CB  . MET B  1 133 ? 77.540  55.133  120.573 1.00 30.22  ? 110 MET B CB  1 
ATOM   3622  C  CG  . MET B  1 133 ? 78.691  55.765  119.826 1.00 29.84  ? 110 MET B CG  1 
ATOM   3623  S  SD  . MET B  1 133 ? 79.051  54.961  118.242 1.00 38.57  ? 110 MET B SD  1 
ATOM   3624  C  CE  . MET B  1 133 ? 79.869  53.471  118.791 1.00 21.91  ? 110 MET B CE  1 
ATOM   3625  N  N   . ALA B  1 134 ? 75.518  54.331  122.876 1.00 35.76  ? 111 ALA B N   1 
ATOM   3626  C  CA  . ALA B  1 134 ? 74.166  54.007  123.337 1.00 36.00  ? 111 ALA B CA  1 
ATOM   3627  C  C   . ALA B  1 134 ? 73.733  54.905  124.491 1.00 40.43  ? 111 ALA B C   1 
ATOM   3628  O  O   . ALA B  1 134 ? 72.590  55.346  124.553 1.00 44.43  ? 111 ALA B O   1 
ATOM   3629  C  CB  . ALA B  1 134 ? 74.068  52.556  123.732 1.00 30.90  ? 111 ALA B CB  1 
ATOM   3630  N  N   . VAL B  1 135 ? 74.655  55.179  125.403 1.00 39.27  ? 112 VAL B N   1 
ATOM   3631  C  CA  . VAL B  1 135 ? 74.342  55.983  126.576 1.00 40.12  ? 112 VAL B CA  1 
ATOM   3632  C  C   . VAL B  1 135 ? 73.978  57.421  126.200 1.00 41.39  ? 112 VAL B C   1 
ATOM   3633  O  O   . VAL B  1 135 ? 73.077  58.021  126.807 1.00 37.42  ? 112 VAL B O   1 
ATOM   3634  C  CB  . VAL B  1 135 ? 75.511  55.966  127.592 1.00 36.69  ? 112 VAL B CB  1 
ATOM   3635  C  CG1 . VAL B  1 135 ? 75.498  57.226  128.434 1.00 36.44  ? 112 VAL B CG1 1 
ATOM   3636  C  CG2 . VAL B  1 135 ? 75.428  54.721  128.472 1.00 34.76  ? 112 VAL B CG2 1 
ATOM   3637  N  N   . TRP B  1 136 ? 74.683  57.968  125.206 1.00 35.23  ? 113 TRP B N   1 
ATOM   3638  C  CA  . TRP B  1 136 ? 74.406  59.315  124.709 1.00 29.67  ? 113 TRP B CA  1 
ATOM   3639  C  C   . TRP B  1 136 ? 73.058  59.343  123.992 1.00 31.03  ? 113 TRP B C   1 
ATOM   3640  O  O   . TRP B  1 136 ? 72.311  60.320  124.093 1.00 29.97  ? 113 TRP B O   1 
ATOM   3641  C  CB  . TRP B  1 136 ? 75.510  59.799  123.762 1.00 30.62  ? 113 TRP B CB  1 
ATOM   3642  C  CG  . TRP B  1 136 ? 76.655  60.507  124.441 1.00 32.63  ? 113 TRP B CG  1 
ATOM   3643  C  CD1 . TRP B  1 136 ? 77.915  60.021  124.636 1.00 24.37  ? 113 TRP B CD1 1 
ATOM   3644  C  CD2 . TRP B  1 136 ? 76.646  61.833  124.999 1.00 36.55  ? 113 TRP B CD2 1 
ATOM   3645  N  NE1 . TRP B  1 136 ? 78.690  60.957  125.284 1.00 29.64  ? 113 TRP B NE1 1 
ATOM   3646  C  CE2 . TRP B  1 136 ? 77.936  62.075  125.521 1.00 30.56  ? 113 TRP B CE2 1 
ATOM   3647  C  CE3 . TRP B  1 136 ? 75.674  62.835  125.110 1.00 32.99  ? 113 TRP B CE3 1 
ATOM   3648  C  CZ2 . TRP B  1 136 ? 78.278  63.275  126.149 1.00 28.20  ? 113 TRP B CZ2 1 
ATOM   3649  C  CZ3 . TRP B  1 136 ? 76.016  64.025  125.730 1.00 39.12  ? 113 TRP B CZ3 1 
ATOM   3650  C  CH2 . TRP B  1 136 ? 77.312  64.236  126.241 1.00 35.01  ? 113 TRP B CH2 1 
ATOM   3651  N  N   . ASP B  1 137 ? 72.754  58.276  123.254 1.00 29.12  ? 114 ASP B N   1 
ATOM   3652  C  CA  . ASP B  1 137 ? 71.429  58.131  122.658 1.00 37.22  ? 114 ASP B CA  1 
ATOM   3653  C  C   . ASP B  1 137 ? 70.339  58.216  123.738 1.00 39.43  ? 114 ASP B C   1 
ATOM   3654  O  O   . ASP B  1 137 ? 69.429  59.042  123.656 1.00 42.73  ? 114 ASP B O   1 
ATOM   3655  C  CB  . ASP B  1 137 ? 71.324  56.818  121.892 1.00 38.92  ? 114 ASP B CB  1 
ATOM   3656  C  CG  . ASP B  1 137 ? 69.984  56.648  121.214 1.00 49.49  ? 114 ASP B CG  1 
ATOM   3657  O  OD1 . ASP B  1 137 ? 69.693  57.425  120.280 1.00 49.94  ? 114 ASP B OD1 1 
ATOM   3658  O  OD2 . ASP B  1 137 ? 69.226  55.730  121.609 1.00 57.40  ? 114 ASP B OD2 1 
ATOM   3659  N  N   . ALA B  1 138 ? 70.455  57.374  124.759 1.00 32.78  ? 115 ALA B N   1 
ATOM   3660  C  CA  . ALA B  1 138 ? 69.526  57.399  125.886 1.00 31.03  ? 115 ALA B CA  1 
ATOM   3661  C  C   . ALA B  1 138 ? 69.376  58.793  126.489 1.00 40.14  ? 115 ALA B C   1 
ATOM   3662  O  O   . ALA B  1 138 ? 68.260  59.232  126.752 1.00 39.93  ? 115 ALA B O   1 
ATOM   3663  C  CB  . ALA B  1 138 ? 69.951  56.400  126.958 1.00 22.93  ? 115 ALA B CB  1 
ATOM   3664  N  N   . LEU B  1 139 ? 70.488  59.497  126.700 1.00 39.16  ? 116 LEU B N   1 
ATOM   3665  C  CA  . LEU B  1 139 ? 70.413  60.806  127.341 1.00 29.19  ? 116 LEU B CA  1 
ATOM   3666  C  C   . LEU B  1 139 ? 69.645  61.795  126.482 1.00 29.60  ? 116 LEU B C   1 
ATOM   3667  O  O   . LEU B  1 139 ? 68.833  62.567  126.990 1.00 33.25  ? 116 LEU B O   1 
ATOM   3668  C  CB  . LEU B  1 139 ? 71.797  61.377  127.666 1.00 28.92  ? 116 LEU B CB  1 
ATOM   3669  C  CG  . LEU B  1 139 ? 71.738  62.741  128.382 1.00 30.91  ? 116 LEU B CG  1 
ATOM   3670  C  CD1 . LEU B  1 139 ? 71.103  62.607  129.755 1.00 31.88  ? 116 LEU B CD1 1 
ATOM   3671  C  CD2 . LEU B  1 139 ? 73.114  63.407  128.502 1.00 32.63  ? 116 LEU B CD2 1 
ATOM   3672  N  N   . ALA B  1 140 ? 69.908  61.784  125.183 1.00 24.87  ? 117 ALA B N   1 
ATOM   3673  C  CA  . ALA B  1 140 ? 69.220  62.705  124.287 1.00 30.55  ? 117 ALA B CA  1 
ATOM   3674  C  C   . ALA B  1 140 ? 67.726  62.374  124.245 1.00 34.55  ? 117 ALA B C   1 
ATOM   3675  O  O   . ALA B  1 140 ? 66.886  63.274  124.208 1.00 35.54  ? 117 ALA B O   1 
ATOM   3676  C  CB  . ALA B  1 140 ? 69.835  62.660  122.883 1.00 22.76  ? 117 ALA B CB  1 
ATOM   3677  N  N   . ARG B  1 141 ? 67.403  61.081  124.255 1.00 28.65  ? 118 ARG B N   1 
ATOM   3678  C  CA  . ARG B  1 141 ? 66.012  60.646  124.318 1.00 37.87  ? 118 ARG B CA  1 
ATOM   3679  C  C   . ARG B  1 141 ? 65.353  61.180  125.577 1.00 45.55  ? 118 ARG B C   1 
ATOM   3680  O  O   . ARG B  1 141 ? 64.242  61.700  125.531 1.00 48.32  ? 118 ARG B O   1 
ATOM   3681  C  CB  . ARG B  1 141 ? 65.908  59.125  124.275 1.00 36.67  ? 118 ARG B CB  1 
ATOM   3682  C  CG  . ARG B  1 141 ? 66.148  58.542  122.887 1.00 41.67  ? 118 ARG B CG  1 
ATOM   3683  C  CD  . ARG B  1 141 ? 66.018  57.024  122.881 1.00 41.46  ? 118 ARG B CD  1 
ATOM   3684  N  NE  . ARG B  1 141 ? 66.392  56.443  121.589 1.00 49.32  ? 118 ARG B NE  1 
ATOM   3685  C  CZ  . ARG B  1 141 ? 65.571  56.330  120.548 1.00 45.51  ? 118 ARG B CZ  1 
ATOM   3686  N  NH1 . ARG B  1 141 ? 64.321  56.759  120.639 1.00 49.89  ? 118 ARG B NH1 1 
ATOM   3687  N  NH2 . ARG B  1 141 ? 65.999  55.791  119.417 1.00 41.05  ? 118 ARG B NH2 1 
ATOM   3688  N  N   . ALA B  1 142 ? 66.048  61.065  126.702 1.00 41.27  ? 119 ALA B N   1 
ATOM   3689  C  CA  . ALA B  1 142 ? 65.509  61.547  127.964 1.00 36.92  ? 119 ALA B CA  1 
ATOM   3690  C  C   . ALA B  1 142 ? 65.219  63.043  127.917 1.00 40.42  ? 119 ALA B C   1 
ATOM   3691  O  O   . ALA B  1 142 ? 64.363  63.532  128.656 1.00 38.37  ? 119 ALA B O   1 
ATOM   3692  C  CB  . ALA B  1 142 ? 66.441  61.217  129.103 1.00 38.51  ? 119 ALA B CB  1 
ATOM   3693  N  N   . ALA B  1 143 ? 65.925  63.769  127.049 1.00 30.64  ? 120 ALA B N   1 
ATOM   3694  C  CA  . ALA B  1 143 ? 65.702  65.205  126.903 1.00 30.57  ? 120 ALA B CA  1 
ATOM   3695  C  C   . ALA B  1 143 ? 64.700  65.463  125.799 1.00 39.32  ? 120 ALA B C   1 
ATOM   3696  O  O   . ALA B  1 143 ? 64.336  66.609  125.522 1.00 36.74  ? 120 ALA B O   1 
ATOM   3697  C  CB  . ALA B  1 143 ? 67.005  65.920  126.595 1.00 38.96  ? 120 ALA B CB  1 
ATOM   3698  N  N   . ASN B  1 144 ? 64.248  64.383  125.175 1.00 45.09  ? 121 ASN B N   1 
ATOM   3699  C  CA  . ASN B  1 144 ? 63.417  64.484  123.986 1.00 47.47  ? 121 ASN B CA  1 
ATOM   3700  C  C   . ASN B  1 144 ? 64.071  65.388  122.946 1.00 46.18  ? 121 ASN B C   1 
ATOM   3701  O  O   . ASN B  1 144 ? 63.483  66.378  122.508 1.00 46.35  ? 121 ASN B O   1 
ATOM   3702  C  CB  . ASN B  1 144 ? 62.017  64.987  124.334 1.00 52.54  ? 121 ASN B CB  1 
ATOM   3703  C  CG  . ASN B  1 144 ? 60.990  64.585  123.299 1.00 56.42  ? 121 ASN B CG  1 
ATOM   3704  O  OD1 . ASN B  1 144 ? 60.959  63.434  122.848 1.00 57.09  ? 121 ASN B OD1 1 
ATOM   3705  N  ND2 . ASN B  1 144 ? 60.160  65.536  122.894 1.00 55.65  ? 121 ASN B ND2 1 
ATOM   3706  N  N   . MET B  1 145 ? 65.304  65.045  122.577 1.00 45.66  ? 122 MET B N   1 
ATOM   3707  C  CA  . MET B  1 145 ? 66.083  65.815  121.606 1.00 39.24  ? 122 MET B CA  1 
ATOM   3708  C  C   . MET B  1 145 ? 66.855  64.899  120.662 1.00 32.60  ? 122 MET B C   1 
ATOM   3709  O  O   . MET B  1 145 ? 67.283  63.812  121.057 1.00 40.73  ? 122 MET B O   1 
ATOM   3710  C  CB  . MET B  1 145 ? 67.076  66.728  122.322 1.00 34.39  ? 122 MET B CB  1 
ATOM   3711  C  CG  . MET B  1 145 ? 66.441  67.806  123.157 1.00 32.10  ? 122 MET B CG  1 
ATOM   3712  S  SD  . MET B  1 145 ? 67.668  68.899  123.911 1.00 41.42  ? 122 MET B SD  1 
ATOM   3713  C  CE  . MET B  1 145 ? 66.605  69.974  124.877 1.00 61.98  ? 122 MET B CE  1 
ATOM   3714  N  N   . PRO B  1 146 ? 67.025  65.324  119.402 1.00 33.72  ? 123 PRO B N   1 
ATOM   3715  C  CA  . PRO B  1 146 ? 68.018  64.632  118.573 1.00 39.10  ? 123 PRO B CA  1 
ATOM   3716  C  C   . PRO B  1 146 ? 69.382  64.798  119.238 1.00 37.89  ? 123 PRO B C   1 
ATOM   3717  O  O   . PRO B  1 146 ? 69.589  65.809  119.914 1.00 35.93  ? 123 PRO B O   1 
ATOM   3718  C  CB  . PRO B  1 146 ? 67.981  65.410  117.253 1.00 28.01  ? 123 PRO B CB  1 
ATOM   3719  C  CG  . PRO B  1 146 ? 66.648  66.056  117.230 1.00 30.08  ? 123 PRO B CG  1 
ATOM   3720  C  CD  . PRO B  1 146 ? 66.326  66.384  118.658 1.00 33.14  ? 123 PRO B CD  1 
ATOM   3721  N  N   . LEU B  1 147 ? 70.277  63.827  119.073 1.00 31.32  ? 124 LEU B N   1 
ATOM   3722  C  CA  . LEU B  1 147 ? 71.611  63.921  119.647 1.00 32.22  ? 124 LEU B CA  1 
ATOM   3723  C  C   . LEU B  1 147 ? 72.239  65.280  119.350 1.00 38.87  ? 124 LEU B C   1 
ATOM   3724  O  O   . LEU B  1 147 ? 72.626  65.998  120.274 1.00 38.30  ? 124 LEU B O   1 
ATOM   3725  C  CB  . LEU B  1 147 ? 72.500  62.795  119.125 1.00 36.44  ? 124 LEU B CB  1 
ATOM   3726  C  CG  . LEU B  1 147 ? 73.884  62.725  119.767 1.00 31.16  ? 124 LEU B CG  1 
ATOM   3727  C  CD1 . LEU B  1 147 ? 73.760  62.753  121.286 1.00 24.83  ? 124 LEU B CD1 1 
ATOM   3728  C  CD2 . LEU B  1 147 ? 74.623  61.481  119.299 1.00 25.92  ? 124 LEU B CD2 1 
ATOM   3729  N  N   . CYS B  1 148 ? 72.308  65.648  118.069 1.00 32.47  ? 125 CYS B N   1 
ATOM   3730  C  CA  . CYS B  1 148 ? 72.983  66.890  117.674 1.00 30.23  ? 125 CYS B CA  1 
ATOM   3731  C  C   . CYS B  1 148 ? 72.405  68.096  118.396 1.00 33.99  ? 125 CYS B C   1 
ATOM   3732  O  O   . CYS B  1 148 ? 73.126  69.058  118.705 1.00 28.69  ? 125 CYS B O   1 
ATOM   3733  C  CB  . CYS B  1 148 ? 72.916  67.108  116.160 1.00 30.99  ? 125 CYS B CB  1 
ATOM   3734  S  SG  . CYS B  1 148 ? 71.241  67.054  115.475 1.00 43.90  ? 125 CYS B SG  1 
ATOM   3735  N  N   . THR B  1 149 ? 71.104  68.051  118.666 1.00 25.41  ? 126 THR B N   1 
ATOM   3736  C  CA  . THR B  1 149 ? 70.462  69.147  119.392 1.00 29.73  ? 126 THR B CA  1 
ATOM   3737  C  C   . THR B  1 149 ? 70.941  69.151  120.845 1.00 32.78  ? 126 THR B C   1 
ATOM   3738  O  O   . THR B  1 149 ? 71.227  70.207  121.414 1.00 34.31  ? 126 THR B O   1 
ATOM   3739  C  CB  . THR B  1 149 ? 68.913  69.058  119.325 1.00 43.27  ? 126 THR B CB  1 
ATOM   3740  O  OG1 . THR B  1 149 ? 68.481  69.195  117.967 1.00 48.52  ? 126 THR B OG1 1 
ATOM   3741  C  CG2 . THR B  1 149 ? 68.265  70.151  120.169 1.00 35.03  ? 126 THR B CG2 1 
ATOM   3742  N  N   . LEU B  1 150 ? 71.040  67.961  121.435 1.00 31.58  ? 127 LEU B N   1 
ATOM   3743  C  CA  . LEU B  1 150 ? 71.601  67.819  122.777 1.00 36.15  ? 127 LEU B CA  1 
ATOM   3744  C  C   . LEU B  1 150 ? 73.029  68.404  122.846 1.00 35.80  ? 127 LEU B C   1 
ATOM   3745  O  O   . LEU B  1 150 ? 73.409  69.057  123.824 1.00 31.28  ? 127 LEU B O   1 
ATOM   3746  C  CB  . LEU B  1 150 ? 71.603  66.342  123.175 1.00 35.41  ? 127 LEU B CB  1 
ATOM   3747  C  CG  . LEU B  1 150 ? 72.128  65.958  124.554 1.00 38.81  ? 127 LEU B CG  1 
ATOM   3748  C  CD1 . LEU B  1 150 ? 71.181  66.427  125.633 1.00 40.78  ? 127 LEU B CD1 1 
ATOM   3749  C  CD2 . LEU B  1 150 ? 72.311  64.451  124.623 1.00 31.84  ? 127 LEU B CD2 1 
ATOM   3750  N  N   . LEU B  1 151 ? 73.814  68.180  121.796 1.00 34.15  ? 128 LEU B N   1 
ATOM   3751  C  CA  . LEU B  1 151 ? 75.203  68.632  121.775 1.00 32.45  ? 128 LEU B CA  1 
ATOM   3752  C  C   . LEU B  1 151 ? 75.317  70.115  121.428 1.00 32.87  ? 128 LEU B C   1 
ATOM   3753  O  O   . LEU B  1 151 ? 76.411  70.640  121.364 1.00 45.79  ? 128 LEU B O   1 
ATOM   3754  C  CB  . LEU B  1 151 ? 76.026  67.794  120.792 1.00 30.97  ? 128 LEU B CB  1 
ATOM   3755  C  CG  . LEU B  1 151 ? 76.012  66.298  121.107 1.00 29.49  ? 128 LEU B CG  1 
ATOM   3756  C  CD1 . LEU B  1 151 ? 76.751  65.481  120.053 1.00 23.90  ? 128 LEU B CD1 1 
ATOM   3757  C  CD2 . LEU B  1 151 ? 76.586  66.040  122.502 1.00 28.88  ? 128 LEU B CD2 1 
ATOM   3758  N  N   . GLY B  1 152 ? 74.188  70.780  121.189 1.00 32.26  ? 129 GLY B N   1 
ATOM   3759  C  CA  . GLY B  1 152 ? 74.186  72.208  120.928 1.00 26.42  ? 129 GLY B CA  1 
ATOM   3760  C  C   . GLY B  1 152 ? 73.986  72.642  119.478 1.00 31.89  ? 129 GLY B C   1 
ATOM   3761  O  O   . GLY B  1 152 ? 74.034  73.836  119.177 1.00 37.14  ? 129 GLY B O   1 
ATOM   3762  N  N   . GLY B  1 153 ? 73.760  71.688  118.578 1.00 22.60  ? 130 GLY B N   1 
ATOM   3763  C  CA  . GLY B  1 153 ? 73.446  72.005  117.192 1.00 24.69  ? 130 GLY B CA  1 
ATOM   3764  C  C   . GLY B  1 153 ? 71.978  71.784  116.850 1.00 37.68  ? 130 GLY B C   1 
ATOM   3765  O  O   . GLY B  1 153 ? 71.124  71.737  117.748 1.00 35.79  ? 130 GLY B O   1 
ATOM   3766  N  N   . THR B  1 154 ? 71.686  71.654  115.553 1.00 34.09  ? 131 THR B N   1 
ATOM   3767  C  CA  . THR B  1 154 ? 70.337  71.352  115.065 1.00 37.75  ? 131 THR B CA  1 
ATOM   3768  C  C   . THR B  1 154 ? 70.423  70.332  113.947 1.00 43.25  ? 131 THR B C   1 
ATOM   3769  O  O   . THR B  1 154 ? 71.455  70.255  113.269 1.00 41.47  ? 131 THR B O   1 
ATOM   3770  C  CB  . THR B  1 154 ? 69.635  72.590  114.472 1.00 47.37  ? 131 THR B CB  1 
ATOM   3771  O  OG1 . THR B  1 154 ? 70.229  72.917  113.209 1.00 52.44  ? 131 THR B OG1 1 
ATOM   3772  C  CG2 . THR B  1 154 ? 69.734  73.783  115.407 1.00 48.41  ? 131 THR B CG2 1 
ATOM   3773  N  N   . PRO B  1 155 ? 69.338  69.551  113.737 1.00 39.31  ? 132 PRO B N   1 
ATOM   3774  C  CA  . PRO B  1 155 ? 69.331  68.586  112.628 1.00 40.46  ? 132 PRO B CA  1 
ATOM   3775  C  C   . PRO B  1 155 ? 69.415  69.309  111.291 1.00 37.97  ? 132 PRO B C   1 
ATOM   3776  O  O   . PRO B  1 155 ? 68.836  70.382  111.131 1.00 41.86  ? 132 PRO B O   1 
ATOM   3777  C  CB  . PRO B  1 155 ? 67.967  67.878  112.768 1.00 37.10  ? 132 PRO B CB  1 
ATOM   3778  C  CG  . PRO B  1 155 ? 67.534  68.122  114.185 1.00 32.02  ? 132 PRO B CG  1 
ATOM   3779  C  CD  . PRO B  1 155 ? 68.091  69.496  114.522 1.00 34.72  ? 132 PRO B CD  1 
ATOM   3780  N  N   . GLY B  1 156 ? 70.139  68.726  110.344 1.00 38.16  ? 133 GLY B N   1 
ATOM   3781  C  CA  . GLY B  1 156 ? 70.292  69.321  109.031 1.00 31.60  ? 133 GLY B CA  1 
ATOM   3782  C  C   . GLY B  1 156 ? 71.095  68.401  108.141 1.00 35.23  ? 133 GLY B C   1 
ATOM   3783  O  O   . GLY B  1 156 ? 71.211  67.212  108.415 1.00 42.84  ? 133 GLY B O   1 
ATOM   3784  N  N   . SER B  1 157 ? 71.670  68.953  107.082 1.00 41.76  ? 134 SER B N   1 
ATOM   3785  C  CA  . SER B  1 157 ? 72.343  68.137  106.084 1.00 49.06  ? 134 SER B CA  1 
ATOM   3786  C  C   . SER B  1 157 ? 73.865  68.181  106.240 1.00 44.72  ? 134 SER B C   1 
ATOM   3787  O  O   . SER B  1 157 ? 74.431  69.209  106.605 1.00 41.76  ? 134 SER B O   1 
ATOM   3788  C  CB  . SER B  1 157 ? 71.919  68.576  104.679 1.00 50.47  ? 134 SER B CB  1 
ATOM   3789  O  OG  . SER B  1 157 ? 71.871  69.991  104.593 1.00 60.01  ? 134 SER B OG  1 
ATOM   3790  N  N   . VAL B  1 158 ? 74.510  67.052  105.957 1.00 38.71  ? 135 VAL B N   1 
ATOM   3791  C  CA  . VAL B  1 158 ? 75.949  66.892  106.121 1.00 38.34  ? 135 VAL B CA  1 
ATOM   3792  C  C   . VAL B  1 158 ? 76.548  66.314  104.837 1.00 38.71  ? 135 VAL B C   1 
ATOM   3793  O  O   . VAL B  1 158 ? 76.177  65.216  104.426 1.00 28.49  ? 135 VAL B O   1 
ATOM   3794  C  CB  . VAL B  1 158 ? 76.267  65.933  107.294 1.00 42.03  ? 135 VAL B CB  1 
ATOM   3795  C  CG1 . VAL B  1 158 ? 77.759  65.729  107.413 1.00 39.82  ? 135 VAL B CG1 1 
ATOM   3796  C  CG2 . VAL B  1 158 ? 75.684  66.462  108.604 1.00 40.03  ? 135 VAL B CG2 1 
ATOM   3797  N  N   . LYS B  1 159 ? 77.458  67.050  104.198 1.00 34.88  ? 136 LYS B N   1 
ATOM   3798  C  CA  . LYS B  1 159 ? 78.031  66.614  102.929 1.00 30.54  ? 136 LYS B CA  1 
ATOM   3799  C  C   . LYS B  1 159 ? 78.787  65.294  103.069 1.00 35.99  ? 136 LYS B C   1 
ATOM   3800  O  O   . LYS B  1 159 ? 79.633  65.140  103.947 1.00 33.03  ? 136 LYS B O   1 
ATOM   3801  C  CB  . LYS B  1 159 ? 78.958  67.687  102.359 1.00 31.03  ? 136 LYS B CB  1 
ATOM   3802  C  CG  . LYS B  1 159 ? 79.680  67.262  101.082 1.00 36.28  ? 136 LYS B CG  1 
ATOM   3803  C  CD  . LYS B  1 159 ? 80.506  68.403  100.470 1.00 37.72  ? 136 LYS B CD  1 
ATOM   3804  C  CE  . LYS B  1 159 ? 81.742  68.712  101.312 1.00 48.09  ? 136 LYS B CE  1 
ATOM   3805  N  NZ  . LYS B  1 159 ? 82.772  69.488  100.562 1.00 53.38  ? 136 LYS B NZ  1 
ATOM   3806  N  N   . ALA B  1 160 ? 78.498  64.344  102.190 1.00 26.56  ? 137 ALA B N   1 
ATOM   3807  C  CA  . ALA B  1 160 ? 79.076  63.015  102.331 1.00 21.74  ? 137 ALA B CA  1 
ATOM   3808  C  C   . ALA B  1 160 ? 79.717  62.528  101.043 1.00 29.57  ? 137 ALA B C   1 
ATOM   3809  O  O   . ALA B  1 160 ? 79.560  63.138  99.992  1.00 30.78  ? 137 ALA B O   1 
ATOM   3810  C  CB  . ALA B  1 160 ? 78.016  62.023  102.820 1.00 21.86  ? 137 ALA B CB  1 
ATOM   3811  N  N   . TYR B  1 161 ? 80.462  61.437  101.141 1.00 24.85  ? 138 TYR B N   1 
ATOM   3812  C  CA  . TYR B  1 161 ? 81.005  60.768  99.972  1.00 28.47  ? 138 TYR B CA  1 
ATOM   3813  C  C   . TYR B  1 161 ? 80.742  59.274  100.140 1.00 38.80  ? 138 TYR B C   1 
ATOM   3814  O  O   . TYR B  1 161 ? 80.523  58.799  101.261 1.00 33.76  ? 138 TYR B O   1 
ATOM   3815  C  CB  . TYR B  1 161 ? 82.496  61.056  99.788  1.00 34.79  ? 138 TYR B CB  1 
ATOM   3816  C  CG  . TYR B  1 161 ? 83.396  60.444  100.836 1.00 37.45  ? 138 TYR B CG  1 
ATOM   3817  C  CD1 . TYR B  1 161 ? 84.026  59.227  100.613 1.00 34.14  ? 138 TYR B CD1 1 
ATOM   3818  C  CD2 . TYR B  1 161 ? 83.624  61.091  102.046 1.00 37.45  ? 138 TYR B CD2 1 
ATOM   3819  C  CE1 . TYR B  1 161 ? 84.845  58.665  101.572 1.00 38.11  ? 138 TYR B CE1 1 
ATOM   3820  C  CE2 . TYR B  1 161 ? 84.448  60.541  103.006 1.00 34.67  ? 138 TYR B CE2 1 
ATOM   3821  C  CZ  . TYR B  1 161 ? 85.055  59.330  102.766 1.00 37.49  ? 138 TYR B CZ  1 
ATOM   3822  O  OH  . TYR B  1 161 ? 85.866  58.779  103.722 1.00 36.83  ? 138 TYR B OH  1 
ATOM   3823  N  N   . ASN B  1 162 ? 80.750  58.536  99.034  1.00 36.31  ? 139 ASN B N   1 
ATOM   3824  C  CA  . ASN B  1 162 ? 80.304  57.151  99.062  1.00 37.98  ? 139 ASN B CA  1 
ATOM   3825  C  C   . ASN B  1 162 ? 81.452  56.169  99.200  1.00 33.47  ? 139 ASN B C   1 
ATOM   3826  O  O   . ASN B  1 162 ? 82.306  56.104  98.329  1.00 33.77  ? 139 ASN B O   1 
ATOM   3827  C  CB  . ASN B  1 162 ? 79.531  56.846  97.779  1.00 45.72  ? 139 ASN B CB  1 
ATOM   3828  C  CG  . ASN B  1 162 ? 78.627  55.651  97.914  1.00 42.60  ? 139 ASN B CG  1 
ATOM   3829  O  OD1 . ASN B  1 162 ? 78.968  54.667  98.572  1.00 39.35  ? 139 ASN B OD1 1 
ATOM   3830  N  ND2 . ASN B  1 162 ? 77.457  55.731  97.299  1.00 39.39  ? 139 ASN B ND2 1 
ATOM   3831  N  N   . SER B  1 163 ? 81.479  55.396  100.281 1.00 27.52  ? 140 SER B N   1 
ATOM   3832  C  CA  . SER B  1 163 ? 82.514  54.376  100.413 1.00 30.71  ? 140 SER B CA  1 
ATOM   3833  C  C   . SER B  1 163 ? 81.964  52.955  100.260 1.00 36.16  ? 140 SER B C   1 
ATOM   3834  O  O   . SER B  1 163 ? 82.566  51.996  100.738 1.00 41.14  ? 140 SER B O   1 
ATOM   3835  C  CB  . SER B  1 163 ? 83.298  54.524  101.731 1.00 33.32  ? 140 SER B CB  1 
ATOM   3836  O  OG  . SER B  1 163 ? 82.551  54.068  102.847 1.00 42.19  ? 140 SER B OG  1 
ATOM   3837  N  N   . ASN B  1 164 ? 80.831  52.820  99.582  1.00 41.62  ? 141 ASN B N   1 
ATOM   3838  C  CA  . ASN B  1 164 ? 80.202  51.508  99.403  1.00 43.84  ? 141 ASN B CA  1 
ATOM   3839  C  C   . ASN B  1 164 ? 81.076  50.486  98.672  1.00 45.87  ? 141 ASN B C   1 
ATOM   3840  O  O   . ASN B  1 164 ? 80.972  49.288  98.928  1.00 54.18  ? 141 ASN B O   1 
ATOM   3841  C  CB  . ASN B  1 164 ? 78.837  51.632  98.712  1.00 41.52  ? 141 ASN B CB  1 
ATOM   3842  C  CG  . ASN B  1 164 ? 77.688  51.655  99.695  1.00 36.62  ? 141 ASN B CG  1 
ATOM   3843  O  OD1 . ASN B  1 164 ? 77.867  51.341  100.863 1.00 37.57  ? 141 ASN B OD1 1 
ATOM   3844  N  ND2 . ASN B  1 164 ? 76.501  52.016  99.223  1.00 36.72  ? 141 ASN B ND2 1 
ATOM   3845  N  N   . GLY B  1 165 ? 81.937  50.953  97.772  1.00 35.77  ? 142 GLY B N   1 
ATOM   3846  C  CA  . GLY B  1 165 ? 82.796  50.044  97.035  1.00 38.72  ? 142 GLY B CA  1 
ATOM   3847  C  C   . GLY B  1 165 ? 84.012  50.650  96.347  1.00 43.98  ? 142 GLY B C   1 
ATOM   3848  O  O   . GLY B  1 165 ? 84.874  51.264  96.992  1.00 44.40  ? 142 GLY B O   1 
ATOM   3849  N  N   . LEU B  1 166 ? 84.067  50.476  95.028  1.00 36.27  ? 143 LEU B N   1 
ATOM   3850  C  CA  . LEU B  1 166 ? 85.267  50.734  94.231  1.00 37.29  ? 143 LEU B CA  1 
ATOM   3851  C  C   . LEU B  1 166 ? 86.456  49.947  94.772  1.00 44.17  ? 143 LEU B C   1 
ATOM   3852  O  O   . LEU B  1 166 ? 87.551  50.492  94.932  1.00 42.87  ? 143 LEU B O   1 
ATOM   3853  C  CB  . LEU B  1 166 ? 85.610  52.225  94.183  1.00 26.60  ? 143 LEU B CB  1 
ATOM   3854  C  CG  . LEU B  1 166 ? 84.515  53.146  93.665  1.00 32.27  ? 143 LEU B CG  1 
ATOM   3855  C  CD1 . LEU B  1 166 ? 85.131  54.476  93.264  1.00 37.11  ? 143 LEU B CD1 1 
ATOM   3856  C  CD2 . LEU B  1 166 ? 83.809  52.507  92.476  1.00 39.01  ? 143 LEU B CD2 1 
ATOM   3857  N  N   . TRP B  1 167 ? 86.230  48.666  95.051  1.00 38.56  ? 144 TRP B N   1 
ATOM   3858  C  CA  . TRP B  1 167 ? 87.278  47.775  95.534  1.00 37.98  ? 144 TRP B CA  1 
ATOM   3859  C  C   . TRP B  1 167 ? 88.201  47.355  94.395  1.00 39.80  ? 144 TRP B C   1 
ATOM   3860  O  O   . TRP B  1 167 ? 88.089  47.881  93.294  1.00 37.58  ? 144 TRP B O   1 
ATOM   3861  C  CB  . TRP B  1 167 ? 86.666  46.571  96.237  1.00 41.41  ? 144 TRP B CB  1 
ATOM   3862  C  CG  . TRP B  1 167 ? 86.070  46.951  97.552  1.00 48.03  ? 144 TRP B CG  1 
ATOM   3863  C  CD1 . TRP B  1 167 ? 84.746  47.142  97.837  1.00 51.47  ? 144 TRP B CD1 1 
ATOM   3864  C  CD2 . TRP B  1 167 ? 86.785  47.226  98.762  1.00 44.74  ? 144 TRP B CD2 1 
ATOM   3865  N  NE1 . TRP B  1 167 ? 84.593  47.494  99.158  1.00 56.27  ? 144 TRP B NE1 1 
ATOM   3866  C  CE2 . TRP B  1 167 ? 85.831  47.559  99.745  1.00 53.33  ? 144 TRP B CE2 1 
ATOM   3867  C  CE3 . TRP B  1 167 ? 88.139  47.214  99.109  1.00 46.77  ? 144 TRP B CE3 1 
ATOM   3868  C  CZ2 . TRP B  1 167 ? 86.191  47.878  101.057 1.00 59.16  ? 144 TRP B CZ2 1 
ATOM   3869  C  CZ3 . TRP B  1 167 ? 88.499  47.534  100.414 1.00 50.71  ? 144 TRP B CZ3 1 
ATOM   3870  C  CH2 . TRP B  1 167 ? 87.528  47.862  101.370 1.00 54.71  ? 144 TRP B CH2 1 
ATOM   3871  N  N   . LEU B  1 168 ? 89.110  46.418  94.653  1.00 34.63  ? 145 LEU B N   1 
ATOM   3872  C  CA  . LEU B  1 168 ? 90.194  46.148  93.699  1.00 47.24  ? 145 LEU B CA  1 
ATOM   3873  C  C   . LEU B  1 168 ? 89.824  45.274  92.480  1.00 55.76  ? 145 LEU B C   1 
ATOM   3874  O  O   . LEU B  1 168 ? 90.431  44.227  92.231  1.00 54.19  ? 145 LEU B O   1 
ATOM   3875  C  CB  . LEU B  1 168 ? 91.418  45.584  94.431  1.00 45.46  ? 145 LEU B CB  1 
ATOM   3876  C  CG  . LEU B  1 168 ? 92.012  46.498  95.509  1.00 43.56  ? 145 LEU B CG  1 
ATOM   3877  C  CD1 . LEU B  1 168 ? 93.357  45.969  95.927  1.00 43.58  ? 145 LEU B CD1 1 
ATOM   3878  C  CD2 . LEU B  1 168 ? 92.150  47.929  95.004  1.00 39.21  ? 145 LEU B CD2 1 
ATOM   3879  N  N   . LYS B  1 169 ? 88.841  45.720  91.710  1.00 55.22  ? 146 LYS B N   1 
ATOM   3880  C  CA  . LYS B  1 169 ? 88.463  45.008  90.500  1.00 64.00  ? 146 LYS B CA  1 
ATOM   3881  C  C   . LYS B  1 169 ? 89.003  45.766  89.294  1.00 72.30  ? 146 LYS B C   1 
ATOM   3882  O  O   . LYS B  1 169 ? 89.459  46.902  89.431  1.00 76.53  ? 146 LYS B O   1 
ATOM   3883  C  CB  . LYS B  1 169 ? 86.942  44.858  90.421  1.00 65.23  ? 146 LYS B CB  1 
ATOM   3884  C  CG  . LYS B  1 169 ? 86.301  44.435  91.743  1.00 65.68  ? 146 LYS B CG  1 
ATOM   3885  C  CD  . LYS B  1 169 ? 84.945  43.769  91.537  1.00 70.92  ? 146 LYS B CD  1 
ATOM   3886  C  CE  . LYS B  1 169 ? 83.955  44.683  90.826  1.00 75.49  ? 146 LYS B CE  1 
ATOM   3887  N  NZ  . LYS B  1 169 ? 83.433  45.760  91.713  1.00 77.06  ? 146 LYS B NZ  1 
ATOM   3888  N  N   . SER B  1 170 ? 88.962  45.135  88.123  1.00 68.44  ? 147 SER B N   1 
ATOM   3889  C  CA  . SER B  1 170 ? 89.448  45.749  86.888  1.00 57.30  ? 147 SER B CA  1 
ATOM   3890  C  C   . SER B  1 170 ? 88.895  47.161  86.703  1.00 51.00  ? 147 SER B C   1 
ATOM   3891  O  O   . SER B  1 170 ? 87.836  47.500  87.232  1.00 55.75  ? 147 SER B O   1 
ATOM   3892  C  CB  . SER B  1 170 ? 89.059  44.894  85.681  1.00 58.95  ? 147 SER B CB  1 
ATOM   3893  O  OG  . SER B  1 170 ? 87.683  45.060  85.373  1.00 54.45  ? 147 SER B OG  1 
ATOM   3894  N  N   . PRO B  1 171 ? 89.613  47.991  85.941  1.00 48.48  ? 148 PRO B N   1 
ATOM   3895  C  CA  . PRO B  1 171 ? 89.216  49.383  85.698  1.00 43.11  ? 148 PRO B CA  1 
ATOM   3896  C  C   . PRO B  1 171 ? 87.802  49.557  85.145  1.00 45.12  ? 148 PRO B C   1 
ATOM   3897  O  O   . PRO B  1 171 ? 87.041  50.367  85.677  1.00 39.79  ? 148 PRO B O   1 
ATOM   3898  C  CB  . PRO B  1 171 ? 90.248  49.856  84.677  1.00 41.63  ? 148 PRO B CB  1 
ATOM   3899  C  CG  . PRO B  1 171 ? 91.469  49.068  85.016  1.00 48.09  ? 148 PRO B CG  1 
ATOM   3900  C  CD  . PRO B  1 171 ? 90.963  47.705  85.425  1.00 49.84  ? 148 PRO B CD  1 
ATOM   3901  N  N   . ALA B  1 172 ? 87.458  48.826  84.087  1.00 56.84  ? 149 ALA B N   1 
ATOM   3902  C  CA  . ALA B  1 172 ? 86.142  48.974  83.469  1.00 52.24  ? 149 ALA B CA  1 
ATOM   3903  C  C   . ALA B  1 172 ? 85.026  48.682  84.470  1.00 48.06  ? 149 ALA B C   1 
ATOM   3904  O  O   . ALA B  1 172 ? 84.060  49.436  84.558  1.00 44.39  ? 149 ALA B O   1 
ATOM   3905  C  CB  . ALA B  1 172 ? 86.015  48.086  82.245  1.00 49.48  ? 149 ALA B CB  1 
ATOM   3906  N  N   . GLU B  1 173 ? 85.166  47.598  85.231  1.00 44.54  ? 150 GLU B N   1 
ATOM   3907  C  CA  . GLU B  1 173 ? 84.186  47.274  86.269  1.00 51.70  ? 150 GLU B CA  1 
ATOM   3908  C  C   . GLU B  1 173 ? 84.057  48.377  87.325  1.00 57.84  ? 150 GLU B C   1 
ATOM   3909  O  O   . GLU B  1 173 ? 82.947  48.749  87.706  1.00 62.86  ? 150 GLU B O   1 
ATOM   3910  C  CB  . GLU B  1 173 ? 84.526  45.954  86.957  1.00 56.22  ? 150 GLU B CB  1 
ATOM   3911  C  CG  . GLU B  1 173 ? 84.645  44.773  86.022  1.00 65.41  ? 150 GLU B CG  1 
ATOM   3912  C  CD  . GLU B  1 173 ? 84.824  43.472  86.774  1.00 74.28  ? 150 GLU B CD  1 
ATOM   3913  O  OE1 . GLU B  1 173 ? 85.982  43.116  87.097  1.00 74.17  ? 150 GLU B OE1 1 
ATOM   3914  O  OE2 . GLU B  1 173 ? 83.800  42.812  87.050  1.00 79.39  ? 150 GLU B OE2 1 
ATOM   3915  N  N   . VAL B  1 174 ? 85.190  48.890  87.802  1.00 53.08  ? 151 VAL B N   1 
ATOM   3916  C  CA  . VAL B  1 174 ? 85.176  49.940  88.820  1.00 46.66  ? 151 VAL B CA  1 
ATOM   3917  C  C   . VAL B  1 174 ? 84.484  51.201  88.297  1.00 48.02  ? 151 VAL B C   1 
ATOM   3918  O  O   . VAL B  1 174 ? 83.698  51.840  89.011  1.00 45.23  ? 151 VAL B O   1 
ATOM   3919  C  CB  . VAL B  1 174 ? 86.595  50.264  89.343  1.00 38.34  ? 151 VAL B CB  1 
ATOM   3920  C  CG1 . VAL B  1 174 ? 86.551  51.445  90.287  1.00 41.85  ? 151 VAL B CG1 1 
ATOM   3921  C  CG2 . VAL B  1 174 ? 87.191  49.049  90.058  1.00 28.76  ? 151 VAL B CG2 1 
ATOM   3922  N  N   . ALA B  1 175 ? 84.755  51.532  87.037  1.00 45.76  ? 152 ALA B N   1 
ATOM   3923  C  CA  . ALA B  1 175 ? 84.131  52.679  86.378  1.00 41.99  ? 152 ALA B CA  1 
ATOM   3924  C  C   . ALA B  1 175 ? 82.609  52.574  86.354  1.00 49.93  ? 152 ALA B C   1 
ATOM   3925  O  O   . ALA B  1 175 ? 81.902  53.540  86.675  1.00 49.92  ? 152 ALA B O   1 
ATOM   3926  C  CB  . ALA B  1 175 ? 84.673  52.825  84.960  1.00 40.20  ? 152 ALA B CB  1 
ATOM   3927  N  N   . ALA B  1 176 ? 82.106  51.401  85.966  1.00 50.51  ? 153 ALA B N   1 
ATOM   3928  C  CA  . ALA B  1 176 ? 80.667  51.186  85.871  1.00 52.87  ? 153 ALA B CA  1 
ATOM   3929  C  C   . ALA B  1 176 ? 80.042  51.327  87.244  1.00 47.34  ? 153 ALA B C   1 
ATOM   3930  O  O   . ALA B  1 176 ? 79.002  51.958  87.400  1.00 55.76  ? 153 ALA B O   1 
ATOM   3931  C  CB  . ALA B  1 176 ? 80.362  49.815  85.291  1.00 55.09  ? 153 ALA B CB  1 
ATOM   3932  N  N   . GLU B  1 177 ? 80.693  50.739  88.240  1.00 38.79  ? 154 GLU B N   1 
ATOM   3933  C  CA  . GLU B  1 177 ? 80.185  50.774  89.603  1.00 40.40  ? 154 GLU B CA  1 
ATOM   3934  C  C   . GLU B  1 177 ? 80.177  52.187  90.174  1.00 43.80  ? 154 GLU B C   1 
ATOM   3935  O  O   . GLU B  1 177 ? 79.290  52.545  90.945  1.00 43.82  ? 154 GLU B O   1 
ATOM   3936  C  CB  . GLU B  1 177 ? 80.987  49.841  90.500  1.00 35.84  ? 154 GLU B CB  1 
ATOM   3937  C  CG  . GLU B  1 177 ? 80.521  49.856  91.935  1.00 48.68  ? 154 GLU B CG  1 
ATOM   3938  C  CD  . GLU B  1 177 ? 81.216  48.802  92.779  1.00 66.62  ? 154 GLU B CD  1 
ATOM   3939  O  OE1 . GLU B  1 177 ? 81.319  47.646  92.311  1.00 78.38  ? 154 GLU B OE1 1 
ATOM   3940  O  OE2 . GLU B  1 177 ? 81.660  49.128  93.904  1.00 60.37  ? 154 GLU B OE2 1 
ATOM   3941  N  N   . ALA B  1 178 ? 81.163  52.990  89.786  1.00 42.22  ? 155 ALA B N   1 
ATOM   3942  C  CA  . ALA B  1 178 ? 81.217  54.386  90.213  1.00 41.40  ? 155 ALA B CA  1 
ATOM   3943  C  C   . ALA B  1 178 ? 79.938  55.133  89.830  1.00 49.12  ? 155 ALA B C   1 
ATOM   3944  O  O   . ALA B  1 178 ? 79.378  55.888  90.630  1.00 52.28  ? 155 ALA B O   1 
ATOM   3945  C  CB  . ALA B  1 178 ? 82.439  55.085  89.618  1.00 31.69  ? 155 ALA B CB  1 
ATOM   3946  N  N   . VAL B  1 179 ? 79.483  54.921  88.601  1.00 46.89  ? 156 VAL B N   1 
ATOM   3947  C  CA  . VAL B  1 179 ? 78.257  55.546  88.128  1.00 40.93  ? 156 VAL B CA  1 
ATOM   3948  C  C   . VAL B  1 179 ? 77.085  55.267  89.071  1.00 37.35  ? 156 VAL B C   1 
ATOM   3949  O  O   . VAL B  1 179 ? 76.324  56.174  89.415  1.00 34.34  ? 156 VAL B O   1 
ATOM   3950  C  CB  . VAL B  1 179 ? 77.908  55.095  86.695  1.00 40.37  ? 156 VAL B CB  1 
ATOM   3951  C  CG1 . VAL B  1 179 ? 76.618  55.760  86.241  1.00 44.72  ? 156 VAL B CG1 1 
ATOM   3952  C  CG2 . VAL B  1 179 ? 79.044  55.445  85.741  1.00 39.67  ? 156 VAL B CG2 1 
ATOM   3953  N  N   . GLU B  1 180 ? 76.948  54.012  89.484  1.00 39.00  ? 157 GLU B N   1 
ATOM   3954  C  CA  . GLU B  1 180 ? 75.925  53.619  90.443  1.00 47.02  ? 157 GLU B CA  1 
ATOM   3955  C  C   . GLU B  1 180 ? 76.128  54.352  91.765  1.00 50.37  ? 157 GLU B C   1 
ATOM   3956  O  O   . GLU B  1 180 ? 75.179  54.863  92.360  1.00 51.77  ? 157 GLU B O   1 
ATOM   3957  C  CB  . GLU B  1 180 ? 75.981  52.108  90.696  1.00 51.25  ? 157 GLU B CB  1 
ATOM   3958  C  CG  . GLU B  1 180 ? 75.839  51.243  89.459  1.00 61.55  ? 157 GLU B CG  1 
ATOM   3959  C  CD  . GLU B  1 180 ? 76.145  49.776  89.734  1.00 73.39  ? 157 GLU B CD  1 
ATOM   3960  O  OE1 . GLU B  1 180 ? 76.099  49.368  90.916  1.00 77.10  ? 157 GLU B OE1 1 
ATOM   3961  O  OE2 . GLU B  1 180 ? 76.441  49.034  88.768  1.00 74.21  ? 157 GLU B OE2 1 
ATOM   3962  N  N   . LEU B  1 181 ? 77.376  54.388  92.225  1.00 46.60  ? 158 LEU B N   1 
ATOM   3963  C  CA  . LEU B  1 181 ? 77.701  54.994  93.513  1.00 44.58  ? 158 LEU B CA  1 
ATOM   3964  C  C   . LEU B  1 181 ? 77.386  56.486  93.547  1.00 39.39  ? 158 LEU B C   1 
ATOM   3965  O  O   . LEU B  1 181 ? 76.802  56.966  94.514  1.00 37.39  ? 158 LEU B O   1 
ATOM   3966  C  CB  . LEU B  1 181 ? 79.157  54.717  93.914  1.00 38.59  ? 158 LEU B CB  1 
ATOM   3967  C  CG  . LEU B  1 181 ? 79.418  53.242  94.234  1.00 43.49  ? 158 LEU B CG  1 
ATOM   3968  C  CD1 . LEU B  1 181 ? 80.706  53.059  94.991  1.00 46.54  ? 158 LEU B CD1 1 
ATOM   3969  C  CD2 . LEU B  1 181 ? 78.266  52.668  95.033  1.00 45.30  ? 158 LEU B CD2 1 
ATOM   3970  N  N   . LYS B  1 182 ? 77.758  57.223  92.504  1.00 41.42  ? 159 LYS B N   1 
ATOM   3971  C  CA  . LYS B  1 182 ? 77.400  58.632  92.466  1.00 41.48  ? 159 LYS B CA  1 
ATOM   3972  C  C   . LYS B  1 182 ? 75.884  58.752  92.650  1.00 46.57  ? 159 LYS B C   1 
ATOM   3973  O  O   . LYS B  1 182 ? 75.406  59.597  93.415  1.00 44.87  ? 159 LYS B O   1 
ATOM   3974  C  CB  . LYS B  1 182 ? 77.847  59.298  91.160  1.00 37.96  ? 159 LYS B CB  1 
ATOM   3975  C  CG  . LYS B  1 182 ? 77.769  60.837  91.201  1.00 39.06  ? 159 LYS B CG  1 
ATOM   3976  C  CD  . LYS B  1 182 ? 78.177  61.485  89.876  1.00 37.72  ? 159 LYS B CD  1 
ATOM   3977  C  CE  . LYS B  1 182 ? 78.286  63.008  89.980  1.00 47.41  ? 159 LYS B CE  1 
ATOM   3978  N  NZ  . LYS B  1 182 ? 79.437  63.471  90.855  1.00 55.67  ? 159 LYS B NZ  1 
ATOM   3979  N  N   . ALA B  1 183 ? 75.146  57.871  91.973  1.00 45.09  ? 160 ALA B N   1 
ATOM   3980  C  CA  . ALA B  1 183 ? 73.683  57.919  91.930  1.00 43.61  ? 160 ALA B CA  1 
ATOM   3981  C  C   . ALA B  1 183 ? 73.006  57.628  93.267  1.00 39.64  ? 160 ALA B C   1 
ATOM   3982  O  O   . ALA B  1 183 ? 71.954  58.192  93.557  1.00 35.62  ? 160 ALA B O   1 
ATOM   3983  C  CB  . ALA B  1 183 ? 73.152  56.972  90.859  1.00 43.50  ? 160 ALA B CB  1 
ATOM   3984  N  N   . GLU B  1 184 ? 73.596  56.741  94.069  1.00 38.13  ? 161 GLU B N   1 
ATOM   3985  C  CA  . GLU B  1 184 ? 73.059  56.430  95.396  1.00 38.41  ? 161 GLU B CA  1 
ATOM   3986  C  C   . GLU B  1 184 ? 72.904  57.684  96.255  1.00 36.72  ? 161 GLU B C   1 
ATOM   3987  O  O   . GLU B  1 184 ? 72.217  57.664  97.273  1.00 37.58  ? 161 GLU B O   1 
ATOM   3988  C  CB  . GLU B  1 184 ? 73.935  55.406  96.133  1.00 41.38  ? 161 GLU B CB  1 
ATOM   3989  C  CG  . GLU B  1 184 ? 73.818  53.966  95.636  1.00 47.79  ? 161 GLU B CG  1 
ATOM   3990  C  CD  . GLU B  1 184 ? 74.799  53.010  96.319  1.00 53.93  ? 161 GLU B CD  1 
ATOM   3991  O  OE1 . GLU B  1 184 ? 75.909  53.445  96.687  1.00 58.35  ? 161 GLU B OE1 1 
ATOM   3992  O  OE2 . GLU B  1 184 ? 74.462  51.820  96.493  1.00 53.78  ? 161 GLU B OE2 1 
ATOM   3993  N  N   . GLY B  1 185 ? 73.548  58.772  95.843  1.00 35.48  ? 162 GLY B N   1 
ATOM   3994  C  CA  . GLY B  1 185 ? 73.505  60.014  96.595  1.00 36.35  ? 162 GLY B CA  1 
ATOM   3995  C  C   . GLY B  1 185 ? 72.262  60.847  96.334  1.00 42.17  ? 162 GLY B C   1 
ATOM   3996  O  O   . GLY B  1 185 ? 72.050  61.875  96.997  1.00 34.97  ? 162 GLY B O   1 
ATOM   3997  N  N   . GLN B  1 186 ? 71.457  60.406  95.363  1.00 47.41  ? 163 GLN B N   1 
ATOM   3998  C  CA  . GLN B  1 186 ? 70.182  61.041  95.002  1.00 50.47  ? 163 GLN B CA  1 
ATOM   3999  C  C   . GLN B  1 186 ? 70.379  62.421  94.390  1.00 46.01  ? 163 GLN B C   1 
ATOM   4000  O  O   . GLN B  1 186 ? 71.303  63.137  94.764  1.00 43.62  ? 163 GLN B O   1 
ATOM   4001  C  CB  . GLN B  1 186 ? 69.252  61.139  96.217  1.00 57.43  ? 163 GLN B CB  1 
ATOM   4002  C  CG  . GLN B  1 186 ? 69.076  59.827  96.991  1.00 69.51  ? 163 GLN B CG  1 
ATOM   4003  C  CD  . GLN B  1 186 ? 68.169  58.832  96.281  1.00 76.53  ? 163 GLN B CD  1 
ATOM   4004  O  OE1 . GLN B  1 186 ? 68.630  57.811  95.767  1.00 74.32  ? 163 GLN B OE1 1 
ATOM   4005  N  NE2 . GLN B  1 186 ? 66.871  59.123  96.259  1.00 78.98  ? 163 GLN B NE2 1 
ATOM   4006  N  N   . GLY B  1 187 ? 69.508  62.786  93.450  1.00 46.54  ? 164 GLY B N   1 
ATOM   4007  C  CA  . GLY B  1 187 ? 69.537  64.106  92.834  1.00 46.33  ? 164 GLY B CA  1 
ATOM   4008  C  C   . GLY B  1 187 ? 70.785  64.349  92.002  1.00 47.44  ? 164 GLY B C   1 
ATOM   4009  O  O   . GLY B  1 187 ? 71.086  63.582  91.096  1.00 43.67  ? 164 GLY B O   1 
ATOM   4010  N  N   . THR B  1 188 ? 71.527  65.407  92.317  1.00 56.42  ? 165 THR B N   1 
ATOM   4011  C  CA  . THR B  1 188 ? 72.806  65.659  91.644  1.00 55.26  ? 165 THR B CA  1 
ATOM   4012  C  C   . THR B  1 188 ? 73.894  64.642  92.025  1.00 47.83  ? 165 THR B C   1 
ATOM   4013  O  O   . THR B  1 188 ? 74.961  64.610  91.415  1.00 48.65  ? 165 THR B O   1 
ATOM   4014  C  CB  . THR B  1 188 ? 73.309  67.093  91.879  1.00 54.35  ? 165 THR B CB  1 
ATOM   4015  O  OG1 . THR B  1 188 ? 73.367  67.366  93.286  1.00 54.53  ? 165 THR B OG1 1 
ATOM   4016  C  CG2 . THR B  1 188 ? 72.378  68.092  91.204  1.00 54.06  ? 165 THR B CG2 1 
ATOM   4017  N  N   . GLY B  1 189 ? 73.615  63.813  93.029  1.00 42.43  ? 166 GLY B N   1 
ATOM   4018  C  CA  . GLY B  1 189 ? 74.484  62.693  93.369  1.00 46.12  ? 166 GLY B CA  1 
ATOM   4019  C  C   . GLY B  1 189 ? 75.518  63.002  94.442  1.00 44.92  ? 166 GLY B C   1 
ATOM   4020  O  O   . GLY B  1 189 ? 75.574  64.114  94.965  1.00 39.64  ? 166 GLY B O   1 
ATOM   4021  N  N   . PHE B  1 190 ? 76.332  62.006  94.775  1.00 40.45  ? 167 PHE B N   1 
ATOM   4022  C  CA  . PHE B  1 190 ? 77.461  62.209  95.675  1.00 39.83  ? 167 PHE B CA  1 
ATOM   4023  C  C   . PHE B  1 190 ? 78.533  63.091  95.019  1.00 44.92  ? 167 PHE B C   1 
ATOM   4024  O  O   . PHE B  1 190 ? 78.830  62.943  93.830  1.00 48.77  ? 167 PHE B O   1 
ATOM   4025  C  CB  . PHE B  1 190 ? 78.069  60.867  96.067  1.00 34.46  ? 167 PHE B CB  1 
ATOM   4026  C  CG  . PHE B  1 190 ? 77.369  60.189  97.206  1.00 41.21  ? 167 PHE B CG  1 
ATOM   4027  C  CD1 . PHE B  1 190 ? 77.283  60.802  98.446  1.00 40.36  ? 167 PHE B CD1 1 
ATOM   4028  C  CD2 . PHE B  1 190 ? 76.818  58.924  97.049  1.00 40.94  ? 167 PHE B CD2 1 
ATOM   4029  C  CE1 . PHE B  1 190 ? 76.646  60.169  99.496  1.00 34.82  ? 167 PHE B CE1 1 
ATOM   4030  C  CE2 . PHE B  1 190 ? 76.180  58.291  98.099  1.00 38.24  ? 167 PHE B CE2 1 
ATOM   4031  C  CZ  . PHE B  1 190 ? 76.095  58.912  99.320  1.00 35.06  ? 167 PHE B CZ  1 
ATOM   4032  N  N   . LYS B  1 191 ? 79.103  64.015  95.788  1.00 39.96  ? 168 LYS B N   1 
ATOM   4033  C  CA  . LYS B  1 191 ? 80.132  64.905  95.261  1.00 34.08  ? 168 LYS B CA  1 
ATOM   4034  C  C   . LYS B  1 191 ? 81.520  64.293  95.442  1.00 36.51  ? 168 LYS B C   1 
ATOM   4035  O  O   . LYS B  1 191 ? 82.520  64.830  94.965  1.00 40.41  ? 168 LYS B O   1 
ATOM   4036  C  CB  . LYS B  1 191 ? 80.061  66.274  95.928  1.00 36.29  ? 168 LYS B CB  1 
ATOM   4037  C  CG  . LYS B  1 191 ? 78.827  67.086  95.568  1.00 43.39  ? 168 LYS B CG  1 
ATOM   4038  C  CD  . LYS B  1 191 ? 78.683  68.291  96.481  1.00 45.36  ? 168 LYS B CD  1 
ATOM   4039  C  CE  . LYS B  1 191 ? 77.510  69.170  96.075  1.00 51.12  ? 168 LYS B CE  1 
ATOM   4040  N  NZ  . LYS B  1 191 ? 76.185  68.557  96.396  1.00 58.06  ? 168 LYS B NZ  1 
ATOM   4041  N  N   . GLY B  1 192 ? 81.582  63.158  96.121  1.00 27.75  ? 169 GLY B N   1 
ATOM   4042  C  CA  . GLY B  1 192 ? 82.837  62.443  96.204  1.00 28.31  ? 169 GLY B CA  1 
ATOM   4043  C  C   . GLY B  1 192 ? 82.633  60.957  96.323  1.00 22.92  ? 169 GLY B C   1 
ATOM   4044  O  O   . GLY B  1 192 ? 81.564  60.515  96.738  1.00 28.67  ? 169 GLY B O   1 
ATOM   4045  N  N   . LEU B  1 193 ? 83.665  60.194  95.962  1.00 26.63  ? 170 LEU B N   1 
ATOM   4046  C  CA  . LEU B  1 193 ? 83.650  58.733  96.030  1.00 32.26  ? 170 LEU B CA  1 
ATOM   4047  C  C   . LEU B  1 193 ? 84.974  58.212  96.601  1.00 30.93  ? 170 LEU B C   1 
ATOM   4048  O  O   . LEU B  1 193 ? 86.033  58.705  96.225  1.00 32.88  ? 170 LEU B O   1 
ATOM   4049  C  CB  . LEU B  1 193 ? 83.483  58.156  94.623  1.00 34.96  ? 170 LEU B CB  1 
ATOM   4050  C  CG  . LEU B  1 193 ? 82.278  58.555  93.766  1.00 39.27  ? 170 LEU B CG  1 
ATOM   4051  C  CD1 . LEU B  1 193 ? 82.463  58.056  92.362  1.00 40.94  ? 170 LEU B CD1 1 
ATOM   4052  C  CD2 . LEU B  1 193 ? 81.010  57.990  94.352  1.00 41.84  ? 170 LEU B CD2 1 
ATOM   4053  N  N   . LYS B  1 194 ? 84.932  57.208  97.480  1.00 27.00  ? 171 LYS B N   1 
ATOM   4054  C  CA  . LYS B  1 194 ? 86.173  56.537  97.892  1.00 30.97  ? 171 LYS B CA  1 
ATOM   4055  C  C   . LYS B  1 194 ? 86.617  55.411  96.954  1.00 36.87  ? 171 LYS B C   1 
ATOM   4056  O  O   . LYS B  1 194 ? 85.935  54.404  96.800  1.00 43.55  ? 171 LYS B O   1 
ATOM   4057  C  CB  . LYS B  1 194 ? 86.100  56.008  99.321  1.00 37.32  ? 171 LYS B CB  1 
ATOM   4058  C  CG  . LYS B  1 194 ? 87.307  55.144  99.695  1.00 41.71  ? 171 LYS B CG  1 
ATOM   4059  C  CD  . LYS B  1 194 ? 87.441  54.975  101.204 1.00 44.64  ? 171 LYS B CD  1 
ATOM   4060  C  CE  . LYS B  1 194 ? 87.906  56.261  101.858 1.00 41.54  ? 171 LYS B CE  1 
ATOM   4061  N  NZ  . LYS B  1 194 ? 87.732  56.225  103.331 1.00 46.64  ? 171 LYS B NZ  1 
ATOM   4062  N  N   . LEU B  1 195 ? 87.785  55.589  96.354  1.00 37.94  ? 172 LEU B N   1 
ATOM   4063  C  CA  . LEU B  1 195 ? 88.379  54.603  95.465  1.00 35.00  ? 172 LEU B CA  1 
ATOM   4064  C  C   . LEU B  1 195 ? 89.508  53.879  96.190  1.00 40.32  ? 172 LEU B C   1 
ATOM   4065  O  O   . LEU B  1 195 ? 90.462  54.521  96.640  1.00 40.80  ? 172 LEU B O   1 
ATOM   4066  C  CB  . LEU B  1 195 ? 88.944  55.319  94.240  1.00 35.91  ? 172 LEU B CB  1 
ATOM   4067  C  CG  . LEU B  1 195 ? 89.909  54.540  93.350  1.00 43.55  ? 172 LEU B CG  1 
ATOM   4068  C  CD1 . LEU B  1 195 ? 89.163  53.439  92.648  1.00 41.82  ? 172 LEU B CD1 1 
ATOM   4069  C  CD2 . LEU B  1 195 ? 90.570  55.467  92.341  1.00 40.20  ? 172 LEU B CD2 1 
ATOM   4070  N  N   . ARG B  1 196 ? 89.413  52.557  96.318  1.00 36.96  ? 173 ARG B N   1 
ATOM   4071  C  CA  . ARG B  1 196 ? 90.492  51.791  96.953  1.00 37.68  ? 173 ARG B CA  1 
ATOM   4072  C  C   . ARG B  1 196 ? 91.640  51.511  95.991  1.00 37.63  ? 173 ARG B C   1 
ATOM   4073  O  O   . ARG B  1 196 ? 91.427  51.351  94.794  1.00 39.65  ? 173 ARG B O   1 
ATOM   4074  C  CB  . ARG B  1 196 ? 89.983  50.488  97.544  1.00 30.50  ? 173 ARG B CB  1 
ATOM   4075  C  CG  . ARG B  1 196 ? 89.345  50.636  98.881  1.00 34.74  ? 173 ARG B CG  1 
ATOM   4076  C  CD  . ARG B  1 196 ? 87.877  51.004  98.792  1.00 38.72  ? 173 ARG B CD  1 
ATOM   4077  N  NE  . ARG B  1 196 ? 87.355  51.231  100.137 1.00 44.90  ? 173 ARG B NE  1 
ATOM   4078  C  CZ  . ARG B  1 196 ? 86.075  51.407  100.439 1.00 42.99  ? 173 ARG B CZ  1 
ATOM   4079  N  NH1 . ARG B  1 196 ? 85.150  51.380  99.488  1.00 46.90  ? 173 ARG B NH1 1 
ATOM   4080  N  NH2 . ARG B  1 196 ? 85.722  51.607  101.701 1.00 38.61  ? 173 ARG B NH2 1 
ATOM   4081  N  N   . MET B  1 197 ? 92.861  51.478  96.517  1.00 35.83  ? 174 MET B N   1 
ATOM   4082  C  CA  . MET B  1 197 ? 94.039  51.267  95.680  1.00 31.86  ? 174 MET B CA  1 
ATOM   4083  C  C   . MET B  1 197 ? 94.993  50.260  96.301  1.00 36.04  ? 174 MET B C   1 
ATOM   4084  O  O   . MET B  1 197 ? 94.859  49.896  97.469  1.00 41.22  ? 174 MET B O   1 
ATOM   4085  C  CB  . MET B  1 197 ? 94.780  52.585  95.420  1.00 37.28  ? 174 MET B CB  1 
ATOM   4086  C  CG  . MET B  1 197 ? 94.206  53.460  94.303  1.00 33.65  ? 174 MET B CG  1 
ATOM   4087  S  SD  . MET B  1 197 ? 95.417  54.673  93.708  1.00 46.30  ? 174 MET B SD  1 
ATOM   4088  C  CE  . MET B  1 197 ? 94.445  55.632  92.545  1.00 36.96  ? 174 MET B CE  1 
ATOM   4089  N  N   . GLY B  1 198 ? 95.964  49.816  95.511  1.00 39.75  ? 175 GLY B N   1 
ATOM   4090  C  CA  . GLY B  1 198 ? 96.941  48.855  95.983  1.00 43.39  ? 175 GLY B CA  1 
ATOM   4091  C  C   . GLY B  1 198 ? 96.961  47.554  95.198  1.00 48.37  ? 175 GLY B C   1 
ATOM   4092  O  O   . GLY B  1 198 ? 97.189  46.492  95.770  1.00 45.80  ? 175 GLY B O   1 
ATOM   4093  N  N   . ARG B  1 199 ? 96.726  47.635  93.890  1.00 48.76  ? 176 ARG B N   1 
ATOM   4094  C  CA  . ARG B  1 199 ? 96.876  46.480  93.005  1.00 46.68  ? 176 ARG B CA  1 
ATOM   4095  C  C   . ARG B  1 199 ? 98.352  46.093  92.860  1.00 50.82  ? 176 ARG B C   1 
ATOM   4096  O  O   . ARG B  1 199 ? 99.231  46.853  93.255  1.00 45.97  ? 176 ARG B O   1 
ATOM   4097  C  CB  . ARG B  1 199 ? 96.273  46.798  91.640  1.00 38.80  ? 176 ARG B CB  1 
ATOM   4098  C  CG  . ARG B  1 199 ? 94.765  46.972  91.695  1.00 36.20  ? 176 ARG B CG  1 
ATOM   4099  C  CD  . ARG B  1 199 ? 94.218  47.739  90.500  1.00 39.28  ? 176 ARG B CD  1 
ATOM   4100  N  NE  . ARG B  1 199 ? 92.764  47.778  90.551  1.00 46.60  ? 176 ARG B NE  1 
ATOM   4101  C  CZ  . ARG B  1 199 ? 92.066  48.680  91.231  1.00 48.90  ? 176 ARG B CZ  1 
ATOM   4102  N  NH1 . ARG B  1 199 ? 92.686  49.637  91.913  1.00 44.34  ? 176 ARG B NH1 1 
ATOM   4103  N  NH2 . ARG B  1 199 ? 90.745  48.621  91.233  1.00 47.89  ? 176 ARG B NH2 1 
ATOM   4104  N  N   . ASP B  1 200 ? 98.619  44.914  92.302  1.00 57.06  ? 177 ASP B N   1 
ATOM   4105  C  CA  . ASP B  1 200 ? 99.993  44.449  92.081  1.00 58.04  ? 177 ASP B CA  1 
ATOM   4106  C  C   . ASP B  1 200 ? 100.751 45.384  91.147  1.00 48.50  ? 177 ASP B C   1 
ATOM   4107  O  O   . ASP B  1 200 ? 101.954 45.593  91.299  1.00 48.09  ? 177 ASP B O   1 
ATOM   4108  C  CB  . ASP B  1 200 ? 100.002 43.035  91.486  1.00 70.00  ? 177 ASP B CB  1 
ATOM   4109  C  CG  . ASP B  1 200 ? 99.460  41.990  92.443  1.00 83.63  ? 177 ASP B CG  1 
ATOM   4110  O  OD1 . ASP B  1 200 ? 99.979  41.902  93.577  1.00 91.33  ? 177 ASP B OD1 1 
ATOM   4111  O  OD2 . ASP B  1 200 ? 98.513  41.263  92.064  1.00 82.74  ? 177 ASP B OD2 1 
ATOM   4112  N  N   . ASP B  1 201 ? 100.035 45.928  90.169  1.00 46.32  ? 178 ASP B N   1 
ATOM   4113  C  CA  . ASP B  1 201 ? 100.606 46.847  89.195  1.00 47.08  ? 178 ASP B CA  1 
ATOM   4114  C  C   . ASP B  1 201 ? 100.060 48.238  89.481  1.00 47.64  ? 178 ASP B C   1 
ATOM   4115  O  O   . ASP B  1 201 ? 98.866  48.492  89.306  1.00 50.61  ? 178 ASP B O   1 
ATOM   4116  C  CB  . ASP B  1 201 ? 100.233 46.410  87.773  1.00 48.73  ? 178 ASP B CB  1 
ATOM   4117  C  CG  . ASP B  1 201 ? 100.886 47.263  86.689  1.00 55.06  ? 178 ASP B CG  1 
ATOM   4118  O  OD1 . ASP B  1 201 ? 101.481 48.322  87.002  1.00 58.05  ? 178 ASP B OD1 1 
ATOM   4119  O  OD2 . ASP B  1 201 ? 100.788 46.869  85.503  1.00 58.16  ? 178 ASP B OD2 1 
ATOM   4120  N  N   . PRO B  1 202 ? 100.935 49.144  89.939  1.00 43.37  ? 179 PRO B N   1 
ATOM   4121  C  CA  . PRO B  1 202 ? 100.565 50.531  90.245  1.00 41.92  ? 179 PRO B CA  1 
ATOM   4122  C  C   . PRO B  1 202 ? 99.917  51.212  89.031  1.00 44.62  ? 179 PRO B C   1 
ATOM   4123  O  O   . PRO B  1 202 ? 99.005  52.027  89.179  1.00 56.23  ? 179 PRO B O   1 
ATOM   4124  C  CB  . PRO B  1 202 ? 101.909 51.187  90.559  1.00 46.44  ? 179 PRO B CB  1 
ATOM   4125  C  CG  . PRO B  1 202 ? 102.812 50.051  90.943  1.00 48.56  ? 179 PRO B CG  1 
ATOM   4126  C  CD  . PRO B  1 202 ? 102.371 48.889  90.121  1.00 36.00  ? 179 PRO B CD  1 
ATOM   4127  N  N   . ALA B  1 203 ? 100.390 50.871  87.838  1.00 34.13  ? 180 ALA B N   1 
ATOM   4128  C  CA  . ALA B  1 203 ? 99.842  51.441  86.611  1.00 41.47  ? 180 ALA B CA  1 
ATOM   4129  C  C   . ALA B  1 203 ? 98.354  51.168  86.495  1.00 34.18  ? 180 ALA B C   1 
ATOM   4130  O  O   . ALA B  1 203 ? 97.610  51.985  85.960  1.00 44.85  ? 180 ALA B O   1 
ATOM   4131  C  CB  . ALA B  1 203 ? 100.574 50.906  85.389  1.00 36.86  ? 180 ALA B CB  1 
ATOM   4132  N  N   . VAL B  1 204 ? 97.918  50.021  87.000  1.00 32.82  ? 181 VAL B N   1 
ATOM   4133  C  CA  . VAL B  1 204 ? 96.497  49.680  86.964  1.00 37.26  ? 181 VAL B CA  1 
ATOM   4134  C  C   . VAL B  1 204 ? 95.696  50.555  87.934  1.00 46.78  ? 181 VAL B C   1 
ATOM   4135  O  O   . VAL B  1 204 ? 94.568  50.953  87.621  1.00 48.42  ? 181 VAL B O   1 
ATOM   4136  C  CB  . VAL B  1 204 ? 96.255  48.196  87.267  1.00 37.32  ? 181 VAL B CB  1 
ATOM   4137  C  CG1 . VAL B  1 204 ? 94.797  47.840  87.009  1.00 41.19  ? 181 VAL B CG1 1 
ATOM   4138  C  CG2 . VAL B  1 204 ? 97.171  47.331  86.407  1.00 37.06  ? 181 VAL B CG2 1 
ATOM   4139  N  N   . ASP B  1 205 ? 96.276  50.861  89.099  1.00 38.31  ? 182 ASP B N   1 
ATOM   4140  C  CA  . ASP B  1 205 ? 95.637  51.785  90.038  1.00 37.65  ? 182 ASP B CA  1 
ATOM   4141  C  C   . ASP B  1 205 ? 95.343  53.123  89.350  1.00 37.67  ? 182 ASP B C   1 
ATOM   4142  O  O   . ASP B  1 205 ? 94.256  53.686  89.488  1.00 36.36  ? 182 ASP B O   1 
ATOM   4143  C  CB  . ASP B  1 205 ? 96.514  52.017  91.276  1.00 37.59  ? 182 ASP B CB  1 
ATOM   4144  C  CG  . ASP B  1 205 ? 96.447  50.869  92.275  1.00 43.48  ? 182 ASP B CG  1 
ATOM   4145  O  OD1 . ASP B  1 205 ? 95.396  50.205  92.361  1.00 40.87  ? 182 ASP B OD1 1 
ATOM   4146  O  OD2 . ASP B  1 205 ? 97.447  50.632  92.984  1.00 43.86  ? 182 ASP B OD2 1 
ATOM   4147  N  N   . ILE B  1 206 ? 96.328  53.628  88.615  1.00 33.89  ? 183 ILE B N   1 
ATOM   4148  C  CA  . ILE B  1 206 ? 96.176  54.888  87.901  1.00 38.82  ? 183 ILE B CA  1 
ATOM   4149  C  C   . ILE B  1 206 ? 95.101  54.736  86.813  1.00 38.93  ? 183 ILE B C   1 
ATOM   4150  O  O   . ILE B  1 206 ? 94.155  55.515  86.744  1.00 40.59  ? 183 ILE B O   1 
ATOM   4151  C  CB  . ILE B  1 206 ? 97.536  55.364  87.331  1.00 36.38  ? 183 ILE B CB  1 
ATOM   4152  C  CG1 . ILE B  1 206 ? 98.451  55.782  88.487  1.00 41.98  ? 183 ILE B CG1 1 
ATOM   4153  C  CG2 . ILE B  1 206 ? 97.352  56.515  86.349  1.00 31.85  ? 183 ILE B CG2 1 
ATOM   4154  C  CD1 . ILE B  1 206 ? 99.896  56.041  88.102  1.00 37.54  ? 183 ILE B CD1 1 
ATOM   4155  N  N   . GLU B  1 207 ? 95.239  53.697  85.998  1.00 37.32  ? 184 GLU B N   1 
ATOM   4156  C  CA  . GLU B  1 207 ? 94.256  53.357  84.979  1.00 40.98  ? 184 GLU B CA  1 
ATOM   4157  C  C   . GLU B  1 207 ? 92.822  53.414  85.528  1.00 41.82  ? 184 GLU B C   1 
ATOM   4158  O  O   . GLU B  1 207 ? 91.931  54.008  84.919  1.00 42.02  ? 184 GLU B O   1 
ATOM   4159  C  CB  . GLU B  1 207 ? 94.560  51.955  84.467  1.00 41.51  ? 184 GLU B CB  1 
ATOM   4160  C  CG  . GLU B  1 207 ? 94.374  51.745  82.984  1.00 55.53  ? 184 GLU B CG  1 
ATOM   4161  C  CD  . GLU B  1 207 ? 94.512  50.274  82.598  1.00 68.63  ? 184 GLU B CD  1 
ATOM   4162  O  OE1 . GLU B  1 207 ? 95.595  49.681  82.837  1.00 63.73  ? 184 GLU B OE1 1 
ATOM   4163  O  OE2 . GLU B  1 207 ? 93.529  49.711  82.067  1.00 75.50  ? 184 GLU B OE2 1 
ATOM   4164  N  N   . THR B  1 208 ? 92.613  52.801  86.689  1.00 39.72  ? 185 THR B N   1 
ATOM   4165  C  CA  . THR B  1 208 ? 91.301  52.772  87.344  1.00 36.30  ? 185 THR B CA  1 
ATOM   4166  C  C   . THR B  1 208 ? 90.774  54.147  87.768  1.00 43.44  ? 185 THR B C   1 
ATOM   4167  O  O   . THR B  1 208 ? 89.574  54.417  87.669  1.00 42.32  ? 185 THR B O   1 
ATOM   4168  C  CB  . THR B  1 208 ? 91.350  51.889  88.581  1.00 37.53  ? 185 THR B CB  1 
ATOM   4169  O  OG1 . THR B  1 208 ? 91.849  50.597  88.217  1.00 40.79  ? 185 THR B OG1 1 
ATOM   4170  C  CG2 . THR B  1 208 ? 89.971  51.771  89.226  1.00 37.26  ? 185 THR B CG2 1 
ATOM   4171  N  N   . ALA B  1 209 ? 91.663  55.006  88.259  1.00 37.70  ? 186 ALA B N   1 
ATOM   4172  C  CA  . ALA B  1 209 ? 91.260  56.346  88.660  1.00 41.17  ? 186 ALA B CA  1 
ATOM   4173  C  C   . ALA B  1 209 ? 90.856  57.152  87.434  1.00 39.02  ? 186 ALA B C   1 
ATOM   4174  O  O   . ALA B  1 209 ? 89.905  57.935  87.467  1.00 37.20  ? 186 ALA B O   1 
ATOM   4175  C  CB  . ALA B  1 209 ? 92.391  57.052  89.414  1.00 37.49  ? 186 ALA B CB  1 
ATOM   4176  N  N   . GLU B  1 210 ? 91.597  56.970  86.351  1.00 39.02  ? 187 GLU B N   1 
ATOM   4177  C  CA  . GLU B  1 210 ? 91.312  57.701  85.127  1.00 41.76  ? 187 GLU B CA  1 
ATOM   4178  C  C   . GLU B  1 210 ? 90.026  57.195  84.470  1.00 37.86  ? 187 GLU B C   1 
ATOM   4179  O  O   . GLU B  1 210 ? 89.273  57.980  83.884  1.00 39.68  ? 187 GLU B O   1 
ATOM   4180  C  CB  . GLU B  1 210 ? 92.500  57.618  84.173  1.00 43.21  ? 187 GLU B CB  1 
ATOM   4181  C  CG  . GLU B  1 210 ? 93.744  58.305  84.720  1.00 48.32  ? 187 GLU B CG  1 
ATOM   4182  C  CD  . GLU B  1 210 ? 93.672  59.824  84.639  1.00 58.74  ? 187 GLU B CD  1 
ATOM   4183  O  OE1 . GLU B  1 210 ? 93.286  60.347  83.574  1.00 71.30  ? 187 GLU B OE1 1 
ATOM   4184  O  OE2 . GLU B  1 210 ? 94.005  60.499  85.634  1.00 61.75  ? 187 GLU B OE2 1 
ATOM   4185  N  N   . ALA B  1 211 ? 89.758  55.896  84.593  1.00 30.19  ? 188 ALA B N   1 
ATOM   4186  C  CA  . ALA B  1 211 ? 88.527  55.327  84.032  1.00 41.15  ? 188 ALA B CA  1 
ATOM   4187  C  C   . ALA B  1 211 ? 87.290  55.761  84.821  1.00 50.52  ? 188 ALA B C   1 
ATOM   4188  O  O   . ALA B  1 211 ? 86.211  55.924  84.251  1.00 53.47  ? 188 ALA B O   1 
ATOM   4189  C  CB  . ALA B  1 211 ? 88.610  53.811  83.969  1.00 33.57  ? 188 ALA B CB  1 
ATOM   4190  N  N   . VAL B  1 212 ? 87.454  55.940  86.133  1.00 46.71  ? 189 VAL B N   1 
ATOM   4191  C  CA  . VAL B  1 212 ? 86.366  56.399  86.994  1.00 35.81  ? 189 VAL B CA  1 
ATOM   4192  C  C   . VAL B  1 212 ? 85.973  57.839  86.682  1.00 40.73  ? 189 VAL B C   1 
ATOM   4193  O  O   . VAL B  1 212 ? 84.797  58.181  86.670  1.00 38.98  ? 189 VAL B O   1 
ATOM   4194  C  CB  . VAL B  1 212 ? 86.736  56.285  88.487  1.00 31.99  ? 189 VAL B CB  1 
ATOM   4195  C  CG1 . VAL B  1 212 ? 85.841  57.198  89.347  1.00 29.49  ? 189 VAL B CG1 1 
ATOM   4196  C  CG2 . VAL B  1 212 ? 86.640  54.832  88.951  1.00 31.51  ? 189 VAL B CG2 1 
ATOM   4197  N  N   . TRP B  1 213 ? 86.970  58.681  86.439  1.00 40.40  ? 190 TRP B N   1 
ATOM   4198  C  CA  . TRP B  1 213 ? 86.731  60.078  86.113  1.00 42.28  ? 190 TRP B CA  1 
ATOM   4199  C  C   . TRP B  1 213 ? 86.128  60.232  84.719  1.00 41.63  ? 190 TRP B C   1 
ATOM   4200  O  O   . TRP B  1 213 ? 85.316  61.129  84.484  1.00 43.22  ? 190 TRP B O   1 
ATOM   4201  C  CB  . TRP B  1 213 ? 88.030  60.885  86.223  1.00 46.06  ? 190 TRP B CB  1 
ATOM   4202  C  CG  . TRP B  1 213 ? 88.247  61.524  87.578  1.00 51.72  ? 190 TRP B CG  1 
ATOM   4203  C  CD1 . TRP B  1 213 ? 87.297  62.086  88.381  1.00 50.08  ? 190 TRP B CD1 1 
ATOM   4204  C  CD2 . TRP B  1 213 ? 89.491  61.658  88.277  1.00 45.19  ? 190 TRP B CD2 1 
ATOM   4205  N  NE1 . TRP B  1 213 ? 87.872  62.567  89.528  1.00 49.90  ? 190 TRP B NE1 1 
ATOM   4206  C  CE2 . TRP B  1 213 ? 89.219  62.316  89.490  1.00 50.85  ? 190 TRP B CE2 1 
ATOM   4207  C  CE3 . TRP B  1 213 ? 90.807  61.285  87.993  1.00 42.45  ? 190 TRP B CE3 1 
ATOM   4208  C  CZ2 . TRP B  1 213 ? 90.215  62.612  90.419  1.00 46.82  ? 190 TRP B CZ2 1 
ATOM   4209  C  CZ3 . TRP B  1 213 ? 91.795  61.583  88.912  1.00 47.37  ? 190 TRP B CZ3 1 
ATOM   4210  C  CH2 . TRP B  1 213 ? 91.494  62.237  90.111  1.00 43.92  ? 190 TRP B CH2 1 
ATOM   4211  N  N   . ASP B  1 214 ? 86.535  59.373  83.792  1.00 39.56  ? 191 ASP B N   1 
ATOM   4212  C  CA  . ASP B  1 214 ? 85.928  59.368  82.462  1.00 53.93  ? 191 ASP B CA  1 
ATOM   4213  C  C   . ASP B  1 214 ? 84.413  59.164  82.578  1.00 53.21  ? 191 ASP B C   1 
ATOM   4214  O  O   . ASP B  1 214 ? 83.625  59.792  81.867  1.00 56.85  ? 191 ASP B O   1 
ATOM   4215  C  CB  . ASP B  1 214 ? 86.526  58.256  81.586  1.00 57.50  ? 191 ASP B CB  1 
ATOM   4216  C  CG  . ASP B  1 214 ? 87.893  58.615  81.022  1.00 62.45  ? 191 ASP B CG  1 
ATOM   4217  O  OD1 . ASP B  1 214 ? 88.245  59.816  81.011  1.00 60.25  ? 191 ASP B OD1 1 
ATOM   4218  O  OD2 . ASP B  1 214 ? 88.612  57.689  80.579  1.00 63.72  ? 191 ASP B OD2 1 
ATOM   4219  N  N   . ALA B  1 215 ? 84.026  58.295  83.504  1.00 43.83  ? 192 ALA B N   1 
ATOM   4220  C  CA  . ALA B  1 215 ? 82.653  57.827  83.633  1.00 37.51  ? 192 ALA B CA  1 
ATOM   4221  C  C   . ALA B  1 215 ? 81.736  58.774  84.409  1.00 45.62  ? 192 ALA B C   1 
ATOM   4222  O  O   . ALA B  1 215 ? 80.602  59.020  83.997  1.00 46.65  ? 192 ALA B O   1 
ATOM   4223  C  CB  . ALA B  1 215 ? 82.648  56.433  84.274  1.00 29.40  ? 192 ALA B CB  1 
ATOM   4224  N  N   . VAL B  1 216 ? 82.215  59.285  85.541  1.00 40.64  ? 193 VAL B N   1 
ATOM   4225  C  CA  . VAL B  1 216 ? 81.396  60.144  86.396  1.00 31.71  ? 193 VAL B CA  1 
ATOM   4226  C  C   . VAL B  1 216 ? 81.744  61.617  86.242  1.00 32.11  ? 193 VAL B C   1 
ATOM   4227  O  O   . VAL B  1 216 ? 81.031  62.474  86.757  1.00 34.11  ? 193 VAL B O   1 
ATOM   4228  C  CB  . VAL B  1 216 ? 81.521  59.772  87.898  1.00 39.84  ? 193 VAL B CB  1 
ATOM   4229  C  CG1 . VAL B  1 216 ? 81.097  58.343  88.137  1.00 27.54  ? 193 VAL B CG1 1 
ATOM   4230  C  CG2 . VAL B  1 216 ? 82.949  60.003  88.397  1.00 40.68  ? 193 VAL B CG2 1 
ATOM   4231  N  N   . GLY B  1 217 ? 82.844  61.911  85.550  1.00 35.61  ? 194 GLY B N   1 
ATOM   4232  C  CA  . GLY B  1 217 ? 83.277  63.289  85.352  1.00 33.97  ? 194 GLY B CA  1 
ATOM   4233  C  C   . GLY B  1 217 ? 84.294  63.811  86.365  1.00 42.95  ? 194 GLY B C   1 
ATOM   4234  O  O   . GLY B  1 217 ? 84.291  63.410  87.524  1.00 37.46  ? 194 GLY B O   1 
ATOM   4235  N  N   . ARG B  1 218 ? 85.149  64.729  85.918  1.00 45.02  ? 195 ARG B N   1 
ATOM   4236  C  CA  . ARG B  1 218 ? 86.262  65.236  86.715  1.00 44.42  ? 195 ARG B CA  1 
ATOM   4237  C  C   . ARG B  1 218 ? 85.829  66.030  87.941  1.00 53.85  ? 195 ARG B C   1 
ATOM   4238  O  O   . ARG B  1 218 ? 86.627  66.244  88.851  1.00 55.57  ? 195 ARG B O   1 
ATOM   4239  C  CB  . ARG B  1 218 ? 87.166  66.119  85.850  1.00 46.03  ? 195 ARG B CB  1 
ATOM   4240  C  CG  . ARG B  1 218 ? 87.808  65.408  84.673  1.00 52.57  ? 195 ARG B CG  1 
ATOM   4241  C  CD  . ARG B  1 218 ? 89.198  64.879  85.011  1.00 58.91  ? 195 ARG B CD  1 
ATOM   4242  N  NE  . ARG B  1 218 ? 89.513  63.697  84.213  1.00 68.07  ? 195 ARG B NE  1 
ATOM   4243  C  CZ  . ARG B  1 218 ? 90.635  62.990  84.312  1.00 64.33  ? 195 ARG B CZ  1 
ATOM   4244  N  NH1 . ARG B  1 218 ? 90.806  61.922  83.539  1.00 65.43  ? 195 ARG B NH1 1 
ATOM   4245  N  NH2 . ARG B  1 218 ? 91.579  63.346  85.178  1.00 53.44  ? 195 ARG B NH2 1 
ATOM   4246  N  N   . ASP B  1 219 ? 84.579  66.482  87.961  1.00 51.33  ? 196 ASP B N   1 
ATOM   4247  C  CA  . ASP B  1 219 ? 84.077  67.268  89.086  1.00 53.67  ? 196 ASP B CA  1 
ATOM   4248  C  C   . ASP B  1 219 ? 83.929  66.441  90.368  1.00 47.14  ? 196 ASP B C   1 
ATOM   4249  O  O   . ASP B  1 219 ? 83.740  66.994  91.455  1.00 45.61  ? 196 ASP B O   1 
ATOM   4250  C  CB  . ASP B  1 219 ? 82.737  67.904  88.726  1.00 71.57  ? 196 ASP B CB  1 
ATOM   4251  C  CG  . ASP B  1 219 ? 82.877  69.340  88.265  1.00 92.33  ? 196 ASP B CG  1 
ATOM   4252  O  OD1 . ASP B  1 219 ? 84.008  69.756  87.924  1.00 96.27  ? 196 ASP B OD1 1 
ATOM   4253  O  OD2 . ASP B  1 219 ? 81.850  70.054  88.242  1.00 101.34 ? 196 ASP B OD2 1 
ATOM   4254  N  N   . THR B  1 220 ? 84.015  65.120  90.231  1.00 30.52  ? 197 THR B N   1 
ATOM   4255  C  CA  . THR B  1 220 ? 83.837  64.207  91.348  1.00 31.10  ? 197 THR B CA  1 
ATOM   4256  C  C   . THR B  1 220 ? 85.148  64.024  92.103  1.00 34.10  ? 197 THR B C   1 
ATOM   4257  O  O   . THR B  1 220 ? 86.177  63.718  91.507  1.00 37.26  ? 197 THR B O   1 
ATOM   4258  C  CB  . THR B  1 220 ? 83.333  62.836  90.871  1.00 38.44  ? 197 THR B CB  1 
ATOM   4259  O  OG1 . THR B  1 220 ? 82.106  63.006  90.150  1.00 47.26  ? 197 THR B OG1 1 
ATOM   4260  C  CG2 . THR B  1 220 ? 83.089  61.919  92.056  1.00 38.97  ? 197 THR B CG2 1 
ATOM   4261  N  N   . ALA B  1 221 ? 85.107  64.229  93.415  1.00 30.62  ? 198 ALA B N   1 
ATOM   4262  C  CA  . ALA B  1 221 ? 86.284  64.043  94.260  1.00 28.81  ? 198 ALA B CA  1 
ATOM   4263  C  C   . ALA B  1 221 ? 86.526  62.560  94.499  1.00 36.56  ? 198 ALA B C   1 
ATOM   4264  O  O   . ALA B  1 221 ? 85.596  61.822  94.815  1.00 42.82  ? 198 ALA B O   1 
ATOM   4265  C  CB  . ALA B  1 221 ? 86.110  64.780  95.592  1.00 20.68  ? 198 ALA B CB  1 
ATOM   4266  N  N   . LEU B  1 222 ? 87.770  62.121  94.331  1.00 35.38  ? 199 LEU B N   1 
ATOM   4267  C  CA  . LEU B  1 222 ? 88.124  60.731  94.604  1.00 32.93  ? 199 LEU B CA  1 
ATOM   4268  C  C   . LEU B  1 222 ? 89.018  60.667  95.824  1.00 34.71  ? 199 LEU B C   1 
ATOM   4269  O  O   . LEU B  1 222 ? 90.083  61.276  95.847  1.00 36.37  ? 199 LEU B O   1 
ATOM   4270  C  CB  . LEU B  1 222 ? 88.863  60.111  93.421  1.00 26.75  ? 199 LEU B CB  1 
ATOM   4271  C  CG  . LEU B  1 222 ? 88.139  60.115  92.083  1.00 35.59  ? 199 LEU B CG  1 
ATOM   4272  C  CD1 . LEU B  1 222 ? 88.924  59.293  91.065  1.00 34.74  ? 199 LEU B CD1 1 
ATOM   4273  C  CD2 . LEU B  1 222 ? 86.736  59.547  92.277  1.00 37.38  ? 199 LEU B CD2 1 
ATOM   4274  N  N   . MET B  1 223 ? 88.578  59.942  96.840  1.00 27.99  ? 200 MET B N   1 
ATOM   4275  C  CA  . MET B  1 223 ? 89.386  59.745  98.027  1.00 28.57  ? 200 MET B CA  1 
ATOM   4276  C  C   . MET B  1 223 ? 90.054  58.377  97.906  1.00 30.11  ? 200 MET B C   1 
ATOM   4277  O  O   . MET B  1 223 ? 89.373  57.359  97.871  1.00 46.17  ? 200 MET B O   1 
ATOM   4278  C  CB  . MET B  1 223 ? 88.508  59.795  99.276  1.00 25.38  ? 200 MET B CB  1 
ATOM   4279  C  CG  . MET B  1 223 ? 87.880  61.144  99.577  1.00 30.74  ? 200 MET B CG  1 
ATOM   4280  S  SD  . MET B  1 223 ? 86.807  61.841  98.295  1.00 35.79  ? 200 MET B SD  1 
ATOM   4281  C  CE  . MET B  1 223 ? 85.772  62.905  99.319  1.00 27.00  ? 200 MET B CE  1 
ATOM   4282  N  N   . VAL B  1 224 ? 91.380  58.349  97.833  1.00 23.75  ? 201 VAL B N   1 
ATOM   4283  C  CA  . VAL B  1 224 ? 92.108  57.097  97.625  1.00 24.15  ? 201 VAL B CA  1 
ATOM   4284  C  C   . VAL B  1 224 ? 92.534  56.482  98.945  1.00 27.24  ? 201 VAL B C   1 
ATOM   4285  O  O   . VAL B  1 224 ? 93.045  57.171  99.817  1.00 31.37  ? 201 VAL B O   1 
ATOM   4286  C  CB  . VAL B  1 224 ? 93.337  57.283  96.710  1.00 28.86  ? 201 VAL B CB  1 
ATOM   4287  C  CG1 . VAL B  1 224 ? 94.267  56.104  96.829  1.00 29.61  ? 201 VAL B CG1 1 
ATOM   4288  C  CG2 . VAL B  1 224 ? 92.900  57.466  95.259  1.00 29.02  ? 201 VAL B CG2 1 
ATOM   4289  N  N   . ASP B  1 225 ? 92.312  55.179  99.090  1.00 31.57  ? 202 ASP B N   1 
ATOM   4290  C  CA  . ASP B  1 225 ? 92.607  54.478  100.329 1.00 25.91  ? 202 ASP B CA  1 
ATOM   4291  C  C   . ASP B  1 225 ? 93.446  53.232  100.037 1.00 35.20  ? 202 ASP B C   1 
ATOM   4292  O  O   . ASP B  1 225 ? 93.051  52.395  99.222  1.00 41.86  ? 202 ASP B O   1 
ATOM   4293  C  CB  . ASP B  1 225 ? 91.301  54.092  101.025 1.00 23.46  ? 202 ASP B CB  1 
ATOM   4294  C  CG  . ASP B  1 225 ? 91.503  53.703  102.483 1.00 29.73  ? 202 ASP B CG  1 
ATOM   4295  O  OD1 . ASP B  1 225 ? 92.631  53.309  102.864 1.00 25.40  ? 202 ASP B OD1 1 
ATOM   4296  O  OD2 . ASP B  1 225 ? 90.524  53.790  103.253 1.00 31.55  ? 202 ASP B OD2 1 
ATOM   4297  N  N   . PHE B  1 226 ? 94.603  53.121  100.691 1.00 27.19  ? 203 PHE B N   1 
ATOM   4298  C  CA  . PHE B  1 226 ? 95.508  51.984  100.500 1.00 32.18  ? 203 PHE B CA  1 
ATOM   4299  C  C   . PHE B  1 226 ? 95.401  50.956  101.632 1.00 37.35  ? 203 PHE B C   1 
ATOM   4300  O  O   . PHE B  1 226 ? 96.109  49.948  101.634 1.00 34.82  ? 203 PHE B O   1 
ATOM   4301  C  CB  . PHE B  1 226 ? 96.952  52.460  100.433 1.00 29.12  ? 203 PHE B CB  1 
ATOM   4302  C  CG  . PHE B  1 226 ? 97.377  52.962  99.085  1.00 31.56  ? 203 PHE B CG  1 
ATOM   4303  C  CD1 . PHE B  1 226 ? 97.712  52.076  98.075  1.00 30.62  ? 203 PHE B CD1 1 
ATOM   4304  C  CD2 . PHE B  1 226 ? 97.489  54.319  98.841  1.00 27.11  ? 203 PHE B CD2 1 
ATOM   4305  C  CE1 . PHE B  1 226 ? 98.130  52.535  96.830  1.00 24.32  ? 203 PHE B CE1 1 
ATOM   4306  C  CE2 . PHE B  1 226 ? 97.911  54.789  97.594  1.00 36.86  ? 203 PHE B CE2 1 
ATOM   4307  C  CZ  . PHE B  1 226 ? 98.233  53.890  96.590  1.00 27.38  ? 203 PHE B CZ  1 
ATOM   4308  N  N   . ASN B  1 227 ? 94.552  51.248  102.611 1.00 31.83  ? 204 ASN B N   1 
ATOM   4309  C  CA  . ASN B  1 227 ? 94.291  50.333  103.714 1.00 35.56  ? 204 ASN B CA  1 
ATOM   4310  C  C   . ASN B  1 227 ? 95.569  49.723  104.289 1.00 33.10  ? 204 ASN B C   1 
ATOM   4311  O  O   . ASN B  1 227 ? 95.647  48.519  104.526 1.00 34.46  ? 204 ASN B O   1 
ATOM   4312  C  CB  . ASN B  1 227 ? 93.273  49.249  103.294 1.00 35.13  ? 204 ASN B CB  1 
ATOM   4313  C  CG  . ASN B  1 227 ? 91.855  49.811  103.097 1.00 41.91  ? 204 ASN B CG  1 
ATOM   4314  O  OD1 . ASN B  1 227 ? 91.184  50.161  104.066 1.00 52.33  ? 204 ASN B OD1 1 
ATOM   4315  N  ND2 . ASN B  1 227 ? 91.406  49.905  101.844 1.00 38.50  ? 204 ASN B ND2 1 
ATOM   4316  N  N   . GLN B  1 228 ? 96.573  50.567  104.500 1.00 28.55  ? 205 GLN B N   1 
ATOM   4317  C  CA  . GLN B  1 228 ? 97.798  50.159  105.176 1.00 25.81  ? 205 GLN B CA  1 
ATOM   4318  C  C   . GLN B  1 228 ? 98.556  49.084  104.433 1.00 30.79  ? 205 GLN B C   1 
ATOM   4319  O  O   . GLN B  1 228 ? 99.354  48.371  105.036 1.00 36.24  ? 205 GLN B O   1 
ATOM   4320  C  CB  . GLN B  1 228 ? 97.502  49.624  106.587 1.00 24.80  ? 205 GLN B CB  1 
ATOM   4321  C  CG  . GLN B  1 228 ? 96.704  50.549  107.490 1.00 30.59  ? 205 GLN B CG  1 
ATOM   4322  C  CD  . GLN B  1 228 ? 96.515  49.973  108.900 1.00 37.51  ? 205 GLN B CD  1 
ATOM   4323  O  OE1 . GLN B  1 228 ? 97.480  49.746  109.633 1.00 32.68  ? 205 GLN B OE1 1 
ATOM   4324  N  NE2 . GLN B  1 228 ? 95.264  49.736  109.276 1.00 29.42  ? 205 GLN B NE2 1 
ATOM   4325  N  N   . GLY B  1 229 ? 98.319  48.963  103.132 1.00 34.77  ? 206 GLY B N   1 
ATOM   4326  C  CA  . GLY B  1 229 ? 98.847  47.839  102.380 1.00 29.91  ? 206 GLY B CA  1 
ATOM   4327  C  C   . GLY B  1 229 ? 100.311 47.897  101.994 1.00 40.14  ? 206 GLY B C   1 
ATOM   4328  O  O   . GLY B  1 229 ? 100.867 46.909  101.503 1.00 43.32  ? 206 GLY B O   1 
ATOM   4329  N  N   . LEU B  1 230 ? 100.945 49.046  102.215 1.00 34.80  ? 207 LEU B N   1 
ATOM   4330  C  CA  . LEU B  1 230 ? 102.283 49.269  101.694 1.00 27.38  ? 207 LEU B CA  1 
ATOM   4331  C  C   . LEU B  1 230 ? 103.333 49.348  102.780 1.00 29.76  ? 207 LEU B C   1 
ATOM   4332  O  O   . LEU B  1 230 ? 103.059 49.829  103.881 1.00 35.64  ? 207 LEU B O   1 
ATOM   4333  C  CB  . LEU B  1 230 ? 102.316 50.570  100.879 1.00 28.20  ? 207 LEU B CB  1 
ATOM   4334  C  CG  . LEU B  1 230 ? 101.294 50.715  99.758  1.00 31.63  ? 207 LEU B CG  1 
ATOM   4335  C  CD1 . LEU B  1 230 ? 101.480 52.073  99.064  1.00 25.24  ? 207 LEU B CD1 1 
ATOM   4336  C  CD2 . LEU B  1 230 ? 101.416 49.541  98.764  1.00 22.91  ? 207 LEU B CD2 1 
ATOM   4337  N  N   . ASP B  1 231 ? 104.548 48.906  102.466 1.00 24.21  ? 208 ASP B N   1 
ATOM   4338  C  CA  . ASP B  1 231 ? 105.679 49.250  103.316 1.00 31.87  ? 208 ASP B CA  1 
ATOM   4339  C  C   . ASP B  1 231 ? 106.157 50.637  102.875 1.00 34.00  ? 208 ASP B C   1 
ATOM   4340  O  O   . ASP B  1 231 ? 105.675 51.155  101.868 1.00 35.90  ? 208 ASP B O   1 
ATOM   4341  C  CB  . ASP B  1 231 ? 106.789 48.186  103.260 1.00 35.38  ? 208 ASP B CB  1 
ATOM   4342  C  CG  . ASP B  1 231 ? 107.578 48.214  101.964 1.00 50.84  ? 208 ASP B CG  1 
ATOM   4343  O  OD1 . ASP B  1 231 ? 107.473 49.208  101.217 1.00 57.55  ? 208 ASP B OD1 1 
ATOM   4344  O  OD2 . ASP B  1 231 ? 108.325 47.245  101.701 1.00 57.34  ? 208 ASP B OD2 1 
ATOM   4345  N  N   . MET B  1 232 ? 107.084 51.241  103.619 1.00 27.07  ? 209 MET B N   1 
ATOM   4346  C  CA  . MET B  1 232 ? 107.516 52.614  103.341 1.00 25.34  ? 209 MET B CA  1 
ATOM   4347  C  C   . MET B  1 232 ? 108.108 52.858  101.956 1.00 20.56  ? 209 MET B C   1 
ATOM   4348  O  O   . MET B  1 232 ? 107.867 53.899  101.353 1.00 31.51  ? 209 MET B O   1 
ATOM   4349  C  CB  . MET B  1 232 ? 108.495 53.112  104.414 1.00 23.11  ? 209 MET B CB  1 
ATOM   4350  C  CG  . MET B  1 232 ? 107.803 53.780  105.573 1.00 25.89  ? 209 MET B CG  1 
ATOM   4351  S  SD  . MET B  1 232 ? 106.806 55.202  105.071 1.00 34.58  ? 209 MET B SD  1 
ATOM   4352  C  CE  . MET B  1 232 ? 108.085 56.310  104.479 1.00 16.92  ? 209 MET B CE  1 
ATOM   4353  N  N   . ALA B  1 233 ? 108.912 51.928  101.468 1.00 26.04  ? 210 ALA B N   1 
ATOM   4354  C  CA  . ALA B  1 233 ? 109.505 52.077  100.138 1.00 26.20  ? 210 ALA B CA  1 
ATOM   4355  C  C   . ALA B  1 233 ? 108.425 52.028  99.051  1.00 32.30  ? 210 ALA B C   1 
ATOM   4356  O  O   . ALA B  1 233 ? 108.442 52.817  98.109  1.00 34.56  ? 210 ALA B O   1 
ATOM   4357  C  CB  . ALA B  1 233 ? 110.546 51.020  99.899  1.00 27.84  ? 210 ALA B CB  1 
ATOM   4358  N  N   . GLU B  1 234 ? 107.479 51.106  99.183  1.00 27.68  ? 211 GLU B N   1 
ATOM   4359  C  CA  . GLU B  1 234 ? 106.413 51.018  98.205  1.00 28.06  ? 211 GLU B CA  1 
ATOM   4360  C  C   . GLU B  1 234 ? 105.581 52.291  98.292  1.00 33.35  ? 211 GLU B C   1 
ATOM   4361  O  O   . GLU B  1 234 ? 105.180 52.852  97.271  1.00 25.79  ? 211 GLU B O   1 
ATOM   4362  C  CB  . GLU B  1 234 ? 105.536 49.790  98.451  1.00 37.71  ? 211 GLU B CB  1 
ATOM   4363  C  CG  . GLU B  1 234 ? 106.219 48.440  98.180  1.00 55.87  ? 211 GLU B CG  1 
ATOM   4364  C  CD  . GLU B  1 234 ? 105.409 47.236  98.695  1.00 68.50  ? 211 GLU B CD  1 
ATOM   4365  O  OE1 . GLU B  1 234 ? 104.701 47.363  99.721  1.00 59.78  ? 211 GLU B OE1 1 
ATOM   4366  O  OE2 . GLU B  1 234 ? 105.481 46.154  98.069  1.00 79.75  ? 211 GLU B OE2 1 
ATOM   4367  N  N   . ALA B  1 235 ? 105.328 52.740  99.520  1.00 26.07  ? 212 ALA B N   1 
ATOM   4368  C  CA  . ALA B  1 235 ? 104.532 53.936  99.747  1.00 25.59  ? 212 ALA B CA  1 
ATOM   4369  C  C   . ALA B  1 235 ? 105.197 55.161  99.112  1.00 27.81  ? 212 ALA B C   1 
ATOM   4370  O  O   . ALA B  1 235 ? 104.527 55.960  98.458  1.00 26.37  ? 212 ALA B O   1 
ATOM   4371  C  CB  . ALA B  1 235 ? 104.309 54.156  101.240 1.00 22.70  ? 212 ALA B CB  1 
ATOM   4372  N  N   . MET B  1 236 ? 106.510 55.306  99.301  1.00 29.04  ? 213 MET B N   1 
ATOM   4373  C  CA  . MET B  1 236 ? 107.242 56.404  98.664  1.00 36.29  ? 213 MET B CA  1 
ATOM   4374  C  C   . MET B  1 236 ? 107.071 56.403  97.147  1.00 35.60  ? 213 MET B C   1 
ATOM   4375  O  O   . MET B  1 236 ? 106.732 57.430  96.564  1.00 33.47  ? 213 MET B O   1 
ATOM   4376  C  CB  . MET B  1 236 ? 108.727 56.402  99.044  1.00 25.55  ? 213 MET B CB  1 
ATOM   4377  C  CG  . MET B  1 236 ? 108.967 56.785  100.497 1.00 32.58  ? 213 MET B CG  1 
ATOM   4378  S  SD  . MET B  1 236 ? 110.683 56.675  101.028 1.00 34.23  ? 213 MET B SD  1 
ATOM   4379  C  CE  . MET B  1 236 ? 111.394 58.032  100.089 1.00 32.85  ? 213 MET B CE  1 
ATOM   4380  N  N   . HIS B  1 237 ? 107.279 55.252  96.511  1.00 29.83  ? 214 HIS B N   1 
ATOM   4381  C  CA  . HIS B  1 237 ? 107.153 55.173  95.052  1.00 32.05  ? 214 HIS B CA  1 
ATOM   4382  C  C   . HIS B  1 237 ? 105.706 55.377  94.583  1.00 33.48  ? 214 HIS B C   1 
ATOM   4383  O  O   . HIS B  1 237 ? 105.444 56.178  93.691  1.00 32.15  ? 214 HIS B O   1 
ATOM   4384  C  CB  . HIS B  1 237 ? 107.694 53.846  94.516  1.00 31.10  ? 214 HIS B CB  1 
ATOM   4385  C  CG  . HIS B  1 237 ? 109.183 53.719  94.599  1.00 40.65  ? 214 HIS B CG  1 
ATOM   4386  N  ND1 . HIS B  1 237 ? 109.808 52.802  95.419  1.00 45.12  ? 214 HIS B ND1 1 
ATOM   4387  C  CD2 . HIS B  1 237 ? 110.172 54.391  93.963  1.00 44.66  ? 214 HIS B CD2 1 
ATOM   4388  C  CE1 . HIS B  1 237 ? 111.119 52.919  95.288  1.00 44.75  ? 214 HIS B CE1 1 
ATOM   4389  N  NE2 . HIS B  1 237 ? 111.366 53.876  94.410  1.00 43.57  ? 214 HIS B NE2 1 
ATOM   4390  N  N   . ARG B  1 238 ? 104.766 54.664  95.193  1.00 33.53  ? 215 ARG B N   1 
ATOM   4391  C  CA  . ARG B  1 238 ? 103.391 54.688  94.711  1.00 29.04  ? 215 ARG B CA  1 
ATOM   4392  C  C   . ARG B  1 238 ? 102.661 55.973  95.022  1.00 33.69  ? 215 ARG B C   1 
ATOM   4393  O  O   . ARG B  1 238 ? 101.856 56.424  94.218  1.00 36.78  ? 215 ARG B O   1 
ATOM   4394  C  CB  . ARG B  1 238 ? 102.603 53.516  95.259  1.00 29.08  ? 215 ARG B CB  1 
ATOM   4395  C  CG  . ARG B  1 238 ? 102.964 52.181  94.635  1.00 33.46  ? 215 ARG B CG  1 
ATOM   4396  C  CD  . ARG B  1 238 ? 102.315 51.088  95.437  1.00 46.03  ? 215 ARG B CD  1 
ATOM   4397  N  NE  . ARG B  1 238 ? 102.472 49.770  94.850  1.00 49.89  ? 215 ARG B NE  1 
ATOM   4398  C  CZ  . ARG B  1 238 ? 101.479 49.092  94.296  1.00 48.69  ? 215 ARG B CZ  1 
ATOM   4399  N  NH1 . ARG B  1 238 ? 100.260 49.618  94.245  1.00 37.01  ? 215 ARG B NH1 1 
ATOM   4400  N  NH2 . ARG B  1 238 ? 101.710 47.891  93.791  1.00 56.69  ? 215 ARG B NH2 1 
ATOM   4401  N  N   . THR B  1 239 ? 102.910 56.562  96.187  1.00 33.40  ? 216 THR B N   1 
ATOM   4402  C  CA  . THR B  1 239 ? 102.229 57.814  96.489  1.00 31.45  ? 216 THR B CA  1 
ATOM   4403  C  C   . THR B  1 239 ? 102.806 58.906  95.612  1.00 21.83  ? 216 THR B C   1 
ATOM   4404  O  O   . THR B  1 239 ? 102.088 59.789  95.168  1.00 29.13  ? 216 THR B O   1 
ATOM   4405  C  CB  . THR B  1 239 ? 102.223 58.219  98.011  1.00 33.97  ? 216 THR B CB  1 
ATOM   4406  O  OG1 . THR B  1 239 ? 103.556 58.372  98.495  1.00 22.03  ? 216 THR B OG1 1 
ATOM   4407  C  CG2 . THR B  1 239 ? 101.497 57.192  98.860  1.00 26.25  ? 216 THR B CG2 1 
ATOM   4408  N  N   . ARG B  1 240 ? 104.099 58.839  95.333  1.00 28.23  ? 217 ARG B N   1 
ATOM   4409  C  CA  . ARG B  1 240 ? 104.686 59.801  94.407  1.00 29.71  ? 217 ARG B CA  1 
ATOM   4410  C  C   . ARG B  1 240 ? 104.042 59.719  93.014  1.00 36.75  ? 217 ARG B C   1 
ATOM   4411  O  O   . ARG B  1 240 ? 103.834 60.738  92.359  1.00 32.52  ? 217 ARG B O   1 
ATOM   4412  C  CB  . ARG B  1 240 ? 106.186 59.593  94.295  1.00 30.78  ? 217 ARG B CB  1 
ATOM   4413  C  CG  . ARG B  1 240 ? 106.874 60.560  93.347  1.00 30.64  ? 217 ARG B CG  1 
ATOM   4414  C  CD  . ARG B  1 240 ? 108.345 60.181  93.130  1.00 28.41  ? 217 ARG B CD  1 
ATOM   4415  N  NE  . ARG B  1 240 ? 109.030 61.169  92.304  1.00 31.53  ? 217 ARG B NE  1 
ATOM   4416  C  CZ  . ARG B  1 240 ? 110.344 61.200  92.110  1.00 34.49  ? 217 ARG B CZ  1 
ATOM   4417  N  NH1 . ARG B  1 240 ? 111.123 60.291  92.689  1.00 29.99  ? 217 ARG B NH1 1 
ATOM   4418  N  NH2 . ARG B  1 240 ? 110.883 62.148  91.345  1.00 30.25  ? 217 ARG B NH2 1 
ATOM   4419  N  N   . GLN B  1 241 ? 103.721 58.507  92.570  1.00 35.65  ? 218 GLN B N   1 
ATOM   4420  C  CA  . GLN B  1 241 ? 103.115 58.312  91.253  1.00 36.23  ? 218 GLN B CA  1 
ATOM   4421  C  C   . GLN B  1 241 ? 101.755 58.991  91.096  1.00 35.95  ? 218 GLN B C   1 
ATOM   4422  O  O   . GLN B  1 241 ? 101.403 59.440  90.010  1.00 35.67  ? 218 GLN B O   1 
ATOM   4423  C  CB  . GLN B  1 241 ? 102.935 56.831  90.955  1.00 43.54  ? 218 GLN B CB  1 
ATOM   4424  C  CG  . GLN B  1 241 ? 104.184 56.096  90.540  1.00 56.94  ? 218 GLN B CG  1 
ATOM   4425  C  CD  . GLN B  1 241 ? 103.894 54.639  90.258  1.00 60.71  ? 218 GLN B CD  1 
ATOM   4426  O  OE1 . GLN B  1 241 ? 102.964 54.316  89.517  1.00 60.64  ? 218 GLN B OE1 1 
ATOM   4427  N  NE2 . GLN B  1 241 ? 104.671 53.747  90.868  1.00 59.72  ? 218 GLN B NE2 1 
ATOM   4428  N  N   . ILE B  1 242 ? 100.982 59.040  92.175  1.00 31.67  ? 219 ILE B N   1 
ATOM   4429  C  CA  . ILE B  1 242 ? 99.616  59.545  92.105  1.00 24.48  ? 219 ILE B CA  1 
ATOM   4430  C  C   . ILE B  1 242 ? 99.510  60.964  92.666  1.00 28.03  ? 219 ILE B C   1 
ATOM   4431  O  O   . ILE B  1 242 ? 98.413  61.488  92.841  1.00 32.03  ? 219 ILE B O   1 
ATOM   4432  C  CB  . ILE B  1 242 ? 98.635  58.613  92.858  1.00 27.55  ? 219 ILE B CB  1 
ATOM   4433  C  CG1 . ILE B  1 242 ? 99.011  58.531  94.337  1.00 28.90  ? 219 ILE B CG1 1 
ATOM   4434  C  CG2 . ILE B  1 242 ? 98.614  57.188  92.241  1.00 15.38  ? 219 ILE B CG2 1 
ATOM   4435  C  CD1 . ILE B  1 242 ? 98.047  57.699  95.167  1.00 33.50  ? 219 ILE B CD1 1 
ATOM   4436  N  N   . ASP B  1 243 ? 100.650 61.590  92.944  1.00 27.70  ? 220 ASP B N   1 
ATOM   4437  C  CA  . ASP B  1 243 ? 100.644 62.875  93.636  1.00 28.11  ? 220 ASP B CA  1 
ATOM   4438  C  C   . ASP B  1 243 ? 100.099 64.006  92.766  1.00 27.02  ? 220 ASP B C   1 
ATOM   4439  O  O   . ASP B  1 243 ? 99.671  65.038  93.280  1.00 31.80  ? 220 ASP B O   1 
ATOM   4440  C  CB  . ASP B  1 243 ? 102.038 63.231  94.179  1.00 29.94  ? 220 ASP B CB  1 
ATOM   4441  C  CG  . ASP B  1 243 ? 101.977 64.277  95.287  1.00 35.01  ? 220 ASP B CG  1 
ATOM   4442  O  OD1 . ASP B  1 243 ? 100.951 64.304  95.998  1.00 38.07  ? 220 ASP B OD1 1 
ATOM   4443  O  OD2 . ASP B  1 243 ? 102.934 65.077  95.437  1.00 36.36  ? 220 ASP B OD2 1 
ATOM   4444  N  N   . ASP B  1 244 ? 100.091 63.799  91.455  1.00 30.30  ? 221 ASP B N   1 
ATOM   4445  C  CA  . ASP B  1 244 ? 99.611  64.824  90.528  1.00 30.76  ? 221 ASP B CA  1 
ATOM   4446  C  C   . ASP B  1 244 ? 98.316  64.470  89.783  1.00 33.59  ? 221 ASP B C   1 
ATOM   4447  O  O   . ASP B  1 244 ? 97.957  65.136  88.809  1.00 35.93  ? 221 ASP B O   1 
ATOM   4448  C  CB  . ASP B  1 244 ? 100.710 65.172  89.529  1.00 32.48  ? 221 ASP B CB  1 
ATOM   4449  C  CG  . ASP B  1 244 ? 101.887 65.882  90.182  1.00 49.31  ? 221 ASP B CG  1 
ATOM   4450  O  OD1 . ASP B  1 244 ? 101.739 67.073  90.524  1.00 57.10  ? 221 ASP B OD1 1 
ATOM   4451  O  OD2 . ASP B  1 244 ? 102.957 65.256  90.349  1.00 51.71  ? 221 ASP B OD2 1 
ATOM   4452  N  N   . LEU B  1 245 ? 97.617  63.437  90.243  1.00 30.51  ? 222 LEU B N   1 
ATOM   4453  C  CA  . LEU B  1 245 ? 96.366  63.007  89.617  1.00 32.34  ? 222 LEU B CA  1 
ATOM   4454  C  C   . LEU B  1 245 ? 95.228  63.966  89.903  1.00 35.89  ? 222 LEU B C   1 
ATOM   4455  O  O   . LEU B  1 245 ? 94.269  64.049  89.148  1.00 38.66  ? 222 LEU B O   1 
ATOM   4456  C  CB  . LEU B  1 245 ? 95.958  61.631  90.136  1.00 36.41  ? 222 LEU B CB  1 
ATOM   4457  C  CG  . LEU B  1 245 ? 96.677  60.416  89.570  1.00 34.77  ? 222 LEU B CG  1 
ATOM   4458  C  CD1 . LEU B  1 245 ? 96.124  59.151  90.219  1.00 41.06  ? 222 LEU B CD1 1 
ATOM   4459  C  CD2 . LEU B  1 245 ? 96.483  60.373  88.075  1.00 36.20  ? 222 LEU B CD2 1 
ATOM   4460  N  N   . GLY B  1 246 ? 95.325  64.679  91.015  1.00 40.42  ? 223 GLY B N   1 
ATOM   4461  C  CA  . GLY B  1 246 ? 94.230  65.515  91.465  1.00 38.27  ? 223 GLY B CA  1 
ATOM   4462  C  C   . GLY B  1 246 ? 93.298  64.820  92.445  1.00 36.54  ? 223 GLY B C   1 
ATOM   4463  O  O   . GLY B  1 246 ? 92.109  65.116  92.463  1.00 38.43  ? 223 GLY B O   1 
ATOM   4464  N  N   . LEU B  1 247 ? 93.834  63.913  93.266  1.00 36.43  ? 224 LEU B N   1 
ATOM   4465  C  CA  . LEU B  1 247 ? 93.034  63.211  94.284  1.00 28.32  ? 224 LEU B CA  1 
ATOM   4466  C  C   . LEU B  1 247 ? 92.597  64.151  95.390  1.00 20.81  ? 224 LEU B C   1 
ATOM   4467  O  O   . LEU B  1 247 ? 93.292  65.104  95.700  1.00 24.52  ? 224 LEU B O   1 
ATOM   4468  C  CB  . LEU B  1 247 ? 93.824  62.053  94.887  1.00 22.75  ? 224 LEU B CB  1 
ATOM   4469  C  CG  . LEU B  1 247 ? 94.236  61.030  93.834  1.00 29.69  ? 224 LEU B CG  1 
ATOM   4470  C  CD1 . LEU B  1 247 ? 95.222  60.011  94.377  1.00 29.69  ? 224 LEU B CD1 1 
ATOM   4471  C  CD2 . LEU B  1 247 ? 92.993  60.347  93.267  1.00 32.29  ? 224 LEU B CD2 1 
ATOM   4472  N  N   . GLU B  1 248 ? 91.435  63.899  95.976  1.00 24.28  ? 225 GLU B N   1 
ATOM   4473  C  CA  . GLU B  1 248 ? 90.989  64.686  97.120  1.00 25.56  ? 225 GLU B CA  1 
ATOM   4474  C  C   . GLU B  1 248 ? 91.948  64.442  98.300  1.00 27.11  ? 225 GLU B C   1 
ATOM   4475  O  O   . GLU B  1 248 ? 92.387  65.367  98.976  1.00 24.12  ? 225 GLU B O   1 
ATOM   4476  C  CB  . GLU B  1 248 ? 89.547  64.322  97.501  1.00 23.57  ? 225 GLU B CB  1 
ATOM   4477  C  CG  . GLU B  1 248 ? 89.040  64.959  98.794  1.00 25.54  ? 225 GLU B CG  1 
ATOM   4478  C  CD  . GLU B  1 248 ? 88.614  66.420  98.629  1.00 38.84  ? 225 GLU B CD  1 
ATOM   4479  O  OE1 . GLU B  1 248 ? 88.562  66.908  97.473  1.00 38.31  ? 225 GLU B OE1 1 
ATOM   4480  O  OE2 . GLU B  1 248 ? 88.328  67.080  99.663  1.00 39.64  ? 225 GLU B OE2 1 
ATOM   4481  N  N   . TRP B  1 249 ? 92.276  63.186  98.540  1.00 26.08  ? 226 TRP B N   1 
ATOM   4482  C  CA  . TRP B  1 249 ? 93.314  62.881  99.506  1.00 28.24  ? 226 TRP B CA  1 
ATOM   4483  C  C   . TRP B  1 249 ? 93.894  61.489  99.280  1.00 30.17  ? 226 TRP B C   1 
ATOM   4484  O  O   . TRP B  1 249 ? 93.437  60.740  98.411  1.00 33.11  ? 226 TRP B O   1 
ATOM   4485  C  CB  . TRP B  1 249 ? 92.798  63.038  100.937 1.00 26.01  ? 226 TRP B CB  1 
ATOM   4486  C  CG  . TRP B  1 249 ? 91.838  61.986  101.403 1.00 30.31  ? 226 TRP B CG  1 
ATOM   4487  C  CD1 . TRP B  1 249 ? 92.048  60.639  101.441 1.00 32.76  ? 226 TRP B CD1 1 
ATOM   4488  C  CD2 . TRP B  1 249 ? 90.535  62.203  101.957 1.00 26.02  ? 226 TRP B CD2 1 
ATOM   4489  N  NE1 . TRP B  1 249 ? 90.948  60.001  101.961 1.00 29.75  ? 226 TRP B NE1 1 
ATOM   4490  C  CE2 . TRP B  1 249 ? 90.011  60.941  102.298 1.00 31.13  ? 226 TRP B CE2 1 
ATOM   4491  C  CE3 . TRP B  1 249 ? 89.762  63.341  102.197 1.00 24.14  ? 226 TRP B CE3 1 
ATOM   4492  C  CZ2 . TRP B  1 249 ? 88.743  60.785  102.859 1.00 29.74  ? 226 TRP B CZ2 1 
ATOM   4493  C  CZ3 . TRP B  1 249 ? 88.510  63.186  102.774 1.00 25.60  ? 226 TRP B CZ3 1 
ATOM   4494  C  CH2 . TRP B  1 249 ? 88.012  61.916  103.090 1.00 23.39  ? 226 TRP B CH2 1 
ATOM   4495  N  N   . ILE B  1 250 ? 94.920  61.160  100.049 1.00 25.94  ? 227 ILE B N   1 
ATOM   4496  C  CA  . ILE B  1 250 ? 95.522  59.837  100.001 1.00 27.47  ? 227 ILE B CA  1 
ATOM   4497  C  C   . ILE B  1 250 ? 95.534  59.263  101.413 1.00 30.19  ? 227 ILE B C   1 
ATOM   4498  O  O   . ILE B  1 250 ? 96.086  59.860  102.341 1.00 31.54  ? 227 ILE B O   1 
ATOM   4499  C  CB  . ILE B  1 250 ? 96.920  59.897  99.403  1.00 23.79  ? 227 ILE B CB  1 
ATOM   4500  C  CG1 . ILE B  1 250 ? 96.828  60.262  97.921  1.00 24.72  ? 227 ILE B CG1 1 
ATOM   4501  C  CG2 . ILE B  1 250 ? 97.635  58.575  99.580  1.00 22.76  ? 227 ILE B CG2 1 
ATOM   4502  C  CD1 . ILE B  1 250 ? 98.165  60.402  97.259  1.00 23.02  ? 227 ILE B CD1 1 
ATOM   4503  N  N   . GLU B  1 251 ? 94.895  58.113  101.576 1.00 26.51  ? 228 GLU B N   1 
ATOM   4504  C  CA  . GLU B  1 251 ? 94.566  57.618  102.901 1.00 22.70  ? 228 GLU B CA  1 
ATOM   4505  C  C   . GLU B  1 251 ? 95.427  56.421  103.288 1.00 30.00  ? 228 GLU B C   1 
ATOM   4506  O  O   . GLU B  1 251 ? 95.675  55.533  102.471 1.00 20.81  ? 228 GLU B O   1 
ATOM   4507  C  CB  . GLU B  1 251 ? 93.087  57.251  102.933 1.00 34.25  ? 228 GLU B CB  1 
ATOM   4508  C  CG  . GLU B  1 251 ? 92.550  56.869  104.288 1.00 41.83  ? 228 GLU B CG  1 
ATOM   4509  C  CD  . GLU B  1 251 ? 91.041  56.743  104.280 1.00 48.14  ? 228 GLU B CD  1 
ATOM   4510  O  OE1 . GLU B  1 251 ? 90.391  57.469  103.492 1.00 51.84  ? 228 GLU B OE1 1 
ATOM   4511  O  OE2 . GLU B  1 251 ? 90.504  55.917  105.052 1.00 46.84  ? 228 GLU B OE2 1 
ATOM   4512  N  N   . GLU B  1 252 ? 95.906  56.431  104.530 1.00 36.40  ? 229 GLU B N   1 
ATOM   4513  C  CA  . GLU B  1 252 ? 96.639  55.308  105.138 1.00 40.43  ? 229 GLU B CA  1 
ATOM   4514  C  C   . GLU B  1 252 ? 97.459  54.413  104.195 1.00 41.66  ? 229 GLU B C   1 
ATOM   4515  O  O   . GLU B  1 252 ? 97.108  53.255  103.962 1.00 37.22  ? 229 GLU B O   1 
ATOM   4516  C  CB  . GLU B  1 252 ? 95.683  54.441  105.965 1.00 34.82  ? 229 GLU B CB  1 
ATOM   4517  C  CG  . GLU B  1 252 ? 95.243  55.073  107.271 1.00 43.55  ? 229 GLU B CG  1 
ATOM   4518  C  CD  . GLU B  1 252 ? 94.585  54.069  108.211 1.00 60.67  ? 229 GLU B CD  1 
ATOM   4519  O  OE1 . GLU B  1 252 ? 93.909  53.127  107.729 1.00 64.31  ? 229 GLU B OE1 1 
ATOM   4520  O  OE2 . GLU B  1 252 ? 94.755  54.220  109.438 1.00 62.97  ? 229 GLU B OE2 1 
ATOM   4521  N  N   . PRO B  1 253 ? 98.562  54.945  103.662 1.00 37.55  ? 230 PRO B N   1 
ATOM   4522  C  CA  . PRO B  1 253 ? 99.450  54.135  102.824 1.00 37.01  ? 230 PRO B CA  1 
ATOM   4523  C  C   . PRO B  1 253 ? 100.218 53.033  103.570 1.00 32.57  ? 230 PRO B C   1 
ATOM   4524  O  O   . PRO B  1 253 ? 100.397 51.948  103.012 1.00 28.19  ? 230 PRO B O   1 
ATOM   4525  C  CB  . PRO B  1 253 ? 100.422 55.170  102.242 1.00 33.49  ? 230 PRO B CB  1 
ATOM   4526  C  CG  . PRO B  1 253 ? 100.293 56.371  103.118 1.00 33.02  ? 230 PRO B CG  1 
ATOM   4527  C  CD  . PRO B  1 253 ? 98.891  56.377  103.597 1.00 33.41  ? 230 PRO B CD  1 
ATOM   4528  N  N   . VAL B  1 254 ? 100.679 53.301  104.788 1.00 30.34  ? 231 VAL B N   1 
ATOM   4529  C  CA  . VAL B  1 254 ? 101.463 52.306  105.533 1.00 26.96  ? 231 VAL B CA  1 
ATOM   4530  C  C   . VAL B  1 254 ? 100.765 51.923  106.840 1.00 29.70  ? 231 VAL B C   1 
ATOM   4531  O  O   . VAL B  1 254 ? 99.718  52.478  107.163 1.00 25.30  ? 231 VAL B O   1 
ATOM   4532  C  CB  . VAL B  1 254 ? 102.894 52.804  105.811 1.00 27.25  ? 231 VAL B CB  1 
ATOM   4533  C  CG1 . VAL B  1 254 ? 103.620 53.112  104.498 1.00 21.99  ? 231 VAL B CG1 1 
ATOM   4534  C  CG2 . VAL B  1 254 ? 102.865 54.040  106.704 1.00 28.99  ? 231 VAL B CG2 1 
ATOM   4535  N  N   . VAL B  1 255 ? 101.332 50.977  107.586 1.00 29.42  ? 232 VAL B N   1 
ATOM   4536  C  CA  . VAL B  1 255 ? 100.728 50.558  108.848 1.00 26.26  ? 232 VAL B CA  1 
ATOM   4537  C  C   . VAL B  1 255 ? 100.469 51.760  109.763 1.00 27.62  ? 232 VAL B C   1 
ATOM   4538  O  O   . VAL B  1 255 ? 101.255 52.690  109.810 1.00 22.86  ? 232 VAL B O   1 
ATOM   4539  C  CB  . VAL B  1 255 ? 101.562 49.484  109.572 1.00 29.33  ? 232 VAL B CB  1 
ATOM   4540  C  CG1 . VAL B  1 255 ? 102.884 50.041  109.998 1.00 22.60  ? 232 VAL B CG1 1 
ATOM   4541  C  CG2 . VAL B  1 255 ? 100.801 48.966  110.783 1.00 34.69  ? 232 VAL B CG2 1 
ATOM   4542  N  N   . TYR B  1 256 ? 99.365  51.716  110.503 1.00 30.68  ? 233 TYR B N   1 
ATOM   4543  C  CA  . TYR B  1 256 ? 98.772  52.924  111.067 1.00 28.34  ? 233 TYR B CA  1 
ATOM   4544  C  C   . TYR B  1 256 ? 99.532  53.610  112.177 1.00 31.73  ? 233 TYR B C   1 
ATOM   4545  O  O   . TYR B  1 256 ? 99.222  54.752  112.508 1.00 29.80  ? 233 TYR B O   1 
ATOM   4546  C  CB  . TYR B  1 256 ? 97.332  52.679  111.522 1.00 30.08  ? 233 TYR B CB  1 
ATOM   4547  C  CG  . TYR B  1 256 ? 97.158  51.869  112.801 1.00 35.52  ? 233 TYR B CG  1 
ATOM   4548  C  CD1 . TYR B  1 256 ? 97.575  52.365  114.034 1.00 35.32  ? 233 TYR B CD1 1 
ATOM   4549  C  CD2 . TYR B  1 256 ? 96.530  50.619  112.776 1.00 37.34  ? 233 TYR B CD2 1 
ATOM   4550  C  CE1 . TYR B  1 256 ? 97.394  51.631  115.203 1.00 38.09  ? 233 TYR B CE1 1 
ATOM   4551  C  CE2 . TYR B  1 256 ? 96.340  49.877  113.941 1.00 36.33  ? 233 TYR B CE2 1 
ATOM   4552  C  CZ  . TYR B  1 256 ? 96.772  50.388  115.154 1.00 39.20  ? 233 TYR B CZ  1 
ATOM   4553  O  OH  . TYR B  1 256 ? 96.581  49.663  116.319 1.00 39.75  ? 233 TYR B OH  1 
ATOM   4554  N  N   . ASP B  1 257 ? 100.512 52.927  112.760 1.00 31.67  ? 234 ASP B N   1 
ATOM   4555  C  CA  . ASP B  1 257 ? 101.214 53.489  113.908 1.00 27.36  ? 234 ASP B CA  1 
ATOM   4556  C  C   . ASP B  1 257 ? 102.645 53.924  113.567 1.00 32.16  ? 234 ASP B C   1 
ATOM   4557  O  O   . ASP B  1 257 ? 103.416 54.302  114.445 1.00 32.35  ? 234 ASP B O   1 
ATOM   4558  C  CB  . ASP B  1 257 ? 101.178 52.518  115.105 1.00 24.85  ? 234 ASP B CB  1 
ATOM   4559  C  CG  . ASP B  1 257 ? 101.945 51.239  114.845 1.00 41.29  ? 234 ASP B CG  1 
ATOM   4560  O  OD1 . ASP B  1 257 ? 102.409 51.033  113.704 1.00 41.54  ? 234 ASP B OD1 1 
ATOM   4561  O  OD2 . ASP B  1 257 ? 102.082 50.428  115.784 1.00 54.56  ? 234 ASP B OD2 1 
ATOM   4562  N  N   . ASN B  1 258 ? 102.983 53.865  112.280 1.00 32.11  ? 235 ASN B N   1 
ATOM   4563  C  CA  . ASN B  1 258 ? 104.277 54.321  111.791 1.00 33.39  ? 235 ASN B CA  1 
ATOM   4564  C  C   . ASN B  1 258 ? 104.274 55.842  111.580 1.00 35.61  ? 235 ASN B C   1 
ATOM   4565  O  O   . ASN B  1 258 ? 104.280 56.320  110.443 1.00 32.54  ? 235 ASN B O   1 
ATOM   4566  C  CB  . ASN B  1 258 ? 104.640 53.586  110.486 1.00 29.17  ? 235 ASN B CB  1 
ATOM   4567  C  CG  . ASN B  1 258 ? 106.030 53.975  109.941 1.00 32.67  ? 235 ASN B CG  1 
ATOM   4568  O  OD1 . ASN B  1 258 ? 106.784 54.724  110.577 1.00 26.86  ? 235 ASN B OD1 1 
ATOM   4569  N  ND2 . ASN B  1 258 ? 106.369 53.450  108.765 1.00 26.78  ? 235 ASN B ND2 1 
ATOM   4570  N  N   . PHE B  1 259 ? 104.252 56.593  112.680 1.00 32.59  ? 236 PHE B N   1 
ATOM   4571  C  CA  . PHE B  1 259 ? 104.236 58.059  112.622 1.00 29.64  ? 236 PHE B CA  1 
ATOM   4572  C  C   . PHE B  1 259 ? 105.475 58.662  111.957 1.00 31.46  ? 236 PHE B C   1 
ATOM   4573  O  O   . PHE B  1 259 ? 105.375 59.668  111.261 1.00 32.75  ? 236 PHE B O   1 
ATOM   4574  C  CB  . PHE B  1 259 ? 104.054 58.659  114.022 1.00 28.10  ? 236 PHE B CB  1 
ATOM   4575  C  CG  . PHE B  1 259 ? 102.682 58.456  114.596 1.00 31.90  ? 236 PHE B CG  1 
ATOM   4576  C  CD1 . PHE B  1 259 ? 101.700 57.805  113.866 1.00 26.17  ? 236 PHE B CD1 1 
ATOM   4577  C  CD2 . PHE B  1 259 ? 102.367 58.931  115.860 1.00 41.09  ? 236 PHE B CD2 1 
ATOM   4578  C  CE1 . PHE B  1 259 ? 100.433 57.613  114.389 1.00 34.64  ? 236 PHE B CE1 1 
ATOM   4579  C  CE2 . PHE B  1 259 ? 101.102 58.747  116.389 1.00 41.21  ? 236 PHE B CE2 1 
ATOM   4580  C  CZ  . PHE B  1 259 ? 100.131 58.080  115.650 1.00 37.52  ? 236 PHE B CZ  1 
ATOM   4581  N  N   . ASP B  1 260 ? 106.642 58.061  112.175 1.00 27.64  ? 237 ASP B N   1 
ATOM   4582  C  CA  . ASP B  1 260 ? 107.863 58.548  111.524 1.00 32.11  ? 237 ASP B CA  1 
ATOM   4583  C  C   . ASP B  1 260 ? 107.722 58.517  110.006 1.00 29.27  ? 237 ASP B C   1 
ATOM   4584  O  O   . ASP B  1 260 ? 108.199 59.408  109.313 1.00 24.90  ? 237 ASP B O   1 
ATOM   4585  C  CB  . ASP B  1 260 ? 109.080 57.717  111.938 1.00 33.55  ? 237 ASP B CB  1 
ATOM   4586  C  CG  . ASP B  1 260 ? 109.384 57.828  113.429 1.00 41.08  ? 237 ASP B CG  1 
ATOM   4587  O  OD1 . ASP B  1 260 ? 109.462 58.969  113.933 1.00 36.94  ? 237 ASP B OD1 1 
ATOM   4588  O  OD2 . ASP B  1 260 ? 109.531 56.778  114.097 1.00 38.11  ? 237 ASP B OD2 1 
ATOM   4589  N  N   . GLY B  1 261 ? 107.060 57.485  109.497 1.00 26.57  ? 238 GLY B N   1 
ATOM   4590  C  CA  . GLY B  1 261 ? 106.905 57.327  108.065 1.00 24.19  ? 238 GLY B CA  1 
ATOM   4591  C  C   . GLY B  1 261 ? 105.862 58.269  107.520 1.00 29.29  ? 238 GLY B C   1 
ATOM   4592  O  O   . GLY B  1 261 ? 106.068 58.905  106.485 1.00 32.80  ? 238 GLY B O   1 
ATOM   4593  N  N   . TYR B  1 262 ? 104.730 58.360  108.210 1.00 26.24  ? 239 TYR B N   1 
ATOM   4594  C  CA  . TYR B  1 262 ? 103.687 59.279  107.786 1.00 24.79  ? 239 TYR B CA  1 
ATOM   4595  C  C   . TYR B  1 262 ? 104.214 60.702  107.701 1.00 26.15  ? 239 TYR B C   1 
ATOM   4596  O  O   . TYR B  1 262 ? 103.821 61.453  106.819 1.00 32.63  ? 239 TYR B O   1 
ATOM   4597  C  CB  . TYR B  1 262 ? 102.485 59.215  108.715 1.00 26.78  ? 239 TYR B CB  1 
ATOM   4598  C  CG  . TYR B  1 262 ? 101.541 58.082  108.393 1.00 29.12  ? 239 TYR B CG  1 
ATOM   4599  C  CD1 . TYR B  1 262 ? 101.150 57.842  107.094 1.00 28.70  ? 239 TYR B CD1 1 
ATOM   4600  C  CD2 . TYR B  1 262 ? 101.047 57.252  109.387 1.00 31.94  ? 239 TYR B CD2 1 
ATOM   4601  C  CE1 . TYR B  1 262 ? 100.290 56.802  106.782 1.00 28.72  ? 239 TYR B CE1 1 
ATOM   4602  C  CE2 . TYR B  1 262 ? 100.184 56.213  109.085 1.00 39.15  ? 239 TYR B CE2 1 
ATOM   4603  C  CZ  . TYR B  1 262 ? 99.816  55.994  107.773 1.00 35.35  ? 239 TYR B CZ  1 
ATOM   4604  O  OH  . TYR B  1 262 ? 98.955  54.974  107.443 1.00 40.03  ? 239 TYR B OH  1 
ATOM   4605  N  N   . ALA B  1 263 ? 105.107 61.079  108.612 1.00 23.49  ? 240 ALA B N   1 
ATOM   4606  C  CA  . ALA B  1 263 ? 105.641 62.435  108.607 1.00 24.94  ? 240 ALA B CA  1 
ATOM   4607  C  C   . ALA B  1 263 ? 106.434 62.679  107.323 1.00 25.24  ? 240 ALA B C   1 
ATOM   4608  O  O   . ALA B  1 263 ? 106.294 63.711  106.688 1.00 31.87  ? 240 ALA B O   1 
ATOM   4609  C  CB  . ALA B  1 263 ? 106.499 62.709  109.866 1.00 15.50  ? 240 ALA B CB  1 
ATOM   4610  N  N   . GLN B  1 264 ? 107.249 61.708  106.939 1.00 19.20  ? 241 GLN B N   1 
ATOM   4611  C  CA  . GLN B  1 264 ? 107.995 61.773  105.684 1.00 24.30  ? 241 GLN B CA  1 
ATOM   4612  C  C   . GLN B  1 264 ? 107.096 61.869  104.456 1.00 25.18  ? 241 GLN B C   1 
ATOM   4613  O  O   . GLN B  1 264 ? 107.338 62.680  103.581 1.00 29.05  ? 241 GLN B O   1 
ATOM   4614  C  CB  . GLN B  1 264 ? 108.898 60.544  105.540 1.00 24.89  ? 241 GLN B CB  1 
ATOM   4615  C  CG  . GLN B  1 264 ? 110.059 60.535  106.486 1.00 39.29  ? 241 GLN B CG  1 
ATOM   4616  C  CD  . GLN B  1 264 ? 110.932 61.754  106.280 1.00 59.96  ? 241 GLN B CD  1 
ATOM   4617  O  OE1 . GLN B  1 264 ? 111.282 62.089  105.144 1.00 67.96  ? 241 GLN B OE1 1 
ATOM   4618  N  NE2 . GLN B  1 264 ? 111.263 62.445  107.373 1.00 58.44  ? 241 GLN B NE2 1 
ATOM   4619  N  N   . LEU B  1 265 ? 106.075 61.020  104.384 1.00 18.96  ? 242 LEU B N   1 
ATOM   4620  C  CA  . LEU B  1 265 ? 105.191 60.986  103.220 1.00 24.40  ? 242 LEU B CA  1 
ATOM   4621  C  C   . LEU B  1 265 ? 104.433 62.300  103.106 1.00 24.33  ? 242 LEU B C   1 
ATOM   4622  O  O   . LEU B  1 265 ? 104.264 62.850  102.027 1.00 28.50  ? 242 LEU B O   1 
ATOM   4623  C  CB  . LEU B  1 265 ? 104.192 59.825  103.327 1.00 26.33  ? 242 LEU B CB  1 
ATOM   4624  C  CG  . LEU B  1 265 ? 104.758 58.409  103.243 1.00 27.71  ? 242 LEU B CG  1 
ATOM   4625  C  CD1 . LEU B  1 265 ? 103.702 57.404  103.612 1.00 21.30  ? 242 LEU B CD1 1 
ATOM   4626  C  CD2 . LEU B  1 265 ? 105.334 58.113  101.849 1.00 23.86  ? 242 LEU B CD2 1 
ATOM   4627  N  N   . ARG B  1 266 ? 103.983 62.796  104.247 1.00 24.19  ? 243 ARG B N   1 
ATOM   4628  C  CA  . ARG B  1 266 ? 103.264 64.053  104.313 1.00 30.10  ? 243 ARG B CA  1 
ATOM   4629  C  C   . ARG B  1 266 ? 104.110 65.198  103.733 1.00 29.82  ? 243 ARG B C   1 
ATOM   4630  O  O   . ARG B  1 266 ? 103.607 66.056  103.005 1.00 25.22  ? 243 ARG B O   1 
ATOM   4631  C  CB  . ARG B  1 266 ? 102.909 64.326  105.771 1.00 30.31  ? 243 ARG B CB  1 
ATOM   4632  C  CG  . ARG B  1 266 ? 101.906 65.423  106.000 1.00 28.75  ? 243 ARG B CG  1 
ATOM   4633  C  CD  . ARG B  1 266 ? 102.512 66.412  106.941 1.00 34.73  ? 243 ARG B CD  1 
ATOM   4634  N  NE  . ARG B  1 266 ? 101.508 67.225  107.579 1.00 41.20  ? 243 ARG B NE  1 
ATOM   4635  C  CZ  . ARG B  1 266 ? 101.775 68.116  108.520 1.00 46.81  ? 243 ARG B CZ  1 
ATOM   4636  N  NH1 . ARG B  1 266 ? 103.028 68.304  108.909 1.00 47.07  ? 243 ARG B NH1 1 
ATOM   4637  N  NH2 . ARG B  1 266 ? 100.788 68.815  109.065 1.00 48.11  ? 243 ARG B NH2 1 
ATOM   4638  N  N   . HIS B  1 267 ? 105.400 65.203  104.053 1.00 27.15  ? 244 HIS B N   1 
ATOM   4639  C  CA  . HIS B  1 267 ? 106.284 66.263  103.585 1.00 29.02  ? 244 HIS B CA  1 
ATOM   4640  C  C   . HIS B  1 267 ? 106.551 66.134  102.083 1.00 27.95  ? 244 HIS B C   1 
ATOM   4641  O  O   . HIS B  1 267 ? 106.578 67.122  101.363 1.00 27.23  ? 244 HIS B O   1 
ATOM   4642  C  CB  . HIS B  1 267 ? 107.594 66.277  104.375 1.00 22.72  ? 244 HIS B CB  1 
ATOM   4643  C  CG  . HIS B  1 267 ? 108.689 67.031  103.694 1.00 38.17  ? 244 HIS B CG  1 
ATOM   4644  N  ND1 . HIS B  1 267 ? 109.372 66.531  102.605 1.00 45.26  ? 244 HIS B ND1 1 
ATOM   4645  C  CD2 . HIS B  1 267 ? 109.208 68.259  103.930 1.00 51.10  ? 244 HIS B CD2 1 
ATOM   4646  C  CE1 . HIS B  1 267 ? 110.269 67.412  102.202 1.00 49.60  ? 244 HIS B CE1 1 
ATOM   4647  N  NE2 . HIS B  1 267 ? 110.190 68.471  102.988 1.00 58.16  ? 244 HIS B NE2 1 
ATOM   4648  N  N   . ASP B  1 268 ? 106.734 64.907  101.616 1.00 22.20  ? 245 ASP B N   1 
ATOM   4649  C  CA  . ASP B  1 268 ? 107.018 64.668  100.216 1.00 20.00  ? 245 ASP B CA  1 
ATOM   4650  C  C   . ASP B  1 268 ? 105.795 64.888  99.326  1.00 24.56  ? 245 ASP B C   1 
ATOM   4651  O  O   . ASP B  1 268 ? 105.925 65.325  98.188  1.00 28.46  ? 245 ASP B O   1 
ATOM   4652  C  CB  . ASP B  1 268 ? 107.608 63.264  100.020 1.00 29.42  ? 245 ASP B CB  1 
ATOM   4653  C  CG  . ASP B  1 268 ? 109.097 63.199  100.385 1.00 44.68  ? 245 ASP B CG  1 
ATOM   4654  O  OD1 . ASP B  1 268 ? 109.749 64.271  100.411 1.00 50.56  ? 245 ASP B OD1 1 
ATOM   4655  O  OD2 . ASP B  1 268 ? 109.617 62.088  100.640 1.00 44.26  ? 245 ASP B OD2 1 
ATOM   4656  N  N   . LEU B  1 269 ? 104.610 64.602  99.855  1.00 22.87  ? 246 LEU B N   1 
ATOM   4657  C  CA  . LEU B  1 269 ? 103.377 64.698  99.073  1.00 21.58  ? 246 LEU B CA  1 
ATOM   4658  C  C   . LEU B  1 269 ? 102.774 66.098  99.098  1.00 28.33  ? 246 LEU B C   1 
ATOM   4659  O  O   . LEU B  1 269 ? 102.737 66.754  100.145 1.00 25.44  ? 246 LEU B O   1 
ATOM   4660  C  CB  . LEU B  1 269 ? 102.340 63.715  99.604  1.00 21.72  ? 246 LEU B CB  1 
ATOM   4661  C  CG  . LEU B  1 269 ? 102.578 62.237  99.310  1.00 29.74  ? 246 LEU B CG  1 
ATOM   4662  C  CD1 . LEU B  1 269 ? 101.620 61.413  100.154 1.00 26.59  ? 246 LEU B CD1 1 
ATOM   4663  C  CD2 . LEU B  1 269 ? 102.399 61.937  97.821  1.00 22.00  ? 246 LEU B CD2 1 
ATOM   4664  N  N   . LYS B  1 270 ? 102.308 66.551  97.939  1.00 22.82  ? 247 LYS B N   1 
ATOM   4665  C  CA  . LYS B  1 270 ? 101.569 67.800  97.855  1.00 30.92  ? 247 LYS B CA  1 
ATOM   4666  C  C   . LYS B  1 270 ? 100.072 67.561  98.136  1.00 34.47  ? 247 LYS B C   1 
ATOM   4667  O  O   . LYS B  1 270 ? 99.389  68.407  98.722  1.00 31.73  ? 247 LYS B O   1 
ATOM   4668  C  CB  . LYS B  1 270 ? 101.773 68.430  96.482  1.00 37.97  ? 247 LYS B CB  1 
ATOM   4669  C  CG  . LYS B  1 270 ? 102.394 69.812  96.507  1.00 51.31  ? 247 LYS B CG  1 
ATOM   4670  C  CD  . LYS B  1 270 ? 103.841 69.783  96.959  1.00 63.33  ? 247 LYS B CD  1 
ATOM   4671  C  CE  . LYS B  1 270 ? 104.373 71.202  97.127  1.00 70.44  ? 247 LYS B CE  1 
ATOM   4672  N  NZ  . LYS B  1 270 ? 103.965 72.088  95.989  1.00 73.63  ? 247 LYS B NZ  1 
ATOM   4673  N  N   . THR B  1 271 ? 99.578  66.397  97.714  1.00 34.30  ? 248 THR B N   1 
ATOM   4674  C  CA  . THR B  1 271 ? 98.204  65.967  97.971  1.00 23.43  ? 248 THR B CA  1 
ATOM   4675  C  C   . THR B  1 271 ? 98.035  65.691  99.463  1.00 29.63  ? 248 THR B C   1 
ATOM   4676  O  O   . THR B  1 271 ? 98.929  65.141  100.085 1.00 26.41  ? 248 THR B O   1 
ATOM   4677  C  CB  . THR B  1 271 ? 97.889  64.684  97.173  1.00 22.05  ? 248 THR B CB  1 
ATOM   4678  O  OG1 . THR B  1 271 ? 97.959  64.961  95.773  1.00 25.81  ? 248 THR B OG1 1 
ATOM   4679  C  CG2 . THR B  1 271 ? 96.526  64.180  97.490  1.00 20.33  ? 248 THR B CG2 1 
ATOM   4680  N  N   . PRO B  1 272 ? 96.895  66.088  100.051 1.00 29.33  ? 249 PRO B N   1 
ATOM   4681  C  CA  . PRO B  1 272 ? 96.706  65.913  101.498 1.00 30.04  ? 249 PRO B CA  1 
ATOM   4682  C  C   . PRO B  1 272 ? 96.792  64.447  101.905 1.00 28.20  ? 249 PRO B C   1 
ATOM   4683  O  O   . PRO B  1 272 ? 96.275  63.592  101.194 1.00 23.85  ? 249 PRO B O   1 
ATOM   4684  C  CB  . PRO B  1 272 ? 95.281  66.427  101.733 1.00 31.52  ? 249 PRO B CB  1 
ATOM   4685  C  CG  . PRO B  1 272 ? 94.978  67.281  100.575 1.00 27.41  ? 249 PRO B CG  1 
ATOM   4686  C  CD  . PRO B  1 272 ? 95.728  66.717  99.414  1.00 22.25  ? 249 PRO B CD  1 
ATOM   4687  N  N   . LEU B  1 273 ? 97.437  64.175  103.036 1.00 31.60  ? 250 LEU B N   1 
ATOM   4688  C  CA  . LEU B  1 273 ? 97.583  62.822  103.564 1.00 19.43  ? 250 LEU B CA  1 
ATOM   4689  C  C   . LEU B  1 273 ? 96.570  62.629  104.667 1.00 23.16  ? 250 LEU B C   1 
ATOM   4690  O  O   . LEU B  1 273 ? 96.521  63.407  105.616 1.00 27.52  ? 250 LEU B O   1 
ATOM   4691  C  CB  . LEU B  1 273 ? 98.991  62.630  104.124 1.00 23.53  ? 250 LEU B CB  1 
ATOM   4692  C  CG  . LEU B  1 273 ? 99.417  61.257  104.652 1.00 29.36  ? 250 LEU B CG  1 
ATOM   4693  C  CD1 . LEU B  1 273 ? 99.238  60.162  103.601 1.00 24.74  ? 250 LEU B CD1 1 
ATOM   4694  C  CD2 . LEU B  1 273 ? 100.865 61.318  105.089 1.00 24.23  ? 250 LEU B CD2 1 
ATOM   4695  N  N   . MET B  1 274 ? 95.753  61.591  104.542 1.00 29.65  ? 251 MET B N   1 
ATOM   4696  C  CA  . MET B  1 274 ? 94.680  61.358  105.491 1.00 23.50  ? 251 MET B CA  1 
ATOM   4697  C  C   . MET B  1 274 ? 94.981  60.134  106.354 1.00 28.81  ? 251 MET B C   1 
ATOM   4698  O  O   . MET B  1 274 ? 95.310  59.079  105.816 1.00 22.60  ? 251 MET B O   1 
ATOM   4699  C  CB  . MET B  1 274 ? 93.362  61.161  104.732 1.00 31.94  ? 251 MET B CB  1 
ATOM   4700  C  CG  . MET B  1 274 ? 92.205  60.601  105.567 1.00 32.97  ? 251 MET B CG  1 
ATOM   4701  S  SD  . MET B  1 274 ? 91.527  61.784  106.772 1.00 27.64  ? 251 MET B SD  1 
ATOM   4702  C  CE  . MET B  1 274 ? 90.277  62.620  105.790 1.00 14.25  ? 251 MET B CE  1 
ATOM   4703  N  N   . ILE B  1 275 ? 94.879  60.286  107.682 1.00 21.95  ? 252 ILE B N   1 
ATOM   4704  C  CA  . ILE B  1 275 ? 94.865  59.141  108.606 1.00 23.73  ? 252 ILE B CA  1 
ATOM   4705  C  C   . ILE B  1 275 ? 93.838  59.355  109.712 1.00 27.08  ? 252 ILE B C   1 
ATOM   4706  O  O   . ILE B  1 275 ? 93.017  60.264  109.642 1.00 25.32  ? 252 ILE B O   1 
ATOM   4707  C  CB  . ILE B  1 275 ? 96.225  58.883  109.285 1.00 16.95  ? 252 ILE B CB  1 
ATOM   4708  C  CG1 . ILE B  1 275 ? 96.571  60.019  110.246 1.00 18.38  ? 252 ILE B CG1 1 
ATOM   4709  C  CG2 . ILE B  1 275 ? 97.343  58.694  108.254 1.00 17.03  ? 252 ILE B CG2 1 
ATOM   4710  C  CD1 . ILE B  1 275 ? 97.844  59.744  111.058 1.00 20.93  ? 252 ILE B CD1 1 
ATOM   4711  N  N   . GLY B  1 276 ? 93.884  58.514  110.736 1.00 28.72  ? 253 GLY B N   1 
ATOM   4712  C  CA  . GLY B  1 276 ? 93.067  58.741  111.917 1.00 23.82  ? 253 GLY B CA  1 
ATOM   4713  C  C   . GLY B  1 276 ? 92.040  57.669  112.245 1.00 29.09  ? 253 GLY B C   1 
ATOM   4714  O  O   . GLY B  1 276 ? 91.621  57.548  113.395 1.00 31.98  ? 253 GLY B O   1 
ATOM   4715  N  N   . GLU B  1 277 ? 91.628  56.878  111.262 1.00 25.96  ? 254 GLU B N   1 
ATOM   4716  C  CA  . GLU B  1 277 ? 90.605  55.875  111.546 1.00 31.72  ? 254 GLU B CA  1 
ATOM   4717  C  C   . GLU B  1 277 ? 91.099  54.885  112.592 1.00 34.15  ? 254 GLU B C   1 
ATOM   4718  O  O   . GLU B  1 277 ? 90.300  54.236  113.268 1.00 29.52  ? 254 GLU B O   1 
ATOM   4719  C  CB  . GLU B  1 277 ? 90.139  55.154  110.278 1.00 31.47  ? 254 GLU B CB  1 
ATOM   4720  C  CG  . GLU B  1 277 ? 91.118  54.152  109.708 1.00 37.33  ? 254 GLU B CG  1 
ATOM   4721  C  CD  . GLU B  1 277 ? 90.582  53.499  108.442 1.00 38.67  ? 254 GLU B CD  1 
ATOM   4722  O  OE1 . GLU B  1 277 ? 90.529  54.170  107.396 1.00 46.04  ? 254 GLU B OE1 1 
ATOM   4723  O  OE2 . GLU B  1 277 ? 90.191  52.321  108.489 1.00 44.90  ? 254 GLU B OE2 1 
ATOM   4724  N  N   . ASN B  1 278 ? 92.415  54.782  112.749 1.00 29.74  ? 255 ASN B N   1 
ATOM   4725  C  CA  . ASN B  1 278 ? 92.953  53.944  113.817 1.00 29.02  ? 255 ASN B CA  1 
ATOM   4726  C  C   . ASN B  1 278 ? 93.442  54.670  115.084 1.00 28.57  ? 255 ASN B C   1 
ATOM   4727  O  O   . ASN B  1 278 ? 94.157  54.082  115.889 1.00 30.13  ? 255 ASN B O   1 
ATOM   4728  C  CB  . ASN B  1 278 ? 94.016  52.992  113.280 1.00 28.91  ? 255 ASN B CB  1 
ATOM   4729  C  CG  . ASN B  1 278 ? 93.422  51.891  112.423 1.00 41.44  ? 255 ASN B CG  1 
ATOM   4730  O  OD1 . ASN B  1 278 ? 92.934  50.878  112.934 1.00 39.27  ? 255 ASN B OD1 1 
ATOM   4731  N  ND2 . ASN B  1 278 ? 93.438  52.092  111.114 1.00 43.19  ? 255 ASN B ND2 1 
ATOM   4732  N  N   . PHE B  1 279 ? 93.039  55.925  115.275 1.00 24.74  ? 256 PHE B N   1 
ATOM   4733  C  CA  . PHE B  1 279 ? 93.345  56.629  116.525 1.00 24.90  ? 256 PHE B CA  1 
ATOM   4734  C  C   . PHE B  1 279 ? 92.522  56.049  117.670 1.00 27.62  ? 256 PHE B C   1 
ATOM   4735  O  O   . PHE B  1 279 ? 91.300  55.991  117.582 1.00 29.33  ? 256 PHE B O   1 
ATOM   4736  C  CB  . PHE B  1 279 ? 93.006  58.118  116.433 1.00 25.08  ? 256 PHE B CB  1 
ATOM   4737  C  CG  . PHE B  1 279 ? 93.933  58.916  115.562 1.00 22.08  ? 256 PHE B CG  1 
ATOM   4738  C  CD1 . PHE B  1 279 ? 95.175  58.427  115.206 1.00 20.46  ? 256 PHE B CD1 1 
ATOM   4739  C  CD2 . PHE B  1 279 ? 93.548  60.169  115.098 1.00 22.36  ? 256 PHE B CD2 1 
ATOM   4740  C  CE1 . PHE B  1 279 ? 96.021  59.174  114.399 1.00 24.51  ? 256 PHE B CE1 1 
ATOM   4741  C  CE2 . PHE B  1 279 ? 94.391  60.923  114.288 1.00 25.16  ? 256 PHE B CE2 1 
ATOM   4742  C  CZ  . PHE B  1 279 ? 95.630  60.430  113.943 1.00 22.42  ? 256 PHE B CZ  1 
ATOM   4743  N  N   . TYR B  1 280 ? 93.174  55.643  118.755 1.00 26.41  ? 257 TYR B N   1 
ATOM   4744  C  CA  . TYR B  1 280 ? 92.435  55.152  119.915 1.00 24.85  ? 257 TYR B CA  1 
ATOM   4745  C  C   . TYR B  1 280 ? 92.380  56.241  120.980 1.00 27.86  ? 257 TYR B C   1 
ATOM   4746  O  O   . TYR B  1 280 ? 93.182  56.263  121.910 1.00 37.38  ? 257 TYR B O   1 
ATOM   4747  C  CB  . TYR B  1 280 ? 93.035  53.843  120.455 1.00 27.10  ? 257 TYR B CB  1 
ATOM   4748  C  CG  . TYR B  1 280 ? 92.674  52.625  119.629 1.00 32.51  ? 257 TYR B CG  1 
ATOM   4749  C  CD1 . TYR B  1 280 ? 91.444  51.988  119.796 1.00 38.66  ? 257 TYR B CD1 1 
ATOM   4750  C  CD2 . TYR B  1 280 ? 93.550  52.115  118.676 1.00 40.44  ? 257 TYR B CD2 1 
ATOM   4751  C  CE1 . TYR B  1 280 ? 91.092  50.880  119.029 1.00 38.85  ? 257 TYR B CE1 1 
ATOM   4752  C  CE2 . TYR B  1 280 ? 93.207  51.005  117.905 1.00 40.49  ? 257 TYR B CE2 1 
ATOM   4753  C  CZ  . TYR B  1 280 ? 91.978  50.397  118.092 1.00 42.04  ? 257 TYR B CZ  1 
ATOM   4754  O  OH  . TYR B  1 280 ? 91.628  49.306  117.339 1.00 50.31  ? 257 TYR B OH  1 
ATOM   4755  N  N   . GLY B  1 281 ? 91.433  57.157  120.816 1.00 28.96  ? 258 GLY B N   1 
ATOM   4756  C  CA  . GLY B  1 281 ? 91.279  58.285  121.712 1.00 24.21  ? 258 GLY B CA  1 
ATOM   4757  C  C   . GLY B  1 281 ? 91.881  59.581  121.197 1.00 33.11  ? 258 GLY B C   1 
ATOM   4758  O  O   . GLY B  1 281 ? 92.781  59.578  120.349 1.00 32.58  ? 258 GLY B O   1 
ATOM   4759  N  N   . PRO B  1 282 ? 91.380  60.707  121.719 1.00 33.85  ? 259 PRO B N   1 
ATOM   4760  C  CA  . PRO B  1 282 ? 91.824  62.075  121.437 1.00 30.74  ? 259 PRO B CA  1 
ATOM   4761  C  C   . PRO B  1 282 ? 93.336  62.245  121.594 1.00 28.25  ? 259 PRO B C   1 
ATOM   4762  O  O   . PRO B  1 282 ? 93.980  62.853  120.737 1.00 31.82  ? 259 PRO B O   1 
ATOM   4763  C  CB  . PRO B  1 282 ? 91.118  62.885  122.522 1.00 32.57  ? 259 PRO B CB  1 
ATOM   4764  C  CG  . PRO B  1 282 ? 89.900  62.107  122.832 1.00 35.58  ? 259 PRO B CG  1 
ATOM   4765  C  CD  . PRO B  1 282 ? 90.274  60.674  122.690 1.00 35.60  ? 259 PRO B CD  1 
ATOM   4766  N  N   . ARG B  1 283 ? 93.888  61.723  122.685 1.00 17.64  ? 260 ARG B N   1 
ATOM   4767  C  CA  . ARG B  1 283 ? 95.313  61.867  122.965 1.00 24.77  ? 260 ARG B CA  1 
ATOM   4768  C  C   . ARG B  1 283 ? 96.205  61.281  121.852 1.00 28.49  ? 260 ARG B C   1 
ATOM   4769  O  O   . ARG B  1 283 ? 97.249  61.840  121.525 1.00 31.29  ? 260 ARG B O   1 
ATOM   4770  C  CB  . ARG B  1 283 ? 95.682  61.281  124.331 1.00 17.70  ? 260 ARG B CB  1 
ATOM   4771  C  CG  . ARG B  1 283 ? 97.199  61.233  124.556 1.00 27.27  ? 260 ARG B CG  1 
ATOM   4772  C  CD  . ARG B  1 283 ? 97.547  60.966  125.998 1.00 23.24  ? 260 ARG B CD  1 
ATOM   4773  N  NE  . ARG B  1 283 ? 97.187  62.096  126.831 1.00 25.53  ? 260 ARG B NE  1 
ATOM   4774  C  CZ  . ARG B  1 283 ? 96.953  62.020  128.134 1.00 31.74  ? 260 ARG B CZ  1 
ATOM   4775  N  NH1 . ARG B  1 283 ? 97.035  60.854  128.761 1.00 36.16  ? 260 ARG B NH1 1 
ATOM   4776  N  NH2 . ARG B  1 283 ? 96.621  63.109  128.806 1.00 27.93  ? 260 ARG B NH2 1 
ATOM   4777  N  N   . GLU B  1 284 ? 95.786  60.170  121.261 1.00 32.26  ? 261 GLU B N   1 
ATOM   4778  C  CA  . GLU B  1 284 ? 96.537  59.588  120.157 1.00 28.43  ? 261 GLU B CA  1 
ATOM   4779  C  C   . GLU B  1 284 ? 96.493  60.533  118.965 1.00 24.27  ? 261 GLU B C   1 
ATOM   4780  O  O   . GLU B  1 284 ? 97.476  60.673  118.238 1.00 31.74  ? 261 GLU B O   1 
ATOM   4781  C  CB  . GLU B  1 284 ? 95.980  58.220  119.787 1.00 34.96  ? 261 GLU B CB  1 
ATOM   4782  C  CG  . GLU B  1 284 ? 97.012  57.192  119.333 1.00 55.24  ? 261 GLU B CG  1 
ATOM   4783  C  CD  . GLU B  1 284 ? 96.512  55.749  119.520 1.00 71.22  ? 261 GLU B CD  1 
ATOM   4784  O  OE1 . GLU B  1 284 ? 95.872  55.202  118.588 1.00 67.54  ? 261 GLU B OE1 1 
ATOM   4785  O  OE2 . GLU B  1 284 ? 96.751  55.168  120.609 1.00 73.84  ? 261 GLU B OE2 1 
ATOM   4786  N  N   . MET B  1 285 ? 95.368  61.213  118.774 1.00 20.68  ? 262 MET B N   1 
ATOM   4787  C  CA  . MET B  1 285 ? 95.295  62.203  117.700 1.00 25.97  ? 262 MET B CA  1 
ATOM   4788  C  C   . MET B  1 285 ? 96.267  63.364  117.979 1.00 22.91  ? 262 MET B C   1 
ATOM   4789  O  O   . MET B  1 285 ? 96.958  63.864  117.079 1.00 31.79  ? 262 MET B O   1 
ATOM   4790  C  CB  . MET B  1 285 ? 93.864  62.733  117.521 1.00 20.33  ? 262 MET B CB  1 
ATOM   4791  C  CG  . MET B  1 285 ? 93.792  63.856  116.500 1.00 26.06  ? 262 MET B CG  1 
ATOM   4792  S  SD  . MET B  1 285 ? 92.188  64.650  116.350 1.00 34.14  ? 262 MET B SD  1 
ATOM   4793  C  CE  . MET B  1 285 ? 91.252  63.298  115.693 1.00 29.15  ? 262 MET B CE  1 
ATOM   4794  N  N   . HIS B  1 286 ? 96.318  63.784  119.238 1.00 22.34  ? 263 HIS B N   1 
ATOM   4795  C  CA  . HIS B  1 286 ? 97.148  64.907  119.636 1.00 20.69  ? 263 HIS B CA  1 
ATOM   4796  C  C   . HIS B  1 286 ? 98.617  64.550  119.374 1.00 23.26  ? 263 HIS B C   1 
ATOM   4797  O  O   . HIS B  1 286 ? 99.407  65.385  118.934 1.00 29.46  ? 263 HIS B O   1 
ATOM   4798  C  CB  . HIS B  1 286 ? 96.851  65.280  121.105 1.00 24.12  ? 263 HIS B CB  1 
ATOM   4799  C  CG  . HIS B  1 286 ? 98.029  65.829  121.854 1.00 25.94  ? 263 HIS B CG  1 
ATOM   4800  N  ND1 . HIS B  1 286 ? 98.406  67.154  121.787 1.00 28.46  ? 263 HIS B ND1 1 
ATOM   4801  C  CD2 . HIS B  1 286 ? 98.913  65.227  122.689 1.00 27.07  ? 263 HIS B CD2 1 
ATOM   4802  C  CE1 . HIS B  1 286 ? 99.470  67.346  122.548 1.00 24.22  ? 263 HIS B CE1 1 
ATOM   4803  N  NE2 . HIS B  1 286 ? 99.798  66.193  123.107 1.00 27.49  ? 263 HIS B NE2 1 
ATOM   4804  N  N   . GLN B  1 287 ? 98.957  63.285  119.598 1.00 17.23  ? 264 GLN B N   1 
ATOM   4805  C  CA  . GLN B  1 287 ? 100.318 62.806  119.394 1.00 27.75  ? 264 GLN B CA  1 
ATOM   4806  C  C   . GLN B  1 287 ? 100.674 62.737  117.924 1.00 24.63  ? 264 GLN B C   1 
ATOM   4807  O  O   . GLN B  1 287 ? 101.763 63.149  117.545 1.00 29.67  ? 264 GLN B O   1 
ATOM   4808  C  CB  . GLN B  1 287 ? 100.529 61.443  120.051 1.00 26.71  ? 264 GLN B CB  1 
ATOM   4809  C  CG  . GLN B  1 287 ? 100.618 61.506  121.584 1.00 37.31  ? 264 GLN B CG  1 
ATOM   4810  C  CD  . GLN B  1 287 ? 100.469 60.137  122.248 1.00 49.78  ? 264 GLN B CD  1 
ATOM   4811  O  OE1 . GLN B  1 287 ? 100.276 59.121  121.572 1.00 54.31  ? 264 GLN B OE1 1 
ATOM   4812  N  NE2 . GLN B  1 287 ? 100.560 60.109  123.578 1.00 47.78  ? 264 GLN B NE2 1 
ATOM   4813  N  N   . ALA B  1 288 ? 99.761  62.216  117.103 1.00 18.44  ? 265 ALA B N   1 
ATOM   4814  C  CA  . ALA B  1 288 ? 99.997  62.150  115.666 1.00 17.83  ? 265 ALA B CA  1 
ATOM   4815  C  C   . ALA B  1 288 ? 100.265 63.538  115.111 1.00 19.71  ? 265 ALA B C   1 
ATOM   4816  O  O   . ALA B  1 288 ? 101.199 63.716  114.344 1.00 30.69  ? 265 ALA B O   1 
ATOM   4817  C  CB  . ALA B  1 288 ? 98.834  61.498  114.942 1.00 13.11  ? 265 ALA B CB  1 
ATOM   4818  N  N   . LEU B  1 289 ? 99.453  64.515  115.528 1.00 20.77  ? 266 LEU B N   1 
ATOM   4819  C  CA  . LEU B  1 289 ? 99.602  65.915  115.098 1.00 13.68  ? 266 LEU B CA  1 
ATOM   4820  C  C   . LEU B  1 289 ? 100.917 66.555  115.553 1.00 18.58  ? 266 LEU B C   1 
ATOM   4821  O  O   . LEU B  1 289 ? 101.581 67.222  114.770 1.00 19.77  ? 266 LEU B O   1 
ATOM   4822  C  CB  . LEU B  1 289 ? 98.424  66.764  115.582 1.00 20.92  ? 266 LEU B CB  1 
ATOM   4823  C  CG  . LEU B  1 289 ? 97.038  66.385  115.062 1.00 25.79  ? 266 LEU B CG  1 
ATOM   4824  C  CD1 . LEU B  1 289 ? 95.970  67.231  115.720 1.00 29.28  ? 266 LEU B CD1 1 
ATOM   4825  C  CD2 . LEU B  1 289 ? 97.011  66.544  113.555 1.00 28.17  ? 266 LEU B CD2 1 
ATOM   4826  N  N   . GLN B  1 290 ? 101.286 66.375  116.816 1.00 20.54  ? 267 GLN B N   1 
ATOM   4827  C  CA  . GLN B  1 290 ? 102.613 66.809  117.260 1.00 18.16  ? 267 GLN B CA  1 
ATOM   4828  C  C   . GLN B  1 290 ? 103.714 66.214  116.394 1.00 23.32  ? 267 GLN B C   1 
ATOM   4829  O  O   . GLN B  1 290 ? 104.761 66.828  116.197 1.00 28.27  ? 267 GLN B O   1 
ATOM   4830  C  CB  . GLN B  1 290 ? 102.873 66.371  118.689 1.00 22.84  ? 267 GLN B CB  1 
ATOM   4831  C  CG  . GLN B  1 290 ? 102.072 67.112  119.735 1.00 27.13  ? 267 GLN B CG  1 
ATOM   4832  C  CD  . GLN B  1 290 ? 102.453 66.672  121.143 1.00 43.35  ? 267 GLN B CD  1 
ATOM   4833  O  OE1 . GLN B  1 290 ? 102.453 65.473  121.459 1.00 41.75  ? 267 GLN B OE1 1 
ATOM   4834  N  NE2 . GLN B  1 290 ? 102.788 67.642  121.996 1.00 44.89  ? 267 GLN B NE2 1 
ATOM   4835  N  N   . ALA B  1 291 ? 103.489 65.006  115.880 1.00 26.33  ? 268 ALA B N   1 
ATOM   4836  C  CA  . ALA B  1 291 ? 104.527 64.326  115.116 1.00 24.15  ? 268 ALA B CA  1 
ATOM   4837  C  C   . ALA B  1 291 ? 104.548 64.793  113.665 1.00 26.51  ? 268 ALA B C   1 
ATOM   4838  O  O   . ALA B  1 291 ? 105.454 64.451  112.922 1.00 33.00  ? 268 ALA B O   1 
ATOM   4839  C  CB  . ALA B  1 291 ? 104.348 62.833  115.191 1.00 20.42  ? 268 ALA B CB  1 
ATOM   4840  N  N   . GLY B  1 292 ? 103.557 65.591  113.280 1.00 21.64  ? 269 GLY B N   1 
ATOM   4841  C  CA  . GLY B  1 292 ? 103.442 66.073  111.913 1.00 19.80  ? 269 GLY B CA  1 
ATOM   4842  C  C   . GLY B  1 292 ? 103.101 64.945  110.942 1.00 24.94  ? 269 GLY B C   1 
ATOM   4843  O  O   . GLY B  1 292 ? 103.686 64.862  109.869 1.00 23.48  ? 269 GLY B O   1 
ATOM   4844  N  N   . ALA B  1 293 ? 102.143 64.086  111.307 1.00 16.14  ? 270 ALA B N   1 
ATOM   4845  C  CA  . ALA B  1 293 ? 101.884 62.860  110.538 1.00 21.40  ? 270 ALA B CA  1 
ATOM   4846  C  C   . ALA B  1 293 ? 100.786 62.933  109.470 1.00 27.01  ? 270 ALA B C   1 
ATOM   4847  O  O   . ALA B  1 293 ? 100.648 62.010  108.680 1.00 28.98  ? 270 ALA B O   1 
ATOM   4848  C  CB  . ALA B  1 293 ? 101.609 61.688  111.483 1.00 15.90  ? 270 ALA B CB  1 
ATOM   4849  N  N   . CYS B  1 294 ? 99.999  64.003  109.442 1.00 23.12  ? 271 CYS B N   1 
ATOM   4850  C  CA  . CYS B  1 294 ? 98.873  64.048  108.512 1.00 28.27  ? 271 CYS B CA  1 
ATOM   4851  C  C   . CYS B  1 294 ? 98.368  65.464  108.278 1.00 23.60  ? 271 CYS B C   1 
ATOM   4852  O  O   . CYS B  1 294 ? 98.595  66.353  109.102 1.00 26.94  ? 271 CYS B O   1 
ATOM   4853  C  CB  . CYS B  1 294 ? 97.731  63.196  109.052 1.00 34.13  ? 271 CYS B CB  1 
ATOM   4854  S  SG  . CYS B  1 294 ? 97.285  63.676  110.721 1.00 36.51  ? 271 CYS B SG  1 
ATOM   4855  N  N   . ASP B  1 295 ? 97.680  65.659  107.153 1.00 18.23  ? 272 ASP B N   1 
ATOM   4856  C  CA  . ASP B  1 295 ? 97.042  66.940  106.845 1.00 23.02  ? 272 ASP B CA  1 
ATOM   4857  C  C   . ASP B  1 295 ? 95.531  66.922  107.186 1.00 29.80  ? 272 ASP B C   1 
ATOM   4858  O  O   . ASP B  1 295 ? 94.904  67.966  107.359 1.00 28.43  ? 272 ASP B O   1 
ATOM   4859  C  CB  . ASP B  1 295 ? 97.256  67.292  105.366 1.00 26.57  ? 272 ASP B CB  1 
ATOM   4860  C  CG  . ASP B  1 295 ? 98.732  67.178  104.921 1.00 30.97  ? 272 ASP B CG  1 
ATOM   4861  O  OD1 . ASP B  1 295 ? 99.041  66.307  104.080 1.00 25.67  ? 272 ASP B OD1 1 
ATOM   4862  O  OD2 . ASP B  1 295 ? 99.585  67.966  105.395 1.00 28.96  ? 272 ASP B OD2 1 
ATOM   4863  N  N   . LEU B  1 296 ? 94.957  65.725  107.273 1.00 27.80  ? 273 LEU B N   1 
ATOM   4864  C  CA  . LEU B  1 296 ? 93.531  65.552  107.526 1.00 21.02  ? 273 LEU B CA  1 
ATOM   4865  C  C   . LEU B  1 296 ? 93.365  64.380  108.489 1.00 20.74  ? 273 LEU B C   1 
ATOM   4866  O  O   . LEU B  1 296 ? 94.194  63.476  108.505 1.00 24.33  ? 273 LEU B O   1 
ATOM   4867  C  CB  . LEU B  1 296 ? 92.802  65.234  106.209 1.00 20.96  ? 273 LEU B CB  1 
ATOM   4868  C  CG  . LEU B  1 296 ? 92.978  66.174  105.015 1.00 23.15  ? 273 LEU B CG  1 
ATOM   4869  C  CD1 . LEU B  1 296 ? 92.344  65.596  103.748 1.00 25.77  ? 273 LEU B CD1 1 
ATOM   4870  C  CD2 . LEU B  1 296 ? 92.367  67.524  105.320 1.00 25.41  ? 273 LEU B CD2 1 
ATOM   4871  N  N   . VAL B  1 297 ? 92.310  64.387  109.294 1.00 24.02  ? 274 VAL B N   1 
ATOM   4872  C  CA  . VAL B  1 297 ? 92.032  63.251  110.183 1.00 26.46  ? 274 VAL B CA  1 
ATOM   4873  C  C   . VAL B  1 297 ? 90.594  62.777  110.021 1.00 26.77  ? 274 VAL B C   1 
ATOM   4874  O  O   . VAL B  1 297 ? 89.719  63.547  109.605 1.00 30.67  ? 274 VAL B O   1 
ATOM   4875  C  CB  . VAL B  1 297 ? 92.286  63.590  111.685 1.00 19.29  ? 274 VAL B CB  1 
ATOM   4876  C  CG1 . VAL B  1 297 ? 93.772  63.790  111.950 1.00 20.29  ? 274 VAL B CG1 1 
ATOM   4877  C  CG2 . VAL B  1 297 ? 91.527  64.835  112.074 1.00 13.50  ? 274 VAL B CG2 1 
ATOM   4878  N  N   . MET B  1 298 ? 90.356  61.512  110.361 1.00 23.89  ? 275 MET B N   1 
ATOM   4879  C  CA  . MET B  1 298 ? 89.023  60.915  110.280 1.00 29.36  ? 275 MET B CA  1 
ATOM   4880  C  C   . MET B  1 298 ? 88.883  59.795  111.291 1.00 22.64  ? 275 MET B C   1 
ATOM   4881  O  O   . MET B  1 298 ? 89.033  58.626  110.954 1.00 29.64  ? 275 MET B O   1 
ATOM   4882  C  CB  . MET B  1 298 ? 88.742  60.371  108.867 1.00 21.65  ? 275 MET B CB  1 
ATOM   4883  C  CG  . MET B  1 298 ? 89.736  59.317  108.394 1.00 22.26  ? 275 MET B CG  1 
ATOM   4884  S  SD  . MET B  1 298 ? 89.496  58.783  106.678 1.00 33.15  ? 275 MET B SD  1 
ATOM   4885  C  CE  . MET B  1 298 ? 88.108  57.693  106.905 1.00 29.93  ? 275 MET B CE  1 
ATOM   4886  N  N   . PRO B  1 299 ? 88.595  60.152  112.541 1.00 26.64  ? 276 PRO B N   1 
ATOM   4887  C  CA  . PRO B  1 299 ? 88.367  59.182  113.621 1.00 30.03  ? 276 PRO B CA  1 
ATOM   4888  C  C   . PRO B  1 299 ? 87.219  58.188  113.353 1.00 32.90  ? 276 PRO B C   1 
ATOM   4889  O  O   . PRO B  1 299 ? 86.209  58.517  112.726 1.00 32.56  ? 276 PRO B O   1 
ATOM   4890  C  CB  . PRO B  1 299 ? 88.013  60.072  114.812 1.00 32.33  ? 276 PRO B CB  1 
ATOM   4891  C  CG  . PRO B  1 299 ? 88.665  61.391  114.492 1.00 24.86  ? 276 PRO B CG  1 
ATOM   4892  C  CD  . PRO B  1 299 ? 88.511  61.541  113.016 1.00 24.86  ? 276 PRO B CD  1 
ATOM   4893  N  N   . ASP B  1 300 ? 87.406  56.965  113.837 1.00 31.84  ? 277 ASP B N   1 
ATOM   4894  C  CA  . ASP B  1 300 ? 86.379  55.937  113.837 1.00 31.96  ? 277 ASP B CA  1 
ATOM   4895  C  C   . ASP B  1 300 ? 85.720  55.854  115.223 1.00 32.50  ? 277 ASP B C   1 
ATOM   4896  O  O   . ASP B  1 300 ? 86.402  55.699  116.240 1.00 37.27  ? 277 ASP B O   1 
ATOM   4897  C  CB  . ASP B  1 300 ? 86.992  54.585  113.463 1.00 31.47  ? 277 ASP B CB  1 
ATOM   4898  C  CG  . ASP B  1 300 ? 85.996  53.437  113.584 1.00 40.84  ? 277 ASP B CG  1 
ATOM   4899  O  OD1 . ASP B  1 300 ? 85.414  53.241  114.673 1.00 48.14  ? 277 ASP B OD1 1 
ATOM   4900  O  OD2 . ASP B  1 300 ? 85.786  52.733  112.580 1.00 40.93  ? 277 ASP B OD2 1 
ATOM   4901  N  N   . PHE B  1 301 ? 84.394  55.922  115.256 1.00 33.27  ? 278 PHE B N   1 
ATOM   4902  C  CA  . PHE B  1 301 ? 83.671  56.029  116.521 1.00 35.87  ? 278 PHE B CA  1 
ATOM   4903  C  C   . PHE B  1 301 ? 83.916  54.931  117.557 1.00 32.78  ? 278 PHE B C   1 
ATOM   4904  O  O   . PHE B  1 301 ? 83.762  55.172  118.751 1.00 32.78  ? 278 PHE B O   1 
ATOM   4905  C  CB  . PHE B  1 301 ? 82.183  56.253  116.272 1.00 32.05  ? 278 PHE B CB  1 
ATOM   4906  C  CG  . PHE B  1 301 ? 81.883  57.617  115.740 1.00 37.63  ? 278 PHE B CG  1 
ATOM   4907  C  CD1 . PHE B  1 301 ? 81.694  58.683  116.606 1.00 32.99  ? 278 PHE B CD1 1 
ATOM   4908  C  CD2 . PHE B  1 301 ? 81.831  57.846  114.371 1.00 36.73  ? 278 PHE B CD2 1 
ATOM   4909  C  CE1 . PHE B  1 301 ? 81.434  59.954  116.117 1.00 37.86  ? 278 PHE B CE1 1 
ATOM   4910  C  CE2 . PHE B  1 301 ? 81.573  59.115  113.871 1.00 37.15  ? 278 PHE B CE2 1 
ATOM   4911  C  CZ  . PHE B  1 301 ? 81.376  60.173  114.744 1.00 37.81  ? 278 PHE B CZ  1 
ATOM   4912  N  N   . MET B  1 302 ? 84.314  53.741  117.130 1.00 29.93  ? 279 MET B N   1 
ATOM   4913  C  CA  . MET B  1 302 ? 84.597  52.704  118.115 1.00 34.51  ? 279 MET B CA  1 
ATOM   4914  C  C   . MET B  1 302 ? 86.024  52.802  118.660 1.00 37.80  ? 279 MET B C   1 
ATOM   4915  O  O   . MET B  1 302 ? 86.328  52.257  119.715 1.00 39.46  ? 279 MET B O   1 
ATOM   4916  C  CB  . MET B  1 302 ? 84.312  51.297  117.574 1.00 32.71  ? 279 MET B CB  1 
ATOM   4917  C  CG  . MET B  1 302 ? 85.280  50.809  116.509 1.00 47.45  ? 279 MET B CG  1 
ATOM   4918  S  SD  . MET B  1 302 ? 85.171  49.032  116.198 1.00 50.13  ? 279 MET B SD  1 
ATOM   4919  C  CE  . MET B  1 302 ? 86.165  48.906  114.715 1.00 51.80  ? 279 MET B CE  1 
ATOM   4920  N  N   . ARG B  1 303 ? 86.903  53.496  117.947 1.00 34.21  ? 280 ARG B N   1 
ATOM   4921  C  CA  . ARG B  1 303 ? 88.287  53.590  118.396 1.00 29.54  ? 280 ARG B CA  1 
ATOM   4922  C  C   . ARG B  1 303 ? 88.574  54.932  119.070 1.00 33.59  ? 280 ARG B C   1 
ATOM   4923  O  O   . ARG B  1 303 ? 89.432  55.020  119.945 1.00 34.04  ? 280 ARG B O   1 
ATOM   4924  C  CB  . ARG B  1 303 ? 89.258  53.339  117.243 1.00 29.90  ? 280 ARG B CB  1 
ATOM   4925  C  CG  . ARG B  1 303 ? 89.077  52.006  116.533 1.00 31.67  ? 280 ARG B CG  1 
ATOM   4926  C  CD  . ARG B  1 303 ? 90.190  51.770  115.528 1.00 31.25  ? 280 ARG B CD  1 
ATOM   4927  N  NE  . ARG B  1 303 ? 90.011  50.523  114.788 1.00 41.14  ? 280 ARG B NE  1 
ATOM   4928  C  CZ  . ARG B  1 303 ? 89.531  50.438  113.547 1.00 43.71  ? 280 ARG B CZ  1 
ATOM   4929  N  NH1 . ARG B  1 303 ? 89.179  51.528  112.875 1.00 36.73  ? 280 ARG B NH1 1 
ATOM   4930  N  NH2 . ARG B  1 303 ? 89.408  49.253  112.970 1.00 48.00  ? 280 ARG B NH2 1 
ATOM   4931  N  N   . ILE B  1 304 ? 87.839  55.968  118.672 1.00 32.56  ? 281 ILE B N   1 
ATOM   4932  C  CA  . ILE B  1 304 ? 88.063  57.309  119.199 1.00 29.28  ? 281 ILE B CA  1 
ATOM   4933  C  C   . ILE B  1 304 ? 87.399  57.520  120.562 1.00 35.28  ? 281 ILE B C   1 
ATOM   4934  O  O   . ILE B  1 304 ? 87.675  58.506  121.254 1.00 33.20  ? 281 ILE B O   1 
ATOM   4935  C  CB  . ILE B  1 304 ? 87.550  58.377  118.224 1.00 25.99  ? 281 ILE B CB  1 
ATOM   4936  C  CG1 . ILE B  1 304 ? 88.252  59.714  118.473 1.00 22.63  ? 281 ILE B CG1 1 
ATOM   4937  C  CG2 . ILE B  1 304 ? 86.048  58.525  118.356 1.00 19.12  ? 281 ILE B CG2 1 
ATOM   4938  C  CD1 . ILE B  1 304 ? 89.741  59.678  118.251 1.00 25.74  ? 281 ILE B CD1 1 
ATOM   4939  N  N   . GLY B  1 305 ? 86.522  56.599  120.955 1.00 37.79  ? 282 GLY B N   1 
ATOM   4940  C  CA  . GLY B  1 305 ? 85.849  56.714  122.241 1.00 26.76  ? 282 GLY B CA  1 
ATOM   4941  C  C   . GLY B  1 305 ? 84.405  57.194  122.169 1.00 28.46  ? 282 GLY B C   1 
ATOM   4942  O  O   . GLY B  1 305 ? 83.936  57.924  123.056 1.00 29.19  ? 282 GLY B O   1 
ATOM   4943  N  N   . GLY B  1 306 ? 83.691  56.777  121.126 1.00 23.34  ? 283 GLY B N   1 
ATOM   4944  C  CA  . GLY B  1 306 ? 82.285  57.110  120.983 1.00 21.43  ? 283 GLY B CA  1 
ATOM   4945  C  C   . GLY B  1 306 ? 82.040  58.588  120.749 1.00 31.58  ? 283 GLY B C   1 
ATOM   4946  O  O   . GLY B  1 306 ? 82.868  59.281  120.156 1.00 32.84  ? 283 GLY B O   1 
ATOM   4947  N  N   . VAL B  1 307 ? 80.890  59.072  121.206 1.00 32.49  ? 284 VAL B N   1 
ATOM   4948  C  CA  . VAL B  1 307 ? 80.541  60.482  121.076 1.00 22.31  ? 284 VAL B CA  1 
ATOM   4949  C  C   . VAL B  1 307 ? 81.426  61.332  121.995 1.00 33.37  ? 284 VAL B C   1 
ATOM   4950  O  O   . VAL B  1 307 ? 81.821  62.445  121.638 1.00 27.54  ? 284 VAL B O   1 
ATOM   4951  C  CB  . VAL B  1 307 ? 79.047  60.720  121.390 1.00 23.78  ? 284 VAL B CB  1 
ATOM   4952  C  CG1 . VAL B  1 307 ? 78.748  62.211  121.605 1.00 22.17  ? 284 VAL B CG1 1 
ATOM   4953  C  CG2 . VAL B  1 307 ? 78.163  60.135  120.285 1.00 20.10  ? 284 VAL B CG2 1 
ATOM   4954  N  N   . SER B  1 308 ? 81.744  60.797  123.173 1.00 36.97  ? 285 SER B N   1 
ATOM   4955  C  CA  . SER B  1 308 ? 82.587  61.503  124.141 1.00 27.10  ? 285 SER B CA  1 
ATOM   4956  C  C   . SER B  1 308 ? 84.005  61.748  123.604 1.00 27.67  ? 285 SER B C   1 
ATOM   4957  O  O   . SER B  1 308 ? 84.526  62.863  123.655 1.00 34.56  ? 285 SER B O   1 
ATOM   4958  C  CB  . SER B  1 308 ? 82.635  60.746  125.476 1.00 30.26  ? 285 SER B CB  1 
ATOM   4959  O  OG  . SER B  1 308 ? 81.347  60.658  126.071 1.00 31.19  ? 285 SER B OG  1 
ATOM   4960  N  N   . GLY B  1 309 ? 84.625  60.702  123.083 1.00 25.32  ? 286 GLY B N   1 
ATOM   4961  C  CA  . GLY B  1 309 ? 85.929  60.836  122.474 1.00 17.66  ? 286 GLY B CA  1 
ATOM   4962  C  C   . GLY B  1 309 ? 85.871  61.796  121.296 1.00 26.27  ? 286 GLY B C   1 
ATOM   4963  O  O   . GLY B  1 309 ? 86.707  62.695  121.173 1.00 27.28  ? 286 GLY B O   1 
ATOM   4964  N  N   . TRP B  1 310 ? 84.881  61.608  120.431 1.00 23.04  ? 287 TRP B N   1 
ATOM   4965  C  CA  . TRP B  1 310 ? 84.790  62.411  119.225 1.00 23.15  ? 287 TRP B CA  1 
ATOM   4966  C  C   . TRP B  1 310 ? 84.707  63.875  119.602 1.00 25.93  ? 287 TRP B C   1 
ATOM   4967  O  O   . TRP B  1 310 ? 85.369  64.708  118.997 1.00 22.41  ? 287 TRP B O   1 
ATOM   4968  C  CB  . TRP B  1 310 ? 83.582  62.040  118.362 1.00 23.09  ? 287 TRP B CB  1 
ATOM   4969  C  CG  . TRP B  1 310 ? 83.446  62.977  117.213 1.00 25.78  ? 287 TRP B CG  1 
ATOM   4970  C  CD1 . TRP B  1 310 ? 82.897  64.225  117.237 1.00 25.59  ? 287 TRP B CD1 1 
ATOM   4971  C  CD2 . TRP B  1 310 ? 83.914  62.770  115.876 1.00 20.72  ? 287 TRP B CD2 1 
ATOM   4972  N  NE1 . TRP B  1 310 ? 82.980  64.805  115.993 1.00 26.75  ? 287 TRP B NE1 1 
ATOM   4973  C  CE2 . TRP B  1 310 ? 83.603  63.932  115.139 1.00 21.97  ? 287 TRP B CE2 1 
ATOM   4974  C  CE3 . TRP B  1 310 ? 84.556  61.711  115.227 1.00 19.55  ? 287 TRP B CE3 1 
ATOM   4975  C  CZ2 . TRP B  1 310 ? 83.910  64.064  113.786 1.00 21.89  ? 287 TRP B CZ2 1 
ATOM   4976  C  CZ3 . TRP B  1 310 ? 84.855  61.836  113.881 1.00 22.45  ? 287 TRP B CZ3 1 
ATOM   4977  C  CH2 . TRP B  1 310 ? 84.545  63.009  113.178 1.00 25.47  ? 287 TRP B CH2 1 
ATOM   4978  N  N   . MET B  1 311 ? 83.901  64.196  120.607 1.00 20.03  ? 288 MET B N   1 
ATOM   4979  C  CA  . MET B  1 311 ? 83.749  65.595  120.982 1.00 26.09  ? 288 MET B CA  1 
ATOM   4980  C  C   . MET B  1 311 ? 85.074  66.181  121.454 1.00 27.05  ? 288 MET B C   1 
ATOM   4981  O  O   . MET B  1 311 ? 85.409  67.326  121.131 1.00 32.72  ? 288 MET B O   1 
ATOM   4982  C  CB  . MET B  1 311 ? 82.635  65.792  122.027 1.00 25.16  ? 288 MET B CB  1 
ATOM   4983  C  CG  . MET B  1 311 ? 81.206  65.614  121.459 1.00 28.79  ? 288 MET B CG  1 
ATOM   4984  S  SD  . MET B  1 311 ? 80.919  66.357  119.819 1.00 43.04  ? 288 MET B SD  1 
ATOM   4985  C  CE  . MET B  1 311 ? 80.743  68.086  120.271 1.00 25.43  ? 288 MET B CE  1 
ATOM   4986  N  N   . ARG B  1 312 ? 85.833  65.390  122.207 1.00 22.59  ? 289 ARG B N   1 
ATOM   4987  C  CA  . ARG B  1 312 ? 87.151  65.827  122.679 1.00 25.21  ? 289 ARG B CA  1 
ATOM   4988  C  C   . ARG B  1 312 ? 88.154  65.950  121.537 1.00 29.31  ? 289 ARG B C   1 
ATOM   4989  O  O   . ARG B  1 312 ? 88.883  66.934  121.463 1.00 24.84  ? 289 ARG B O   1 
ATOM   4990  C  CB  . ARG B  1 312 ? 87.671  64.893  123.768 1.00 23.06  ? 289 ARG B CB  1 
ATOM   4991  C  CG  . ARG B  1 312 ? 86.789  64.939  125.000 1.00 30.51  ? 289 ARG B CG  1 
ATOM   4992  C  CD  . ARG B  1 312 ? 87.138  63.893  126.033 1.00 30.51  ? 289 ARG B CD  1 
ATOM   4993  N  NE  . ARG B  1 312 ? 86.165  63.913  127.116 1.00 34.50  ? 289 ARG B NE  1 
ATOM   4994  C  CZ  . ARG B  1 312 ? 86.199  63.102  128.165 1.00 42.44  ? 289 ARG B CZ  1 
ATOM   4995  N  NH1 . ARG B  1 312 ? 87.165  62.191  128.278 1.00 40.03  ? 289 ARG B NH1 1 
ATOM   4996  N  NH2 . ARG B  1 312 ? 85.266  63.209  129.102 1.00 41.24  ? 289 ARG B NH2 1 
ATOM   4997  N  N   . ALA B  1 313 ? 88.172  64.963  120.644 1.00 23.45  ? 290 ALA B N   1 
ATOM   4998  C  CA  . ALA B  1 313 ? 89.025  65.011  119.451 1.00 19.67  ? 290 ALA B CA  1 
ATOM   4999  C  C   . ALA B  1 313 ? 88.695  66.229  118.611 1.00 22.40  ? 290 ALA B C   1 
ATOM   5000  O  O   . ALA B  1 313 ? 89.586  66.878  118.070 1.00 30.65  ? 290 ALA B O   1 
ATOM   5001  C  CB  . ALA B  1 313 ? 88.862  63.743  118.619 1.00 21.47  ? 290 ALA B CB  1 
ATOM   5002  N  N   . ALA B  1 314 ? 87.409  66.541  118.511 1.00 25.11  ? 291 ALA B N   1 
ATOM   5003  C  CA  . ALA B  1 314 ? 86.961  67.713  117.774 1.00 23.34  ? 291 ALA B CA  1 
ATOM   5004  C  C   . ALA B  1 314 ? 87.528  69.001  118.378 1.00 22.85  ? 291 ALA B C   1 
ATOM   5005  O  O   . ALA B  1 314 ? 87.766  69.978  117.671 1.00 23.94  ? 291 ALA B O   1 
ATOM   5006  C  CB  . ALA B  1 314 ? 85.448  67.767  117.738 1.00 27.22  ? 291 ALA B CB  1 
ATOM   5007  N  N   . GLY B  1 315 ? 87.734  69.011  119.689 1.00 25.45  ? 292 GLY B N   1 
ATOM   5008  C  CA  . GLY B  1 315 ? 88.358  70.162  120.336 1.00 22.78  ? 292 GLY B CA  1 
ATOM   5009  C  C   . GLY B  1 315 ? 89.825  70.271  119.944 1.00 22.92  ? 292 GLY B C   1 
ATOM   5010  O  O   . GLY B  1 315 ? 90.329  71.361  119.690 1.00 20.54  ? 292 GLY B O   1 
ATOM   5011  N  N   . VAL B  1 316 ? 90.508  69.124  119.902 1.00 26.19  ? 293 VAL B N   1 
ATOM   5012  C  CA  . VAL B  1 316 ? 91.919  69.059  119.543 1.00 22.30  ? 293 VAL B CA  1 
ATOM   5013  C  C   . VAL B  1 316 ? 92.061  69.507  118.089 1.00 25.86  ? 293 VAL B C   1 
ATOM   5014  O  O   . VAL B  1 316 ? 92.847  70.392  117.775 1.00 27.32  ? 293 VAL B O   1 
ATOM   5015  C  CB  . VAL B  1 316 ? 92.478  67.626  119.754 1.00 19.09  ? 293 VAL B CB  1 
ATOM   5016  C  CG1 . VAL B  1 316 ? 93.792  67.435  119.036 1.00 18.24  ? 293 VAL B CG1 1 
ATOM   5017  C  CG2 . VAL B  1 316 ? 92.644  67.317  121.242 1.00 23.38  ? 293 VAL B CG2 1 
ATOM   5018  N  N   . ALA B  1 317 ? 91.252  68.931  117.207 1.00 22.74  ? 294 ALA B N   1 
ATOM   5019  C  CA  . ALA B  1 317 ? 91.346  69.235  115.786 1.00 20.46  ? 294 ALA B CA  1 
ATOM   5020  C  C   . ALA B  1 317 ? 91.010  70.695  115.493 1.00 25.61  ? 294 ALA B C   1 
ATOM   5021  O  O   . ALA B  1 317 ? 91.659  71.344  114.664 1.00 25.34  ? 294 ALA B O   1 
ATOM   5022  C  CB  . ALA B  1 317 ? 90.452  68.296  114.986 1.00 18.44  ? 294 ALA B CB  1 
ATOM   5023  N  N   . GLY B  1 318 ? 90.001  71.209  116.185 1.00 23.67  ? 295 GLY B N   1 
ATOM   5024  C  CA  . GLY B  1 318 ? 89.589  72.592  116.026 1.00 18.71  ? 295 GLY B CA  1 
ATOM   5025  C  C   . GLY B  1 318 ? 90.697  73.564  116.383 1.00 26.43  ? 295 GLY B C   1 
ATOM   5026  O  O   . GLY B  1 318 ? 90.808  74.632  115.776 1.00 37.17  ? 295 GLY B O   1 
ATOM   5027  N  N   . ALA B  1 319 ? 91.517  73.194  117.367 1.00 23.25  ? 296 ALA B N   1 
ATOM   5028  C  CA  . ALA B  1 319 ? 92.601  74.059  117.830 1.00 20.28  ? 296 ALA B CA  1 
ATOM   5029  C  C   . ALA B  1 319 ? 93.750  74.078  116.820 1.00 20.27  ? 296 ALA B C   1 
ATOM   5030  O  O   . ALA B  1 319 ? 94.340  75.124  116.566 1.00 24.16  ? 296 ALA B O   1 
ATOM   5031  C  CB  . ALA B  1 319 ? 93.087  73.618  119.216 1.00 15.28  ? 296 ALA B CB  1 
ATOM   5032  N  N   . TRP B  1 320 ? 94.048  72.917  116.235 1.00 22.97  ? 297 TRP B N   1 
ATOM   5033  C  CA  . TRP B  1 320 ? 95.040  72.804  115.158 1.00 23.24  ? 297 TRP B CA  1 
ATOM   5034  C  C   . TRP B  1 320 ? 94.509  73.313  113.819 1.00 24.85  ? 297 TRP B C   1 
ATOM   5035  O  O   . TRP B  1 320 ? 95.288  73.606  112.921 1.00 24.59  ? 297 TRP B O   1 
ATOM   5036  C  CB  . TRP B  1 320 ? 95.473  71.342  114.948 1.00 19.22  ? 297 TRP B CB  1 
ATOM   5037  C  CG  . TRP B  1 320 ? 96.483  70.815  115.928 1.00 29.23  ? 297 TRP B CG  1 
ATOM   5038  C  CD1 . TRP B  1 320 ? 96.232  70.240  117.153 1.00 24.51  ? 297 TRP B CD1 1 
ATOM   5039  C  CD2 . TRP B  1 320 ? 97.902  70.777  115.753 1.00 25.94  ? 297 TRP B CD2 1 
ATOM   5040  N  NE1 . TRP B  1 320 ? 97.413  69.867  117.747 1.00 27.40  ? 297 TRP B NE1 1 
ATOM   5041  C  CE2 . TRP B  1 320 ? 98.452  70.184  116.913 1.00 29.50  ? 297 TRP B CE2 1 
ATOM   5042  C  CE3 . TRP B  1 320 ? 98.763  71.200  114.739 1.00 26.21  ? 297 TRP B CE3 1 
ATOM   5043  C  CZ2 . TRP B  1 320 ? 99.826  69.997  117.080 1.00 26.44  ? 297 TRP B CZ2 1 
ATOM   5044  C  CZ3 . TRP B  1 320 ? 100.125 71.013  114.905 1.00 27.82  ? 297 TRP B CZ3 1 
ATOM   5045  C  CH2 . TRP B  1 320 ? 100.645 70.420  116.069 1.00 24.53  ? 297 TRP B CH2 1 
ATOM   5046  N  N   . GLY B  1 321 ? 93.188  73.371  113.667 1.00 26.21  ? 298 GLY B N   1 
ATOM   5047  C  CA  . GLY B  1 321 ? 92.597  73.742  112.392 1.00 23.02  ? 298 GLY B CA  1 
ATOM   5048  C  C   . GLY B  1 321 ? 92.644  72.647  111.338 1.00 28.50  ? 298 GLY B C   1 
ATOM   5049  O  O   . GLY B  1 321 ? 92.602  72.929  110.135 1.00 30.60  ? 298 GLY B O   1 
ATOM   5050  N  N   . ILE B  1 322 ? 92.712  71.398  111.788 1.00 19.24  ? 299 ILE B N   1 
ATOM   5051  C  CA  . ILE B  1 322 ? 92.751  70.241  110.896 1.00 33.33  ? 299 ILE B CA  1 
ATOM   5052  C  C   . ILE B  1 322 ? 91.333  69.828  110.505 1.00 35.77  ? 299 ILE B C   1 
ATOM   5053  O  O   . ILE B  1 322 ? 90.484  69.599  111.380 1.00 26.54  ? 299 ILE B O   1 
ATOM   5054  C  CB  . ILE B  1 322 ? 93.469  69.031  111.567 1.00 24.91  ? 299 ILE B CB  1 
ATOM   5055  C  CG1 . ILE B  1 322 ? 94.847  69.443  112.050 1.00 33.64  ? 299 ILE B CG1 1 
ATOM   5056  C  CG2 . ILE B  1 322 ? 93.644  67.900  110.594 1.00 16.96  ? 299 ILE B CG2 1 
ATOM   5057  C  CD1 . ILE B  1 322 ? 95.818  69.713  110.924 1.00 43.39  ? 299 ILE B CD1 1 
ATOM   5058  N  N   . PRO B  1 323 ? 91.062  69.759  109.188 1.00 32.80  ? 300 PRO B N   1 
ATOM   5059  C  CA  . PRO B  1 323 ? 89.755  69.300  108.701 1.00 25.83  ? 300 PRO B CA  1 
ATOM   5060  C  C   . PRO B  1 323 ? 89.457  67.897  109.224 1.00 25.57  ? 300 PRO B C   1 
ATOM   5061  O  O   . PRO B  1 323 ? 90.293  67.002  109.121 1.00 25.29  ? 300 PRO B O   1 
ATOM   5062  C  CB  . PRO B  1 323 ? 89.940  69.279  107.188 1.00 21.92  ? 300 PRO B CB  1 
ATOM   5063  C  CG  . PRO B  1 323 ? 90.964  70.331  106.928 1.00 26.59  ? 300 PRO B CG  1 
ATOM   5064  C  CD  . PRO B  1 323 ? 91.929  70.226  108.090 1.00 28.90  ? 300 PRO B CD  1 
ATOM   5065  N  N   . MET B  1 324 ? 88.277  67.711  109.797 1.00 24.16  ? 301 MET B N   1 
ATOM   5066  C  CA  . MET B  1 324 ? 87.971  66.467  110.481 1.00 20.77  ? 301 MET B CA  1 
ATOM   5067  C  C   . MET B  1 324 ? 86.835  65.728  109.809 1.00 29.64  ? 301 MET B C   1 
ATOM   5068  O  O   . MET B  1 324 ? 85.740  66.266  109.662 1.00 28.39  ? 301 MET B O   1 
ATOM   5069  C  CB  . MET B  1 324 ? 87.613  66.767  111.921 1.00 22.40  ? 301 MET B CB  1 
ATOM   5070  C  CG  . MET B  1 324 ? 87.509  65.546  112.780 1.00 34.75  ? 301 MET B CG  1 
ATOM   5071  S  SD  . MET B  1 324 ? 87.310  66.049  114.485 1.00 38.04  ? 301 MET B SD  1 
ATOM   5072  C  CE  . MET B  1 324 ? 87.048  64.474  115.283 1.00 36.26  ? 301 MET B CE  1 
ATOM   5073  N  N   . SER B  1 325 ? 87.100  64.499  109.385 1.00 25.58  ? 302 SER B N   1 
ATOM   5074  C  CA  . SER B  1 325 ? 86.072  63.683  108.747 1.00 21.96  ? 302 SER B CA  1 
ATOM   5075  C  C   . SER B  1 325 ? 85.698  62.500  109.643 1.00 25.56  ? 302 SER B C   1 
ATOM   5076  O  O   . SER B  1 325 ? 86.301  62.304  110.693 1.00 27.66  ? 302 SER B O   1 
ATOM   5077  C  CB  . SER B  1 325 ? 86.544  63.187  107.378 1.00 25.05  ? 302 SER B CB  1 
ATOM   5078  O  OG  . SER B  1 325 ? 86.712  64.272  106.484 1.00 25.20  ? 302 SER B OG  1 
ATOM   5079  N  N   . THR B  1 326 ? 84.704  61.717  109.226 1.00 25.92  ? 303 THR B N   1 
ATOM   5080  C  CA  . THR B  1 326 ? 84.224  60.583  110.023 1.00 25.92  ? 303 THR B CA  1 
ATOM   5081  C  C   . THR B  1 326 ? 84.638  59.258  109.407 1.00 31.71  ? 303 THR B C   1 
ATOM   5082  O  O   . THR B  1 326 ? 85.101  59.196  108.268 1.00 31.21  ? 303 THR B O   1 
ATOM   5083  C  CB  . THR B  1 326 ? 82.702  60.552  110.080 1.00 28.79  ? 303 THR B CB  1 
ATOM   5084  O  OG1 . THR B  1 326 ? 82.192  60.521  108.738 1.00 31.83  ? 303 THR B OG1 1 
ATOM   5085  C  CG2 . THR B  1 326 ? 82.165  61.773  110.808 1.00 23.51  ? 303 THR B CG2 1 
ATOM   5086  N  N   . HIS B  1 327 ? 84.470  58.189  110.168 1.00 29.51  ? 304 HIS B N   1 
ATOM   5087  C  CA  . HIS B  1 327 ? 84.695  56.866  109.628 1.00 32.69  ? 304 HIS B CA  1 
ATOM   5088  C  C   . HIS B  1 327 ? 83.639  55.904  110.161 1.00 37.59  ? 304 HIS B C   1 
ATOM   5089  O  O   . HIS B  1 327 ? 83.520  55.720  111.371 1.00 41.46  ? 304 HIS B O   1 
ATOM   5090  C  CB  . HIS B  1 327 ? 86.102  56.381  109.952 1.00 25.15  ? 304 HIS B CB  1 
ATOM   5091  C  CG  . HIS B  1 327 ? 86.407  55.021  109.406 1.00 31.65  ? 304 HIS B CG  1 
ATOM   5092  N  ND1 . HIS B  1 327 ? 86.519  53.906  110.208 1.00 34.46  ? 304 HIS B ND1 1 
ATOM   5093  C  CD2 . HIS B  1 327 ? 86.615  54.595  108.137 1.00 28.82  ? 304 HIS B CD2 1 
ATOM   5094  C  CE1 . HIS B  1 327 ? 86.786  52.851  109.459 1.00 33.12  ? 304 HIS B CE1 1 
ATOM   5095  N  NE2 . HIS B  1 327 ? 86.849  53.242  108.198 1.00 35.73  ? 304 HIS B NE2 1 
ATOM   5096  N  N   . LEU B  1 328 ? 82.869  55.321  109.239 1.00 37.62  ? 305 LEU B N   1 
ATOM   5097  C  CA  . LEU B  1 328 ? 81.738  54.445  109.560 1.00 29.24  ? 305 LEU B CA  1 
ATOM   5098  C  C   . LEU B  1 328 ? 80.675  55.184  110.378 1.00 37.09  ? 305 LEU B C   1 
ATOM   5099  O  O   . LEU B  1 328 ? 80.716  56.412  110.489 1.00 38.73  ? 305 LEU B O   1 
ATOM   5100  C  CB  . LEU B  1 328 ? 82.216  53.177  110.268 1.00 30.71  ? 305 LEU B CB  1 
ATOM   5101  C  CG  . LEU B  1 328 ? 83.218  52.341  109.462 1.00 31.47  ? 305 LEU B CG  1 
ATOM   5102  C  CD1 . LEU B  1 328 ? 83.696  51.125  110.237 1.00 28.19  ? 305 LEU B CD1 1 
ATOM   5103  C  CD2 . LEU B  1 328 ? 82.600  51.908  108.146 1.00 38.69  ? 305 LEU B CD2 1 
ATOM   5104  N  N   . TYR B  1 329 ? 79.715  54.445  110.921 1.00 31.24  ? 306 TYR B N   1 
ATOM   5105  C  CA  . TYR B  1 329 ? 78.685  55.022  111.792 1.00 29.18  ? 306 TYR B CA  1 
ATOM   5106  C  C   . TYR B  1 329 ? 78.045  56.311  111.256 1.00 36.39  ? 306 TYR B C   1 
ATOM   5107  O  O   . TYR B  1 329 ? 77.975  57.321  111.970 1.00 32.41  ? 306 TYR B O   1 
ATOM   5108  C  CB  . TYR B  1 329 ? 79.253  55.250  113.190 1.00 25.95  ? 306 TYR B CB  1 
ATOM   5109  C  CG  . TYR B  1 329 ? 80.017  54.052  113.703 1.00 33.29  ? 306 TYR B CG  1 
ATOM   5110  C  CD1 . TYR B  1 329 ? 79.395  53.091  114.481 1.00 37.54  ? 306 TYR B CD1 1 
ATOM   5111  C  CD2 . TYR B  1 329 ? 81.356  53.868  113.386 1.00 29.55  ? 306 TYR B CD2 1 
ATOM   5112  C  CE1 . TYR B  1 329 ? 80.086  51.985  114.936 1.00 38.95  ? 306 TYR B CE1 1 
ATOM   5113  C  CE2 . TYR B  1 329 ? 82.055  52.768  113.841 1.00 32.95  ? 306 TYR B CE2 1 
ATOM   5114  C  CZ  . TYR B  1 329 ? 81.413  51.828  114.617 1.00 35.07  ? 306 TYR B CZ  1 
ATOM   5115  O  OH  . TYR B  1 329 ? 82.097  50.726  115.075 1.00 39.75  ? 306 TYR B OH  1 
ATOM   5116  N  N   . PRO B  1 330 ? 77.555  56.271  110.003 1.00 32.99  ? 307 PRO B N   1 
ATOM   5117  C  CA  . PRO B  1 330 ? 76.996  57.460  109.356 1.00 30.74  ? 307 PRO B CA  1 
ATOM   5118  C  C   . PRO B  1 330 ? 75.975  58.184  110.233 1.00 34.25  ? 307 PRO B C   1 
ATOM   5119  O  O   . PRO B  1 330 ? 75.905  59.420  110.208 1.00 37.25  ? 307 PRO B O   1 
ATOM   5120  C  CB  . PRO B  1 330 ? 76.320  56.887  108.113 1.00 35.00  ? 307 PRO B CB  1 
ATOM   5121  C  CG  . PRO B  1 330 ? 77.096  55.660  107.805 1.00 33.54  ? 307 PRO B CG  1 
ATOM   5122  C  CD  . PRO B  1 330 ? 77.456  55.082  109.140 1.00 33.87  ? 307 PRO B CD  1 
ATOM   5123  N  N   . GLU B  1 331 ? 75.208  57.430  111.016 1.00 27.78  ? 308 GLU B N   1 
ATOM   5124  C  CA  . GLU B  1 331 ? 74.156  58.032  111.837 1.00 31.47  ? 308 GLU B CA  1 
ATOM   5125  C  C   . GLU B  1 331 ? 74.729  58.840  113.005 1.00 32.00  ? 308 GLU B C   1 
ATOM   5126  O  O   . GLU B  1 331 ? 74.341  59.988  113.216 1.00 38.17  ? 308 GLU B O   1 
ATOM   5127  C  CB  . GLU B  1 331 ? 73.144  56.973  112.329 1.00 41.09  ? 308 GLU B CB  1 
ATOM   5128  C  CG  . GLU B  1 331 ? 72.446  56.182  111.208 1.00 39.47  ? 308 GLU B CG  1 
ATOM   5129  C  CD  . GLU B  1 331 ? 73.302  55.033  110.673 1.00 44.94  ? 308 GLU B CD  1 
ATOM   5130  O  OE1 . GLU B  1 331 ? 74.171  54.541  111.425 1.00 45.40  ? 308 GLU B OE1 1 
ATOM   5131  O  OE2 . GLU B  1 331 ? 73.106  54.612  109.508 1.00 49.67  ? 308 GLU B OE2 1 
ATOM   5132  N  N   . VAL B  1 332 ? 75.649  58.241  113.759 1.00 32.50  ? 309 VAL B N   1 
ATOM   5133  C  CA  . VAL B  1 332 ? 76.354  58.968  114.810 1.00 31.86  ? 309 VAL B CA  1 
ATOM   5134  C  C   . VAL B  1 332 ? 77.173  60.096  114.176 1.00 33.47  ? 309 VAL B C   1 
ATOM   5135  O  O   . VAL B  1 332 ? 77.164  61.233  114.657 1.00 29.33  ? 309 VAL B O   1 
ATOM   5136  C  CB  . VAL B  1 332 ? 77.291  58.040  115.611 1.00 34.05  ? 309 VAL B CB  1 
ATOM   5137  C  CG1 . VAL B  1 332 ? 78.152  58.843  116.568 1.00 34.05  ? 309 VAL B CG1 1 
ATOM   5138  C  CG2 . VAL B  1 332 ? 76.488  57.024  116.376 1.00 45.11  ? 309 VAL B CG2 1 
ATOM   5139  N  N   . GLY B  1 333 ? 77.873  59.765  113.089 1.00 33.02  ? 310 GLY B N   1 
ATOM   5140  C  CA  . GLY B  1 333 ? 78.694  60.721  112.363 1.00 31.68  ? 310 GLY B CA  1 
ATOM   5141  C  C   . GLY B  1 333 ? 77.970  61.986  111.935 1.00 29.04  ? 310 GLY B C   1 
ATOM   5142  O  O   . GLY B  1 333 ? 78.438  63.095  112.197 1.00 27.54  ? 310 GLY B O   1 
ATOM   5143  N  N   . ALA B  1 334 ? 76.823  61.823  111.281 1.00 29.00  ? 311 ALA B N   1 
ATOM   5144  C  CA  . ALA B  1 334 ? 76.028  62.962  110.832 1.00 27.69  ? 311 ALA B CA  1 
ATOM   5145  C  C   . ALA B  1 334 ? 75.681  63.881  111.996 1.00 34.38  ? 311 ALA B C   1 
ATOM   5146  O  O   . ALA B  1 334 ? 75.773  65.112  111.892 1.00 36.10  ? 311 ALA B O   1 
ATOM   5147  C  CB  . ALA B  1 334 ? 74.759  62.479  110.134 1.00 31.16  ? 311 ALA B CB  1 
ATOM   5148  N  N   . HIS B  1 335 ? 75.288  63.272  113.108 1.00 32.69  ? 312 HIS B N   1 
ATOM   5149  C  CA  . HIS B  1 335 ? 74.953  64.018  114.317 1.00 35.65  ? 312 HIS B CA  1 
ATOM   5150  C  C   . HIS B  1 335 ? 76.089  64.867  114.898 1.00 33.32  ? 312 HIS B C   1 
ATOM   5151  O  O   . HIS B  1 335 ? 75.911  66.064  115.135 1.00 35.81  ? 312 HIS B O   1 
ATOM   5152  C  CB  . HIS B  1 335 ? 74.457  63.068  115.393 1.00 35.59  ? 312 HIS B CB  1 
ATOM   5153  C  CG  . HIS B  1 335 ? 73.004  62.771  115.294 1.00 38.12  ? 312 HIS B CG  1 
ATOM   5154  N  ND1 . HIS B  1 335 ? 72.043  63.614  115.807 1.00 42.69  ? 312 HIS B ND1 1 
ATOM   5155  C  CD2 . HIS B  1 335 ? 72.344  61.729  114.740 1.00 32.62  ? 312 HIS B CD2 1 
ATOM   5156  C  CE1 . HIS B  1 335 ? 70.850  63.100  115.576 1.00 38.06  ? 312 HIS B CE1 1 
ATOM   5157  N  NE2 . HIS B  1 335 ? 71.005  61.958  114.931 1.00 34.43  ? 312 HIS B NE2 1 
ATOM   5158  N  N   . VAL B  1 336 ? 77.234  64.252  115.175 1.00 26.10  ? 313 VAL B N   1 
ATOM   5159  C  CA  . VAL B  1 336 ? 78.354  65.013  115.741 1.00 32.22  ? 313 VAL B CA  1 
ATOM   5160  C  C   . VAL B  1 336 ? 78.964  65.991  114.734 1.00 31.37  ? 313 VAL B C   1 
ATOM   5161  O  O   . VAL B  1 336 ? 79.449  67.048  115.132 1.00 30.11  ? 313 VAL B O   1 
ATOM   5162  C  CB  . VAL B  1 336 ? 79.458  64.113  116.302 1.00 30.00  ? 313 VAL B CB  1 
ATOM   5163  C  CG1 . VAL B  1 336 ? 78.923  63.269  117.456 1.00 27.42  ? 313 VAL B CG1 1 
ATOM   5164  C  CG2 . VAL B  1 336 ? 80.026  63.240  115.197 1.00 21.01  ? 313 VAL B CG2 1 
ATOM   5165  N  N   . MET B  1 337 ? 78.924  65.645  113.442 1.00 33.22  ? 314 MET B N   1 
ATOM   5166  C  CA  . MET B  1 337 ? 79.393  66.544  112.377 1.00 25.40  ? 314 MET B CA  1 
ATOM   5167  C  C   . MET B  1 337 ? 78.638  67.873  112.345 1.00 33.05  ? 314 MET B C   1 
ATOM   5168  O  O   . MET B  1 337 ? 79.206  68.910  112.007 1.00 35.01  ? 314 MET B O   1 
ATOM   5169  C  CB  . MET B  1 337 ? 79.318  65.870  111.012 1.00 18.13  ? 314 MET B CB  1 
ATOM   5170  C  CG  . MET B  1 337 ? 80.401  64.834  110.779 1.00 22.01  ? 314 MET B CG  1 
ATOM   5171  S  SD  . MET B  1 337 ? 82.044  65.574  110.562 1.00 30.81  ? 314 MET B SD  1 
ATOM   5172  C  CE  . MET B  1 337 ? 82.087  65.794  108.775 1.00 20.86  ? 314 MET B CE  1 
ATOM   5173  N  N   . ARG B  1 338 ? 77.361  67.844  112.713 1.00 36.59  ? 315 ARG B N   1 
ATOM   5174  C  CA  . ARG B  1 338 ? 76.559  69.063  112.787 1.00 31.83  ? 315 ARG B CA  1 
ATOM   5175  C  C   . ARG B  1 338 ? 77.150  70.044  113.802 1.00 38.50  ? 315 ARG B C   1 
ATOM   5176  O  O   . ARG B  1 338 ? 76.930  71.248  113.696 1.00 40.93  ? 315 ARG B O   1 
ATOM   5177  C  CB  . ARG B  1 338 ? 75.106  68.730  113.166 1.00 31.64  ? 315 ARG B CB  1 
ATOM   5178  C  CG  . ARG B  1 338 ? 74.322  67.940  112.110 1.00 29.88  ? 315 ARG B CG  1 
ATOM   5179  C  CD  . ARG B  1 338 ? 74.028  68.807  110.871 1.00 36.62  ? 315 ARG B CD  1 
ATOM   5180  N  NE  . ARG B  1 338 ? 73.315  70.028  111.247 1.00 42.22  ? 315 ARG B NE  1 
ATOM   5181  C  CZ  . ARG B  1 338 ? 73.102  71.062  110.440 1.00 44.58  ? 315 ARG B CZ  1 
ATOM   5182  N  NH1 . ARG B  1 338 ? 73.547  71.040  109.187 1.00 41.90  ? 315 ARG B NH1 1 
ATOM   5183  N  NH2 . ARG B  1 338 ? 72.440  72.121  110.889 1.00 41.29  ? 315 ARG B NH2 1 
ATOM   5184  N  N   . VAL B  1 339 ? 77.894  69.532  114.786 1.00 32.88  ? 316 VAL B N   1 
ATOM   5185  C  CA  . VAL B  1 339 ? 78.504  70.392  115.807 1.00 31.98  ? 316 VAL B CA  1 
ATOM   5186  C  C   . VAL B  1 339 ? 80.031  70.333  115.825 1.00 32.72  ? 316 VAL B C   1 
ATOM   5187  O  O   . VAL B  1 339 ? 80.659  70.751  116.795 1.00 34.97  ? 316 VAL B O   1 
ATOM   5188  C  CB  . VAL B  1 339 ? 77.996  70.054  117.221 1.00 33.88  ? 316 VAL B CB  1 
ATOM   5189  C  CG1 . VAL B  1 339 ? 76.490  70.299  117.318 1.00 30.49  ? 316 VAL B CG1 1 
ATOM   5190  C  CG2 . VAL B  1 339 ? 78.325  68.620  117.553 1.00 26.68  ? 316 VAL B CG2 1 
ATOM   5191  N  N   . THR B  1 340 ? 80.626  69.814  114.758 1.00 34.44  ? 317 THR B N   1 
ATOM   5192  C  CA  . THR B  1 340 ? 82.083  69.791  114.649 1.00 29.79  ? 317 THR B CA  1 
ATOM   5193  C  C   . THR B  1 340 ? 82.624  71.014  113.889 1.00 29.49  ? 317 THR B C   1 
ATOM   5194  O  O   . THR B  1 340 ? 82.293  71.275  112.726 1.00 29.88  ? 317 THR B O   1 
ATOM   5195  C  CB  . THR B  1 340 ? 82.593  68.464  114.051 1.00 31.17  ? 317 THR B CB  1 
ATOM   5196  O  OG1 . THR B  1 340 ? 82.186  67.380  114.901 1.00 30.86  ? 317 THR B OG1 1 
ATOM   5197  C  CG2 . THR B  1 340 ? 84.111  68.465  113.936 1.00 21.92  ? 317 THR B CG2 1 
ATOM   5198  N  N   . GLU B  1 341 ? 83.459  71.767  114.583 1.00 28.62  ? 318 GLU B N   1 
ATOM   5199  C  CA  . GLU B  1 341 ? 83.928  73.051  114.108 1.00 25.69  ? 318 GLU B CA  1 
ATOM   5200  C  C   . GLU B  1 341 ? 84.682  72.941  112.770 1.00 29.91  ? 318 GLU B C   1 
ATOM   5201  O  O   . GLU B  1 341 ? 84.474  73.759  111.875 1.00 26.44  ? 318 GLU B O   1 
ATOM   5202  C  CB  . GLU B  1 341 ? 84.783  73.704  115.199 1.00 25.49  ? 318 GLU B CB  1 
ATOM   5203  C  CG  . GLU B  1 341 ? 85.527  74.962  114.774 1.00 51.04  ? 318 GLU B CG  1 
ATOM   5204  C  CD  . GLU B  1 341 ? 86.610  75.389  115.781 1.00 62.90  ? 318 GLU B CD  1 
ATOM   5205  O  OE1 . GLU B  1 341 ? 86.581  74.924  116.951 1.00 64.34  ? 318 GLU B OE1 1 
ATOM   5206  O  OE2 . GLU B  1 341 ? 87.495  76.185  115.390 1.00 60.50  ? 318 GLU B OE2 1 
ATOM   5207  N  N   . THR B  1 342 ? 85.545  71.934  112.637 1.00 24.81  ? 319 THR B N   1 
ATOM   5208  C  CA  . THR B  1 342 ? 86.308  71.731  111.402 1.00 24.58  ? 319 THR B CA  1 
ATOM   5209  C  C   . THR B  1 342 ? 85.703  70.622  110.522 1.00 28.00  ? 319 THR B C   1 
ATOM   5210  O  O   . THR B  1 342 ? 86.393  70.045  109.679 1.00 24.30  ? 319 THR B O   1 
ATOM   5211  C  CB  . THR B  1 342 ? 87.812  71.408  111.683 1.00 30.35  ? 319 THR B CB  1 
ATOM   5212  O  OG1 . THR B  1 342 ? 87.923  70.183  112.413 1.00 29.48  ? 319 THR B OG1 1 
ATOM   5213  C  CG2 . THR B  1 342 ? 88.510  72.540  112.483 1.00 28.33  ? 319 THR B CG2 1 
ATOM   5214  N  N   . ALA B  1 343 ? 84.425  70.309  110.730 1.00 23.59  ? 320 ALA B N   1 
ATOM   5215  C  CA  . ALA B  1 343 ? 83.769  69.267  109.945 1.00 21.15  ? 320 ALA B CA  1 
ATOM   5216  C  C   . ALA B  1 343 ? 84.194  69.357  108.482 1.00 23.94  ? 320 ALA B C   1 
ATOM   5217  O  O   . ALA B  1 343 ? 84.209  70.438  107.909 1.00 24.82  ? 320 ALA B O   1 
ATOM   5218  C  CB  . ALA B  1 343 ? 82.273  69.397  110.054 1.00 22.99  ? 320 ALA B CB  1 
ATOM   5219  N  N   . HIS B  1 344 ? 84.542  68.223  107.888 1.00 27.90  ? 321 HIS B N   1 
ATOM   5220  C  CA  . HIS B  1 344 ? 85.014  68.192  106.512 1.00 27.05  ? 321 HIS B CA  1 
ATOM   5221  C  C   . HIS B  1 344 ? 84.095  67.323  105.628 1.00 31.02  ? 321 HIS B C   1 
ATOM   5222  O  O   . HIS B  1 344 ? 83.153  67.851  105.047 1.00 30.06  ? 321 HIS B O   1 
ATOM   5223  C  CB  . HIS B  1 344 ? 86.468  67.727  106.457 1.00 27.22  ? 321 HIS B CB  1 
ATOM   5224  C  CG  . HIS B  1 344 ? 87.118  67.938  105.123 1.00 34.87  ? 321 HIS B CG  1 
ATOM   5225  N  ND1 . HIS B  1 344 ? 88.277  67.292  104.745 1.00 29.94  ? 321 HIS B ND1 1 
ATOM   5226  C  CD2 . HIS B  1 344 ? 86.769  68.725  104.077 1.00 26.91  ? 321 HIS B CD2 1 
ATOM   5227  C  CE1 . HIS B  1 344 ? 88.606  67.664  103.520 1.00 26.32  ? 321 HIS B CE1 1 
ATOM   5228  N  NE2 . HIS B  1 344 ? 87.717  68.543  103.098 1.00 19.46  ? 321 HIS B NE2 1 
ATOM   5229  N  N   . TRP B  1 345 ? 84.364  66.014  105.526 1.00 24.01  ? 322 TRP B N   1 
ATOM   5230  C  CA  . TRP B  1 345 ? 83.463  65.072  104.830 1.00 20.35  ? 322 TRP B CA  1 
ATOM   5231  C  C   . TRP B  1 345 ? 82.901  64.008  105.772 1.00 32.74  ? 322 TRP B C   1 
ATOM   5232  O  O   . TRP B  1 345 ? 83.556  63.610  106.737 1.00 37.30  ? 322 TRP B O   1 
ATOM   5233  C  CB  . TRP B  1 345 ? 84.178  64.306  103.715 1.00 17.63  ? 322 TRP B CB  1 
ATOM   5234  C  CG  . TRP B  1 345 ? 84.598  65.101  102.547 1.00 30.03  ? 322 TRP B CG  1 
ATOM   5235  C  CD1 . TRP B  1 345 ? 85.718  65.853  102.444 1.00 33.46  ? 322 TRP B CD1 1 
ATOM   5236  C  CD2 . TRP B  1 345 ? 83.927  65.200  101.287 1.00 35.86  ? 322 TRP B CD2 1 
ATOM   5237  N  NE1 . TRP B  1 345 ? 85.787  66.433  101.209 1.00 36.95  ? 322 TRP B NE1 1 
ATOM   5238  C  CE2 . TRP B  1 345 ? 84.702  66.046  100.474 1.00 34.28  ? 322 TRP B CE2 1 
ATOM   5239  C  CE3 . TRP B  1 345 ? 82.748  64.654  100.767 1.00 31.13  ? 322 TRP B CE3 1 
ATOM   5240  C  CZ2 . TRP B  1 345 ? 84.343  66.366  99.168  1.00 32.49  ? 322 TRP B CZ2 1 
ATOM   5241  C  CZ3 . TRP B  1 345 ? 82.387  64.979  99.461  1.00 24.64  ? 322 TRP B CZ3 1 
ATOM   5242  C  CH2 . TRP B  1 345 ? 83.186  65.822  98.680  1.00 35.99  ? 322 TRP B CH2 1 
ATOM   5243  N  N   . LEU B  1 346 ? 81.699  63.529  105.465 1.00 32.71  ? 323 LEU B N   1 
ATOM   5244  C  CA  . LEU B  1 346 ? 81.124  62.374  106.143 1.00 33.03  ? 323 LEU B CA  1 
ATOM   5245  C  C   . LEU B  1 346 ? 81.250  61.146  105.240 1.00 36.19  ? 323 LEU B C   1 
ATOM   5246  O  O   . LEU B  1 346 ? 80.857  61.170  104.074 1.00 40.08  ? 323 LEU B O   1 
ATOM   5247  C  CB  . LEU B  1 346 ? 79.661  62.631  106.512 1.00 30.39  ? 323 LEU B CB  1 
ATOM   5248  C  CG  . LEU B  1 346 ? 78.888  61.498  107.195 1.00 35.14  ? 323 LEU B CG  1 
ATOM   5249  C  CD1 . LEU B  1 346 ? 77.907  62.053  108.188 1.00 45.07  ? 323 LEU B CD1 1 
ATOM   5250  C  CD2 . LEU B  1 346 ? 78.147  60.651  106.184 1.00 45.30  ? 323 LEU B CD2 1 
ATOM   5251  N  N   . GLU B  1 347 ? 81.829  60.079  105.770 1.00 30.58  ? 324 GLU B N   1 
ATOM   5252  C  CA  . GLU B  1 347 ? 81.951  58.857  105.002 1.00 33.68  ? 324 GLU B CA  1 
ATOM   5253  C  C   . GLU B  1 347 ? 80.659  58.069  105.064 1.00 45.46  ? 324 GLU B C   1 
ATOM   5254  O  O   . GLU B  1 347 ? 80.279  57.568  106.124 1.00 47.36  ? 324 GLU B O   1 
ATOM   5255  C  CB  . GLU B  1 347 ? 83.081  57.998  105.541 1.00 32.91  ? 324 GLU B CB  1 
ATOM   5256  C  CG  . GLU B  1 347 ? 83.394  56.832  104.644 1.00 44.98  ? 324 GLU B CG  1 
ATOM   5257  C  CD  . GLU B  1 347 ? 84.187  55.770  105.347 1.00 47.85  ? 324 GLU B CD  1 
ATOM   5258  O  OE1 . GLU B  1 347 ? 85.343  55.515  104.941 1.00 53.03  ? 324 GLU B OE1 1 
ATOM   5259  O  OE2 . GLU B  1 347 ? 83.646  55.191  106.306 1.00 51.40  ? 324 GLU B OE2 1 
ATOM   5260  N  N   . TRP B  1 348 ? 79.985  57.954  103.926 1.00 49.53  ? 325 TRP B N   1 
ATOM   5261  C  CA  . TRP B  1 348 ? 78.719  57.231  103.872 1.00 46.06  ? 325 TRP B CA  1 
ATOM   5262  C  C   . TRP B  1 348 ? 78.836  55.828  103.272 1.00 40.45  ? 325 TRP B C   1 
ATOM   5263  O  O   . TRP B  1 348 ? 79.597  55.603  102.328 1.00 39.62  ? 325 TRP B O   1 
ATOM   5264  C  CB  . TRP B  1 348 ? 77.677  58.040  103.100 1.00 41.45  ? 325 TRP B CB  1 
ATOM   5265  C  CG  . TRP B  1 348 ? 76.342  57.367  103.039 1.00 43.60  ? 325 TRP B CG  1 
ATOM   5266  C  CD1 . TRP B  1 348 ? 75.335  57.468  103.947 1.00 40.94  ? 325 TRP B CD1 1 
ATOM   5267  C  CD2 . TRP B  1 348 ? 75.875  56.480  102.017 1.00 44.94  ? 325 TRP B CD2 1 
ATOM   5268  N  NE1 . TRP B  1 348 ? 74.267  56.706  103.558 1.00 42.09  ? 325 TRP B NE1 1 
ATOM   5269  C  CE2 . TRP B  1 348 ? 74.570  56.085  102.375 1.00 46.45  ? 325 TRP B CE2 1 
ATOM   5270  C  CE3 . TRP B  1 348 ? 76.432  55.984  100.831 1.00 46.24  ? 325 TRP B CE3 1 
ATOM   5271  C  CZ2 . TRP B  1 348 ? 73.804  55.218  101.586 1.00 40.77  ? 325 TRP B CZ2 1 
ATOM   5272  C  CZ3 . TRP B  1 348 ? 75.677  55.119  100.051 1.00 48.76  ? 325 TRP B CZ3 1 
ATOM   5273  C  CH2 . TRP B  1 348 ? 74.373  54.746  100.432 1.00 41.91  ? 325 TRP B CH2 1 
ATOM   5274  N  N   . GLN B  1 349 ? 78.078  54.892  103.839 1.00 38.77  ? 326 GLN B N   1 
ATOM   5275  C  CA  . GLN B  1 349 ? 77.902  53.558  103.261 1.00 42.15  ? 326 GLN B CA  1 
ATOM   5276  C  C   . GLN B  1 349 ? 76.642  52.892  103.837 1.00 45.01  ? 326 GLN B C   1 
ATOM   5277  O  O   . GLN B  1 349 ? 76.230  53.188  104.956 1.00 48.71  ? 326 GLN B O   1 
ATOM   5278  C  CB  . GLN B  1 349 ? 79.135  52.678  103.492 1.00 41.00  ? 326 GLN B CB  1 
ATOM   5279  C  CG  . GLN B  1 349 ? 79.179  52.005  104.846 1.00 53.93  ? 326 GLN B CG  1 
ATOM   5280  C  CD  . GLN B  1 349 ? 79.633  52.935  105.951 1.00 71.08  ? 326 GLN B CD  1 
ATOM   5281  O  OE1 . GLN B  1 349 ? 79.101  52.898  107.065 1.00 76.02  ? 326 GLN B OE1 1 
ATOM   5282  N  NE2 . GLN B  1 349 ? 80.634  53.765  105.657 1.00 73.66  ? 326 GLN B NE2 1 
ATOM   5283  N  N   . SER B  1 350 ? 76.027  51.994  103.078 1.00 38.24  ? 327 SER B N   1 
ATOM   5284  C  CA  . SER B  1 350 ? 74.758  51.409  103.501 1.00 39.54  ? 327 SER B CA  1 
ATOM   5285  C  C   . SER B  1 350 ? 74.932  50.009  104.094 1.00 43.31  ? 327 SER B C   1 
ATOM   5286  O  O   . SER B  1 350 ? 73.964  49.275  104.257 1.00 46.69  ? 327 SER B O   1 
ATOM   5287  C  CB  . SER B  1 350 ? 73.743  51.401  102.342 1.00 39.93  ? 327 SER B CB  1 
ATOM   5288  O  OG  . SER B  1 350 ? 74.330  50.989  101.110 1.00 38.18  ? 327 SER B OG  1 
ATOM   5289  N  N   . TRP B  1 351 ? 76.170  49.663  104.429 1.00 42.32  ? 328 TRP B N   1 
ATOM   5290  C  CA  . TRP B  1 351 ? 76.513  48.346  104.950 1.00 38.03  ? 328 TRP B CA  1 
ATOM   5291  C  C   . TRP B  1 351 ? 75.743  47.933  106.203 1.00 53.64  ? 328 TRP B C   1 
ATOM   5292  O  O   . TRP B  1 351 ? 75.693  46.751  106.545 1.00 56.86  ? 328 TRP B O   1 
ATOM   5293  C  CB  . TRP B  1 351 ? 78.002  48.293  105.265 1.00 41.65  ? 328 TRP B CB  1 
ATOM   5294  C  CG  . TRP B  1 351 ? 78.886  48.491  104.090 1.00 47.75  ? 328 TRP B CG  1 
ATOM   5295  C  CD1 . TRP B  1 351 ? 78.504  48.667  102.796 1.00 48.75  ? 328 TRP B CD1 1 
ATOM   5296  C  CD2 . TRP B  1 351 ? 80.317  48.530  104.097 1.00 54.06  ? 328 TRP B CD2 1 
ATOM   5297  N  NE1 . TRP B  1 351 ? 79.611  48.819  101.994 1.00 52.49  ? 328 TRP B NE1 1 
ATOM   5298  C  CE2 . TRP B  1 351 ? 80.736  48.738  102.771 1.00 52.81  ? 328 TRP B CE2 1 
ATOM   5299  C  CE3 . TRP B  1 351 ? 81.284  48.408  105.097 1.00 56.99  ? 328 TRP B CE3 1 
ATOM   5300  C  CZ2 . TRP B  1 351 ? 82.076  48.825  102.419 1.00 59.52  ? 328 TRP B CZ2 1 
ATOM   5301  C  CZ3 . TRP B  1 351 ? 82.613  48.498  104.745 1.00 58.56  ? 328 TRP B CZ3 1 
ATOM   5302  C  CH2 . TRP B  1 351 ? 82.999  48.702  103.418 1.00 59.55  ? 328 TRP B CH2 1 
ATOM   5303  N  N   . ALA B  1 352 ? 75.164  48.894  106.910 1.00 56.20  ? 329 ALA B N   1 
ATOM   5304  C  CA  . ALA B  1 352 ? 74.442  48.561  108.132 1.00 53.82  ? 329 ALA B CA  1 
ATOM   5305  C  C   . ALA B  1 352 ? 72.954  48.857  108.002 1.00 53.79  ? 329 ALA B C   1 
ATOM   5306  O  O   . ALA B  1 352 ? 72.197  48.699  108.961 1.00 55.81  ? 329 ALA B O   1 
ATOM   5307  C  CB  . ALA B  1 352 ? 75.034  49.298  109.318 1.00 48.86  ? 329 ALA B CB  1 
ATOM   5308  N  N   . ASP B  1 353 ? 72.540  49.281  106.810 1.00 53.18  ? 330 ASP B N   1 
ATOM   5309  C  CA  . ASP B  1 353 ? 71.141  49.640  106.550 1.00 59.32  ? 330 ASP B CA  1 
ATOM   5310  C  C   . ASP B  1 353 ? 70.099  48.543  106.864 1.00 57.66  ? 330 ASP B C   1 
ATOM   5311  O  O   . ASP B  1 353 ? 69.062  48.836  107.450 1.00 58.83  ? 330 ASP B O   1 
ATOM   5312  C  CB  . ASP B  1 353 ? 70.968  50.187  105.120 1.00 62.62  ? 330 ASP B CB  1 
ATOM   5313  C  CG  . ASP B  1 353 ? 71.310  51.679  105.009 1.00 66.53  ? 330 ASP B CG  1 
ATOM   5314  O  OD1 . ASP B  1 353 ? 71.918  52.226  105.957 1.00 71.18  ? 330 ASP B OD1 1 
ATOM   5315  O  OD2 . ASP B  1 353 ? 70.975  52.305  103.972 1.00 60.32  ? 330 ASP B OD2 1 
ATOM   5316  N  N   . PRO B  1 354 ? 70.372  47.283  106.475 1.00 56.60  ? 331 PRO B N   1 
ATOM   5317  C  CA  . PRO B  1 354 ? 69.441  46.174  106.723 1.00 55.41  ? 331 PRO B CA  1 
ATOM   5318  C  C   . PRO B  1 354 ? 68.854  46.129  108.135 1.00 58.13  ? 331 PRO B C   1 
ATOM   5319  O  O   . PRO B  1 354 ? 67.641  45.963  108.260 1.00 58.04  ? 331 PRO B O   1 
ATOM   5320  C  CB  . PRO B  1 354 ? 70.311  44.945  106.481 1.00 57.35  ? 331 PRO B CB  1 
ATOM   5321  C  CG  . PRO B  1 354 ? 71.240  45.385  105.401 1.00 55.65  ? 331 PRO B CG  1 
ATOM   5322  C  CD  . PRO B  1 354 ? 71.527  46.844  105.669 1.00 53.87  ? 331 PRO B CD  1 
ATOM   5323  N  N   . ILE B  1 355 ? 69.684  46.260  109.169 1.00 49.31  ? 332 ILE B N   1 
ATOM   5324  C  CA  . ILE B  1 355 ? 69.190  46.177  110.545 1.00 43.01  ? 332 ILE B CA  1 
ATOM   5325  C  C   . ILE B  1 355 ? 68.417  47.419  110.988 1.00 42.05  ? 332 ILE B C   1 
ATOM   5326  O  O   . ILE B  1 355 ? 67.853  47.440  112.081 1.00 41.95  ? 332 ILE B O   1 
ATOM   5327  C  CB  . ILE B  1 355 ? 70.324  45.942  111.557 1.00 49.65  ? 332 ILE B CB  1 
ATOM   5328  C  CG1 . ILE B  1 355 ? 71.331  47.089  111.488 1.00 52.87  ? 332 ILE B CG1 1 
ATOM   5329  C  CG2 . ILE B  1 355 ? 71.002  44.623  111.295 1.00 53.25  ? 332 ILE B CG2 1 
ATOM   5330  C  CD1 . ILE B  1 355 ? 72.145  47.255  112.737 1.00 54.50  ? 332 ILE B CD1 1 
ATOM   5331  N  N   . LEU B  1 356 ? 68.399  48.453  110.148 1.00 44.16  ? 333 LEU B N   1 
ATOM   5332  C  CA  . LEU B  1 356 ? 67.694  49.697  110.471 1.00 41.88  ? 333 LEU B CA  1 
ATOM   5333  C  C   . LEU B  1 356 ? 66.316  49.783  109.822 1.00 42.73  ? 333 LEU B C   1 
ATOM   5334  O  O   . LEU B  1 356 ? 66.159  49.482  108.631 1.00 41.12  ? 333 LEU B O   1 
ATOM   5335  C  CB  . LEU B  1 356 ? 68.511  50.914  110.031 1.00 48.02  ? 333 LEU B CB  1 
ATOM   5336  C  CG  . LEU B  1 356 ? 69.859  51.171  110.696 1.00 50.21  ? 333 LEU B CG  1 
ATOM   5337  C  CD1 . LEU B  1 356 ? 70.356  52.536  110.277 1.00 56.40  ? 333 LEU B CD1 1 
ATOM   5338  C  CD2 . LEU B  1 356 ? 69.752  51.091  112.212 1.00 50.20  ? 333 LEU B CD2 1 
ATOM   5339  N  N   . GLN B  1 357 ? 65.322  50.208  110.597 1.00 42.65  ? 334 GLN B N   1 
ATOM   5340  C  CA  . GLN B  1 357 ? 63.989  50.417  110.037 1.00 54.96  ? 334 GLN B CA  1 
ATOM   5341  C  C   . GLN B  1 357 ? 64.026  51.508  108.974 1.00 57.29  ? 334 GLN B C   1 
ATOM   5342  O  O   . GLN B  1 357 ? 63.692  51.259  107.811 1.00 55.33  ? 334 GLN B O   1 
ATOM   5343  C  CB  . GLN B  1 357 ? 62.961  50.736  111.123 1.00 56.03  ? 334 GLN B CB  1 
ATOM   5344  C  CG  . GLN B  1 357 ? 62.501  49.500  111.882 1.00 58.30  ? 334 GLN B CG  1 
ATOM   5345  C  CD  . GLN B  1 357 ? 61.503  49.819  112.973 1.00 55.36  ? 334 GLN B CD  1 
ATOM   5346  O  OE1 . GLN B  1 357 ? 60.686  50.736  112.840 1.00 52.08  ? 334 GLN B OE1 1 
ATOM   5347  N  NE2 . GLN B  1 357 ? 61.570  49.069  114.067 1.00 49.19  ? 334 GLN B NE2 1 
ATOM   5348  N  N   . GLU B  1 358 ? 64.434  52.711  109.367 1.00 50.91  ? 335 GLU B N   1 
ATOM   5349  C  CA  . GLU B  1 358 ? 64.663  53.763  108.386 1.00 57.94  ? 335 GLU B CA  1 
ATOM   5350  C  C   . GLU B  1 358 ? 66.029  54.435  108.505 1.00 55.35  ? 335 GLU B C   1 
ATOM   5351  O  O   . GLU B  1 358 ? 66.273  55.253  109.406 1.00 47.95  ? 335 GLU B O   1 
ATOM   5352  C  CB  . GLU B  1 358 ? 63.524  54.789  108.364 1.00 69.65  ? 335 GLU B CB  1 
ATOM   5353  C  CG  . GLU B  1 358 ? 63.114  55.346  109.707 1.00 83.54  ? 335 GLU B CG  1 
ATOM   5354  C  CD  . GLU B  1 358 ? 62.059  56.434  109.564 1.00 101.99 ? 335 GLU B CD  1 
ATOM   5355  O  OE1 . GLU B  1 358 ? 61.843  56.902  108.421 1.00 104.35 ? 335 GLU B OE1 1 
ATOM   5356  O  OE2 . GLU B  1 358 ? 61.447  56.819  110.587 1.00 109.39 ? 335 GLU B OE2 1 
ATOM   5357  N  N   . PRO B  1 359 ? 66.932  54.071  107.586 1.00 52.09  ? 336 PRO B N   1 
ATOM   5358  C  CA  . PRO B  1 359 ? 68.244  54.704  107.409 1.00 51.86  ? 336 PRO B CA  1 
ATOM   5359  C  C   . PRO B  1 359 ? 68.038  56.170  107.065 1.00 45.53  ? 336 PRO B C   1 
ATOM   5360  O  O   . PRO B  1 359 ? 66.945  56.535  106.633 1.00 47.85  ? 336 PRO B O   1 
ATOM   5361  C  CB  . PRO B  1 359 ? 68.837  53.960  106.212 1.00 52.31  ? 336 PRO B CB  1 
ATOM   5362  C  CG  . PRO B  1 359 ? 68.109  52.651  106.177 1.00 54.77  ? 336 PRO B CG  1 
ATOM   5363  C  CD  . PRO B  1 359 ? 66.719  52.957  106.651 1.00 48.28  ? 336 PRO B CD  1 
ATOM   5364  N  N   . TYR B  1 360 ? 69.051  57.004  107.262 1.00 43.66  ? 337 TYR B N   1 
ATOM   5365  C  CA  . TYR B  1 360 ? 68.866  58.428  107.017 1.00 39.68  ? 337 TYR B CA  1 
ATOM   5366  C  C   . TYR B  1 360 ? 68.668  58.673  105.537 1.00 40.95  ? 337 TYR B C   1 
ATOM   5367  O  O   . TYR B  1 360 ? 69.227  57.956  104.699 1.00 46.14  ? 337 TYR B O   1 
ATOM   5368  C  CB  . TYR B  1 360 ? 70.053  59.233  107.531 1.00 39.48  ? 337 TYR B CB  1 
ATOM   5369  C  CG  . TYR B  1 360 ? 70.147  59.313  109.037 1.00 38.01  ? 337 TYR B CG  1 
ATOM   5370  C  CD1 . TYR B  1 360 ? 69.256  58.626  109.854 1.00 38.55  ? 337 TYR B CD1 1 
ATOM   5371  C  CD2 . TYR B  1 360 ? 71.128  60.089  109.642 1.00 38.09  ? 337 TYR B CD2 1 
ATOM   5372  C  CE1 . TYR B  1 360 ? 69.350  58.700  111.240 1.00 40.19  ? 337 TYR B CE1 1 
ATOM   5373  C  CE2 . TYR B  1 360 ? 71.229  60.180  111.011 1.00 36.24  ? 337 TYR B CE2 1 
ATOM   5374  C  CZ  . TYR B  1 360 ? 70.344  59.484  111.807 1.00 42.75  ? 337 TYR B CZ  1 
ATOM   5375  O  OH  . TYR B  1 360 ? 70.467  59.582  113.163 1.00 31.01  ? 337 TYR B OH  1 
ATOM   5376  N  N   . ALA B  1 361 ? 67.872  59.686  105.215 1.00 40.52  ? 338 ALA B N   1 
ATOM   5377  C  CA  . ALA B  1 361 ? 67.629  60.054  103.819 1.00 46.35  ? 338 ALA B CA  1 
ATOM   5378  C  C   . ALA B  1 361 ? 68.843  60.747  103.207 1.00 50.63  ? 338 ALA B C   1 
ATOM   5379  O  O   . ALA B  1 361 ? 69.518  61.534  103.878 1.00 51.66  ? 338 ALA B O   1 
ATOM   5380  C  CB  . ALA B  1 361 ? 66.411  60.963  103.719 1.00 42.18  ? 338 ALA B CB  1 
ATOM   5381  N  N   . LEU B  1 362 ? 69.116  60.455  101.937 1.00 48.20  ? 339 LEU B N   1 
ATOM   5382  C  CA  . LEU B  1 362 ? 70.150  61.168  101.191 1.00 45.62  ? 339 LEU B CA  1 
ATOM   5383  C  C   . LEU B  1 362 ? 69.538  62.233  100.292 1.00 45.33  ? 339 LEU B C   1 
ATOM   5384  O  O   . LEU B  1 362 ? 68.446  62.055  99.773  1.00 44.96  ? 339 LEU B O   1 
ATOM   5385  C  CB  . LEU B  1 362 ? 71.000  60.201  100.364 1.00 38.08  ? 339 LEU B CB  1 
ATOM   5386  C  CG  . LEU B  1 362 ? 72.085  59.506  101.181 1.00 38.16  ? 339 LEU B CG  1 
ATOM   5387  C  CD1 . LEU B  1 362 ? 72.741  58.402  100.392 1.00 45.64  ? 339 LEU B CD1 1 
ATOM   5388  C  CD2 . LEU B  1 362 ? 73.121  60.512  101.651 1.00 37.42  ? 339 LEU B CD2 1 
ATOM   5389  N  N   . SER B  1 363 ? 70.248  63.340  100.111 1.00 49.43  ? 340 SER B N   1 
ATOM   5390  C  CA  . SER B  1 363 ? 69.766  64.422  99.263  1.00 44.43  ? 340 SER B CA  1 
ATOM   5391  C  C   . SER B  1 363 ? 70.921  65.207  98.651  1.00 48.96  ? 340 SER B C   1 
ATOM   5392  O  O   . SER B  1 363 ? 71.588  65.984  99.331  1.00 47.16  ? 340 SER B O   1 
ATOM   5393  C  CB  . SER B  1 363 ? 68.855  65.361  100.053 1.00 47.65  ? 340 SER B CB  1 
ATOM   5394  O  OG  . SER B  1 363 ? 68.565  66.535  99.311  1.00 53.15  ? 340 SER B OG  1 
ATOM   5395  N  N   . ASP B  1 364 ? 71.142  65.000  97.357  1.00 53.57  ? 341 ASP B N   1 
ATOM   5396  C  CA  . ASP B  1 364 ? 72.186  65.698  96.614  1.00 49.02  ? 341 ASP B CA  1 
ATOM   5397  C  C   . ASP B  1 364 ? 73.572  65.437  97.202  1.00 45.29  ? 341 ASP B C   1 
ATOM   5398  O  O   . ASP B  1 364 ? 74.440  66.294  97.149  1.00 47.77  ? 341 ASP B O   1 
ATOM   5399  C  CB  . ASP B  1 364 ? 71.895  67.205  96.535  1.00 53.95  ? 341 ASP B CB  1 
ATOM   5400  C  CG  . ASP B  1 364 ? 70.679  67.529  95.660  1.00 67.47  ? 341 ASP B CG  1 
ATOM   5401  O  OD1 . ASP B  1 364 ? 70.376  66.745  94.731  1.00 66.47  ? 341 ASP B OD1 1 
ATOM   5402  O  OD2 . ASP B  1 364 ? 70.027  68.573  95.898  1.00 72.02  ? 341 ASP B OD2 1 
ATOM   5403  N  N   . GLY B  1 365 ? 73.769  64.242  97.752  1.00 44.77  ? 342 GLY B N   1 
ATOM   5404  C  CA  . GLY B  1 365 ? 75.044  63.861  98.331  1.00 42.51  ? 342 GLY B CA  1 
ATOM   5405  C  C   . GLY B  1 365 ? 75.155  64.128  99.825  1.00 41.99  ? 342 GLY B C   1 
ATOM   5406  O  O   . GLY B  1 365 ? 76.096  63.671  100.466 1.00 43.94  ? 342 GLY B O   1 
ATOM   5407  N  N   . ASP B  1 366 ? 74.204  64.876  100.376 1.00 32.69  ? 343 ASP B N   1 
ATOM   5408  C  CA  . ASP B  1 366 ? 74.180  65.168  101.806 1.00 41.44  ? 343 ASP B CA  1 
ATOM   5409  C  C   . ASP B  1 366 ? 73.341  64.144  102.558 1.00 45.18  ? 343 ASP B C   1 
ATOM   5410  O  O   . ASP B  1 366 ? 72.213  63.847  102.163 1.00 41.96  ? 343 ASP B O   1 
ATOM   5411  C  CB  . ASP B  1 366 ? 73.578  66.554  102.083 1.00 42.58  ? 343 ASP B CB  1 
ATOM   5412  C  CG  . ASP B  1 366 ? 74.319  67.680  101.385 1.00 51.53  ? 343 ASP B CG  1 
ATOM   5413  O  OD1 . ASP B  1 366 ? 75.525  67.522  101.096 1.00 50.90  ? 343 ASP B OD1 1 
ATOM   5414  O  OD2 . ASP B  1 366 ? 73.685  68.733  101.138 1.00 54.84  ? 343 ASP B OD2 1 
ATOM   5415  N  N   . LEU B  1 367 ? 73.879  63.623  103.655 1.00 43.87  ? 344 LEU B N   1 
ATOM   5416  C  CA  . LEU B  1 367 ? 73.086  62.802  104.556 1.00 34.79  ? 344 LEU B CA  1 
ATOM   5417  C  C   . LEU B  1 367 ? 72.240  63.737  105.396 1.00 36.41  ? 344 LEU B C   1 
ATOM   5418  O  O   . LEU B  1 367 ? 72.709  64.790  105.824 1.00 45.01  ? 344 LEU B O   1 
ATOM   5419  C  CB  . LEU B  1 367 ? 73.976  61.950  105.446 1.00 30.62  ? 344 LEU B CB  1 
ATOM   5420  C  CG  . LEU B  1 367 ? 73.231  60.816  106.130 1.00 39.86  ? 344 LEU B CG  1 
ATOM   5421  C  CD1 . LEU B  1 367 ? 72.777  59.809  105.080 1.00 40.90  ? 344 LEU B CD1 1 
ATOM   5422  C  CD2 . LEU B  1 367 ? 74.106  60.148  107.182 1.00 38.22  ? 344 LEU B CD2 1 
ATOM   5423  N  N   . ILE B  1 368 ? 70.986  63.367  105.622 1.00 43.88  ? 345 ILE B N   1 
ATOM   5424  C  CA  . ILE B  1 368 ? 70.046  64.264  106.288 1.00 42.76  ? 345 ILE B CA  1 
ATOM   5425  C  C   . ILE B  1 368 ? 69.706  63.811  107.701 1.00 39.20  ? 345 ILE B C   1 
ATOM   5426  O  O   . ILE B  1 368 ? 69.091  62.767  107.894 1.00 41.28  ? 345 ILE B O   1 
ATOM   5427  C  CB  . ILE B  1 368 ? 68.752  64.412  105.476 1.00 45.44  ? 345 ILE B CB  1 
ATOM   5428  C  CG1 . ILE B  1 368 ? 69.058  65.100  104.140 1.00 43.45  ? 345 ILE B CG1 1 
ATOM   5429  C  CG2 . ILE B  1 368 ? 67.708  65.179  106.283 1.00 40.08  ? 345 ILE B CG2 1 
ATOM   5430  C  CD1 . ILE B  1 368 ? 67.875  65.800  103.536 1.00 52.40  ? 345 ILE B CD1 1 
ATOM   5431  N  N   . VAL B  1 369 ? 70.122  64.590  108.690 1.00 34.42  ? 346 VAL B N   1 
ATOM   5432  C  CA  . VAL B  1 369 ? 69.835  64.243  110.070 1.00 34.39  ? 346 VAL B CA  1 
ATOM   5433  C  C   . VAL B  1 369 ? 68.349  64.421  110.333 1.00 38.21  ? 346 VAL B C   1 
ATOM   5434  O  O   . VAL B  1 369 ? 67.827  65.530  110.232 1.00 42.37  ? 346 VAL B O   1 
ATOM   5435  C  CB  . VAL B  1 369 ? 70.653  65.098  111.058 1.00 39.64  ? 346 VAL B CB  1 
ATOM   5436  C  CG1 . VAL B  1 369 ? 70.296  64.744  112.507 1.00 41.29  ? 346 VAL B CG1 1 
ATOM   5437  C  CG2 . VAL B  1 369 ? 72.135  64.900  110.813 1.00 35.84  ? 346 VAL B CG2 1 
ATOM   5438  N  N   . PRO B  1 370 ? 67.664  63.319  110.671 1.00 44.37  ? 347 PRO B N   1 
ATOM   5439  C  CA  . PRO B  1 370 ? 66.222  63.311  110.917 1.00 46.36  ? 347 PRO B CA  1 
ATOM   5440  C  C   . PRO B  1 370 ? 65.897  63.941  112.263 1.00 50.99  ? 347 PRO B C   1 
ATOM   5441  O  O   . PRO B  1 370 ? 66.632  63.750  113.235 1.00 47.12  ? 347 PRO B O   1 
ATOM   5442  C  CB  . PRO B  1 370 ? 65.891  61.825  110.941 1.00 45.14  ? 347 PRO B CB  1 
ATOM   5443  C  CG  . PRO B  1 370 ? 67.133  61.194  111.449 1.00 41.28  ? 347 PRO B CG  1 
ATOM   5444  C  CD  . PRO B  1 370 ? 68.269  61.996  110.903 1.00 41.09  ? 347 PRO B CD  1 
ATOM   5445  N  N   . ASP B  1 371 ? 64.810  64.698  112.315 1.00 52.25  ? 348 ASP B N   1 
ATOM   5446  C  CA  . ASP B  1 371 ? 64.418  65.341  113.554 1.00 51.92  ? 348 ASP B CA  1 
ATOM   5447  C  C   . ASP B  1 371 ? 63.693  64.364  114.484 1.00 48.10  ? 348 ASP B C   1 
ATOM   5448  O  O   . ASP B  1 371 ? 62.508  64.523  114.758 1.00 44.84  ? 348 ASP B O   1 
ATOM   5449  C  CB  . ASP B  1 371 ? 63.546  66.561  113.271 1.00 56.71  ? 348 ASP B CB  1 
ATOM   5450  C  CG  . ASP B  1 371 ? 63.430  67.476  114.475 1.00 69.64  ? 348 ASP B CG  1 
ATOM   5451  O  OD1 . ASP B  1 371 ? 63.465  66.964  115.616 1.00 65.68  ? 348 ASP B OD1 1 
ATOM   5452  O  OD2 . ASP B  1 371 ? 63.322  68.706  114.282 1.00 79.57  ? 348 ASP B OD2 1 
ATOM   5453  N  N   . LYS B  1 372 ? 64.425  63.362  114.959 1.00 49.64  ? 349 LYS B N   1 
ATOM   5454  C  CA  . LYS B  1 372 ? 63.921  62.366  115.900 1.00 44.79  ? 349 LYS B CA  1 
ATOM   5455  C  C   . LYS B  1 372 ? 64.870  62.266  117.098 1.00 49.33  ? 349 LYS B C   1 
ATOM   5456  O  O   . LYS B  1 372 ? 66.065  62.511  116.965 1.00 59.50  ? 349 LYS B O   1 
ATOM   5457  C  CB  . LYS B  1 372 ? 63.835  61.004  115.216 1.00 43.81  ? 349 LYS B CB  1 
ATOM   5458  C  CG  . LYS B  1 372 ? 63.268  61.045  113.812 1.00 52.70  ? 349 LYS B CG  1 
ATOM   5459  C  CD  . LYS B  1 372 ? 62.872  59.654  113.323 1.00 62.09  ? 349 LYS B CD  1 
ATOM   5460  C  CE  . LYS B  1 372 ? 63.990  58.641  113.517 1.00 66.40  ? 349 LYS B CE  1 
ATOM   5461  N  NZ  . LYS B  1 372 ? 63.581  57.277  113.070 1.00 68.60  ? 349 LYS B NZ  1 
ATOM   5462  N  N   . PRO B  1 373 ? 64.348  61.883  118.270 1.00 49.70  ? 350 PRO B N   1 
ATOM   5463  C  CA  . PRO B  1 373 ? 65.135  61.844  119.513 1.00 51.93  ? 350 PRO B CA  1 
ATOM   5464  C  C   . PRO B  1 373 ? 66.283  60.835  119.461 1.00 45.99  ? 350 PRO B C   1 
ATOM   5465  O  O   . PRO B  1 373 ? 66.127  59.774  118.866 1.00 44.32  ? 350 PRO B O   1 
ATOM   5466  C  CB  . PRO B  1 373 ? 64.108  61.415  120.571 1.00 54.18  ? 350 PRO B CB  1 
ATOM   5467  C  CG  . PRO B  1 373 ? 62.771  61.699  119.949 1.00 54.73  ? 350 PRO B CG  1 
ATOM   5468  C  CD  . PRO B  1 373 ? 62.962  61.442  118.488 1.00 50.12  ? 350 PRO B CD  1 
ATOM   5469  N  N   . GLY B  1 374 ? 67.416  61.167  120.078 1.00 40.67  ? 351 GLY B N   1 
ATOM   5470  C  CA  . GLY B  1 374 ? 68.600  60.328  120.005 1.00 35.62  ? 351 GLY B CA  1 
ATOM   5471  C  C   . GLY B  1 374 ? 69.191  60.281  118.601 1.00 36.01  ? 351 GLY B C   1 
ATOM   5472  O  O   . GLY B  1 374 ? 69.181  61.270  117.875 1.00 36.18  ? 351 GLY B O   1 
ATOM   5473  N  N   . LEU B  1 375 ? 69.703  59.117  118.222 1.00 36.01  ? 352 LEU B N   1 
ATOM   5474  C  CA  . LEU B  1 375 ? 70.145  58.862  116.859 1.00 42.85  ? 352 LEU B CA  1 
ATOM   5475  C  C   . LEU B  1 375 ? 68.970  58.458  115.976 1.00 51.75  ? 352 LEU B C   1 
ATOM   5476  O  O   . LEU B  1 375 ? 69.130  58.269  114.774 1.00 47.14  ? 352 LEU B O   1 
ATOM   5477  C  CB  . LEU B  1 375 ? 71.167  57.722  116.847 1.00 41.02  ? 352 LEU B CB  1 
ATOM   5478  C  CG  . LEU B  1 375 ? 72.369  57.854  117.779 1.00 35.14  ? 352 LEU B CG  1 
ATOM   5479  C  CD1 . LEU B  1 375 ? 73.070  56.504  117.938 1.00 28.44  ? 352 LEU B CD1 1 
ATOM   5480  C  CD2 . LEU B  1 375 ? 73.309  58.927  117.251 1.00 28.28  ? 352 LEU B CD2 1 
ATOM   5481  N  N   . GLY B  1 376 ? 67.799  58.289  116.581 1.00 57.14  ? 353 GLY B N   1 
ATOM   5482  C  CA  . GLY B  1 376 ? 66.626  57.837  115.854 1.00 51.44  ? 353 GLY B CA  1 
ATOM   5483  C  C   . GLY B  1 376 ? 66.794  56.471  115.204 1.00 47.87  ? 353 GLY B C   1 
ATOM   5484  O  O   . GLY B  1 376 ? 66.398  56.256  114.058 1.00 44.48  ? 353 GLY B O   1 
ATOM   5485  N  N   . LEU B  1 377 ? 67.390  55.536  115.930 1.00 47.11  ? 354 LEU B N   1 
ATOM   5486  C  CA  . LEU B  1 377 ? 67.483  54.169  115.441 1.00 42.31  ? 354 LEU B CA  1 
ATOM   5487  C  C   . LEU B  1 377 ? 66.377  53.295  116.024 1.00 49.99  ? 354 LEU B C   1 
ATOM   5488  O  O   . LEU B  1 377 ? 66.086  53.353  117.227 1.00 51.19  ? 354 LEU B O   1 
ATOM   5489  C  CB  . LEU B  1 377 ? 68.837  53.552  115.793 1.00 37.25  ? 354 LEU B CB  1 
ATOM   5490  C  CG  . LEU B  1 377 ? 70.079  54.335  115.382 1.00 41.73  ? 354 LEU B CG  1 
ATOM   5491  C  CD1 . LEU B  1 377 ? 71.348  53.626  115.857 1.00 42.01  ? 354 LEU B CD1 1 
ATOM   5492  C  CD2 . LEU B  1 377 ? 70.087  54.550  113.875 1.00 44.34  ? 354 LEU B CD2 1 
ATOM   5493  N  N   . ASP B  1 378 ? 65.763  52.495  115.159 1.00 43.43  ? 355 ASP B N   1 
ATOM   5494  C  CA  . ASP B  1 378 ? 64.915  51.389  115.592 1.00 48.28  ? 355 ASP B CA  1 
ATOM   5495  C  C   . ASP B  1 378 ? 65.307  50.164  114.783 1.00 49.17  ? 355 ASP B C   1 
ATOM   5496  O  O   . ASP B  1 378 ? 65.384  50.220  113.550 1.00 49.05  ? 355 ASP B O   1 
ATOM   5497  C  CB  . ASP B  1 378 ? 63.441  51.703  115.370 1.00 46.69  ? 355 ASP B CB  1 
ATOM   5498  C  CG  . ASP B  1 378 ? 63.033  53.014  115.985 1.00 56.10  ? 355 ASP B CG  1 
ATOM   5499  O  OD1 . ASP B  1 378 ? 63.045  54.037  115.258 1.00 61.05  ? 355 ASP B OD1 1 
ATOM   5500  O  OD2 . ASP B  1 378 ? 62.703  53.018  117.194 1.00 58.07  ? 355 ASP B OD2 1 
ATOM   5501  N  N   . TRP B  1 379 ? 65.573  49.061  115.472 1.00 43.49  ? 356 TRP B N   1 
ATOM   5502  C  CA  . TRP B  1 379 ? 66.029  47.862  114.788 1.00 45.96  ? 356 TRP B CA  1 
ATOM   5503  C  C   . TRP B  1 379 ? 64.903  47.257  113.950 1.00 54.47  ? 356 TRP B C   1 
ATOM   5504  O  O   . TRP B  1 379 ? 63.719  47.396  114.278 1.00 53.57  ? 356 TRP B O   1 
ATOM   5505  C  CB  . TRP B  1 379 ? 66.535  46.829  115.791 1.00 51.01  ? 356 TRP B CB  1 
ATOM   5506  C  CG  . TRP B  1 379 ? 67.476  47.351  116.839 1.00 60.07  ? 356 TRP B CG  1 
ATOM   5507  C  CD1 . TRP B  1 379 ? 67.360  47.201  118.195 1.00 64.96  ? 356 TRP B CD1 1 
ATOM   5508  C  CD2 . TRP B  1 379 ? 68.686  48.089  116.624 1.00 61.33  ? 356 TRP B CD2 1 
ATOM   5509  N  NE1 . TRP B  1 379 ? 68.423  47.797  118.835 1.00 61.36  ? 356 TRP B NE1 1 
ATOM   5510  C  CE2 . TRP B  1 379 ? 69.248  48.353  117.893 1.00 60.85  ? 356 TRP B CE2 1 
ATOM   5511  C  CE3 . TRP B  1 379 ? 69.346  48.557  115.483 1.00 53.45  ? 356 TRP B CE3 1 
ATOM   5512  C  CZ2 . TRP B  1 379 ? 70.434  49.061  118.050 1.00 54.50  ? 356 TRP B CZ2 1 
ATOM   5513  C  CZ3 . TRP B  1 379 ? 70.518  49.258  115.641 1.00 50.32  ? 356 TRP B CZ3 1 
ATOM   5514  C  CH2 . TRP B  1 379 ? 71.054  49.502  116.914 1.00 52.24  ? 356 TRP B CH2 1 
ATOM   5515  N  N   . ASP B  1 380 ? 65.282  46.607  112.855 1.00 58.55  ? 357 ASP B N   1 
ATOM   5516  C  CA  . ASP B  1 380 ? 64.370  45.785  112.062 1.00 57.85  ? 357 ASP B CA  1 
ATOM   5517  C  C   . ASP B  1 380 ? 64.520  44.349  112.575 1.00 54.99  ? 357 ASP B C   1 
ATOM   5518  O  O   . ASP B  1 380 ? 65.394  43.596  112.115 1.00 45.64  ? 357 ASP B O   1 
ATOM   5519  C  CB  . ASP B  1 380 ? 64.751  45.878  110.582 1.00 55.12  ? 357 ASP B CB  1 
ATOM   5520  C  CG  . ASP B  1 380 ? 63.833  45.076  109.674 1.00 57.59  ? 357 ASP B CG  1 
ATOM   5521  O  OD1 . ASP B  1 380 ? 63.128  45.699  108.854 1.00 62.54  ? 357 ASP B OD1 1 
ATOM   5522  O  OD2 . ASP B  1 380 ? 63.830  43.831  109.760 1.00 57.89  ? 357 ASP B OD2 1 
ATOM   5523  N  N   . GLU B  1 381 ? 63.683  43.975  113.542 1.00 51.89  ? 358 GLU B N   1 
ATOM   5524  C  CA  . GLU B  1 381 ? 63.892  42.725  114.276 1.00 53.53  ? 358 GLU B CA  1 
ATOM   5525  C  C   . GLU B  1 381 ? 63.784  41.449  113.415 1.00 56.21  ? 358 GLU B C   1 
ATOM   5526  O  O   . GLU B  1 381 ? 64.301  40.386  113.798 1.00 48.01  ? 358 GLU B O   1 
ATOM   5527  C  CB  . GLU B  1 381 ? 62.984  42.663  115.507 1.00 50.87  ? 358 GLU B CB  1 
ATOM   5528  C  CG  . GLU B  1 381 ? 63.217  43.796  116.518 1.00 49.20  ? 358 GLU B CG  1 
ATOM   5529  C  CD  . GLU B  1 381 ? 64.494  43.639  117.359 1.00 55.50  ? 358 GLU B CD  1 
ATOM   5530  O  OE1 . GLU B  1 381 ? 65.371  42.818  117.012 1.00 51.33  ? 358 GLU B OE1 1 
ATOM   5531  O  OE2 . GLU B  1 381 ? 64.620  44.353  118.383 1.00 59.29  ? 358 GLU B OE2 1 
ATOM   5532  N  N   . ASP B  1 382 ? 63.137  41.571  112.251 1.00 59.31  ? 359 ASP B N   1 
ATOM   5533  C  CA  . ASP B  1 382 ? 63.046  40.482  111.269 1.00 62.44  ? 359 ASP B CA  1 
ATOM   5534  C  C   . ASP B  1 382 ? 64.398  40.134  110.642 1.00 61.24  ? 359 ASP B C   1 
ATOM   5535  O  O   . ASP B  1 382 ? 64.795  38.964  110.576 1.00 54.01  ? 359 ASP B O   1 
ATOM   5536  C  CB  . ASP B  1 382 ? 62.061  40.846  110.154 1.00 74.30  ? 359 ASP B CB  1 
ATOM   5537  C  CG  . ASP B  1 382 ? 60.606  40.709  110.579 1.00 84.09  ? 359 ASP B CG  1 
ATOM   5538  O  OD1 . ASP B  1 382 ? 60.293  39.807  111.392 1.00 82.46  ? 359 ASP B OD1 1 
ATOM   5539  O  OD2 . ASP B  1 382 ? 59.775  41.506  110.088 1.00 87.92  ? 359 ASP B OD2 1 
ATOM   5540  N  N   . VAL B  1 383 ? 65.093  41.163  110.163 1.00 62.18  ? 360 VAL B N   1 
ATOM   5541  C  CA  . VAL B  1 383 ? 66.414  40.992  109.583 1.00 50.06  ? 360 VAL B CA  1 
ATOM   5542  C  C   . VAL B  1 383 ? 67.405  40.699  110.698 1.00 47.26  ? 360 VAL B C   1 
ATOM   5543  O  O   . VAL B  1 383 ? 68.363  39.935  110.515 1.00 48.99  ? 360 VAL B O   1 
ATOM   5544  C  CB  . VAL B  1 383 ? 66.858  42.241  108.805 1.00 53.99  ? 360 VAL B CB  1 
ATOM   5545  C  CG1 . VAL B  1 383 ? 68.114  41.942  108.013 1.00 58.57  ? 360 VAL B CG1 1 
ATOM   5546  C  CG2 . VAL B  1 383 ? 65.750  42.711  107.869 1.00 48.89  ? 360 VAL B CG2 1 
ATOM   5547  N  N   . VAL B  1 384 ? 67.169  41.298  111.861 1.00 40.94  ? 361 VAL B N   1 
ATOM   5548  C  CA  . VAL B  1 384 ? 67.988  40.991  113.026 1.00 48.49  ? 361 VAL B CA  1 
ATOM   5549  C  C   . VAL B  1 384 ? 67.943  39.492  113.284 1.00 50.86  ? 361 VAL B C   1 
ATOM   5550  O  O   . VAL B  1 384 ? 68.981  38.851  113.437 1.00 51.08  ? 361 VAL B O   1 
ATOM   5551  C  CB  . VAL B  1 384 ? 67.535  41.758  114.292 1.00 52.65  ? 361 VAL B CB  1 
ATOM   5552  C  CG1 . VAL B  1 384 ? 68.232  41.210  115.515 1.00 44.40  ? 361 VAL B CG1 1 
ATOM   5553  C  CG2 . VAL B  1 384 ? 67.821  43.243  114.153 1.00 54.67  ? 361 VAL B CG2 1 
ATOM   5554  N  N   . ALA B  1 385 ? 66.731  38.935  113.300 1.00 58.30  ? 362 ALA B N   1 
ATOM   5555  C  CA  . ALA B  1 385 ? 66.526  37.506  113.558 1.00 48.26  ? 362 ALA B CA  1 
ATOM   5556  C  C   . ALA B  1 385 ? 67.052  36.587  112.451 1.00 43.25  ? 362 ALA B C   1 
ATOM   5557  O  O   . ALA B  1 385 ? 67.546  35.493  112.735 1.00 42.73  ? 362 ALA B O   1 
ATOM   5558  C  CB  . ALA B  1 385 ? 65.057  37.220  113.834 1.00 43.46  ? 362 ALA B CB  1 
ATOM   5559  N  N   . ALA B  1 386 ? 66.948  37.033  111.199 1.00 40.61  ? 363 ALA B N   1 
ATOM   5560  C  CA  . ALA B  1 386 ? 67.424  36.254  110.053 1.00 40.11  ? 363 ALA B CA  1 
ATOM   5561  C  C   . ALA B  1 386 ? 68.943  36.125  110.035 1.00 54.26  ? 363 ALA B C   1 
ATOM   5562  O  O   . ALA B  1 386 ? 69.502  35.269  109.329 1.00 51.87  ? 363 ALA B O   1 
ATOM   5563  C  CB  . ALA B  1 386 ? 66.940  36.885  108.735 1.00 34.69  ? 363 ALA B CB  1 
ATOM   5564  N  N   . ASN B  1 387 ? 69.605  36.980  110.813 1.00 57.70  ? 364 ASN B N   1 
ATOM   5565  C  CA  . ASN B  1 387 ? 71.049  37.114  110.732 1.00 49.13  ? 364 ASN B CA  1 
ATOM   5566  C  C   . ASN B  1 387 ? 71.791  36.994  112.056 1.00 50.45  ? 364 ASN B C   1 
ATOM   5567  O  O   . ASN B  1 387 ? 73.024  37.049  112.082 1.00 52.73  ? 364 ASN B O   1 
ATOM   5568  C  CB  . ASN B  1 387 ? 71.402  38.435  110.054 1.00 46.28  ? 364 ASN B CB  1 
ATOM   5569  C  CG  . ASN B  1 387 ? 70.957  38.481  108.617 1.00 44.23  ? 364 ASN B CG  1 
ATOM   5570  O  OD1 . ASN B  1 387 ? 71.639  37.966  107.731 1.00 43.11  ? 364 ASN B OD1 1 
ATOM   5571  N  ND2 . ASN B  1 387 ? 69.808  39.100  108.371 1.00 42.87  ? 364 ASN B ND2 1 
ATOM   5572  N  N   . LEU B  1 388 ? 71.051  36.827  113.150 1.00 45.81  ? 365 LEU B N   1 
ATOM   5573  C  CA  . LEU B  1 388 ? 71.664  36.725  114.472 1.00 44.19  ? 365 LEU B CA  1 
ATOM   5574  C  C   . LEU B  1 388 ? 72.637  35.544  114.527 1.00 46.88  ? 365 LEU B C   1 
ATOM   5575  O  O   . LEU B  1 388 ? 72.374  34.500  113.943 1.00 53.42  ? 365 LEU B O   1 
ATOM   5576  C  CB  . LEU B  1 388 ? 70.580  36.591  115.539 1.00 50.61  ? 365 LEU B CB  1 
ATOM   5577  C  CG  . LEU B  1 388 ? 70.961  36.766  117.012 1.00 64.42  ? 365 LEU B CG  1 
ATOM   5578  C  CD1 . LEU B  1 388 ? 69.710  36.987  117.861 1.00 67.17  ? 365 LEU B CD1 1 
ATOM   5579  C  CD2 . LEU B  1 388 ? 71.766  35.581  117.539 1.00 70.15  ? 365 LEU B CD2 1 
ATOM   5580  N  N   . VAL B  1 389 ? 73.769  35.715  115.208 1.00 49.98  ? 366 VAL B N   1 
ATOM   5581  C  CA  . VAL B  1 389 ? 74.740  34.630  115.355 1.00 54.92  ? 366 VAL B CA  1 
ATOM   5582  C  C   . VAL B  1 389 ? 74.393  33.715  116.526 1.00 62.57  ? 366 VAL B C   1 
ATOM   5583  O  O   . VAL B  1 389 ? 74.476  34.123  117.684 1.00 70.16  ? 366 VAL B O   1 
ATOM   5584  C  CB  . VAL B  1 389 ? 76.174  35.159  115.552 1.00 56.13  ? 366 VAL B CB  1 
ATOM   5585  C  CG1 . VAL B  1 389 ? 77.121  34.015  115.902 1.00 58.55  ? 366 VAL B CG1 1 
ATOM   5586  C  CG2 . VAL B  1 389 ? 76.649  35.882  114.312 1.00 55.55  ? 366 VAL B CG2 1 
ATOM   5587  N  N   . THR C  1 27  ? 125.329 21.291  126.636 1.00 82.77  ? 4   THR C N   1 
ATOM   5588  C  CA  . THR C  1 27  ? 126.324 22.355  126.793 1.00 86.17  ? 4   THR C CA  1 
ATOM   5589  C  C   . THR C  1 27  ? 127.301 22.436  125.606 1.00 77.10  ? 4   THR C C   1 
ATOM   5590  O  O   . THR C  1 27  ? 127.566 21.433  124.938 1.00 62.35  ? 4   THR C O   1 
ATOM   5591  C  CB  . THR C  1 27  ? 127.121 22.195  128.103 1.00 85.79  ? 4   THR C CB  1 
ATOM   5592  O  OG1 . THR C  1 27  ? 128.214 21.288  127.899 1.00 81.53  ? 4   THR C OG1 1 
ATOM   5593  C  CG2 . THR C  1 27  ? 126.214 21.677  129.212 1.00 84.02  ? 4   THR C CG2 1 
ATOM   5594  N  N   . LEU C  1 28  ? 127.840 23.633  125.366 1.00 70.98  ? 5   LEU C N   1 
ATOM   5595  C  CA  . LEU C  1 28  ? 128.640 23.905  124.170 1.00 58.80  ? 5   LEU C CA  1 
ATOM   5596  C  C   . LEU C  1 28  ? 129.867 24.773  124.479 1.00 52.36  ? 5   LEU C C   1 
ATOM   5597  O  O   . LEU C  1 28  ? 129.743 25.858  125.046 1.00 46.41  ? 5   LEU C O   1 
ATOM   5598  C  CB  . LEU C  1 28  ? 127.756 24.573  123.120 1.00 53.45  ? 5   LEU C CB  1 
ATOM   5599  C  CG  . LEU C  1 28  ? 128.353 24.837  121.741 1.00 55.37  ? 5   LEU C CG  1 
ATOM   5600  C  CD1 . LEU C  1 28  ? 129.131 23.628  121.247 1.00 52.05  ? 5   LEU C CD1 1 
ATOM   5601  C  CD2 . LEU C  1 28  ? 127.245 25.217  120.760 1.00 52.47  ? 5   LEU C CD2 1 
ATOM   5602  N  N   . THR C  1 29  ? 131.051 24.299  124.097 1.00 52.76  ? 6   THR C N   1 
ATOM   5603  C  CA  . THR C  1 29  ? 132.298 24.921  124.552 1.00 56.21  ? 6   THR C CA  1 
ATOM   5604  C  C   . THR C  1 29  ? 133.282 25.272  123.438 1.00 56.91  ? 6   THR C C   1 
ATOM   5605  O  O   . THR C  1 29  ? 133.699 24.409  122.666 1.00 57.47  ? 6   THR C O   1 
ATOM   5606  C  CB  . THR C  1 29  ? 133.029 24.019  125.573 1.00 57.93  ? 6   THR C CB  1 
ATOM   5607  O  OG1 . THR C  1 29  ? 132.150 23.717  126.662 1.00 64.27  ? 6   THR C OG1 1 
ATOM   5608  C  CG2 . THR C  1 29  ? 134.282 24.709  126.102 1.00 47.38  ? 6   THR C CG2 1 
ATOM   5609  N  N   . PHE C  1 30  ? 133.668 26.545  123.382 1.00 60.11  ? 7   PHE C N   1 
ATOM   5610  C  CA  . PHE C  1 30  ? 134.633 27.043  122.396 1.00 54.14  ? 7   PHE C CA  1 
ATOM   5611  C  C   . PHE C  1 30  ? 136.030 26.467  122.627 1.00 46.33  ? 7   PHE C C   1 
ATOM   5612  O  O   . PHE C  1 30  ? 136.571 26.565  123.733 1.00 45.72  ? 7   PHE C O   1 
ATOM   5613  C  CB  . PHE C  1 30  ? 134.702 28.571  122.479 1.00 47.69  ? 7   PHE C CB  1 
ATOM   5614  C  CG  . PHE C  1 30  ? 135.596 29.198  121.447 1.00 52.84  ? 7   PHE C CG  1 
ATOM   5615  C  CD1 . PHE C  1 30  ? 136.967 29.267  121.646 1.00 52.05  ? 7   PHE C CD1 1 
ATOM   5616  C  CD2 . PHE C  1 30  ? 135.061 29.737  120.280 1.00 54.98  ? 7   PHE C CD2 1 
ATOM   5617  C  CE1 . PHE C  1 30  ? 137.791 29.843  120.697 1.00 51.32  ? 7   PHE C CE1 1 
ATOM   5618  C  CE2 . PHE C  1 30  ? 135.876 30.319  119.330 1.00 49.19  ? 7   PHE C CE2 1 
ATOM   5619  C  CZ  . PHE C  1 30  ? 137.245 30.373  119.538 1.00 50.71  ? 7   PHE C CZ  1 
ATOM   5620  N  N   . ARG C  1 31  ? 136.621 25.889  121.587 1.00 49.10  ? 8   ARG C N   1 
ATOM   5621  C  CA  . ARG C  1 31  ? 137.986 25.367  121.693 1.00 59.47  ? 8   ARG C CA  1 
ATOM   5622  C  C   . ARG C  1 31  ? 138.995 26.293  121.027 1.00 55.40  ? 8   ARG C C   1 
ATOM   5623  O  O   . ARG C  1 31  ? 139.883 26.831  121.687 1.00 55.30  ? 8   ARG C O   1 
ATOM   5624  C  CB  . ARG C  1 31  ? 138.102 23.952  121.106 1.00 69.44  ? 8   ARG C CB  1 
ATOM   5625  C  CG  . ARG C  1 31  ? 139.520 23.362  121.199 1.00 78.45  ? 8   ARG C CG  1 
ATOM   5626  C  CD  . ARG C  1 31  ? 139.680 22.080  120.382 1.00 81.97  ? 8   ARG C CD  1 
ATOM   5627  N  NE  . ARG C  1 31  ? 138.831 20.998  120.872 1.00 86.09  ? 8   ARG C NE  1 
ATOM   5628  C  CZ  . ARG C  1 31  ? 138.494 19.931  120.154 1.00 89.30  ? 8   ARG C CZ  1 
ATOM   5629  N  NH1 . ARG C  1 31  ? 138.931 19.809  118.909 1.00 92.64  ? 8   ARG C NH1 1 
ATOM   5630  N  NH2 . ARG C  1 31  ? 137.713 18.990  120.673 1.00 85.97  ? 8   ARG C NH2 1 
ATOM   5631  N  N   . LYS C  1 32  ? 138.859 26.464  119.716 1.00 55.45  ? 9   LYS C N   1 
ATOM   5632  C  CA  . LYS C  1 32  ? 139.741 27.350  118.963 1.00 55.91  ? 9   LYS C CA  1 
ATOM   5633  C  C   . LYS C  1 32  ? 139.065 27.850  117.691 1.00 56.51  ? 9   LYS C C   1 
ATOM   5634  O  O   . LYS C  1 32  ? 138.037 27.321  117.265 1.00 51.19  ? 9   LYS C O   1 
ATOM   5635  C  CB  . LYS C  1 32  ? 141.045 26.643  118.597 1.00 54.12  ? 9   LYS C CB  1 
ATOM   5636  C  CG  . LYS C  1 32  ? 140.859 25.524  117.589 1.00 63.75  ? 9   LYS C CG  1 
ATOM   5637  C  CD  . LYS C  1 32  ? 142.162 24.797  117.262 1.00 64.40  ? 9   LYS C CD  1 
ATOM   5638  C  CE  . LYS C  1 32  ? 142.991 25.566  116.252 1.00 65.84  ? 9   LYS C CE  1 
ATOM   5639  N  NZ  . LYS C  1 32  ? 143.807 24.637  115.416 1.00 66.79  ? 9   LYS C NZ  1 
ATOM   5640  N  N   . LEU C  1 33  ? 139.665 28.871  117.088 1.00 55.91  ? 10  LEU C N   1 
ATOM   5641  C  CA  . LEU C  1 33  ? 139.183 29.433  115.834 1.00 57.70  ? 10  LEU C CA  1 
ATOM   5642  C  C   . LEU C  1 33  ? 140.342 29.588  114.857 1.00 58.18  ? 10  LEU C C   1 
ATOM   5643  O  O   . LEU C  1 33  ? 141.430 30.037  115.233 1.00 47.60  ? 10  LEU C O   1 
ATOM   5644  C  CB  . LEU C  1 33  ? 138.504 30.787  116.075 1.00 52.84  ? 10  LEU C CB  1 
ATOM   5645  C  CG  . LEU C  1 33  ? 138.101 31.615  114.852 1.00 49.76  ? 10  LEU C CG  1 
ATOM   5646  C  CD1 . LEU C  1 33  ? 136.895 32.471  115.175 1.00 52.53  ? 10  LEU C CD1 1 
ATOM   5647  C  CD2 . LEU C  1 33  ? 139.250 32.480  114.356 1.00 46.63  ? 10  LEU C CD2 1 
ATOM   5648  N  N   . THR C  1 34  ? 140.100 29.225  113.602 1.00 64.68  ? 11  THR C N   1 
ATOM   5649  C  CA  . THR C  1 34  ? 141.131 29.300  112.572 1.00 66.93  ? 11  THR C CA  1 
ATOM   5650  C  C   . THR C  1 34  ? 140.683 30.202  111.425 1.00 59.78  ? 11  THR C C   1 
ATOM   5651  O  O   . THR C  1 34  ? 139.581 30.045  110.901 1.00 62.12  ? 11  THR C O   1 
ATOM   5652  C  CB  . THR C  1 34  ? 141.454 27.903  112.007 1.00 65.47  ? 11  THR C CB  1 
ATOM   5653  O  OG1 . THR C  1 34  ? 141.527 26.955  113.082 1.00 62.68  ? 11  THR C OG1 1 
ATOM   5654  C  CG2 . THR C  1 34  ? 142.775 27.924  111.235 1.00 62.55  ? 11  THR C CG2 1 
ATOM   5655  N  N   . ALA C  1 35  ? 141.545 31.133  111.030 1.00 50.12  ? 12  ALA C N   1 
ATOM   5656  C  CA  . ALA C  1 35  ? 141.220 32.068  109.959 1.00 47.36  ? 12  ALA C CA  1 
ATOM   5657  C  C   . ALA C  1 35  ? 142.178 31.925  108.782 1.00 50.24  ? 12  ALA C C   1 
ATOM   5658  O  O   . ALA C  1 35  ? 143.372 32.182  108.915 1.00 55.25  ? 12  ALA C O   1 
ATOM   5659  C  CB  . ALA C  1 35  ? 141.227 33.506  110.486 1.00 40.84  ? 12  ALA C CB  1 
ATOM   5660  N  N   . ARG C  1 36  ? 141.646 31.529  107.629 1.00 54.33  ? 13  ARG C N   1 
ATOM   5661  C  CA  . ARG C  1 36  ? 142.461 31.294  106.437 1.00 53.86  ? 13  ARG C CA  1 
ATOM   5662  C  C   . ARG C  1 36  ? 142.251 32.338  105.339 1.00 57.44  ? 13  ARG C C   1 
ATOM   5663  O  O   . ARG C  1 36  ? 141.189 32.390  104.716 1.00 59.90  ? 13  ARG C O   1 
ATOM   5664  C  CB  . ARG C  1 36  ? 142.185 29.899  105.875 1.00 50.42  ? 13  ARG C CB  1 
ATOM   5665  C  CG  . ARG C  1 36  ? 142.739 28.769  106.725 1.00 49.86  ? 13  ARG C CG  1 
ATOM   5666  C  CD  . ARG C  1 36  ? 142.386 27.418  106.118 1.00 52.10  ? 13  ARG C CD  1 
ATOM   5667  N  NE  . ARG C  1 36  ? 140.974 27.093  106.281 1.00 54.59  ? 13  ARG C NE  1 
ATOM   5668  C  CZ  . ARG C  1 36  ? 140.325 26.185  105.562 1.00 58.26  ? 13  ARG C CZ  1 
ATOM   5669  N  NH1 . ARG C  1 36  ? 140.961 25.517  104.612 1.00 60.17  ? 13  ARG C NH1 1 
ATOM   5670  N  NH2 . ARG C  1 36  ? 139.036 25.951  105.785 1.00 62.66  ? 13  ARG C NH2 1 
ATOM   5671  N  N   . PRO C  1 37  ? 143.282 33.154  105.074 1.00 52.48  ? 14  PRO C N   1 
ATOM   5672  C  CA  . PRO C  1 37  ? 143.186 34.201  104.055 1.00 50.56  ? 14  PRO C CA  1 
ATOM   5673  C  C   . PRO C  1 37  ? 143.189 33.602  102.653 1.00 52.75  ? 14  PRO C C   1 
ATOM   5674  O  O   . PRO C  1 37  ? 143.997 32.724  102.361 1.00 51.98  ? 14  PRO C O   1 
ATOM   5675  C  CB  . PRO C  1 37  ? 144.468 35.001  104.274 1.00 48.70  ? 14  PRO C CB  1 
ATOM   5676  C  CG  . PRO C  1 37  ? 145.446 33.973  104.724 1.00 42.64  ? 14  PRO C CG  1 
ATOM   5677  C  CD  . PRO C  1 37  ? 144.645 33.048  105.622 1.00 42.00  ? 14  PRO C CD  1 
ATOM   5678  N  N   . VAL C  1 38  ? 142.300 34.090  101.797 1.00 54.57  ? 15  VAL C N   1 
ATOM   5679  C  CA  . VAL C  1 38  ? 142.174 33.590  100.433 1.00 51.60  ? 15  VAL C CA  1 
ATOM   5680  C  C   . VAL C  1 38  ? 141.924 34.745  99.466  1.00 52.58  ? 15  VAL C C   1 
ATOM   5681  O  O   . VAL C  1 38  ? 141.167 35.662  99.778  1.00 50.87  ? 15  VAL C O   1 
ATOM   5682  C  CB  . VAL C  1 38  ? 141.019 32.579  100.330 1.00 42.52  ? 15  VAL C CB  1 
ATOM   5683  C  CG1 . VAL C  1 38  ? 140.663 32.314  98.880  1.00 44.15  ? 15  VAL C CG1 1 
ATOM   5684  C  CG2 . VAL C  1 38  ? 141.382 31.296  101.056 1.00 44.04  ? 15  VAL C CG2 1 
ATOM   5685  N  N   . LEU C  1 39  ? 142.562 34.701  98.299  1.00 49.88  ? 16  LEU C N   1 
ATOM   5686  C  CA  . LEU C  1 39  ? 142.412 35.758  97.301  1.00 50.53  ? 16  LEU C CA  1 
ATOM   5687  C  C   . LEU C  1 39  ? 141.901 35.214  95.967  1.00 51.30  ? 16  LEU C C   1 
ATOM   5688  O  O   . LEU C  1 39  ? 142.634 34.547  95.242  1.00 55.88  ? 16  LEU C O   1 
ATOM   5689  C  CB  . LEU C  1 39  ? 143.746 36.488  97.097  1.00 53.22  ? 16  LEU C CB  1 
ATOM   5690  C  CG  . LEU C  1 39  ? 143.779 37.763  96.243  1.00 51.84  ? 16  LEU C CG  1 
ATOM   5691  C  CD1 . LEU C  1 39  ? 142.900 38.849  96.847  1.00 48.07  ? 16  LEU C CD1 1 
ATOM   5692  C  CD2 . LEU C  1 39  ? 145.205 38.263  96.091  1.00 45.42  ? 16  LEU C CD2 1 
ATOM   5693  N  N   . LEU C  1 40  ? 140.646 35.512  95.644  1.00 49.34  ? 17  LEU C N   1 
ATOM   5694  C  CA  . LEU C  1 40  ? 140.023 35.035  94.414  1.00 47.71  ? 17  LEU C CA  1 
ATOM   5695  C  C   . LEU C  1 40  ? 140.135 36.043  93.279  1.00 59.94  ? 17  LEU C C   1 
ATOM   5696  O  O   . LEU C  1 40  ? 140.403 37.221  93.508  1.00 69.10  ? 17  LEU C O   1 
ATOM   5697  C  CB  . LEU C  1 40  ? 138.545 34.751  94.660  1.00 51.34  ? 17  LEU C CB  1 
ATOM   5698  C  CG  . LEU C  1 40  ? 138.113 33.323  94.986  1.00 60.57  ? 17  LEU C CG  1 
ATOM   5699  C  CD1 . LEU C  1 40  ? 139.189 32.583  95.767  1.00 62.78  ? 17  LEU C CD1 1 
ATOM   5700  C  CD2 . LEU C  1 40  ? 136.783 33.340  95.737  1.00 54.50  ? 17  LEU C CD2 1 
ATOM   5701  N  N   . LYS C  1 41  ? 139.914 35.568  92.055  1.00 58.93  ? 18  LYS C N   1 
ATOM   5702  C  CA  . LYS C  1 41  ? 139.836 36.426  90.878  1.00 60.89  ? 18  LYS C CA  1 
ATOM   5703  C  C   . LYS C  1 41  ? 138.366 36.589  90.503  1.00 61.49  ? 18  LYS C C   1 
ATOM   5704  O  O   . LYS C  1 41  ? 137.669 35.598  90.289  1.00 59.43  ? 18  LYS C O   1 
ATOM   5705  C  CB  . LYS C  1 41  ? 140.591 35.787  89.710  1.00 66.30  ? 18  LYS C CB  1 
ATOM   5706  C  CG  . LYS C  1 41  ? 141.109 36.774  88.666  1.00 73.89  ? 18  LYS C CG  1 
ATOM   5707  C  CD  . LYS C  1 41  ? 142.405 37.442  89.135  1.00 76.75  ? 18  LYS C CD  1 
ATOM   5708  C  CE  . LYS C  1 41  ? 143.058 38.271  88.029  1.00 72.28  ? 18  LYS C CE  1 
ATOM   5709  N  NZ  . LYS C  1 41  ? 144.353 38.874  88.467  1.00 64.22  ? 18  LYS C NZ  1 
ATOM   5710  N  N   . LEU C  1 42  ? 137.892 37.831  90.431  1.00 64.09  ? 19  LEU C N   1 
ATOM   5711  C  CA  . LEU C  1 42  ? 136.500 38.103  90.073  1.00 62.59  ? 19  LEU C CA  1 
ATOM   5712  C  C   . LEU C  1 42  ? 136.228 37.763  88.614  1.00 64.80  ? 19  LEU C C   1 
ATOM   5713  O  O   . LEU C  1 42  ? 137.026 38.083  87.729  1.00 61.83  ? 19  LEU C O   1 
ATOM   5714  C  CB  . LEU C  1 42  ? 136.155 39.574  90.298  1.00 60.74  ? 19  LEU C CB  1 
ATOM   5715  C  CG  . LEU C  1 42  ? 136.166 40.144  91.710  1.00 62.94  ? 19  LEU C CG  1 
ATOM   5716  C  CD1 . LEU C  1 42  ? 136.175 41.661  91.628  1.00 61.60  ? 19  LEU C CD1 1 
ATOM   5717  C  CD2 . LEU C  1 42  ? 134.970 39.644  92.500  1.00 59.92  ? 19  LEU C CD2 1 
ATOM   5718  N  N   . GLN C  1 43  ? 135.088 37.128  88.368  1.00 66.56  ? 20  GLN C N   1 
ATOM   5719  C  CA  . GLN C  1 43  ? 134.692 36.792  87.009  1.00 74.34  ? 20  GLN C CA  1 
ATOM   5720  C  C   . GLN C  1 43  ? 134.529 38.075  86.199  1.00 72.35  ? 20  GLN C C   1 
ATOM   5721  O  O   . GLN C  1 43  ? 135.038 38.190  85.083  1.00 74.34  ? 20  GLN C O   1 
ATOM   5722  C  CB  . GLN C  1 43  ? 133.388 35.989  87.020  1.00 78.13  ? 20  GLN C CB  1 
ATOM   5723  C  CG  . GLN C  1 43  ? 133.007 35.403  85.673  1.00 80.73  ? 20  GLN C CG  1 
ATOM   5724  C  CD  . GLN C  1 43  ? 131.543 35.017  85.608  1.00 84.10  ? 20  GLN C CD  1 
ATOM   5725  O  OE1 . GLN C  1 43  ? 130.910 34.745  86.633  1.00 81.61  ? 20  GLN C OE1 1 
ATOM   5726  N  NE2 . GLN C  1 43  ? 130.992 35.005  84.398  1.00 84.61  ? 20  GLN C NE2 1 
ATOM   5727  N  N   . ARG C  1 44  ? 133.814 39.034  86.779  1.00 70.42  ? 21  ARG C N   1 
ATOM   5728  C  CA  . ARG C  1 44  ? 133.646 40.360  86.196  1.00 69.22  ? 21  ARG C CA  1 
ATOM   5729  C  C   . ARG C  1 44  ? 134.283 41.402  87.114  1.00 73.47  ? 21  ARG C C   1 
ATOM   5730  O  O   . ARG C  1 44  ? 133.711 41.738  88.157  1.00 77.74  ? 21  ARG C O   1 
ATOM   5731  C  CB  . ARG C  1 44  ? 132.164 40.682  86.023  1.00 64.15  ? 21  ARG C CB  1 
ATOM   5732  C  CG  . ARG C  1 44  ? 131.355 39.630  85.277  1.00 61.90  ? 21  ARG C CG  1 
ATOM   5733  C  CD  . ARG C  1 44  ? 129.914 40.097  85.116  1.00 61.45  ? 21  ARG C CD  1 
ATOM   5734  N  NE  . ARG C  1 44  ? 129.085 39.148  84.381  1.00 62.92  ? 21  ARG C NE  1 
ATOM   5735  C  CZ  . ARG C  1 44  ? 128.336 38.215  84.958  1.00 68.20  ? 21  ARG C CZ  1 
ATOM   5736  N  NH1 . ARG C  1 44  ? 128.315 38.100  86.279  1.00 68.84  ? 21  ARG C NH1 1 
ATOM   5737  N  NH2 . ARG C  1 44  ? 127.610 37.395  84.213  1.00 71.25  ? 21  ARG C NH2 1 
ATOM   5738  N  N   . PRO C  1 45  ? 135.456 41.935  86.716  1.00 68.39  ? 22  PRO C N   1 
ATOM   5739  C  CA  . PRO C  1 45  ? 136.286 42.815  87.551  1.00 68.31  ? 22  PRO C CA  1 
ATOM   5740  C  C   . PRO C  1 45  ? 135.644 44.179  87.819  1.00 72.08  ? 22  PRO C C   1 
ATOM   5741  O  O   . PRO C  1 45  ? 134.954 44.729  86.954  1.00 76.44  ? 22  PRO C O   1 
ATOM   5742  C  CB  . PRO C  1 45  ? 137.550 42.991  86.707  1.00 62.59  ? 22  PRO C CB  1 
ATOM   5743  C  CG  . PRO C  1 45  ? 137.052 42.908  85.317  1.00 64.73  ? 22  PRO C CG  1 
ATOM   5744  C  CD  . PRO C  1 45  ? 135.958 41.870  85.333  1.00 63.94  ? 22  PRO C CD  1 
ATOM   5745  N  N   . VAL C  1 46  ? 135.880 44.714  89.014  1.00 66.54  ? 23  VAL C N   1 
ATOM   5746  C  CA  . VAL C  1 46  ? 135.338 46.012  89.407  1.00 63.87  ? 23  VAL C CA  1 
ATOM   5747  C  C   . VAL C  1 46  ? 135.966 47.138  88.595  1.00 68.20  ? 23  VAL C C   1 
ATOM   5748  O  O   . VAL C  1 46  ? 137.089 47.550  88.873  1.00 73.74  ? 23  VAL C O   1 
ATOM   5749  C  CB  . VAL C  1 46  ? 135.593 46.297  90.904  1.00 52.51  ? 23  VAL C CB  1 
ATOM   5750  C  CG1 . VAL C  1 46  ? 135.206 47.724  91.243  1.00 42.22  ? 23  VAL C CG1 1 
ATOM   5751  C  CG2 . VAL C  1 46  ? 134.836 45.306  91.778  1.00 51.96  ? 23  VAL C CG2 1 
ATOM   5752  N  N   . THR C  1 47  ? 135.244 47.631  87.591  1.00 70.24  ? 24  THR C N   1 
ATOM   5753  C  CA  . THR C  1 47  ? 135.739 48.727  86.756  1.00 70.38  ? 24  THR C CA  1 
ATOM   5754  C  C   . THR C  1 47  ? 135.262 50.068  87.306  1.00 72.93  ? 24  THR C C   1 
ATOM   5755  O  O   . THR C  1 47  ? 134.139 50.495  87.032  1.00 75.88  ? 24  THR C O   1 
ATOM   5756  C  CB  . THR C  1 47  ? 135.280 48.593  85.277  1.00 62.74  ? 24  THR C CB  1 
ATOM   5757  O  OG1 . THR C  1 47  ? 135.600 47.287  84.778  1.00 69.07  ? 24  THR C OG1 1 
ATOM   5758  C  CG2 . THR C  1 47  ? 135.961 49.639  84.405  1.00 59.36  ? 24  THR C CG2 1 
ATOM   5759  N  N   . ALA C  1 48  ? 136.111 50.729  88.087  1.00 75.41  ? 25  ALA C N   1 
ATOM   5760  C  CA  . ALA C  1 48  ? 135.750 52.018  88.672  1.00 85.44  ? 25  ALA C CA  1 
ATOM   5761  C  C   . ALA C  1 48  ? 136.335 53.179  87.869  1.00 90.81  ? 25  ALA C C   1 
ATOM   5762  O  O   . ALA C  1 48  ? 136.830 52.988  86.758  1.00 90.97  ? 25  ALA C O   1 
ATOM   5763  C  CB  . ALA C  1 48  ? 136.190 52.091  90.130  1.00 85.24  ? 25  ALA C CB  1 
ATOM   5764  N  N   . ARG C  1 49  ? 136.271 54.382  88.430  1.00 93.65  ? 26  ARG C N   1 
ATOM   5765  C  CA  . ARG C  1 49  ? 136.791 55.560  87.747  1.00 97.35  ? 26  ARG C CA  1 
ATOM   5766  C  C   . ARG C  1 49  ? 138.313 55.636  87.871  1.00 104.42 ? 26  ARG C C   1 
ATOM   5767  O  O   . ARG C  1 49  ? 139.013 55.916  86.891  1.00 96.35  ? 26  ARG C O   1 
ATOM   5768  C  CB  . ARG C  1 49  ? 136.153 56.832  88.311  1.00 95.57  ? 26  ARG C CB  1 
ATOM   5769  C  CG  . ARG C  1 49  ? 135.749 57.849  87.253  1.00 94.06  ? 26  ARG C CG  1 
ATOM   5770  C  CD  . ARG C  1 49  ? 135.783 59.271  87.796  1.00 95.94  ? 26  ARG C CD  1 
ATOM   5771  N  NE  . ARG C  1 49  ? 137.150 59.776  87.912  1.00 102.93 ? 26  ARG C NE  1 
ATOM   5772  C  CZ  . ARG C  1 49  ? 137.878 59.726  89.025  1.00 107.68 ? 26  ARG C CZ  1 
ATOM   5773  N  NH1 . ARG C  1 49  ? 139.116 60.208  89.036  1.00 103.90 ? 26  ARG C NH1 1 
ATOM   5774  N  NH2 . ARG C  1 49  ? 137.368 59.197  90.130  1.00 112.02 ? 26  ARG C NH2 1 
ATOM   5775  N  N   . ILE C  1 50  ? 138.813 55.373  89.080  1.00 117.20 ? 27  ILE C N   1 
ATOM   5776  C  CA  . ILE C  1 50  ? 140.240 55.512  89.395  1.00 124.42 ? 27  ILE C CA  1 
ATOM   5777  C  C   . ILE C  1 50  ? 141.081 54.309  88.939  1.00 122.44 ? 27  ILE C C   1 
ATOM   5778  O  O   . ILE C  1 50  ? 142.181 54.478  88.404  1.00 121.02 ? 27  ILE C O   1 
ATOM   5779  C  CB  . ILE C  1 50  ? 140.468 55.795  90.919  1.00 141.55 ? 27  ILE C CB  1 
ATOM   5780  C  CG1 . ILE C  1 50  ? 141.845 56.427  91.167  1.00 139.10 ? 27  ILE C CG1 1 
ATOM   5781  C  CG2 . ILE C  1 50  ? 140.264 54.533  91.757  1.00 140.03 ? 27  ILE C CG2 1 
ATOM   5782  C  CD1 . ILE C  1 50  ? 141.952 57.878  90.722  1.00 135.76 ? 27  ILE C CD1 1 
ATOM   5783  N  N   . ALA C  1 51  ? 140.560 53.102  89.144  1.00 116.40 ? 28  ALA C N   1 
ATOM   5784  C  CA  . ALA C  1 51  ? 141.273 51.890  88.752  1.00 109.46 ? 28  ALA C CA  1 
ATOM   5785  C  C   . ALA C  1 51  ? 140.338 50.700  88.550  1.00 102.03 ? 28  ALA C C   1 
ATOM   5786  O  O   . ALA C  1 51  ? 139.117 50.850  88.512  1.00 101.42 ? 28  ALA C O   1 
ATOM   5787  C  CB  . ALA C  1 51  ? 142.352 51.553  89.774  1.00 109.87 ? 28  ALA C CB  1 
ATOM   5788  N  N   . THR C  1 52  ? 140.932 49.516  88.428  1.00 95.21  ? 29  THR C N   1 
ATOM   5789  C  CA  . THR C  1 52  ? 140.194 48.285  88.165  1.00 83.73  ? 29  THR C CA  1 
ATOM   5790  C  C   . THR C  1 52  ? 140.665 47.163  89.086  1.00 77.99  ? 29  THR C C   1 
ATOM   5791  O  O   . THR C  1 52  ? 141.818 46.735  89.006  1.00 77.63  ? 29  THR C O   1 
ATOM   5792  C  CB  . THR C  1 52  ? 140.386 47.841  86.705  1.00 77.84  ? 29  THR C CB  1 
ATOM   5793  O  OG1 . THR C  1 52  ? 139.783 48.802  85.829  1.00 74.23  ? 29  THR C OG1 1 
ATOM   5794  C  CG2 . THR C  1 52  ? 139.766 46.471  86.472  1.00 76.71  ? 29  THR C CG2 1 
ATOM   5795  N  N   . ILE C  1 53  ? 139.775 46.685  89.955  1.00 73.57  ? 30  ILE C N   1 
ATOM   5796  C  CA  . ILE C  1 53  ? 140.124 45.636  90.916  1.00 69.53  ? 30  ILE C CA  1 
ATOM   5797  C  C   . ILE C  1 53  ? 139.593 44.259  90.508  1.00 70.06  ? 30  ILE C C   1 
ATOM   5798  O  O   . ILE C  1 53  ? 138.392 44.000  90.584  1.00 70.07  ? 30  ILE C O   1 
ATOM   5799  C  CB  . ILE C  1 53  ? 139.606 45.956  92.332  1.00 67.65  ? 30  ILE C CB  1 
ATOM   5800  C  CG1 . ILE C  1 53  ? 139.812 47.432  92.669  1.00 67.56  ? 30  ILE C CG1 1 
ATOM   5801  C  CG2 . ILE C  1 53  ? 140.289 45.068  93.356  1.00 68.87  ? 30  ILE C CG2 1 
ATOM   5802  C  CD1 . ILE C  1 53  ? 138.696 48.325  92.190  1.00 69.78  ? 30  ILE C CD1 1 
ATOM   5803  N  N   . PRO C  1 54  ? 140.493 43.363  90.080  1.00 72.01  ? 31  PRO C N   1 
ATOM   5804  C  CA  . PRO C  1 54  ? 140.051 42.029  89.665  1.00 68.13  ? 31  PRO C CA  1 
ATOM   5805  C  C   . PRO C  1 54  ? 140.001 41.047  90.825  1.00 63.62  ? 31  PRO C C   1 
ATOM   5806  O  O   . PRO C  1 54  ? 139.357 40.013  90.691  1.00 71.97  ? 31  PRO C O   1 
ATOM   5807  C  CB  . PRO C  1 54  ? 141.139 41.603  88.683  1.00 69.20  ? 31  PRO C CB  1 
ATOM   5808  C  CG  . PRO C  1 54  ? 142.376 42.260  89.221  1.00 72.87  ? 31  PRO C CG  1 
ATOM   5809  C  CD  . PRO C  1 54  ? 141.935 43.566  89.851  1.00 71.95  ? 31  PRO C CD  1 
ATOM   5810  N  N   . ASP C  1 55  ? 140.658 41.368  91.939  1.00 59.60  ? 32  ASP C N   1 
ATOM   5811  C  CA  . ASP C  1 55  ? 140.830 40.414  93.042  1.00 58.97  ? 32  ASP C CA  1 
ATOM   5812  C  C   . ASP C  1 55  ? 139.897 40.648  94.235  1.00 51.56  ? 32  ASP C C   1 
ATOM   5813  O  O   . ASP C  1 55  ? 139.584 41.784  94.576  1.00 56.19  ? 32  ASP C O   1 
ATOM   5814  C  CB  . ASP C  1 55  ? 142.289 40.404  93.506  1.00 65.64  ? 32  ASP C CB  1 
ATOM   5815  C  CG  . ASP C  1 55  ? 143.242 39.987  92.405  1.00 77.33  ? 32  ASP C CG  1 
ATOM   5816  O  OD1 . ASP C  1 55  ? 142.970 38.967  91.732  1.00 78.70  ? 32  ASP C OD1 1 
ATOM   5817  O  OD2 . ASP C  1 55  ? 144.258 40.686  92.204  1.00 82.94  ? 32  ASP C OD2 1 
ATOM   5818  N  N   . TRP C  1 56  ? 139.470 39.561  94.871  1.00 48.02  ? 33  TRP C N   1 
ATOM   5819  C  CA  . TRP C  1 56  ? 138.487 39.631  95.942  1.00 46.39  ? 33  TRP C CA  1 
ATOM   5820  C  C   . TRP C  1 56  ? 138.935 38.795  97.134  1.00 49.14  ? 33  TRP C C   1 
ATOM   5821  O  O   . TRP C  1 56  ? 138.904 37.569  97.087  1.00 47.51  ? 33  TRP C O   1 
ATOM   5822  C  CB  . TRP C  1 56  ? 137.128 39.147  95.435  1.00 44.43  ? 33  TRP C CB  1 
ATOM   5823  C  CG  . TRP C  1 56  ? 135.966 39.429  96.367  1.00 46.98  ? 33  TRP C CG  1 
ATOM   5824  C  CD1 . TRP C  1 56  ? 135.117 38.513  96.920  1.00 38.34  ? 33  TRP C CD1 1 
ATOM   5825  C  CD2 . TRP C  1 56  ? 135.525 40.716  96.834  1.00 39.65  ? 33  TRP C CD2 1 
ATOM   5826  N  NE1 . TRP C  1 56  ? 134.182 39.145  97.700  1.00 41.41  ? 33  TRP C NE1 1 
ATOM   5827  C  CE2 . TRP C  1 56  ? 134.413 40.496  97.669  1.00 42.10  ? 33  TRP C CE2 1 
ATOM   5828  C  CE3 . TRP C  1 56  ? 135.972 42.027  96.634  1.00 38.23  ? 33  TRP C CE3 1 
ATOM   5829  C  CZ2 . TRP C  1 56  ? 133.737 41.539  98.302  1.00 46.60  ? 33  TRP C CZ2 1 
ATOM   5830  C  CZ3 . TRP C  1 56  ? 135.303 43.061  97.262  1.00 43.53  ? 33  TRP C CZ3 1 
ATOM   5831  C  CH2 . TRP C  1 56  ? 134.196 42.811  98.085  1.00 47.00  ? 33  TRP C CH2 1 
ATOM   5832  N  N   . PRO C  1 57  ? 139.347 39.463  98.217  1.00 48.62  ? 34  PRO C N   1 
ATOM   5833  C  CA  . PRO C  1 57  ? 139.867 38.785  99.408  1.00 43.03  ? 34  PRO C CA  1 
ATOM   5834  C  C   . PRO C  1 57  ? 138.760 38.159  100.257 1.00 42.41  ? 34  PRO C C   1 
ATOM   5835  O  O   . PRO C  1 57  ? 137.663 38.712  100.384 1.00 45.94  ? 34  PRO C O   1 
ATOM   5836  C  CB  . PRO C  1 57  ? 140.537 39.927  100.181 1.00 42.15  ? 34  PRO C CB  1 
ATOM   5837  C  CG  . PRO C  1 57  ? 139.709 41.128  99.827  1.00 41.82  ? 34  PRO C CG  1 
ATOM   5838  C  CD  . PRO C  1 57  ? 139.300 40.928  98.387  1.00 49.51  ? 34  PRO C CD  1 
ATOM   5839  N  N   . LEU C  1 58  ? 139.058 37.003  100.834 1.00 40.29  ? 35  LEU C N   1 
ATOM   5840  C  CA  . LEU C  1 58  ? 138.130 36.320  101.729 1.00 44.23  ? 35  LEU C CA  1 
ATOM   5841  C  C   . LEU C  1 58  ? 138.889 35.795  102.931 1.00 42.16  ? 35  LEU C C   1 
ATOM   5842  O  O   . LEU C  1 58  ? 140.086 35.521  102.854 1.00 42.08  ? 35  LEU C O   1 
ATOM   5843  C  CB  . LEU C  1 58  ? 137.438 35.153  101.024 1.00 45.28  ? 35  LEU C CB  1 
ATOM   5844  C  CG  . LEU C  1 58  ? 136.506 35.469  99.862  1.00 49.31  ? 35  LEU C CG  1 
ATOM   5845  C  CD1 . LEU C  1 58  ? 135.942 34.187  99.283  1.00 49.26  ? 35  LEU C CD1 1 
ATOM   5846  C  CD2 . LEU C  1 58  ? 135.388 36.361  100.353 1.00 55.86  ? 35  LEU C CD2 1 
ATOM   5847  N  N   . ILE C  1 59  ? 138.196 35.663  104.050 1.00 41.22  ? 36  ILE C N   1 
ATOM   5848  C  CA  . ILE C  1 59  ? 138.795 35.028  105.204 1.00 40.60  ? 36  ILE C CA  1 
ATOM   5849  C  C   . ILE C  1 59  ? 137.859 33.945  105.691 1.00 51.09  ? 36  ILE C C   1 
ATOM   5850  O  O   . ILE C  1 59  ? 136.812 34.235  106.267 1.00 55.94  ? 36  ILE C O   1 
ATOM   5851  C  CB  . ILE C  1 59  ? 139.078 36.029  106.327 1.00 39.40  ? 36  ILE C CB  1 
ATOM   5852  C  CG1 . ILE C  1 59  ? 140.192 36.993  105.913 1.00 40.00  ? 36  ILE C CG1 1 
ATOM   5853  C  CG2 . ILE C  1 59  ? 139.481 35.293  107.587 1.00 38.92  ? 36  ILE C CG2 1 
ATOM   5854  C  CD1 . ILE C  1 59  ? 140.317 38.210  106.808 1.00 45.99  ? 36  ILE C CD1 1 
ATOM   5855  N  N   . LEU C  1 60  ? 138.222 32.693  105.427 1.00 54.60  ? 37  LEU C N   1 
ATOM   5856  C  CA  . LEU C  1 60  ? 137.428 31.564  105.888 1.00 53.95  ? 37  LEU C CA  1 
ATOM   5857  C  C   . LEU C  1 60  ? 137.683 31.336  107.372 1.00 61.04  ? 37  LEU C C   1 
ATOM   5858  O  O   . LEU C  1 60  ? 138.836 31.263  107.806 1.00 65.65  ? 37  LEU C O   1 
ATOM   5859  C  CB  . LEU C  1 60  ? 137.749 30.312  105.083 1.00 51.00  ? 37  LEU C CB  1 
ATOM   5860  C  CG  . LEU C  1 60  ? 137.137 30.278  103.683 1.00 55.84  ? 37  LEU C CG  1 
ATOM   5861  C  CD1 . LEU C  1 60  ? 137.714 31.366  102.814 1.00 46.88  ? 37  LEU C CD1 1 
ATOM   5862  C  CD2 . LEU C  1 60  ? 137.362 28.924  103.040 1.00 63.22  ? 37  LEU C CD2 1 
ATOM   5863  N  N   . ILE C  1 61  ? 136.602 31.247  108.144 1.00 57.58  ? 38  ILE C N   1 
ATOM   5864  C  CA  . ILE C  1 61  ? 136.692 31.096  109.593 1.00 54.76  ? 38  ILE C CA  1 
ATOM   5865  C  C   . ILE C  1 61  ? 136.120 29.755  110.049 1.00 58.34  ? 38  ILE C C   1 
ATOM   5866  O  O   . ILE C  1 61  ? 135.005 29.384  109.675 1.00 56.54  ? 38  ILE C O   1 
ATOM   5867  C  CB  . ILE C  1 61  ? 135.949 32.227  110.321 1.00 52.04  ? 38  ILE C CB  1 
ATOM   5868  C  CG1 . ILE C  1 61  ? 136.545 33.583  109.951 1.00 45.78  ? 38  ILE C CG1 1 
ATOM   5869  C  CG2 . ILE C  1 61  ? 135.985 32.009  111.831 1.00 46.48  ? 38  ILE C CG2 1 
ATOM   5870  C  CD1 . ILE C  1 61  ? 135.772 34.732  110.534 1.00 53.73  ? 38  ILE C CD1 1 
ATOM   5871  N  N   . ASP C  1 62  ? 136.894 29.033  110.853 1.00 57.49  ? 39  ASP C N   1 
ATOM   5872  C  CA  . ASP C  1 62  ? 136.476 27.727  111.351 1.00 60.07  ? 39  ASP C CA  1 
ATOM   5873  C  C   . ASP C  1 62  ? 136.490 27.649  112.878 1.00 61.54  ? 39  ASP C C   1 
ATOM   5874  O  O   . ASP C  1 62  ? 137.522 27.872  113.524 1.00 57.22  ? 39  ASP C O   1 
ATOM   5875  C  CB  . ASP C  1 62  ? 137.349 26.614  110.759 1.00 61.66  ? 39  ASP C CB  1 
ATOM   5876  C  CG  . ASP C  1 62  ? 136.979 26.280  109.329 1.00 57.00  ? 39  ASP C CG  1 
ATOM   5877  O  OD1 . ASP C  1 62  ? 136.069 25.446  109.127 1.00 57.45  ? 39  ASP C OD1 1 
ATOM   5878  O  OD2 . ASP C  1 62  ? 137.606 26.841  108.409 1.00 59.15  ? 39  ASP C OD2 1 
ATOM   5879  N  N   . ILE C  1 63  ? 135.330 27.329  113.445 1.00 62.35  ? 40  ILE C N   1 
ATOM   5880  C  CA  . ILE C  1 63  ? 135.202 27.137  114.880 1.00 58.44  ? 40  ILE C CA  1 
ATOM   5881  C  C   . ILE C  1 63  ? 135.269 25.653  115.247 1.00 61.25  ? 40  ILE C C   1 
ATOM   5882  O  O   . ILE C  1 63  ? 134.653 24.809  114.590 1.00 60.79  ? 40  ILE C O   1 
ATOM   5883  C  CB  . ILE C  1 63  ? 133.867 27.692  115.397 1.00 51.49  ? 40  ILE C CB  1 
ATOM   5884  C  CG1 . ILE C  1 63  ? 133.723 29.167  115.030 1.00 51.27  ? 40  ILE C CG1 1 
ATOM   5885  C  CG2 . ILE C  1 63  ? 133.764 27.505  116.908 1.00 44.44  ? 40  ILE C CG2 1 
ATOM   5886  C  CD1 . ILE C  1 63  ? 134.598 30.072  115.843 1.00 46.08  ? 40  ILE C CD1 1 
ATOM   5887  N  N   . GLU C  1 64  ? 136.024 25.345  116.298 1.00 60.72  ? 41  GLU C N   1 
ATOM   5888  C  CA  . GLU C  1 64  ? 135.997 24.019  116.900 1.00 65.66  ? 41  GLU C CA  1 
ATOM   5889  C  C   . GLU C  1 64  ? 135.391 24.098  118.305 1.00 61.61  ? 41  GLU C C   1 
ATOM   5890  O  O   . GLU C  1 64  ? 135.653 25.038  119.054 1.00 51.69  ? 41  GLU C O   1 
ATOM   5891  C  CB  . GLU C  1 64  ? 137.405 23.411  116.964 1.00 71.42  ? 41  GLU C CB  1 
ATOM   5892  C  CG  . GLU C  1 64  ? 137.956 22.887  115.632 1.00 75.05  ? 41  GLU C CG  1 
ATOM   5893  C  CD  . GLU C  1 64  ? 139.313 22.198  115.781 1.00 74.03  ? 41  GLU C CD  1 
ATOM   5894  O  OE1 . GLU C  1 64  ? 139.411 21.225  116.560 1.00 70.00  ? 41  GLU C OE1 1 
ATOM   5895  O  OE2 . GLU C  1 64  ? 140.285 22.632  115.125 1.00 74.33  ? 41  GLU C OE2 1 
ATOM   5896  N  N   . THR C  1 65  ? 134.577 23.111  118.655 1.00 64.08  ? 42  THR C N   1 
ATOM   5897  C  CA  . THR C  1 65  ? 134.023 23.027  120.001 1.00 64.02  ? 42  THR C CA  1 
ATOM   5898  C  C   . THR C  1 65  ? 134.413 21.714  120.679 1.00 72.23  ? 42  THR C C   1 
ATOM   5899  O  O   . THR C  1 65  ? 134.502 20.672  120.022 1.00 73.20  ? 42  THR C O   1 
ATOM   5900  C  CB  . THR C  1 65  ? 132.502 23.123  119.976 1.00 60.15  ? 42  THR C CB  1 
ATOM   5901  O  OG1 . THR C  1 65  ? 131.975 22.087  119.142 1.00 63.59  ? 42  THR C OG1 1 
ATOM   5902  C  CG2 . THR C  1 65  ? 132.074 24.460  119.430 1.00 59.60  ? 42  THR C CG2 1 
ATOM   5903  N  N   . GLU C  1 66  ? 134.636 21.768  121.991 1.00 59.79  ? 43  GLU C N   1 
ATOM   5904  C  CA  . GLU C  1 66  ? 134.979 20.576  122.765 1.00 63.22  ? 43  GLU C CA  1 
ATOM   5905  C  C   . GLU C  1 66  ? 133.950 19.462  122.577 1.00 63.00  ? 43  GLU C C   1 
ATOM   5906  O  O   . GLU C  1 66  ? 134.231 18.303  122.860 1.00 72.34  ? 43  GLU C O   1 
ATOM   5907  C  CB  . GLU C  1 66  ? 135.112 20.906  124.255 1.00 69.26  ? 43  GLU C CB  1 
ATOM   5908  C  CG  . GLU C  1 66  ? 136.275 21.823  124.606 1.00 84.83  ? 43  GLU C CG  1 
ATOM   5909  C  CD  . GLU C  1 66  ? 137.638 21.186  124.365 1.00 101.93 ? 43  GLU C CD  1 
ATOM   5910  O  OE1 . GLU C  1 66  ? 137.692 19.987  124.010 1.00 108.40 ? 43  GLU C OE1 1 
ATOM   5911  O  OE2 . GLU C  1 66  ? 138.661 21.889  124.535 1.00 105.11 ? 43  GLU C OE2 1 
ATOM   5912  N  N   . GLU C  1 67  ? 132.767 19.823  122.090 1.00 59.69  ? 44  GLU C N   1 
ATOM   5913  C  CA  . GLU C  1 67  ? 131.667 18.881  121.917 1.00 53.27  ? 44  GLU C CA  1 
ATOM   5914  C  C   . GLU C  1 67  ? 131.577 18.306  120.501 1.00 59.15  ? 44  GLU C C   1 
ATOM   5915  O  O   . GLU C  1 67  ? 130.739 17.440  120.233 1.00 59.58  ? 44  GLU C O   1 
ATOM   5916  C  CB  . GLU C  1 67  ? 130.333 19.528  122.317 1.00 50.10  ? 44  GLU C CB  1 
ATOM   5917  C  CG  . GLU C  1 67  ? 130.126 19.671  123.831 1.00 55.81  ? 44  GLU C CG  1 
ATOM   5918  C  CD  . GLU C  1 67  ? 130.847 20.874  124.443 1.00 67.91  ? 44  GLU C CD  1 
ATOM   5919  O  OE1 . GLU C  1 67  ? 131.619 21.547  123.724 1.00 69.66  ? 44  GLU C OE1 1 
ATOM   5920  O  OE2 . GLU C  1 67  ? 130.636 21.149  125.649 1.00 67.80  ? 44  GLU C OE2 1 
ATOM   5921  N  N   . GLY C  1 68  ? 132.433 18.789  119.600 1.00 59.01  ? 45  GLY C N   1 
ATOM   5922  C  CA  . GLY C  1 68  ? 132.532 18.231  118.260 1.00 52.04  ? 45  GLY C CA  1 
ATOM   5923  C  C   . GLY C  1 68  ? 131.637 18.895  117.228 1.00 63.96  ? 45  GLY C C   1 
ATOM   5924  O  O   . GLY C  1 68  ? 131.405 18.349  116.145 1.00 65.69  ? 45  GLY C O   1 
ATOM   5925  N  N   . VAL C  1 69  ? 131.129 20.077  117.562 1.00 66.31  ? 46  VAL C N   1 
ATOM   5926  C  CA  . VAL C  1 69  ? 130.292 20.842  116.641 1.00 63.30  ? 46  VAL C CA  1 
ATOM   5927  C  C   . VAL C  1 69  ? 131.109 21.938  115.963 1.00 59.87  ? 46  VAL C C   1 
ATOM   5928  O  O   . VAL C  1 69  ? 131.817 22.690  116.635 1.00 58.31  ? 46  VAL C O   1 
ATOM   5929  C  CB  . VAL C  1 69  ? 129.097 21.485  117.372 1.00 59.24  ? 46  VAL C CB  1 
ATOM   5930  C  CG1 . VAL C  1 69  ? 128.334 22.408  116.435 1.00 60.17  ? 46  VAL C CG1 1 
ATOM   5931  C  CG2 . VAL C  1 69  ? 128.179 20.413  117.931 1.00 53.91  ? 46  VAL C CG2 1 
ATOM   5932  N  N   . PRO C  1 70  ? 131.027 22.024  114.625 1.00 54.96  ? 47  PRO C N   1 
ATOM   5933  C  CA  . PRO C  1 70  ? 131.769 23.060  113.898 1.00 55.54  ? 47  PRO C CA  1 
ATOM   5934  C  C   . PRO C  1 70  ? 130.943 24.323  113.677 1.00 54.68  ? 47  PRO C C   1 
ATOM   5935  O  O   . PRO C  1 70  ? 129.707 24.297  113.736 1.00 48.91  ? 47  PRO C O   1 
ATOM   5936  C  CB  . PRO C  1 70  ? 132.029 22.400  112.542 1.00 45.69  ? 47  PRO C CB  1 
ATOM   5937  C  CG  . PRO C  1 70  ? 130.800 21.571  112.327 1.00 44.69  ? 47  PRO C CG  1 
ATOM   5938  C  CD  . PRO C  1 70  ? 130.371 21.076  113.705 1.00 46.49  ? 47  PRO C CD  1 
ATOM   5939  N  N   . GLY C  1 71  ? 131.639 25.421  113.413 1.00 53.96  ? 48  GLY C N   1 
ATOM   5940  C  CA  . GLY C  1 71  ? 131.008 26.644  112.953 1.00 45.85  ? 48  GLY C CA  1 
ATOM   5941  C  C   . GLY C  1 71  ? 131.813 27.183  111.792 1.00 42.27  ? 48  GLY C C   1 
ATOM   5942  O  O   . GLY C  1 71  ? 133.036 27.258  111.879 1.00 45.14  ? 48  GLY C O   1 
ATOM   5943  N  N   . ARG C  1 72  ? 131.134 27.532  110.702 1.00 52.52  ? 49  ARG C N   1 
ATOM   5944  C  CA  . ARG C  1 72  ? 131.799 28.020  109.495 1.00 53.95  ? 49  ARG C CA  1 
ATOM   5945  C  C   . ARG C  1 72  ? 131.146 29.293  108.952 1.00 51.14  ? 49  ARG C C   1 
ATOM   5946  O  O   . ARG C  1 72  ? 129.953 29.315  108.676 1.00 57.26  ? 49  ARG C O   1 
ATOM   5947  C  CB  . ARG C  1 72  ? 131.814 26.935  108.410 1.00 51.39  ? 49  ARG C CB  1 
ATOM   5948  C  CG  . ARG C  1 72  ? 132.900 25.876  108.593 1.00 57.24  ? 49  ARG C CG  1 
ATOM   5949  C  CD  . ARG C  1 72  ? 132.983 24.906  107.409 1.00 56.45  ? 49  ARG C CD  1 
ATOM   5950  N  NE  . ARG C  1 72  ? 131.850 23.986  107.354 1.00 60.50  ? 49  ARG C NE  1 
ATOM   5951  C  CZ  . ARG C  1 72  ? 131.732 22.901  108.118 1.00 62.50  ? 49  ARG C CZ  1 
ATOM   5952  N  NH1 . ARG C  1 72  ? 132.679 22.612  109.006 1.00 63.81  ? 49  ARG C NH1 1 
ATOM   5953  N  NH2 . ARG C  1 72  ? 130.666 22.110  108.003 1.00 51.64  ? 49  ARG C NH2 1 
ATOM   5954  N  N   . ALA C  1 73  ? 131.940 30.347  108.803 1.00 46.15  ? 50  ALA C N   1 
ATOM   5955  C  CA  . ALA C  1 73  ? 131.481 31.589  108.186 1.00 46.97  ? 50  ALA C CA  1 
ATOM   5956  C  C   . ALA C  1 73  ? 132.660 32.300  107.541 1.00 47.91  ? 50  ALA C C   1 
ATOM   5957  O  O   . ALA C  1 73  ? 133.810 31.926  107.772 1.00 51.50  ? 50  ALA C O   1 
ATOM   5958  C  CB  . ALA C  1 73  ? 130.813 32.494  109.218 1.00 36.02  ? 50  ALA C CB  1 
ATOM   5959  N  N   . TYR C  1 74  ? 132.381 33.325  106.740 1.00 44.93  ? 51  TYR C N   1 
ATOM   5960  C  CA  . TYR C  1 74  ? 133.449 34.065  106.071 1.00 40.95  ? 51  TYR C CA  1 
ATOM   5961  C  C   . TYR C  1 74  ? 133.317 35.588  106.125 1.00 37.82  ? 51  TYR C C   1 
ATOM   5962  O  O   . TYR C  1 74  ? 132.219 36.127  106.232 1.00 38.69  ? 51  TYR C O   1 
ATOM   5963  C  CB  . TYR C  1 74  ? 133.600 33.598  104.620 1.00 42.79  ? 51  TYR C CB  1 
ATOM   5964  C  CG  . TYR C  1 74  ? 132.422 33.895  103.709 1.00 44.46  ? 51  TYR C CG  1 
ATOM   5965  C  CD1 . TYR C  1 74  ? 132.337 35.093  103.023 1.00 42.59  ? 51  TYR C CD1 1 
ATOM   5966  C  CD2 . TYR C  1 74  ? 131.414 32.963  103.511 1.00 43.02  ? 51  TYR C CD2 1 
ATOM   5967  C  CE1 . TYR C  1 74  ? 131.277 35.365  102.179 1.00 35.94  ? 51  TYR C CE1 1 
ATOM   5968  C  CE2 . TYR C  1 74  ? 130.346 33.228  102.668 1.00 41.03  ? 51  TYR C CE2 1 
ATOM   5969  C  CZ  . TYR C  1 74  ? 130.283 34.435  102.006 1.00 38.60  ? 51  TYR C CZ  1 
ATOM   5970  O  OH  . TYR C  1 74  ? 129.224 34.721  101.165 1.00 32.18  ? 51  TYR C OH  1 
ATOM   5971  N  N   . LEU C  1 75  ? 134.466 36.255  106.059 1.00 36.25  ? 52  LEU C N   1 
ATOM   5972  C  CA  . LEU C  1 75  ? 134.572 37.702  105.930 1.00 28.76  ? 52  LEU C CA  1 
ATOM   5973  C  C   . LEU C  1 75  ? 134.969 38.094  104.510 1.00 39.37  ? 52  LEU C C   1 
ATOM   5974  O  O   . LEU C  1 75  ? 135.697 37.359  103.838 1.00 35.60  ? 52  LEU C O   1 
ATOM   5975  C  CB  . LEU C  1 75  ? 135.637 38.226  106.886 1.00 26.58  ? 52  LEU C CB  1 
ATOM   5976  C  CG  . LEU C  1 75  ? 135.198 38.203  108.341 1.00 34.67  ? 52  LEU C CG  1 
ATOM   5977  C  CD1 . LEU C  1 75  ? 136.324 38.637  109.271 1.00 37.82  ? 52  LEU C CD1 1 
ATOM   5978  C  CD2 . LEU C  1 75  ? 133.992 39.107  108.488 1.00 27.50  ? 52  LEU C CD2 1 
ATOM   5979  N  N   . GLU C  1 76  ? 134.482 39.251  104.063 1.00 43.42  ? 53  GLU C N   1 
ATOM   5980  C  CA  . GLU C  1 76  ? 134.859 39.842  102.775 1.00 37.43  ? 53  GLU C CA  1 
ATOM   5981  C  C   . GLU C  1 76  ? 135.341 41.268  103.029 1.00 37.28  ? 53  GLU C C   1 
ATOM   5982  O  O   . GLU C  1 76  ? 134.574 42.229  102.894 1.00 35.71  ? 53  GLU C O   1 
ATOM   5983  C  CB  . GLU C  1 76  ? 133.668 39.828  101.806 1.00 40.73  ? 53  GLU C CB  1 
ATOM   5984  C  CG  . GLU C  1 76  ? 133.070 38.431  101.605 1.00 49.83  ? 53  GLU C CG  1 
ATOM   5985  C  CD  . GLU C  1 76  ? 131.828 38.396  100.715 1.00 55.05  ? 53  GLU C CD  1 
ATOM   5986  O  OE1 . GLU C  1 76  ? 131.972 38.219  99.484  1.00 60.37  ? 53  GLU C OE1 1 
ATOM   5987  O  OE2 . GLU C  1 76  ? 130.703 38.507  101.253 1.00 53.00  ? 53  GLU C OE2 1 
ATOM   5988  N  N   . PRO C  1 77  ? 136.617 41.404  103.428 1.00 34.33  ? 54  PRO C N   1 
ATOM   5989  C  CA  . PRO C  1 77  ? 137.236 42.634  103.945 1.00 30.24  ? 54  PRO C CA  1 
ATOM   5990  C  C   . PRO C  1 77  ? 137.769 43.580  102.865 1.00 42.00  ? 54  PRO C C   1 
ATOM   5991  O  O   . PRO C  1 77  ? 138.425 44.565  103.224 1.00 35.94  ? 54  PRO C O   1 
ATOM   5992  C  CB  . PRO C  1 77  ? 138.407 42.096  104.758 1.00 31.71  ? 54  PRO C CB  1 
ATOM   5993  C  CG  . PRO C  1 77  ? 138.843 40.892  103.966 1.00 29.48  ? 54  PRO C CG  1 
ATOM   5994  C  CD  . PRO C  1 77  ? 137.573 40.283  103.403 1.00 32.68  ? 54  PRO C CD  1 
ATOM   5995  N  N   . TYR C  1 78  ? 137.519 43.279  101.587 1.00 41.92  ? 55  TYR C N   1 
ATOM   5996  C  CA  . TYR C  1 78  ? 137.799 44.219  100.491 1.00 46.59  ? 55  TYR C CA  1 
ATOM   5997  C  C   . TYR C  1 78  ? 139.270 44.395  100.115 1.00 46.12  ? 55  TYR C C   1 
ATOM   5998  O  O   . TYR C  1 78  ? 139.648 44.238  98.956  1.00 47.13  ? 55  TYR C O   1 
ATOM   5999  C  CB  . TYR C  1 78  ? 137.246 45.603  100.830 1.00 41.14  ? 55  TYR C CB  1 
ATOM   6000  C  CG  . TYR C  1 78  ? 135.799 45.813  100.490 1.00 39.99  ? 55  TYR C CG  1 
ATOM   6001  C  CD1 . TYR C  1 78  ? 135.423 46.217  99.214  1.00 39.84  ? 55  TYR C CD1 1 
ATOM   6002  C  CD2 . TYR C  1 78  ? 134.806 45.647  101.453 1.00 38.65  ? 55  TYR C CD2 1 
ATOM   6003  C  CE1 . TYR C  1 78  ? 134.097 46.439  98.898  1.00 44.35  ? 55  TYR C CE1 1 
ATOM   6004  C  CE2 . TYR C  1 78  ? 133.474 45.867  101.148 1.00 43.07  ? 55  TYR C CE2 1 
ATOM   6005  C  CZ  . TYR C  1 78  ? 133.124 46.262  99.868  1.00 44.33  ? 55  TYR C CZ  1 
ATOM   6006  O  OH  . TYR C  1 78  ? 131.803 46.477  99.545  1.00 45.25  ? 55  TYR C OH  1 
ATOM   6007  N  N   . VAL C  1 79  ? 140.082 44.776  101.094 1.00 42.74  ? 56  VAL C N   1 
ATOM   6008  C  CA  . VAL C  1 79  ? 141.484 45.086  100.860 1.00 44.40  ? 56  VAL C CA  1 
ATOM   6009  C  C   . VAL C  1 79  ? 142.384 43.929  101.326 1.00 51.75  ? 56  VAL C C   1 
ATOM   6010  O  O   . VAL C  1 79  ? 142.527 43.676  102.532 1.00 45.97  ? 56  VAL C O   1 
ATOM   6011  C  CB  . VAL C  1 79  ? 141.864 46.428  101.524 1.00 49.77  ? 56  VAL C CB  1 
ATOM   6012  C  CG1 . VAL C  1 79  ? 141.164 46.574  102.861 1.00 59.33  ? 56  VAL C CG1 1 
ATOM   6013  C  CG2 . VAL C  1 79  ? 143.365 46.560  101.679 1.00 53.26  ? 56  VAL C CG2 1 
ATOM   6014  N  N   . PRO C  1 80  ? 142.977 43.207  100.356 1.00 46.88  ? 57  PRO C N   1 
ATOM   6015  C  CA  . PRO C  1 80  ? 143.800 42.021  100.616 1.00 46.25  ? 57  PRO C CA  1 
ATOM   6016  C  C   . PRO C  1 80  ? 144.816 42.250  101.729 1.00 41.80  ? 57  PRO C C   1 
ATOM   6017  O  O   . PRO C  1 80  ? 144.898 41.453  102.668 1.00 40.55  ? 57  PRO C O   1 
ATOM   6018  C  CB  . PRO C  1 80  ? 144.498 41.789  99.273  1.00 46.12  ? 57  PRO C CB  1 
ATOM   6019  C  CG  . PRO C  1 80  ? 143.497 42.265  98.265  1.00 43.35  ? 57  PRO C CG  1 
ATOM   6020  C  CD  . PRO C  1 80  ? 142.838 43.470  98.911  1.00 44.58  ? 57  PRO C CD  1 
ATOM   6021  N  N   . LYS C  1 81  ? 145.567 43.340  101.637 1.00 38.16  ? 58  LYS C N   1 
ATOM   6022  C  CA  . LYS C  1 81  ? 146.569 43.641  102.652 1.00 45.63  ? 58  LYS C CA  1 
ATOM   6023  C  C   . LYS C  1 81  ? 146.013 43.700  104.080 1.00 52.98  ? 58  LYS C C   1 
ATOM   6024  O  O   . LYS C  1 81  ? 146.764 43.533  105.042 1.00 58.29  ? 58  LYS C O   1 
ATOM   6025  C  CB  . LYS C  1 81  ? 147.289 44.943  102.315 1.00 59.48  ? 58  LYS C CB  1 
ATOM   6026  C  CG  . LYS C  1 81  ? 147.866 44.954  100.917 1.00 73.60  ? 58  LYS C CG  1 
ATOM   6027  C  CD  . LYS C  1 81  ? 149.276 45.511  100.918 1.00 83.21  ? 58  LYS C CD  1 
ATOM   6028  C  CE  . LYS C  1 81  ? 149.899 45.435  99.532  1.00 88.13  ? 58  LYS C CE  1 
ATOM   6029  N  NZ  . LYS C  1 81  ? 151.274 46.002  99.524  1.00 90.79  ? 58  LYS C NZ  1 
ATOM   6030  N  N   . ALA C  1 82  ? 144.713 43.935  104.235 1.00 49.81  ? 59  ALA C N   1 
ATOM   6031  C  CA  . ALA C  1 82  ? 144.155 44.041  105.585 1.00 52.76  ? 59  ALA C CA  1 
ATOM   6032  C  C   . ALA C  1 82  ? 143.996 42.673  106.257 1.00 46.88  ? 59  ALA C C   1 
ATOM   6033  O  O   . ALA C  1 82  ? 143.829 42.583  107.480 1.00 43.30  ? 59  ALA C O   1 
ATOM   6034  C  CB  . ALA C  1 82  ? 142.824 44.839  105.598 1.00 34.52  ? 59  ALA C CB  1 
ATOM   6035  N  N   . MET C  1 83  ? 144.062 41.607  105.468 1.00 39.30  ? 60  MET C N   1 
ATOM   6036  C  CA  . MET C  1 83  ? 144.021 40.270  106.047 1.00 46.78  ? 60  MET C CA  1 
ATOM   6037  C  C   . MET C  1 83  ? 145.232 40.007  106.944 1.00 48.62  ? 60  MET C C   1 
ATOM   6038  O  O   . MET C  1 83  ? 145.215 39.111  107.795 1.00 54.58  ? 60  MET C O   1 
ATOM   6039  C  CB  . MET C  1 83  ? 143.911 39.213  104.959 1.00 39.22  ? 60  MET C CB  1 
ATOM   6040  C  CG  . MET C  1 83  ? 142.677 39.387  104.107 1.00 39.19  ? 60  MET C CG  1 
ATOM   6041  S  SD  . MET C  1 83  ? 142.375 37.963  103.057 1.00 53.96  ? 60  MET C SD  1 
ATOM   6042  C  CE  . MET C  1 83  ? 143.811 38.059  101.980 1.00 48.82  ? 60  MET C CE  1 
ATOM   6043  N  N   . LYS C  1 84  ? 146.276 40.802  106.754 1.00 36.89  ? 61  LYS C N   1 
ATOM   6044  C  CA  . LYS C  1 84  ? 147.455 40.716  107.594 1.00 47.96  ? 61  LYS C CA  1 
ATOM   6045  C  C   . LYS C  1 84  ? 147.129 41.224  108.987 1.00 52.24  ? 61  LYS C C   1 
ATOM   6046  O  O   . LYS C  1 84  ? 147.721 40.782  109.967 1.00 55.40  ? 61  LYS C O   1 
ATOM   6047  C  CB  . LYS C  1 84  ? 148.598 41.543  107.005 1.00 59.41  ? 61  LYS C CB  1 
ATOM   6048  C  CG  . LYS C  1 84  ? 149.239 40.950  105.757 1.00 63.85  ? 61  LYS C CG  1 
ATOM   6049  C  CD  . LYS C  1 84  ? 150.156 41.965  105.082 1.00 64.99  ? 61  LYS C CD  1 
ATOM   6050  C  CE  . LYS C  1 84  ? 151.343 42.324  105.961 1.00 69.46  ? 61  LYS C CE  1 
ATOM   6051  N  NZ  . LYS C  1 84  ? 152.163 43.412  105.357 1.00 75.79  ? 61  LYS C NZ  1 
ATOM   6052  N  N   . TYR C  1 85  ? 146.191 42.162  109.079 1.00 46.40  ? 62  TYR C N   1 
ATOM   6053  C  CA  . TYR C  1 85  ? 145.833 42.721  110.375 1.00 42.80  ? 62  TYR C CA  1 
ATOM   6054  C  C   . TYR C  1 85  ? 144.764 41.872  111.038 1.00 41.11  ? 62  TYR C C   1 
ATOM   6055  O  O   . TYR C  1 85  ? 144.785 41.669  112.247 1.00 44.92  ? 62  TYR C O   1 
ATOM   6056  C  CB  . TYR C  1 85  ? 145.326 44.152  110.236 1.00 48.61  ? 62  TYR C CB  1 
ATOM   6057  C  CG  . TYR C  1 85  ? 146.004 44.955  109.153 1.00 53.00  ? 62  TYR C CG  1 
ATOM   6058  C  CD1 . TYR C  1 85  ? 147.362 44.817  108.895 1.00 47.77  ? 62  TYR C CD1 1 
ATOM   6059  C  CD2 . TYR C  1 85  ? 145.276 45.853  108.382 1.00 50.56  ? 62  TYR C CD2 1 
ATOM   6060  C  CE1 . TYR C  1 85  ? 147.971 45.561  107.902 1.00 48.59  ? 62  TYR C CE1 1 
ATOM   6061  C  CE2 . TYR C  1 85  ? 145.874 46.596  107.391 1.00 46.57  ? 62  TYR C CE2 1 
ATOM   6062  C  CZ  . TYR C  1 85  ? 147.220 46.449  107.154 1.00 45.09  ? 62  TYR C CZ  1 
ATOM   6063  O  OH  . TYR C  1 85  ? 147.805 47.196  106.157 1.00 44.02  ? 62  TYR C OH  1 
ATOM   6064  N  N   . LEU C  1 86  ? 143.829 41.369  110.242 1.00 50.47  ? 63  LEU C N   1 
ATOM   6065  C  CA  . LEU C  1 86  ? 142.683 40.647  110.790 1.00 49.11  ? 63  LEU C CA  1 
ATOM   6066  C  C   . LEU C  1 86  ? 143.015 39.249  111.318 1.00 45.17  ? 63  LEU C C   1 
ATOM   6067  O  O   . LEU C  1 86  ? 142.547 38.863  112.390 1.00 46.85  ? 63  LEU C O   1 
ATOM   6068  C  CB  . LEU C  1 86  ? 141.541 40.586  109.771 1.00 48.43  ? 63  LEU C CB  1 
ATOM   6069  C  CG  . LEU C  1 86  ? 140.894 41.939  109.459 1.00 42.16  ? 63  LEU C CG  1 
ATOM   6070  C  CD1 . LEU C  1 86  ? 139.848 41.777  108.367 1.00 35.31  ? 63  LEU C CD1 1 
ATOM   6071  C  CD2 . LEU C  1 86  ? 140.285 42.557  110.721 1.00 41.32  ? 63  LEU C CD2 1 
ATOM   6072  N  N   . VAL C  1 87  ? 143.818 38.493  110.578 1.00 42.18  ? 64  VAL C N   1 
ATOM   6073  C  CA  . VAL C  1 87  ? 144.140 37.126  110.991 1.00 47.36  ? 64  VAL C CA  1 
ATOM   6074  C  C   . VAL C  1 87  ? 144.837 37.068  112.365 1.00 43.75  ? 64  VAL C C   1 
ATOM   6075  O  O   . VAL C  1 87  ? 144.386 36.348  113.253 1.00 39.82  ? 64  VAL C O   1 
ATOM   6076  C  CB  . VAL C  1 87  ? 144.908 36.356  109.895 1.00 46.34  ? 64  VAL C CB  1 
ATOM   6077  C  CG1 . VAL C  1 87  ? 145.439 35.053  110.434 1.00 47.10  ? 64  VAL C CG1 1 
ATOM   6078  C  CG2 . VAL C  1 87  ? 143.992 36.096  108.706 1.00 46.49  ? 64  VAL C CG2 1 
ATOM   6079  N  N   . PRO C  1 88  ? 145.915 37.850  112.554 1.00 42.64  ? 65  PRO C N   1 
ATOM   6080  C  CA  . PRO C  1 88  ? 146.492 38.036  113.893 1.00 47.16  ? 65  PRO C CA  1 
ATOM   6081  C  C   . PRO C  1 88  ? 145.440 38.440  114.928 1.00 51.07  ? 65  PRO C C   1 
ATOM   6082  O  O   . PRO C  1 88  ? 145.470 37.945  116.054 1.00 50.40  ? 65  PRO C O   1 
ATOM   6083  C  CB  . PRO C  1 88  ? 147.461 39.204  113.695 1.00 46.68  ? 65  PRO C CB  1 
ATOM   6084  C  CG  . PRO C  1 88  ? 147.866 39.107  112.280 1.00 45.52  ? 65  PRO C CG  1 
ATOM   6085  C  CD  . PRO C  1 88  ? 146.661 38.599  111.530 1.00 45.30  ? 65  PRO C CD  1 
ATOM   6086  N  N   . ALA C  1 89  ? 144.533 39.338  114.549 1.00 44.24  ? 66  ALA C N   1 
ATOM   6087  C  CA  . ALA C  1 89  ? 143.469 39.776  115.444 1.00 44.14  ? 66  ALA C CA  1 
ATOM   6088  C  C   . ALA C  1 89  ? 142.490 38.644  115.726 1.00 48.86  ? 66  ALA C C   1 
ATOM   6089  O  O   . ALA C  1 89  ? 142.060 38.458  116.870 1.00 53.75  ? 66  ALA C O   1 
ATOM   6090  C  CB  . ALA C  1 89  ? 142.738 40.980  114.870 1.00 43.17  ? 66  ALA C CB  1 
ATOM   6091  N  N   . LEU C  1 90  ? 142.142 37.883  114.691 1.00 38.30  ? 67  LEU C N   1 
ATOM   6092  C  CA  . LEU C  1 90  ? 141.221 36.762  114.867 1.00 38.20  ? 67  LEU C CA  1 
ATOM   6093  C  C   . LEU C  1 90  ? 141.807 35.703  115.779 1.00 46.48  ? 67  LEU C C   1 
ATOM   6094  O  O   . LEU C  1 90  ? 141.144 35.224  116.699 1.00 50.26  ? 67  LEU C O   1 
ATOM   6095  C  CB  . LEU C  1 90  ? 140.833 36.150  113.528 1.00 35.43  ? 67  LEU C CB  1 
ATOM   6096  C  CG  . LEU C  1 90  ? 139.788 36.970  112.773 1.00 37.96  ? 67  LEU C CG  1 
ATOM   6097  C  CD1 . LEU C  1 90  ? 139.619 36.472  111.339 1.00 28.51  ? 67  LEU C CD1 1 
ATOM   6098  C  CD2 . LEU C  1 90  ? 138.467 36.942  113.531 1.00 35.84  ? 67  LEU C CD2 1 
ATOM   6099  N  N   . HIS C  1 91  ? 143.060 35.346  115.531 1.00 49.04  ? 68  HIS C N   1 
ATOM   6100  C  CA  . HIS C  1 91  ? 143.711 34.331  116.346 1.00 50.84  ? 68  HIS C CA  1 
ATOM   6101  C  C   . HIS C  1 91  ? 143.919 34.803  117.790 1.00 47.31  ? 68  HIS C C   1 
ATOM   6102  O  O   . HIS C  1 91  ? 143.764 34.020  118.725 1.00 49.93  ? 68  HIS C O   1 
ATOM   6103  C  CB  . HIS C  1 91  ? 144.996 33.842  115.674 1.00 55.07  ? 68  HIS C CB  1 
ATOM   6104  C  CG  . HIS C  1 91  ? 144.747 33.085  114.400 1.00 62.24  ? 68  HIS C CG  1 
ATOM   6105  N  ND1 . HIS C  1 91  ? 145.555 33.201  113.288 1.00 65.49  ? 68  HIS C ND1 1 
ATOM   6106  C  CD2 . HIS C  1 91  ? 143.767 32.211  114.061 1.00 61.71  ? 68  HIS C CD2 1 
ATOM   6107  C  CE1 . HIS C  1 91  ? 145.087 32.427  112.323 1.00 66.13  ? 68  HIS C CE1 1 
ATOM   6108  N  NE2 . HIS C  1 91  ? 144.003 31.816  112.766 1.00 64.13  ? 68  HIS C NE2 1 
ATOM   6109  N  N   . ASP C  1 92  ? 144.225 36.085  117.969 1.00 40.41  ? 69  ASP C N   1 
ATOM   6110  C  CA  . ASP C  1 92  ? 144.315 36.666  119.306 1.00 50.18  ? 69  ASP C CA  1 
ATOM   6111  C  C   . ASP C  1 92  ? 143.008 36.505  120.091 1.00 57.29  ? 69  ASP C C   1 
ATOM   6112  O  O   . ASP C  1 92  ? 143.019 36.467  121.328 1.00 56.34  ? 69  ASP C O   1 
ATOM   6113  C  CB  . ASP C  1 92  ? 144.688 38.147  119.234 1.00 57.00  ? 69  ASP C CB  1 
ATOM   6114  C  CG  . ASP C  1 92  ? 146.183 38.378  119.280 1.00 66.87  ? 69  ASP C CG  1 
ATOM   6115  O  OD1 . ASP C  1 92  ? 146.894 37.566  119.910 1.00 69.91  ? 69  ASP C OD1 1 
ATOM   6116  O  OD2 . ASP C  1 92  ? 146.646 39.381  118.695 1.00 70.10  ? 69  ASP C OD2 1 
ATOM   6117  N  N   . MET C  1 93  ? 141.889 36.423  119.371 1.00 55.26  ? 70  MET C N   1 
ATOM   6118  C  CA  . MET C  1 93  ? 140.577 36.260  119.996 1.00 51.65  ? 70  MET C CA  1 
ATOM   6119  C  C   . MET C  1 93  ? 140.316 34.789  120.312 1.00 52.73  ? 70  MET C C   1 
ATOM   6120  O  O   . MET C  1 93  ? 139.677 34.457  121.310 1.00 49.49  ? 70  MET C O   1 
ATOM   6121  C  CB  . MET C  1 93  ? 139.466 36.831  119.106 1.00 51.40  ? 70  MET C CB  1 
ATOM   6122  C  CG  . MET C  1 93  ? 139.384 38.370  119.097 1.00 57.02  ? 70  MET C CG  1 
ATOM   6123  S  SD  . MET C  1 93  ? 138.191 39.047  117.909 1.00 49.74  ? 70  MET C SD  1 
ATOM   6124  C  CE  . MET C  1 93  ? 138.376 40.808  118.181 1.00 53.11  ? 70  MET C CE  1 
ATOM   6125  N  N   . SER C  1 94  ? 140.816 33.906  119.455 1.00 49.68  ? 71  SER C N   1 
ATOM   6126  C  CA  . SER C  1 94  ? 140.761 32.480  119.734 1.00 48.90  ? 71  SER C CA  1 
ATOM   6127  C  C   . SER C  1 94  ? 141.415 32.184  121.087 1.00 44.13  ? 71  SER C C   1 
ATOM   6128  O  O   . SER C  1 94  ? 140.795 31.580  121.964 1.00 41.83  ? 71  SER C O   1 
ATOM   6129  C  CB  . SER C  1 94  ? 141.440 31.688  118.616 1.00 51.16  ? 71  SER C CB  1 
ATOM   6130  O  OG  . SER C  1 94  ? 141.235 30.298  118.786 1.00 52.32  ? 71  SER C OG  1 
ATOM   6131  N  N   . ASP C  1 95  ? 142.659 32.627  121.258 1.00 45.43  ? 72  ASP C N   1 
ATOM   6132  C  CA  . ASP C  1 95  ? 143.391 32.416  122.509 1.00 54.24  ? 72  ASP C CA  1 
ATOM   6133  C  C   . ASP C  1 95  ? 142.559 32.871  123.705 1.00 61.02  ? 72  ASP C C   1 
ATOM   6134  O  O   . ASP C  1 95  ? 142.533 32.224  124.753 1.00 62.69  ? 72  ASP C O   1 
ATOM   6135  C  CB  . ASP C  1 95  ? 144.729 33.177  122.506 1.00 59.44  ? 72  ASP C CB  1 
ATOM   6136  C  CG  . ASP C  1 95  ? 145.690 32.709  121.406 1.00 63.47  ? 72  ASP C CG  1 
ATOM   6137  O  OD1 . ASP C  1 95  ? 145.473 31.619  120.829 1.00 61.83  ? 72  ASP C OD1 1 
ATOM   6138  O  OD2 . ASP C  1 95  ? 146.674 33.436  121.125 1.00 64.61  ? 72  ASP C OD2 1 
ATOM   6139  N  N   . MET C  1 96  ? 141.869 33.990  123.529 1.00 62.47  ? 73  MET C N   1 
ATOM   6140  C  CA  . MET C  1 96  ? 141.161 34.636  124.624 1.00 54.33  ? 73  MET C CA  1 
ATOM   6141  C  C   . MET C  1 96  ? 139.866 33.918  124.990 1.00 53.22  ? 73  MET C C   1 
ATOM   6142  O  O   . MET C  1 96  ? 139.463 33.905  126.157 1.00 52.30  ? 73  MET C O   1 
ATOM   6143  C  CB  . MET C  1 96  ? 140.867 36.088  124.255 1.00 45.67  ? 73  MET C CB  1 
ATOM   6144  C  CG  . MET C  1 96  ? 140.215 36.891  125.356 1.00 50.56  ? 73  MET C CG  1 
ATOM   6145  S  SD  . MET C  1 96  ? 139.265 38.273  124.690 1.00 94.64  ? 73  MET C SD  1 
ATOM   6146  C  CE  . MET C  1 96  ? 137.903 37.413  123.908 1.00 54.73  ? 73  MET C CE  1 
ATOM   6147  N  N   . LEU C  1 97  ? 139.221 33.328  123.988 1.00 47.58  ? 74  LEU C N   1 
ATOM   6148  C  CA  . LEU C  1 97  ? 137.906 32.712  124.152 1.00 46.97  ? 74  LEU C CA  1 
ATOM   6149  C  C   . LEU C  1 97  ? 138.011 31.240  124.541 1.00 54.33  ? 74  LEU C C   1 
ATOM   6150  O  O   . LEU C  1 97  ? 137.029 30.631  124.974 1.00 58.71  ? 74  LEU C O   1 
ATOM   6151  C  CB  . LEU C  1 97  ? 137.094 32.836  122.851 1.00 49.01  ? 74  LEU C CB  1 
ATOM   6152  C  CG  . LEU C  1 97  ? 136.624 34.226  122.404 1.00 48.04  ? 74  LEU C CG  1 
ATOM   6153  C  CD1 . LEU C  1 97  ? 136.096 34.212  120.975 1.00 40.07  ? 74  LEU C CD1 1 
ATOM   6154  C  CD2 . LEU C  1 97  ? 135.572 34.751  123.359 1.00 49.90  ? 74  LEU C CD2 1 
ATOM   6155  N  N   . ALA C  1 98  ? 139.204 30.677  124.373 1.00 55.42  ? 75  ALA C N   1 
ATOM   6156  C  CA  . ALA C  1 98  ? 139.430 29.244  124.544 1.00 48.64  ? 75  ALA C CA  1 
ATOM   6157  C  C   . ALA C  1 98  ? 138.965 28.740  125.910 1.00 46.88  ? 75  ALA C C   1 
ATOM   6158  O  O   . ALA C  1 98  ? 139.391 29.252  126.943 1.00 46.08  ? 75  ALA C O   1 
ATOM   6159  C  CB  . ALA C  1 98  ? 140.898 28.927  124.335 1.00 46.38  ? 75  ALA C CB  1 
ATOM   6160  N  N   . GLY C  1 99  ? 138.086 27.740  125.905 1.00 42.41  ? 76  GLY C N   1 
ATOM   6161  C  CA  . GLY C  1 99  ? 137.587 27.153  127.136 1.00 42.03  ? 76  GLY C CA  1 
ATOM   6162  C  C   . GLY C  1 99  ? 136.297 27.776  127.639 1.00 50.70  ? 76  GLY C C   1 
ATOM   6163  O  O   . GLY C  1 99  ? 135.732 27.329  128.636 1.00 51.37  ? 76  GLY C O   1 
ATOM   6164  N  N   . GLN C  1 100 ? 135.823 28.812  126.952 1.00 56.87  ? 77  GLN C N   1 
ATOM   6165  C  CA  . GLN C  1 100 ? 134.622 29.515  127.387 1.00 52.71  ? 77  GLN C CA  1 
ATOM   6166  C  C   . GLN C  1 100 ? 133.374 29.071  126.639 1.00 46.49  ? 77  GLN C C   1 
ATOM   6167  O  O   . GLN C  1 100 ? 133.459 28.538  125.537 1.00 50.03  ? 77  GLN C O   1 
ATOM   6168  C  CB  . GLN C  1 100 ? 134.807 31.025  127.285 1.00 54.54  ? 77  GLN C CB  1 
ATOM   6169  C  CG  . GLN C  1 100 ? 135.456 31.636  128.505 1.00 59.82  ? 77  GLN C CG  1 
ATOM   6170  C  CD  . GLN C  1 100 ? 136.451 32.707  128.127 1.00 67.22  ? 77  GLN C CD  1 
ATOM   6171  O  OE1 . GLN C  1 100 ? 136.128 33.896  128.101 1.00 69.83  ? 77  GLN C OE1 1 
ATOM   6172  N  NE2 . GLN C  1 100 ? 137.673 32.290  127.818 1.00 68.49  ? 77  GLN C NE2 1 
ATOM   6173  N  N   . PRO C  1 101 ? 132.202 29.296  127.247 1.00 48.13  ? 78  PRO C N   1 
ATOM   6174  C  CA  . PRO C  1 101 ? 130.949 28.822  126.649 1.00 47.67  ? 78  PRO C CA  1 
ATOM   6175  C  C   . PRO C  1 101 ? 130.749 29.413  125.258 1.00 42.97  ? 78  PRO C C   1 
ATOM   6176  O  O   . PRO C  1 101 ? 131.067 30.582  125.042 1.00 47.08  ? 78  PRO C O   1 
ATOM   6177  C  CB  . PRO C  1 101 ? 129.877 29.350  127.612 1.00 46.70  ? 78  PRO C CB  1 
ATOM   6178  C  CG  . PRO C  1 101 ? 130.613 29.651  128.902 1.00 42.40  ? 78  PRO C CG  1 
ATOM   6179  C  CD  . PRO C  1 101 ? 131.982 30.071  128.484 1.00 41.44  ? 78  PRO C CD  1 
ATOM   6180  N  N   . LEU C  1 102 ? 130.231 28.620  124.326 1.00 30.99  ? 79  LEU C N   1 
ATOM   6181  C  CA  . LEU C  1 102 ? 129.973 29.124  122.989 1.00 35.59  ? 79  LEU C CA  1 
ATOM   6182  C  C   . LEU C  1 102 ? 128.590 29.761  122.958 1.00 46.36  ? 79  LEU C C   1 
ATOM   6183  O  O   . LEU C  1 102 ? 127.608 29.142  122.540 1.00 50.15  ? 79  LEU C O   1 
ATOM   6184  C  CB  . LEU C  1 102 ? 130.092 28.021  121.935 1.00 32.38  ? 79  LEU C CB  1 
ATOM   6185  C  CG  . LEU C  1 102 ? 130.154 28.613  120.529 1.00 38.68  ? 79  LEU C CG  1 
ATOM   6186  C  CD1 . LEU C  1 102 ? 131.555 28.459  119.950 1.00 44.17  ? 79  LEU C CD1 1 
ATOM   6187  C  CD2 . LEU C  1 102 ? 129.137 27.971  119.619 1.00 46.15  ? 79  LEU C CD2 1 
ATOM   6188  N  N   . ALA C  1 103 ? 128.524 31.001  123.436 1.00 43.88  ? 80  ALA C N   1 
ATOM   6189  C  CA  . ALA C  1 103 ? 127.287 31.760  123.473 1.00 35.71  ? 80  ALA C CA  1 
ATOM   6190  C  C   . ALA C  1 103 ? 127.505 33.100  122.767 1.00 42.36  ? 80  ALA C C   1 
ATOM   6191  O  O   . ALA C  1 103 ? 128.152 33.993  123.305 1.00 45.74  ? 80  ALA C O   1 
ATOM   6192  C  CB  . ALA C  1 103 ? 126.843 31.968  124.916 1.00 33.72  ? 80  ALA C CB  1 
ATOM   6193  N  N   . PRO C  1 104 ? 126.958 33.235  121.552 1.00 48.73  ? 81  PRO C N   1 
ATOM   6194  C  CA  . PRO C  1 104 ? 127.197 34.370  120.651 1.00 50.43  ? 81  PRO C CA  1 
ATOM   6195  C  C   . PRO C  1 104 ? 127.114 35.736  121.338 1.00 46.49  ? 81  PRO C C   1 
ATOM   6196  O  O   . PRO C  1 104 ? 127.998 36.570  121.156 1.00 46.61  ? 81  PRO C O   1 
ATOM   6197  C  CB  . PRO C  1 104 ? 126.077 34.232  119.618 1.00 51.49  ? 81  PRO C CB  1 
ATOM   6198  C  CG  . PRO C  1 104 ? 125.766 32.782  119.602 1.00 52.52  ? 81  PRO C CG  1 
ATOM   6199  C  CD  . PRO C  1 104 ? 125.959 32.300  121.006 1.00 47.80  ? 81  PRO C CD  1 
ATOM   6200  N  N   . ALA C  1 105 ? 126.065 35.964  122.116 1.00 41.96  ? 82  ALA C N   1 
ATOM   6201  C  CA  . ALA C  1 105 ? 125.879 37.263  122.743 1.00 42.76  ? 82  ALA C CA  1 
ATOM   6202  C  C   . ALA C  1 105 ? 126.974 37.548  123.761 1.00 45.19  ? 82  ALA C C   1 
ATOM   6203  O  O   . ALA C  1 105 ? 127.449 38.680  123.864 1.00 43.90  ? 82  ALA C O   1 
ATOM   6204  C  CB  . ALA C  1 105 ? 124.513 37.355  123.389 1.00 37.95  ? 82  ALA C CB  1 
ATOM   6205  N  N   . GLU C  1 106 ? 127.380 36.530  124.513 1.00 40.74  ? 83  GLU C N   1 
ATOM   6206  C  CA  . GLU C  1 106 ? 128.423 36.730  125.516 1.00 42.50  ? 83  GLU C CA  1 
ATOM   6207  C  C   . GLU C  1 106 ? 129.771 37.005  124.850 1.00 42.52  ? 83  GLU C C   1 
ATOM   6208  O  O   . GLU C  1 106 ? 130.525 37.877  125.272 1.00 43.83  ? 83  GLU C O   1 
ATOM   6209  C  CB  . GLU C  1 106 ? 128.521 35.524  126.451 1.00 44.17  ? 83  GLU C CB  1 
ATOM   6210  C  CG  . GLU C  1 106 ? 127.281 35.282  127.286 1.00 47.36  ? 83  GLU C CG  1 
ATOM   6211  C  CD  . GLU C  1 106 ? 127.507 34.236  128.367 1.00 66.06  ? 83  GLU C CD  1 
ATOM   6212  O  OE1 . GLU C  1 106 ? 128.547 33.533  128.318 1.00 69.67  ? 83  GLU C OE1 1 
ATOM   6213  O  OE2 . GLU C  1 106 ? 126.644 34.121  129.267 1.00 67.25  ? 83  GLU C OE2 1 
ATOM   6214  N  N   . ILE C  1 107 ? 130.059 36.249  123.802 1.00 38.39  ? 84  ILE C N   1 
ATOM   6215  C  CA  . ILE C  1 107 ? 131.298 36.391  123.055 1.00 37.59  ? 84  ILE C CA  1 
ATOM   6216  C  C   . ILE C  1 107 ? 131.377 37.745  122.343 1.00 41.26  ? 84  ILE C C   1 
ATOM   6217  O  O   . ILE C  1 107 ? 132.435 38.372  122.296 1.00 39.52  ? 84  ILE C O   1 
ATOM   6218  C  CB  . ILE C  1 107 ? 131.451 35.226  122.058 1.00 31.72  ? 84  ILE C CB  1 
ATOM   6219  C  CG1 . ILE C  1 107 ? 131.629 33.920  122.846 1.00 30.35  ? 84  ILE C CG1 1 
ATOM   6220  C  CG2 . ILE C  1 107 ? 132.609 35.484  121.119 1.00 25.59  ? 84  ILE C CG2 1 
ATOM   6221  C  CD1 . ILE C  1 107 ? 131.688 32.666  122.015 1.00 31.75  ? 84  ILE C CD1 1 
ATOM   6222  N  N   . TYR C  1 108 ? 130.248 38.194  121.804 1.00 45.43  ? 85  TYR C N   1 
ATOM   6223  C  CA  . TYR C  1 108 ? 130.147 39.522  121.207 1.00 46.00  ? 85  TYR C CA  1 
ATOM   6224  C  C   . TYR C  1 108 ? 130.590 40.591  122.211 1.00 44.29  ? 85  TYR C C   1 
ATOM   6225  O  O   . TYR C  1 108 ? 131.463 41.417  121.917 1.00 36.91  ? 85  TYR C O   1 
ATOM   6226  C  CB  . TYR C  1 108 ? 128.712 39.767  120.755 1.00 42.35  ? 85  TYR C CB  1 
ATOM   6227  C  CG  . TYR C  1 108 ? 128.499 40.999  119.905 1.00 49.87  ? 85  TYR C CG  1 
ATOM   6228  C  CD1 . TYR C  1 108 ? 129.060 41.101  118.637 1.00 47.78  ? 85  TYR C CD1 1 
ATOM   6229  C  CD2 . TYR C  1 108 ? 127.696 42.043  120.352 1.00 56.36  ? 85  TYR C CD2 1 
ATOM   6230  C  CE1 . TYR C  1 108 ? 128.848 42.219  117.847 1.00 52.15  ? 85  TYR C CE1 1 
ATOM   6231  C  CE2 . TYR C  1 108 ? 127.473 43.163  119.567 1.00 55.72  ? 85  TYR C CE2 1 
ATOM   6232  C  CZ  . TYR C  1 108 ? 128.053 43.248  118.319 1.00 57.17  ? 85  TYR C CZ  1 
ATOM   6233  O  OH  . TYR C  1 108 ? 127.838 44.363  117.542 1.00 60.95  ? 85  TYR C OH  1 
ATOM   6234  N  N   . ASP C  1 109 ? 130.000 40.563  123.402 1.00 37.69  ? 86  ASP C N   1 
ATOM   6235  C  CA  . ASP C  1 109 ? 130.421 41.462  124.476 1.00 40.78  ? 86  ASP C CA  1 
ATOM   6236  C  C   . ASP C  1 109 ? 131.929 41.404  124.736 1.00 44.87  ? 86  ASP C C   1 
ATOM   6237  O  O   . ASP C  1 109 ? 132.575 42.441  124.879 1.00 51.69  ? 86  ASP C O   1 
ATOM   6238  C  CB  . ASP C  1 109 ? 129.653 41.166  125.767 1.00 48.82  ? 86  ASP C CB  1 
ATOM   6239  C  CG  . ASP C  1 109 ? 130.309 41.781  126.997 1.00 63.77  ? 86  ASP C CG  1 
ATOM   6240  O  OD1 . ASP C  1 109 ? 130.299 43.024  127.116 1.00 67.42  ? 86  ASP C OD1 1 
ATOM   6241  O  OD2 . ASP C  1 109 ? 130.827 41.022  127.851 1.00 70.87  ? 86  ASP C OD2 1 
ATOM   6242  N  N   . LYS C  1 110 ? 132.491 40.198  124.784 1.00 41.83  ? 87  LYS C N   1 
ATOM   6243  C  CA  . LYS C  1 110 ? 133.894 40.022  125.185 1.00 46.09  ? 87  LYS C CA  1 
ATOM   6244  C  C   . LYS C  1 110 ? 134.917 40.371  124.097 1.00 41.71  ? 87  LYS C C   1 
ATOM   6245  O  O   . LYS C  1 110 ? 136.019 40.844  124.389 1.00 43.26  ? 87  LYS C O   1 
ATOM   6246  C  CB  . LYS C  1 110 ? 134.127 38.610  125.747 1.00 53.86  ? 87  LYS C CB  1 
ATOM   6247  C  CG  . LYS C  1 110 ? 133.347 38.348  127.043 1.00 55.10  ? 87  LYS C CG  1 
ATOM   6248  C  CD  . LYS C  1 110 ? 133.803 37.087  127.767 1.00 57.29  ? 87  LYS C CD  1 
ATOM   6249  C  CE  . LYS C  1 110 ? 133.311 35.822  127.077 1.00 56.89  ? 87  LYS C CE  1 
ATOM   6250  N  NZ  . LYS C  1 110 ? 133.161 34.701  128.054 1.00 53.63  ? 87  LYS C NZ  1 
ATOM   6251  N  N   . THR C  1 111 ? 134.552 40.155  122.842 1.00 37.21  ? 88  THR C N   1 
ATOM   6252  C  CA  . THR C  1 111 ? 135.435 40.539  121.748 1.00 41.84  ? 88  THR C CA  1 
ATOM   6253  C  C   . THR C  1 111 ? 135.544 42.053  121.623 1.00 41.83  ? 88  THR C C   1 
ATOM   6254  O  O   . THR C  1 111 ? 136.643 42.588  121.487 1.00 43.36  ? 88  THR C O   1 
ATOM   6255  C  CB  . THR C  1 111 ? 134.998 39.929  120.399 1.00 43.95  ? 88  THR C CB  1 
ATOM   6256  O  OG1 . THR C  1 111 ? 133.645 40.304  120.111 1.00 39.19  ? 88  THR C OG1 1 
ATOM   6257  C  CG2 . THR C  1 111 ? 135.111 38.413  120.448 1.00 44.85  ? 88  THR C CG2 1 
ATOM   6258  N  N   . ARG C  1 112 ? 134.408 42.741  121.668 1.00 43.50  ? 89  ARG C N   1 
ATOM   6259  C  CA  . ARG C  1 112 ? 134.406 44.194  121.546 1.00 47.14  ? 89  ARG C CA  1 
ATOM   6260  C  C   . ARG C  1 112 ? 135.194 44.838  122.682 1.00 43.96  ? 89  ARG C C   1 
ATOM   6261  O  O   . ARG C  1 112 ? 136.039 45.704  122.457 1.00 34.79  ? 89  ARG C O   1 
ATOM   6262  C  CB  . ARG C  1 112 ? 132.977 44.736  121.543 1.00 54.93  ? 89  ARG C CB  1 
ATOM   6263  C  CG  . ARG C  1 112 ? 132.072 44.106  120.508 1.00 69.30  ? 89  ARG C CG  1 
ATOM   6264  C  CD  . ARG C  1 112 ? 130.839 44.960  120.276 1.00 76.68  ? 89  ARG C CD  1 
ATOM   6265  N  NE  . ARG C  1 112 ? 131.122 46.059  119.358 1.00 79.88  ? 89  ARG C NE  1 
ATOM   6266  C  CZ  . ARG C  1 112 ? 130.265 47.034  119.083 1.00 80.81  ? 89  ARG C CZ  1 
ATOM   6267  N  NH1 . ARG C  1 112 ? 129.072 47.046  119.661 1.00 81.52  ? 89  ARG C NH1 1 
ATOM   6268  N  NH2 . ARG C  1 112 ? 130.600 47.996  118.235 1.00 80.30  ? 89  ARG C NH2 1 
ATOM   6269  N  N   . LYS C  1 113 ? 134.908 44.410  123.905 1.00 42.76  ? 90  LYS C N   1 
ATOM   6270  C  CA  . LYS C  1 113 ? 135.527 45.008  125.077 1.00 43.77  ? 90  LYS C CA  1 
ATOM   6271  C  C   . LYS C  1 113 ? 137.051 44.844  125.045 1.00 49.44  ? 90  LYS C C   1 
ATOM   6272  O  O   . LYS C  1 113 ? 137.788 45.687  125.561 1.00 47.54  ? 90  LYS C O   1 
ATOM   6273  C  CB  . LYS C  1 113 ? 134.935 44.409  126.352 1.00 40.17  ? 90  LYS C CB  1 
ATOM   6274  C  CG  . LYS C  1 113 ? 135.279 45.167  127.608 1.00 62.74  ? 90  LYS C CG  1 
ATOM   6275  C  CD  . LYS C  1 113 ? 134.921 44.375  128.866 1.00 80.42  ? 90  LYS C CD  1 
ATOM   6276  C  CE  . LYS C  1 113 ? 133.414 44.255  129.061 1.00 86.33  ? 90  LYS C CE  1 
ATOM   6277  N  NZ  . LYS C  1 113 ? 133.080 43.723  130.418 1.00 85.30  ? 90  LYS C NZ  1 
ATOM   6278  N  N   . SER C  1 114 ? 137.528 43.771  124.420 1.00 50.00  ? 91  SER C N   1 
ATOM   6279  C  CA  . SER C  1 114 ? 138.968 43.490  124.406 1.00 49.15  ? 91  SER C CA  1 
ATOM   6280  C  C   . SER C  1 114 ? 139.761 44.453  123.516 1.00 50.24  ? 91  SER C C   1 
ATOM   6281  O  O   . SER C  1 114 ? 140.976 44.585  123.664 1.00 54.24  ? 91  SER C O   1 
ATOM   6282  C  CB  . SER C  1 114 ? 139.254 42.025  124.027 1.00 42.81  ? 91  SER C CB  1 
ATOM   6283  O  OG  . SER C  1 114 ? 139.363 41.841  122.621 1.00 43.53  ? 91  SER C OG  1 
ATOM   6284  N  N   . LEU C  1 115 ? 139.075 45.132  122.601 1.00 46.17  ? 92  LEU C N   1 
ATOM   6285  C  CA  . LEU C  1 115 ? 139.746 46.085  121.716 1.00 40.14  ? 92  LEU C CA  1 
ATOM   6286  C  C   . LEU C  1 115 ? 139.173 47.510  121.795 1.00 48.25  ? 92  LEU C C   1 
ATOM   6287  O  O   . LEU C  1 115 ? 139.515 48.359  120.963 1.00 48.43  ? 92  LEU C O   1 
ATOM   6288  C  CB  . LEU C  1 115 ? 139.724 45.580  120.269 1.00 35.34  ? 92  LEU C CB  1 
ATOM   6289  C  CG  . LEU C  1 115 ? 140.514 44.302  119.956 1.00 39.87  ? 92  LEU C CG  1 
ATOM   6290  C  CD1 . LEU C  1 115 ? 140.246 43.847  118.527 1.00 44.89  ? 92  LEU C CD1 1 
ATOM   6291  C  CD2 . LEU C  1 115 ? 142.019 44.491  120.188 1.00 33.99  ? 92  LEU C CD2 1 
ATOM   6292  N  N   . HIS C  1 116 ? 138.315 47.774  122.788 1.00 44.27  ? 93  HIS C N   1 
ATOM   6293  C  CA  . HIS C  1 116 ? 137.623 49.063  122.871 1.00 39.12  ? 93  HIS C CA  1 
ATOM   6294  C  C   . HIS C  1 116 ? 138.632 50.209  122.897 1.00 39.56  ? 93  HIS C C   1 
ATOM   6295  O  O   . HIS C  1 116 ? 138.361 51.302  122.398 1.00 35.19  ? 93  HIS C O   1 
ATOM   6296  C  CB  . HIS C  1 116 ? 136.688 49.132  124.085 1.00 45.64  ? 93  HIS C CB  1 
ATOM   6297  C  CG  . HIS C  1 116 ? 137.372 49.520  125.363 1.00 52.74  ? 93  HIS C CG  1 
ATOM   6298  N  ND1 . HIS C  1 116 ? 137.880 48.594  126.250 1.00 53.08  ? 93  HIS C ND1 1 
ATOM   6299  C  CD2 . HIS C  1 116 ? 137.620 50.735  125.907 1.00 57.93  ? 93  HIS C CD2 1 
ATOM   6300  C  CE1 . HIS C  1 116 ? 138.419 49.222  127.280 1.00 55.61  ? 93  HIS C CE1 1 
ATOM   6301  N  NE2 . HIS C  1 116 ? 138.277 50.522  127.095 1.00 54.67  ? 93  HIS C NE2 1 
ATOM   6302  N  N   . PHE C  1 117 ? 139.803 49.945  123.465 1.00 32.49  ? 94  PHE C N   1 
ATOM   6303  C  CA  . PHE C  1 117 ? 140.874 50.930  123.481 1.00 34.97  ? 94  PHE C CA  1 
ATOM   6304  C  C   . PHE C  1 117 ? 141.386 51.264  122.088 1.00 30.64  ? 94  PHE C C   1 
ATOM   6305  O  O   . PHE C  1 117 ? 141.919 52.338  121.876 1.00 28.90  ? 94  PHE C O   1 
ATOM   6306  C  CB  . PHE C  1 117 ? 142.023 50.483  124.391 1.00 27.73  ? 94  PHE C CB  1 
ATOM   6307  C  CG  . PHE C  1 117 ? 141.817 50.840  125.834 1.00 35.14  ? 94  PHE C CG  1 
ATOM   6308  C  CD1 . PHE C  1 117 ? 141.344 52.100  126.187 1.00 39.60  ? 94  PHE C CD1 1 
ATOM   6309  C  CD2 . PHE C  1 117 ? 142.079 49.919  126.841 1.00 35.88  ? 94  PHE C CD2 1 
ATOM   6310  C  CE1 . PHE C  1 117 ? 141.141 52.443  127.524 1.00 48.24  ? 94  PHE C CE1 1 
ATOM   6311  C  CE2 . PHE C  1 117 ? 141.886 50.256  128.181 1.00 43.60  ? 94  PHE C CE2 1 
ATOM   6312  C  CZ  . PHE C  1 117 ? 141.415 51.519  128.523 1.00 47.70  ? 94  PHE C CZ  1 
ATOM   6313  N  N   . VAL C  1 118 ? 141.225 50.355  121.134 1.00 32.58  ? 95  VAL C N   1 
ATOM   6314  C  CA  . VAL C  1 118 ? 141.603 50.671  119.756 1.00 33.00  ? 95  VAL C CA  1 
ATOM   6315  C  C   . VAL C  1 118 ? 140.374 50.827  118.851 1.00 36.91  ? 95  VAL C C   1 
ATOM   6316  O  O   . VAL C  1 118 ? 140.435 50.571  117.651 1.00 34.28  ? 95  VAL C O   1 
ATOM   6317  C  CB  . VAL C  1 118 ? 142.638 49.664  119.176 1.00 41.07  ? 95  VAL C CB  1 
ATOM   6318  C  CG1 . VAL C  1 118 ? 143.991 49.800  119.899 1.00 34.37  ? 95  VAL C CG1 1 
ATOM   6319  C  CG2 . VAL C  1 118 ? 142.121 48.227  119.258 1.00 36.86  ? 95  VAL C CG2 1 
ATOM   6320  N  N   . GLY C  1 119 ? 139.265 51.266  119.445 1.00 40.11  ? 96  GLY C N   1 
ATOM   6321  C  CA  . GLY C  1 119 ? 138.053 51.596  118.708 1.00 34.50  ? 96  GLY C CA  1 
ATOM   6322  C  C   . GLY C  1 119 ? 137.010 50.487  118.693 1.00 39.90  ? 96  GLY C C   1 
ATOM   6323  O  O   . GLY C  1 119 ? 137.357 49.313  118.514 1.00 35.71  ? 96  GLY C O   1 
ATOM   6324  N  N   . TYR C  1 120 ? 135.740 50.849  118.894 1.00 30.90  ? 97  TYR C N   1 
ATOM   6325  C  CA  . TYR C  1 120 ? 134.636 49.922  118.647 1.00 38.05  ? 97  TYR C CA  1 
ATOM   6326  C  C   . TYR C  1 120 ? 134.367 49.777  117.148 1.00 39.90  ? 97  TYR C C   1 
ATOM   6327  O  O   . TYR C  1 120 ? 133.973 48.705  116.688 1.00 43.86  ? 97  TYR C O   1 
ATOM   6328  C  CB  . TYR C  1 120 ? 133.343 50.342  119.368 1.00 35.20  ? 97  TYR C CB  1 
ATOM   6329  C  CG  . TYR C  1 120 ? 133.355 50.097  120.859 1.00 39.67  ? 97  TYR C CG  1 
ATOM   6330  C  CD1 . TYR C  1 120 ? 133.415 48.813  121.375 1.00 44.32  ? 97  TYR C CD1 1 
ATOM   6331  C  CD2 . TYR C  1 120 ? 133.302 51.159  121.754 1.00 39.39  ? 97  TYR C CD2 1 
ATOM   6332  C  CE1 . TYR C  1 120 ? 133.434 48.596  122.749 1.00 44.54  ? 97  TYR C CE1 1 
ATOM   6333  C  CE2 . TYR C  1 120 ? 133.321 50.952  123.113 1.00 36.27  ? 97  TYR C CE2 1 
ATOM   6334  C  CZ  . TYR C  1 120 ? 133.384 49.674  123.607 1.00 37.89  ? 97  TYR C CZ  1 
ATOM   6335  O  OH  . TYR C  1 120 ? 133.384 49.489  124.964 1.00 38.95  ? 97  TYR C OH  1 
ATOM   6336  N  N   . ALA C  1 121 ? 134.560 50.849  116.385 1.00 34.49  ? 98  ALA C N   1 
ATOM   6337  C  CA  . ALA C  1 121 ? 134.396 50.752  114.936 1.00 38.33  ? 98  ALA C CA  1 
ATOM   6338  C  C   . ALA C  1 121 ? 135.698 50.293  114.302 1.00 39.41  ? 98  ALA C C   1 
ATOM   6339  O  O   . ALA C  1 121 ? 136.715 50.168  114.981 1.00 37.29  ? 98  ALA C O   1 
ATOM   6340  C  CB  . ALA C  1 121 ? 133.962 52.084  114.339 1.00 34.60  ? 98  ALA C CB  1 
ATOM   6341  N  N   . GLY C  1 122 ? 135.659 50.045  112.997 1.00 40.50  ? 99  GLY C N   1 
ATOM   6342  C  CA  . GLY C  1 122 ? 136.857 49.719  112.248 1.00 37.41  ? 99  GLY C CA  1 
ATOM   6343  C  C   . GLY C  1 122 ? 137.257 48.258  112.301 1.00 37.32  ? 99  GLY C C   1 
ATOM   6344  O  O   . GLY C  1 122 ? 136.424 47.359  112.406 1.00 46.50  ? 99  GLY C O   1 
ATOM   6345  N  N   . LEU C  1 123 ? 138.556 48.023  112.234 1.00 31.40  ? 100 LEU C N   1 
ATOM   6346  C  CA  . LEU C  1 123 ? 139.087 46.674  112.132 1.00 34.46  ? 100 LEU C CA  1 
ATOM   6347  C  C   . LEU C  1 123 ? 138.690 45.780  113.300 1.00 42.71  ? 100 LEU C C   1 
ATOM   6348  O  O   . LEU C  1 123 ? 138.479 44.584  113.113 1.00 46.22  ? 100 LEU C O   1 
ATOM   6349  C  CB  . LEU C  1 123 ? 140.606 46.716  111.950 1.00 40.38  ? 100 LEU C CB  1 
ATOM   6350  C  CG  . LEU C  1 123 ? 141.035 47.103  110.526 1.00 39.22  ? 100 LEU C CG  1 
ATOM   6351  C  CD1 . LEU C  1 123 ? 142.441 47.707  110.499 1.00 33.00  ? 100 LEU C CD1 1 
ATOM   6352  C  CD2 . LEU C  1 123 ? 140.928 45.889  109.605 1.00 39.18  ? 100 LEU C CD2 1 
ATOM   6353  N  N   . SER C  1 124 ? 138.581 46.352  114.498 1.00 38.52  ? 101 SER C N   1 
ATOM   6354  C  CA  . SER C  1 124 ? 138.189 45.562  115.669 1.00 40.56  ? 101 SER C CA  1 
ATOM   6355  C  C   . SER C  1 124 ? 136.772 44.976  115.546 1.00 44.73  ? 101 SER C C   1 
ATOM   6356  O  O   . SER C  1 124 ? 136.550 43.789  115.813 1.00 42.22  ? 101 SER C O   1 
ATOM   6357  C  CB  . SER C  1 124 ? 138.334 46.382  116.947 1.00 42.49  ? 101 SER C CB  1 
ATOM   6358  O  OG  . SER C  1 124 ? 137.977 47.727  116.716 1.00 51.25  ? 101 SER C OG  1 
ATOM   6359  N  N   . MET C  1 125 ? 135.818 45.807  115.136 1.00 39.99  ? 102 MET C N   1 
ATOM   6360  C  CA  . MET C  1 125 ? 134.455 45.346  114.884 1.00 34.98  ? 102 MET C CA  1 
ATOM   6361  C  C   . MET C  1 125 ? 134.421 44.263  113.803 1.00 40.03  ? 102 MET C C   1 
ATOM   6362  O  O   . MET C  1 125 ? 133.686 43.277  113.910 1.00 32.92  ? 102 MET C O   1 
ATOM   6363  C  CB  . MET C  1 125 ? 133.588 46.516  114.437 1.00 32.93  ? 102 MET C CB  1 
ATOM   6364  C  CG  . MET C  1 125 ? 132.199 46.114  113.991 1.00 38.70  ? 102 MET C CG  1 
ATOM   6365  S  SD  . MET C  1 125 ? 131.290 45.288  115.304 1.00 54.07  ? 102 MET C SD  1 
ATOM   6366  C  CE  . MET C  1 125 ? 129.838 46.320  115.401 1.00 23.06  ? 102 MET C CE  1 
ATOM   6367  N  N   . ILE C  1 126 ? 135.209 44.468  112.751 1.00 35.38  ? 103 ILE C N   1 
ATOM   6368  C  CA  . ILE C  1 126 ? 135.305 43.518  111.654 1.00 37.88  ? 103 ILE C CA  1 
ATOM   6369  C  C   . ILE C  1 126 ? 135.731 42.134  112.146 1.00 38.21  ? 103 ILE C C   1 
ATOM   6370  O  O   . ILE C  1 126 ? 135.129 41.118  111.795 1.00 38.59  ? 103 ILE C O   1 
ATOM   6371  C  CB  . ILE C  1 126 ? 136.249 44.053  110.555 1.00 33.11  ? 103 ILE C CB  1 
ATOM   6372  C  CG1 . ILE C  1 126 ? 135.567 45.208  109.830 1.00 27.77  ? 103 ILE C CG1 1 
ATOM   6373  C  CG2 . ILE C  1 126 ? 136.562 42.985  109.556 1.00 35.06  ? 103 ILE C CG2 1 
ATOM   6374  C  CD1 . ILE C  1 126 ? 136.401 45.819  108.725 1.00 33.12  ? 103 ILE C CD1 1 
ATOM   6375  N  N   . ALA C  1 127 ? 136.753 42.095  112.989 1.00 38.32  ? 104 ALA C N   1 
ATOM   6376  C  CA  . ALA C  1 127 ? 137.190 40.833  113.568 1.00 42.39  ? 104 ALA C CA  1 
ATOM   6377  C  C   . ALA C  1 127 ? 136.078 40.189  114.410 1.00 47.28  ? 104 ALA C C   1 
ATOM   6378  O  O   . ALA C  1 127 ? 135.801 39.000  114.274 1.00 46.47  ? 104 ALA C O   1 
ATOM   6379  C  CB  . ALA C  1 127 ? 138.445 41.044  114.400 1.00 33.29  ? 104 ALA C CB  1 
ATOM   6380  N  N   . ALA C  1 128 ? 135.439 40.979  115.275 1.00 44.15  ? 105 ALA C N   1 
ATOM   6381  C  CA  . ALA C  1 128 ? 134.364 40.475  116.146 1.00 36.11  ? 105 ALA C CA  1 
ATOM   6382  C  C   . ALA C  1 128 ? 133.159 39.900  115.380 1.00 37.67  ? 105 ALA C C   1 
ATOM   6383  O  O   . ALA C  1 128 ? 132.529 38.931  115.821 1.00 39.11  ? 105 ALA C O   1 
ATOM   6384  C  CB  . ALA C  1 128 ? 133.907 41.559  117.092 1.00 22.76  ? 105 ALA C CB  1 
ATOM   6385  N  N   . SER C  1 129 ? 132.847 40.513  114.242 1.00 34.89  ? 106 SER C N   1 
ATOM   6386  C  CA  . SER C  1 129 ? 131.706 40.128  113.416 1.00 33.14  ? 106 SER C CA  1 
ATOM   6387  C  C   . SER C  1 129 ? 131.949 38.785  112.752 1.00 36.61  ? 106 SER C C   1 
ATOM   6388  O  O   . SER C  1 129 ? 131.045 37.951  112.677 1.00 41.64  ? 106 SER C O   1 
ATOM   6389  C  CB  . SER C  1 129 ? 131.439 41.186  112.337 1.00 31.78  ? 106 SER C CB  1 
ATOM   6390  O  OG  . SER C  1 129 ? 131.099 42.439  112.902 1.00 31.71  ? 106 SER C OG  1 
ATOM   6391  N  N   . GLY C  1 130 ? 133.168 38.587  112.255 1.00 36.14  ? 107 GLY C N   1 
ATOM   6392  C  CA  . GLY C  1 130 ? 133.548 37.317  111.656 1.00 35.09  ? 107 GLY C CA  1 
ATOM   6393  C  C   . GLY C  1 130 ? 133.354 36.209  112.666 1.00 40.67  ? 107 GLY C C   1 
ATOM   6394  O  O   . GLY C  1 130 ? 132.702 35.203  112.382 1.00 38.71  ? 107 GLY C O   1 
ATOM   6395  N  N   . VAL C  1 131 ? 133.911 36.408  113.859 1.00 40.34  ? 108 VAL C N   1 
ATOM   6396  C  CA  . VAL C  1 131 ? 133.694 35.490  114.968 1.00 40.60  ? 108 VAL C CA  1 
ATOM   6397  C  C   . VAL C  1 131 ? 132.212 35.295  115.246 1.00 47.21  ? 108 VAL C C   1 
ATOM   6398  O  O   . VAL C  1 131 ? 131.743 34.163  115.378 1.00 46.96  ? 108 VAL C O   1 
ATOM   6399  C  CB  . VAL C  1 131 ? 134.338 36.003  116.261 1.00 37.50  ? 108 VAL C CB  1 
ATOM   6400  C  CG1 . VAL C  1 131 ? 134.000 35.065  117.428 1.00 33.95  ? 108 VAL C CG1 1 
ATOM   6401  C  CG2 . VAL C  1 131 ? 135.847 36.160  116.080 1.00 33.86  ? 108 VAL C CG2 1 
ATOM   6402  N  N   . ASP C  1 132 ? 131.478 36.402  115.353 1.00 45.76  ? 109 ASP C N   1 
ATOM   6403  C  CA  . ASP C  1 132 ? 130.058 36.335  115.682 1.00 38.85  ? 109 ASP C CA  1 
ATOM   6404  C  C   . ASP C  1 132 ? 129.254 35.478  114.698 1.00 36.66  ? 109 ASP C C   1 
ATOM   6405  O  O   . ASP C  1 132 ? 128.343 34.759  115.099 1.00 30.83  ? 109 ASP C O   1 
ATOM   6406  C  CB  . ASP C  1 132 ? 129.448 37.734  115.778 1.00 40.50  ? 109 ASP C CB  1 
ATOM   6407  C  CG  . ASP C  1 132 ? 127.973 37.698  116.163 1.00 46.30  ? 109 ASP C CG  1 
ATOM   6408  O  OD1 . ASP C  1 132 ? 127.684 37.757  117.387 1.00 34.95  ? 109 ASP C OD1 1 
ATOM   6409  O  OD2 . ASP C  1 132 ? 127.112 37.599  115.243 1.00 37.98  ? 109 ASP C OD2 1 
ATOM   6410  N  N   . MET C  1 133 ? 129.591 35.543  113.413 1.00 36.13  ? 110 MET C N   1 
ATOM   6411  C  CA  . MET C  1 133 ? 128.871 34.759  112.407 1.00 32.66  ? 110 MET C CA  1 
ATOM   6412  C  C   . MET C  1 133 ? 129.165 33.259  112.519 1.00 40.68  ? 110 MET C C   1 
ATOM   6413  O  O   . MET C  1 133 ? 128.252 32.433  112.455 1.00 41.30  ? 110 MET C O   1 
ATOM   6414  C  CB  . MET C  1 133 ? 129.175 35.272  110.996 1.00 31.51  ? 110 MET C CB  1 
ATOM   6415  C  CG  . MET C  1 133 ? 128.579 36.644  110.708 1.00 26.83  ? 110 MET C CG  1 
ATOM   6416  S  SD  . MET C  1 133 ? 128.781 37.150  108.992 1.00 41.04  ? 110 MET C SD  1 
ATOM   6417  C  CE  . MET C  1 133 ? 130.376 37.978  109.054 1.00 24.71  ? 110 MET C CE  1 
ATOM   6418  N  N   . ALA C  1 134 ? 130.435 32.913  112.704 1.00 36.87  ? 111 ALA C N   1 
ATOM   6419  C  CA  . ALA C  1 134 ? 130.834 31.519  112.838 1.00 40.32  ? 111 ALA C CA  1 
ATOM   6420  C  C   . ALA C  1 134 ? 130.200 30.917  114.085 1.00 43.96  ? 111 ALA C C   1 
ATOM   6421  O  O   . ALA C  1 134 ? 129.694 29.799  114.060 1.00 38.62  ? 111 ALA C O   1 
ATOM   6422  C  CB  . ALA C  1 134 ? 132.337 31.412  112.907 1.00 40.66  ? 111 ALA C CB  1 
ATOM   6423  N  N   . VAL C  1 135 ? 130.215 31.684  115.167 1.00 40.18  ? 112 VAL C N   1 
ATOM   6424  C  CA  . VAL C  1 135 ? 129.660 31.250  116.437 1.00 39.82  ? 112 VAL C CA  1 
ATOM   6425  C  C   . VAL C  1 135 ? 128.143 31.057  116.388 1.00 45.88  ? 112 VAL C C   1 
ATOM   6426  O  O   . VAL C  1 135 ? 127.609 30.115  116.982 1.00 44.42  ? 112 VAL C O   1 
ATOM   6427  C  CB  . VAL C  1 135 ? 130.039 32.230  117.559 1.00 46.76  ? 112 VAL C CB  1 
ATOM   6428  C  CG1 . VAL C  1 135 ? 129.179 32.004  118.786 1.00 55.38  ? 112 VAL C CG1 1 
ATOM   6429  C  CG2 . VAL C  1 135 ? 131.514 32.083  117.895 1.00 51.22  ? 112 VAL C CG2 1 
ATOM   6430  N  N   . TRP C  1 136 ? 127.441 31.940  115.688 1.00 51.02  ? 113 TRP C N   1 
ATOM   6431  C  CA  . TRP C  1 136 ? 126.001 31.756  115.536 1.00 48.66  ? 113 TRP C CA  1 
ATOM   6432  C  C   . TRP C  1 136 ? 125.768 30.509  114.699 1.00 44.82  ? 113 TRP C C   1 
ATOM   6433  O  O   . TRP C  1 136 ? 124.862 29.726  114.972 1.00 44.20  ? 113 TRP C O   1 
ATOM   6434  C  CB  . TRP C  1 136 ? 125.311 32.984  114.914 1.00 43.68  ? 113 TRP C CB  1 
ATOM   6435  C  CG  . TRP C  1 136 ? 124.825 34.004  115.923 1.00 34.84  ? 113 TRP C CG  1 
ATOM   6436  C  CD1 . TRP C  1 136 ? 125.414 35.197  116.237 1.00 30.97  ? 113 TRP C CD1 1 
ATOM   6437  C  CD2 . TRP C  1 136 ? 123.649 33.913  116.743 1.00 37.92  ? 113 TRP C CD2 1 
ATOM   6438  N  NE1 . TRP C  1 136 ? 124.679 35.852  117.200 1.00 32.15  ? 113 TRP C NE1 1 
ATOM   6439  C  CE2 . TRP C  1 136 ? 123.592 35.086  117.526 1.00 33.65  ? 113 TRP C CE2 1 
ATOM   6440  C  CE3 . TRP C  1 136 ? 122.644 32.949  116.897 1.00 47.37  ? 113 TRP C CE3 1 
ATOM   6441  C  CZ2 . TRP C  1 136 ? 122.570 35.323  118.444 1.00 36.74  ? 113 TRP C CZ2 1 
ATOM   6442  C  CZ3 . TRP C  1 136 ? 121.626 33.187  117.808 1.00 43.25  ? 113 TRP C CZ3 1 
ATOM   6443  C  CH2 . TRP C  1 136 ? 121.598 34.365  118.570 1.00 39.46  ? 113 TRP C CH2 1 
ATOM   6444  N  N   . ASP C  1 137 ? 126.610 30.308  113.691 1.00 42.74  ? 114 ASP C N   1 
ATOM   6445  C  CA  . ASP C  1 137 ? 126.505 29.108  112.871 1.00 40.30  ? 114 ASP C CA  1 
ATOM   6446  C  C   . ASP C  1 137 ? 126.692 27.842  113.723 1.00 40.68  ? 114 ASP C C   1 
ATOM   6447  O  O   . ASP C  1 137 ? 125.916 26.890  113.618 1.00 35.44  ? 114 ASP C O   1 
ATOM   6448  C  CB  . ASP C  1 137 ? 127.500 29.147  111.709 1.00 45.11  ? 114 ASP C CB  1 
ATOM   6449  C  CG  . ASP C  1 137 ? 127.495 27.867  110.899 1.00 48.68  ? 114 ASP C CG  1 
ATOM   6450  O  OD1 . ASP C  1 137 ? 126.490 27.601  110.203 1.00 51.38  ? 114 ASP C OD1 1 
ATOM   6451  O  OD2 . ASP C  1 137 ? 128.494 27.124  110.966 1.00 44.35  ? 114 ASP C OD2 1 
ATOM   6452  N  N   . ALA C  1 138 ? 127.710 27.839  114.578 1.00 35.63  ? 115 ALA C N   1 
ATOM   6453  C  CA  . ALA C  1 138 ? 127.940 26.705  115.465 1.00 39.40  ? 115 ALA C CA  1 
ATOM   6454  C  C   . ALA C  1 138 ? 126.728 26.455  116.358 1.00 42.56  ? 115 ALA C C   1 
ATOM   6455  O  O   . ALA C  1 138 ? 126.320 25.315  116.551 1.00 48.94  ? 115 ALA C O   1 
ATOM   6456  C  CB  . ALA C  1 138 ? 129.199 26.917  116.305 1.00 37.55  ? 115 ALA C CB  1 
ATOM   6457  N  N   . LEU C  1 139 ? 126.140 27.520  116.890 1.00 46.01  ? 116 LEU C N   1 
ATOM   6458  C  CA  . LEU C  1 139 ? 125.004 27.365  117.797 1.00 47.19  ? 116 LEU C CA  1 
ATOM   6459  C  C   . LEU C  1 139 ? 123.799 26.752  117.102 1.00 48.62  ? 116 LEU C C   1 
ATOM   6460  O  O   . LEU C  1 139 ? 123.023 26.027  117.715 1.00 53.63  ? 116 LEU C O   1 
ATOM   6461  C  CB  . LEU C  1 139 ? 124.597 28.700  118.417 1.00 42.62  ? 116 LEU C CB  1 
ATOM   6462  C  CG  . LEU C  1 139 ? 123.565 28.554  119.535 1.00 39.49  ? 116 LEU C CG  1 
ATOM   6463  C  CD1 . LEU C  1 139 ? 124.194 27.874  120.760 1.00 32.46  ? 116 LEU C CD1 1 
ATOM   6464  C  CD2 . LEU C  1 139 ? 122.978 29.905  119.900 1.00 41.30  ? 116 LEU C CD2 1 
ATOM   6465  N  N   . ALA C  1 140 ? 123.633 27.055  115.821 1.00 45.65  ? 117 ALA C N   1 
ATOM   6466  C  CA  . ALA C  1 140 ? 122.495 26.534  115.080 1.00 46.36  ? 117 ALA C CA  1 
ATOM   6467  C  C   . ALA C  1 140 ? 122.730 25.066  114.753 1.00 49.23  ? 117 ALA C C   1 
ATOM   6468  O  O   . ALA C  1 140 ? 121.797 24.255  114.741 1.00 50.30  ? 117 ALA C O   1 
ATOM   6469  C  CB  . ALA C  1 140 ? 122.282 27.332  113.819 1.00 47.36  ? 117 ALA C CB  1 
ATOM   6470  N  N   . ARG C  1 141 ? 123.985 24.725  114.488 1.00 44.86  ? 118 ARG C N   1 
ATOM   6471  C  CA  . ARG C  1 141 ? 124.326 23.342  114.215 1.00 47.40  ? 118 ARG C CA  1 
ATOM   6472  C  C   . ARG C  1 141 ? 124.055 22.514  115.465 1.00 52.44  ? 118 ARG C C   1 
ATOM   6473  O  O   . ARG C  1 141 ? 123.377 21.493  115.402 1.00 48.92  ? 118 ARG C O   1 
ATOM   6474  C  CB  . ARG C  1 141 ? 125.778 23.218  113.743 1.00 40.70  ? 118 ARG C CB  1 
ATOM   6475  C  CG  . ARG C  1 141 ? 126.016 23.818  112.363 1.00 47.09  ? 118 ARG C CG  1 
ATOM   6476  C  CD  . ARG C  1 141 ? 127.428 23.549  111.841 1.00 53.54  ? 118 ARG C CD  1 
ATOM   6477  N  NE  . ARG C  1 141 ? 127.701 24.205  110.556 1.00 51.85  ? 118 ARG C NE  1 
ATOM   6478  C  CZ  . ARG C  1 141 ? 127.473 23.659  109.360 1.00 55.73  ? 118 ARG C CZ  1 
ATOM   6479  N  NH1 . ARG C  1 141 ? 126.953 22.444  109.266 1.00 55.93  ? 118 ARG C NH1 1 
ATOM   6480  N  NH2 . ARG C  1 141 ? 127.757 24.331  108.251 1.00 52.90  ? 118 ARG C NH2 1 
ATOM   6481  N  N   . ALA C  1 142 ? 124.547 22.983  116.608 1.00 53.35  ? 119 ALA C N   1 
ATOM   6482  C  CA  . ALA C  1 142 ? 124.329 22.290  117.877 1.00 46.69  ? 119 ALA C CA  1 
ATOM   6483  C  C   . ALA C  1 142 ? 122.851 22.025  118.147 1.00 43.84  ? 119 ALA C C   1 
ATOM   6484  O  O   . ALA C  1 142 ? 122.492 21.032  118.769 1.00 50.21  ? 119 ALA C O   1 
ATOM   6485  C  CB  . ALA C  1 142 ? 124.954 23.073  119.032 1.00 44.09  ? 119 ALA C CB  1 
ATOM   6486  N  N   . ALA C  1 143 ? 121.991 22.920  117.686 1.00 48.91  ? 120 ALA C N   1 
ATOM   6487  C  CA  . ALA C  1 143 ? 120.558 22.756  117.883 1.00 49.74  ? 120 ALA C CA  1 
ATOM   6488  C  C   . ALA C  1 143 ? 119.944 21.965  116.731 1.00 52.59  ? 120 ALA C C   1 
ATOM   6489  O  O   . ALA C  1 143 ? 118.743 21.683  116.723 1.00 53.79  ? 120 ALA C O   1 
ATOM   6490  C  CB  . ALA C  1 143 ? 119.891 24.113  118.007 1.00 48.84  ? 120 ALA C CB  1 
ATOM   6491  N  N   . ASN C  1 144 ? 120.779 21.613  115.760 1.00 52.73  ? 121 ASN C N   1 
ATOM   6492  C  CA  . ASN C  1 144 ? 120.318 20.964  114.538 1.00 59.11  ? 121 ASN C CA  1 
ATOM   6493  C  C   . ASN C  1 144 ? 119.167 21.720  113.864 1.00 57.84  ? 121 ASN C C   1 
ATOM   6494  O  O   . ASN C  1 144 ? 118.133 21.134  113.534 1.00 53.50  ? 121 ASN C O   1 
ATOM   6495  C  CB  . ASN C  1 144 ? 119.932 19.509  114.813 1.00 64.47  ? 121 ASN C CB  1 
ATOM   6496  C  CG  . ASN C  1 144 ? 119.669 18.725  113.542 1.00 70.24  ? 121 ASN C CG  1 
ATOM   6497  O  OD1 . ASN C  1 144 ? 120.530 18.634  112.660 1.00 68.75  ? 121 ASN C OD1 1 
ATOM   6498  N  ND2 . ASN C  1 144 ? 118.474 18.146  113.444 1.00 68.16  ? 121 ASN C ND2 1 
ATOM   6499  N  N   . MET C  1 145 ? 119.355 23.027  113.676 1.00 52.23  ? 122 MET C N   1 
ATOM   6500  C  CA  . MET C  1 145 ? 118.380 23.866  112.981 1.00 45.21  ? 122 MET C CA  1 
ATOM   6501  C  C   . MET C  1 145 ? 119.097 24.756  111.979 1.00 42.64  ? 122 MET C C   1 
ATOM   6502  O  O   . MET C  1 145 ? 120.232 25.168  112.216 1.00 38.06  ? 122 MET C O   1 
ATOM   6503  C  CB  . MET C  1 145 ? 117.616 24.760  113.967 1.00 44.44  ? 122 MET C CB  1 
ATOM   6504  C  CG  . MET C  1 145 ? 116.734 24.038  114.973 1.00 46.64  ? 122 MET C CG  1 
ATOM   6505  S  SD  . MET C  1 145 ? 116.050 25.136  116.247 1.00 52.70  ? 122 MET C SD  1 
ATOM   6506  C  CE  . MET C  1 145 ? 115.090 23.978  117.224 1.00 72.65  ? 122 MET C CE  1 
ATOM   6507  N  N   . PRO C  1 146 ? 118.437 25.065  110.852 1.00 43.66  ? 123 PRO C N   1 
ATOM   6508  C  CA  . PRO C  1 146 ? 118.971 26.138  110.011 1.00 47.84  ? 123 PRO C CA  1 
ATOM   6509  C  C   . PRO C  1 146 ? 119.026 27.430  110.837 1.00 48.10  ? 123 PRO C C   1 
ATOM   6510  O  O   . PRO C  1 146 ? 118.216 27.589  111.748 1.00 48.95  ? 123 PRO C O   1 
ATOM   6511  C  CB  . PRO C  1 146 ? 117.925 26.260  108.895 1.00 46.86  ? 123 PRO C CB  1 
ATOM   6512  C  CG  . PRO C  1 146 ? 117.192 24.965  108.894 1.00 40.34  ? 123 PRO C CG  1 
ATOM   6513  C  CD  . PRO C  1 146 ? 117.169 24.530  110.331 1.00 40.39  ? 123 PRO C CD  1 
ATOM   6514  N  N   . LEU C  1 147 ? 119.959 28.330  110.542 1.00 49.05  ? 124 LEU C N   1 
ATOM   6515  C  CA  . LEU C  1 147 ? 120.107 29.537  111.355 1.00 44.82  ? 124 LEU C CA  1 
ATOM   6516  C  C   . LEU C  1 147 ? 118.808 30.335  111.469 1.00 44.47  ? 124 LEU C C   1 
ATOM   6517  O  O   . LEU C  1 147 ? 118.435 30.776  112.555 1.00 47.88  ? 124 LEU C O   1 
ATOM   6518  C  CB  . LEU C  1 147 ? 121.234 30.424  110.830 1.00 39.85  ? 124 LEU C CB  1 
ATOM   6519  C  CG  . LEU C  1 147 ? 121.403 31.751  111.574 1.00 36.41  ? 124 LEU C CG  1 
ATOM   6520  C  CD1 . LEU C  1 147 ? 121.537 31.524  113.071 1.00 36.60  ? 124 LEU C CD1 1 
ATOM   6521  C  CD2 . LEU C  1 147 ? 122.604 32.501  111.044 1.00 32.86  ? 124 LEU C CD2 1 
ATOM   6522  N  N   . CYS C  1 148 ? 118.111 30.516  110.355 1.00 41.22  ? 125 CYS C N   1 
ATOM   6523  C  CA  . CYS C  1 148 ? 116.856 31.266  110.391 1.00 48.96  ? 125 CYS C CA  1 
ATOM   6524  C  C   . CYS C  1 148 ? 115.827 30.614  111.318 1.00 49.15  ? 125 CYS C C   1 
ATOM   6525  O  O   . CYS C  1 148 ? 115.028 31.296  111.961 1.00 44.84  ? 125 CYS C O   1 
ATOM   6526  C  CB  . CYS C  1 148 ? 116.272 31.407  108.985 1.00 53.35  ? 125 CYS C CB  1 
ATOM   6527  S  SG  . CYS C  1 148 ? 115.933 29.831  108.196 1.00 54.66  ? 125 CYS C SG  1 
ATOM   6528  N  N   . THR C  1 149 ? 115.849 29.289  111.380 1.00 48.32  ? 126 THR C N   1 
ATOM   6529  C  CA  . THR C  1 149 ? 114.916 28.556  112.220 1.00 51.25  ? 126 THR C CA  1 
ATOM   6530  C  C   . THR C  1 149 ? 115.212 28.795  113.701 1.00 47.81  ? 126 THR C C   1 
ATOM   6531  O  O   . THR C  1 149 ? 114.307 29.017  114.500 1.00 48.47  ? 126 THR C O   1 
ATOM   6532  C  CB  . THR C  1 149 ? 114.951 27.057  111.890 1.00 53.92  ? 126 THR C CB  1 
ATOM   6533  O  OG1 . THR C  1 149 ? 114.338 26.847  110.611 1.00 55.90  ? 126 THR C OG1 1 
ATOM   6534  C  CG2 . THR C  1 149 ? 114.205 26.252  112.947 1.00 50.86  ? 126 THR C CG2 1 
ATOM   6535  N  N   . LEU C  1 150 ? 116.490 28.759  114.052 1.00 42.39  ? 127 LEU C N   1 
ATOM   6536  C  CA  . LEU C  1 150 ? 116.929 29.077  115.402 1.00 48.78  ? 127 LEU C CA  1 
ATOM   6537  C  C   . LEU C  1 150 ? 116.475 30.473  115.812 1.00 47.86  ? 127 LEU C C   1 
ATOM   6538  O  O   . LEU C  1 150 ? 116.114 30.697  116.971 1.00 42.13  ? 127 LEU C O   1 
ATOM   6539  C  CB  . LEU C  1 150 ? 118.451 29.018  115.481 1.00 48.75  ? 127 LEU C CB  1 
ATOM   6540  C  CG  . LEU C  1 150 ? 119.069 29.409  116.813 1.00 44.02  ? 127 LEU C CG  1 
ATOM   6541  C  CD1 . LEU C  1 150 ? 119.013 28.225  117.735 1.00 43.29  ? 127 LEU C CD1 1 
ATOM   6542  C  CD2 . LEU C  1 150 ? 120.504 29.835  116.598 1.00 49.92  ? 127 LEU C CD2 1 
ATOM   6543  N  N   . LEU C  1 151 ? 116.506 31.405  114.857 1.00 42.90  ? 128 LEU C N   1 
ATOM   6544  C  CA  . LEU C  1 151 ? 116.156 32.805  115.116 1.00 39.08  ? 128 LEU C CA  1 
ATOM   6545  C  C   . LEU C  1 151 ? 114.651 33.030  115.142 1.00 44.02  ? 128 LEU C C   1 
ATOM   6546  O  O   . LEU C  1 151 ? 114.193 34.142  115.410 1.00 47.62  ? 128 LEU C O   1 
ATOM   6547  C  CB  . LEU C  1 151 ? 116.795 33.729  114.078 1.00 33.30  ? 128 LEU C CB  1 
ATOM   6548  C  CG  . LEU C  1 151 ? 118.319 33.724  114.062 1.00 32.01  ? 128 LEU C CG  1 
ATOM   6549  C  CD1 . LEU C  1 151 ? 118.891 34.594  112.930 1.00 21.67  ? 128 LEU C CD1 1 
ATOM   6550  C  CD2 . LEU C  1 151 ? 118.842 34.153  115.439 1.00 26.12  ? 128 LEU C CD2 1 
ATOM   6551  N  N   . GLY C  1 152 ? 113.890 31.976  114.849 1.00 44.43  ? 129 GLY C N   1 
ATOM   6552  C  CA  . GLY C  1 152 ? 112.444 32.005  114.994 1.00 40.73  ? 129 GLY C CA  1 
ATOM   6553  C  C   . GLY C  1 152 ? 111.660 31.995  113.694 1.00 36.13  ? 129 GLY C C   1 
ATOM   6554  O  O   . GLY C  1 152 ? 110.441 32.192  113.703 1.00 39.34  ? 129 GLY C O   1 
ATOM   6555  N  N   . GLY C  1 153 ? 112.352 31.772  112.579 1.00 38.61  ? 130 GLY C N   1 
ATOM   6556  C  CA  . GLY C  1 153 ? 111.716 31.732  111.271 1.00 41.16  ? 130 GLY C CA  1 
ATOM   6557  C  C   . GLY C  1 153 ? 111.768 30.345  110.662 1.00 48.45  ? 130 GLY C C   1 
ATOM   6558  O  O   . GLY C  1 153 ? 111.965 29.363  111.377 1.00 45.59  ? 130 GLY C O   1 
ATOM   6559  N  N   . THR C  1 154 ? 111.578 30.265  109.346 1.00 53.60  ? 131 THR C N   1 
ATOM   6560  C  CA  . THR C  1 154 ? 111.759 29.015  108.599 1.00 52.33  ? 131 THR C CA  1 
ATOM   6561  C  C   . THR C  1 154 ? 112.412 29.294  107.259 1.00 48.42  ? 131 THR C C   1 
ATOM   6562  O  O   . THR C  1 154 ? 112.260 30.384  106.708 1.00 49.15  ? 131 THR C O   1 
ATOM   6563  C  CB  . THR C  1 154 ? 110.425 28.282  108.303 1.00 55.64  ? 131 THR C CB  1 
ATOM   6564  O  OG1 . THR C  1 154 ? 109.627 29.059  107.396 1.00 53.16  ? 131 THR C OG1 1 
ATOM   6565  C  CG2 . THR C  1 154 ? 109.649 28.017  109.586 1.00 57.24  ? 131 THR C CG2 1 
ATOM   6566  N  N   . PRO C  1 155 ? 113.125 28.299  106.717 1.00 51.59  ? 132 PRO C N   1 
ATOM   6567  C  CA  . PRO C  1 155 ? 113.725 28.461  105.387 1.00 51.32  ? 132 PRO C CA  1 
ATOM   6568  C  C   . PRO C  1 155 ? 112.675 28.924  104.379 1.00 45.95  ? 132 PRO C C   1 
ATOM   6569  O  O   . PRO C  1 155 ? 111.477 28.680  104.558 1.00 43.45  ? 132 PRO C O   1 
ATOM   6570  C  CB  . PRO C  1 155 ? 114.206 27.050  105.046 1.00 46.88  ? 132 PRO C CB  1 
ATOM   6571  C  CG  . PRO C  1 155 ? 114.441 26.401  106.381 1.00 51.27  ? 132 PRO C CG  1 
ATOM   6572  C  CD  . PRO C  1 155 ? 113.389 26.968  107.294 1.00 48.89  ? 132 PRO C CD  1 
ATOM   6573  N  N   . GLY C  1 156 ? 113.119 29.595  103.327 1.00 38.02  ? 133 GLY C N   1 
ATOM   6574  C  CA  . GLY C  1 156 ? 112.194 30.096  102.329 1.00 37.07  ? 133 GLY C CA  1 
ATOM   6575  C  C   . GLY C  1 156 ? 112.866 31.013  101.332 1.00 38.55  ? 133 GLY C C   1 
ATOM   6576  O  O   . GLY C  1 156 ? 114.093 31.106  101.271 1.00 41.93  ? 133 GLY C O   1 
ATOM   6577  N  N   . SER C  1 157 ? 112.056 31.697  100.541 1.00 43.23  ? 134 SER C N   1 
ATOM   6578  C  CA  . SER C  1 157 ? 112.591 32.551  99.505  1.00 51.07  ? 134 SER C CA  1 
ATOM   6579  C  C   . SER C  1 157 ? 112.714 33.968  100.024 1.00 47.06  ? 134 SER C C   1 
ATOM   6580  O  O   . SER C  1 157 ? 111.900 34.425  100.829 1.00 46.06  ? 134 SER C O   1 
ATOM   6581  C  CB  . SER C  1 157 ? 111.721 32.494  98.241  1.00 57.50  ? 134 SER C CB  1 
ATOM   6582  O  OG  . SER C  1 157 ? 110.344 32.555  98.566  1.00 62.13  ? 134 SER C OG  1 
ATOM   6583  N  N   . VAL C  1 158 ? 113.750 34.648  99.554  1.00 37.91  ? 135 VAL C N   1 
ATOM   6584  C  CA  . VAL C  1 158 ? 114.008 36.026  99.911  1.00 33.57  ? 135 VAL C CA  1 
ATOM   6585  C  C   . VAL C  1 158 ? 114.311 36.795  98.633  1.00 40.41  ? 135 VAL C C   1 
ATOM   6586  O  O   . VAL C  1 158 ? 115.292 36.494  97.942  1.00 35.99  ? 135 VAL C O   1 
ATOM   6587  C  CB  . VAL C  1 158 ? 115.210 36.119  100.862 1.00 33.13  ? 135 VAL C CB  1 
ATOM   6588  C  CG1 . VAL C  1 158 ? 115.528 37.569  101.158 1.00 33.74  ? 135 VAL C CG1 1 
ATOM   6589  C  CG2 . VAL C  1 158 ? 114.926 35.345  102.145 1.00 29.76  ? 135 VAL C CG2 1 
ATOM   6590  N  N   . LYS C  1 159 ? 113.469 37.772  98.302  1.00 36.96  ? 136 LYS C N   1 
ATOM   6591  C  CA  . LYS C  1 159 ? 113.644 38.502  97.047  1.00 34.81  ? 136 LYS C CA  1 
ATOM   6592  C  C   . LYS C  1 159 ? 115.017 39.171  97.015  1.00 36.05  ? 136 LYS C C   1 
ATOM   6593  O  O   . LYS C  1 159 ? 115.451 39.766  98.006  1.00 27.67  ? 136 LYS C O   1 
ATOM   6594  C  CB  . LYS C  1 159 ? 112.531 39.534  96.848  1.00 32.37  ? 136 LYS C CB  1 
ATOM   6595  C  CG  . LYS C  1 159 ? 112.643 40.266  95.533  1.00 37.26  ? 136 LYS C CG  1 
ATOM   6596  C  CD  . LYS C  1 159 ? 111.489 41.215  95.324  1.00 43.79  ? 136 LYS C CD  1 
ATOM   6597  C  CE  . LYS C  1 159 ? 111.510 42.356  96.329  1.00 46.43  ? 136 LYS C CE  1 
ATOM   6598  N  NZ  . LYS C  1 159 ? 110.371 43.280  96.073  1.00 48.86  ? 136 LYS C NZ  1 
ATOM   6599  N  N   . ALA C  1 160 ? 115.710 39.061  95.885  1.00 28.92  ? 137 ALA C N   1 
ATOM   6600  C  CA  . ALA C  1 160 ? 117.065 39.583  95.792  1.00 26.03  ? 137 ALA C CA  1 
ATOM   6601  C  C   . ALA C  1 160 ? 117.260 40.445  94.554  1.00 35.83  ? 137 ALA C C   1 
ATOM   6602  O  O   . ALA C  1 160 ? 116.452 40.402  93.633  1.00 39.21  ? 137 ALA C O   1 
ATOM   6603  C  CB  . ALA C  1 160 ? 118.079 38.450  95.813  1.00 25.07  ? 137 ALA C CB  1 
ATOM   6604  N  N   . TYR C  1 161 ? 118.326 41.244  94.555  1.00 37.68  ? 138 TYR C N   1 
ATOM   6605  C  CA  . TYR C  1 161 ? 118.760 41.944  93.349  1.00 37.53  ? 138 TYR C CA  1 
ATOM   6606  C  C   . TYR C  1 161 ? 120.230 41.650  93.059  1.00 36.13  ? 138 TYR C C   1 
ATOM   6607  O  O   . TYR C  1 161 ? 121.001 41.296  93.959  1.00 27.77  ? 138 TYR C O   1 
ATOM   6608  C  CB  . TYR C  1 161 ? 118.502 43.445  93.440  1.00 28.69  ? 138 TYR C CB  1 
ATOM   6609  C  CG  . TYR C  1 161 ? 119.410 44.191  94.386  1.00 35.15  ? 138 TYR C CG  1 
ATOM   6610  C  CD1 . TYR C  1 161 ? 120.475 44.941  93.905  1.00 33.83  ? 138 TYR C CD1 1 
ATOM   6611  C  CD2 . TYR C  1 161 ? 119.185 44.176  95.755  1.00 34.70  ? 138 TYR C CD2 1 
ATOM   6612  C  CE1 . TYR C  1 161 ? 121.299 45.634  94.759  1.00 32.76  ? 138 TYR C CE1 1 
ATOM   6613  C  CE2 . TYR C  1 161 ? 120.005 44.872  96.621  1.00 33.43  ? 138 TYR C CE2 1 
ATOM   6614  C  CZ  . TYR C  1 161 ? 121.057 45.597  96.115  1.00 35.20  ? 138 TYR C CZ  1 
ATOM   6615  O  OH  . TYR C  1 161 ? 121.878 46.283  96.965  1.00 41.75  ? 138 TYR C OH  1 
ATOM   6616  N  N   . ASN C  1 162 ? 120.611 41.785  91.795  1.00 34.84  ? 139 ASN C N   1 
ATOM   6617  C  CA  . ASN C  1 162 ? 121.916 41.324  91.357  1.00 33.42  ? 139 ASN C CA  1 
ATOM   6618  C  C   . ASN C  1 162 ? 122.952 42.442  91.356  1.00 33.52  ? 139 ASN C C   1 
ATOM   6619  O  O   . ASN C  1 162 ? 122.840 43.400  90.591  1.00 35.58  ? 139 ASN C O   1 
ATOM   6620  C  CB  . ASN C  1 162 ? 121.793 40.692  89.969  1.00 38.06  ? 139 ASN C CB  1 
ATOM   6621  C  CG  . ASN C  1 162 ? 123.054 39.974  89.540  1.00 45.42  ? 139 ASN C CG  1 
ATOM   6622  O  OD1 . ASN C  1 162 ? 124.033 39.907  90.286  1.00 49.55  ? 139 ASN C OD1 1 
ATOM   6623  N  ND2 . ASN C  1 162 ? 123.033 39.418  88.334  1.00 49.57  ? 139 ASN C ND2 1 
ATOM   6624  N  N   . SER C  1 163 ? 123.960 42.326  92.215  1.00 31.21  ? 140 SER C N   1 
ATOM   6625  C  CA  . SER C  1 163 ? 124.997 43.355  92.288  1.00 33.39  ? 140 SER C CA  1 
ATOM   6626  C  C   . SER C  1 163 ? 126.328 42.865  91.728  1.00 39.86  ? 140 SER C C   1 
ATOM   6627  O  O   . SER C  1 163 ? 127.383 43.433  92.029  1.00 39.98  ? 140 SER C O   1 
ATOM   6628  C  CB  . SER C  1 163 ? 125.168 43.883  93.714  1.00 32.86  ? 140 SER C CB  1 
ATOM   6629  O  OG  . SER C  1 163 ? 125.961 43.016  94.502  1.00 43.88  ? 140 SER C OG  1 
ATOM   6630  N  N   . ASN C  1 164 ? 126.262 41.820  90.903  1.00 33.53  ? 141 ASN C N   1 
ATOM   6631  C  CA  . ASN C  1 164 ? 127.451 41.224  90.279  1.00 42.90  ? 141 ASN C CA  1 
ATOM   6632  C  C   . ASN C  1 164 ? 128.312 42.159  89.414  1.00 39.26  ? 141 ASN C C   1 
ATOM   6633  O  O   . ASN C  1 164 ? 129.511 41.928  89.249  1.00 40.19  ? 141 ASN C O   1 
ATOM   6634  C  CB  . ASN C  1 164 ? 127.062 39.988  89.454  1.00 46.13  ? 141 ASN C CB  1 
ATOM   6635  C  CG  . ASN C  1 164 ? 127.283 38.695  90.208  1.00 43.39  ? 141 ASN C CG  1 
ATOM   6636  O  OD1 . ASN C  1 164 ? 128.035 38.661  91.180  1.00 40.68  ? 141 ASN C OD1 1 
ATOM   6637  N  ND2 . ASN C  1 164 ? 126.639 37.619  89.758  1.00 39.38  ? 141 ASN C ND2 1 
ATOM   6638  N  N   . GLY C  1 165 ? 127.713 43.205  88.855  1.00 36.18  ? 142 GLY C N   1 
ATOM   6639  C  CA  . GLY C  1 165 ? 128.464 44.074  87.964  1.00 35.30  ? 142 GLY C CA  1 
ATOM   6640  C  C   . GLY C  1 165 ? 127.787 45.368  87.561  1.00 38.19  ? 142 GLY C C   1 
ATOM   6641  O  O   . GLY C  1 165 ? 127.388 46.168  88.406  1.00 37.49  ? 142 GLY C O   1 
ATOM   6642  N  N   . LEU C  1 166 ? 127.651 45.564  86.255  1.00 38.51  ? 143 LEU C N   1 
ATOM   6643  C  CA  . LEU C  1 166 ? 127.246 46.849  85.699  1.00 32.54  ? 143 LEU C CA  1 
ATOM   6644  C  C   . LEU C  1 166 ? 128.162 47.946  86.227  1.00 37.50  ? 143 LEU C C   1 
ATOM   6645  O  O   . LEU C  1 166 ? 127.692 48.982  86.691  1.00 40.37  ? 143 LEU C O   1 
ATOM   6646  C  CB  . LEU C  1 166 ? 125.785 47.175  86.019  1.00 29.05  ? 143 LEU C CB  1 
ATOM   6647  C  CG  . LEU C  1 166 ? 124.760 46.087  85.707  1.00 37.92  ? 143 LEU C CG  1 
ATOM   6648  C  CD1 . LEU C  1 166 ? 123.361 46.570  86.056  1.00 42.57  ? 143 LEU C CD1 1 
ATOM   6649  C  CD2 . LEU C  1 166 ? 124.843 45.671  84.242  1.00 41.55  ? 143 LEU C CD2 1 
ATOM   6650  N  N   . TRP C  1 167 ? 129.471 47.707  86.160  1.00 36.75  ? 144 TRP C N   1 
ATOM   6651  C  CA  . TRP C  1 167 ? 130.453 48.721  86.547  1.00 35.76  ? 144 TRP C CA  1 
ATOM   6652  C  C   . TRP C  1 167 ? 130.581 49.804  85.496  1.00 31.19  ? 144 TRP C C   1 
ATOM   6653  O  O   . TRP C  1 167 ? 129.752 49.878  84.589  1.00 40.28  ? 144 TRP C O   1 
ATOM   6654  C  CB  . TRP C  1 167 ? 131.803 48.094  86.885  1.00 38.41  ? 144 TRP C CB  1 
ATOM   6655  C  CG  . TRP C  1 167 ? 131.716 47.279  88.124  1.00 42.90  ? 144 TRP C CG  1 
ATOM   6656  C  CD1 . TRP C  1 167 ? 131.559 45.932  88.207  1.00 40.93  ? 144 TRP C CD1 1 
ATOM   6657  C  CD2 . TRP C  1 167 ? 131.725 47.769  89.469  1.00 49.21  ? 144 TRP C CD2 1 
ATOM   6658  N  NE1 . TRP C  1 167 ? 131.490 45.546  89.524  1.00 49.57  ? 144 TRP C NE1 1 
ATOM   6659  C  CE2 . TRP C  1 167 ? 131.592 46.657  90.318  1.00 46.92  ? 144 TRP C CE2 1 
ATOM   6660  C  CE3 . TRP C  1 167 ? 131.851 49.043  90.038  1.00 52.91  ? 144 TRP C CE3 1 
ATOM   6661  C  CZ2 . TRP C  1 167 ? 131.575 46.776  91.704  1.00 50.88  ? 144 TRP C CZ2 1 
ATOM   6662  C  CZ3 . TRP C  1 167 ? 131.835 49.158  91.415  1.00 48.67  ? 144 TRP C CZ3 1 
ATOM   6663  C  CH2 . TRP C  1 167 ? 131.697 48.032  92.231  1.00 52.39  ? 144 TRP C CH2 1 
ATOM   6664  N  N   . LEU C  1 168 ? 131.602 50.649  85.624  1.00 27.32  ? 145 LEU C N   1 
ATOM   6665  C  CA  . LEU C  1 168 ? 131.684 51.880  84.823  1.00 38.59  ? 145 LEU C CA  1 
ATOM   6666  C  C   . LEU C  1 168 ? 132.186 51.684  83.389  1.00 47.02  ? 145 LEU C C   1 
ATOM   6667  O  O   . LEU C  1 168 ? 133.212 52.237  82.991  1.00 48.22  ? 145 LEU C O   1 
ATOM   6668  C  CB  . LEU C  1 168 ? 132.514 52.944  85.550  1.00 35.29  ? 145 LEU C CB  1 
ATOM   6669  C  CG  . LEU C  1 168 ? 131.700 53.849  86.477  1.00 40.17  ? 145 LEU C CG  1 
ATOM   6670  C  CD1 . LEU C  1 168 ? 130.544 53.092  87.108  1.00 40.19  ? 145 LEU C CD1 1 
ATOM   6671  C  CD2 . LEU C  1 168 ? 132.568 54.501  87.533  1.00 38.71  ? 145 LEU C CD2 1 
ATOM   6672  N  N   . LYS C  1 169 ? 131.440 50.909  82.611  1.00 44.60  ? 146 LYS C N   1 
ATOM   6673  C  CA  . LYS C  1 169 ? 131.806 50.647  81.231  1.00 43.61  ? 146 LYS C CA  1 
ATOM   6674  C  C   . LYS C  1 169 ? 130.886 51.369  80.246  1.00 46.92  ? 146 LYS C C   1 
ATOM   6675  O  O   . LYS C  1 169 ? 129.972 52.087  80.643  1.00 52.07  ? 146 LYS C O   1 
ATOM   6676  C  CB  . LYS C  1 169 ? 131.787 49.149  80.972  1.00 43.08  ? 146 LYS C CB  1 
ATOM   6677  C  CG  . LYS C  1 169 ? 132.675 48.370  81.922  1.00 58.54  ? 146 LYS C CG  1 
ATOM   6678  C  CD  . LYS C  1 169 ? 132.788 46.907  81.508  1.00 72.50  ? 146 LYS C CD  1 
ATOM   6679  C  CE  . LYS C  1 169 ? 131.426 46.228  81.467  1.00 76.16  ? 146 LYS C CE  1 
ATOM   6680  N  NZ  . LYS C  1 169 ? 131.559 44.775  81.175  1.00 79.70  ? 146 LYS C NZ  1 
ATOM   6681  N  N   . SER C  1 170 ? 131.145 51.179  78.960  1.00 42.01  ? 147 SER C N   1 
ATOM   6682  C  CA  . SER C  1 170 ? 130.322 51.750  77.904  1.00 45.25  ? 147 SER C CA  1 
ATOM   6683  C  C   . SER C  1 170 ? 128.841 51.470  78.137  1.00 46.03  ? 147 SER C C   1 
ATOM   6684  O  O   . SER C  1 170 ? 128.473 50.385  78.592  1.00 42.15  ? 147 SER C O   1 
ATOM   6685  C  CB  . SER C  1 170 ? 130.752 51.168  76.553  1.00 47.84  ? 147 SER C CB  1 
ATOM   6686  O  OG  . SER C  1 170 ? 129.813 51.462  75.539  1.00 57.77  ? 147 SER C OG  1 
ATOM   6687  N  N   . PRO C  1 171 ? 127.978 52.446  77.817  1.00 43.59  ? 148 PRO C N   1 
ATOM   6688  C  CA  . PRO C  1 171 ? 126.530 52.223  77.916  1.00 45.96  ? 148 PRO C CA  1 
ATOM   6689  C  C   . PRO C  1 171 ? 126.074 50.909  77.274  1.00 48.66  ? 148 PRO C C   1 
ATOM   6690  O  O   . PRO C  1 171 ? 125.266 50.203  77.885  1.00 38.68  ? 148 PRO C O   1 
ATOM   6691  C  CB  . PRO C  1 171 ? 125.941 53.425  77.172  1.00 42.46  ? 148 PRO C CB  1 
ATOM   6692  C  CG  . PRO C  1 171 ? 126.943 54.513  77.425  1.00 45.24  ? 148 PRO C CG  1 
ATOM   6693  C  CD  . PRO C  1 171 ? 128.298 53.827  77.409  1.00 45.87  ? 148 PRO C CD  1 
ATOM   6694  N  N   . ALA C  1 172 ? 126.587 50.582  76.085  1.00 51.13  ? 149 ALA C N   1 
ATOM   6695  C  CA  . ALA C  1 172 ? 126.178 49.360  75.379  1.00 46.62  ? 149 ALA C CA  1 
ATOM   6696  C  C   . ALA C  1 172 ? 126.713 48.107  76.058  1.00 43.16  ? 149 ALA C C   1 
ATOM   6697  O  O   . ALA C  1 172 ? 126.000 47.111  76.201  1.00 42.92  ? 149 ALA C O   1 
ATOM   6698  C  CB  . ALA C  1 172 ? 126.609 49.399  73.917  1.00 45.19  ? 149 ALA C CB  1 
ATOM   6699  N  N   . GLU C  1 173 ? 127.973 48.157  76.470  1.00 36.77  ? 150 GLU C N   1 
ATOM   6700  C  CA  . GLU C  1 173 ? 128.557 47.060  77.223  1.00 46.85  ? 150 GLU C CA  1 
ATOM   6701  C  C   . GLU C  1 173 ? 127.745 46.745  78.485  1.00 49.52  ? 150 GLU C C   1 
ATOM   6702  O  O   . GLU C  1 173 ? 127.522 45.575  78.821  1.00 53.97  ? 150 GLU C O   1 
ATOM   6703  C  CB  . GLU C  1 173 ? 130.005 47.388  77.599  1.00 60.53  ? 150 GLU C CB  1 
ATOM   6704  C  CG  . GLU C  1 173 ? 130.994 47.356  76.439  1.00 66.21  ? 150 GLU C CG  1 
ATOM   6705  C  CD  . GLU C  1 173 ? 132.396 47.780  76.855  1.00 71.82  ? 150 GLU C CD  1 
ATOM   6706  O  OE1 . GLU C  1 173 ? 132.581 48.973  77.187  1.00 74.30  ? 150 GLU C OE1 1 
ATOM   6707  O  OE2 . GLU C  1 173 ? 133.310 46.923  76.855  1.00 71.18  ? 150 GLU C OE2 1 
ATOM   6708  N  N   . VAL C  1 174 ? 127.308 47.791  79.182  1.00 41.10  ? 151 VAL C N   1 
ATOM   6709  C  CA  . VAL C  1 174 ? 126.549 47.622  80.417  1.00 36.46  ? 151 VAL C CA  1 
ATOM   6710  C  C   . VAL C  1 174 ? 125.145 47.092  80.137  1.00 38.43  ? 151 VAL C C   1 
ATOM   6711  O  O   . VAL C  1 174 ? 124.632 46.248  80.872  1.00 49.43  ? 151 VAL C O   1 
ATOM   6712  C  CB  . VAL C  1 174 ? 126.493 48.932  81.257  1.00 36.89  ? 151 VAL C CB  1 
ATOM   6713  C  CG1 . VAL C  1 174 ? 125.591 48.762  82.464  1.00 34.33  ? 151 VAL C CG1 1 
ATOM   6714  C  CG2 . VAL C  1 174 ? 127.891 49.337  81.707  1.00 40.72  ? 151 VAL C CG2 1 
ATOM   6715  N  N   . ALA C  1 175 ? 124.528 47.580  79.068  1.00 40.14  ? 152 ALA C N   1 
ATOM   6716  C  CA  . ALA C  1 175 ? 123.206 47.102  78.663  1.00 44.43  ? 152 ALA C CA  1 
ATOM   6717  C  C   . ALA C  1 175 ? 123.224 45.599  78.385  1.00 44.19  ? 152 ALA C C   1 
ATOM   6718  O  O   . ALA C  1 175 ? 122.333 44.858  78.814  1.00 41.49  ? 152 ALA C O   1 
ATOM   6719  C  CB  . ALA C  1 175 ? 122.725 47.858  77.433  1.00 44.52  ? 152 ALA C CB  1 
ATOM   6720  N  N   . ALA C  1 176 ? 124.249 45.156  77.665  1.00 38.00  ? 153 ALA C N   1 
ATOM   6721  C  CA  . ALA C  1 176 ? 124.375 43.746  77.321  1.00 46.49  ? 153 ALA C CA  1 
ATOM   6722  C  C   . ALA C  1 176 ? 124.563 42.916  78.577  1.00 43.47  ? 153 ALA C C   1 
ATOM   6723  O  O   . ALA C  1 176 ? 123.908 41.898  78.759  1.00 58.62  ? 153 ALA C O   1 
ATOM   6724  C  CB  . ALA C  1 176 ? 125.538 43.528  76.368  1.00 44.73  ? 153 ALA C CB  1 
ATOM   6725  N  N   . GLU C  1 177 ? 125.467 43.353  79.441  1.00 42.58  ? 154 GLU C N   1 
ATOM   6726  C  CA  . GLU C  1 177 ? 125.717 42.645  80.689  1.00 48.21  ? 154 GLU C CA  1 
ATOM   6727  C  C   . GLU C  1 177 ? 124.431 42.536  81.514  1.00 46.21  ? 154 GLU C C   1 
ATOM   6728  O  O   . GLU C  1 177 ? 124.199 41.539  82.202  1.00 45.94  ? 154 GLU C O   1 
ATOM   6729  C  CB  . GLU C  1 177 ? 126.817 43.349  81.484  1.00 49.06  ? 154 GLU C CB  1 
ATOM   6730  C  CG  . GLU C  1 177 ? 127.537 42.470  82.503  1.00 60.00  ? 154 GLU C CG  1 
ATOM   6731  C  CD  . GLU C  1 177 ? 128.820 43.114  83.020  1.00 71.75  ? 154 GLU C CD  1 
ATOM   6732  O  OE1 . GLU C  1 177 ? 129.865 42.429  83.072  1.00 72.85  ? 154 GLU C OE1 1 
ATOM   6733  O  OE2 . GLU C  1 177 ? 128.785 44.314  83.369  1.00 81.53  ? 154 GLU C OE2 1 
ATOM   6734  N  N   . ALA C  1 178 ? 123.586 43.556  81.422  1.00 38.04  ? 155 ALA C N   1 
ATOM   6735  C  CA  . ALA C  1 178 ? 122.379 43.601  82.241  1.00 48.35  ? 155 ALA C CA  1 
ATOM   6736  C  C   . ALA C  1 178 ? 121.453 42.432  81.912  1.00 56.53  ? 155 ALA C C   1 
ATOM   6737  O  O   . ALA C  1 178 ? 120.731 41.932  82.781  1.00 55.57  ? 155 ALA C O   1 
ATOM   6738  C  CB  . ALA C  1 178 ? 121.654 44.937  82.063  1.00 36.84  ? 155 ALA C CB  1 
ATOM   6739  N  N   . VAL C  1 179 ? 121.477 42.002  80.654  1.00 52.34  ? 156 VAL C N   1 
ATOM   6740  C  CA  . VAL C  1 179 ? 120.651 40.884  80.221  1.00 48.35  ? 156 VAL C CA  1 
ATOM   6741  C  C   . VAL C  1 179 ? 121.132 39.605  80.899  1.00 40.86  ? 156 VAL C C   1 
ATOM   6742  O  O   . VAL C  1 179 ? 120.330 38.845  81.462  1.00 37.90  ? 156 VAL C O   1 
ATOM   6743  C  CB  . VAL C  1 179 ? 120.675 40.717  78.680  1.00 51.10  ? 156 VAL C CB  1 
ATOM   6744  C  CG1 . VAL C  1 179 ? 119.714 39.621  78.248  1.00 42.62  ? 156 VAL C CG1 1 
ATOM   6745  C  CG2 . VAL C  1 179 ? 120.315 42.031  78.003  1.00 50.06  ? 156 VAL C CG2 1 
ATOM   6746  N  N   . GLU C  1 180 ? 122.444 39.376  80.848  1.00 36.42  ? 157 GLU C N   1 
ATOM   6747  C  CA  . GLU C  1 180 ? 123.037 38.222  81.507  1.00 38.49  ? 157 GLU C CA  1 
ATOM   6748  C  C   . GLU C  1 180 ? 122.720 38.243  83.002  1.00 49.86  ? 157 GLU C C   1 
ATOM   6749  O  O   . GLU C  1 180 ? 122.460 37.201  83.607  1.00 57.94  ? 157 GLU C O   1 
ATOM   6750  C  CB  . GLU C  1 180 ? 124.553 38.210  81.327  1.00 45.11  ? 157 GLU C CB  1 
ATOM   6751  C  CG  . GLU C  1 180 ? 125.058 38.420  79.912  1.00 58.67  ? 157 GLU C CG  1 
ATOM   6752  C  CD  . GLU C  1 180 ? 126.579 38.301  79.822  1.00 68.26  ? 157 GLU C CD  1 
ATOM   6753  O  OE1 . GLU C  1 180 ? 127.066 37.244  79.366  1.00 72.84  ? 157 GLU C OE1 1 
ATOM   6754  O  OE2 . GLU C  1 180 ? 127.289 39.257  80.215  1.00 67.56  ? 157 GLU C OE2 1 
ATOM   6755  N  N   . LEU C  1 181 ? 122.762 39.433  83.598  1.00 48.09  ? 158 LEU C N   1 
ATOM   6756  C  CA  . LEU C  1 181 ? 122.552 39.567  85.036  1.00 38.22  ? 158 LEU C CA  1 
ATOM   6757  C  C   . LEU C  1 181 ? 121.130 39.228  85.446  1.00 32.41  ? 158 LEU C C   1 
ATOM   6758  O  O   . LEU C  1 181 ? 120.915 38.556  86.448  1.00 33.83  ? 158 LEU C O   1 
ATOM   6759  C  CB  . LEU C  1 181 ? 122.938 40.962  85.527  1.00 35.27  ? 158 LEU C CB  1 
ATOM   6760  C  CG  . LEU C  1 181 ? 124.441 41.249  85.491  1.00 35.01  ? 158 LEU C CG  1 
ATOM   6761  C  CD1 . LEU C  1 181 ? 124.802 42.437  86.370  1.00 38.02  ? 158 LEU C CD1 1 
ATOM   6762  C  CD2 . LEU C  1 181 ? 125.218 40.020  85.920  1.00 36.47  ? 158 LEU C CD2 1 
ATOM   6763  N  N   . LYS C  1 182 ? 120.152 39.688  84.678  1.00 35.74  ? 159 LYS C N   1 
ATOM   6764  C  CA  . LYS C  1 182 ? 118.771 39.360  84.997  1.00 39.59  ? 159 LYS C CA  1 
ATOM   6765  C  C   . LYS C  1 182 ? 118.583 37.842  84.985  1.00 45.28  ? 159 LYS C C   1 
ATOM   6766  O  O   . LYS C  1 182 ? 117.889 37.274  85.837  1.00 49.36  ? 159 LYS C O   1 
ATOM   6767  C  CB  . LYS C  1 182 ? 117.811 40.033  84.017  1.00 34.30  ? 159 LYS C CB  1 
ATOM   6768  C  CG  . LYS C  1 182 ? 116.357 40.011  84.482  1.00 41.55  ? 159 LYS C CG  1 
ATOM   6769  C  CD  . LYS C  1 182 ? 115.433 40.677  83.465  1.00 50.41  ? 159 LYS C CD  1 
ATOM   6770  C  CE  . LYS C  1 182 ? 113.978 40.645  83.916  1.00 55.15  ? 159 LYS C CE  1 
ATOM   6771  N  NZ  . LYS C  1 182 ? 113.771 41.427  85.179  1.00 61.24  ? 159 LYS C NZ  1 
ATOM   6772  N  N   . ALA C  1 183 ? 119.239 37.197  84.027  1.00 42.34  ? 160 ALA C N   1 
ATOM   6773  C  CA  . ALA C  1 183 ? 119.076 35.767  83.787  1.00 44.89  ? 160 ALA C CA  1 
ATOM   6774  C  C   . ALA C  1 183 ? 119.746 34.882  84.845  1.00 45.53  ? 160 ALA C C   1 
ATOM   6775  O  O   . ALA C  1 183 ? 119.366 33.723  85.021  1.00 43.92  ? 160 ALA C O   1 
ATOM   6776  C  CB  . ALA C  1 183 ? 119.579 35.404  82.371  1.00 36.64  ? 160 ALA C CB  1 
ATOM   6777  N  N   . GLU C  1 184 ? 120.743 35.417  85.544  1.00 40.19  ? 161 GLU C N   1 
ATOM   6778  C  CA  . GLU C  1 184 ? 121.369 34.671  86.629  1.00 28.96  ? 161 GLU C CA  1 
ATOM   6779  C  C   . GLU C  1 184 ? 120.356 34.353  87.726  1.00 35.54  ? 161 GLU C C   1 
ATOM   6780  O  O   . GLU C  1 184 ? 120.528 33.404  88.490  1.00 41.82  ? 161 GLU C O   1 
ATOM   6781  C  CB  . GLU C  1 184 ? 122.563 35.435  87.207  1.00 36.66  ? 161 GLU C CB  1 
ATOM   6782  C  CG  . GLU C  1 184 ? 123.763 35.513  86.274  1.00 41.09  ? 161 GLU C CG  1 
ATOM   6783  C  CD  . GLU C  1 184 ? 124.962 36.178  86.922  1.00 52.48  ? 161 GLU C CD  1 
ATOM   6784  O  OE1 . GLU C  1 184 ? 124.797 37.284  87.471  1.00 49.58  ? 161 GLU C OE1 1 
ATOM   6785  O  OE2 . GLU C  1 184 ? 126.069 35.594  86.889  1.00 60.08  ? 161 GLU C OE2 1 
ATOM   6786  N  N   . GLY C  1 185 ? 119.292 35.146  87.791  1.00 38.58  ? 162 GLY C N   1 
ATOM   6787  C  CA  . GLY C  1 185 ? 118.259 34.951  88.790  1.00 45.08  ? 162 GLY C CA  1 
ATOM   6788  C  C   . GLY C  1 185 ? 117.390 33.737  88.538  1.00 53.68  ? 162 GLY C C   1 
ATOM   6789  O  O   . GLY C  1 185 ? 116.631 33.322  89.415  1.00 60.56  ? 162 GLY C O   1 
ATOM   6790  N  N   . GLN C  1 186 ? 117.501 33.178  87.334  1.00 54.55  ? 163 GLN C N   1 
ATOM   6791  C  CA  . GLN C  1 186 ? 116.725 32.011  86.900  1.00 49.96  ? 163 GLN C CA  1 
ATOM   6792  C  C   . GLN C  1 186 ? 115.248 32.334  86.701  1.00 51.27  ? 163 GLN C C   1 
ATOM   6793  O  O   . GLN C  1 186 ? 114.725 33.278  87.288  1.00 54.35  ? 163 GLN C O   1 
ATOM   6794  C  CB  . GLN C  1 186 ? 116.880 30.833  87.869  1.00 46.85  ? 163 GLN C CB  1 
ATOM   6795  C  CG  . GLN C  1 186 ? 118.322 30.500  88.257  1.00 56.22  ? 163 GLN C CG  1 
ATOM   6796  C  CD  . GLN C  1 186 ? 119.173 29.974  87.103  1.00 63.64  ? 163 GLN C CD  1 
ATOM   6797  O  OE1 . GLN C  1 186 ? 118.701 29.218  86.249  1.00 70.03  ? 163 GLN C OE1 1 
ATOM   6798  N  NE2 . GLN C  1 186 ? 120.442 30.370  87.086  1.00 60.90  ? 163 GLN C NE2 1 
ATOM   6799  N  N   . GLY C  1 187 ? 114.581 31.541  85.869  1.00 49.13  ? 164 GLY C N   1 
ATOM   6800  C  CA  . GLY C  1 187 ? 113.163 31.716  85.615  1.00 45.44  ? 164 GLY C CA  1 
ATOM   6801  C  C   . GLY C  1 187 ? 112.843 33.065  85.011  1.00 45.10  ? 164 GLY C C   1 
ATOM   6802  O  O   . GLY C  1 187 ? 113.481 33.484  84.044  1.00 49.39  ? 164 GLY C O   1 
ATOM   6803  N  N   . THR C  1 188 ? 111.857 33.749  85.589  1.00 48.29  ? 165 THR C N   1 
ATOM   6804  C  CA  . THR C  1 188 ? 111.488 35.100  85.165  1.00 49.63  ? 165 THR C CA  1 
ATOM   6805  C  C   . THR C  1 188 ? 112.581 36.129  85.456  1.00 43.76  ? 165 THR C C   1 
ATOM   6806  O  O   . THR C  1 188 ? 112.471 37.288  85.049  1.00 43.49  ? 165 THR C O   1 
ATOM   6807  C  CB  . THR C  1 188 ? 110.187 35.562  85.838  1.00 55.40  ? 165 THR C CB  1 
ATOM   6808  O  OG1 . THR C  1 188 ? 110.280 35.342  87.252  1.00 50.63  ? 165 THR C OG1 1 
ATOM   6809  C  CG2 . THR C  1 188 ? 109.002 34.788  85.283  1.00 58.15  ? 165 THR C CG2 1 
ATOM   6810  N  N   . GLY C  1 189 ? 113.617 35.704  86.179  1.00 41.77  ? 166 GLY C N   1 
ATOM   6811  C  CA  . GLY C  1 189 ? 114.802 36.521  86.399  1.00 51.03  ? 166 GLY C CA  1 
ATOM   6812  C  C   . GLY C  1 189 ? 114.781 37.451  87.607  1.00 52.68  ? 166 GLY C C   1 
ATOM   6813  O  O   . GLY C  1 189 ? 113.763 37.567  88.308  1.00 46.14  ? 166 GLY C O   1 
ATOM   6814  N  N   . PHE C  1 190 ? 115.917 38.109  87.848  1.00 44.74  ? 167 PHE C N   1 
ATOM   6815  C  CA  . PHE C  1 190 ? 116.025 39.118  88.900  1.00 42.46  ? 167 PHE C CA  1 
ATOM   6816  C  C   . PHE C  1 190 ? 115.093 40.288  88.624  1.00 43.46  ? 167 PHE C C   1 
ATOM   6817  O  O   . PHE C  1 190 ? 115.058 40.807  87.506  1.00 43.60  ? 167 PHE C O   1 
ATOM   6818  C  CB  . PHE C  1 190 ? 117.455 39.646  89.001  1.00 36.52  ? 167 PHE C CB  1 
ATOM   6819  C  CG  . PHE C  1 190 ? 118.378 38.763  89.784  1.00 37.34  ? 167 PHE C CG  1 
ATOM   6820  C  CD1 . PHE C  1 190 ? 118.136 38.499  91.125  1.00 36.86  ? 167 PHE C CD1 1 
ATOM   6821  C  CD2 . PHE C  1 190 ? 119.503 38.215  89.192  1.00 36.19  ? 167 PHE C CD2 1 
ATOM   6822  C  CE1 . PHE C  1 190 ? 118.997 37.693  91.855  1.00 36.43  ? 167 PHE C CE1 1 
ATOM   6823  C  CE2 . PHE C  1 190 ? 120.371 37.405  89.922  1.00 38.21  ? 167 PHE C CE2 1 
ATOM   6824  C  CZ  . PHE C  1 190 ? 120.121 37.146  91.251  1.00 32.66  ? 167 PHE C CZ  1 
ATOM   6825  N  N   . LYS C  1 191 ? 114.348 40.712  89.643  1.00 37.34  ? 168 LYS C N   1 
ATOM   6826  C  CA  . LYS C  1 191 ? 113.445 41.850  89.497  1.00 34.63  ? 168 LYS C CA  1 
ATOM   6827  C  C   . LYS C  1 191 ? 114.179 43.174  89.749  1.00 40.28  ? 168 LYS C C   1 
ATOM   6828  O  O   . LYS C  1 191 ? 113.591 44.259  89.667  1.00 39.30  ? 168 LYS C O   1 
ATOM   6829  C  CB  . LYS C  1 191 ? 112.240 41.699  90.429  1.00 42.41  ? 168 LYS C CB  1 
ATOM   6830  C  CG  . LYS C  1 191 ? 111.544 40.345  90.332  1.00 48.16  ? 168 LYS C CG  1 
ATOM   6831  C  CD  . LYS C  1 191 ? 110.277 40.271  91.184  1.00 53.15  ? 168 LYS C CD  1 
ATOM   6832  C  CE  . LYS C  1 191 ? 109.742 38.840  91.286  1.00 55.39  ? 168 LYS C CE  1 
ATOM   6833  N  NZ  . LYS C  1 191 ? 110.647 37.949  92.089  1.00 60.66  ? 168 LYS C NZ  1 
ATOM   6834  N  N   . GLY C  1 192 ? 115.473 43.078  90.044  1.00 35.56  ? 169 GLY C N   1 
ATOM   6835  C  CA  . GLY C  1 192 ? 116.271 44.256  90.300  1.00 38.08  ? 169 GLY C CA  1 
ATOM   6836  C  C   . GLY C  1 192 ? 117.744 44.068  90.011  1.00 38.84  ? 169 GLY C C   1 
ATOM   6837  O  O   . GLY C  1 192 ? 118.289 42.971  90.162  1.00 35.40  ? 169 GLY C O   1 
ATOM   6838  N  N   . LEU C  1 193 ? 118.390 45.158  89.610  1.00 35.69  ? 170 LEU C N   1 
ATOM   6839  C  CA  . LEU C  1 193 ? 119.815 45.159  89.301  1.00 37.06  ? 170 LEU C CA  1 
ATOM   6840  C  C   . LEU C  1 193 ? 120.509 46.360  89.958  1.00 36.28  ? 170 LEU C C   1 
ATOM   6841  O  O   . LEU C  1 193 ? 119.994 47.476  89.907  1.00 29.74  ? 170 LEU C O   1 
ATOM   6842  C  CB  . LEU C  1 193 ? 120.008 45.230  87.779  1.00 33.70  ? 170 LEU C CB  1 
ATOM   6843  C  CG  . LEU C  1 193 ? 119.420 44.088  86.935  1.00 39.57  ? 170 LEU C CG  1 
ATOM   6844  C  CD1 . LEU C  1 193 ? 119.580 44.370  85.440  1.00 36.52  ? 170 LEU C CD1 1 
ATOM   6845  C  CD2 . LEU C  1 193 ? 120.064 42.746  87.294  1.00 32.98  ? 170 LEU C CD2 1 
ATOM   6846  N  N   . LYS C  1 194 ? 121.675 46.147  90.566  1.00 31.48  ? 171 LYS C N   1 
ATOM   6847  C  CA  . LYS C  1 194 ? 122.503 47.288  90.945  1.00 31.13  ? 171 LYS C CA  1 
ATOM   6848  C  C   . LYS C  1 194 ? 123.316 47.869  89.780  1.00 32.22  ? 171 LYS C C   1 
ATOM   6849  O  O   . LYS C  1 194 ? 124.083 47.177  89.119  1.00 33.51  ? 171 LYS C O   1 
ATOM   6850  C  CB  . LYS C  1 194 ? 123.429 46.975  92.113  1.00 35.03  ? 171 LYS C CB  1 
ATOM   6851  C  CG  . LYS C  1 194 ? 124.168 48.232  92.574  1.00 38.95  ? 171 LYS C CG  1 
ATOM   6852  C  CD  . LYS C  1 194 ? 124.669 48.123  93.994  1.00 38.72  ? 171 LYS C CD  1 
ATOM   6853  C  CE  . LYS C  1 194 ? 123.550 48.268  94.983  1.00 36.58  ? 171 LYS C CE  1 
ATOM   6854  N  NZ  . LYS C  1 194 ? 124.011 47.868  96.349  1.00 39.21  ? 171 LYS C NZ  1 
ATOM   6855  N  N   . LEU C  1 195 ? 123.138 49.159  89.548  1.00 33.07  ? 172 LEU C N   1 
ATOM   6856  C  CA  . LEU C  1 195 ? 123.848 49.880  88.504  1.00 32.43  ? 172 LEU C CA  1 
ATOM   6857  C  C   . LEU C  1 195 ? 124.803 50.876  89.165  1.00 36.08  ? 172 LEU C C   1 
ATOM   6858  O  O   . LEU C  1 195 ? 124.370 51.664  90.009  1.00 28.94  ? 172 LEU C O   1 
ATOM   6859  C  CB  . LEU C  1 195 ? 122.824 50.629  87.657  1.00 32.60  ? 172 LEU C CB  1 
ATOM   6860  C  CG  . LEU C  1 195 ? 123.327 51.545  86.559  1.00 39.95  ? 172 LEU C CG  1 
ATOM   6861  C  CD1 . LEU C  1 195 ? 124.108 50.733  85.538  1.00 41.68  ? 172 LEU C CD1 1 
ATOM   6862  C  CD2 . LEU C  1 195 ? 122.156 52.267  85.916  1.00 40.63  ? 172 LEU C CD2 1 
ATOM   6863  N  N   . ARG C  1 196 ? 126.093 50.840  88.815  1.00 32.38  ? 173 ARG C N   1 
ATOM   6864  C  CA  . ARG C  1 196 ? 127.053 51.792  89.389  1.00 33.59  ? 173 ARG C CA  1 
ATOM   6865  C  C   . ARG C  1 196 ? 127.129 53.070  88.562  1.00 34.06  ? 173 ARG C C   1 
ATOM   6866  O  O   . ARG C  1 196 ? 127.224 53.026  87.342  1.00 31.33  ? 173 ARG C O   1 
ATOM   6867  C  CB  . ARG C  1 196 ? 128.450 51.179  89.513  1.00 34.99  ? 173 ARG C CB  1 
ATOM   6868  C  CG  . ARG C  1 196 ? 128.669 50.284  90.726  1.00 31.24  ? 173 ARG C CG  1 
ATOM   6869  C  CD  . ARG C  1 196 ? 128.142 48.856  90.547  1.00 30.39  ? 173 ARG C CD  1 
ATOM   6870  N  NE  . ARG C  1 196 ? 128.251 48.116  91.806  1.00 41.68  ? 173 ARG C NE  1 
ATOM   6871  C  CZ  . ARG C  1 196 ? 128.048 46.808  91.960  1.00 40.80  ? 173 ARG C CZ  1 
ATOM   6872  N  NH1 . ARG C  1 196 ? 127.729 46.038  90.926  1.00 41.54  ? 173 ARG C NH1 1 
ATOM   6873  N  NH2 . ARG C  1 196 ? 128.177 46.261  93.161  1.00 38.39  ? 173 ARG C NH2 1 
ATOM   6874  N  N   . MET C  1 197 ? 127.062 54.211  89.230  1.00 33.55  ? 174 MET C N   1 
ATOM   6875  C  CA  . MET C  1 197 ? 127.210 55.488  88.551  1.00 27.66  ? 174 MET C CA  1 
ATOM   6876  C  C   . MET C  1 197 ? 128.460 56.196  89.057  1.00 31.20  ? 174 MET C C   1 
ATOM   6877  O  O   . MET C  1 197 ? 129.163 55.678  89.920  1.00 45.28  ? 174 MET C O   1 
ATOM   6878  C  CB  . MET C  1 197 ? 125.961 56.354  88.735  1.00 31.21  ? 174 MET C CB  1 
ATOM   6879  C  CG  . MET C  1 197 ? 124.718 55.827  88.002  1.00 31.78  ? 174 MET C CG  1 
ATOM   6880  S  SD  . MET C  1 197 ? 123.546 57.140  87.583  1.00 46.96  ? 174 MET C SD  1 
ATOM   6881  C  CE  . MET C  1 197 ? 122.270 56.228  86.713  1.00 26.89  ? 174 MET C CE  1 
ATOM   6882  N  N   . GLY C  1 198 ? 128.745 57.373  88.521  1.00 27.21  ? 175 GLY C N   1 
ATOM   6883  C  CA  . GLY C  1 198 ? 129.967 58.074  88.865  1.00 30.04  ? 175 GLY C CA  1 
ATOM   6884  C  C   . GLY C  1 198 ? 130.960 58.256  87.720  1.00 39.99  ? 175 GLY C C   1 
ATOM   6885  O  O   . GLY C  1 198 ? 132.157 58.431  87.963  1.00 45.63  ? 175 GLY C O   1 
ATOM   6886  N  N   . ARG C  1 199 ? 130.472 58.223  86.479  1.00 39.09  ? 176 ARG C N   1 
ATOM   6887  C  CA  . ARG C  1 199 ? 131.317 58.489  85.312  1.00 37.28  ? 176 ARG C CA  1 
ATOM   6888  C  C   . ARG C  1 199 ? 131.715 59.957  85.267  1.00 39.33  ? 176 ARG C C   1 
ATOM   6889  O  O   . ARG C  1 199 ? 131.026 60.798  85.830  1.00 37.51  ? 176 ARG C O   1 
ATOM   6890  C  CB  . ARG C  1 199 ? 130.581 58.127  84.026  1.00 30.69  ? 176 ARG C CB  1 
ATOM   6891  C  CG  . ARG C  1 199 ? 130.401 56.651  83.833  1.00 33.62  ? 176 ARG C CG  1 
ATOM   6892  C  CD  . ARG C  1 199 ? 129.350 56.336  82.768  1.00 37.85  ? 176 ARG C CD  1 
ATOM   6893  N  NE  . ARG C  1 199 ? 129.261 54.892  82.553  1.00 38.99  ? 176 ARG C NE  1 
ATOM   6894  C  CZ  . ARG C  1 199 ? 128.560 54.065  83.317  1.00 39.93  ? 176 ARG C CZ  1 
ATOM   6895  N  NH1 . ARG C  1 199 ? 127.858 54.542  84.343  1.00 35.33  ? 176 ARG C NH1 1 
ATOM   6896  N  NH2 . ARG C  1 199 ? 128.554 52.764  83.053  1.00 40.05  ? 176 ARG C NH2 1 
ATOM   6897  N  N   . ASP C  1 200 ? 132.819 60.261  84.592  1.00 41.53  ? 177 ASP C N   1 
ATOM   6898  C  CA  . ASP C  1 200 ? 133.276 61.644  84.452  1.00 45.75  ? 177 ASP C CA  1 
ATOM   6899  C  C   . ASP C  1 200 ? 132.184 62.546  83.872  1.00 46.60  ? 177 ASP C C   1 
ATOM   6900  O  O   . ASP C  1 200 ? 132.009 63.681  84.313  1.00 46.54  ? 177 ASP C O   1 
ATOM   6901  C  CB  . ASP C  1 200 ? 134.545 61.712  83.598  1.00 58.56  ? 177 ASP C CB  1 
ATOM   6902  C  CG  . ASP C  1 200 ? 135.808 61.369  84.386  1.00 74.86  ? 177 ASP C CG  1 
ATOM   6903  O  OD1 . ASP C  1 200 ? 135.958 60.207  84.827  1.00 78.83  ? 177 ASP C OD1 1 
ATOM   6904  O  OD2 . ASP C  1 200 ? 136.666 62.264  84.543  1.00 77.77  ? 177 ASP C OD2 1 
ATOM   6905  N  N   . ASP C  1 201 ? 131.448 62.027  82.895  1.00 48.38  ? 178 ASP C N   1 
ATOM   6906  C  CA  . ASP C  1 201 ? 130.352 62.757  82.267  1.00 46.41  ? 178 ASP C CA  1 
ATOM   6907  C  C   . ASP C  1 201 ? 129.022 62.199  82.777  1.00 44.13  ? 178 ASP C C   1 
ATOM   6908  O  O   . ASP C  1 201 ? 128.671 61.058  82.483  1.00 44.96  ? 178 ASP C O   1 
ATOM   6909  C  CB  . ASP C  1 201 ? 130.454 62.638  80.736  1.00 48.39  ? 178 ASP C CB  1 
ATOM   6910  C  CG  . ASP C  1 201 ? 129.321 63.358  79.996  1.00 53.76  ? 178 ASP C CG  1 
ATOM   6911  O  OD1 . ASP C  1 201 ? 128.479 64.022  80.641  1.00 50.70  ? 178 ASP C OD1 1 
ATOM   6912  O  OD2 . ASP C  1 201 ? 129.285 63.269  78.748  1.00 60.80  ? 178 ASP C OD2 1 
ATOM   6913  N  N   . PRO C  1 202 ? 128.277 63.006  83.546  1.00 37.91  ? 179 PRO C N   1 
ATOM   6914  C  CA  . PRO C  1 202 ? 127.028 62.532  84.140  1.00 40.26  ? 179 PRO C CA  1 
ATOM   6915  C  C   . PRO C  1 202 ? 126.029 62.088  83.082  1.00 39.32  ? 179 PRO C C   1 
ATOM   6916  O  O   . PRO C  1 202 ? 125.235 61.183  83.328  1.00 44.95  ? 179 PRO C O   1 
ATOM   6917  C  CB  . PRO C  1 202 ? 126.502 63.767  84.878  1.00 37.81  ? 179 PRO C CB  1 
ATOM   6918  C  CG  . PRO C  1 202 ? 127.709 64.600  85.118  1.00 37.15  ? 179 PRO C CG  1 
ATOM   6919  C  CD  . PRO C  1 202 ? 128.577 64.395  83.930  1.00 32.22  ? 179 PRO C CD  1 
ATOM   6920  N  N   . ALA C  1 203 ? 126.067 62.707  81.911  1.00 27.15  ? 180 ALA C N   1 
ATOM   6921  C  CA  . ALA C  1 203 ? 125.122 62.343  80.855  1.00 35.16  ? 180 ALA C CA  1 
ATOM   6922  C  C   . ALA C  1 203 ? 125.227 60.867  80.469  1.00 36.20  ? 180 ALA C C   1 
ATOM   6923  O  O   . ALA C  1 203 ? 124.231 60.231  80.145  1.00 44.84  ? 180 ALA C O   1 
ATOM   6924  C  CB  . ALA C  1 203 ? 125.306 63.237  79.633  1.00 28.69  ? 180 ALA C CB  1 
ATOM   6925  N  N   . VAL C  1 204 ? 126.437 60.325  80.515  1.00 33.64  ? 181 VAL C N   1 
ATOM   6926  C  CA  . VAL C  1 204 ? 126.658 58.924  80.183  1.00 34.95  ? 181 VAL C CA  1 
ATOM   6927  C  C   . VAL C  1 204 ? 126.159 57.975  81.288  1.00 40.75  ? 181 VAL C C   1 
ATOM   6928  O  O   . VAL C  1 204 ? 125.809 56.831  81.009  1.00 45.12  ? 181 VAL C O   1 
ATOM   6929  C  CB  . VAL C  1 204 ? 128.142 58.660  79.834  1.00 35.33  ? 181 VAL C CB  1 
ATOM   6930  C  CG1 . VAL C  1 204 ? 128.369 57.204  79.464  1.00 35.11  ? 181 VAL C CG1 1 
ATOM   6931  C  CG2 . VAL C  1 204 ? 128.588 59.568  78.689  1.00 30.19  ? 181 VAL C CG2 1 
ATOM   6932  N  N   . ASP C  1 205 ? 126.122 58.442  82.535  1.00 34.20  ? 182 ASP C N   1 
ATOM   6933  C  CA  . ASP C  1 205 ? 125.467 57.681  83.597  1.00 34.10  ? 182 ASP C CA  1 
ATOM   6934  C  C   . ASP C  1 205 ? 123.998 57.458  83.220  1.00 35.99  ? 182 ASP C C   1 
ATOM   6935  O  O   . ASP C  1 205 ? 123.464 56.364  83.365  1.00 36.70  ? 182 ASP C O   1 
ATOM   6936  C  CB  . ASP C  1 205 ? 125.521 58.433  84.936  1.00 41.24  ? 182 ASP C CB  1 
ATOM   6937  C  CG  . ASP C  1 205 ? 126.769 58.108  85.776  1.00 51.77  ? 182 ASP C CG  1 
ATOM   6938  O  OD1 . ASP C  1 205 ? 127.669 57.367  85.318  1.00 44.70  ? 182 ASP C OD1 1 
ATOM   6939  O  OD2 . ASP C  1 205 ? 126.847 58.625  86.915  1.00 54.53  ? 182 ASP C OD2 1 
ATOM   6940  N  N   . ILE C  1 206 ? 123.345 58.517  82.758  1.00 33.15  ? 183 ILE C N   1 
ATOM   6941  C  CA  . ILE C  1 206 ? 121.917 58.478  82.471  1.00 31.08  ? 183 ILE C CA  1 
ATOM   6942  C  C   . ILE C  1 206 ? 121.658 57.623  81.242  1.00 37.69  ? 183 ILE C C   1 
ATOM   6943  O  O   . ILE C  1 206 ? 120.766 56.772  81.230  1.00 37.57  ? 183 ILE C O   1 
ATOM   6944  C  CB  . ILE C  1 206 ? 121.381 59.878  82.225  1.00 34.90  ? 183 ILE C CB  1 
ATOM   6945  C  CG1 . ILE C  1 206 ? 121.301 60.646  83.550  1.00 44.89  ? 183 ILE C CG1 1 
ATOM   6946  C  CG2 . ILE C  1 206 ? 120.034 59.810  81.551  1.00 35.98  ? 183 ILE C CG2 1 
ATOM   6947  C  CD1 . ILE C  1 206 ? 120.837 62.076  83.394  1.00 44.81  ? 183 ILE C CD1 1 
ATOM   6948  N  N   . GLU C  1 207 ? 122.459 57.850  80.211  1.00 36.15  ? 184 GLU C N   1 
ATOM   6949  C  CA  . GLU C  1 207 ? 122.426 57.024  79.015  1.00 45.25  ? 184 GLU C CA  1 
ATOM   6950  C  C   . GLU C  1 207 ? 122.488 55.539  79.386  1.00 40.32  ? 184 GLU C C   1 
ATOM   6951  O  O   . GLU C  1 207 ? 121.742 54.714  78.844  1.00 38.84  ? 184 GLU C O   1 
ATOM   6952  C  CB  . GLU C  1 207 ? 123.603 57.394  78.113  1.00 57.94  ? 184 GLU C CB  1 
ATOM   6953  C  CG  . GLU C  1 207 ? 123.346 57.233  76.632  1.00 69.13  ? 184 GLU C CG  1 
ATOM   6954  C  CD  . GLU C  1 207 ? 124.605 57.437  75.817  1.00 78.76  ? 184 GLU C CD  1 
ATOM   6955  O  OE1 . GLU C  1 207 ? 125.607 57.930  76.384  1.00 78.95  ? 184 GLU C OE1 1 
ATOM   6956  O  OE2 . GLU C  1 207 ? 124.592 57.098  74.614  1.00 83.35  ? 184 GLU C OE2 1 
ATOM   6957  N  N   . THR C  1 208 ? 123.376 55.205  80.316  1.00 34.32  ? 185 THR C N   1 
ATOM   6958  C  CA  . THR C  1 208 ? 123.536 53.825  80.761  1.00 34.39  ? 185 THR C CA  1 
ATOM   6959  C  C   . THR C  1 208 ? 122.252 53.303  81.415  1.00 34.05  ? 185 THR C C   1 
ATOM   6960  O  O   . THR C  1 208 ? 121.802 52.197  81.122  1.00 35.35  ? 185 THR C O   1 
ATOM   6961  C  CB  . THR C  1 208 ? 124.750 53.671  81.704  1.00 34.63  ? 185 THR C CB  1 
ATOM   6962  O  OG1 . THR C  1 208 ? 125.931 54.129  81.036  1.00 35.72  ? 185 THR C OG1 1 
ATOM   6963  C  CG2 . THR C  1 208 ? 124.942 52.218  82.117  1.00 28.23  ? 185 THR C CG2 1 
ATOM   6964  N  N   . ALA C  1 209 ? 121.639 54.115  82.268  1.00 33.59  ? 186 ALA C N   1 
ATOM   6965  C  CA  . ALA C  1 209 ? 120.361 53.733  82.859  1.00 37.84  ? 186 ALA C CA  1 
ATOM   6966  C  C   . ALA C  1 209 ? 119.313 53.455  81.783  1.00 39.61  ? 186 ALA C C   1 
ATOM   6967  O  O   . ALA C  1 209 ? 118.635 52.430  81.828  1.00 35.02  ? 186 ALA C O   1 
ATOM   6968  C  CB  . ALA C  1 209 ? 119.854 54.810  83.820  1.00 31.88  ? 186 ALA C CB  1 
ATOM   6969  N  N   . GLU C  1 210 ? 119.169 54.382  80.834  1.00 34.91  ? 187 GLU C N   1 
ATOM   6970  C  CA  . GLU C  1 210 ? 118.181 54.251  79.774  1.00 34.17  ? 187 GLU C CA  1 
ATOM   6971  C  C   . GLU C  1 210 ? 118.486 53.038  78.888  1.00 41.14  ? 187 GLU C C   1 
ATOM   6972  O  O   . GLU C  1 210 ? 117.569 52.343  78.456  1.00 46.33  ? 187 GLU C O   1 
ATOM   6973  C  CB  . GLU C  1 210 ? 118.080 55.532  78.937  1.00 39.02  ? 187 GLU C CB  1 
ATOM   6974  C  CG  . GLU C  1 210 ? 117.529 56.755  79.684  1.00 55.43  ? 187 GLU C CG  1 
ATOM   6975  C  CD  . GLU C  1 210 ? 116.075 56.596  80.116  1.00 71.14  ? 187 GLU C CD  1 
ATOM   6976  O  OE1 . GLU C  1 210 ? 115.169 56.721  79.262  1.00 76.01  ? 187 GLU C OE1 1 
ATOM   6977  O  OE2 . GLU C  1 210 ? 115.834 56.354  81.317  1.00 77.84  ? 187 GLU C OE2 1 
ATOM   6978  N  N   . ALA C  1 211 ? 119.769 52.770  78.646  1.00 42.31  ? 188 ALA C N   1 
ATOM   6979  C  CA  . ALA C  1 211 ? 120.175 51.621  77.824  1.00 41.73  ? 188 ALA C CA  1 
ATOM   6980  C  C   . ALA C  1 211 ? 119.948 50.284  78.526  1.00 48.16  ? 188 ALA C C   1 
ATOM   6981  O  O   . ALA C  1 211 ? 119.587 49.296  77.896  1.00 44.93  ? 188 ALA C O   1 
ATOM   6982  C  CB  . ALA C  1 211 ? 121.629 51.746  77.398  1.00 34.47  ? 188 ALA C CB  1 
ATOM   6983  N  N   . VAL C  1 212 ? 120.180 50.252  79.832  1.00 52.85  ? 189 VAL C N   1 
ATOM   6984  C  CA  . VAL C  1 212 ? 119.916 49.049  80.606  1.00 44.32  ? 189 VAL C CA  1 
ATOM   6985  C  C   . VAL C  1 212 ? 118.420 48.749  80.606  1.00 40.96  ? 189 VAL C C   1 
ATOM   6986  O  O   . VAL C  1 212 ? 118.014 47.597  80.487  1.00 44.79  ? 189 VAL C O   1 
ATOM   6987  C  CB  . VAL C  1 212 ? 120.468 49.172  82.043  1.00 37.65  ? 189 VAL C CB  1 
ATOM   6988  C  CG1 . VAL C  1 212 ? 119.858 48.119  82.970  1.00 29.10  ? 189 VAL C CG1 1 
ATOM   6989  C  CG2 . VAL C  1 212 ? 121.986 49.062  82.020  1.00 32.24  ? 189 VAL C CG2 1 
ATOM   6990  N  N   . TRP C  1 213 ? 117.598 49.788  80.708  1.00 35.34  ? 190 TRP C N   1 
ATOM   6991  C  CA  . TRP C  1 213 ? 116.146 49.605  80.698  1.00 35.59  ? 190 TRP C CA  1 
ATOM   6992  C  C   . TRP C  1 213 ? 115.621 49.183  79.330  1.00 42.64  ? 190 TRP C C   1 
ATOM   6993  O  O   . TRP C  1 213 ? 114.722 48.344  79.239  1.00 39.58  ? 190 TRP C O   1 
ATOM   6994  C  CB  . TRP C  1 213 ? 115.425 50.870  81.165  1.00 34.57  ? 190 TRP C CB  1 
ATOM   6995  C  CG  . TRP C  1 213 ? 115.059 50.871  82.628  1.00 43.04  ? 190 TRP C CG  1 
ATOM   6996  C  CD1 . TRP C  1 213 ? 114.573 49.823  83.354  1.00 45.69  ? 190 TRP C CD1 1 
ATOM   6997  C  CD2 . TRP C  1 213 ? 115.158 51.974  83.539  1.00 38.07  ? 190 TRP C CD2 1 
ATOM   6998  N  NE1 . TRP C  1 213 ? 114.355 50.205  84.655  1.00 40.81  ? 190 TRP C NE1 1 
ATOM   6999  C  CE2 . TRP C  1 213 ? 114.701 51.524  84.792  1.00 38.21  ? 190 TRP C CE2 1 
ATOM   7000  C  CE3 . TRP C  1 213 ? 115.580 53.298  83.413  1.00 41.20  ? 190 TRP C CE3 1 
ATOM   7001  C  CZ2 . TRP C  1 213 ? 114.664 52.346  85.910  1.00 38.39  ? 190 TRP C CZ2 1 
ATOM   7002  C  CZ3 . TRP C  1 213 ? 115.539 54.116  84.525  1.00 42.95  ? 190 TRP C CZ3 1 
ATOM   7003  C  CH2 . TRP C  1 213 ? 115.087 53.638  85.757  1.00 43.48  ? 190 TRP C CH2 1 
ATOM   7004  N  N   . ASP C  1 214 ? 116.163 49.781  78.271  1.00 50.55  ? 191 ASP C N   1 
ATOM   7005  C  CA  . ASP C  1 214 ? 115.797 49.385  76.909  1.00 55.50  ? 191 ASP C CA  1 
ATOM   7006  C  C   . ASP C  1 214 ? 115.955 47.869  76.752  1.00 52.44  ? 191 ASP C C   1 
ATOM   7007  O  O   . ASP C  1 214 ? 115.080 47.200  76.195  1.00 39.52  ? 191 ASP C O   1 
ATOM   7008  C  CB  . ASP C  1 214 ? 116.655 50.119  75.861  1.00 51.85  ? 191 ASP C CB  1 
ATOM   7009  C  CG  . ASP C  1 214 ? 116.268 51.593  75.698  1.00 54.21  ? 191 ASP C CG  1 
ATOM   7010  O  OD1 . ASP C  1 214 ? 115.205 51.993  76.231  1.00 54.53  ? 191 ASP C OD1 1 
ATOM   7011  O  OD2 . ASP C  1 214 ? 117.023 52.347  75.025  1.00 47.66  ? 191 ASP C OD2 1 
ATOM   7012  N  N   . ALA C  1 215 ? 117.063 47.344  77.284  1.00 52.45  ? 192 ALA C N   1 
ATOM   7013  C  CA  . ALA C  1 215 ? 117.435 45.933  77.154  1.00 52.23  ? 192 ALA C CA  1 
ATOM   7014  C  C   . ALA C  1 215 ? 116.669 44.945  78.049  1.00 54.69  ? 192 ALA C C   1 
ATOM   7015  O  O   . ALA C  1 215 ? 116.432 43.809  77.630  1.00 56.11  ? 192 ALA C O   1 
ATOM   7016  C  CB  . ALA C  1 215 ? 118.940 45.760  77.356  1.00 47.91  ? 192 ALA C CB  1 
ATOM   7017  N  N   . VAL C  1 216 ? 116.289 45.351  79.264  1.00 40.49  ? 193 VAL C N   1 
ATOM   7018  C  CA  . VAL C  1 216 ? 115.622 44.418  80.182  1.00 33.09  ? 193 VAL C CA  1 
ATOM   7019  C  C   . VAL C  1 216 ? 114.159 44.740  80.533  1.00 38.46  ? 193 VAL C C   1 
ATOM   7020  O  O   . VAL C  1 216 ? 113.487 43.957  81.208  1.00 39.65  ? 193 VAL C O   1 
ATOM   7021  C  CB  . VAL C  1 216 ? 116.450 44.192  81.475  1.00 39.07  ? 193 VAL C CB  1 
ATOM   7022  C  CG1 . VAL C  1 216 ? 117.859 43.748  81.123  1.00 27.98  ? 193 VAL C CG1 1 
ATOM   7023  C  CG2 . VAL C  1 216 ? 116.477 45.461  82.351  1.00 25.90  ? 193 VAL C CG2 1 
ATOM   7024  N  N   . GLY C  1 217 ? 113.667 45.882  80.068  1.00 41.96  ? 194 GLY C N   1 
ATOM   7025  C  CA  . GLY C  1 217 ? 112.301 46.289  80.346  1.00 40.73  ? 194 GLY C CA  1 
ATOM   7026  C  C   . GLY C  1 217 ? 112.220 47.196  81.559  1.00 43.53  ? 194 GLY C C   1 
ATOM   7027  O  O   . GLY C  1 217 ? 112.952 46.995  82.537  1.00 38.78  ? 194 GLY C O   1 
ATOM   7028  N  N   . ARG C  1 218 ? 111.332 48.188  81.501  1.00 42.75  ? 195 ARG C N   1 
ATOM   7029  C  CA  . ARG C  1 218 ? 111.204 49.170  82.583  1.00 44.92  ? 195 ARG C CA  1 
ATOM   7030  C  C   . ARG C  1 218 ? 110.624 48.534  83.835  1.00 47.97  ? 195 ARG C C   1 
ATOM   7031  O  O   . ARG C  1 218 ? 110.523 49.180  84.875  1.00 49.59  ? 195 ARG C O   1 
ATOM   7032  C  CB  . ARG C  1 218 ? 110.333 50.356  82.169  1.00 46.11  ? 195 ARG C CB  1 
ATOM   7033  C  CG  . ARG C  1 218 ? 110.437 50.741  80.706  1.00 58.13  ? 195 ARG C CG  1 
ATOM   7034  C  CD  . ARG C  1 218 ? 111.739 51.456  80.382  1.00 59.03  ? 195 ARG C CD  1 
ATOM   7035  N  NE  . ARG C  1 218 ? 111.797 52.787  80.977  1.00 57.40  ? 195 ARG C NE  1 
ATOM   7036  C  CZ  . ARG C  1 218 ? 112.616 53.754  80.569  1.00 61.95  ? 195 ARG C CZ  1 
ATOM   7037  N  NH1 . ARG C  1 218 ? 112.596 54.936  81.175  1.00 68.72  ? 195 ARG C NH1 1 
ATOM   7038  N  NH2 . ARG C  1 218 ? 113.451 53.548  79.553  1.00 52.14  ? 195 ARG C NH2 1 
ATOM   7039  N  N   . ASP C  1 219 ? 110.232 47.270  83.721  1.00 53.56  ? 196 ASP C N   1 
ATOM   7040  C  CA  . ASP C  1 219 ? 109.742 46.505  84.858  1.00 55.10  ? 196 ASP C CA  1 
ATOM   7041  C  C   . ASP C  1 219 ? 110.841 46.343  85.887  1.00 47.59  ? 196 ASP C C   1 
ATOM   7042  O  O   . ASP C  1 219 ? 110.567 46.186  87.081  1.00 45.68  ? 196 ASP C O   1 
ATOM   7043  C  CB  . ASP C  1 219 ? 109.283 45.117  84.411  1.00 70.38  ? 196 ASP C CB  1 
ATOM   7044  C  CG  . ASP C  1 219 ? 107.849 45.101  83.946  1.00 81.29  ? 196 ASP C CG  1 
ATOM   7045  O  OD1 . ASP C  1 219 ? 107.108 46.051  84.284  1.00 78.08  ? 196 ASP C OD1 1 
ATOM   7046  O  OD2 . ASP C  1 219 ? 107.460 44.135  83.254  1.00 89.12  ? 196 ASP C OD2 1 
ATOM   7047  N  N   . THR C  1 220 ? 112.085 46.381  85.412  1.00 41.56  ? 197 THR C N   1 
ATOM   7048  C  CA  . THR C  1 220 ? 113.240 46.038  86.237  1.00 38.18  ? 197 THR C CA  1 
ATOM   7049  C  C   . THR C  1 220 ? 113.662 47.197  87.133  1.00 38.52  ? 197 THR C C   1 
ATOM   7050  O  O   . THR C  1 220 ? 113.885 48.312  86.668  1.00 42.43  ? 197 THR C O   1 
ATOM   7051  C  CB  . THR C  1 220 ? 114.432 45.583  85.374  1.00 45.13  ? 197 THR C CB  1 
ATOM   7052  O  OG1 . THR C  1 220 ? 113.999 44.583  84.441  1.00 56.51  ? 197 THR C OG1 1 
ATOM   7053  C  CG2 . THR C  1 220 ? 115.531 44.998  86.242  1.00 42.35  ? 197 THR C CG2 1 
ATOM   7054  N  N   . ALA C  1 221 ? 113.755 46.928  88.428  1.00 40.10  ? 198 ALA C N   1 
ATOM   7055  C  CA  . ALA C  1 221 ? 114.220 47.934  89.376  1.00 37.34  ? 198 ALA C CA  1 
ATOM   7056  C  C   . ALA C  1 221 ? 115.715 48.193  89.186  1.00 38.44  ? 198 ALA C C   1 
ATOM   7057  O  O   . ALA C  1 221 ? 116.508 47.248  89.073  1.00 34.90  ? 198 ALA C O   1 
ATOM   7058  C  CB  . ALA C  1 221 ? 113.933 47.476  90.810  1.00 33.08  ? 198 ALA C CB  1 
ATOM   7059  N  N   . LEU C  1 222 ? 116.098 49.466  89.135  1.00 32.43  ? 199 LEU C N   1 
ATOM   7060  C  CA  . LEU C  1 222 ? 117.514 49.824  89.125  1.00 31.92  ? 199 LEU C CA  1 
ATOM   7061  C  C   . LEU C  1 222 ? 117.885 50.480  90.442  1.00 33.27  ? 199 LEU C C   1 
ATOM   7062  O  O   . LEU C  1 222 ? 117.261 51.463  90.850  1.00 31.14  ? 199 LEU C O   1 
ATOM   7063  C  CB  . LEU C  1 222 ? 117.848 50.759  87.964  1.00 22.77  ? 199 LEU C CB  1 
ATOM   7064  C  CG  . LEU C  1 222 ? 117.772 50.080  86.595  1.00 38.67  ? 199 LEU C CG  1 
ATOM   7065  C  CD1 . LEU C  1 222 ? 118.288 51.002  85.483  1.00 37.08  ? 199 LEU C CD1 1 
ATOM   7066  C  CD2 . LEU C  1 222 ? 118.557 48.769  86.617  1.00 34.56  ? 199 LEU C CD2 1 
ATOM   7067  N  N   . MET C  1 223 ? 118.886 49.920  91.113  1.00 27.78  ? 200 MET C N   1 
ATOM   7068  C  CA  . MET C  1 223 ? 119.452 50.542  92.306  1.00 28.65  ? 200 MET C CA  1 
ATOM   7069  C  C   . MET C  1 223 ? 120.795 51.160  91.925  1.00 34.27  ? 200 MET C C   1 
ATOM   7070  O  O   . MET C  1 223 ? 121.754 50.444  91.659  1.00 35.60  ? 200 MET C O   1 
ATOM   7071  C  CB  . MET C  1 223 ? 119.654 49.506  93.425  1.00 30.61  ? 200 MET C CB  1 
ATOM   7072  C  CG  . MET C  1 223 ? 118.381 48.849  93.974  1.00 31.16  ? 200 MET C CG  1 
ATOM   7073  S  SD  . MET C  1 223 ? 117.521 47.723  92.823  1.00 34.29  ? 200 MET C SD  1 
ATOM   7074  C  CE  . MET C  1 223 ? 116.618 46.706  93.996  1.00 32.92  ? 200 MET C CE  1 
ATOM   7075  N  N   . VAL C  1 224 ? 120.859 52.486  91.886  1.00 34.31  ? 201 VAL C N   1 
ATOM   7076  C  CA  . VAL C  1 224 ? 122.093 53.202  91.552  1.00 28.49  ? 201 VAL C CA  1 
ATOM   7077  C  C   . VAL C  1 224 ? 123.064 53.391  92.738  1.00 29.04  ? 201 VAL C C   1 
ATOM   7078  O  O   . VAL C  1 224 ? 122.660 53.747  93.840  1.00 32.10  ? 201 VAL C O   1 
ATOM   7079  C  CB  . VAL C  1 224 ? 121.759 54.569  90.961  1.00 27.23  ? 201 VAL C CB  1 
ATOM   7080  C  CG1 . VAL C  1 224 ? 122.896 55.534  91.173  1.00 30.99  ? 201 VAL C CG1 1 
ATOM   7081  C  CG2 . VAL C  1 224 ? 121.426 54.424  89.499  1.00 30.11  ? 201 VAL C CG2 1 
ATOM   7082  N  N   . ASP C  1 225 ? 124.348 53.163  92.503  1.00 30.03  ? 202 ASP C N   1 
ATOM   7083  C  CA  . ASP C  1 225 ? 125.340 53.290  93.559  1.00 27.70  ? 202 ASP C CA  1 
ATOM   7084  C  C   . ASP C  1 225 ? 126.529 54.121  93.097  1.00 31.22  ? 202 ASP C C   1 
ATOM   7085  O  O   . ASP C  1 225 ? 127.216 53.734  92.160  1.00 33.82  ? 202 ASP C O   1 
ATOM   7086  C  CB  . ASP C  1 225 ? 125.839 51.910  93.973  1.00 32.00  ? 202 ASP C CB  1 
ATOM   7087  C  CG  . ASP C  1 225 ? 126.526 51.922  95.330  1.00 35.38  ? 202 ASP C CG  1 
ATOM   7088  O  OD1 . ASP C  1 225 ? 126.827 53.019  95.842  1.00 32.61  ? 202 ASP C OD1 1 
ATOM   7089  O  OD2 . ASP C  1 225 ? 126.756 50.835  95.892  1.00 37.79  ? 202 ASP C OD2 1 
ATOM   7090  N  N   . PHE C  1 226 ? 126.779 55.244  93.772  1.00 28.01  ? 203 PHE C N   1 
ATOM   7091  C  CA  . PHE C  1 226 ? 127.939 56.102  93.498  1.00 26.83  ? 203 PHE C CA  1 
ATOM   7092  C  C   . PHE C  1 226 ? 129.183 55.729  94.304  1.00 26.68  ? 203 PHE C C   1 
ATOM   7093  O  O   . PHE C  1 226 ? 130.260 56.252  94.052  1.00 32.13  ? 203 PHE C O   1 
ATOM   7094  C  CB  . PHE C  1 226 ? 127.608 57.567  93.809  1.00 29.86  ? 203 PHE C CB  1 
ATOM   7095  C  CG  . PHE C  1 226 ? 126.663 58.190  92.842  1.00 26.17  ? 203 PHE C CG  1 
ATOM   7096  C  CD1 . PHE C  1 226 ? 127.126 58.696  91.641  1.00 26.39  ? 203 PHE C CD1 1 
ATOM   7097  C  CD2 . PHE C  1 226 ? 125.314 58.280  93.134  1.00 28.47  ? 203 PHE C CD2 1 
ATOM   7098  C  CE1 . PHE C  1 226 ? 126.258 59.285  90.738  1.00 25.67  ? 203 PHE C CE1 1 
ATOM   7099  C  CE2 . PHE C  1 226 ? 124.438 58.862  92.247  1.00 35.25  ? 203 PHE C CE2 1 
ATOM   7100  C  CZ  . PHE C  1 226 ? 124.911 59.370  91.037  1.00 29.84  ? 203 PHE C CZ  1 
ATOM   7101  N  N   . ASN C  1 227 ? 129.028 54.870  95.304  1.00 25.52  ? 204 ASN C N   1 
ATOM   7102  C  CA  . ASN C  1 227 ? 130.159 54.462  96.132  1.00 23.19  ? 204 ASN C CA  1 
ATOM   7103  C  C   . ASN C  1 227 ? 130.939 55.615  96.779  1.00 22.49  ? 204 ASN C C   1 
ATOM   7104  O  O   . ASN C  1 227 ? 132.163 55.609  96.792  1.00 25.71  ? 204 ASN C O   1 
ATOM   7105  C  CB  . ASN C  1 227 ? 131.114 53.572  95.320  1.00 29.34  ? 204 ASN C CB  1 
ATOM   7106  C  CG  . ASN C  1 227 ? 130.573 52.171  95.129  1.00 41.05  ? 204 ASN C CG  1 
ATOM   7107  O  OD1 . ASN C  1 227 ? 130.498 51.399  96.090  1.00 46.94  ? 204 ASN C OD1 1 
ATOM   7108  N  ND2 . ASN C  1 227 ? 130.189 51.830  93.893  1.00 32.05  ? 204 ASN C ND2 1 
ATOM   7109  N  N   . GLN C  1 228 ? 130.228 56.586  97.339  1.00 27.79  ? 205 GLN C N   1 
ATOM   7110  C  CA  . GLN C  1 228 ? 130.856 57.756  97.976  1.00 26.26  ? 205 GLN C CA  1 
ATOM   7111  C  C   . GLN C  1 228 ? 131.832 58.491  97.061  1.00 28.23  ? 205 GLN C C   1 
ATOM   7112  O  O   . GLN C  1 228 ? 132.751 59.137  97.548  1.00 37.33  ? 205 GLN C O   1 
ATOM   7113  C  CB  . GLN C  1 228 ? 131.608 57.364  99.252  1.00 22.88  ? 205 GLN C CB  1 
ATOM   7114  C  CG  . GLN C  1 228 ? 130.974 56.256  100.060 1.00 17.75  ? 205 GLN C CG  1 
ATOM   7115  C  CD  . GLN C  1 228 ? 131.882 55.783  101.176 1.00 33.32  ? 205 GLN C CD  1 
ATOM   7116  O  OE1 . GLN C  1 228 ? 132.358 56.579  101.989 1.00 31.92  ? 205 GLN C OE1 1 
ATOM   7117  N  NE2 . GLN C  1 228 ? 132.143 54.478  101.212 1.00 36.18  ? 205 GLN C NE2 1 
ATOM   7118  N  N   . GLY C  1 229 ? 131.645 58.399  95.747  1.00 25.60  ? 206 GLY C N   1 
ATOM   7119  C  CA  . GLY C  1 229 ? 132.547 59.053  94.812  1.00 26.79  ? 206 GLY C CA  1 
ATOM   7120  C  C   . GLY C  1 229 ? 132.389 60.552  94.596  1.00 31.24  ? 206 GLY C C   1 
ATOM   7121  O  O   . GLY C  1 229 ? 133.132 61.139  93.813  1.00 33.57  ? 206 GLY C O   1 
ATOM   7122  N  N   . LEU C  1 230 ? 131.450 61.194  95.283  1.00 31.13  ? 207 LEU C N   1 
ATOM   7123  C  CA  . LEU C  1 230 ? 131.211 62.616  95.025  1.00 28.49  ? 207 LEU C CA  1 
ATOM   7124  C  C   . LEU C  1 230 ? 131.401 63.499  96.253  1.00 26.58  ? 207 LEU C C   1 
ATOM   7125  O  O   . LEU C  1 230 ? 131.177 63.061  97.380  1.00 31.19  ? 207 LEU C O   1 
ATOM   7126  C  CB  . LEU C  1 230 ? 129.799 62.822  94.469  1.00 22.66  ? 207 LEU C CB  1 
ATOM   7127  C  CG  . LEU C  1 230 ? 129.300 61.854  93.390  1.00 30.40  ? 207 LEU C CG  1 
ATOM   7128  C  CD1 . LEU C  1 230 ? 127.876 62.225  92.956  1.00 29.26  ? 207 LEU C CD1 1 
ATOM   7129  C  CD2 . LEU C  1 230 ? 130.230 61.849  92.195  1.00 23.72  ? 207 LEU C CD2 1 
ATOM   7130  N  N   . ASP C  1 231 ? 131.794 64.753  96.039  1.00 23.23  ? 208 ASP C N   1 
ATOM   7131  C  CA  . ASP C  1 231 ? 131.708 65.744  97.115  1.00 28.24  ? 208 ASP C CA  1 
ATOM   7132  C  C   . ASP C  1 231 ? 130.282 66.294  97.111  1.00 27.74  ? 208 ASP C C   1 
ATOM   7133  O  O   . ASP C  1 231 ? 129.485 65.922  96.243  1.00 26.35  ? 208 ASP C O   1 
ATOM   7134  C  CB  . ASP C  1 231 ? 132.773 66.857  97.012  1.00 27.51  ? 208 ASP C CB  1 
ATOM   7135  C  CG  . ASP C  1 231 ? 132.538 67.827  95.837  1.00 44.57  ? 208 ASP C CG  1 
ATOM   7136  O  OD1 . ASP C  1 231 ? 131.373 68.098  95.460  1.00 41.57  ? 208 ASP C OD1 1 
ATOM   7137  O  OD2 . ASP C  1 231 ? 133.539 68.339  95.294  1.00 56.09  ? 208 ASP C OD2 1 
ATOM   7138  N  N   . MET C  1 232 ? 129.947 67.150  98.075  1.00 19.23  ? 209 MET C N   1 
ATOM   7139  C  CA  . MET C  1 232 ? 128.555 67.568  98.232  1.00 17.29  ? 209 MET C CA  1 
ATOM   7140  C  C   . MET C  1 232 ? 128.029 68.368  97.047  1.00 20.17  ? 209 MET C C   1 
ATOM   7141  O  O   . MET C  1 232 ? 126.871 68.233  96.673  1.00 29.37  ? 209 MET C O   1 
ATOM   7142  C  CB  . MET C  1 232 ? 128.337 68.330  99.535  1.00 13.63  ? 209 MET C CB  1 
ATOM   7143  C  CG  . MET C  1 232 ? 127.808 67.459  100.663 1.00 20.22  ? 209 MET C CG  1 
ATOM   7144  S  SD  . MET C  1 232 ? 126.269 66.604  100.290 1.00 29.14  ? 209 MET C SD  1 
ATOM   7145  C  CE  . MET C  1 232 ? 125.127 67.965  100.113 1.00 18.11  ? 209 MET C CE  1 
ATOM   7146  N  N   . ALA C  1 233 ? 128.880 69.199  96.460  1.00 18.39  ? 210 ALA C N   1 
ATOM   7147  C  CA  . ALA C  1 233 ? 128.482 69.980  95.295  1.00 25.62  ? 210 ALA C CA  1 
ATOM   7148  C  C   . ALA C  1 233 ? 128.184 69.075  94.086  1.00 30.30  ? 210 ALA C C   1 
ATOM   7149  O  O   . ALA C  1 233 ? 127.168 69.239  93.406  1.00 27.57  ? 210 ALA C O   1 
ATOM   7150  C  CB  . ALA C  1 233 ? 129.547 70.992  94.953  1.00 23.64  ? 210 ALA C CB  1 
ATOM   7151  N  N   . GLU C  1 234 ? 129.063 68.117  93.823  1.00 24.71  ? 211 GLU C N   1 
ATOM   7152  C  CA  . GLU C  1 234 ? 128.801 67.143  92.765  1.00 29.49  ? 211 GLU C CA  1 
ATOM   7153  C  C   . GLU C  1 234 ? 127.528 66.335  93.057  1.00 29.14  ? 211 GLU C C   1 
ATOM   7154  O  O   . GLU C  1 234 ? 126.701 66.111  92.168  1.00 31.75  ? 211 GLU C O   1 
ATOM   7155  C  CB  . GLU C  1 234 ? 130.006 66.220  92.583  1.00 25.94  ? 211 GLU C CB  1 
ATOM   7156  C  CG  . GLU C  1 234 ? 131.243 66.951  92.036  1.00 40.14  ? 211 GLU C CG  1 
ATOM   7157  C  CD  . GLU C  1 234 ? 132.568 66.202  92.253  1.00 54.12  ? 211 GLU C CD  1 
ATOM   7158  O  OE1 . GLU C  1 234 ? 132.714 65.475  93.267  1.00 44.44  ? 211 GLU C OE1 1 
ATOM   7159  O  OE2 . GLU C  1 234 ? 133.477 66.356  91.402  1.00 68.64  ? 211 GLU C OE2 1 
ATOM   7160  N  N   . ALA C  1 235 ? 127.363 65.926  94.312  1.00 24.07  ? 212 ALA C N   1 
ATOM   7161  C  CA  . ALA C  1 235 ? 126.220 65.112  94.704  1.00 26.38  ? 212 ALA C CA  1 
ATOM   7162  C  C   . ALA C  1 235 ? 124.909 65.846  94.467  1.00 26.47  ? 212 ALA C C   1 
ATOM   7163  O  O   . ALA C  1 235 ? 123.932 65.247  94.011  1.00 30.48  ? 212 ALA C O   1 
ATOM   7164  C  CB  . ALA C  1 235 ? 126.339 64.709  96.159  1.00 28.54  ? 212 ALA C CB  1 
ATOM   7165  N  N   . MET C  1 236 ? 124.887 67.141  94.782  1.00 17.60  ? 213 MET C N   1 
ATOM   7166  C  CA  . MET C  1 236 ? 123.674 67.942  94.611  1.00 23.83  ? 213 MET C CA  1 
ATOM   7167  C  C   . MET C  1 236 ? 123.263 68.017  93.154  1.00 26.75  ? 213 MET C C   1 
ATOM   7168  O  O   . MET C  1 236 ? 122.117 67.753  92.813  1.00 38.28  ? 213 MET C O   1 
ATOM   7169  C  CB  . MET C  1 236 ? 123.848 69.365  95.169  1.00 18.63  ? 213 MET C CB  1 
ATOM   7170  C  CG  . MET C  1 236 ? 123.825 69.419  96.675  1.00 20.28  ? 213 MET C CG  1 
ATOM   7171  S  SD  . MET C  1 236 ? 124.110 71.069  97.321  1.00 40.64  ? 213 MET C SD  1 
ATOM   7172  C  CE  . MET C  1 236 ? 122.536 71.867  96.944  1.00 24.73  ? 213 MET C CE  1 
ATOM   7173  N  N   . HIS C  1 237 ? 124.199 68.392  92.298  1.00 27.22  ? 214 HIS C N   1 
ATOM   7174  C  CA  . HIS C  1 237 ? 123.925 68.472  90.864  1.00 27.27  ? 214 HIS C CA  1 
ATOM   7175  C  C   . HIS C  1 237 ? 123.487 67.151  90.250  1.00 20.69  ? 214 HIS C C   1 
ATOM   7176  O  O   . HIS C  1 237 ? 122.473 67.088  89.561  1.00 34.75  ? 214 HIS C O   1 
ATOM   7177  C  CB  . HIS C  1 237 ? 125.148 68.999  90.120  1.00 24.41  ? 214 HIS C CB  1 
ATOM   7178  C  CG  . HIS C  1 237 ? 125.445 70.427  90.428  1.00 38.19  ? 214 HIS C CG  1 
ATOM   7179  N  ND1 . HIS C  1 237 ? 124.555 71.440  90.145  1.00 40.91  ? 214 HIS C ND1 1 
ATOM   7180  C  CD2 . HIS C  1 237 ? 126.509 71.012  91.025  1.00 32.29  ? 214 HIS C CD2 1 
ATOM   7181  C  CE1 . HIS C  1 237 ? 125.068 72.591  90.538  1.00 32.18  ? 214 HIS C CE1 1 
ATOM   7182  N  NE2 . HIS C  1 237 ? 126.252 72.360  91.073  1.00 31.46  ? 214 HIS C NE2 1 
ATOM   7183  N  N   . ARG C  1 238 ? 124.251 66.102  90.510  1.00 16.98  ? 215 ARG C N   1 
ATOM   7184  C  CA  . ARG C  1 238 ? 124.039 64.819  89.855  1.00 21.17  ? 215 ARG C CA  1 
ATOM   7185  C  C   . ARG C  1 238 ? 122.823 64.037  90.348  1.00 30.33  ? 215 ARG C C   1 
ATOM   7186  O  O   . ARG C  1 238 ? 122.094 63.453  89.539  1.00 24.76  ? 215 ARG C O   1 
ATOM   7187  C  CB  . ARG C  1 238 ? 125.273 63.947  90.011  1.00 26.03  ? 215 ARG C CB  1 
ATOM   7188  C  CG  . ARG C  1 238 ? 126.478 64.389  89.211  1.00 29.04  ? 215 ARG C CG  1 
ATOM   7189  C  CD  . ARG C  1 238 ? 127.566 63.393  89.508  1.00 33.36  ? 215 ARG C CD  1 
ATOM   7190  N  NE  . ARG C  1 238 ? 128.778 63.581  88.736  1.00 32.26  ? 215 ARG C NE  1 
ATOM   7191  C  CZ  . ARG C  1 238 ? 129.273 62.671  87.907  1.00 34.37  ? 215 ARG C CZ  1 
ATOM   7192  N  NH1 . ARG C  1 238 ? 128.644 61.514  87.732  1.00 24.20  ? 215 ARG C NH1 1 
ATOM   7193  N  NH2 . ARG C  1 238 ? 130.395 62.928  87.250  1.00 43.96  ? 215 ARG C NH2 1 
ATOM   7194  N  N   . THR C  1 239 ? 122.610 63.999  91.664  1.00 28.82  ? 216 THR C N   1 
ATOM   7195  C  CA  . THR C  1 239 ? 121.447 63.292  92.177  1.00 21.94  ? 216 THR C CA  1 
ATOM   7196  C  C   . THR C  1 239 ? 120.187 63.998  91.687  1.00 23.91  ? 216 THR C C   1 
ATOM   7197  O  O   . THR C  1 239 ? 119.174 63.353  91.416  1.00 27.58  ? 216 THR C O   1 
ATOM   7198  C  CB  . THR C  1 239 ? 121.462 63.081  93.731  1.00 23.42  ? 216 THR C CB  1 
ATOM   7199  O  OG1 . THR C  1 239 ? 121.311 64.330  94.417  1.00 25.80  ? 216 THR C OG1 1 
ATOM   7200  C  CG2 . THR C  1 239 ? 122.757 62.411  94.158  1.00 22.38  ? 216 THR C CG2 1 
ATOM   7201  N  N   . ARG C  1 240 ? 120.258 65.317  91.543  1.00 19.36  ? 217 ARG C N   1 
ATOM   7202  C  CA  . ARG C  1 240 ? 119.126 66.063  91.009  1.00 21.56  ? 217 ARG C CA  1 
ATOM   7203  C  C   . ARG C  1 240 ? 118.820 65.677  89.549  1.00 25.78  ? 217 ARG C C   1 
ATOM   7204  O  O   . ARG C  1 240 ? 117.659 65.511  89.174  1.00 28.44  ? 217 ARG C O   1 
ATOM   7205  C  CB  . ARG C  1 240 ? 119.362 67.563  91.143  1.00 19.87  ? 217 ARG C CB  1 
ATOM   7206  C  CG  . ARG C  1 240 ? 118.197 68.418  90.687  1.00 16.91  ? 217 ARG C CG  1 
ATOM   7207  C  CD  . ARG C  1 240 ? 118.623 69.865  90.620  1.00 28.90  ? 217 ARG C CD  1 
ATOM   7208  N  NE  . ARG C  1 240 ? 117.548 70.730  90.155  1.00 36.31  ? 217 ARG C NE  1 
ATOM   7209  C  CZ  . ARG C  1 240 ? 117.636 72.052  90.108  1.00 30.91  ? 217 ARG C CZ  1 
ATOM   7210  N  NH1 . ARG C  1 240 ? 118.752 72.655  90.502  1.00 25.34  ? 217 ARG C NH1 1 
ATOM   7211  N  NH2 . ARG C  1 240 ? 116.606 72.768  89.682  1.00 34.73  ? 217 ARG C NH2 1 
ATOM   7212  N  N   . GLN C  1 241 ? 119.859 65.495  88.743  1.00 25.46  ? 218 GLN C N   1 
ATOM   7213  C  CA  . GLN C  1 241 ? 119.677 65.095  87.351  1.00 29.25  ? 218 GLN C CA  1 
ATOM   7214  C  C   . GLN C  1 241 ? 118.987 63.748  87.198  1.00 32.37  ? 218 GLN C C   1 
ATOM   7215  O  O   . GLN C  1 241 ? 118.294 63.514  86.209  1.00 33.23  ? 218 GLN C O   1 
ATOM   7216  C  CB  . GLN C  1 241 ? 121.011 65.020  86.630  1.00 36.00  ? 218 GLN C CB  1 
ATOM   7217  C  CG  . GLN C  1 241 ? 121.601 66.344  86.223  1.00 48.30  ? 218 GLN C CG  1 
ATOM   7218  C  CD  . GLN C  1 241 ? 123.046 66.195  85.800  1.00 56.90  ? 218 GLN C CD  1 
ATOM   7219  O  OE1 . GLN C  1 241 ? 123.484 65.099  85.424  1.00 51.30  ? 218 GLN C OE1 1 
ATOM   7220  N  NE2 . GLN C  1 241 ? 123.806 67.290  85.881  1.00 56.91  ? 218 GLN C NE2 1 
ATOM   7221  N  N   . ILE C  1 242 ? 119.196 62.851  88.154  1.00 21.59  ? 219 ILE C N   1 
ATOM   7222  C  CA  . ILE C  1 242 ? 118.639 61.503  88.041  1.00 20.78  ? 219 ILE C CA  1 
ATOM   7223  C  C   . ILE C  1 242 ? 117.377 61.296  88.882  1.00 24.70  ? 219 ILE C C   1 
ATOM   7224  O  O   . ILE C  1 242 ? 116.876 60.175  88.995  1.00 32.99  ? 219 ILE C O   1 
ATOM   7225  C  CB  . ILE C  1 242 ? 119.674 60.427  88.405  1.00 25.69  ? 219 ILE C CB  1 
ATOM   7226  C  CG1 . ILE C  1 242 ? 120.114 60.554  89.868  1.00 26.17  ? 219 ILE C CG1 1 
ATOM   7227  C  CG2 . ILE C  1 242 ? 120.880 60.532  87.497  1.00 15.05  ? 219 ILE C CG2 1 
ATOM   7228  C  CD1 . ILE C  1 242 ? 121.035 59.397  90.342  1.00 15.86  ? 219 ILE C CD1 1 
ATOM   7229  N  N   . ASP C  1 243 ? 116.841 62.375  89.449  1.00 21.26  ? 220 ASP C N   1 
ATOM   7230  C  CA  . ASP C  1 243 ? 115.763 62.224  90.426  1.00 26.40  ? 220 ASP C CA  1 
ATOM   7231  C  C   . ASP C  1 243 ? 114.435 61.841  89.800  1.00 30.06  ? 220 ASP C C   1 
ATOM   7232  O  O   . ASP C  1 243 ? 113.573 61.285  90.480  1.00 35.48  ? 220 ASP C O   1 
ATOM   7233  C  CB  . ASP C  1 243 ? 115.597 63.476  91.296  1.00 25.65  ? 220 ASP C CB  1 
ATOM   7234  C  CG  . ASP C  1 243 ? 114.925 63.173  92.645  1.00 30.90  ? 220 ASP C CG  1 
ATOM   7235  O  OD1 . ASP C  1 243 ? 115.183 62.094  93.219  1.00 29.05  ? 220 ASP C OD1 1 
ATOM   7236  O  OD2 . ASP C  1 243 ? 114.133 64.007  93.134  1.00 30.10  ? 220 ASP C OD2 1 
ATOM   7237  N  N   . ASP C  1 244 ? 114.269 62.110  88.508  1.00 36.23  ? 221 ASP C N   1 
ATOM   7238  C  CA  . ASP C  1 244 ? 113.023 61.746  87.834  1.00 29.54  ? 221 ASP C CA  1 
ATOM   7239  C  C   . ASP C  1 244 ? 113.145 60.551  86.917  1.00 30.03  ? 221 ASP C C   1 
ATOM   7240  O  O   . ASP C  1 244 ? 112.252 60.320  86.113  1.00 35.52  ? 221 ASP C O   1 
ATOM   7241  C  CB  . ASP C  1 244 ? 112.471 62.923  87.039  1.00 39.47  ? 221 ASP C CB  1 
ATOM   7242  C  CG  . ASP C  1 244 ? 112.167 64.121  87.912  1.00 52.17  ? 221 ASP C CG  1 
ATOM   7243  O  OD1 . ASP C  1 244 ? 111.503 63.954  88.958  1.00 53.18  ? 221 ASP C OD1 1 
ATOM   7244  O  OD2 . ASP C  1 244 ? 112.605 65.234  87.553  1.00 62.94  ? 221 ASP C OD2 1 
ATOM   7245  N  N   . LEU C  1 245 ? 114.236 59.796  87.030  1.00 30.54  ? 222 LEU C N   1 
ATOM   7246  C  CA  . LEU C  1 245 ? 114.467 58.643  86.152  1.00 34.34  ? 222 LEU C CA  1 
ATOM   7247  C  C   . LEU C  1 245 ? 113.662 57.395  86.498  1.00 37.35  ? 222 LEU C C   1 
ATOM   7248  O  O   . LEU C  1 245 ? 113.518 56.500  85.666  1.00 40.34  ? 222 LEU C O   1 
ATOM   7249  C  CB  . LEU C  1 245 ? 115.935 58.238  86.159  1.00 40.89  ? 222 LEU C CB  1 
ATOM   7250  C  CG  . LEU C  1 245 ? 116.917 59.110  85.416  1.00 46.36  ? 222 LEU C CG  1 
ATOM   7251  C  CD1 . LEU C  1 245 ? 118.098 58.246  85.083  1.00 39.70  ? 222 LEU C CD1 1 
ATOM   7252  C  CD2 . LEU C  1 245 ? 116.256 59.650  84.170  1.00 53.35  ? 222 LEU C CD2 1 
ATOM   7253  N  N   . GLY C  1 246 ? 113.185 57.310  87.735  1.00 31.92  ? 223 GLY C N   1 
ATOM   7254  C  CA  . GLY C  1 246 ? 112.474 56.125  88.177  1.00 25.67  ? 223 GLY C CA  1 
ATOM   7255  C  C   . GLY C  1 246 ? 113.382 55.071  88.788  1.00 28.69  ? 223 GLY C C   1 
ATOM   7256  O  O   . GLY C  1 246 ? 113.148 53.875  88.629  1.00 34.50  ? 223 GLY C O   1 
ATOM   7257  N  N   . LEU C  1 247 ? 114.422 55.513  89.492  1.00 29.41  ? 224 LEU C N   1 
ATOM   7258  C  CA  . LEU C  1 247 ? 115.318 54.585  90.173  1.00 24.78  ? 224 LEU C CA  1 
ATOM   7259  C  C   . LEU C  1 247 ? 114.666 53.987  91.427  1.00 25.59  ? 224 LEU C C   1 
ATOM   7260  O  O   . LEU C  1 247 ? 113.788 54.601  92.037  1.00 24.19  ? 224 LEU C O   1 
ATOM   7261  C  CB  . LEU C  1 247 ? 116.636 55.280  90.514  1.00 21.84  ? 224 LEU C CB  1 
ATOM   7262  C  CG  . LEU C  1 247 ? 117.333 55.926  89.311  1.00 31.38  ? 224 LEU C CG  1 
ATOM   7263  C  CD1 . LEU C  1 247 ? 118.580 56.706  89.733  1.00 26.99  ? 224 LEU C CD1 1 
ATOM   7264  C  CD2 . LEU C  1 247 ? 117.683 54.877  88.264  1.00 27.02  ? 224 LEU C CD2 1 
ATOM   7265  N  N   . GLU C  1 248 ? 115.081 52.780  91.798  1.00 19.79  ? 225 GLU C N   1 
ATOM   7266  C  CA  . GLU C  1 248 ? 114.599 52.158  93.031  1.00 24.33  ? 225 GLU C CA  1 
ATOM   7267  C  C   . GLU C  1 248 ? 115.169 52.915  94.228  1.00 26.45  ? 225 GLU C C   1 
ATOM   7268  O  O   . GLU C  1 248 ? 114.471 53.164  95.207  1.00 32.63  ? 225 GLU C O   1 
ATOM   7269  C  CB  . GLU C  1 248 ? 114.994 50.676  93.084  1.00 29.27  ? 225 GLU C CB  1 
ATOM   7270  C  CG  . GLU C  1 248 ? 114.576 49.947  94.362  1.00 36.79  ? 225 GLU C CG  1 
ATOM   7271  C  CD  . GLU C  1 248 ? 113.079 49.640  94.450  1.00 40.45  ? 225 GLU C CD  1 
ATOM   7272  O  OE1 . GLU C  1 248 ? 112.333 49.901  93.472  1.00 37.82  ? 225 GLU C OE1 1 
ATOM   7273  O  OE2 . GLU C  1 248 ? 112.649 49.130  95.516  1.00 37.76  ? 225 GLU C OE2 1 
ATOM   7274  N  N   . TRP C  1 249 ? 116.441 53.294  94.125  1.00 25.24  ? 226 TRP C N   1 
ATOM   7275  C  CA  . TRP C  1 249 ? 117.080 54.133  95.122  1.00 24.01  ? 226 TRP C CA  1 
ATOM   7276  C  C   . TRP C  1 249 ? 118.409 54.685  94.635  1.00 30.10  ? 226 TRP C C   1 
ATOM   7277  O  O   . TRP C  1 249 ? 118.949 54.213  93.637  1.00 27.04  ? 226 TRP C O   1 
ATOM   7278  C  CB  . TRP C  1 249 ? 117.279 53.380  96.439  1.00 18.83  ? 226 TRP C CB  1 
ATOM   7279  C  CG  . TRP C  1 249 ? 118.355 52.320  96.466  1.00 20.18  ? 226 TRP C CG  1 
ATOM   7280  C  CD1 . TRP C  1 249 ? 119.688 52.469  96.181  1.00 22.84  ? 226 TRP C CD1 1 
ATOM   7281  C  CD2 . TRP C  1 249 ? 118.187 50.954  96.876  1.00 23.38  ? 226 TRP C CD2 1 
ATOM   7282  N  NE1 . TRP C  1 249 ? 120.356 51.267  96.372  1.00 21.92  ? 226 TRP C NE1 1 
ATOM   7283  C  CE2 . TRP C  1 249 ? 119.452 50.329  96.801  1.00 23.32  ? 226 TRP C CE2 1 
ATOM   7284  C  CE3 . TRP C  1 249 ? 117.087 50.199  97.299  1.00 26.19  ? 226 TRP C CE3 1 
ATOM   7285  C  CZ2 . TRP C  1 249 ? 119.637 48.987  97.124  1.00 30.71  ? 226 TRP C CZ2 1 
ATOM   7286  C  CZ3 . TRP C  1 249 ? 117.277 48.869  97.625  1.00 33.27  ? 226 TRP C CZ3 1 
ATOM   7287  C  CH2 . TRP C  1 249 ? 118.540 48.278  97.536  1.00 33.11  ? 226 TRP C CH2 1 
ATOM   7288  N  N   . ILE C  1 250 ? 118.921 55.687  95.353  1.00 25.14  ? 227 ILE C N   1 
ATOM   7289  C  CA  . ILE C  1 250 ? 120.242 56.273  95.107  1.00 23.09  ? 227 ILE C CA  1 
ATOM   7290  C  C   . ILE C  1 250 ? 121.117 56.027  96.336  1.00 26.25  ? 227 ILE C C   1 
ATOM   7291  O  O   . ILE C  1 250 ? 120.768 56.423  97.457  1.00 26.02  ? 227 ILE C O   1 
ATOM   7292  C  CB  . ILE C  1 250 ? 120.130 57.795  94.828  1.00 26.88  ? 227 ILE C CB  1 
ATOM   7293  C  CG1 . ILE C  1 250 ? 119.379 58.043  93.523  1.00 27.89  ? 227 ILE C CG1 1 
ATOM   7294  C  CG2 . ILE C  1 250 ? 121.499 58.449  94.752  1.00 13.27  ? 227 ILE C CG2 1 
ATOM   7295  C  CD1 . ILE C  1 250 ? 118.861 59.469  93.368  1.00 30.38  ? 227 ILE C CD1 1 
ATOM   7296  N  N   . GLU C  1 251 ? 122.261 55.389  96.123  1.00 27.53  ? 228 GLU C N   1 
ATOM   7297  C  CA  . GLU C  1 251 ? 123.056 54.832  97.216  1.00 26.52  ? 228 GLU C CA  1 
ATOM   7298  C  C   . GLU C  1 251 ? 124.390 55.552  97.441  1.00 26.61  ? 228 GLU C C   1 
ATOM   7299  O  O   . GLU C  1 251 ? 125.127 55.802  96.491  1.00 24.95  ? 228 GLU C O   1 
ATOM   7300  C  CB  . GLU C  1 251 ? 123.306 53.343  96.951  1.00 28.79  ? 228 GLU C CB  1 
ATOM   7301  C  CG  . GLU C  1 251 ? 124.046 52.605  98.061  1.00 26.84  ? 228 GLU C CG  1 
ATOM   7302  C  CD  . GLU C  1 251 ? 124.104 51.106  97.826  1.00 37.30  ? 228 GLU C CD  1 
ATOM   7303  O  OE1 . GLU C  1 251 ? 123.234 50.579  97.095  1.00 42.75  ? 228 GLU C OE1 1 
ATOM   7304  O  OE2 . GLU C  1 251 ? 125.017 50.459  98.374  1.00 34.97  ? 228 GLU C OE2 1 
ATOM   7305  N  N   . GLU C  1 252 ? 124.683 55.881  98.704  1.00 28.80  ? 229 GLU C N   1 
ATOM   7306  C  CA  . GLU C  1 252 ? 125.952 56.525  99.115  1.00 25.59  ? 229 GLU C CA  1 
ATOM   7307  C  C   . GLU C  1 252 ? 126.637 57.438  98.094  1.00 26.05  ? 229 GLU C C   1 
ATOM   7308  O  O   . GLU C  1 252 ? 127.735 57.139  97.644  1.00 29.45  ? 229 GLU C O   1 
ATOM   7309  C  CB  . GLU C  1 252 ? 126.975 55.489  99.580  1.00 15.79  ? 229 GLU C CB  1 
ATOM   7310  C  CG  . GLU C  1 252 ? 126.672 54.837  100.932 1.00 26.43  ? 229 GLU C CG  1 
ATOM   7311  C  CD  . GLU C  1 252 ? 127.856 54.012  101.475 1.00 47.92  ? 229 GLU C CD  1 
ATOM   7312  O  OE1 . GLU C  1 252 ? 128.570 53.349  100.675 1.00 50.47  ? 229 GLU C OE1 1 
ATOM   7313  O  OE2 . GLU C  1 252 ? 128.074 54.034  102.711 1.00 50.58  ? 229 GLU C OE2 1 
ATOM   7314  N  N   . PRO C  1 253 ? 125.992 58.554  97.741  1.00 22.12  ? 230 PRO C N   1 
ATOM   7315  C  CA  . PRO C  1 253 ? 126.576 59.577  96.877  1.00 26.78  ? 230 PRO C CA  1 
ATOM   7316  C  C   . PRO C  1 253 ? 127.843 60.230  97.435  1.00 29.55  ? 230 PRO C C   1 
ATOM   7317  O  O   . PRO C  1 253 ? 128.729 60.583  96.655  1.00 26.68  ? 230 PRO C O   1 
ATOM   7318  C  CB  . PRO C  1 253 ? 125.447 60.615  96.748  1.00 26.09  ? 230 PRO C CB  1 
ATOM   7319  C  CG  . PRO C  1 253 ? 124.517 60.335  97.878  1.00 27.74  ? 230 PRO C CG  1 
ATOM   7320  C  CD  . PRO C  1 253 ? 124.586 58.854  98.061  1.00 26.69  ? 230 PRO C CD  1 
ATOM   7321  N  N   . VAL C  1 254 ? 127.933 60.410  98.748  1.00 25.08  ? 231 VAL C N   1 
ATOM   7322  C  CA  . VAL C  1 254 ? 129.091 61.092  99.315  1.00 24.20  ? 231 VAL C CA  1 
ATOM   7323  C  C   . VAL C  1 254 ? 129.726 60.257  100.431 1.00 30.45  ? 231 VAL C C   1 
ATOM   7324  O  O   . VAL C  1 254 ? 129.205 59.201  100.791 1.00 27.15  ? 231 VAL C O   1 
ATOM   7325  C  CB  . VAL C  1 254 ? 128.722 62.492  99.843  1.00 28.38  ? 231 VAL C CB  1 
ATOM   7326  C  CG1 . VAL C  1 254 ? 128.184 63.365  98.707  1.00 27.24  ? 231 VAL C CG1 1 
ATOM   7327  C  CG2 . VAL C  1 254 ? 127.706 62.379  100.971 1.00 17.62  ? 231 VAL C CG2 1 
ATOM   7328  N  N   . VAL C  1 255 ? 130.849 60.731  100.970 1.00 27.54  ? 232 VAL C N   1 
ATOM   7329  C  CA  . VAL C  1 255 ? 131.586 60.001  102.007 1.00 26.59  ? 232 VAL C CA  1 
ATOM   7330  C  C   . VAL C  1 255 ? 130.664 59.574  103.165 1.00 29.69  ? 232 VAL C C   1 
ATOM   7331  O  O   . VAL C  1 255 ? 129.800 60.335  103.622 1.00 27.71  ? 232 VAL C O   1 
ATOM   7332  C  CB  . VAL C  1 255 ? 132.802 60.822  102.520 1.00 23.95  ? 232 VAL C CB  1 
ATOM   7333  C  CG1 . VAL C  1 255 ? 132.330 62.090  103.180 1.00 20.06  ? 232 VAL C CG1 1 
ATOM   7334  C  CG2 . VAL C  1 255 ? 133.644 60.009  103.489 1.00 22.08  ? 232 VAL C CG2 1 
ATOM   7335  N  N   . TYR C  1 256 ? 130.845 58.346  103.631 1.00 25.40  ? 233 TYR C N   1 
ATOM   7336  C  CA  . TYR C  1 256 ? 129.818 57.697  104.448 1.00 25.06  ? 233 TYR C CA  1 
ATOM   7337  C  C   . TYR C  1 256 ? 129.473 58.334  105.803 1.00 27.22  ? 233 TYR C C   1 
ATOM   7338  O  O   . TYR C  1 256 ? 128.397 58.068  106.339 1.00 27.95  ? 233 TYR C O   1 
ATOM   7339  C  CB  . TYR C  1 256 ? 130.101 56.196  104.599 1.00 19.78  ? 233 TYR C CB  1 
ATOM   7340  C  CG  . TYR C  1 256 ? 131.180 55.814  105.603 1.00 32.28  ? 233 TYR C CG  1 
ATOM   7341  C  CD1 . TYR C  1 256 ? 130.972 55.960  106.985 1.00 29.84  ? 233 TYR C CD1 1 
ATOM   7342  C  CD2 . TYR C  1 256 ? 132.390 55.260  105.174 1.00 31.59  ? 233 TYR C CD2 1 
ATOM   7343  C  CE1 . TYR C  1 256 ? 131.953 55.590  107.908 1.00 24.73  ? 233 TYR C CE1 1 
ATOM   7344  C  CE2 . TYR C  1 256 ? 133.372 54.882  106.078 1.00 31.85  ? 233 TYR C CE2 1 
ATOM   7345  C  CZ  . TYR C  1 256 ? 133.155 55.048  107.444 1.00 38.48  ? 233 TYR C CZ  1 
ATOM   7346  O  OH  . TYR C  1 256 ? 134.137 54.664  108.336 1.00 42.59  ? 233 TYR C OH  1 
ATOM   7347  N  N   . ASP C  1 257 ? 130.356 59.161  106.365 1.00 20.60  ? 234 ASP C N   1 
ATOM   7348  C  CA  . ASP C  1 257 ? 130.062 59.732  107.682 1.00 23.65  ? 234 ASP C CA  1 
ATOM   7349  C  C   . ASP C  1 257 ? 129.542 61.148  107.599 1.00 27.89  ? 234 ASP C C   1 
ATOM   7350  O  O   . ASP C  1 257 ? 129.412 61.825  108.623 1.00 29.07  ? 234 ASP C O   1 
ATOM   7351  C  CB  . ASP C  1 257 ? 131.250 59.631  108.672 1.00 17.72  ? 234 ASP C CB  1 
ATOM   7352  C  CG  . ASP C  1 257 ? 132.555 60.207  108.115 1.00 35.18  ? 234 ASP C CG  1 
ATOM   7353  O  OD1 . ASP C  1 257 ? 132.547 60.786  107.014 1.00 32.08  ? 234 ASP C OD1 1 
ATOM   7354  O  OD2 . ASP C  1 257 ? 133.602 60.096  108.792 1.00 48.98  ? 234 ASP C OD2 1 
ATOM   7355  N  N   . ASN C  1 258 ? 129.261 61.612  106.381 1.00 25.70  ? 235 ASN C N   1 
ATOM   7356  C  CA  . ASN C  1 258 ? 128.768 62.979  106.221 1.00 23.80  ? 235 ASN C CA  1 
ATOM   7357  C  C   . ASN C  1 258 ? 127.251 63.042  106.403 1.00 24.67  ? 235 ASN C C   1 
ATOM   7358  O  O   . ASN C  1 258 ? 126.509 63.171  105.434 1.00 24.66  ? 235 ASN C O   1 
ATOM   7359  C  CB  . ASN C  1 258 ? 129.196 63.584  104.878 1.00 16.98  ? 235 ASN C CB  1 
ATOM   7360  C  CG  . ASN C  1 258 ? 128.769 65.029  104.737 1.00 19.61  ? 235 ASN C CG  1 
ATOM   7361  O  OD1 . ASN C  1 258 ? 128.157 65.591  105.646 1.00 22.27  ? 235 ASN C OD1 1 
ATOM   7362  N  ND2 . ASN C  1 258 ? 129.088 65.642  103.599 1.00 32.67  ? 235 ASN C ND2 1 
ATOM   7363  N  N   . PHE C  1 259 ? 126.806 62.933  107.657 1.00 27.22  ? 236 PHE C N   1 
ATOM   7364  C  CA  . PHE C  1 259 ? 125.375 62.884  107.980 1.00 27.97  ? 236 PHE C CA  1 
ATOM   7365  C  C   . PHE C  1 259 ? 124.647 64.189  107.671 1.00 28.05  ? 236 PHE C C   1 
ATOM   7366  O  O   . PHE C  1 259 ? 123.490 64.171  107.263 1.00 27.41  ? 236 PHE C O   1 
ATOM   7367  C  CB  . PHE C  1 259 ? 125.154 62.482  109.440 1.00 26.12  ? 236 PHE C CB  1 
ATOM   7368  C  CG  . PHE C  1 259 ? 125.424 61.018  109.716 1.00 27.16  ? 236 PHE C CG  1 
ATOM   7369  C  CD1 . PHE C  1 259 ? 125.631 60.130  108.678 1.00 22.55  ? 236 PHE C CD1 1 
ATOM   7370  C  CD2 . PHE C  1 259 ? 125.463 60.539  111.015 1.00 37.24  ? 236 PHE C CD2 1 
ATOM   7371  C  CE1 . PHE C  1 259 ? 125.890 58.806  108.925 1.00 27.35  ? 236 PHE C CE1 1 
ATOM   7372  C  CE2 . PHE C  1 259 ? 125.708 59.205  111.271 1.00 35.23  ? 236 PHE C CE2 1 
ATOM   7373  C  CZ  . PHE C  1 259 ? 125.929 58.341  110.228 1.00 30.88  ? 236 PHE C CZ  1 
ATOM   7374  N  N   . ASP C  1 260 ? 125.329 65.316  107.869 1.00 21.84  ? 237 ASP C N   1 
ATOM   7375  C  CA  . ASP C  1 260 ? 124.767 66.602  107.505 1.00 23.34  ? 237 ASP C CA  1 
ATOM   7376  C  C   . ASP C  1 260 ? 124.422 66.673  106.014 1.00 30.94  ? 237 ASP C C   1 
ATOM   7377  O  O   . ASP C  1 260 ? 123.349 67.130  105.658 1.00 28.47  ? 237 ASP C O   1 
ATOM   7378  C  CB  . ASP C  1 260 ? 125.722 67.726  107.876 1.00 20.25  ? 237 ASP C CB  1 
ATOM   7379  C  CG  . ASP C  1 260 ? 125.833 67.913  109.376 1.00 40.03  ? 237 ASP C CG  1 
ATOM   7380  O  OD1 . ASP C  1 260 ? 124.775 67.991  110.051 1.00 41.91  ? 237 ASP C OD1 1 
ATOM   7381  O  OD2 . ASP C  1 260 ? 126.979 67.961  109.875 1.00 33.67  ? 237 ASP C OD2 1 
ATOM   7382  N  N   . GLY C  1 261 ? 125.339 66.239  105.153 1.00 28.10  ? 238 GLY C N   1 
ATOM   7383  C  CA  . GLY C  1 261 ? 125.114 66.265  103.721 1.00 16.04  ? 238 GLY C CA  1 
ATOM   7384  C  C   . GLY C  1 261 ? 123.997 65.310  103.311 1.00 20.01  ? 238 GLY C C   1 
ATOM   7385  O  O   . GLY C  1 261 ? 123.133 65.658  102.508 1.00 22.75  ? 238 GLY C O   1 
ATOM   7386  N  N   . TYR C  1 262 ? 124.016 64.098  103.862 1.00 18.78  ? 239 TYR C N   1 
ATOM   7387  C  CA  . TYR C  1 262 ? 122.979 63.115  103.563 1.00 24.97  ? 239 TYR C CA  1 
ATOM   7388  C  C   . TYR C  1 262 ? 121.591 63.660  103.895 1.00 25.29  ? 239 TYR C C   1 
ATOM   7389  O  O   . TYR C  1 262 ? 120.682 63.503  103.111 1.00 23.39  ? 239 TYR C O   1 
ATOM   7390  C  CB  . TYR C  1 262 ? 123.226 61.795  104.301 1.00 21.24  ? 239 TYR C CB  1 
ATOM   7391  C  CG  . TYR C  1 262 ? 124.212 60.887  103.610 1.00 21.39  ? 239 TYR C CG  1 
ATOM   7392  C  CD1 . TYR C  1 262 ? 124.092 60.597  102.257 1.00 31.05  ? 239 TYR C CD1 1 
ATOM   7393  C  CD2 . TYR C  1 262 ? 125.275 60.329  104.305 1.00 29.35  ? 239 TYR C CD2 1 
ATOM   7394  C  CE1 . TYR C  1 262 ? 125.017 59.766  101.605 1.00 32.79  ? 239 TYR C CE1 1 
ATOM   7395  C  CE2 . TYR C  1 262 ? 126.192 59.495  103.669 1.00 32.67  ? 239 TYR C CE2 1 
ATOM   7396  C  CZ  . TYR C  1 262 ? 126.059 59.224  102.319 1.00 33.11  ? 239 TYR C CZ  1 
ATOM   7397  O  OH  . TYR C  1 262 ? 126.970 58.400  101.698 1.00 37.74  ? 239 TYR C OH  1 
ATOM   7398  N  N   . ALA C  1 263 ? 121.443 64.306  105.051 1.00 20.68  ? 240 ALA C N   1 
ATOM   7399  C  CA  . ALA C  1 263 ? 120.173 64.901  105.441 1.00 21.17  ? 240 ALA C CA  1 
ATOM   7400  C  C   . ALA C  1 263 ? 119.664 65.917  104.422 1.00 24.32  ? 240 ALA C C   1 
ATOM   7401  O  O   . ALA C  1 263 ? 118.471 65.959  104.142 1.00 26.68  ? 240 ALA C O   1 
ATOM   7402  C  CB  . ALA C  1 263 ? 120.273 65.536  106.823 1.00 15.51  ? 240 ALA C CB  1 
ATOM   7403  N  N   . GLN C  1 264 ? 120.563 66.744  103.890 1.00 21.13  ? 241 GLN C N   1 
ATOM   7404  C  CA  . GLN C  1 264 ? 120.218 67.683  102.815 1.00 20.65  ? 241 GLN C CA  1 
ATOM   7405  C  C   . GLN C  1 264 ? 119.783 66.975  101.536 1.00 21.62  ? 241 GLN C C   1 
ATOM   7406  O  O   . GLN C  1 264 ? 118.815 67.378  100.905 1.00 21.20  ? 241 GLN C O   1 
ATOM   7407  C  CB  . GLN C  1 264 ? 121.394 68.594  102.470 1.00 19.74  ? 241 GLN C CB  1 
ATOM   7408  C  CG  . GLN C  1 264 ? 121.720 69.592  103.531 1.00 43.99  ? 241 GLN C CG  1 
ATOM   7409  C  CD  . GLN C  1 264 ? 120.537 70.465  103.855 1.00 58.72  ? 241 GLN C CD  1 
ATOM   7410  O  OE1 . GLN C  1 264 ? 120.157 70.596  105.023 1.00 62.22  ? 241 GLN C OE1 1 
ATOM   7411  N  NE2 . GLN C  1 264 ? 119.934 71.065  102.821 1.00 58.14  ? 241 GLN C NE2 1 
ATOM   7412  N  N   . LEU C  1 265 ? 120.513 65.939  101.149 1.00 19.05  ? 242 LEU C N   1 
ATOM   7413  C  CA  . LEU C  1 265 ? 120.207 65.217  99.911  1.00 31.33  ? 242 LEU C CA  1 
ATOM   7414  C  C   . LEU C  1 265 ? 118.868 64.491  100.009 1.00 28.61  ? 242 LEU C C   1 
ATOM   7415  O  O   . LEU C  1 265 ? 118.056 64.503  99.079  1.00 31.73  ? 242 LEU C O   1 
ATOM   7416  C  CB  . LEU C  1 265 ? 121.314 64.209  99.586  1.00 20.87  ? 242 LEU C CB  1 
ATOM   7417  C  CG  . LEU C  1 265 ? 122.675 64.811  99.286  1.00 18.19  ? 242 LEU C CG  1 
ATOM   7418  C  CD1 . LEU C  1 265 ? 123.738 63.730  99.210  1.00 22.30  ? 242 LEU C CD1 1 
ATOM   7419  C  CD2 . LEU C  1 265 ? 122.606 65.609  97.981  1.00 12.39  ? 242 LEU C CD2 1 
ATOM   7420  N  N   . ARG C  1 266 ? 118.655 63.853  101.147 1.00 20.38  ? 243 ARG C N   1 
ATOM   7421  C  CA  . ARG C  1 266 ? 117.424 63.132  101.405 1.00 26.55  ? 243 ARG C CA  1 
ATOM   7422  C  C   . ARG C  1 266 ? 116.241 64.078  101.241 1.00 27.56  ? 243 ARG C C   1 
ATOM   7423  O  O   . ARG C  1 266 ? 115.235 63.732  100.627 1.00 23.06  ? 243 ARG C O   1 
ATOM   7424  C  CB  . ARG C  1 266 ? 117.450 62.567  102.827 1.00 23.04  ? 243 ARG C CB  1 
ATOM   7425  C  CG  . ARG C  1 266 ? 116.268 61.687  103.200 1.00 25.69  ? 243 ARG C CG  1 
ATOM   7426  C  CD  . ARG C  1 266 ? 115.931 61.872  104.672 1.00 30.16  ? 243 ARG C CD  1 
ATOM   7427  N  NE  . ARG C  1 266 ? 115.099 60.789  105.158 1.00 45.07  ? 243 ARG C NE  1 
ATOM   7428  C  CZ  . ARG C  1 266 ? 114.510 60.773  106.346 1.00 53.18  ? 243 ARG C CZ  1 
ATOM   7429  N  NH1 . ARG C  1 266 ? 114.653 61.798  107.175 1.00 48.30  ? 243 ARG C NH1 1 
ATOM   7430  N  NH2 . ARG C  1 266 ? 113.771 59.730  106.697 1.00 61.35  ? 243 ARG C NH2 1 
ATOM   7431  N  N   . HIS C  1 267 ? 116.370 65.280  101.788 1.00 23.57  ? 244 HIS C N   1 
ATOM   7432  C  CA  . HIS C  1 267 ? 115.284 66.244  101.744 1.00 22.71  ? 244 HIS C CA  1 
ATOM   7433  C  C   . HIS C  1 267 ? 115.042 66.753  100.318 1.00 25.74  ? 244 HIS C C   1 
ATOM   7434  O  O   . HIS C  1 267 ? 113.909 66.851  99.869  1.00 23.22  ? 244 HIS C O   1 
ATOM   7435  C  CB  . HIS C  1 267 ? 115.562 67.408  102.697 1.00 25.80  ? 244 HIS C CB  1 
ATOM   7436  C  CG  . HIS C  1 267 ? 114.611 68.554  102.531 1.00 49.52  ? 244 HIS C CG  1 
ATOM   7437  N  ND1 . HIS C  1 267 ? 114.786 69.536  101.577 1.00 58.04  ? 244 HIS C ND1 1 
ATOM   7438  C  CD2 . HIS C  1 267 ? 113.463 68.864  103.181 1.00 52.80  ? 244 HIS C CD2 1 
ATOM   7439  C  CE1 . HIS C  1 267 ? 113.793 70.404  101.651 1.00 56.54  ? 244 HIS C CE1 1 
ATOM   7440  N  NE2 . HIS C  1 267 ? 112.976 70.020  102.616 1.00 56.39  ? 244 HIS C NE2 1 
ATOM   7441  N  N   . ASP C  1 268 ? 116.117 67.072  99.610  1.00 26.48  ? 245 ASP C N   1 
ATOM   7442  C  CA  . ASP C  1 268 ? 116.024 67.555  98.236  1.00 23.14  ? 245 ASP C CA  1 
ATOM   7443  C  C   . ASP C  1 268 ? 115.513 66.468  97.269  1.00 20.71  ? 245 ASP C C   1 
ATOM   7444  O  O   . ASP C  1 268 ? 114.785 66.772  96.346  1.00 26.96  ? 245 ASP C O   1 
ATOM   7445  C  CB  . ASP C  1 268 ? 117.393 68.045  97.744  1.00 25.07  ? 245 ASP C CB  1 
ATOM   7446  C  CG  . ASP C  1 268 ? 117.727 69.465  98.199  1.00 37.18  ? 245 ASP C CG  1 
ATOM   7447  O  OD1 . ASP C  1 268 ? 116.792 70.269  98.392  1.00 43.21  ? 245 ASP C OD1 1 
ATOM   7448  O  OD2 . ASP C  1 268 ? 118.938 69.773  98.337  1.00 38.88  ? 245 ASP C OD2 1 
ATOM   7449  N  N   . LEU C  1 269 ? 115.910 65.214  97.477  1.00 17.42  ? 246 LEU C N   1 
ATOM   7450  C  CA  . LEU C  1 269 ? 115.574 64.133  96.546  1.00 23.26  ? 246 LEU C CA  1 
ATOM   7451  C  C   . LEU C  1 269 ? 114.257 63.465  96.877  1.00 29.73  ? 246 LEU C C   1 
ATOM   7452  O  O   . LEU C  1 269 ? 113.977 63.165  98.036  1.00 28.16  ? 246 LEU C O   1 
ATOM   7453  C  CB  . LEU C  1 269 ? 116.650 63.063  96.574  1.00 23.83  ? 246 LEU C CB  1 
ATOM   7454  C  CG  . LEU C  1 269 ? 117.983 63.434  95.955  1.00 34.23  ? 246 LEU C CG  1 
ATOM   7455  C  CD1 . LEU C  1 269 ? 118.996 62.347  96.293  1.00 34.90  ? 246 LEU C CD1 1 
ATOM   7456  C  CD2 . LEU C  1 269 ? 117.799 63.584  94.456  1.00 26.14  ? 246 LEU C CD2 1 
ATOM   7457  N  N   . LYS C  1 270 ? 113.457 63.212  95.853  1.00 27.07  ? 247 LYS C N   1 
ATOM   7458  C  CA  . LYS C  1 270 ? 112.209 62.480  96.043  1.00 28.04  ? 247 LYS C CA  1 
ATOM   7459  C  C   . LYS C  1 270 ? 112.426 60.976  95.982  1.00 25.44  ? 247 LYS C C   1 
ATOM   7460  O  O   . LYS C  1 270 ? 111.723 60.209  96.626  1.00 32.75  ? 247 LYS C O   1 
ATOM   7461  C  CB  . LYS C  1 270 ? 111.169 62.920  95.011  1.00 26.97  ? 247 LYS C CB  1 
ATOM   7462  C  CG  . LYS C  1 270 ? 110.419 64.192  95.421  1.00 40.97  ? 247 LYS C CG  1 
ATOM   7463  C  CD  . LYS C  1 270 ? 109.997 64.995  94.201  1.00 58.11  ? 247 LYS C CD  1 
ATOM   7464  C  CE  . LYS C  1 270 ? 108.901 65.984  94.544  1.00 70.52  ? 247 LYS C CE  1 
ATOM   7465  N  NZ  . LYS C  1 270 ? 107.657 65.271  94.935  1.00 75.32  ? 247 LYS C NZ  1 
ATOM   7466  N  N   . THR C  1 271 ? 113.402 60.566  95.187  1.00 27.79  ? 248 THR C N   1 
ATOM   7467  C  CA  . THR C  1 271 ? 113.824 59.181  95.113  1.00 23.79  ? 248 THR C CA  1 
ATOM   7468  C  C   . THR C  1 271 ? 114.446 58.838  96.458  1.00 22.44  ? 248 THR C C   1 
ATOM   7469  O  O   . THR C  1 271 ? 115.137 59.662  97.034  1.00 24.56  ? 248 THR C O   1 
ATOM   7470  C  CB  . THR C  1 271 ? 114.880 59.016  93.989  1.00 16.91  ? 248 THR C CB  1 
ATOM   7471  O  OG1 . THR C  1 271 ? 114.276 59.295  92.718  1.00 27.67  ? 248 THR C OG1 1 
ATOM   7472  C  CG2 . THR C  1 271 ? 115.447 57.616  93.977  1.00 15.76  ? 248 THR C CG2 1 
ATOM   7473  N  N   . PRO C  1 272 ? 114.192 57.631  96.972  1.00 24.95  ? 249 PRO C N   1 
ATOM   7474  C  CA  . PRO C  1 272 ? 114.750 57.230  98.280  1.00 26.45  ? 249 PRO C CA  1 
ATOM   7475  C  C   . PRO C  1 272 ? 116.279 57.246  98.302  1.00 28.42  ? 249 PRO C C   1 
ATOM   7476  O  O   . PRO C  1 272 ? 116.904 56.870  97.323  1.00 28.35  ? 249 PRO C O   1 
ATOM   7477  C  CB  . PRO C  1 272 ? 114.247 55.784  98.462  1.00 20.59  ? 249 PRO C CB  1 
ATOM   7478  C  CG  . PRO C  1 272 ? 113.022 55.679  97.572  1.00 21.41  ? 249 PRO C CG  1 
ATOM   7479  C  CD  . PRO C  1 272 ? 113.294 56.611  96.398  1.00 20.74  ? 249 PRO C CD  1 
ATOM   7480  N  N   . LEU C  1 273 ? 116.866 57.676  99.413  1.00 27.59  ? 250 LEU C N   1 
ATOM   7481  C  CA  . LEU C  1 273 ? 118.317 57.712  99.565  1.00 23.97  ? 250 LEU C CA  1 
ATOM   7482  C  C   . LEU C  1 273 ? 118.721 56.538  100.445 1.00 27.99  ? 250 LEU C C   1 
ATOM   7483  O  O   . LEU C  1 273 ? 118.202 56.391  101.549 1.00 28.43  ? 250 LEU C O   1 
ATOM   7484  C  CB  . LEU C  1 273 ? 118.745 59.030  100.211 1.00 22.47  ? 250 LEU C CB  1 
ATOM   7485  C  CG  . LEU C  1 273 ? 120.214 59.406  100.413 1.00 25.95  ? 250 LEU C CG  1 
ATOM   7486  C  CD1 . LEU C  1 273 ? 120.964 59.594  99.099  1.00 24.14  ? 250 LEU C CD1 1 
ATOM   7487  C  CD2 . LEU C  1 273 ? 120.249 60.684  101.199 1.00 27.87  ? 250 LEU C CD2 1 
ATOM   7488  N  N   . MET C  1 274 ? 119.621 55.695  99.935  1.00 23.27  ? 251 MET C N   1 
ATOM   7489  C  CA  . MET C  1 274 ? 120.087 54.499  100.637 1.00 24.56  ? 251 MET C CA  1 
ATOM   7490  C  C   . MET C  1 274 ? 121.515 54.628  101.184 1.00 29.64  ? 251 MET C C   1 
ATOM   7491  O  O   . MET C  1 274 ? 122.445 54.992  100.450 1.00 22.97  ? 251 MET C O   1 
ATOM   7492  C  CB  . MET C  1 274 ? 120.027 53.281  99.714  1.00 22.91  ? 251 MET C CB  1 
ATOM   7493  C  CG  . MET C  1 274 ? 120.750 52.063  100.266 1.00 25.66  ? 251 MET C CG  1 
ATOM   7494  S  SD  . MET C  1 274 ? 119.783 51.178  101.525 1.00 30.81  ? 251 MET C SD  1 
ATOM   7495  C  CE  . MET C  1 274 ? 118.775 50.141  100.477 1.00 24.72  ? 251 MET C CE  1 
ATOM   7496  N  N   . ILE C  1 275 ? 121.681 54.324  102.471 1.00 21.51  ? 252 ILE C N   1 
ATOM   7497  C  CA  . ILE C  1 275 ? 123.014 54.200  103.061 1.00 23.35  ? 252 ILE C CA  1 
ATOM   7498  C  C   . ILE C  1 275 ? 123.071 53.040  104.049 1.00 22.27  ? 252 ILE C C   1 
ATOM   7499  O  O   . ILE C  1 275 ? 122.128 52.256  104.156 1.00 24.83  ? 252 ILE C O   1 
ATOM   7500  C  CB  . ILE C  1 275 ? 123.442 55.471  103.832 1.00 17.91  ? 252 ILE C CB  1 
ATOM   7501  C  CG1 . ILE C  1 275 ? 122.612 55.627  105.108 1.00 26.36  ? 252 ILE C CG1 1 
ATOM   7502  C  CG2 . ILE C  1 275 ? 123.380 56.691  102.942 1.00 19.96  ? 252 ILE C CG2 1 
ATOM   7503  C  CD1 . ILE C  1 275 ? 123.024 56.805  105.947 1.00 26.93  ? 252 ILE C CD1 1 
ATOM   7504  N  N   . GLY C  1 276 ? 124.178 52.934  104.777 1.00 25.10  ? 253 GLY C N   1 
ATOM   7505  C  CA  . GLY C  1 276 ? 124.232 52.030  105.912 1.00 25.53  ? 253 GLY C CA  1 
ATOM   7506  C  C   . GLY C  1 276 ? 125.235 50.906  105.806 1.00 27.35  ? 253 GLY C C   1 
ATOM   7507  O  O   . GLY C  1 276 ? 125.531 50.228  106.795 1.00 27.74  ? 253 GLY C O   1 
ATOM   7508  N  N   . GLU C  1 277 ? 125.780 50.697  104.615 1.00 24.10  ? 254 GLU C N   1 
ATOM   7509  C  CA  . GLU C  1 277 ? 126.737 49.623  104.460 1.00 22.65  ? 254 GLU C CA  1 
ATOM   7510  C  C   . GLU C  1 277 ? 128.008 49.888  105.268 1.00 30.01  ? 254 GLU C C   1 
ATOM   7511  O  O   . GLU C  1 277 ? 128.807 48.983  105.490 1.00 37.41  ? 254 GLU C O   1 
ATOM   7512  C  CB  . GLU C  1 277 ? 127.056 49.390  102.997 1.00 24.62  ? 254 GLU C CB  1 
ATOM   7513  C  CG  . GLU C  1 277 ? 128.025 50.349  102.369 1.00 22.63  ? 254 GLU C CG  1 
ATOM   7514  C  CD  . GLU C  1 277 ? 128.237 50.004  100.899 1.00 36.81  ? 254 GLU C CD  1 
ATOM   7515  O  OE1 . GLU C  1 277 ? 127.249 50.032  100.131 1.00 35.92  ? 254 GLU C OE1 1 
ATOM   7516  O  OE2 . GLU C  1 277 ? 129.382 49.674  100.519 1.00 45.12  ? 254 GLU C OE2 1 
ATOM   7517  N  N   . ASN C  1 278 ? 128.176 51.125  105.721 1.00 24.00  ? 255 ASN C N   1 
ATOM   7518  C  CA  . ASN C  1 278 ? 129.332 51.502  106.525 1.00 29.29  ? 255 ASN C CA  1 
ATOM   7519  C  C   . ASN C  1 278 ? 128.977 51.829  107.968 1.00 30.74  ? 255 ASN C C   1 
ATOM   7520  O  O   . ASN C  1 278 ? 129.761 52.450  108.672 1.00 36.41  ? 255 ASN C O   1 
ATOM   7521  C  CB  . ASN C  1 278 ? 130.086 52.667  105.885 1.00 23.52  ? 255 ASN C CB  1 
ATOM   7522  C  CG  . ASN C  1 278 ? 130.828 52.252  104.635 1.00 30.81  ? 255 ASN C CG  1 
ATOM   7523  O  OD1 . ASN C  1 278 ? 131.913 51.680  104.710 1.00 34.11  ? 255 ASN C OD1 1 
ATOM   7524  N  ND2 . ASN C  1 278 ? 130.246 52.531  103.477 1.00 34.83  ? 255 ASN C ND2 1 
ATOM   7525  N  N   . PHE C  1 279 ? 127.799 51.401  108.403 1.00 28.14  ? 256 PHE C N   1 
ATOM   7526  C  CA  . PHE C  1 279 ? 127.399 51.591  109.782 1.00 29.14  ? 256 PHE C CA  1 
ATOM   7527  C  C   . PHE C  1 279 ? 128.203 50.603  110.587 1.00 31.34  ? 256 PHE C C   1 
ATOM   7528  O  O   . PHE C  1 279 ? 128.139 49.412  110.329 1.00 34.06  ? 256 PHE C O   1 
ATOM   7529  C  CB  . PHE C  1 279 ? 125.920 51.252  109.983 1.00 32.12  ? 256 PHE C CB  1 
ATOM   7530  C  CG  . PHE C  1 279 ? 124.972 52.299  109.479 1.00 28.82  ? 256 PHE C CG  1 
ATOM   7531  C  CD1 . PHE C  1 279 ? 125.413 53.570  109.202 1.00 22.07  ? 256 PHE C CD1 1 
ATOM   7532  C  CD2 . PHE C  1 279 ? 123.628 51.998  109.282 1.00 25.55  ? 256 PHE C CD2 1 
ATOM   7533  C  CE1 . PHE C  1 279 ? 124.526 54.544  108.733 1.00 31.53  ? 256 PHE C CE1 1 
ATOM   7534  C  CE2 . PHE C  1 279 ? 122.746 52.951  108.816 1.00 23.93  ? 256 PHE C CE2 1 
ATOM   7535  C  CZ  . PHE C  1 279 ? 123.193 54.231  108.539 1.00 24.59  ? 256 PHE C CZ  1 
ATOM   7536  N  N   . TYR C  1 280 ? 128.964 51.098  111.555 1.00 29.97  ? 257 TYR C N   1 
ATOM   7537  C  CA  . TYR C  1 280 ? 129.644 50.233  112.502 1.00 26.90  ? 257 TYR C CA  1 
ATOM   7538  C  C   . TYR C  1 280 ? 128.798 50.104  113.763 1.00 28.20  ? 257 TYR C C   1 
ATOM   7539  O  O   . TYR C  1 280 ? 128.931 50.878  114.704 1.00 34.43  ? 257 TYR C O   1 
ATOM   7540  C  CB  . TYR C  1 280 ? 131.073 50.740  112.787 1.00 24.04  ? 257 TYR C CB  1 
ATOM   7541  C  CG  . TYR C  1 280 ? 132.016 50.470  111.619 1.00 32.31  ? 257 TYR C CG  1 
ATOM   7542  C  CD1 . TYR C  1 280 ? 132.603 49.219  111.453 1.00 24.82  ? 257 TYR C CD1 1 
ATOM   7543  C  CD2 . TYR C  1 280 ? 132.282 51.442  110.661 1.00 34.97  ? 257 TYR C CD2 1 
ATOM   7544  C  CE1 . TYR C  1 280 ? 133.442 48.943  110.384 1.00 27.69  ? 257 TYR C CE1 1 
ATOM   7545  C  CE2 . TYR C  1 280 ? 133.133 51.170  109.582 1.00 33.91  ? 257 TYR C CE2 1 
ATOM   7546  C  CZ  . TYR C  1 280 ? 133.701 49.916  109.457 1.00 33.00  ? 257 TYR C CZ  1 
ATOM   7547  O  OH  . TYR C  1 280 ? 134.546 49.623  108.416 1.00 35.29  ? 257 TYR C OH  1 
ATOM   7548  N  N   . GLY C  1 281 ? 127.899 49.130  113.753 1.00 26.83  ? 258 GLY C N   1 
ATOM   7549  C  CA  . GLY C  1 281 ? 127.054 48.856  114.895 1.00 27.02  ? 258 GLY C CA  1 
ATOM   7550  C  C   . GLY C  1 281 ? 125.670 49.467  114.787 1.00 30.47  ? 258 GLY C C   1 
ATOM   7551  O  O   . GLY C  1 281 ? 125.460 50.419  114.035 1.00 34.01  ? 258 GLY C O   1 
ATOM   7552  N  N   . PRO C  1 282 ? 124.719 48.912  115.551 1.00 25.21  ? 259 PRO C N   1 
ATOM   7553  C  CA  . PRO C  1 282 ? 123.319 49.320  115.693 1.00 23.14  ? 259 PRO C CA  1 
ATOM   7554  C  C   . PRO C  1 282 ? 123.154 50.771  116.178 1.00 27.39  ? 259 PRO C C   1 
ATOM   7555  O  O   . PRO C  1 282 ? 122.218 51.455  115.751 1.00 28.82  ? 259 PRO C O   1 
ATOM   7556  C  CB  . PRO C  1 282 ? 122.789 48.360  116.763 1.00 20.74  ? 259 PRO C CB  1 
ATOM   7557  C  CG  . PRO C  1 282 ? 123.680 47.195  116.715 1.00 24.04  ? 259 PRO C CG  1 
ATOM   7558  C  CD  . PRO C  1 282 ? 125.026 47.713  116.345 1.00 25.85  ? 259 PRO C CD  1 
ATOM   7559  N  N   . ARG C  1 283 ? 124.032 51.229  117.068 1.00 28.86  ? 260 ARG C N   1 
ATOM   7560  C  CA  . ARG C  1 283 ? 123.946 52.604  117.578 1.00 26.90  ? 260 ARG C CA  1 
ATOM   7561  C  C   . ARG C  1 283 ? 124.210 53.620  116.484 1.00 22.30  ? 260 ARG C C   1 
ATOM   7562  O  O   . ARG C  1 283 ? 123.638 54.703  116.473 1.00 28.75  ? 260 ARG C O   1 
ATOM   7563  C  CB  . ARG C  1 283 ? 124.939 52.830  118.715 1.00 19.75  ? 260 ARG C CB  1 
ATOM   7564  C  CG  . ARG C  1 283 ? 124.978 54.272  119.229 1.00 25.37  ? 260 ARG C CG  1 
ATOM   7565  C  CD  . ARG C  1 283 ? 125.601 54.333  120.605 1.00 26.41  ? 260 ARG C CD  1 
ATOM   7566  N  NE  . ARG C  1 283 ? 124.701 53.846  121.645 1.00 32.25  ? 260 ARG C NE  1 
ATOM   7567  C  CZ  . ARG C  1 283 ? 125.102 53.418  122.840 1.00 32.28  ? 260 ARG C CZ  1 
ATOM   7568  N  NH1 . ARG C  1 283 ? 126.387 53.378  123.136 1.00 38.03  ? 260 ARG C NH1 1 
ATOM   7569  N  NH2 . ARG C  1 283 ? 124.221 53.010  123.737 1.00 32.33  ? 260 ARG C NH2 1 
ATOM   7570  N  N   . GLU C  1 284 ? 125.089 53.265  115.563 1.00 21.72  ? 261 GLU C N   1 
ATOM   7571  C  CA  . GLU C  1 284 ? 125.433 54.149  114.460 1.00 26.33  ? 261 GLU C CA  1 
ATOM   7572  C  C   . GLU C  1 284 ? 124.233 54.269  113.520 1.00 22.14  ? 261 GLU C C   1 
ATOM   7573  O  O   . GLU C  1 284 ? 123.986 55.329  112.960 1.00 22.06  ? 261 GLU C O   1 
ATOM   7574  C  CB  . GLU C  1 284 ? 126.681 53.633  113.726 1.00 36.19  ? 261 GLU C CB  1 
ATOM   7575  C  CG  . GLU C  1 284 ? 127.565 54.730  113.126 1.00 58.19  ? 261 GLU C CG  1 
ATOM   7576  C  CD  . GLU C  1 284 ? 129.037 54.312  113.020 1.00 67.30  ? 261 GLU C CD  1 
ATOM   7577  O  OE1 . GLU C  1 284 ? 129.537 54.141  111.884 1.00 70.13  ? 261 GLU C OE1 1 
ATOM   7578  O  OE2 . GLU C  1 284 ? 129.696 54.158  114.075 1.00 63.77  ? 261 GLU C OE2 1 
ATOM   7579  N  N   . MET C  1 285 ? 123.453 53.201  113.384 1.00 18.37  ? 262 MET C N   1 
ATOM   7580  C  CA  . MET C  1 285 ? 122.257 53.277  112.552 1.00 22.70  ? 262 MET C CA  1 
ATOM   7581  C  C   . MET C  1 285 ? 121.267 54.196  113.239 1.00 27.84  ? 262 MET C C   1 
ATOM   7582  O  O   . MET C  1 285 ? 120.640 55.051  112.616 1.00 29.40  ? 262 MET C O   1 
ATOM   7583  C  CB  . MET C  1 285 ? 121.629 51.898  112.340 1.00 24.40  ? 262 MET C CB  1 
ATOM   7584  C  CG  . MET C  1 285 ? 120.272 51.975  111.658 1.00 26.76  ? 262 MET C CG  1 
ATOM   7585  S  SD  . MET C  1 285 ? 119.526 50.366  111.398 1.00 36.55  ? 262 MET C SD  1 
ATOM   7586  C  CE  . MET C  1 285 ? 120.640 49.720  110.170 1.00 29.86  ? 262 MET C CE  1 
ATOM   7587  N  N   . HIS C  1 286 ? 121.156 54.017  114.548 1.00 25.77  ? 263 HIS C N   1 
ATOM   7588  C  CA  . HIS C  1 286 ? 120.301 54.846  115.389 1.00 22.91  ? 263 HIS C CA  1 
ATOM   7589  C  C   . HIS C  1 286 ? 120.640 56.328  115.243 1.00 23.75  ? 263 HIS C C   1 
ATOM   7590  O  O   . HIS C  1 286 ? 119.748 57.160  115.073 1.00 29.59  ? 263 HIS C O   1 
ATOM   7591  C  CB  . HIS C  1 286 ? 120.428 54.366  116.838 1.00 29.45  ? 263 HIS C CB  1 
ATOM   7592  C  CG  . HIS C  1 286 ? 119.917 55.336  117.852 1.00 27.47  ? 263 HIS C CG  1 
ATOM   7593  N  ND1 . HIS C  1 286 ? 118.603 55.743  117.896 1.00 31.27  ? 263 HIS C ND1 1 
ATOM   7594  C  CD2 . HIS C  1 286 ? 120.542 55.956  118.884 1.00 23.33  ? 263 HIS C CD2 1 
ATOM   7595  C  CE1 . HIS C  1 286 ? 118.442 56.579  118.908 1.00 35.41  ? 263 HIS C CE1 1 
ATOM   7596  N  NE2 . HIS C  1 286 ? 119.605 56.731  119.517 1.00 20.85  ? 263 HIS C NE2 1 
ATOM   7597  N  N   . GLN C  1 287 ? 121.929 56.654  115.270 1.00 22.25  ? 264 GLN C N   1 
ATOM   7598  C  CA  . GLN C  1 287 ? 122.373 58.042  115.078 1.00 23.73  ? 264 GLN C CA  1 
ATOM   7599  C  C   . GLN C  1 287 ? 122.041 58.569  113.672 1.00 22.17  ? 264 GLN C C   1 
ATOM   7600  O  O   . GLN C  1 287 ? 121.551 59.685  113.515 1.00 26.33  ? 264 GLN C O   1 
ATOM   7601  C  CB  . GLN C  1 287 ? 123.871 58.183  115.373 1.00 27.79  ? 264 GLN C CB  1 
ATOM   7602  C  CG  . GLN C  1 287 ? 124.248 57.958  116.841 1.00 33.00  ? 264 GLN C CG  1 
ATOM   7603  C  CD  . GLN C  1 287 ? 125.738 57.637  117.040 1.00 51.53  ? 264 GLN C CD  1 
ATOM   7604  O  OE1 . GLN C  1 287 ? 126.475 57.380  116.079 1.00 62.13  ? 264 GLN C OE1 1 
ATOM   7605  N  NE2 . GLN C  1 287 ? 126.182 57.653  118.297 1.00 46.10  ? 264 GLN C NE2 1 
ATOM   7606  N  N   . ALA C  1 288 ? 122.265 57.750  112.654 1.00 21.01  ? 265 ALA C N   1 
ATOM   7607  C  CA  . ALA C  1 288 ? 121.920 58.144  111.298 1.00 19.67  ? 265 ALA C CA  1 
ATOM   7608  C  C   . ALA C  1 288 ? 120.437 58.489  111.169 1.00 19.60  ? 265 ALA C C   1 
ATOM   7609  O  O   . ALA C  1 288 ? 120.080 59.514  110.597 1.00 27.09  ? 265 ALA C O   1 
ATOM   7610  C  CB  . ALA C  1 288 ? 122.312 57.056  110.317 1.00 23.66  ? 265 ALA C CB  1 
ATOM   7611  N  N   . LEU C  1 289 ? 119.576 57.640  111.715 1.00 24.47  ? 266 LEU C N   1 
ATOM   7612  C  CA  . LEU C  1 289 ? 118.127 57.869  111.676 1.00 21.82  ? 266 LEU C CA  1 
ATOM   7613  C  C   . LEU C  1 289 ? 117.696 59.115  112.461 1.00 26.67  ? 266 LEU C C   1 
ATOM   7614  O  O   . LEU C  1 289 ? 116.813 59.851  112.018 1.00 26.26  ? 266 LEU C O   1 
ATOM   7615  C  CB  . LEU C  1 289 ? 117.365 56.622  112.154 1.00 17.97  ? 266 LEU C CB  1 
ATOM   7616  C  CG  . LEU C  1 289 ? 117.599 55.364  111.315 1.00 21.25  ? 266 LEU C CG  1 
ATOM   7617  C  CD1 . LEU C  1 289 ? 116.813 54.198  111.856 1.00 25.15  ? 266 LEU C CD1 1 
ATOM   7618  C  CD2 . LEU C  1 289 ? 117.216 55.599  109.857 1.00 26.93  ? 266 LEU C CD2 1 
ATOM   7619  N  N   . GLN C  1 290 ? 118.316 59.359  113.615 1.00 29.58  ? 267 GLN C N   1 
ATOM   7620  C  CA  . GLN C  1 290 ? 118.072 60.605  114.362 1.00 25.50  ? 267 GLN C CA  1 
ATOM   7621  C  C   . GLN C  1 290 ? 118.497 61.829  113.545 1.00 24.21  ? 267 GLN C C   1 
ATOM   7622  O  O   . GLN C  1 290 ? 117.913 62.895  113.650 1.00 24.56  ? 267 GLN C O   1 
ATOM   7623  C  CB  . GLN C  1 290 ? 118.828 60.616  115.703 1.00 29.37  ? 267 GLN C CB  1 
ATOM   7624  C  CG  . GLN C  1 290 ? 118.289 59.684  116.796 1.00 29.19  ? 267 GLN C CG  1 
ATOM   7625  C  CD  . GLN C  1 290 ? 119.165 59.720  118.066 1.00 42.72  ? 267 GLN C CD  1 
ATOM   7626  O  OE1 . GLN C  1 290 ? 120.397 59.592  117.996 1.00 44.89  ? 267 GLN C OE1 1 
ATOM   7627  N  NE2 . GLN C  1 290 ? 118.529 59.906  119.226 1.00 29.39  ? 267 GLN C NE2 1 
ATOM   7628  N  N   . ALA C  1 291 ? 119.525 61.672  112.728 1.00 25.99  ? 268 ALA C N   1 
ATOM   7629  C  CA  . ALA C  1 291 ? 120.031 62.790  111.953 1.00 23.16  ? 268 ALA C CA  1 
ATOM   7630  C  C   . ALA C  1 291 ? 119.203 63.031  110.682 1.00 24.67  ? 268 ALA C C   1 
ATOM   7631  O  O   . ALA C  1 291 ? 119.393 64.030  109.985 1.00 28.83  ? 268 ALA C O   1 
ATOM   7632  C  CB  . ALA C  1 291 ? 121.510 62.553  111.613 1.00 25.48  ? 268 ALA C CB  1 
ATOM   7633  N  N   . GLY C  1 292 ? 118.283 62.117  110.383 1.00 20.91  ? 269 GLY C N   1 
ATOM   7634  C  CA  . GLY C  1 292 ? 117.500 62.197  109.156 1.00 15.84  ? 269 GLY C CA  1 
ATOM   7635  C  C   . GLY C  1 292 ? 118.326 61.958  107.895 1.00 26.68  ? 269 GLY C C   1 
ATOM   7636  O  O   . GLY C  1 292 ? 118.057 62.522  106.830 1.00 23.37  ? 269 GLY C O   1 
ATOM   7637  N  N   . ALA C  1 293 ? 119.320 61.089  108.016 1.00 22.92  ? 270 ALA C N   1 
ATOM   7638  C  CA  . ALA C  1 293 ? 120.279 60.845  106.953 1.00 23.89  ? 270 ALA C CA  1 
ATOM   7639  C  C   . ALA C  1 293 ? 119.798 59.989  105.764 1.00 26.97  ? 270 ALA C C   1 
ATOM   7640  O  O   . ALA C  1 293 ? 120.417 60.031  104.701 1.00 31.23  ? 270 ALA C O   1 
ATOM   7641  C  CB  . ALA C  1 293 ? 121.549 60.242  107.549 1.00 29.73  ? 270 ALA C CB  1 
ATOM   7642  N  N   . CYS C  1 294 ? 118.718 59.223  105.909 1.00 21.45  ? 271 CYS C N   1 
ATOM   7643  C  CA  . CYS C  1 294 ? 118.355 58.295  104.826 1.00 24.91  ? 271 CYS C CA  1 
ATOM   7644  C  C   . CYS C  1 294 ? 116.912 57.822  104.872 1.00 26.84  ? 271 CYS C C   1 
ATOM   7645  O  O   . CYS C  1 294 ? 116.240 57.977  105.885 1.00 28.21  ? 271 CYS C O   1 
ATOM   7646  C  CB  . CYS C  1 294 ? 119.257 57.066  104.898 1.00 29.59  ? 271 CYS C CB  1 
ATOM   7647  S  SG  . CYS C  1 294 ? 119.135 56.286  106.517 1.00 35.43  ? 271 CYS C SG  1 
ATOM   7648  N  N   . ASP C  1 295 ? 116.451 57.223  103.775 1.00 24.33  ? 272 ASP C N   1 
ATOM   7649  C  CA  . ASP C  1 295 ? 115.118 56.628  103.736 1.00 23.73  ? 272 ASP C CA  1 
ATOM   7650  C  C   . ASP C  1 295 ? 115.163 55.101  103.847 1.00 29.98  ? 272 ASP C C   1 
ATOM   7651  O  O   . ASP C  1 295 ? 114.182 54.474  104.252 1.00 36.24  ? 272 ASP C O   1 
ATOM   7652  C  CB  . ASP C  1 295 ? 114.401 57.006  102.443 1.00 26.29  ? 272 ASP C CB  1 
ATOM   7653  C  CG  . ASP C  1 295 ? 114.520 58.482  102.107 1.00 32.65  ? 272 ASP C CG  1 
ATOM   7654  O  OD1 . ASP C  1 295 ? 115.220 58.816  101.120 1.00 28.99  ? 272 ASP C OD1 1 
ATOM   7655  O  OD2 . ASP C  1 295 ? 113.894 59.307  102.806 1.00 30.67  ? 272 ASP C OD2 1 
ATOM   7656  N  N   . LEU C  1 296 ? 116.300 54.514  103.468 1.00 25.51  ? 273 LEU C N   1 
ATOM   7657  C  CA  . LEU C  1 296 ? 116.501 53.065  103.469 1.00 21.30  ? 273 LEU C CA  1 
ATOM   7658  C  C   . LEU C  1 296 ? 117.858 52.761  104.104 1.00 27.90  ? 273 LEU C C   1 
ATOM   7659  O  O   . LEU C  1 296 ? 118.757 53.596  104.059 1.00 20.38  ? 273 LEU C O   1 
ATOM   7660  C  CB  . LEU C  1 296 ? 116.502 52.517  102.032 1.00 22.44  ? 273 LEU C CB  1 
ATOM   7661  C  CG  . LEU C  1 296 ? 115.409 52.977  101.056 1.00 28.06  ? 273 LEU C CG  1 
ATOM   7662  C  CD1 . LEU C  1 296 ? 115.601 52.381  99.647  1.00 24.08  ? 273 LEU C CD1 1 
ATOM   7663  C  CD2 . LEU C  1 296 ? 114.038 52.616  101.607 1.00 27.04  ? 273 LEU C CD2 1 
ATOM   7664  N  N   . VAL C  1 297 ? 118.019 51.572  104.684 1.00 23.57  ? 274 VAL C N   1 
ATOM   7665  C  CA  . VAL C  1 297 ? 119.309 51.193  105.241 1.00 24.88  ? 274 VAL C CA  1 
ATOM   7666  C  C   . VAL C  1 297 ? 119.712 49.797  104.769 1.00 26.22  ? 274 VAL C C   1 
ATOM   7667  O  O   . VAL C  1 297 ? 118.852 48.979  104.440 1.00 27.76  ? 274 VAL C O   1 
ATOM   7668  C  CB  . VAL C  1 297 ? 119.304 51.282  106.779 1.00 22.69  ? 274 VAL C CB  1 
ATOM   7669  C  CG1 . VAL C  1 297 ? 119.021 52.711  107.201 1.00 18.11  ? 274 VAL C CG1 1 
ATOM   7670  C  CG2 . VAL C  1 297 ? 118.264 50.355  107.354 1.00 23.74  ? 274 VAL C CG2 1 
ATOM   7671  N  N   . MET C  1 298 ? 121.015 49.530  104.713 1.00 23.35  ? 275 MET C N   1 
ATOM   7672  C  CA  . MET C  1 298 ? 121.504 48.206  104.303 1.00 18.30  ? 275 MET C CA  1 
ATOM   7673  C  C   . MET C  1 298 ? 122.789 47.822  105.031 1.00 23.48  ? 275 MET C C   1 
ATOM   7674  O  O   . MET C  1 298 ? 123.877 47.907  104.478 1.00 34.02  ? 275 MET C O   1 
ATOM   7675  C  CB  . MET C  1 298 ? 121.682 48.109  102.774 1.00 18.89  ? 275 MET C CB  1 
ATOM   7676  C  CG  . MET C  1 298 ? 122.429 49.296  102.128 1.00 33.00  ? 275 MET C CG  1 
ATOM   7677  S  SD  . MET C  1 298 ? 122.677 49.198  100.318 1.00 31.11  ? 275 MET C SD  1 
ATOM   7678  C  CE  . MET C  1 298 ? 123.938 47.948  100.224 1.00 34.11  ? 275 MET C CE  1 
ATOM   7679  N  N   . PRO C  1 299 ? 122.662 47.404  106.291 1.00 29.39  ? 276 PRO C N   1 
ATOM   7680  C  CA  . PRO C  1 299 ? 123.820 46.997  107.091 1.00 30.17  ? 276 PRO C CA  1 
ATOM   7681  C  C   . PRO C  1 299 ? 124.672 45.948  106.404 1.00 29.04  ? 276 PRO C C   1 
ATOM   7682  O  O   . PRO C  1 299 ? 124.148 45.057  105.716 1.00 25.62  ? 276 PRO C O   1 
ATOM   7683  C  CB  . PRO C  1 299 ? 123.175 46.403  108.336 1.00 33.45  ? 276 PRO C CB  1 
ATOM   7684  C  CG  . PRO C  1 299 ? 121.940 47.206  108.498 1.00 31.06  ? 276 PRO C CG  1 
ATOM   7685  C  CD  . PRO C  1 299 ? 121.431 47.438  107.095 1.00 22.14  ? 276 PRO C CD  1 
ATOM   7686  N  N   . ASP C  1 300 ? 125.983 46.069  106.594 1.00 26.92  ? 277 ASP C N   1 
ATOM   7687  C  CA  . ASP C  1 300 ? 126.949 45.097  106.095 1.00 34.04  ? 277 ASP C CA  1 
ATOM   7688  C  C   . ASP C  1 300 ? 127.371 44.248  107.268 1.00 34.61  ? 277 ASP C C   1 
ATOM   7689  O  O   . ASP C  1 300 ? 127.699 44.769  108.332 1.00 37.36  ? 277 ASP C O   1 
ATOM   7690  C  CB  . ASP C  1 300 ? 128.175 45.796  105.512 1.00 34.93  ? 277 ASP C CB  1 
ATOM   7691  C  CG  . ASP C  1 300 ? 129.280 44.821  105.135 1.00 40.50  ? 277 ASP C CG  1 
ATOM   7692  O  OD1 . ASP C  1 300 ? 129.937 44.262  106.041 1.00 44.29  ? 277 ASP C OD1 1 
ATOM   7693  O  OD2 . ASP C  1 300 ? 129.503 44.620  103.925 1.00 44.53  ? 277 ASP C OD2 1 
ATOM   7694  N  N   . PHE C  1 301 ? 127.378 42.939  107.075 1.00 37.44  ? 278 PHE C N   1 
ATOM   7695  C  CA  . PHE C  1 301 ? 127.508 42.025  108.207 1.00 40.61  ? 278 PHE C CA  1 
ATOM   7696  C  C   . PHE C  1 301 ? 128.836 42.058  108.961 1.00 36.98  ? 278 PHE C C   1 
ATOM   7697  O  O   . PHE C  1 301 ? 128.882 41.687  110.126 1.00 38.33  ? 278 PHE C O   1 
ATOM   7698  C  CB  . PHE C  1 301 ? 127.137 40.603  107.786 1.00 39.43  ? 278 PHE C CB  1 
ATOM   7699  C  CG  . PHE C  1 301 ? 125.693 40.451  107.475 1.00 32.41  ? 278 PHE C CG  1 
ATOM   7700  C  CD1 . PHE C  1 301 ? 124.784 40.189  108.482 1.00 33.20  ? 278 PHE C CD1 1 
ATOM   7701  C  CD2 . PHE C  1 301 ? 125.234 40.617  106.186 1.00 32.54  ? 278 PHE C CD2 1 
ATOM   7702  C  CE1 . PHE C  1 301 ? 123.451 40.070  108.203 1.00 34.13  ? 278 PHE C CE1 1 
ATOM   7703  C  CE2 . PHE C  1 301 ? 123.903 40.496  105.900 1.00 34.80  ? 278 PHE C CE2 1 
ATOM   7704  C  CZ  . PHE C  1 301 ? 123.008 40.222  106.910 1.00 34.69  ? 278 PHE C CZ  1 
ATOM   7705  N  N   . MET C  1 302 ? 129.910 42.498  108.314 1.00 35.86  ? 279 MET C N   1 
ATOM   7706  C  CA  . MET C  1 302 ? 131.186 42.585  109.013 1.00 30.06  ? 279 MET C CA  1 
ATOM   7707  C  C   . MET C  1 302 ? 131.335 43.901  109.762 1.00 35.99  ? 279 MET C C   1 
ATOM   7708  O  O   . MET C  1 302 ? 132.209 44.031  110.624 1.00 40.60  ? 279 MET C O   1 
ATOM   7709  C  CB  . MET C  1 302 ? 132.366 42.380  108.063 1.00 33.47  ? 279 MET C CB  1 
ATOM   7710  C  CG  . MET C  1 302 ? 132.751 43.591  107.239 1.00 33.73  ? 279 MET C CG  1 
ATOM   7711  S  SD  . MET C  1 302 ? 134.366 43.357  106.453 1.00 61.36  ? 279 MET C SD  1 
ATOM   7712  C  CE  . MET C  1 302 ? 134.524 44.853  105.479 1.00 37.81  ? 279 MET C CE  1 
ATOM   7713  N  N   . ARG C  1 303 ? 130.482 44.874  109.445 1.00 29.67  ? 280 ARG C N   1 
ATOM   7714  C  CA  . ARG C  1 303 ? 130.583 46.191  110.068 1.00 28.51  ? 280 ARG C CA  1 
ATOM   7715  C  C   . ARG C  1 303 ? 129.523 46.380  111.136 1.00 29.73  ? 280 ARG C C   1 
ATOM   7716  O  O   . ARG C  1 303 ? 129.776 47.004  112.159 1.00 34.04  ? 280 ARG C O   1 
ATOM   7717  C  CB  . ARG C  1 303 ? 130.490 47.303  109.022 1.00 28.95  ? 280 ARG C CB  1 
ATOM   7718  C  CG  . ARG C  1 303 ? 131.593 47.242  107.969 1.00 24.32  ? 280 ARG C CG  1 
ATOM   7719  C  CD  . ARG C  1 303 ? 131.661 48.504  107.153 1.00 19.71  ? 280 ARG C CD  1 
ATOM   7720  N  NE  . ARG C  1 303 ? 132.708 48.462  106.123 1.00 28.86  ? 280 ARG C NE  1 
ATOM   7721  C  CZ  . ARG C  1 303 ? 132.477 48.227  104.831 1.00 34.44  ? 280 ARG C CZ  1 
ATOM   7722  N  NH1 . ARG C  1 303 ? 131.245 47.997  104.403 1.00 32.46  ? 280 ARG C NH1 1 
ATOM   7723  N  NH2 . ARG C  1 303 ? 133.475 48.209  103.967 1.00 39.98  ? 280 ARG C NH2 1 
ATOM   7724  N  N   . ILE C  1 304 ? 128.342 45.823  110.892 1.00 25.68  ? 281 ILE C N   1 
ATOM   7725  C  CA  . ILE C  1 304 ? 127.210 45.993  111.781 1.00 27.31  ? 281 ILE C CA  1 
ATOM   7726  C  C   . ILE C  1 304 ? 127.347 45.098  113.016 1.00 33.99  ? 281 ILE C C   1 
ATOM   7727  O  O   . ILE C  1 304 ? 126.675 45.312  114.019 1.00 40.42  ? 281 ILE C O   1 
ATOM   7728  C  CB  . ILE C  1 304 ? 125.889 45.669  111.062 1.00 25.08  ? 281 ILE C CB  1 
ATOM   7729  C  CG1 . ILE C  1 304 ? 124.710 46.381  111.730 1.00 22.41  ? 281 ILE C CG1 1 
ATOM   7730  C  CG2 . ILE C  1 304 ? 125.635 44.176  111.077 1.00 20.16  ? 281 ILE C CG2 1 
ATOM   7731  C  CD1 . ILE C  1 304 ? 124.712 47.888  111.581 1.00 31.56  ? 281 ILE C CD1 1 
ATOM   7732  N  N   . GLY C  1 305 ? 128.216 44.093  112.941 1.00 30.32  ? 282 GLY C N   1 
ATOM   7733  C  CA  . GLY C  1 305 ? 128.472 43.246  114.089 1.00 22.25  ? 282 GLY C CA  1 
ATOM   7734  C  C   . GLY C  1 305 ? 127.882 41.862  113.927 1.00 31.42  ? 282 GLY C C   1 
ATOM   7735  O  O   . GLY C  1 305 ? 127.405 41.253  114.886 1.00 36.92  ? 282 GLY C O   1 
ATOM   7736  N  N   . GLY C  1 306 ? 127.915 41.358  112.701 1.00 29.10  ? 283 GLY C N   1 
ATOM   7737  C  CA  . GLY C  1 306 ? 127.479 40.004  112.444 1.00 31.14  ? 283 GLY C CA  1 
ATOM   7738  C  C   . GLY C  1 306 ? 126.008 39.840  112.730 1.00 32.82  ? 283 GLY C C   1 
ATOM   7739  O  O   . GLY C  1 306 ? 125.224 40.774  112.582 1.00 39.35  ? 283 GLY C O   1 
ATOM   7740  N  N   . VAL C  1 307 ? 125.634 38.645  113.148 1.00 36.39  ? 284 VAL C N   1 
ATOM   7741  C  CA  . VAL C  1 307 ? 124.235 38.336  113.356 1.00 33.77  ? 284 VAL C CA  1 
ATOM   7742  C  C   . VAL C  1 307 ? 123.711 39.063  114.585 1.00 34.02  ? 284 VAL C C   1 
ATOM   7743  O  O   . VAL C  1 307 ? 122.620 39.620  114.560 1.00 34.96  ? 284 VAL C O   1 
ATOM   7744  C  CB  . VAL C  1 307 ? 124.034 36.824  113.490 1.00 35.80  ? 284 VAL C CB  1 
ATOM   7745  C  CG1 . VAL C  1 307 ? 122.569 36.494  113.808 1.00 32.95  ? 284 VAL C CG1 1 
ATOM   7746  C  CG2 . VAL C  1 307 ? 124.505 36.140  112.214 1.00 30.77  ? 284 VAL C CG2 1 
ATOM   7747  N  N   . SER C  1 308 ? 124.493 39.065  115.658 1.00 31.94  ? 285 SER C N   1 
ATOM   7748  C  CA  . SER C  1 308 ? 124.093 39.776  116.861 1.00 33.87  ? 285 SER C CA  1 
ATOM   7749  C  C   . SER C  1 308 ? 123.746 41.221  116.514 1.00 31.25  ? 285 SER C C   1 
ATOM   7750  O  O   . SER C  1 308 ? 122.663 41.709  116.833 1.00 40.02  ? 285 SER C O   1 
ATOM   7751  C  CB  . SER C  1 308 ? 125.205 39.722  117.911 1.00 36.39  ? 285 SER C CB  1 
ATOM   7752  O  OG  . SER C  1 308 ? 125.437 38.388  118.325 1.00 34.23  ? 285 SER C OG  1 
ATOM   7753  N  N   . GLY C  1 309 ? 124.676 41.898  115.851 1.00 31.94  ? 286 GLY C N   1 
ATOM   7754  C  CA  . GLY C  1 309 ? 124.469 43.271  115.428 1.00 29.07  ? 286 GLY C CA  1 
ATOM   7755  C  C   . GLY C  1 309 ? 123.258 43.430  114.525 1.00 29.20  ? 286 GLY C C   1 
ATOM   7756  O  O   . GLY C  1 309 ? 122.461 44.343  114.723 1.00 31.59  ? 286 GLY C O   1 
ATOM   7757  N  N   . TRP C  1 310 ? 123.106 42.547  113.540 1.00 28.99  ? 287 TRP C N   1 
ATOM   7758  C  CA  . TRP C  1 310 ? 121.974 42.652  112.615 1.00 26.06  ? 287 TRP C CA  1 
ATOM   7759  C  C   . TRP C  1 310 ? 120.618 42.601  113.323 1.00 34.15  ? 287 TRP C C   1 
ATOM   7760  O  O   . TRP C  1 310 ? 119.769 43.468  113.110 1.00 37.45  ? 287 TRP C O   1 
ATOM   7761  C  CB  . TRP C  1 310 ? 122.026 41.582  111.525 1.00 19.21  ? 287 TRP C CB  1 
ATOM   7762  C  CG  . TRP C  1 310 ? 120.828 41.642  110.620 1.00 27.30  ? 287 TRP C CG  1 
ATOM   7763  C  CD1 . TRP C  1 310 ? 119.602 41.096  110.855 1.00 27.74  ? 287 TRP C CD1 1 
ATOM   7764  C  CD2 . TRP C  1 310 ? 120.738 42.295  109.349 1.00 25.67  ? 287 TRP C CD2 1 
ATOM   7765  N  NE1 . TRP C  1 310 ? 118.752 41.366  109.809 1.00 32.97  ? 287 TRP C NE1 1 
ATOM   7766  C  CE2 . TRP C  1 310 ? 119.425 42.100  108.872 1.00 33.45  ? 287 TRP C CE2 1 
ATOM   7767  C  CE3 . TRP C  1 310 ? 121.641 43.015  108.563 1.00 26.07  ? 287 TRP C CE3 1 
ATOM   7768  C  CZ2 . TRP C  1 310 ? 118.990 42.606  107.645 1.00 30.25  ? 287 TRP C CZ2 1 
ATOM   7769  C  CZ3 . TRP C  1 310 ? 121.212 43.517  107.351 1.00 22.91  ? 287 TRP C CZ3 1 
ATOM   7770  C  CH2 . TRP C  1 310 ? 119.895 43.311  106.901 1.00 26.41  ? 287 TRP C CH2 1 
ATOM   7771  N  N   . MET C  1 311 ? 120.407 41.582  114.150 1.00 31.47  ? 288 MET C N   1 
ATOM   7772  C  CA  . MET C  1 311 ? 119.144 41.437  114.866 1.00 27.34  ? 288 MET C CA  1 
ATOM   7773  C  C   . MET C  1 311 ? 118.814 42.656  115.746 1.00 29.30  ? 288 MET C C   1 
ATOM   7774  O  O   . MET C  1 311 ? 117.647 42.989  115.947 1.00 29.38  ? 288 MET C O   1 
ATOM   7775  C  CB  . MET C  1 311 ? 119.134 40.152  115.700 1.00 30.07  ? 288 MET C CB  1 
ATOM   7776  C  CG  . MET C  1 311 ? 119.227 38.859  114.886 1.00 30.41  ? 288 MET C CG  1 
ATOM   7777  S  SD  . MET C  1 311 ? 118.016 38.726  113.545 1.00 41.11  ? 288 MET C SD  1 
ATOM   7778  C  CE  . MET C  1 311 ? 116.477 38.605  114.467 1.00 45.15  ? 288 MET C CE  1 
ATOM   7779  N  N   . ARG C  1 312 ? 119.839 43.320  116.266 1.00 30.93  ? 289 ARG C N   1 
ATOM   7780  C  CA  . ARG C  1 312 ? 119.627 44.528  117.058 1.00 32.32  ? 289 ARG C CA  1 
ATOM   7781  C  C   . ARG C  1 312 ? 119.299 45.714  116.165 1.00 29.37  ? 289 ARG C C   1 
ATOM   7782  O  O   . ARG C  1 312 ? 118.419 46.520  116.473 1.00 29.16  ? 289 ARG C O   1 
ATOM   7783  C  CB  . ARG C  1 312 ? 120.855 44.825  117.906 1.00 32.70  ? 289 ARG C CB  1 
ATOM   7784  C  CG  . ARG C  1 312 ? 121.123 43.736  118.919 1.00 34.15  ? 289 ARG C CG  1 
ATOM   7785  C  CD  . ARG C  1 312 ? 122.391 43.974  119.693 1.00 31.99  ? 289 ARG C CD  1 
ATOM   7786  N  NE  . ARG C  1 312 ? 122.662 42.848  120.574 1.00 38.31  ? 289 ARG C NE  1 
ATOM   7787  C  CZ  . ARG C  1 312 ? 123.673 42.798  121.432 1.00 51.43  ? 289 ARG C CZ  1 
ATOM   7788  N  NH1 . ARG C  1 312 ? 124.518 43.818  121.531 1.00 53.58  ? 289 ARG C NH1 1 
ATOM   7789  N  NH2 . ARG C  1 312 ? 123.837 41.725  122.195 1.00 58.21  ? 289 ARG C NH2 1 
ATOM   7790  N  N   . ALA C  1 313 ? 120.026 45.812  115.060 1.00 26.10  ? 290 ALA C N   1 
ATOM   7791  C  CA  . ALA C  1 313 ? 119.772 46.816  114.046 1.00 21.65  ? 290 ALA C CA  1 
ATOM   7792  C  C   . ALA C  1 313 ? 118.350 46.679  113.513 1.00 23.41  ? 290 ALA C C   1 
ATOM   7793  O  O   . ALA C  1 313 ? 117.689 47.666  113.216 1.00 34.41  ? 290 ALA C O   1 
ATOM   7794  C  CB  . ALA C  1 313 ? 120.783 46.667  112.910 1.00 18.06  ? 290 ALA C CB  1 
ATOM   7795  N  N   . ALA C  1 314 ? 117.885 45.446  113.393 1.00 20.34  ? 291 ALA C N   1 
ATOM   7796  C  CA  . ALA C  1 314 ? 116.552 45.170  112.877 1.00 27.69  ? 291 ALA C CA  1 
ATOM   7797  C  C   . ALA C  1 314 ? 115.469 45.615  113.857 1.00 36.48  ? 291 ALA C C   1 
ATOM   7798  O  O   . ALA C  1 314 ? 114.346 45.919  113.446 1.00 33.97  ? 291 ALA C O   1 
ATOM   7799  C  CB  . ALA C  1 314 ? 116.404 43.682  112.570 1.00 25.24  ? 291 ALA C CB  1 
ATOM   7800  N  N   . GLY C  1 315 ? 115.800 45.623  115.149 1.00 27.37  ? 292 GLY C N   1 
ATOM   7801  C  CA  . GLY C  1 315 ? 114.884 46.110  116.166 1.00 21.67  ? 292 GLY C CA  1 
ATOM   7802  C  C   . GLY C  1 315 ? 114.721 47.609  116.001 1.00 28.15  ? 292 GLY C C   1 
ATOM   7803  O  O   . GLY C  1 315 ? 113.613 48.136  116.051 1.00 33.83  ? 292 GLY C O   1 
ATOM   7804  N  N   . VAL C  1 316 ? 115.840 48.289  115.766 1.00 25.58  ? 293 VAL C N   1 
ATOM   7805  C  CA  . VAL C  1 316 ? 115.843 49.730  115.524 1.00 30.64  ? 293 VAL C CA  1 
ATOM   7806  C  C   . VAL C  1 316 ? 115.072 50.107  114.268 1.00 26.11  ? 293 VAL C C   1 
ATOM   7807  O  O   . VAL C  1 316 ? 114.131 50.889  114.329 1.00 30.83  ? 293 VAL C O   1 
ATOM   7808  C  CB  . VAL C  1 316 ? 117.280 50.265  115.408 1.00 31.79  ? 293 VAL C CB  1 
ATOM   7809  C  CG1 . VAL C  1 316 ? 117.272 51.722  115.011 1.00 30.12  ? 293 VAL C CG1 1 
ATOM   7810  C  CG2 . VAL C  1 316 ? 118.027 50.060  116.728 1.00 26.08  ? 293 VAL C CG2 1 
ATOM   7811  N  N   . ALA C  1 317 ? 115.469 49.538  113.133 1.00 32.63  ? 294 ALA C N   1 
ATOM   7812  C  CA  . ALA C  1 317 ? 114.806 49.806  111.859 1.00 35.49  ? 294 ALA C CA  1 
ATOM   7813  C  C   . ALA C  1 317 ? 113.321 49.440  111.927 1.00 28.18  ? 294 ALA C C   1 
ATOM   7814  O  O   . ALA C  1 317 ? 112.478 50.114  111.342 1.00 29.52  ? 294 ALA C O   1 
ATOM   7815  C  CB  . ALA C  1 317 ? 115.499 49.058  110.726 1.00 28.29  ? 294 ALA C CB  1 
ATOM   7816  N  N   . GLY C  1 318 ? 113.010 48.382  112.665 1.00 27.43  ? 295 GLY C N   1 
ATOM   7817  C  CA  . GLY C  1 318 ? 111.635 47.952  112.851 1.00 27.68  ? 295 GLY C CA  1 
ATOM   7818  C  C   . GLY C  1 318 ? 110.799 48.977  113.596 1.00 31.62  ? 295 GLY C C   1 
ATOM   7819  O  O   . GLY C  1 318 ? 109.634 49.199  113.265 1.00 32.63  ? 295 GLY C O   1 
ATOM   7820  N  N   . ALA C  1 319 ? 111.386 49.605  114.611 1.00 28.44  ? 296 ALA C N   1 
ATOM   7821  C  CA  . ALA C  1 319 ? 110.676 50.639  115.359 1.00 26.26  ? 296 ALA C CA  1 
ATOM   7822  C  C   . ALA C  1 319 ? 110.485 51.917  114.525 1.00 28.02  ? 296 ALA C C   1 
ATOM   7823  O  O   . ALA C  1 319 ? 109.454 52.581  114.624 1.00 33.08  ? 296 ALA C O   1 
ATOM   7824  C  CB  . ALA C  1 319 ? 111.389 50.938  116.675 1.00 28.73  ? 296 ALA C CB  1 
ATOM   7825  N  N   . TRP C  1 320 ? 111.467 52.257  113.696 1.00 28.86  ? 297 TRP C N   1 
ATOM   7826  C  CA  . TRP C  1 320 ? 111.340 53.419  112.818 1.00 23.98  ? 297 TRP C CA  1 
ATOM   7827  C  C   . TRP C  1 320 ? 110.455 53.100  111.622 1.00 25.65  ? 297 TRP C C   1 
ATOM   7828  O  O   . TRP C  1 320 ? 109.870 53.994  111.011 1.00 24.31  ? 297 TRP C O   1 
ATOM   7829  C  CB  . TRP C  1 320 ? 112.703 53.888  112.297 1.00 20.60  ? 297 TRP C CB  1 
ATOM   7830  C  CG  . TRP C  1 320 ? 113.517 54.705  113.256 1.00 28.57  ? 297 TRP C CG  1 
ATOM   7831  C  CD1 . TRP C  1 320 ? 114.362 54.235  114.227 1.00 26.27  ? 297 TRP C CD1 1 
ATOM   7832  C  CD2 . TRP C  1 320 ? 113.583 56.135  113.326 1.00 27.75  ? 297 TRP C CD2 1 
ATOM   7833  N  NE1 . TRP C  1 320 ? 114.940 55.285  114.899 1.00 30.06  ? 297 TRP C NE1 1 
ATOM   7834  C  CE2 . TRP C  1 320 ? 114.485 56.463  114.363 1.00 27.94  ? 297 TRP C CE2 1 
ATOM   7835  C  CE3 . TRP C  1 320 ? 112.962 57.170  112.619 1.00 25.98  ? 297 TRP C CE3 1 
ATOM   7836  C  CZ2 . TRP C  1 320 ? 114.783 57.784  114.709 1.00 22.01  ? 297 TRP C CZ2 1 
ATOM   7837  C  CZ3 . TRP C  1 320 ? 113.264 58.480  112.953 1.00 22.63  ? 297 TRP C CZ3 1 
ATOM   7838  C  CH2 . TRP C  1 320 ? 114.167 58.775  113.993 1.00 24.03  ? 297 TRP C CH2 1 
ATOM   7839  N  N   . GLY C  1 321 ? 110.362 51.827  111.267 1.00 21.43  ? 298 GLY C N   1 
ATOM   7840  C  CA  . GLY C  1 321 ? 109.618 51.473  110.075 1.00 21.88  ? 298 GLY C CA  1 
ATOM   7841  C  C   . GLY C  1 321 ? 110.439 51.657  108.809 1.00 26.21  ? 298 GLY C C   1 
ATOM   7842  O  O   . GLY C  1 321 ? 109.885 51.690  107.713 1.00 23.53  ? 298 GLY C O   1 
ATOM   7843  N  N   . ILE C  1 322 ? 111.760 51.752  108.964 1.00 23.20  ? 299 ILE C N   1 
ATOM   7844  C  CA  . ILE C  1 322 ? 112.673 51.861  107.826 1.00 24.61  ? 299 ILE C CA  1 
ATOM   7845  C  C   . ILE C  1 322 ? 112.911 50.510  107.181 1.00 24.57  ? 299 ILE C C   1 
ATOM   7846  O  O   . ILE C  1 322 ? 113.326 49.570  107.854 1.00 25.35  ? 299 ILE C O   1 
ATOM   7847  C  CB  . ILE C  1 322 ? 114.036 52.463  108.241 1.00 32.23  ? 299 ILE C CB  1 
ATOM   7848  C  CG1 . ILE C  1 322 ? 113.822 53.755  109.021 1.00 38.02  ? 299 ILE C CG1 1 
ATOM   7849  C  CG2 . ILE C  1 322 ? 114.884 52.800  107.011 1.00 35.38  ? 299 ILE C CG2 1 
ATOM   7850  C  CD1 . ILE C  1 322 ? 113.259 54.883  108.184 1.00 39.49  ? 299 ILE C CD1 1 
ATOM   7851  N  N   . PRO C  1 323 ? 112.642 50.404  105.870 1.00 23.73  ? 300 PRO C N   1 
ATOM   7852  C  CA  . PRO C  1 323 ? 112.918 49.169  105.119 1.00 23.54  ? 300 PRO C CA  1 
ATOM   7853  C  C   . PRO C  1 323 ? 114.403 48.814  105.145 1.00 26.63  ? 300 PRO C C   1 
ATOM   7854  O  O   . PRO C  1 323 ? 115.244 49.640  104.803 1.00 30.30  ? 300 PRO C O   1 
ATOM   7855  C  CB  . PRO C  1 323 ? 112.477 49.508  103.685 1.00 18.85  ? 300 PRO C CB  1 
ATOM   7856  C  CG  . PRO C  1 323 ? 111.485 50.634  103.846 1.00 25.97  ? 300 PRO C CG  1 
ATOM   7857  C  CD  . PRO C  1 323 ? 111.981 51.428  105.043 1.00 22.71  ? 300 PRO C CD  1 
ATOM   7858  N  N   . MET C  1 324 ? 114.711 47.586  105.537 1.00 22.17  ? 301 MET C N   1 
ATOM   7859  C  CA  . MET C  1 324 ? 116.084 47.159  105.768 1.00 26.41  ? 301 MET C CA  1 
ATOM   7860  C  C   . MET C  1 324 ? 116.525 46.137  104.726 1.00 31.71  ? 301 MET C C   1 
ATOM   7861  O  O   . MET C  1 324 ? 115.900 45.092  104.570 1.00 32.99  ? 301 MET C O   1 
ATOM   7862  C  CB  . MET C  1 324 ? 116.164 46.539  107.156 1.00 28.78  ? 301 MET C CB  1 
ATOM   7863  C  CG  . MET C  1 324 ? 117.543 46.435  107.739 1.00 35.99  ? 301 MET C CG  1 
ATOM   7864  S  SD  . MET C  1 324 ? 117.403 45.806  109.418 1.00 38.66  ? 301 MET C SD  1 
ATOM   7865  C  CE  . MET C  1 324 ? 119.110 45.429  109.783 1.00 42.74  ? 301 MET C CE  1 
ATOM   7866  N  N   . SER C  1 325 ? 117.597 46.447  104.007 1.00 30.65  ? 302 SER C N   1 
ATOM   7867  C  CA  . SER C  1 325 ? 118.172 45.522  103.034 1.00 25.06  ? 302 SER C CA  1 
ATOM   7868  C  C   . SER C  1 325 ? 119.561 45.077  103.496 1.00 28.30  ? 302 SER C C   1 
ATOM   7869  O  O   . SER C  1 325 ? 120.054 45.548  104.512 1.00 29.85  ? 302 SER C O   1 
ATOM   7870  C  CB  . SER C  1 325 ? 118.265 46.187  101.662 1.00 27.25  ? 302 SER C CB  1 
ATOM   7871  O  OG  . SER C  1 325 ? 116.987 46.565  101.198 1.00 31.10  ? 302 SER C OG  1 
ATOM   7872  N  N   . THR C  1 326 ? 120.200 44.179  102.753 1.00 25.38  ? 303 THR C N   1 
ATOM   7873  C  CA  . THR C  1 326 ? 121.496 43.647  103.176 1.00 32.90  ? 303 THR C CA  1 
ATOM   7874  C  C   . THR C  1 326 ? 122.636 44.107  102.268 1.00 38.56  ? 303 THR C C   1 
ATOM   7875  O  O   . THR C  1 326 ? 122.412 44.674  101.199 1.00 37.54  ? 303 THR C O   1 
ATOM   7876  C  CB  . THR C  1 326 ? 121.491 42.109  103.195 1.00 33.64  ? 303 THR C CB  1 
ATOM   7877  O  OG1 . THR C  1 326 ? 121.431 41.625  101.848 1.00 32.38  ? 303 THR C OG1 1 
ATOM   7878  C  CG2 . THR C  1 326 ? 120.280 41.591  103.978 1.00 30.42  ? 303 THR C CG2 1 
ATOM   7879  N  N   . HIS C  1 327 ? 123.863 43.860  102.702 1.00 35.53  ? 304 HIS C N   1 
ATOM   7880  C  CA  . HIS C  1 327 ? 125.028 44.150  101.885 1.00 29.47  ? 304 HIS C CA  1 
ATOM   7881  C  C   . HIS C  1 327 ? 126.007 42.983  101.981 1.00 35.80  ? 304 HIS C C   1 
ATOM   7882  O  O   . HIS C  1 327 ? 126.415 42.608  103.080 1.00 33.18  ? 304 HIS C O   1 
ATOM   7883  C  CB  . HIS C  1 327 ? 125.693 45.442  102.340 1.00 28.86  ? 304 HIS C CB  1 
ATOM   7884  C  CG  . HIS C  1 327 ? 126.897 45.803  101.535 1.00 31.94  ? 304 HIS C CG  1 
ATOM   7885  N  ND1 . HIS C  1 327 ? 128.180 45.668  102.016 1.00 31.46  ? 304 HIS C ND1 1 
ATOM   7886  C  CD2 . HIS C  1 327 ? 127.016 46.271  100.269 1.00 35.68  ? 304 HIS C CD2 1 
ATOM   7887  C  CE1 . HIS C  1 327 ? 129.038 46.047  101.086 1.00 31.76  ? 304 HIS C CE1 1 
ATOM   7888  N  NE2 . HIS C  1 327 ? 128.357 46.418  100.016 1.00 36.98  ? 304 HIS C NE2 1 
ATOM   7889  N  N   . LEU C  1 328 ? 126.369 42.410  100.831 1.00 38.56  ? 305 LEU C N   1 
ATOM   7890  C  CA  . LEU C  1 328 ? 127.213 41.216  100.775 1.00 35.13  ? 305 LEU C CA  1 
ATOM   7891  C  C   . LEU C  1 328 ? 126.696 40.098  101.679 1.00 39.08  ? 305 LEU C C   1 
ATOM   7892  O  O   . LEU C  1 328 ? 125.599 40.185  102.241 1.00 35.12  ? 305 LEU C O   1 
ATOM   7893  C  CB  . LEU C  1 328 ? 128.658 41.551  101.139 1.00 36.27  ? 305 LEU C CB  1 
ATOM   7894  C  CG  . LEU C  1 328 ? 129.331 42.569  100.221 1.00 39.39  ? 305 LEU C CG  1 
ATOM   7895  C  CD1 . LEU C  1 328 ? 130.713 42.925  100.736 1.00 40.51  ? 305 LEU C CD1 1 
ATOM   7896  C  CD2 . LEU C  1 328 ? 129.398 42.037  98.798  1.00 37.85  ? 305 LEU C CD2 1 
ATOM   7897  N  N   . TYR C  1 329 ? 127.491 39.042  101.801 1.00 44.24  ? 306 TYR C N   1 
ATOM   7898  C  CA  . TYR C  1 329 ? 127.128 37.880  102.612 1.00 40.15  ? 306 TYR C CA  1 
ATOM   7899  C  C   . TYR C  1 329 ? 125.719 37.344  102.323 1.00 37.75  ? 306 TYR C C   1 
ATOM   7900  O  O   . TYR C  1 329 ? 124.889 37.272  103.224 1.00 40.25  ? 306 TYR C O   1 
ATOM   7901  C  CB  . TYR C  1 329 ? 127.277 38.211  104.100 1.00 36.15  ? 306 TYR C CB  1 
ATOM   7902  C  CG  . TYR C  1 329 ? 128.592 38.886  104.433 1.00 38.51  ? 306 TYR C CG  1 
ATOM   7903  C  CD1 . TYR C  1 329 ? 129.674 38.154  104.902 1.00 35.62  ? 306 TYR C CD1 1 
ATOM   7904  C  CD2 . TYR C  1 329 ? 128.753 40.257  104.261 1.00 38.31  ? 306 TYR C CD2 1 
ATOM   7905  C  CE1 . TYR C  1 329 ? 130.882 38.768  105.197 1.00 39.72  ? 306 TYR C CE1 1 
ATOM   7906  C  CE2 . TYR C  1 329 ? 129.952 40.882  104.555 1.00 38.74  ? 306 TYR C CE2 1 
ATOM   7907  C  CZ  . TYR C  1 329 ? 131.014 40.134  105.023 1.00 42.52  ? 306 TYR C CZ  1 
ATOM   7908  O  OH  . TYR C  1 329 ? 132.203 40.757  105.314 1.00 42.10  ? 306 TYR C OH  1 
ATOM   7909  N  N   . PRO C  1 330 ? 125.456 36.937  101.071 1.00 37.72  ? 307 PRO C N   1 
ATOM   7910  C  CA  . PRO C  1 330 ? 124.115 36.475  100.696 1.00 35.88  ? 307 PRO C CA  1 
ATOM   7911  C  C   . PRO C  1 330 ? 123.559 35.362  101.585 1.00 41.70  ? 307 PRO C C   1 
ATOM   7912  O  O   . PRO C  1 330 ? 122.336 35.250  101.713 1.00 48.96  ? 307 PRO C O   1 
ATOM   7913  C  CB  . PRO C  1 330 ? 124.312 35.961  99.267  1.00 35.78  ? 307 PRO C CB  1 
ATOM   7914  C  CG  . PRO C  1 330 ? 125.434 36.763  98.745  1.00 32.19  ? 307 PRO C CG  1 
ATOM   7915  C  CD  . PRO C  1 330 ? 126.368 36.956  99.914  1.00 35.79  ? 307 PRO C CD  1 
ATOM   7916  N  N   . GLU C  1 331 ? 124.416 34.554  102.198 1.00 42.56  ? 308 GLU C N   1 
ATOM   7917  C  CA  . GLU C  1 331 ? 123.898 33.426  102.970 1.00 42.43  ? 308 GLU C CA  1 
ATOM   7918  C  C   . GLU C  1 331 ? 123.411 33.846  104.349 1.00 42.55  ? 308 GLU C C   1 
ATOM   7919  O  O   . GLU C  1 331 ? 122.248 33.640  104.689 1.00 53.30  ? 308 GLU C O   1 
ATOM   7920  C  CB  . GLU C  1 331 ? 124.906 32.278  103.055 1.00 42.55  ? 308 GLU C CB  1 
ATOM   7921  C  CG  . GLU C  1 331 ? 125.184 31.621  101.716 1.00 44.80  ? 308 GLU C CG  1 
ATOM   7922  C  CD  . GLU C  1 331 ? 126.258 32.347  100.937 1.00 49.96  ? 308 GLU C CD  1 
ATOM   7923  O  OE1 . GLU C  1 331 ? 127.074 33.056  101.564 1.00 50.49  ? 308 GLU C OE1 1 
ATOM   7924  O  OE2 . GLU C  1 331 ? 126.288 32.207  99.699  1.00 58.04  ? 308 GLU C OE2 1 
ATOM   7925  N  N   . VAL C  1 332 ? 124.292 34.436  105.144 1.00 39.32  ? 309 VAL C N   1 
ATOM   7926  C  CA  . VAL C  1 332 ? 123.857 35.009  106.405 1.00 38.89  ? 309 VAL C CA  1 
ATOM   7927  C  C   . VAL C  1 332 ? 122.650 35.900  106.129 1.00 39.04  ? 309 VAL C C   1 
ATOM   7928  O  O   . VAL C  1 332 ? 121.643 35.860  106.845 1.00 41.29  ? 309 VAL C O   1 
ATOM   7929  C  CB  . VAL C  1 332 ? 124.967 35.833  107.066 1.00 40.97  ? 309 VAL C CB  1 
ATOM   7930  C  CG1 . VAL C  1 332 ? 124.612 36.113  108.513 1.00 43.97  ? 309 VAL C CG1 1 
ATOM   7931  C  CG2 . VAL C  1 332 ? 126.286 35.091  106.989 1.00 47.30  ? 309 VAL C CG2 1 
ATOM   7932  N  N   . GLY C  1 333 ? 122.751 36.683  105.061 1.00 39.60  ? 310 GLY C N   1 
ATOM   7933  C  CA  . GLY C  1 333 ? 121.723 37.645  104.708 1.00 40.27  ? 310 GLY C CA  1 
ATOM   7934  C  C   . GLY C  1 333 ? 120.339 37.052  104.544 1.00 39.33  ? 310 GLY C C   1 
ATOM   7935  O  O   . GLY C  1 333 ? 119.364 37.575  105.092 1.00 30.76  ? 310 GLY C O   1 
ATOM   7936  N  N   . ALA C  1 334 ? 120.257 35.966  103.779 1.00 40.24  ? 311 ALA C N   1 
ATOM   7937  C  CA  . ALA C  1 334 ? 118.991 35.291  103.523 1.00 35.23  ? 311 ALA C CA  1 
ATOM   7938  C  C   . ALA C  1 334 ? 118.393 34.728  104.803 1.00 32.13  ? 311 ALA C C   1 
ATOM   7939  O  O   . ALA C  1 334 ? 117.189 34.818  105.028 1.00 35.43  ? 311 ALA C O   1 
ATOM   7940  C  CB  . ALA C  1 334 ? 119.179 34.191  102.503 1.00 34.09  ? 311 ALA C CB  1 
ATOM   7941  N  N   . HIS C  1 335 ? 119.237 34.136  105.638 1.00 29.18  ? 312 HIS C N   1 
ATOM   7942  C  CA  . HIS C  1 335 ? 118.788 33.655  106.940 1.00 38.10  ? 312 HIS C CA  1 
ATOM   7943  C  C   . HIS C  1 335 ? 118.133 34.762  107.771 1.00 43.23  ? 312 HIS C C   1 
ATOM   7944  O  O   . HIS C  1 335 ? 116.971 34.638  108.162 1.00 47.28  ? 312 HIS C O   1 
ATOM   7945  C  CB  . HIS C  1 335 ? 119.931 32.998  107.723 1.00 38.41  ? 312 HIS C CB  1 
ATOM   7946  C  CG  . HIS C  1 335 ? 120.198 31.582  107.327 1.00 46.73  ? 312 HIS C CG  1 
ATOM   7947  N  ND1 . HIS C  1 335 ? 119.488 30.518  107.843 1.00 51.52  ? 312 HIS C ND1 1 
ATOM   7948  C  CD2 . HIS C  1 335 ? 121.092 31.054  106.457 1.00 40.89  ? 312 HIS C CD2 1 
ATOM   7949  C  CE1 . HIS C  1 335 ? 119.934 29.396  107.308 1.00 47.03  ? 312 HIS C CE1 1 
ATOM   7950  N  NE2 . HIS C  1 335 ? 120.912 29.694  106.470 1.00 42.50  ? 312 HIS C NE2 1 
ATOM   7951  N  N   . VAL C  1 336 ? 118.858 35.844  108.038 1.00 38.27  ? 313 VAL C N   1 
ATOM   7952  C  CA  . VAL C  1 336 ? 118.311 36.866  108.931 1.00 35.09  ? 313 VAL C CA  1 
ATOM   7953  C  C   . VAL C  1 336 ? 117.117 37.605  108.324 1.00 35.52  ? 313 VAL C C   1 
ATOM   7954  O  O   . VAL C  1 336 ? 116.195 37.985  109.044 1.00 44.36  ? 313 VAL C O   1 
ATOM   7955  C  CB  . VAL C  1 336 ? 119.393 37.846  109.460 1.00 34.40  ? 313 VAL C CB  1 
ATOM   7956  C  CG1 . VAL C  1 336 ? 120.467 37.087  110.224 1.00 31.32  ? 313 VAL C CG1 1 
ATOM   7957  C  CG2 . VAL C  1 336 ? 120.003 38.648  108.325 1.00 27.78  ? 313 VAL C CG2 1 
ATOM   7958  N  N   . MET C  1 337 ? 117.118 37.784  107.004 1.00 36.36  ? 314 MET C N   1 
ATOM   7959  C  CA  . MET C  1 337 ? 116.011 38.458  106.311 1.00 34.13  ? 314 MET C CA  1 
ATOM   7960  C  C   . MET C  1 337 ? 114.676 37.738  106.507 1.00 38.23  ? 314 MET C C   1 
ATOM   7961  O  O   . MET C  1 337 ? 113.612 38.368  106.529 1.00 35.17  ? 314 MET C O   1 
ATOM   7962  C  CB  . MET C  1 337 ? 116.306 38.588  104.816 1.00 31.18  ? 314 MET C CB  1 
ATOM   7963  C  CG  . MET C  1 337 ? 117.338 39.639  104.473 1.00 26.89  ? 314 MET C CG  1 
ATOM   7964  S  SD  . MET C  1 337 ? 116.709 41.317  104.645 1.00 33.76  ? 314 MET C SD  1 
ATOM   7965  C  CE  . MET C  1 337 ? 116.049 41.578  103.001 1.00 32.33  ? 314 MET C CE  1 
ATOM   7966  N  N   . ARG C  1 338 ? 114.739 36.415  106.639 1.00 36.21  ? 315 ARG C N   1 
ATOM   7967  C  CA  . ARG C  1 338 ? 113.550 35.609  106.893 1.00 33.60  ? 315 ARG C CA  1 
ATOM   7968  C  C   . ARG C  1 338 ? 112.896 36.027  108.197 1.00 40.99  ? 315 ARG C C   1 
ATOM   7969  O  O   . ARG C  1 338 ? 111.690 35.859  108.364 1.00 48.39  ? 315 ARG C O   1 
ATOM   7970  C  CB  . ARG C  1 338 ? 113.890 34.110  106.934 1.00 33.90  ? 315 ARG C CB  1 
ATOM   7971  C  CG  . ARG C  1 338 ? 114.368 33.509  105.605 1.00 36.97  ? 315 ARG C CG  1 
ATOM   7972  C  CD  . ARG C  1 338 ? 113.251 33.414  104.570 1.00 43.30  ? 315 ARG C CD  1 
ATOM   7973  N  NE  . ARG C  1 338 ? 112.160 32.555  105.013 1.00 46.68  ? 315 ARG C NE  1 
ATOM   7974  C  CZ  . ARG C  1 338 ? 110.953 32.537  104.460 1.00 51.30  ? 315 ARG C CZ  1 
ATOM   7975  N  NH1 . ARG C  1 338 ? 110.683 33.335  103.436 1.00 49.78  ? 315 ARG C NH1 1 
ATOM   7976  N  NH2 . ARG C  1 338 ? 110.013 31.726  104.934 1.00 48.10  ? 315 ARG C NH2 1 
ATOM   7977  N  N   . VAL C  1 339 ? 113.683 36.574  109.121 1.00 32.04  ? 316 VAL C N   1 
ATOM   7978  C  CA  . VAL C  1 339 ? 113.134 37.001  110.406 1.00 37.64  ? 316 VAL C CA  1 
ATOM   7979  C  C   . VAL C  1 339 ? 113.219 38.518  110.618 1.00 45.04  ? 316 VAL C C   1 
ATOM   7980  O  O   . VAL C  1 339 ? 113.069 39.002  111.737 1.00 43.99  ? 316 VAL C O   1 
ATOM   7981  C  CB  . VAL C  1 339 ? 113.793 36.254  111.593 1.00 36.07  ? 316 VAL C CB  1 
ATOM   7982  C  CG1 . VAL C  1 339 ? 113.638 34.762  111.415 1.00 44.84  ? 316 VAL C CG1 1 
ATOM   7983  C  CG2 . VAL C  1 339 ? 115.261 36.607  111.703 1.00 34.25  ? 316 VAL C CG2 1 
ATOM   7984  N  N   . THR C  1 340 ? 113.456 39.268  109.545 1.00 45.96  ? 317 THR C N   1 
ATOM   7985  C  CA  . THR C  1 340 ? 113.551 40.724  109.656 1.00 29.76  ? 317 THR C CA  1 
ATOM   7986  C  C   . THR C  1 340 ? 112.240 41.408  109.309 1.00 32.03  ? 317 THR C C   1 
ATOM   7987  O  O   . THR C  1 340 ? 111.750 41.334  108.183 1.00 40.03  ? 317 THR C O   1 
ATOM   7988  C  CB  . THR C  1 340 ? 114.686 41.290  108.815 1.00 23.08  ? 317 THR C CB  1 
ATOM   7989  O  OG1 . THR C  1 340 ? 115.917 40.743  109.285 1.00 30.23  ? 317 THR C OG1 1 
ATOM   7990  C  CG2 . THR C  1 340 ? 114.740 42.805  108.949 1.00 24.86  ? 317 THR C CG2 1 
ATOM   7991  N  N   . GLU C  1 341 ? 111.681 42.076  110.306 1.00 33.49  ? 318 GLU C N   1 
ATOM   7992  C  CA  . GLU C  1 341 ? 110.365 42.675  110.211 1.00 32.18  ? 318 GLU C CA  1 
ATOM   7993  C  C   . GLU C  1 341 ? 110.187 43.600  108.993 1.00 36.54  ? 318 GLU C C   1 
ATOM   7994  O  O   . GLU C  1 341 ? 109.144 43.577  108.349 1.00 34.04  ? 318 GLU C O   1 
ATOM   7995  C  CB  . GLU C  1 341 ? 110.051 43.403  111.520 1.00 34.92  ? 318 GLU C CB  1 
ATOM   7996  C  CG  . GLU C  1 341 ? 108.794 44.254  111.506 1.00 48.97  ? 318 GLU C CG  1 
ATOM   7997  C  CD  . GLU C  1 341 ? 108.676 45.132  112.750 1.00 61.60  ? 318 GLU C CD  1 
ATOM   7998  O  OE1 . GLU C  1 341 ? 109.459 44.922  113.714 1.00 59.33  ? 318 GLU C OE1 1 
ATOM   7999  O  OE2 . GLU C  1 341 ? 107.801 46.033  112.755 1.00 64.19  ? 318 GLU C OE2 1 
ATOM   8000  N  N   . THR C  1 342 ? 111.190 44.409  108.674 1.00 28.54  ? 319 THR C N   1 
ATOM   8001  C  CA  . THR C  1 342 ? 111.044 45.361  107.579 1.00 28.28  ? 319 THR C CA  1 
ATOM   8002  C  C   . THR C  1 342 ? 111.916 44.978  106.379 1.00 31.42  ? 319 THR C C   1 
ATOM   8003  O  O   . THR C  1 342 ? 112.245 45.820  105.525 1.00 27.23  ? 319 THR C O   1 
ATOM   8004  C  CB  . THR C  1 342 ? 111.350 46.805  108.033 1.00 31.07  ? 319 THR C CB  1 
ATOM   8005  O  OG1 . THR C  1 342 ? 112.655 46.859  108.621 1.00 33.11  ? 319 THR C OG1 1 
ATOM   8006  C  CG2 . THR C  1 342 ? 110.325 47.279  109.053 1.00 29.99  ? 319 THR C CG2 1 
ATOM   8007  N  N   . ALA C  1 343 ? 112.284 43.702  106.324 1.00 24.09  ? 320 ALA C N   1 
ATOM   8008  C  CA  . ALA C  1 343 ? 113.028 43.155  105.191 1.00 26.78  ? 320 ALA C CA  1 
ATOM   8009  C  C   . ALA C  1 343 ? 112.614 43.800  103.875 1.00 28.52  ? 320 ALA C C   1 
ATOM   8010  O  O   . ALA C  1 343 ? 111.430 43.902  103.558 1.00 31.69  ? 320 ALA C O   1 
ATOM   8011  C  CB  . ALA C  1 343 ? 112.849 41.631  105.116 1.00 20.57  ? 320 ALA C CB  1 
ATOM   8012  N  N   . HIS C  1 344 ? 113.599 44.250  103.112 1.00 29.45  ? 321 HIS C N   1 
ATOM   8013  C  CA  . HIS C  1 344 ? 113.320 44.930  101.864 1.00 30.33  ? 321 HIS C CA  1 
ATOM   8014  C  C   . HIS C  1 344 ? 113.903 44.136  100.702 1.00 31.79  ? 321 HIS C C   1 
ATOM   8015  O  O   . HIS C  1 344 ? 113.230 43.265  100.154 1.00 32.21  ? 321 HIS C O   1 
ATOM   8016  C  CB  . HIS C  1 344 ? 113.860 46.363  101.902 1.00 35.02  ? 321 HIS C CB  1 
ATOM   8017  C  CG  . HIS C  1 344 ? 113.320 47.243  100.820 1.00 29.87  ? 321 HIS C CG  1 
ATOM   8018  N  ND1 . HIS C  1 344 ? 113.852 48.482  100.535 1.00 32.15  ? 321 HIS C ND1 1 
ATOM   8019  C  CD2 . HIS C  1 344 ? 112.302 47.062  99.948  1.00 26.88  ? 321 HIS C CD2 1 
ATOM   8020  C  CE1 . HIS C  1 344 ? 113.182 49.026  99.536  1.00 25.22  ? 321 HIS C CE1 1 
ATOM   8021  N  NE2 . HIS C  1 344 ? 112.238 48.184  99.159  1.00 22.13  ? 321 HIS C NE2 1 
ATOM   8022  N  N   . TRP C  1 345 ? 115.142 44.436  100.321 1.00 27.06  ? 322 TRP C N   1 
ATOM   8023  C  CA  . TRP C  1 345 ? 115.826 43.656  99.290  1.00 30.98  ? 322 TRP C CA  1 
ATOM   8024  C  C   . TRP C  1 345 ? 117.053 42.925  99.848  1.00 33.87  ? 322 TRP C C   1 
ATOM   8025  O  O   . TRP C  1 345 ? 117.724 43.423  100.743 1.00 40.70  ? 322 TRP C O   1 
ATOM   8026  C  CB  . TRP C  1 345 ? 116.318 44.561  98.171  1.00 32.13  ? 322 TRP C CB  1 
ATOM   8027  C  CG  . TRP C  1 345 ? 115.280 45.171  97.308  1.00 32.77  ? 322 TRP C CG  1 
ATOM   8028  C  CD1 . TRP C  1 345 ? 114.593 46.325  97.545  1.00 37.24  ? 322 TRP C CD1 1 
ATOM   8029  C  CD2 . TRP C  1 345 ? 114.842 44.697  96.029  1.00 26.25  ? 322 TRP C CD2 1 
ATOM   8030  N  NE1 . TRP C  1 345 ? 113.741 46.590  96.499  1.00 39.10  ? 322 TRP C NE1 1 
ATOM   8031  C  CE2 . TRP C  1 345 ? 113.879 45.607  95.555  1.00 32.78  ? 322 TRP C CE2 1 
ATOM   8032  C  CE3 . TRP C  1 345 ? 115.169 43.591  95.244  1.00 30.71  ? 322 TRP C CE3 1 
ATOM   8033  C  CZ2 . TRP C  1 345 ? 113.234 45.440  94.331  1.00 35.97  ? 322 TRP C CZ2 1 
ATOM   8034  C  CZ3 . TRP C  1 345 ? 114.526 43.428  94.024  1.00 36.23  ? 322 TRP C CZ3 1 
ATOM   8035  C  CH2 . TRP C  1 345 ? 113.573 44.346  93.581  1.00 36.04  ? 322 TRP C CH2 1 
ATOM   8036  N  N   . LEU C  1 346 ? 117.352 41.753  99.301  1.00 31.64  ? 323 LEU C N   1 
ATOM   8037  C  CA  . LEU C  1 346 ? 118.648 41.114  99.521  1.00 36.52  ? 323 LEU C CA  1 
ATOM   8038  C  C   . LEU C  1 346 ? 119.647 41.455  98.388  1.00 36.66  ? 323 LEU C C   1 
ATOM   8039  O  O   . LEU C  1 346 ? 119.300 41.426  97.210  1.00 37.34  ? 323 LEU C O   1 
ATOM   8040  C  CB  . LEU C  1 346 ? 118.475 39.599  99.656  1.00 35.60  ? 323 LEU C CB  1 
ATOM   8041  C  CG  . LEU C  1 346 ? 119.763 38.815  99.936  1.00 45.99  ? 323 LEU C CG  1 
ATOM   8042  C  CD1 . LEU C  1 346 ? 119.527 37.665  100.899 1.00 55.67  ? 323 LEU C CD1 1 
ATOM   8043  C  CD2 . LEU C  1 346 ? 120.375 38.314  98.648  1.00 49.49  ? 323 LEU C CD2 1 
ATOM   8044  N  N   . GLU C  1 347 ? 120.885 41.782  98.741  1.00 35.55  ? 324 GLU C N   1 
ATOM   8045  C  CA  . GLU C  1 347 ? 121.912 42.041  97.732  1.00 37.91  ? 324 GLU C CA  1 
ATOM   8046  C  C   . GLU C  1 347 ? 122.614 40.737  97.343  1.00 40.15  ? 324 GLU C C   1 
ATOM   8047  O  O   . GLU C  1 347 ? 123.312 40.132  98.157  1.00 37.25  ? 324 GLU C O   1 
ATOM   8048  C  CB  . GLU C  1 347 ? 122.944 43.060  98.245  1.00 39.70  ? 324 GLU C CB  1 
ATOM   8049  C  CG  . GLU C  1 347 ? 123.791 43.700  97.139  1.00 52.00  ? 324 GLU C CG  1 
ATOM   8050  C  CD  . GLU C  1 347 ? 125.147 44.225  97.612  1.00 54.36  ? 324 GLU C CD  1 
ATOM   8051  O  OE1 . GLU C  1 347 ? 125.614 45.247  97.066  1.00 58.09  ? 324 GLU C OE1 1 
ATOM   8052  O  OE2 . GLU C  1 347 ? 125.764 43.606  98.503  1.00 57.63  ? 324 GLU C OE2 1 
ATOM   8053  N  N   . TRP C  1 348 ? 122.433 40.293  96.103  1.00 43.34  ? 325 TRP C N   1 
ATOM   8054  C  CA  . TRP C  1 348 ? 123.063 39.042  95.677  1.00 39.36  ? 325 TRP C CA  1 
ATOM   8055  C  C   . TRP C  1 348 ? 124.268 39.284  94.783  1.00 42.55  ? 325 TRP C C   1 
ATOM   8056  O  O   . TRP C  1 348 ? 124.251 40.159  93.919  1.00 49.41  ? 325 TRP C O   1 
ATOM   8057  C  CB  . TRP C  1 348 ? 122.066 38.119  94.972  1.00 39.60  ? 325 TRP C CB  1 
ATOM   8058  C  CG  . TRP C  1 348 ? 122.675 36.799  94.550  1.00 49.62  ? 325 TRP C CG  1 
ATOM   8059  C  CD1 . TRP C  1 348 ? 122.802 35.667  95.312  1.00 52.84  ? 325 TRP C CD1 1 
ATOM   8060  C  CD2 . TRP C  1 348 ? 123.237 36.482  93.269  1.00 48.84  ? 325 TRP C CD2 1 
ATOM   8061  N  NE1 . TRP C  1 348 ? 123.409 34.667  94.583  1.00 53.43  ? 325 TRP C NE1 1 
ATOM   8062  C  CE2 . TRP C  1 348 ? 123.685 35.141  93.327  1.00 50.68  ? 325 TRP C CE2 1 
ATOM   8063  C  CE3 . TRP C  1 348 ? 123.406 37.199  92.080  1.00 44.48  ? 325 TRP C CE3 1 
ATOM   8064  C  CZ2 . TRP C  1 348 ? 124.294 34.509  92.244  1.00 45.05  ? 325 TRP C CZ2 1 
ATOM   8065  C  CZ3 . TRP C  1 348 ? 124.008 36.569  91.004  1.00 41.02  ? 325 TRP C CZ3 1 
ATOM   8066  C  CH2 . TRP C  1 348 ? 124.446 35.236  91.094  1.00 41.82  ? 325 TRP C CH2 1 
ATOM   8067  N  N   . GLN C  1 349 ? 125.319 38.507  95.014  1.00 41.15  ? 326 GLN C N   1 
ATOM   8068  C  CA  . GLN C  1 349 ? 126.487 38.481  94.146  1.00 41.75  ? 326 GLN C CA  1 
ATOM   8069  C  C   . GLN C  1 349 ? 127.116 37.104  94.335  1.00 46.25  ? 326 GLN C C   1 
ATOM   8070  O  O   . GLN C  1 349 ? 126.780 36.401  95.288  1.00 45.98  ? 326 GLN C O   1 
ATOM   8071  C  CB  . GLN C  1 349 ? 127.469 39.608  94.492  1.00 42.75  ? 326 GLN C CB  1 
ATOM   8072  C  CG  . GLN C  1 349 ? 128.558 39.225  95.494  1.00 57.20  ? 326 GLN C CG  1 
ATOM   8073  C  CD  . GLN C  1 349 ? 128.066 39.196  96.932  1.00 68.29  ? 326 GLN C CD  1 
ATOM   8074  O  OE1 . GLN C  1 349 ? 127.126 39.908  97.297  1.00 71.02  ? 326 GLN C OE1 1 
ATOM   8075  N  NE2 . GLN C  1 349 ? 128.708 38.370  97.760  1.00 73.02  ? 326 GLN C NE2 1 
ATOM   8076  N  N   . SER C  1 350 ? 128.007 36.703  93.433  1.00 42.25  ? 327 SER C N   1 
ATOM   8077  C  CA  . SER C  1 350 ? 128.563 35.352  93.485  1.00 39.06  ? 327 SER C CA  1 
ATOM   8078  C  C   . SER C  1 350 ? 130.086 35.339  93.591  1.00 47.37  ? 327 SER C C   1 
ATOM   8079  O  O   . SER C  1 350 ? 130.738 34.349  93.264  1.00 54.74  ? 327 SER C O   1 
ATOM   8080  C  CB  . SER C  1 350 ? 128.084 34.517  92.285  1.00 41.60  ? 327 SER C CB  1 
ATOM   8081  O  OG  . SER C  1 350 ? 128.493 35.078  91.049  1.00 43.07  ? 327 SER C OG  1 
ATOM   8082  N  N   . TRP C  1 351 ? 130.643 36.440  94.073  1.00 53.56  ? 328 TRP C N   1 
ATOM   8083  C  CA  . TRP C  1 351 ? 132.084 36.570  94.248  1.00 58.36  ? 328 TRP C CA  1 
ATOM   8084  C  C   . TRP C  1 351 ? 132.656 35.556  95.243  1.00 59.34  ? 328 TRP C C   1 
ATOM   8085  O  O   . TRP C  1 351 ? 133.827 35.187  95.155  1.00 55.74  ? 328 TRP C O   1 
ATOM   8086  C  CB  . TRP C  1 351 ? 132.420 37.986  94.710  1.00 54.44  ? 328 TRP C CB  1 
ATOM   8087  C  CG  . TRP C  1 351 ? 131.838 39.042  93.831  1.00 57.16  ? 328 TRP C CG  1 
ATOM   8088  C  CD1 . TRP C  1 351 ? 131.316 38.874  92.580  1.00 54.49  ? 328 TRP C CD1 1 
ATOM   8089  C  CD2 . TRP C  1 351 ? 131.709 40.434  94.135  1.00 54.92  ? 328 TRP C CD2 1 
ATOM   8090  N  NE1 . TRP C  1 351 ? 130.879 40.078  92.084  1.00 50.88  ? 328 TRP C NE1 1 
ATOM   8091  C  CE2 . TRP C  1 351 ? 131.109 41.053  93.018  1.00 47.61  ? 328 TRP C CE2 1 
ATOM   8092  C  CE3 . TRP C  1 351 ? 132.046 41.219  95.242  1.00 55.99  ? 328 TRP C CE3 1 
ATOM   8093  C  CZ2 . TRP C  1 351 ? 130.835 42.416  92.976  1.00 49.06  ? 328 TRP C CZ2 1 
ATOM   8094  C  CZ3 . TRP C  1 351 ? 131.776 42.574  95.196  1.00 60.15  ? 328 TRP C CZ3 1 
ATOM   8095  C  CH2 . TRP C  1 351 ? 131.175 43.160  94.070  1.00 53.74  ? 328 TRP C CH2 1 
ATOM   8096  N  N   . ALA C  1 352 ? 131.835 35.116  96.194  1.00 57.20  ? 329 ALA C N   1 
ATOM   8097  C  CA  . ALA C  1 352 ? 132.282 34.137  97.184  1.00 57.06  ? 329 ALA C CA  1 
ATOM   8098  C  C   . ALA C  1 352 ? 131.910 32.699  96.814  1.00 56.12  ? 329 ALA C C   1 
ATOM   8099  O  O   . ALA C  1 352 ? 132.264 31.765  97.529  1.00 56.17  ? 329 ALA C O   1 
ATOM   8100  C  CB  . ALA C  1 352 ? 131.743 34.487  98.571  1.00 51.01  ? 329 ALA C CB  1 
ATOM   8101  N  N   . ASP C  1 353 ? 131.206 32.526  95.697  1.00 57.28  ? 330 ASP C N   1 
ATOM   8102  C  CA  . ASP C  1 353 ? 130.721 31.205  95.283  1.00 59.86  ? 330 ASP C CA  1 
ATOM   8103  C  C   . ASP C  1 353 ? 131.816 30.137  95.168  1.00 59.50  ? 330 ASP C C   1 
ATOM   8104  O  O   . ASP C  1 353 ? 131.680 29.050  95.734  1.00 52.17  ? 330 ASP C O   1 
ATOM   8105  C  CB  . ASP C  1 353 ? 129.923 31.289  93.975  1.00 61.53  ? 330 ASP C CB  1 
ATOM   8106  C  CG  . ASP C  1 353 ? 128.439 31.526  94.212  1.00 69.61  ? 330 ASP C CG  1 
ATOM   8107  O  OD1 . ASP C  1 353 ? 128.081 31.972  95.325  1.00 73.02  ? 330 ASP C OD1 1 
ATOM   8108  O  OD2 . ASP C  1 353 ? 127.631 31.264  93.289  1.00 70.48  ? 330 ASP C OD2 1 
ATOM   8109  N  N   . PRO C  1 354 ? 132.903 30.442  94.439  1.00 57.40  ? 331 PRO C N   1 
ATOM   8110  C  CA  . PRO C  1 354 ? 133.967 29.456  94.235  1.00 58.52  ? 331 PRO C CA  1 
ATOM   8111  C  C   . PRO C  1 354 ? 134.373 28.679  95.507  1.00 63.24  ? 331 PRO C C   1 
ATOM   8112  O  O   . PRO C  1 354 ? 134.621 27.474  95.400  1.00 60.41  ? 331 PRO C O   1 
ATOM   8113  C  CB  . PRO C  1 354 ? 135.128 30.311  93.720  1.00 55.21  ? 331 PRO C CB  1 
ATOM   8114  C  CG  . PRO C  1 354 ? 134.459 31.425  92.994  1.00 50.14  ? 331 PRO C CG  1 
ATOM   8115  C  CD  . PRO C  1 354 ? 133.214 31.728  93.785  1.00 54.44  ? 331 PRO C CD  1 
ATOM   8116  N  N   . ILE C  1 355 ? 134.429 29.326  96.674  1.00 57.13  ? 332 ILE C N   1 
ATOM   8117  C  CA  . ILE C  1 355 ? 134.858 28.623  97.892  1.00 52.47  ? 332 ILE C CA  1 
ATOM   8118  C  C   . ILE C  1 355 ? 133.754 27.844  98.611  1.00 51.24  ? 332 ILE C C   1 
ATOM   8119  O  O   . ILE C  1 355 ? 133.984 27.278  99.680  1.00 55.65  ? 332 ILE C O   1 
ATOM   8120  C  CB  . ILE C  1 355 ? 135.587 29.541  98.900  1.00 53.90  ? 332 ILE C CB  1 
ATOM   8121  C  CG1 . ILE C  1 355 ? 134.730 30.753  99.259  1.00 60.75  ? 332 ILE C CG1 1 
ATOM   8122  C  CG2 . ILE C  1 355 ? 136.923 29.975  98.346  1.00 58.28  ? 332 ILE C CG2 1 
ATOM   8123  C  CD1 . ILE C  1 355 ? 133.668 30.474  100.304 1.00 62.58  ? 332 ILE C CD1 1 
ATOM   8124  N  N   . LEU C  1 356 ? 132.566 27.801  98.024  1.00 48.91  ? 333 LEU C N   1 
ATOM   8125  C  CA  . LEU C  1 356 ? 131.476 27.010  98.591  1.00 57.69  ? 333 LEU C CA  1 
ATOM   8126  C  C   . LEU C  1 356 ? 131.147 25.812  97.711  1.00 62.18  ? 333 LEU C C   1 
ATOM   8127  O  O   . LEU C  1 356 ? 131.076 25.924  96.482  1.00 65.17  ? 333 LEU C O   1 
ATOM   8128  C  CB  . LEU C  1 356 ? 130.216 27.861  98.772  1.00 59.87  ? 333 LEU C CB  1 
ATOM   8129  C  CG  . LEU C  1 356 ? 130.291 29.118  99.636  1.00 55.51  ? 333 LEU C CG  1 
ATOM   8130  C  CD1 . LEU C  1 356 ? 128.930 29.794  99.647  1.00 57.75  ? 333 LEU C CD1 1 
ATOM   8131  C  CD2 . LEU C  1 356 ? 130.740 28.776  101.046 1.00 50.69  ? 333 LEU C CD2 1 
ATOM   8132  N  N   . GLN C  1 357 ? 130.938 24.664  98.345  1.00 66.29  ? 334 GLN C N   1 
ATOM   8133  C  CA  . GLN C  1 357 ? 130.561 23.464  97.613  1.00 66.32  ? 334 GLN C CA  1 
ATOM   8134  C  C   . GLN C  1 357 ? 129.198 23.681  96.973  1.00 64.17  ? 334 GLN C C   1 
ATOM   8135  O  O   . GLN C  1 357 ? 128.987 23.354  95.804  1.00 64.61  ? 334 GLN C O   1 
ATOM   8136  C  CB  . GLN C  1 357 ? 130.542 22.241  98.540  1.00 62.99  ? 334 GLN C CB  1 
ATOM   8137  C  CG  . GLN C  1 357 ? 131.922 21.825  99.071  1.00 63.12  ? 334 GLN C CG  1 
ATOM   8138  C  CD  . GLN C  1 357 ? 131.852 20.662  100.062 1.00 62.85  ? 334 GLN C CD  1 
ATOM   8139  O  OE1 . GLN C  1 357 ? 130.850 19.944  100.125 1.00 67.53  ? 334 GLN C OE1 1 
ATOM   8140  N  NE2 . GLN C  1 357 ? 132.913 20.483  100.849 1.00 52.20  ? 334 GLN C NE2 1 
ATOM   8141  N  N   . GLU C  1 358 ? 128.287 24.269  97.743  1.00 64.79  ? 335 GLU C N   1 
ATOM   8142  C  CA  . GLU C  1 358 ? 126.914 24.458  97.296  1.00 68.33  ? 335 GLU C CA  1 
ATOM   8143  C  C   . GLU C  1 358 ? 126.354 25.835  97.677  1.00 68.19  ? 335 GLU C C   1 
ATOM   8144  O  O   . GLU C  1 358 ? 125.780 26.006  98.756  1.00 64.17  ? 335 GLU C O   1 
ATOM   8145  C  CB  . GLU C  1 358 ? 126.029 23.348  97.863  1.00 72.00  ? 335 GLU C CB  1 
ATOM   8146  C  CG  . GLU C  1 358 ? 124.749 23.086  97.088  1.00 79.87  ? 335 GLU C CG  1 
ATOM   8147  C  CD  . GLU C  1 358 ? 124.057 21.805  97.539  1.00 87.27  ? 335 GLU C CD  1 
ATOM   8148  O  OE1 . GLU C  1 358 ? 124.738 20.937  98.126  1.00 90.46  ? 335 GLU C OE1 1 
ATOM   8149  O  OE2 . GLU C  1 358 ? 122.834 21.666  97.314  1.00 86.17  ? 335 GLU C OE2 1 
ATOM   8150  N  N   . PRO C  1 359 ? 126.536 26.825  96.788  1.00 63.78  ? 336 PRO C N   1 
ATOM   8151  C  CA  . PRO C  1 359 ? 125.860 28.120  96.901  1.00 56.81  ? 336 PRO C CA  1 
ATOM   8152  C  C   . PRO C  1 359 ? 124.356 27.910  96.927  1.00 52.68  ? 336 PRO C C   1 
ATOM   8153  O  O   . PRO C  1 359 ? 123.886 26.879  96.447  1.00 55.27  ? 336 PRO C O   1 
ATOM   8154  C  CB  . PRO C  1 359 ? 126.255 28.834  95.606  1.00 63.04  ? 336 PRO C CB  1 
ATOM   8155  C  CG  . PRO C  1 359 ? 127.565 28.232  95.232  1.00 65.78  ? 336 PRO C CG  1 
ATOM   8156  C  CD  . PRO C  1 359 ? 127.477 26.788  95.656  1.00 65.94  ? 336 PRO C CD  1 
ATOM   8157  N  N   . TYR C  1 360 ? 123.619 28.867  97.482  1.00 47.88  ? 337 TYR C N   1 
ATOM   8158  C  CA  . TYR C  1 360 ? 122.172 28.753  97.603  1.00 44.85  ? 337 TYR C CA  1 
ATOM   8159  C  C   . TYR C  1 360 ? 121.517 28.833  96.238  1.00 45.70  ? 337 TYR C C   1 
ATOM   8160  O  O   . TYR C  1 360 ? 122.040 29.466  95.327  1.00 45.37  ? 337 TYR C O   1 
ATOM   8161  C  CB  . TYR C  1 360 ? 121.601 29.859  98.497  1.00 43.47  ? 337 TYR C CB  1 
ATOM   8162  C  CG  . TYR C  1 360 ? 121.952 29.755  99.962  1.00 39.40  ? 337 TYR C CG  1 
ATOM   8163  C  CD1 . TYR C  1 360 ? 122.846 28.802  100.428 1.00 38.54  ? 337 TYR C CD1 1 
ATOM   8164  C  CD2 . TYR C  1 360 ? 121.369 30.608  100.887 1.00 42.32  ? 337 TYR C CD2 1 
ATOM   8165  C  CE1 . TYR C  1 360 ? 123.153 28.714  101.774 1.00 38.16  ? 337 TYR C CE1 1 
ATOM   8166  C  CE2 . TYR C  1 360 ? 121.663 30.526  102.225 1.00 36.81  ? 337 TYR C CE2 1 
ATOM   8167  C  CZ  . TYR C  1 360 ? 122.554 29.586  102.664 1.00 38.80  ? 337 TYR C CZ  1 
ATOM   8168  O  OH  . TYR C  1 360 ? 122.836 29.532  104.004 1.00 39.21  ? 337 TYR C OH  1 
ATOM   8169  N  N   . ALA C  1 361 ? 120.359 28.201  96.108  1.00 51.03  ? 338 ALA C N   1 
ATOM   8170  C  CA  . ALA C  1 361 ? 119.632 28.180  94.846  1.00 53.23  ? 338 ALA C CA  1 
ATOM   8171  C  C   . ALA C  1 361 ? 118.893 29.489  94.569  1.00 49.41  ? 338 ALA C C   1 
ATOM   8172  O  O   . ALA C  1 361 ? 118.444 30.173  95.488  1.00 42.26  ? 338 ALA C O   1 
ATOM   8173  C  CB  . ALA C  1 361 ? 118.652 27.012  94.832  1.00 52.18  ? 338 ALA C CB  1 
ATOM   8174  N  N   . LEU C  1 362 ? 118.760 29.822  93.290  1.00 50.22  ? 339 LEU C N   1 
ATOM   8175  C  CA  . LEU C  1 362 ? 117.992 30.985  92.876  1.00 47.92  ? 339 LEU C CA  1 
ATOM   8176  C  C   . LEU C  1 362 ? 116.743 30.526  92.130  1.00 55.66  ? 339 LEU C C   1 
ATOM   8177  O  O   . LEU C  1 362 ? 116.790 29.549  91.383  1.00 60.19  ? 339 LEU C O   1 
ATOM   8178  C  CB  . LEU C  1 362 ? 118.840 31.881  91.973  1.00 43.91  ? 339 LEU C CB  1 
ATOM   8179  C  CG  . LEU C  1 362 ? 119.868 32.796  92.646  1.00 43.87  ? 339 LEU C CG  1 
ATOM   8180  C  CD1 . LEU C  1 362 ? 121.003 33.170  91.693  1.00 42.49  ? 339 LEU C CD1 1 
ATOM   8181  C  CD2 . LEU C  1 362 ? 119.184 34.047  93.182  1.00 41.67  ? 339 LEU C CD2 1 
ATOM   8182  N  N   . SER C  1 363 ? 115.628 31.223  92.333  1.00 45.27  ? 340 SER C N   1 
ATOM   8183  C  CA  . SER C  1 363 ? 114.404 30.911  91.607  1.00 52.01  ? 340 SER C CA  1 
ATOM   8184  C  C   . SER C  1 363 ? 113.520 32.138  91.378  1.00 56.84  ? 340 SER C C   1 
ATOM   8185  O  O   . SER C  1 363 ? 112.891 32.645  92.309  1.00 57.45  ? 340 SER C O   1 
ATOM   8186  C  CB  . SER C  1 363 ? 113.612 29.828  92.341  1.00 62.02  ? 340 SER C CB  1 
ATOM   8187  O  OG  . SER C  1 363 ? 112.325 29.665  91.765  1.00 65.98  ? 340 SER C OG  1 
ATOM   8188  N  N   . ASP C  1 364 ? 113.459 32.605  90.135  1.00 57.96  ? 341 ASP C N   1 
ATOM   8189  C  CA  . ASP C  1 364 ? 112.644 33.770  89.803  1.00 61.92  ? 341 ASP C CA  1 
ATOM   8190  C  C   . ASP C  1 364 ? 113.090 35.022  90.577  1.00 56.68  ? 341 ASP C C   1 
ATOM   8191  O  O   . ASP C  1 364 ? 112.274 35.886  90.894  1.00 56.57  ? 341 ASP C O   1 
ATOM   8192  C  CB  . ASP C  1 364 ? 111.158 33.493  90.075  1.00 66.25  ? 341 ASP C CB  1 
ATOM   8193  C  CG  . ASP C  1 364 ? 110.521 32.561  89.045  1.00 64.21  ? 341 ASP C CG  1 
ATOM   8194  O  OD1 . ASP C  1 364 ? 111.097 32.360  87.953  1.00 59.72  ? 341 ASP C OD1 1 
ATOM   8195  O  OD2 . ASP C  1 364 ? 109.418 32.045  89.327  1.00 61.56  ? 341 ASP C OD2 1 
ATOM   8196  N  N   . GLY C  1 365 ? 114.382 35.106  90.885  1.00 52.64  ? 342 GLY C N   1 
ATOM   8197  C  CA  . GLY C  1 365 ? 114.939 36.274  91.545  1.00 54.09  ? 342 GLY C CA  1 
ATOM   8198  C  C   . GLY C  1 365 ? 115.116 36.134  93.048  1.00 54.68  ? 342 GLY C C   1 
ATOM   8199  O  O   . GLY C  1 365 ? 115.903 36.858  93.651  1.00 57.34  ? 342 GLY C O   1 
ATOM   8200  N  N   . ASP C  1 366 ? 114.380 35.205  93.651  1.00 46.96  ? 343 ASP C N   1 
ATOM   8201  C  CA  . ASP C  1 366 ? 114.440 34.983  95.089  1.00 40.83  ? 343 ASP C CA  1 
ATOM   8202  C  C   . ASP C  1 366 ? 115.567 34.022  95.425  1.00 44.33  ? 343 ASP C C   1 
ATOM   8203  O  O   . ASP C  1 366 ? 115.799 33.050  94.705  1.00 52.61  ? 343 ASP C O   1 
ATOM   8204  C  CB  . ASP C  1 366 ? 113.114 34.411  95.600  1.00 54.65  ? 343 ASP C CB  1 
ATOM   8205  C  CG  . ASP C  1 366 ? 111.905 35.209  95.127  1.00 70.93  ? 343 ASP C CG  1 
ATOM   8206  O  OD1 . ASP C  1 366 ? 112.067 36.407  94.793  1.00 79.76  ? 343 ASP C OD1 1 
ATOM   8207  O  OD2 . ASP C  1 366 ? 110.789 34.637  95.094  1.00 67.68  ? 343 ASP C OD2 1 
ATOM   8208  N  N   . LEU C  1 367 ? 116.281 34.295  96.513  1.00 41.82  ? 344 LEU C N   1 
ATOM   8209  C  CA  . LEU C  1 367 ? 117.335 33.397  96.970  1.00 38.14  ? 344 LEU C CA  1 
ATOM   8210  C  C   . LEU C  1 367 ? 116.709 32.399  97.935  1.00 42.61  ? 344 LEU C C   1 
ATOM   8211  O  O   . LEU C  1 367 ? 115.888 32.771  98.780  1.00 40.44  ? 344 LEU C O   1 
ATOM   8212  C  CB  . LEU C  1 367 ? 118.464 34.165  97.653  1.00 29.66  ? 344 LEU C CB  1 
ATOM   8213  C  CG  . LEU C  1 367 ? 119.716 33.330  97.925  1.00 36.98  ? 344 LEU C CG  1 
ATOM   8214  C  CD1 . LEU C  1 367 ? 120.284 32.837  96.615  1.00 37.64  ? 344 LEU C CD1 1 
ATOM   8215  C  CD2 . LEU C  1 367 ? 120.771 34.105  98.711  1.00 32.80  ? 344 LEU C CD2 1 
ATOM   8216  N  N   . ILE C  1 368 ? 117.072 31.129  97.796  1.00 39.06  ? 345 ILE C N   1 
ATOM   8217  C  CA  . ILE C  1 368 ? 116.415 30.081  98.565  1.00 40.62  ? 345 ILE C CA  1 
ATOM   8218  C  C   . ILE C  1 368 ? 117.270 29.625  99.737  1.00 43.73  ? 345 ILE C C   1 
ATOM   8219  O  O   . ILE C  1 368 ? 118.309 28.992  99.553  1.00 57.98  ? 345 ILE C O   1 
ATOM   8220  C  CB  . ILE C  1 368 ? 116.049 28.864  97.676  1.00 48.73  ? 345 ILE C CB  1 
ATOM   8221  C  CG1 . ILE C  1 368 ? 115.179 29.313  96.506  1.00 50.29  ? 345 ILE C CG1 1 
ATOM   8222  C  CG2 . ILE C  1 368 ? 115.316 27.804  98.481  1.00 45.48  ? 345 ILE C CG2 1 
ATOM   8223  C  CD1 . ILE C  1 368 ? 113.953 30.090  96.932  1.00 50.31  ? 345 ILE C CD1 1 
ATOM   8224  N  N   . VAL C  1 369 ? 116.837 29.962  100.943 1.00 40.51  ? 346 VAL C N   1 
ATOM   8225  C  CA  . VAL C  1 369 ? 117.466 29.417  102.129 1.00 44.33  ? 346 VAL C CA  1 
ATOM   8226  C  C   . VAL C  1 369 ? 117.163 27.923  102.150 1.00 48.57  ? 346 VAL C C   1 
ATOM   8227  O  O   . VAL C  1 369 ? 115.995 27.528  102.152 1.00 47.32  ? 346 VAL C O   1 
ATOM   8228  C  CB  . VAL C  1 369 ? 116.917 30.072  103.396 1.00 39.65  ? 346 VAL C CB  1 
ATOM   8229  C  CG1 . VAL C  1 369 ? 117.659 29.562  104.621 1.00 38.58  ? 346 VAL C CG1 1 
ATOM   8230  C  CG2 . VAL C  1 369 ? 117.048 31.571  103.287 1.00 41.42  ? 346 VAL C CG2 1 
ATOM   8231  N  N   . PRO C  1 370 ? 118.217 27.088  102.134 1.00 51.15  ? 347 PRO C N   1 
ATOM   8232  C  CA  . PRO C  1 370 ? 118.071 25.629  102.133 1.00 55.55  ? 347 PRO C CA  1 
ATOM   8233  C  C   . PRO C  1 370 ? 117.691 25.098  103.509 1.00 58.65  ? 347 PRO C C   1 
ATOM   8234  O  O   . PRO C  1 370 ? 117.774 25.823  104.504 1.00 53.28  ? 347 PRO C O   1 
ATOM   8235  C  CB  . PRO C  1 370 ? 119.476 25.142  101.757 1.00 48.32  ? 347 PRO C CB  1 
ATOM   8236  C  CG  . PRO C  1 370 ? 120.374 26.188  102.296 1.00 49.67  ? 347 PRO C CG  1 
ATOM   8237  C  CD  . PRO C  1 370 ? 119.632 27.491  102.075 1.00 51.60  ? 347 PRO C CD  1 
ATOM   8238  N  N   . ASP C  1 371 ? 117.282 23.834  103.557 1.00 63.59  ? 348 ASP C N   1 
ATOM   8239  C  CA  . ASP C  1 371 ? 116.903 23.205  104.813 1.00 65.13  ? 348 ASP C CA  1 
ATOM   8240  C  C   . ASP C  1 371 ? 118.097 22.497  105.462 1.00 65.87  ? 348 ASP C C   1 
ATOM   8241  O  O   . ASP C  1 371 ? 117.983 21.360  105.924 1.00 71.40  ? 348 ASP C O   1 
ATOM   8242  C  CB  . ASP C  1 371 ? 115.751 22.230  104.585 1.00 66.99  ? 348 ASP C CB  1 
ATOM   8243  C  CG  . ASP C  1 371 ? 114.777 22.204  105.745 1.00 76.64  ? 348 ASP C CG  1 
ATOM   8244  O  OD1 . ASP C  1 371 ? 115.211 22.440  106.894 1.00 79.51  ? 348 ASP C OD1 1 
ATOM   8245  O  OD2 . ASP C  1 371 ? 113.577 21.951  105.508 1.00 80.44  ? 348 ASP C OD2 1 
ATOM   8246  N  N   . LYS C  1 372 ? 119.241 23.179  105.483 1.00 57.32  ? 349 LYS C N   1 
ATOM   8247  C  CA  . LYS C  1 372 ? 120.457 22.659  106.099 1.00 54.24  ? 349 LYS C CA  1 
ATOM   8248  C  C   . LYS C  1 372 ? 120.694 23.336  107.449 1.00 56.99  ? 349 LYS C C   1 
ATOM   8249  O  O   . LYS C  1 372 ? 120.198 24.436  107.685 1.00 55.66  ? 349 LYS C O   1 
ATOM   8250  C  CB  . LYS C  1 372 ? 121.650 22.883  105.169 1.00 54.24  ? 349 LYS C CB  1 
ATOM   8251  C  CG  . LYS C  1 372 ? 121.462 22.243  103.799 1.00 60.96  ? 349 LYS C CG  1 
ATOM   8252  C  CD  . LYS C  1 372 ? 122.775 22.079  103.042 1.00 61.28  ? 349 LYS C CD  1 
ATOM   8253  C  CE  . LYS C  1 372 ? 123.072 23.275  102.162 1.00 62.97  ? 349 LYS C CE  1 
ATOM   8254  N  NZ  . LYS C  1 372 ? 124.363 23.102  101.443 1.00 68.27  ? 349 LYS C NZ  1 
ATOM   8255  N  N   . PRO C  1 373 ? 121.438 22.673  108.351 1.00 60.97  ? 350 PRO C N   1 
ATOM   8256  C  CA  . PRO C  1 373 ? 121.677 23.264  109.672 1.00 60.82  ? 350 PRO C CA  1 
ATOM   8257  C  C   . PRO C  1 373 ? 122.671 24.419  109.576 1.00 62.69  ? 350 PRO C C   1 
ATOM   8258  O  O   . PRO C  1 373 ? 123.453 24.456  108.629 1.00 62.52  ? 350 PRO C O   1 
ATOM   8259  C  CB  . PRO C  1 373 ? 122.280 22.104  110.479 1.00 63.52  ? 350 PRO C CB  1 
ATOM   8260  C  CG  . PRO C  1 373 ? 122.025 20.864  109.667 1.00 67.17  ? 350 PRO C CG  1 
ATOM   8261  C  CD  . PRO C  1 373 ? 122.006 21.321  108.242 1.00 67.74  ? 350 PRO C CD  1 
ATOM   8262  N  N   . GLY C  1 374 ? 122.638 25.341  110.538 1.00 60.12  ? 351 GLY C N   1 
ATOM   8263  C  CA  . GLY C  1 374 ? 123.507 26.508  110.510 1.00 56.64  ? 351 GLY C CA  1 
ATOM   8264  C  C   . GLY C  1 374 ? 123.285 27.346  109.261 1.00 48.58  ? 351 GLY C C   1 
ATOM   8265  O  O   . GLY C  1 374 ? 122.143 27.603  108.873 1.00 39.15  ? 351 GLY C O   1 
ATOM   8266  N  N   . LEU C  1 375 ? 124.377 27.768  108.633 1.00 44.32  ? 352 LEU C N   1 
ATOM   8267  C  CA  . LEU C  1 375 ? 124.316 28.490  107.366 1.00 47.23  ? 352 LEU C CA  1 
ATOM   8268  C  C   . LEU C  1 375 ? 124.364 27.517  106.192 1.00 51.43  ? 352 LEU C C   1 
ATOM   8269  O  O   . LEU C  1 375 ? 124.046 27.870  105.059 1.00 42.72  ? 352 LEU C O   1 
ATOM   8270  C  CB  . LEU C  1 375 ? 125.480 29.478  107.261 1.00 43.14  ? 352 LEU C CB  1 
ATOM   8271  C  CG  . LEU C  1 375 ? 125.529 30.552  108.349 1.00 45.43  ? 352 LEU C CG  1 
ATOM   8272  C  CD1 . LEU C  1 375 ? 126.886 31.260  108.376 1.00 47.37  ? 352 LEU C CD1 1 
ATOM   8273  C  CD2 . LEU C  1 375 ? 124.395 31.540  108.142 1.00 32.94  ? 352 LEU C CD2 1 
ATOM   8274  N  N   . GLY C  1 376 ? 124.781 26.288  106.470 1.00 57.26  ? 353 GLY C N   1 
ATOM   8275  C  CA  . GLY C  1 376 ? 124.900 25.280  105.438 1.00 53.55  ? 353 GLY C CA  1 
ATOM   8276  C  C   . GLY C  1 376 ? 126.111 25.495  104.553 1.00 54.06  ? 353 GLY C C   1 
ATOM   8277  O  O   . GLY C  1 376 ? 126.106 25.110  103.385 1.00 52.93  ? 353 GLY C O   1 
ATOM   8278  N  N   . LEU C  1 377 ? 127.155 26.110  105.100 1.00 55.39  ? 354 LEU C N   1 
ATOM   8279  C  CA  . LEU C  1 377 ? 128.382 26.300  104.334 1.00 57.07  ? 354 LEU C CA  1 
ATOM   8280  C  C   . LEU C  1 377 ? 129.342 25.114  104.482 1.00 63.92  ? 354 LEU C C   1 
ATOM   8281  O  O   . LEU C  1 377 ? 129.560 24.611  105.587 1.00 67.19  ? 354 LEU C O   1 
ATOM   8282  C  CB  . LEU C  1 377 ? 129.097 27.591  104.747 1.00 49.13  ? 354 LEU C CB  1 
ATOM   8283  C  CG  . LEU C  1 377 ? 128.338 28.921  104.787 1.00 41.48  ? 354 LEU C CG  1 
ATOM   8284  C  CD1 . LEU C  1 377 ? 129.334 30.066  104.893 1.00 46.22  ? 354 LEU C CD1 1 
ATOM   8285  C  CD2 . LEU C  1 377 ? 127.468 29.110  103.567 1.00 35.02  ? 354 LEU C CD2 1 
ATOM   8286  N  N   . ASP C  1 378 ? 129.903 24.673  103.356 1.00 65.39  ? 355 ASP C N   1 
ATOM   8287  C  CA  . ASP C  1 378 ? 131.011 23.716  103.336 1.00 58.64  ? 355 ASP C CA  1 
ATOM   8288  C  C   . ASP C  1 378 ? 132.057 24.236  102.357 1.00 53.08  ? 355 ASP C C   1 
ATOM   8289  O  O   . ASP C  1 378 ? 131.715 24.643  101.248 1.00 55.08  ? 355 ASP C O   1 
ATOM   8290  C  CB  . ASP C  1 378 ? 130.537 22.332  102.892 1.00 56.55  ? 355 ASP C CB  1 
ATOM   8291  C  CG  . ASP C  1 378 ? 129.331 21.842  103.679 1.00 61.15  ? 355 ASP C CG  1 
ATOM   8292  O  OD1 . ASP C  1 378 ? 128.189 22.019  103.200 1.00 70.79  ? 355 ASP C OD1 1 
ATOM   8293  O  OD2 . ASP C  1 378 ? 129.521 21.279  104.775 1.00 52.89  ? 355 ASP C OD2 1 
ATOM   8294  N  N   . TRP C  1 379 ? 133.323 24.240  102.762 1.00 49.66  ? 356 TRP C N   1 
ATOM   8295  C  CA  . TRP C  1 379 ? 134.376 24.769  101.899 1.00 51.20  ? 356 TRP C CA  1 
ATOM   8296  C  C   . TRP C  1 379 ? 134.748 23.785  100.792 1.00 67.51  ? 356 TRP C C   1 
ATOM   8297  O  O   . TRP C  1 379 ? 134.777 22.570  101.006 1.00 72.94  ? 356 TRP C O   1 
ATOM   8298  C  CB  . TRP C  1 379 ? 135.639 25.130  102.698 1.00 39.96  ? 356 TRP C CB  1 
ATOM   8299  C  CG  . TRP C  1 379 ? 135.402 25.947  103.941 1.00 47.93  ? 356 TRP C CG  1 
ATOM   8300  C  CD1 . TRP C  1 379 ? 135.869 25.678  105.196 1.00 49.99  ? 356 TRP C CD1 1 
ATOM   8301  C  CD2 . TRP C  1 379 ? 134.651 27.167  104.048 1.00 58.27  ? 356 TRP C CD2 1 
ATOM   8302  N  NE1 . TRP C  1 379 ? 135.454 26.645  106.076 1.00 54.69  ? 356 TRP C NE1 1 
ATOM   8303  C  CE2 . TRP C  1 379 ? 134.706 27.572  105.398 1.00 58.83  ? 356 TRP C CE2 1 
ATOM   8304  C  CE3 . TRP C  1 379 ? 133.937 27.952  103.138 1.00 55.13  ? 356 TRP C CE3 1 
ATOM   8305  C  CZ2 . TRP C  1 379 ? 134.073 28.727  105.857 1.00 54.89  ? 356 TRP C CZ2 1 
ATOM   8306  C  CZ3 . TRP C  1 379 ? 133.310 29.095  103.598 1.00 54.64  ? 356 TRP C CZ3 1 
ATOM   8307  C  CH2 . TRP C  1 379 ? 133.379 29.469  104.944 1.00 49.73  ? 356 TRP C CH2 1 
ATOM   8308  N  N   . ASP C  1 380 ? 135.022 24.323  99.608  1.00 70.29  ? 357 ASP C N   1 
ATOM   8309  C  CA  . ASP C  1 380 ? 135.650 23.570  98.530  1.00 67.29  ? 357 ASP C CA  1 
ATOM   8310  C  C   . ASP C  1 380 ? 137.158 23.728  98.703  1.00 66.26  ? 357 ASP C C   1 
ATOM   8311  O  O   . ASP C  1 380 ? 137.758 24.682  98.194  1.00 60.44  ? 357 ASP C O   1 
ATOM   8312  C  CB  . ASP C  1 380 ? 135.206 24.125  97.179  1.00 64.93  ? 357 ASP C CB  1 
ATOM   8313  C  CG  . ASP C  1 380 ? 135.797 23.368  96.007  1.00 69.07  ? 357 ASP C CG  1 
ATOM   8314  O  OD1 . ASP C  1 380 ? 137.040 23.253  95.918  1.00 69.59  ? 357 ASP C OD1 1 
ATOM   8315  O  OD2 . ASP C  1 380 ? 135.005 22.893  95.166  1.00 68.96  ? 357 ASP C OD2 1 
ATOM   8316  N  N   . GLU C  1 381 ? 137.757 22.796  99.439  1.00 65.01  ? 358 GLU C N   1 
ATOM   8317  C  CA  . GLU C  1 381 ? 139.150 22.915  99.871  1.00 62.75  ? 358 GLU C CA  1 
ATOM   8318  C  C   . GLU C  1 381 ? 140.160 22.871  98.723  1.00 60.78  ? 358 GLU C C   1 
ATOM   8319  O  O   . GLU C  1 381 ? 141.327 23.223  98.905  1.00 61.60  ? 358 GLU C O   1 
ATOM   8320  C  CB  . GLU C  1 381 ? 139.474 21.853  100.922 1.00 63.99  ? 358 GLU C CB  1 
ATOM   8321  C  CG  . GLU C  1 381 ? 138.729 22.049  102.242 1.00 71.37  ? 358 GLU C CG  1 
ATOM   8322  C  CD  . GLU C  1 381 ? 139.299 23.194  103.073 1.00 74.14  ? 358 GLU C CD  1 
ATOM   8323  O  OE1 . GLU C  1 381 ? 140.375 23.713  102.709 1.00 75.48  ? 358 GLU C OE1 1 
ATOM   8324  O  OE2 . GLU C  1 381 ? 138.678 23.570  104.090 1.00 69.54  ? 358 GLU C OE2 1 
ATOM   8325  N  N   . ASP C  1 382 ? 139.708 22.445  97.547  1.00 56.82  ? 359 ASP C N   1 
ATOM   8326  C  CA  . ASP C  1 382 ? 140.546 22.482  96.357  1.00 65.70  ? 359 ASP C CA  1 
ATOM   8327  C  C   . ASP C  1 382 ? 140.788 23.923  95.931  1.00 67.87  ? 359 ASP C C   1 
ATOM   8328  O  O   . ASP C  1 382 ? 141.932 24.348  95.749  1.00 68.60  ? 359 ASP C O   1 
ATOM   8329  C  CB  . ASP C  1 382 ? 139.893 21.705  95.213  1.00 74.11  ? 359 ASP C CB  1 
ATOM   8330  C  CG  . ASP C  1 382 ? 140.076 20.201  95.344  1.00 79.13  ? 359 ASP C CG  1 
ATOM   8331  O  OD1 . ASP C  1 382 ? 141.147 19.760  95.820  1.00 75.01  ? 359 ASP C OD1 1 
ATOM   8332  O  OD2 . ASP C  1 382 ? 139.142 19.462  94.963  1.00 81.22  ? 359 ASP C OD2 1 
ATOM   8333  N  N   . VAL C  1 383 ? 139.697 24.667  95.770  1.00 66.68  ? 360 VAL C N   1 
ATOM   8334  C  CA  . VAL C  1 383 ? 139.761 26.073  95.393  1.00 57.04  ? 360 VAL C CA  1 
ATOM   8335  C  C   . VAL C  1 383 ? 140.470 26.890  96.468  1.00 51.48  ? 360 VAL C C   1 
ATOM   8336  O  O   . VAL C  1 383 ? 141.283 27.762  96.161  1.00 56.52  ? 360 VAL C O   1 
ATOM   8337  C  CB  . VAL C  1 383 ? 138.359 26.649  95.157  1.00 59.90  ? 360 VAL C CB  1 
ATOM   8338  C  CG1 . VAL C  1 383 ? 138.448 28.125  94.800  1.00 65.70  ? 360 VAL C CG1 1 
ATOM   8339  C  CG2 . VAL C  1 383 ? 137.635 25.864  94.061  1.00 57.95  ? 360 VAL C CG2 1 
ATOM   8340  N  N   . VAL C  1 384 ? 140.161 26.602  97.728  1.00 49.11  ? 361 VAL C N   1 
ATOM   8341  C  CA  . VAL C  1 384 ? 140.884 27.206  98.842  1.00 58.51  ? 361 VAL C CA  1 
ATOM   8342  C  C   . VAL C  1 384 ? 142.396 27.035  98.665  1.00 64.40  ? 361 VAL C C   1 
ATOM   8343  O  O   . VAL C  1 384 ? 143.138 28.017  98.624  1.00 61.03  ? 361 VAL C O   1 
ATOM   8344  C  CB  . VAL C  1 384 ? 140.460 26.599  100.199 1.00 57.07  ? 361 VAL C CB  1 
ATOM   8345  C  CG1 . VAL C  1 384 ? 141.232 27.252  101.339 1.00 57.82  ? 361 VAL C CG1 1 
ATOM   8346  C  CG2 . VAL C  1 384 ? 138.978 26.763  100.404 1.00 54.98  ? 361 VAL C CG2 1 
ATOM   8347  N  N   . ALA C  1 385 ? 142.846 25.786  98.556  1.00 65.92  ? 362 ALA C N   1 
ATOM   8348  C  CA  . ALA C  1 385 ? 144.266 25.497  98.362  1.00 62.03  ? 362 ALA C CA  1 
ATOM   8349  C  C   . ALA C  1 385 ? 144.832 26.198  97.125  1.00 55.58  ? 362 ALA C C   1 
ATOM   8350  O  O   . ALA C  1 385 ? 145.946 26.719  97.160  1.00 56.93  ? 362 ALA C O   1 
ATOM   8351  C  CB  . ALA C  1 385 ? 144.495 24.001  98.281  1.00 60.98  ? 362 ALA C CB  1 
ATOM   8352  N  N   . ALA C  1 386 ? 144.061 26.214  96.040  1.00 52.96  ? 363 ALA C N   1 
ATOM   8353  C  CA  . ALA C  1 386 ? 144.459 26.918  94.816  1.00 54.39  ? 363 ALA C CA  1 
ATOM   8354  C  C   . ALA C  1 386 ? 144.609 28.429  95.006  1.00 62.71  ? 363 ALA C C   1 
ATOM   8355  O  O   . ALA C  1 386 ? 145.431 29.062  94.338  1.00 62.58  ? 363 ALA C O   1 
ATOM   8356  C  CB  . ALA C  1 386 ? 143.477 26.636  93.687  1.00 41.82  ? 363 ALA C CB  1 
ATOM   8357  N  N   . ASN C  1 387 ? 143.819 29.012  95.906  1.00 64.48  ? 364 ASN C N   1 
ATOM   8358  C  CA  . ASN C  1 387 ? 143.853 30.464  96.096  1.00 65.55  ? 364 ASN C CA  1 
ATOM   8359  C  C   . ASN C  1 387 ? 144.302 30.958  97.485  1.00 64.03  ? 364 ASN C C   1 
ATOM   8360  O  O   . ASN C  1 387 ? 144.103 32.129  97.815  1.00 67.74  ? 364 ASN C O   1 
ATOM   8361  C  CB  . ASN C  1 387 ? 142.497 31.090  95.732  1.00 64.24  ? 364 ASN C CB  1 
ATOM   8362  C  CG  . ASN C  1 387 ? 142.119 30.886  94.267  1.00 62.56  ? 364 ASN C CG  1 
ATOM   8363  O  OD1 . ASN C  1 387 ? 142.530 31.658  93.386  1.00 57.65  ? 364 ASN C OD1 1 
ATOM   8364  N  ND2 . ASN C  1 387 ? 141.310 29.856  94.004  1.00 54.70  ? 364 ASN C ND2 1 
ATOM   8365  N  N   . LEU C  1 388 ? 144.901 30.081  98.291  1.00 52.45  ? 365 LEU C N   1 
ATOM   8366  C  CA  . LEU C  1 388 ? 145.368 30.461  99.629  1.00 52.74  ? 365 LEU C CA  1 
ATOM   8367  C  C   . LEU C  1 388 ? 146.454 31.538  99.519  1.00 64.66  ? 365 LEU C C   1 
ATOM   8368  O  O   . LEU C  1 388 ? 146.851 31.908  98.413  1.00 68.34  ? 365 LEU C O   1 
ATOM   8369  C  CB  . LEU C  1 388 ? 145.889 29.234  100.386 1.00 54.19  ? 365 LEU C CB  1 
ATOM   8370  C  CG  . LEU C  1 388 ? 146.094 29.293  101.909 1.00 56.22  ? 365 LEU C CG  1 
ATOM   8371  C  CD1 . LEU C  1 388 ? 144.786 29.576  102.636 1.00 58.45  ? 365 LEU C CD1 1 
ATOM   8372  C  CD2 . LEU C  1 388 ? 146.718 27.990  102.437 1.00 47.31  ? 365 LEU C CD2 1 
ATOM   8373  N  N   . VAL C  1 389 ? 146.927 32.054  100.652 1.00 67.99  ? 366 VAL C N   1 
ATOM   8374  C  CA  . VAL C  1 389 ? 147.935 33.117  100.613 1.00 68.82  ? 366 VAL C CA  1 
ATOM   8375  C  C   . VAL C  1 389 ? 149.304 32.703  101.177 1.00 68.38  ? 366 VAL C C   1 
ATOM   8376  O  O   . VAL C  1 389 ? 149.588 32.855  102.362 1.00 69.75  ? 366 VAL C O   1 
ATOM   8377  C  CB  . VAL C  1 389 ? 147.415 34.434  101.250 1.00 63.56  ? 366 VAL C CB  1 
ATOM   8378  C  CG1 . VAL C  1 389 ? 148.567 35.373  101.571 1.00 66.70  ? 366 VAL C CG1 1 
ATOM   8379  C  CG2 . VAL C  1 389 ? 146.420 35.122  100.311 1.00 50.81  ? 366 VAL C CG2 1 
ATOM   8380  N  N   . THR D  1 27  ? 165.241 81.356  115.239 1.00 74.37  ? 4   THR D N   1 
ATOM   8381  C  CA  . THR D  1 27  ? 164.374 82.435  115.722 1.00 77.19  ? 4   THR D CA  1 
ATOM   8382  C  C   . THR D  1 27  ? 164.025 83.469  114.638 1.00 71.75  ? 4   THR D C   1 
ATOM   8383  O  O   . THR D  1 27  ? 164.776 83.652  113.672 1.00 67.21  ? 4   THR D O   1 
ATOM   8384  C  CB  . THR D  1 27  ? 164.999 83.186  116.919 1.00 76.21  ? 4   THR D CB  1 
ATOM   8385  O  OG1 . THR D  1 27  ? 165.921 84.178  116.440 1.00 64.83  ? 4   THR D OG1 1 
ATOM   8386  C  CG2 . THR D  1 27  ? 165.699 82.208  117.867 1.00 78.85  ? 4   THR D CG2 1 
ATOM   8387  N  N   . LEU D  1 28  ? 162.891 84.152  114.826 1.00 56.99  ? 5   LEU D N   1 
ATOM   8388  C  CA  . LEU D  1 28  ? 162.362 85.097  113.845 1.00 42.44  ? 5   LEU D CA  1 
ATOM   8389  C  C   . LEU D  1 28  ? 161.651 86.250  114.555 1.00 36.41  ? 5   LEU D C   1 
ATOM   8390  O  O   . LEU D  1 28  ? 160.725 86.028  115.322 1.00 43.39  ? 5   LEU D O   1 
ATOM   8391  C  CB  . LEU D  1 28  ? 161.402 84.376  112.894 1.00 28.59  ? 5   LEU D CB  1 
ATOM   8392  C  CG  . LEU D  1 28  ? 161.158 85.067  111.557 1.00 35.98  ? 5   LEU D CG  1 
ATOM   8393  C  CD1 . LEU D  1 28  ? 162.446 85.119  110.737 1.00 35.73  ? 5   LEU D CD1 1 
ATOM   8394  C  CD2 . LEU D  1 28  ? 160.050 84.349  110.795 1.00 31.70  ? 5   LEU D CD2 1 
ATOM   8395  N  N   . THR D  1 29  ? 162.086 87.481  114.306 1.00 34.93  ? 6   THR D N   1 
ATOM   8396  C  CA  . THR D  1 29  ? 161.620 88.620  115.098 1.00 36.34  ? 6   THR D CA  1 
ATOM   8397  C  C   . THR D  1 29  ? 161.081 89.779  114.254 1.00 36.94  ? 6   THR D C   1 
ATOM   8398  O  O   . THR D  1 29  ? 161.722 90.228  113.307 1.00 38.47  ? 6   THR D O   1 
ATOM   8399  C  CB  . THR D  1 29  ? 162.740 89.165  116.019 1.00 34.12  ? 6   THR D CB  1 
ATOM   8400  O  OG1 . THR D  1 29  ? 163.298 88.095  116.786 1.00 43.49  ? 6   THR D OG1 1 
ATOM   8401  C  CG2 . THR D  1 29  ? 162.189 90.214  116.977 1.00 36.28  ? 6   THR D CG2 1 
ATOM   8402  N  N   . PHE D  1 30  ? 159.907 90.270  114.631 1.00 32.88  ? 7   PHE D N   1 
ATOM   8403  C  CA  . PHE D  1 30  ? 159.233 91.344  113.911 1.00 37.04  ? 7   PHE D CA  1 
ATOM   8404  C  C   . PHE D  1 30  ? 159.909 92.704  114.140 1.00 36.62  ? 7   PHE D C   1 
ATOM   8405  O  O   . PHE D  1 30  ? 160.073 93.142  115.280 1.00 32.65  ? 7   PHE D O   1 
ATOM   8406  C  CB  . PHE D  1 30  ? 157.764 91.389  114.350 1.00 35.09  ? 7   PHE D CB  1 
ATOM   8407  C  CG  . PHE D  1 30  ? 156.937 92.423  113.643 1.00 41.99  ? 7   PHE D CG  1 
ATOM   8408  C  CD1 . PHE D  1 30  ? 157.051 93.765  113.968 1.00 40.78  ? 7   PHE D CD1 1 
ATOM   8409  C  CD2 . PHE D  1 30  ? 156.014 92.047  112.682 1.00 49.95  ? 7   PHE D CD2 1 
ATOM   8410  C  CE1 . PHE D  1 30  ? 156.293 94.718  113.329 1.00 43.29  ? 7   PHE D CE1 1 
ATOM   8411  C  CE2 . PHE D  1 30  ? 155.244 92.996  112.043 1.00 54.49  ? 7   PHE D CE2 1 
ATOM   8412  C  CZ  . PHE D  1 30  ? 155.384 94.337  112.368 1.00 52.36  ? 7   PHE D CZ  1 
ATOM   8413  N  N   . ARG D  1 31  ? 160.287 93.374  113.053 1.00 37.63  ? 8   ARG D N   1 
ATOM   8414  C  CA  . ARG D  1 31  ? 160.863 94.711  113.149 1.00 44.99  ? 8   ARG D CA  1 
ATOM   8415  C  C   . ARG D  1 31  ? 159.852 95.822  112.835 1.00 49.67  ? 8   ARG D C   1 
ATOM   8416  O  O   . ARG D  1 31  ? 159.577 96.684  113.674 1.00 51.39  ? 8   ARG D O   1 
ATOM   8417  C  CB  . ARG D  1 31  ? 162.082 94.853  112.238 1.00 46.53  ? 8   ARG D CB  1 
ATOM   8418  C  CG  . ARG D  1 31  ? 162.649 96.267  112.229 1.00 49.13  ? 8   ARG D CG  1 
ATOM   8419  C  CD  . ARG D  1 31  ? 163.766 96.416  111.214 1.00 55.63  ? 8   ARG D CD  1 
ATOM   8420  N  NE  . ARG D  1 31  ? 165.014 95.829  111.682 1.00 66.73  ? 8   ARG D NE  1 
ATOM   8421  C  CZ  . ARG D  1 31  ? 165.988 95.422  110.875 1.00 79.23  ? 8   ARG D CZ  1 
ATOM   8422  N  NH1 . ARG D  1 31  ? 165.842 95.523  109.559 1.00 78.64  ? 8   ARG D NH1 1 
ATOM   8423  N  NH2 . ARG D  1 31  ? 167.101 94.903  111.383 1.00 82.72  ? 8   ARG D NH2 1 
ATOM   8424  N  N   . LYS D  1 32  ? 159.322 95.815  111.618 1.00 44.10  ? 9   LYS D N   1 
ATOM   8425  C  CA  . LYS D  1 32  ? 158.290 96.776  111.249 1.00 43.80  ? 9   LYS D CA  1 
ATOM   8426  C  C   . LYS D  1 32  ? 157.487 96.341  110.036 1.00 41.36  ? 9   LYS D C   1 
ATOM   8427  O  O   . LYS D  1 32  ? 157.809 95.364  109.361 1.00 44.06  ? 9   LYS D O   1 
ATOM   8428  C  CB  . LYS D  1 32  ? 158.884 98.167  111.000 1.00 43.36  ? 9   LYS D CB  1 
ATOM   8429  C  CG  . LYS D  1 32  ? 159.707 98.285  109.737 1.00 47.26  ? 9   LYS D CG  1 
ATOM   8430  C  CD  . LYS D  1 32  ? 160.149 99.730  109.514 1.00 59.13  ? 9   LYS D CD  1 
ATOM   8431  C  CE  . LYS D  1 32  ? 160.975 99.864  108.247 1.00 67.55  ? 9   LYS D CE  1 
ATOM   8432  N  NZ  . LYS D  1 32  ? 160.656 101.121 107.510 1.00 76.68  ? 9   LYS D NZ  1 
ATOM   8433  N  N   . LEU D  1 33  ? 156.443 97.100  109.756 1.00 38.82  ? 10  LEU D N   1 
ATOM   8434  C  CA  . LEU D  1 33  ? 155.549 96.782  108.669 1.00 38.44  ? 10  LEU D CA  1 
ATOM   8435  C  C   . LEU D  1 33  ? 155.260 98.070  107.943 1.00 44.11  ? 10  LEU D C   1 
ATOM   8436  O  O   . LEU D  1 33  ? 155.013 99.098  108.573 1.00 47.77  ? 10  LEU D O   1 
ATOM   8437  C  CB  . LEU D  1 33  ? 154.258 96.193  109.239 1.00 36.84  ? 10  LEU D CB  1 
ATOM   8438  C  CG  . LEU D  1 33  ? 153.098 95.797  108.337 1.00 39.27  ? 10  LEU D CG  1 
ATOM   8439  C  CD1 . LEU D  1 33  ? 152.302 94.676  108.990 1.00 38.16  ? 10  LEU D CD1 1 
ATOM   8440  C  CD2 . LEU D  1 33  ? 152.212 96.995  108.057 1.00 41.13  ? 10  LEU D CD2 1 
ATOM   8441  N  N   . THR D  1 34  ? 155.299 98.013  106.617 1.00 48.54  ? 11  THR D N   1 
ATOM   8442  C  CA  . THR D  1 34  ? 154.970 99.160  105.788 1.00 45.76  ? 11  THR D CA  1 
ATOM   8443  C  C   . THR D  1 34  ? 153.708 98.860  104.997 1.00 47.02  ? 11  THR D C   1 
ATOM   8444  O  O   . THR D  1 34  ? 153.581 97.791  104.393 1.00 45.03  ? 11  THR D O   1 
ATOM   8445  C  CB  . THR D  1 34  ? 156.096 99.484  104.799 1.00 48.55  ? 11  THR D CB  1 
ATOM   8446  O  OG1 . THR D  1 34  ? 157.357 99.436  105.476 1.00 49.80  ? 11  THR D OG1 1 
ATOM   8447  C  CG2 . THR D  1 34  ? 155.893 100.875 104.198 1.00 52.17  ? 11  THR D CG2 1 
ATOM   8448  N  N   . ALA D  1 35  ? 152.777 99.810  105.010 1.00 42.12  ? 12  ALA D N   1 
ATOM   8449  C  CA  . ALA D  1 35  ? 151.547 99.702  104.243 1.00 29.25  ? 12  ALA D CA  1 
ATOM   8450  C  C   . ALA D  1 35  ? 151.496 100.834 103.237 1.00 32.25  ? 12  ALA D C   1 
ATOM   8451  O  O   . ALA D  1 35  ? 151.448 101.993 103.621 1.00 33.09  ? 12  ALA D O   1 
ATOM   8452  C  CB  . ALA D  1 35  ? 150.334 99.759  105.171 1.00 29.85  ? 12  ALA D CB  1 
ATOM   8453  N  N   . ARG D  1 36  ? 151.518 100.497 101.953 1.00 35.89  ? 13  ARG D N   1 
ATOM   8454  C  CA  . ARG D  1 36  ? 151.447 101.501 100.896 1.00 36.35  ? 13  ARG D CA  1 
ATOM   8455  C  C   . ARG D  1 36  ? 150.186 101.382 100.043 1.00 37.32  ? 13  ARG D C   1 
ATOM   8456  O  O   . ARG D  1 36  ? 149.959 100.363 99.394  1.00 35.80  ? 13  ARG D O   1 
ATOM   8457  C  CB  . ARG D  1 36  ? 152.681 101.411 100.012 1.00 40.21  ? 13  ARG D CB  1 
ATOM   8458  C  CG  . ARG D  1 36  ? 153.961 101.798 100.741 1.00 42.45  ? 13  ARG D CG  1 
ATOM   8459  C  CD  . ARG D  1 36  ? 155.160 101.580 99.852  1.00 36.02  ? 13  ARG D CD  1 
ATOM   8460  N  NE  . ARG D  1 36  ? 155.281 100.180 99.467  1.00 42.47  ? 13  ARG D NE  1 
ATOM   8461  C  CZ  . ARG D  1 36  ? 155.896 99.761  98.365  1.00 42.25  ? 13  ARG D CZ  1 
ATOM   8462  N  NH1 . ARG D  1 36  ? 156.452 100.638 97.530  1.00 35.92  ? 13  ARG D NH1 1 
ATOM   8463  N  NH2 . ARG D  1 36  ? 155.955 98.460  98.102  1.00 37.98  ? 13  ARG D NH2 1 
ATOM   8464  N  N   . PRO D  1 37  ? 149.363 102.436 100.046 1.00 40.63  ? 14  PRO D N   1 
ATOM   8465  C  CA  . PRO D  1 37  ? 148.109 102.508 99.285  1.00 32.30  ? 14  PRO D CA  1 
ATOM   8466  C  C   . PRO D  1 37  ? 148.328 102.783 97.803  1.00 34.71  ? 14  PRO D C   1 
ATOM   8467  O  O   . PRO D  1 37  ? 149.033 103.731 97.461  1.00 36.83  ? 14  PRO D O   1 
ATOM   8468  C  CB  . PRO D  1 37  ? 147.398 103.711 99.911  1.00 39.15  ? 14  PRO D CB  1 
ATOM   8469  C  CG  . PRO D  1 37  ? 148.536 104.615 100.350 1.00 40.31  ? 14  PRO D CG  1 
ATOM   8470  C  CD  . PRO D  1 37  ? 149.608 103.659 100.838 1.00 41.28  ? 14  PRO D CD  1 
ATOM   8471  N  N   . VAL D  1 38  ? 147.720 101.972 96.940  1.00 30.29  ? 15  VAL D N   1 
ATOM   8472  C  CA  . VAL D  1 38  ? 147.719 102.243 95.504  1.00 35.38  ? 15  VAL D CA  1 
ATOM   8473  C  C   . VAL D  1 38  ? 146.298 102.163 94.917  1.00 37.73  ? 15  VAL D C   1 
ATOM   8474  O  O   . VAL D  1 38  ? 145.391 101.581 95.516  1.00 33.47  ? 15  VAL D O   1 
ATOM   8475  C  CB  . VAL D  1 38  ? 148.677 101.302 94.722  1.00 27.99  ? 15  VAL D CB  1 
ATOM   8476  C  CG1 . VAL D  1 38  ? 149.919 101.024 95.529  1.00 30.06  ? 15  VAL D CG1 1 
ATOM   8477  C  CG2 . VAL D  1 38  ? 147.985 100.010 94.374  1.00 32.82  ? 15  VAL D CG2 1 
ATOM   8478  N  N   . LEU D  1 39  ? 146.108 102.763 93.748  1.00 36.09  ? 16  LEU D N   1 
ATOM   8479  C  CA  . LEU D  1 39  ? 144.816 102.730 93.083  1.00 34.84  ? 16  LEU D CA  1 
ATOM   8480  C  C   . LEU D  1 39  ? 145.010 102.390 91.618  1.00 37.57  ? 16  LEU D C   1 
ATOM   8481  O  O   . LEU D  1 39  ? 145.620 103.149 90.866  1.00 39.93  ? 16  LEU D O   1 
ATOM   8482  C  CB  . LEU D  1 39  ? 144.087 104.068 93.244  1.00 30.47  ? 16  LEU D CB  1 
ATOM   8483  C  CG  . LEU D  1 39  ? 142.621 104.135 92.807  1.00 36.08  ? 16  LEU D CG  1 
ATOM   8484  C  CD1 . LEU D  1 39  ? 141.750 103.235 93.679  1.00 27.42  ? 16  LEU D CD1 1 
ATOM   8485  C  CD2 . LEU D  1 39  ? 142.100 105.584 92.837  1.00 37.07  ? 16  LEU D CD2 1 
ATOM   8486  N  N   . LEU D  1 40  ? 144.493 101.237 91.217  1.00 35.29  ? 17  LEU D N   1 
ATOM   8487  C  CA  . LEU D  1 40  ? 144.670 100.750 89.854  1.00 41.14  ? 17  LEU D CA  1 
ATOM   8488  C  C   . LEU D  1 40  ? 143.472 101.071 88.959  1.00 42.89  ? 17  LEU D C   1 
ATOM   8489  O  O   . LEU D  1 40  ? 142.336 101.122 89.428  1.00 48.45  ? 17  LEU D O   1 
ATOM   8490  C  CB  . LEU D  1 40  ? 144.900 99.239  89.878  1.00 41.05  ? 17  LEU D CB  1 
ATOM   8491  C  CG  . LEU D  1 40  ? 146.329 98.696  89.801  1.00 41.89  ? 17  LEU D CG  1 
ATOM   8492  C  CD1 . LEU D  1 40  ? 147.319 99.501  90.642  1.00 38.78  ? 17  LEU D CD1 1 
ATOM   8493  C  CD2 . LEU D  1 40  ? 146.333 97.236  90.195  1.00 32.63  ? 17  LEU D CD2 1 
ATOM   8494  N  N   . LYS D  1 41  ? 143.736 101.288 87.673  1.00 39.77  ? 18  LYS D N   1 
ATOM   8495  C  CA  . LYS D  1 41  ? 142.680 101.400 86.670  1.00 42.36  ? 18  LYS D CA  1 
ATOM   8496  C  C   . LYS D  1 41  ? 142.281 100.001 86.184  1.00 49.82  ? 18  LYS D C   1 
ATOM   8497  O  O   . LYS D  1 41  ? 143.065 99.321  85.520  1.00 49.73  ? 18  LYS D O   1 
ATOM   8498  C  CB  . LYS D  1 41  ? 143.163 102.228 85.476  1.00 48.29  ? 18  LYS D CB  1 
ATOM   8499  C  CG  . LYS D  1 41  ? 142.048 102.896 84.687  1.00 58.83  ? 18  LYS D CG  1 
ATOM   8500  C  CD  . LYS D  1 41  ? 141.547 104.122 85.440  1.00 71.23  ? 18  LYS D CD  1 
ATOM   8501  C  CE  . LYS D  1 41  ? 140.294 104.730 84.813  1.00 74.22  ? 18  LYS D CE  1 
ATOM   8502  N  NZ  . LYS D  1 41  ? 139.757 105.861 85.650  1.00 68.23  ? 18  LYS D NZ  1 
ATOM   8503  N  N   . LEU D  1 42  ? 141.069 99.567  86.516  1.00 47.43  ? 19  LEU D N   1 
ATOM   8504  C  CA  . LEU D  1 42  ? 140.590 98.262  86.072  1.00 41.86  ? 19  LEU D CA  1 
ATOM   8505  C  C   . LEU D  1 42  ? 140.582 98.150  84.543  1.00 49.34  ? 19  LEU D C   1 
ATOM   8506  O  O   . LEU D  1 42  ? 140.239 99.103  83.836  1.00 47.23  ? 19  LEU D O   1 
ATOM   8507  C  CB  . LEU D  1 42  ? 139.186 97.984  86.622  1.00 31.00  ? 19  LEU D CB  1 
ATOM   8508  C  CG  . LEU D  1 42  ? 139.067 97.647  88.110  1.00 36.88  ? 19  LEU D CG  1 
ATOM   8509  C  CD1 . LEU D  1 42  ? 137.606 97.507  88.544  1.00 30.73  ? 19  LEU D CD1 1 
ATOM   8510  C  CD2 . LEU D  1 42  ? 139.853 96.381  88.434  1.00 38.58  ? 19  LEU D CD2 1 
ATOM   8511  N  N   . GLN D  1 43  ? 140.961 96.975  84.049  1.00 47.06  ? 20  GLN D N   1 
ATOM   8512  C  CA  . GLN D  1 43  ? 140.913 96.661  82.625  1.00 44.78  ? 20  GLN D CA  1 
ATOM   8513  C  C   . GLN D  1 43  ? 139.474 96.597  82.121  1.00 50.41  ? 20  GLN D C   1 
ATOM   8514  O  O   . GLN D  1 43  ? 139.160 97.056  81.013  1.00 46.54  ? 20  GLN D O   1 
ATOM   8515  C  CB  . GLN D  1 43  ? 141.601 95.320  82.371  1.00 42.85  ? 20  GLN D CB  1 
ATOM   8516  C  CG  . GLN D  1 43  ? 141.516 94.835  80.944  1.00 45.18  ? 20  GLN D CG  1 
ATOM   8517  C  CD  . GLN D  1 43  ? 142.271 93.541  80.740  1.00 55.15  ? 20  GLN D CD  1 
ATOM   8518  O  OE1 . GLN D  1 43  ? 143.285 93.292  81.396  1.00 56.93  ? 20  GLN D OE1 1 
ATOM   8519  N  NE2 . GLN D  1 43  ? 141.780 92.705  79.832  1.00 55.70  ? 20  GLN D NE2 1 
ATOM   8520  N  N   . ARG D  1 44  ? 138.603 96.011  82.939  1.00 41.88  ? 21  ARG D N   1 
ATOM   8521  C  CA  . ARG D  1 44  ? 137.185 95.942  82.626  1.00 39.75  ? 21  ARG D CA  1 
ATOM   8522  C  C   . ARG D  1 44  ? 136.417 96.555  83.791  1.00 47.00  ? 21  ARG D C   1 
ATOM   8523  O  O   . ARG D  1 44  ? 136.309 95.947  84.858  1.00 49.52  ? 21  ARG D O   1 
ATOM   8524  C  CB  . ARG D  1 44  ? 136.748 94.489  82.384  1.00 37.77  ? 21  ARG D CB  1 
ATOM   8525  C  CG  . ARG D  1 44  ? 137.520 93.750  81.268  1.00 37.77  ? 21  ARG D CG  1 
ATOM   8526  C  CD  . ARG D  1 44  ? 136.955 92.348  81.057  1.00 39.55  ? 21  ARG D CD  1 
ATOM   8527  N  NE  . ARG D  1 44  ? 137.451 91.688  79.851  1.00 39.86  ? 21  ARG D NE  1 
ATOM   8528  C  CZ  . ARG D  1 44  ? 138.548 90.937  79.800  1.00 38.32  ? 21  ARG D CZ  1 
ATOM   8529  N  NH1 . ARG D  1 44  ? 139.296 90.750  80.886  1.00 33.67  ? 21  ARG D NH1 1 
ATOM   8530  N  NH2 . ARG D  1 44  ? 138.905 90.378  78.654  1.00 38.59  ? 21  ARG D NH2 1 
ATOM   8531  N  N   . PRO D  1 45  ? 135.882 97.769  83.596  1.00 50.12  ? 22  PRO D N   1 
ATOM   8532  C  CA  . PRO D  1 45  ? 135.220 98.451  84.710  1.00 52.11  ? 22  PRO D CA  1 
ATOM   8533  C  C   . PRO D  1 45  ? 134.027 97.674  85.253  1.00 52.07  ? 22  PRO D C   1 
ATOM   8534  O  O   . PRO D  1 45  ? 133.275 97.043  84.500  1.00 53.27  ? 22  PRO D O   1 
ATOM   8535  C  CB  . PRO D  1 45  ? 134.762 99.776  84.093  1.00 46.87  ? 22  PRO D CB  1 
ATOM   8536  C  CG  . PRO D  1 45  ? 134.679 99.509  82.646  1.00 48.89  ? 22  PRO D CG  1 
ATOM   8537  C  CD  . PRO D  1 45  ? 135.782 98.540  82.347  1.00 51.05  ? 22  PRO D CD  1 
ATOM   8538  N  N   . VAL D  1 46  ? 133.881 97.713  86.572  1.00 45.56  ? 23  VAL D N   1 
ATOM   8539  C  CA  . VAL D  1 46  ? 132.722 97.151  87.237  1.00 41.60  ? 23  VAL D CA  1 
ATOM   8540  C  C   . VAL D  1 46  ? 131.477 97.956  86.884  1.00 43.84  ? 23  VAL D C   1 
ATOM   8541  O  O   . VAL D  1 46  ? 131.293 99.078  87.343  1.00 54.55  ? 23  VAL D O   1 
ATOM   8542  C  CB  . VAL D  1 46  ? 132.906 97.137  88.759  1.00 38.91  ? 23  VAL D CB  1 
ATOM   8543  C  CG1 . VAL D  1 46  ? 131.568 96.894  89.451  1.00 34.96  ? 23  VAL D CG1 1 
ATOM   8544  C  CG2 . VAL D  1 46  ? 133.947 96.094  89.152  1.00 32.06  ? 23  VAL D CG2 1 
ATOM   8545  N  N   . THR D  1 47  ? 130.627 97.367  86.057  1.00 38.35  ? 24  THR D N   1 
ATOM   8546  C  CA  . THR D  1 47  ? 129.381 97.992  85.655  1.00 42.73  ? 24  THR D CA  1 
ATOM   8547  C  C   . THR D  1 47  ? 128.236 97.416  86.480  1.00 42.49  ? 24  THR D C   1 
ATOM   8548  O  O   . THR D  1 47  ? 127.560 96.491  86.043  1.00 30.95  ? 24  THR D O   1 
ATOM   8549  C  CB  . THR D  1 47  ? 129.106 97.716  84.162  1.00 43.87  ? 24  THR D CB  1 
ATOM   8550  O  OG1 . THR D  1 47  ? 130.225 98.160  83.383  1.00 49.16  ? 24  THR D OG1 1 
ATOM   8551  C  CG2 . THR D  1 47  ? 127.818 98.410  83.688  1.00 39.88  ? 24  THR D CG2 1 
ATOM   8552  N  N   . ALA D  1 48  ? 128.030 97.944  87.681  1.00 56.14  ? 25  ALA D N   1 
ATOM   8553  C  CA  . ALA D  1 48  ? 126.894 97.517  88.494  1.00 69.17  ? 25  ALA D CA  1 
ATOM   8554  C  C   . ALA D  1 48  ? 125.657 98.318  88.081  1.00 82.25  ? 25  ALA D C   1 
ATOM   8555  O  O   . ALA D  1 48  ? 125.706 99.078  87.108  1.00 83.42  ? 25  ALA D O   1 
ATOM   8556  C  CB  . ALA D  1 48  ? 127.195 97.689  89.974  1.00 64.97  ? 25  ALA D CB  1 
ATOM   8557  N  N   . ARG D  1 49  ? 124.553 98.150  88.806  1.00 91.68  ? 26  ARG D N   1 
ATOM   8558  C  CA  . ARG D  1 49  ? 123.315 98.863  88.479  1.00 94.99  ? 26  ARG D CA  1 
ATOM   8559  C  C   . ARG D  1 49  ? 123.368 100.341 88.889  1.00 98.72  ? 26  ARG D C   1 
ATOM   8560  O  O   . ARG D  1 49  ? 122.986 101.222 88.115  1.00 95.78  ? 26  ARG D O   1 
ATOM   8561  C  CB  . ARG D  1 49  ? 122.100 98.178  89.117  1.00 93.19  ? 26  ARG D CB  1 
ATOM   8562  C  CG  . ARG D  1 49  ? 120.861 98.167  88.226  1.00 92.92  ? 26  ARG D CG  1 
ATOM   8563  C  CD  . ARG D  1 49  ? 119.585 97.907  89.016  1.00 100.67 ? 26  ARG D CD  1 
ATOM   8564  N  NE  . ARG D  1 49  ? 118.928 99.152  89.417  1.00 111.84 ? 26  ARG D NE  1 
ATOM   8565  C  CZ  . ARG D  1 49  ? 119.089 99.745  90.598  1.00 116.66 ? 26  ARG D CZ  1 
ATOM   8566  N  NH1 . ARG D  1 49  ? 119.886 99.208  91.514  1.00 119.88 ? 26  ARG D NH1 1 
ATOM   8567  N  NH2 . ARG D  1 49  ? 118.449 100.877 90.865  1.00 113.64 ? 26  ARG D NH2 1 
ATOM   8568  N  N   . ILE D  1 50  ? 123.839 100.605 90.106  1.00 103.69 ? 27  ILE D N   1 
ATOM   8569  C  CA  . ILE D  1 50  ? 123.902 101.972 90.622  1.00 105.81 ? 27  ILE D CA  1 
ATOM   8570  C  C   . ILE D  1 50  ? 124.915 102.846 89.878  1.00 106.27 ? 27  ILE D C   1 
ATOM   8571  O  O   . ILE D  1 50  ? 124.606 103.980 89.508  1.00 111.92 ? 27  ILE D O   1 
ATOM   8572  C  CB  . ILE D  1 50  ? 124.156 102.013 92.158  1.00 87.65  ? 27  ILE D CB  1 
ATOM   8573  C  CG1 . ILE D  1 50  ? 125.275 101.046 92.562  1.00 84.01  ? 27  ILE D CG1 1 
ATOM   8574  C  CG2 . ILE D  1 50  ? 122.875 101.683 92.921  1.00 87.45  ? 27  ILE D CG2 1 
ATOM   8575  C  CD1 . ILE D  1 50  ? 126.674 101.620 92.461  1.00 81.01  ? 27  ILE D CD1 1 
ATOM   8576  N  N   . ALA D  1 51  ? 126.114 102.318 89.649  1.00 99.57  ? 28  ALA D N   1 
ATOM   8577  C  CA  . ALA D  1 51  ? 127.158 103.081 88.970  1.00 91.87  ? 28  ALA D CA  1 
ATOM   8578  C  C   . ALA D  1 51  ? 128.272 102.197 88.421  1.00 78.01  ? 28  ALA D C   1 
ATOM   8579  O  O   . ALA D  1 51  ? 128.379 101.022 88.772  1.00 76.59  ? 28  ALA D O   1 
ATOM   8580  C  CB  . ALA D  1 51  ? 127.739 104.137 89.904  1.00 92.26  ? 28  ALA D CB  1 
ATOM   8581  N  N   . THR D  1 52  ? 129.094 102.784 87.557  1.00 64.77  ? 29  THR D N   1 
ATOM   8582  C  CA  . THR D  1 52  ? 130.274 102.125 87.009  1.00 57.33  ? 29  THR D CA  1 
ATOM   8583  C  C   . THR D  1 52  ? 131.511 102.450 87.852  1.00 56.59  ? 29  THR D C   1 
ATOM   8584  O  O   . THR D  1 52  ? 131.850 103.617 88.044  1.00 66.80  ? 29  THR D O   1 
ATOM   8585  C  CB  . THR D  1 52  ? 130.518 102.557 85.539  1.00 55.44  ? 29  THR D CB  1 
ATOM   8586  O  OG1 . THR D  1 52  ? 129.466 102.055 84.703  1.00 49.73  ? 29  THR D OG1 1 
ATOM   8587  C  CG2 . THR D  1 52  ? 131.850 102.038 85.029  1.00 57.01  ? 29  THR D CG2 1 
ATOM   8588  N  N   . ILE D  1 53  ? 132.178 101.414 88.356  1.00 46.29  ? 30  ILE D N   1 
ATOM   8589  C  CA  . ILE D  1 53  ? 133.373 101.581 89.183  1.00 46.05  ? 30  ILE D CA  1 
ATOM   8590  C  C   . ILE D  1 53  ? 134.642 101.187 88.421  1.00 48.82  ? 30  ILE D C   1 
ATOM   8591  O  O   . ILE D  1 53  ? 134.864 100.012 88.137  1.00 50.19  ? 30  ILE D O   1 
ATOM   8592  C  CB  . ILE D  1 53  ? 133.277 100.762 90.488  1.00 46.24  ? 30  ILE D CB  1 
ATOM   8593  C  CG1 . ILE D  1 53  ? 132.266 101.400 91.443  1.00 53.15  ? 30  ILE D CG1 1 
ATOM   8594  C  CG2 . ILE D  1 53  ? 134.652 100.650 91.163  1.00 34.81  ? 30  ILE D CG2 1 
ATOM   8595  C  CD1 . ILE D  1 53  ? 130.873 101.650 90.846  1.00 50.41  ? 30  ILE D CD1 1 
ATOM   8596  N  N   . PRO D  1 54  ? 135.480 102.180 88.085  1.00 44.11  ? 31  PRO D N   1 
ATOM   8597  C  CA  . PRO D  1 54  ? 136.656 101.958 87.236  1.00 39.43  ? 31  PRO D CA  1 
ATOM   8598  C  C   . PRO D  1 54  ? 137.953 101.740 88.018  1.00 41.04  ? 31  PRO D C   1 
ATOM   8599  O  O   . PRO D  1 54  ? 138.931 101.259 87.435  1.00 38.13  ? 31  PRO D O   1 
ATOM   8600  C  CB  . PRO D  1 54  ? 136.743 103.262 86.442  1.00 39.77  ? 31  PRO D CB  1 
ATOM   8601  C  CG  . PRO D  1 54  ? 136.244 104.303 87.411  1.00 41.53  ? 31  PRO D CG  1 
ATOM   8602  C  CD  . PRO D  1 54  ? 135.220 103.615 88.304  1.00 44.26  ? 31  PRO D CD  1 
ATOM   8603  N  N   . ASP D  1 55  ? 137.952 102.070 89.310  1.00 43.90  ? 32  ASP D N   1 
ATOM   8604  C  CA  . ASP D  1 55  ? 139.174 102.020 90.117  1.00 51.26  ? 32  ASP D CA  1 
ATOM   8605  C  C   . ASP D  1 55  ? 139.185 100.908 91.179  1.00 48.52  ? 32  ASP D C   1 
ATOM   8606  O  O   . ASP D  1 55  ? 138.161 100.594 91.793  1.00 49.41  ? 32  ASP D O   1 
ATOM   8607  C  CB  . ASP D  1 55  ? 139.447 103.385 90.758  1.00 62.38  ? 32  ASP D CB  1 
ATOM   8608  C  CG  . ASP D  1 55  ? 139.731 104.469 89.725  1.00 73.10  ? 32  ASP D CG  1 
ATOM   8609  O  OD1 . ASP D  1 55  ? 140.540 104.226 88.800  1.00 73.68  ? 32  ASP D OD1 1 
ATOM   8610  O  OD2 . ASP D  1 55  ? 139.136 105.562 89.835  1.00 76.86  ? 32  ASP D OD2 1 
ATOM   8611  N  N   . TRP D  1 56  ? 140.363 100.328 91.388  1.00 33.97  ? 33  TRP D N   1 
ATOM   8612  C  CA  . TRP D  1 56  ? 140.528 99.205  92.291  1.00 29.20  ? 33  TRP D CA  1 
ATOM   8613  C  C   . TRP D  1 56  ? 141.656 99.485  93.273  1.00 28.69  ? 33  TRP D C   1 
ATOM   8614  O  O   . TRP D  1 56  ? 142.807 99.566  92.881  1.00 23.67  ? 33  TRP D O   1 
ATOM   8615  C  CB  . TRP D  1 56  ? 140.828 97.939  91.485  1.00 24.08  ? 33  TRP D CB  1 
ATOM   8616  C  CG  . TRP D  1 56  ? 140.781 96.675  92.277  1.00 25.24  ? 33  TRP D CG  1 
ATOM   8617  C  CD1 . TRP D  1 56  ? 141.797 95.781  92.452  1.00 29.33  ? 33  TRP D CD1 1 
ATOM   8618  C  CD2 . TRP D  1 56  ? 139.664 96.160  93.002  1.00 23.87  ? 33  TRP D CD2 1 
ATOM   8619  N  NE1 . TRP D  1 56  ? 141.378 94.739  93.231  1.00 34.27  ? 33  TRP D NE1 1 
ATOM   8620  C  CE2 . TRP D  1 56  ? 140.072 94.948  93.587  1.00 32.12  ? 33  TRP D CE2 1 
ATOM   8621  C  CE3 . TRP D  1 56  ? 138.355 96.608  93.215  1.00 32.37  ? 33  TRP D CE3 1 
ATOM   8622  C  CZ2 . TRP D  1 56  ? 139.222 94.177  94.376  1.00 34.18  ? 33  TRP D CZ2 1 
ATOM   8623  C  CZ3 . TRP D  1 56  ? 137.504 95.836  93.992  1.00 29.11  ? 33  TRP D CZ3 1 
ATOM   8624  C  CH2 . TRP D  1 56  ? 137.942 94.636  94.567  1.00 28.70  ? 33  TRP D CH2 1 
ATOM   8625  N  N   . PRO D  1 57  ? 141.322 99.636  94.563  1.00 29.62  ? 34  PRO D N   1 
ATOM   8626  C  CA  . PRO D  1 57  ? 142.334 99.959  95.576  1.00 21.17  ? 34  PRO D CA  1 
ATOM   8627  C  C   . PRO D  1 57  ? 143.060 98.716  96.096  1.00 32.18  ? 34  PRO D C   1 
ATOM   8628  O  O   . PRO D  1 57  ? 142.470 97.629  96.141  1.00 33.37  ? 34  PRO D O   1 
ATOM   8629  C  CB  . PRO D  1 57  ? 141.516 100.592 96.690  1.00 24.64  ? 34  PRO D CB  1 
ATOM   8630  C  CG  . PRO D  1 57  ? 140.157 99.946  96.566  1.00 21.79  ? 34  PRO D CG  1 
ATOM   8631  C  CD  . PRO D  1 57  ? 139.953 99.621  95.112  1.00 24.23  ? 34  PRO D CD  1 
ATOM   8632  N  N   . LEU D  1 58  ? 144.328 98.889  96.470  1.00 32.11  ? 35  LEU D N   1 
ATOM   8633  C  CA  . LEU D  1 58  ? 145.176 97.818  96.996  1.00 32.13  ? 35  LEU D CA  1 
ATOM   8634  C  C   . LEU D  1 58  ? 146.092 98.400  98.055  1.00 37.10  ? 35  LEU D C   1 
ATOM   8635  O  O   . LEU D  1 58  ? 146.655 99.475  97.863  1.00 40.25  ? 35  LEU D O   1 
ATOM   8636  C  CB  . LEU D  1 58  ? 146.054 97.230  95.887  1.00 25.27  ? 35  LEU D CB  1 
ATOM   8637  C  CG  . LEU D  1 58  ? 145.403 96.413  94.774  1.00 37.95  ? 35  LEU D CG  1 
ATOM   8638  C  CD1 . LEU D  1 58  ? 146.272 96.387  93.545  1.00 40.42  ? 35  LEU D CD1 1 
ATOM   8639  C  CD2 . LEU D  1 58  ? 145.135 94.997  95.231  1.00 41.22  ? 35  LEU D CD2 1 
ATOM   8640  N  N   . ILE D  1 59  ? 146.261 97.696  99.166  1.00 36.99  ? 36  ILE D N   1 
ATOM   8641  C  CA  . ILE D  1 59  ? 147.258 98.099  100.157 1.00 26.67  ? 36  ILE D CA  1 
ATOM   8642  C  C   . ILE D  1 59  ? 148.402 97.082  100.183 1.00 34.13  ? 36  ILE D C   1 
ATOM   8643  O  O   . ILE D  1 59  ? 148.211 95.914  100.522 1.00 35.90  ? 36  ILE D O   1 
ATOM   8644  C  CB  . ILE D  1 59  ? 146.631 98.260  101.548 1.00 29.42  ? 36  ILE D CB  1 
ATOM   8645  C  CG1 . ILE D  1 59  ? 145.541 99.342  101.508 1.00 33.36  ? 36  ILE D CG1 1 
ATOM   8646  C  CG2 . ILE D  1 59  ? 147.704 98.568  102.585 1.00 29.52  ? 36  ILE D CG2 1 
ATOM   8647  C  CD1 . ILE D  1 59  ? 144.633 99.372  102.728 1.00 39.05  ? 36  ILE D CD1 1 
ATOM   8648  N  N   . LEU D  1 60  ? 149.589 97.523  99.789  1.00 34.10  ? 37  LEU D N   1 
ATOM   8649  C  CA  . LEU D  1 60  ? 150.736 96.627  99.720  1.00 32.48  ? 37  LEU D CA  1 
ATOM   8650  C  C   . LEU D  1 60  ? 151.389 96.579  101.083 1.00 30.44  ? 37  LEU D C   1 
ATOM   8651  O  O   . LEU D  1 60  ? 151.616 97.610  101.708 1.00 36.63  ? 37  LEU D O   1 
ATOM   8652  C  CB  . LEU D  1 60  ? 151.735 97.088  98.658  1.00 30.23  ? 37  LEU D CB  1 
ATOM   8653  C  CG  . LEU D  1 60  ? 151.291 96.851  97.209  1.00 34.72  ? 37  LEU D CG  1 
ATOM   8654  C  CD1 . LEU D  1 60  ? 149.833 97.185  97.010  1.00 38.40  ? 37  LEU D CD1 1 
ATOM   8655  C  CD2 . LEU D  1 60  ? 152.136 97.641  96.236  1.00 36.59  ? 37  LEU D CD2 1 
ATOM   8656  N  N   . ILE D  1 61  ? 151.673 95.372  101.546 1.00 24.66  ? 38  ILE D N   1 
ATOM   8657  C  CA  . ILE D  1 61  ? 152.232 95.191  102.867 1.00 26.42  ? 38  ILE D CA  1 
ATOM   8658  C  C   . ILE D  1 61  ? 153.611 94.535  102.793 1.00 35.25  ? 38  ILE D C   1 
ATOM   8659  O  O   . ILE D  1 61  ? 153.760 93.443  102.242 1.00 35.08  ? 38  ILE D O   1 
ATOM   8660  C  CB  . ILE D  1 61  ? 151.300 94.368  103.758 1.00 24.66  ? 38  ILE D CB  1 
ATOM   8661  C  CG1 . ILE D  1 61  ? 149.902 94.990  103.768 1.00 32.12  ? 38  ILE D CG1 1 
ATOM   8662  C  CG2 . ILE D  1 61  ? 151.871 94.282  105.153 1.00 20.50  ? 38  ILE D CG2 1 
ATOM   8663  C  CD1 . ILE D  1 61  ? 148.978 94.418  104.819 1.00 36.09  ? 38  ILE D CD1 1 
ATOM   8664  N  N   . ASP D  1 62  ? 154.615 95.231  103.328 1.00 36.30  ? 39  ASP D N   1 
ATOM   8665  C  CA  . ASP D  1 62  ? 155.973 94.703  103.433 1.00 33.12  ? 39  ASP D CA  1 
ATOM   8666  C  C   . ASP D  1 62  ? 156.391 94.609  104.896 1.00 33.71  ? 39  ASP D C   1 
ATOM   8667  O  O   . ASP D  1 62  ? 156.409 95.613  105.611 1.00 27.70  ? 39  ASP D O   1 
ATOM   8668  C  CB  . ASP D  1 62  ? 156.965 95.598  102.689 1.00 31.07  ? 39  ASP D CB  1 
ATOM   8669  C  CG  . ASP D  1 62  ? 156.864 95.465  101.198 1.00 39.51  ? 39  ASP D CG  1 
ATOM   8670  O  OD1 . ASP D  1 62  ? 157.621 94.653  100.623 1.00 51.23  ? 39  ASP D OD1 1 
ATOM   8671  O  OD2 . ASP D  1 62  ? 156.037 96.178  100.600 1.00 44.72  ? 39  ASP D OD2 1 
ATOM   8672  N  N   . ILE D  1 63  ? 156.724 93.400  105.331 1.00 38.06  ? 40  ILE D N   1 
ATOM   8673  C  CA  . ILE D  1 63  ? 157.197 93.165  106.683 1.00 34.55  ? 40  ILE D CA  1 
ATOM   8674  C  C   . ILE D  1 63  ? 158.709 92.982  106.687 1.00 42.70  ? 40  ILE D C   1 
ATOM   8675  O  O   . ILE D  1 63  ? 159.261 92.332  105.795 1.00 43.44  ? 40  ILE D O   1 
ATOM   8676  C  CB  . ILE D  1 63  ? 156.558 91.915  107.271 1.00 31.25  ? 40  ILE D CB  1 
ATOM   8677  C  CG1 . ILE D  1 63  ? 155.060 92.139  107.431 1.00 36.29  ? 40  ILE D CG1 1 
ATOM   8678  C  CG2 . ILE D  1 63  ? 157.206 91.561  108.619 1.00 27.39  ? 40  ILE D CG2 1 
ATOM   8679  C  CD1 . ILE D  1 63  ? 154.442 91.272  108.486 1.00 42.24  ? 40  ILE D CD1 1 
ATOM   8680  N  N   . GLU D  1 64  ? 159.370 93.562  107.687 1.00 45.32  ? 41  GLU D N   1 
ATOM   8681  C  CA  . GLU D  1 64  ? 160.807 93.367  107.889 1.00 47.59  ? 41  GLU D CA  1 
ATOM   8682  C  C   . GLU D  1 64  ? 161.026 92.625  109.190 1.00 39.45  ? 41  GLU D C   1 
ATOM   8683  O  O   . GLU D  1 64  ? 160.343 92.887  110.177 1.00 36.13  ? 41  GLU D O   1 
ATOM   8684  C  CB  . GLU D  1 64  ? 161.544 94.708  107.981 1.00 48.36  ? 41  GLU D CB  1 
ATOM   8685  C  CG  . GLU D  1 64  ? 161.472 95.586  106.753 1.00 59.34  ? 41  GLU D CG  1 
ATOM   8686  C  CD  . GLU D  1 64  ? 162.263 96.876  106.929 1.00 69.46  ? 41  GLU D CD  1 
ATOM   8687  O  OE1 . GLU D  1 64  ? 163.120 96.925  107.842 1.00 73.72  ? 41  GLU D OE1 1 
ATOM   8688  O  OE2 . GLU D  1 64  ? 162.027 97.839  106.160 1.00 64.40  ? 41  GLU D OE2 1 
ATOM   8689  N  N   . THR D  1 65  ? 161.989 91.712  109.207 1.00 35.54  ? 42  THR D N   1 
ATOM   8690  C  CA  . THR D  1 65  ? 162.374 91.081  110.459 1.00 38.15  ? 42  THR D CA  1 
ATOM   8691  C  C   . THR D  1 65  ? 163.794 91.481  110.860 1.00 43.20  ? 42  THR D C   1 
ATOM   8692  O  O   . THR D  1 65  ? 164.557 91.964  110.028 1.00 44.84  ? 42  THR D O   1 
ATOM   8693  C  CB  . THR D  1 65  ? 162.265 89.551  110.369 1.00 35.13  ? 42  THR D CB  1 
ATOM   8694  O  OG1 . THR D  1 65  ? 163.035 89.082  109.257 1.00 34.56  ? 42  THR D OG1 1 
ATOM   8695  C  CG2 . THR D  1 65  ? 160.820 89.142  110.180 1.00 34.76  ? 42  THR D CG2 1 
ATOM   8696  N  N   . GLU D  1 66  ? 164.147 91.278  112.130 1.00 40.76  ? 43  GLU D N   1 
ATOM   8697  C  CA  . GLU D  1 66  ? 165.515 91.544  112.595 1.00 43.79  ? 43  GLU D CA  1 
ATOM   8698  C  C   . GLU D  1 66  ? 166.510 90.621  111.911 1.00 43.18  ? 43  GLU D C   1 
ATOM   8699  O  O   . GLU D  1 66  ? 167.695 90.929  111.841 1.00 42.06  ? 43  GLU D O   1 
ATOM   8700  C  CB  . GLU D  1 66  ? 165.653 91.385  114.115 1.00 37.62  ? 43  GLU D CB  1 
ATOM   8701  C  CG  . GLU D  1 66  ? 164.834 92.361  114.949 1.00 55.80  ? 43  GLU D CG  1 
ATOM   8702  C  CD  . GLU D  1 66  ? 165.256 93.810  114.761 1.00 78.50  ? 43  GLU D CD  1 
ATOM   8703  O  OE1 . GLU D  1 66  ? 166.387 94.056  114.279 1.00 86.17  ? 43  GLU D OE1 1 
ATOM   8704  O  OE2 . GLU D  1 66  ? 164.448 94.707  115.095 1.00 85.00  ? 43  GLU D OE2 1 
ATOM   8705  N  N   . GLU D  1 67  ? 166.025 89.490  111.409 1.00 39.56  ? 44  GLU D N   1 
ATOM   8706  C  CA  . GLU D  1 67  ? 166.898 88.498  110.787 1.00 39.93  ? 44  GLU D CA  1 
ATOM   8707  C  C   . GLU D  1 67  ? 167.007 88.678  109.265 1.00 42.90  ? 44  GLU D C   1 
ATOM   8708  O  O   . GLU D  1 67  ? 167.643 87.878  108.572 1.00 41.11  ? 44  GLU D O   1 
ATOM   8709  C  CB  . GLU D  1 67  ? 166.429 87.084  111.137 1.00 37.67  ? 44  GLU D CB  1 
ATOM   8710  C  CG  . GLU D  1 67  ? 166.525 86.741  112.626 1.00 45.37  ? 44  GLU D CG  1 
ATOM   8711  C  CD  . GLU D  1 67  ? 165.400 87.345  113.473 1.00 52.69  ? 44  GLU D CD  1 
ATOM   8712  O  OE1 . GLU D  1 67  ? 164.493 88.003  112.912 1.00 50.31  ? 44  GLU D OE1 1 
ATOM   8713  O  OE2 . GLU D  1 67  ? 165.423 87.151  114.708 1.00 52.27  ? 44  GLU D OE2 1 
ATOM   8714  N  N   . GLY D  1 68  ? 166.381 89.726  108.746 1.00 40.02  ? 45  GLY D N   1 
ATOM   8715  C  CA  . GLY D  1 68  ? 166.470 90.020  107.328 1.00 39.33  ? 45  GLY D CA  1 
ATOM   8716  C  C   . GLY D  1 68  ? 165.469 89.299  106.439 1.00 43.32  ? 45  GLY D C   1 
ATOM   8717  O  O   . GLY D  1 68  ? 165.447 89.531  105.233 1.00 43.79  ? 45  GLY D O   1 
ATOM   8718  N  N   . VAL D  1 69  ? 164.642 88.426  107.013 1.00 41.76  ? 46  VAL D N   1 
ATOM   8719  C  CA  . VAL D  1 69  ? 163.621 87.718  106.229 1.00 35.56  ? 46  VAL D CA  1 
ATOM   8720  C  C   . VAL D  1 69  ? 162.421 88.621  106.020 1.00 33.34  ? 46  VAL D C   1 
ATOM   8721  O  O   . VAL D  1 69  ? 161.851 89.110  106.986 1.00 38.86  ? 46  VAL D O   1 
ATOM   8722  C  CB  . VAL D  1 69  ? 163.129 86.454  106.942 1.00 38.06  ? 46  VAL D CB  1 
ATOM   8723  C  CG1 . VAL D  1 69  ? 162.245 85.637  106.010 1.00 30.57  ? 46  VAL D CG1 1 
ATOM   8724  C  CG2 . VAL D  1 69  ? 164.313 85.628  107.434 1.00 44.38  ? 46  VAL D CG2 1 
ATOM   8725  N  N   . PRO D  1 70  ? 162.024 88.835  104.757 1.00 32.94  ? 47  PRO D N   1 
ATOM   8726  C  CA  . PRO D  1 70  ? 160.920 89.730  104.392 1.00 37.38  ? 47  PRO D CA  1 
ATOM   8727  C  C   . PRO D  1 70  ? 159.553 89.026  104.328 1.00 34.32  ? 47  PRO D C   1 
ATOM   8728  O  O   . PRO D  1 70  ? 159.486 87.805  104.212 1.00 37.66  ? 47  PRO D O   1 
ATOM   8729  C  CB  . PRO D  1 70  ? 161.326 90.194  102.994 1.00 22.77  ? 47  PRO D CB  1 
ATOM   8730  C  CG  . PRO D  1 70  ? 162.014 88.986  102.420 1.00 20.21  ? 47  PRO D CG  1 
ATOM   8731  C  CD  . PRO D  1 70  ? 162.623 88.207  103.568 1.00 27.91  ? 47  PRO D CD  1 
ATOM   8732  N  N   . GLY D  1 71  ? 158.483 89.811  104.408 1.00 33.36  ? 48  GLY D N   1 
ATOM   8733  C  CA  . GLY D  1 71  ? 157.125 89.327  104.232 1.00 30.29  ? 48  GLY D CA  1 
ATOM   8734  C  C   . GLY D  1 71  ? 156.359 90.247  103.288 1.00 37.11  ? 48  GLY D C   1 
ATOM   8735  O  O   . GLY D  1 71  ? 156.459 91.477  103.385 1.00 29.91  ? 48  GLY D O   1 
ATOM   8736  N  N   . ARG D  1 72  ? 155.602 89.655  102.365 1.00 32.71  ? 49  ARG D N   1 
ATOM   8737  C  CA  . ARG D  1 72  ? 154.878 90.427  101.358 1.00 34.57  ? 49  ARG D CA  1 
ATOM   8738  C  C   . ARG D  1 72  ? 153.493 89.857  101.069 1.00 33.64  ? 49  ARG D C   1 
ATOM   8739  O  O   . ARG D  1 72  ? 153.360 88.703  100.656 1.00 32.99  ? 49  ARG D O   1 
ATOM   8740  C  CB  . ARG D  1 72  ? 155.684 90.518  100.056 1.00 31.20  ? 49  ARG D CB  1 
ATOM   8741  C  CG  . ARG D  1 72  ? 156.803 91.537  100.113 1.00 39.14  ? 49  ARG D CG  1 
ATOM   8742  C  CD  . ARG D  1 72  ? 157.397 91.846  98.741  1.00 34.11  ? 49  ARG D CD  1 
ATOM   8743  N  NE  . ARG D  1 72  ? 158.201 90.754  98.202  1.00 35.88  ? 49  ARG D NE  1 
ATOM   8744  C  CZ  . ARG D  1 72  ? 159.440 90.465  98.594  1.00 37.84  ? 49  ARG D CZ  1 
ATOM   8745  N  NH1 . ARG D  1 72  ? 160.021 91.170  99.556  1.00 39.31  ? 49  ARG D NH1 1 
ATOM   8746  N  NH2 . ARG D  1 72  ? 160.096 89.454  98.037  1.00 30.25  ? 49  ARG D NH2 1 
ATOM   8747  N  N   . ALA D  1 73  ? 152.467 90.677  101.284 1.00 26.52  ? 50  ALA D N   1 
ATOM   8748  C  CA  . ALA D  1 73  ? 151.112 90.341  100.871 1.00 21.78  ? 50  ALA D CA  1 
ATOM   8749  C  C   . ALA D  1 73  ? 150.352 91.635  100.595 1.00 32.86  ? 50  ALA D C   1 
ATOM   8750  O  O   . ALA D  1 73  ? 150.891 92.734  100.815 1.00 24.82  ? 50  ALA D O   1 
ATOM   8751  C  CB  . ALA D  1 73  ? 150.411 89.511  101.954 1.00 19.28  ? 50  ALA D CB  1 
ATOM   8752  N  N   . TYR D  1 74  ? 149.102 91.514  100.136 1.00 23.81  ? 51  TYR D N   1 
ATOM   8753  C  CA  . TYR D  1 74  ? 148.291 92.694  99.852  1.00 25.16  ? 51  TYR D CA  1 
ATOM   8754  C  C   . TYR D  1 74  ? 146.848 92.574  100.319 1.00 23.76  ? 51  TYR D C   1 
ATOM   8755  O  O   . TYR D  1 74  ? 146.336 91.481  100.537 1.00 25.86  ? 51  TYR D O   1 
ATOM   8756  C  CB  . TYR D  1 74  ? 148.345 93.064  98.366  1.00 24.63  ? 51  TYR D CB  1 
ATOM   8757  C  CG  . TYR D  1 74  ? 147.761 92.029  97.432  1.00 27.04  ? 51  TYR D CG  1 
ATOM   8758  C  CD1 . TYR D  1 74  ? 146.407 92.023  97.138  1.00 34.39  ? 51  TYR D CD1 1 
ATOM   8759  C  CD2 . TYR D  1 74  ? 148.563 91.084  96.821  1.00 32.18  ? 51  TYR D CD2 1 
ATOM   8760  C  CE1 . TYR D  1 74  ? 145.862 91.088  96.280  1.00 28.51  ? 51  TYR D CE1 1 
ATOM   8761  C  CE2 . TYR D  1 74  ? 148.026 90.144  95.956  1.00 28.85  ? 51  TYR D CE2 1 
ATOM   8762  C  CZ  . TYR D  1 74  ? 146.674 90.154  95.693  1.00 28.14  ? 51  TYR D CZ  1 
ATOM   8763  O  OH  . TYR D  1 74  ? 146.122 89.223  94.849  1.00 26.20  ? 51  TYR D OH  1 
ATOM   8764  N  N   . LEU D  1 75  ? 146.208 93.722  100.485 1.00 21.92  ? 52  LEU D N   1 
ATOM   8765  C  CA  . LEU D  1 75  ? 144.799 93.788  100.829 1.00 21.40  ? 52  LEU D CA  1 
ATOM   8766  C  C   . LEU D  1 75  ? 144.055 94.385  99.653  1.00 18.82  ? 52  LEU D C   1 
ATOM   8767  O  O   . LEU D  1 75  ? 144.595 95.230  98.950  1.00 23.86  ? 52  LEU D O   1 
ATOM   8768  C  CB  . LEU D  1 75  ? 144.594 94.678  102.050 1.00 24.99  ? 52  LEU D CB  1 
ATOM   8769  C  CG  . LEU D  1 75  ? 144.826 94.051  103.415 1.00 26.02  ? 52  LEU D CG  1 
ATOM   8770  C  CD1 . LEU D  1 75  ? 144.566 95.061  104.495 1.00 24.64  ? 52  LEU D CD1 1 
ATOM   8771  C  CD2 . LEU D  1 75  ? 143.900 92.854  103.578 1.00 25.45  ? 52  LEU D CD2 1 
ATOM   8772  N  N   . GLU D  1 76  ? 142.816 93.942  99.446  1.00 34.97  ? 53  GLU D N   1 
ATOM   8773  C  CA  . GLU D  1 76  ? 141.925 94.497  98.423  1.00 31.11  ? 53  GLU D CA  1 
ATOM   8774  C  C   . GLU D  1 76  ? 140.637 95.009  99.071  1.00 31.19  ? 53  GLU D C   1 
ATOM   8775  O  O   . GLU D  1 76  ? 139.617 94.313  99.082  1.00 29.37  ? 53  GLU D O   1 
ATOM   8776  C  CB  . GLU D  1 76  ? 141.599 93.425  97.386  1.00 28.73  ? 53  GLU D CB  1 
ATOM   8777  C  CG  . GLU D  1 76  ? 142.804 93.023  96.576  1.00 30.92  ? 53  GLU D CG  1 
ATOM   8778  C  CD  . GLU D  1 76  ? 142.530 91.916  95.577  1.00 28.85  ? 53  GLU D CD  1 
ATOM   8779  O  OE1 . GLU D  1 76  ? 142.504 92.208  94.366  1.00 35.73  ? 53  GLU D OE1 1 
ATOM   8780  O  OE2 . GLU D  1 76  ? 142.384 90.748  96.000  1.00 34.73  ? 53  GLU D OE2 1 
ATOM   8781  N  N   . PRO D  1 77  ? 140.676 96.231  99.615  1.00 31.31  ? 54  PRO D N   1 
ATOM   8782  C  CA  . PRO D  1 77  ? 139.579 96.676  100.486 1.00 29.92  ? 54  PRO D CA  1 
ATOM   8783  C  C   . PRO D  1 77  ? 138.389 97.342  99.772  1.00 27.81  ? 54  PRO D C   1 
ATOM   8784  O  O   . PRO D  1 77  ? 137.519 97.859  100.489 1.00 26.56  ? 54  PRO D O   1 
ATOM   8785  C  CB  . PRO D  1 77  ? 140.271 97.697  101.394 1.00 26.65  ? 54  PRO D CB  1 
ATOM   8786  C  CG  . PRO D  1 77  ? 141.264 98.347  100.460 1.00 23.84  ? 54  PRO D CG  1 
ATOM   8787  C  CD  . PRO D  1 77  ? 141.768 97.225  99.554  1.00 21.48  ? 54  PRO D CD  1 
ATOM   8788  N  N   . TYR D  1 78  ? 138.353 97.346  98.436  1.00 19.12  ? 55  TYR D N   1 
ATOM   8789  C  CA  . TYR D  1 78  ? 137.192 97.862  97.685  1.00 28.34  ? 55  TYR D CA  1 
ATOM   8790  C  C   . TYR D  1 78  ? 137.006 99.392  97.659  1.00 33.35  ? 55  TYR D C   1 
ATOM   8791  O  O   . TYR D  1 78  ? 136.952 100.005 96.590  1.00 32.62  ? 55  TYR D O   1 
ATOM   8792  C  CB  . TYR D  1 78  ? 135.912 97.286  98.261  1.00 29.35  ? 55  TYR D CB  1 
ATOM   8793  C  CG  . TYR D  1 78  ? 135.574 95.884  97.853  1.00 34.89  ? 55  TYR D CG  1 
ATOM   8794  C  CD1 . TYR D  1 78  ? 134.696 95.648  96.799  1.00 42.06  ? 55  TYR D CD1 1 
ATOM   8795  C  CD2 . TYR D  1 78  ? 136.092 94.793  98.543  1.00 31.75  ? 55  TYR D CD2 1 
ATOM   8796  C  CE1 . TYR D  1 78  ? 134.357 94.358  96.430  1.00 48.81  ? 55  TYR D CE1 1 
ATOM   8797  C  CE2 . TYR D  1 78  ? 135.762 93.498  98.183  1.00 35.25  ? 55  TYR D CE2 1 
ATOM   8798  C  CZ  . TYR D  1 78  ? 134.892 93.289  97.128  1.00 48.56  ? 55  TYR D CZ  1 
ATOM   8799  O  OH  . TYR D  1 78  ? 134.556 92.012  96.757  1.00 53.53  ? 55  TYR D OH  1 
ATOM   8800  N  N   . VAL D  1 79  ? 136.861 99.981  98.846  1.00 35.30  ? 56  VAL D N   1 
ATOM   8801  C  CA  . VAL D  1 79  ? 136.546 101.405 99.031  1.00 35.10  ? 56  VAL D CA  1 
ATOM   8802  C  C   . VAL D  1 79  ? 137.820 102.245 99.217  1.00 43.25  ? 56  VAL D C   1 
ATOM   8803  O  O   . VAL D  1 79  ? 138.440 102.195 100.277 1.00 43.68  ? 56  VAL D O   1 
ATOM   8804  C  CB  . VAL D  1 79  ? 135.688 101.591 100.313 1.00 35.89  ? 56  VAL D CB  1 
ATOM   8805  C  CG1 . VAL D  1 79  ? 135.270 103.047 100.498 1.00 30.88  ? 56  VAL D CG1 1 
ATOM   8806  C  CG2 . VAL D  1 79  ? 134.478 100.681 100.289 1.00 29.70  ? 56  VAL D CG2 1 
ATOM   8807  N  N   . PRO D  1 80  ? 138.216 103.028 98.198  1.00 35.54  ? 57  PRO D N   1 
ATOM   8808  C  CA  . PRO D  1 80  ? 139.485 103.762 98.292  1.00 38.89  ? 57  PRO D CA  1 
ATOM   8809  C  C   . PRO D  1 80  ? 139.612 104.682 99.502  1.00 32.76  ? 57  PRO D C   1 
ATOM   8810  O  O   . PRO D  1 80  ? 140.698 104.758 100.064 1.00 34.77  ? 57  PRO D O   1 
ATOM   8811  C  CB  . PRO D  1 80  ? 139.523 104.564 96.986  1.00 33.60  ? 57  PRO D CB  1 
ATOM   8812  C  CG  . PRO D  1 80  ? 138.737 103.716 96.038  1.00 29.42  ? 57  PRO D CG  1 
ATOM   8813  C  CD  . PRO D  1 80  ? 137.603 103.171 96.868  1.00 27.62  ? 57  PRO D CD  1 
ATOM   8814  N  N   . LYS D  1 81  ? 138.543 105.361 99.898  1.00 34.41  ? 58  LYS D N   1 
ATOM   8815  C  CA  . LYS D  1 81  ? 138.594 106.210 101.093 1.00 37.51  ? 58  LYS D CA  1 
ATOM   8816  C  C   . LYS D  1 81  ? 138.978 105.426 102.356 1.00 38.49  ? 58  LYS D C   1 
ATOM   8817  O  O   . LYS D  1 81  ? 139.506 105.988 103.317 1.00 31.91  ? 58  LYS D O   1 
ATOM   8818  C  CB  . LYS D  1 81  ? 137.266 106.943 101.300 1.00 38.72  ? 58  LYS D CB  1 
ATOM   8819  C  CG  . LYS D  1 81  ? 137.175 108.234 100.496 1.00 54.04  ? 58  LYS D CG  1 
ATOM   8820  C  CD  . LYS D  1 81  ? 135.791 108.865 100.554 1.00 67.18  ? 58  LYS D CD  1 
ATOM   8821  C  CE  . LYS D  1 81  ? 135.721 110.139 99.696  1.00 76.76  ? 58  LYS D CE  1 
ATOM   8822  N  NZ  . LYS D  1 81  ? 136.371 111.322 100.341 1.00 80.55  ? 58  LYS D NZ  1 
ATOM   8823  N  N   . ALA D  1 82  ? 138.723 104.123 102.345 1.00 30.18  ? 59  ALA D N   1 
ATOM   8824  C  CA  . ALA D  1 82  ? 138.938 103.316 103.531 1.00 31.96  ? 59  ALA D CA  1 
ATOM   8825  C  C   . ALA D  1 82  ? 140.420 103.122 103.812 1.00 35.40  ? 59  ALA D C   1 
ATOM   8826  O  O   . ALA D  1 82  ? 140.798 102.878 104.959 1.00 31.65  ? 59  ALA D O   1 
ATOM   8827  C  CB  . ALA D  1 82  ? 138.214 101.964 103.424 1.00 37.79  ? 59  ALA D CB  1 
ATOM   8828  N  N   . MET D  1 83  ? 141.260 103.234 102.782 1.00 31.39  ? 60  MET D N   1 
ATOM   8829  C  CA  . MET D  1 83  ? 142.704 103.080 102.987 1.00 31.78  ? 60  MET D CA  1 
ATOM   8830  C  C   . MET D  1 83  ? 143.231 104.083 104.021 1.00 39.09  ? 60  MET D C   1 
ATOM   8831  O  O   . MET D  1 83  ? 144.162 103.788 104.772 1.00 42.97  ? 60  MET D O   1 
ATOM   8832  C  CB  . MET D  1 83  ? 143.489 103.163 101.666 1.00 26.06  ? 60  MET D CB  1 
ATOM   8833  C  CG  . MET D  1 83  ? 143.074 102.076 100.641 1.00 32.94  ? 60  MET D CG  1 
ATOM   8834  S  SD  . MET D  1 83  ? 144.172 101.828 99.212  1.00 35.12  ? 60  MET D SD  1 
ATOM   8835  C  CE  . MET D  1 83  ? 143.837 103.286 98.227  1.00 31.53  ? 60  MET D CE  1 
ATOM   8836  N  N   . LYS D  1 84  ? 142.612 105.254 104.085 1.00 32.72  ? 61  LYS D N   1 
ATOM   8837  C  CA  . LYS D  1 84  ? 143.009 106.252 105.072 1.00 41.97  ? 61  LYS D CA  1 
ATOM   8838  C  C   . LYS D  1 84  ? 142.603 105.860 106.495 1.00 40.12  ? 61  LYS D C   1 
ATOM   8839  O  O   . LYS D  1 84  ? 142.978 106.543 107.449 1.00 39.63  ? 61  LYS D O   1 
ATOM   8840  C  CB  . LYS D  1 84  ? 142.408 107.619 104.741 1.00 49.71  ? 61  LYS D CB  1 
ATOM   8841  C  CG  . LYS D  1 84  ? 142.561 108.045 103.299 1.00 52.37  ? 61  LYS D CG  1 
ATOM   8842  C  CD  . LYS D  1 84  ? 141.887 109.389 103.071 1.00 55.59  ? 61  LYS D CD  1 
ATOM   8843  C  CE  . LYS D  1 84  ? 140.614 109.520 103.895 1.00 50.24  ? 61  LYS D CE  1 
ATOM   8844  N  NZ  . LYS D  1 84  ? 139.522 110.166 103.111 1.00 48.68  ? 61  LYS D NZ  1 
ATOM   8845  N  N   . TYR D  1 85  ? 141.813 104.796 106.646 1.00 28.62  ? 62  TYR D N   1 
ATOM   8846  C  CA  . TYR D  1 85  ? 141.532 104.294 107.990 1.00 37.13  ? 62  TYR D CA  1 
ATOM   8847  C  C   . TYR D  1 85  ? 142.401 103.071 108.257 1.00 39.37  ? 62  TYR D C   1 
ATOM   8848  O  O   . TYR D  1 85  ? 142.787 102.818 109.400 1.00 36.25  ? 62  TYR D O   1 
ATOM   8849  C  CB  . TYR D  1 85  ? 140.061 103.918 108.194 1.00 28.76  ? 62  TYR D CB  1 
ATOM   8850  C  CG  . TYR D  1 85  ? 139.041 104.759 107.455 1.00 30.79  ? 62  TYR D CG  1 
ATOM   8851  C  CD1 . TYR D  1 85  ? 139.232 106.123 107.248 1.00 27.05  ? 62  TYR D CD1 1 
ATOM   8852  C  CD2 . TYR D  1 85  ? 137.871 104.169 106.955 1.00 23.66  ? 62  TYR D CD2 1 
ATOM   8853  C  CE1 . TYR D  1 85  ? 138.276 106.886 106.547 1.00 30.26  ? 62  TYR D CE1 1 
ATOM   8854  C  CE2 . TYR D  1 85  ? 136.917 104.911 106.263 1.00 26.03  ? 62  TYR D CE2 1 
ATOM   8855  C  CZ  . TYR D  1 85  ? 137.118 106.267 106.064 1.00 31.11  ? 62  TYR D CZ  1 
ATOM   8856  O  OH  . TYR D  1 85  ? 136.157 106.983 105.374 1.00 30.13  ? 62  TYR D OH  1 
ATOM   8857  N  N   . LEU D  1 86  ? 142.699 102.318 107.195 1.00 37.34  ? 63  LEU D N   1 
ATOM   8858  C  CA  . LEU D  1 86  ? 143.442 101.058 107.302 1.00 33.61  ? 63  LEU D CA  1 
ATOM   8859  C  C   . LEU D  1 86  ? 144.957 101.230 107.421 1.00 32.79  ? 63  LEU D C   1 
ATOM   8860  O  O   . LEU D  1 86  ? 145.591 100.532 108.209 1.00 34.27  ? 63  LEU D O   1 
ATOM   8861  C  CB  . LEU D  1 86  ? 143.108 100.098 106.145 1.00 26.00  ? 63  LEU D CB  1 
ATOM   8862  C  CG  . LEU D  1 86  ? 141.689 99.550  106.236 1.00 23.95  ? 63  LEU D CG  1 
ATOM   8863  C  CD1 . LEU D  1 86  ? 141.230 98.872  104.944 1.00 27.75  ? 63  LEU D CD1 1 
ATOM   8864  C  CD2 . LEU D  1 86  ? 141.572 98.621  107.425 1.00 27.55  ? 63  LEU D CD2 1 
ATOM   8865  N  N   . VAL D  1 87  ? 145.539 102.132 106.637 1.00 30.80  ? 64  VAL D N   1 
ATOM   8866  C  CA  . VAL D  1 87  ? 146.982 102.369 106.728 1.00 28.03  ? 64  VAL D CA  1 
ATOM   8867  C  C   . VAL D  1 87  ? 147.392 102.815 108.142 1.00 29.77  ? 64  VAL D C   1 
ATOM   8868  O  O   . VAL D  1 87  ? 148.272 102.224 108.750 1.00 36.37  ? 64  VAL D O   1 
ATOM   8869  C  CB  . VAL D  1 87  ? 147.477 103.362 105.679 1.00 25.03  ? 64  VAL D CB  1 
ATOM   8870  C  CG1 . VAL D  1 87  ? 148.931 103.637 105.902 1.00 30.17  ? 64  VAL D CG1 1 
ATOM   8871  C  CG2 . VAL D  1 87  ? 147.263 102.796 104.290 1.00 30.49  ? 64  VAL D CG2 1 
ATOM   8872  N  N   . PRO D  1 88  ? 146.728 103.840 108.686 1.00 36.06  ? 65  PRO D N   1 
ATOM   8873  C  CA  . PRO D  1 88  ? 146.965 104.174 110.097 1.00 29.81  ? 65  PRO D CA  1 
ATOM   8874  C  C   . PRO D  1 88  ? 146.788 102.990 111.048 1.00 37.33  ? 65  PRO D C   1 
ATOM   8875  O  O   . PRO D  1 88  ? 147.533 102.894 112.025 1.00 37.73  ? 65  PRO D O   1 
ATOM   8876  C  CB  . PRO D  1 88  ? 145.891 105.220 110.381 1.00 38.85  ? 65  PRO D CB  1 
ATOM   8877  C  CG  . PRO D  1 88  ? 145.716 105.912 109.066 1.00 40.43  ? 65  PRO D CG  1 
ATOM   8878  C  CD  . PRO D  1 88  ? 145.904 104.857 108.007 1.00 38.88  ? 65  PRO D CD  1 
ATOM   8879  N  N   . ALA D  1 89  ? 145.816 102.114 110.788 1.00 41.29  ? 66  ALA D N   1 
ATOM   8880  C  CA  . ALA D  1 89  ? 145.553 100.991 111.694 1.00 40.71  ? 66  ALA D CA  1 
ATOM   8881  C  C   . ALA D  1 89  ? 146.664 99.934  111.624 1.00 35.49  ? 66  ALA D C   1 
ATOM   8882  O  O   . ALA D  1 89  ? 147.036 99.329  112.638 1.00 29.00  ? 66  ALA D O   1 
ATOM   8883  C  CB  . ALA D  1 89  ? 144.190 100.368 111.408 1.00 30.11  ? 66  ALA D CB  1 
ATOM   8884  N  N   . LEU D  1 90  ? 147.180 99.725  110.416 1.00 33.86  ? 67  LEU D N   1 
ATOM   8885  C  CA  . LEU D  1 90  ? 148.293 98.822  110.175 1.00 30.47  ? 67  LEU D CA  1 
ATOM   8886  C  C   . LEU D  1 90  ? 149.546 99.342  110.854 1.00 39.30  ? 67  LEU D C   1 
ATOM   8887  O  O   . LEU D  1 90  ? 150.235 98.587  111.533 1.00 37.97  ? 67  LEU D O   1 
ATOM   8888  C  CB  . LEU D  1 90  ? 148.535 98.661  108.672 1.00 30.63  ? 67  LEU D CB  1 
ATOM   8889  C  CG  . LEU D  1 90  ? 147.475 97.801  107.970 1.00 33.84  ? 67  LEU D CG  1 
ATOM   8890  C  CD1 . LEU D  1 90  ? 147.436 98.055  106.462 1.00 33.45  ? 67  LEU D CD1 1 
ATOM   8891  C  CD2 . LEU D  1 90  ? 147.709 96.328  108.272 1.00 26.83  ? 67  LEU D CD2 1 
ATOM   8892  N  N   . HIS D  1 91  ? 149.834 100.635 110.686 1.00 40.11  ? 68  HIS D N   1 
ATOM   8893  C  CA  . HIS D  1 91  ? 151.030 101.213 111.297 1.00 36.21  ? 68  HIS D CA  1 
ATOM   8894  C  C   . HIS D  1 91  ? 150.943 101.212 112.822 1.00 40.22  ? 68  HIS D C   1 
ATOM   8895  O  O   . HIS D  1 91  ? 151.952 101.063 113.498 1.00 45.21  ? 68  HIS D O   1 
ATOM   8896  C  CB  . HIS D  1 91  ? 151.370 102.592 110.718 1.00 36.77  ? 68  HIS D CB  1 
ATOM   8897  C  CG  . HIS D  1 91  ? 151.867 102.545 109.297 1.00 46.10  ? 68  HIS D CG  1 
ATOM   8898  N  ND1 . HIS D  1 91  ? 151.742 103.606 108.423 1.00 51.37  ? 68  HIS D ND1 1 
ATOM   8899  C  CD2 . HIS D  1 91  ? 152.474 101.556 108.596 1.00 48.57  ? 68  HIS D CD2 1 
ATOM   8900  C  CE1 . HIS D  1 91  ? 152.255 103.275 107.249 1.00 48.33  ? 68  HIS D CE1 1 
ATOM   8901  N  NE2 . HIS D  1 91  ? 152.704 102.036 107.326 1.00 48.55  ? 68  HIS D NE2 1 
ATOM   8902  N  N   . ASP D  1 92  ? 149.738 101.338 113.368 1.00 34.46  ? 69  ASP D N   1 
ATOM   8903  C  CA  . ASP D  1 92  ? 149.570 101.174 114.808 1.00 31.94  ? 69  ASP D CA  1 
ATOM   8904  C  C   . ASP D  1 92  ? 149.855 99.741  115.246 1.00 37.59  ? 69  ASP D C   1 
ATOM   8905  O  O   . ASP D  1 92  ? 150.406 99.515  116.321 1.00 36.72  ? 69  ASP D O   1 
ATOM   8906  C  CB  . ASP D  1 92  ? 148.175 101.602 115.269 1.00 33.77  ? 69  ASP D CB  1 
ATOM   8907  C  CG  . ASP D  1 92  ? 148.015 103.107 115.310 1.00 45.44  ? 69  ASP D CG  1 
ATOM   8908  O  OD1 . ASP D  1 92  ? 149.038 103.796 115.542 1.00 53.97  ? 69  ASP D OD1 1 
ATOM   8909  O  OD2 . ASP D  1 92  ? 146.876 103.598 115.111 1.00 37.34  ? 69  ASP D OD2 1 
ATOM   8910  N  N   . MET D  1 93  ? 149.474 98.774  114.417 1.00 39.28  ? 70  MET D N   1 
ATOM   8911  C  CA  . MET D  1 93  ? 149.791 97.377  114.704 1.00 39.78  ? 70  MET D CA  1 
ATOM   8912  C  C   . MET D  1 93  ? 151.303 97.138  114.610 1.00 36.87  ? 70  MET D C   1 
ATOM   8913  O  O   . MET D  1 93  ? 151.890 96.421  115.421 1.00 36.93  ? 70  MET D O   1 
ATOM   8914  C  CB  . MET D  1 93  ? 149.003 96.424  113.785 1.00 32.98  ? 70  MET D CB  1 
ATOM   8915  C  CG  . MET D  1 93  ? 147.504 96.346  114.132 1.00 30.01  ? 70  MET D CG  1 
ATOM   8916  S  SD  . MET D  1 93  ? 146.540 95.287  113.023 1.00 41.04  ? 70  MET D SD  1 
ATOM   8917  C  CE  . MET D  1 93  ? 144.879 95.474  113.671 1.00 38.89  ? 70  MET D CE  1 
ATOM   8918  N  N   . SER D  1 94  ? 151.933 97.763  113.626 1.00 38.24  ? 71  SER D N   1 
ATOM   8919  C  CA  . SER D  1 94  ? 153.371 97.686  113.492 1.00 35.49  ? 71  SER D CA  1 
ATOM   8920  C  C   . SER D  1 94  ? 154.039 98.130  114.798 1.00 41.89  ? 71  SER D C   1 
ATOM   8921  O  O   . SER D  1 94  ? 154.884 97.417  115.344 1.00 40.89  ? 71  SER D O   1 
ATOM   8922  C  CB  . SER D  1 94  ? 153.832 98.563  112.333 1.00 28.86  ? 71  SER D CB  1 
ATOM   8923  O  OG  . SER D  1 94  ? 155.162 98.263  111.977 1.00 34.88  ? 71  SER D OG  1 
ATOM   8924  N  N   . ASP D  1 95  ? 153.645 99.297  115.305 1.00 41.34  ? 72  ASP D N   1 
ATOM   8925  C  CA  . ASP D  1 95  ? 154.256 99.843  116.519 1.00 46.11  ? 72  ASP D CA  1 
ATOM   8926  C  C   . ASP D  1 95  ? 154.079 98.891  117.692 1.00 43.37  ? 72  ASP D C   1 
ATOM   8927  O  O   . ASP D  1 95  ? 154.985 98.698  118.511 1.00 41.36  ? 72  ASP D O   1 
ATOM   8928  C  CB  . ASP D  1 95  ? 153.658 101.208 116.881 1.00 48.67  ? 72  ASP D CB  1 
ATOM   8929  C  CG  . ASP D  1 95  ? 153.959 102.282 115.839 1.00 56.81  ? 72  ASP D CG  1 
ATOM   8930  O  OD1 . ASP D  1 95  ? 154.899 102.077 115.028 1.00 53.13  ? 72  ASP D OD1 1 
ATOM   8931  O  OD2 . ASP D  1 95  ? 153.253 103.327 115.843 1.00 53.11  ? 72  ASP D OD2 1 
ATOM   8932  N  N   . MET D  1 96  ? 152.896 98.299  117.761 1.00 37.21  ? 73  MET D N   1 
ATOM   8933  C  CA  . MET D  1 96  ? 152.535 97.440  118.868 1.00 36.34  ? 73  MET D CA  1 
ATOM   8934  C  C   . MET D  1 96  ? 153.269 96.097  118.803 1.00 33.79  ? 73  MET D C   1 
ATOM   8935  O  O   . MET D  1 96  ? 153.526 95.479  119.830 1.00 35.02  ? 73  MET D O   1 
ATOM   8936  C  CB  . MET D  1 96  ? 151.022 97.244  118.873 1.00 40.27  ? 73  MET D CB  1 
ATOM   8937  C  CG  . MET D  1 96  ? 150.514 96.335  119.968 1.00 46.87  ? 73  MET D CG  1 
ATOM   8938  S  SD  . MET D  1 96  ? 149.031 95.456  119.458 1.00 76.25  ? 73  MET D SD  1 
ATOM   8939  C  CE  . MET D  1 96  ? 149.700 94.381  118.205 1.00 55.24  ? 73  MET D CE  1 
ATOM   8940  N  N   . LEU D  1 97  ? 153.617 95.663  117.593 1.00 38.67  ? 74  LEU D N   1 
ATOM   8941  C  CA  . LEU D  1 97  ? 154.230 94.349  117.376 1.00 39.62  ? 74  LEU D CA  1 
ATOM   8942  C  C   . LEU D  1 97  ? 155.759 94.382  117.387 1.00 46.10  ? 74  LEU D C   1 
ATOM   8943  O  O   . LEU D  1 97  ? 156.400 93.341  117.548 1.00 37.34  ? 74  LEU D O   1 
ATOM   8944  C  CB  . LEU D  1 97  ? 153.750 93.742  116.054 1.00 33.28  ? 74  LEU D CB  1 
ATOM   8945  C  CG  . LEU D  1 97  ? 152.259 93.414  115.955 1.00 38.43  ? 74  LEU D CG  1 
ATOM   8946  C  CD1 . LEU D  1 97  ? 151.871 93.094  114.521 1.00 30.04  ? 74  LEU D CD1 1 
ATOM   8947  C  CD2 . LEU D  1 97  ? 151.866 92.278  116.905 1.00 32.43  ? 74  LEU D CD2 1 
ATOM   8948  N  N   . ALA D  1 98  ? 156.329 95.576  117.210 1.00 45.97  ? 75  ALA D N   1 
ATOM   8949  C  CA  . ALA D  1 98  ? 157.783 95.761  117.142 1.00 42.92  ? 75  ALA D CA  1 
ATOM   8950  C  C   . ALA D  1 98  ? 158.532 94.975  118.214 1.00 37.86  ? 75  ALA D C   1 
ATOM   8951  O  O   . ALA D  1 98  ? 158.186 95.042  119.397 1.00 30.26  ? 75  ALA D O   1 
ATOM   8952  C  CB  . ALA D  1 98  ? 158.148 97.259  117.221 1.00 33.19  ? 75  ALA D CB  1 
ATOM   8953  N  N   . GLY D  1 99  ? 159.549 94.226  117.787 1.00 31.44  ? 76  GLY D N   1 
ATOM   8954  C  CA  . GLY D  1 99  ? 160.382 93.472  118.707 1.00 24.32  ? 76  GLY D CA  1 
ATOM   8955  C  C   . GLY D  1 99  ? 159.855 92.107  119.108 1.00 36.94  ? 76  GLY D C   1 
ATOM   8956  O  O   . GLY D  1 99  ? 160.596 91.288  119.649 1.00 41.34  ? 76  GLY D O   1 
ATOM   8957  N  N   . GLN D  1 100 ? 158.582 91.841  118.837 1.00 34.94  ? 77  GLN D N   1 
ATOM   8958  C  CA  . GLN D  1 100 ? 158.004 90.555  119.222 1.00 34.86  ? 77  GLN D CA  1 
ATOM   8959  C  C   . GLN D  1 100 ? 158.258 89.438  118.203 1.00 28.70  ? 77  GLN D C   1 
ATOM   8960  O  O   . GLN D  1 100 ? 158.591 89.699  117.048 1.00 30.37  ? 77  GLN D O   1 
ATOM   8961  C  CB  . GLN D  1 100 ? 156.515 90.705  119.538 1.00 40.38  ? 77  GLN D CB  1 
ATOM   8962  C  CG  . GLN D  1 100 ? 156.245 91.321  120.902 1.00 50.22  ? 77  GLN D CG  1 
ATOM   8963  C  CD  . GLN D  1 100 ? 154.922 92.055  120.948 1.00 71.01  ? 77  GLN D CD  1 
ATOM   8964  O  OE1 . GLN D  1 100 ? 154.200 92.007  121.944 1.00 81.02  ? 77  GLN D OE1 1 
ATOM   8965  N  NE2 . GLN D  1 100 ? 154.599 92.748  119.868 1.00 79.12  ? 77  GLN D NE2 1 
ATOM   8966  N  N   . PRO D  1 101 ? 158.135 88.181  118.646 1.00 25.73  ? 78  PRO D N   1 
ATOM   8967  C  CA  . PRO D  1 101 ? 158.353 87.054  117.733 1.00 27.58  ? 78  PRO D CA  1 
ATOM   8968  C  C   . PRO D  1 101 ? 157.384 87.116  116.561 1.00 28.21  ? 78  PRO D C   1 
ATOM   8969  O  O   . PRO D  1 101 ? 156.205 87.418  116.746 1.00 32.43  ? 78  PRO D O   1 
ATOM   8970  C  CB  . PRO D  1 101 ? 158.057 85.826  118.605 1.00 31.46  ? 78  PRO D CB  1 
ATOM   8971  C  CG  . PRO D  1 101 ? 158.230 86.325  120.037 1.00 34.65  ? 78  PRO D CG  1 
ATOM   8972  C  CD  . PRO D  1 101 ? 157.762 87.745  120.005 1.00 28.02  ? 78  PRO D CD  1 
ATOM   8973  N  N   . LEU D  1 102 ? 157.897 86.833  115.372 1.00 23.62  ? 79  LEU D N   1 
ATOM   8974  C  CA  . LEU D  1 102 ? 157.115 86.786  114.150 1.00 29.63  ? 79  LEU D CA  1 
ATOM   8975  C  C   . LEU D  1 102 ? 156.433 85.426  114.094 1.00 28.72  ? 79  LEU D C   1 
ATOM   8976  O  O   . LEU D  1 102 ? 156.900 84.499  113.435 1.00 38.65  ? 79  LEU D O   1 
ATOM   8977  C  CB  . LEU D  1 102 ? 158.052 86.956  112.954 1.00 29.21  ? 79  LEU D CB  1 
ATOM   8978  C  CG  . LEU D  1 102 ? 157.509 87.314  111.570 1.00 31.79  ? 79  LEU D CG  1 
ATOM   8979  C  CD1 . LEU D  1 102 ? 156.734 86.173  111.004 1.00 33.28  ? 79  LEU D CD1 1 
ATOM   8980  C  CD2 . LEU D  1 102 ? 156.665 88.576  111.631 1.00 33.36  ? 79  LEU D CD2 1 
ATOM   8981  N  N   . ALA D  1 103 ? 155.341 85.307  114.826 1.00 26.80  ? 80  ALA D N   1 
ATOM   8982  C  CA  . ALA D  1 103 ? 154.586 84.065  114.915 1.00 32.36  ? 80  ALA D CA  1 
ATOM   8983  C  C   . ALA D  1 103 ? 153.122 84.388  114.629 1.00 27.37  ? 80  ALA D C   1 
ATOM   8984  O  O   . ALA D  1 103 ? 152.453 85.004  115.455 1.00 24.64  ? 80  ALA D O   1 
ATOM   8985  C  CB  . ALA D  1 103 ? 154.746 83.459  116.307 1.00 21.42  ? 80  ALA D CB  1 
ATOM   8986  N  N   . PRO D  1 104 ? 152.636 84.001  113.440 1.00 32.06  ? 81  PRO D N   1 
ATOM   8987  C  CA  . PRO D  1 104 ? 151.292 84.358  112.963 1.00 28.69  ? 81  PRO D CA  1 
ATOM   8988  C  C   . PRO D  1 104 ? 150.188 84.127  113.994 1.00 28.78  ? 81  PRO D C   1 
ATOM   8989  O  O   . PRO D  1 104 ? 149.380 85.025  114.219 1.00 29.91  ? 81  PRO D O   1 
ATOM   8990  C  CB  . PRO D  1 104 ? 151.092 83.440  111.745 1.00 26.40  ? 81  PRO D CB  1 
ATOM   8991  C  CG  . PRO D  1 104 ? 152.459 83.207  111.233 1.00 36.55  ? 81  PRO D CG  1 
ATOM   8992  C  CD  . PRO D  1 104 ? 153.392 83.230  112.435 1.00 33.90  ? 81  PRO D CD  1 
ATOM   8993  N  N   . ALA D  1 105 ? 150.144 82.952  114.609 1.00 29.89  ? 82  ALA D N   1 
ATOM   8994  C  CA  . ALA D  1 105 ? 149.041 82.651  115.516 1.00 29.86  ? 82  ALA D CA  1 
ATOM   8995  C  C   . ALA D  1 105 ? 149.074 83.543  116.765 1.00 36.01  ? 82  ALA D C   1 
ATOM   8996  O  O   . ALA D  1 105 ? 148.025 83.936  117.285 1.00 30.55  ? 82  ALA D O   1 
ATOM   8997  C  CB  . ALA D  1 105 ? 149.029 81.183  115.889 1.00 22.76  ? 82  ALA D CB  1 
ATOM   8998  N  N   . GLU D  1 106 ? 150.270 83.877  117.244 1.00 21.71  ? 83  GLU D N   1 
ATOM   8999  C  CA  . GLU D  1 106 ? 150.358 84.788  118.384 1.00 26.60  ? 83  GLU D CA  1 
ATOM   9000  C  C   . GLU D  1 106 ? 150.004 86.192  117.958 1.00 29.46  ? 83  GLU D C   1 
ATOM   9001  O  O   . GLU D  1 106 ? 149.335 86.918  118.686 1.00 29.14  ? 83  GLU D O   1 
ATOM   9002  C  CB  . GLU D  1 106 ? 151.741 84.765  119.025 1.00 27.96  ? 83  GLU D CB  1 
ATOM   9003  C  CG  . GLU D  1 106 ? 151.943 83.587  119.922 1.00 38.19  ? 83  GLU D CG  1 
ATOM   9004  C  CD  . GLU D  1 106 ? 153.367 83.461  120.381 1.00 49.69  ? 83  GLU D CD  1 
ATOM   9005  O  OE1 . GLU D  1 106 ? 154.149 84.413  120.162 1.00 54.64  ? 83  GLU D OE1 1 
ATOM   9006  O  OE2 . GLU D  1 106 ? 153.705 82.405  120.957 1.00 52.08  ? 83  GLU D OE2 1 
ATOM   9007  N  N   . ILE D  1 107 ? 150.449 86.573  116.767 1.00 28.03  ? 84  ILE D N   1 
ATOM   9008  C  CA  . ILE D  1 107 ? 150.148 87.902  116.261 1.00 30.96  ? 84  ILE D CA  1 
ATOM   9009  C  C   . ILE D  1 107 ? 148.652 88.084  115.970 1.00 35.10  ? 84  ILE D C   1 
ATOM   9010  O  O   . ILE D  1 107 ? 148.078 89.135  116.251 1.00 36.87  ? 84  ILE D O   1 
ATOM   9011  C  CB  . ILE D  1 107 ? 151.003 88.239  115.036 1.00 29.49  ? 84  ILE D CB  1 
ATOM   9012  C  CG1 . ILE D  1 107 ? 152.476 88.361  115.460 1.00 24.79  ? 84  ILE D CG1 1 
ATOM   9013  C  CG2 . ILE D  1 107 ? 150.530 89.531  114.404 1.00 19.89  ? 84  ILE D CG2 1 
ATOM   9014  C  CD1 . ILE D  1 107 ? 153.405 88.749  114.340 1.00 33.43  ? 84  ILE D CD1 1 
ATOM   9015  N  N   . TYR D  1 108 ? 148.018 87.051  115.431 1.00 32.42  ? 85  TYR D N   1 
ATOM   9016  C  CA  . TYR D  1 108 ? 146.587 87.100  115.146 1.00 30.77  ? 85  TYR D CA  1 
ATOM   9017  C  C   . TYR D  1 108 ? 145.795 87.372  116.419 1.00 33.74  ? 85  TYR D C   1 
ATOM   9018  O  O   . TYR D  1 108 ? 144.777 88.066  116.395 1.00 24.11  ? 85  TYR D O   1 
ATOM   9019  C  CB  . TYR D  1 108 ? 146.132 85.789  114.511 1.00 19.72  ? 85  TYR D CB  1 
ATOM   9020  C  CG  . TYR D  1 108 ? 144.694 85.772  114.064 1.00 34.57  ? 85  TYR D CG  1 
ATOM   9021  C  CD1 . TYR D  1 108 ? 144.265 86.561  113.002 1.00 41.43  ? 85  TYR D CD1 1 
ATOM   9022  C  CD2 . TYR D  1 108 ? 143.764 84.942  114.683 1.00 44.21  ? 85  TYR D CD2 1 
ATOM   9023  C  CE1 . TYR D  1 108 ? 142.946 86.539  112.577 1.00 46.66  ? 85  TYR D CE1 1 
ATOM   9024  C  CE2 . TYR D  1 108 ? 142.444 84.909  114.262 1.00 49.89  ? 85  TYR D CE2 1 
ATOM   9025  C  CZ  . TYR D  1 108 ? 142.039 85.710  113.209 1.00 52.92  ? 85  TYR D CZ  1 
ATOM   9026  O  OH  . TYR D  1 108 ? 140.721 85.682  112.791 1.00 59.14  ? 85  TYR D OH  1 
ATOM   9027  N  N   . ASP D  1 109 ? 146.271 86.825  117.534 1.00 34.56  ? 86  ASP D N   1 
ATOM   9028  C  CA  . ASP D  1 109 ? 145.648 87.070  118.828 1.00 31.20  ? 86  ASP D CA  1 
ATOM   9029  C  C   . ASP D  1 109 ? 145.859 88.506  119.327 1.00 34.24  ? 86  ASP D C   1 
ATOM   9030  O  O   . ASP D  1 109 ? 144.909 89.181  119.731 1.00 29.84  ? 86  ASP D O   1 
ATOM   9031  C  CB  . ASP D  1 109 ? 146.168 86.076  119.860 1.00 42.31  ? 86  ASP D CB  1 
ATOM   9032  C  CG  . ASP D  1 109 ? 145.279 85.992  121.080 1.00 58.93  ? 86  ASP D CG  1 
ATOM   9033  O  OD1 . ASP D  1 109 ? 144.224 85.327  120.990 1.00 71.86  ? 86  ASP D OD1 1 
ATOM   9034  O  OD2 . ASP D  1 109 ? 145.627 86.591  122.123 1.00 57.30  ? 86  ASP D OD2 1 
ATOM   9035  N  N   . LYS D  1 110 ? 147.099 88.981  119.300 1.00 33.88  ? 87  LYS D N   1 
ATOM   9036  C  CA  . LYS D  1 110 ? 147.384 90.340  119.776 1.00 39.66  ? 87  LYS D CA  1 
ATOM   9037  C  C   . LYS D  1 110 ? 146.732 91.450  118.933 1.00 37.52  ? 87  LYS D C   1 
ATOM   9038  O  O   . LYS D  1 110 ? 146.314 92.480  119.470 1.00 40.11  ? 87  LYS D O   1 
ATOM   9039  C  CB  . LYS D  1 110 ? 148.892 90.590  119.876 1.00 39.78  ? 87  LYS D CB  1 
ATOM   9040  C  CG  . LYS D  1 110 ? 149.657 89.558  120.699 1.00 40.34  ? 87  LYS D CG  1 
ATOM   9041  C  CD  . LYS D  1 110 ? 151.146 89.834  120.633 1.00 41.75  ? 87  LYS D CD  1 
ATOM   9042  C  CE  . LYS D  1 110 ? 151.944 88.746  121.324 1.00 51.63  ? 87  LYS D CE  1 
ATOM   9043  N  NZ  . LYS D  1 110 ? 153.398 88.870  121.009 1.00 57.07  ? 87  LYS D NZ  1 
ATOM   9044  N  N   . THR D  1 111 ? 146.667 91.259  117.618 1.00 30.47  ? 88  THR D N   1 
ATOM   9045  C  CA  . THR D  1 111 ? 146.064 92.274  116.758 1.00 37.31  ? 88  THR D CA  1 
ATOM   9046  C  C   . THR D  1 111 ? 144.558 92.406  116.978 1.00 38.55  ? 88  THR D C   1 
ATOM   9047  O  O   . THR D  1 111 ? 144.035 93.521  117.054 1.00 39.50  ? 88  THR D O   1 
ATOM   9048  C  CB  . THR D  1 111 ? 146.335 92.028  115.271 1.00 30.59  ? 88  THR D CB  1 
ATOM   9049  O  OG1 . THR D  1 111 ? 145.936 90.699  114.928 1.00 34.26  ? 88  THR D OG1 1 
ATOM   9050  C  CG2 . THR D  1 111 ? 147.812 92.230  114.960 1.00 26.24  ? 88  THR D CG2 1 
ATOM   9051  N  N   . ARG D  1 112 ? 143.873 91.270  117.090 1.00 36.75  ? 89  ARG D N   1 
ATOM   9052  C  CA  . ARG D  1 112 ? 142.436 91.262  117.342 1.00 34.70  ? 89  ARG D CA  1 
ATOM   9053  C  C   . ARG D  1 112 ? 142.120 91.823  118.719 1.00 30.42  ? 89  ARG D C   1 
ATOM   9054  O  O   . ARG D  1 112 ? 141.201 92.636  118.881 1.00 25.17  ? 89  ARG D O   1 
ATOM   9055  C  CB  . ARG D  1 112 ? 141.864 89.846  117.214 1.00 38.76  ? 89  ARG D CB  1 
ATOM   9056  C  CG  . ARG D  1 112 ? 141.840 89.348  115.783 1.00 56.38  ? 89  ARG D CG  1 
ATOM   9057  C  CD  . ARG D  1 112 ? 140.960 88.122  115.628 1.00 62.40  ? 89  ARG D CD  1 
ATOM   9058  N  NE  . ARG D  1 112 ? 139.641 88.443  115.087 1.00 56.73  ? 89  ARG D NE  1 
ATOM   9059  C  CZ  . ARG D  1 112 ? 138.521 87.841  115.477 1.00 69.28  ? 89  ARG D CZ  1 
ATOM   9060  N  NH1 . ARG D  1 112 ? 138.573 86.900  116.414 1.00 78.81  ? 89  ARG D NH1 1 
ATOM   9061  N  NH2 . ARG D  1 112 ? 137.352 88.177  114.944 1.00 69.18  ? 89  ARG D NH2 1 
ATOM   9062  N  N   . LYS D  1 113 ? 142.869 91.373  119.717 1.00 31.23  ? 90  LYS D N   1 
ATOM   9063  C  CA  . LYS D  1 113 ? 142.622 91.803  121.085 1.00 34.83  ? 90  LYS D CA  1 
ATOM   9064  C  C   . LYS D  1 113 ? 142.738 93.318  121.181 1.00 32.17  ? 90  LYS D C   1 
ATOM   9065  O  O   . LYS D  1 113 ? 141.948 93.953  121.867 1.00 35.05  ? 90  LYS D O   1 
ATOM   9066  C  CB  . LYS D  1 113 ? 143.586 91.118  122.053 1.00 43.23  ? 90  LYS D CB  1 
ATOM   9067  C  CG  . LYS D  1 113 ? 143.313 91.405  123.522 1.00 64.16  ? 90  LYS D CG  1 
ATOM   9068  C  CD  . LYS D  1 113 ? 142.035 90.721  124.014 1.00 78.86  ? 90  LYS D CD  1 
ATOM   9069  C  CE  . LYS D  1 113 ? 141.757 91.041  125.490 1.00 80.16  ? 90  LYS D CE  1 
ATOM   9070  N  NZ  . LYS D  1 113 ? 140.494 90.422  126.004 1.00 75.41  ? 90  LYS D NZ  1 
ATOM   9071  N  N   . SER D  1 114 ? 143.701 93.902  120.464 1.00 29.40  ? 91  SER D N   1 
ATOM   9072  C  CA  . SER D  1 114 ? 143.956 95.345  120.571 1.00 26.28  ? 91  SER D CA  1 
ATOM   9073  C  C   . SER D  1 114 ? 142.758 96.209  120.120 1.00 34.77  ? 91  SER D C   1 
ATOM   9074  O  O   . SER D  1 114 ? 142.567 97.325  120.605 1.00 33.10  ? 91  SER D O   1 
ATOM   9075  C  CB  . SER D  1 114 ? 145.232 95.747  119.816 1.00 30.32  ? 91  SER D CB  1 
ATOM   9076  O  OG  . SER D  1 114 ? 145.040 95.725  118.407 1.00 39.16  ? 91  SER D OG  1 
ATOM   9077  N  N   . LEU D  1 115 ? 141.944 95.701  119.202 1.00 31.54  ? 92  LEU D N   1 
ATOM   9078  C  CA  . LEU D  1 115 ? 140.788 96.474  118.766 1.00 31.01  ? 92  LEU D CA  1 
ATOM   9079  C  C   . LEU D  1 115 ? 139.424 95.880  119.145 1.00 28.64  ? 92  LEU D C   1 
ATOM   9080  O  O   . LEU D  1 115 ? 138.398 96.312  118.603 1.00 25.67  ? 92  LEU D O   1 
ATOM   9081  C  CB  . LEU D  1 115 ? 140.850 96.731  117.256 1.00 34.52  ? 92  LEU D CB  1 
ATOM   9082  C  CG  . LEU D  1 115 ? 142.058 97.503  116.715 1.00 32.38  ? 92  LEU D CG  1 
ATOM   9083  C  CD1 . LEU D  1 115 ? 142.036 97.505  115.183 1.00 28.73  ? 92  LEU D CD1 1 
ATOM   9084  C  CD2 . LEU D  1 115 ? 142.105 98.923  117.285 1.00 27.48  ? 92  LEU D CD2 1 
ATOM   9085  N  N   . HIS D  1 116 ? 139.392 94.910  120.063 1.00 25.15  ? 93  HIS D N   1 
ATOM   9086  C  CA  . HIS D  1 116 ? 138.116 94.253  120.375 1.00 33.29  ? 93  HIS D CA  1 
ATOM   9087  C  C   . HIS D  1 116 ? 137.032 95.266  120.791 1.00 32.40  ? 93  HIS D C   1 
ATOM   9088  O  O   . HIS D  1 116 ? 135.860 95.080  120.485 1.00 29.31  ? 93  HIS D O   1 
ATOM   9089  C  CB  . HIS D  1 116 ? 138.274 93.140  121.424 1.00 31.32  ? 93  HIS D CB  1 
ATOM   9090  C  CG  . HIS D  1 116 ? 138.335 93.633  122.838 1.00 44.21  ? 93  HIS D CG  1 
ATOM   9091  N  ND1 . HIS D  1 116 ? 139.497 94.095  123.420 1.00 50.92  ? 93  HIS D ND1 1 
ATOM   9092  C  CD2 . HIS D  1 116 ? 137.381 93.714  123.796 1.00 45.72  ? 93  HIS D CD2 1 
ATOM   9093  C  CE1 . HIS D  1 116 ? 139.256 94.444  124.672 1.00 48.75  ? 93  HIS D CE1 1 
ATOM   9094  N  NE2 . HIS D  1 116 ? 137.977 94.228  124.923 1.00 46.98  ? 93  HIS D NE2 1 
ATOM   9095  N  N   . PHE D  1 117 ? 137.433 96.340  121.468 1.00 28.35  ? 94  PHE D N   1 
ATOM   9096  C  CA  . PHE D  1 117 ? 136.507 97.412  121.832 1.00 28.11  ? 94  PHE D CA  1 
ATOM   9097  C  C   . PHE D  1 117 ? 135.853 98.119  120.636 1.00 30.39  ? 94  PHE D C   1 
ATOM   9098  O  O   . PHE D  1 117 ? 134.748 98.634  120.736 1.00 28.12  ? 94  PHE D O   1 
ATOM   9099  C  CB  . PHE D  1 117 ? 137.209 98.434  122.714 1.00 30.79  ? 94  PHE D CB  1 
ATOM   9100  C  CG  . PHE D  1 117 ? 137.243 98.055  124.164 1.00 36.69  ? 94  PHE D CG  1 
ATOM   9101  C  CD1 . PHE D  1 117 ? 136.130 97.476  124.769 1.00 33.11  ? 94  PHE D CD1 1 
ATOM   9102  C  CD2 . PHE D  1 117 ? 138.385 98.290  124.933 1.00 38.95  ? 94  PHE D CD2 1 
ATOM   9103  C  CE1 . PHE D  1 117 ? 136.148 97.135  126.125 1.00 33.45  ? 94  PHE D CE1 1 
ATOM   9104  C  CE2 . PHE D  1 117 ? 138.418 97.950  126.290 1.00 36.98  ? 94  PHE D CE2 1 
ATOM   9105  C  CZ  . PHE D  1 117 ? 137.299 97.371  126.887 1.00 33.46  ? 94  PHE D CZ  1 
ATOM   9106  N  N   . VAL D  1 118 ? 136.531 98.173  119.503 1.00 35.98  ? 95  VAL D N   1 
ATOM   9107  C  CA  . VAL D  1 118 ? 135.868 98.717  118.336 1.00 41.72  ? 95  VAL D CA  1 
ATOM   9108  C  C   . VAL D  1 118 ? 135.472 97.575  117.376 1.00 35.37  ? 95  VAL D C   1 
ATOM   9109  O  O   . VAL D  1 118 ? 135.378 97.755  116.163 1.00 36.37  ? 95  VAL D O   1 
ATOM   9110  C  CB  . VAL D  1 118 ? 136.679 99.873  117.691 1.00 33.72  ? 95  VAL D CB  1 
ATOM   9111  C  CG1 . VAL D  1 118 ? 136.773 101.064 118.670 1.00 21.98  ? 95  VAL D CG1 1 
ATOM   9112  C  CG2 . VAL D  1 118 ? 138.069 99.406  117.297 1.00 25.22  ? 95  VAL D CG2 1 
ATOM   9113  N  N   . GLY D  1 119 ? 135.233 96.396  117.947 1.00 21.80  ? 96  GLY D N   1 
ATOM   9114  C  CA  . GLY D  1 119 ? 134.676 95.287  117.192 1.00 33.26  ? 96  GLY D CA  1 
ATOM   9115  C  C   . GLY D  1 119 ? 135.694 94.300  116.647 1.00 32.82  ? 96  GLY D C   1 
ATOM   9116  O  O   . GLY D  1 119 ? 136.755 94.694  116.179 1.00 30.15  ? 96  GLY D O   1 
ATOM   9117  N  N   . TYR D  1 120 ? 135.365 93.011  116.725 1.00 29.64  ? 97  TYR D N   1 
ATOM   9118  C  CA  . TYR D  1 120 ? 136.155 91.967  116.079 1.00 31.36  ? 97  TYR D CA  1 
ATOM   9119  C  C   . TYR D  1 120 ? 135.896 91.947  114.575 1.00 35.18  ? 97  TYR D C   1 
ATOM   9120  O  O   . TYR D  1 120 ? 136.781 91.626  113.782 1.00 46.84  ? 97  TYR D O   1 
ATOM   9121  C  CB  . TYR D  1 120 ? 135.862 90.590  116.693 1.00 25.01  ? 97  TYR D CB  1 
ATOM   9122  C  CG  . TYR D  1 120 ? 136.481 90.387  118.064 1.00 33.83  ? 97  TYR D CG  1 
ATOM   9123  C  CD1 . TYR D  1 120 ? 137.867 90.396  118.237 1.00 29.86  ? 97  TYR D CD1 1 
ATOM   9124  C  CD2 . TYR D  1 120 ? 135.686 90.179  119.189 1.00 37.54  ? 97  TYR D CD2 1 
ATOM   9125  C  CE1 . TYR D  1 120 ? 138.443 90.202  119.503 1.00 32.91  ? 97  TYR D CE1 1 
ATOM   9126  C  CE2 . TYR D  1 120 ? 136.253 89.994  120.459 1.00 22.98  ? 97  TYR D CE2 1 
ATOM   9127  C  CZ  . TYR D  1 120 ? 137.623 89.995  120.606 1.00 29.25  ? 97  TYR D CZ  1 
ATOM   9128  O  OH  . TYR D  1 120 ? 138.172 89.806  121.854 1.00 35.90  ? 97  TYR D OH  1 
ATOM   9129  N  N   . ALA D  1 121 ? 134.684 92.309  114.180 1.00 31.64  ? 98  ALA D N   1 
ATOM   9130  C  CA  . ALA D  1 121 ? 134.306 92.264  112.768 1.00 31.65  ? 98  ALA D CA  1 
ATOM   9131  C  C   . ALA D  1 121 ? 134.532 93.621  112.091 1.00 28.87  ? 98  ALA D C   1 
ATOM   9132  O  O   . ALA D  1 121 ? 134.675 94.632  112.769 1.00 31.75  ? 98  ALA D O   1 
ATOM   9133  C  CB  . ALA D  1 121 ? 132.841 91.804  112.623 1.00 13.87  ? 98  ALA D CB  1 
ATOM   9134  N  N   . GLY D  1 122 ? 134.567 93.638  110.759 1.00 28.39  ? 99  GLY D N   1 
ATOM   9135  C  CA  . GLY D  1 122 ? 134.745 94.874  110.004 1.00 32.34  ? 99  GLY D CA  1 
ATOM   9136  C  C   . GLY D  1 122 ? 136.187 95.362  109.876 1.00 34.33  ? 99  GLY D C   1 
ATOM   9137  O  O   . GLY D  1 122 ? 137.120 94.558  109.766 1.00 29.18  ? 99  GLY D O   1 
ATOM   9138  N  N   . LEU D  1 123 ? 136.377 96.680  109.894 1.00 25.85  ? 100 LEU D N   1 
ATOM   9139  C  CA  . LEU D  1 123 ? 137.716 97.265  109.695 1.00 33.75  ? 100 LEU D CA  1 
ATOM   9140  C  C   . LEU D  1 123 ? 138.835 96.678  110.570 1.00 32.44  ? 100 LEU D C   1 
ATOM   9141  O  O   . LEU D  1 123 ? 139.958 96.484  110.088 1.00 37.20  ? 100 LEU D O   1 
ATOM   9142  C  CB  . LEU D  1 123 ? 137.684 98.799  109.799 1.00 26.78  ? 100 LEU D CB  1 
ATOM   9143  C  CG  . LEU D  1 123 ? 137.004 99.473  108.600 1.00 25.28  ? 100 LEU D CG  1 
ATOM   9144  C  CD1 . LEU D  1 123 ? 136.500 100.883 108.910 1.00 16.95  ? 100 LEU D CD1 1 
ATOM   9145  C  CD2 . LEU D  1 123 ? 137.933 99.475  107.386 1.00 29.84  ? 100 LEU D CD2 1 
ATOM   9146  N  N   . SER D  1 124 ? 138.530 96.406  111.838 1.00 24.00  ? 101 SER D N   1 
ATOM   9147  C  CA  . SER D  1 124 ? 139.484 95.753  112.745 1.00 34.33  ? 101 SER D CA  1 
ATOM   9148  C  C   . SER D  1 124 ? 140.026 94.454  112.135 1.00 29.72  ? 101 SER D C   1 
ATOM   9149  O  O   . SER D  1 124 ? 141.233 94.268  111.996 1.00 21.41  ? 101 SER D O   1 
ATOM   9150  C  CB  . SER D  1 124 ? 138.832 95.430  114.103 1.00 31.97  ? 101 SER D CB  1 
ATOM   9151  O  OG  . SER D  1 124 ? 138.365 96.593  114.770 1.00 34.00  ? 101 SER D OG  1 
ATOM   9152  N  N   . MET D  1 125 ? 139.112 93.553  111.800 1.00 30.77  ? 102 MET D N   1 
ATOM   9153  C  CA  . MET D  1 125 ? 139.459 92.273  111.218 1.00 26.56  ? 102 MET D CA  1 
ATOM   9154  C  C   . MET D  1 125 ? 140.300 92.459  109.957 1.00 26.68  ? 102 MET D C   1 
ATOM   9155  O  O   . MET D  1 125 ? 141.269 91.740  109.731 1.00 24.65  ? 102 MET D O   1 
ATOM   9156  C  CB  . MET D  1 125 ? 138.184 91.488  110.893 1.00 27.70  ? 102 MET D CB  1 
ATOM   9157  C  CG  . MET D  1 125 ? 138.431 90.134  110.235 1.00 31.71  ? 102 MET D CG  1 
ATOM   9158  S  SD  . MET D  1 125 ? 139.482 89.033  111.226 1.00 40.93  ? 102 MET D SD  1 
ATOM   9159  C  CE  . MET D  1 125 ? 138.253 87.805  111.692 1.00 40.12  ? 102 MET D CE  1 
ATOM   9160  N  N   . ILE D  1 126 ? 139.935 93.446  109.151 1.00 28.15  ? 103 ILE D N   1 
ATOM   9161  C  CA  . ILE D  1 126 ? 140.583 93.660  107.875 1.00 23.42  ? 103 ILE D CA  1 
ATOM   9162  C  C   . ILE D  1 126 ? 142.062 94.015  108.022 1.00 26.71  ? 103 ILE D C   1 
ATOM   9163  O  O   . ILE D  1 126 ? 142.901 93.458  107.315 1.00 21.58  ? 103 ILE D O   1 
ATOM   9164  C  CB  . ILE D  1 126 ? 139.829 94.689  107.047 1.00 31.33  ? 103 ILE D CB  1 
ATOM   9165  C  CG1 . ILE D  1 126 ? 138.438 94.136  106.716 1.00 28.46  ? 103 ILE D CG1 1 
ATOM   9166  C  CG2 . ILE D  1 126 ? 140.599 95.015  105.778 1.00 36.85  ? 103 ILE D CG2 1 
ATOM   9167  C  CD1 . ILE D  1 126 ? 137.537 95.118  106.015 1.00 32.86  ? 103 ILE D CD1 1 
ATOM   9168  N  N   . ALA D  1 127 ? 142.383 94.911  108.950 1.00 28.00  ? 104 ALA D N   1 
ATOM   9169  C  CA  . ALA D  1 127 ? 143.784 95.221  109.269 1.00 32.08  ? 104 ALA D CA  1 
ATOM   9170  C  C   . ALA D  1 127 ? 144.544 93.991  109.786 1.00 30.43  ? 104 ALA D C   1 
ATOM   9171  O  O   . ALA D  1 127 ? 145.663 93.722  109.369 1.00 24.95  ? 104 ALA D O   1 
ATOM   9172  C  CB  . ALA D  1 127 ? 143.855 96.337  110.293 1.00 30.33  ? 104 ALA D CB  1 
ATOM   9173  N  N   . ALA D  1 128 ? 143.921 93.250  110.697 1.00 31.97  ? 105 ALA D N   1 
ATOM   9174  C  CA  . ALA D  1 128 ? 144.538 92.065  111.290 1.00 27.84  ? 105 ALA D CA  1 
ATOM   9175  C  C   . ALA D  1 128 ? 144.809 90.977  110.243 1.00 27.12  ? 105 ALA D C   1 
ATOM   9176  O  O   . ALA D  1 128 ? 145.785 90.241  110.338 1.00 20.92  ? 105 ALA D O   1 
ATOM   9177  C  CB  . ALA D  1 128 ? 143.651 91.530  112.392 1.00 22.84  ? 105 ALA D CB  1 
ATOM   9178  N  N   . SER D  1 129 ? 143.939 90.899  109.240 1.00 25.66  ? 106 SER D N   1 
ATOM   9179  C  CA  . SER D  1 129 ? 144.063 89.921  108.163 1.00 24.03  ? 106 SER D CA  1 
ATOM   9180  C  C   . SER D  1 129 ? 145.209 90.238  107.211 1.00 24.40  ? 106 SER D C   1 
ATOM   9181  O  O   . SER D  1 129 ? 145.830 89.335  106.685 1.00 29.76  ? 106 SER D O   1 
ATOM   9182  C  CB  . SER D  1 129 ? 142.762 89.836  107.370 1.00 20.38  ? 106 SER D CB  1 
ATOM   9183  O  OG  . SER D  1 129 ? 141.784 89.098  108.074 1.00 25.58  ? 106 SER D OG  1 
ATOM   9184  N  N   . GLY D  1 130 ? 145.479 91.518  106.985 1.00 25.40  ? 107 GLY D N   1 
ATOM   9185  C  CA  . GLY D  1 130 ? 146.599 91.917  106.152 1.00 27.85  ? 107 GLY D CA  1 
ATOM   9186  C  C   . GLY D  1 130 ? 147.923 91.629  106.838 1.00 33.14  ? 107 GLY D C   1 
ATOM   9187  O  O   . GLY D  1 130 ? 148.863 91.154  106.205 1.00 27.60  ? 107 GLY D O   1 
ATOM   9188  N  N   . VAL D  1 131 ? 148.008 91.923  108.134 1.00 32.67  ? 108 VAL D N   1 
ATOM   9189  C  CA  . VAL D  1 131 ? 149.186 91.543  108.915 1.00 29.00  ? 108 VAL D CA  1 
ATOM   9190  C  C   . VAL D  1 131 ? 149.394 90.022  108.815 1.00 36.79  ? 108 VAL D C   1 
ATOM   9191  O  O   . VAL D  1 131 ? 150.487 89.537  108.500 1.00 33.76  ? 108 VAL D O   1 
ATOM   9192  C  CB  . VAL D  1 131 ? 149.032 91.918  110.410 1.00 27.31  ? 108 VAL D CB  1 
ATOM   9193  C  CG1 . VAL D  1 131 ? 150.136 91.281  111.237 1.00 22.65  ? 108 VAL D CG1 1 
ATOM   9194  C  CG2 . VAL D  1 131 ? 149.004 93.429  110.600 1.00 27.32  ? 108 VAL D CG2 1 
ATOM   9195  N  N   . ASP D  1 132 ? 148.323 89.272  109.057 1.00 28.88  ? 109 ASP D N   1 
ATOM   9196  C  CA  . ASP D  1 132 ? 148.397 87.815  109.074 1.00 20.55  ? 109 ASP D CA  1 
ATOM   9197  C  C   . ASP D  1 132 ? 148.956 87.180  107.796 1.00 21.08  ? 109 ASP D C   1 
ATOM   9198  O  O   . ASP D  1 132 ? 149.809 86.298  107.862 1.00 21.55  ? 109 ASP D O   1 
ATOM   9199  C  CB  . ASP D  1 132 ? 147.029 87.229  109.364 1.00 22.64  ? 109 ASP D CB  1 
ATOM   9200  C  CG  . ASP D  1 132 ? 147.078 85.754  109.584 1.00 29.53  ? 109 ASP D CG  1 
ATOM   9201  O  OD1 . ASP D  1 132 ? 147.367 85.350  110.727 1.00 33.21  ? 109 ASP D OD1 1 
ATOM   9202  O  OD2 . ASP D  1 132 ? 146.825 85.002  108.620 1.00 35.19  ? 109 ASP D OD2 1 
ATOM   9203  N  N   . MET D  1 133 ? 148.448 87.598  106.643 1.00 19.54  ? 110 MET D N   1 
ATOM   9204  C  CA  . MET D  1 133 ? 148.915 87.063  105.374 1.00 21.86  ? 110 MET D CA  1 
ATOM   9205  C  C   . MET D  1 133 ? 150.398 87.329  105.158 1.00 25.15  ? 110 MET D C   1 
ATOM   9206  O  O   . MET D  1 133 ? 151.125 86.449  104.697 1.00 24.91  ? 110 MET D O   1 
ATOM   9207  C  CB  . MET D  1 133 ? 148.106 87.640  104.215 1.00 19.56  ? 110 MET D CB  1 
ATOM   9208  C  CG  . MET D  1 133 ? 146.723 87.049  104.088 1.00 20.25  ? 110 MET D CG  1 
ATOM   9209  S  SD  . MET D  1 133 ? 145.822 87.694  102.671 1.00 31.06  ? 110 MET D SD  1 
ATOM   9210  C  CE  . MET D  1 133 ? 145.278 89.283  103.297 1.00 26.24  ? 110 MET D CE  1 
ATOM   9211  N  N   . ALA D  1 134 ? 150.841 88.541  105.487 1.00 31.57  ? 111 ALA D N   1 
ATOM   9212  C  CA  . ALA D  1 134 ? 152.249 88.908  105.317 1.00 26.69  ? 111 ALA D CA  1 
ATOM   9213  C  C   . ALA D  1 134 ? 153.173 88.190  106.315 1.00 29.80  ? 111 ALA D C   1 
ATOM   9214  O  O   . ALA D  1 134 ? 154.267 87.769  105.945 1.00 32.62  ? 111 ALA D O   1 
ATOM   9215  C  CB  . ALA D  1 134 ? 152.429 90.430  105.384 1.00 22.63  ? 111 ALA D CB  1 
ATOM   9216  N  N   . VAL D  1 135 ? 152.740 88.007  107.563 1.00 21.26  ? 112 VAL D N   1 
ATOM   9217  C  CA  . VAL D  1 135 ? 153.596 87.265  108.492 1.00 31.47  ? 112 VAL D CA  1 
ATOM   9218  C  C   . VAL D  1 135 ? 153.691 85.769  108.161 1.00 30.96  ? 112 VAL D C   1 
ATOM   9219  O  O   . VAL D  1 135 ? 154.747 85.166  108.350 1.00 32.81  ? 112 VAL D O   1 
ATOM   9220  C  CB  . VAL D  1 135 ? 153.268 87.485  109.999 1.00 30.89  ? 112 VAL D CB  1 
ATOM   9221  C  CG1 . VAL D  1 135 ? 153.052 88.956  110.292 1.00 24.66  ? 112 VAL D CG1 1 
ATOM   9222  C  CG2 . VAL D  1 135 ? 152.081 86.667  110.416 1.00 45.48  ? 112 VAL D CG2 1 
ATOM   9223  N  N   . TRP D  1 136 ? 152.611 85.163  107.673 1.00 22.74  ? 113 TRP D N   1 
ATOM   9224  C  CA  . TRP D  1 136 ? 152.719 83.787  107.175 1.00 25.09  ? 113 TRP D CA  1 
ATOM   9225  C  C   . TRP D  1 136 ? 153.647 83.763  105.962 1.00 30.32  ? 113 TRP D C   1 
ATOM   9226  O  O   . TRP D  1 136 ? 154.323 82.773  105.713 1.00 24.12  ? 113 TRP D O   1 
ATOM   9227  C  CB  . TRP D  1 136 ? 151.362 83.187  106.791 1.00 23.19  ? 113 TRP D CB  1 
ATOM   9228  C  CG  . TRP D  1 136 ? 150.576 82.610  107.943 1.00 21.19  ? 113 TRP D CG  1 
ATOM   9229  C  CD1 . TRP D  1 136 ? 149.534 83.195  108.592 1.00 17.90  ? 113 TRP D CD1 1 
ATOM   9230  C  CD2 . TRP D  1 136 ? 150.768 81.332  108.563 1.00 20.66  ? 113 TRP D CD2 1 
ATOM   9231  N  NE1 . TRP D  1 136 ? 149.060 82.365  109.573 1.00 25.76  ? 113 TRP D NE1 1 
ATOM   9232  C  CE2 . TRP D  1 136 ? 149.804 81.215  109.581 1.00 23.81  ? 113 TRP D CE2 1 
ATOM   9233  C  CE3 . TRP D  1 136 ? 151.675 80.282  108.367 1.00 19.40  ? 113 TRP D CE3 1 
ATOM   9234  C  CZ2 . TRP D  1 136 ? 149.716 80.090  110.404 1.00 21.26  ? 113 TRP D CZ2 1 
ATOM   9235  C  CZ3 . TRP D  1 136 ? 151.578 79.161  109.172 1.00 15.39  ? 113 TRP D CZ3 1 
ATOM   9236  C  CH2 . TRP D  1 136 ? 150.606 79.074  110.179 1.00 26.81  ? 113 TRP D CH2 1 
ATOM   9237  N  N   . ASP D  1 137 ? 153.676 84.845  105.192 1.00 29.05  ? 114 ASP D N   1 
ATOM   9238  C  CA  . ASP D  1 137 ? 154.595 84.876  104.063 1.00 29.66  ? 114 ASP D CA  1 
ATOM   9239  C  C   . ASP D  1 137 ? 156.022 84.820  104.588 1.00 26.64  ? 114 ASP D C   1 
ATOM   9240  O  O   . ASP D  1 137 ? 156.829 84.009  104.135 1.00 27.21  ? 114 ASP D O   1 
ATOM   9241  C  CB  . ASP D  1 137 ? 154.395 86.117  103.191 1.00 26.61  ? 114 ASP D CB  1 
ATOM   9242  C  CG  . ASP D  1 137 ? 155.297 86.108  101.966 1.00 36.21  ? 114 ASP D CG  1 
ATOM   9243  O  OD1 . ASP D  1 137 ? 155.156 85.197  101.115 1.00 35.46  ? 114 ASP D OD1 1 
ATOM   9244  O  OD2 . ASP D  1 137 ? 156.158 87.002  101.863 1.00 38.01  ? 114 ASP D OD2 1 
ATOM   9245  N  N   . ALA D  1 138 ? 156.322 85.679  105.558 1.00 25.55  ? 115 ALA D N   1 
ATOM   9246  C  CA  . ALA D  1 138 ? 157.644 85.710  106.175 1.00 19.43  ? 115 ALA D CA  1 
ATOM   9247  C  C   . ALA D  1 138 ? 158.034 84.362  106.803 1.00 29.10  ? 115 ALA D C   1 
ATOM   9248  O  O   . ALA D  1 138 ? 159.176 83.931  106.691 1.00 25.19  ? 115 ALA D O   1 
ATOM   9249  C  CB  . ALA D  1 138 ? 157.716 86.823  107.205 1.00 19.86  ? 115 ALA D CB  1 
ATOM   9250  N  N   . LEU D  1 139 ? 157.087 83.688  107.451 1.00 29.84  ? 116 LEU D N   1 
ATOM   9251  C  CA  . LEU D  1 139 ? 157.399 82.424  108.104 1.00 29.32  ? 116 LEU D CA  1 
ATOM   9252  C  C   . LEU D  1 139 ? 157.769 81.356  107.078 1.00 30.29  ? 116 LEU D C   1 
ATOM   9253  O  O   . LEU D  1 139 ? 158.699 80.587  107.281 1.00 27.77  ? 116 LEU D O   1 
ATOM   9254  C  CB  . LEU D  1 139 ? 156.232 81.954  108.974 1.00 30.02  ? 116 LEU D CB  1 
ATOM   9255  C  CG  . LEU D  1 139 ? 156.493 80.714  109.830 1.00 26.34  ? 116 LEU D CG  1 
ATOM   9256  C  CD1 . LEU D  1 139 ? 157.646 80.979  110.781 1.00 24.41  ? 116 LEU D CD1 1 
ATOM   9257  C  CD2 . LEU D  1 139 ? 155.241 80.332  110.601 1.00 20.07  ? 116 LEU D CD2 1 
ATOM   9258  N  N   . ALA D  1 140 ? 157.038 81.317  105.969 1.00 31.08  ? 117 ALA D N   1 
ATOM   9259  C  CA  . ALA D  1 140 ? 157.313 80.357  104.910 1.00 28.12  ? 117 ALA D CA  1 
ATOM   9260  C  C   . ALA D  1 140 ? 158.644 80.667  104.226 1.00 35.27  ? 117 ALA D C   1 
ATOM   9261  O  O   . ALA D  1 140 ? 159.409 79.756  103.899 1.00 35.50  ? 117 ALA D O   1 
ATOM   9262  C  CB  . ALA D  1 140 ? 156.188 80.348  103.898 1.00 24.97  ? 117 ALA D CB  1 
ATOM   9263  N  N   . ARG D  1 141 ? 158.917 81.946  103.994 1.00 26.19  ? 118 ARG D N   1 
ATOM   9264  C  CA  . ARG D  1 141 ? 160.230 82.335  103.481 1.00 30.26  ? 118 ARG D CA  1 
ATOM   9265  C  C   . ARG D  1 141 ? 161.322 81.872  104.446 1.00 35.54  ? 118 ARG D C   1 
ATOM   9266  O  O   . ARG D  1 141 ? 162.329 81.304  104.034 1.00 33.24  ? 118 ARG D O   1 
ATOM   9267  C  CB  . ARG D  1 141 ? 160.321 83.849  103.263 1.00 25.03  ? 118 ARG D CB  1 
ATOM   9268  C  CG  . ARG D  1 141 ? 159.555 84.328  102.051 1.00 34.64  ? 118 ARG D CG  1 
ATOM   9269  C  CD  . ARG D  1 141 ? 159.555 85.842  101.896 1.00 35.16  ? 118 ARG D CD  1 
ATOM   9270  N  NE  . ARG D  1 141 ? 158.628 86.228  100.838 1.00 41.11  ? 118 ARG D NE  1 
ATOM   9271  C  CZ  . ARG D  1 141 ? 158.915 86.234  99.533  1.00 43.19  ? 118 ARG D CZ  1 
ATOM   9272  N  NH1 . ARG D  1 141 ? 160.129 85.897  99.099  1.00 25.27  ? 118 ARG D NH1 1 
ATOM   9273  N  NH2 . ARG D  1 141 ? 157.977 86.591  98.655  1.00 39.31  ? 118 ARG D NH2 1 
ATOM   9274  N  N   . ALA D  1 142 ? 161.107 82.093  105.738 1.00 34.08  ? 119 ALA D N   1 
ATOM   9275  C  CA  . ALA D  1 142 ? 162.107 81.732  106.731 1.00 32.98  ? 119 ALA D CA  1 
ATOM   9276  C  C   . ALA D  1 142 ? 162.396 80.237  106.689 1.00 34.11  ? 119 ALA D C   1 
ATOM   9277  O  O   . ALA D  1 142 ? 163.488 79.805  107.012 1.00 33.77  ? 119 ALA D O   1 
ATOM   9278  C  CB  . ALA D  1 142 ? 161.665 82.165  108.129 1.00 28.47  ? 119 ALA D CB  1 
ATOM   9279  N  N   . ALA D  1 143 ? 161.411 79.445  106.294 1.00 37.90  ? 120 ALA D N   1 
ATOM   9280  C  CA  . ALA D  1 143 ? 161.594 78.004  106.223 1.00 31.74  ? 120 ALA D CA  1 
ATOM   9281  C  C   . ALA D  1 143 ? 162.088 77.632  104.840 1.00 27.65  ? 120 ALA D C   1 
ATOM   9282  O  O   . ALA D  1 143 ? 162.246 76.463  104.527 1.00 33.33  ? 120 ALA D O   1 
ATOM   9283  C  CB  . ALA D  1 143 ? 160.284 77.303  106.515 1.00 29.58  ? 120 ALA D CB  1 
ATOM   9284  N  N   . ASN D  1 144 ? 162.320 78.642  104.010 1.00 30.04  ? 121 ASN D N   1 
ATOM   9285  C  CA  . ASN D  1 144 ? 162.557 78.428  102.588 1.00 39.75  ? 121 ASN D CA  1 
ATOM   9286  C  C   . ASN D  1 144 ? 161.553 77.460  101.953 1.00 42.16  ? 121 ASN D C   1 
ATOM   9287  O  O   . ASN D  1 144 ? 161.934 76.594  101.163 1.00 38.22  ? 121 ASN D O   1 
ATOM   9288  C  CB  . ASN D  1 144 ? 163.974 77.926  102.340 1.00 48.05  ? 121 ASN D CB  1 
ATOM   9289  C  CG  . ASN D  1 144 ? 164.461 78.250  100.945 1.00 55.01  ? 121 ASN D CG  1 
ATOM   9290  O  OD1 . ASN D  1 144 ? 164.363 79.397  100.492 1.00 59.68  ? 121 ASN D OD1 1 
ATOM   9291  N  ND2 . ASN D  1 144 ? 164.974 77.243  100.246 1.00 47.55  ? 121 ASN D ND2 1 
ATOM   9292  N  N   . MET D  1 145 ? 160.277 77.616  102.307 1.00 36.69  ? 122 MET D N   1 
ATOM   9293  C  CA  . MET D  1 145 ? 159.198 76.801  101.758 1.00 29.06  ? 122 MET D CA  1 
ATOM   9294  C  C   . MET D  1 145 ? 158.098 77.661  101.132 1.00 30.02  ? 122 MET D C   1 
ATOM   9295  O  O   . MET D  1 145 ? 157.776 78.743  101.628 1.00 29.82  ? 122 MET D O   1 
ATOM   9296  C  CB  . MET D  1 145 ? 158.573 75.938  102.855 1.00 29.40  ? 122 MET D CB  1 
ATOM   9297  C  CG  . MET D  1 145 ? 159.480 74.853  103.417 1.00 27.34  ? 122 MET D CG  1 
ATOM   9298  S  SD  . MET D  1 145 ? 158.734 74.019  104.842 1.00 33.99  ? 122 MET D SD  1 
ATOM   9299  C  CE  . MET D  1 145 ? 159.942 72.731  105.163 1.00 43.52  ? 122 MET D CE  1 
ATOM   9300  N  N   . PRO D  1 146 ? 157.512 77.180  100.034 1.00 30.48  ? 123 PRO D N   1 
ATOM   9301  C  CA  . PRO D  1 146 ? 156.269 77.782  99.551  1.00 36.30  ? 123 PRO D CA  1 
ATOM   9302  C  C   . PRO D  1 146 ? 155.219 77.695  100.661 1.00 33.33  ? 123 PRO D C   1 
ATOM   9303  O  O   . PRO D  1 146 ? 155.272 76.735  101.439 1.00 35.19  ? 123 PRO D O   1 
ATOM   9304  C  CB  . PRO D  1 146 ? 155.866 76.856  98.401  1.00 31.42  ? 123 PRO D CB  1 
ATOM   9305  C  CG  . PRO D  1 146 ? 157.108 76.147  98.008  1.00 23.76  ? 123 PRO D CG  1 
ATOM   9306  C  CD  . PRO D  1 146 ? 157.898 75.995  99.252  1.00 26.59  ? 123 PRO D CD  1 
ATOM   9307  N  N   . LEU D  1 147 ? 154.283 78.643  100.729 1.00 24.28  ? 124 LEU D N   1 
ATOM   9308  C  CA  . LEU D  1 147 ? 153.289 78.637  101.809 1.00 23.30  ? 124 LEU D CA  1 
ATOM   9309  C  C   . LEU D  1 147 ? 152.528 77.319  101.901 1.00 34.00  ? 124 LEU D C   1 
ATOM   9310  O  O   . LEU D  1 147 ? 152.391 76.758  102.993 1.00 34.00  ? 124 LEU D O   1 
ATOM   9311  C  CB  . LEU D  1 147 ? 152.309 79.813  101.701 1.00 22.08  ? 124 LEU D CB  1 
ATOM   9312  C  CG  . LEU D  1 147 ? 151.332 79.990  102.881 1.00 24.08  ? 124 LEU D CG  1 
ATOM   9313  C  CD1 . LEU D  1 147 ? 152.066 80.151  104.220 1.00 17.62  ? 124 LEU D CD1 1 
ATOM   9314  C  CD2 . LEU D  1 147 ? 150.427 81.181  102.645 1.00 20.34  ? 124 LEU D CD2 1 
ATOM   9315  N  N   . CYS D  1 148 ? 152.030 76.816  100.769 1.00 28.72  ? 125 CYS D N   1 
ATOM   9316  C  CA  . CYS D  1 148 ? 151.247 75.575  100.808 1.00 25.36  ? 125 CYS D CA  1 
ATOM   9317  C  C   . CYS D  1 148 ? 152.071 74.460  101.450 1.00 26.09  ? 125 CYS D C   1 
ATOM   9318  O  O   . CYS D  1 148 ? 151.532 73.609  102.148 1.00 28.85  ? 125 CYS D O   1 
ATOM   9319  C  CB  . CYS D  1 148 ? 150.774 75.160  99.406  1.00 20.48  ? 125 CYS D CB  1 
ATOM   9320  S  SG  . CYS D  1 148 ? 152.107 75.081  98.175  1.00 35.83  ? 125 CYS D SG  1 
ATOM   9321  N  N   . THR D  1 149 ? 153.384 74.491  101.230 1.00 31.22  ? 126 THR D N   1 
ATOM   9322  C  CA  . THR D  1 149 ? 154.290 73.458  101.748 1.00 35.06  ? 126 THR D CA  1 
ATOM   9323  C  C   . THR D  1 149 ? 154.504 73.569  103.260 1.00 28.21  ? 126 THR D C   1 
ATOM   9324  O  O   . THR D  1 149 ? 154.444 72.576  103.980 1.00 26.53  ? 126 THR D O   1 
ATOM   9325  C  CB  . THR D  1 149 ? 155.648 73.482  101.017 1.00 34.09  ? 126 THR D CB  1 
ATOM   9326  O  OG1 . THR D  1 149 ? 155.431 73.243  99.627  1.00 33.51  ? 126 THR D OG1 1 
ATOM   9327  C  CG2 . THR D  1 149 ? 156.569 72.405  101.558 1.00 35.64  ? 126 THR D CG2 1 
ATOM   9328  N  N   . LEU D  1 150 ? 154.743 74.784  103.731 1.00 25.64  ? 127 LEU D N   1 
ATOM   9329  C  CA  . LEU D  1 150 ? 154.750 75.071  105.162 1.00 22.93  ? 127 LEU D CA  1 
ATOM   9330  C  C   . LEU D  1 150 ? 153.436 74.653  105.841 1.00 31.72  ? 127 LEU D C   1 
ATOM   9331  O  O   . LEU D  1 150 ? 153.431 74.268  107.014 1.00 28.08  ? 127 LEU D O   1 
ATOM   9332  C  CB  . LEU D  1 150 ? 154.972 76.564  105.387 1.00 25.42  ? 127 LEU D CB  1 
ATOM   9333  C  CG  . LEU D  1 150 ? 154.906 77.018  106.847 1.00 38.80  ? 127 LEU D CG  1 
ATOM   9334  C  CD1 . LEU D  1 150 ? 156.204 76.683  107.515 1.00 34.19  ? 127 LEU D CD1 1 
ATOM   9335  C  CD2 . LEU D  1 150 ? 154.644 78.516  106.945 1.00 45.14  ? 127 LEU D CD2 1 
ATOM   9336  N  N   . LEU D  1 151 ? 152.327 74.742  105.105 1.00 28.20  ? 128 LEU D N   1 
ATOM   9337  C  CA  . LEU D  1 151 ? 151.010 74.368  105.628 1.00 23.01  ? 128 LEU D CA  1 
ATOM   9338  C  C   . LEU D  1 151 ? 150.735 72.879  105.477 1.00 29.34  ? 128 LEU D C   1 
ATOM   9339  O  O   . LEU D  1 151 ? 149.689 72.401  105.886 1.00 31.86  ? 128 LEU D O   1 
ATOM   9340  C  CB  . LEU D  1 151 ? 149.889 75.162  104.941 1.00 22.37  ? 128 LEU D CB  1 
ATOM   9341  C  CG  . LEU D  1 151 ? 149.843 76.679  105.120 1.00 24.00  ? 128 LEU D CG  1 
ATOM   9342  C  CD1 . LEU D  1 151 ? 148.742 77.316  104.263 1.00 18.53  ? 128 LEU D CD1 1 
ATOM   9343  C  CD2 . LEU D  1 151 ? 149.675 77.049  106.602 1.00 28.69  ? 128 LEU D CD2 1 
ATOM   9344  N  N   . GLY D  1 152 ? 151.669 72.144  104.883 1.00 27.43  ? 129 GLY D N   1 
ATOM   9345  C  CA  . GLY D  1 152 ? 151.553 70.700  104.853 1.00 26.02  ? 129 GLY D CA  1 
ATOM   9346  C  C   . GLY D  1 152 ? 151.197 70.068  103.515 1.00 29.16  ? 129 GLY D C   1 
ATOM   9347  O  O   . GLY D  1 152 ? 151.010 68.857  103.444 1.00 28.85  ? 129 GLY D O   1 
ATOM   9348  N  N   . GLY D  1 153 ? 151.096 70.870  102.458 1.00 25.59  ? 130 GLY D N   1 
ATOM   9349  C  CA  . GLY D  1 153 ? 150.830 70.334  101.134 1.00 25.50  ? 130 GLY D CA  1 
ATOM   9350  C  C   . GLY D  1 153 ? 152.028 70.482  100.213 1.00 28.87  ? 130 GLY D C   1 
ATOM   9351  O  O   . GLY D  1 153 ? 153.169 70.442  100.658 1.00 30.45  ? 130 GLY D O   1 
ATOM   9352  N  N   . THR D  1 154 ? 151.765 70.645  98.922  1.00 24.40  ? 131 THR D N   1 
ATOM   9353  C  CA  . THR D  1 154 ? 152.811 70.941  97.950  1.00 28.48  ? 131 THR D CA  1 
ATOM   9354  C  C   . THR D  1 154 ? 152.273 71.851  96.842  1.00 37.24  ? 131 THR D C   1 
ATOM   9355  O  O   . THR D  1 154 ? 151.053 71.937  96.633  1.00 30.66  ? 131 THR D O   1 
ATOM   9356  C  CB  . THR D  1 154 ? 153.370 69.663  97.278  1.00 37.66  ? 131 THR D CB  1 
ATOM   9357  O  OG1 . THR D  1 154 ? 152.319 68.976  96.585  1.00 37.11  ? 131 THR D OG1 1 
ATOM   9358  C  CG2 . THR D  1 154 ? 154.010 68.739  98.296  1.00 37.84  ? 131 THR D CG2 1 
ATOM   9359  N  N   . PRO D  1 155 ? 153.180 72.540  96.129  1.00 32.43  ? 132 PRO D N   1 
ATOM   9360  C  CA  . PRO D  1 155 ? 152.747 73.331  94.975  1.00 28.10  ? 132 PRO D CA  1 
ATOM   9361  C  C   . PRO D  1 155 ? 152.051 72.429  93.966  1.00 30.14  ? 132 PRO D C   1 
ATOM   9362  O  O   . PRO D  1 155 ? 152.309 71.225  93.925  1.00 36.06  ? 132 PRO D O   1 
ATOM   9363  C  CB  . PRO D  1 155 ? 154.066 73.866  94.398  1.00 25.17  ? 132 PRO D CB  1 
ATOM   9364  C  CG  . PRO D  1 155 ? 154.976 73.945  95.588  1.00 31.51  ? 132 PRO D CG  1 
ATOM   9365  C  CD  . PRO D  1 155 ? 154.615 72.712  96.407  1.00 33.45  ? 132 PRO D CD  1 
ATOM   9366  N  N   . GLY D  1 156 ? 151.162 73.010  93.172  1.00 33.37  ? 133 GLY D N   1 
ATOM   9367  C  CA  . GLY D  1 156 ? 150.394 72.262  92.193  1.00 23.17  ? 133 GLY D CA  1 
ATOM   9368  C  C   . GLY D  1 156 ? 149.342 73.157  91.581  1.00 25.18  ? 133 GLY D C   1 
ATOM   9369  O  O   . GLY D  1 156 ? 149.428 74.385  91.666  1.00 33.41  ? 133 GLY D O   1 
ATOM   9370  N  N   . SER D  1 157 ? 148.333 72.550  90.973  1.00 26.97  ? 134 SER D N   1 
ATOM   9371  C  CA  . SER D  1 157 ? 147.342 73.324  90.252  1.00 33.29  ? 134 SER D CA  1 
ATOM   9372  C  C   . SER D  1 157 ? 146.037 73.316  91.039  1.00 34.71  ? 134 SER D C   1 
ATOM   9373  O  O   . SER D  1 157 ? 145.756 72.373  91.781  1.00 37.52  ? 134 SER D O   1 
ATOM   9374  C  CB  . SER D  1 157 ? 147.157 72.769  88.845  1.00 32.09  ? 134 SER D CB  1 
ATOM   9375  O  OG  . SER D  1 157 ? 146.724 71.431  88.912  1.00 49.85  ? 134 SER D OG  1 
ATOM   9376  N  N   . VAL D  1 158 ? 145.275 74.395  90.901  1.00 26.50  ? 135 VAL D N   1 
ATOM   9377  C  CA  . VAL D  1 158 ? 143.997 74.552  91.573  1.00 25.84  ? 135 VAL D CA  1 
ATOM   9378  C  C   . VAL D  1 158 ? 142.949 74.957  90.542  1.00 21.41  ? 135 VAL D C   1 
ATOM   9379  O  O   . VAL D  1 158 ? 143.102 75.985  89.877  1.00 20.05  ? 135 VAL D O   1 
ATOM   9380  C  CB  . VAL D  1 158 ? 144.084 75.621  92.682  1.00 30.07  ? 135 VAL D CB  1 
ATOM   9381  C  CG1 . VAL D  1 158 ? 142.727 75.803  93.359  1.00 33.15  ? 135 VAL D CG1 1 
ATOM   9382  C  CG2 . VAL D  1 158 ? 145.148 75.236  93.705  1.00 30.74  ? 135 VAL D CG2 1 
ATOM   9383  N  N   . LYS D  1 159 ? 141.903 74.147  90.385  1.00 21.69  ? 136 LYS D N   1 
ATOM   9384  C  CA  . LYS D  1 159 ? 140.848 74.467  89.417  1.00 28.84  ? 136 LYS D CA  1 
ATOM   9385  C  C   . LYS D  1 159 ? 140.208 75.820  89.749  1.00 29.62  ? 136 LYS D C   1 
ATOM   9386  O  O   . LYS D  1 159 ? 139.809 76.061  90.893  1.00 23.87  ? 136 LYS D O   1 
ATOM   9387  C  CB  . LYS D  1 159 ? 139.785 73.360  89.348  1.00 24.85  ? 136 LYS D CB  1 
ATOM   9388  C  CG  . LYS D  1 159 ? 138.651 73.697  88.372  1.00 25.18  ? 136 LYS D CG  1 
ATOM   9389  C  CD  . LYS D  1 159 ? 137.601 72.588  88.248  1.00 20.38  ? 136 LYS D CD  1 
ATOM   9390  C  CE  . LYS D  1 159 ? 136.857 72.383  89.564  1.00 32.95  ? 136 LYS D CE  1 
ATOM   9391  N  NZ  . LYS D  1 159 ? 135.639 71.515  89.423  1.00 39.66  ? 136 LYS D NZ  1 
ATOM   9392  N  N   . ALA D  1 160 ? 140.116 76.695  88.750  1.00 23.47  ? 137 ALA D N   1 
ATOM   9393  C  CA  . ALA D  1 160 ? 139.673 78.069  88.966  1.00 13.75  ? 137 ALA D CA  1 
ATOM   9394  C  C   . ALA D  1 160 ? 138.518 78.469  88.054  1.00 21.18  ? 137 ALA D C   1 
ATOM   9395  O  O   . ALA D  1 160 ? 138.241 77.811  87.057  1.00 24.07  ? 137 ALA D O   1 
ATOM   9396  C  CB  . ALA D  1 160 ? 140.842 79.033  88.754  1.00 14.75  ? 137 ALA D CB  1 
ATOM   9397  N  N   . TYR D  1 161 ? 137.857 79.567  88.390  1.00 21.56  ? 138 TYR D N   1 
ATOM   9398  C  CA  . TYR D  1 161 ? 136.849 80.152  87.503  1.00 18.64  ? 138 TYR D CA  1 
ATOM   9399  C  C   . TYR D  1 161 ? 137.138 81.632  87.344  1.00 14.14  ? 138 TYR D C   1 
ATOM   9400  O  O   . TYR D  1 161 ? 137.827 82.224  88.167  1.00 18.72  ? 138 TYR D O   1 
ATOM   9401  C  CB  . TYR D  1 161 ? 135.421 79.910  88.005  1.00 16.60  ? 138 TYR D CB  1 
ATOM   9402  C  CG  . TYR D  1 161 ? 135.002 80.673  89.265  1.00 19.70  ? 138 TYR D CG  1 
ATOM   9403  C  CD1 . TYR D  1 161 ? 134.317 81.884  89.185  1.00 19.51  ? 138 TYR D CD1 1 
ATOM   9404  C  CD2 . TYR D  1 161 ? 135.249 80.157  90.525  1.00 21.09  ? 138 TYR D CD2 1 
ATOM   9405  C  CE1 . TYR D  1 161 ? 133.916 82.566  90.339  1.00 19.90  ? 138 TYR D CE1 1 
ATOM   9406  C  CE2 . TYR D  1 161 ? 134.854 80.830  91.673  1.00 16.63  ? 138 TYR D CE2 1 
ATOM   9407  C  CZ  . TYR D  1 161 ? 134.190 82.021  91.576  1.00 19.46  ? 138 TYR D CZ  1 
ATOM   9408  O  OH  . TYR D  1 161 ? 133.801 82.654  92.728  1.00 27.81  ? 138 TYR D OH  1 
ATOM   9409  N  N   . ASN D  1 162 ? 136.626 82.233  86.280  1.00 22.21  ? 139 ASN D N   1 
ATOM   9410  C  CA  . ASN D  1 162 ? 137.074 83.572  85.916  1.00 18.97  ? 139 ASN D CA  1 
ATOM   9411  C  C   . ASN D  1 162 ? 136.066 84.597  86.338  1.00 19.94  ? 139 ASN D C   1 
ATOM   9412  O  O   . ASN D  1 162 ? 134.936 84.569  85.869  1.00 22.90  ? 139 ASN D O   1 
ATOM   9413  C  CB  . ASN D  1 162 ? 137.313 83.675  84.405  1.00 21.38  ? 139 ASN D CB  1 
ATOM   9414  C  CG  . ASN D  1 162 ? 138.051 84.943  84.019  1.00 28.75  ? 139 ASN D CG  1 
ATOM   9415  O  OD1 . ASN D  1 162 ? 138.047 85.940  84.763  1.00 22.45  ? 139 ASN D OD1 1 
ATOM   9416  N  ND2 . ASN D  1 162 ? 138.699 84.915  82.857  1.00 23.30  ? 139 ASN D ND2 1 
ATOM   9417  N  N   . SER D  1 163 ? 136.468 85.517  87.208  1.00 20.60  ? 140 SER D N   1 
ATOM   9418  C  CA  . SER D  1 163 ? 135.520 86.529  87.673  1.00 29.81  ? 140 SER D CA  1 
ATOM   9419  C  C   . SER D  1 163 ? 135.928 87.933  87.267  1.00 25.63  ? 140 SER D C   1 
ATOM   9420  O  O   . SER D  1 163 ? 135.556 88.906  87.913  1.00 24.30  ? 140 SER D O   1 
ATOM   9421  C  CB  . SER D  1 163 ? 135.268 86.434  89.195  1.00 23.97  ? 140 SER D CB  1 
ATOM   9422  O  OG  . SER D  1 163 ? 136.403 86.840  89.940  1.00 29.43  ? 140 SER D OG  1 
ATOM   9423  N  N   . ASN D  1 164 ? 136.660 88.034  86.167  1.00 24.41  ? 141 ASN D N   1 
ATOM   9424  C  CA  . ASN D  1 164 ? 137.107 89.329  85.668  1.00 21.80  ? 141 ASN D CA  1 
ATOM   9425  C  C   . ASN D  1 164 ? 136.007 90.273  85.202  1.00 25.93  ? 141 ASN D C   1 
ATOM   9426  O  O   . ASN D  1 164 ? 136.216 91.487  85.161  1.00 36.86  ? 141 ASN D O   1 
ATOM   9427  C  CB  . ASN D  1 164 ? 138.101 89.142  84.518  1.00 24.08  ? 141 ASN D CB  1 
ATOM   9428  C  CG  . ASN D  1 164 ? 139.528 89.160  84.981  1.00 28.37  ? 141 ASN D CG  1 
ATOM   9429  O  OD1 . ASN D  1 164 ? 139.817 89.547  86.114  1.00 31.35  ? 141 ASN D OD1 1 
ATOM   9430  N  ND2 . ASN D  1 164 ? 140.442 88.759  84.104  1.00 29.35  ? 141 ASN D ND2 1 
ATOM   9431  N  N   . GLY D  1 165 ? 134.854 89.738  84.807  1.00 23.78  ? 142 GLY D N   1 
ATOM   9432  C  CA  . GLY D  1 165 ? 133.818 90.594  84.246  1.00 22.59  ? 142 GLY D CA  1 
ATOM   9433  C  C   . GLY D  1 165 ? 132.428 89.990  84.163  1.00 30.89  ? 142 GLY D C   1 
ATOM   9434  O  O   . GLY D  1 165 ? 131.902 89.462  85.150  1.00 36.42  ? 142 GLY D O   1 
ATOM   9435  N  N   . LEU D  1 166 ? 131.826 90.065  82.979  1.00 22.38  ? 143 LEU D N   1 
ATOM   9436  C  CA  . LEU D  1 166 ? 130.431 89.667  82.815  1.00 22.83  ? 143 LEU D CA  1 
ATOM   9437  C  C   . LEU D  1 166 ? 129.536 90.496  83.757  1.00 21.36  ? 143 LEU D C   1 
ATOM   9438  O  O   . LEU D  1 166 ? 128.593 89.986  84.357  1.00 18.38  ? 143 LEU D O   1 
ATOM   9439  C  CB  . LEU D  1 166 ? 130.251 88.154  83.029  1.00 10.37  ? 143 LEU D CB  1 
ATOM   9440  C  CG  . LEU D  1 166 ? 131.227 87.253  82.256  1.00 21.27  ? 143 LEU D CG  1 
ATOM   9441  C  CD1 . LEU D  1 166 ? 130.673 85.858  82.169  1.00 16.47  ? 143 LEU D CD1 1 
ATOM   9442  C  CD2 . LEU D  1 166 ? 131.510 87.778  80.832  1.00 17.59  ? 143 LEU D CD2 1 
ATOM   9443  N  N   . TRP D  1 167 ? 129.858 91.780  83.879  1.00 19.39  ? 144 TRP D N   1 
ATOM   9444  C  CA  . TRP D  1 167 ? 128.993 92.752  84.543  1.00 20.56  ? 144 TRP D CA  1 
ATOM   9445  C  C   . TRP D  1 167 ? 127.708 93.063  83.768  1.00 31.15  ? 144 TRP D C   1 
ATOM   9446  O  O   . TRP D  1 167 ? 127.360 92.371  82.810  1.00 29.04  ? 144 TRP D O   1 
ATOM   9447  C  CB  . TRP D  1 167 ? 129.776 94.030  84.849  1.00 22.28  ? 144 TRP D CB  1 
ATOM   9448  C  CG  . TRP D  1 167 ? 130.862 93.746  85.836  1.00 28.35  ? 144 TRP D CG  1 
ATOM   9449  C  CD1 . TRP D  1 167 ? 132.181 93.576  85.575  1.00 27.88  ? 144 TRP D CD1 1 
ATOM   9450  C  CD2 . TRP D  1 167 ? 130.697 93.541  87.249  1.00 34.79  ? 144 TRP D CD2 1 
ATOM   9451  N  NE1 . TRP D  1 167 ? 132.860 93.302  86.741  1.00 37.02  ? 144 TRP D NE1 1 
ATOM   9452  C  CE2 . TRP D  1 167 ? 131.968 93.273  87.781  1.00 33.52  ? 144 TRP D CE2 1 
ATOM   9453  C  CE3 . TRP D  1 167 ? 129.592 93.571  88.114  1.00 31.92  ? 144 TRP D CE3 1 
ATOM   9454  C  CZ2 . TRP D  1 167 ? 132.172 93.025  89.138  1.00 34.97  ? 144 TRP D CZ2 1 
ATOM   9455  C  CZ3 . TRP D  1 167 ? 129.793 93.337  89.452  1.00 32.84  ? 144 TRP D CZ3 1 
ATOM   9456  C  CH2 . TRP D  1 167 ? 131.078 93.068  89.957  1.00 35.08  ? 144 TRP D CH2 1 
ATOM   9457  N  N   . LEU D  1 168 ? 127.009 94.111  84.190  1.00 28.75  ? 145 LEU D N   1 
ATOM   9458  C  CA  . LEU D  1 168 ? 125.625 94.318  83.787  1.00 29.80  ? 145 LEU D CA  1 
ATOM   9459  C  C   . LEU D  1 168 ? 125.455 95.028  82.449  1.00 29.98  ? 145 LEU D C   1 
ATOM   9460  O  O   . LEU D  1 168 ? 124.656 95.942  82.341  1.00 35.72  ? 145 LEU D O   1 
ATOM   9461  C  CB  . LEU D  1 168 ? 124.861 95.053  84.894  1.00 27.21  ? 145 LEU D CB  1 
ATOM   9462  C  CG  . LEU D  1 168 ? 124.089 94.151  85.869  1.00 32.08  ? 145 LEU D CG  1 
ATOM   9463  C  CD1 . LEU D  1 168 ? 124.790 92.841  86.103  1.00 26.31  ? 145 LEU D CD1 1 
ATOM   9464  C  CD2 . LEU D  1 168 ? 123.762 94.834  87.206  1.00 28.30  ? 145 LEU D CD2 1 
ATOM   9465  N  N   . LYS D  1 169 ? 126.188 94.584  81.432  1.00 27.44  ? 146 LYS D N   1 
ATOM   9466  C  CA  . LYS D  1 169 ? 126.064 95.143  80.089  1.00 30.54  ? 146 LYS D CA  1 
ATOM   9467  C  C   . LYS D  1 169 ? 124.977 94.393  79.320  1.00 31.69  ? 146 LYS D C   1 
ATOM   9468  O  O   . LYS D  1 169 ? 124.274 93.568  79.892  1.00 28.60  ? 146 LYS D O   1 
ATOM   9469  C  CB  . LYS D  1 169 ? 127.411 95.074  79.355  1.00 25.66  ? 146 LYS D CB  1 
ATOM   9470  C  CG  . LYS D  1 169 ? 128.553 95.747  80.130  1.00 39.53  ? 146 LYS D CG  1 
ATOM   9471  C  CD  . LYS D  1 169 ? 129.847 95.838  79.335  1.00 47.53  ? 146 LYS D CD  1 
ATOM   9472  C  CE  . LYS D  1 169 ? 130.486 94.474  79.157  1.00 56.65  ? 146 LYS D CE  1 
ATOM   9473  N  NZ  . LYS D  1 169 ? 131.676 94.547  78.260  1.00 57.98  ? 146 LYS D NZ  1 
ATOM   9474  N  N   . SER D  1 170 ? 124.830 94.677  78.028  1.00 33.63  ? 147 SER D N   1 
ATOM   9475  C  CA  . SER D  1 170 ? 123.836 93.969  77.219  1.00 26.85  ? 147 SER D CA  1 
ATOM   9476  C  C   . SER D  1 170 ? 124.228 92.500  77.039  1.00 26.00  ? 147 SER D C   1 
ATOM   9477  O  O   . SER D  1 170 ? 125.417 92.152  77.091  1.00 28.09  ? 147 SER D O   1 
ATOM   9478  C  CB  . SER D  1 170 ? 123.682 94.625  75.855  1.00 32.37  ? 147 SER D CB  1 
ATOM   9479  O  OG  . SER D  1 170 ? 124.768 94.287  75.004  1.00 43.19  ? 147 SER D OG  1 
ATOM   9480  N  N   . PRO D  1 171 ? 123.227 91.630  76.830  1.00 21.59  ? 148 PRO D N   1 
ATOM   9481  C  CA  . PRO D  1 171 ? 123.449 90.189  76.616  1.00 19.55  ? 148 PRO D CA  1 
ATOM   9482  C  C   . PRO D  1 171 ? 124.482 89.909  75.514  1.00 22.61  ? 148 PRO D C   1 
ATOM   9483  O  O   . PRO D  1 171 ? 125.388 89.102  75.715  1.00 26.02  ? 148 PRO D O   1 
ATOM   9484  C  CB  . PRO D  1 171 ? 122.064 89.688  76.191  1.00 23.29  ? 148 PRO D CB  1 
ATOM   9485  C  CG  . PRO D  1 171 ? 121.116 90.635  76.911  1.00 23.83  ? 148 PRO D CG  1 
ATOM   9486  C  CD  . PRO D  1 171 ? 121.795 91.984  76.760  1.00 18.38  ? 148 PRO D CD  1 
ATOM   9487  N  N   . ALA D  1 172 ? 124.379 90.591  74.377  1.00 21.78  ? 149 ALA D N   1 
ATOM   9488  C  CA  . ALA D  1 172 ? 125.312 90.329  73.286  1.00 29.91  ? 149 ALA D CA  1 
ATOM   9489  C  C   . ALA D  1 172 ? 126.713 90.794  73.664  1.00 24.03  ? 149 ALA D C   1 
ATOM   9490  O  O   . ALA D  1 172 ? 127.704 90.192  73.262  1.00 32.16  ? 149 ALA D O   1 
ATOM   9491  C  CB  . ALA D  1 172 ? 124.833 90.977  71.963  1.00 26.88  ? 149 ALA D CB  1 
ATOM   9492  N  N   . GLU D  1 173 ? 126.795 91.852  74.460  1.00 25.73  ? 150 GLU D N   1 
ATOM   9493  C  CA  . GLU D  1 173 ? 128.095 92.329  74.922  1.00 22.45  ? 150 GLU D CA  1 
ATOM   9494  C  C   . GLU D  1 173 ? 128.729 91.391  75.960  1.00 25.69  ? 150 GLU D C   1 
ATOM   9495  O  O   . GLU D  1 173 ? 129.943 91.191  75.958  1.00 32.45  ? 150 GLU D O   1 
ATOM   9496  C  CB  . GLU D  1 173 ? 127.995 93.757  75.452  1.00 28.84  ? 150 GLU D CB  1 
ATOM   9497  C  CG  . GLU D  1 173 ? 127.757 94.802  74.356  1.00 50.69  ? 150 GLU D CG  1 
ATOM   9498  C  CD  . GLU D  1 173 ? 127.530 96.214  74.898  1.00 62.10  ? 150 GLU D CD  1 
ATOM   9499  O  OE1 . GLU D  1 173 ? 126.382 96.520  75.292  1.00 66.55  ? 150 GLU D OE1 1 
ATOM   9500  O  OE2 . GLU D  1 173 ? 128.496 97.018  74.918  1.00 61.01  ? 150 GLU D OE2 1 
ATOM   9501  N  N   . VAL D  1 174 ? 127.909 90.800  76.826  1.00 24.02  ? 151 VAL D N   1 
ATOM   9502  C  CA  . VAL D  1 174 ? 128.420 89.875  77.836  1.00 24.48  ? 151 VAL D CA  1 
ATOM   9503  C  C   . VAL D  1 174 ? 128.853 88.553  77.177  1.00 22.56  ? 151 VAL D C   1 
ATOM   9504  O  O   . VAL D  1 174 ? 129.896 87.981  77.508  1.00 30.27  ? 151 VAL D O   1 
ATOM   9505  C  CB  . VAL D  1 174 ? 127.373 89.631  78.953  1.00 23.68  ? 151 VAL D CB  1 
ATOM   9506  C  CG1 . VAL D  1 174 ? 127.899 88.653  79.969  1.00 27.79  ? 151 VAL D CG1 1 
ATOM   9507  C  CG2 . VAL D  1 174 ? 127.012 90.944  79.640  1.00 19.24  ? 151 VAL D CG2 1 
ATOM   9508  N  N   . ALA D  1 175 ? 128.054 88.082  76.224  1.00 20.39  ? 152 ALA D N   1 
ATOM   9509  C  CA  . ALA D  1 175 ? 128.386 86.873  75.489  1.00 22.25  ? 152 ALA D CA  1 
ATOM   9510  C  C   . ALA D  1 175 ? 129.749 87.002  74.793  1.00 24.82  ? 152 ALA D C   1 
ATOM   9511  O  O   . ALA D  1 175 ? 130.562 86.092  74.885  1.00 32.05  ? 152 ALA D O   1 
ATOM   9512  C  CB  . ALA D  1 175 ? 127.289 86.531  74.493  1.00 20.30  ? 152 ALA D CB  1 
ATOM   9513  N  N   . ALA D  1 176 ? 130.015 88.129  74.129  1.00 15.77  ? 153 ALA D N   1 
ATOM   9514  C  CA  . ALA D  1 176 ? 131.344 88.354  73.537  1.00 21.17  ? 153 ALA D CA  1 
ATOM   9515  C  C   . ALA D  1 176 ? 132.468 88.385  74.587  1.00 22.76  ? 153 ALA D C   1 
ATOM   9516  O  O   . ALA D  1 176 ? 133.487 87.701  74.450  1.00 25.78  ? 153 ALA D O   1 
ATOM   9517  C  CB  . ALA D  1 176 ? 131.364 89.641  72.690  1.00 14.83  ? 153 ALA D CB  1 
ATOM   9518  N  N   . GLU D  1 177 ? 132.286 89.180  75.635  1.00 21.09  ? 154 GLU D N   1 
ATOM   9519  C  CA  . GLU D  1 177 ? 133.257 89.220  76.734  1.00 27.18  ? 154 GLU D CA  1 
ATOM   9520  C  C   . GLU D  1 177 ? 133.513 87.822  77.319  1.00 26.14  ? 154 GLU D C   1 
ATOM   9521  O  O   . GLU D  1 177 ? 134.651 87.481  77.642  1.00 27.57  ? 154 GLU D O   1 
ATOM   9522  C  CB  . GLU D  1 177 ? 132.792 90.180  77.821  1.00 27.14  ? 154 GLU D CB  1 
ATOM   9523  C  CG  . GLU D  1 177 ? 133.752 90.352  78.988  1.00 33.29  ? 154 GLU D CG  1 
ATOM   9524  C  CD  . GLU D  1 177 ? 133.454 91.616  79.786  1.00 48.39  ? 154 GLU D CD  1 
ATOM   9525  O  OE1 . GLU D  1 177 ? 133.597 92.722  79.211  1.00 49.49  ? 154 GLU D OE1 1 
ATOM   9526  O  OE2 . GLU D  1 177 ? 133.058 91.507  80.973  1.00 49.02  ? 154 GLU D OE2 1 
ATOM   9527  N  N   . ALA D  1 178 ? 132.464 87.007  77.413  1.00 19.85  ? 155 ALA D N   1 
ATOM   9528  C  CA  . ALA D  1 178 ? 132.610 85.647  77.934  1.00 24.56  ? 155 ALA D CA  1 
ATOM   9529  C  C   . ALA D  1 178 ? 133.595 84.820  77.116  1.00 24.96  ? 155 ALA D C   1 
ATOM   9530  O  O   . ALA D  1 178 ? 134.425 84.091  77.678  1.00 23.01  ? 155 ALA D O   1 
ATOM   9531  C  CB  . ALA D  1 178 ? 131.238 84.934  78.020  1.00 20.61  ? 155 ALA D CB  1 
ATOM   9532  N  N   . VAL D  1 179 ? 133.508 84.919  75.791  1.00 31.89  ? 156 VAL D N   1 
ATOM   9533  C  CA  . VAL D  1 179 ? 134.476 84.233  74.923  1.00 24.42  ? 156 VAL D CA  1 
ATOM   9534  C  C   . VAL D  1 179 ? 135.911 84.573  75.330  1.00 25.04  ? 156 VAL D C   1 
ATOM   9535  O  O   . VAL D  1 179 ? 136.735 83.683  75.517  1.00 31.12  ? 156 VAL D O   1 
ATOM   9536  C  CB  . VAL D  1 179 ? 134.264 84.555  73.430  1.00 26.01  ? 156 VAL D CB  1 
ATOM   9537  C  CG1 . VAL D  1 179 ? 135.404 83.953  72.554  1.00 17.36  ? 156 VAL D CG1 1 
ATOM   9538  C  CG2 . VAL D  1 179 ? 132.927 84.028  72.972  1.00 19.84  ? 156 VAL D CG2 1 
ATOM   9539  N  N   . GLU D  1 180 ? 136.199 85.862  75.482  1.00 24.04  ? 157 GLU D N   1 
ATOM   9540  C  CA  . GLU D  1 180 ? 137.530 86.299  75.885  1.00 25.23  ? 157 GLU D CA  1 
ATOM   9541  C  C   . GLU D  1 180 ? 137.918 85.754  77.259  1.00 26.80  ? 157 GLU D C   1 
ATOM   9542  O  O   . GLU D  1 180 ? 139.047 85.320  77.454  1.00 28.11  ? 157 GLU D O   1 
ATOM   9543  C  CB  . GLU D  1 180 ? 137.639 87.830  75.899  1.00 33.64  ? 157 GLU D CB  1 
ATOM   9544  C  CG  . GLU D  1 180 ? 136.960 88.547  74.741  1.00 56.29  ? 157 GLU D CG  1 
ATOM   9545  C  CD  . GLU D  1 180 ? 136.832 90.057  74.964  1.00 73.14  ? 157 GLU D CD  1 
ATOM   9546  O  OE1 . GLU D  1 180 ? 137.531 90.595  75.855  1.00 77.30  ? 157 GLU D OE1 1 
ATOM   9547  O  OE2 . GLU D  1 180 ? 136.024 90.703  74.252  1.00 75.29  ? 157 GLU D OE2 1 
ATOM   9548  N  N   . LEU D  1 181 ? 136.993 85.792  78.218  1.00 30.57  ? 158 LEU D N   1 
ATOM   9549  C  CA  . LEU D  1 181 ? 137.315 85.379  79.587  1.00 21.93  ? 158 LEU D CA  1 
ATOM   9550  C  C   . LEU D  1 181 ? 137.644 83.896  79.660  1.00 20.20  ? 158 LEU D C   1 
ATOM   9551  O  O   . LEU D  1 181 ? 138.548 83.484  80.389  1.00 22.04  ? 158 LEU D O   1 
ATOM   9552  C  CB  . LEU D  1 181 ? 136.161 85.687  80.533  1.00 25.41  ? 158 LEU D CB  1 
ATOM   9553  C  CG  . LEU D  1 181 ? 135.763 87.159  80.609  1.00 30.28  ? 158 LEU D CG  1 
ATOM   9554  C  CD1 . LEU D  1 181 ? 134.756 87.376  81.741  1.00 22.64  ? 158 LEU D CD1 1 
ATOM   9555  C  CD2 . LEU D  1 181 ? 137.003 88.021  80.794  1.00 21.95  ? 158 LEU D CD2 1 
ATOM   9556  N  N   . LYS D  1 182 ? 136.902 83.085  78.916  1.00 18.72  ? 159 LYS D N   1 
ATOM   9557  C  CA  . LYS D  1 182 ? 137.176 81.665  78.924  1.00 25.51  ? 159 LYS D CA  1 
ATOM   9558  C  C   . LYS D  1 182 ? 138.586 81.466  78.422  1.00 31.46  ? 159 LYS D C   1 
ATOM   9559  O  O   . LYS D  1 182 ? 139.348 80.687  79.001  1.00 37.59  ? 159 LYS D O   1 
ATOM   9560  C  CB  . LYS D  1 182 ? 136.195 80.900  78.048  1.00 26.68  ? 159 LYS D CB  1 
ATOM   9561  C  CG  . LYS D  1 182 ? 136.417 79.401  78.067  1.00 29.69  ? 159 LYS D CG  1 
ATOM   9562  C  CD  . LYS D  1 182 ? 135.360 78.726  77.215  1.00 29.44  ? 159 LYS D CD  1 
ATOM   9563  C  CE  . LYS D  1 182 ? 135.337 77.234  77.413  1.00 40.08  ? 159 LYS D CE  1 
ATOM   9564  N  NZ  . LYS D  1 182 ? 136.665 76.653  77.122  1.00 60.05  ? 159 LYS D NZ  1 
ATOM   9565  N  N   . ALA D  1 183 ? 138.943 82.203  77.366  1.00 26.87  ? 160 ALA D N   1 
ATOM   9566  C  CA  . ALA D  1 183 ? 140.282 82.087  76.756  1.00 30.88  ? 160 ALA D CA  1 
ATOM   9567  C  C   . ALA D  1 183 ? 141.437 82.516  77.674  1.00 27.80  ? 160 ALA D C   1 
ATOM   9568  O  O   . ALA D  1 183 ? 142.559 82.059  77.503  1.00 26.24  ? 160 ALA D O   1 
ATOM   9569  C  CB  . ALA D  1 183 ? 140.349 82.838  75.397  1.00 26.42  ? 160 ALA D CB  1 
ATOM   9570  N  N   . GLU D  1 184 ? 141.174 83.393  78.644  1.00 31.29  ? 161 GLU D N   1 
ATOM   9571  C  CA  . GLU D  1 184 ? 142.232 83.825  79.559  1.00 23.03  ? 161 GLU D CA  1 
ATOM   9572  C  C   . GLU D  1 184 ? 142.746 82.634  80.361  1.00 26.06  ? 161 GLU D C   1 
ATOM   9573  O  O   . GLU D  1 184 ? 143.858 82.661  80.884  1.00 26.79  ? 161 GLU D O   1 
ATOM   9574  C  CB  . GLU D  1 184 ? 141.759 84.949  80.491  1.00 26.54  ? 161 GLU D CB  1 
ATOM   9575  C  CG  . GLU D  1 184 ? 141.608 86.318  79.821  1.00 28.56  ? 161 GLU D CG  1 
ATOM   9576  C  CD  . GLU D  1 184 ? 141.109 87.410  80.772  1.00 42.85  ? 161 GLU D CD  1 
ATOM   9577  O  OE1 . GLU D  1 184 ? 140.257 87.114  81.636  1.00 43.77  ? 161 GLU D OE1 1 
ATOM   9578  O  OE2 . GLU D  1 184 ? 141.564 88.570  80.650  1.00 48.27  ? 161 GLU D OE2 1 
ATOM   9579  N  N   . GLY D  1 185 ? 141.944 81.574  80.431  1.00 22.96  ? 162 GLY D N   1 
ATOM   9580  C  CA  . GLY D  1 185 ? 142.342 80.367  81.137  1.00 18.48  ? 162 GLY D CA  1 
ATOM   9581  C  C   . GLY D  1 185 ? 143.459 79.563  80.483  1.00 27.22  ? 162 GLY D C   1 
ATOM   9582  O  O   . GLY D  1 185 ? 144.016 78.654  81.115  1.00 27.67  ? 162 GLY D O   1 
ATOM   9583  N  N   . GLN D  1 186 ? 143.790 79.904  79.230  1.00 23.11  ? 163 GLN D N   1 
ATOM   9584  C  CA  . GLN D  1 186 ? 144.845 79.226  78.459  1.00 31.00  ? 163 GLN D CA  1 
ATOM   9585  C  C   . GLN D  1 186 ? 144.446 77.809  78.054  1.00 31.89  ? 163 GLN D C   1 
ATOM   9586  O  O   . GLN D  1 186 ? 143.598 77.182  78.692  1.00 28.01  ? 163 GLN D O   1 
ATOM   9587  C  CB  . GLN D  1 186 ? 146.187 79.194  79.218  1.00 28.77  ? 163 GLN D CB  1 
ATOM   9588  C  CG  . GLN D  1 186 ? 146.734 80.568  79.637  1.00 36.54  ? 163 GLN D CG  1 
ATOM   9589  C  CD  . GLN D  1 186 ? 146.839 81.541  78.469  1.00 46.34  ? 163 GLN D CD  1 
ATOM   9590  O  OE1 . GLN D  1 186 ? 147.505 81.264  77.465  1.00 51.98  ? 163 GLN D OE1 1 
ATOM   9591  N  NE2 . GLN D  1 186 ? 146.160 82.683  78.587  1.00 38.09  ? 163 GLN D NE2 1 
ATOM   9592  N  N   . GLY D  1 187 ? 145.067 77.299  77.000  1.00 30.29  ? 164 GLY D N   1 
ATOM   9593  C  CA  . GLY D  1 187 ? 144.792 75.942  76.559  1.00 24.12  ? 164 GLY D CA  1 
ATOM   9594  C  C   . GLY D  1 187 ? 143.314 75.741  76.303  1.00 28.95  ? 164 GLY D C   1 
ATOM   9595  O  O   . GLY D  1 187 ? 142.717 76.463  75.510  1.00 28.71  ? 164 GLY D O   1 
ATOM   9596  N  N   . THR D  1 188 ? 142.711 74.773  76.986  1.00 30.31  ? 165 THR D N   1 
ATOM   9597  C  CA  . THR D  1 188 ? 141.288 74.507  76.806  1.00 31.38  ? 165 THR D CA  1 
ATOM   9598  C  C   . THR D  1 188 ? 140.403 75.529  77.553  1.00 30.60  ? 165 THR D C   1 
ATOM   9599  O  O   . THR D  1 188 ? 139.177 75.454  77.480  1.00 30.27  ? 165 THR D O   1 
ATOM   9600  C  CB  . THR D  1 188 ? 140.933 73.074  77.247  1.00 33.69  ? 165 THR D CB  1 
ATOM   9601  O  OG1 . THR D  1 188 ? 141.335 72.889  78.605  1.00 31.42  ? 165 THR D OG1 1 
ATOM   9602  C  CG2 . THR D  1 188 ? 141.670 72.057  76.387  1.00 31.39  ? 165 THR D CG2 1 
ATOM   9603  N  N   . GLY D  1 189 ? 141.030 76.453  78.287  1.00 25.88  ? 166 GLY D N   1 
ATOM   9604  C  CA  . GLY D  1 189 ? 140.336 77.558  78.940  1.00 23.86  ? 166 GLY D CA  1 
ATOM   9605  C  C   . GLY D  1 189 ? 139.663 77.279  80.283  1.00 18.69  ? 166 GLY D C   1 
ATOM   9606  O  O   . GLY D  1 189 ? 139.669 76.149  80.780  1.00 19.38  ? 166 GLY D O   1 
ATOM   9607  N  N   . PHE D  1 190 ? 139.079 78.323  80.871  1.00 27.43  ? 167 PHE D N   1 
ATOM   9608  C  CA  . PHE D  1 190 ? 138.334 78.199  82.132  1.00 27.83  ? 167 PHE D CA  1 
ATOM   9609  C  C   . PHE D  1 190 ? 137.118 77.293  81.997  1.00 27.35  ? 167 PHE D C   1 
ATOM   9610  O  O   . PHE D  1 190 ? 136.382 77.360  81.001  1.00 24.39  ? 167 PHE D O   1 
ATOM   9611  C  CB  . PHE D  1 190 ? 137.902 79.576  82.657  1.00 20.41  ? 167 PHE D CB  1 
ATOM   9612  C  CG  . PHE D  1 190 ? 138.995 80.310  83.370  1.00 27.61  ? 167 PHE D CG  1 
ATOM   9613  C  CD1 . PHE D  1 190 ? 139.452 79.868  84.600  1.00 28.95  ? 167 PHE D CD1 1 
ATOM   9614  C  CD2 . PHE D  1 190 ? 139.587 81.434  82.804  1.00 27.18  ? 167 PHE D CD2 1 
ATOM   9615  C  CE1 . PHE D  1 190 ? 140.483 80.542  85.258  1.00 24.07  ? 167 PHE D CE1 1 
ATOM   9616  C  CE2 . PHE D  1 190 ? 140.620 82.117  83.461  1.00 23.97  ? 167 PHE D CE2 1 
ATOM   9617  C  CZ  . PHE D  1 190 ? 141.071 81.666  84.676  1.00 20.43  ? 167 PHE D CZ  1 
ATOM   9618  N  N   . LYS D  1 191 ? 136.911 76.448  83.002  1.00 28.51  ? 168 LYS D N   1 
ATOM   9619  C  CA  . LYS D  1 191 ? 135.726 75.602  83.050  1.00 24.85  ? 168 LYS D CA  1 
ATOM   9620  C  C   . LYS D  1 191 ? 134.575 76.313  83.764  1.00 20.06  ? 168 LYS D C   1 
ATOM   9621  O  O   . LYS D  1 191 ? 133.491 75.764  83.902  1.00 20.81  ? 168 LYS D O   1 
ATOM   9622  C  CB  . LYS D  1 191 ? 136.036 74.273  83.737  1.00 29.20  ? 168 LYS D CB  1 
ATOM   9623  C  CG  . LYS D  1 191 ? 137.095 73.413  83.030  1.00 33.19  ? 168 LYS D CG  1 
ATOM   9624  C  CD  . LYS D  1 191 ? 137.575 72.287  83.966  1.00 43.13  ? 168 LYS D CD  1 
ATOM   9625  C  CE  . LYS D  1 191 ? 138.543 71.304  83.292  1.00 50.63  ? 168 LYS D CE  1 
ATOM   9626  N  NZ  . LYS D  1 191 ? 139.834 71.922  82.857  1.00 47.22  ? 168 LYS D NZ  1 
ATOM   9627  N  N   . GLY D  1 192 ? 134.800 77.539  84.219  1.00 17.82  ? 169 GLY D N   1 
ATOM   9628  C  CA  . GLY D  1 192 ? 133.717 78.275  84.841  1.00 13.12  ? 169 GLY D CA  1 
ATOM   9629  C  C   . GLY D  1 192 ? 133.906 79.770  84.749  1.00 22.23  ? 169 GLY D C   1 
ATOM   9630  O  O   . GLY D  1 192 ? 135.035 80.250  84.750  1.00 23.02  ? 169 GLY D O   1 
ATOM   9631  N  N   . LEU D  1 193 ? 132.795 80.504  84.700  1.00 22.10  ? 170 LEU D N   1 
ATOM   9632  C  CA  . LEU D  1 193 ? 132.826 81.959  84.625  1.00 19.58  ? 170 LEU D CA  1 
ATOM   9633  C  C   . LEU D  1 193 ? 131.843 82.532  85.637  1.00 23.70  ? 170 LEU D C   1 
ATOM   9634  O  O   . LEU D  1 193 ? 130.752 82.005  85.804  1.00 17.53  ? 170 LEU D O   1 
ATOM   9635  C  CB  . LEU D  1 193 ? 132.388 82.423  83.234  1.00 20.67  ? 170 LEU D CB  1 
ATOM   9636  C  CG  . LEU D  1 193 ? 133.090 81.804  82.024  1.00 19.75  ? 170 LEU D CG  1 
ATOM   9637  C  CD1 . LEU D  1 193 ? 132.495 82.330  80.736  1.00 17.78  ? 170 LEU D CD1 1 
ATOM   9638  C  CD2 . LEU D  1 193 ? 134.554 82.130  82.106  1.00 17.58  ? 170 LEU D CD2 1 
ATOM   9639  N  N   . LYS D  1 194 ? 132.205 83.625  86.296  1.00 20.16  ? 171 LYS D N   1 
ATOM   9640  C  CA  . LYS D  1 194 ? 131.219 84.307  87.108  1.00 18.24  ? 171 LYS D CA  1 
ATOM   9641  C  C   . LYS D  1 194 ? 130.423 85.301  86.285  1.00 16.60  ? 171 LYS D C   1 
ATOM   9642  O  O   . LYS D  1 194 ? 130.986 86.165  85.614  1.00 20.92  ? 171 LYS D O   1 
ATOM   9643  C  CB  . LYS D  1 194 ? 131.840 85.015  88.307  1.00 19.23  ? 171 LYS D CB  1 
ATOM   9644  C  CG  . LYS D  1 194 ? 130.800 85.709  89.161  1.00 15.91  ? 171 LYS D CG  1 
ATOM   9645  C  CD  . LYS D  1 194 ? 131.335 86.050  90.531  1.00 25.95  ? 171 LYS D CD  1 
ATOM   9646  C  CE  . LYS D  1 194 ? 131.157 84.887  91.473  1.00 30.08  ? 171 LYS D CE  1 
ATOM   9647  N  NZ  . LYS D  1 194 ? 131.914 85.142  92.734  1.00 33.77  ? 171 LYS D NZ  1 
ATOM   9648  N  N   . LEU D  1 195 ? 129.106 85.187  86.381  1.00 12.82  ? 172 LEU D N   1 
ATOM   9649  C  CA  . LEU D  1 195 ? 128.191 86.055  85.659  1.00 20.20  ? 172 LEU D CA  1 
ATOM   9650  C  C   . LEU D  1 195 ? 127.345 86.848  86.661  1.00 25.08  ? 172 LEU D C   1 
ATOM   9651  O  O   . LEU D  1 195 ? 126.621 86.271  87.474  1.00 21.12  ? 172 LEU D O   1 
ATOM   9652  C  CB  . LEU D  1 195 ? 127.280 85.194  84.782  1.00 27.57  ? 172 LEU D CB  1 
ATOM   9653  C  CG  . LEU D  1 195 ? 126.135 85.872  84.042  1.00 30.54  ? 172 LEU D CG  1 
ATOM   9654  C  CD1 . LEU D  1 195 ? 126.645 86.467  82.773  1.00 31.10  ? 172 LEU D CD1 1 
ATOM   9655  C  CD2 . LEU D  1 195 ? 125.069 84.843  83.743  1.00 35.25  ? 172 LEU D CD2 1 
ATOM   9656  N  N   . ARG D  1 196 ? 127.425 88.171  86.592  1.00 13.74  ? 173 ARG D N   1 
ATOM   9657  C  CA  . ARG D  1 196 ? 126.640 89.010  87.475  1.00 17.28  ? 173 ARG D CA  1 
ATOM   9658  C  C   . ARG D  1 196 ? 125.206 89.200  87.000  1.00 23.78  ? 173 ARG D C   1 
ATOM   9659  O  O   . ARG D  1 196 ? 124.955 89.407  85.820  1.00 27.88  ? 173 ARG D O   1 
ATOM   9660  C  CB  . ARG D  1 196 ? 127.321 90.367  87.642  1.00 19.53  ? 173 ARG D CB  1 
ATOM   9661  C  CG  . ARG D  1 196 ? 128.454 90.335  88.630  1.00 18.14  ? 173 ARG D CG  1 
ATOM   9662  C  CD  . ARG D  1 196 ? 129.788 89.865  88.047  1.00 29.93  ? 173 ARG D CD  1 
ATOM   9663  N  NE  . ARG D  1 196 ? 130.795 89.708  89.107  1.00 31.05  ? 173 ARG D NE  1 
ATOM   9664  C  CZ  . ARG D  1 196 ? 132.105 89.561  88.913  1.00 30.42  ? 173 ARG D CZ  1 
ATOM   9665  N  NH1 . ARG D  1 196 ? 132.618 89.542  87.686  1.00 34.03  ? 173 ARG D NH1 1 
ATOM   9666  N  NH2 . ARG D  1 196 ? 132.912 89.426  89.958  1.00 23.38  ? 173 ARG D NH2 1 
ATOM   9667  N  N   . MET D  1 197 ? 124.263 89.129  87.929  1.00 22.51  ? 174 MET D N   1 
ATOM   9668  C  CA  . MET D  1 197 ? 122.872 89.407  87.608  1.00 27.87  ? 174 MET D CA  1 
ATOM   9669  C  C   . MET D  1 197 ? 122.296 90.528  88.474  1.00 27.91  ? 174 MET D C   1 
ATOM   9670  O  O   . MET D  1 197 ? 122.929 90.983  89.421  1.00 20.64  ? 174 MET D O   1 
ATOM   9671  C  CB  . MET D  1 197 ? 122.035 88.144  87.750  1.00 29.18  ? 174 MET D CB  1 
ATOM   9672  C  CG  . MET D  1 197 ? 122.288 87.124  86.654  1.00 25.77  ? 174 MET D CG  1 
ATOM   9673  S  SD  . MET D  1 197 ? 121.063 85.823  86.770  1.00 31.54  ? 174 MET D SD  1 
ATOM   9674  C  CE  . MET D  1 197 ? 121.381 84.877  85.284  1.00 29.96  ? 174 MET D CE  1 
ATOM   9675  N  N   . GLY D  1 198 ? 121.096 90.979  88.137  1.00 27.10  ? 175 GLY D N   1 
ATOM   9676  C  CA  . GLY D  1 198 ? 120.466 92.047  88.879  1.00 23.31  ? 175 GLY D CA  1 
ATOM   9677  C  C   . GLY D  1 198 ? 119.930 93.200  88.052  1.00 28.90  ? 175 GLY D C   1 
ATOM   9678  O  O   . GLY D  1 198 ? 119.601 94.248  88.601  1.00 34.46  ? 175 GLY D O   1 
ATOM   9679  N  N   . ARG D  1 199 ? 119.818 93.013  86.742  1.00 26.81  ? 176 ARG D N   1 
ATOM   9680  C  CA  . ARG D  1 199 ? 119.250 94.049  85.878  1.00 23.79  ? 176 ARG D CA  1 
ATOM   9681  C  C   . ARG D  1 199 ? 117.820 94.415  86.292  1.00 29.78  ? 176 ARG D C   1 
ATOM   9682  O  O   . ARG D  1 199 ? 117.116 93.603  86.899  1.00 31.92  ? 176 ARG D O   1 
ATOM   9683  C  CB  . ARG D  1 199 ? 119.283 93.576  84.418  1.00 14.98  ? 176 ARG D CB  1 
ATOM   9684  C  CG  . ARG D  1 199 ? 120.699 93.251  83.931  1.00 20.83  ? 176 ARG D CG  1 
ATOM   9685  C  CD  . ARG D  1 199 ? 120.717 92.468  82.618  1.00 19.72  ? 176 ARG D CD  1 
ATOM   9686  N  NE  . ARG D  1 199 ? 122.085 92.308  82.129  1.00 26.07  ? 176 ARG D NE  1 
ATOM   9687  C  CZ  . ARG D  1 199 ? 122.957 91.403  82.568  1.00 29.72  ? 176 ARG D CZ  1 
ATOM   9688  N  NH1 . ARG D  1 199 ? 122.623 90.538  83.527  1.00 24.27  ? 176 ARG D NH1 1 
ATOM   9689  N  NH2 . ARG D  1 199 ? 124.179 91.365  82.047  1.00 25.88  ? 176 ARG D NH2 1 
ATOM   9690  N  N   . ASP D  1 200 ? 117.380 95.620  85.949  1.00 32.67  ? 177 ASP D N   1 
ATOM   9691  C  CA  . ASP D  1 200 ? 116.021 96.048  86.277  1.00 37.15  ? 177 ASP D CA  1 
ATOM   9692  C  C   . ASP D  1 200 ? 114.983 95.056  85.801  1.00 34.71  ? 177 ASP D C   1 
ATOM   9693  O  O   . ASP D  1 200 ? 113.970 94.849  86.458  1.00 36.40  ? 177 ASP D O   1 
ATOM   9694  C  CB  . ASP D  1 200 ? 115.723 97.422  85.684  1.00 52.06  ? 177 ASP D CB  1 
ATOM   9695  C  CG  . ASP D  1 200 ? 116.497 98.524  86.369  1.00 68.77  ? 177 ASP D CG  1 
ATOM   9696  O  OD1 . ASP D  1 200 ? 116.702 98.418  87.597  1.00 74.20  ? 177 ASP D OD1 1 
ATOM   9697  O  OD2 . ASP D  1 200 ? 116.907 99.488  85.685  1.00 78.01  ? 177 ASP D OD2 1 
ATOM   9698  N  N   . ASP D  1 201 ? 115.241 94.443  84.652  1.00 34.86  ? 178 ASP D N   1 
ATOM   9699  C  CA  . ASP D  1 201 ? 114.324 93.470  84.071  1.00 27.92  ? 178 ASP D CA  1 
ATOM   9700  C  C   . ASP D  1 201 ? 114.935 92.069  84.159  1.00 32.68  ? 178 ASP D C   1 
ATOM   9701  O  O   . ASP D  1 201 ? 115.880 91.753  83.443  1.00 33.17  ? 178 ASP D O   1 
ATOM   9702  C  CB  . ASP D  1 201 ? 114.008 93.858  82.618  1.00 27.95  ? 178 ASP D CB  1 
ATOM   9703  C  CG  . ASP D  1 201 ? 113.084 92.867  81.923  1.00 44.59  ? 178 ASP D CG  1 
ATOM   9704  O  OD1 . ASP D  1 201 ? 112.597 91.922  82.582  1.00 44.84  ? 178 ASP D OD1 1 
ATOM   9705  O  OD2 . ASP D  1 201 ? 112.836 93.050  80.706  1.00 53.36  ? 178 ASP D OD2 1 
ATOM   9706  N  N   . PRO D  1 202 ? 114.386 91.224  85.047  1.00 32.90  ? 179 PRO D N   1 
ATOM   9707  C  CA  . PRO D  1 202 ? 114.840 89.844  85.283  1.00 30.55  ? 179 PRO D CA  1 
ATOM   9708  C  C   . PRO D  1 202 ? 115.007 89.018  83.985  1.00 34.59  ? 179 PRO D C   1 
ATOM   9709  O  O   . PRO D  1 202 ? 115.947 88.229  83.888  1.00 35.82  ? 179 PRO D O   1 
ATOM   9710  C  CB  . PRO D  1 202 ? 113.712 89.255  86.128  1.00 32.24  ? 179 PRO D CB  1 
ATOM   9711  C  CG  . PRO D  1 202 ? 113.072 90.424  86.778  1.00 32.05  ? 179 PRO D CG  1 
ATOM   9712  C  CD  . PRO D  1 202 ? 113.152 91.532  85.786  1.00 27.98  ? 179 PRO D CD  1 
ATOM   9713  N  N   . ALA D  1 203 ? 114.111 89.197  83.015  1.00 24.92  ? 180 ALA D N   1 
ATOM   9714  C  CA  . ALA D  1 203 ? 114.205 88.499  81.724  1.00 29.51  ? 180 ALA D CA  1 
ATOM   9715  C  C   . ALA D  1 203 ? 115.508 88.776  80.982  1.00 22.69  ? 180 ALA D C   1 
ATOM   9716  O  O   . ALA D  1 203 ? 116.012 87.917  80.263  1.00 27.23  ? 180 ALA D O   1 
ATOM   9717  C  CB  . ALA D  1 203 ? 113.007 88.844  80.822  1.00 27.89  ? 180 ALA D CB  1 
ATOM   9718  N  N   . VAL D  1 204 ? 116.055 89.974  81.142  1.00 20.24  ? 181 VAL D N   1 
ATOM   9719  C  CA  . VAL D  1 204 ? 117.344 90.270  80.526  1.00 13.90  ? 181 VAL D CA  1 
ATOM   9720  C  C   . VAL D  1 204 ? 118.514 89.541  81.236  1.00 32.83  ? 181 VAL D C   1 
ATOM   9721  O  O   . VAL D  1 204 ? 119.507 89.164  80.602  1.00 25.61  ? 181 VAL D O   1 
ATOM   9722  C  CB  . VAL D  1 204 ? 117.583 91.785  80.389  1.00 20.92  ? 181 VAL D CB  1 
ATOM   9723  C  CG1 . VAL D  1 204 ? 118.872 92.062  79.589  1.00 22.57  ? 181 VAL D CG1 1 
ATOM   9724  C  CG2 . VAL D  1 204 ? 116.413 92.419  79.679  1.00 22.61  ? 181 VAL D CG2 1 
ATOM   9725  N  N   . ASP D  1 205 ? 118.402 89.327  82.540  1.00 27.92  ? 182 ASP D N   1 
ATOM   9726  C  CA  . ASP D  1 205 ? 119.376 88.486  83.242  1.00 22.94  ? 182 ASP D CA  1 
ATOM   9727  C  C   . ASP D  1 205 ? 119.417 87.091  82.611  1.00 24.77  ? 182 ASP D C   1 
ATOM   9728  O  O   . ASP D  1 205 ? 120.470 86.493  82.400  1.00 27.80  ? 182 ASP D O   1 
ATOM   9729  C  CB  . ASP D  1 205 ? 118.980 88.325  84.719  1.00 21.73  ? 182 ASP D CB  1 
ATOM   9730  C  CG  . ASP D  1 205 ? 119.418 89.486  85.586  1.00 28.09  ? 182 ASP D CG  1 
ATOM   9731  O  OD1 . ASP D  1 205 ? 120.271 90.286  85.155  1.00 26.27  ? 182 ASP D OD1 1 
ATOM   9732  O  OD2 . ASP D  1 205 ? 118.908 89.583  86.720  1.00 38.45  ? 182 ASP D OD2 1 
ATOM   9733  N  N   . ILE D  1 206 ? 118.242 86.555  82.347  1.00 28.83  ? 183 ILE D N   1 
ATOM   9734  C  CA  . ILE D  1 206 ? 118.124 85.202  81.837  1.00 28.54  ? 183 ILE D CA  1 
ATOM   9735  C  C   . ILE D  1 206 ? 118.623 85.153  80.395  1.00 29.01  ? 183 ILE D C   1 
ATOM   9736  O  O   . ILE D  1 206 ? 119.417 84.289  80.020  1.00 30.01  ? 183 ILE D O   1 
ATOM   9737  C  CB  . ILE D  1 206 ? 116.674 84.745  81.967  1.00 21.87  ? 183 ILE D CB  1 
ATOM   9738  C  CG1 . ILE D  1 206 ? 116.435 84.296  83.409  1.00 24.58  ? 183 ILE D CG1 1 
ATOM   9739  C  CG2 . ILE D  1 206 ? 116.365 83.649  80.993  1.00 13.21  ? 183 ILE D CG2 1 
ATOM   9740  C  CD1 . ILE D  1 206 ? 114.979 84.346  83.817  1.00 29.97  ? 183 ILE D CD1 1 
ATOM   9741  N  N   . GLU D  1 207 ? 118.180 86.116  79.599  1.00 25.52  ? 184 GLU D N   1 
ATOM   9742  C  CA  . GLU D  1 207 ? 118.687 86.291  78.254  1.00 25.15  ? 184 GLU D CA  1 
ATOM   9743  C  C   . GLU D  1 207 ? 120.221 86.321  78.235  1.00 23.33  ? 184 GLU D C   1 
ATOM   9744  O  O   . GLU D  1 207 ? 120.855 85.788  77.331  1.00 27.80  ? 184 GLU D O   1 
ATOM   9745  C  CB  . GLU D  1 207 ? 118.109 87.582  77.674  1.00 37.57  ? 184 GLU D CB  1 
ATOM   9746  C  CG  . GLU D  1 207 ? 118.471 87.850  76.224  1.00 57.87  ? 184 GLU D CG  1 
ATOM   9747  C  CD  . GLU D  1 207 ? 117.871 89.149  75.698  1.00 67.55  ? 184 GLU D CD  1 
ATOM   9748  O  OE1 . GLU D  1 207 ? 116.989 89.723  76.382  1.00 66.37  ? 184 GLU D OE1 1 
ATOM   9749  O  OE2 . GLU D  1 207 ? 118.284 89.591  74.600  1.00 70.59  ? 184 GLU D OE2 1 
ATOM   9750  N  N   . THR D  1 208 ? 120.826 86.953  79.235  1.00 27.83  ? 185 THR D N   1 
ATOM   9751  C  CA  . THR D  1 208 ? 122.279 87.071  79.268  1.00 20.85  ? 185 THR D CA  1 
ATOM   9752  C  C   . THR D  1 208 ? 122.932 85.713  79.527  1.00 23.64  ? 185 THR D C   1 
ATOM   9753  O  O   . THR D  1 208 ? 123.927 85.357  78.895  1.00 18.30  ? 185 THR D O   1 
ATOM   9754  C  CB  . THR D  1 208 ? 122.760 88.081  80.326  1.00 25.65  ? 185 THR D CB  1 
ATOM   9755  O  OG1 . THR D  1 208 ? 122.253 89.385  80.019  1.00 22.64  ? 185 THR D OG1 1 
ATOM   9756  C  CG2 . THR D  1 208 ? 124.278 88.129  80.356  1.00 19.43  ? 185 THR D CG2 1 
ATOM   9757  N  N   . ALA D  1 209 ? 122.371 84.953  80.459  1.00 16.96  ? 186 ALA D N   1 
ATOM   9758  C  CA  . ALA D  1 209 ? 122.890 83.629  80.717  1.00 17.44  ? 186 ALA D CA  1 
ATOM   9759  C  C   . ALA D  1 209 ? 122.806 82.783  79.449  1.00 23.75  ? 186 ALA D C   1 
ATOM   9760  O  O   . ALA D  1 209 ? 123.764 82.090  79.093  1.00 26.80  ? 186 ALA D O   1 
ATOM   9761  C  CB  . ALA D  1 209 ? 122.123 82.957  81.886  1.00 14.33  ? 186 ALA D CB  1 
ATOM   9762  N  N   . GLU D  1 210 ? 121.659 82.832  78.772  1.00 19.31  ? 187 GLU D N   1 
ATOM   9763  C  CA  . GLU D  1 210 ? 121.465 82.037  77.555  1.00 18.73  ? 187 GLU D CA  1 
ATOM   9764  C  C   . GLU D  1 210 ? 122.426 82.454  76.448  1.00 22.89  ? 187 GLU D C   1 
ATOM   9765  O  O   . GLU D  1 210 ? 122.910 81.606  75.709  1.00 24.54  ? 187 GLU D O   1 
ATOM   9766  C  CB  . GLU D  1 210 ? 120.015 82.083  77.058  1.00 24.80  ? 187 GLU D CB  1 
ATOM   9767  C  CG  . GLU D  1 210 ? 119.013 81.394  77.999  1.00 41.70  ? 187 GLU D CG  1 
ATOM   9768  C  CD  . GLU D  1 210 ? 119.338 79.924  78.256  1.00 57.85  ? 187 GLU D CD  1 
ATOM   9769  O  OE1 . GLU D  1 210 ? 119.913 79.278  77.353  1.00 68.91  ? 187 GLU D OE1 1 
ATOM   9770  O  OE2 . GLU D  1 210 ? 119.019 79.416  79.358  1.00 56.51  ? 187 GLU D OE2 1 
ATOM   9771  N  N   . ALA D  1 211 ? 122.718 83.748  76.346  1.00 27.35  ? 188 ALA D N   1 
ATOM   9772  C  CA  . ALA D  1 211 ? 123.640 84.231  75.311  1.00 28.69  ? 188 ALA D CA  1 
ATOM   9773  C  C   . ALA D  1 211 ? 125.054 83.761  75.591  1.00 31.24  ? 188 ALA D C   1 
ATOM   9774  O  O   . ALA D  1 211 ? 125.778 83.343  74.681  1.00 25.81  ? 188 ALA D O   1 
ATOM   9775  C  CB  . ALA D  1 211 ? 123.609 85.751  75.217  1.00 14.22  ? 188 ALA D CB  1 
ATOM   9776  N  N   . VAL D  1 212 ? 125.440 83.849  76.862  1.00 25.43  ? 189 VAL D N   1 
ATOM   9777  C  CA  . VAL D  1 212 ? 126.770 83.443  77.300  1.00 18.04  ? 189 VAL D CA  1 
ATOM   9778  C  C   . VAL D  1 212 ? 126.989 81.953  77.040  1.00 23.26  ? 189 VAL D C   1 
ATOM   9779  O  O   . VAL D  1 212 ? 127.990 81.564  76.439  1.00 26.15  ? 189 VAL D O   1 
ATOM   9780  C  CB  . VAL D  1 212 ? 126.990 83.765  78.792  1.00 16.92  ? 189 VAL D CB  1 
ATOM   9781  C  CG1 . VAL D  1 212 ? 128.196 83.003  79.337  1.00 15.73  ? 189 VAL D CG1 1 
ATOM   9782  C  CG2 . VAL D  1 212 ? 127.145 85.284  78.991  1.00 16.87  ? 189 VAL D CG2 1 
ATOM   9783  N  N   . TRP D  1 213 ? 126.045 81.125  77.485  1.00 12.97  ? 190 TRP D N   1 
ATOM   9784  C  CA  . TRP D  1 213 ? 126.115 79.688  77.224  1.00 14.87  ? 190 TRP D CA  1 
ATOM   9785  C  C   . TRP D  1 213 ? 126.111 79.337  75.742  1.00 26.71  ? 190 TRP D C   1 
ATOM   9786  O  O   . TRP D  1 213 ? 126.756 78.371  75.353  1.00 29.81  ? 190 TRP D O   1 
ATOM   9787  C  CB  . TRP D  1 213 ? 124.956 78.953  77.888  1.00 14.46  ? 190 TRP D CB  1 
ATOM   9788  C  CG  . TRP D  1 213 ? 125.283 78.435  79.241  1.00 23.86  ? 190 TRP D CG  1 
ATOM   9789  C  CD1 . TRP D  1 213 ? 126.505 77.991  79.688  1.00 23.67  ? 190 TRP D CD1 1 
ATOM   9790  C  CD2 . TRP D  1 213 ? 124.388 78.321  80.342  1.00 23.68  ? 190 TRP D CD2 1 
ATOM   9791  N  NE1 . TRP D  1 213 ? 126.405 77.593  81.001  1.00 24.75  ? 190 TRP D NE1 1 
ATOM   9792  C  CE2 . TRP D  1 213 ? 125.117 77.793  81.424  1.00 28.44  ? 190 TRP D CE2 1 
ATOM   9793  C  CE3 . TRP D  1 213 ? 123.037 78.611  80.522  1.00 22.29  ? 190 TRP D CE3 1 
ATOM   9794  C  CZ2 . TRP D  1 213 ? 124.538 77.556  82.657  1.00 25.83  ? 190 TRP D CZ2 1 
ATOM   9795  C  CZ3 . TRP D  1 213 ? 122.471 78.371  81.743  1.00 25.21  ? 190 TRP D CZ3 1 
ATOM   9796  C  CH2 . TRP D  1 213 ? 123.217 77.856  82.795  1.00 24.23  ? 190 TRP D CH2 1 
ATOM   9797  N  N   . ASP D  1 214 ? 125.362 80.086  74.924  1.00 24.68  ? 191 ASP D N   1 
ATOM   9798  C  CA  . ASP D  1 214 ? 125.387 79.862  73.476  1.00 22.81  ? 191 ASP D CA  1 
ATOM   9799  C  C   . ASP D  1 214 ? 126.795 80.112  72.973  1.00 20.18  ? 191 ASP D C   1 
ATOM   9800  O  O   . ASP D  1 214 ? 127.372 79.269  72.291  1.00 26.29  ? 191 ASP D O   1 
ATOM   9801  C  CB  . ASP D  1 214 ? 124.396 80.763  72.728  1.00 31.20  ? 191 ASP D CB  1 
ATOM   9802  C  CG  . ASP D  1 214 ? 122.963 80.213  72.734  1.00 40.32  ? 191 ASP D CG  1 
ATOM   9803  O  OD1 . ASP D  1 214 ? 122.773 79.002  72.969  1.00 46.99  ? 191 ASP D OD1 1 
ATOM   9804  O  OD2 . ASP D  1 214 ? 122.015 80.997  72.506  1.00 43.81  ? 191 ASP D OD2 1 
ATOM   9805  N  N   . ALA D  1 215 ? 127.357 81.262  73.344  1.00 15.36  ? 192 ALA D N   1 
ATOM   9806  C  CA  . ALA D  1 215 ? 128.702 81.642  72.910  1.00 17.81  ? 192 ALA D CA  1 
ATOM   9807  C  C   . ALA D  1 215 ? 129.827 80.680  73.319  1.00 23.67  ? 192 ALA D C   1 
ATOM   9808  O  O   . ALA D  1 215 ? 130.594 80.251  72.468  1.00 26.73  ? 192 ALA D O   1 
ATOM   9809  C  CB  . ALA D  1 215 ? 129.033 83.087  73.354  1.00 22.85  ? 192 ALA D CB  1 
ATOM   9810  N  N   . VAL D  1 216 ? 129.941 80.361  74.611  1.00 22.72  ? 193 VAL D N   1 
ATOM   9811  C  CA  . VAL D  1 216 ? 131.082 79.577  75.098  1.00 18.97  ? 193 VAL D CA  1 
ATOM   9812  C  C   . VAL D  1 216 ? 130.785 78.096  75.269  1.00 19.36  ? 193 VAL D C   1 
ATOM   9813  O  O   . VAL D  1 216 ? 131.704 77.298  75.434  1.00 27.80  ? 193 VAL D O   1 
ATOM   9814  C  CB  . VAL D  1 216 ? 131.657 80.119  76.425  1.00 24.19  ? 193 VAL D CB  1 
ATOM   9815  C  CG1 . VAL D  1 216 ? 132.054 81.579  76.276  1.00 25.68  ? 193 VAL D CG1 1 
ATOM   9816  C  CG2 . VAL D  1 216 ? 130.648 79.909  77.579  1.00 17.61  ? 193 VAL D CG2 1 
ATOM   9817  N  N   . GLY D  1 217 ? 129.510 77.731  75.225  1.00 15.35  ? 194 GLY D N   1 
ATOM   9818  C  CA  . GLY D  1 217 ? 129.108 76.342  75.340  1.00 19.22  ? 194 GLY D CA  1 
ATOM   9819  C  C   . GLY D  1 217 ? 128.533 76.002  76.704  1.00 24.65  ? 194 GLY D C   1 
ATOM   9820  O  O   . GLY D  1 217 ? 129.030 76.470  77.735  1.00 23.39  ? 194 GLY D O   1 
ATOM   9821  N  N   . ARG D  1 218 ? 127.498 75.170  76.719  1.00 17.78  ? 195 ARG D N   1 
ATOM   9822  C  CA  . ARG D  1 218 ? 126.806 74.881  77.967  1.00 25.18  ? 195 ARG D CA  1 
ATOM   9823  C  C   . ARG D  1 218 ? 127.619 74.004  78.900  1.00 24.33  ? 195 ARG D C   1 
ATOM   9824  O  O   . ARG D  1 218 ? 127.247 73.816  80.042  1.00 26.08  ? 195 ARG D O   1 
ATOM   9825  C  CB  . ARG D  1 218 ? 125.430 74.261  77.713  1.00 34.57  ? 195 ARG D CB  1 
ATOM   9826  C  CG  . ARG D  1 218 ? 124.475 75.217  77.031  1.00 49.46  ? 195 ARG D CG  1 
ATOM   9827  C  CD  . ARG D  1 218 ? 123.087 74.634  76.860  1.00 59.29  ? 195 ARG D CD  1 
ATOM   9828  N  NE  . ARG D  1 218 ? 122.188 75.083  77.916  1.00 72.80  ? 195 ARG D NE  1 
ATOM   9829  C  CZ  . ARG D  1 218 ? 121.467 76.198  77.854  1.00 74.47  ? 195 ARG D CZ  1 
ATOM   9830  N  NH1 . ARG D  1 218 ? 121.548 76.978  76.776  1.00 79.69  ? 195 ARG D NH1 1 
ATOM   9831  N  NH2 . ARG D  1 218 ? 120.675 76.532  78.870  1.00 61.72  ? 195 ARG D NH2 1 
ATOM   9832  N  N   . ASP D  1 219 ? 128.730 73.460  78.426  1.00 32.78  ? 196 ASP D N   1 
ATOM   9833  C  CA  . ASP D  1 219 ? 129.574 72.679  79.317  1.00 26.55  ? 196 ASP D CA  1 
ATOM   9834  C  C   . ASP D  1 219 ? 130.313 73.592  80.294  1.00 31.95  ? 196 ASP D C   1 
ATOM   9835  O  O   . ASP D  1 219 ? 130.873 73.129  81.275  1.00 30.01  ? 196 ASP D O   1 
ATOM   9836  C  CB  . ASP D  1 219 ? 130.547 71.794  78.537  1.00 23.54  ? 196 ASP D CB  1 
ATOM   9837  C  CG  . ASP D  1 219 ? 129.845 70.629  77.840  1.00 34.52  ? 196 ASP D CG  1 
ATOM   9838  O  OD1 . ASP D  1 219 ? 128.673 70.339  78.190  1.00 35.18  ? 196 ASP D OD1 1 
ATOM   9839  O  OD2 . ASP D  1 219 ? 130.463 69.999  76.951  1.00 24.29  ? 196 ASP D OD2 1 
ATOM   9840  N  N   . THR D  1 220 ? 130.295 74.894  80.026  1.00 31.64  ? 197 THR D N   1 
ATOM   9841  C  CA  . THR D  1 220 ? 130.971 75.844  80.890  1.00 22.41  ? 197 THR D CA  1 
ATOM   9842  C  C   . THR D  1 220 ? 130.099 76.145  82.097  1.00 26.10  ? 197 THR D C   1 
ATOM   9843  O  O   . THR D  1 220 ? 128.953 76.560  81.940  1.00 25.59  ? 197 THR D O   1 
ATOM   9844  C  CB  . THR D  1 220 ? 131.301 77.133  80.149  1.00 26.45  ? 197 THR D CB  1 
ATOM   9845  O  OG1 . THR D  1 220 ? 132.220 76.845  79.086  1.00 26.79  ? 197 THR D OG1 1 
ATOM   9846  C  CG2 . THR D  1 220 ? 131.949 78.121  81.085  1.00 27.71  ? 197 THR D CG2 1 
ATOM   9847  N  N   . ALA D  1 221 ? 130.621 75.894  83.300  1.00 16.49  ? 198 ALA D N   1 
ATOM   9848  C  CA  . ALA D  1 221 ? 129.896 76.248  84.525  1.00 19.21  ? 198 ALA D CA  1 
ATOM   9849  C  C   . ALA D  1 221 ? 129.698 77.763  84.632  1.00 15.86  ? 198 ALA D C   1 
ATOM   9850  O  O   . ALA D  1 221 ? 130.614 78.537  84.336  1.00 22.03  ? 198 ALA D O   1 
ATOM   9851  C  CB  . ALA D  1 221 ? 130.627 75.717  85.758  1.00 12.71  ? 198 ALA D CB  1 
ATOM   9852  N  N   . LEU D  1 222 ? 128.500 78.179  85.045  1.00 16.77  ? 199 LEU D N   1 
ATOM   9853  C  CA  . LEU D  1 222 ? 128.208 79.590  85.315  1.00 21.15  ? 199 LEU D CA  1 
ATOM   9854  C  C   . LEU D  1 222 ? 127.868 79.766  86.793  1.00 25.10  ? 199 LEU D C   1 
ATOM   9855  O  O   . LEU D  1 222 ? 126.941 79.141  87.305  1.00 20.04  ? 199 LEU D O   1 
ATOM   9856  C  CB  . LEU D  1 222 ? 127.013 80.104  84.480  1.00 21.70  ? 199 LEU D CB  1 
ATOM   9857  C  CG  . LEU D  1 222 ? 127.143 80.273  82.964  1.00 28.91  ? 199 LEU D CG  1 
ATOM   9858  C  CD1 . LEU D  1 222 ? 125.922 80.987  82.368  1.00 26.24  ? 199 LEU D CD1 1 
ATOM   9859  C  CD2 . LEU D  1 222 ? 128.438 81.011  82.598  1.00 20.17  ? 199 LEU D CD2 1 
ATOM   9860  N  N   . MET D  1 223 ? 128.621 80.612  87.476  1.00 25.23  ? 200 MET D N   1 
ATOM   9861  C  CA  . MET D  1 223 ? 128.304 80.977  88.844  1.00 21.81  ? 200 MET D CA  1 
ATOM   9862  C  C   . MET D  1 223 ? 127.631 82.344  88.816  1.00 24.58  ? 200 MET D C   1 
ATOM   9863  O  O   . MET D  1 223 ? 128.238 83.312  88.391  1.00 23.34  ? 200 MET D O   1 
ATOM   9864  C  CB  . MET D  1 223 ? 129.582 81.040  89.670  1.00 14.70  ? 200 MET D CB  1 
ATOM   9865  C  CG  . MET D  1 223 ? 130.249 79.698  89.861  1.00 18.82  ? 200 MET D CG  1 
ATOM   9866  S  SD  . MET D  1 223 ? 131.037 79.021  88.387  1.00 23.83  ? 200 MET D SD  1 
ATOM   9867  C  CE  . MET D  1 223 ? 132.288 78.022  89.199  1.00 13.44  ? 200 MET D CE  1 
ATOM   9868  N  N   . VAL D  1 224 ? 126.379 82.424  89.254  1.00 19.30  ? 201 VAL D N   1 
ATOM   9869  C  CA  . VAL D  1 224 ? 125.642 83.690  89.232  1.00 24.00  ? 201 VAL D CA  1 
ATOM   9870  C  C   . VAL D  1 224 ? 125.728 84.463  90.551  1.00 24.55  ? 201 VAL D C   1 
ATOM   9871  O  O   . VAL D  1 224 ? 125.488 83.905  91.623  1.00 22.63  ? 201 VAL D O   1 
ATOM   9872  C  CB  . VAL D  1 224 ? 124.168 83.461  88.847  1.00 24.14  ? 201 VAL D CB  1 
ATOM   9873  C  CG1 . VAL D  1 224 ? 123.282 84.505  89.445  1.00 24.55  ? 201 VAL D CG1 1 
ATOM   9874  C  CG2 . VAL D  1 224 ? 124.026 83.433  87.317  1.00 29.03  ? 201 VAL D CG2 1 
ATOM   9875  N  N   . ASP D  1 225 ? 126.079 85.745  90.462  1.00 17.20  ? 202 ASP D N   1 
ATOM   9876  C  CA  . ASP D  1 225 ? 126.220 86.604  91.648  1.00 22.57  ? 202 ASP D CA  1 
ATOM   9877  C  C   . ASP D  1 225 ? 125.308 87.844  91.578  1.00 17.06  ? 202 ASP D C   1 
ATOM   9878  O  O   . ASP D  1 225 ? 125.338 88.583  90.608  1.00 23.37  ? 202 ASP D O   1 
ATOM   9879  C  CB  . ASP D  1 225 ? 127.686 87.019  91.831  1.00 19.10  ? 202 ASP D CB  1 
ATOM   9880  C  CG  . ASP D  1 225 ? 127.994 87.548  93.246  1.00 26.08  ? 202 ASP D CG  1 
ATOM   9881  O  OD1 . ASP D  1 225 ? 127.065 87.880  94.021  1.00 23.55  ? 202 ASP D OD1 1 
ATOM   9882  O  OD2 . ASP D  1 225 ? 129.191 87.647  93.580  1.00 26.22  ? 202 ASP D OD2 1 
ATOM   9883  N  N   . PHE D  1 226 ? 124.480 88.042  92.604  1.00 23.25  ? 203 PHE D N   1 
ATOM   9884  C  CA  . PHE D  1 226 ? 123.550 89.177  92.674  1.00 13.35  ? 203 PHE D CA  1 
ATOM   9885  C  C   . PHE D  1 226 ? 124.125 90.290  93.551  1.00 19.03  ? 203 PHE D C   1 
ATOM   9886  O  O   . PHE D  1 226 ? 123.542 91.371  93.665  1.00 14.29  ? 203 PHE D O   1 
ATOM   9887  C  CB  . PHE D  1 226 ? 122.219 88.723  93.290  1.00 21.78  ? 203 PHE D CB  1 
ATOM   9888  C  CG  . PHE D  1 226 ? 121.285 88.018  92.329  1.00 21.15  ? 203 PHE D CG  1 
ATOM   9889  C  CD1 . PHE D  1 226 ? 120.463 88.749  91.474  1.00 25.76  ? 203 PHE D CD1 1 
ATOM   9890  C  CD2 . PHE D  1 226 ? 121.204 86.635  92.307  1.00 15.35  ? 203 PHE D CD2 1 
ATOM   9891  C  CE1 . PHE D  1 226 ? 119.588 88.109  90.591  1.00 24.36  ? 203 PHE D CE1 1 
ATOM   9892  C  CE2 . PHE D  1 226 ? 120.340 85.985  91.427  1.00 24.58  ? 203 PHE D CE2 1 
ATOM   9893  C  CZ  . PHE D  1 226 ? 119.524 86.729  90.572  1.00 21.10  ? 203 PHE D CZ  1 
ATOM   9894  N  N   . ASN D  1 227 ? 125.255 90.018  94.202  1.00 21.67  ? 204 ASN D N   1 
ATOM   9895  C  CA  . ASN D  1 227 ? 125.900 91.031  95.041  1.00 18.90  ? 204 ASN D CA  1 
ATOM   9896  C  C   . ASN D  1 227 ? 124.930 91.728  95.986  1.00 19.35  ? 204 ASN D C   1 
ATOM   9897  O  O   . ASN D  1 227 ? 124.913 92.953  96.064  1.00 22.79  ? 204 ASN D O   1 
ATOM   9898  C  CB  . ASN D  1 227 ? 126.630 92.082  94.185  1.00 13.73  ? 204 ASN D CB  1 
ATOM   9899  C  CG  . ASN D  1 227 ? 127.943 91.564  93.631  1.00 31.28  ? 204 ASN D CG  1 
ATOM   9900  O  OD1 . ASN D  1 227 ? 128.931 91.453  94.369  1.00 36.51  ? 204 ASN D OD1 1 
ATOM   9901  N  ND2 . ASN D  1 227 ? 127.963 91.226  92.330  1.00 26.82  ? 204 ASN D ND2 1 
ATOM   9902  N  N   . GLN D  1 228 ? 124.128 90.937  96.695  1.00 23.53  ? 205 GLN D N   1 
ATOM   9903  C  CA  . GLN D  1 228 ? 123.244 91.441  97.753  1.00 21.80  ? 205 GLN D CA  1 
ATOM   9904  C  C   . GLN D  1 228 ? 122.236 92.484  97.266  1.00 23.14  ? 205 GLN D C   1 
ATOM   9905  O  O   . GLN D  1 228 ? 121.682 93.224  98.077  1.00 26.91  ? 205 GLN D O   1 
ATOM   9906  C  CB  . GLN D  1 228 ? 124.056 92.060  98.901  1.00 17.44  ? 205 GLN D CB  1 
ATOM   9907  C  CG  . GLN D  1 228 ? 125.148 91.194  99.476  1.00 17.09  ? 205 GLN D CG  1 
ATOM   9908  C  CD  . GLN D  1 228 ? 125.947 91.933  100.548 1.00 27.24  ? 205 GLN D CD  1 
ATOM   9909  O  OE1 . GLN D  1 228 ? 125.428 92.250  101.611 1.00 35.01  ? 205 GLN D OE1 1 
ATOM   9910  N  NE2 . GLN D  1 228 ? 127.204 92.229  100.258 1.00 20.26  ? 205 GLN D NE2 1 
ATOM   9911  N  N   . GLY D  1 229 ? 121.996 92.557  95.959  1.00 24.22  ? 206 GLY D N   1 
ATOM   9912  C  CA  . GLY D  1 229 ? 121.174 93.631  95.412  1.00 19.75  ? 206 GLY D CA  1 
ATOM   9913  C  C   . GLY D  1 229 ? 119.662 93.482  95.522  1.00 27.98  ? 206 GLY D C   1 
ATOM   9914  O  O   . GLY D  1 229 ? 118.920 94.384  95.122  1.00 27.38  ? 206 GLY D O   1 
ATOM   9915  N  N   . LEU D  1 230 ? 119.191 92.362  96.071  1.00 21.30  ? 207 LEU D N   1 
ATOM   9916  C  CA  . LEU D  1 230 ? 117.758 92.110  96.125  1.00 19.74  ? 207 LEU D CA  1 
ATOM   9917  C  C   . LEU D  1 230 ? 117.218 92.130  97.558  1.00 23.96  ? 207 LEU D C   1 
ATOM   9918  O  O   . LEU D  1 230 ? 117.906 91.702  98.486  1.00 26.95  ? 207 LEU D O   1 
ATOM   9919  C  CB  . LEU D  1 230 ? 117.448 90.751  95.491  1.00 16.21  ? 207 LEU D CB  1 
ATOM   9920  C  CG  . LEU D  1 230 ? 118.130 90.410  94.165  1.00 19.83  ? 207 LEU D CG  1 
ATOM   9921  C  CD1 . LEU D  1 230 ? 117.795 88.977  93.795  1.00 13.42  ? 207 LEU D CD1 1 
ATOM   9922  C  CD2 . LEU D  1 230 ? 117.685 91.353  93.083  1.00 17.75  ? 207 LEU D CD2 1 
ATOM   9923  N  N   . ASP D  1 231 ? 115.983 92.599  97.740  1.00 21.62  ? 208 ASP D N   1 
ATOM   9924  C  CA  . ASP D  1 231 ? 115.279 92.346  98.999  1.00 24.28  ? 208 ASP D CA  1 
ATOM   9925  C  C   . ASP D  1 231 ? 114.655 90.945  98.927  1.00 18.63  ? 208 ASP D C   1 
ATOM   9926  O  O   . ASP D  1 231 ? 114.609 90.354  97.853  1.00 19.03  ? 208 ASP D O   1 
ATOM   9927  C  CB  . ASP D  1 231 ? 114.252 93.443  99.344  1.00 22.63  ? 208 ASP D CB  1 
ATOM   9928  C  CG  . ASP D  1 231 ? 112.955 93.349  98.519  1.00 38.39  ? 208 ASP D CG  1 
ATOM   9929  O  OD1 . ASP D  1 231 ? 112.668 92.302  97.897  1.00 28.23  ? 208 ASP D OD1 1 
ATOM   9930  O  OD2 . ASP D  1 231 ? 112.193 94.342  98.510  1.00 48.67  ? 208 ASP D OD2 1 
ATOM   9931  N  N   . MET D  1 232 ? 114.205 90.408  100.062 1.00 16.44  ? 209 MET D N   1 
ATOM   9932  C  CA  . MET D  1 232 ? 113.649 89.056  100.107 1.00 16.41  ? 209 MET D CA  1 
ATOM   9933  C  C   . MET D  1 232 ? 112.562 88.733  99.078  1.00 19.89  ? 209 MET D C   1 
ATOM   9934  O  O   . MET D  1 232 ? 112.614 87.685  98.439  1.00 29.82  ? 209 MET D O   1 
ATOM   9935  C  CB  . MET D  1 232 ? 113.157 88.710  101.517 1.00 18.57  ? 209 MET D CB  1 
ATOM   9936  C  CG  . MET D  1 232 ? 114.214 88.009  102.369 1.00 28.52  ? 209 MET D CG  1 
ATOM   9937  S  SD  . MET D  1 232 ? 114.916 86.533  101.597 1.00 29.15  ? 209 MET D SD  1 
ATOM   9938  C  CE  . MET D  1 232 ? 113.500 85.427  101.649 1.00 15.83  ? 209 MET D CE  1 
ATOM   9939  N  N   . ALA D  1 233 ? 111.568 89.604  98.929  1.00 23.46  ? 210 ALA D N   1 
ATOM   9940  C  CA  . ALA D  1 233 ? 110.495 89.343  97.968  1.00 21.53  ? 210 ALA D CA  1 
ATOM   9941  C  C   . ALA D  1 233 ? 111.038 89.236  96.534  1.00 24.65  ? 210 ALA D C   1 
ATOM   9942  O  O   . ALA D  1 233 ? 110.681 88.313  95.804  1.00 27.98  ? 210 ALA D O   1 
ATOM   9943  C  CB  . ALA D  1 233 ? 109.429 90.396  98.066  1.00 21.72  ? 210 ALA D CB  1 
ATOM   9944  N  N   . GLU D  1 234 ? 111.912 90.166  96.145  1.00 17.45  ? 211 GLU D N   1 
ATOM   9945  C  CA  . GLU D  1 234 ? 112.584 90.107  94.845  1.00 24.29  ? 211 GLU D CA  1 
ATOM   9946  C  C   . GLU D  1 234 ? 113.416 88.832  94.722  1.00 24.79  ? 211 GLU D C   1 
ATOM   9947  O  O   . GLU D  1 234 ? 113.487 88.240  93.654  1.00 19.30  ? 211 GLU D O   1 
ATOM   9948  C  CB  . GLU D  1 234 ? 113.505 91.320  94.629  1.00 31.52  ? 211 GLU D CB  1 
ATOM   9949  C  CG  . GLU D  1 234 ? 112.790 92.677  94.470  1.00 37.19  ? 211 GLU D CG  1 
ATOM   9950  C  CD  . GLU D  1 234 ? 113.765 93.862  94.379  1.00 47.25  ? 211 GLU D CD  1 
ATOM   9951  O  OE1 . GLU D  1 234 ? 114.727 93.920  95.186  1.00 37.80  ? 211 GLU D OE1 1 
ATOM   9952  O  OE2 . GLU D  1 234 ? 113.578 94.730  93.490  1.00 54.97  ? 211 GLU D OE2 1 
ATOM   9953  N  N   . ALA D  1 235 ? 114.047 88.412  95.814  1.00 16.18  ? 212 ALA D N   1 
ATOM   9954  C  CA  . ALA D  1 235 ? 114.892 87.220  95.776  1.00 13.55  ? 212 ALA D CA  1 
ATOM   9955  C  C   . ALA D  1 235 ? 114.069 85.954  95.549  1.00 25.46  ? 212 ALA D C   1 
ATOM   9956  O  O   . ALA D  1 235 ? 114.484 85.051  94.811  1.00 23.98  ? 212 ALA D O   1 
ATOM   9957  C  CB  . ALA D  1 235 ? 115.706 87.094  97.058  1.00 9.88   ? 212 ALA D CB  1 
ATOM   9958  N  N   . MET D  1 236 ? 112.913 85.885  96.204  1.00 17.25  ? 213 MET D N   1 
ATOM   9959  C  CA  . MET D  1 236 ? 112.050 84.729  96.074  1.00 18.79  ? 213 MET D CA  1 
ATOM   9960  C  C   . MET D  1 236 ? 111.624 84.572  94.621  1.00 18.55  ? 213 MET D C   1 
ATOM   9961  O  O   . MET D  1 236 ? 111.721 83.489  94.051  1.00 26.34  ? 213 MET D O   1 
ATOM   9962  C  CB  . MET D  1 236 ? 110.832 84.825  97.003  1.00 13.23  ? 213 MET D CB  1 
ATOM   9963  C  CG  . MET D  1 236 ? 111.172 84.714  98.486  1.00 17.32  ? 213 MET D CG  1 
ATOM   9964  S  SD  . MET D  1 236 ? 109.729 84.665  99.598  1.00 26.23  ? 213 MET D SD  1 
ATOM   9965  C  CE  . MET D  1 236 ? 108.937 83.125  99.079  1.00 23.19  ? 213 MET D CE  1 
ATOM   9966  N  N   . HIS D  1 237 ? 111.191 85.662  94.008  1.00 19.40  ? 214 HIS D N   1 
ATOM   9967  C  CA  . HIS D  1 237 ? 110.768 85.608  92.612  1.00 22.35  ? 214 HIS D CA  1 
ATOM   9968  C  C   . HIS D  1 237 ? 111.901 85.306  91.642  1.00 21.99  ? 214 HIS D C   1 
ATOM   9969  O  O   . HIS D  1 237 ? 111.776 84.415  90.804  1.00 19.69  ? 214 HIS D O   1 
ATOM   9970  C  CB  . HIS D  1 237 ? 110.054 86.906  92.215  1.00 24.62  ? 214 HIS D CB  1 
ATOM   9971  C  CG  . HIS D  1 237 ? 108.733 87.083  92.896  1.00 26.79  ? 214 HIS D CG  1 
ATOM   9972  N  ND1 . HIS D  1 237 ? 108.491 88.092  93.803  1.00 26.69  ? 214 HIS D ND1 1 
ATOM   9973  C  CD2 . HIS D  1 237 ? 107.593 86.353  92.827  1.00 24.57  ? 214 HIS D CD2 1 
ATOM   9974  C  CE1 . HIS D  1 237 ? 107.249 87.991  94.245  1.00 34.84  ? 214 HIS D CE1 1 
ATOM   9975  N  NE2 . HIS D  1 237 ? 106.682 86.943  93.671  1.00 36.23  ? 214 HIS D NE2 1 
ATOM   9976  N  N   . ARG D  1 238 ? 113.010 86.032  91.776  1.00 14.07  ? 215 ARG D N   1 
ATOM   9977  C  CA  . ARG D  1 238 ? 114.067 85.969  90.781  1.00 20.02  ? 215 ARG D CA  1 
ATOM   9978  C  C   . ARG D  1 238 ? 114.883 84.692  90.870  1.00 22.01  ? 215 ARG D C   1 
ATOM   9979  O  O   . ARG D  1 238 ? 115.231 84.099  89.857  1.00 23.27  ? 215 ARG D O   1 
ATOM   9980  C  CB  . ARG D  1 238 ? 114.981 87.174  90.912  1.00 20.16  ? 215 ARG D CB  1 
ATOM   9981  C  CG  . ARG D  1 238 ? 114.361 88.480  90.432  1.00 22.98  ? 215 ARG D CG  1 
ATOM   9982  C  CD  . ARG D  1 238 ? 115.384 89.563  90.637  1.00 25.07  ? 215 ARG D CD  1 
ATOM   9983  N  NE  . ARG D  1 238 ? 114.990 90.838  90.085  1.00 33.44  ? 215 ARG D NE  1 
ATOM   9984  C  CZ  . ARG D  1 238 ? 115.661 91.464  89.128  1.00 31.72  ? 215 ARG D CZ  1 
ATOM   9985  N  NH1 . ARG D  1 238 ? 116.753 90.915  88.604  1.00 22.47  ? 215 ARG D NH1 1 
ATOM   9986  N  NH2 . ARG D  1 238 ? 115.231 92.635  88.698  1.00 35.68  ? 215 ARG D NH2 1 
ATOM   9987  N  N   . THR D  1 239 ? 115.192 84.263  92.085  1.00 22.14  ? 216 THR D N   1 
ATOM   9988  C  CA  . THR D  1 239 ? 115.956 83.035  92.226  1.00 22.63  ? 216 THR D CA  1 
ATOM   9989  C  C   . THR D  1 239 ? 115.107 81.850  91.762  1.00 19.37  ? 216 THR D C   1 
ATOM   9990  O  O   . THR D  1 239 ? 115.623 80.909  91.185  1.00 18.91  ? 216 THR D O   1 
ATOM   9991  C  CB  . THR D  1 239 ? 116.524 82.842  93.656  1.00 16.30  ? 216 THR D CB  1 
ATOM   9992  O  OG1 . THR D  1 239 ? 115.459 82.654  94.581  1.00 21.29  ? 216 THR D OG1 1 
ATOM   9993  C  CG2 . THR D  1 239 ? 117.342 84.078  94.073  1.00 12.61  ? 216 THR D CG2 1 
ATOM   9994  N  N   . ARG D  1 240 ? 113.800 81.920  91.990  1.00 19.44  ? 217 ARG D N   1 
ATOM   9995  C  CA  . ARG D  1 240 ? 112.903 80.883  91.515  1.00 19.95  ? 217 ARG D CA  1 
ATOM   9996  C  C   . ARG D  1 240 ? 112.961 80.817  89.987  1.00 29.86  ? 217 ARG D C   1 
ATOM   9997  O  O   . ARG D  1 240 ? 113.025 79.730  89.420  1.00 28.91  ? 217 ARG D O   1 
ATOM   9998  C  CB  . ARG D  1 240 ? 111.461 81.123  91.990  1.00 15.40  ? 217 ARG D CB  1 
ATOM   9999  C  CG  . ARG D  1 240 ? 110.499 79.989  91.648  1.00 19.95  ? 217 ARG D CG  1 
ATOM   10000 C  CD  . ARG D  1 240 ? 109.060 80.391  91.951  1.00 27.06  ? 217 ARG D CD  1 
ATOM   10001 N  NE  . ARG D  1 240 ? 108.090 79.359  91.583  1.00 31.96  ? 217 ARG D NE  1 
ATOM   10002 C  CZ  . ARG D  1 240 ? 106.785 79.431  91.862  1.00 33.11  ? 217 ARG D CZ  1 
ATOM   10003 N  NH1 . ARG D  1 240 ? 106.284 80.483  92.520  1.00 22.30  ? 217 ARG D NH1 1 
ATOM   10004 N  NH2 . ARG D  1 240 ? 105.976 78.446  91.495  1.00 27.77  ? 217 ARG D NH2 1 
ATOM   10005 N  N   . GLN D  1 241 ? 112.972 81.975  89.328  1.00 23.41  ? 218 GLN D N   1 
ATOM   10006 C  CA  . GLN D  1 241 ? 112.974 82.015  87.866  1.00 21.37  ? 218 GLN D CA  1 
ATOM   10007 C  C   . GLN D  1 241 ? 114.209 81.362  87.271  1.00 20.99  ? 218 GLN D C   1 
ATOM   10008 O  O   . GLN D  1 241 ? 114.162 80.878  86.152  1.00 28.93  ? 218 GLN D O   1 
ATOM   10009 C  CB  . GLN D  1 241 ? 112.922 83.442  87.342  1.00 29.46  ? 218 GLN D CB  1 
ATOM   10010 C  CG  . GLN D  1 241 ? 111.574 84.089  87.309  1.00 46.78  ? 218 GLN D CG  1 
ATOM   10011 C  CD  . GLN D  1 241 ? 111.696 85.568  86.985  1.00 56.37  ? 218 GLN D CD  1 
ATOM   10012 O  OE1 . GLN D  1 241 ? 112.488 85.957  86.117  1.00 50.18  ? 218 GLN D OE1 1 
ATOM   10013 N  NE2 . GLN D  1 241 ? 110.937 86.404  87.703  1.00 54.48  ? 218 GLN D NE2 1 
ATOM   10014 N  N   . ILE D  1 242 ? 115.320 81.375  87.997  1.00 19.24  ? 219 ILE D N   1 
ATOM   10015 C  CA  . ILE D  1 242 ? 116.551 80.836  87.441  1.00 20.89  ? 219 ILE D CA  1 
ATOM   10016 C  C   . ILE D  1 242 ? 116.909 79.485  88.015  1.00 19.51  ? 219 ILE D C   1 
ATOM   10017 O  O   . ILE D  1 242 ? 117.939 78.923  87.650  1.00 24.50  ? 219 ILE D O   1 
ATOM   10018 C  CB  . ILE D  1 242 ? 117.763 81.783  87.621  1.00 18.70  ? 219 ILE D CB  1 
ATOM   10019 C  CG1 . ILE D  1 242 ? 117.979 82.121  89.096  1.00 23.22  ? 219 ILE D CG1 1 
ATOM   10020 C  CG2 . ILE D  1 242 ? 117.585 83.062  86.830  1.00 14.69  ? 219 ILE D CG2 1 
ATOM   10021 C  CD1 . ILE D  1 242 ? 119.087 83.170  89.289  1.00 22.18  ? 219 ILE D CD1 1 
ATOM   10022 N  N   . ASP D  1 243 ? 116.062 78.955  88.896  1.00 21.89  ? 220 ASP D N   1 
ATOM   10023 C  CA  . ASP D  1 243 ? 116.389 77.714  89.624  1.00 20.56  ? 220 ASP D CA  1 
ATOM   10024 C  C   . ASP D  1 243 ? 116.583 76.517  88.687  1.00 20.18  ? 220 ASP D C   1 
ATOM   10025 O  O   . ASP D  1 243 ? 117.279 75.568  89.022  1.00 20.76  ? 220 ASP D O   1 
ATOM   10026 C  CB  . ASP D  1 243 ? 115.304 77.402  90.669  1.00 20.59  ? 220 ASP D CB  1 
ATOM   10027 C  CG  . ASP D  1 243 ? 115.801 76.482  91.784  1.00 27.19  ? 220 ASP D CG  1 
ATOM   10028 O  OD1 . ASP D  1 243 ? 117.023 76.414  91.997  1.00 23.91  ? 220 ASP D OD1 1 
ATOM   10029 O  OD2 . ASP D  1 243 ? 114.966 75.841  92.463  1.00 35.21  ? 220 ASP D OD2 1 
ATOM   10030 N  N   . ASP D  1 244 ? 115.973 76.564  87.504  1.00 16.58  ? 221 ASP D N   1 
ATOM   10031 C  CA  . ASP D  1 244 ? 116.062 75.440  86.573  1.00 24.32  ? 221 ASP D CA  1 
ATOM   10032 C  C   . ASP D  1 244 ? 116.973 75.700  85.378  1.00 26.58  ? 221 ASP D C   1 
ATOM   10033 O  O   . ASP D  1 244 ? 116.937 74.959  84.410  1.00 31.14  ? 221 ASP D O   1 
ATOM   10034 C  CB  . ASP D  1 244 ? 114.662 75.011  86.086  1.00 35.16  ? 221 ASP D CB  1 
ATOM   10035 C  CG  . ASP D  1 244 ? 113.740 74.548  87.235  1.00 48.28  ? 221 ASP D CG  1 
ATOM   10036 O  OD1 . ASP D  1 244 ? 114.124 73.642  88.011  1.00 43.24  ? 221 ASP D OD1 1 
ATOM   10037 O  OD2 . ASP D  1 244 ? 112.622 75.099  87.365  1.00 62.40  ? 221 ASP D OD2 1 
ATOM   10038 N  N   . LEU D  1 245 ? 117.799 76.737  85.449  1.00 26.81  ? 222 LEU D N   1 
ATOM   10039 C  CA  . LEU D  1 245 ? 118.694 77.065  84.341  1.00 18.15  ? 222 LEU D CA  1 
ATOM   10040 C  C   . LEU D  1 245 ? 119.910 76.159  84.234  1.00 30.08  ? 222 LEU D C   1 
ATOM   10041 O  O   . LEU D  1 245 ? 120.504 76.057  83.158  1.00 31.70  ? 222 LEU D O   1 
ATOM   10042 C  CB  . LEU D  1 245 ? 119.186 78.500  84.451  1.00 21.06  ? 222 LEU D CB  1 
ATOM   10043 C  CG  . LEU D  1 245 ? 118.212 79.609  84.091  1.00 34.91  ? 222 LEU D CG  1 
ATOM   10044 C  CD1 . LEU D  1 245 ? 118.940 80.936  84.124  1.00 27.11  ? 222 LEU D CD1 1 
ATOM   10045 C  CD2 . LEU D  1 245 ? 117.686 79.338  82.710  1.00 40.47  ? 222 LEU D CD2 1 
ATOM   10046 N  N   . GLY D  1 246 ? 120.304 75.536  85.347  1.00 29.65  ? 223 GLY D N   1 
ATOM   10047 C  CA  . GLY D  1 246 ? 121.516 74.731  85.389  1.00 18.76  ? 223 GLY D CA  1 
ATOM   10048 C  C   . GLY D  1 246 ? 122.761 75.489  85.863  1.00 21.92  ? 223 GLY D C   1 
ATOM   10049 O  O   . GLY D  1 246 ? 123.898 75.158  85.490  1.00 20.69  ? 223 GLY D O   1 
ATOM   10050 N  N   . LEU D  1 247 ? 122.564 76.515  86.679  1.00 18.69  ? 224 LEU D N   1 
ATOM   10051 C  CA  . LEU D  1 247 ? 123.691 77.311  87.173  1.00 21.08  ? 224 LEU D CA  1 
ATOM   10052 C  C   . LEU D  1 247 ? 124.553 76.480  88.130  1.00 22.04  ? 224 LEU D C   1 
ATOM   10053 O  O   . LEU D  1 247 ? 124.046 75.581  88.801  1.00 21.22  ? 224 LEU D O   1 
ATOM   10054 C  CB  . LEU D  1 247 ? 123.174 78.572  87.868  1.00 16.62  ? 224 LEU D CB  1 
ATOM   10055 C  CG  . LEU D  1 247 ? 122.250 79.428  86.998  1.00 23.69  ? 224 LEU D CG  1 
ATOM   10056 C  CD1 . LEU D  1 247 ? 121.574 80.543  87.804  1.00 16.13  ? 224 LEU D CD1 1 
ATOM   10057 C  CD2 . LEU D  1 247 ? 123.018 79.996  85.808  1.00 22.42  ? 224 LEU D CD2 1 
ATOM   10058 N  N   . GLU D  1 248 ? 125.852 76.757  88.178  1.00 14.79  ? 225 GLU D N   1 
ATOM   10059 C  CA  . GLU D  1 248 ? 126.726 76.109  89.164  1.00 19.57  ? 225 GLU D CA  1 
ATOM   10060 C  C   . GLU D  1 248 ? 126.267 76.476  90.586  1.00 21.06  ? 225 GLU D C   1 
ATOM   10061 O  O   . GLU D  1 248 ? 126.113 75.608  91.444  1.00 14.81  ? 225 GLU D O   1 
ATOM   10062 C  CB  . GLU D  1 248 ? 128.192 76.513  88.942  1.00 23.44  ? 225 GLU D CB  1 
ATOM   10063 C  CG  . GLU D  1 248 ? 129.201 75.890  89.902  1.00 22.60  ? 225 GLU D CG  1 
ATOM   10064 C  CD  . GLU D  1 248 ? 129.500 74.428  89.599  1.00 32.25  ? 225 GLU D CD  1 
ATOM   10065 O  OE1 . GLU D  1 248 ? 128.982 73.920  88.585  1.00 31.82  ? 225 GLU D OE1 1 
ATOM   10066 O  OE2 . GLU D  1 248 ? 130.256 73.784  90.376  1.00 29.32  ? 225 GLU D OE2 1 
ATOM   10067 N  N   . TRP D  1 249 ? 126.040 77.765  90.829  1.00 11.52  ? 226 TRP D N   1 
ATOM   10068 C  CA  . TRP D  1 249 ? 125.421 78.198  92.078  1.00 13.74  ? 226 TRP D CA  1 
ATOM   10069 C  C   . TRP D  1 249 ? 124.822 79.592  91.935  1.00 21.77  ? 226 TRP D C   1 
ATOM   10070 O  O   . TRP D  1 249 ? 125.024 80.266  90.916  1.00 17.78  ? 226 TRP D O   1 
ATOM   10071 C  CB  . TRP D  1 249 ? 126.408 78.159  93.258  1.00 12.98  ? 226 TRP D CB  1 
ATOM   10072 C  CG  . TRP D  1 249 ? 127.517 79.184  93.189  1.00 17.57  ? 226 TRP D CG  1 
ATOM   10073 C  CD1 . TRP D  1 249 ? 127.388 80.550  93.145  1.00 15.74  ? 226 TRP D CD1 1 
ATOM   10074 C  CD2 . TRP D  1 249 ? 128.922 78.918  93.174  1.00 11.98  ? 226 TRP D CD2 1 
ATOM   10075 N  NE1 . TRP D  1 249 ? 128.632 81.142  93.094  1.00 12.07  ? 226 TRP D NE1 1 
ATOM   10076 C  CE2 . TRP D  1 249 ? 129.587 80.162  93.121  1.00 12.07  ? 226 TRP D CE2 1 
ATOM   10077 C  CE3 . TRP D  1 249 ? 129.685 77.745  93.196  1.00 19.25  ? 226 TRP D CE3 1 
ATOM   10078 C  CZ2 . TRP D  1 249 ? 130.974 80.266  93.083  1.00 21.46  ? 226 TRP D CZ2 1 
ATOM   10079 C  CZ3 . TRP D  1 249 ? 131.070 77.853  93.175  1.00 24.12  ? 226 TRP D CZ3 1 
ATOM   10080 C  CH2 . TRP D  1 249 ? 131.696 79.103  93.114  1.00 24.38  ? 226 TRP D CH2 1 
ATOM   10081 N  N   . ILE D  1 250 ? 124.074 79.997  92.958  1.00 15.80  ? 227 ILE D N   1 
ATOM   10082 C  CA  . ILE D  1 250 ? 123.496 81.331  93.064  1.00 13.73  ? 227 ILE D CA  1 
ATOM   10083 C  C   . ILE D  1 250 ? 124.101 82.027  94.289  1.00 22.95  ? 227 ILE D C   1 
ATOM   10084 O  O   . ILE D  1 250 ? 124.022 81.515  95.418  1.00 18.31  ? 227 ILE D O   1 
ATOM   10085 C  CB  . ILE D  1 250 ? 121.953 81.254  93.189  1.00 17.06  ? 227 ILE D CB  1 
ATOM   10086 C  CG1 . ILE D  1 250 ? 121.343 80.705  91.888  1.00 18.74  ? 227 ILE D CG1 1 
ATOM   10087 C  CG2 . ILE D  1 250 ? 121.377 82.613  93.501  1.00 15.01  ? 227 ILE D CG2 1 
ATOM   10088 C  CD1 . ILE D  1 250 ? 119.874 80.367  91.979  1.00 14.33  ? 227 ILE D CD1 1 
ATOM   10089 N  N   . GLU D  1 251 ? 124.706 83.191  94.072  1.00 21.78  ? 228 GLU D N   1 
ATOM   10090 C  CA  . GLU D  1 251 ? 125.493 83.838  95.122  1.00 21.73  ? 228 GLU D CA  1 
ATOM   10091 C  C   . GLU D  1 251 ? 124.875 85.128  95.697  1.00 24.34  ? 228 GLU D C   1 
ATOM   10092 O  O   . GLU D  1 251 ? 124.445 86.009  94.950  1.00 23.21  ? 228 GLU D O   1 
ATOM   10093 C  CB  . GLU D  1 251 ? 126.897 84.110  94.590  1.00 27.20  ? 228 GLU D CB  1 
ATOM   10094 C  CG  . GLU D  1 251 ? 127.938 84.532  95.614  1.00 17.27  ? 228 GLU D CG  1 
ATOM   10095 C  CD  . GLU D  1 251 ? 129.291 84.786  94.960  1.00 29.48  ? 228 GLU D CD  1 
ATOM   10096 O  OE1 . GLU D  1 251 ? 129.659 84.041  94.008  1.00 22.19  ? 228 GLU D OE1 1 
ATOM   10097 O  OE2 . GLU D  1 251 ? 129.972 85.742  95.384  1.00 28.96  ? 228 GLU D OE2 1 
ATOM   10098 N  N   . GLU D  1 252 ? 124.858 85.205  97.032  1.00 24.34  ? 229 GLU D N   1 
ATOM   10099 C  CA  . GLU D  1 252 ? 124.355 86.343  97.836  1.00 19.75  ? 229 GLU D CA  1 
ATOM   10100 C  C   . GLU D  1 252 ? 123.268 87.209  97.218  1.00 16.70  ? 229 GLU D C   1 
ATOM   10101 O  O   . GLU D  1 252 ? 123.505 88.363  96.896  1.00 25.46  ? 229 GLU D O   1 
ATOM   10102 C  CB  . GLU D  1 252 ? 125.489 87.268  98.279  1.00 16.37  ? 229 GLU D CB  1 
ATOM   10103 C  CG  . GLU D  1 252 ? 126.528 86.670  99.206  1.00 19.70  ? 229 GLU D CG  1 
ATOM   10104 C  CD  . GLU D  1 252 ? 127.533 87.723  99.666  1.00 35.92  ? 229 GLU D CD  1 
ATOM   10105 O  OE1 . GLU D  1 252 ? 128.016 88.506  98.817  1.00 42.65  ? 229 GLU D OE1 1 
ATOM   10106 O  OE2 . GLU D  1 252 ? 127.818 87.789  100.883 1.00 41.43  ? 229 GLU D OE2 1 
ATOM   10107 N  N   . PRO D  1 253 ? 122.065 86.662  97.086  1.00 18.87  ? 230 PRO D N   1 
ATOM   10108 C  CA  . PRO D  1 253 ? 120.904 87.390  96.586  1.00 21.63  ? 230 PRO D CA  1 
ATOM   10109 C  C   . PRO D  1 253 ? 120.555 88.564  97.478  1.00 26.27  ? 230 PRO D C   1 
ATOM   10110 O  O   . PRO D  1 253 ? 120.207 89.619  96.955  1.00 29.69  ? 230 PRO D O   1 
ATOM   10111 C  CB  . PRO D  1 253 ? 119.786 86.362  96.689  1.00 22.53  ? 230 PRO D CB  1 
ATOM   10112 C  CG  . PRO D  1 253 ? 120.458 85.066  96.688  1.00 19.08  ? 230 PRO D CG  1 
ATOM   10113 C  CD  . PRO D  1 253 ? 121.778 85.241  97.318  1.00 13.18  ? 230 PRO D CD  1 
ATOM   10114 N  N   . VAL D  1 254 ? 120.614 88.369  98.798  1.00 26.54  ? 231 VAL D N   1 
ATOM   10115 C  CA  . VAL D  1 254 ? 120.166 89.392  99.755  1.00 24.16  ? 231 VAL D CA  1 
ATOM   10116 C  C   . VAL D  1 254 ? 121.294 89.910  100.652 1.00 19.89  ? 231 VAL D C   1 
ATOM   10117 O  O   . VAL D  1 254 ? 122.382 89.370  100.645 1.00 19.91  ? 231 VAL D O   1 
ATOM   10118 C  CB  . VAL D  1 254 ? 118.997 88.882  100.638 1.00 17.25  ? 231 VAL D CB  1 
ATOM   10119 C  CG1 . VAL D  1 254 ? 117.823 88.470  99.789  1.00 5.89   ? 231 VAL D CG1 1 
ATOM   10120 C  CG2 . VAL D  1 254 ? 119.420 87.716  101.496 1.00 12.10  ? 231 VAL D CG2 1 
ATOM   10121 N  N   . VAL D  1 255 ? 121.038 90.973  101.404 1.00 23.66  ? 232 VAL D N   1 
ATOM   10122 C  CA  . VAL D  1 255 ? 122.038 91.491  102.338 1.00 12.72  ? 232 VAL D CA  1 
ATOM   10123 C  C   . VAL D  1 255 ? 122.670 90.368  103.193 1.00 16.59  ? 232 VAL D C   1 
ATOM   10124 O  O   . VAL D  1 255 ? 121.998 89.440  103.667 1.00 18.87  ? 232 VAL D O   1 
ATOM   10125 C  CB  . VAL D  1 255 ? 121.470 92.636  103.216 1.00 15.29  ? 232 VAL D CB  1 
ATOM   10126 C  CG1 . VAL D  1 255 ? 120.474 92.103  104.224 1.00 15.21  ? 232 VAL D CG1 1 
ATOM   10127 C  CG2 . VAL D  1 255 ? 122.580 93.370  103.930 1.00 15.33  ? 232 VAL D CG2 1 
ATOM   10128 N  N   . TYR D  1 256 ? 123.976 90.461  103.390 1.00 17.21  ? 233 TYR D N   1 
ATOM   10129 C  CA  . TYR D  1 256 ? 124.735 89.299  103.816 1.00 18.28  ? 233 TYR D CA  1 
ATOM   10130 C  C   . TYR D  1 256 ? 124.429 88.735  105.193 1.00 22.13  ? 233 TYR D C   1 
ATOM   10131 O  O   . TYR D  1 256 ? 124.632 87.549  105.416 1.00 24.47  ? 233 TYR D O   1 
ATOM   10132 C  CB  . TYR D  1 256 ? 126.233 89.527  103.648 1.00 14.35  ? 233 TYR D CB  1 
ATOM   10133 C  CG  . TYR D  1 256 ? 126.900 90.456  104.650 1.00 25.25  ? 233 TYR D CG  1 
ATOM   10134 C  CD1 . TYR D  1 256 ? 127.183 90.031  105.951 1.00 24.37  ? 233 TYR D CD1 1 
ATOM   10135 C  CD2 . TYR D  1 256 ? 127.313 91.729  104.272 1.00 23.09  ? 233 TYR D CD2 1 
ATOM   10136 C  CE1 . TYR D  1 256 ? 127.821 90.872  106.860 1.00 20.35  ? 233 TYR D CE1 1 
ATOM   10137 C  CE2 . TYR D  1 256 ? 127.946 92.570  105.168 1.00 25.95  ? 233 TYR D CE2 1 
ATOM   10138 C  CZ  . TYR D  1 256 ? 128.199 92.138  106.458 1.00 26.81  ? 233 TYR D CZ  1 
ATOM   10139 O  OH  . TYR D  1 256 ? 128.837 92.981  107.336 1.00 32.10  ? 233 TYR D OH  1 
ATOM   10140 N  N   . ASP D  1 257 ? 123.944 89.564  106.111 1.00 16.73  ? 234 ASP D N   1 
ATOM   10141 C  CA  . ASP D  1 257 ? 123.649 89.081  107.466 1.00 23.08  ? 234 ASP D CA  1 
ATOM   10142 C  C   . ASP D  1 257 ? 122.195 88.616  107.677 1.00 16.57  ? 234 ASP D C   1 
ATOM   10143 O  O   . ASP D  1 257 ? 121.787 88.352  108.802 1.00 23.92  ? 234 ASP D O   1 
ATOM   10144 C  CB  . ASP D  1 257 ? 124.049 90.126  108.523 1.00 18.89  ? 234 ASP D CB  1 
ATOM   10145 C  CG  . ASP D  1 257 ? 123.271 91.436  108.393 1.00 26.45  ? 234 ASP D CG  1 
ATOM   10146 O  OD1 . ASP D  1 257 ? 122.428 91.569  107.476 1.00 26.53  ? 234 ASP D OD1 1 
ATOM   10147 O  OD2 . ASP D  1 257 ? 123.508 92.344  109.214 1.00 35.25  ? 234 ASP D OD2 1 
ATOM   10148 N  N   . ASN D  1 258 ? 121.417 88.517  106.603 1.00 19.67  ? 235 ASN D N   1 
ATOM   10149 C  CA  . ASN D  1 258 ? 120.032 88.032  106.706 1.00 15.89  ? 235 ASN D CA  1 
ATOM   10150 C  C   . ASN D  1 258 ? 119.945 86.513  106.674 1.00 21.37  ? 235 ASN D C   1 
ATOM   10151 O  O   . ASN D  1 258 ? 119.490 85.935  105.684 1.00 21.56  ? 235 ASN D O   1 
ATOM   10152 C  CB  . ASN D  1 258 ? 119.148 88.627  105.597 1.00 16.89  ? 235 ASN D CB  1 
ATOM   10153 C  CG  . ASN D  1 258 ? 117.669 88.250  105.754 1.00 20.89  ? 235 ASN D CG  1 
ATOM   10154 O  OD1 . ASN D  1 258 ? 117.288 87.569  106.706 1.00 20.80  ? 235 ASN D OD1 1 
ATOM   10155 N  ND2 . ASN D  1 258 ? 116.838 88.705  104.827 1.00 18.72  ? 235 ASN D ND2 1 
ATOM   10156 N  N   . PHE D  1 259 ? 120.369 85.867  107.758 1.00 21.46  ? 236 PHE D N   1 
ATOM   10157 C  CA  . PHE D  1 259 ? 120.409 84.402  107.807 1.00 12.95  ? 236 PHE D CA  1 
ATOM   10158 C  C   . PHE D  1 259 ? 119.023 83.763  107.758 1.00 17.67  ? 236 PHE D C   1 
ATOM   10159 O  O   . PHE D  1 259 ? 118.855 82.679  107.185 1.00 20.64  ? 236 PHE D O   1 
ATOM   10160 C  CB  . PHE D  1 259 ? 121.162 83.908  109.053 1.00 22.99  ? 236 PHE D CB  1 
ATOM   10161 C  CG  . PHE D  1 259 ? 122.656 84.159  109.017 1.00 28.22  ? 236 PHE D CG  1 
ATOM   10162 C  CD1 . PHE D  1 259 ? 123.278 84.614  107.864 1.00 22.84  ? 236 PHE D CD1 1 
ATOM   10163 C  CD2 . PHE D  1 259 ? 123.436 83.922  110.141 1.00 34.46  ? 236 PHE D CD2 1 
ATOM   10164 C  CE1 . PHE D  1 259 ? 124.647 84.845  107.837 1.00 21.29  ? 236 PHE D CE1 1 
ATOM   10165 C  CE2 . PHE D  1 259 ? 124.803 84.145  110.122 1.00 36.60  ? 236 PHE D CE2 1 
ATOM   10166 C  CZ  . PHE D  1 259 ? 125.409 84.610  108.970 1.00 33.03  ? 236 PHE D CZ  1 
ATOM   10167 N  N   . ASP D  1 260 ? 118.040 84.413  108.376 1.00 15.72  ? 237 ASP D N   1 
ATOM   10168 C  CA  . ASP D  1 260 ? 116.666 83.938  108.299 1.00 20.29  ? 237 ASP D CA  1 
ATOM   10169 C  C   . ASP D  1 260 ? 116.237 83.848  106.814 1.00 21.71  ? 237 ASP D C   1 
ATOM   10170 O  O   . ASP D  1 260 ? 115.650 82.866  106.393 1.00 24.49  ? 237 ASP D O   1 
ATOM   10171 C  CB  . ASP D  1 260 ? 115.713 84.873  109.062 1.00 18.90  ? 237 ASP D CB  1 
ATOM   10172 C  CG  . ASP D  1 260 ? 115.969 84.909  110.577 1.00 30.44  ? 237 ASP D CG  1 
ATOM   10173 O  OD1 . ASP D  1 260 ? 116.109 83.845  111.217 1.00 33.98  ? 237 ASP D OD1 1 
ATOM   10174 O  OD2 . ASP D  1 260 ? 116.004 86.024  111.139 1.00 28.79  ? 237 ASP D OD2 1 
ATOM   10175 N  N   . GLY D  1 261 ? 116.539 84.874  106.027 1.00 20.31  ? 238 GLY D N   1 
ATOM   10176 C  CA  . GLY D  1 261 ? 116.179 84.883  104.614 1.00 15.46  ? 238 GLY D CA  1 
ATOM   10177 C  C   . GLY D  1 261 ? 116.961 83.830  103.831 1.00 20.83  ? 238 GLY D C   1 
ATOM   10178 O  O   . GLY D  1 261 ? 116.403 83.106  103.011 1.00 16.38  ? 238 GLY D O   1 
ATOM   10179 N  N   . TYR D  1 262 ? 118.256 83.716  104.106 1.00 14.70  ? 239 TYR D N   1 
ATOM   10180 C  CA  . TYR D  1 262 ? 119.056 82.714  103.423 1.00 15.81  ? 239 TYR D CA  1 
ATOM   10181 C  C   . TYR D  1 262 ? 118.551 81.302  103.669 1.00 21.81  ? 239 TYR D C   1 
ATOM   10182 O  O   . TYR D  1 262 ? 118.478 80.504  102.733 1.00 24.86  ? 239 TYR D O   1 
ATOM   10183 C  CB  . TYR D  1 262 ? 120.537 82.845  103.759 1.00 14.63  ? 239 TYR D CB  1 
ATOM   10184 C  CG  . TYR D  1 262 ? 121.222 83.892  102.934 1.00 13.55  ? 239 TYR D CG  1 
ATOM   10185 C  CD1 . TYR D  1 262 ? 121.243 83.802  101.556 1.00 29.30  ? 239 TYR D CD1 1 
ATOM   10186 C  CD2 . TYR D  1 262 ? 121.848 84.980  103.527 1.00 27.70  ? 239 TYR D CD2 1 
ATOM   10187 C  CE1 . TYR D  1 262 ? 121.861 84.775  100.779 1.00 24.87  ? 239 TYR D CE1 1 
ATOM   10188 C  CE2 . TYR D  1 262 ? 122.469 85.954  102.759 1.00 25.59  ? 239 TYR D CE2 1 
ATOM   10189 C  CZ  . TYR D  1 262 ? 122.465 85.840  101.385 1.00 23.46  ? 239 TYR D CZ  1 
ATOM   10190 O  OH  . TYR D  1 262 ? 123.078 86.788  100.614 1.00 39.03  ? 239 TYR D OH  1 
ATOM   10191 N  N   . ALA D  1 263 ? 118.186 81.001  104.916 1.00 17.60  ? 240 ALA D N   1 
ATOM   10192 C  CA  . ALA D  1 263 ? 117.644 79.695  105.252 1.00 17.81  ? 240 ALA D CA  1 
ATOM   10193 C  C   . ALA D  1 263 ? 116.418 79.385  104.398 1.00 16.43  ? 240 ALA D C   1 
ATOM   10194 O  O   . ALA D  1 263 ? 116.234 78.270  103.950 1.00 15.58  ? 240 ALA D O   1 
ATOM   10195 C  CB  . ALA D  1 263 ? 117.275 79.626  106.745 1.00 11.72  ? 240 ALA D CB  1 
ATOM   10196 N  N   . GLN D  1 264 ? 115.570 80.384  104.209 1.00 12.87  ? 241 GLN D N   1 
ATOM   10197 C  CA  . GLN D  1 264 ? 114.406 80.241  103.359 1.00 18.73  ? 241 GLN D CA  1 
ATOM   10198 C  C   . GLN D  1 264 ? 114.782 80.000  101.891 1.00 23.32  ? 241 GLN D C   1 
ATOM   10199 O  O   . GLN D  1 264 ? 114.273 79.073  101.261 1.00 24.43  ? 241 GLN D O   1 
ATOM   10200 C  CB  . GLN D  1 264 ? 113.521 81.481  103.472 1.00 22.18  ? 241 GLN D CB  1 
ATOM   10201 C  CG  . GLN D  1 264 ? 112.856 81.645  104.824 1.00 41.23  ? 241 GLN D CG  1 
ATOM   10202 C  CD  . GLN D  1 264 ? 111.933 80.485  105.149 1.00 67.19  ? 241 GLN D CD  1 
ATOM   10203 O  OE1 . GLN D  1 264 ? 111.118 80.070  104.316 1.00 77.54  ? 241 GLN D OE1 1 
ATOM   10204 N  NE2 . GLN D  1 264 ? 112.065 79.941  106.361 1.00 66.70  ? 241 GLN D NE2 1 
ATOM   10205 N  N   . LEU D  1 265 ? 115.658 80.840  101.339 1.00 16.75  ? 242 LEU D N   1 
ATOM   10206 C  CA  . LEU D  1 265 ? 116.047 80.699  99.937  1.00 14.35  ? 242 LEU D CA  1 
ATOM   10207 C  C   . LEU D  1 265 ? 116.630 79.314  99.678  1.00 15.80  ? 242 LEU D C   1 
ATOM   10208 O  O   . LEU D  1 265 ? 116.246 78.627  98.731  1.00 22.62  ? 242 LEU D O   1 
ATOM   10209 C  CB  . LEU D  1 265 ? 117.023 81.814  99.512  1.00 18.40  ? 242 LEU D CB  1 
ATOM   10210 C  CG  . LEU D  1 265 ? 116.408 83.217  99.598  1.00 21.98  ? 242 LEU D CG  1 
ATOM   10211 C  CD1 . LEU D  1 265 ? 117.440 84.279  99.409  1.00 14.68  ? 242 LEU D CD1 1 
ATOM   10212 C  CD2 . LEU D  1 265 ? 115.269 83.380  98.574  1.00 17.45  ? 242 LEU D CD2 1 
ATOM   10213 N  N   . ARG D  1 266 ? 117.537 78.894  100.545 1.00 18.94  ? 243 ARG D N   1 
ATOM   10214 C  CA  . ARG D  1 266 ? 118.208 77.608  100.385 1.00 19.98  ? 243 ARG D CA  1 
ATOM   10215 C  C   . ARG D  1 266 ? 117.248 76.418  100.381 1.00 20.58  ? 243 ARG D C   1 
ATOM   10216 O  O   . ARG D  1 266 ? 117.436 75.479  99.620  1.00 18.52  ? 243 ARG D O   1 
ATOM   10217 C  CB  . ARG D  1 266 ? 119.243 77.423  101.490 1.00 15.03  ? 243 ARG D CB  1 
ATOM   10218 C  CG  . ARG D  1 266 ? 120.005 76.123  101.415 1.00 23.50  ? 243 ARG D CG  1 
ATOM   10219 C  CD  . ARG D  1 266 ? 120.205 75.595  102.798 1.00 20.25  ? 243 ARG D CD  1 
ATOM   10220 N  NE  . ARG D  1 266 ? 121.279 74.627  102.864 1.00 33.55  ? 243 ARG D NE  1 
ATOM   10221 C  CZ  . ARG D  1 266 ? 121.552 73.918  103.954 1.00 46.83  ? 243 ARG D CZ  1 
ATOM   10222 N  NH1 . ARG D  1 266 ? 120.802 74.071  105.035 1.00 38.56  ? 243 ARG D NH1 1 
ATOM   10223 N  NH2 . ARG D  1 266 ? 122.559 73.050  103.961 1.00 61.23  ? 243 ARG D NH2 1 
ATOM   10224 N  N   . HIS D  1 267 ? 116.228 76.450  101.233 1.00 19.86  ? 244 HIS D N   1 
ATOM   10225 C  CA  . HIS D  1 267 ? 115.254 75.367  101.260 1.00 14.12  ? 244 HIS D CA  1 
ATOM   10226 C  C   . HIS D  1 267 ? 114.443 75.320  99.960  1.00 22.04  ? 244 HIS D C   1 
ATOM   10227 O  O   . HIS D  1 267 ? 114.190 74.250  99.415  1.00 24.96  ? 244 HIS D O   1 
ATOM   10228 C  CB  . HIS D  1 267 ? 114.316 75.503  102.467 1.00 25.99  ? 244 HIS D CB  1 
ATOM   10229 C  CG  . HIS D  1 267 ? 113.056 74.697  102.338 1.00 51.50  ? 244 HIS D CG  1 
ATOM   10230 N  ND1 . HIS D  1 267 ? 111.921 75.178  101.715 1.00 59.58  ? 244 HIS D ND1 1 
ATOM   10231 C  CD2 . HIS D  1 267 ? 112.758 73.436  102.735 1.00 54.14  ? 244 HIS D CD2 1 
ATOM   10232 C  CE1 . HIS D  1 267 ? 110.980 74.251  101.737 1.00 55.60  ? 244 HIS D CE1 1 
ATOM   10233 N  NE2 . HIS D  1 267 ? 111.462 73.184  102.351 1.00 56.13  ? 244 HIS D NE2 1 
ATOM   10234 N  N   . ASP D  1 268 ? 114.042 76.486  99.470  1.00 14.58  ? 245 ASP D N   1 
ATOM   10235 C  CA  . ASP D  1 268 ? 113.242 76.585  98.239  1.00 23.52  ? 245 ASP D CA  1 
ATOM   10236 C  C   . ASP D  1 268 ? 114.020 76.315  96.935  1.00 19.88  ? 245 ASP D C   1 
ATOM   10237 O  O   . ASP D  1 268 ? 113.479 75.771  95.985  1.00 19.88  ? 245 ASP D O   1 
ATOM   10238 C  CB  . ASP D  1 268 ? 112.584 77.967  98.160  1.00 15.15  ? 245 ASP D CB  1 
ATOM   10239 C  CG  . ASP D  1 268 ? 111.323 78.061  98.994  1.00 33.38  ? 245 ASP D CG  1 
ATOM   10240 O  OD1 . ASP D  1 268 ? 110.821 77.006  99.447  1.00 42.17  ? 245 ASP D OD1 1 
ATOM   10241 O  OD2 . ASP D  1 268 ? 110.820 79.191  99.176  1.00 37.24  ? 245 ASP D OD2 1 
ATOM   10242 N  N   . LEU D  1 269 ? 115.282 76.720  96.897  1.00 15.25  ? 246 LEU D N   1 
ATOM   10243 C  CA  . LEU D  1 269 ? 116.123 76.533  95.722  1.00 18.00  ? 246 LEU D CA  1 
ATOM   10244 C  C   . LEU D  1 269 ? 116.742 75.160  95.740  1.00 18.75  ? 246 LEU D C   1 
ATOM   10245 O  O   . LEU D  1 269 ? 117.274 74.721  96.766  1.00 24.53  ? 246 LEU D O   1 
ATOM   10246 C  CB  . LEU D  1 269 ? 117.247 77.579  95.692  1.00 15.70  ? 246 LEU D CB  1 
ATOM   10247 C  CG  . LEU D  1 269 ? 116.767 79.019  95.583  1.00 19.92  ? 246 LEU D CG  1 
ATOM   10248 C  CD1 . LEU D  1 269 ? 117.903 79.962  95.845  1.00 20.95  ? 246 LEU D CD1 1 
ATOM   10249 C  CD2 . LEU D  1 269 ? 116.138 79.260  94.209  1.00 14.57  ? 246 LEU D CD2 1 
ATOM   10250 N  N   . LYS D  1 270 ? 116.682 74.494  94.595  1.00 14.82  ? 247 LYS D N   1 
ATOM   10251 C  CA  . LYS D  1 270 ? 117.343 73.213  94.379  1.00 17.15  ? 247 LYS D CA  1 
ATOM   10252 C  C   . LYS D  1 270 ? 118.803 73.457  93.992  1.00 24.64  ? 247 LYS D C   1 
ATOM   10253 O  O   . LYS D  1 270 ? 119.689 72.634  94.245  1.00 34.18  ? 247 LYS D O   1 
ATOM   10254 C  CB  . LYS D  1 270 ? 116.634 72.463  93.247  1.00 20.58  ? 247 LYS D CB  1 
ATOM   10255 C  CG  . LYS D  1 270 ? 116.006 71.148  93.646  1.00 34.77  ? 247 LYS D CG  1 
ATOM   10256 C  CD  . LYS D  1 270 ? 115.026 71.326  94.790  1.00 54.64  ? 247 LYS D CD  1 
ATOM   10257 C  CE  . LYS D  1 270 ? 114.437 69.984  95.199  1.00 64.56  ? 247 LYS D CE  1 
ATOM   10258 N  NZ  . LYS D  1 270 ? 113.952 69.223  94.002  1.00 62.68  ? 247 LYS D NZ  1 
ATOM   10259 N  N   . THR D  1 271 ? 119.035 74.599  93.356  1.00 16.63  ? 248 THR D N   1 
ATOM   10260 C  CA  . THR D  1 271 ? 120.366 75.010  92.933  1.00 19.50  ? 248 THR D CA  1 
ATOM   10261 C  C   . THR D  1 271 ? 121.118 75.443  94.172  1.00 17.76  ? 248 THR D C   1 
ATOM   10262 O  O   . THR D  1 271 ? 120.551 76.105  95.026  1.00 14.07  ? 248 THR D O   1 
ATOM   10263 C  CB  . THR D  1 271 ? 120.239 76.205  91.986  1.00 19.81  ? 248 THR D CB  1 
ATOM   10264 O  OG1 . THR D  1 271 ? 119.531 75.789  90.814  1.00 31.35  ? 248 THR D OG1 1 
ATOM   10265 C  CG2 . THR D  1 271 ? 121.590 76.748  91.596  1.00 13.15  ? 248 THR D CG2 1 
ATOM   10266 N  N   . PRO D  1 272 ? 122.394 75.068  94.285  1.00 22.05  ? 249 PRO D N   1 
ATOM   10267 C  CA  . PRO D  1 272 ? 123.161 75.430  95.489  1.00 17.71  ? 249 PRO D CA  1 
ATOM   10268 C  C   . PRO D  1 272 ? 123.191 76.932  95.719  1.00 21.17  ? 249 PRO D C   1 
ATOM   10269 O  O   . PRO D  1 272 ? 123.435 77.695  94.777  1.00 21.26  ? 249 PRO D O   1 
ATOM   10270 C  CB  . PRO D  1 272 ? 124.569 74.911  95.177  1.00 23.16  ? 249 PRO D CB  1 
ATOM   10271 C  CG  . PRO D  1 272 ? 124.319 73.760  94.164  1.00 16.74  ? 249 PRO D CG  1 
ATOM   10272 C  CD  . PRO D  1 272 ? 123.195 74.292  93.319  1.00 18.61  ? 249 PRO D CD  1 
ATOM   10273 N  N   . LEU D  1 273 ? 122.911 77.336  96.957  1.00 16.61  ? 250 LEU D N   1 
ATOM   10274 C  CA  . LEU D  1 273 ? 123.026 78.720  97.389  1.00 19.80  ? 250 LEU D CA  1 
ATOM   10275 C  C   . LEU D  1 273 ? 124.406 78.970  98.018  1.00 21.83  ? 250 LEU D C   1 
ATOM   10276 O  O   . LEU D  1 273 ? 124.831 78.249  98.919  1.00 20.33  ? 250 LEU D O   1 
ATOM   10277 C  CB  . LEU D  1 273 ? 121.934 79.039  98.404  1.00 16.07  ? 250 LEU D CB  1 
ATOM   10278 C  CG  . LEU D  1 273 ? 121.885 80.466  98.941  1.00 22.17  ? 250 LEU D CG  1 
ATOM   10279 C  CD1 . LEU D  1 273 ? 121.511 81.461  97.829  1.00 16.67  ? 250 LEU D CD1 1 
ATOM   10280 C  CD2 . LEU D  1 273 ? 120.881 80.534  100.100 1.00 24.82  ? 250 LEU D CD2 1 
ATOM   10281 N  N   . MET D  1 274 ? 125.087 80.006  97.546  1.00 14.40  ? 251 MET D N   1 
ATOM   10282 C  CA  . MET D  1 274 ? 126.459 80.291  97.943  1.00 18.16  ? 251 MET D CA  1 
ATOM   10283 C  C   . MET D  1 274 ? 126.566 81.626  98.679  1.00 17.45  ? 251 MET D C   1 
ATOM   10284 O  O   . MET D  1 274 ? 126.034 82.631  98.220  1.00 16.74  ? 251 MET D O   1 
ATOM   10285 C  CB  . MET D  1 274 ? 127.364 80.323  96.696  1.00 11.21  ? 251 MET D CB  1 
ATOM   10286 C  CG  . MET D  1 274 ? 128.670 81.061  96.907  1.00 14.53  ? 251 MET D CG  1 
ATOM   10287 S  SD  . MET D  1 274 ? 129.834 80.050  97.859  1.00 20.80  ? 251 MET D SD  1 
ATOM   10288 C  CE  . MET D  1 274 ? 130.430 78.951  96.555  1.00 17.45  ? 251 MET D CE  1 
ATOM   10289 N  N   . ILE D  1 275 ? 127.254 81.628  99.815  1.00 12.66  ? 252 ILE D N   1 
ATOM   10290 C  CA  . ILE D  1 275 ? 127.577 82.867  100.537 1.00 12.14  ? 252 ILE D CA  1 
ATOM   10291 C  C   . ILE D  1 275 ? 128.956 82.707  101.166 1.00 15.71  ? 252 ILE D C   1 
ATOM   10292 O  O   . ILE D  1 275 ? 129.620 81.673  100.994 1.00 17.16  ? 252 ILE D O   1 
ATOM   10293 C  CB  . ILE D  1 275 ? 126.571 83.170  101.702 1.00 22.78  ? 252 ILE D CB  1 
ATOM   10294 C  CG1 . ILE D  1 275 ? 126.756 82.185  102.869 1.00 19.67  ? 252 ILE D CG1 1 
ATOM   10295 C  CG2 . ILE D  1 275 ? 125.145 83.154  101.215 1.00 13.11  ? 252 ILE D CG2 1 
ATOM   10296 C  CD1 . ILE D  1 275 ? 125.756 82.407  104.032 1.00 20.46  ? 252 ILE D CD1 1 
ATOM   10297 N  N   . GLY D  1 276 ? 129.383 83.708  101.925 1.00 19.21  ? 253 GLY D N   1 
ATOM   10298 C  CA  . GLY D  1 276 ? 130.557 83.541  102.766 1.00 14.08  ? 253 GLY D CA  1 
ATOM   10299 C  C   . GLY D  1 276 ? 131.598 84.632  102.618 1.00 19.30  ? 253 GLY D C   1 
ATOM   10300 O  O   . GLY D  1 276 ? 132.452 84.817  103.486 1.00 23.63  ? 253 GLY D O   1 
ATOM   10301 N  N   . GLU D  1 277 ? 131.532 85.379  101.525 1.00 16.84  ? 254 GLU D N   1 
ATOM   10302 C  CA  . GLU D  1 277 ? 132.559 86.367  101.291 1.00 13.66  ? 254 GLU D CA  1 
ATOM   10303 C  C   . GLU D  1 277 ? 132.526 87.470  102.334 1.00 19.01  ? 254 GLU D C   1 
ATOM   10304 O  O   . GLU D  1 277 ? 133.504 88.208  102.499 1.00 22.79  ? 254 GLU D O   1 
ATOM   10305 C  CB  . GLU D  1 277 ? 132.460 86.949  99.884  1.00 17.59  ? 254 GLU D CB  1 
ATOM   10306 C  CG  . GLU D  1 277 ? 131.288 87.869  99.654  1.00 17.36  ? 254 GLU D CG  1 
ATOM   10307 C  CD  . GLU D  1 277 ? 131.218 88.310  98.188  1.00 37.09  ? 254 GLU D CD  1 
ATOM   10308 O  OE1 . GLU D  1 277 ? 131.243 87.437  97.290  1.00 32.80  ? 254 GLU D OE1 1 
ATOM   10309 O  OE2 . GLU D  1 277 ? 131.159 89.530  97.930  1.00 44.64  ? 254 GLU D OE2 1 
ATOM   10310 N  N   . ASN D  1 278 ? 131.407 87.586  103.042 1.00 13.28  ? 255 ASN D N   1 
ATOM   10311 C  CA  . ASN D  1 278 ? 131.295 88.575  104.114 1.00 13.25  ? 255 ASN D CA  1 
ATOM   10312 C  C   . ASN D  1 278 ? 131.269 87.946  105.510 1.00 22.82  ? 255 ASN D C   1 
ATOM   10313 O  O   . ASN D  1 278 ? 130.792 88.565  106.458 1.00 20.06  ? 255 ASN D O   1 
ATOM   10314 C  CB  . ASN D  1 278 ? 130.056 89.440  103.930 1.00 20.09  ? 255 ASN D CB  1 
ATOM   10315 C  CG  . ASN D  1 278 ? 130.195 90.410  102.784 1.00 25.45  ? 255 ASN D CG  1 
ATOM   10316 O  OD1 . ASN D  1 278 ? 130.782 91.467  102.939 1.00 22.11  ? 255 ASN D OD1 1 
ATOM   10317 N  ND2 . ASN D  1 278 ? 129.653 90.056  101.625 1.00 24.55  ? 255 ASN D ND2 1 
ATOM   10318 N  N   . PHE D  1 279 ? 131.745 86.709  105.629 1.00 16.06  ? 256 PHE D N   1 
ATOM   10319 C  CA  . PHE D  1 279 ? 131.913 86.095  106.938 1.00 13.05  ? 256 PHE D CA  1 
ATOM   10320 C  C   . PHE D  1 279 ? 133.089 86.795  107.620 1.00 24.11  ? 256 PHE D C   1 
ATOM   10321 O  O   . PHE D  1 279 ? 134.196 86.772  107.089 1.00 16.02  ? 256 PHE D O   1 
ATOM   10322 C  CB  . PHE D  1 279 ? 132.291 84.627  106.802 1.00 12.34  ? 256 PHE D CB  1 
ATOM   10323 C  CG  . PHE D  1 279 ? 131.151 83.724  106.436 1.00 12.92  ? 256 PHE D CG  1 
ATOM   10324 C  CD1 . PHE D  1 279 ? 129.841 84.134  106.578 1.00 10.38  ? 256 PHE D CD1 1 
ATOM   10325 C  CD2 . PHE D  1 279 ? 131.400 82.445  105.976 1.00 14.59  ? 256 PHE D CD2 1 
ATOM   10326 C  CE1 . PHE D  1 279 ? 128.790 83.282  106.260 1.00 16.18  ? 256 PHE D CE1 1 
ATOM   10327 C  CE2 . PHE D  1 279 ? 130.355 81.582  105.657 1.00 15.82  ? 256 PHE D CE2 1 
ATOM   10328 C  CZ  . PHE D  1 279 ? 129.050 82.004  105.790 1.00 12.59  ? 256 PHE D CZ  1 
ATOM   10329 N  N   . TYR D  1 280 ? 132.870 87.408  108.784 1.00 21.58  ? 257 TYR D N   1 
ATOM   10330 C  CA  . TYR D  1 280 ? 133.996 87.898  109.590 1.00 26.86  ? 257 TYR D CA  1 
ATOM   10331 C  C   . TYR D  1 280 ? 134.465 86.875  110.624 1.00 30.79  ? 257 TYR D C   1 
ATOM   10332 O  O   . TYR D  1 280 ? 134.082 86.937  111.788 1.00 37.48  ? 257 TYR D O   1 
ATOM   10333 C  CB  . TYR D  1 280 ? 133.670 89.250  110.236 1.00 25.07  ? 257 TYR D CB  1 
ATOM   10334 C  CG  . TYR D  1 280 ? 133.681 90.369  109.215 1.00 28.73  ? 257 TYR D CG  1 
ATOM   10335 C  CD1 . TYR D  1 280 ? 134.866 91.009  108.873 1.00 25.14  ? 257 TYR D CD1 1 
ATOM   10336 C  CD2 . TYR D  1 280 ? 132.516 90.755  108.566 1.00 25.70  ? 257 TYR D CD2 1 
ATOM   10337 C  CE1 . TYR D  1 280 ? 134.887 92.017  107.919 1.00 23.67  ? 257 TYR D CE1 1 
ATOM   10338 C  CE2 . TYR D  1 280 ? 132.525 91.754  107.618 1.00 27.14  ? 257 TYR D CE2 1 
ATOM   10339 C  CZ  . TYR D  1 280 ? 133.715 92.378  107.293 1.00 26.14  ? 257 TYR D CZ  1 
ATOM   10340 O  OH  . TYR D  1 280 ? 133.729 93.374  106.347 1.00 34.23  ? 257 TYR D OH  1 
ATOM   10341 N  N   . GLY D  1 281 ? 135.278 85.920  110.184 1.00 24.09  ? 258 GLY D N   1 
ATOM   10342 C  CA  . GLY D  1 281 ? 135.811 84.893  111.067 1.00 16.98  ? 258 GLY D CA  1 
ATOM   10343 C  C   . GLY D  1 281 ? 135.127 83.532  111.000 1.00 19.61  ? 258 GLY D C   1 
ATOM   10344 O  O   . GLY D  1 281 ? 133.974 83.423  110.623 1.00 19.64  ? 258 GLY D O   1 
ATOM   10345 N  N   . PRO D  1 282 ? 135.843 82.475  111.392 1.00 18.61  ? 259 PRO D N   1 
ATOM   10346 C  CA  . PRO D  1 282 ? 135.291 81.116  111.419 1.00 15.21  ? 259 PRO D CA  1 
ATOM   10347 C  C   . PRO D  1 282 ? 133.997 81.018  112.261 1.00 21.31  ? 259 PRO D C   1 
ATOM   10348 O  O   . PRO D  1 282 ? 133.057 80.307  111.894 1.00 23.52  ? 259 PRO D O   1 
ATOM   10349 C  CB  . PRO D  1 282 ? 136.410 80.290  112.094 1.00 17.14  ? 259 PRO D CB  1 
ATOM   10350 C  CG  . PRO D  1 282 ? 137.627 81.118  112.035 1.00 20.62  ? 259 PRO D CG  1 
ATOM   10351 C  CD  . PRO D  1 282 ? 137.183 82.555  111.998 1.00 19.97  ? 259 PRO D CD  1 
ATOM   10352 N  N   . ARG D  1 283 ? 133.936 81.716  113.389 1.00 19.17  ? 260 ARG D N   1 
ATOM   10353 C  CA  . ARG D  1 283 ? 132.742 81.601  114.232 1.00 26.98  ? 260 ARG D CA  1 
ATOM   10354 C  C   . ARG D  1 283 ? 131.495 82.041  113.462 1.00 22.47  ? 260 ARG D C   1 
ATOM   10355 O  O   . ARG D  1 283 ? 130.420 81.452  113.605 1.00 14.98  ? 260 ARG D O   1 
ATOM   10356 C  CB  . ARG D  1 283 ? 132.886 82.373  115.547 1.00 23.58  ? 260 ARG D CB  1 
ATOM   10357 C  CG  . ARG D  1 283 ? 131.620 82.400  116.420 1.00 19.66  ? 260 ARG D CG  1 
ATOM   10358 C  CD  . ARG D  1 283 ? 131.986 82.842  117.846 1.00 24.16  ? 260 ARG D CD  1 
ATOM   10359 N  NE  . ARG D  1 283 ? 132.629 81.766  118.593 1.00 32.33  ? 260 ARG D NE  1 
ATOM   10360 C  CZ  . ARG D  1 283 ? 133.409 81.921  119.664 1.00 32.49  ? 260 ARG D CZ  1 
ATOM   10361 N  NH1 . ARG D  1 283 ? 133.709 83.121  120.154 1.00 24.73  ? 260 ARG D NH1 1 
ATOM   10362 N  NH2 . ARG D  1 283 ? 133.904 80.852  120.250 1.00 28.18  ? 260 ARG D NH2 1 
ATOM   10363 N  N   . GLU D  1 284 ? 131.643 83.056  112.622 1.00 16.52  ? 261 GLU D N   1 
ATOM   10364 C  CA  . GLU D  1 284 ? 130.498 83.536  111.862 1.00 21.31  ? 261 GLU D CA  1 
ATOM   10365 C  C   . GLU D  1 284 ? 130.081 82.472  110.837 1.00 23.08  ? 261 GLU D C   1 
ATOM   10366 O  O   . GLU D  1 284 ? 128.889 82.249  110.603 1.00 28.03  ? 261 GLU D O   1 
ATOM   10367 C  CB  . GLU D  1 284 ? 130.824 84.869  111.207 1.00 22.62  ? 261 GLU D CB  1 
ATOM   10368 C  CG  . GLU D  1 284 ? 129.644 85.763  110.925 1.00 46.73  ? 261 GLU D CG  1 
ATOM   10369 C  CD  . GLU D  1 284 ? 130.084 87.209  110.752 1.00 60.55  ? 261 GLU D CD  1 
ATOM   10370 O  OE1 . GLU D  1 284 ? 130.041 87.717  109.606 1.00 58.02  ? 261 GLU D OE1 1 
ATOM   10371 O  OE2 . GLU D  1 284 ? 130.489 87.830  111.766 1.00 63.35  ? 261 GLU D OE2 1 
ATOM   10372 N  N   . MET D  1 285 ? 131.065 81.797  110.252 1.00 17.51  ? 262 MET D N   1 
ATOM   10373 C  CA  . MET D  1 285 ? 130.780 80.713  109.333 1.00 16.68  ? 262 MET D CA  1 
ATOM   10374 C  C   . MET D  1 285 ? 129.980 79.638  110.071 1.00 24.12  ? 262 MET D C   1 
ATOM   10375 O  O   . MET D  1 285 ? 128.957 79.148  109.574 1.00 25.58  ? 262 MET D O   1 
ATOM   10376 C  CB  . MET D  1 285 ? 132.072 80.090  108.771 1.00 13.12  ? 262 MET D CB  1 
ATOM   10377 C  CG  . MET D  1 285 ? 131.745 78.920  107.830 1.00 19.36  ? 262 MET D CG  1 
ATOM   10378 S  SD  . MET D  1 285 ? 133.129 78.008  107.158 1.00 25.15  ? 262 MET D SD  1 
ATOM   10379 C  CE  . MET D  1 285 ? 133.814 79.267  106.090 1.00 9.58   ? 262 MET D CE  1 
ATOM   10380 N  N   . HIS D  1 286 ? 130.457 79.281  111.261 1.00 20.80  ? 263 HIS D N   1 
ATOM   10381 C  CA  . HIS D  1 286 ? 129.814 78.260  112.089 1.00 18.19  ? 263 HIS D CA  1 
ATOM   10382 C  C   . HIS D  1 286 ? 128.363 78.646  112.421 1.00 19.14  ? 263 HIS D C   1 
ATOM   10383 O  O   . HIS D  1 286 ? 127.463 77.812  112.376 1.00 23.56  ? 263 HIS D O   1 
ATOM   10384 C  CB  . HIS D  1 286 ? 130.678 78.023  113.331 1.00 19.62  ? 263 HIS D CB  1 
ATOM   10385 C  CG  . HIS D  1 286 ? 129.930 77.603  114.561 1.00 21.09  ? 263 HIS D CG  1 
ATOM   10386 N  ND1 . HIS D  1 286 ? 129.577 76.296  114.808 1.00 17.26  ? 263 HIS D ND1 1 
ATOM   10387 C  CD2 . HIS D  1 286 ? 129.549 78.307  115.655 1.00 24.05  ? 263 HIS D CD2 1 
ATOM   10388 C  CE1 . HIS D  1 286 ? 128.964 76.219  115.978 1.00 25.97  ? 263 HIS D CE1 1 
ATOM   10389 N  NE2 . HIS D  1 286 ? 128.938 77.425  116.514 1.00 24.46  ? 263 HIS D NE2 1 
ATOM   10390 N  N   . GLN D  1 287 ? 128.119 79.919  112.705 1.00 13.36  ? 264 GLN D N   1 
ATOM   10391 C  CA  . GLN D  1 287 ? 126.757 80.350  112.984 1.00 16.89  ? 264 GLN D CA  1 
ATOM   10392 C  C   . GLN D  1 287 ? 125.872 80.289  111.743 1.00 23.70  ? 264 GLN D C   1 
ATOM   10393 O  O   . GLN D  1 287 ? 124.700 79.918  111.840 1.00 24.60  ? 264 GLN D O   1 
ATOM   10394 C  CB  . GLN D  1 287 ? 126.727 81.750  113.590 1.00 18.20  ? 264 GLN D CB  1 
ATOM   10395 C  CG  . GLN D  1 287 ? 127.570 81.872  114.862 1.00 23.77  ? 264 GLN D CG  1 
ATOM   10396 C  CD  . GLN D  1 287 ? 127.818 83.321  115.265 1.00 38.36  ? 264 GLN D CD  1 
ATOM   10397 O  OE1 . GLN D  1 287 ? 127.663 84.250  114.454 1.00 41.74  ? 264 GLN D OE1 1 
ATOM   10398 N  NE2 . GLN D  1 287 ? 128.203 83.524  116.526 1.00 34.48  ? 264 GLN D NE2 1 
ATOM   10399 N  N   . ALA D  1 288 ? 126.424 80.657  110.586 1.00 11.43  ? 265 ALA D N   1 
ATOM   10400 C  CA  . ALA D  1 288 ? 125.692 80.541  109.328 1.00 12.89  ? 265 ALA D CA  1 
ATOM   10401 C  C   . ALA D  1 288 ? 125.304 79.093  109.010 1.00 14.46  ? 265 ALA D C   1 
ATOM   10402 O  O   . ALA D  1 288 ? 124.207 78.845  108.552 1.00 19.74  ? 265 ALA D O   1 
ATOM   10403 C  CB  . ALA D  1 288 ? 126.500 81.163  108.170 1.00 12.99  ? 265 ALA D CB  1 
ATOM   10404 N  N   . LEU D  1 289 ? 126.211 78.144  109.263 1.00 19.61  ? 266 LEU D N   1 
ATOM   10405 C  CA  . LEU D  1 289 ? 125.938 76.718  109.056 1.00 16.82  ? 266 LEU D CA  1 
ATOM   10406 C  C   . LEU D  1 289 ? 124.907 76.166  110.062 1.00 23.74  ? 266 LEU D C   1 
ATOM   10407 O  O   . LEU D  1 289 ? 124.009 75.380  109.709 1.00 24.84  ? 266 LEU D O   1 
ATOM   10408 C  CB  . LEU D  1 289 ? 127.248 75.915  109.102 1.00 17.61  ? 266 LEU D CB  1 
ATOM   10409 C  CG  . LEU D  1 289 ? 128.263 76.356  108.040 1.00 17.44  ? 266 LEU D CG  1 
ATOM   10410 C  CD1 . LEU D  1 289 ? 129.551 75.573  108.124 1.00 18.66  ? 266 LEU D CD1 1 
ATOM   10411 C  CD2 . LEU D  1 289 ? 127.666 76.206  106.648 1.00 22.71  ? 266 LEU D CD2 1 
ATOM   10412 N  N   . GLN D  1 290 ? 125.018 76.592  111.312 1.00 18.88  ? 267 GLN D N   1 
ATOM   10413 C  CA  . GLN D  1 290 ? 123.985 76.268  112.295 1.00 22.72  ? 267 GLN D CA  1 
ATOM   10414 C  C   . GLN D  1 290 ? 122.615 76.809  111.878 1.00 22.11  ? 267 GLN D C   1 
ATOM   10415 O  O   . GLN D  1 290 ? 121.585 76.178  112.119 1.00 22.97  ? 267 GLN D O   1 
ATOM   10416 C  CB  . GLN D  1 290 ? 124.343 76.853  113.653 1.00 17.57  ? 267 GLN D CB  1 
ATOM   10417 C  CG  . GLN D  1 290 ? 125.373 76.102  114.439 1.00 32.60  ? 267 GLN D CG  1 
ATOM   10418 C  CD  . GLN D  1 290 ? 125.665 76.809  115.761 1.00 53.25  ? 267 GLN D CD  1 
ATOM   10419 O  OE1 . GLN D  1 290 ? 125.815 78.036  115.801 1.00 51.23  ? 267 GLN D OE1 1 
ATOM   10420 N  NE2 . GLN D  1 290 ? 125.725 76.043  116.848 1.00 56.68  ? 267 GLN D NE2 1 
ATOM   10421 N  N   . ALA D  1 291 ? 122.597 77.990  111.267 1.00 19.61  ? 268 ALA D N   1 
ATOM   10422 C  CA  . ALA D  1 291 ? 121.332 78.599  110.854 1.00 15.45  ? 268 ALA D CA  1 
ATOM   10423 C  C   . ALA D  1 291 ? 120.817 78.001  109.539 1.00 25.29  ? 268 ALA D C   1 
ATOM   10424 O  O   . ALA D  1 291 ? 119.752 78.383  109.060 1.00 27.98  ? 268 ALA D O   1 
ATOM   10425 C  CB  . ALA D  1 291 ? 121.478 80.111  110.743 1.00 12.93  ? 268 ALA D CB  1 
ATOM   10426 N  N   . GLY D  1 292 ? 121.570 77.056  108.972 1.00 25.13  ? 269 GLY D N   1 
ATOM   10427 C  CA  . GLY D  1 292 ? 121.229 76.451  107.691 1.00 20.38  ? 269 GLY D CA  1 
ATOM   10428 C  C   . GLY D  1 292 ? 121.144 77.453  106.545 1.00 25.01  ? 269 GLY D C   1 
ATOM   10429 O  O   . GLY D  1 292 ? 120.300 77.319  105.676 1.00 16.99  ? 269 GLY D O   1 
ATOM   10430 N  N   . ALA D  1 293 ? 122.035 78.443  106.537 1.00 17.94  ? 270 ALA D N   1 
ATOM   10431 C  CA  . ALA D  1 293 ? 121.982 79.559  105.586 1.00 17.07  ? 270 ALA D CA  1 
ATOM   10432 C  C   . ALA D  1 293 ? 122.466 79.261  104.157 1.00 26.31  ? 270 ALA D C   1 
ATOM   10433 O  O   . ALA D  1 293 ? 122.104 79.974  103.217 1.00 25.44  ? 270 ALA D O   1 
ATOM   10434 C  CB  . ALA D  1 293 ? 122.764 80.759  106.150 1.00 9.55   ? 270 ALA D CB  1 
ATOM   10435 N  N   . CYS D  1 294 ? 123.285 78.226  103.987 1.00 20.34  ? 271 CYS D N   1 
ATOM   10436 C  CA  . CYS D  1 294 ? 123.928 78.017  102.696 1.00 24.80  ? 271 CYS D CA  1 
ATOM   10437 C  C   . CYS D  1 294 ? 124.333 76.573  102.419 1.00 24.74  ? 271 CYS D C   1 
ATOM   10438 O  O   . CYS D  1 294 ? 124.483 75.769  103.345 1.00 22.52  ? 271 CYS D O   1 
ATOM   10439 C  CB  . CYS D  1 294 ? 125.173 78.881  102.613 1.00 21.25  ? 271 CYS D CB  1 
ATOM   10440 S  SG  . CYS D  1 294 ? 126.368 78.472  103.895 1.00 27.73  ? 271 CYS D SG  1 
ATOM   10441 N  N   . ASP D  1 295 ? 124.518 76.271  101.133 1.00 21.58  ? 272 ASP D N   1 
ATOM   10442 C  CA  . ASP D  1 295 ? 124.965 74.955  100.669 1.00 19.34  ? 272 ASP D CA  1 
ATOM   10443 C  C   . ASP D  1 295 ? 126.468 74.972  100.438 1.00 15.98  ? 272 ASP D C   1 
ATOM   10444 O  O   . ASP D  1 295 ? 127.123 73.932  100.498 1.00 21.93  ? 272 ASP D O   1 
ATOM   10445 C  CB  . ASP D  1 295 ? 124.274 74.578  99.345  1.00 12.57  ? 272 ASP D CB  1 
ATOM   10446 C  CG  . ASP D  1 295 ? 122.758 74.624  99.435  1.00 25.91  ? 272 ASP D CG  1 
ATOM   10447 O  OD1 . ASP D  1 295 ? 122.157 75.452  98.715  1.00 22.31  ? 272 ASP D OD1 1 
ATOM   10448 O  OD2 . ASP D  1 295 ? 122.166 73.830  100.214 1.00 25.89  ? 272 ASP D OD2 1 
ATOM   10449 N  N   . LEU D  1 296 ? 127.000 76.157  100.141 1.00 14.19  ? 273 LEU D N   1 
ATOM   10450 C  CA  . LEU D  1 296 ? 128.420 76.333  99.815  1.00 11.27  ? 273 LEU D CA  1 
ATOM   10451 C  C   . LEU D  1 296 ? 128.930 77.610  100.497 1.00 12.62  ? 273 LEU D C   1 
ATOM   10452 O  O   . LEU D  1 296 ? 128.144 78.529  100.760 1.00 16.82  ? 273 LEU D O   1 
ATOM   10453 C  CB  . LEU D  1 296 ? 128.611 76.452  98.293  1.00 16.19  ? 273 LEU D CB  1 
ATOM   10454 C  CG  . LEU D  1 296 ? 127.984 75.405  97.365  1.00 18.55  ? 273 LEU D CG  1 
ATOM   10455 C  CD1 . LEU D  1 296 ? 128.054 75.854  95.929  1.00 19.98  ? 273 LEU D CD1 1 
ATOM   10456 C  CD2 . LEU D  1 296 ? 128.675 74.097  97.516  1.00 18.80  ? 273 LEU D CD2 1 
ATOM   10457 N  N   . VAL D  1 297 ? 130.231 77.682  100.773 1.00 10.45  ? 274 VAL D N   1 
ATOM   10458 C  CA  . VAL D  1 297 ? 130.814 78.899  101.356 1.00 15.64  ? 274 VAL D CA  1 
ATOM   10459 C  C   . VAL D  1 297 ? 132.051 79.376  100.584 1.00 21.02  ? 274 VAL D C   1 
ATOM   10460 O  O   . VAL D  1 297 ? 132.804 78.572  100.023 1.00 15.53  ? 274 VAL D O   1 
ATOM   10461 C  CB  . VAL D  1 297 ? 131.183 78.685  102.835 1.00 20.17  ? 274 VAL D CB  1 
ATOM   10462 C  CG1 . VAL D  1 297