data_3UMO
# 
_entry.id   3UMO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UMO         
RCSB  RCSB068945   
WWPDB D_1000068945 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CQD . unspecified 
PDB 3UMP . unspecified 
# 
_pdbx_database_status.entry_id                        3UMO 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-14 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pereira, H.M.' 1 
'Caniuguir, A.' 2 
'Baez, M.'      3 
'Cabrera, R.'   4 
'Garratt, R.C.' 5 
'Babul, J.'     6 
# 
_citation.id                        primary 
_citation.title                     
'A Ribokinase Family Conserved Monovalent Cation Binding Site Enhances the MgATP-induced Inhibition in E. coli Phosphofructokinase-2' 
_citation.journal_abbrev            Biophys.J. 
_citation.journal_volume            105 
_citation.page_first                185 
_citation.page_last                 193 
_citation.year                      2013 
_citation.journal_id_ASTM           BIOJAU 
_citation.country                   US 
_citation.journal_id_ISSN           0006-3495 
_citation.journal_id_CSD            0030 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23823238 
_citation.pdbx_database_id_DOI      10.1016/j.bpj.2013.05.028 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Baez, M.'                1  
primary 'Cabrera, R.'             2  
primary 'Pereira, H.M.'           3  
primary 'Blanco, A.'              4  
primary 'Villalobos, P.'          5  
primary 'Ramirez-Sarmiento, C.A.' 6  
primary 'Caniuguir, A.'           7  
primary 'Guixe, V.'               8  
primary 'Garratt, R.C.'           9  
primary 'Babul, J.'               10 
# 
_cell.length_a           43.812 
_cell.length_b           88.770 
_cell.length_c           176.120 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3UMO 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 2 2 21' 
_symmetry.entry_id                         3UMO 
_symmetry.Int_Tables_number                17 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '6-phosphofructokinase isozyme 2' 32486.900 2   2.7.1.11 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                   24.305    4   ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"       507.181   4   ?        ? ? ? 
4 non-polymer syn 'POTASSIUM ION'                   39.098    2   ?        ? ? ? 
5 water       nat water                             18.015    568 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Phosphofructokinase-2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPV
ATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQG
IRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKIYAYLSR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPV
ATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQG
IRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKIYAYLSR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ARG n 
1 4   ILE n 
1 5   TYR n 
1 6   THR n 
1 7   LEU n 
1 8   THR n 
1 9   LEU n 
1 10  ALA n 
1 11  PRO n 
1 12  SER n 
1 13  LEU n 
1 14  ASP n 
1 15  SER n 
1 16  ALA n 
1 17  THR n 
1 18  ILE n 
1 19  THR n 
1 20  PRO n 
1 21  GLN n 
1 22  ILE n 
1 23  TYR n 
1 24  PRO n 
1 25  GLU n 
1 26  GLY n 
1 27  LYS n 
1 28  LEU n 
1 29  ARG n 
1 30  CYS n 
1 31  THR n 
1 32  ALA n 
1 33  PRO n 
1 34  VAL n 
1 35  PHE n 
1 36  GLU n 
1 37  PRO n 
1 38  GLY n 
1 39  GLY n 
1 40  GLY n 
1 41  GLY n 
1 42  ILE n 
1 43  ASN n 
1 44  VAL n 
1 45  ALA n 
1 46  ARG n 
1 47  ALA n 
1 48  ILE n 
1 49  ALA n 
1 50  HIS n 
1 51  LEU n 
1 52  GLY n 
1 53  GLY n 
1 54  SER n 
1 55  ALA n 
1 56  THR n 
1 57  ALA n 
1 58  ILE n 
1 59  PHE n 
1 60  PRO n 
1 61  ALA n 
1 62  GLY n 
1 63  GLY n 
1 64  ALA n 
1 65  THR n 
1 66  GLY n 
1 67  GLU n 
1 68  HIS n 
1 69  LEU n 
1 70  VAL n 
1 71  SER n 
1 72  LEU n 
1 73  LEU n 
1 74  ALA n 
1 75  ASP n 
1 76  GLU n 
1 77  ASN n 
1 78  VAL n 
1 79  PRO n 
1 80  VAL n 
1 81  ALA n 
1 82  THR n 
1 83  VAL n 
1 84  GLU n 
1 85  ALA n 
1 86  LYS n 
1 87  ASP n 
1 88  TRP n 
1 89  THR n 
1 90  ARG n 
1 91  GLN n 
1 92  ASN n 
1 93  LEU n 
1 94  HIS n 
1 95  VAL n 
1 96  HIS n 
1 97  VAL n 
1 98  GLU n 
1 99  ALA n 
1 100 SER n 
1 101 GLY n 
1 102 GLU n 
1 103 GLN n 
1 104 TYR n 
1 105 ARG n 
1 106 PHE n 
1 107 VAL n 
1 108 MET n 
1 109 PRO n 
1 110 GLY n 
1 111 ALA n 
1 112 ALA n 
1 113 LEU n 
1 114 ASN n 
1 115 GLU n 
1 116 ASP n 
1 117 GLU n 
1 118 PHE n 
1 119 ARG n 
1 120 GLN n 
1 121 LEU n 
1 122 GLU n 
1 123 GLU n 
1 124 GLN n 
1 125 VAL n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 GLU n 
1 130 SER n 
1 131 GLY n 
1 132 ALA n 
1 133 ILE n 
1 134 LEU n 
1 135 VAL n 
1 136 ILE n 
1 137 SER n 
1 138 GLY n 
1 139 SER n 
1 140 LEU n 
1 141 PRO n 
1 142 PRO n 
1 143 GLY n 
1 144 VAL n 
1 145 LYS n 
1 146 LEU n 
1 147 GLU n 
1 148 LYS n 
1 149 LEU n 
1 150 THR n 
1 151 GLN n 
1 152 LEU n 
1 153 ILE n 
1 154 SER n 
1 155 ALA n 
1 156 ALA n 
1 157 GLN n 
1 158 LYS n 
1 159 GLN n 
1 160 GLY n 
1 161 ILE n 
1 162 ARG n 
1 163 CYS n 
1 164 ILE n 
1 165 VAL n 
1 166 ASP n 
1 167 SER n 
1 168 SER n 
1 169 GLY n 
1 170 GLU n 
1 171 ALA n 
1 172 LEU n 
1 173 SER n 
1 174 ALA n 
1 175 ALA n 
1 176 LEU n 
1 177 ALA n 
1 178 ILE n 
1 179 GLY n 
1 180 ASN n 
1 181 ILE n 
1 182 GLU n 
1 183 LEU n 
1 184 VAL n 
1 185 LYS n 
1 186 PRO n 
1 187 ASN n 
1 188 GLN n 
1 189 LYS n 
1 190 GLU n 
1 191 LEU n 
1 192 SER n 
1 193 ALA n 
1 194 LEU n 
1 195 VAL n 
1 196 ASN n 
1 197 ARG n 
1 198 GLU n 
1 199 LEU n 
1 200 THR n 
1 201 GLN n 
1 202 PRO n 
1 203 ASP n 
1 204 ASP n 
1 205 VAL n 
1 206 ARG n 
1 207 LYS n 
1 208 ALA n 
1 209 ALA n 
1 210 GLN n 
1 211 GLU n 
1 212 ILE n 
1 213 VAL n 
1 214 ASN n 
1 215 SER n 
1 216 GLY n 
1 217 LYS n 
1 218 ALA n 
1 219 LYS n 
1 220 ARG n 
1 221 VAL n 
1 222 VAL n 
1 223 VAL n 
1 224 SER n 
1 225 LEU n 
1 226 GLY n 
1 227 PRO n 
1 228 GLN n 
1 229 GLY n 
1 230 ALA n 
1 231 LEU n 
1 232 GLY n 
1 233 VAL n 
1 234 ASP n 
1 235 SER n 
1 236 GLU n 
1 237 ASN n 
1 238 CYS n 
1 239 ILE n 
1 240 GLN n 
1 241 VAL n 
1 242 VAL n 
1 243 PRO n 
1 244 PRO n 
1 245 PRO n 
1 246 VAL n 
1 247 LYS n 
1 248 SER n 
1 249 GLN n 
1 250 SER n 
1 251 THR n 
1 252 VAL n 
1 253 GLY n 
1 254 ALA n 
1 255 GLY n 
1 256 ASP n 
1 257 SER n 
1 258 MET n 
1 259 VAL n 
1 260 GLY n 
1 261 ALA n 
1 262 MET n 
1 263 THR n 
1 264 LEU n 
1 265 LYS n 
1 266 LEU n 
1 267 ALA n 
1 268 GLU n 
1 269 ASN n 
1 270 ALA n 
1 271 SER n 
1 272 LEU n 
1 273 GLU n 
1 274 GLU n 
1 275 MET n 
1 276 VAL n 
1 277 ARG n 
1 278 PHE n 
1 279 GLY n 
1 280 VAL n 
1 281 ALA n 
1 282 ALA n 
1 283 GLY n 
1 284 SER n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 LEU n 
1 289 ASN n 
1 290 GLN n 
1 291 GLY n 
1 292 THR n 
1 293 ARG n 
1 294 LEU n 
1 295 CYS n 
1 296 SER n 
1 297 HIS n 
1 298 ASP n 
1 299 ASP n 
1 300 THR n 
1 301 GLN n 
1 302 LYS n 
1 303 ILE n 
1 304 TYR n 
1 305 ALA n 
1 306 TYR n 
1 307 LEU n 
1 308 SER n 
1 309 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'b1723, JW5280, PFK2, pfkB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21-D 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    K6PF2_ECOLI 
_struct_ref.pdbx_db_accession          P06999 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPV
ATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQG
IRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKIYAYLSR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UMO A 1 ? 309 ? P06999 1 ? 309 ? 1 309 
2 1 3UMO B 1 ? 309 ? P06999 1 ? 309 ? 1 309 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'             ? 'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3UMO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.75 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'23% PEG 4000, 0.1 M SODIUM ACETATE PH 4.75, 0.2 M AMMONIUM ACETATE, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-09-09 
_diffrn_detector.details                'DCM Si(311) and Si(111)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'SI(311) AND SI(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97627 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_wavelength_list        0.97627 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
# 
_reflns.entry_id                     3UMO 
_reflns.d_resolution_high            1.696 
_reflns.number_obs                   76251 
_reflns.pdbx_Rmerge_I_obs            0.051 
_reflns.pdbx_netI_over_sigmaI        15.060 
_reflns.percent_possible_obs         98.800 
_reflns.B_iso_Wilson_estimate        34.020 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   77204 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.696 1.800 53412 ? 12064 0.590 2.040  ? ? ? ? ? 98.100 1 1 
1.800 1.920 49794 ? 11535 0.339 3.590  ? ? ? ? ? 99.600 2 1 
1.920 2.080 48977 ? 10794 0.188 6.790  ? ? ? ? ? 99.700 3 1 
2.080 2.270 42101 ? 9818  0.116 11.230 ? ? ? ? ? 98.800 4 1 
2.270 2.540 40211 ? 8985  0.078 16.940 ? ? ? ? ? 98.900 5 1 
2.540 2.930 33333 ? 7929  0.056 24.010 ? ? ? ? ? 98.500 6 1 
2.930 3.590 28803 ? 6728  0.039 33.330 ? ? ? ? ? 98.300 7 1 
3.590 5.060 21218 ? 5293  0.032 38.920 ? ? ? ? ? 98.100 8 1 
5.060 50.0  12666 ? 3105  0.026 40.580 ? ? ? ? ? 97.600 9 1 
# 
_refine.entry_id                                 3UMO 
_refine.ls_d_res_high                            1.6960 
_refine.ls_d_res_low                             48.9670 
_refine.pdbx_ls_sigma_F                          2.020 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.7700 
_refine.ls_number_reflns_obs                     76249 
_refine.ls_number_reflns_all                     77204 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.details                                  ? 
_refine.ls_R_factor_obs                          0.1828 
_refine.ls_R_factor_R_work                       0.1814 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2079 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  3813 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               30.7992 
_refine.solvent_model_param_bsol                 29.3140 
_refine.solvent_model_param_ksol                 0.3210 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -1.8126 
_refine.aniso_B[2][2]                            2.0555 
_refine.aniso_B[3][3]                            -0.2429 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4800 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3CQD 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                87.650 
_refine.B_iso_min                                10.970 
_refine.pdbx_overall_phase_error                 19.2900 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.380 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4542 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         130 
_refine_hist.number_atoms_solvent             568 
_refine_hist.number_atoms_total               5240 
_refine_hist.d_res_high                       1.6960 
_refine_hist.d_res_low                        48.9670 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           4826 0.011  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          6606 1.297  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     776  0.064  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      838  0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1794 20.150 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.6960 1.7177  27 93.0000  2454 . 0.3052 0.3374 . 129 . 2583 . . 'X-RAY DIFFRACTION' 
1.7177 1.7403  27 100.0000 2717 . 0.2979 0.3697 . 143 . 2860 . . 'X-RAY DIFFRACTION' 
1.7403 1.7641  27 100.0000 2646 . 0.2791 0.3005 . 139 . 2785 . . 'X-RAY DIFFRACTION' 
1.7641 1.7893  27 100.0000 2639 . 0.2716 0.2931 . 139 . 2778 . . 'X-RAY DIFFRACTION' 
1.7893 1.8160  27 100.0000 2701 . 0.2648 0.2947 . 142 . 2843 . . 'X-RAY DIFFRACTION' 
1.8160 1.8444  27 100.0000 2656 . 0.2584 0.2982 . 140 . 2796 . . 'X-RAY DIFFRACTION' 
1.8444 1.8746  27 99.0000  2637 . 0.2399 0.2784 . 139 . 2776 . . 'X-RAY DIFFRACTION' 
1.8746 1.9070  27 100.0000 2744 . 0.2246 0.2297 . 144 . 2888 . . 'X-RAY DIFFRACTION' 
1.9070 1.9416  27 100.0000 2639 . 0.2010 0.2397 . 139 . 2778 . . 'X-RAY DIFFRACTION' 
1.9416 1.9790  27 100.0000 2705 . 0.1988 0.2294 . 143 . 2848 . . 'X-RAY DIFFRACTION' 
1.9790 2.0194  27 100.0000 2659 . 0.1961 0.2285 . 140 . 2799 . . 'X-RAY DIFFRACTION' 
2.0194 2.0633  27 100.0000 2683 . 0.1866 0.2127 . 141 . 2824 . . 'X-RAY DIFFRACTION' 
2.0633 2.1113  27 99.0000  2679 . 0.1868 0.2002 . 141 . 2820 . . 'X-RAY DIFFRACTION' 
2.1113 2.1641  27 99.0000  2647 . 0.1736 0.2001 . 139 . 2786 . . 'X-RAY DIFFRACTION' 
2.1641 2.2226  27 99.0000  2658 . 0.1760 0.2080 . 140 . 2798 . . 'X-RAY DIFFRACTION' 
2.2226 2.2880  27 98.0000  2670 . 0.1803 0.2453 . 141 . 2811 . . 'X-RAY DIFFRACTION' 
2.2880 2.3619  27 99.0000  2668 . 0.1787 0.2088 . 140 . 2808 . . 'X-RAY DIFFRACTION' 
2.3619 2.4463  27 99.0000  2706 . 0.1771 0.2134 . 143 . 2849 . . 'X-RAY DIFFRACTION' 
2.4463 2.5442  27 99.0000  2663 . 0.1764 0.2088 . 140 . 2803 . . 'X-RAY DIFFRACTION' 
2.5442 2.6600  27 99.0000  2680 . 0.1742 0.2189 . 141 . 2821 . . 'X-RAY DIFFRACTION' 
2.6600 2.8002  27 99.0000  2687 . 0.1829 0.2217 . 141 . 2828 . . 'X-RAY DIFFRACTION' 
2.8002 2.9756  27 98.0000  2688 . 0.1794 0.2176 . 142 . 2830 . . 'X-RAY DIFFRACTION' 
2.9756 3.2053  27 98.0000  2696 . 0.1864 0.2251 . 141 . 2837 . . 'X-RAY DIFFRACTION' 
3.2053 3.5278  27 98.0000  2720 . 0.1831 0.2039 . 144 . 2864 . . 'X-RAY DIFFRACTION' 
3.5278 4.0381  27 98.0000  2749 . 0.1596 0.1837 . 144 . 2893 . . 'X-RAY DIFFRACTION' 
4.0381 5.0867  27 98.0000  2730 . 0.1383 0.1446 . 144 . 2874 . . 'X-RAY DIFFRACTION' 
5.0867 48.9875 27 98.0000  2915 . 0.1761 0.1886 . 154 . 3069 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UMO 
_struct.title                     'Crystal structure of the Phosphofructokinase-2 from Escherichia coli in complex with Potassium' 
_struct.pdbx_descriptor           '6-phosphofructokinase isozyme 2 (E.C.2.7.1.11)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UMO 
_struct_keywords.text            'GLYCOLYSIS, TRANSFERASE, PFK, enzyme' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 39  ? LEU A 51  ? GLY A 39  LEU A 51  1 ? 13 
HELX_P HELX_P2  2  GLY A 62  ? GLU A 76  ? GLY A 62  GLU A 76  1 ? 15 
HELX_P HELX_P3  3  ASN A 114 ? LEU A 126 ? ASN A 114 LEU A 126 1 ? 13 
HELX_P HELX_P4  4  LYS A 145 ? GLN A 159 ? LYS A 145 GLN A 159 1 ? 15 
HELX_P HELX_P5  5  SER A 168 ? LEU A 176 ? SER A 168 LEU A 176 1 ? 9  
HELX_P HELX_P6  6  ASN A 187 ? ASN A 196 ? ASN A 187 ASN A 196 1 ? 10 
HELX_P HELX_P7  7  ASP A 203 ? SER A 215 ? ASP A 203 SER A 215 1 ? 13 
HELX_P HELX_P8  8  GLY A 226 ? GLN A 228 ? GLY A 226 GLN A 228 5 ? 3  
HELX_P HELX_P9  9  GLY A 253 ? GLU A 268 ? GLY A 253 GLU A 268 1 ? 16 
HELX_P HELX_P10 10 SER A 271 ? THR A 287 ? SER A 271 THR A 287 1 ? 17 
HELX_P HELX_P11 11 SER A 296 ? SER A 308 ? SER A 296 SER A 308 1 ? 13 
HELX_P HELX_P12 12 GLY B 39  ? LEU B 51  ? GLY B 39  LEU B 51  1 ? 13 
HELX_P HELX_P13 13 GLY B 62  ? GLU B 76  ? GLY B 62  GLU B 76  1 ? 15 
HELX_P HELX_P14 14 ASN B 114 ? LEU B 126 ? ASN B 114 LEU B 126 1 ? 13 
HELX_P HELX_P15 15 LYS B 145 ? GLN B 159 ? LYS B 145 GLN B 159 1 ? 15 
HELX_P HELX_P16 16 SER B 168 ? LEU B 176 ? SER B 168 LEU B 176 1 ? 9  
HELX_P HELX_P17 17 ASN B 187 ? ASN B 196 ? ASN B 187 ASN B 196 1 ? 10 
HELX_P HELX_P18 18 ASP B 203 ? SER B 215 ? ASP B 203 SER B 215 1 ? 13 
HELX_P HELX_P19 19 GLY B 226 ? GLN B 228 ? GLY B 226 GLN B 228 5 ? 3  
HELX_P HELX_P20 20 GLY B 253 ? GLU B 268 ? GLY B 253 GLU B 268 1 ? 16 
HELX_P HELX_P21 21 SER B 271 ? LEU B 288 ? SER B 271 LEU B 288 1 ? 18 
HELX_P HELX_P22 22 SER B 296 ? SER B 308 ? SER B 296 SER B 308 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? J MG  .   MG ? ? ? 1_555 K ATP . O2B ? ? B MG  311 B ATP 313 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc2  metalc ? ? G MG  .   MG ? ? ? 1_555 H ATP . O3G B ? A MG  312 A ATP 315 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc3  metalc ? ? D MG  .   MG ? ? ? 1_555 I ATP . O3G B ? A MG  311 B ATP 312 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc4  metalc ? ? C MG  .   MG ? ? ? 1_555 E ATP . O2B ? ? A MG  310 A ATP 313 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc5  metalc ? ? D MG  .   MG ? ? ? 1_555 E ATP . O1B ? ? A MG  311 A ATP 313 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc6  metalc ? ? G MG  .   MG ? ? ? 1_555 H ATP . O1B B ? A MG  312 A ATP 315 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc7  metalc ? ? D MG  .   MG ? ? ? 1_555 E ATP . O3G ? ? A MG  311 A ATP 313 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc8  metalc ? ? G MG  .   MG ? ? ? 1_555 H ATP . O1G A ? A MG  312 A ATP 315 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc9  metalc ? ? G MG  .   MG ? ? ? 1_555 K ATP . O1B ? ? A MG  312 B ATP 313 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc10 metalc ? ? C MG  .   MG ? ? ? 1_555 E ATP . O1G ? ? A MG  310 A ATP 313 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc11 metalc ? ? J MG  .   MG ? ? ? 1_555 M HOH . O   ? ? B MG  311 A HOH 339 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc12 metalc ? ? J MG  .   MG ? ? ? 1_555 K ATP . O1G ? ? B MG  311 B ATP 313 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc13 metalc ? ? D MG  .   MG ? ? ? 1_555 I ATP . O1G A ? A MG  311 B ATP 312 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc14 metalc ? ? G MG  .   MG ? ? ? 1_555 H ATP . O2B A ? A MG  312 A ATP 315 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc15 metalc ? ? C MG  .   MG ? ? ? 1_555 M HOH . O   ? ? A MG  310 A HOH 532 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc16 metalc ? ? G MG  .   MG ? ? ? 1_555 K ATP . O3G ? ? A MG  312 B ATP 313 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc17 metalc ? ? D MG  .   MG ? ? ? 1_555 I ATP . O1B B ? A MG  311 B ATP 312 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc18 metalc ? ? J MG  .   MG ? ? ? 1_555 N HOH . O   ? ? B MG  311 B HOH 342 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc19 metalc ? ? C MG  .   MG ? ? ? 1_555 M HOH . O   ? ? A MG  310 A HOH 533 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc20 metalc ? ? G MG  .   MG ? ? ? 1_555 N HOH . O   ? ? A MG  312 B HOH 669 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc21 metalc ? ? J MG  .   MG ? ? ? 1_555 N HOH . O   ? ? B MG  311 B HOH 310 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc22 metalc ? ? D MG  .   MG ? ? ? 1_555 M HOH . O   ? ? A MG  311 A HOH 686 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc23 metalc ? ? C MG  .   MG ? ? ? 1_555 M HOH . O   ? ? A MG  310 A HOH 535 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc24 metalc ? ? D MG  .   MG ? ? ? 1_555 I ATP . O2B A ? A MG  311 B ATP 312 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc25 metalc ? ? C MG  .   MG ? ? ? 1_555 N HOH . O   ? ? A MG  310 B HOH 534 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc26 metalc ? ? G MG  .   MG ? ? ? 1_555 M HOH . O   ? ? A MG  312 A HOH 536 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc27 metalc ? ? J MG  .   MG ? ? ? 1_555 N HOH . O   ? ? B MG  311 B HOH 318 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc28 metalc ? ? D MG  .   MG ? ? ? 1_555 N HOH . O   ? ? A MG  311 B HOH 531 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc29 metalc ? ? A ASN 289 O  ? ? ? 1_555 F K   . K   ? ? A ASN 289 A K   314 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc30 metalc ? ? B ASN 289 O  ? ? ? 1_555 L K   . K   ? ? B ASN 289 B K   314 1_555 ? ? ? ? ? ? ? 2.801 ? 
metalc31 metalc ? ? A GLY 291 O  ? ? ? 1_555 F K   . K   ? ? A GLY 291 A K   314 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc32 metalc ? ? A VAL 252 O  ? ? ? 1_555 F K   . K   ? ? A VAL 252 A K   314 1_555 ? ? ? ? ? ? ? 2.848 ? 
metalc33 metalc ? ? B GLY 291 O  ? ? ? 1_555 L K   . K   ? ? B GLY 291 B K   314 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc34 metalc ? ? A ARG 293 O  ? ? ? 1_555 F K   . K   ? ? A ARG 293 A K   314 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc35 metalc ? ? A ALA 286 O  ? ? ? 1_555 F K   . K   ? ? A ALA 286 A K   314 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc36 metalc ? ? B ALA 286 O  ? ? ? 1_555 L K   . K   ? ? B ALA 286 B K   314 1_555 ? ? ? ? ? ? ? 2.942 ? 
metalc37 metalc ? ? B ARG 293 O  ? ? ? 1_555 L K   . K   ? ? B ARG 293 B K   314 1_555 ? ? ? ? ? ? ? 2.951 ? 
metalc38 metalc ? ? A SER 250 O  ? ? ? 1_555 F K   . K   ? ? A SER 250 A K   314 1_555 ? ? ? ? ? ? ? 3.071 ? 
metalc39 metalc ? ? B SER 250 O  ? ? ? 1_555 L K   . K   ? ? B SER 250 B K   314 1_555 ? ? ? ? ? ? ? 3.110 ? 
metalc40 metalc ? ? B VAL 252 O  ? ? ? 1_555 L K   . K   ? ? B VAL 252 B K   314 1_555 ? ? ? ? ? ? ? 3.214 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 5 ? 
D ? 3 ? 
E ? 6 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 80  ? GLU A 84  ? VAL A 80  GLU A 84  
A 2 ALA A 55  ? ALA A 61  ? ALA A 55  ALA A 61  
A 3 ILE A 4   ? LEU A 7   ? ILE A 4   LEU A 7   
A 4 ILE A 133 ? SER A 137 ? ILE A 133 SER A 137 
A 5 ARG A 162 ? ASP A 166 ? ARG A 162 ASP A 166 
A 6 LEU A 183 ? VAL A 184 ? LEU A 183 VAL A 184 
B 1 VAL A 34  ? GLY A 38  ? VAL A 34  GLY A 38  
B 2 SER A 12  ? THR A 19  ? SER A 12  THR A 19  
B 3 LEU A 93  ? VAL A 97  ? LEU A 93  VAL A 97  
B 4 GLN A 103 ? VAL A 107 ? GLN A 103 VAL A 107 
B 5 LYS B 27  ? ARG B 29  ? LYS B 27  ARG B 29  
C 1 LYS A 27  ? ARG A 29  ? LYS A 27  ARG A 29  
C 2 GLN B 103 ? VAL B 107 ? GLN B 103 VAL B 107 
C 3 LEU B 93  ? VAL B 97  ? LEU B 93  VAL B 97  
C 4 SER B 12  ? THR B 19  ? SER B 12  THR B 19  
C 5 VAL B 34  ? GLY B 38  ? VAL B 34  GLY B 38  
D 1 VAL A 221 ? SER A 224 ? VAL A 221 SER A 224 
D 2 ALA A 230 ? VAL A 233 ? ALA A 230 VAL A 233 
D 3 CYS A 238 ? VAL A 241 ? CYS A 238 VAL A 241 
E 1 VAL B 80  ? GLU B 84  ? VAL B 80  GLU B 84  
E 2 ALA B 55  ? ALA B 61  ? ALA B 55  ALA B 61  
E 3 ILE B 4   ? LEU B 7   ? ILE B 4   LEU B 7   
E 4 ILE B 133 ? SER B 137 ? ILE B 133 SER B 137 
E 5 ARG B 162 ? ASP B 166 ? ARG B 162 ASP B 166 
E 6 LEU B 183 ? VAL B 184 ? LEU B 183 VAL B 184 
F 1 VAL B 221 ? SER B 224 ? VAL B 221 SER B 224 
F 2 ALA B 230 ? VAL B 233 ? ALA B 230 VAL B 233 
F 3 CYS B 238 ? VAL B 241 ? CYS B 238 VAL B 241 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 83  ? O VAL A 83  N ALA A 61  ? N ALA A 61  
A 2 3 O ILE A 58  ? O ILE A 58  N THR A 6   ? N THR A 6   
A 3 4 N LEU A 7   ? N LEU A 7   O VAL A 135 ? O VAL A 135 
A 4 5 N ILE A 136 ? N ILE A 136 O ILE A 164 ? O ILE A 164 
A 5 6 N VAL A 165 ? N VAL A 165 O LEU A 183 ? O LEU A 183 
B 1 2 O VAL A 34  ? O VAL A 34  N ALA A 16  ? N ALA A 16  
B 2 3 N SER A 15  ? N SER A 15  O HIS A 94  ? O HIS A 94  
B 3 4 N VAL A 95  ? N VAL A 95  O TYR A 104 ? O TYR A 104 
B 4 5 N VAL A 107 ? N VAL A 107 O LEU B 28  ? O LEU B 28  
C 1 2 N LEU A 28  ? N LEU A 28  O VAL B 107 ? O VAL B 107 
C 2 3 O TYR B 104 ? O TYR B 104 N VAL B 95  ? N VAL B 95  
C 3 4 O HIS B 94  ? O HIS B 94  N SER B 15  ? N SER B 15  
C 4 5 N ALA B 16  ? N ALA B 16  O VAL B 34  ? O VAL B 34  
D 1 2 N VAL A 223 ? N VAL A 223 O LEU A 231 ? O LEU A 231 
D 2 3 N GLY A 232 ? N GLY A 232 O ILE A 239 ? O ILE A 239 
E 1 2 O VAL B 83  ? O VAL B 83  N ALA B 61  ? N ALA B 61  
E 2 3 O ILE B 58  ? O ILE B 58  N THR B 6   ? N THR B 6   
E 3 4 N LEU B 7   ? N LEU B 7   O VAL B 135 ? O VAL B 135 
E 4 5 N ILE B 136 ? N ILE B 136 O ILE B 164 ? O ILE B 164 
E 5 6 N VAL B 165 ? N VAL B 165 O LEU B 183 ? O LEU B 183 
F 1 2 N VAL B 221 ? N VAL B 221 O VAL B 233 ? O VAL B 233 
F 2 3 N GLY B 232 ? N GLY B 232 O ILE B 239 ? O ILE B 239 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 310'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 311'  
AC3 Software ? ? ? ? 31 'BINDING SITE FOR RESIDUE ATP A 313' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K A 314'   
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 312'  
AC6 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ATP A 315' 
AC7 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ATP B 312' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 311'  
AC9 Software ? ? ? ? 31 'BINDING SITE FOR RESIDUE ATP B 313' 
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K B 314'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ATP E .   ? ATP A 313 . ? 1_555 ? 
2   AC1 5  HOH M .   ? HOH A 532 . ? 1_555 ? 
3   AC1 5  HOH M .   ? HOH A 533 . ? 1_555 ? 
4   AC1 5  HOH M .   ? HOH A 535 . ? 1_555 ? 
5   AC1 5  HOH N .   ? HOH B 534 . ? 1_555 ? 
6   AC2 4  ATP E .   ? ATP A 313 . ? 1_555 ? 
7   AC2 4  HOH M .   ? HOH A 686 . ? 1_555 ? 
8   AC2 4  ATP I .   ? ATP B 312 . ? 1_555 ? 
9   AC2 4  HOH N .   ? HOH B 531 . ? 1_555 ? 
10  AC3 31 LYS A 185 ? LYS A 185 . ? 1_555 ? 
11  AC3 31 ASN A 187 ? ASN A 187 . ? 1_555 ? 
12  AC3 31 SER A 224 ? SER A 224 . ? 1_555 ? 
13  AC3 31 LEU A 225 ? LEU A 225 . ? 1_555 ? 
14  AC3 31 GLY A 226 ? GLY A 226 . ? 1_555 ? 
15  AC3 31 PRO A 227 ? PRO A 227 . ? 1_555 ? 
16  AC3 31 GLY A 229 ? GLY A 229 . ? 1_555 ? 
17  AC3 31 THR A 251 ? THR A 251 . ? 1_555 ? 
18  AC3 31 ALA A 254 ? ALA A 254 . ? 1_555 ? 
19  AC3 31 GLY A 255 ? GLY A 255 . ? 1_555 ? 
20  AC3 31 MET A 258 ? MET A 258 . ? 1_555 ? 
21  AC3 31 VAL A 280 ? VAL A 280 . ? 1_555 ? 
22  AC3 31 GLY A 283 ? GLY A 283 . ? 1_555 ? 
23  AC3 31 SER A 284 ? SER A 284 . ? 1_555 ? 
24  AC3 31 THR A 287 ? THR A 287 . ? 1_555 ? 
25  AC3 31 MG  C .   ? MG  A 310 . ? 1_555 ? 
26  AC3 31 MG  D .   ? MG  A 311 . ? 1_555 ? 
27  AC3 31 HOH M .   ? HOH A 320 . ? 1_555 ? 
28  AC3 31 HOH M .   ? HOH A 323 . ? 1_555 ? 
29  AC3 31 HOH M .   ? HOH A 326 . ? 1_555 ? 
30  AC3 31 HOH M .   ? HOH A 360 . ? 1_555 ? 
31  AC3 31 HOH M .   ? HOH A 516 . ? 1_555 ? 
32  AC3 31 HOH M .   ? HOH A 518 . ? 1_555 ? 
33  AC3 31 HOH M .   ? HOH A 532 . ? 1_555 ? 
34  AC3 31 HOH M .   ? HOH A 533 . ? 1_555 ? 
35  AC3 31 HOH M .   ? HOH A 535 . ? 1_555 ? 
36  AC3 31 HOH M .   ? HOH A 649 . ? 1_555 ? 
37  AC3 31 HOH M .   ? HOH A 686 . ? 1_555 ? 
38  AC3 31 LYS B 27  ? LYS B 27  . ? 1_555 ? 
39  AC3 31 ATP I .   ? ATP B 312 . ? 1_555 ? 
40  AC3 31 HOH N .   ? HOH B 531 . ? 1_555 ? 
41  AC4 6  SER A 250 ? SER A 250 . ? 1_555 ? 
42  AC4 6  VAL A 252 ? VAL A 252 . ? 1_555 ? 
43  AC4 6  ALA A 286 ? ALA A 286 . ? 1_555 ? 
44  AC4 6  ASN A 289 ? ASN A 289 . ? 1_555 ? 
45  AC4 6  GLY A 291 ? GLY A 291 . ? 1_555 ? 
46  AC4 6  ARG A 293 ? ARG A 293 . ? 1_555 ? 
47  AC5 4  ATP H .   ? ATP A 315 . ? 1_555 ? 
48  AC5 4  HOH M .   ? HOH A 536 . ? 1_555 ? 
49  AC5 4  ATP K .   ? ATP B 313 . ? 1_555 ? 
50  AC5 4  HOH N .   ? HOH B 669 . ? 1_555 ? 
51  AC6 22 TYR A 23  ? TYR A 23  . ? 1_555 ? 
52  AC6 22 PRO A 24  ? PRO A 24  . ? 1_555 ? 
53  AC6 22 GLY A 26  ? GLY A 26  . ? 1_555 ? 
54  AC6 22 LYS A 27  ? LYS A 27  . ? 1_555 ? 
55  AC6 22 GLU A 102 ? GLU A 102 . ? 4_555 ? 
56  AC6 22 MG  G .   ? MG  A 312 . ? 1_555 ? 
57  AC6 22 HOH M .   ? HOH A 339 . ? 1_555 ? 
58  AC6 22 HOH M .   ? HOH A 344 . ? 1_555 ? 
59  AC6 22 HOH M .   ? HOH A 348 . ? 1_555 ? 
60  AC6 22 HOH M .   ? HOH A 382 . ? 1_555 ? 
61  AC6 22 HOH M .   ? HOH A 437 . ? 4_555 ? 
62  AC6 22 HOH M .   ? HOH A 514 . ? 1_555 ? 
63  AC6 22 HOH M .   ? HOH A 529 . ? 1_555 ? 
64  AC6 22 HOH M .   ? HOH A 536 . ? 1_555 ? 
65  AC6 22 HOH M .   ? HOH A 682 . ? 1_555 ? 
66  AC6 22 ASN B 187 ? ASN B 187 . ? 1_555 ? 
67  AC6 22 LYS B 189 ? LYS B 189 . ? 1_555 ? 
68  AC6 22 GLY B 226 ? GLY B 226 . ? 1_555 ? 
69  AC6 22 PRO B 227 ? PRO B 227 . ? 1_555 ? 
70  AC6 22 THR B 251 ? THR B 251 . ? 1_555 ? 
71  AC6 22 ATP K .   ? ATP B 313 . ? 1_555 ? 
72  AC6 22 HOH N .   ? HOH B 452 . ? 1_555 ? 
73  AC7 23 ASN A 187 ? ASN A 187 . ? 1_555 ? 
74  AC7 23 LYS A 189 ? LYS A 189 . ? 1_555 ? 
75  AC7 23 GLY A 226 ? GLY A 226 . ? 1_555 ? 
76  AC7 23 THR A 251 ? THR A 251 . ? 1_555 ? 
77  AC7 23 MG  D .   ? MG  A 311 . ? 1_555 ? 
78  AC7 23 ATP E .   ? ATP A 313 . ? 1_555 ? 
79  AC7 23 HOH M .   ? HOH A 358 . ? 1_555 ? 
80  AC7 23 HOH M .   ? HOH A 547 . ? 1_555 ? 
81  AC7 23 TYR B 23  ? TYR B 23  . ? 1_555 ? 
82  AC7 23 GLY B 26  ? GLY B 26  . ? 1_555 ? 
83  AC7 23 LYS B 27  ? LYS B 27  . ? 1_555 ? 
84  AC7 23 GLU B 102 ? GLU B 102 . ? 4_555 ? 
85  AC7 23 HOH N .   ? HOH B 386 . ? 1_555 ? 
86  AC7 23 HOH N .   ? HOH B 418 . ? 1_555 ? 
87  AC7 23 HOH N .   ? HOH B 423 . ? 1_555 ? 
88  AC7 23 HOH N .   ? HOH B 434 . ? 1_555 ? 
89  AC7 23 HOH N .   ? HOH B 463 . ? 1_555 ? 
90  AC7 23 HOH N .   ? HOH B 480 . ? 1_555 ? 
91  AC7 23 HOH N .   ? HOH B 508 . ? 4_555 ? 
92  AC7 23 HOH N .   ? HOH B 531 . ? 1_555 ? 
93  AC7 23 HOH N .   ? HOH B 534 . ? 1_555 ? 
94  AC7 23 HOH N .   ? HOH B 582 . ? 1_555 ? 
95  AC7 23 HOH N .   ? HOH B 591 . ? 1_555 ? 
96  AC8 5  HOH M .   ? HOH A 339 . ? 1_555 ? 
97  AC8 5  HOH N .   ? HOH B 310 . ? 1_555 ? 
98  AC8 5  ATP K .   ? ATP B 313 . ? 1_555 ? 
99  AC8 5  HOH N .   ? HOH B 318 . ? 1_555 ? 
100 AC8 5  HOH N .   ? HOH B 342 . ? 1_555 ? 
101 AC9 31 LYS A 27  ? LYS A 27  . ? 1_555 ? 
102 AC9 31 MG  G .   ? MG  A 312 . ? 1_555 ? 
103 AC9 31 ATP H .   ? ATP A 315 . ? 1_555 ? 
104 AC9 31 HOH M .   ? HOH A 339 . ? 1_555 ? 
105 AC9 31 HOH M .   ? HOH A 536 . ? 1_555 ? 
106 AC9 31 LYS B 185 ? LYS B 185 . ? 1_555 ? 
107 AC9 31 ASN B 187 ? ASN B 187 . ? 1_555 ? 
108 AC9 31 SER B 224 ? SER B 224 . ? 1_555 ? 
109 AC9 31 LEU B 225 ? LEU B 225 . ? 1_555 ? 
110 AC9 31 GLY B 226 ? GLY B 226 . ? 1_555 ? 
111 AC9 31 PRO B 227 ? PRO B 227 . ? 1_555 ? 
112 AC9 31 GLY B 229 ? GLY B 229 . ? 1_555 ? 
113 AC9 31 ALA B 254 ? ALA B 254 . ? 1_555 ? 
114 AC9 31 GLY B 255 ? GLY B 255 . ? 1_555 ? 
115 AC9 31 MET B 258 ? MET B 258 . ? 1_555 ? 
116 AC9 31 VAL B 280 ? VAL B 280 . ? 1_555 ? 
117 AC9 31 GLY B 283 ? GLY B 283 . ? 1_555 ? 
118 AC9 31 SER B 284 ? SER B 284 . ? 1_555 ? 
119 AC9 31 THR B 287 ? THR B 287 . ? 1_555 ? 
120 AC9 31 HOH N .   ? HOH B 310 . ? 1_555 ? 
121 AC9 31 MG  J .   ? MG  B 311 . ? 1_555 ? 
122 AC9 31 HOH N .   ? HOH B 318 . ? 1_555 ? 
123 AC9 31 HOH N .   ? HOH B 325 . ? 1_555 ? 
124 AC9 31 HOH N .   ? HOH B 342 . ? 1_555 ? 
125 AC9 31 HOH N .   ? HOH B 344 . ? 1_555 ? 
126 AC9 31 HOH N .   ? HOH B 352 . ? 1_555 ? 
127 AC9 31 HOH N .   ? HOH B 412 . ? 1_555 ? 
128 AC9 31 HOH N .   ? HOH B 441 . ? 1_555 ? 
129 AC9 31 HOH N .   ? HOH B 548 . ? 1_555 ? 
130 AC9 31 HOH N .   ? HOH B 557 . ? 1_555 ? 
131 AC9 31 HOH N .   ? HOH B 669 . ? 1_555 ? 
132 BC1 6  SER B 250 ? SER B 250 . ? 1_555 ? 
133 BC1 6  VAL B 252 ? VAL B 252 . ? 1_555 ? 
134 BC1 6  ALA B 286 ? ALA B 286 . ? 1_555 ? 
135 BC1 6  ASN B 289 ? ASN B 289 . ? 1_555 ? 
136 BC1 6  GLY B 291 ? GLY B 291 . ? 1_555 ? 
137 BC1 6  ARG B 293 ? ARG B 293 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3UMO 
_atom_sites.fract_transf_matrix[1][1]   0.022825 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011265 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005678 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 2.085   -32.289 37.809  1.00 68.57 ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 2.791   -31.296 37.007  1.00 63.66 ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 3.559   -30.325 37.900  1.00 64.61 ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 3.038   -29.855 38.914  1.00 69.39 ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 1.813   -30.524 36.115  1.00 54.58 ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 2.504   -29.626 35.098  1.00 45.77 ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 1.453   -28.373 34.334  1.00 83.02 ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 0.796   -29.256 32.919  1.00 80.93 ? 1   MET A CE    1 
ATOM   9    N  N     . VAL A 1 2   ? 4.800   -30.031 37.526  1.00 55.26 ? 2   VAL A N     1 
ATOM   10   C  CA    . VAL A 1 2   ? 5.613   -29.085 38.281  1.00 44.52 ? 2   VAL A CA    1 
ATOM   11   C  C     . VAL A 1 2   ? 5.221   -27.660 37.922  1.00 37.06 ? 2   VAL A C     1 
ATOM   12   O  O     . VAL A 1 2   ? 4.530   -27.433 36.935  1.00 41.32 ? 2   VAL A O     1 
ATOM   13   C  CB    . VAL A 1 2   ? 7.116   -29.283 38.011  1.00 41.20 ? 2   VAL A CB    1 
ATOM   14   C  CG1   . VAL A 1 2   ? 7.581   -30.626 38.563  1.00 46.37 ? 2   VAL A CG1   1 
ATOM   15   C  CG2   . VAL A 1 2   ? 7.408   -29.178 36.524  1.00 32.95 ? 2   VAL A CG2   1 
ATOM   16   N  N     . ARG A 1 3   ? 5.660   -26.702 38.727  1.00 32.68 ? 3   ARG A N     1 
ATOM   17   C  CA    . ARG A 1 3   ? 5.339   -25.306 38.463  1.00 36.55 ? 3   ARG A CA    1 
ATOM   18   C  C     . ARG A 1 3   ? 6.180   -24.738 37.322  1.00 30.53 ? 3   ARG A C     1 
ATOM   19   O  O     . ARG A 1 3   ? 7.295   -25.194 37.066  1.00 30.87 ? 3   ARG A O     1 
ATOM   20   C  CB    . ARG A 1 3   ? 5.514   -24.471 39.731  1.00 29.70 ? 3   ARG A CB    1 
ATOM   21   C  CG    . ARG A 1 3   ? 4.630   -24.936 40.888  1.00 42.74 ? 3   ARG A CG    1 
ATOM   22   C  CD    . ARG A 1 3   ? 4.518   -23.851 41.934  1.00 55.36 ? 3   ARG A CD    1 
ATOM   23   N  NE    . ARG A 1 3   ? 4.346   -22.548 41.298  1.00 66.34 ? 3   ARG A NE    1 
ATOM   24   C  CZ    . ARG A 1 3   ? 4.236   -21.397 41.952  1.00 70.57 ? 3   ARG A CZ    1 
ATOM   25   N  NH1   . ARG A 1 3   ? 4.282   -21.374 43.278  1.00 71.40 ? 3   ARG A NH1   1 
ATOM   26   N  NH2   . ARG A 1 3   ? 4.088   -20.265 41.277  1.00 70.74 ? 3   ARG A NH2   1 
ATOM   27   N  N     . ILE A 1 4   ? 5.631   -23.739 36.639  1.00 23.51 ? 4   ILE A N     1 
ATOM   28   C  CA    . ILE A 1 4   ? 6.305   -23.115 35.506  1.00 22.12 ? 4   ILE A CA    1 
ATOM   29   C  C     . ILE A 1 4   ? 6.491   -21.618 35.725  1.00 27.10 ? 4   ILE A C     1 
ATOM   30   O  O     . ILE A 1 4   ? 5.560   -20.915 36.133  1.00 27.19 ? 4   ILE A O     1 
ATOM   31   C  CB    . ILE A 1 4   ? 5.514   -23.338 34.206  1.00 26.52 ? 4   ILE A CB    1 
ATOM   32   C  CG1   . ILE A 1 4   ? 5.313   -24.835 33.967  1.00 27.50 ? 4   ILE A CG1   1 
ATOM   33   C  CG2   . ILE A 1 4   ? 6.229   -22.702 33.019  1.00 25.53 ? 4   ILE A CG2   1 
ATOM   34   C  CD1   . ILE A 1 4   ? 4.275   -25.151 32.893  1.00 29.43 ? 4   ILE A CD1   1 
ATOM   35   N  N     . TYR A 1 5   ? 7.700   -21.139 35.452  1.00 22.97 ? 5   TYR A N     1 
ATOM   36   C  CA    . TYR A 1 5   ? 8.015   -19.723 35.535  1.00 24.31 ? 5   TYR A CA    1 
ATOM   37   C  C     . TYR A 1 5   ? 8.613   -19.266 34.219  1.00 23.08 ? 5   TYR A C     1 
ATOM   38   O  O     . TYR A 1 5   ? 9.216   -20.063 33.493  1.00 20.93 ? 5   TYR A O     1 
ATOM   39   C  CB    . TYR A 1 5   ? 9.021   -19.468 36.661  1.00 22.62 ? 5   TYR A CB    1 
ATOM   40   C  CG    . TYR A 1 5   ? 8.507   -19.818 38.039  1.00 22.05 ? 5   TYR A CG    1 
ATOM   41   C  CD1   . TYR A 1 5   ? 8.568   -21.121 38.513  1.00 24.80 ? 5   TYR A CD1   1 
ATOM   42   C  CD2   . TYR A 1 5   ? 7.968   -18.841 38.868  1.00 29.22 ? 5   TYR A CD2   1 
ATOM   43   C  CE1   . TYR A 1 5   ? 8.093   -21.446 39.774  1.00 27.53 ? 5   TYR A CE1   1 
ATOM   44   C  CE2   . TYR A 1 5   ? 7.496   -19.156 40.131  1.00 30.90 ? 5   TYR A CE2   1 
ATOM   45   C  CZ    . TYR A 1 5   ? 7.561   -20.458 40.575  1.00 31.01 ? 5   TYR A CZ    1 
ATOM   46   O  OH    . TYR A 1 5   ? 7.100   -20.772 41.833  1.00 35.48 ? 5   TYR A OH    1 
ATOM   47   N  N     . THR A 1 6   ? 8.458   -17.985 33.901  1.00 19.27 ? 6   THR A N     1 
ATOM   48   C  CA    . THR A 1 6   ? 9.163   -17.433 32.748  1.00 20.51 ? 6   THR A CA    1 
ATOM   49   C  C     . THR A 1 6   ? 9.965   -16.205 33.149  1.00 22.00 ? 6   THR A C     1 
ATOM   50   O  O     . THR A 1 6   ? 9.661   -15.542 34.153  1.00 23.48 ? 6   THR A O     1 
ATOM   51   C  CB    . THR A 1 6   ? 8.227   -17.071 31.569  1.00 21.53 ? 6   THR A CB    1 
ATOM   52   O  OG1   . THR A 1 6   ? 7.513   -15.867 31.871  1.00 24.16 ? 6   THR A OG1   1 
ATOM   53   C  CG2   . THR A 1 6   ? 7.256   -18.210 31.257  1.00 22.71 ? 6   THR A CG2   1 
ATOM   54   N  N     . LEU A 1 7   ? 10.996  -15.915 32.368  1.00 21.32 ? 7   LEU A N     1 
ATOM   55   C  CA    . LEU A 1 7   ? 11.856  -14.775 32.643  1.00 22.83 ? 7   LEU A CA    1 
ATOM   56   C  C     . LEU A 1 7   ? 12.005  -13.924 31.394  1.00 21.61 ? 7   LEU A C     1 
ATOM   57   O  O     . LEU A 1 7   ? 12.416  -14.423 30.340  1.00 22.66 ? 7   LEU A O     1 
ATOM   58   C  CB    . LEU A 1 7   ? 13.231  -15.241 33.131  1.00 22.47 ? 7   LEU A CB    1 
ATOM   59   C  CG    . LEU A 1 7   ? 14.229  -14.110 33.376  1.00 23.04 ? 7   LEU A CG    1 
ATOM   60   C  CD1   . LEU A 1 7   ? 13.729  -13.197 34.485  1.00 23.66 ? 7   LEU A CD1   1 
ATOM   61   C  CD2   . LEU A 1 7   ? 15.607  -14.672 33.714  1.00 22.49 ? 7   LEU A CD2   1 
ATOM   62   N  N     . THR A 1 8   ? 11.663  -12.642 31.510  1.00 19.84 ? 8   THR A N     1 
ATOM   63   C  CA    . THR A 1 8   ? 11.742  -11.709 30.387  1.00 16.98 ? 8   THR A CA    1 
ATOM   64   C  C     . THR A 1 8   ? 12.598  -10.528 30.795  1.00 22.49 ? 8   THR A C     1 
ATOM   65   O  O     . THR A 1 8   ? 12.125  -9.627  31.487  1.00 22.36 ? 8   THR A O     1 
ATOM   66   C  CB    . THR A 1 8   ? 10.352  -11.184 29.992  1.00 23.44 ? 8   THR A CB    1 
ATOM   67   O  OG1   . THR A 1 8   ? 9.483   -12.292 29.761  1.00 22.46 ? 8   THR A OG1   1 
ATOM   68   C  CG2   . THR A 1 8   ? 10.429  -10.342 28.716  1.00 23.99 ? 8   THR A CG2   1 
ATOM   69   N  N     . LEU A 1 9   ? 13.865  -10.534 30.389  1.00 19.02 ? 9   LEU A N     1 
ATOM   70   C  CA    . LEU A 1 9   ? 14.763  -9.457  30.778  1.00 20.61 ? 9   LEU A CA    1 
ATOM   71   C  C     . LEU A 1 9   ? 14.462  -8.176  30.015  1.00 24.14 ? 9   LEU A C     1 
ATOM   72   O  O     . LEU A 1 9   ? 14.784  -7.080  30.479  1.00 21.29 ? 9   LEU A O     1 
ATOM   73   C  CB    . LEU A 1 9   ? 16.224  -9.869  30.589  1.00 21.81 ? 9   LEU A CB    1 
ATOM   74   C  CG    . LEU A 1 9   ? 16.696  -11.030 31.462  1.00 23.53 ? 9   LEU A CG    1 
ATOM   75   C  CD1   . LEU A 1 9   ? 18.106  -11.441 31.065  1.00 25.92 ? 9   LEU A CD1   1 
ATOM   76   C  CD2   . LEU A 1 9   ? 16.621  -10.669 32.944  1.00 24.73 ? 9   LEU A CD2   1 
ATOM   77   N  N     . ALA A 1 10  ? 13.821  -8.317  28.856  1.00 22.61 ? 10  ALA A N     1 
ATOM   78   C  CA    . ALA A 1 10  ? 13.429  -7.157  28.058  1.00 22.09 ? 10  ALA A CA    1 
ATOM   79   C  C     . ALA A 1 10  ? 11.942  -7.172  27.737  1.00 21.92 ? 10  ALA A C     1 
ATOM   80   O  O     . ALA A 1 10  ? 11.552  -7.459  26.604  1.00 23.08 ? 10  ALA A O     1 
ATOM   81   C  CB    . ALA A 1 10  ? 14.241  -7.094  26.766  1.00 23.30 ? 10  ALA A CB    1 
ATOM   82   N  N     . PRO A 1 11  ? 11.100  -6.870  28.736  1.00 21.94 ? 11  PRO A N     1 
ATOM   83   C  CA    . PRO A 1 11  ? 9.661   -6.790  28.460  1.00 17.78 ? 11  PRO A CA    1 
ATOM   84   C  C     . PRO A 1 11  ? 9.306   -5.495  27.740  1.00 20.74 ? 11  PRO A C     1 
ATOM   85   O  O     . PRO A 1 11  ? 10.138  -4.598  27.600  1.00 23.26 ? 11  PRO A O     1 
ATOM   86   C  CB    . PRO A 1 11  ? 9.044   -6.778  29.856  1.00 21.46 ? 11  PRO A CB    1 
ATOM   87   C  CG    . PRO A 1 11  ? 10.082  -6.162  30.718  1.00 23.25 ? 11  PRO A CG    1 
ATOM   88   C  CD    . PRO A 1 11  ? 11.408  -6.617  30.154  1.00 21.00 ? 11  PRO A CD    1 
ATOM   89   N  N     . SER A 1 12  ? 8.062   -5.389  27.297  1.00 23.91 ? 12  SER A N     1 
ATOM   90   C  CA    . SER A 1 12  ? 7.609   -4.135  26.721  1.00 26.41 ? 12  SER A CA    1 
ATOM   91   C  C     . SER A 1 12  ? 6.120   -3.926  26.920  1.00 22.75 ? 12  SER A C     1 
ATOM   92   O  O     . SER A 1 12  ? 5.369   -4.881  27.141  1.00 25.57 ? 12  SER A O     1 
ATOM   93   C  CB    . SER A 1 12  ? 7.961   -4.057  25.230  1.00 29.81 ? 12  SER A CB    1 
ATOM   94   O  OG    . SER A 1 12  ? 7.368   -5.115  24.504  1.00 26.96 ? 12  SER A OG    1 
ATOM   95   N  N     . LEU A 1 13  ? 5.708   -2.663  26.862  1.00 22.26 ? 13  LEU A N     1 
ATOM   96   C  CA    . LEU A 1 13  ? 4.296   -2.321  26.784  1.00 23.57 ? 13  LEU A CA    1 
ATOM   97   C  C     . LEU A 1 13  ? 4.045   -1.923  25.341  1.00 25.97 ? 13  LEU A C     1 
ATOM   98   O  O     . LEU A 1 13  ? 4.417   -0.828  24.918  1.00 28.07 ? 13  LEU A O     1 
ATOM   99   C  CB    . LEU A 1 13  ? 3.949   -1.154  27.711  1.00 26.16 ? 13  LEU A CB    1 
ATOM   100  C  CG    . LEU A 1 13  ? 2.474   -0.737  27.680  1.00 26.02 ? 13  LEU A CG    1 
ATOM   101  C  CD1   . LEU A 1 13  ? 1.624   -1.823  28.315  1.00 26.61 ? 13  LEU A CD1   1 
ATOM   102  C  CD2   . LEU A 1 13  ? 2.266   0.594   28.395  1.00 26.32 ? 13  LEU A CD2   1 
ATOM   103  N  N     . ASP A 1 14  ? 3.436   -2.817  24.575  1.00 23.46 ? 14  ASP A N     1 
ATOM   104  C  CA    . ASP A 1 14  ? 3.301   -2.589  23.144  1.00 24.02 ? 14  ASP A CA    1 
ATOM   105  C  C     . ASP A 1 14  ? 2.048   -1.793  22.812  1.00 25.94 ? 14  ASP A C     1 
ATOM   106  O  O     . ASP A 1 14  ? 1.006   -1.949  23.452  1.00 29.01 ? 14  ASP A O     1 
ATOM   107  C  CB    . ASP A 1 14  ? 3.322   -3.916  22.374  1.00 24.67 ? 14  ASP A CB    1 
ATOM   108  C  CG    . ASP A 1 14  ? 4.649   -4.639  22.498  1.00 32.05 ? 14  ASP A CG    1 
ATOM   109  O  OD1   . ASP A 1 14  ? 5.660   -3.975  22.815  1.00 29.53 ? 14  ASP A OD1   1 
ATOM   110  O  OD2   . ASP A 1 14  ? 4.683   -5.867  22.277  1.00 30.21 ? 14  ASP A OD2   1 
ATOM   111  N  N     . SER A 1 15  ? 2.169   -0.924  21.817  1.00 22.39 ? 15  SER A N     1 
ATOM   112  C  CA    . SER A 1 15  ? 1.033   -0.157  21.328  1.00 23.36 ? 15  SER A CA    1 
ATOM   113  C  C     . SER A 1 15  ? 0.594   -0.742  20.001  1.00 21.86 ? 15  SER A C     1 
ATOM   114  O  O     . SER A 1 15  ? 1.412   -0.926  19.106  1.00 22.46 ? 15  SER A O     1 
ATOM   115  C  CB    . SER A 1 15  ? 1.416   1.310   21.120  1.00 30.39 ? 15  SER A CB    1 
ATOM   116  O  OG    . SER A 1 15  ? 1.633   1.973   22.349  1.00 35.50 ? 15  SER A OG    1 
ATOM   117  N  N     . ALA A 1 16  ? -0.693  -1.043  19.873  1.00 19.54 ? 16  ALA A N     1 
ATOM   118  C  CA    . ALA A 1 16  ? -1.238  -1.463  18.588  1.00 21.36 ? 16  ALA A CA    1 
ATOM   119  C  C     . ALA A 1 16  ? -2.126  -0.345  18.062  1.00 23.53 ? 16  ALA A C     1 
ATOM   120  O  O     . ALA A 1 16  ? -3.089  0.063   18.719  1.00 24.16 ? 16  ALA A O     1 
ATOM   121  C  CB    . ALA A 1 16  ? -2.036  -2.749  18.727  1.00 23.49 ? 16  ALA A CB    1 
ATOM   122  N  N     . THR A 1 17  ? -1.794  0.157   16.879  1.00 19.39 ? 17  THR A N     1 
ATOM   123  C  CA    . THR A 1 17  ? -2.548  1.258   16.300  1.00 20.77 ? 17  THR A CA    1 
ATOM   124  C  C     . THR A 1 17  ? -2.949  0.973   14.857  1.00 21.22 ? 17  THR A C     1 
ATOM   125  O  O     . THR A 1 17  ? -2.439  0.032   14.229  1.00 21.33 ? 17  THR A O     1 
ATOM   126  C  CB    . THR A 1 17  ? -1.751  2.576   16.371  1.00 24.37 ? 17  THR A CB    1 
ATOM   127  O  OG1   . THR A 1 17  ? -2.572  3.655   15.913  1.00 24.53 ? 17  THR A OG1   1 
ATOM   128  C  CG2   . THR A 1 17  ? -0.489  2.496   15.514  1.00 21.02 ? 17  THR A CG2   1 
ATOM   129  N  N     . ILE A 1 18  ? -3.859  1.794   14.339  1.00 18.28 ? 18  ILE A N     1 
ATOM   130  C  CA    . ILE A 1 18  ? -4.403  1.621   13.000  1.00 18.35 ? 18  ILE A CA    1 
ATOM   131  C  C     . ILE A 1 18  ? -4.226  2.912   12.204  1.00 17.20 ? 18  ILE A C     1 
ATOM   132  O  O     . ILE A 1 18  ? -4.382  4.009   12.746  1.00 20.93 ? 18  ILE A O     1 
ATOM   133  C  CB    . ILE A 1 18  ? -5.907  1.258   13.070  1.00 21.34 ? 18  ILE A CB    1 
ATOM   134  C  CG1   . ILE A 1 18  ? -6.101  -0.066  13.819  1.00 24.21 ? 18  ILE A CG1   1 
ATOM   135  C  CG2   . ILE A 1 18  ? -6.503  1.150   11.689  1.00 25.94 ? 18  ILE A CG2   1 
ATOM   136  C  CD1   . ILE A 1 18  ? -7.555  -0.338  14.213  1.00 27.38 ? 18  ILE A CD1   1 
ATOM   137  N  N     . THR A 1 19  ? -3.892  2.779   10.923  1.00 22.21 ? 19  THR A N     1 
ATOM   138  C  CA    . THR A 1 19  ? -3.790  3.937   10.034  1.00 28.50 ? 19  THR A CA    1 
ATOM   139  C  C     . THR A 1 19  ? -4.292  3.526   8.639   1.00 26.25 ? 19  THR A C     1 
ATOM   140  O  O     . THR A 1 19  ? -4.227  2.352   8.282   1.00 19.93 ? 19  THR A O     1 
ATOM   141  C  CB    . THR A 1 19  ? -2.335  4.498   10.023  1.00 21.61 ? 19  THR A CB    1 
ATOM   142  O  OG1   . THR A 1 19  ? -2.325  5.841   9.512   1.00 25.19 ? 19  THR A OG1   1 
ATOM   143  C  CG2   . THR A 1 19  ? -1.413  3.616   9.194   1.00 23.02 ? 19  THR A CG2   1 
ATOM   144  N  N     . PRO A 1 20  ? -4.843  4.473   7.861   1.00 20.92 ? 20  PRO A N     1 
ATOM   145  C  CA    . PRO A 1 20  ? -5.445  4.053   6.584   1.00 21.25 ? 20  PRO A CA    1 
ATOM   146  C  C     . PRO A 1 20  ? -4.437  3.620   5.525   1.00 23.08 ? 20  PRO A C     1 
ATOM   147  O  O     . PRO A 1 20  ? -4.680  2.647   4.811   1.00 23.39 ? 20  PRO A O     1 
ATOM   148  C  CB    . PRO A 1 20  ? -6.180  5.317   6.110   1.00 27.26 ? 20  PRO A CB    1 
ATOM   149  C  CG    . PRO A 1 20  ? -6.408  6.111   7.350   1.00 33.13 ? 20  PRO A CG    1 
ATOM   150  C  CD    . PRO A 1 20  ? -5.199  5.860   8.205   1.00 26.47 ? 20  PRO A CD    1 
ATOM   151  N  N     . GLN A 1 21  ? -3.325  4.333   5.416   1.00 20.84 ? 21  GLN A N     1 
ATOM   152  C  CA    . GLN A 1 21  ? -2.345  4.040   4.379   1.00 24.65 ? 21  GLN A CA    1 
ATOM   153  C  C     . GLN A 1 21  ? -0.947  4.119   4.972   1.00 20.37 ? 21  GLN A C     1 
ATOM   154  O  O     . GLN A 1 21  ? -0.745  4.716   6.033   1.00 22.96 ? 21  GLN A O     1 
ATOM   155  C  CB    . GLN A 1 21  ? -2.477  5.039   3.217   1.00 24.13 ? 21  GLN A CB    1 
ATOM   156  C  CG    . GLN A 1 21  ? -3.865  5.111   2.572   1.00 25.91 ? 21  GLN A CG    1 
ATOM   157  C  CD    . GLN A 1 21  ? -4.080  4.056   1.502   1.00 26.85 ? 21  GLN A CD    1 
ATOM   158  O  OE1   . GLN A 1 21  ? -3.159  3.316   1.150   1.00 32.22 ? 21  GLN A OE1   1 
ATOM   159  N  NE2   . GLN A 1 21  ? -5.304  3.978   0.977   1.00 28.05 ? 21  GLN A NE2   1 
ATOM   160  N  N     . ILE A 1 22  ? 0.022   3.509   4.300   1.00 21.03 ? 22  ILE A N     1 
ATOM   161  C  CA    . ILE A 1 22  ? 1.407   3.686   4.712   1.00 15.78 ? 22  ILE A CA    1 
ATOM   162  C  C     . ILE A 1 22  ? 2.245   4.226   3.562   1.00 24.55 ? 22  ILE A C     1 
ATOM   163  O  O     . ILE A 1 22  ? 2.232   3.701   2.444   1.00 24.30 ? 22  ILE A O     1 
ATOM   164  C  CB    . ILE A 1 22  ? 2.023   2.406   5.337   1.00 21.54 ? 22  ILE A CB    1 
ATOM   165  C  CG1   . ILE A 1 22  ? 3.451   2.691   5.831   1.00 21.89 ? 22  ILE A CG1   1 
ATOM   166  C  CG2   . ILE A 1 22  ? 1.993   1.247   4.354   1.00 25.01 ? 22  ILE A CG2   1 
ATOM   167  C  CD1   . ILE A 1 22  ? 3.965   1.649   6.814   1.00 23.31 ? 22  ILE A CD1   1 
ATOM   168  N  N     . TYR A 1 23  ? 2.935   5.320   3.849   1.00 21.87 ? 23  TYR A N     1 
ATOM   169  C  CA    . TYR A 1 23  ? 3.796   5.978   2.890   1.00 21.17 ? 23  TYR A CA    1 
ATOM   170  C  C     . TYR A 1 23  ? 4.755   6.835   3.694   1.00 22.92 ? 23  TYR A C     1 
ATOM   171  O  O     . TYR A 1 23  ? 4.479   7.139   4.857   1.00 20.36 ? 23  TYR A O     1 
ATOM   172  C  CB    . TYR A 1 23  ? 2.970   6.833   1.922   1.00 23.69 ? 23  TYR A CB    1 
ATOM   173  C  CG    . TYR A 1 23  ? 1.992   7.778   2.588   1.00 22.38 ? 23  TYR A CG    1 
ATOM   174  C  CD1   . TYR A 1 23  ? 2.405   9.010   3.086   1.00 22.83 ? 23  TYR A CD1   1 
ATOM   175  C  CD2   . TYR A 1 23  ? 0.648   7.445   2.701   1.00 21.15 ? 23  TYR A CD2   1 
ATOM   176  C  CE1   . TYR A 1 23  ? 1.505   9.880   3.690   1.00 22.98 ? 23  TYR A CE1   1 
ATOM   177  C  CE2   . TYR A 1 23  ? -0.257  8.305   3.298   1.00 27.36 ? 23  TYR A CE2   1 
ATOM   178  C  CZ    . TYR A 1 23  ? 0.174   9.520   3.788   1.00 25.76 ? 23  TYR A CZ    1 
ATOM   179  O  OH    . TYR A 1 23  ? -0.732  10.367  4.382   1.00 27.29 ? 23  TYR A OH    1 
ATOM   180  N  N     . PRO A 1 24  ? 5.895   7.203   3.093   1.00 17.84 ? 24  PRO A N     1 
ATOM   181  C  CA    . PRO A 1 24  ? 6.887   7.969   3.844   1.00 16.01 ? 24  PRO A CA    1 
ATOM   182  C  C     . PRO A 1 24  ? 6.641   9.468   3.794   1.00 18.46 ? 24  PRO A C     1 
ATOM   183  O  O     . PRO A 1 24  ? 5.738   9.939   3.093   1.00 20.43 ? 24  PRO A O     1 
ATOM   184  C  CB    . PRO A 1 24  ? 8.192   7.633   3.120   1.00 21.42 ? 24  PRO A CB    1 
ATOM   185  C  CG    . PRO A 1 24  ? 7.762   7.437   1.687   1.00 20.59 ? 24  PRO A CG    1 
ATOM   186  C  CD    . PRO A 1 24  ? 6.401   6.784   1.769   1.00 22.50 ? 24  PRO A CD    1 
ATOM   187  N  N     . GLU A 1 25  ? 7.457   10.178  4.567   1.00 16.86 ? 25  GLU A N     1 
ATOM   188  C  CA    . GLU A 1 25  ? 7.529   11.640  4.611   1.00 18.67 ? 25  GLU A CA    1 
ATOM   189  C  C     . GLU A 1 25  ? 6.400   12.323  5.395   1.00 27.12 ? 25  GLU A C     1 
ATOM   190  O  O     . GLU A 1 25  ? 6.662   13.097  6.315   1.00 26.20 ? 25  GLU A O     1 
ATOM   191  C  CB    . GLU A 1 25  ? 7.675   12.231  3.203   1.00 24.32 ? 25  GLU A CB    1 
ATOM   192  C  CG    . GLU A 1 25  ? 8.121   13.692  3.182   1.00 30.66 ? 25  GLU A CG    1 
ATOM   193  C  CD    . GLU A 1 25  ? 9.583   13.889  3.578   1.00 35.93 ? 25  GLU A CD    1 
ATOM   194  O  OE1   . GLU A 1 25  ? 10.306  12.881  3.778   1.00 31.25 ? 25  GLU A OE1   1 
ATOM   195  O  OE2   . GLU A 1 25  ? 10.009  15.066  3.681   1.00 26.90 ? 25  GLU A OE2   1 
ATOM   196  N  N     . GLY A 1 26  ? 5.152   12.046  5.033   1.00 21.17 ? 26  GLY A N     1 
ATOM   197  C  CA    . GLY A 1 26  ? 4.022   12.697  5.677   1.00 20.74 ? 26  GLY A CA    1 
ATOM   198  C  C     . GLY A 1 26  ? 3.681   12.141  7.051   1.00 21.09 ? 26  GLY A C     1 
ATOM   199  O  O     . GLY A 1 26  ? 4.165   11.072  7.435   1.00 22.69 ? 26  GLY A O     1 
ATOM   200  N  N     . LYS A 1 27  ? 2.845   12.864  7.796   1.00 19.63 ? 27  LYS A N     1 
ATOM   201  C  CA    . LYS A 1 27  ? 2.375   12.368  9.085   1.00 17.21 ? 27  LYS A CA    1 
ATOM   202  C  C     . LYS A 1 27  ? 1.322   11.299  8.863   1.00 22.93 ? 27  LYS A C     1 
ATOM   203  O  O     . LYS A 1 27  ? 0.306   11.549  8.209   1.00 20.73 ? 27  LYS A O     1 
ATOM   204  C  CB    . LYS A 1 27  ? 1.766   13.492  9.916   1.00 17.67 ? 27  LYS A CB    1 
ATOM   205  C  CG    . LYS A 1 27  ? 2.637   14.725  10.046  1.00 24.17 ? 27  LYS A CG    1 
ATOM   206  C  CD    . LYS A 1 27  ? 1.811   15.869  10.596  1.00 30.59 ? 27  LYS A CD    1 
ATOM   207  C  CE    . LYS A 1 27  ? 2.456   17.208  10.315  1.00 19.54 ? 27  LYS A CE    1 
ATOM   208  N  NZ    . LYS A 1 27  ? 1.539   18.311  10.750  1.00 19.69 ? 27  LYS A NZ    1 
ATOM   209  N  N     . LEU A 1 28  ? 1.557   10.105  9.398   1.00 17.08 ? 28  LEU A N     1 
ATOM   210  C  CA    . LEU A 1 28  ? 0.534   9.076   9.341   1.00 17.35 ? 28  LEU A CA    1 
ATOM   211  C  C     . LEU A 1 28  ? -0.299  9.166   10.614  1.00 17.06 ? 28  LEU A C     1 
ATOM   212  O  O     . LEU A 1 28  ? 0.197   8.892   11.710  1.00 21.99 ? 28  LEU A O     1 
ATOM   213  C  CB    . LEU A 1 28  ? 1.155   7.689   9.171   1.00 18.17 ? 28  LEU A CB    1 
ATOM   214  C  CG    . LEU A 1 28  ? 2.112   7.610   7.979   1.00 19.88 ? 28  LEU A CG    1 
ATOM   215  C  CD1   . LEU A 1 28  ? 2.839   6.270   7.947   1.00 21.97 ? 28  LEU A CD1   1 
ATOM   216  C  CD2   . LEU A 1 28  ? 1.370   7.857   6.668   1.00 20.31 ? 28  LEU A CD2   1 
ATOM   217  N  N     . ARG A 1 29  ? -1.556  9.584   10.462  1.00 17.85 ? 29  ARG A N     1 
ATOM   218  C  CA    . ARG A 1 29  ? -2.464  9.717   11.599  1.00 19.46 ? 29  ARG A CA    1 
ATOM   219  C  C     . ARG A 1 29  ? -2.877  8.330   12.058  1.00 24.71 ? 29  ARG A C     1 
ATOM   220  O  O     . ARG A 1 29  ? -3.529  7.585   11.318  1.00 23.04 ? 29  ARG A O     1 
ATOM   221  C  CB    . ARG A 1 29  ? -3.707  10.538  11.236  1.00 27.87 ? 29  ARG A CB    1 
ATOM   222  C  CG    . ARG A 1 29  ? -3.459  12.039  11.109  1.00 43.31 ? 29  ARG A CG    1 
ATOM   223  C  CD    . ARG A 1 29  ? -4.774  12.825  11.016  1.00 56.72 ? 29  ARG A CD    1 
ATOM   224  N  NE    . ARG A 1 29  ? -5.314  13.193  12.327  1.00 67.64 ? 29  ARG A NE    1 
ATOM   225  C  CZ    . ARG A 1 29  ? -6.431  12.696  12.852  1.00 74.70 ? 29  ARG A CZ    1 
ATOM   226  N  NH1   . ARG A 1 29  ? -7.145  11.802  12.181  1.00 75.92 ? 29  ARG A NH1   1 
ATOM   227  N  NH2   . ARG A 1 29  ? -6.840  13.098  14.050  1.00 72.92 ? 29  ARG A NH2   1 
ATOM   228  N  N     . CYS A 1 30  ? -2.484  7.992   13.279  1.00 22.73 ? 30  CYS A N     1 
ATOM   229  C  CA    . CYS A 1 30  ? -2.741  6.677   13.842  1.00 20.01 ? 30  CYS A CA    1 
ATOM   230  C  C     . CYS A 1 30  ? -3.778  6.771   14.942  1.00 22.66 ? 30  CYS A C     1 
ATOM   231  O  O     . CYS A 1 30  ? -3.828  7.760   15.677  1.00 24.56 ? 30  CYS A O     1 
ATOM   232  C  CB    . CYS A 1 30  ? -1.450  6.092   14.392  1.00 20.43 ? 30  CYS A CB    1 
ATOM   233  S  SG    . CYS A 1 30  ? -0.271  5.748   13.092  1.00 23.62 ? 30  CYS A SG    1 
ATOM   234  N  N     . THR A 1 31  ? -4.614  5.744   15.054  1.00 25.52 ? 31  THR A N     1 
ATOM   235  C  CA    . THR A 1 31  ? -5.631  5.717   16.099  1.00 24.07 ? 31  THR A CA    1 
ATOM   236  C  C     . THR A 1 31  ? -5.021  5.599   17.493  1.00 25.02 ? 31  THR A C     1 
ATOM   237  O  O     . THR A 1 31  ? -3.865  5.183   17.646  1.00 22.84 ? 31  THR A O     1 
ATOM   238  C  CB    . THR A 1 31  ? -6.632  4.570   15.888  1.00 25.19 ? 31  THR A CB    1 
ATOM   239  O  OG1   . THR A 1 31  ? -5.923  3.327   15.796  1.00 23.96 ? 31  THR A OG1   1 
ATOM   240  C  CG2   . THR A 1 31  ? -7.437  4.793   14.616  1.00 23.54 ? 31  THR A CG2   1 
ATOM   241  N  N     . ALA A 1 32  ? -5.803  5.969   18.505  1.00 27.21 ? 32  ALA A N     1 
ATOM   242  C  CA    . ALA A 1 32  ? -5.384  5.830   19.894  1.00 20.97 ? 32  ALA A CA    1 
ATOM   243  C  C     . ALA A 1 32  ? -5.019  4.368   20.121  1.00 22.99 ? 32  ALA A C     1 
ATOM   244  O  O     . ALA A 1 32  ? -5.826  3.475   19.855  1.00 23.38 ? 32  ALA A O     1 
ATOM   245  C  CB    . ALA A 1 32  ? -6.507  6.245   20.828  1.00 30.74 ? 32  ALA A CB    1 
ATOM   246  N  N     . PRO A 1 33  ? -3.799  4.119   20.598  1.00 22.81 ? 33  PRO A N     1 
ATOM   247  C  CA    . PRO A 1 33  ? -3.306  2.737   20.631  1.00 25.12 ? 33  PRO A CA    1 
ATOM   248  C  C     . PRO A 1 33  ? -3.993  1.864   21.672  1.00 22.96 ? 33  PRO A C     1 
ATOM   249  O  O     . PRO A 1 33  ? -4.418  2.348   22.730  1.00 27.18 ? 33  PRO A O     1 
ATOM   250  C  CB    . PRO A 1 33  ? -1.831  2.908   20.995  1.00 25.73 ? 33  PRO A CB    1 
ATOM   251  C  CG    . PRO A 1 33  ? -1.786  4.192   21.770  1.00 27.57 ? 33  PRO A CG    1 
ATOM   252  C  CD    . PRO A 1 33  ? -2.813  5.079   21.126  1.00 25.63 ? 33  PRO A CD    1 
ATOM   253  N  N     . VAL A 1 34  ? -4.106  0.578   21.352  1.00 22.73 ? 34  VAL A N     1 
ATOM   254  C  CA    . VAL A 1 34  ? -4.493  -0.429  22.327  1.00 26.17 ? 34  VAL A CA    1 
ATOM   255  C  C     . VAL A 1 34  ? -3.203  -1.001  22.893  1.00 26.41 ? 34  VAL A C     1 
ATOM   256  O  O     . VAL A 1 34  ? -2.326  -1.415  22.135  1.00 23.14 ? 34  VAL A O     1 
ATOM   257  C  CB    . VAL A 1 34  ? -5.322  -1.561  21.687  1.00 27.28 ? 34  VAL A CB    1 
ATOM   258  C  CG1   . VAL A 1 34  ? -5.509  -2.708  22.679  1.00 34.45 ? 34  VAL A CG1   1 
ATOM   259  C  CG2   . VAL A 1 34  ? -6.670  -1.028  21.219  1.00 37.12 ? 34  VAL A CG2   1 
ATOM   260  N  N     . PHE A 1 35  ? -3.070  -1.010  24.215  1.00 24.74 ? 35  PHE A N     1 
ATOM   261  C  CA    . PHE A 1 35  ? -1.839  -1.503  24.825  1.00 21.42 ? 35  PHE A CA    1 
ATOM   262  C  C     . PHE A 1 35  ? -1.917  -2.992  25.115  1.00 26.82 ? 35  PHE A C     1 
ATOM   263  O  O     . PHE A 1 35  ? -2.969  -3.512  25.485  1.00 27.39 ? 35  PHE A O     1 
ATOM   264  C  CB    . PHE A 1 35  ? -1.507  -0.726  26.101  1.00 22.09 ? 35  PHE A CB    1 
ATOM   265  C  CG    . PHE A 1 35  ? -1.333  0.747   25.873  1.00 29.78 ? 35  PHE A CG    1 
ATOM   266  C  CD1   . PHE A 1 35  ? -0.235  1.223   25.181  1.00 24.58 ? 35  PHE A CD1   1 
ATOM   267  C  CD2   . PHE A 1 35  ? -2.276  1.657   26.334  1.00 36.85 ? 35  PHE A CD2   1 
ATOM   268  C  CE1   . PHE A 1 35  ? -0.063  2.581   24.954  1.00 30.20 ? 35  PHE A CE1   1 
ATOM   269  C  CE2   . PHE A 1 35  ? -2.115  3.020   26.108  1.00 40.07 ? 35  PHE A CE2   1 
ATOM   270  C  CZ    . PHE A 1 35  ? -1.003  3.481   25.417  1.00 31.65 ? 35  PHE A CZ    1 
ATOM   271  N  N     . GLU A 1 36  ? -0.797  -3.678  24.928  1.00 23.14 ? 36  GLU A N     1 
ATOM   272  C  CA    . GLU A 1 36  ? -0.740  -5.109  25.203  1.00 27.21 ? 36  GLU A CA    1 
ATOM   273  C  C     . GLU A 1 36  ? 0.628   -5.474  25.767  1.00 20.15 ? 36  GLU A C     1 
ATOM   274  O  O     . GLU A 1 36  ? 1.621   -4.785  25.505  1.00 24.53 ? 36  GLU A O     1 
ATOM   275  C  CB    . GLU A 1 36  ? -1.029  -5.920  23.935  1.00 33.47 ? 36  GLU A CB    1 
ATOM   276  C  CG    . GLU A 1 36  ? 0.134   -5.987  22.961  1.00 44.08 ? 36  GLU A CG    1 
ATOM   277  C  CD    . GLU A 1 36  ? -0.301  -6.348  21.550  1.00 58.82 ? 36  GLU A CD    1 
ATOM   278  O  OE1   . GLU A 1 36  ? -1.520  -6.325  21.270  1.00 57.64 ? 36  GLU A OE1   1 
ATOM   279  O  OE2   . GLU A 1 36  ? 0.583   -6.647  20.718  1.00 65.17 ? 36  GLU A OE2   1 
ATOM   280  N  N     . PRO A 1 37  ? 0.680   -6.556  26.560  1.00 26.59 ? 37  PRO A N     1 
ATOM   281  C  CA    . PRO A 1 37  ? 1.960   -7.025  27.097  1.00 26.72 ? 37  PRO A CA    1 
ATOM   282  C  C     . PRO A 1 37  ? 2.883   -7.519  25.993  1.00 25.93 ? 37  PRO A C     1 
ATOM   283  O  O     . PRO A 1 37  ? 2.446   -8.183  25.052  1.00 31.19 ? 37  PRO A O     1 
ATOM   284  C  CB    . PRO A 1 37  ? 1.551   -8.192  28.003  1.00 27.12 ? 37  PRO A CB    1 
ATOM   285  C  CG    . PRO A 1 37  ? 0.129   -7.909  28.369  1.00 31.01 ? 37  PRO A CG    1 
ATOM   286  C  CD    . PRO A 1 37  ? -0.458  -7.302  27.129  1.00 25.83 ? 37  PRO A CD    1 
ATOM   287  N  N     . GLY A 1 38  ? 4.160   -7.185  26.105  1.00 27.28 ? 38  GLY A N     1 
ATOM   288  C  CA    . GLY A 1 38  ? 5.129   -7.627  25.125  1.00 26.51 ? 38  GLY A CA    1 
ATOM   289  C  C     . GLY A 1 38  ? 6.305   -8.283  25.807  1.00 23.33 ? 38  GLY A C     1 
ATOM   290  O  O     . GLY A 1 38  ? 6.567   -8.032  26.983  1.00 23.08 ? 38  GLY A O     1 
ATOM   291  N  N     . GLY A 1 39  ? 7.012   -9.132  25.072  1.00 20.27 ? 39  GLY A N     1 
ATOM   292  C  CA    . GLY A 1 39  ? 8.186   -9.786  25.618  1.00 23.57 ? 39  GLY A CA    1 
ATOM   293  C  C     . GLY A 1 39  ? 8.060   -11.288 25.522  1.00 23.18 ? 39  GLY A C     1 
ATOM   294  O  O     . GLY A 1 39  ? 6.962   -11.833 25.665  1.00 23.51 ? 39  GLY A O     1 
ATOM   295  N  N     . GLY A 1 40  ? 9.190   -11.952 25.285  1.00 18.60 ? 40  GLY A N     1 
ATOM   296  C  CA    . GLY A 1 40  ? 9.215   -13.384 25.050  1.00 21.53 ? 40  GLY A CA    1 
ATOM   297  C  C     . GLY A 1 40  ? 8.602   -14.204 26.165  1.00 19.34 ? 40  GLY A C     1 
ATOM   298  O  O     . GLY A 1 40  ? 7.587   -14.873 25.959  1.00 20.17 ? 40  GLY A O     1 
ATOM   299  N  N     . GLY A 1 41  ? 9.217   -14.153 27.344  1.00 18.06 ? 41  GLY A N     1 
ATOM   300  C  CA    . GLY A 1 41  ? 8.748   -14.908 28.493  1.00 21.38 ? 41  GLY A CA    1 
ATOM   301  C  C     . GLY A 1 41  ? 7.338   -14.525 28.894  1.00 21.66 ? 41  GLY A C     1 
ATOM   302  O  O     . GLY A 1 41  ? 6.549   -15.376 29.302  1.00 19.95 ? 41  GLY A O     1 
ATOM   303  N  N     . ILE A 1 42  ? 7.008   -13.242 28.772  1.00 19.55 ? 42  ILE A N     1 
ATOM   304  C  CA    . ILE A 1 42  ? 5.658   -12.793 29.089  1.00 20.82 ? 42  ILE A CA    1 
ATOM   305  C  C     . ILE A 1 42  ? 4.640   -13.456 28.165  1.00 20.69 ? 42  ILE A C     1 
ATOM   306  O  O     . ILE A 1 42  ? 3.603   -13.945 28.618  1.00 22.09 ? 42  ILE A O     1 
ATOM   307  C  CB    . ILE A 1 42  ? 5.545   -11.254 29.040  1.00 18.40 ? 42  ILE A CB    1 
ATOM   308  C  CG1   . ILE A 1 42  ? 6.149   -10.656 30.312  1.00 21.25 ? 42  ILE A CG1   1 
ATOM   309  C  CG2   . ILE A 1 42  ? 4.084   -10.822 28.907  1.00 20.72 ? 42  ILE A CG2   1 
ATOM   310  C  CD1   . ILE A 1 42  ? 6.275   -9.146  30.286  1.00 23.60 ? 42  ILE A CD1   1 
ATOM   311  N  N     . ASN A 1 43  ? 4.948   -13.494 26.872  1.00 18.71 ? 43  ASN A N     1 
ATOM   312  C  CA    . ASN A 1 43  ? 4.046   -14.113 25.912  1.00 18.02 ? 43  ASN A CA    1 
ATOM   313  C  C     . ASN A 1 43  ? 3.959   -15.627 26.065  1.00 19.99 ? 43  ASN A C     1 
ATOM   314  O  O     . ASN A 1 43  ? 2.905   -16.208 25.841  1.00 21.08 ? 43  ASN A O     1 
ATOM   315  C  CB    . ASN A 1 43  ? 4.399   -13.701 24.482  1.00 19.14 ? 43  ASN A CB    1 
ATOM   316  C  CG    . ASN A 1 43  ? 3.861   -12.330 24.136  1.00 34.66 ? 43  ASN A CG    1 
ATOM   317  O  OD1   . ASN A 1 43  ? 2.778   -11.953 24.581  1.00 37.75 ? 43  ASN A OD1   1 
ATOM   318  N  ND2   . ASN A 1 43  ? 4.613   -11.577 23.342  1.00 48.16 ? 43  ASN A ND2   1 
ATOM   319  N  N     . VAL A 1 44  ? 5.062   -16.259 26.458  1.00 18.29 ? 44  VAL A N     1 
ATOM   320  C  CA    . VAL A 1 44  ? 5.040   -17.682 26.772  1.00 17.24 ? 44  VAL A CA    1 
ATOM   321  C  C     . VAL A 1 44  ? 4.049   -17.938 27.910  1.00 22.71 ? 44  VAL A C     1 
ATOM   322  O  O     . VAL A 1 44  ? 3.241   -18.872 27.848  1.00 21.03 ? 44  VAL A O     1 
ATOM   323  C  CB    . VAL A 1 44  ? 6.447   -18.204 27.142  1.00 18.48 ? 44  VAL A CB    1 
ATOM   324  C  CG1   . VAL A 1 44  ? 6.371   -19.623 27.709  1.00 17.62 ? 44  VAL A CG1   1 
ATOM   325  C  CG2   . VAL A 1 44  ? 7.343   -18.181 25.920  1.00 19.66 ? 44  VAL A CG2   1 
ATOM   326  N  N     . ALA A 1 45  ? 4.089   -17.084 28.933  1.00 21.12 ? 45  ALA A N     1 
ATOM   327  C  CA    . ALA A 1 45  ? 3.174   -17.217 30.068  1.00 20.03 ? 45  ALA A CA    1 
ATOM   328  C  C     . ALA A 1 45  ? 1.713   -17.013 29.648  1.00 20.28 ? 45  ALA A C     1 
ATOM   329  O  O     . ALA A 1 45  ? 0.809   -17.712 30.125  1.00 24.59 ? 45  ALA A O     1 
ATOM   330  C  CB    . ALA A 1 45  ? 3.550   -16.249 31.183  1.00 21.92 ? 45  ALA A CB    1 
ATOM   331  N  N     . ARG A 1 46  ? 1.480   -16.055 28.757  1.00 18.55 ? 46  ARG A N     1 
ATOM   332  C  CA    . ARG A 1 46  ? 0.128   -15.807 28.258  1.00 25.10 ? 46  ARG A CA    1 
ATOM   333  C  C     . ARG A 1 46  ? -0.387  -16.988 27.431  1.00 26.05 ? 46  ARG A C     1 
ATOM   334  O  O     . ARG A 1 46  ? -1.545  -17.400 27.570  1.00 21.82 ? 46  ARG A O     1 
ATOM   335  C  CB    . ARG A 1 46  ? 0.078   -14.510 27.451  1.00 22.18 ? 46  ARG A CB    1 
ATOM   336  C  CG    . ARG A 1 46  ? 0.415   -13.269 28.274  1.00 24.73 ? 46  ARG A CG    1 
ATOM   337  C  CD    . ARG A 1 46  ? 0.509   -12.028 27.397  1.00 25.62 ? 46  ARG A CD    1 
ATOM   338  N  NE    . ARG A 1 46  ? -0.801  -11.576 26.938  1.00 28.82 ? 46  ARG A NE    1 
ATOM   339  C  CZ    . ARG A 1 46  ? -1.062  -11.181 25.696  1.00 35.12 ? 46  ARG A CZ    1 
ATOM   340  N  NH1   . ARG A 1 46  ? -0.103  -11.185 24.783  1.00 32.03 ? 46  ARG A NH1   1 
ATOM   341  N  NH2   . ARG A 1 46  ? -2.285  -10.781 25.366  1.00 34.63 ? 46  ARG A NH2   1 
ATOM   342  N  N     . ALA A 1 47  ? 0.479   -17.545 26.589  1.00 20.71 ? 47  ALA A N     1 
ATOM   343  C  CA    . ALA A 1 47  ? 0.109   -18.708 25.774  1.00 20.10 ? 47  ALA A CA    1 
ATOM   344  C  C     . ALA A 1 47  ? -0.231  -19.888 26.667  1.00 23.49 ? 47  ALA A C     1 
ATOM   345  O  O     . ALA A 1 47  ? -1.181  -20.637 26.407  1.00 21.09 ? 47  ALA A O     1 
ATOM   346  C  CB    . ALA A 1 47  ? 1.240   -19.079 24.813  1.00 20.93 ? 47  ALA A CB    1 
ATOM   347  N  N     . ILE A 1 48  ? 0.544   -20.052 27.734  1.00 18.80 ? 48  ILE A N     1 
ATOM   348  C  CA    . ILE A 1 48  ? 0.306   -21.148 28.660  1.00 24.71 ? 48  ILE A CA    1 
ATOM   349  C  C     . ILE A 1 48  ? -1.069  -21.005 29.309  1.00 24.91 ? 48  ILE A C     1 
ATOM   350  O  O     . ILE A 1 48  ? -1.804  -21.984 29.443  1.00 24.93 ? 48  ILE A O     1 
ATOM   351  C  CB    . ILE A 1 48  ? 1.432   -21.251 29.707  1.00 21.04 ? 48  ILE A CB    1 
ATOM   352  C  CG1   . ILE A 1 48  ? 2.654   -21.916 29.063  1.00 22.25 ? 48  ILE A CG1   1 
ATOM   353  C  CG2   . ILE A 1 48  ? 0.961   -22.027 30.932  1.00 23.61 ? 48  ILE A CG2   1 
ATOM   354  C  CD1   . ILE A 1 48  ? 3.935   -21.857 29.910  1.00 22.31 ? 48  ILE A CD1   1 
ATOM   355  N  N     . ALA A 1 49  ? -1.429  -19.779 29.676  1.00 24.45 ? 49  ALA A N     1 
ATOM   356  C  CA    . ALA A 1 49  ? -2.760  -19.512 30.212  1.00 25.86 ? 49  ALA A CA    1 
ATOM   357  C  C     . ALA A 1 49  ? -3.854  -19.894 29.209  1.00 24.79 ? 49  ALA A C     1 
ATOM   358  O  O     . ALA A 1 49  ? -4.844  -20.534 29.578  1.00 27.18 ? 49  ALA A O     1 
ATOM   359  C  CB    . ALA A 1 49  ? -2.889  -18.049 30.618  1.00 26.23 ? 49  ALA A CB    1 
ATOM   360  N  N     . HIS A 1 50  ? -3.678  -19.508 27.947  1.00 23.59 ? 50  HIS A N     1 
ATOM   361  C  CA    . HIS A 1 50  ? -4.648  -19.854 26.903  1.00 26.97 ? 50  HIS A CA    1 
ATOM   362  C  C     . HIS A 1 50  ? -4.817  -21.362 26.781  1.00 30.84 ? 50  HIS A C     1 
ATOM   363  O  O     . HIS A 1 50  ? -5.921  -21.855 26.535  1.00 26.83 ? 50  HIS A O     1 
ATOM   364  C  CB    . HIS A 1 50  ? -4.231  -19.298 25.540  1.00 24.41 ? 50  HIS A CB    1 
ATOM   365  C  CG    . HIS A 1 50  ? -4.304  -17.809 25.443  1.00 27.43 ? 50  HIS A CG    1 
ATOM   366  N  ND1   . HIS A 1 50  ? -4.558  -17.007 26.534  1.00 42.58 ? 50  HIS A ND1   1 
ATOM   367  C  CD2   . HIS A 1 50  ? -4.166  -16.977 24.385  1.00 35.39 ? 50  HIS A CD2   1 
ATOM   368  C  CE1   . HIS A 1 50  ? -4.572  -15.743 26.151  1.00 48.36 ? 50  HIS A CE1   1 
ATOM   369  N  NE2   . HIS A 1 50  ? -4.335  -15.697 24.853  1.00 45.07 ? 50  HIS A NE2   1 
ATOM   370  N  N     . LEU A 1 51  ? -3.720  -22.093 26.949  1.00 22.21 ? 51  LEU A N     1 
ATOM   371  C  CA    . LEU A 1 51  ? -3.760  -23.544 26.789  1.00 23.27 ? 51  LEU A CA    1 
ATOM   372  C  C     . LEU A 1 51  ? -4.221  -24.266 28.053  1.00 28.76 ? 51  LEU A C     1 
ATOM   373  O  O     . LEU A 1 51  ? -4.263  -25.494 28.096  1.00 29.88 ? 51  LEU A O     1 
ATOM   374  C  CB    . LEU A 1 51  ? -2.412  -24.078 26.306  1.00 22.75 ? 51  LEU A CB    1 
ATOM   375  C  CG    . LEU A 1 51  ? -1.943  -23.520 24.959  1.00 24.67 ? 51  LEU A CG    1 
ATOM   376  C  CD1   . LEU A 1 51  ? -0.592  -24.116 24.584  1.00 23.14 ? 51  LEU A CD1   1 
ATOM   377  C  CD2   . LEU A 1 51  ? -2.974  -23.778 23.867  1.00 24.29 ? 51  LEU A CD2   1 
ATOM   378  N  N     . GLY A 1 52  ? -4.569  -23.498 29.080  1.00 28.10 ? 52  GLY A N     1 
ATOM   379  C  CA    . GLY A 1 52  ? -5.170  -24.065 30.273  1.00 35.75 ? 52  GLY A CA    1 
ATOM   380  C  C     . GLY A 1 52  ? -4.226  -24.283 31.437  1.00 35.70 ? 52  GLY A C     1 
ATOM   381  O  O     . GLY A 1 52  ? -4.632  -24.792 32.481  1.00 33.76 ? 52  GLY A O     1 
ATOM   382  N  N     . GLY A 1 53  ? -2.967  -23.896 31.265  1.00 27.63 ? 53  GLY A N     1 
ATOM   383  C  CA    . GLY A 1 53  ? -1.980  -24.046 32.317  1.00 24.79 ? 53  GLY A CA    1 
ATOM   384  C  C     . GLY A 1 53  ? -1.758  -22.739 33.054  1.00 26.33 ? 53  GLY A C     1 
ATOM   385  O  O     . GLY A 1 53  ? -2.508  -21.780 32.875  1.00 30.06 ? 53  GLY A O     1 
ATOM   386  N  N     . SER A 1 54  ? -0.727  -22.706 33.893  1.00 26.12 ? 54  SER A N     1 
ATOM   387  C  CA    . SER A 1 54  ? -0.395  -21.498 34.638  1.00 27.24 ? 54  SER A CA    1 
ATOM   388  C  C     . SER A 1 54  ? 1.120   -21.318 34.702  1.00 26.57 ? 54  SER A C     1 
ATOM   389  O  O     . SER A 1 54  ? 1.856   -22.267 34.969  1.00 32.06 ? 54  SER A O     1 
ATOM   390  C  CB    . SER A 1 54  ? -0.972  -21.566 36.055  1.00 37.29 ? 54  SER A CB    1 
ATOM   391  O  OG    . SER A 1 54  ? -0.834  -20.323 36.721  1.00 44.59 ? 54  SER A OG    1 
ATOM   392  N  N     . ALA A 1 55  ? 1.582   -20.099 34.443  1.00 25.06 ? 55  ALA A N     1 
ATOM   393  C  CA    . ALA A 1 55  ? 3.004   -19.788 34.522  1.00 23.49 ? 55  ALA A CA    1 
ATOM   394  C  C     . ALA A 1 55  ? 3.192   -18.397 35.098  1.00 27.41 ? 55  ALA A C     1 
ATOM   395  O  O     . ALA A 1 55  ? 2.472   -17.464 34.732  1.00 27.75 ? 55  ALA A O     1 
ATOM   396  C  CB    . ALA A 1 55  ? 3.660   -19.883 33.146  1.00 24.56 ? 55  ALA A CB    1 
ATOM   397  N  N     . THR A 1 56  ? 4.161   -18.260 35.999  1.00 24.45 ? 56  THR A N     1 
ATOM   398  C  CA    . THR A 1 56  ? 4.444   -16.970 36.616  1.00 25.37 ? 56  THR A CA    1 
ATOM   399  C  C     . THR A 1 56  ? 5.511   -16.226 35.826  1.00 24.25 ? 56  THR A C     1 
ATOM   400  O  O     . THR A 1 56  ? 6.618   -16.734 35.637  1.00 25.27 ? 56  THR A O     1 
ATOM   401  C  CB    . THR A 1 56  ? 4.902   -17.131 38.072  1.00 24.30 ? 56  THR A CB    1 
ATOM   402  O  OG1   . THR A 1 56  ? 3.855   -17.753 38.825  1.00 23.87 ? 56  THR A OG1   1 
ATOM   403  C  CG2   . THR A 1 56  ? 5.210   -15.775 38.687  1.00 25.22 ? 56  THR A CG2   1 
ATOM   404  N  N     . ALA A 1 57  ? 5.175   -15.022 35.370  1.00 25.13 ? 57  ALA A N     1 
ATOM   405  C  CA    . ALA A 1 57  ? 6.106   -14.210 34.587  1.00 26.05 ? 57  ALA A CA    1 
ATOM   406  C  C     . ALA A 1 57  ? 6.979   -13.333 35.480  1.00 24.69 ? 57  ALA A C     1 
ATOM   407  O  O     . ALA A 1 57  ? 6.475   -12.462 36.189  1.00 24.61 ? 57  ALA A O     1 
ATOM   408  C  CB    . ALA A 1 57  ? 5.352   -13.351 33.586  1.00 24.17 ? 57  ALA A CB    1 
ATOM   409  N  N     . ILE A 1 58  ? 8.291   -13.551 35.422  1.00 22.74 ? 58  ILE A N     1 
ATOM   410  C  CA    . ILE A 1 58  ? 9.242   -12.728 36.165  1.00 23.40 ? 58  ILE A CA    1 
ATOM   411  C  C     . ILE A 1 58  ? 9.835   -11.715 35.193  1.00 19.54 ? 58  ILE A C     1 
ATOM   412  O  O     . ILE A 1 58  ? 10.279  -12.093 34.108  1.00 22.60 ? 58  ILE A O     1 
ATOM   413  C  CB    . ILE A 1 58  ? 10.386  -13.584 36.755  1.00 22.41 ? 58  ILE A CB    1 
ATOM   414  C  CG1   . ILE A 1 58  ? 9.824   -14.729 37.603  1.00 25.27 ? 58  ILE A CG1   1 
ATOM   415  C  CG2   . ILE A 1 58  ? 11.344  -12.720 37.574  1.00 26.75 ? 58  ILE A CG2   1 
ATOM   416  C  CD1   . ILE A 1 58  ? 10.873  -15.749 38.031  1.00 28.85 ? 58  ILE A CD1   1 
ATOM   417  N  N     . PHE A 1 59  ? 9.831   -10.438 35.572  1.00 22.93 ? 59  PHE A N     1 
ATOM   418  C  CA    . PHE A 1 59  ? 10.355  -9.380  34.703  1.00 21.05 ? 59  PHE A CA    1 
ATOM   419  C  C     . PHE A 1 59  ? 10.549  -8.059  35.444  1.00 25.16 ? 59  PHE A C     1 
ATOM   420  O  O     . PHE A 1 59  ? 9.895   -7.808  36.459  1.00 25.62 ? 59  PHE A O     1 
ATOM   421  C  CB    . PHE A 1 59  ? 9.446   -9.167  33.474  1.00 19.41 ? 59  PHE A CB    1 
ATOM   422  C  CG    . PHE A 1 59  ? 8.032   -8.779  33.815  1.00 22.80 ? 59  PHE A CG    1 
ATOM   423  C  CD1   . PHE A 1 59  ? 7.668   -7.441  33.908  1.00 21.50 ? 59  PHE A CD1   1 
ATOM   424  C  CD2   . PHE A 1 59  ? 7.060   -9.753  34.023  1.00 27.55 ? 59  PHE A CD2   1 
ATOM   425  C  CE1   . PHE A 1 59  ? 6.360   -7.075  34.222  1.00 24.71 ? 59  PHE A CE1   1 
ATOM   426  C  CE2   . PHE A 1 59  ? 5.748   -9.399  34.335  1.00 28.72 ? 59  PHE A CE2   1 
ATOM   427  C  CZ    . PHE A 1 59  ? 5.398   -8.056  34.435  1.00 24.91 ? 59  PHE A CZ    1 
ATOM   428  N  N     . PRO A 1 60  ? 11.460  -7.211  34.937  1.00 19.46 ? 60  PRO A N     1 
ATOM   429  C  CA    . PRO A 1 60  ? 11.602  -5.857  35.473  1.00 20.68 ? 60  PRO A CA    1 
ATOM   430  C  C     . PRO A 1 60  ? 10.509  -4.959  34.912  1.00 23.91 ? 60  PRO A C     1 
ATOM   431  O  O     . PRO A 1 60  ? 10.165  -5.061  33.729  1.00 24.33 ? 60  PRO A O     1 
ATOM   432  C  CB    . PRO A 1 60  ? 12.965  -5.412  34.936  1.00 21.47 ? 60  PRO A CB    1 
ATOM   433  C  CG    . PRO A 1 60  ? 13.111  -6.156  33.637  1.00 24.73 ? 60  PRO A CG    1 
ATOM   434  C  CD    . PRO A 1 60  ? 12.437  -7.491  33.864  1.00 22.55 ? 60  PRO A CD    1 
ATOM   435  N  N     . ALA A 1 61  ? 9.970   -4.090  35.756  1.00 24.22 ? 61  ALA A N     1 
ATOM   436  C  CA    . ALA A 1 61  ? 8.973   -3.127  35.319  1.00 25.58 ? 61  ALA A CA    1 
ATOM   437  C  C     . ALA A 1 61  ? 9.329   -1.754  35.874  1.00 24.76 ? 61  ALA A C     1 
ATOM   438  O  O     . ALA A 1 61  ? 9.738   -1.628  37.030  1.00 26.67 ? 61  ALA A O     1 
ATOM   439  C  CB    . ALA A 1 61  ? 7.595   -3.548  35.789  1.00 24.44 ? 61  ALA A CB    1 
ATOM   440  N  N     . GLY A 1 62  ? 9.165   -0.724  35.051  1.00 26.52 ? 62  GLY A N     1 
ATOM   441  C  CA    . GLY A 1 62  ? 9.518   0.622   35.463  1.00 26.11 ? 62  GLY A CA    1 
ATOM   442  C  C     . GLY A 1 62  ? 8.545   1.671   34.968  1.00 24.44 ? 62  GLY A C     1 
ATOM   443  O  O     . GLY A 1 62  ? 8.060   1.604   33.837  1.00 23.79 ? 62  GLY A O     1 
ATOM   444  N  N     . GLY A 1 63  ? 8.255   2.645   35.825  1.00 32.23 ? 63  GLY A N     1 
ATOM   445  C  CA    . GLY A 1 63  ? 7.403   3.756   35.450  1.00 34.24 ? 63  GLY A CA    1 
ATOM   446  C  C     . GLY A 1 63  ? 5.952   3.381   35.232  1.00 33.84 ? 63  GLY A C     1 
ATOM   447  O  O     . GLY A 1 63  ? 5.528   2.260   35.531  1.00 33.18 ? 63  GLY A O     1 
ATOM   448  N  N     . ALA A 1 64  ? 5.190   4.331   34.699  1.00 33.69 ? 64  ALA A N     1 
ATOM   449  C  CA    . ALA A 1 64  ? 3.761   4.145   34.474  1.00 29.70 ? 64  ALA A CA    1 
ATOM   450  C  C     . ALA A 1 64  ? 3.491   3.111   33.388  1.00 26.44 ? 64  ALA A C     1 
ATOM   451  O  O     . ALA A 1 64  ? 2.461   2.441   33.405  1.00 27.68 ? 64  ALA A O     1 
ATOM   452  C  CB    . ALA A 1 64  ? 3.107   5.470   34.118  1.00 29.85 ? 64  ALA A CB    1 
ATOM   453  N  N     . THR A 1 65  ? 4.408   2.995   32.434  1.00 29.89 ? 65  THR A N     1 
ATOM   454  C  CA    . THR A 1 65  ? 4.272   1.983   31.396  1.00 24.60 ? 65  THR A CA    1 
ATOM   455  C  C     . THR A 1 65  ? 4.421   0.595   31.996  1.00 25.64 ? 65  THR A C     1 
ATOM   456  O  O     . THR A 1 65  ? 3.687   -0.325  31.640  1.00 26.95 ? 65  THR A O     1 
ATOM   457  C  CB    . THR A 1 65  ? 5.285   2.186   30.252  1.00 26.72 ? 65  THR A CB    1 
ATOM   458  O  OG1   . THR A 1 65  ? 6.595   2.394   30.795  1.00 30.10 ? 65  THR A OG1   1 
ATOM   459  C  CG2   . THR A 1 65  ? 4.898   3.394   29.419  1.00 27.35 ? 65  THR A CG2   1 
ATOM   460  N  N     . GLY A 1 66  ? 5.370   0.451   32.916  1.00 25.26 ? 66  GLY A N     1 
ATOM   461  C  CA    . GLY A 1 66  ? 5.546   -0.799  33.632  1.00 25.68 ? 66  GLY A CA    1 
ATOM   462  C  C     . GLY A 1 66  ? 4.337   -1.132  34.489  1.00 24.98 ? 66  GLY A C     1 
ATOM   463  O  O     . GLY A 1 66  ? 3.928   -2.297  34.573  1.00 25.59 ? 66  GLY A O     1 
ATOM   464  N  N     . GLU A 1 67  ? 3.754   -0.116  35.121  1.00 26.55 ? 67  GLU A N     1 
ATOM   465  C  CA    . GLU A 1 67  ? 2.559   -0.321  35.934  1.00 27.52 ? 67  GLU A CA    1 
ATOM   466  C  C     . GLU A 1 67  ? 1.418   -0.849  35.070  1.00 27.39 ? 67  GLU A C     1 
ATOM   467  O  O     . GLU A 1 67  ? 0.665   -1.733  35.485  1.00 29.43 ? 67  GLU A O     1 
ATOM   468  C  CB    . GLU A 1 67  ? 2.118   0.981   36.616  1.00 36.42 ? 67  GLU A CB    1 
ATOM   469  C  CG    . GLU A 1 67  ? 3.017   1.462   37.739  1.00 44.66 ? 67  GLU A CG    1 
ATOM   470  C  CD    . GLU A 1 67  ? 2.474   2.713   38.411  1.00 57.25 ? 67  GLU A CD    1 
ATOM   471  O  OE1   . GLU A 1 67  ? 3.212   3.718   38.484  1.00 65.91 ? 67  GLU A OE1   1 
ATOM   472  O  OE2   . GLU A 1 67  ? 1.309   2.689   38.864  1.00 59.27 ? 67  GLU A OE2   1 
ATOM   473  N  N     . HIS A 1 68  ? 1.295   -0.300  33.867  1.00 29.43 ? 68  HIS A N     1 
ATOM   474  C  CA    . HIS A 1 68  ? 0.218   -0.695  32.973  1.00 30.34 ? 68  HIS A CA    1 
ATOM   475  C  C     . HIS A 1 68  ? 0.437   -2.114  32.474  1.00 25.89 ? 68  HIS A C     1 
ATOM   476  O  O     . HIS A 1 68  ? -0.510  -2.888  32.348  1.00 27.99 ? 68  HIS A O     1 
ATOM   477  C  CB    . HIS A 1 68  ? 0.088   0.274   31.796  1.00 27.72 ? 68  HIS A CB    1 
ATOM   478  C  CG    . HIS A 1 68  ? -1.231  0.185   31.095  1.00 28.95 ? 68  HIS A CG    1 
ATOM   479  N  ND1   . HIS A 1 68  ? -2.431  0.273   31.763  1.00 41.40 ? 68  HIS A ND1   1 
ATOM   480  C  CD2   . HIS A 1 68  ? -1.539  -0.000  29.789  1.00 32.30 ? 68  HIS A CD2   1 
ATOM   481  C  CE1   . HIS A 1 68  ? -3.424  0.155   30.900  1.00 43.89 ? 68  HIS A CE1   1 
ATOM   482  N  NE2   . HIS A 1 68  ? -2.910  -0.013  29.695  1.00 37.93 ? 68  HIS A NE2   1 
ATOM   483  N  N     . LEU A 1 69  ? 1.693   -2.446  32.183  1.00 25.99 ? 69  LEU A N     1 
ATOM   484  C  CA    . LEU A 1 69  ? 2.060   -3.805  31.794  1.00 22.55 ? 69  LEU A CA    1 
ATOM   485  C  C     . LEU A 1 69  ? 1.625   -4.812  32.863  1.00 28.60 ? 69  LEU A C     1 
ATOM   486  O  O     . LEU A 1 69  ? 1.010   -5.842  32.557  1.00 25.86 ? 69  LEU A O     1 
ATOM   487  C  CB    . LEU A 1 69  ? 3.575   -3.899  31.564  1.00 23.16 ? 69  LEU A CB    1 
ATOM   488  C  CG    . LEU A 1 69  ? 4.158   -5.293  31.301  1.00 23.40 ? 69  LEU A CG    1 
ATOM   489  C  CD1   . LEU A 1 69  ? 3.545   -5.891  30.049  1.00 25.13 ? 69  LEU A CD1   1 
ATOM   490  C  CD2   . LEU A 1 69  ? 5.676   -5.234  31.167  1.00 26.90 ? 69  LEU A CD2   1 
ATOM   491  N  N     . VAL A 1 70  ? 1.939   -4.499  34.117  1.00 27.30 ? 70  VAL A N     1 
ATOM   492  C  CA    . VAL A 1 70  ? 1.571   -5.348  35.244  1.00 24.78 ? 70  VAL A CA    1 
ATOM   493  C  C     . VAL A 1 70  ? 0.054   -5.471  35.363  1.00 26.56 ? 70  VAL A C     1 
ATOM   494  O  O     . VAL A 1 70  ? -0.479  -6.556  35.618  1.00 29.72 ? 70  VAL A O     1 
ATOM   495  C  CB    . VAL A 1 70  ? 2.164   -4.801  36.556  1.00 24.38 ? 70  VAL A CB    1 
ATOM   496  C  CG1   . VAL A 1 70  ? 1.611   -5.551  37.764  1.00 30.55 ? 70  VAL A CG1   1 
ATOM   497  C  CG2   . VAL A 1 70  ? 3.688   -4.904  36.516  1.00 21.75 ? 70  VAL A CG2   1 
ATOM   498  N  N     . SER A 1 71  ? -0.635  -4.355  35.160  1.00 27.12 ? 71  SER A N     1 
ATOM   499  C  CA    . SER A 1 71  ? -2.093  -4.326  35.256  1.00 29.30 ? 71  SER A CA    1 
ATOM   500  C  C     . SER A 1 71  ? -2.765  -5.151  34.160  1.00 29.56 ? 71  SER A C     1 
ATOM   501  O  O     . SER A 1 71  ? -3.788  -5.800  34.398  1.00 33.11 ? 71  SER A O     1 
ATOM   502  C  CB    . SER A 1 71  ? -2.599  -2.884  35.214  1.00 37.33 ? 71  SER A CB    1 
ATOM   503  O  OG    . SER A 1 71  ? -4.011  -2.844  35.090  1.00 53.20 ? 71  SER A OG    1 
ATOM   504  N  N     . LEU A 1 72  ? -2.199  -5.111  32.957  1.00 27.02 ? 72  LEU A N     1 
ATOM   505  C  CA    . LEU A 1 72  ? -2.741  -5.873  31.840  1.00 28.61 ? 72  LEU A CA    1 
ATOM   506  C  C     . LEU A 1 72  ? -2.641  -7.363  32.113  1.00 27.41 ? 72  LEU A C     1 
ATOM   507  O  O     . LEU A 1 72  ? -3.560  -8.119  31.801  1.00 29.79 ? 72  LEU A O     1 
ATOM   508  C  CB    . LEU A 1 72  ? -2.013  -5.528  30.540  1.00 28.41 ? 72  LEU A CB    1 
ATOM   509  C  CG    . LEU A 1 72  ? -2.353  -4.165  29.936  1.00 33.39 ? 72  LEU A CG    1 
ATOM   510  C  CD1   . LEU A 1 72  ? -1.480  -3.887  28.725  1.00 41.88 ? 72  LEU A CD1   1 
ATOM   511  C  CD2   . LEU A 1 72  ? -3.833  -4.094  29.565  1.00 36.64 ? 72  LEU A CD2   1 
ATOM   512  N  N     . LEU A 1 73  ? -1.521  -7.784  32.698  1.00 23.96 ? 73  LEU A N     1 
ATOM   513  C  CA    . LEU A 1 73  ? -1.314  -9.198  33.001  1.00 27.17 ? 73  LEU A CA    1 
ATOM   514  C  C     . LEU A 1 73  ? -2.241  -9.659  34.120  1.00 27.70 ? 73  LEU A C     1 
ATOM   515  O  O     . LEU A 1 73  ? -2.716  -10.798 34.112  1.00 30.92 ? 73  LEU A O     1 
ATOM   516  C  CB    . LEU A 1 73  ? 0.154   -9.475  33.342  1.00 27.37 ? 73  LEU A CB    1 
ATOM   517  C  CG    . LEU A 1 73  ? 1.071   -9.350  32.123  1.00 25.27 ? 73  LEU A CG    1 
ATOM   518  C  CD1   . LEU A 1 73  ? 2.543   -9.364  32.528  1.00 25.32 ? 73  LEU A CD1   1 
ATOM   519  C  CD2   . LEU A 1 73  ? 0.776   -10.464 31.129  1.00 23.85 ? 73  LEU A CD2   1 
ATOM   520  N  N     . ALA A 1 74  ? -2.498  -8.770  35.076  1.00 28.16 ? 74  ALA A N     1 
ATOM   521  C  CA    . ALA A 1 74  ? -3.419  -9.067  36.167  1.00 34.00 ? 74  ALA A CA    1 
ATOM   522  C  C     . ALA A 1 74  ? -4.814  -9.308  35.601  1.00 32.19 ? 74  ALA A C     1 
ATOM   523  O  O     . ALA A 1 74  ? -5.510  -10.232 36.020  1.00 35.23 ? 74  ALA A O     1 
ATOM   524  C  CB    . ALA A 1 74  ? -3.446  -7.925  37.170  1.00 34.21 ? 74  ALA A CB    1 
ATOM   525  N  N     . ASP A 1 75  ? -5.211  -8.469  34.646  1.00 34.50 ? 75  ASP A N     1 
ATOM   526  C  CA    . ASP A 1 75  ? -6.513  -8.593  33.999  1.00 37.05 ? 75  ASP A CA    1 
ATOM   527  C  C     . ASP A 1 75  ? -6.615  -9.884  33.186  1.00 39.46 ? 75  ASP A C     1 
ATOM   528  O  O     . ASP A 1 75  ? -7.710  -10.403 32.962  1.00 46.12 ? 75  ASP A O     1 
ATOM   529  C  CB    . ASP A 1 75  ? -6.787  -7.376  33.107  1.00 40.51 ? 75  ASP A CB    1 
ATOM   530  C  CG    . ASP A 1 75  ? -6.996  -6.097  33.908  1.00 47.14 ? 75  ASP A CG    1 
ATOM   531  O  OD1   . ASP A 1 75  ? -7.202  -6.186  35.139  1.00 48.59 ? 75  ASP A OD1   1 
ATOM   532  O  OD2   . ASP A 1 75  ? -6.965  -5.003  33.303  1.00 48.01 ? 75  ASP A OD2   1 
ATOM   533  N  N     . GLU A 1 76  ? -5.468  -10.398 32.751  1.00 38.48 ? 76  GLU A N     1 
ATOM   534  C  CA    . GLU A 1 76  ? -5.424  -11.643 31.990  1.00 35.54 ? 76  GLU A CA    1 
ATOM   535  C  C     . GLU A 1 76  ? -5.207  -12.841 32.905  1.00 33.22 ? 76  GLU A C     1 
ATOM   536  O  O     . GLU A 1 76  ? -5.085  -13.974 32.438  1.00 39.72 ? 76  GLU A O     1 
ATOM   537  C  CB    . GLU A 1 76  ? -4.336  -11.582 30.917  1.00 35.39 ? 76  GLU A CB    1 
ATOM   538  C  CG    . GLU A 1 76  ? -4.613  -10.539 29.851  1.00 39.04 ? 76  GLU A CG    1 
ATOM   539  C  CD    . GLU A 1 76  ? -3.592  -10.555 28.734  1.00 46.41 ? 76  GLU A CD    1 
ATOM   540  O  OE1   . GLU A 1 76  ? -2.594  -11.302 28.846  1.00 40.61 ? 76  GLU A OE1   1 
ATOM   541  O  OE2   . GLU A 1 76  ? -3.793  -9.820  27.743  1.00 48.41 ? 76  GLU A OE2   1 
ATOM   542  N  N     . ASN A 1 77  ? -5.161  -12.573 34.207  1.00 30.26 ? 77  ASN A N     1 
ATOM   543  C  CA    . ASN A 1 77  ? -4.957  -13.604 35.225  1.00 36.36 ? 77  ASN A CA    1 
ATOM   544  C  C     . ASN A 1 77  ? -3.650  -14.376 35.068  1.00 38.22 ? 77  ASN A C     1 
ATOM   545  O  O     . ASN A 1 77  ? -3.577  -15.566 35.376  1.00 38.39 ? 77  ASN A O     1 
ATOM   546  C  CB    . ASN A 1 77  ? -6.156  -14.556 35.292  1.00 51.06 ? 77  ASN A CB    1 
ATOM   547  C  CG    . ASN A 1 77  ? -7.401  -13.882 35.836  1.00 57.64 ? 77  ASN A CG    1 
ATOM   548  O  OD1   . ASN A 1 77  ? -7.344  -13.156 36.830  1.00 54.86 ? 77  ASN A OD1   1 
ATOM   549  N  ND2   . ASN A 1 77  ? -8.535  -14.111 35.179  1.00 61.77 ? 77  ASN A ND2   1 
ATOM   550  N  N     . VAL A 1 78  ? -2.621  -13.684 34.590  1.00 30.60 ? 78  VAL A N     1 
ATOM   551  C  CA    . VAL A 1 78  ? -1.276  -14.240 34.524  1.00 27.02 ? 78  VAL A CA    1 
ATOM   552  C  C     . VAL A 1 78  ? -0.515  -13.788 35.766  1.00 33.42 ? 78  VAL A C     1 
ATOM   553  O  O     . VAL A 1 78  ? -0.310  -12.588 35.967  1.00 31.55 ? 78  VAL A O     1 
ATOM   554  C  CB    . VAL A 1 78  ? -0.536  -13.751 33.265  1.00 27.66 ? 78  VAL A CB    1 
ATOM   555  C  CG1   . VAL A 1 78  ? 0.901   -14.272 33.247  1.00 22.82 ? 78  VAL A CG1   1 
ATOM   556  C  CG2   . VAL A 1 78  ? -1.292  -14.170 32.008  1.00 32.95 ? 78  VAL A CG2   1 
ATOM   557  N  N     . PRO A 1 79  ? -0.109  -14.743 36.617  1.00 34.75 ? 79  PRO A N     1 
ATOM   558  C  CA    . PRO A 1 79  ? 0.641   -14.374 37.822  1.00 37.20 ? 79  PRO A CA    1 
ATOM   559  C  C     . PRO A 1 79  ? 1.995   -13.789 37.456  1.00 31.37 ? 79  PRO A C     1 
ATOM   560  O  O     . PRO A 1 79  ? 2.617   -14.233 36.488  1.00 29.75 ? 79  PRO A O     1 
ATOM   561  C  CB    . PRO A 1 79  ? 0.810   -15.707 38.560  1.00 34.13 ? 79  PRO A CB    1 
ATOM   562  C  CG    . PRO A 1 79  ? 0.646   -16.752 37.512  1.00 43.95 ? 79  PRO A CG    1 
ATOM   563  C  CD    . PRO A 1 79  ? -0.328  -16.196 36.519  1.00 40.78 ? 79  PRO A CD    1 
ATOM   564  N  N     . VAL A 1 80  ? 2.442   -12.789 38.210  1.00 29.83 ? 80  VAL A N     1 
ATOM   565  C  CA    . VAL A 1 80  ? 3.740   -12.182 37.943  1.00 30.79 ? 80  VAL A CA    1 
ATOM   566  C  C     . VAL A 1 80  ? 4.595   -12.064 39.193  1.00 31.06 ? 80  VAL A C     1 
ATOM   567  O  O     . VAL A 1 80  ? 4.116   -12.205 40.317  1.00 30.22 ? 80  VAL A O     1 
ATOM   568  C  CB    . VAL A 1 80  ? 3.618   -10.776 37.324  1.00 29.92 ? 80  VAL A CB    1 
ATOM   569  C  CG1   . VAL A 1 80  ? 2.696   -10.795 36.107  1.00 28.46 ? 80  VAL A CG1   1 
ATOM   570  C  CG2   . VAL A 1 80  ? 3.134   -9.775  38.366  1.00 34.79 ? 80  VAL A CG2   1 
ATOM   571  N  N     . ALA A 1 81  ? 5.876   -11.805 38.976  1.00 24.92 ? 81  ALA A N     1 
ATOM   572  C  CA    . ALA A 1 81  ? 6.797   -11.494 40.053  1.00 30.30 ? 81  ALA A CA    1 
ATOM   573  C  C     . ALA A 1 81  ? 7.738   -10.472 39.456  1.00 33.54 ? 81  ALA A C     1 
ATOM   574  O  O     . ALA A 1 81  ? 8.501   -10.775 38.543  1.00 33.78 ? 81  ALA A O     1 
ATOM   575  C  CB    . ALA A 1 81  ? 7.558   -12.734 40.493  1.00 36.01 ? 81  ALA A CB    1 
ATOM   576  N  N     . THR A 1 82  ? 7.660   -9.243  39.940  1.00 29.12 ? 82  THR A N     1 
ATOM   577  C  CA    . THR A 1 82  ? 8.374   -8.163  39.280  1.00 28.25 ? 82  THR A CA    1 
ATOM   578  C  C     . THR A 1 82  ? 9.488   -7.568  40.136  1.00 29.72 ? 82  THR A C     1 
ATOM   579  O  O     . THR A 1 82  ? 9.514   -7.728  41.359  1.00 29.92 ? 82  THR A O     1 
ATOM   580  C  CB    . THR A 1 82  ? 7.410   -7.042  38.831  1.00 28.13 ? 82  THR A CB    1 
ATOM   581  O  OG1   . THR A 1 82  ? 6.739   -6.498  39.972  1.00 34.40 ? 82  THR A OG1   1 
ATOM   582  C  CG2   . THR A 1 82  ? 6.368   -7.580  37.847  1.00 28.14 ? 82  THR A CG2   1 
ATOM   583  N  N     . VAL A 1 83  ? 10.415  -6.901  39.461  1.00 29.03 ? 83  VAL A N     1 
ATOM   584  C  CA    . VAL A 1 83  ? 11.436  -6.101  40.109  1.00 33.38 ? 83  VAL A CA    1 
ATOM   585  C  C     . VAL A 1 83  ? 11.255  -4.691  39.580  1.00 27.04 ? 83  VAL A C     1 
ATOM   586  O  O     . VAL A 1 83  ? 11.125  -4.493  38.373  1.00 28.08 ? 83  VAL A O     1 
ATOM   587  C  CB    . VAL A 1 83  ? 12.846  -6.604  39.752  1.00 32.91 ? 83  VAL A CB    1 
ATOM   588  C  CG1   . VAL A 1 83  ? 13.900  -5.579  40.155  1.00 32.94 ? 83  VAL A CG1   1 
ATOM   589  C  CG2   . VAL A 1 83  ? 13.102  -7.952  40.408  1.00 30.15 ? 83  VAL A CG2   1 
ATOM   590  N  N     . GLU A 1 84  ? 11.218  -3.709  40.471  1.00 30.60 ? 84  GLU A N     1 
ATOM   591  C  CA    . GLU A 1 84  ? 11.052  -2.333  40.026  1.00 33.47 ? 84  GLU A CA    1 
ATOM   592  C  C     . GLU A 1 84  ? 12.375  -1.826  39.467  1.00 32.60 ? 84  GLU A C     1 
ATOM   593  O  O     . GLU A 1 84  ? 13.410  -1.919  40.127  1.00 35.59 ? 84  GLU A O     1 
ATOM   594  C  CB    . GLU A 1 84  ? 10.568  -1.446  41.173  1.00 35.20 ? 84  GLU A CB    1 
ATOM   595  C  CG    . GLU A 1 84  ? 9.944   -0.144  40.713  1.00 45.87 ? 84  GLU A CG    1 
ATOM   596  C  CD    . GLU A 1 84  ? 9.006   0.441   41.747  1.00 62.57 ? 84  GLU A CD    1 
ATOM   597  O  OE1   . GLU A 1 84  ? 9.100   0.046   42.931  1.00 67.90 ? 84  GLU A OE1   1 
ATOM   598  O  OE2   . GLU A 1 84  ? 8.169   1.290   41.372  1.00 67.25 ? 84  GLU A OE2   1 
ATOM   599  N  N     . ALA A 1 85  ? 12.346  -1.316  38.240  1.00 28.17 ? 85  ALA A N     1 
ATOM   600  C  CA    . ALA A 1 85  ? 13.563  -0.832  37.597  1.00 26.92 ? 85  ALA A CA    1 
ATOM   601  C  C     . ALA A 1 85  ? 13.529  0.681   37.426  1.00 31.20 ? 85  ALA A C     1 
ATOM   602  O  O     . ALA A 1 85  ? 12.455  1.276   37.313  1.00 34.76 ? 85  ALA A O     1 
ATOM   603  C  CB    . ALA A 1 85  ? 13.769  -1.519  36.254  1.00 27.34 ? 85  ALA A CB    1 
ATOM   604  N  N     . LYS A 1 86  ? 14.709  1.295   37.401  1.00 28.55 ? 86  LYS A N     1 
ATOM   605  C  CA    . LYS A 1 86  ? 14.818  2.747   37.283  1.00 27.35 ? 86  LYS A CA    1 
ATOM   606  C  C     . LYS A 1 86  ? 14.384  3.241   35.906  1.00 29.90 ? 86  LYS A C     1 
ATOM   607  O  O     . LYS A 1 86  ? 13.678  4.240   35.799  1.00 33.59 ? 86  LYS A O     1 
ATOM   608  C  CB    . LYS A 1 86  ? 16.247  3.205   37.587  1.00 34.55 ? 86  LYS A CB    1 
ATOM   609  C  CG    . LYS A 1 86  ? 16.696  2.935   39.016  1.00 45.32 ? 86  LYS A CG    1 
ATOM   610  C  CD    . LYS A 1 86  ? 16.230  4.033   39.963  1.00 59.20 ? 86  LYS A CD    1 
ATOM   611  C  CE    . LYS A 1 86  ? 16.529  3.689   41.420  1.00 65.01 ? 86  LYS A CE    1 
ATOM   612  N  NZ    . LYS A 1 86  ? 15.593  2.659   41.958  1.00 64.65 ? 86  LYS A NZ    1 
ATOM   613  N  N     . ASP A 1 87  ? 14.814  2.539   34.861  1.00 27.44 ? 87  ASP A N     1 
ATOM   614  C  CA    . ASP A 1 87  ? 14.491  2.914   33.487  1.00 32.76 ? 87  ASP A CA    1 
ATOM   615  C  C     . ASP A 1 87  ? 13.083  2.430   33.137  1.00 32.36 ? 87  ASP A C     1 
ATOM   616  O  O     . ASP A 1 87  ? 12.737  1.272   33.389  1.00 30.48 ? 87  ASP A O     1 
ATOM   617  C  CB    . ASP A 1 87  ? 15.531  2.318   32.532  1.00 30.19 ? 87  ASP A CB    1 
ATOM   618  C  CG    . ASP A 1 87  ? 15.570  3.022   31.182  1.00 36.35 ? 87  ASP A CG    1 
ATOM   619  O  OD1   . ASP A 1 87  ? 14.989  4.124   31.053  1.00 36.90 ? 87  ASP A OD1   1 
ATOM   620  O  OD2   . ASP A 1 87  ? 16.201  2.470   30.254  1.00 35.30 ? 87  ASP A OD2   1 
ATOM   621  N  N     . TRP A 1 88  ? 12.271  3.308   32.555  1.00 27.74 ? 88  TRP A N     1 
ATOM   622  C  CA    . TRP A 1 88  ? 10.865  2.984   32.315  1.00 25.98 ? 88  TRP A CA    1 
ATOM   623  C  C     . TRP A 1 88  ? 10.664  1.923   31.227  1.00 27.30 ? 88  TRP A C     1 
ATOM   624  O  O     . TRP A 1 88  ? 11.396  1.880   30.232  1.00 26.55 ? 88  TRP A O     1 
ATOM   625  C  CB    . TRP A 1 88  ? 10.048  4.250   31.995  1.00 31.01 ? 88  TRP A CB    1 
ATOM   626  C  CG    . TRP A 1 88  ? 10.211  4.756   30.583  1.00 36.12 ? 88  TRP A CG    1 
ATOM   627  C  CD1   . TRP A 1 88  ? 9.572   4.298   29.458  1.00 38.43 ? 88  TRP A CD1   1 
ATOM   628  C  CD2   . TRP A 1 88  ? 11.056  5.830   30.153  1.00 37.27 ? 88  TRP A CD2   1 
ATOM   629  N  NE1   . TRP A 1 88  ? 9.981   5.015   28.358  1.00 42.55 ? 88  TRP A NE1   1 
ATOM   630  C  CE2   . TRP A 1 88  ? 10.885  5.960   28.757  1.00 38.38 ? 88  TRP A CE2   1 
ATOM   631  C  CE3   . TRP A 1 88  ? 11.939  6.686   30.811  1.00 34.64 ? 88  TRP A CE3   1 
ATOM   632  C  CZ2   . TRP A 1 88  ? 11.573  6.920   28.012  1.00 49.86 ? 88  TRP A CZ2   1 
ATOM   633  C  CZ3   . TRP A 1 88  ? 12.618  7.638   30.069  1.00 49.92 ? 88  TRP A CZ3   1 
ATOM   634  C  CH2   . TRP A 1 88  ? 12.432  7.746   28.684  1.00 51.72 ? 88  TRP A CH2   1 
ATOM   635  N  N     . THR A 1 89  ? 9.658   1.075   31.424  1.00 27.20 ? 89  THR A N     1 
ATOM   636  C  CA    . THR A 1 89  ? 9.341   -0.003  30.487  1.00 25.58 ? 89  THR A CA    1 
ATOM   637  C  C     . THR A 1 89  ? 9.101   0.546   29.080  1.00 23.38 ? 89  THR A C     1 
ATOM   638  O  O     . THR A 1 89  ? 8.254   1.422   28.885  1.00 25.35 ? 89  THR A O     1 
ATOM   639  C  CB    . THR A 1 89  ? 8.109   -0.807  30.972  1.00 28.66 ? 89  THR A CB    1 
ATOM   640  O  OG1   . THR A 1 89  ? 8.438   -1.473  32.199  1.00 26.62 ? 89  THR A OG1   1 
ATOM   641  C  CG2   . THR A 1 89  ? 7.678   -1.845  29.930  1.00 23.67 ? 89  THR A CG2   1 
ATOM   642  N  N     . ARG A 1 90  ? 9.866   0.034   28.116  1.00 22.37 ? 90  ARG A N     1 
ATOM   643  C  CA    . ARG A 1 90  ? 9.849   0.537   26.742  1.00 21.38 ? 90  ARG A CA    1 
ATOM   644  C  C     . ARG A 1 90  ? 8.660   0.012   25.943  1.00 26.55 ? 90  ARG A C     1 
ATOM   645  O  O     . ARG A 1 90  ? 8.009   -0.955  26.342  1.00 25.06 ? 90  ARG A O     1 
ATOM   646  C  CB    . ARG A 1 90  ? 11.159  0.187   26.027  1.00 27.17 ? 90  ARG A CB    1 
ATOM   647  C  CG    . ARG A 1 90  ? 12.383  0.903   26.576  1.00 22.21 ? 90  ARG A CG    1 
ATOM   648  C  CD    . ARG A 1 90  ? 12.233  2.415   26.470  1.00 25.06 ? 90  ARG A CD    1 
ATOM   649  N  NE    . ARG A 1 90  ? 13.506  3.117   26.645  1.00 28.64 ? 90  ARG A NE    1 
ATOM   650  C  CZ    . ARG A 1 90  ? 13.913  3.669   27.785  1.00 30.26 ? 90  ARG A CZ    1 
ATOM   651  N  NH1   . ARG A 1 90  ? 15.085  4.290   27.839  1.00 32.78 ? 90  ARG A NH1   1 
ATOM   652  N  NH2   . ARG A 1 90  ? 13.151  3.603   28.871  1.00 32.78 ? 90  ARG A NH2   1 
ATOM   653  N  N     . GLN A 1 91  ? 8.390   0.657   24.811  1.00 22.63 ? 91  GLN A N     1 
ATOM   654  C  CA    . GLN A 1 91  ? 7.221   0.342   23.997  1.00 27.39 ? 91  GLN A CA    1 
ATOM   655  C  C     . GLN A 1 91  ? 7.596   -0.016  22.565  1.00 28.17 ? 91  GLN A C     1 
ATOM   656  O  O     . GLN A 1 91  ? 8.346   0.720   21.914  1.00 30.62 ? 91  GLN A O     1 
ATOM   657  C  CB    . GLN A 1 91  ? 6.278   1.544   23.949  1.00 28.32 ? 91  GLN A CB    1 
ATOM   658  C  CG    . GLN A 1 91  ? 5.854   2.097   25.303  1.00 35.70 ? 91  GLN A CG    1 
ATOM   659  C  CD    . GLN A 1 91  ? 4.490   2.768   25.237  1.00 44.73 ? 91  GLN A CD    1 
ATOM   660  O  OE1   . GLN A 1 91  ? 4.335   3.931   25.606  1.00 49.35 ? 91  GLN A OE1   1 
ATOM   661  N  NE2   . GLN A 1 91  ? 3.491   2.029   24.758  1.00 49.12 ? 91  GLN A NE2   1 
ATOM   662  N  N     . ASN A 1 92  ? 7.079   -1.141  22.073  1.00 18.82 ? 92  ASN A N     1 
ATOM   663  C  CA    . ASN A 1 92  ? 7.169   -1.440  20.646  1.00 18.93 ? 92  ASN A CA    1 
ATOM   664  C  C     . ASN A 1 92  ? 5.866   -1.041  19.962  1.00 25.30 ? 92  ASN A C     1 
ATOM   665  O  O     . ASN A 1 92  ? 4.844   -0.863  20.626  1.00 24.43 ? 92  ASN A O     1 
ATOM   666  C  CB    . ASN A 1 92  ? 7.490   -2.917  20.394  1.00 21.92 ? 92  ASN A CB    1 
ATOM   667  C  CG    . ASN A 1 92  ? 8.868   -3.295  20.874  1.00 23.55 ? 92  ASN A CG    1 
ATOM   668  O  OD1   . ASN A 1 92  ? 9.771   -2.461  20.895  1.00 23.34 ? 92  ASN A OD1   1 
ATOM   669  N  ND2   . ASN A 1 92  ? 9.038   -4.549  21.275  1.00 27.77 ? 92  ASN A ND2   1 
ATOM   670  N  N     . LEU A 1 93  ? 5.905   -0.888  18.643  1.00 21.79 ? 93  LEU A N     1 
ATOM   671  C  CA    . LEU A 1 93  ? 4.735   -0.408  17.917  1.00 22.28 ? 93  LEU A CA    1 
ATOM   672  C  C     . LEU A 1 93  ? 4.280   -1.378  16.837  1.00 23.68 ? 93  LEU A C     1 
ATOM   673  O  O     . LEU A 1 93  ? 5.071   -1.784  15.977  1.00 21.02 ? 93  LEU A O     1 
ATOM   674  C  CB    . LEU A 1 93  ? 5.003   0.966   17.294  1.00 19.32 ? 93  LEU A CB    1 
ATOM   675  C  CG    . LEU A 1 93  ? 3.799   1.628   16.611  1.00 27.71 ? 93  LEU A CG    1 
ATOM   676  C  CD1   . LEU A 1 93  ? 2.689   1.919   17.613  1.00 26.52 ? 93  LEU A CD1   1 
ATOM   677  C  CD2   . LEU A 1 93  ? 4.198   2.899   15.858  1.00 23.75 ? 93  LEU A CD2   1 
ATOM   678  N  N     . HIS A 1 94  ? 2.994   -1.726  16.887  1.00 18.13 ? 94  HIS A N     1 
ATOM   679  C  CA    . HIS A 1 94  ? 2.353   -2.569  15.888  1.00 18.96 ? 94  HIS A CA    1 
ATOM   680  C  C     . HIS A 1 94  ? 1.389   -1.686  15.112  1.00 18.84 ? 94  HIS A C     1 
ATOM   681  O  O     . HIS A 1 94  ? 0.476   -1.098  15.694  1.00 23.17 ? 94  HIS A O     1 
ATOM   682  C  CB    . HIS A 1 94  ? 1.583   -3.702  16.580  1.00 23.58 ? 94  HIS A CB    1 
ATOM   683  C  CG    . HIS A 1 94  ? 0.836   -4.603  15.643  1.00 28.97 ? 94  HIS A CG    1 
ATOM   684  N  ND1   . HIS A 1 94  ? -0.413  -4.289  15.146  1.00 30.44 ? 94  HIS A ND1   1 
ATOM   685  C  CD2   . HIS A 1 94  ? 1.149   -5.817  15.136  1.00 28.25 ? 94  HIS A CD2   1 
ATOM   686  C  CE1   . HIS A 1 94  ? -0.828  -5.270  14.360  1.00 27.69 ? 94  HIS A CE1   1 
ATOM   687  N  NE2   . HIS A 1 94  ? 0.101   -6.208  14.339  1.00 27.95 ? 94  HIS A NE2   1 
ATOM   688  N  N     . VAL A 1 95  ? 1.585   -1.584  13.801  1.00 18.75 ? 95  VAL A N     1 
ATOM   689  C  CA    . VAL A 1 95  ? 0.713   -0.746  12.982  1.00 18.85 ? 95  VAL A CA    1 
ATOM   690  C  C     . VAL A 1 95  ? -0.067  -1.565  11.964  1.00 20.90 ? 95  VAL A C     1 
ATOM   691  O  O     . VAL A 1 95  ? 0.520   -2.234  11.111  1.00 20.97 ? 95  VAL A O     1 
ATOM   692  C  CB    . VAL A 1 95  ? 1.516   0.323   12.212  1.00 20.58 ? 95  VAL A CB    1 
ATOM   693  C  CG1   . VAL A 1 95  ? 0.570   1.246   11.436  1.00 25.53 ? 95  VAL A CG1   1 
ATOM   694  C  CG2   . VAL A 1 95  ? 2.396   1.118   13.153  1.00 19.28 ? 95  VAL A CG2   1 
ATOM   695  N  N     . HIS A 1 96  ? -1.392  -1.505  12.040  1.00 19.89 ? 96  HIS A N     1 
ATOM   696  C  CA    . HIS A 1 96  ? -2.224  -2.131  11.021  1.00 20.96 ? 96  HIS A CA    1 
ATOM   697  C  C     . HIS A 1 96  ? -2.594  -1.106  9.951   1.00 25.07 ? 96  HIS A C     1 
ATOM   698  O  O     . HIS A 1 96  ? -3.087  -0.025  10.270  1.00 24.71 ? 96  HIS A O     1 
ATOM   699  C  CB    . HIS A 1 96  ? -3.497  -2.695  11.633  1.00 24.17 ? 96  HIS A CB    1 
ATOM   700  C  CG    . HIS A 1 96  ? -4.380  -3.374  10.635  1.00 27.77 ? 96  HIS A CG    1 
ATOM   701  N  ND1   . HIS A 1 96  ? -4.213  -4.697  10.283  1.00 31.90 ? 96  HIS A ND1   1 
ATOM   702  C  CD2   . HIS A 1 96  ? -5.404  -2.909  9.886   1.00 27.62 ? 96  HIS A CD2   1 
ATOM   703  C  CE1   . HIS A 1 96  ? -5.119  -5.023  9.373   1.00 33.97 ? 96  HIS A CE1   1 
ATOM   704  N  NE2   . HIS A 1 96  ? -5.850  -3.951  9.114   1.00 30.01 ? 96  HIS A NE2   1 
ATOM   705  N  N     . VAL A 1 97  ? -2.343  -1.438  8.685   1.00 22.12 ? 97  VAL A N     1 
ATOM   706  C  CA    . VAL A 1 97  ? -2.712  -0.561  7.579   1.00 24.28 ? 97  VAL A CA    1 
ATOM   707  C  C     . VAL A 1 97  ? -4.035  -1.027  6.967   1.00 23.13 ? 97  VAL A C     1 
ATOM   708  O  O     . VAL A 1 97  ? -4.122  -2.116  6.395   1.00 23.36 ? 97  VAL A O     1 
ATOM   709  C  CB    . VAL A 1 97  ? -1.603  -0.489  6.509   1.00 27.23 ? 97  VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 97  ? -1.972  0.537   5.458   1.00 22.96 ? 97  VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 97  ? -0.267  -0.134  7.155   1.00 25.00 ? 97  VAL A CG2   1 
ATOM   712  N  N     . GLU A 1 98  ? -5.068  -0.194  7.083   1.00 23.21 ? 98  GLU A N     1 
ATOM   713  C  CA    A GLU A 1 98  ? -6.417  -0.563  6.656   0.46 25.09 ? 98  GLU A CA    1 
ATOM   714  C  CA    B GLU A 1 98  ? -6.411  -0.594  6.666   0.54 26.22 ? 98  GLU A CA    1 
ATOM   715  C  C     . GLU A 1 98  ? -6.526  -0.901  5.172   1.00 26.75 ? 98  GLU A C     1 
ATOM   716  O  O     . GLU A 1 98  ? -7.201  -1.856  4.789   1.00 29.77 ? 98  GLU A O     1 
ATOM   717  C  CB    A GLU A 1 98  ? -7.418  0.543   7.019   0.46 21.66 ? 98  GLU A CB    1 
ATOM   718  C  CB    B GLU A 1 98  ? -7.454  0.456   7.068   0.54 26.11 ? 98  GLU A CB    1 
ATOM   719  C  CG    A GLU A 1 98  ? -7.727  0.618   8.509   0.46 21.91 ? 98  GLU A CG    1 
ATOM   720  C  CG    B GLU A 1 98  ? -8.826  -0.128  7.429   0.54 40.74 ? 98  GLU A CG    1 
ATOM   721  C  CD    A GLU A 1 98  ? -8.642  1.777   8.882   0.46 38.78 ? 98  GLU A CD    1 
ATOM   722  C  CD    B GLU A 1 98  ? -8.913  -0.574  8.884   0.54 47.43 ? 98  GLU A CD    1 
ATOM   723  O  OE1   A GLU A 1 98  ? -9.603  1.555   9.654   0.46 42.95 ? 98  GLU A OE1   1 
ATOM   724  O  OE1   B GLU A 1 98  ? -8.406  -1.668  9.210   0.54 37.76 ? 98  GLU A OE1   1 
ATOM   725  O  OE2   A GLU A 1 98  ? -8.391  2.914   8.423   0.46 36.04 ? 98  GLU A OE2   1 
ATOM   726  O  OE2   B GLU A 1 98  ? -9.487  0.176   9.704   0.54 50.56 ? 98  GLU A OE2   1 
ATOM   727  N  N     . ALA A 1 99  ? -5.861  -0.114  4.334   1.00 23.98 ? 99  ALA A N     1 
ATOM   728  C  CA    . ALA A 1 99  ? -6.012  -0.278  2.884   1.00 25.61 ? 99  ALA A CA    1 
ATOM   729  C  C     . ALA A 1 99  ? -5.464  -1.608  2.344   1.00 24.74 ? 99  ALA A C     1 
ATOM   730  O  O     . ALA A 1 99  ? -5.986  -2.154  1.368   1.00 26.55 ? 99  ALA A O     1 
ATOM   731  C  CB    . ALA A 1 99  ? -5.392  0.894   2.153   1.00 32.88 ? 99  ALA A CB    1 
ATOM   732  N  N     . SER A 1 100 ? -4.422  -2.125  2.979   1.00 26.14 ? 100 SER A N     1 
ATOM   733  C  CA    . SER A 1 100 ? -3.761  -3.337  2.496   1.00 30.49 ? 100 SER A CA    1 
ATOM   734  C  C     . SER A 1 100 ? -3.995  -4.541  3.401   1.00 31.04 ? 100 SER A C     1 
ATOM   735  O  O     . SER A 1 100 ? -3.813  -5.687  2.983   1.00 33.94 ? 100 SER A O     1 
ATOM   736  C  CB    . SER A 1 100 ? -2.260  -3.086  2.399   1.00 31.28 ? 100 SER A CB    1 
ATOM   737  O  OG    . SER A 1 100 ? -1.747  -2.749  3.671   1.00 28.15 ? 100 SER A OG    1 
ATOM   738  N  N     . GLY A 1 101 ? -4.372  -4.282  4.650   1.00 29.42 ? 101 GLY A N     1 
ATOM   739  C  CA    . GLY A 1 101 ? -4.541  -5.343  5.629   1.00 29.46 ? 101 GLY A CA    1 
ATOM   740  C  C     . GLY A 1 101 ? -3.212  -5.808  6.205   1.00 26.85 ? 101 GLY A C     1 
ATOM   741  O  O     . GLY A 1 101 ? -3.156  -6.776  6.973   1.00 27.99 ? 101 GLY A O     1 
ATOM   742  N  N     . GLU A 1 102 ? -2.140  -5.121  5.825   1.00 25.86 ? 102 GLU A N     1 
ATOM   743  C  CA    . GLU A 1 102 ? -0.792  -5.471  6.267   1.00 23.27 ? 102 GLU A CA    1 
ATOM   744  C  C     . GLU A 1 102 ? -0.506  -4.936  7.669   1.00 24.23 ? 102 GLU A C     1 
ATOM   745  O  O     . GLU A 1 102 ? -1.085  -3.936  8.094   1.00 27.17 ? 102 GLU A O     1 
ATOM   746  C  CB    . GLU A 1 102 ? 0.243   -4.923  5.276   1.00 28.35 ? 102 GLU A CB    1 
ATOM   747  C  CG    . GLU A 1 102 ? 0.199   -5.592  3.898   1.00 39.62 ? 102 GLU A CG    1 
ATOM   748  C  CD    . GLU A 1 102 ? 1.213   -5.011  2.925   1.00 60.18 ? 102 GLU A CD    1 
ATOM   749  O  OE1   . GLU A 1 102 ? 1.667   -3.867  3.147   1.00 66.65 ? 102 GLU A OE1   1 
ATOM   750  O  OE2   . GLU A 1 102 ? 1.556   -5.701  1.938   1.00 65.20 ? 102 GLU A OE2   1 
ATOM   751  N  N     . GLN A 1 103 ? 0.387   -5.609  8.384   1.00 18.86 ? 103 GLN A N     1 
ATOM   752  C  CA    . GLN A 1 103 ? 0.801   -5.155  9.704   1.00 19.52 ? 103 GLN A CA    1 
ATOM   753  C  C     . GLN A 1 103 ? 2.293   -4.888  9.696   1.00 24.91 ? 103 GLN A C     1 
ATOM   754  O  O     . GLN A 1 103 ? 3.056   -5.619  9.069   1.00 22.33 ? 103 GLN A O     1 
ATOM   755  C  CB    . GLN A 1 103 ? 0.454   -6.180  10.783  1.00 21.81 ? 103 GLN A CB    1 
ATOM   756  C  CG    . GLN A 1 103 ? 1.071   -7.554  10.557  1.00 24.41 ? 103 GLN A CG    1 
ATOM   757  C  CD    . GLN A 1 103 ? 0.564   -8.581  11.541  1.00 30.73 ? 103 GLN A CD    1 
ATOM   758  O  OE1   . GLN A 1 103 ? 0.247   -8.255  12.687  1.00 30.14 ? 103 GLN A OE1   1 
ATOM   759  N  NE2   . GLN A 1 103 ? 0.485   -9.834  11.102  1.00 26.53 ? 103 GLN A NE2   1 
ATOM   760  N  N     . TYR A 1 104 ? 2.693   -3.826  10.382  1.00 19.30 ? 104 TYR A N     1 
ATOM   761  C  CA    . TYR A 1 104 ? 4.096   -3.449  10.481  1.00 16.91 ? 104 TYR A CA    1 
ATOM   762  C  C     . TYR A 1 104 ? 4.506   -3.466  11.935  1.00 22.51 ? 104 TYR A C     1 
ATOM   763  O  O     . TYR A 1 104 ? 3.779   -2.989  12.803  1.00 20.14 ? 104 TYR A O     1 
ATOM   764  C  CB    . TYR A 1 104 ? 4.320   -2.073  9.855   1.00 18.30 ? 104 TYR A CB    1 
ATOM   765  C  CG    . TYR A 1 104 ? 4.183   -2.096  8.347   1.00 19.49 ? 104 TYR A CG    1 
ATOM   766  C  CD1   . TYR A 1 104 ? 5.302   -2.230  7.529   1.00 21.52 ? 104 TYR A CD1   1 
ATOM   767  C  CD2   . TYR A 1 104 ? 2.932   -2.019  7.743   1.00 19.55 ? 104 TYR A CD2   1 
ATOM   768  C  CE1   . TYR A 1 104 ? 5.183   -2.267  6.158   1.00 20.95 ? 104 TYR A CE1   1 
ATOM   769  C  CE2   . TYR A 1 104 ? 2.802   -2.056  6.366   1.00 22.91 ? 104 TYR A CE2   1 
ATOM   770  C  CZ    . TYR A 1 104 ? 3.929   -2.183  5.580   1.00 24.16 ? 104 TYR A CZ    1 
ATOM   771  O  OH    . TYR A 1 104 ? 3.795   -2.217  4.212   1.00 26.72 ? 104 TYR A OH    1 
ATOM   772  N  N     . ARG A 1 105 ? 5.685   -4.009  12.207  1.00 17.24 ? 105 ARG A N     1 
ATOM   773  C  CA    . ARG A 1 105 ? 6.079   -4.262  13.583  1.00 16.52 ? 105 ARG A CA    1 
ATOM   774  C  C     . ARG A 1 105 ? 7.436   -3.656  13.849  1.00 17.75 ? 105 ARG A C     1 
ATOM   775  O  O     . ARG A 1 105 ? 8.444   -4.142  13.350  1.00 19.90 ? 105 ARG A O     1 
ATOM   776  C  CB    . ARG A 1 105 ? 6.119   -5.767  13.834  1.00 22.28 ? 105 ARG A CB    1 
ATOM   777  C  CG    . ARG A 1 105 ? 4.784   -6.458  13.582  1.00 22.26 ? 105 ARG A CG    1 
ATOM   778  C  CD    . ARG A 1 105 ? 4.988   -7.944  13.331  1.00 27.05 ? 105 ARG A CD    1 
ATOM   779  N  NE    . ARG A 1 105 ? 5.451   -8.637  14.528  1.00 24.25 ? 105 ARG A NE    1 
ATOM   780  C  CZ    . ARG A 1 105 ? 5.945   -9.876  14.543  1.00 22.06 ? 105 ARG A CZ    1 
ATOM   781  N  NH1   . ARG A 1 105 ? 6.060   -10.575 13.421  1.00 23.62 ? 105 ARG A NH1   1 
ATOM   782  N  NH2   . ARG A 1 105 ? 6.333   -10.415 15.688  1.00 21.39 ? 105 ARG A NH2   1 
ATOM   783  N  N     . PHE A 1 106 ? 7.463   -2.589  14.635  1.00 17.17 ? 106 PHE A N     1 
ATOM   784  C  CA    . PHE A 1 106 ? 8.720   -1.913  14.929  1.00 16.98 ? 106 PHE A CA    1 
ATOM   785  C  C     . PHE A 1 106 ? 9.192   -2.314  16.313  1.00 22.27 ? 106 PHE A C     1 
ATOM   786  O  O     . PHE A 1 106 ? 8.562   -1.982  17.320  1.00 21.67 ? 106 PHE A O     1 
ATOM   787  C  CB    . PHE A 1 106 ? 8.543   -0.400  14.787  1.00 18.08 ? 106 PHE A CB    1 
ATOM   788  C  CG    . PHE A 1 106 ? 8.036   0.001   13.435  1.00 17.21 ? 106 PHE A CG    1 
ATOM   789  C  CD1   . PHE A 1 106 ? 6.673   0.136   13.200  1.00 18.34 ? 106 PHE A CD1   1 
ATOM   790  C  CD2   . PHE A 1 106 ? 8.912   0.177   12.374  1.00 17.18 ? 106 PHE A CD2   1 
ATOM   791  C  CE1   . PHE A 1 106 ? 6.192   0.469   11.943  1.00 19.17 ? 106 PHE A CE1   1 
ATOM   792  C  CE2   . PHE A 1 106 ? 8.441   0.518   11.110  1.00 17.63 ? 106 PHE A CE2   1 
ATOM   793  C  CZ    . PHE A 1 106 ? 7.075   0.664   10.894  1.00 21.19 ? 106 PHE A CZ    1 
ATOM   794  N  N     . VAL A 1 107 ? 10.289  -3.066  16.344  1.00 20.67 ? 107 VAL A N     1 
ATOM   795  C  CA    . VAL A 1 107 ? 10.781  -3.669  17.575  1.00 18.32 ? 107 VAL A CA    1 
ATOM   796  C  C     . VAL A 1 107 ? 12.060  -2.989  18.027  1.00 22.85 ? 107 VAL A C     1 
ATOM   797  O  O     . VAL A 1 107 ? 13.095  -3.077  17.355  1.00 21.40 ? 107 VAL A O     1 
ATOM   798  C  CB    . VAL A 1 107 ? 11.038  -5.180  17.398  1.00 20.21 ? 107 VAL A CB    1 
ATOM   799  C  CG1   . VAL A 1 107 ? 11.537  -5.789  18.705  1.00 26.64 ? 107 VAL A CG1   1 
ATOM   800  C  CG2   . VAL A 1 107 ? 9.773   -5.881  16.925  1.00 25.11 ? 107 VAL A CG2   1 
ATOM   801  N  N     . MET A 1 108 ? 11.972  -2.288  19.155  1.00 25.25 ? 108 MET A N     1 
ATOM   802  C  CA    . MET A 1 108 ? 13.102  -1.558  19.714  1.00 24.38 ? 108 MET A CA    1 
ATOM   803  C  C     . MET A 1 108 ? 13.595  -2.282  20.963  1.00 23.52 ? 108 MET A C     1 
ATOM   804  O  O     . MET A 1 108 ? 12.916  -3.186  21.455  1.00 21.74 ? 108 MET A O     1 
ATOM   805  C  CB    . MET A 1 108 ? 12.685  -0.117  20.016  1.00 22.24 ? 108 MET A CB    1 
ATOM   806  C  CG    . MET A 1 108 ? 12.690  0.754   18.780  1.00 23.50 ? 108 MET A CG    1 
ATOM   807  S  SD    . MET A 1 108 ? 11.829  2.314   19.013  1.00 30.86 ? 108 MET A SD    1 
ATOM   808  C  CE    . MET A 1 108 ? 10.133  1.723   19.121  1.00 31.22 ? 108 MET A CE    1 
ATOM   809  N  N     . PRO A 1 109 ? 14.791  -1.921  21.458  1.00 23.89 ? 109 PRO A N     1 
ATOM   810  C  CA    . PRO A 1 109 ? 15.324  -2.624  22.629  1.00 25.74 ? 109 PRO A CA    1 
ATOM   811  C  C     . PRO A 1 109 ? 14.492  -2.387  23.884  1.00 20.99 ? 109 PRO A C     1 
ATOM   812  O  O     . PRO A 1 109 ? 13.743  -1.403  23.971  1.00 22.68 ? 109 PRO A O     1 
ATOM   813  C  CB    . PRO A 1 109 ? 16.712  -1.997  22.809  1.00 27.23 ? 109 PRO A CB    1 
ATOM   814  C  CG    . PRO A 1 109 ? 17.053  -1.439  21.449  1.00 22.29 ? 109 PRO A CG    1 
ATOM   815  C  CD    . PRO A 1 109 ? 15.754  -0.943  20.924  1.00 19.83 ? 109 PRO A CD    1 
ATOM   816  N  N     . GLY A 1 110 ? 14.619  -3.295  24.849  1.00 21.36 ? 110 GLY A N     1 
ATOM   817  C  CA    . GLY A 1 110 ? 13.948  -3.124  26.125  1.00 20.24 ? 110 GLY A CA    1 
ATOM   818  C  C     . GLY A 1 110 ? 14.639  -2.056  26.953  1.00 23.76 ? 110 GLY A C     1 
ATOM   819  O  O     . GLY A 1 110 ? 15.725  -1.584  26.600  1.00 26.07 ? 110 GLY A O     1 
ATOM   820  N  N     . ALA A 1 111 ? 14.016  -1.675  28.064  1.00 23.71 ? 111 ALA A N     1 
ATOM   821  C  CA    . ALA A 1 111 ? 14.635  -0.737  28.995  1.00 22.88 ? 111 ALA A CA    1 
ATOM   822  C  C     . ALA A 1 111 ? 15.977  -1.263  29.494  1.00 26.07 ? 111 ALA A C     1 
ATOM   823  O  O     . ALA A 1 111 ? 16.227  -2.469  29.514  1.00 22.36 ? 111 ALA A O     1 
ATOM   824  C  CB    . ALA A 1 111 ? 13.712  -0.463  30.173  1.00 24.48 ? 111 ALA A CB    1 
ATOM   825  N  N     . ALA A 1 112 ? 16.836  -0.345  29.912  1.00 22.72 ? 112 ALA A N     1 
ATOM   826  C  CA    . ALA A 1 112 ? 18.125  -0.721  30.478  1.00 28.55 ? 112 ALA A CA    1 
ATOM   827  C  C     . ALA A 1 112 ? 17.943  -1.389  31.837  1.00 26.26 ? 112 ALA A C     1 
ATOM   828  O  O     . ALA A 1 112 ? 16.960  -1.137  32.538  1.00 24.15 ? 112 ALA A O     1 
ATOM   829  C  CB    . ALA A 1 112 ? 19.027  0.494   30.599  1.00 29.55 ? 112 ALA A CB    1 
ATOM   830  N  N     . LEU A 1 113 ? 18.892  -2.249  32.195  1.00 24.04 ? 113 LEU A N     1 
ATOM   831  C  CA    . LEU A 1 113 ? 18.901  -2.894  33.503  1.00 31.86 ? 113 LEU A CA    1 
ATOM   832  C  C     . LEU A 1 113 ? 20.250  -2.617  34.139  1.00 30.00 ? 113 LEU A C     1 
ATOM   833  O  O     . LEU A 1 113 ? 21.281  -2.853  33.513  1.00 31.17 ? 113 LEU A O     1 
ATOM   834  C  CB    . LEU A 1 113 ? 18.727  -4.408  33.366  1.00 37.44 ? 113 LEU A CB    1 
ATOM   835  C  CG    . LEU A 1 113 ? 17.331  -5.027  33.366  1.00 39.67 ? 113 LEU A CG    1 
ATOM   836  C  CD1   . LEU A 1 113 ? 17.443  -6.540  33.218  1.00 32.09 ? 113 LEU A CD1   1 
ATOM   837  C  CD2   . LEU A 1 113 ? 16.594  -4.667  34.644  1.00 38.57 ? 113 LEU A CD2   1 
ATOM   838  N  N     . ASN A 1 114 ? 20.264  -2.111  35.367  1.00 26.71 ? 114 ASN A N     1 
ATOM   839  C  CA    . ASN A 1 114 ? 21.545  -1.957  36.050  1.00 29.47 ? 114 ASN A CA    1 
ATOM   840  C  C     . ASN A 1 114 ? 21.923  -3.255  36.751  1.00 27.27 ? 114 ASN A C     1 
ATOM   841  O  O     . ASN A 1 114 ? 21.149  -4.210  36.750  1.00 28.58 ? 114 ASN A O     1 
ATOM   842  C  CB    . ASN A 1 114 ? 21.575  -0.746  36.999  1.00 36.39 ? 114 ASN A CB    1 
ATOM   843  C  CG    . ASN A 1 114 ? 20.561  -0.842  38.131  1.00 41.45 ? 114 ASN A CG    1 
ATOM   844  O  OD1   . ASN A 1 114 ? 20.296  -1.919  38.665  1.00 38.17 ? 114 ASN A OD1   1 
ATOM   845  N  ND2   . ASN A 1 114 ? 19.997  0.300   38.508  1.00 37.78 ? 114 ASN A ND2   1 
ATOM   846  N  N     . GLU A 1 115 ? 23.111  -3.295  37.339  1.00 28.63 ? 115 GLU A N     1 
ATOM   847  C  CA    . GLU A 1 115 ? 23.592  -4.525  37.954  1.00 30.68 ? 115 GLU A CA    1 
ATOM   848  C  C     . GLU A 1 115 ? 22.767  -4.925  39.175  1.00 30.76 ? 115 GLU A C     1 
ATOM   849  O  O     . GLU A 1 115 ? 22.501  -6.107  39.380  1.00 29.88 ? 115 GLU A O     1 
ATOM   850  C  CB    . GLU A 1 115 ? 25.074  -4.410  38.302  1.00 28.61 ? 115 GLU A CB    1 
ATOM   851  C  CG    . GLU A 1 115 ? 25.976  -4.356  37.078  1.00 36.26 ? 115 GLU A CG    1 
ATOM   852  C  CD    . GLU A 1 115 ? 27.425  -4.075  37.429  1.00 52.62 ? 115 GLU A CD    1 
ATOM   853  O  OE1   . GLU A 1 115 ? 27.674  -3.354  38.419  1.00 58.79 ? 115 GLU A OE1   1 
ATOM   854  O  OE2   . GLU A 1 115 ? 28.315  -4.575  36.713  1.00 60.58 ? 115 GLU A OE2   1 
ATOM   855  N  N     . ASP A 1 116 ? 22.352  -3.943  39.972  1.00 29.72 ? 116 ASP A N     1 
ATOM   856  C  CA    . ASP A 1 116 ? 21.531  -4.220  41.149  1.00 27.49 ? 116 ASP A CA    1 
ATOM   857  C  C     . ASP A 1 116 ? 20.212  -4.872  40.750  1.00 28.44 ? 116 ASP A C     1 
ATOM   858  O  O     . ASP A 1 116 ? 19.792  -5.867  41.341  1.00 30.06 ? 116 ASP A O     1 
ATOM   859  C  CB    . ASP A 1 116 ? 21.251  -2.937  41.929  1.00 35.14 ? 116 ASP A CB    1 
ATOM   860  C  CG    . ASP A 1 116 ? 20.276  -3.155  43.076  1.00 41.51 ? 116 ASP A CG    1 
ATOM   861  O  OD1   . ASP A 1 116 ? 20.393  -4.184  43.777  1.00 48.31 ? 116 ASP A OD1   1 
ATOM   862  O  OD2   . ASP A 1 116 ? 19.392  -2.298  43.278  1.00 54.06 ? 116 ASP A OD2   1 
ATOM   863  N  N     . GLU A 1 117 ? 19.564  -4.300  39.741  1.00 27.93 ? 117 GLU A N     1 
ATOM   864  C  CA    . GLU A 1 117 ? 18.292  -4.812  39.253  1.00 27.43 ? 117 GLU A CA    1 
ATOM   865  C  C     . GLU A 1 117 ? 18.403  -6.245  38.731  1.00 26.27 ? 117 GLU A C     1 
ATOM   866  O  O     . GLU A 1 117 ? 17.521  -7.069  38.975  1.00 27.27 ? 117 GLU A O     1 
ATOM   867  C  CB    . GLU A 1 117 ? 17.718  -3.876  38.182  1.00 31.26 ? 117 GLU A CB    1 
ATOM   868  C  CG    . GLU A 1 117 ? 17.165  -2.569  38.761  1.00 32.29 ? 117 GLU A CG    1 
ATOM   869  C  CD    . GLU A 1 117 ? 17.148  -1.426  37.759  1.00 27.05 ? 117 GLU A CD    1 
ATOM   870  O  OE1   . GLU A 1 117 ? 16.768  -0.299  38.155  1.00 34.21 ? 117 GLU A OE1   1 
ATOM   871  O  OE2   . GLU A 1 117 ? 17.515  -1.647  36.584  1.00 31.44 ? 117 GLU A OE2   1 
ATOM   872  N  N     . PHE A 1 118 ? 19.491  -6.546  38.027  1.00 25.26 ? 118 PHE A N     1 
ATOM   873  C  CA    . PHE A 1 118 ? 19.686  -7.897  37.517  1.00 24.26 ? 118 PHE A CA    1 
ATOM   874  C  C     . PHE A 1 118 ? 19.863  -8.901  38.658  1.00 25.46 ? 118 PHE A C     1 
ATOM   875  O  O     . PHE A 1 118 ? 19.328  -10.009 38.604  1.00 25.39 ? 118 PHE A O     1 
ATOM   876  C  CB    . PHE A 1 118 ? 20.870  -7.963  36.556  1.00 25.55 ? 118 PHE A CB    1 
ATOM   877  C  CG    . PHE A 1 118 ? 21.039  -9.306  35.906  1.00 29.51 ? 118 PHE A CG    1 
ATOM   878  C  CD1   . PHE A 1 118 ? 21.876  -10.261 36.463  1.00 30.52 ? 118 PHE A CD1   1 
ATOM   879  C  CD2   . PHE A 1 118 ? 20.349  -9.622  34.745  1.00 33.79 ? 118 PHE A CD2   1 
ATOM   880  C  CE1   . PHE A 1 118 ? 22.030  -11.504 35.873  1.00 31.84 ? 118 PHE A CE1   1 
ATOM   881  C  CE2   . PHE A 1 118 ? 20.502  -10.866 34.147  1.00 34.16 ? 118 PHE A CE2   1 
ATOM   882  C  CZ    . PHE A 1 118 ? 21.345  -11.806 34.712  1.00 34.79 ? 118 PHE A CZ    1 
ATOM   883  N  N     . ARG A 1 119 ? 20.616  -8.513  39.687  1.00 26.67 ? 119 ARG A N     1 
ATOM   884  C  CA    . ARG A 1 119 ? 20.782  -9.358  40.865  1.00 25.79 ? 119 ARG A CA    1 
ATOM   885  C  C     . ARG A 1 119 ? 19.446  -9.580  41.578  1.00 25.01 ? 119 ARG A C     1 
ATOM   886  O  O     . ARG A 1 119 ? 19.210  -10.644 42.150  1.00 25.08 ? 119 ARG A O     1 
ATOM   887  C  CB    . ARG A 1 119 ? 21.820  -8.771  41.827  1.00 26.54 ? 119 ARG A CB    1 
ATOM   888  C  CG    . ARG A 1 119 ? 23.264  -9.038  41.414  1.00 28.80 ? 119 ARG A CG    1 
ATOM   889  C  CD    . ARG A 1 119 ? 24.248  -8.513  42.457  1.00 32.01 ? 119 ARG A CD    1 
ATOM   890  N  NE    . ARG A 1 119 ? 24.273  -7.053  42.471  1.00 38.88 ? 119 ARG A NE    1 
ATOM   891  C  CZ    . ARG A 1 119 ? 25.201  -6.317  41.868  1.00 29.24 ? 119 ARG A CZ    1 
ATOM   892  N  NH1   . ARG A 1 119 ? 26.205  -6.904  41.226  1.00 32.36 ? 119 ARG A NH1   1 
ATOM   893  N  NH2   . ARG A 1 119 ? 25.138  -4.992  41.933  1.00 32.97 ? 119 ARG A NH2   1 
ATOM   894  N  N     . GLN A 1 120 ? 18.576  -8.573  41.545  1.00 26.56 ? 120 GLN A N     1 
ATOM   895  C  CA    . GLN A 1 120 ? 17.236  -8.718  42.112  1.00 29.62 ? 120 GLN A CA    1 
ATOM   896  C  C     . GLN A 1 120 ? 16.418  -9.740  41.340  1.00 26.50 ? 120 GLN A C     1 
ATOM   897  O  O     . GLN A 1 120 ? 15.646  -10.508 41.924  1.00 29.83 ? 120 GLN A O     1 
ATOM   898  C  CB    . GLN A 1 120 ? 16.499  -7.381  42.115  1.00 25.38 ? 120 GLN A CB    1 
ATOM   899  C  CG    . GLN A 1 120 ? 16.986  -6.413  43.180  1.00 29.28 ? 120 GLN A CG    1 
ATOM   900  C  CD    . GLN A 1 120 ? 16.201  -5.126  43.172  1.00 36.49 ? 120 GLN A CD    1 
ATOM   901  O  OE1   . GLN A 1 120 ? 14.983  -5.130  43.357  1.00 33.72 ? 120 GLN A OE1   1 
ATOM   902  N  NE2   . GLN A 1 120 ? 16.890  -4.013  42.941  1.00 35.49 ? 120 GLN A NE2   1 
ATOM   903  N  N     . LEU A 1 121 ? 16.587  -9.739  40.023  1.00 26.57 ? 121 LEU A N     1 
ATOM   904  C  CA    . LEU A 1 121 ? 15.897  -10.695 39.166  1.00 27.09 ? 121 LEU A CA    1 
ATOM   905  C  C     . LEU A 1 121 ? 16.444  -12.093 39.422  1.00 25.24 ? 121 LEU A C     1 
ATOM   906  O  O     . LEU A 1 121 ? 15.691  -13.065 39.501  1.00 26.71 ? 121 LEU A O     1 
ATOM   907  C  CB    . LEU A 1 121 ? 16.057  -10.307 37.697  1.00 26.25 ? 121 LEU A CB    1 
ATOM   908  C  CG    . LEU A 1 121 ? 15.194  -9.124  37.250  1.00 27.36 ? 121 LEU A CG    1 
ATOM   909  C  CD1   . LEU A 1 121 ? 15.731  -8.501  35.973  1.00 27.75 ? 121 LEU A CD1   1 
ATOM   910  C  CD2   . LEU A 1 121 ? 13.752  -9.569  37.046  1.00 30.72 ? 121 LEU A CD2   1 
ATOM   911  N  N     . GLU A 1 122 ? 17.762  -12.178 39.565  1.00 25.12 ? 122 GLU A N     1 
ATOM   912  C  CA    . GLU A 1 122 ? 18.434  -13.429 39.892  1.00 26.75 ? 122 GLU A CA    1 
ATOM   913  C  C     . GLU A 1 122 ? 17.911  -13.989 41.219  1.00 28.43 ? 122 GLU A C     1 
ATOM   914  O  O     . GLU A 1 122 ? 17.690  -15.194 41.350  1.00 27.61 ? 122 GLU A O     1 
ATOM   915  C  CB    . GLU A 1 122 ? 19.943  -13.184 39.974  1.00 32.77 ? 122 GLU A CB    1 
ATOM   916  C  CG    . GLU A 1 122 ? 20.819  -14.378 39.654  1.00 53.39 ? 122 GLU A CG    1 
ATOM   917  C  CD    . GLU A 1 122 ? 22.234  -13.961 39.283  1.00 59.23 ? 122 GLU A CD    1 
ATOM   918  O  OE1   . GLU A 1 122 ? 22.495  -12.738 39.209  1.00 55.49 ? 122 GLU A OE1   1 
ATOM   919  O  OE2   . GLU A 1 122 ? 23.081  -14.852 39.064  1.00 65.70 ? 122 GLU A OE2   1 
ATOM   920  N  N     . GLU A 1 123 ? 17.702  -13.108 42.195  1.00 22.81 ? 123 GLU A N     1 
ATOM   921  C  CA    . GLU A 1 123 ? 17.165  -13.507 43.497  1.00 28.38 ? 123 GLU A CA    1 
ATOM   922  C  C     . GLU A 1 123 ? 15.776  -14.132 43.355  1.00 30.24 ? 123 GLU A C     1 
ATOM   923  O  O     . GLU A 1 123 ? 15.473  -15.134 44.009  1.00 31.29 ? 123 GLU A O     1 
ATOM   924  C  CB    . GLU A 1 123 ? 17.125  -12.311 44.458  1.00 35.06 ? 123 GLU A CB    1 
ATOM   925  C  CG    . GLU A 1 123 ? 16.692  -12.656 45.870  1.00 38.74 ? 123 GLU A CG    1 
ATOM   926  C  CD    . GLU A 1 123 ? 16.806  -11.477 46.818  1.00 43.88 ? 123 GLU A CD    1 
ATOM   927  O  OE1   . GLU A 1 123 ? 16.731  -10.320 46.347  1.00 41.05 ? 123 GLU A OE1   1 
ATOM   928  O  OE2   . GLU A 1 123 ? 16.975  -11.709 48.031  1.00 50.57 ? 123 GLU A OE2   1 
ATOM   929  N  N     . GLN A 1 124 ? 14.947  -13.546 42.494  1.00 29.56 ? 124 GLN A N     1 
ATOM   930  C  CA    . GLN A 1 124 ? 13.611  -14.081 42.233  1.00 33.14 ? 124 GLN A CA    1 
ATOM   931  C  C     . GLN A 1 124 ? 13.689  -15.487 41.646  1.00 30.24 ? 124 GLN A C     1 
ATOM   932  O  O     . GLN A 1 124 ? 12.963  -16.389 42.063  1.00 33.08 ? 124 GLN A O     1 
ATOM   933  C  CB    . GLN A 1 124 ? 12.827  -13.167 41.283  1.00 34.14 ? 124 GLN A CB    1 
ATOM   934  C  CG    . GLN A 1 124 ? 12.271  -11.906 41.939  1.00 43.52 ? 124 GLN A CG    1 
ATOM   935  C  CD    . GLN A 1 124 ? 11.396  -12.206 43.147  1.00 48.47 ? 124 GLN A CD    1 
ATOM   936  O  OE1   . GLN A 1 124 ? 11.617  -11.671 44.234  1.00 59.39 ? 124 GLN A OE1   1 
ATOM   937  N  NE2   . GLN A 1 124 ? 10.396  -13.062 42.961  1.00 49.86 ? 124 GLN A NE2   1 
ATOM   938  N  N     . VAL A 1 125 ? 14.579  -15.662 40.675  1.00 29.99 ? 125 VAL A N     1 
ATOM   939  C  CA    . VAL A 1 125 ? 14.746  -16.949 40.008  1.00 28.29 ? 125 VAL A CA    1 
ATOM   940  C  C     . VAL A 1 125 ? 15.182  -18.044 40.977  1.00 28.62 ? 125 VAL A C     1 
ATOM   941  O  O     . VAL A 1 125 ? 14.692  -19.168 40.909  1.00 29.95 ? 125 VAL A O     1 
ATOM   942  C  CB    . VAL A 1 125 ? 15.752  -16.852 38.844  1.00 25.41 ? 125 VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 125 ? 16.126  -18.236 38.335  1.00 28.87 ? 125 VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 125 ? 15.173  -16.011 37.722  1.00 24.09 ? 125 VAL A CG2   1 
ATOM   945  N  N     . LEU A 1 126 ? 16.085  -17.712 41.891  1.00 26.65 ? 126 LEU A N     1 
ATOM   946  C  CA    . LEU A 1 126 ? 16.601  -18.708 42.823  1.00 32.00 ? 126 LEU A CA    1 
ATOM   947  C  C     . LEU A 1 126 ? 15.632  -19.033 43.967  1.00 28.13 ? 126 LEU A C     1 
ATOM   948  O  O     . LEU A 1 126 ? 15.925  -19.876 44.821  1.00 32.44 ? 126 LEU A O     1 
ATOM   949  C  CB    . LEU A 1 126 ? 17.986  -18.302 43.339  1.00 32.54 ? 126 LEU A CB    1 
ATOM   950  C  CG    . LEU A 1 126 ? 19.004  -18.170 42.198  1.00 37.51 ? 126 LEU A CG    1 
ATOM   951  C  CD1   . LEU A 1 126 ? 20.393  -17.827 42.720  1.00 41.08 ? 126 LEU A CD1   1 
ATOM   952  C  CD2   . LEU A 1 126 ? 19.038  -19.444 41.351  1.00 31.09 ? 126 LEU A CD2   1 
ATOM   953  N  N     . GLU A 1 127 ? 14.477  -18.375 43.974  1.00 31.51 ? 127 GLU A N     1 
ATOM   954  C  CA    . GLU A 1 127 ? 13.406  -18.734 44.899  1.00 41.70 ? 127 GLU A CA    1 
ATOM   955  C  C     . GLU A 1 127 ? 12.507  -19.809 44.299  1.00 36.23 ? 127 GLU A C     1 
ATOM   956  O  O     . GLU A 1 127 ? 11.648  -20.366 44.982  1.00 38.78 ? 127 GLU A O     1 
ATOM   957  C  CB    . GLU A 1 127 ? 12.583  -17.505 45.288  1.00 40.45 ? 127 GLU A CB    1 
ATOM   958  C  CG    . GLU A 1 127 ? 13.337  -16.521 46.164  1.00 54.58 ? 127 GLU A CG    1 
ATOM   959  C  CD    . GLU A 1 127 ? 12.539  -15.268 46.457  1.00 68.50 ? 127 GLU A CD    1 
ATOM   960  O  OE1   . GLU A 1 127 ? 11.355  -15.209 46.062  1.00 72.90 ? 127 GLU A OE1   1 
ATOM   961  O  OE2   . GLU A 1 127 ? 13.099  -14.340 47.081  1.00 73.92 ? 127 GLU A OE2   1 
ATOM   962  N  N     . ILE A 1 128 ? 12.706  -20.092 43.015  1.00 30.95 ? 128 ILE A N     1 
ATOM   963  C  CA    . ILE A 1 128 ? 11.973  -21.158 42.342  1.00 36.61 ? 128 ILE A CA    1 
ATOM   964  C  C     . ILE A 1 128 ? 12.402  -22.496 42.940  1.00 38.83 ? 128 ILE A C     1 
ATOM   965  O  O     . ILE A 1 128 ? 13.588  -22.708 43.211  1.00 32.90 ? 128 ILE A O     1 
ATOM   966  C  CB    . ILE A 1 128 ? 12.233  -21.130 40.820  1.00 30.74 ? 128 ILE A CB    1 
ATOM   967  C  CG1   . ILE A 1 128 ? 11.630  -19.863 40.208  1.00 29.81 ? 128 ILE A CG1   1 
ATOM   968  C  CG2   . ILE A 1 128 ? 11.666  -22.357 40.146  1.00 28.39 ? 128 ILE A CG2   1 
ATOM   969  C  CD1   . ILE A 1 128 ? 12.081  -19.598 38.781  1.00 27.23 ? 128 ILE A CD1   1 
ATOM   970  N  N     . GLU A 1 129 ? 11.438  -23.384 43.172  1.00 33.34 ? 129 GLU A N     1 
ATOM   971  C  CA    . GLU A 1 129 ? 11.733  -24.674 43.785  1.00 40.28 ? 129 GLU A CA    1 
ATOM   972  C  C     . GLU A 1 129 ? 12.474  -25.602 42.826  1.00 39.72 ? 129 GLU A C     1 
ATOM   973  O  O     . GLU A 1 129 ? 12.397  -25.440 41.608  1.00 38.72 ? 129 GLU A O     1 
ATOM   974  C  CB    . GLU A 1 129 ? 10.446  -25.345 44.276  1.00 41.15 ? 129 GLU A CB    1 
ATOM   975  C  CG    . GLU A 1 129 ? 9.394   -25.554 43.201  1.00 44.21 ? 129 GLU A CG    1 
ATOM   976  C  CD    . GLU A 1 129 ? 8.426   -24.389 43.089  1.00 52.09 ? 129 GLU A CD    1 
ATOM   977  O  OE1   . GLU A 1 129 ? 8.869   -23.237 42.888  1.00 41.37 ? 129 GLU A OE1   1 
ATOM   978  O  OE2   . GLU A 1 129 ? 7.210   -24.632 43.216  1.00 67.37 ? 129 GLU A OE2   1 
ATOM   979  N  N     . SER A 1 130 ? 13.194  -26.572 43.380  1.00 33.16 ? 130 SER A N     1 
ATOM   980  C  CA    . SER A 1 130 ? 13.870  -27.575 42.562  1.00 34.36 ? 130 SER A CA    1 
ATOM   981  C  C     . SER A 1 130 ? 12.845  -28.398 41.793  1.00 38.54 ? 130 SER A C     1 
ATOM   982  O  O     . SER A 1 130 ? 11.795  -28.759 42.334  1.00 38.24 ? 130 SER A O     1 
ATOM   983  C  CB    . SER A 1 130 ? 14.734  -28.491 43.438  1.00 40.29 ? 130 SER A CB    1 
ATOM   984  O  OG    . SER A 1 130 ? 15.041  -29.704 42.770  1.00 44.47 ? 130 SER A OG    1 
ATOM   985  N  N     . GLY A 1 131 ? 13.138  -28.676 40.526  1.00 33.14 ? 131 GLY A N     1 
ATOM   986  C  CA    . GLY A 1 131 ? 12.259  -29.488 39.708  1.00 35.96 ? 131 GLY A CA    1 
ATOM   987  C  C     . GLY A 1 131 ? 11.306  -28.662 38.865  1.00 28.46 ? 131 GLY A C     1 
ATOM   988  O  O     . GLY A 1 131 ? 10.760  -29.149 37.875  1.00 35.06 ? 131 GLY A O     1 
ATOM   989  N  N     . ALA A 1 132 ? 11.097  -27.412 39.264  1.00 30.24 ? 132 ALA A N     1 
ATOM   990  C  CA    . ALA A 1 132 ? 10.256  -26.506 38.488  1.00 26.91 ? 132 ALA A CA    1 
ATOM   991  C  C     . ALA A 1 132 ? 10.943  -26.081 37.198  1.00 26.76 ? 132 ALA A C     1 
ATOM   992  O  O     . ALA A 1 132 ? 12.160  -26.210 37.052  1.00 29.74 ? 132 ALA A O     1 
ATOM   993  C  CB    . ALA A 1 132 ? 9.873   -25.288 39.310  1.00 27.47 ? 132 ALA A CB    1 
ATOM   994  N  N     . ILE A 1 133 ? 10.148  -25.559 36.271  1.00 25.43 ? 133 ILE A N     1 
ATOM   995  C  CA    . ILE A 1 133 ? 10.641  -25.156 34.966  1.00 28.70 ? 133 ILE A CA    1 
ATOM   996  C  C     . ILE A 1 133 ? 10.715  -23.638 34.849  1.00 28.62 ? 133 ILE A C     1 
ATOM   997  O  O     . ILE A 1 133 ? 9.787   -22.928 35.239  1.00 29.15 ? 133 ILE A O     1 
ATOM   998  C  CB    . ILE A 1 133 ? 9.747   -25.738 33.853  1.00 26.06 ? 133 ILE A CB    1 
ATOM   999  C  CG1   . ILE A 1 133 ? 9.850   -27.267 33.862  1.00 30.51 ? 133 ILE A CG1   1 
ATOM   1000 C  CG2   . ILE A 1 133 ? 10.133  -25.193 32.483  1.00 22.61 ? 133 ILE A CG2   1 
ATOM   1001 C  CD1   . ILE A 1 133 ? 8.836   -27.948 32.973  1.00 31.89 ? 133 ILE A CD1   1 
ATOM   1002 N  N     . LEU A 1 134 ? 11.837  -23.152 34.324  1.00 25.33 ? 134 LEU A N     1 
ATOM   1003 C  CA    . LEU A 1 134 ? 12.022  -21.736 34.038  1.00 23.86 ? 134 LEU A CA    1 
ATOM   1004 C  C     . LEU A 1 134 ? 12.264  -21.526 32.551  1.00 25.59 ? 134 LEU A C     1 
ATOM   1005 O  O     . LEU A 1 134 ? 13.216  -22.066 31.980  1.00 25.26 ? 134 LEU A O     1 
ATOM   1006 C  CB    . LEU A 1 134 ? 13.206  -21.171 34.820  1.00 20.58 ? 134 LEU A CB    1 
ATOM   1007 C  CG    . LEU A 1 134 ? 13.517  -19.715 34.462  1.00 25.45 ? 134 LEU A CG    1 
ATOM   1008 C  CD1   . LEU A 1 134 ? 12.359  -18.829 34.888  1.00 26.81 ? 134 LEU A CD1   1 
ATOM   1009 C  CD2   . LEU A 1 134 ? 14.829  -19.264 35.110  1.00 26.18 ? 134 LEU A CD2   1 
ATOM   1010 N  N     . VAL A 1 135 ? 11.405  -20.734 31.923  1.00 19.25 ? 135 VAL A N     1 
ATOM   1011 C  CA    . VAL A 1 135 ? 11.584  -20.400 30.514  1.00 17.57 ? 135 VAL A CA    1 
ATOM   1012 C  C     . VAL A 1 135 ? 12.193  -19.015 30.374  1.00 26.97 ? 135 VAL A C     1 
ATOM   1013 O  O     . VAL A 1 135 ? 11.553  -18.013 30.692  1.00 25.21 ? 135 VAL A O     1 
ATOM   1014 C  CB    . VAL A 1 135 ? 10.246  -20.431 29.744  1.00 21.33 ? 135 VAL A CB    1 
ATOM   1015 C  CG1   . VAL A 1 135 ? 10.484  -20.161 28.256  1.00 22.73 ? 135 VAL A CG1   1 
ATOM   1016 C  CG2   . VAL A 1 135 ? 9.544   -21.765 29.940  1.00 21.58 ? 135 VAL A CG2   1 
ATOM   1017 N  N     . ILE A 1 136 ? 13.432  -18.962 29.896  1.00 22.39 ? 136 ILE A N     1 
ATOM   1018 C  CA    . ILE A 1 136 ? 14.105  -17.696 29.641  1.00 20.44 ? 136 ILE A CA    1 
ATOM   1019 C  C     . ILE A 1 136 ? 13.925  -17.369 28.160  1.00 25.87 ? 136 ILE A C     1 
ATOM   1020 O  O     . ILE A 1 136 ? 14.504  -18.026 27.293  1.00 20.48 ? 136 ILE A O     1 
ATOM   1021 C  CB    . ILE A 1 136 ? 15.604  -17.779 29.988  1.00 20.81 ? 136 ILE A CB    1 
ATOM   1022 C  CG1   . ILE A 1 136 ? 15.789  -18.294 31.413  1.00 23.37 ? 136 ILE A CG1   1 
ATOM   1023 C  CG2   . ILE A 1 136 ? 16.260  -16.413 29.835  1.00 25.62 ? 136 ILE A CG2   1 
ATOM   1024 C  CD1   . ILE A 1 136 ? 16.528  -19.608 31.492  1.00 32.59 ? 136 ILE A CD1   1 
ATOM   1025 N  N     . SER A 1 137 ? 13.108  -16.361 27.867  1.00 19.53 ? 137 SER A N     1 
ATOM   1026 C  CA    . SER A 1 137 ? 12.748  -16.062 26.486  1.00 17.95 ? 137 SER A CA    1 
ATOM   1027 C  C     . SER A 1 137 ? 12.770  -14.565 26.174  1.00 21.68 ? 137 SER A C     1 
ATOM   1028 O  O     . SER A 1 137 ? 12.237  -13.748 26.929  1.00 20.42 ? 137 SER A O     1 
ATOM   1029 C  CB    . SER A 1 137 ? 11.356  -16.632 26.159  1.00 18.05 ? 137 SER A CB    1 
ATOM   1030 O  OG    . SER A 1 137 ? 10.937  -16.192 24.881  1.00 19.79 ? 137 SER A OG    1 
ATOM   1031 N  N     . GLY A 1 138 ? 13.391  -14.212 25.055  1.00 22.63 ? 138 GLY A N     1 
ATOM   1032 C  CA    . GLY A 1 138 ? 13.382  -12.839 24.593  1.00 18.34 ? 138 GLY A CA    1 
ATOM   1033 C  C     . GLY A 1 138 ? 14.783  -12.292 24.440  1.00 22.13 ? 138 GLY A C     1 
ATOM   1034 O  O     . GLY A 1 138 ? 15.771  -12.984 24.709  1.00 22.96 ? 138 GLY A O     1 
ATOM   1035 N  N     . SER A 1 139 ? 14.863  -11.036 24.017  1.00 20.68 ? 139 SER A N     1 
ATOM   1036 C  CA    . SER A 1 139 ? 16.142  -10.374 23.792  1.00 25.68 ? 139 SER A CA    1 
ATOM   1037 C  C     . SER A 1 139 ? 16.853  -10.008 25.094  1.00 30.23 ? 139 SER A C     1 
ATOM   1038 O  O     . SER A 1 139 ? 16.262  -10.054 26.179  1.00 23.89 ? 139 SER A O     1 
ATOM   1039 C  CB    . SER A 1 139 ? 15.935  -9.107  22.957  1.00 24.76 ? 139 SER A CB    1 
ATOM   1040 O  OG    . SER A 1 139 ? 15.094  -8.180  23.629  1.00 25.83 ? 139 SER A OG    1 
ATOM   1041 N  N     . LEU A 1 140 ? 18.126  -9.641  24.970  1.00 23.13 ? 140 LEU A N     1 
ATOM   1042 C  CA    . LEU A 1 140 ? 18.923  -9.178  26.104  1.00 22.05 ? 140 LEU A CA    1 
ATOM   1043 C  C     . LEU A 1 140 ? 18.947  -7.653  26.112  1.00 25.55 ? 140 LEU A C     1 
ATOM   1044 O  O     . LEU A 1 140 ? 19.385  -7.033  25.138  1.00 27.35 ? 140 LEU A O     1 
ATOM   1045 C  CB    . LEU A 1 140 ? 20.357  -9.715  26.009  1.00 27.55 ? 140 LEU A CB    1 
ATOM   1046 C  CG    . LEU A 1 140 ? 21.222  -9.447  27.242  1.00 28.41 ? 140 LEU A CG    1 
ATOM   1047 C  CD1   . LEU A 1 140 ? 20.777  -10.334 28.396  1.00 29.87 ? 140 LEU A CD1   1 
ATOM   1048 C  CD2   . LEU A 1 140 ? 22.707  -9.649  26.946  1.00 35.44 ? 140 LEU A CD2   1 
ATOM   1049 N  N     . PRO A 1 141 ? 18.473  -7.041  27.209  1.00 23.60 ? 141 PRO A N     1 
ATOM   1050 C  CA    . PRO A 1 141 ? 18.390  -5.579  27.293  1.00 26.76 ? 141 PRO A CA    1 
ATOM   1051 C  C     . PRO A 1 141 ? 19.758  -4.963  27.532  1.00 23.32 ? 141 PRO A C     1 
ATOM   1052 O  O     . PRO A 1 141 ? 20.672  -5.676  27.963  1.00 27.14 ? 141 PRO A O     1 
ATOM   1053 C  CB    . PRO A 1 141 ? 17.493  -5.359  28.516  1.00 24.88 ? 141 PRO A CB    1 
ATOM   1054 C  CG    . PRO A 1 141 ? 17.777  -6.539  29.387  1.00 26.06 ? 141 PRO A CG    1 
ATOM   1055 C  CD    . PRO A 1 141 ? 17.960  -7.690  28.430  1.00 24.20 ? 141 PRO A CD    1 
ATOM   1056 N  N     . PRO A 1 142 ? 19.904  -3.657  27.249  1.00 28.40 ? 142 PRO A N     1 
ATOM   1057 C  CA    . PRO A 1 142 ? 21.166  -2.965  27.526  1.00 30.51 ? 142 PRO A CA    1 
ATOM   1058 C  C     . PRO A 1 142 ? 21.490  -3.027  29.013  1.00 28.77 ? 142 PRO A C     1 
ATOM   1059 O  O     . PRO A 1 142 ? 20.570  -3.043  29.837  1.00 29.59 ? 142 PRO A O     1 
ATOM   1060 C  CB    . PRO A 1 142 ? 20.865  -1.511  27.139  1.00 34.99 ? 142 PRO A CB    1 
ATOM   1061 C  CG    . PRO A 1 142 ? 19.700  -1.577  26.220  1.00 36.09 ? 142 PRO A CG    1 
ATOM   1062 C  CD    . PRO A 1 142 ? 18.892  -2.762  26.658  1.00 30.24 ? 142 PRO A CD    1 
ATOM   1063 N  N     . GLY A 1 143 ? 22.774  -3.073  29.353  1.00 32.96 ? 143 GLY A N     1 
ATOM   1064 C  CA    . GLY A 1 143 ? 23.187  -3.040  30.745  1.00 34.91 ? 143 GLY A CA    1 
ATOM   1065 C  C     . GLY A 1 143 ? 23.516  -4.397  31.338  1.00 36.11 ? 143 GLY A C     1 
ATOM   1066 O  O     . GLY A 1 143 ? 23.998  -4.484  32.469  1.00 39.00 ? 143 GLY A O     1 
ATOM   1067 N  N     . VAL A 1 144 ? 23.258  -5.461  30.584  1.00 31.16 ? 144 VAL A N     1 
ATOM   1068 C  CA    . VAL A 1 144 ? 23.510  -6.810  31.079  1.00 34.06 ? 144 VAL A CA    1 
ATOM   1069 C  C     . VAL A 1 144 ? 24.605  -7.511  30.280  1.00 37.84 ? 144 VAL A C     1 
ATOM   1070 O  O     . VAL A 1 144 ? 24.422  -7.822  29.104  1.00 35.33 ? 144 VAL A O     1 
ATOM   1071 C  CB    . VAL A 1 144 ? 22.237  -7.674  31.036  1.00 33.08 ? 144 VAL A CB    1 
ATOM   1072 C  CG1   . VAL A 1 144 ? 22.496  -9.029  31.689  1.00 30.32 ? 144 VAL A CG1   1 
ATOM   1073 C  CG2   . VAL A 1 144 ? 21.084  -6.962  31.730  1.00 36.78 ? 144 VAL A CG2   1 
ATOM   1074 N  N     . LYS A 1 145 ? 25.746  -7.752  30.919  1.00 39.45 ? 145 LYS A N     1 
ATOM   1075 C  CA    . LYS A 1 145 ? 26.833  -8.478  30.273  1.00 39.67 ? 145 LYS A CA    1 
ATOM   1076 C  C     . LYS A 1 145 ? 26.426  -9.924  30.020  1.00 36.74 ? 145 LYS A C     1 
ATOM   1077 O  O     . LYS A 1 145 ? 25.730  -10.531 30.835  1.00 34.81 ? 145 LYS A O     1 
ATOM   1078 C  CB    . LYS A 1 145 ? 28.096  -8.433  31.135  1.00 35.34 ? 145 LYS A CB    1 
ATOM   1079 C  CG    . LYS A 1 145 ? 28.778  -7.081  31.158  1.00 45.05 ? 145 LYS A CG    1 
ATOM   1080 C  CD    . LYS A 1 145 ? 30.012  -7.108  32.048  1.00 58.14 ? 145 LYS A CD    1 
ATOM   1081 C  CE    . LYS A 1 145 ? 30.903  -5.916  31.765  1.00 63.81 ? 145 LYS A CE    1 
ATOM   1082 N  NZ    . LYS A 1 145 ? 30.099  -4.668  31.677  1.00 68.28 ? 145 LYS A NZ    1 
ATOM   1083 N  N     . LEU A 1 146 ? 26.864  -10.470 28.889  1.00 48.80 ? 146 LEU A N     1 
ATOM   1084 C  CA    . LEU A 1 146 ? 26.520  -11.837 28.512  1.00 40.34 ? 146 LEU A CA    1 
ATOM   1085 C  C     . LEU A 1 146 ? 26.892  -12.832 29.606  1.00 36.23 ? 146 LEU A C     1 
ATOM   1086 O  O     . LEU A 1 146 ? 26.167  -13.798 29.846  1.00 45.47 ? 146 LEU A O     1 
ATOM   1087 C  CB    . LEU A 1 146 ? 27.206  -12.219 27.201  1.00 41.75 ? 146 LEU A CB    1 
ATOM   1088 C  CG    . LEU A 1 146 ? 26.799  -11.440 25.948  1.00 38.96 ? 146 LEU A CG    1 
ATOM   1089 C  CD1   . LEU A 1 146 ? 27.813  -11.675 24.840  1.00 42.57 ? 146 LEU A CD1   1 
ATOM   1090 C  CD2   . LEU A 1 146 ? 25.404  -11.838 25.492  1.00 31.74 ? 146 LEU A CD2   1 
ATOM   1091 N  N     . GLU A 1 147 ? 28.015  -12.579 30.275  1.00 42.43 ? 147 GLU A N     1 
ATOM   1092 C  CA    . GLU A 1 147 ? 28.477  -13.442 31.358  1.00 46.93 ? 147 GLU A CA    1 
ATOM   1093 C  C     . GLU A 1 147 ? 27.472  -13.537 32.506  1.00 44.45 ? 147 GLU A C     1 
ATOM   1094 O  O     . GLU A 1 147 ? 27.383  -14.572 33.168  1.00 42.46 ? 147 GLU A O     1 
ATOM   1095 C  CB    . GLU A 1 147 ? 29.848  -12.985 31.877  1.00 60.60 ? 147 GLU A CB    1 
ATOM   1096 C  CG    . GLU A 1 147 ? 29.923  -11.516 32.269  1.00 70.00 ? 147 GLU A CG    1 
ATOM   1097 C  CD    . GLU A 1 147 ? 31.246  -11.151 32.924  1.00 81.43 ? 147 GLU A CD    1 
ATOM   1098 O  OE1   . GLU A 1 147 ? 31.884  -12.043 33.524  1.00 85.17 ? 147 GLU A OE1   1 
ATOM   1099 O  OE2   . GLU A 1 147 ? 31.649  -9.970  32.839  1.00 84.15 ? 147 GLU A OE2   1 
ATOM   1100 N  N     . LYS A 1 148 ? 26.713  -12.466 32.733  1.00 42.37 ? 148 LYS A N     1 
ATOM   1101 C  CA    . LYS A 1 148 ? 25.709  -12.450 33.799  1.00 41.66 ? 148 LYS A CA    1 
ATOM   1102 C  C     . LYS A 1 148 ? 24.516  -13.346 33.461  1.00 36.19 ? 148 LYS A C     1 
ATOM   1103 O  O     . LYS A 1 148 ? 23.888  -13.929 34.350  1.00 36.76 ? 148 LYS A O     1 
ATOM   1104 C  CB    . LYS A 1 148 ? 25.232  -11.020 34.085  1.00 45.21 ? 148 LYS A CB    1 
ATOM   1105 C  CG    . LYS A 1 148 ? 26.321  -10.071 34.555  1.00 52.08 ? 148 LYS A CG    1 
ATOM   1106 C  CD    . LYS A 1 148 ? 26.945  -10.517 35.872  1.00 58.67 ? 148 LYS A CD    1 
ATOM   1107 C  CE    . LYS A 1 148 ? 25.982  -10.389 37.045  1.00 65.71 ? 148 LYS A CE    1 
ATOM   1108 N  NZ    . LYS A 1 148 ? 25.227  -11.643 37.332  1.00 70.18 ? 148 LYS A NZ    1 
ATOM   1109 N  N     . LEU A 1 149 ? 24.198  -13.442 32.177  1.00 32.63 ? 149 LEU A N     1 
ATOM   1110 C  CA    . LEU A 1 149 ? 23.143  -14.340 31.733  1.00 34.76 ? 149 LEU A CA    1 
ATOM   1111 C  C     . LEU A 1 149 ? 23.591  -15.783 31.922  1.00 30.94 ? 149 LEU A C     1 
ATOM   1112 O  O     . LEU A 1 149 ? 22.816  -16.633 32.356  1.00 33.85 ? 149 LEU A O     1 
ATOM   1113 C  CB    . LEU A 1 149 ? 22.794  -14.084 30.268  1.00 37.88 ? 149 LEU A CB    1 
ATOM   1114 C  CG    . LEU A 1 149 ? 21.724  -14.996 29.670  1.00 37.10 ? 149 LEU A CG    1 
ATOM   1115 C  CD1   . LEU A 1 149 ? 20.403  -14.843 30.417  1.00 30.56 ? 149 LEU A CD1   1 
ATOM   1116 C  CD2   . LEU A 1 149 ? 21.543  -14.694 28.187  1.00 39.94 ? 149 LEU A CD2   1 
ATOM   1117 N  N     . THR A 1 150 ? 24.853  -16.048 31.598  1.00 34.58 ? 150 THR A N     1 
ATOM   1118 C  CA    . THR A 1 150 ? 25.440  -17.363 31.818  1.00 32.12 ? 150 THR A CA    1 
ATOM   1119 C  C     . THR A 1 150 ? 25.405  -17.712 33.306  1.00 30.20 ? 150 THR A C     1 
ATOM   1120 O  O     . THR A 1 150 ? 25.019  -18.818 33.686  1.00 36.54 ? 150 THR A O     1 
ATOM   1121 C  CB    . THR A 1 150 ? 26.889  -17.418 31.294  1.00 35.52 ? 150 THR A CB    1 
ATOM   1122 O  OG1   . THR A 1 150 ? 26.890  -17.265 29.869  1.00 36.82 ? 150 THR A OG1   1 
ATOM   1123 C  CG2   . THR A 1 150 ? 27.544  -18.739 31.651  1.00 39.90 ? 150 THR A CG2   1 
ATOM   1124 N  N     . GLN A 1 151 ? 25.792  -16.753 34.143  1.00 34.35 ? 151 GLN A N     1 
ATOM   1125 C  CA    . GLN A 1 151 ? 25.806  -16.948 35.589  1.00 37.16 ? 151 GLN A CA    1 
ATOM   1126 C  C     . GLN A 1 151 ? 24.422  -17.247 36.145  1.00 33.56 ? 151 GLN A C     1 
ATOM   1127 O  O     . GLN A 1 151 ? 24.280  -18.064 37.054  1.00 36.52 ? 151 GLN A O     1 
ATOM   1128 C  CB    . GLN A 1 151 ? 26.394  -15.723 36.294  1.00 48.26 ? 151 GLN A CB    1 
ATOM   1129 C  CG    . GLN A 1 151 ? 27.902  -15.589 36.136  1.00 63.64 ? 151 GLN A CG    1 
ATOM   1130 C  CD    . GLN A 1 151 ? 28.410  -14.210 36.513  1.00 74.63 ? 151 GLN A CD    1 
ATOM   1131 O  OE1   . GLN A 1 151 ? 27.743  -13.462 37.232  1.00 75.50 ? 151 GLN A OE1   1 
ATOM   1132 N  NE2   . GLN A 1 151 ? 29.595  -13.862 36.020  1.00 77.00 ? 151 GLN A NE2   1 
ATOM   1133 N  N     . LEU A 1 152 ? 23.404  -16.588 35.601  1.00 31.69 ? 152 LEU A N     1 
ATOM   1134 C  CA    . LEU A 1 152 ? 22.047  -16.773 36.109  1.00 36.99 ? 152 LEU A CA    1 
ATOM   1135 C  C     . LEU A 1 152 ? 21.579  -18.194 35.828  1.00 35.20 ? 152 LEU A C     1 
ATOM   1136 O  O     . LEU A 1 152 ? 21.040  -18.872 36.704  1.00 30.65 ? 152 LEU A O     1 
ATOM   1137 C  CB    . LEU A 1 152 ? 21.083  -15.756 35.490  1.00 38.13 ? 152 LEU A CB    1 
ATOM   1138 C  CG    . LEU A 1 152 ? 19.632  -15.801 35.980  1.00 40.82 ? 152 LEU A CG    1 
ATOM   1139 C  CD1   . LEU A 1 152 ? 19.068  -14.396 36.113  1.00 46.25 ? 152 LEU A CD1   1 
ATOM   1140 C  CD2   . LEU A 1 152 ? 18.764  -16.623 35.040  1.00 37.03 ? 152 LEU A CD2   1 
ATOM   1141 N  N     . ILE A 1 153 ? 21.803  -18.641 34.599  1.00 31.91 ? 153 ILE A N     1 
ATOM   1142 C  CA    . ILE A 1 153 ? 21.379  -19.969 34.185  1.00 33.91 ? 153 ILE A CA    1 
ATOM   1143 C  C     . ILE A 1 153 ? 22.149  -21.055 34.929  1.00 31.40 ? 153 ILE A C     1 
ATOM   1144 O  O     . ILE A 1 153 ? 21.563  -22.054 35.355  1.00 34.58 ? 153 ILE A O     1 
ATOM   1145 C  CB    . ILE A 1 153 ? 21.474  -20.126 32.657  1.00 32.26 ? 153 ILE A CB    1 
ATOM   1146 C  CG1   . ILE A 1 153 ? 20.405  -19.256 31.998  1.00 35.81 ? 153 ILE A CG1   1 
ATOM   1147 C  CG2   . ILE A 1 153 ? 21.301  -21.578 32.250  1.00 29.57 ? 153 ILE A CG2   1 
ATOM   1148 C  CD1   . ILE A 1 153 ? 20.695  -18.925 30.562  1.00 44.94 ? 153 ILE A CD1   1 
ATOM   1149 N  N     . SER A 1 154 ? 23.451  -20.848 35.115  1.00 30.21 ? 154 SER A N     1 
ATOM   1150 C  CA    A SER A 1 154 ? 24.273  -21.785 35.871  0.42 32.07 ? 154 SER A CA    1 
ATOM   1151 C  CA    B SER A 1 154 ? 24.257  -21.800 35.865  0.58 32.00 ? 154 SER A CA    1 
ATOM   1152 C  C     . SER A 1 154 ? 23.759  -21.890 37.302  1.00 32.05 ? 154 SER A C     1 
ATOM   1153 O  O     . SER A 1 154 ? 23.671  -22.979 37.867  1.00 39.39 ? 154 SER A O     1 
ATOM   1154 C  CB    A SER A 1 154 ? 25.730  -21.319 35.896  0.42 35.03 ? 154 SER A CB    1 
ATOM   1155 C  CB    B SER A 1 154 ? 25.734  -21.400 35.853  0.58 31.04 ? 154 SER A CB    1 
ATOM   1156 O  OG    A SER A 1 154 ? 26.155  -20.895 34.615  0.42 41.80 ? 154 SER A OG    1 
ATOM   1157 O  OG    B SER A 1 154 ? 26.520  -22.373 36.520  0.58 32.61 ? 154 SER A OG    1 
ATOM   1158 N  N     . ALA A 1 155 ? 23.430  -20.738 37.879  1.00 32.93 ? 155 ALA A N     1 
ATOM   1159 C  CA    . ALA A 1 155 ? 22.934  -20.663 39.252  1.00 37.71 ? 155 ALA A CA    1 
ATOM   1160 C  C     . ALA A 1 155 ? 21.621  -21.421 39.399  1.00 40.60 ? 155 ALA A C     1 
ATOM   1161 O  O     . ALA A 1 155 ? 21.422  -22.163 40.362  1.00 48.38 ? 155 ALA A O     1 
ATOM   1162 C  CB    . ALA A 1 155 ? 22.750  -19.212 39.665  1.00 41.76 ? 155 ALA A CB    1 
ATOM   1163 N  N     . ALA A 1 156 ? 20.726  -21.226 38.435  1.00 29.79 ? 156 ALA A N     1 
ATOM   1164 C  CA    . ALA A 1 156 ? 19.418  -21.869 38.466  1.00 30.47 ? 156 ALA A CA    1 
ATOM   1165 C  C     . ALA A 1 156 ? 19.533  -23.387 38.357  1.00 33.31 ? 156 ALA A C     1 
ATOM   1166 O  O     . ALA A 1 156 ? 18.884  -24.124 39.105  1.00 37.49 ? 156 ALA A O     1 
ATOM   1167 C  CB    . ALA A 1 156 ? 18.519  -21.309 37.363  1.00 31.00 ? 156 ALA A CB    1 
ATOM   1168 N  N     . GLN A 1 157 ? 20.367  -23.854 37.432  1.00 30.35 ? 157 GLN A N     1 
ATOM   1169 C  CA    . GLN A 1 157 ? 20.527  -25.290 37.203  1.00 35.53 ? 157 GLN A CA    1 
ATOM   1170 C  C     . GLN A 1 157 ? 21.147  -26.043 38.385  1.00 37.46 ? 157 GLN A C     1 
ATOM   1171 O  O     . GLN A 1 157 ? 20.775  -27.186 38.657  1.00 41.24 ? 157 GLN A O     1 
ATOM   1172 C  CB    . GLN A 1 157 ? 21.308  -25.553 35.910  1.00 36.78 ? 157 GLN A CB    1 
ATOM   1173 C  CG    . GLN A 1 157 ? 20.533  -25.146 34.660  1.00 33.57 ? 157 GLN A CG    1 
ATOM   1174 C  CD    . GLN A 1 157 ? 21.174  -25.623 33.369  1.00 40.33 ? 157 GLN A CD    1 
ATOM   1175 O  OE1   . GLN A 1 157 ? 20.477  -25.982 32.420  1.00 46.26 ? 157 GLN A OE1   1 
ATOM   1176 N  NE2   . GLN A 1 157 ? 22.500  -25.614 33.322  1.00 43.06 ? 157 GLN A NE2   1 
ATOM   1177 N  N     . LYS A 1 158 ? 22.079  -25.405 39.086  1.00 35.81 ? 158 LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 158 ? 22.744  -26.036 40.231  1.00 43.01 ? 158 LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 158 ? 21.771  -26.525 41.302  1.00 52.97 ? 158 LYS A C     1 
ATOM   1180 O  O     . LYS A 1 158 ? 22.076  -27.450 42.057  1.00 58.45 ? 158 LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 158 ? 23.751  -25.081 40.865  1.00 47.22 ? 158 LYS A CB    1 
ATOM   1182 C  CG    . LYS A 1 158 ? 24.996  -24.860 40.039  1.00 55.99 ? 158 LYS A CG    1 
ATOM   1183 C  CD    . LYS A 1 158 ? 25.932  -23.899 40.733  1.00 64.42 ? 158 LYS A CD    1 
ATOM   1184 C  CE    . LYS A 1 158 ? 27.021  -23.411 39.795  1.00 68.48 ? 158 LYS A CE    1 
ATOM   1185 N  NZ    . LYS A 1 158 ? 27.650  -22.156 40.296  1.00 63.89 ? 158 LYS A NZ    1 
ATOM   1186 N  N     . GLN A 1 159 ? 20.598  -25.906 41.361  1.00 44.52 ? 159 GLN A N     1 
ATOM   1187 C  CA    . GLN A 1 159 ? 19.622  -26.254 42.384  1.00 52.33 ? 159 GLN A CA    1 
ATOM   1188 C  C     . GLN A 1 159 ? 18.349  -26.849 41.802  1.00 44.31 ? 159 GLN A C     1 
ATOM   1189 O  O     . GLN A 1 159 ? 17.266  -26.710 42.375  1.00 48.28 ? 159 GLN A O     1 
ATOM   1190 C  CB    . GLN A 1 159 ? 19.280  -25.032 43.220  1.00 47.78 ? 159 GLN A CB    1 
ATOM   1191 C  CG    . GLN A 1 159 ? 18.785  -23.879 42.400  1.00 41.17 ? 159 GLN A CG    1 
ATOM   1192 C  CD    . GLN A 1 159 ? 18.510  -22.669 43.243  1.00 43.80 ? 159 GLN A CD    1 
ATOM   1193 O  OE1   . GLN A 1 159 ? 19.433  -21.956 43.634  1.00 48.43 ? 159 GLN A OE1   1 
ATOM   1194 N  NE2   . GLN A 1 159 ? 17.237  -22.432 43.549  1.00 44.07 ? 159 GLN A NE2   1 
ATOM   1195 N  N     . GLY A 1 160 ? 18.484  -27.502 40.655  1.00 33.65 ? 160 GLY A N     1 
ATOM   1196 C  CA    . GLY A 1 160 ? 17.412  -28.320 40.125  1.00 37.88 ? 160 GLY A CA    1 
ATOM   1197 C  C     . GLY A 1 160 ? 16.339  -27.597 39.341  1.00 31.25 ? 160 GLY A C     1 
ATOM   1198 O  O     . GLY A 1 160 ? 15.307  -28.190 39.035  1.00 39.00 ? 160 GLY A O     1 
ATOM   1199 N  N     . ILE A 1 161 ? 16.566  -26.330 39.010  1.00 31.86 ? 161 ILE A N     1 
ATOM   1200 C  CA    . ILE A 1 161 ? 15.627  -25.619 38.143  1.00 27.93 ? 161 ILE A CA    1 
ATOM   1201 C  C     . ILE A 1 161 ? 15.869  -26.025 36.693  1.00 34.46 ? 161 ILE A C     1 
ATOM   1202 O  O     . ILE A 1 161 ? 16.997  -25.942 36.199  1.00 34.84 ? 161 ILE A O     1 
ATOM   1203 C  CB    . ILE A 1 161 ? 15.748  -24.094 38.284  1.00 27.26 ? 161 ILE A CB    1 
ATOM   1204 C  CG1   . ILE A 1 161 ? 15.449  -23.675 39.726  1.00 33.28 ? 161 ILE A CG1   1 
ATOM   1205 C  CG2   . ILE A 1 161 ? 14.796  -23.395 37.311  1.00 24.59 ? 161 ILE A CG2   1 
ATOM   1206 C  CD1   . ILE A 1 161 ? 15.781  -22.233 40.027  1.00 34.27 ? 161 ILE A CD1   1 
ATOM   1207 N  N     . ARG A 1 162 ? 14.814  -26.484 36.023  1.00 28.98 ? 162 ARG A N     1 
ATOM   1208 C  CA    . ARG A 1 162 ? 14.931  -26.961 34.651  1.00 29.17 ? 162 ARG A CA    1 
ATOM   1209 C  C     . ARG A 1 162 ? 14.756  -25.788 33.688  1.00 26.21 ? 162 ARG A C     1 
ATOM   1210 O  O     . ARG A 1 162 ? 13.706  -25.151 33.664  1.00 25.45 ? 162 ARG A O     1 
ATOM   1211 C  CB    . ARG A 1 162 ? 13.908  -28.068 34.382  1.00 28.45 ? 162 ARG A CB    1 
ATOM   1212 C  CG    . ARG A 1 162 ? 14.071  -29.288 35.300  1.00 32.94 ? 162 ARG A CG    1 
ATOM   1213 C  CD    . ARG A 1 162 ? 12.876  -30.233 35.201  1.00 42.86 ? 162 ARG A CD    1 
ATOM   1214 N  NE    . ARG A 1 162 ? 12.897  -31.043 33.986  1.00 45.10 ? 162 ARG A NE    1 
ATOM   1215 C  CZ    . ARG A 1 162 ? 11.871  -31.770 33.552  1.00 51.27 ? 162 ARG A CZ    1 
ATOM   1216 N  NH1   . ARG A 1 162 ? 10.729  -31.784 34.228  1.00 51.17 ? 162 ARG A NH1   1 
ATOM   1217 N  NH2   . ARG A 1 162 ? 11.984  -32.479 32.436  1.00 58.19 ? 162 ARG A NH2   1 
ATOM   1218 N  N     . CYS A 1 163 ? 15.791  -25.496 32.904  1.00 25.41 ? 163 CYS A N     1 
ATOM   1219 C  CA    . CYS A 1 163 ? 15.788  -24.289 32.079  1.00 24.79 ? 163 CYS A CA    1 
ATOM   1220 C  C     . CYS A 1 163 ? 15.479  -24.527 30.604  1.00 25.92 ? 163 CYS A C     1 
ATOM   1221 O  O     . CYS A 1 163 ? 16.036  -25.427 29.968  1.00 28.76 ? 163 CYS A O     1 
ATOM   1222 C  CB    . CYS A 1 163 ? 17.120  -23.549 32.224  1.00 26.75 ? 163 CYS A CB    1 
ATOM   1223 S  SG    . CYS A 1 163 ? 17.415  -22.932 33.899  1.00 30.39 ? 163 CYS A SG    1 
ATOM   1224 N  N     . ILE A 1 164 ? 14.577  -23.703 30.075  1.00 21.45 ? 164 ILE A N     1 
ATOM   1225 C  CA    . ILE A 1 164 ? 14.238  -23.704 28.662  1.00 18.26 ? 164 ILE A CA    1 
ATOM   1226 C  C     . ILE A 1 164 ? 14.635  -22.341 28.116  1.00 28.32 ? 164 ILE A C     1 
ATOM   1227 O  O     . ILE A 1 164 ? 14.373  -21.314 28.746  1.00 22.62 ? 164 ILE A O     1 
ATOM   1228 C  CB    . ILE A 1 164 ? 12.727  -23.942 28.471  1.00 19.65 ? 164 ILE A CB    1 
ATOM   1229 C  CG1   . ILE A 1 164 ? 12.360  -25.350 28.958  1.00 23.27 ? 164 ILE A CG1   1 
ATOM   1230 C  CG2   . ILE A 1 164 ? 12.315  -23.738 27.016  1.00 21.27 ? 164 ILE A CG2   1 
ATOM   1231 C  CD1   . ILE A 1 164 ? 10.862  -25.635 28.941  1.00 25.50 ? 164 ILE A CD1   1 
ATOM   1232 N  N     . VAL A 1 165 ? 15.294  -22.326 26.962  1.00 21.61 ? 165 VAL A N     1 
ATOM   1233 C  CA    . VAL A 1 165 ? 15.823  -21.075 26.423  1.00 18.20 ? 165 VAL A CA    1 
ATOM   1234 C  C     . VAL A 1 165 ? 15.300  -20.785 25.021  1.00 20.26 ? 165 VAL A C     1 
ATOM   1235 O  O     . VAL A 1 165 ? 15.315  -21.654 24.152  1.00 21.96 ? 165 VAL A O     1 
ATOM   1236 C  CB    . VAL A 1 165 ? 17.369  -21.093 26.389  1.00 23.26 ? 165 VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1 165 ? 17.913  -19.804 25.773  1.00 30.06 ? 165 VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1 165 ? 17.942  -21.306 27.792  1.00 24.78 ? 165 VAL A CG2   1 
ATOM   1239 N  N     . ASP A 1 166 ? 14.820  -19.559 24.809  1.00 19.03 ? 166 ASP A N     1 
ATOM   1240 C  CA    . ASP A 1 166 ? 14.455  -19.092 23.476  1.00 19.45 ? 166 ASP A CA    1 
ATOM   1241 C  C     . ASP A 1 166 ? 14.987  -17.673 23.322  1.00 20.91 ? 166 ASP A C     1 
ATOM   1242 O  O     . ASP A 1 166 ? 14.449  -16.735 23.904  1.00 23.23 ? 166 ASP A O     1 
ATOM   1243 C  CB    . ASP A 1 166 ? 12.937  -19.130 23.289  1.00 18.11 ? 166 ASP A CB    1 
ATOM   1244 C  CG    . ASP A 1 166 ? 12.504  -18.710 21.892  1.00 22.53 ? 166 ASP A CG    1 
ATOM   1245 O  OD1   . ASP A 1 166 ? 11.282  -18.725 21.635  1.00 22.06 ? 166 ASP A OD1   1 
ATOM   1246 O  OD2   . ASP A 1 166 ? 13.372  -18.364 21.056  1.00 27.05 ? 166 ASP A OD2   1 
ATOM   1247 N  N     . SER A 1 167 ? 16.064  -17.517 22.563  1.00 18.88 ? 167 SER A N     1 
ATOM   1248 C  CA    . SER A 1 167 ? 16.661  -16.202 22.399  1.00 21.16 ? 167 SER A CA    1 
ATOM   1249 C  C     . SER A 1 167 ? 17.393  -16.144 21.071  1.00 25.50 ? 167 SER A C     1 
ATOM   1250 O  O     . SER A 1 167 ? 17.160  -16.969 20.189  1.00 23.09 ? 167 SER A O     1 
ATOM   1251 C  CB    . SER A 1 167 ? 17.614  -15.899 23.558  1.00 29.99 ? 167 SER A CB    1 
ATOM   1252 O  OG    . SER A 1 167 ? 17.986  -14.531 23.573  1.00 24.28 ? 167 SER A OG    1 
ATOM   1253 N  N     . SER A 1 168 ? 18.269  -15.163 20.912  1.00 19.84 ? 168 SER A N     1 
ATOM   1254 C  CA    . SER A 1 168 ? 19.013  -15.046 19.665  1.00 19.25 ? 168 SER A CA    1 
ATOM   1255 C  C     . SER A 1 168 ? 20.362  -14.379 19.882  1.00 28.60 ? 168 SER A C     1 
ATOM   1256 O  O     . SER A 1 168 ? 20.665  -13.904 20.981  1.00 25.92 ? 168 SER A O     1 
ATOM   1257 C  CB    . SER A 1 168 ? 18.215  -14.252 18.626  1.00 30.63 ? 168 SER A CB    1 
ATOM   1258 O  OG    . SER A 1 168 ? 18.025  -12.907 19.041  1.00 35.53 ? 168 SER A OG    1 
ATOM   1259 N  N     . GLY A 1 169 ? 21.163  -14.348 18.821  1.00 34.51 ? 169 GLY A N     1 
ATOM   1260 C  CA    . GLY A 1 169 ? 22.463  -13.699 18.845  1.00 37.76 ? 169 GLY A CA    1 
ATOM   1261 C  C     . GLY A 1 169 ? 23.384  -14.207 19.935  1.00 36.14 ? 169 GLY A C     1 
ATOM   1262 O  O     . GLY A 1 169 ? 23.358  -15.392 20.284  1.00 33.47 ? 169 GLY A O     1 
ATOM   1263 N  N     . GLU A 1 170 ? 24.189  -13.299 20.477  1.00 33.20 ? 170 GLU A N     1 
ATOM   1264 C  CA    . GLU A 1 170 ? 25.178  -13.642 21.495  1.00 35.54 ? 170 GLU A CA    1 
ATOM   1265 C  C     . GLU A 1 170 ? 24.525  -14.133 22.790  1.00 31.81 ? 170 GLU A C     1 
ATOM   1266 O  O     . GLU A 1 170 ? 25.115  -14.920 23.533  1.00 39.29 ? 170 GLU A O     1 
ATOM   1267 C  CB    . GLU A 1 170 ? 26.077  -12.436 21.788  1.00 41.54 ? 170 GLU A CB    1 
ATOM   1268 C  CG    . GLU A 1 170 ? 26.773  -11.855 20.569  1.00 55.33 ? 170 GLU A CG    1 
ATOM   1269 C  CD    . GLU A 1 170 ? 27.687  -10.695 20.921  1.00 71.78 ? 170 GLU A CD    1 
ATOM   1270 O  OE1   . GLU A 1 170 ? 28.914  -10.827 20.728  1.00 79.86 ? 170 GLU A OE1   1 
ATOM   1271 O  OE2   . GLU A 1 170 ? 27.181  -9.654  21.393  1.00 75.68 ? 170 GLU A OE2   1 
ATOM   1272 N  N     . ALA A 1 171 ? 23.307  -13.666 23.052  1.00 34.85 ? 171 ALA A N     1 
ATOM   1273 C  CA    . ALA A 1 171 ? 22.559  -14.092 24.230  1.00 35.32 ? 171 ALA A CA    1 
ATOM   1274 C  C     . ALA A 1 171 ? 22.245  -15.592 24.192  1.00 30.63 ? 171 ALA A C     1 
ATOM   1275 O  O     . ALA A 1 171 ? 22.343  -16.278 25.209  1.00 35.63 ? 171 ALA A O     1 
ATOM   1276 C  CB    . ALA A 1 171 ? 21.274  -13.277 24.375  1.00 32.88 ? 171 ALA A CB    1 
ATOM   1277 N  N     . LEU A 1 172 ? 21.877  -16.099 23.021  1.00 31.06 ? 172 LEU A N     1 
ATOM   1278 C  CA    . LEU A 1 172 ? 21.566  -17.523 22.881  1.00 28.72 ? 172 LEU A CA    1 
ATOM   1279 C  C     . LEU A 1 172 ? 22.818  -18.375 23.103  1.00 31.99 ? 172 LEU A C     1 
ATOM   1280 O  O     . LEU A 1 172 ? 22.784  -19.386 23.808  1.00 35.85 ? 172 LEU A O     1 
ATOM   1281 C  CB    . LEU A 1 172 ? 20.953  -17.811 21.505  1.00 31.87 ? 172 LEU A CB    1 
ATOM   1282 C  CG    . LEU A 1 172 ? 20.579  -19.269 21.207  1.00 37.45 ? 172 LEU A CG    1 
ATOM   1283 C  CD1   . LEU A 1 172 ? 19.543  -19.790 22.202  1.00 32.82 ? 172 LEU A CD1   1 
ATOM   1284 C  CD2   . LEU A 1 172 ? 20.059  -19.406 19.780  1.00 32.14 ? 172 LEU A CD2   1 
ATOM   1285 N  N     . SER A 1 173 ? 23.927  -17.963 22.500  1.00 28.66 ? 173 SER A N     1 
ATOM   1286 C  CA    . SER A 1 173 ? 25.187  -18.671 22.693  1.00 33.63 ? 173 SER A CA    1 
ATOM   1287 C  C     . SER A 1 173 ? 25.605  -18.643 24.163  1.00 27.66 ? 173 SER A C     1 
ATOM   1288 O  O     . SER A 1 173 ? 26.103  -19.633 24.695  1.00 35.05 ? 173 SER A O     1 
ATOM   1289 C  CB    . SER A 1 173 ? 26.289  -18.064 21.822  1.00 36.77 ? 173 SER A CB    1 
ATOM   1290 O  OG    . SER A 1 173 ? 25.938  -18.112 20.450  1.00 43.77 ? 173 SER A OG    1 
ATOM   1291 N  N     . ALA A 1 174 ? 25.394  -17.503 24.811  1.00 36.32 ? 174 ALA A N     1 
ATOM   1292 C  CA    . ALA A 1 174 ? 25.789  -17.335 26.207  1.00 41.99 ? 174 ALA A CA    1 
ATOM   1293 C  C     . ALA A 1 174 ? 24.914  -18.188 27.116  1.00 41.39 ? 174 ALA A C     1 
ATOM   1294 O  O     . ALA A 1 174 ? 25.369  -18.700 28.135  1.00 43.47 ? 174 ALA A O     1 
ATOM   1295 C  CB    . ALA A 1 174 ? 25.704  -15.870 26.612  1.00 37.84 ? 174 ALA A CB    1 
ATOM   1296 N  N     . ALA A 1 175 ? 23.652  -18.336 26.731  1.00 39.08 ? 175 ALA A N     1 
ATOM   1297 C  CA    . ALA A 1 175 ? 22.694  -19.100 27.520  1.00 41.94 ? 175 ALA A CA    1 
ATOM   1298 C  C     . ALA A 1 175 ? 22.994  -20.591 27.442  1.00 36.23 ? 175 ALA A C     1 
ATOM   1299 O  O     . ALA A 1 175 ? 22.638  -21.352 28.339  1.00 49.55 ? 175 ALA A O     1 
ATOM   1300 C  CB    . ALA A 1 175 ? 21.271  -18.813 27.046  1.00 39.65 ? 175 ALA A CB    1 
ATOM   1301 N  N     . LEU A 1 176 ? 23.646  -20.999 26.358  1.00 37.57 ? 176 LEU A N     1 
ATOM   1302 C  CA    . LEU A 1 176 ? 23.971  -22.403 26.119  1.00 38.10 ? 176 LEU A CA    1 
ATOM   1303 C  C     . LEU A 1 176 ? 25.423  -22.720 26.460  1.00 45.44 ? 176 LEU A C     1 
ATOM   1304 O  O     . LEU A 1 176 ? 25.884  -23.847 26.262  1.00 44.37 ? 176 LEU A O     1 
ATOM   1305 C  CB    . LEU A 1 176 ? 23.715  -22.761 24.655  1.00 44.82 ? 176 LEU A CB    1 
ATOM   1306 C  CG    . LEU A 1 176 ? 22.305  -23.173 24.236  1.00 47.32 ? 176 LEU A CG    1 
ATOM   1307 C  CD1   . LEU A 1 176 ? 22.020  -22.675 22.836  1.00 46.36 ? 176 LEU A CD1   1 
ATOM   1308 C  CD2   . LEU A 1 176 ? 22.161  -24.688 24.294  1.00 47.09 ? 176 LEU A CD2   1 
ATOM   1309 N  N     . ALA A 1 177 ? 26.147  -21.724 26.957  1.00 46.68 ? 177 ALA A N     1 
ATOM   1310 C  CA    . ALA A 1 177 ? 27.565  -21.899 27.254  1.00 50.84 ? 177 ALA A CA    1 
ATOM   1311 C  C     . ALA A 1 177 ? 27.786  -22.897 28.391  1.00 46.80 ? 177 ALA A C     1 
ATOM   1312 O  O     . ALA A 1 177 ? 28.789  -23.614 28.419  1.00 47.88 ? 177 ALA A O     1 
ATOM   1313 C  CB    . ALA A 1 177 ? 28.212  -20.559 27.578  1.00 54.07 ? 177 ALA A CB    1 
ATOM   1314 N  N     . ILE A 1 178 ? 26.835  -22.944 29.318  1.00 33.05 ? 178 ILE A N     1 
ATOM   1315 C  CA    . ILE A 1 178 ? 26.955  -23.781 30.507  1.00 39.11 ? 178 ILE A CA    1 
ATOM   1316 C  C     . ILE A 1 178 ? 26.600  -25.230 30.212  1.00 38.68 ? 178 ILE A C     1 
ATOM   1317 O  O     . ILE A 1 178 ? 27.123  -26.142 30.849  1.00 36.80 ? 178 ILE A O     1 
ATOM   1318 C  CB    . ILE A 1 178 ? 26.028  -23.301 31.641  1.00 48.93 ? 178 ILE A CB    1 
ATOM   1319 C  CG1   . ILE A 1 178 ? 25.831  -21.788 31.580  1.00 53.44 ? 178 ILE A CG1   1 
ATOM   1320 C  CG2   . ILE A 1 178 ? 26.569  -23.739 32.996  1.00 51.27 ? 178 ILE A CG2   1 
ATOM   1321 C  CD1   . ILE A 1 178 ? 24.565  -21.348 30.875  1.00 52.27 ? 178 ILE A CD1   1 
ATOM   1322 N  N     . GLY A 1 179 ? 25.692  -25.432 29.262  1.00 37.43 ? 179 GLY A N     1 
ATOM   1323 C  CA    . GLY A 1 179 ? 25.260  -26.767 28.892  1.00 35.36 ? 179 GLY A CA    1 
ATOM   1324 C  C     . GLY A 1 179 ? 24.154  -27.316 29.772  1.00 36.51 ? 179 GLY A C     1 
ATOM   1325 O  O     . GLY A 1 179 ? 23.754  -26.684 30.758  1.00 35.95 ? 179 GLY A O     1 
ATOM   1326 N  N     . ASN A 1 180 ? 23.667  -28.500 29.404  1.00 33.64 ? 180 ASN A N     1 
ATOM   1327 C  CA    . ASN A 1 180 ? 22.604  -29.192 30.131  1.00 32.53 ? 180 ASN A CA    1 
ATOM   1328 C  C     . ASN A 1 180 ? 21.282  -28.436 30.147  1.00 33.18 ? 180 ASN A C     1 
ATOM   1329 O  O     . ASN A 1 180 ? 20.461  -28.626 31.045  1.00 35.46 ? 180 ASN A O     1 
ATOM   1330 C  CB    . ASN A 1 180 ? 23.046  -29.540 31.557  1.00 34.51 ? 180 ASN A CB    1 
ATOM   1331 C  CG    . ASN A 1 180 ? 24.229  -30.484 31.581  1.00 48.05 ? 180 ASN A CG    1 
ATOM   1332 O  OD1   . ASN A 1 180 ? 24.259  -31.477 30.852  1.00 47.61 ? 180 ASN A OD1   1 
ATOM   1333 N  ND2   . ASN A 1 180 ? 25.218  -30.176 32.415  1.00 56.83 ? 180 ASN A ND2   1 
ATOM   1334 N  N     . ILE A 1 181 ? 21.080  -27.582 29.147  1.00 32.57 ? 181 ILE A N     1 
ATOM   1335 C  CA    . ILE A 1 181 ? 19.809  -26.893 28.979  1.00 26.51 ? 181 ILE A CA    1 
ATOM   1336 C  C     . ILE A 1 181 ? 18.749  -27.938 28.643  1.00 27.20 ? 181 ILE A C     1 
ATOM   1337 O  O     . ILE A 1 181 ? 18.984  -28.809 27.811  1.00 29.69 ? 181 ILE A O     1 
ATOM   1338 C  CB    . ILE A 1 181 ? 19.883  -25.868 27.829  1.00 33.56 ? 181 ILE A CB    1 
ATOM   1339 C  CG1   . ILE A 1 181 ? 20.995  -24.844 28.078  1.00 40.75 ? 181 ILE A CG1   1 
ATOM   1340 C  CG2   . ILE A 1 181 ? 18.534  -25.187 27.604  1.00 30.58 ? 181 ILE A CG2   1 
ATOM   1341 C  CD1   . ILE A 1 181 ? 20.859  -24.066 29.369  1.00 43.69 ? 181 ILE A CD1   1 
ATOM   1342 N  N     . GLU A 1 182 ? 17.585  -27.858 29.283  1.00 24.95 ? 182 GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 182 ? 16.534  -28.850 29.057  1.00 26.50 ? 182 GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 182 ? 15.996  -28.808 27.629  1.00 23.44 ? 182 GLU A C     1 
ATOM   1345 O  O     . GLU A 1 182 ? 15.749  -29.846 27.012  1.00 25.76 ? 182 GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 182 ? 15.382  -28.648 30.045  1.00 28.43 ? 182 GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 182 ? 15.732  -28.983 31.487  1.00 40.69 ? 182 GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 182 ? 15.698  -30.473 31.775  1.00 49.51 ? 182 GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 182 ? 16.522  -30.940 32.590  1.00 52.78 ? 182 GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 182 ? 14.837  -31.172 31.198  1.00 50.28 ? 182 GLU A OE2   1 
ATOM   1351 N  N     . LEU A 1 183 ? 15.816  -27.599 27.113  1.00 22.74 ? 183 LEU A N     1 
ATOM   1352 C  CA    . LEU A 1 183 ? 15.225  -27.409 25.800  1.00 26.21 ? 183 LEU A CA    1 
ATOM   1353 C  C     . LEU A 1 183 ? 15.601  -26.049 25.254  1.00 22.01 ? 183 LEU A C     1 
ATOM   1354 O  O     . LEU A 1 183 ? 15.522  -25.047 25.961  1.00 22.64 ? 183 LEU A O     1 
ATOM   1355 C  CB    . LEU A 1 183 ? 13.699  -27.496 25.891  1.00 19.07 ? 183 LEU A CB    1 
ATOM   1356 C  CG    . LEU A 1 183 ? 12.882  -27.114 24.655  1.00 25.40 ? 183 LEU A CG    1 
ATOM   1357 C  CD1   . LEU A 1 183 ? 13.111  -28.097 23.526  1.00 26.71 ? 183 LEU A CD1   1 
ATOM   1358 C  CD2   . LEU A 1 183 ? 11.393  -27.029 25.003  1.00 30.29 ? 183 LEU A CD2   1 
ATOM   1359 N  N     . VAL A 1 184 ? 16.001  -26.011 23.989  1.00 22.05 ? 184 VAL A N     1 
ATOM   1360 C  CA    . VAL A 1 184 ? 16.211  -24.739 23.306  1.00 17.50 ? 184 VAL A CA    1 
ATOM   1361 C  C     . VAL A 1 184 ? 15.397  -24.745 22.006  1.00 19.18 ? 184 VAL A C     1 
ATOM   1362 O  O     . VAL A 1 184 ? 15.311  -25.777 21.336  1.00 20.66 ? 184 VAL A O     1 
ATOM   1363 C  CB    . VAL A 1 184 ? 17.724  -24.483 23.040  1.00 23.94 ? 184 VAL A CB    1 
ATOM   1364 C  CG1   . VAL A 1 184 ? 18.312  -25.556 22.130  1.00 24.62 ? 184 VAL A CG1   1 
ATOM   1365 C  CG2   . VAL A 1 184 ? 17.949  -23.082 22.465  1.00 24.77 ? 184 VAL A CG2   1 
ATOM   1366 N  N     . LYS A 1 185 ? 14.773  -23.615 21.672  1.00 18.35 ? 185 LYS A N     1 
ATOM   1367 C  CA    . LYS A 1 185 ? 14.009  -23.508 20.425  1.00 16.75 ? 185 LYS A CA    1 
ATOM   1368 C  C     . LYS A 1 185 ? 14.540  -22.411 19.505  1.00 17.52 ? 185 LYS A C     1 
ATOM   1369 O  O     . LYS A 1 185 ? 13.976  -21.314 19.431  1.00 19.67 ? 185 LYS A O     1 
ATOM   1370 C  CB    . LYS A 1 185 ? 12.491  -23.300 20.647  1.00 19.63 ? 185 LYS A CB    1 
ATOM   1371 C  CG    . LYS A 1 185 ? 11.697  -23.425 19.313  1.00 16.45 ? 185 LYS A CG    1 
ATOM   1372 C  CD    . LYS A 1 185 ? 10.423  -22.586 19.237  1.00 16.59 ? 185 LYS A CD    1 
ATOM   1373 C  CE    . LYS A 1 185 ? 10.707  -21.080 19.132  1.00 17.14 ? 185 LYS A CE    1 
ATOM   1374 N  NZ    . LYS A 1 185 ? 11.583  -20.721 17.975  1.00 16.92 ? 185 LYS A NZ    1 
ATOM   1375 N  N     . PRO A 1 186 ? 15.636  -22.699 18.797  1.00 16.75 ? 186 PRO A N     1 
ATOM   1376 C  CA    . PRO A 1 186 ? 16.019  -21.720 17.785  1.00 15.90 ? 186 PRO A CA    1 
ATOM   1377 C  C     . PRO A 1 186 ? 15.124  -21.856 16.560  1.00 19.61 ? 186 PRO A C     1 
ATOM   1378 O  O     . PRO A 1 186 ? 14.706  -22.967 16.217  1.00 15.70 ? 186 PRO A O     1 
ATOM   1379 C  CB    . PRO A 1 186 ? 17.441  -22.143 17.414  1.00 17.11 ? 186 PRO A CB    1 
ATOM   1380 C  CG    . PRO A 1 186 ? 17.457  -23.640 17.647  1.00 18.38 ? 186 PRO A CG    1 
ATOM   1381 C  CD    . PRO A 1 186 ? 16.528  -23.874 18.826  1.00 19.29 ? 186 PRO A CD    1 
ATOM   1382 N  N     . ASN A 1 187 ? 14.829  -20.746 15.895  1.00 16.45 ? 187 ASN A N     1 
ATOM   1383 C  CA    . ASN A 1 187 ? 14.343  -20.864 14.518  1.00 15.53 ? 187 ASN A CA    1 
ATOM   1384 C  C     . ASN A 1 187 ? 15.535  -21.095 13.597  1.00 17.51 ? 187 ASN A C     1 
ATOM   1385 O  O     . ASN A 1 187 ? 16.657  -21.293 14.074  1.00 17.80 ? 187 ASN A O     1 
ATOM   1386 C  CB    . ASN A 1 187 ? 13.484  -19.671 14.065  1.00 17.01 ? 187 ASN A CB    1 
ATOM   1387 C  CG    . ASN A 1 187 ? 14.250  -18.360 14.015  1.00 16.37 ? 187 ASN A CG    1 
ATOM   1388 O  OD1   . ASN A 1 187 ? 15.484  -18.324 14.010  1.00 17.70 ? 187 ASN A OD1   1 
ATOM   1389 N  ND2   . ASN A 1 187 ? 13.502  -17.259 13.966  1.00 15.93 ? 187 ASN A ND2   1 
ATOM   1390 N  N     . GLN A 1 188 ? 15.308  -21.088 12.289  1.00 19.03 ? 188 GLN A N     1 
ATOM   1391 C  CA    . GLN A 1 188 ? 16.394  -21.408 11.361  1.00 17.91 ? 188 GLN A CA    1 
ATOM   1392 C  C     . GLN A 1 188 ? 17.514  -20.388 11.384  1.00 22.49 ? 188 GLN A C     1 
ATOM   1393 O  O     . GLN A 1 188 ? 18.698  -20.749 11.381  1.00 21.49 ? 188 GLN A O     1 
ATOM   1394 C  CB    . GLN A 1 188 ? 15.863  -21.576 9.944   1.00 22.18 ? 188 GLN A CB    1 
ATOM   1395 C  CG    . GLN A 1 188 ? 15.021  -22.809 9.797   1.00 22.00 ? 188 GLN A CG    1 
ATOM   1396 C  CD    . GLN A 1 188 ? 14.202  -22.781 8.539   1.00 30.20 ? 188 GLN A CD    1 
ATOM   1397 O  OE1   . GLN A 1 188 ? 13.085  -22.262 8.532   1.00 26.08 ? 188 GLN A OE1   1 
ATOM   1398 N  NE2   . GLN A 1 188 ? 14.756  -23.321 7.456   1.00 25.67 ? 188 GLN A NE2   1 
ATOM   1399 N  N     . LYS A 1 189 ? 17.147  -19.115 11.416  1.00 19.43 ? 189 LYS A N     1 
ATOM   1400 C  CA    . LYS A 1 189 ? 18.148  -18.059 11.441  1.00 24.29 ? 189 LYS A CA    1 
ATOM   1401 C  C     . LYS A 1 189 ? 18.940  -18.106 12.744  1.00 23.43 ? 189 LYS A C     1 
ATOM   1402 O  O     . LYS A 1 189 ? 20.162  -17.961 12.742  1.00 21.38 ? 189 LYS A O     1 
ATOM   1403 C  CB    . LYS A 1 189 ? 17.500  -16.686 11.248  1.00 25.96 ? 189 LYS A CB    1 
ATOM   1404 C  CG    . LYS A 1 189 ? 17.176  -16.370 9.797   1.00 44.17 ? 189 LYS A CG    1 
ATOM   1405 C  CD    . LYS A 1 189 ? 16.844  -14.900 9.598   1.00 56.80 ? 189 LYS A CD    1 
ATOM   1406 C  CE    . LYS A 1 189 ? 16.285  -14.659 8.204   1.00 63.44 ? 189 LYS A CE    1 
ATOM   1407 N  NZ    . LYS A 1 189 ? 15.964  -13.225 7.973   1.00 66.51 ? 189 LYS A NZ    1 
ATOM   1408 N  N     . GLU A 1 190 ? 18.235  -18.321 13.847  1.00 18.08 ? 190 GLU A N     1 
ATOM   1409 C  CA    . GLU A 1 190 ? 18.872  -18.419 15.160  1.00 23.82 ? 190 GLU A CA    1 
ATOM   1410 C  C     . GLU A 1 190 ? 19.807  -19.633 15.261  1.00 25.21 ? 190 GLU A C     1 
ATOM   1411 O  O     . GLU A 1 190 ? 20.866  -19.548 15.888  1.00 20.85 ? 190 GLU A O     1 
ATOM   1412 C  CB    . GLU A 1 190 ? 17.810  -18.413 16.271  1.00 22.23 ? 190 GLU A CB    1 
ATOM   1413 C  CG    . GLU A 1 190 ? 17.137  -17.038 16.458  1.00 23.06 ? 190 GLU A CG    1 
ATOM   1414 C  CD    . GLU A 1 190 ? 15.729  -17.119 17.030  1.00 21.34 ? 190 GLU A CD    1 
ATOM   1415 O  OE1   . GLU A 1 190 ? 15.267  -18.237 17.345  1.00 17.93 ? 190 GLU A OE1   1 
ATOM   1416 O  OE2   . GLU A 1 190 ? 15.077  -16.054 17.160  1.00 20.86 ? 190 GLU A OE2   1 
ATOM   1417 N  N     . LEU A 1 191 ? 19.426  -20.754 14.644  1.00 19.71 ? 191 LEU A N     1 
ATOM   1418 C  CA    . LEU A 1 191 ? 20.290  -21.938 14.632  1.00 24.98 ? 191 LEU A CA    1 
ATOM   1419 C  C     . LEU A 1 191 ? 21.560  -21.665 13.831  1.00 22.54 ? 191 LEU A C     1 
ATOM   1420 O  O     . LEU A 1 191 ? 22.673  -21.994 14.262  1.00 21.53 ? 191 LEU A O     1 
ATOM   1421 C  CB    . LEU A 1 191 ? 19.558  -23.151 14.048  1.00 20.88 ? 191 LEU A CB    1 
ATOM   1422 C  CG    . LEU A 1 191 ? 20.397  -24.428 13.917  1.00 20.32 ? 191 LEU A CG    1 
ATOM   1423 C  CD1   . LEU A 1 191 ? 20.851  -24.957 15.284  1.00 22.14 ? 191 LEU A CD1   1 
ATOM   1424 C  CD2   . LEU A 1 191 ? 19.625  -25.488 13.147  1.00 20.40 ? 191 LEU A CD2   1 
ATOM   1425 N  N     . SER A 1 192 ? 21.392  -21.049 12.665  1.00 21.50 ? 192 SER A N     1 
ATOM   1426 C  CA    . SER A 1 192 ? 22.531  -20.704 11.819  1.00 21.67 ? 192 SER A CA    1 
ATOM   1427 C  C     . SER A 1 192 ? 23.527  -19.819 12.560  1.00 29.95 ? 192 SER A C     1 
ATOM   1428 O  O     . SER A 1 192 ? 24.738  -20.036 12.482  1.00 24.03 ? 192 SER A O     1 
ATOM   1429 C  CB    . SER A 1 192 ? 22.063  -20.000 10.547  1.00 25.60 ? 192 SER A CB    1 
ATOM   1430 O  OG    . SER A 1 192 ? 23.177  -19.570 9.785   1.00 34.66 ? 192 SER A OG    1 
ATOM   1431 N  N     . ALA A 1 193 ? 23.025  -18.826 13.287  1.00 25.88 ? 193 ALA A N     1 
ATOM   1432 C  CA    . ALA A 1 193 ? 23.919  -17.912 14.001  1.00 29.17 ? 193 ALA A CA    1 
ATOM   1433 C  C     . ALA A 1 193 ? 24.613  -18.627 15.153  1.00 32.77 ? 193 ALA A C     1 
ATOM   1434 O  O     . ALA A 1 193 ? 25.794  -18.391 15.429  1.00 34.14 ? 193 ALA A O     1 
ATOM   1435 C  CB    . ALA A 1 193 ? 23.159  -16.699 14.505  1.00 30.42 ? 193 ALA A CB    1 
ATOM   1436 N  N     . LEU A 1 194 ? 23.871  -19.510 15.811  1.00 26.49 ? 194 LEU A N     1 
ATOM   1437 C  CA    . LEU A 1 194 ? 24.387  -20.281 16.935  1.00 27.55 ? 194 LEU A CA    1 
ATOM   1438 C  C     . LEU A 1 194 ? 25.562  -21.185 16.552  1.00 30.93 ? 194 LEU A C     1 
ATOM   1439 O  O     . LEU A 1 194 ? 26.605  -21.161 17.212  1.00 29.79 ? 194 LEU A O     1 
ATOM   1440 C  CB    . LEU A 1 194 ? 23.265  -21.103 17.567  1.00 23.17 ? 194 LEU A CB    1 
ATOM   1441 C  CG    . LEU A 1 194 ? 23.669  -21.983 18.747  1.00 33.19 ? 194 LEU A CG    1 
ATOM   1442 C  CD1   . LEU A 1 194 ? 24.336  -21.150 19.836  1.00 37.98 ? 194 LEU A CD1   1 
ATOM   1443 C  CD2   . LEU A 1 194 ? 22.453  -22.699 19.295  1.00 37.87 ? 194 LEU A CD2   1 
ATOM   1444 N  N     . VAL A 1 195 ? 25.403  -21.979 15.495  1.00 30.36 ? 195 VAL A N     1 
ATOM   1445 C  CA    . VAL A 1 195 ? 26.502  -22.849 15.042  1.00 33.43 ? 195 VAL A CA    1 
ATOM   1446 C  C     . VAL A 1 195 ? 27.501  -22.124 14.141  1.00 36.41 ? 195 VAL A C     1 
ATOM   1447 O  O     . VAL A 1 195 ? 28.514  -22.698 13.729  1.00 33.45 ? 195 VAL A O     1 
ATOM   1448 C  CB    . VAL A 1 195 ? 25.998  -24.114 14.310  1.00 31.65 ? 195 VAL A CB    1 
ATOM   1449 C  CG1   . VAL A 1 195 ? 25.172  -24.982 15.247  1.00 35.22 ? 195 VAL A CG1   1 
ATOM   1450 C  CG2   . VAL A 1 195 ? 25.205  -23.733 13.066  1.00 30.12 ? 195 VAL A CG2   1 
ATOM   1451 N  N     . ASN A 1 196 ? 27.207  -20.862 13.844  1.00 29.65 ? 196 ASN A N     1 
ATOM   1452 C  CA    . ASN A 1 196 ? 28.065  -20.013 13.020  1.00 36.18 ? 196 ASN A CA    1 
ATOM   1453 C  C     . ASN A 1 196 ? 28.389  -20.567 11.630  1.00 39.80 ? 196 ASN A C     1 
ATOM   1454 O  O     . ASN A 1 196 ? 29.553  -20.602 11.215  1.00 41.24 ? 196 ASN A O     1 
ATOM   1455 C  CB    . ASN A 1 196 ? 29.358  -19.643 13.762  1.00 39.91 ? 196 ASN A CB    1 
ATOM   1456 C  CG    . ASN A 1 196 ? 30.075  -18.468 13.124  1.00 47.87 ? 196 ASN A CG    1 
ATOM   1457 O  OD1   . ASN A 1 196 ? 29.475  -17.686 12.386  1.00 47.15 ? 196 ASN A OD1   1 
ATOM   1458 N  ND2   . ASN A 1 196 ? 31.369  -18.343 13.398  1.00 45.89 ? 196 ASN A ND2   1 
ATOM   1459 N  N     . ARG A 1 197 ? 27.357  -20.999 10.912  1.00 34.72 ? 197 ARG A N     1 
ATOM   1460 C  CA    . ARG A 1 197 ? 27.518  -21.355 9.507   1.00 40.48 ? 197 ARG A CA    1 
ATOM   1461 C  C     . ARG A 1 197 ? 26.198  -21.252 8.757   1.00 37.10 ? 197 ARG A C     1 
ATOM   1462 O  O     . ARG A 1 197 ? 25.117  -21.368 9.352   1.00 32.77 ? 197 ARG A O     1 
ATOM   1463 C  CB    . ARG A 1 197 ? 28.148  -22.750 9.340   1.00 45.18 ? 197 ARG A CB    1 
ATOM   1464 C  CG    . ARG A 1 197 ? 27.349  -23.895 9.941   1.00 40.03 ? 197 ARG A CG    1 
ATOM   1465 C  CD    . ARG A 1 197 ? 27.972  -25.246 9.608   1.00 39.91 ? 197 ARG A CD    1 
ATOM   1466 N  NE    . ARG A 1 197 ? 27.243  -26.350 10.228  1.00 39.36 ? 197 ARG A NE    1 
ATOM   1467 C  CZ    . ARG A 1 197 ? 27.489  -26.811 11.450  1.00 37.53 ? 197 ARG A CZ    1 
ATOM   1468 N  NH1   . ARG A 1 197 ? 28.451  -26.264 12.182  1.00 50.69 ? 197 ARG A NH1   1 
ATOM   1469 N  NH2   . ARG A 1 197 ? 26.781  -27.821 11.939  1.00 42.89 ? 197 ARG A NH2   1 
ATOM   1470 N  N     . GLU A 1 198 ? 26.287  -20.999 7.455   1.00 33.69 ? 198 GLU A N     1 
ATOM   1471 C  CA    . GLU A 1 198 ? 25.106  -21.029 6.602   1.00 42.44 ? 198 GLU A CA    1 
ATOM   1472 C  C     . GLU A 1 198 ? 24.591  -22.458 6.538   1.00 40.33 ? 198 GLU A C     1 
ATOM   1473 O  O     . GLU A 1 198 ? 25.376  -23.400 6.423   1.00 47.46 ? 198 GLU A O     1 
ATOM   1474 C  CB    . GLU A 1 198 ? 25.432  -20.531 5.193   1.00 53.26 ? 198 GLU A CB    1 
ATOM   1475 C  CG    . GLU A 1 198 ? 25.402  -19.021 5.052   1.00 66.04 ? 198 GLU A CG    1 
ATOM   1476 C  CD    . GLU A 1 198 ? 24.026  -18.450 5.334   1.00 75.90 ? 198 GLU A CD    1 
ATOM   1477 O  OE1   . GLU A 1 198 ? 23.091  -18.743 4.559   1.00 73.48 ? 198 GLU A OE1   1 
ATOM   1478 O  OE2   . GLU A 1 198 ? 23.877  -17.720 6.337   1.00 81.22 ? 198 GLU A OE2   1 
ATOM   1479 N  N     . LEU A 1 199 ? 23.275  -22.626 6.626   1.00 29.42 ? 199 LEU A N     1 
ATOM   1480 C  CA    . LEU A 1 199 ? 22.690  -23.959 6.564   1.00 24.26 ? 199 LEU A CA    1 
ATOM   1481 C  C     . LEU A 1 199 ? 21.990  -24.111 5.221   1.00 30.16 ? 199 LEU A C     1 
ATOM   1482 O  O     . LEU A 1 199 ? 20.773  -23.945 5.110   1.00 33.74 ? 199 LEU A O     1 
ATOM   1483 C  CB    . LEU A 1 199 ? 21.711  -24.169 7.719   1.00 24.55 ? 199 LEU A CB    1 
ATOM   1484 C  CG    . LEU A 1 199 ? 22.288  -23.947 9.119   1.00 28.65 ? 199 LEU A CG    1 
ATOM   1485 C  CD1   . LEU A 1 199 ? 21.184  -23.982 10.169  1.00 31.21 ? 199 LEU A CD1   1 
ATOM   1486 C  CD2   . LEU A 1 199 ? 23.365  -24.974 9.435   1.00 30.49 ? 199 LEU A CD2   1 
ATOM   1487 N  N     . THR A 1 200 ? 22.777  -24.430 4.202   1.00 26.47 ? 200 THR A N     1 
ATOM   1488 C  CA    . THR A 1 200 ? 22.327  -24.365 2.818   1.00 27.72 ? 200 THR A CA    1 
ATOM   1489 C  C     . THR A 1 200 ? 22.016  -25.731 2.220   1.00 28.13 ? 200 THR A C     1 
ATOM   1490 O  O     . THR A 1 200 ? 21.445  -25.816 1.133   1.00 32.22 ? 200 THR A O     1 
ATOM   1491 C  CB    . THR A 1 200 ? 23.392  -23.701 1.934   1.00 39.07 ? 200 THR A CB    1 
ATOM   1492 O  OG1   . THR A 1 200 ? 24.620  -24.428 2.048   1.00 31.65 ? 200 THR A OG1   1 
ATOM   1493 C  CG2   . THR A 1 200 ? 23.627  -22.258 2.360   1.00 46.94 ? 200 THR A CG2   1 
ATOM   1494 N  N     . GLN A 1 201 ? 22.406  -26.795 2.914   1.00 23.09 ? 201 GLN A N     1 
ATOM   1495 C  CA    . GLN A 1 201 ? 22.201  -28.149 2.407   1.00 23.38 ? 201 GLN A CA    1 
ATOM   1496 C  C     . GLN A 1 201 ? 21.032  -28.807 3.130   1.00 23.23 ? 201 GLN A C     1 
ATOM   1497 O  O     . GLN A 1 201 ? 20.760  -28.474 4.286   1.00 23.48 ? 201 GLN A O     1 
ATOM   1498 C  CB    . GLN A 1 201 ? 23.475  -28.973 2.575   1.00 23.38 ? 201 GLN A CB    1 
ATOM   1499 C  CG    . GLN A 1 201 ? 24.718  -28.295 1.998   1.00 24.65 ? 201 GLN A CG    1 
ATOM   1500 C  CD    . GLN A 1 201 ? 24.563  -27.939 0.527   1.00 31.68 ? 201 GLN A CD    1 
ATOM   1501 O  OE1   . GLN A 1 201 ? 24.575  -26.764 0.146   1.00 32.42 ? 201 GLN A OE1   1 
ATOM   1502 N  NE2   . GLN A 1 201 ? 24.421  -28.955 -0.308  1.00 28.51 ? 201 GLN A NE2   1 
ATOM   1503 N  N     . PRO A 1 202 ? 20.339  -29.742 2.451   1.00 24.13 ? 202 PRO A N     1 
ATOM   1504 C  CA    . PRO A 1 202 ? 19.110  -30.324 3.009   1.00 20.10 ? 202 PRO A CA    1 
ATOM   1505 C  C     . PRO A 1 202 ? 19.249  -30.844 4.443   1.00 19.84 ? 202 PRO A C     1 
ATOM   1506 O  O     . PRO A 1 202 ? 18.359  -30.600 5.266   1.00 21.70 ? 202 PRO A O     1 
ATOM   1507 C  CB    . PRO A 1 202 ? 18.809  -31.478 2.049   1.00 20.44 ? 202 PRO A CB    1 
ATOM   1508 C  CG    . PRO A 1 202 ? 19.347  -31.006 0.732   1.00 26.15 ? 202 PRO A CG    1 
ATOM   1509 C  CD    . PRO A 1 202 ? 20.614  -30.243 1.090   1.00 29.72 ? 202 PRO A CD    1 
ATOM   1510 N  N     . ASP A 1 203 ? 20.343  -31.542 4.739   1.00 20.87 ? 203 ASP A N     1 
ATOM   1511 C  CA    . ASP A 1 203 ? 20.532  -32.120 6.071   1.00 20.65 ? 203 ASP A CA    1 
ATOM   1512 C  C     . ASP A 1 203 ? 21.190  -31.196 7.098   1.00 23.59 ? 203 ASP A C     1 
ATOM   1513 O  O     . ASP A 1 203 ? 21.428  -31.614 8.233   1.00 22.43 ? 203 ASP A O     1 
ATOM   1514 C  CB    . ASP A 1 203 ? 21.352  -33.408 5.974   1.00 33.54 ? 203 ASP A CB    1 
ATOM   1515 C  CG    . ASP A 1 203 ? 20.516  -34.645 6.201   1.00 51.38 ? 203 ASP A CG    1 
ATOM   1516 O  OD1   . ASP A 1 203 ? 20.292  -34.996 7.378   1.00 57.84 ? 203 ASP A OD1   1 
ATOM   1517 O  OD2   . ASP A 1 203 ? 20.082  -35.266 5.209   1.00 51.87 ? 203 ASP A OD2   1 
ATOM   1518 N  N     . ASP A 1 204 ? 21.487  -29.956 6.712   1.00 23.35 ? 204 ASP A N     1 
ATOM   1519 C  CA    . ASP A 1 204 ? 22.253  -29.060 7.584   1.00 24.12 ? 204 ASP A CA    1 
ATOM   1520 C  C     . ASP A 1 204 ? 21.567  -28.734 8.912   1.00 24.92 ? 204 ASP A C     1 
ATOM   1521 O  O     . ASP A 1 204 ? 22.229  -28.720 9.952   1.00 22.43 ? 204 ASP A O     1 
ATOM   1522 C  CB    . ASP A 1 204 ? 22.656  -27.767 6.860   1.00 21.11 ? 204 ASP A CB    1 
ATOM   1523 C  CG    . ASP A 1 204 ? 23.840  -27.956 5.935   1.00 33.58 ? 204 ASP A CG    1 
ATOM   1524 O  OD1   . ASP A 1 204 ? 24.150  -27.004 5.184   1.00 33.58 ? 204 ASP A OD1   1 
ATOM   1525 O  OD2   . ASP A 1 204 ? 24.460  -29.047 5.950   1.00 31.83 ? 204 ASP A OD2   1 
ATOM   1526 N  N     . VAL A 1 205 ? 20.259  -28.472 8.877   1.00 19.70 ? 205 VAL A N     1 
ATOM   1527 C  CA    . VAL A 1 205 ? 19.514  -28.151 10.091  1.00 17.56 ? 205 VAL A CA    1 
ATOM   1528 C  C     . VAL A 1 205 ? 19.542  -29.311 11.077  1.00 21.43 ? 205 VAL A C     1 
ATOM   1529 O  O     . VAL A 1 205 ? 19.833  -29.118 12.256  1.00 19.80 ? 205 VAL A O     1 
ATOM   1530 C  CB    . VAL A 1 205 ? 18.059  -27.741 9.782   1.00 18.31 ? 205 VAL A CB    1 
ATOM   1531 C  CG1   . VAL A 1 205 ? 17.205  -27.787 11.046  1.00 21.72 ? 205 VAL A CG1   1 
ATOM   1532 C  CG2   . VAL A 1 205 ? 18.030  -26.341 9.168   1.00 19.08 ? 205 VAL A CG2   1 
ATOM   1533 N  N     . ARG A 1 206 ? 19.264  -30.518 10.590  1.00 20.31 ? 206 ARG A N     1 
ATOM   1534 C  CA    . ARG A 1 206 ? 19.271  -31.697 11.454  1.00 24.48 ? 206 ARG A CA    1 
ATOM   1535 C  C     . ARG A 1 206 ? 20.645  -31.937 12.065  1.00 24.42 ? 206 ARG A C     1 
ATOM   1536 O  O     . ARG A 1 206 ? 20.770  -32.178 13.266  1.00 24.12 ? 206 ARG A O     1 
ATOM   1537 C  CB    . ARG A 1 206 ? 18.841  -32.947 10.685  1.00 29.27 ? 206 ARG A CB    1 
ATOM   1538 C  CG    . ARG A 1 206 ? 18.561  -34.146 11.589  1.00 35.93 ? 206 ARG A CG    1 
ATOM   1539 C  CD    . ARG A 1 206 ? 18.882  -35.457 10.901  1.00 41.34 ? 206 ARG A CD    1 
ATOM   1540 N  NE    . ARG A 1 206 ? 20.308  -35.764 10.979  1.00 61.16 ? 206 ARG A NE    1 
ATOM   1541 C  CZ    . ARG A 1 206 ? 21.004  -36.343 10.007  1.00 67.57 ? 206 ARG A CZ    1 
ATOM   1542 N  NH1   . ARG A 1 206 ? 20.410  -36.675 8.869   1.00 64.87 ? 206 ARG A NH1   1 
ATOM   1543 N  NH2   . ARG A 1 206 ? 22.298  -36.585 10.171  1.00 73.12 ? 206 ARG A NH2   1 
ATOM   1544 N  N     . LYS A 1 207 ? 21.677  -31.876 11.234  1.00 22.82 ? 207 LYS A N     1 
ATOM   1545 C  CA    . LYS A 1 207 ? 23.040  -32.079 11.709  1.00 22.48 ? 207 LYS A CA    1 
ATOM   1546 C  C     . LYS A 1 207 ? 23.437  -31.054 12.766  1.00 24.92 ? 207 LYS A C     1 
ATOM   1547 O  O     . LYS A 1 207 ? 24.031  -31.406 13.781  1.00 28.81 ? 207 LYS A O     1 
ATOM   1548 C  CB    . LYS A 1 207 ? 24.025  -32.071 10.545  1.00 26.27 ? 207 LYS A CB    1 
ATOM   1549 C  CG    . LYS A 1 207 ? 23.990  -33.358 9.744   1.00 29.63 ? 207 LYS A CG    1 
ATOM   1550 C  CD    . LYS A 1 207 ? 24.830  -33.273 8.486   1.00 40.45 ? 207 LYS A CD    1 
ATOM   1551 C  CE    . LYS A 1 207 ? 24.659  -34.540 7.660   1.00 49.55 ? 207 LYS A CE    1 
ATOM   1552 N  NZ    . LYS A 1 207 ? 25.219  -34.406 6.286   1.00 56.97 ? 207 LYS A NZ    1 
ATOM   1553 N  N     . ALA A 1 208 ? 23.103  -29.791 12.525  1.00 21.70 ? 208 ALA A N     1 
ATOM   1554 C  CA    . ALA A 1 208 ? 23.387  -28.735 13.493  1.00 23.88 ? 208 ALA A CA    1 
ATOM   1555 C  C     . ALA A 1 208 ? 22.675  -28.985 14.820  1.00 23.60 ? 208 ALA A C     1 
ATOM   1556 O  O     . ALA A 1 208 ? 23.259  -28.814 15.889  1.00 23.62 ? 208 ALA A O     1 
ATOM   1557 C  CB    . ALA A 1 208 ? 22.992  -27.377 12.927  1.00 23.13 ? 208 ALA A CB    1 
ATOM   1558 N  N     . ALA A 1 209 ? 21.403  -29.372 14.748  1.00 20.67 ? 209 ALA A N     1 
ATOM   1559 C  CA    . ALA A 1 209 ? 20.635  -29.666 15.952  1.00 20.11 ? 209 ALA A CA    1 
ATOM   1560 C  C     . ALA A 1 209 ? 21.264  -30.828 16.723  1.00 28.26 ? 209 ALA A C     1 
ATOM   1561 O  O     . ALA A 1 209 ? 21.402  -30.771 17.947  1.00 29.98 ? 209 ALA A O     1 
ATOM   1562 C  CB    . ALA A 1 209 ? 19.191  -29.985 15.597  1.00 19.35 ? 209 ALA A CB    1 
ATOM   1563 N  N     . GLN A 1 210 ? 21.653  -31.874 15.997  1.00 27.81 ? 210 GLN A N     1 
ATOM   1564 C  CA    A GLN A 1 210 ? 22.290  -33.049 16.590  0.47 31.86 ? 210 GLN A CA    1 
ATOM   1565 C  CA    B GLN A 1 210 ? 22.256  -33.035 16.638  0.53 31.37 ? 210 GLN A CA    1 
ATOM   1566 C  C     . GLN A 1 210 ? 23.597  -32.676 17.273  1.00 32.11 ? 210 GLN A C     1 
ATOM   1567 O  O     . GLN A 1 210 ? 23.947  -33.218 18.319  1.00 33.55 ? 210 GLN A O     1 
ATOM   1568 C  CB    A GLN A 1 210 ? 22.559  -34.107 15.514  0.47 34.49 ? 210 GLN A CB    1 
ATOM   1569 C  CB    B GLN A 1 210 ? 22.421  -34.193 15.653  0.53 34.65 ? 210 GLN A CB    1 
ATOM   1570 C  CG    A GLN A 1 210 ? 21.354  -34.965 15.174  0.47 31.30 ? 210 GLN A CG    1 
ATOM   1571 C  CG    B GLN A 1 210 ? 22.644  -35.542 16.330  0.53 34.42 ? 210 GLN A CG    1 
ATOM   1572 C  CD    A GLN A 1 210 ? 21.548  -35.801 13.916  0.47 31.10 ? 210 GLN A CD    1 
ATOM   1573 C  CD    B GLN A 1 210 ? 21.427  -36.012 17.111  0.53 37.00 ? 210 GLN A CD    1 
ATOM   1574 O  OE1   A GLN A 1 210 ? 22.285  -35.423 13.004  0.47 29.72 ? 210 GLN A OE1   1 
ATOM   1575 O  OE1   B GLN A 1 210 ? 20.350  -36.204 16.546  0.53 41.41 ? 210 GLN A OE1   1 
ATOM   1576 N  NE2   A GLN A 1 210 ? 20.872  -36.940 13.860  0.47 34.56 ? 210 GLN A NE2   1 
ATOM   1577 N  NE2   B GLN A 1 210 ? 21.592  -36.193 18.418  0.53 28.43 ? 210 GLN A NE2   1 
ATOM   1578 N  N     . GLU A 1 211 ? 24.322  -31.751 16.650  1.00 29.20 ? 211 GLU A N     1 
ATOM   1579 C  CA    . GLU A 1 211 ? 25.622  -31.295 17.140  1.00 31.52 ? 211 GLU A CA    1 
ATOM   1580 C  C     . GLU A 1 211 ? 25.483  -30.678 18.532  1.00 32.41 ? 211 GLU A C     1 
ATOM   1581 O  O     . GLU A 1 211 ? 26.310  -30.913 19.422  1.00 37.37 ? 211 GLU A O     1 
ATOM   1582 C  CB    . GLU A 1 211 ? 26.186  -30.266 16.157  1.00 38.76 ? 211 GLU A CB    1 
ATOM   1583 C  CG    . GLU A 1 211 ? 27.643  -29.894 16.338  1.00 59.07 ? 211 GLU A CG    1 
ATOM   1584 C  CD    . GLU A 1 211 ? 28.065  -28.760 15.412  1.00 70.07 ? 211 GLU A CD    1 
ATOM   1585 O  OE1   . GLU A 1 211 ? 27.642  -28.754 14.234  1.00 65.57 ? 211 GLU A OE1   1 
ATOM   1586 O  OE2   . GLU A 1 211 ? 28.810  -27.867 15.871  1.00 76.71 ? 211 GLU A OE2   1 
ATOM   1587 N  N     . ILE A 1 212 ? 24.427  -29.892 18.715  1.00 31.61 ? 212 ILE A N     1 
ATOM   1588 C  CA    . ILE A 1 212 ? 24.156  -29.244 19.998  1.00 32.01 ? 212 ILE A CA    1 
ATOM   1589 C  C     . ILE A 1 212 ? 23.792  -30.264 21.081  1.00 28.52 ? 212 ILE A C     1 
ATOM   1590 O  O     . ILE A 1 212 ? 24.215  -30.141 22.232  1.00 33.22 ? 212 ILE A O     1 
ATOM   1591 C  CB    . ILE A 1 212 ? 23.031  -28.204 19.855  1.00 27.96 ? 212 ILE A CB    1 
ATOM   1592 C  CG1   . ILE A 1 212 ? 23.469  -27.092 18.900  1.00 27.18 ? 212 ILE A CG1   1 
ATOM   1593 C  CG2   . ILE A 1 212 ? 22.649  -27.622 21.211  1.00 28.13 ? 212 ILE A CG2   1 
ATOM   1594 C  CD1   . ILE A 1 212 ? 22.338  -26.172 18.487  1.00 34.12 ? 212 ILE A CD1   1 
ATOM   1595 N  N     . VAL A 1 213 ? 23.001  -31.266 20.711  1.00 27.67 ? 213 VAL A N     1 
ATOM   1596 C  CA    . VAL A 1 213 ? 22.634  -32.314 21.654  1.00 27.54 ? 213 VAL A CA    1 
ATOM   1597 C  C     . VAL A 1 213 ? 23.866  -33.141 22.010  1.00 33.81 ? 213 VAL A C     1 
ATOM   1598 O  O     . VAL A 1 213 ? 24.165  -33.339 23.187  1.00 34.87 ? 213 VAL A O     1 
ATOM   1599 C  CB    . VAL A 1 213 ? 21.525  -33.223 21.096  1.00 29.50 ? 213 VAL A CB    1 
ATOM   1600 C  CG1   . VAL A 1 213 ? 21.248  -34.382 22.047  1.00 32.05 ? 213 VAL A CG1   1 
ATOM   1601 C  CG2   . VAL A 1 213 ? 20.258  -32.411 20.855  1.00 27.90 ? 213 VAL A CG2   1 
ATOM   1602 N  N     . ASN A 1 214 ? 24.586  -33.596 20.988  1.00 35.54 ? 214 ASN A N     1 
ATOM   1603 C  CA    . ASN A 1 214 ? 25.801  -34.383 21.188  1.00 42.61 ? 214 ASN A CA    1 
ATOM   1604 C  C     . ASN A 1 214 ? 26.863  -33.683 22.039  1.00 45.27 ? 214 ASN A C     1 
ATOM   1605 O  O     . ASN A 1 214 ? 27.570  -34.331 22.817  1.00 41.51 ? 214 ASN A O     1 
ATOM   1606 C  CB    . ASN A 1 214 ? 26.401  -34.810 19.843  1.00 41.67 ? 214 ASN A CB    1 
ATOM   1607 C  CG    . ASN A 1 214 ? 25.551  -35.843 19.122  1.00 47.15 ? 214 ASN A CG    1 
ATOM   1608 O  OD1   . ASN A 1 214 ? 24.656  -36.453 19.713  1.00 44.84 ? 214 ASN A OD1   1 
ATOM   1609 N  ND2   . ASN A 1 214 ? 25.835  -36.052 17.839  1.00 45.46 ? 214 ASN A ND2   1 
ATOM   1610 N  N     . SER A 1 215 ? 26.968  -32.364 21.901  1.00 38.68 ? 215 SER A N     1 
ATOM   1611 C  CA    . SER A 1 215 ? 27.973  -31.604 22.641  1.00 44.84 ? 215 SER A CA    1 
ATOM   1612 C  C     . SER A 1 215 ? 27.604  -31.442 24.117  1.00 46.59 ? 215 SER A C     1 
ATOM   1613 O  O     . SER A 1 215 ? 28.437  -31.033 24.931  1.00 43.12 ? 215 SER A O     1 
ATOM   1614 C  CB    . SER A 1 215 ? 28.192  -30.231 22.007  1.00 44.83 ? 215 SER A CB    1 
ATOM   1615 O  OG    . SER A 1 215 ? 27.053  -29.405 22.178  1.00 43.23 ? 215 SER A OG    1 
ATOM   1616 N  N     . GLY A 1 216 ? 26.359  -31.767 24.453  1.00 39.50 ? 216 GLY A N     1 
ATOM   1617 C  CA    . GLY A 1 216 ? 25.873  -31.673 25.819  1.00 43.79 ? 216 GLY A CA    1 
ATOM   1618 C  C     . GLY A 1 216 ? 25.302  -30.311 26.177  1.00 42.56 ? 216 GLY A C     1 
ATOM   1619 O  O     . GLY A 1 216 ? 24.950  -30.062 27.333  1.00 41.86 ? 216 GLY A O     1 
ATOM   1620 N  N     . LYS A 1 217 ? 25.204  -29.427 25.189  1.00 37.82 ? 217 LYS A N     1 
ATOM   1621 C  CA    . LYS A 1 217 ? 24.720  -28.070 25.433  1.00 31.92 ? 217 LYS A CA    1 
ATOM   1622 C  C     . LYS A 1 217 ? 23.235  -28.053 25.782  1.00 27.76 ? 217 LYS A C     1 
ATOM   1623 O  O     . LYS A 1 217 ? 22.802  -27.304 26.659  1.00 31.41 ? 217 LYS A O     1 
ATOM   1624 C  CB    . LYS A 1 217 ? 24.987  -27.170 24.222  1.00 37.14 ? 217 LYS A CB    1 
ATOM   1625 C  CG    . LYS A 1 217 ? 26.451  -26.784 24.056  1.00 49.20 ? 217 LYS A CG    1 
ATOM   1626 C  CD    . LYS A 1 217 ? 26.644  -25.824 22.890  1.00 59.11 ? 217 LYS A CD    1 
ATOM   1627 C  CE    . LYS A 1 217 ? 28.057  -25.250 22.861  1.00 63.90 ? 217 LYS A CE    1 
ATOM   1628 N  NZ    . LYS A 1 217 ? 28.143  -23.913 23.521  1.00 66.62 ? 217 LYS A NZ    1 
ATOM   1629 N  N     . ALA A 1 218 ? 22.457  -28.874 25.087  1.00 29.64 ? 218 ALA A N     1 
ATOM   1630 C  CA    . ALA A 1 218 ? 21.027  -28.969 25.355  1.00 27.10 ? 218 ALA A CA    1 
ATOM   1631 C  C     . ALA A 1 218 ? 20.583  -30.424 25.307  1.00 29.72 ? 218 ALA A C     1 
ATOM   1632 O  O     . ALA A 1 218 ? 21.109  -31.214 24.519  1.00 32.66 ? 218 ALA A O     1 
ATOM   1633 C  CB    . ALA A 1 218 ? 20.230  -28.129 24.356  1.00 24.90 ? 218 ALA A CB    1 
ATOM   1634 N  N     . LYS A 1 219 ? 19.622  -30.779 26.154  1.00 30.29 ? 219 LYS A N     1 
ATOM   1635 C  CA    . LYS A 1 219 ? 19.064  -32.130 26.142  1.00 29.19 ? 219 LYS A CA    1 
ATOM   1636 C  C     . LYS A 1 219 ? 18.168  -32.313 24.926  1.00 29.61 ? 219 LYS A C     1 
ATOM   1637 O  O     . LYS A 1 219 ? 18.157  -33.368 24.292  1.00 29.51 ? 219 LYS A O     1 
ATOM   1638 C  CB    . LYS A 1 219 ? 18.271  -32.397 27.423  1.00 25.88 ? 219 LYS A CB    1 
ATOM   1639 C  CG    . LYS A 1 219 ? 19.136  -32.444 28.689  1.00 34.03 ? 219 LYS A CG    1 
ATOM   1640 C  CD    . LYS A 1 219 ? 18.338  -32.969 29.882  1.00 47.99 ? 219 LYS A CD    1 
ATOM   1641 C  CE    . LYS A 1 219 ? 19.182  -33.050 31.151  1.00 54.92 ? 219 LYS A CE    1 
ATOM   1642 N  NZ    . LYS A 1 219 ? 19.444  -31.709 31.740  1.00 61.12 ? 219 LYS A NZ    1 
ATOM   1643 N  N     . ARG A 1 220 ? 17.419  -31.265 24.610  1.00 24.15 ? 220 ARG A N     1 
ATOM   1644 C  CA    . ARG A 1 220 ? 16.500  -31.273 23.486  1.00 25.82 ? 220 ARG A CA    1 
ATOM   1645 C  C     . ARG A 1 220 ? 16.657  -29.993 22.682  1.00 21.83 ? 220 ARG A C     1 
ATOM   1646 O  O     . ARG A 1 220 ? 16.751  -28.903 23.247  1.00 28.06 ? 220 ARG A O     1 
ATOM   1647 C  CB    . ARG A 1 220 ? 15.062  -31.376 23.987  1.00 26.52 ? 220 ARG A CB    1 
ATOM   1648 C  CG    . ARG A 1 220 ? 14.824  -32.501 24.987  1.00 29.43 ? 220 ARG A CG    1 
ATOM   1649 C  CD    . ARG A 1 220 ? 13.445  -32.369 25.622  1.00 35.88 ? 220 ARG A CD    1 
ATOM   1650 N  NE    . ARG A 1 220 ? 13.269  -33.307 26.728  1.00 37.42 ? 220 ARG A NE    1 
ATOM   1651 C  CZ    . ARG A 1 220 ? 13.731  -33.107 27.959  1.00 44.49 ? 220 ARG A CZ    1 
ATOM   1652 N  NH1   . ARG A 1 220 ? 14.406  -32.001 28.251  1.00 34.00 ? 220 ARG A NH1   1 
ATOM   1653 N  NH2   . ARG A 1 220 ? 13.523  -34.017 28.900  1.00 47.28 ? 220 ARG A NH2   1 
ATOM   1654 N  N     . VAL A 1 221 ? 16.688  -30.135 21.363  1.00 20.89 ? 221 VAL A N     1 
ATOM   1655 C  CA    . VAL A 1 221 ? 16.734  -28.990 20.470  1.00 17.59 ? 221 VAL A CA    1 
ATOM   1656 C  C     . VAL A 1 221 ? 15.544  -29.096 19.536  1.00 20.23 ? 221 VAL A C     1 
ATOM   1657 O  O     . VAL A 1 221 ? 15.375  -30.099 18.837  1.00 21.92 ? 221 VAL A O     1 
ATOM   1658 C  CB    . VAL A 1 221 ? 18.035  -28.954 19.642  1.00 23.42 ? 221 VAL A CB    1 
ATOM   1659 C  CG1   . VAL A 1 221 ? 17.971  -27.838 18.593  1.00 24.29 ? 221 VAL A CG1   1 
ATOM   1660 C  CG2   . VAL A 1 221 ? 19.236  -28.764 20.554  1.00 23.13 ? 221 VAL A CG2   1 
ATOM   1661 N  N     . VAL A 1 222 ? 14.695  -28.083 19.545  1.00 18.22 ? 222 VAL A N     1 
ATOM   1662 C  CA    . VAL A 1 222 ? 13.610  -28.049 18.585  1.00 16.56 ? 222 VAL A CA    1 
ATOM   1663 C  C     . VAL A 1 222 ? 13.848  -26.875 17.654  1.00 17.48 ? 222 VAL A C     1 
ATOM   1664 O  O     . VAL A 1 222 ? 13.742  -25.721 18.066  1.00 23.42 ? 222 VAL A O     1 
ATOM   1665 C  CB    . VAL A 1 222 ? 12.237  -27.934 19.278  1.00 17.36 ? 222 VAL A CB    1 
ATOM   1666 C  CG1   . VAL A 1 222 ? 11.116  -27.820 18.241  1.00 19.36 ? 222 VAL A CG1   1 
ATOM   1667 C  CG2   . VAL A 1 222 ? 12.010  -29.145 20.172  1.00 24.72 ? 222 VAL A CG2   1 
ATOM   1668 N  N     . VAL A 1 223 ? 14.199  -27.171 16.408  1.00 17.49 ? 223 VAL A N     1 
ATOM   1669 C  CA    . VAL A 1 223 ? 14.384  -26.118 15.426  1.00 18.86 ? 223 VAL A CA    1 
ATOM   1670 C  C     . VAL A 1 223 ? 13.038  -25.830 14.778  1.00 18.78 ? 223 VAL A C     1 
ATOM   1671 O  O     . VAL A 1 223 ? 12.477  -26.674 14.079  1.00 17.76 ? 223 VAL A O     1 
ATOM   1672 C  CB    . VAL A 1 223 ? 15.380  -26.511 14.333  1.00 19.25 ? 223 VAL A CB    1 
ATOM   1673 C  CG1   . VAL A 1 223 ? 15.682  -25.299 13.453  1.00 17.10 ? 223 VAL A CG1   1 
ATOM   1674 C  CG2   . VAL A 1 223 ? 16.661  -27.053 14.952  1.00 23.86 ? 223 VAL A CG2   1 
ATOM   1675 N  N     . SER A 1 224 ? 12.509  -24.637 15.007  1.00 14.82 ? 224 SER A N     1 
ATOM   1676 C  CA    . SER A 1 224 ? 11.220  -24.308 14.408  1.00 18.36 ? 224 SER A CA    1 
ATOM   1677 C  C     . SER A 1 224 ? 11.437  -23.755 12.993  1.00 19.47 ? 224 SER A C     1 
ATOM   1678 O  O     . SER A 1 224 ? 12.391  -23.012 12.731  1.00 16.29 ? 224 SER A O     1 
ATOM   1679 C  CB    . SER A 1 224 ? 10.407  -23.374 15.306  1.00 17.19 ? 224 SER A CB    1 
ATOM   1680 O  OG    . SER A 1 224 ? 11.006  -22.090 15.460  1.00 17.98 ? 224 SER A OG    1 
ATOM   1681 N  N     . LEU A 1 225 ? 10.558  -24.155 12.082  1.00 14.75 ? 225 LEU A N     1 
ATOM   1682 C  CA    . LEU A 1 225 ? 10.769  -23.979 10.652  1.00 12.23 ? 225 LEU A CA    1 
ATOM   1683 C  C     . LEU A 1 225 ? 9.633   -23.195 9.993   1.00 12.16 ? 225 LEU A C     1 
ATOM   1684 O  O     . LEU A 1 225 ? 9.339   -23.398 8.810   1.00 14.98 ? 225 LEU A O     1 
ATOM   1685 C  CB    . LEU A 1 225 ? 10.864  -25.356 10.002  1.00 15.22 ? 225 LEU A CB    1 
ATOM   1686 C  CG    . LEU A 1 225 ? 11.906  -26.309 10.593  1.00 23.42 ? 225 LEU A CG    1 
ATOM   1687 C  CD1   . LEU A 1 225 ? 11.809  -27.692 9.951   1.00 17.54 ? 225 LEU A CD1   1 
ATOM   1688 C  CD2   . LEU A 1 225 ? 13.300  -25.742 10.429  1.00 23.59 ? 225 LEU A CD2   1 
ATOM   1689 N  N     . GLY A 1 226 ? 9.001   -22.299 10.748  1.00 17.24 ? 226 GLY A N     1 
ATOM   1690 C  CA    . GLY A 1 226 ? 7.902   -21.511 10.203  1.00 17.81 ? 226 GLY A CA    1 
ATOM   1691 C  C     . GLY A 1 226 ? 6.792   -22.420 9.690   1.00 15.61 ? 226 GLY A C     1 
ATOM   1692 O  O     . GLY A 1 226 ? 6.357   -23.314 10.409  1.00 17.50 ? 226 GLY A O     1 
ATOM   1693 N  N     . PRO A 1 227 ? 6.356   -22.225 8.430   1.00 17.53 ? 227 PRO A N     1 
ATOM   1694 C  CA    . PRO A 1 227 ? 5.272   -23.057 7.886   1.00 17.02 ? 227 PRO A CA    1 
ATOM   1695 C  C     . PRO A 1 227 ? 5.665   -24.525 7.707   1.00 15.39 ? 227 PRO A C     1 
ATOM   1696 O  O     . PRO A 1 227 ? 4.799   -25.381 7.530   1.00 19.45 ? 227 PRO A O     1 
ATOM   1697 C  CB    . PRO A 1 227 ? 4.982   -22.412 6.523   1.00 17.94 ? 227 PRO A CB    1 
ATOM   1698 C  CG    . PRO A 1 227 ? 6.263   -21.762 6.132   1.00 17.86 ? 227 PRO A CG    1 
ATOM   1699 C  CD    . PRO A 1 227 ? 6.889   -21.283 7.427   1.00 19.76 ? 227 PRO A CD    1 
ATOM   1700 N  N     . GLN A 1 228 ? 6.957   -24.829 7.766   1.00 15.71 ? 228 GLN A N     1 
ATOM   1701 C  CA    . GLN A 1 228 ? 7.388   -26.223 7.652   1.00 11.94 ? 228 GLN A CA    1 
ATOM   1702 C  C     . GLN A 1 228 ? 7.291   -26.997 8.967   1.00 14.52 ? 228 GLN A C     1 
ATOM   1703 O  O     . GLN A 1 228 ? 7.575   -28.202 9.018   1.00 17.44 ? 228 GLN A O     1 
ATOM   1704 C  CB    . GLN A 1 228 ? 8.804   -26.296 7.058   1.00 15.09 ? 228 GLN A CB    1 
ATOM   1705 C  CG    . GLN A 1 228 ? 8.812   -25.962 5.582   1.00 14.83 ? 228 GLN A CG    1 
ATOM   1706 C  CD    . GLN A 1 228 ? 10.194  -25.855 4.994   1.00 20.33 ? 228 GLN A CD    1 
ATOM   1707 O  OE1   . GLN A 1 228 ? 11.189  -25.819 5.720   1.00 23.40 ? 228 GLN A OE1   1 
ATOM   1708 N  NE2   . GLN A 1 228 ? 10.266  -25.793 3.667   1.00 20.62 ? 228 GLN A NE2   1 
ATOM   1709 N  N     . GLY A 1 229 ? 6.871   -26.315 10.030  1.00 15.45 ? 229 GLY A N     1 
ATOM   1710 C  CA    . GLY A 1 229 ? 6.705   -26.962 11.317  1.00 14.96 ? 229 GLY A CA    1 
ATOM   1711 C  C     . GLY A 1 229 ? 7.959   -26.928 12.166  1.00 17.45 ? 229 GLY A C     1 
ATOM   1712 O  O     . GLY A 1 229 ? 8.502   -25.865 12.454  1.00 16.50 ? 229 GLY A O     1 
ATOM   1713 N  N     . ALA A 1 230 ? 8.425   -28.097 12.584  1.00 16.22 ? 230 ALA A N     1 
ATOM   1714 C  CA    . ALA A 1 230 ? 9.602   -28.128 13.437  1.00 16.57 ? 230 ALA A CA    1 
ATOM   1715 C  C     . ALA A 1 230 ? 10.342  -29.449 13.365  1.00 18.17 ? 230 ALA A C     1 
ATOM   1716 O  O     . ALA A 1 230 ? 9.771   -30.497 13.039  1.00 20.25 ? 230 ALA A O     1 
ATOM   1717 C  CB    . ALA A 1 230 ? 9.229   -27.796 14.882  1.00 16.64 ? 230 ALA A CB    1 
ATOM   1718 N  N     . LEU A 1 231 ? 11.630  -29.385 13.677  1.00 17.59 ? 231 LEU A N     1 
ATOM   1719 C  CA    . LEU A 1 231 ? 12.440  -30.590 13.798  1.00 19.96 ? 231 LEU A CA    1 
ATOM   1720 C  C     . LEU A 1 231 ? 12.911  -30.702 15.244  1.00 20.96 ? 231 LEU A C     1 
ATOM   1721 O  O     . LEU A 1 231 ? 13.583  -29.805 15.761  1.00 26.00 ? 231 LEU A O     1 
ATOM   1722 C  CB    . LEU A 1 231 ? 13.637  -30.527 12.854  1.00 23.70 ? 231 LEU A CB    1 
ATOM   1723 C  CG    . LEU A 1 231 ? 14.488  -31.798 12.809  1.00 29.61 ? 231 LEU A CG    1 
ATOM   1724 C  CD1   . LEU A 1 231 ? 14.283  -32.514 11.486  1.00 43.92 ? 231 LEU A CD1   1 
ATOM   1725 C  CD2   . LEU A 1 231 ? 15.948  -31.472 13.029  1.00 31.82 ? 231 LEU A CD2   1 
ATOM   1726 N  N     . GLY A 1 232 ? 12.548  -31.802 15.898  1.00 19.99 ? 232 GLY A N     1 
ATOM   1727 C  CA    . GLY A 1 232 ? 12.913  -32.023 17.284  1.00 22.22 ? 232 GLY A CA    1 
ATOM   1728 C  C     . GLY A 1 232 ? 13.982  -33.091 17.389  1.00 24.20 ? 232 GLY A C     1 
ATOM   1729 O  O     . GLY A 1 232 ? 13.873  -34.155 16.775  1.00 23.28 ? 232 GLY A O     1 
ATOM   1730 N  N     . VAL A 1 233 ? 15.025  -32.801 18.160  1.00 24.56 ? 233 VAL A N     1 
ATOM   1731 C  CA    . VAL A 1 233 ? 16.147  -33.722 18.304  1.00 32.30 ? 233 VAL A CA    1 
ATOM   1732 C  C     . VAL A 1 233 ? 16.427  -34.043 19.774  1.00 29.66 ? 233 VAL A C     1 
ATOM   1733 O  O     . VAL A 1 233 ? 16.400  -33.150 20.628  1.00 25.06 ? 233 VAL A O     1 
ATOM   1734 C  CB    . VAL A 1 233 ? 17.414  -33.163 17.610  1.00 37.84 ? 233 VAL A CB    1 
ATOM   1735 C  CG1   . VAL A 1 233 ? 18.637  -33.990 17.948  1.00 47.72 ? 233 VAL A CG1   1 
ATOM   1736 C  CG2   . VAL A 1 233 ? 17.211  -33.117 16.103  1.00 42.55 ? 233 VAL A CG2   1 
ATOM   1737 N  N     . ASP A 1 234 ? 16.668  -35.330 20.039  1.00 27.30 ? 234 ASP A N     1 
ATOM   1738 C  CA    . ASP A 1 234 ? 17.003  -35.868 21.349  1.00 36.45 ? 234 ASP A CA    1 
ATOM   1739 C  C     . ASP A 1 234 ? 18.339  -36.575 21.232  1.00 32.38 ? 234 ASP A C     1 
ATOM   1740 O  O     . ASP A 1 234 ? 18.940  -36.607 20.160  1.00 31.82 ? 234 ASP A O     1 
ATOM   1741 C  CB    . ASP A 1 234 ? 15.987  -36.941 21.741  1.00 43.17 ? 234 ASP A CB    1 
ATOM   1742 C  CG    . ASP A 1 234 ? 15.094  -36.513 22.868  1.00 51.77 ? 234 ASP A CG    1 
ATOM   1743 O  OD1   . ASP A 1 234 ? 15.414  -35.505 23.533  1.00 65.80 ? 234 ASP A OD1   1 
ATOM   1744 O  OD2   . ASP A 1 234 ? 14.073  -37.196 23.092  1.00 46.19 ? 234 ASP A OD2   1 
ATOM   1745 N  N     . SER A 1 235 ? 18.784  -37.184 22.326  1.00 37.72 ? 235 SER A N     1 
ATOM   1746 C  CA    . SER A 1 235 ? 19.945  -38.056 22.267  1.00 41.11 ? 235 SER A CA    1 
ATOM   1747 C  C     . SER A 1 235 ? 19.553  -39.370 21.594  1.00 43.05 ? 235 SER A C     1 
ATOM   1748 O  O     . SER A 1 235 ? 20.413  -40.131 21.151  1.00 46.37 ? 235 SER A O     1 
ATOM   1749 C  CB    . SER A 1 235 ? 20.499  -38.329 23.671  1.00 45.14 ? 235 SER A CB    1 
ATOM   1750 O  OG    . SER A 1 235 ? 19.575  -39.060 24.463  1.00 44.95 ? 235 SER A OG    1 
ATOM   1751 N  N     . GLU A 1 236 ? 18.248  -39.620 21.507  1.00 36.17 ? 236 GLU A N     1 
ATOM   1752 C  CA    . GLU A 1 236 ? 17.737  -40.889 20.998  1.00 41.85 ? 236 GLU A CA    1 
ATOM   1753 C  C     . GLU A 1 236 ? 16.818  -40.740 19.790  1.00 41.50 ? 236 GLU A C     1 
ATOM   1754 O  O     . GLU A 1 236 ? 16.647  -41.680 19.012  1.00 42.96 ? 236 GLU A O     1 
ATOM   1755 C  CB    . GLU A 1 236 ? 16.983  -41.630 22.104  1.00 53.71 ? 236 GLU A CB    1 
ATOM   1756 C  CG    . GLU A 1 236 ? 17.832  -41.955 23.323  1.00 68.32 ? 236 GLU A CG    1 
ATOM   1757 C  CD    . GLU A 1 236 ? 16.992  -42.326 24.528  1.00 79.49 ? 236 GLU A CD    1 
ATOM   1758 O  OE1   . GLU A 1 236 ? 15.760  -42.469 24.371  1.00 81.79 ? 236 GLU A OE1   1 
ATOM   1759 O  OE2   . GLU A 1 236 ? 17.561  -42.468 25.631  1.00 83.84 ? 236 GLU A OE2   1 
ATOM   1760 N  N     . ASN A 1 237 ? 16.220  -39.566 19.628  1.00 31.38 ? 237 ASN A N     1 
ATOM   1761 C  CA    . ASN A 1 237 ? 15.217  -39.393 18.584  1.00 34.18 ? 237 ASN A CA    1 
ATOM   1762 C  C     . ASN A 1 237 ? 15.393  -38.157 17.718  1.00 28.93 ? 237 ASN A C     1 
ATOM   1763 O  O     . ASN A 1 237 ? 16.029  -37.174 18.113  1.00 30.00 ? 237 ASN A O     1 
ATOM   1764 C  CB    . ASN A 1 237 ? 13.813  -39.376 19.194  1.00 40.71 ? 237 ASN A CB    1 
ATOM   1765 C  CG    . ASN A 1 237 ? 13.409  -40.717 19.769  1.00 50.96 ? 237 ASN A CG    1 
ATOM   1766 O  OD1   . ASN A 1 237 ? 13.171  -40.846 20.971  1.00 54.76 ? 237 ASN A OD1   1 
ATOM   1767 N  ND2   . ASN A 1 237 ? 13.319  -41.725 18.909  1.00 53.25 ? 237 ASN A ND2   1 
ATOM   1768 N  N     . CYS A 1 238 ? 14.804  -38.220 16.529  1.00 28.05 ? 238 CYS A N     1 
ATOM   1769 C  CA    . CYS A 1 238 ? 14.764  -37.093 15.612  1.00 29.12 ? 238 CYS A CA    1 
ATOM   1770 C  C     . CYS A 1 238 ? 13.439  -37.154 14.888  1.00 29.96 ? 238 CYS A C     1 
ATOM   1771 O  O     . CYS A 1 238 ? 13.122  -38.155 14.247  1.00 36.14 ? 238 CYS A O     1 
ATOM   1772 C  CB    . CYS A 1 238 ? 15.882  -37.198 14.589  1.00 36.49 ? 238 CYS A CB    1 
ATOM   1773 S  SG    . CYS A 1 238 ? 15.848  -35.878 13.361  1.00 43.73 ? 238 CYS A SG    1 
ATOM   1774 N  N     . ILE A 1 239 ? 12.653  -36.094 14.992  1.00 25.83 ? 239 ILE A N     1 
ATOM   1775 C  CA    . ILE A 1 239 ? 11.359  -36.097 14.338  1.00 30.15 ? 239 ILE A CA    1 
ATOM   1776 C  C     . ILE A 1 239 ? 11.079  -34.755 13.694  1.00 36.14 ? 239 ILE A C     1 
ATOM   1777 O  O     . ILE A 1 239 ? 11.496  -33.708 14.204  1.00 27.02 ? 239 ILE A O     1 
ATOM   1778 C  CB    . ILE A 1 239 ? 10.229  -36.402 15.327  1.00 28.33 ? 239 ILE A CB    1 
ATOM   1779 C  CG1   . ILE A 1 239 ? 10.303  -35.456 16.523  1.00 29.72 ? 239 ILE A CG1   1 
ATOM   1780 C  CG2   . ILE A 1 239 ? 10.276  -37.861 15.790  1.00 39.44 ? 239 ILE A CG2   1 
ATOM   1781 C  CD1   . ILE A 1 239 ? 8.958   -35.112 17.086  1.00 41.41 ? 239 ILE A CD1   1 
ATOM   1782 N  N     . GLN A 1 240 ? 10.382  -34.788 12.563  1.00 28.83 ? 240 GLN A N     1 
ATOM   1783 C  CA    . GLN A 1 240 ? 9.876   -33.561 11.984  1.00 20.13 ? 240 GLN A CA    1 
ATOM   1784 C  C     . GLN A 1 240 ? 8.362   -33.605 12.024  1.00 19.73 ? 240 GLN A C     1 
ATOM   1785 O  O     . GLN A 1 240 ? 7.741   -34.636 11.734  1.00 21.96 ? 240 GLN A O     1 
ATOM   1786 C  CB    . GLN A 1 240 ? 10.370  -33.323 10.547  1.00 35.54 ? 240 GLN A CB    1 
ATOM   1787 C  CG    . GLN A 1 240 ? 9.852   -31.984 9.984   1.00 48.39 ? 240 GLN A CG    1 
ATOM   1788 C  CD    . GLN A 1 240 ? 10.539  -31.521 8.705   1.00 51.34 ? 240 GLN A CD    1 
ATOM   1789 O  OE1   . GLN A 1 240 ? 11.488  -32.147 8.225   1.00 51.74 ? 240 GLN A OE1   1 
ATOM   1790 N  NE2   . GLN A 1 240 ? 10.055  -30.403 8.148   1.00 32.50 ? 240 GLN A NE2   1 
ATOM   1791 N  N     . VAL A 1 241 ? 7.772   -32.485 12.404  1.00 18.50 ? 241 VAL A N     1 
ATOM   1792 C  CA    . VAL A 1 241 ? 6.326   -32.371 12.431  1.00 17.27 ? 241 VAL A CA    1 
ATOM   1793 C  C     . VAL A 1 241 ? 5.933   -31.183 11.571  1.00 17.74 ? 241 VAL A C     1 
ATOM   1794 O  O     . VAL A 1 241 ? 6.433   -30.077 11.774  1.00 22.29 ? 241 VAL A O     1 
ATOM   1795 C  CB    . VAL A 1 241 ? 5.817   -32.173 13.863  1.00 17.58 ? 241 VAL A CB    1 
ATOM   1796 C  CG1   . VAL A 1 241 ? 4.308   -31.885 13.857  1.00 22.27 ? 241 VAL A CG1   1 
ATOM   1797 C  CG2   . VAL A 1 241 ? 6.122   -33.403 14.698  1.00 20.31 ? 241 VAL A CG2   1 
ATOM   1798 N  N     . VAL A 1 242 ? 5.048   -31.421 10.605  1.00 16.64 ? 242 VAL A N     1 
ATOM   1799 C  CA    . VAL A 1 242 ? 4.596   -30.375 9.689   1.00 19.78 ? 242 VAL A CA    1 
ATOM   1800 C  C     . VAL A 1 242 ? 3.135   -30.039 9.992   1.00 16.06 ? 242 VAL A C     1 
ATOM   1801 O  O     . VAL A 1 242 ? 2.323   -30.942 10.192  1.00 22.26 ? 242 VAL A O     1 
ATOM   1802 C  CB    . VAL A 1 242 ? 4.738   -30.857 8.234   1.00 23.46 ? 242 VAL A CB    1 
ATOM   1803 C  CG1   . VAL A 1 242 ? 4.521   -29.717 7.234   1.00 20.75 ? 242 VAL A CG1   1 
ATOM   1804 C  CG2   . VAL A 1 242 ? 6.116   -31.476 8.044   1.00 25.69 ? 242 VAL A CG2   1 
ATOM   1805 N  N     . PRO A 1 243 ? 2.798   -28.738 10.038  1.00 18.96 ? 243 PRO A N     1 
ATOM   1806 C  CA    . PRO A 1 243 ? 1.411   -28.344 10.303  1.00 18.24 ? 243 PRO A CA    1 
ATOM   1807 C  C     . PRO A 1 243 ? 0.505   -28.741 9.149   1.00 18.08 ? 243 PRO A C     1 
ATOM   1808 O  O     . PRO A 1 243 ? 0.978   -28.967 8.030   1.00 18.26 ? 243 PRO A O     1 
ATOM   1809 C  CB    . PRO A 1 243 ? 1.473   -26.808 10.354  1.00 22.68 ? 243 PRO A CB    1 
ATOM   1810 C  CG    . PRO A 1 243 ? 2.909   -26.432 10.289  1.00 22.38 ? 243 PRO A CG    1 
ATOM   1811 C  CD    . PRO A 1 243 ? 3.659   -27.587 9.732   1.00 21.19 ? 243 PRO A CD    1 
ATOM   1812 N  N     . PRO A 1 244 ? -0.805  -28.811 9.408   1.00 17.81 ? 244 PRO A N     1 
ATOM   1813 C  CA    . PRO A 1 244 ? -1.749  -29.060 8.318   1.00 20.26 ? 244 PRO A CA    1 
ATOM   1814 C  C     . PRO A 1 244 ? -1.795  -27.869 7.365   1.00 18.87 ? 244 PRO A C     1 
ATOM   1815 O  O     . PRO A 1 244 ? -1.399  -26.759 7.747   1.00 22.71 ? 244 PRO A O     1 
ATOM   1816 C  CB    . PRO A 1 244 ? -3.092  -29.227 9.046   1.00 22.29 ? 244 PRO A CB    1 
ATOM   1817 C  CG    . PRO A 1 244 ? -2.910  -28.560 10.363  1.00 26.04 ? 244 PRO A CG    1 
ATOM   1818 C  CD    . PRO A 1 244 ? -1.467  -28.746 10.722  1.00 22.72 ? 244 PRO A CD    1 
ATOM   1819 N  N     . PRO A 1 245 ? -2.254  -28.101 6.124   1.00 23.79 ? 245 PRO A N     1 
ATOM   1820 C  CA    . PRO A 1 245 ? -2.256  -27.053 5.098   1.00 27.91 ? 245 PRO A CA    1 
ATOM   1821 C  C     . PRO A 1 245 ? -3.424  -26.091 5.264   1.00 28.87 ? 245 PRO A C     1 
ATOM   1822 O  O     . PRO A 1 245 ? -4.405  -26.161 4.522   1.00 32.30 ? 245 PRO A O     1 
ATOM   1823 C  CB    . PRO A 1 245 ? -2.381  -27.841 3.789   1.00 29.04 ? 245 PRO A CB    1 
ATOM   1824 C  CG    . PRO A 1 245 ? -3.067  -29.111 4.167   1.00 28.73 ? 245 PRO A CG    1 
ATOM   1825 C  CD    . PRO A 1 245 ? -2.657  -29.414 5.585   1.00 23.10 ? 245 PRO A CD    1 
ATOM   1826 N  N     . VAL A 1 246 ? -3.303  -25.213 6.254   1.00 26.32 ? 246 VAL A N     1 
ATOM   1827 C  CA    . VAL A 1 246 ? -4.280  -24.163 6.506   1.00 30.32 ? 246 VAL A CA    1 
ATOM   1828 C  C     . VAL A 1 246 ? -3.583  -22.817 6.391   1.00 35.44 ? 246 VAL A C     1 
ATOM   1829 O  O     . VAL A 1 246 ? -2.445  -22.665 6.833   1.00 34.76 ? 246 VAL A O     1 
ATOM   1830 C  CB    . VAL A 1 246 ? -4.901  -24.301 7.909   1.00 34.33 ? 246 VAL A CB    1 
ATOM   1831 C  CG1   . VAL A 1 246 ? -5.949  -23.213 8.143   1.00 36.46 ? 246 VAL A CG1   1 
ATOM   1832 C  CG2   . VAL A 1 246 ? -5.515  -25.684 8.073   1.00 45.25 ? 246 VAL A CG2   1 
ATOM   1833 N  N     . LYS A 1 247 ? -4.266  -21.846 5.795   1.00 31.40 ? 247 LYS A N     1 
ATOM   1834 C  CA    . LYS A 1 247 ? -3.676  -20.535 5.538   1.00 35.13 ? 247 LYS A CA    1 
ATOM   1835 C  C     . LYS A 1 247 ? -3.422  -19.732 6.809   1.00 33.61 ? 247 LYS A C     1 
ATOM   1836 O  O     . LYS A 1 247 ? -4.306  -19.570 7.653   1.00 35.01 ? 247 LYS A O     1 
ATOM   1837 C  CB    . LYS A 1 247 ? -4.566  -19.725 4.594   1.00 34.14 ? 247 LYS A CB    1 
ATOM   1838 C  CG    . LYS A 1 247 ? -3.960  -18.400 4.148   1.00 45.02 ? 247 LYS A CG    1 
ATOM   1839 C  CD    . LYS A 1 247 ? -4.977  -17.574 3.373   1.00 60.74 ? 247 LYS A CD    1 
ATOM   1840 C  CE    . LYS A 1 247 ? -5.391  -16.341 4.161   1.00 61.96 ? 247 LYS A CE    1 
ATOM   1841 N  NZ    . LYS A 1 247 ? -6.740  -15.845 3.767   1.00 63.56 ? 247 LYS A NZ    1 
ATOM   1842 N  N     . SER A 1 248 ? -2.206  -19.213 6.929   1.00 30.97 ? 248 SER A N     1 
ATOM   1843 C  CA    . SER A 1 248 ? -1.860  -18.350 8.050   1.00 23.35 ? 248 SER A CA    1 
ATOM   1844 C  C     . SER A 1 248 ? -2.494  -16.978 7.834   1.00 31.09 ? 248 SER A C     1 
ATOM   1845 O  O     . SER A 1 248 ? -2.419  -16.422 6.736   1.00 35.45 ? 248 SER A O     1 
ATOM   1846 C  CB    . SER A 1 248 ? -0.339  -18.225 8.171   1.00 27.91 ? 248 SER A CB    1 
ATOM   1847 O  OG    . SER A 1 248 ? 0.019   -17.129 8.995   1.00 32.09 ? 248 SER A OG    1 
ATOM   1848 N  N     . GLN A 1 249 ? -3.147  -16.456 8.870   1.00 26.14 ? 249 GLN A N     1 
ATOM   1849 C  CA    . GLN A 1 249 ? -3.707  -15.108 8.831   1.00 25.32 ? 249 GLN A CA    1 
ATOM   1850 C  C     . GLN A 1 249 ? -2.666  -14.079 9.284   1.00 28.31 ? 249 GLN A C     1 
ATOM   1851 O  O     . GLN A 1 249 ? -2.570  -12.976 8.735   1.00 28.89 ? 249 GLN A O     1 
ATOM   1852 C  CB    . GLN A 1 249 ? -4.958  -15.027 9.704   1.00 35.72 ? 249 GLN A CB    1 
ATOM   1853 C  CG    . GLN A 1 249 ? -6.113  -15.874 9.196   1.00 38.96 ? 249 GLN A CG    1 
ATOM   1854 C  CD    . GLN A 1 249 ? -6.643  -15.406 7.848   1.00 54.57 ? 249 GLN A CD    1 
ATOM   1855 O  OE1   . GLN A 1 249 ? -7.013  -16.219 6.997   1.00 57.82 ? 249 GLN A OE1   1 
ATOM   1856 N  NE2   . GLN A 1 249 ? -6.696  -14.091 7.654   1.00 49.79 ? 249 GLN A NE2   1 
ATOM   1857 N  N     . SER A 1 250 ? -1.907  -14.451 10.311  1.00 26.91 ? 250 SER A N     1 
ATOM   1858 C  CA    . SER A 1 250 ? -0.876  -13.591 10.882  1.00 23.87 ? 250 SER A CA    1 
ATOM   1859 C  C     . SER A 1 250 ? 0.077   -14.417 11.738  1.00 22.16 ? 250 SER A C     1 
ATOM   1860 O  O     . SER A 1 250 ? -0.346  -15.085 12.675  1.00 29.56 ? 250 SER A O     1 
ATOM   1861 C  CB    . SER A 1 250 ? -1.507  -12.483 11.722  1.00 27.53 ? 250 SER A CB    1 
ATOM   1862 O  OG    . SER A 1 250 ? -0.563  -11.922 12.614  1.00 28.87 ? 250 SER A OG    1 
ATOM   1863 N  N     . THR A 1 251 ? 1.362   -14.364 11.412  1.00 18.64 ? 251 THR A N     1 
ATOM   1864 C  CA    . THR A 1 251 ? 2.360   -15.206 12.068  1.00 18.10 ? 251 THR A CA    1 
ATOM   1865 C  C     . THR A 1 251 ? 2.825   -14.708 13.439  1.00 17.45 ? 251 THR A C     1 
ATOM   1866 O  O     . THR A 1 251 ? 3.526   -15.419 14.151  1.00 22.38 ? 251 THR A O     1 
ATOM   1867 C  CB    . THR A 1 251 ? 3.589   -15.405 11.169  1.00 24.99 ? 251 THR A CB    1 
ATOM   1868 O  OG1   . THR A 1 251 ? 4.108   -14.129 10.784  1.00 30.71 ? 251 THR A OG1   1 
ATOM   1869 C  CG2   . THR A 1 251 ? 3.210   -16.185 9.924   1.00 27.80 ? 251 THR A CG2   1 
ATOM   1870 N  N     . VAL A 1 252 ? 2.439   -13.491 13.802  1.00 19.76 ? 252 VAL A N     1 
ATOM   1871 C  CA    . VAL A 1 252 ? 2.807   -12.930 15.093  1.00 17.03 ? 252 VAL A CA    1 
ATOM   1872 C  C     . VAL A 1 252 ? 2.395   -13.837 16.248  1.00 25.96 ? 252 VAL A C     1 
ATOM   1873 O  O     . VAL A 1 252 ? 1.245   -14.253 16.341  1.00 26.27 ? 252 VAL A O     1 
ATOM   1874 C  CB    . VAL A 1 252 ? 2.173   -11.543 15.301  1.00 21.98 ? 252 VAL A CB    1 
ATOM   1875 C  CG1   . VAL A 1 252 ? 2.559   -10.987 16.657  1.00 23.33 ? 252 VAL A CG1   1 
ATOM   1876 C  CG2   . VAL A 1 252 ? 2.595   -10.598 14.192  1.00 25.40 ? 252 VAL A CG2   1 
ATOM   1877 N  N     . GLY A 1 253 ? 3.347   -14.135 17.125  1.00 20.77 ? 253 GLY A N     1 
ATOM   1878 C  CA    . GLY A 1 253 ? 3.074   -14.925 18.309  1.00 18.39 ? 253 GLY A CA    1 
ATOM   1879 C  C     . GLY A 1 253 ? 3.240   -16.423 18.136  1.00 16.30 ? 253 GLY A C     1 
ATOM   1880 O  O     . GLY A 1 253 ? 3.005   -17.181 19.071  1.00 15.92 ? 253 GLY A O     1 
ATOM   1881 N  N     . ALA A 1 254 ? 3.645   -16.857 16.948  1.00 16.14 ? 254 ALA A N     1 
ATOM   1882 C  CA    . ALA A 1 254 ? 3.784   -18.294 16.689  1.00 14.94 ? 254 ALA A CA    1 
ATOM   1883 C  C     . ALA A 1 254 ? 4.865   -18.919 17.573  1.00 17.42 ? 254 ALA A C     1 
ATOM   1884 O  O     . ALA A 1 254 ? 4.658   -19.986 18.167  1.00 16.40 ? 254 ALA A O     1 
ATOM   1885 C  CB    . ALA A 1 254 ? 4.100   -18.541 15.232  1.00 17.16 ? 254 ALA A CB    1 
ATOM   1886 N  N     . GLY A 1 255 ? 6.018   -18.259 17.640  1.00 19.88 ? 255 GLY A N     1 
ATOM   1887 C  CA    . GLY A 1 255 ? 7.146   -18.770 18.402  1.00 19.54 ? 255 GLY A CA    1 
ATOM   1888 C  C     . GLY A 1 255 ? 6.847   -18.938 19.887  1.00 17.20 ? 255 GLY A C     1 
ATOM   1889 O  O     . GLY A 1 255 ? 7.112   -19.990 20.485  1.00 17.54 ? 255 GLY A O     1 
ATOM   1890 N  N     . ASP A 1 256 ? 6.297   -17.898 20.495  1.00 17.51 ? 256 ASP A N     1 
ATOM   1891 C  CA    . ASP A 1 256 ? 6.013   -17.944 21.922  1.00 20.30 ? 256 ASP A CA    1 
ATOM   1892 C  C     . ASP A 1 256 ? 4.886   -18.924 22.239  1.00 15.61 ? 256 ASP A C     1 
ATOM   1893 O  O     . ASP A 1 256 ? 4.894   -19.560 23.290  1.00 19.68 ? 256 ASP A O     1 
ATOM   1894 C  CB    . ASP A 1 256 ? 5.702   -16.543 22.447  1.00 19.77 ? 256 ASP A CB    1 
ATOM   1895 C  CG    . ASP A 1 256 ? 6.882   -15.595 22.300  1.00 22.04 ? 256 ASP A CG    1 
ATOM   1896 O  OD1   . ASP A 1 256 ? 6.653   -14.379 22.126  1.00 25.56 ? 256 ASP A OD1   1 
ATOM   1897 O  OD2   . ASP A 1 256 ? 8.042   -16.063 22.356  1.00 26.00 ? 256 ASP A OD2   1 
ATOM   1898 N  N     . SER A 1 257 ? 3.924   -19.049 21.330  1.00 16.89 ? 257 SER A N     1 
ATOM   1899 C  CA    . SER A 1 257 ? 2.853   -20.021 21.505  1.00 17.37 ? 257 SER A CA    1 
ATOM   1900 C  C     . SER A 1 257 ? 3.425   -21.427 21.476  1.00 17.03 ? 257 SER A C     1 
ATOM   1901 O  O     . SER A 1 257 ? 3.069   -22.265 22.308  1.00 17.24 ? 257 SER A O     1 
ATOM   1902 C  CB    . SER A 1 257 ? 1.790   -19.873 20.415  1.00 15.45 ? 257 SER A CB    1 
ATOM   1903 O  OG    . SER A 1 257 ? 1.075   -18.656 20.579  1.00 19.08 ? 257 SER A OG    1 
ATOM   1904 N  N     . MET A 1 258 ? 4.305   -21.687 20.513  1.00 16.82 ? 258 MET A N     1 
ATOM   1905 C  CA    . MET A 1 258 ? 4.969   -22.986 20.438  1.00 18.62 ? 258 MET A CA    1 
ATOM   1906 C  C     . MET A 1 258 ? 5.764   -23.293 21.705  1.00 20.09 ? 258 MET A C     1 
ATOM   1907 O  O     . MET A 1 258 ? 5.691   -24.408 22.239  1.00 18.20 ? 258 MET A O     1 
ATOM   1908 C  CB    . MET A 1 258 ? 5.892   -23.055 19.215  1.00 17.15 ? 258 MET A CB    1 
ATOM   1909 C  CG    . MET A 1 258 ? 6.876   -24.217 19.272  1.00 17.45 ? 258 MET A CG    1 
ATOM   1910 S  SD    . MET A 1 258 ? 7.794   -24.411 17.732  1.00 18.80 ? 258 MET A SD    1 
ATOM   1911 C  CE    . MET A 1 258 ? 6.770   -25.613 16.884  1.00 21.99 ? 258 MET A CE    1 
ATOM   1912 N  N     . VAL A 1 259 ? 6.538   -22.321 22.183  1.00 17.67 ? 259 VAL A N     1 
ATOM   1913 C  CA    . VAL A 1 259 ? 7.318   -22.529 23.405  1.00 15.75 ? 259 VAL A CA    1 
ATOM   1914 C  C     . VAL A 1 259 ? 6.432   -22.813 24.618  1.00 20.79 ? 259 VAL A C     1 
ATOM   1915 O  O     . VAL A 1 259 ? 6.732   -23.715 25.413  1.00 19.35 ? 259 VAL A O     1 
ATOM   1916 C  CB    . VAL A 1 259 ? 8.287   -21.361 23.680  1.00 16.13 ? 259 VAL A CB    1 
ATOM   1917 C  CG1   . VAL A 1 259 ? 8.930   -21.508 25.051  1.00 18.78 ? 259 VAL A CG1   1 
ATOM   1918 C  CG2   . VAL A 1 259 ? 9.349   -21.313 22.593  1.00 17.98 ? 259 VAL A CG2   1 
ATOM   1919 N  N     . GLY A 1 260 ? 5.337   -22.064 24.744  1.00 20.07 ? 260 GLY A N     1 
ATOM   1920 C  CA    . GLY A 1 260 ? 4.379   -22.287 25.818  1.00 21.57 ? 260 GLY A CA    1 
ATOM   1921 C  C     . GLY A 1 260 ? 3.847   -23.710 25.811  1.00 19.28 ? 260 GLY A C     1 
ATOM   1922 O  O     . GLY A 1 260 ? 3.800   -24.376 26.853  1.00 21.36 ? 260 GLY A O     1 
ATOM   1923 N  N     . ALA A 1 261 ? 3.476   -24.186 24.627  1.00 17.09 ? 261 ALA A N     1 
ATOM   1924 C  CA    . ALA A 1 261 ? 2.947   -25.540 24.476  1.00 19.56 ? 261 ALA A CA    1 
ATOM   1925 C  C     . ALA A 1 261 ? 3.980   -26.605 24.809  1.00 20.53 ? 261 ALA A C     1 
ATOM   1926 O  O     . ALA A 1 261 ? 3.673   -27.601 25.477  1.00 20.51 ? 261 ALA A O     1 
ATOM   1927 C  CB    . ALA A 1 261 ? 2.422   -25.748 23.065  1.00 19.67 ? 261 ALA A CB    1 
ATOM   1928 N  N     . MET A 1 262 ? 5.200   -26.427 24.313  1.00 20.27 ? 262 MET A N     1 
ATOM   1929 C  CA    . MET A 1 262 ? 6.230   -27.423 24.574  1.00 16.63 ? 262 MET A CA    1 
ATOM   1930 C  C     . MET A 1 262 ? 6.619   -27.448 26.047  1.00 22.36 ? 262 MET A C     1 
ATOM   1931 O  O     . MET A 1 262 ? 6.922   -28.505 26.596  1.00 24.39 ? 262 MET A O     1 
ATOM   1932 C  CB    . MET A 1 262 ? 7.448   -27.219 23.666  1.00 16.32 ? 262 MET A CB    1 
ATOM   1933 C  CG    . MET A 1 262 ? 7.102   -27.472 22.197  1.00 16.62 ? 262 MET A CG    1 
ATOM   1934 S  SD    . MET A 1 262 ? 8.532   -27.614 21.117  1.00 20.93 ? 262 MET A SD    1 
ATOM   1935 C  CE    . MET A 1 262 ? 9.372   -26.051 21.404  1.00 21.81 ? 262 MET A CE    1 
ATOM   1936 N  N     . THR A 1 263 ? 6.577   -26.284 26.688  1.00 23.28 ? 263 THR A N     1 
ATOM   1937 C  CA    . THR A 1 263 ? 6.867   -26.171 28.112  1.00 19.95 ? 263 THR A CA    1 
ATOM   1938 C  C     . THR A 1 263 ? 5.865   -26.976 28.934  1.00 24.59 ? 263 THR A C     1 
ATOM   1939 O  O     . THR A 1 263 ? 6.239   -27.696 29.861  1.00 27.00 ? 263 THR A O     1 
ATOM   1940 C  CB    . THR A 1 263 ? 6.829   -24.700 28.566  1.00 21.20 ? 263 THR A CB    1 
ATOM   1941 O  OG1   . THR A 1 263 ? 7.871   -23.969 27.907  1.00 21.87 ? 263 THR A OG1   1 
ATOM   1942 C  CG2   . THR A 1 263 ? 7.019   -24.594 30.069  1.00 19.73 ? 263 THR A CG2   1 
ATOM   1943 N  N     . LEU A 1 264 ? 4.587   -26.842 28.598  1.00 21.54 ? 264 LEU A N     1 
ATOM   1944 C  CA    . LEU A 1 264 ? 3.546   -27.613 29.273  1.00 21.65 ? 264 LEU A CA    1 
ATOM   1945 C  C     . LEU A 1 264 ? 3.753   -29.110 29.093  1.00 23.80 ? 264 LEU A C     1 
ATOM   1946 O  O     . LEU A 1 264 ? 3.595   -29.882 30.038  1.00 29.72 ? 264 LEU A O     1 
ATOM   1947 C  CB    . LEU A 1 264 ? 2.164   -27.212 28.760  1.00 21.72 ? 264 LEU A CB    1 
ATOM   1948 C  CG    . LEU A 1 264 ? 1.616   -25.917 29.352  1.00 28.70 ? 264 LEU A CG    1 
ATOM   1949 C  CD1   . LEU A 1 264 ? 0.391   -25.454 28.566  1.00 26.39 ? 264 LEU A CD1   1 
ATOM   1950 C  CD2   . LEU A 1 264 ? 1.270   -26.119 30.823  1.00 29.61 ? 264 LEU A CD2   1 
ATOM   1951 N  N     . LYS A 1 265 ? 4.109   -29.520 27.879  1.00 21.75 ? 265 LYS A N     1 
ATOM   1952 C  CA    . LYS A 1 265 ? 4.388   -30.933 27.621  1.00 24.42 ? 265 LYS A CA    1 
ATOM   1953 C  C     . LYS A 1 265 ? 5.606   -31.396 28.401  1.00 26.42 ? 265 LYS A C     1 
ATOM   1954 O  O     . LYS A 1 265 ? 5.646   -32.527 28.898  1.00 29.50 ? 265 LYS A O     1 
ATOM   1955 C  CB    . LYS A 1 265 ? 4.588   -31.199 26.126  1.00 25.10 ? 265 LYS A CB    1 
ATOM   1956 C  CG    . LYS A 1 265 ? 3.293   -31.256 25.320  1.00 29.24 ? 265 LYS A CG    1 
ATOM   1957 C  CD    . LYS A 1 265 ? 2.315   -32.267 25.916  1.00 31.97 ? 265 LYS A CD    1 
ATOM   1958 C  CE    . LYS A 1 265 ? 1.088   -32.453 25.034  1.00 34.03 ? 265 LYS A CE    1 
ATOM   1959 N  NZ    . LYS A 1 265 ? 0.095   -33.373 25.664  1.00 40.93 ? 265 LYS A NZ    1 
ATOM   1960 N  N     . LEU A 1 266 ? 6.602   -30.522 28.510  1.00 25.79 ? 266 LEU A N     1 
ATOM   1961 C  CA    . LEU A 1 266 ? 7.822   -30.855 29.242  1.00 28.30 ? 266 LEU A CA    1 
ATOM   1962 C  C     . LEU A 1 266 ? 7.494   -31.068 30.720  1.00 34.07 ? 266 LEU A C     1 
ATOM   1963 O  O     . LEU A 1 266 ? 8.013   -31.989 31.362  1.00 32.40 ? 266 LEU A O     1 
ATOM   1964 C  CB    . LEU A 1 266 ? 8.866   -29.751 29.060  1.00 33.38 ? 266 LEU A CB    1 
ATOM   1965 C  CG    . LEU A 1 266 ? 10.349  -30.128 29.159  1.00 48.60 ? 266 LEU A CG    1 
ATOM   1966 C  CD1   . LEU A 1 266 ? 10.867  -29.939 30.569  1.00 51.51 ? 266 LEU A CD1   1 
ATOM   1967 C  CD2   . LEU A 1 266 ? 10.583  -31.561 28.699  1.00 53.57 ? 266 LEU A CD2   1 
ATOM   1968 N  N     . ALA A 1 267 ? 6.606   -30.229 31.250  1.00 30.85 ? 267 ALA A N     1 
ATOM   1969 C  CA    . ALA A 1 267 ? 6.183   -30.338 32.645  1.00 29.65 ? 267 ALA A CA    1 
ATOM   1970 C  C     . ALA A 1 267 ? 5.410   -31.627 32.906  1.00 37.08 ? 267 ALA A C     1 
ATOM   1971 O  O     . ALA A 1 267 ? 5.373   -32.119 34.035  1.00 38.11 ? 267 ALA A O     1 
ATOM   1972 C  CB    . ALA A 1 267 ? 5.354   -29.135 33.047  1.00 26.20 ? 267 ALA A CB    1 
ATOM   1973 N  N     . GLU A 1 268 ? 4.795   -32.169 31.861  1.00 33.01 ? 268 GLU A N     1 
ATOM   1974 C  CA    . GLU A 1 268 ? 4.033   -33.411 31.974  1.00 37.82 ? 268 GLU A CA    1 
ATOM   1975 C  C     . GLU A 1 268 ? 4.931   -34.603 31.681  1.00 31.59 ? 268 GLU A C     1 
ATOM   1976 O  O     . GLU A 1 268 ? 4.468   -35.744 31.628  1.00 37.81 ? 268 GLU A O     1 
ATOM   1977 C  CB    . GLU A 1 268 ? 2.845   -33.401 31.006  1.00 40.89 ? 268 GLU A CB    1 
ATOM   1978 C  CG    . GLU A 1 268 ? 1.782   -32.357 31.325  1.00 45.75 ? 268 GLU A CG    1 
ATOM   1979 C  CD    . GLU A 1 268 ? 0.844   -32.093 30.158  1.00 54.25 ? 268 GLU A CD    1 
ATOM   1980 O  OE1   . GLU A 1 268 ? 0.110   -31.081 30.202  1.00 51.01 ? 268 GLU A OE1   1 
ATOM   1981 O  OE2   . GLU A 1 268 ? 0.843   -32.894 29.198  1.00 56.41 ? 268 GLU A OE2   1 
ATOM   1982 N  N     . ASN A 1 269 ? 6.218   -34.319 31.494  1.00 31.00 ? 269 ASN A N     1 
ATOM   1983 C  CA    . ASN A 1 269 ? 7.214   -35.320 31.115  1.00 34.34 ? 269 ASN A CA    1 
ATOM   1984 C  C     . ASN A 1 269 ? 6.829   -36.120 29.867  1.00 33.04 ? 269 ASN A C     1 
ATOM   1985 O  O     . ASN A 1 269 ? 7.012   -37.335 29.811  1.00 36.54 ? 269 ASN A O     1 
ATOM   1986 C  CB    . ASN A 1 269 ? 7.526   -36.255 32.286  1.00 46.15 ? 269 ASN A CB    1 
ATOM   1987 C  CG    . ASN A 1 269 ? 8.922   -36.838 32.204  1.00 62.02 ? 269 ASN A CG    1 
ATOM   1988 O  OD1   . ASN A 1 269 ? 9.115   -37.954 31.720  1.00 67.89 ? 269 ASN A OD1   1 
ATOM   1989 N  ND2   . ASN A 1 269 ? 9.909   -36.075 32.665  1.00 69.28 ? 269 ASN A ND2   1 
ATOM   1990 N  N     . ALA A 1 270 ? 6.306   -35.422 28.864  1.00 26.77 ? 270 ALA A N     1 
ATOM   1991 C  CA    . ALA A 1 270 ? 5.857   -36.059 27.631  1.00 31.49 ? 270 ALA A CA    1 
ATOM   1992 C  C     . ALA A 1 270 ? 7.020   -36.506 26.747  1.00 31.01 ? 270 ALA A C     1 
ATOM   1993 O  O     . ALA A 1 270 ? 8.167   -36.098 26.950  1.00 32.59 ? 270 ALA A O     1 
ATOM   1994 C  CB    . ALA A 1 270 ? 4.926   -35.131 26.857  1.00 33.29 ? 270 ALA A CB    1 
ATOM   1995 N  N     . SER A 1 271 ? 6.710   -37.350 25.766  1.00 29.15 ? 271 SER A N     1 
ATOM   1996 C  CA    . SER A 1 271 ? 7.697   -37.808 24.792  1.00 33.70 ? 271 SER A CA    1 
ATOM   1997 C  C     . SER A 1 271 ? 8.123   -36.641 23.905  1.00 31.59 ? 271 SER A C     1 
ATOM   1998 O  O     . SER A 1 271 ? 7.436   -35.618 23.847  1.00 27.53 ? 271 SER A O     1 
ATOM   1999 C  CB    . SER A 1 271 ? 7.107   -38.917 23.920  1.00 33.80 ? 271 SER A CB    1 
ATOM   2000 O  OG    . SER A 1 271 ? 6.109   -38.398 23.052  1.00 31.42 ? 271 SER A OG    1 
ATOM   2001 N  N     . LEU A 1 272 ? 9.256   -36.786 23.224  1.00 27.54 ? 272 LEU A N     1 
ATOM   2002 C  CA    . LEU A 1 272 ? 9.715   -35.747 22.302  1.00 24.43 ? 272 LEU A CA    1 
ATOM   2003 C  C     . LEU A 1 272 ? 8.665   -35.503 21.220  1.00 26.55 ? 272 LEU A C     1 
ATOM   2004 O  O     . LEU A 1 272 ? 8.379   -34.357 20.861  1.00 27.25 ? 272 LEU A O     1 
ATOM   2005 C  CB    . LEU A 1 272 ? 11.049  -36.144 21.664  1.00 31.26 ? 272 LEU A CB    1 
ATOM   2006 C  CG    . LEU A 1 272 ? 11.614  -35.158 20.639  1.00 32.51 ? 272 LEU A CG    1 
ATOM   2007 C  CD1   . LEU A 1 272 ? 12.142  -33.908 21.317  1.00 35.98 ? 272 LEU A CD1   1 
ATOM   2008 C  CD2   . LEU A 1 272 ? 12.700  -35.809 19.800  1.00 28.03 ? 272 LEU A CD2   1 
ATOM   2009 N  N     . GLU A 1 273 ? 8.083   -36.589 20.716  1.00 27.63 ? 273 GLU A N     1 
ATOM   2010 C  CA    . GLU A 1 273 ? 7.058   -36.501 19.682  1.00 27.75 ? 273 GLU A CA    1 
ATOM   2011 C  C     . GLU A 1 273 ? 5.839   -35.707 20.140  1.00 23.39 ? 273 GLU A C     1 
ATOM   2012 O  O     . GLU A 1 273 ? 5.370   -34.809 19.438  1.00 27.16 ? 273 GLU A O     1 
ATOM   2013 C  CB    . GLU A 1 273 ? 6.633   -37.897 19.227  1.00 37.65 ? 273 GLU A CB    1 
ATOM   2014 C  CG    . GLU A 1 273 ? 5.425   -37.887 18.313  1.00 42.19 ? 273 GLU A CG    1 
ATOM   2015 C  CD    . GLU A 1 273 ? 5.377   -39.096 17.405  1.00 52.05 ? 273 GLU A CD    1 
ATOM   2016 O  OE1   . GLU A 1 273 ? 4.628   -40.047 17.716  1.00 49.72 ? 273 GLU A OE1   1 
ATOM   2017 O  OE2   . GLU A 1 273 ? 6.090   -39.091 16.378  1.00 47.80 ? 273 GLU A OE2   1 
ATOM   2018 N  N     . GLU A 1 274 ? 5.340   -36.034 21.326  1.00 22.09 ? 274 GLU A N     1 
ATOM   2019 C  CA    . GLU A 1 274 ? 4.159   -35.374 21.862  1.00 24.57 ? 274 GLU A CA    1 
ATOM   2020 C  C     . GLU A 1 274 ? 4.452   -33.895 22.088  1.00 24.53 ? 274 GLU A C     1 
ATOM   2021 O  O     . GLU A 1 274 ? 3.621   -33.029 21.802  1.00 22.45 ? 274 GLU A O     1 
ATOM   2022 C  CB    . GLU A 1 274 ? 3.736   -36.048 23.170  1.00 30.90 ? 274 GLU A CB    1 
ATOM   2023 C  CG    . GLU A 1 274 ? 2.404   -35.576 23.713  1.00 47.43 ? 274 GLU A CG    1 
ATOM   2024 C  CD    . GLU A 1 274 ? 1.788   -36.569 24.683  1.00 58.90 ? 274 GLU A CD    1 
ATOM   2025 O  OE1   . GLU A 1 274 ? 2.035   -37.786 24.527  1.00 62.62 ? 274 GLU A OE1   1 
ATOM   2026 O  OE2   . GLU A 1 274 ? 1.059   -36.132 25.598  1.00 58.86 ? 274 GLU A OE2   1 
ATOM   2027 N  N     . MET A 1 275 ? 5.656   -33.616 22.584  1.00 22.11 ? 275 MET A N     1 
ATOM   2028 C  CA    . MET A 1 275 ? 6.087   -32.244 22.821  1.00 21.21 ? 275 MET A CA    1 
ATOM   2029 C  C     . MET A 1 275 ? 6.136   -31.419 21.530  1.00 22.34 ? 275 MET A C     1 
ATOM   2030 O  O     . MET A 1 275 ? 5.606   -30.310 21.480  1.00 22.26 ? 275 MET A O     1 
ATOM   2031 C  CB    . MET A 1 275 ? 7.458   -32.238 23.500  1.00 24.75 ? 275 MET A CB    1 
ATOM   2032 C  CG    . MET A 1 275 ? 7.931   -30.863 23.907  1.00 25.52 ? 275 MET A CG    1 
ATOM   2033 S  SD    . MET A 1 275 ? 9.627   -30.911 24.497  1.00 30.05 ? 275 MET A SD    1 
ATOM   2034 C  CE    . MET A 1 275 ? 10.497  -31.264 22.979  1.00 41.77 ? 275 MET A CE    1 
ATOM   2035 N  N     . VAL A 1 276 ? 6.774   -31.952 20.492  1.00 21.11 ? 276 VAL A N     1 
ATOM   2036 C  CA    . VAL A 1 276 ? 6.911   -31.216 19.232  1.00 20.16 ? 276 VAL A CA    1 
ATOM   2037 C  C     . VAL A 1 276 ? 5.563   -31.078 18.528  1.00 21.44 ? 276 VAL A C     1 
ATOM   2038 O  O     . VAL A 1 276 ? 5.242   -30.020 17.973  1.00 18.95 ? 276 VAL A O     1 
ATOM   2039 C  CB    . VAL A 1 276 ? 7.972   -31.856 18.295  1.00 21.19 ? 276 VAL A CB    1 
ATOM   2040 C  CG1   . VAL A 1 276 ? 8.011   -31.151 16.947  1.00 20.41 ? 276 VAL A CG1   1 
ATOM   2041 C  CG2   . VAL A 1 276 ? 9.358   -31.814 18.952  1.00 23.35 ? 276 VAL A CG2   1 
ATOM   2042 N  N     . ARG A 1 277 ? 4.761   -32.136 18.570  1.00 19.19 ? 277 ARG A N     1 
ATOM   2043 C  CA    . ARG A 1 277 ? 3.432   -32.075 17.976  1.00 21.86 ? 277 ARG A CA    1 
ATOM   2044 C  C     . ARG A 1 277 ? 2.584   -30.974 18.605  1.00 24.89 ? 277 ARG A C     1 
ATOM   2045 O  O     . ARG A 1 277 ? 1.948   -30.205 17.898  1.00 23.68 ? 277 ARG A O     1 
ATOM   2046 C  CB    . ARG A 1 277 ? 2.701   -33.406 18.116  1.00 24.45 ? 277 ARG A CB    1 
ATOM   2047 C  CG    . ARG A 1 277 ? 3.183   -34.484 17.185  1.00 22.36 ? 277 ARG A CG    1 
ATOM   2048 C  CD    . ARG A 1 277 ? 2.206   -35.661 17.216  1.00 23.65 ? 277 ARG A CD    1 
ATOM   2049 N  NE    . ARG A 1 277 ? 2.754   -36.894 16.654  1.00 43.94 ? 277 ARG A NE    1 
ATOM   2050 C  CZ    . ARG A 1 277 ? 3.055   -37.074 15.371  1.00 62.69 ? 277 ARG A CZ    1 
ATOM   2051 N  NH1   . ARG A 1 277 ? 2.879   -36.095 14.491  1.00 68.78 ? 277 ARG A NH1   1 
ATOM   2052 N  NH2   . ARG A 1 277 ? 3.542   -38.239 14.966  1.00 67.96 ? 277 ARG A NH2   1 
ATOM   2053 N  N     . PHE A 1 278 ? 2.572   -30.912 19.933  1.00 19.77 ? 278 PHE A N     1 
ATOM   2054 C  CA    . PHE A 1 278 ? 1.779   -29.913 20.633  1.00 23.52 ? 278 PHE A CA    1 
ATOM   2055 C  C     . PHE A 1 278 ? 2.353   -28.525 20.366  1.00 16.67 ? 278 PHE A C     1 
ATOM   2056 O  O     . PHE A 1 278 ? 1.609   -27.554 20.213  1.00 18.05 ? 278 PHE A O     1 
ATOM   2057 C  CB    . PHE A 1 278 ? 1.753   -30.206 22.134  1.00 24.50 ? 278 PHE A CB    1 
ATOM   2058 C  CG    . PHE A 1 278 ? 0.656   -29.497 22.873  1.00 21.84 ? 278 PHE A CG    1 
ATOM   2059 C  CD1   . PHE A 1 278 ? -0.666  -29.656 22.490  1.00 26.30 ? 278 PHE A CD1   1 
ATOM   2060 C  CD2   . PHE A 1 278 ? 0.940   -28.692 23.968  1.00 21.16 ? 278 PHE A CD2   1 
ATOM   2061 C  CE1   . PHE A 1 278 ? -1.687  -29.011 23.172  1.00 26.97 ? 278 PHE A CE1   1 
ATOM   2062 C  CE2   . PHE A 1 278 ? -0.084  -28.039 24.656  1.00 20.99 ? 278 PHE A CE2   1 
ATOM   2063 C  CZ    . PHE A 1 278 ? -1.394  -28.200 24.256  1.00 26.66 ? 278 PHE A CZ    1 
ATOM   2064 N  N     . GLY A 1 279 ? 3.680   -28.440 20.283  1.00 18.39 ? 279 GLY A N     1 
ATOM   2065 C  CA    . GLY A 1 279 ? 4.343   -27.189 19.942  1.00 18.20 ? 279 GLY A CA    1 
ATOM   2066 C  C     . GLY A 1 279 ? 3.930   -26.676 18.568  1.00 20.06 ? 279 GLY A C     1 
ATOM   2067 O  O     . GLY A 1 279 ? 3.600   -25.497 18.404  1.00 18.37 ? 279 GLY A O     1 
ATOM   2068 N  N     . VAL A 1 280 ? 3.966   -27.551 17.567  1.00 15.79 ? 280 VAL A N     1 
ATOM   2069 C  CA    . VAL A 1 280 ? 3.545   -27.166 16.224  1.00 15.44 ? 280 VAL A CA    1 
ATOM   2070 C  C     . VAL A 1 280 ? 2.063   -26.798 16.207  1.00 18.09 ? 280 VAL A C     1 
ATOM   2071 O  O     . VAL A 1 280 ? 1.669   -25.827 15.554  1.00 15.95 ? 280 VAL A O     1 
ATOM   2072 C  CB    . VAL A 1 280 ? 3.851   -28.270 15.182  1.00 15.98 ? 280 VAL A CB    1 
ATOM   2073 C  CG1   . VAL A 1 280 ? 3.057   -28.045 13.888  1.00 16.72 ? 280 VAL A CG1   1 
ATOM   2074 C  CG2   . VAL A 1 280 ? 5.342   -28.297 14.893  1.00 18.31 ? 280 VAL A CG2   1 
ATOM   2075 N  N     . ALA A 1 281 ? 1.247   -27.566 16.927  1.00 18.15 ? 281 ALA A N     1 
ATOM   2076 C  CA    . ALA A 1 281 ? -0.186  -27.273 16.991  1.00 16.31 ? 281 ALA A CA    1 
ATOM   2077 C  C     . ALA A 1 281 ? -0.450  -25.869 17.530  1.00 15.98 ? 281 ALA A C     1 
ATOM   2078 O  O     . ALA A 1 281 ? -1.254  -25.123 16.964  1.00 18.69 ? 281 ALA A O     1 
ATOM   2079 C  CB    . ALA A 1 281 ? -0.934  -28.327 17.820  1.00 18.14 ? 281 ALA A CB    1 
ATOM   2080 N  N     . ALA A 1 282 ? 0.227   -25.506 18.615  1.00 16.88 ? 282 ALA A N     1 
ATOM   2081 C  CA    . ALA A 1 282 ? 0.034   -24.183 19.210  1.00 15.56 ? 282 ALA A CA    1 
ATOM   2082 C  C     . ALA A 1 282 ? 0.634   -23.077 18.352  1.00 21.15 ? 282 ALA A C     1 
ATOM   2083 O  O     . ALA A 1 282 ? 0.033   -22.008 18.189  1.00 17.82 ? 282 ALA A O     1 
ATOM   2084 C  CB    . ALA A 1 282 ? 0.616   -24.137 20.612  1.00 15.59 ? 282 ALA A CB    1 
ATOM   2085 N  N     . GLY A 1 283 ? 1.840   -23.311 17.834  1.00 15.57 ? 283 GLY A N     1 
ATOM   2086 C  CA    . GLY A 1 283 ? 2.476   -22.339 16.963  1.00 14.69 ? 283 GLY A CA    1 
ATOM   2087 C  C     . GLY A 1 283 ? 1.599   -22.019 15.756  1.00 18.99 ? 283 GLY A C     1 
ATOM   2088 O  O     . GLY A 1 283 ? 1.381   -20.858 15.409  1.00 18.05 ? 283 GLY A O     1 
ATOM   2089 N  N     . SER A 1 284 ? 1.088   -23.063 15.113  1.00 17.38 ? 284 SER A N     1 
ATOM   2090 C  CA    . SER A 1 284 ? 0.264   -22.880 13.929  1.00 16.11 ? 284 SER A CA    1 
ATOM   2091 C  C     . SER A 1 284 ? -1.130  -22.356 14.291  1.00 17.07 ? 284 SER A C     1 
ATOM   2092 O  O     . SER A 1 284 ? -1.727  -21.599 13.527  1.00 18.02 ? 284 SER A O     1 
ATOM   2093 C  CB    . SER A 1 284 ? 0.200   -24.175 13.117  1.00 16.36 ? 284 SER A CB    1 
ATOM   2094 O  OG    . SER A 1 284 ? 1.495   -24.530 12.634  1.00 19.20 ? 284 SER A OG    1 
ATOM   2095 N  N     . ALA A 1 285 ? -1.630  -22.730 15.465  1.00 16.58 ? 285 ALA A N     1 
ATOM   2096 C  CA    . ALA A 1 285 ? -2.900  -22.187 15.939  1.00 16.56 ? 285 ALA A CA    1 
ATOM   2097 C  C     . ALA A 1 285 ? -2.774  -20.677 16.095  1.00 21.43 ? 285 ALA A C     1 
ATOM   2098 O  O     . ALA A 1 285 ? -3.699  -19.933 15.763  1.00 19.33 ? 285 ALA A O     1 
ATOM   2099 C  CB    . ALA A 1 285 ? -3.298  -22.825 17.261  1.00 21.33 ? 285 ALA A CB    1 
ATOM   2100 N  N     . ALA A 1 286 ? -1.626  -20.213 16.571  1.00 16.83 ? 286 ALA A N     1 
ATOM   2101 C  CA    . ALA A 1 286 ? -1.411  -18.781 16.718  1.00 18.82 ? 286 ALA A CA    1 
ATOM   2102 C  C     . ALA A 1 286 ? -1.576  -18.048 15.388  1.00 18.23 ? 286 ALA A C     1 
ATOM   2103 O  O     . ALA A 1 286 ? -2.093  -16.938 15.348  1.00 25.12 ? 286 ALA A O     1 
ATOM   2104 C  CB    . ALA A 1 286 ? -0.042  -18.503 17.310  1.00 16.52 ? 286 ALA A CB    1 
ATOM   2105 N  N     . THR A 1 287 ? -1.131  -18.672 14.303  1.00 17.67 ? 287 THR A N     1 
ATOM   2106 C  CA    . THR A 1 287 ? -1.167  -18.029 12.995  1.00 22.41 ? 287 THR A CA    1 
ATOM   2107 C  C     . THR A 1 287 ? -2.578  -17.874 12.438  1.00 21.09 ? 287 THR A C     1 
ATOM   2108 O  O     . THR A 1 287 ? -2.782  -17.157 11.462  1.00 21.18 ? 287 THR A O     1 
ATOM   2109 C  CB    . THR A 1 287 ? -0.304  -18.772 11.956  1.00 24.16 ? 287 THR A CB    1 
ATOM   2110 O  OG1   . THR A 1 287 ? -0.973  -19.968 11.542  1.00 22.53 ? 287 THR A OG1   1 
ATOM   2111 C  CG2   . THR A 1 287 ? 1.053   -19.119 12.537  1.00 24.04 ? 287 THR A CG2   1 
ATOM   2112 N  N     . LEU A 1 288 ? -3.547  -18.547 13.050  1.00 19.89 ? 288 LEU A N     1 
ATOM   2113 C  CA    . LEU A 1 288 ? -4.927  -18.476 12.563  1.00 19.82 ? 288 LEU A CA    1 
ATOM   2114 C  C     . LEU A 1 288 ? -5.645  -17.205 13.004  1.00 30.41 ? 288 LEU A C     1 
ATOM   2115 O  O     . LEU A 1 288 ? -6.647  -16.805 12.415  1.00 29.09 ? 288 LEU A O     1 
ATOM   2116 C  CB    . LEU A 1 288 ? -5.728  -19.689 13.034  1.00 21.26 ? 288 LEU A CB    1 
ATOM   2117 C  CG    . LEU A 1 288 ? -5.124  -21.022 12.620  1.00 24.93 ? 288 LEU A CG    1 
ATOM   2118 C  CD1   . LEU A 1 288 ? -5.951  -22.174 13.185  1.00 27.66 ? 288 LEU A CD1   1 
ATOM   2119 C  CD2   . LEU A 1 288 ? -5.029  -21.093 11.101  1.00 31.42 ? 288 LEU A CD2   1 
ATOM   2120 N  N     . ASN A 1 289 ? -5.114  -16.593 14.060  1.00 30.98 ? 289 ASN A N     1 
ATOM   2121 C  CA    . ASN A 1 289 ? -5.670  -15.377 14.639  1.00 38.93 ? 289 ASN A CA    1 
ATOM   2122 C  C     . ASN A 1 289 ? -4.974  -14.132 14.116  1.00 50.69 ? 289 ASN A C     1 
ATOM   2123 O  O     . ASN A 1 289 ? -3.762  -14.123 13.921  1.00 60.34 ? 289 ASN A O     1 
ATOM   2124 C  CB    . ASN A 1 289 ? -5.563  -15.413 16.165  1.00 35.44 ? 289 ASN A CB    1 
ATOM   2125 C  CG    . ASN A 1 289 ? -6.312  -16.575 16.775  1.00 43.38 ? 289 ASN A CG    1 
ATOM   2126 O  OD1   . ASN A 1 289 ? -7.308  -17.041 16.227  1.00 42.30 ? 289 ASN A OD1   1 
ATOM   2127 N  ND2   . ASN A 1 289 ? -5.838  -17.048 17.919  1.00 30.67 ? 289 ASN A ND2   1 
ATOM   2128 N  N     . GLN A 1 290 ? -5.754  -13.082 13.885  1.00 32.76 ? 290 GLN A N     1 
ATOM   2129 C  CA    . GLN A 1 290 ? -5.227  -11.843 13.333  1.00 32.63 ? 290 GLN A CA    1 
ATOM   2130 C  C     . GLN A 1 290 ? -4.366  -11.091 14.338  1.00 31.83 ? 290 GLN A C     1 
ATOM   2131 O  O     . GLN A 1 290 ? -4.525  -11.238 15.546  1.00 30.31 ? 290 GLN A O     1 
ATOM   2132 C  CB    . GLN A 1 290 ? -6.370  -10.945 12.855  1.00 41.96 ? 290 GLN A CB    1 
ATOM   2133 N  N     . GLY A 1 291 ? -3.450  -10.281 13.824  1.00 32.26 ? 291 GLY A N     1 
ATOM   2134 C  CA    . GLY A 1 291 ? -2.603  -9.463  14.667  1.00 35.99 ? 291 GLY A CA    1 
ATOM   2135 C  C     . GLY A 1 291 ? -1.733  -10.252 15.622  1.00 43.45 ? 291 GLY A C     1 
ATOM   2136 O  O     . GLY A 1 291 ? -1.173  -11.285 15.263  1.00 63.60 ? 291 GLY A O     1 
ATOM   2137 N  N     . THR A 1 292 ? -1.626  -9.757  16.849  1.00 26.73 ? 292 THR A N     1 
ATOM   2138 C  CA    . THR A 1 292 ? -0.702  -10.302 17.836  1.00 27.11 ? 292 THR A CA    1 
ATOM   2139 C  C     . THR A 1 292 ? -1.288  -11.405 18.717  1.00 29.57 ? 292 THR A C     1 
ATOM   2140 O  O     . THR A 1 292 ? -0.601  -11.932 19.586  1.00 27.55 ? 292 THR A O     1 
ATOM   2141 C  CB    . THR A 1 292 ? -0.173  -9.188  18.753  1.00 28.44 ? 292 THR A CB    1 
ATOM   2142 O  OG1   . THR A 1 292 ? -1.272  -8.571  19.431  1.00 29.38 ? 292 THR A OG1   1 
ATOM   2143 C  CG2   . THR A 1 292 ? 0.568   -8.138  17.941  1.00 35.45 ? 292 THR A CG2   1 
ATOM   2144 N  N     . ARG A 1 293 ? -2.552  -11.748 18.494  1.00 24.72 ? 293 ARG A N     1 
ATOM   2145 C  CA    . ARG A 1 293 ? -3.227  -12.755 19.293  1.00 29.49 ? 293 ARG A CA    1 
ATOM   2146 C  C     . ARG A 1 293 ? -2.490  -14.081 19.236  1.00 26.90 ? 293 ARG A C     1 
ATOM   2147 O  O     . ARG A 1 293 ? -2.086  -14.534 18.168  1.00 39.09 ? 293 ARG A O     1 
ATOM   2148 C  CB    . ARG A 1 293 ? -4.667  -12.933 18.809  1.00 35.55 ? 293 ARG A CB    1 
ATOM   2149 C  CG    . ARG A 1 293 ? -5.463  -11.642 18.772  1.00 44.50 ? 293 ARG A CG    1 
ATOM   2150 C  CD    . ARG A 1 293 ? -6.775  -11.815 18.028  1.00 61.64 ? 293 ARG A CD    1 
ATOM   2151 N  NE    . ARG A 1 293 ? -7.597  -12.875 18.604  1.00 75.32 ? 293 ARG A NE    1 
ATOM   2152 C  CZ    . ARG A 1 293 ? -8.536  -13.537 17.937  1.00 81.58 ? 293 ARG A CZ    1 
ATOM   2153 N  NH1   . ARG A 1 293 ? -8.775  -13.253 16.662  1.00 82.22 ? 293 ARG A NH1   1 
ATOM   2154 N  NH2   . ARG A 1 293 ? -9.234  -14.487 18.543  1.00 82.00 ? 293 ARG A NH2   1 
ATOM   2155 N  N     . LEU A 1 294 ? -2.318  -14.694 20.398  1.00 24.63 ? 294 LEU A N     1 
ATOM   2156 C  CA    . LEU A 1 294 ? -1.621  -15.964 20.491  1.00 20.64 ? 294 LEU A CA    1 
ATOM   2157 C  C     . LEU A 1 294 ? -2.563  -17.119 20.197  1.00 21.80 ? 294 LEU A C     1 
ATOM   2158 O  O     . LEU A 1 294 ? -3.693  -16.919 19.763  1.00 26.43 ? 294 LEU A O     1 
ATOM   2159 C  CB    . LEU A 1 294 ? -0.999  -16.126 21.877  1.00 26.57 ? 294 LEU A CB    1 
ATOM   2160 C  CG    . LEU A 1 294 ? -0.184  -14.924 22.352  1.00 25.98 ? 294 LEU A CG    1 
ATOM   2161 C  CD1   . LEU A 1 294 ? 0.197   -15.066 23.813  1.00 25.12 ? 294 LEU A CD1   1 
ATOM   2162 C  CD2   . LEU A 1 294 ? 1.050   -14.750 21.488  1.00 24.04 ? 294 LEU A CD2   1 
ATOM   2163 N  N     . CYS A 1 295 ? -2.082  -18.330 20.436  1.00 20.69 ? 295 CYS A N     1 
ATOM   2164 C  CA    . CYS A 1 295 ? -2.866  -19.540 20.201  1.00 24.75 ? 295 CYS A CA    1 
ATOM   2165 C  C     . CYS A 1 295 ? -4.102  -19.636 21.101  1.00 22.82 ? 295 CYS A C     1 
ATOM   2166 O  O     . CYS A 1 295 ? -4.064  -19.238 22.269  1.00 22.85 ? 295 CYS A O     1 
ATOM   2167 C  CB    . CYS A 1 295 ? -1.985  -20.770 20.445  1.00 23.22 ? 295 CYS A CB    1 
ATOM   2168 S  SG    . CYS A 1 295 ? -1.286  -20.844 22.130  1.00 24.38 ? 295 CYS A SG    1 
ATOM   2169 N  N     . SER A 1 296 ? -5.197  -20.170 20.561  1.00 21.45 ? 296 SER A N     1 
ATOM   2170 C  CA    . SER A 1 296 ? -6.369  -20.473 21.371  1.00 22.71 ? 296 SER A CA    1 
ATOM   2171 C  C     . SER A 1 296 ? -6.378  -21.963 21.695  1.00 22.50 ? 296 SER A C     1 
ATOM   2172 O  O     . SER A 1 296 ? -5.865  -22.774 20.925  1.00 25.70 ? 296 SER A O     1 
ATOM   2173 C  CB    . SER A 1 296 ? -7.660  -20.100 20.639  1.00 28.00 ? 296 SER A CB    1 
ATOM   2174 O  OG    . SER A 1 296 ? -7.897  -20.990 19.563  1.00 28.67 ? 296 SER A OG    1 
ATOM   2175 N  N     . HIS A 1 297 ? -6.973  -22.320 22.828  1.00 23.59 ? 297 HIS A N     1 
ATOM   2176 C  CA    . HIS A 1 297 ? -7.056  -23.724 23.232  1.00 24.52 ? 297 HIS A CA    1 
ATOM   2177 C  C     . HIS A 1 297 ? -7.711  -24.622 22.183  1.00 23.58 ? 297 HIS A C     1 
ATOM   2178 O  O     . HIS A 1 297 ? -7.194  -25.697 21.865  1.00 24.21 ? 297 HIS A O     1 
ATOM   2179 C  CB    . HIS A 1 297 ? -7.794  -23.867 24.567  1.00 27.60 ? 297 HIS A CB    1 
ATOM   2180 C  CG    . HIS A 1 297 ? -8.020  -25.291 24.980  1.00 40.00 ? 297 HIS A CG    1 
ATOM   2181 N  ND1   . HIS A 1 297 ? -9.072  -26.044 24.506  1.00 45.03 ? 297 HIS A ND1   1 
ATOM   2182 C  CD2   . HIS A 1 297 ? -7.324  -26.098 25.815  1.00 50.75 ? 297 HIS A CD2   1 
ATOM   2183 C  CE1   . HIS A 1 297 ? -9.016  -27.256 25.032  1.00 50.64 ? 297 HIS A CE1   1 
ATOM   2184 N  NE2   . HIS A 1 297 ? -7.965  -27.314 25.832  1.00 52.28 ? 297 HIS A NE2   1 
ATOM   2185 N  N     . ASP A 1 298 ? -8.852  -24.188 21.657  1.00 27.88 ? 298 ASP A N     1 
ATOM   2186 C  CA    . ASP A 1 298 ? -9.623  -25.021 20.738  1.00 29.59 ? 298 ASP A CA    1 
ATOM   2187 C  C     . ASP A 1 298 ? -8.908  -25.263 19.413  1.00 25.63 ? 298 ASP A C     1 
ATOM   2188 O  O     . ASP A 1 298 ? -8.915  -26.385 18.906  1.00 25.11 ? 298 ASP A O     1 
ATOM   2189 C  CB    . ASP A 1 298 ? -11.012 -24.433 20.497  1.00 28.54 ? 298 ASP A CB    1 
ATOM   2190 C  CG    . ASP A 1 298 ? -11.871 -24.438 21.748  1.00 42.04 ? 298 ASP A CG    1 
ATOM   2191 O  OD1   . ASP A 1 298 ? -11.424 -24.983 22.782  1.00 34.55 ? 298 ASP A OD1   1 
ATOM   2192 O  OD2   . ASP A 1 298 ? -13.000 -23.904 21.694  1.00 47.14 ? 298 ASP A OD2   1 
ATOM   2193 N  N     . ASP A 1 299 ? -8.299  -24.221 18.853  1.00 23.02 ? 299 ASP A N     1 
ATOM   2194 C  CA    . ASP A 1 299 ? -7.554  -24.372 17.601  1.00 24.06 ? 299 ASP A CA    1 
ATOM   2195 C  C     . ASP A 1 299 ? -6.346  -25.279 17.806  1.00 25.55 ? 299 ASP A C     1 
ATOM   2196 O  O     . ASP A 1 299 ? -6.035  -26.115 16.956  1.00 23.44 ? 299 ASP A O     1 
ATOM   2197 C  CB    . ASP A 1 299 ? -7.091  -23.014 17.066  1.00 23.29 ? 299 ASP A CB    1 
ATOM   2198 C  CG    . ASP A 1 299 ? -8.231  -22.160 16.553  1.00 32.50 ? 299 ASP A CG    1 
ATOM   2199 O  OD1   . ASP A 1 299 ? -9.293  -22.719 16.201  1.00 36.74 ? 299 ASP A OD1   1 
ATOM   2200 O  OD2   . ASP A 1 299 ? -8.049  -20.920 16.495  1.00 30.31 ? 299 ASP A OD2   1 
ATOM   2201 N  N     . THR A 1 300 ? -5.667  -25.115 18.937  1.00 21.03 ? 300 THR A N     1 
ATOM   2202 C  CA    . THR A 1 300 ? -4.494  -25.938 19.236  1.00 20.62 ? 300 THR A CA    1 
ATOM   2203 C  C     . THR A 1 300 ? -4.907  -27.403 19.368  1.00 21.24 ? 300 THR A C     1 
ATOM   2204 O  O     . THR A 1 300 ? -4.258  -28.298 18.823  1.00 21.32 ? 300 THR A O     1 
ATOM   2205 C  CB    . THR A 1 300 ? -3.775  -25.454 20.519  1.00 21.18 ? 300 THR A CB    1 
ATOM   2206 O  OG1   . THR A 1 300 ? -3.387  -24.077 20.364  1.00 19.33 ? 300 THR A OG1   1 
ATOM   2207 C  CG2   . THR A 1 300 ? -2.539  -26.301 20.807  1.00 23.19 ? 300 THR A CG2   1 
ATOM   2208 N  N     . GLN A 1 301 ? -6.008  -27.643 20.074  1.00 21.92 ? 301 GLN A N     1 
ATOM   2209 C  CA    . GLN A 1 301 ? -6.525  -28.999 20.236  1.00 26.03 ? 301 GLN A CA    1 
ATOM   2210 C  C     . GLN A 1 301 ? -6.874  -29.639 18.900  1.00 27.07 ? 301 GLN A C     1 
ATOM   2211 O  O     . GLN A 1 301 ? -6.576  -30.810 18.673  1.00 22.95 ? 301 GLN A O     1 
ATOM   2212 C  CB    . GLN A 1 301 ? -7.749  -29.007 21.156  1.00 23.66 ? 301 GLN A CB    1 
ATOM   2213 C  CG    . GLN A 1 301 ? -8.422  -30.366 21.269  1.00 42.59 ? 301 GLN A CG    1 
ATOM   2214 C  CD    . GLN A 1 301 ? -9.432  -30.429 22.401  1.00 61.16 ? 301 GLN A CD    1 
ATOM   2215 O  OE1   . GLN A 1 301 ? -9.970  -29.406 22.830  1.00 67.17 ? 301 GLN A OE1   1 
ATOM   2216 N  NE2   . GLN A 1 301 ? -9.687  -31.635 22.899  1.00 68.37 ? 301 GLN A NE2   1 
ATOM   2217 N  N     . LYS A 1 302 ? -7.502  -28.864 18.020  1.00 22.35 ? 302 LYS A N     1 
ATOM   2218 C  CA    . LYS A 1 302 ? -7.923  -29.369 16.711  1.00 21.89 ? 302 LYS A CA    1 
ATOM   2219 C  C     . LYS A 1 302 ? -6.720  -29.772 15.861  1.00 21.13 ? 302 LYS A C     1 
ATOM   2220 O  O     . LYS A 1 302 ? -6.700  -30.847 15.252  1.00 23.02 ? 302 LYS A O     1 
ATOM   2221 C  CB    . LYS A 1 302 ? -8.749  -28.309 15.975  1.00 25.79 ? 302 LYS A CB    1 
ATOM   2222 C  CG    . LYS A 1 302 ? -9.296  -28.764 14.623  1.00 28.78 ? 302 LYS A CG    1 
ATOM   2223 C  CD    . LYS A 1 302 ? -9.860  -27.586 13.825  1.00 37.42 ? 302 LYS A CD    1 
ATOM   2224 C  CE    . LYS A 1 302 ? -11.004 -26.906 14.564  1.00 36.89 ? 302 LYS A CE    1 
ATOM   2225 N  NZ    . LYS A 1 302 ? -11.604 -25.781 13.777  1.00 43.02 ? 302 LYS A NZ    1 
ATOM   2226 N  N     . ILE A 1 303 ? -5.718  -28.901 15.817  1.00 21.66 ? 303 ILE A N     1 
ATOM   2227 C  CA    . ILE A 1 303 ? -4.503  -29.201 15.064  1.00 21.68 ? 303 ILE A CA    1 
ATOM   2228 C  C     . ILE A 1 303 ? -3.761  -30.390 15.683  1.00 21.37 ? 303 ILE A C     1 
ATOM   2229 O  O     . ILE A 1 303 ? -3.328  -31.299 14.972  1.00 20.29 ? 303 ILE A O     1 
ATOM   2230 C  CB    . ILE A 1 303 ? -3.574  -27.976 14.963  1.00 19.72 ? 303 ILE A CB    1 
ATOM   2231 C  CG1   . ILE A 1 303 ? -4.260  -26.866 14.160  1.00 23.68 ? 303 ILE A CG1   1 
ATOM   2232 C  CG2   . ILE A 1 303 ? -2.248  -28.372 14.300  1.00 17.73 ? 303 ILE A CG2   1 
ATOM   2233 C  CD1   . ILE A 1 303 ? -3.589  -25.500 14.269  1.00 24.63 ? 303 ILE A CD1   1 
ATOM   2234 N  N     . TYR A 1 304 ? -3.635  -30.396 17.008  1.00 19.31 ? 304 TYR A N     1 
ATOM   2235 C  CA    . TYR A 1 304 ? -2.972  -31.504 17.690  1.00 24.86 ? 304 TYR A CA    1 
ATOM   2236 C  C     . TYR A 1 304 ? -3.651  -32.848 17.412  1.00 29.28 ? 304 TYR A C     1 
ATOM   2237 O  O     . TYR A 1 304 ? -2.976  -33.849 17.185  1.00 25.16 ? 304 TYR A O     1 
ATOM   2238 C  CB    . TYR A 1 304 ? -2.879  -31.243 19.196  1.00 21.32 ? 304 TYR A CB    1 
ATOM   2239 C  CG    . TYR A 1 304 ? -2.195  -32.349 19.965  1.00 22.44 ? 304 TYR A CG    1 
ATOM   2240 C  CD1   . TYR A 1 304 ? -0.812  -32.486 19.944  1.00 24.61 ? 304 TYR A CD1   1 
ATOM   2241 C  CD2   . TYR A 1 304 ? -2.936  -33.260 20.712  1.00 35.01 ? 304 TYR A CD2   1 
ATOM   2242 C  CE1   . TYR A 1 304 ? -0.183  -33.498 20.648  1.00 27.26 ? 304 TYR A CE1   1 
ATOM   2243 C  CE2   . TYR A 1 304 ? -2.319  -34.275 21.419  1.00 42.52 ? 304 TYR A CE2   1 
ATOM   2244 C  CZ    . TYR A 1 304 ? -0.945  -34.390 21.385  1.00 35.84 ? 304 TYR A CZ    1 
ATOM   2245 O  OH    . TYR A 1 304 ? -0.342  -35.404 22.091  1.00 45.10 ? 304 TYR A OH    1 
ATOM   2246 N  N     . ALA A 1 305 ? -4.981  -32.867 17.417  1.00 26.76 ? 305 ALA A N     1 
ATOM   2247 C  CA    . ALA A 1 305 ? -5.721  -34.089 17.099  1.00 28.40 ? 305 ALA A CA    1 
ATOM   2248 C  C     . ALA A 1 305 ? -5.386  -34.595 15.697  1.00 30.95 ? 305 ALA A C     1 
ATOM   2249 O  O     . ALA A 1 305 ? -5.205  -35.799 15.486  1.00 29.40 ? 305 ALA A O     1 
ATOM   2250 C  CB    . ALA A 1 305 ? -7.220  -33.860 17.239  1.00 29.61 ? 305 ALA A CB    1 
ATOM   2251 N  N     . TYR A 1 306 ? -5.305  -33.670 14.744  1.00 25.47 ? 306 TYR A N     1 
ATOM   2252 C  CA    . TYR A 1 306 ? -4.941  -34.010 13.372  1.00 27.61 ? 306 TYR A CA    1 
ATOM   2253 C  C     . TYR A 1 306 ? -3.536  -34.598 13.310  1.00 26.63 ? 306 TYR A C     1 
ATOM   2254 O  O     . TYR A 1 306 ? -3.320  -35.623 12.675  1.00 26.83 ? 306 TYR A O     1 
ATOM   2255 C  CB    . TYR A 1 306 ? -5.039  -32.777 12.473  1.00 24.11 ? 306 TYR A CB    1 
ATOM   2256 C  CG    . TYR A 1 306 ? -4.416  -32.935 11.101  1.00 27.49 ? 306 TYR A CG    1 
ATOM   2257 C  CD1   . TYR A 1 306 ? -5.127  -33.510 10.053  1.00 35.18 ? 306 TYR A CD1   1 
ATOM   2258 C  CD2   . TYR A 1 306 ? -3.123  -32.484 10.846  1.00 30.87 ? 306 TYR A CD2   1 
ATOM   2259 C  CE1   . TYR A 1 306 ? -4.565  -33.643 8.799   1.00 37.54 ? 306 TYR A CE1   1 
ATOM   2260 C  CE2   . TYR A 1 306 ? -2.553  -32.618 9.595   1.00 37.42 ? 306 TYR A CE2   1 
ATOM   2261 C  CZ    . TYR A 1 306 ? -3.281  -33.194 8.575   1.00 34.98 ? 306 TYR A CZ    1 
ATOM   2262 O  OH    . TYR A 1 306 ? -2.716  -33.324 7.327   1.00 38.94 ? 306 TYR A OH    1 
ATOM   2263 N  N     . LEU A 1 307 ? -2.583  -33.948 13.974  1.00 20.84 ? 307 LEU A N     1 
ATOM   2264 C  CA    . LEU A 1 307 ? -1.202  -34.422 13.977  1.00 23.87 ? 307 LEU A CA    1 
ATOM   2265 C  C     . LEU A 1 307 ? -1.052  -35.782 14.659  1.00 25.17 ? 307 LEU A C     1 
ATOM   2266 O  O     . LEU A 1 307 ? -0.108  -36.527 14.375  1.00 29.93 ? 307 LEU A O     1 
ATOM   2267 C  CB    . LEU A 1 307 ? -0.290  -33.405 14.663  1.00 24.41 ? 307 LEU A CB    1 
ATOM   2268 C  CG    . LEU A 1 307 ? -0.212  -32.014 14.041  1.00 22.59 ? 307 LEU A CG    1 
ATOM   2269 C  CD1   . LEU A 1 307 ? 0.553   -31.079 14.962  1.00 22.09 ? 307 LEU A CD1   1 
ATOM   2270 C  CD2   . LEU A 1 307 ? 0.432   -32.074 12.664  1.00 25.06 ? 307 LEU A CD2   1 
ATOM   2271 N  N     . SER A 1 308 ? -1.984  -36.106 15.549  1.00 23.53 ? 308 SER A N     1 
ATOM   2272 C  CA    . SER A 1 308 ? -1.903  -37.343 16.326  1.00 25.82 ? 308 SER A CA    1 
ATOM   2273 C  C     . SER A 1 308 ? -2.781  -38.459 15.769  1.00 29.70 ? 308 SER A C     1 
ATOM   2274 O  O     . SER A 1 308 ? -2.815  -39.563 16.318  1.00 38.53 ? 308 SER A O     1 
ATOM   2275 C  CB    . SER A 1 308 ? -2.285  -37.077 17.785  1.00 29.25 ? 308 SER A CB    1 
ATOM   2276 O  OG    . SER A 1 308 ? -1.432  -36.118 18.376  1.00 35.07 ? 308 SER A OG    1 
ATOM   2277 N  N     . ARG A 1 309 ? -3.479  -38.170 14.674  1.00 30.29 ? 309 ARG A N     1 
ATOM   2278 C  CA    . ARG A 1 309 ? -4.484  -39.079 14.122  1.00 37.32 ? 309 ARG A CA    1 
ATOM   2279 C  C     . ARG A 1 309 ? -3.901  -40.425 13.694  1.00 43.90 ? 309 ARG A C     1 
ATOM   2280 O  O     . ARG A 1 309 ? -2.684  -40.591 13.615  1.00 38.29 ? 309 ARG A O     1 
ATOM   2281 C  CB    . ARG A 1 309 ? -5.195  -38.421 12.938  1.00 35.60 ? 309 ARG A CB    1 
ATOM   2282 C  CG    . ARG A 1 309 ? -4.392  -38.433 11.646  1.00 34.88 ? 309 ARG A CG    1 
ATOM   2283 C  CD    . ARG A 1 309 ? -5.039  -37.549 10.584  1.00 37.20 ? 309 ARG A CD    1 
ATOM   2284 N  NE    . ARG A 1 309 ? -4.366  -37.668 9.290   1.00 40.08 ? 309 ARG A NE    1 
ATOM   2285 C  CZ    . ARG A 1 309 ? -3.197  -37.104 8.996   1.00 36.29 ? 309 ARG A CZ    1 
ATOM   2286 N  NH1   . ARG A 1 309 ? -2.555  -36.380 9.906   1.00 34.40 ? 309 ARG A NH1   1 
ATOM   2287 N  NH2   . ARG A 1 309 ? -2.664  -37.270 7.792   1.00 38.95 ? 309 ARG A NH2   1 
ATOM   2288 N  N     . MET B 1 1   ? 10.952  43.975  22.834  1.00 73.72 ? 1   MET B N     1 
ATOM   2289 C  CA    . MET B 1 1   ? 10.074  42.880  22.440  1.00 61.65 ? 1   MET B CA    1 
ATOM   2290 C  C     . MET B 1 1   ? 9.319   42.311  23.637  1.00 61.35 ? 1   MET B C     1 
ATOM   2291 O  O     . MET B 1 1   ? 9.897   42.105  24.705  1.00 67.20 ? 1   MET B O     1 
ATOM   2292 C  CB    . MET B 1 1   ? 10.877  41.768  21.763  1.00 57.42 ? 1   MET B CB    1 
ATOM   2293 C  CG    . MET B 1 1   ? 10.036  40.582  21.349  1.00 50.82 ? 1   MET B CG    1 
ATOM   2294 S  SD    . MET B 1 1   ? 10.995  39.274  20.571  1.00 82.25 ? 1   MET B SD    1 
ATOM   2295 C  CE    . MET B 1 1   ? 12.005  40.227  19.444  1.00 66.82 ? 1   MET B CE    1 
ATOM   2296 N  N     . VAL B 1 2   ? 8.027   42.057  23.453  1.00 52.51 ? 2   VAL B N     1 
ATOM   2297 C  CA    . VAL B 1 2   ? 7.209   41.470  24.508  1.00 43.36 ? 2   VAL B CA    1 
ATOM   2298 C  C     . VAL B 1 2   ? 7.557   39.995  24.694  1.00 33.11 ? 2   VAL B C     1 
ATOM   2299 O  O     . VAL B 1 2   ? 8.190   39.387  23.831  1.00 37.31 ? 2   VAL B O     1 
ATOM   2300 C  CB    . VAL B 1 2   ? 5.701   41.620  24.203  1.00 49.46 ? 2   VAL B CB    1 
ATOM   2301 C  CG1   . VAL B 1 2   ? 5.322   43.095  24.119  1.00 50.60 ? 2   VAL B CG1   1 
ATOM   2302 C  CG2   . VAL B 1 2   ? 5.337   40.895  22.912  1.00 37.67 ? 2   VAL B CG2   1 
ATOM   2303 N  N     . ARG B 1 3   ? 7.146   39.414  25.817  1.00 28.61 ? 3   ARG B N     1 
ATOM   2304 C  CA    . ARG B 1 3   ? 7.439   38.003  26.060  1.00 31.32 ? 3   ARG B CA    1 
ATOM   2305 C  C     . ARG B 1 3   ? 6.559   37.083  25.218  1.00 27.48 ? 3   ARG B C     1 
ATOM   2306 O  O     . ARG B 1 3   ? 5.458   37.454  24.801  1.00 29.43 ? 3   ARG B O     1 
ATOM   2307 C  CB    . ARG B 1 3   ? 7.340   37.665  27.549  1.00 39.02 ? 3   ARG B CB    1 
ATOM   2308 C  CG    . ARG B 1 3   ? 8.390   38.379  28.392  1.00 50.11 ? 3   ARG B CG    1 
ATOM   2309 C  CD    . ARG B 1 3   ? 8.218   38.098  29.873  1.00 63.73 ? 3   ARG B CD    1 
ATOM   2310 N  NE    . ARG B 1 3   ? 9.151   37.090  30.369  1.00 75.40 ? 3   ARG B NE    1 
ATOM   2311 C  CZ    . ARG B 1 3   ? 9.180   36.663  31.627  1.00 79.48 ? 3   ARG B CZ    1 
ATOM   2312 N  NH1   . ARG B 1 3   ? 8.323   37.154  32.513  1.00 78.83 ? 3   ARG B NH1   1 
ATOM   2313 N  NH2   . ARG B 1 3   ? 10.062  35.745  32.000  1.00 80.93 ? 3   ARG B NH2   1 
ATOM   2314 N  N     . ILE B 1 4   ? 7.067   35.883  24.962  1.00 28.18 ? 4   ILE B N     1 
ATOM   2315 C  CA    . ILE B 1 4   ? 6.382   34.908  24.127  1.00 26.22 ? 4   ILE B CA    1 
ATOM   2316 C  C     . ILE B 1 4   ? 6.197   33.606  24.891  1.00 23.99 ? 4   ILE B C     1 
ATOM   2317 O  O     . ILE B 1 4   ? 7.129   33.104  25.521  1.00 26.62 ? 4   ILE B O     1 
ATOM   2318 C  CB    . ILE B 1 4   ? 7.182   34.621  22.841  1.00 28.07 ? 4   ILE B CB    1 
ATOM   2319 C  CG1   . ILE B 1 4   ? 7.409   35.918  22.058  1.00 29.20 ? 4   ILE B CG1   1 
ATOM   2320 C  CG2   . ILE B 1 4   ? 6.478   33.561  21.987  1.00 22.46 ? 4   ILE B CG2   1 
ATOM   2321 C  CD1   . ILE B 1 4   ? 8.352   35.764  20.876  1.00 30.89 ? 4   ILE B CD1   1 
ATOM   2322 N  N     . TYR B 1 5   ? 4.984   33.068  24.837  1.00 21.88 ? 5   TYR B N     1 
ATOM   2323 C  CA    . TYR B 1 5   ? 4.676   31.785  25.455  1.00 24.44 ? 5   TYR B CA    1 
ATOM   2324 C  C     . TYR B 1 5   ? 4.037   30.898  24.407  1.00 24.13 ? 5   TYR B C     1 
ATOM   2325 O  O     . TYR B 1 5   ? 3.478   31.398  23.432  1.00 22.72 ? 5   TYR B O     1 
ATOM   2326 C  CB    . TYR B 1 5   ? 3.705   31.977  26.621  1.00 24.34 ? 5   TYR B CB    1 
ATOM   2327 C  CG    . TYR B 1 5   ? 4.252   32.872  27.703  1.00 26.26 ? 5   TYR B CG    1 
ATOM   2328 C  CD1   . TYR B 1 5   ? 4.156   34.258  27.602  1.00 24.57 ? 5   TYR B CD1   1 
ATOM   2329 C  CD2   . TYR B 1 5   ? 4.875   32.337  28.821  1.00 31.69 ? 5   TYR B CD2   1 
ATOM   2330 C  CE1   . TYR B 1 5   ? 4.662   35.082  28.587  1.00 31.52 ? 5   TYR B CE1   1 
ATOM   2331 C  CE2   . TYR B 1 5   ? 5.387   33.157  29.814  1.00 27.23 ? 5   TYR B CE2   1 
ATOM   2332 C  CZ    . TYR B 1 5   ? 5.274   34.527  29.690  1.00 33.19 ? 5   TYR B CZ    1 
ATOM   2333 O  OH    . TYR B 1 5   ? 5.781   35.349  30.671  1.00 38.22 ? 5   TYR B OH    1 
ATOM   2334 N  N     . THR B 1 6   ? 4.138   29.586  24.594  1.00 19.33 ? 6   THR B N     1 
ATOM   2335 C  CA    . THR B 1 6   ? 3.453   28.644  23.722  1.00 21.90 ? 6   THR B CA    1 
ATOM   2336 C  C     . THR B 1 6   ? 2.656   27.685  24.591  1.00 23.18 ? 6   THR B C     1 
ATOM   2337 O  O     . THR B 1 6   ? 2.993   27.463  25.754  1.00 21.31 ? 6   THR B O     1 
ATOM   2338 C  CB    . THR B 1 6   ? 4.423   27.865  22.800  1.00 25.02 ? 6   THR B CB    1 
ATOM   2339 O  OG1   . THR B 1 6   ? 5.152   26.891  23.562  1.00 23.79 ? 6   THR B OG1   1 
ATOM   2340 C  CG2   . THR B 1 6   ? 5.399   28.821  22.102  1.00 18.33 ? 6   THR B CG2   1 
ATOM   2341 N  N     . LEU B 1 7   ? 1.576   27.148  24.041  1.00 20.63 ? 7   LEU B N     1 
ATOM   2342 C  CA    . LEU B 1 7   ? 0.761   26.188  24.770  1.00 21.87 ? 7   LEU B CA    1 
ATOM   2343 C  C     . LEU B 1 7   ? 0.608   24.917  23.948  1.00 23.36 ? 7   LEU B C     1 
ATOM   2344 O  O     . LEU B 1 7   ? 0.200   24.965  22.783  1.00 19.79 ? 7   LEU B O     1 
ATOM   2345 C  CB    . LEU B 1 7   ? -0.618  26.771  25.078  1.00 20.64 ? 7   LEU B CB    1 
ATOM   2346 C  CG    . LEU B 1 7   ? -1.604  25.839  25.787  1.00 22.65 ? 7   LEU B CG    1 
ATOM   2347 C  CD1   . LEU B 1 7   ? -1.117  25.506  27.190  1.00 22.37 ? 7   LEU B CD1   1 
ATOM   2348 C  CD2   . LEU B 1 7   ? -2.991  26.468  25.826  1.00 19.92 ? 7   LEU B CD2   1 
ATOM   2349 N  N     . THR B 1 8   ? 0.951   23.786  24.554  1.00 20.65 ? 8   THR B N     1 
ATOM   2350 C  CA    . THR B 1 8   ? 0.819   22.490  23.907  1.00 21.52 ? 8   THR B CA    1 
ATOM   2351 C  C     . THR B 1 8   ? -0.022  21.587  24.795  1.00 25.56 ? 8   THR B C     1 
ATOM   2352 O  O     . THR B 1 8   ? 0.462   21.057  25.793  1.00 21.67 ? 8   THR B O     1 
ATOM   2353 C  CB    . THR B 1 8   ? 2.193   21.834  23.689  1.00 20.61 ? 8   THR B CB    1 
ATOM   2354 O  OG1   . THR B 1 8   ? 3.084   22.777  23.077  1.00 19.42 ? 8   THR B OG1   1 
ATOM   2355 C  CG2   . THR B 1 8   ? 2.068   20.610  22.790  1.00 21.28 ? 8   THR B CG2   1 
ATOM   2356 N  N     . LEU B 1 9   ? -1.290  21.412  24.445  1.00 19.34 ? 9   LEU B N     1 
ATOM   2357 C  CA    . LEU B 1 9   ? -2.162  20.581  25.264  1.00 21.28 ? 9   LEU B CA    1 
ATOM   2358 C  C     . LEU B 1 9   ? -1.876  19.104  25.024  1.00 24.04 ? 9   LEU B C     1 
ATOM   2359 O  O     . LEU B 1 9   ? -2.162  18.263  25.877  1.00 23.13 ? 9   LEU B O     1 
ATOM   2360 C  CB    . LEU B 1 9   ? -3.631  20.901  24.992  1.00 22.15 ? 9   LEU B CB    1 
ATOM   2361 C  CG    . LEU B 1 9   ? -4.094  22.319  25.328  1.00 27.63 ? 9   LEU B CG    1 
ATOM   2362 C  CD1   . LEU B 1 9   ? -5.557  22.490  24.949  1.00 25.88 ? 9   LEU B CD1   1 
ATOM   2363 C  CD2   . LEU B 1 9   ? -3.880  22.608  26.814  1.00 28.02 ? 9   LEU B CD2   1 
ATOM   2364 N  N     . ALA B 1 10  ? -1.292  18.795  23.867  1.00 20.70 ? 10  ALA B N     1 
ATOM   2365 C  CA    . ALA B 1 10  ? -0.936  17.413  23.541  1.00 20.34 ? 10  ALA B CA    1 
ATOM   2366 C  C     . ALA B 1 10  ? 0.531   17.280  23.151  1.00 24.50 ? 10  ALA B C     1 
ATOM   2367 O  O     . ALA B 1 10  ? 0.852   17.127  21.976  1.00 22.58 ? 10  ALA B O     1 
ATOM   2368 C  CB    . ALA B 1 10  ? -1.829  16.880  22.425  1.00 23.96 ? 10  ALA B CB    1 
ATOM   2369 N  N     . PRO B 1 11  ? 1.430   17.331  24.143  1.00 24.96 ? 11  PRO B N     1 
ATOM   2370 C  CA    . PRO B 1 11  ? 2.853   17.176  23.843  1.00 23.06 ? 11  PRO B CA    1 
ATOM   2371 C  C     . PRO B 1 11  ? 3.190   15.702  23.700  1.00 24.72 ? 11  PRO B C     1 
ATOM   2372 O  O     . PRO B 1 11  ? 2.337   14.849  23.942  1.00 24.83 ? 11  PRO B O     1 
ATOM   2373 C  CB    . PRO B 1 11  ? 3.526   17.745  25.090  1.00 23.79 ? 11  PRO B CB    1 
ATOM   2374 C  CG    . PRO B 1 11  ? 2.560   17.464  26.184  1.00 24.96 ? 11  PRO B CG    1 
ATOM   2375 C  CD    . PRO B 1 11  ? 1.182   17.509  25.586  1.00 21.92 ? 11  PRO B CD    1 
ATOM   2376 N  N     . SER B 1 12  ? 4.419   15.401  23.307  1.00 20.96 ? 12  SER B N     1 
ATOM   2377 C  CA    . SER B 1 12  ? 4.854   14.014  23.252  1.00 23.04 ? 12  SER B CA    1 
ATOM   2378 C  C     . SER B 1 12  ? 6.357   13.896  23.465  1.00 22.75 ? 12  SER B C     1 
ATOM   2379 O  O     . SER B 1 12  ? 7.096   14.873  23.315  1.00 24.33 ? 12  SER B O     1 
ATOM   2380 C  CB    . SER B 1 12  ? 4.461   13.368  21.918  1.00 28.20 ? 12  SER B CB    1 
ATOM   2381 O  OG    . SER B 1 12  ? 5.112   13.995  20.826  1.00 29.97 ? 12  SER B OG    1 
ATOM   2382 N  N     . LEU B 1 13  ? 6.791   12.700  23.850  1.00 22.67 ? 13  LEU B N     1 
ATOM   2383 C  CA    . LEU B 1 13  ? 8.205   12.361  23.884  1.00 22.78 ? 13  LEU B CA    1 
ATOM   2384 C  C     . LEU B 1 13  ? 8.412   11.440  22.694  1.00 24.31 ? 13  LEU B C     1 
ATOM   2385 O  O     . LEU B 1 13  ? 8.067   10.259  22.741  1.00 27.60 ? 13  LEU B O     1 
ATOM   2386 C  CB    . LEU B 1 13  ? 8.583   11.639  25.176  1.00 22.32 ? 13  LEU B CB    1 
ATOM   2387 C  CG    . LEU B 1 13  ? 10.059  11.221  25.233  1.00 29.35 ? 13  LEU B CG    1 
ATOM   2388 C  CD1   . LEU B 1 13  ? 10.938  12.460  25.364  1.00 29.19 ? 13  LEU B CD1   1 
ATOM   2389 C  CD2   . LEU B 1 13  ? 10.329  10.232  26.363  1.00 27.13 ? 13  LEU B CD2   1 
ATOM   2390 N  N     . ASP B 1 14  ? 8.951   11.983  21.613  1.00 22.32 ? 14  ASP B N     1 
ATOM   2391 C  CA    . ASP B 1 14  ? 9.046   11.213  20.381  1.00 24.09 ? 14  ASP B CA    1 
ATOM   2392 C  C     . ASP B 1 14  ? 10.288  10.335  20.333  1.00 24.87 ? 14  ASP B C     1 
ATOM   2393 O  O     . ASP B 1 14  ? 11.324  10.677  20.898  1.00 25.53 ? 14  ASP B O     1 
ATOM   2394 C  CB    . ASP B 1 14  ? 8.972   12.139  19.168  1.00 21.99 ? 14  ASP B CB    1 
ATOM   2395 C  CG    . ASP B 1 14  ? 7.620   12.809  19.043  1.00 30.24 ? 14  ASP B CG    1 
ATOM   2396 O  OD1   . ASP B 1 14  ? 6.675   12.344  19.717  1.00 27.26 ? 14  ASP B OD1   1 
ATOM   2397 O  OD2   . ASP B 1 14  ? 7.498   13.786  18.275  1.00 31.66 ? 14  ASP B OD2   1 
ATOM   2398 N  N     . SER B 1 15  ? 10.158  9.182   19.684  1.00 23.90 ? 15  SER B N     1 
ATOM   2399 C  CA    . SER B 1 15  ? 11.286  8.281   19.495  1.00 21.68 ? 15  SER B CA    1 
ATOM   2400 C  C     . SER B 1 15  ? 11.716  8.276   18.041  1.00 20.43 ? 15  SER B C     1 
ATOM   2401 O  O     . SER B 1 15  ? 10.895  8.073   17.139  1.00 21.06 ? 15  SER B O     1 
ATOM   2402 C  CB    . SER B 1 15  ? 10.927  6.857   19.929  1.00 28.79 ? 15  SER B CB    1 
ATOM   2403 O  OG    . SER B 1 15  ? 10.789  6.771   21.332  1.00 35.98 ? 15  SER B OG    1 
ATOM   2404 N  N     . ALA B 1 16  ? 13.005  8.503   17.815  1.00 20.80 ? 16  ALA B N     1 
ATOM   2405 C  CA    . ALA B 1 16  ? 13.567  8.422   16.475  1.00 21.09 ? 16  ALA B CA    1 
ATOM   2406 C  C     . ALA B 1 16  ? 14.451  7.189   16.400  1.00 19.38 ? 16  ALA B C     1 
ATOM   2407 O  O     . ALA B 1 16  ? 15.423  7.054   17.149  1.00 20.77 ? 16  ALA B O     1 
ATOM   2408 C  CB    . ALA B 1 16  ? 14.372  9.672   16.152  1.00 25.50 ? 16  ALA B CB    1 
ATOM   2409 N  N     . THR B 1 17  ? 14.114  6.287   15.491  1.00 18.73 ? 17  THR B N     1 
ATOM   2410 C  CA    . THR B 1 17  ? 14.851  5.039   15.368  1.00 17.67 ? 17  THR B CA    1 
ATOM   2411 C  C     . THR B 1 17  ? 15.200  4.733   13.916  1.00 22.28 ? 17  THR B C     1 
ATOM   2412 O  O     . THR B 1 17  ? 14.665  5.358   12.990  1.00 23.49 ? 17  THR B O     1 
ATOM   2413 C  CB    . THR B 1 17  ? 14.058  3.879   15.976  1.00 17.95 ? 17  THR B CB    1 
ATOM   2414 O  OG1   . THR B 1 17  ? 14.835  2.683   15.894  1.00 19.35 ? 17  THR B OG1   1 
ATOM   2415 C  CG2   . THR B 1 17  ? 12.721  3.688   15.240  1.00 17.68 ? 17  THR B CG2   1 
ATOM   2416 N  N     . ILE B 1 18  ? 16.108  3.777   13.730  1.00 20.92 ? 18  ILE B N     1 
ATOM   2417 C  CA    . ILE B 1 18  ? 16.602  3.406   12.412  1.00 17.74 ? 18  ILE B CA    1 
ATOM   2418 C  C     . ILE B 1 18  ? 16.438  1.903   12.200  1.00 20.62 ? 18  ILE B C     1 
ATOM   2419 O  O     . ILE B 1 18  ? 16.632  1.111   13.123  1.00 20.32 ? 18  ILE B O     1 
ATOM   2420 C  CB    . ILE B 1 18  ? 18.092  3.774   12.266  1.00 17.23 ? 18  ILE B CB    1 
ATOM   2421 C  CG1   . ILE B 1 18  ? 18.299  5.271   12.528  1.00 23.43 ? 18  ILE B CG1   1 
ATOM   2422 C  CG2   . ILE B 1 18  ? 18.608  3.413   10.877  1.00 21.53 ? 18  ILE B CG2   1 
ATOM   2423 C  CD1   . ILE B 1 18  ? 19.752  5.647   12.720  1.00 29.75 ? 18  ILE B CD1   1 
ATOM   2424 N  N     . THR B 1 19  ? 16.072  1.516   10.984  1.00 20.61 ? 19  THR B N     1 
ATOM   2425 C  CA    . THR B 1 19  ? 15.936  0.106   10.641  1.00 23.07 ? 19  THR B CA    1 
ATOM   2426 C  C     . THR B 1 19  ? 16.382  -0.057  9.185   1.00 22.94 ? 19  THR B C     1 
ATOM   2427 O  O     . THR B 1 19  ? 16.234  0.867   8.391   1.00 21.49 ? 19  THR B O     1 
ATOM   2428 C  CB    . THR B 1 19  ? 14.482  -0.375  10.872  1.00 23.24 ? 19  THR B CB    1 
ATOM   2429 O  OG1   . THR B 1 19  ? 14.438  -1.810  10.907  1.00 22.98 ? 19  THR B OG1   1 
ATOM   2430 C  CG2   . THR B 1 19  ? 13.552  0.152   9.792   1.00 22.42 ? 19  THR B CG2   1 
ATOM   2431 N  N     . PRO B 1 20  ? 16.975  -1.209  8.835   1.00 21.49 ? 20  PRO B N     1 
ATOM   2432 C  CA    . PRO B 1 20  ? 17.574  -1.309  7.494   1.00 19.97 ? 20  PRO B CA    1 
ATOM   2433 C  C     . PRO B 1 20  ? 16.562  -1.291  6.345   1.00 24.56 ? 20  PRO B C     1 
ATOM   2434 O  O     . PRO B 1 20  ? 16.826  -0.692  5.302   1.00 26.77 ? 20  PRO B O     1 
ATOM   2435 C  CB    . PRO B 1 20  ? 18.302  -2.663  7.528   1.00 24.26 ? 20  PRO B CB    1 
ATOM   2436 C  CG    . PRO B 1 20  ? 18.485  -2.974  8.984   1.00 30.75 ? 20  PRO B CG    1 
ATOM   2437 C  CD    . PRO B 1 20  ? 17.302  -2.367  9.685   1.00 26.98 ? 20  PRO B CD    1 
ATOM   2438 N  N     . GLN B 1 21  ? 15.423  -1.950  6.532   1.00 21.04 ? 21  GLN B N     1 
ATOM   2439 C  CA    . GLN B 1 21  ? 14.437  -2.103  5.470   1.00 17.35 ? 21  GLN B CA    1 
ATOM   2440 C  C     . GLN B 1 21  ? 13.044  -1.955  6.054   1.00 18.17 ? 21  GLN B C     1 
ATOM   2441 O  O     . GLN B 1 21  ? 12.859  -2.082  7.264   1.00 23.69 ? 21  GLN B O     1 
ATOM   2442 C  CB    . GLN B 1 21  ? 14.561  -3.504  4.849   1.00 22.66 ? 21  GLN B CB    1 
ATOM   2443 C  CG    . GLN B 1 21  ? 15.944  -3.852  4.301   1.00 28.21 ? 21  GLN B CG    1 
ATOM   2444 C  CD    . GLN B 1 21  ? 16.192  -3.289  2.916   1.00 28.61 ? 21  GLN B CD    1 
ATOM   2445 O  OE1   . GLN B 1 21  ? 15.277  -2.770  2.271   1.00 26.88 ? 21  GLN B OE1   1 
ATOM   2446 N  NE2   . GLN B 1 21  ? 17.433  -3.391  2.447   1.00 27.49 ? 21  GLN B NE2   1 
ATOM   2447 N  N     . ILE B 1 22  ? 12.057  -1.711  5.199   1.00 17.02 ? 22  ILE B N     1 
ATOM   2448 C  CA    . ILE B 1 22  ? 10.679  -1.711  5.659   1.00 19.04 ? 22  ILE B CA    1 
ATOM   2449 C  C     . ILE B 1 22  ? 9.817   -2.657  4.821   1.00 25.92 ? 22  ILE B C     1 
ATOM   2450 O  O     . ILE B 1 22  ? 9.872   -2.667  3.587   1.00 23.05 ? 22  ILE B O     1 
ATOM   2451 C  CB    . ILE B 1 22  ? 10.085  -0.285  5.731   1.00 23.61 ? 22  ILE B CB    1 
ATOM   2452 C  CG1   . ILE B 1 22  ? 8.669   -0.324  6.311   1.00 23.74 ? 22  ILE B CG1   1 
ATOM   2453 C  CG2   . ILE B 1 22  ? 10.108  0.385   4.369   1.00 22.88 ? 22  ILE B CG2   1 
ATOM   2454 C  CD1   . ILE B 1 22  ? 8.159   1.031   6.761   1.00 27.61 ? 22  ILE B CD1   1 
ATOM   2455 N  N     . TYR B 1 23  ? 9.047   -3.474  5.527   1.00 21.72 ? 23  TYR B N     1 
ATOM   2456 C  CA    . TYR B 1 23  ? 8.183   -4.469  4.926   1.00 21.53 ? 23  TYR B CA    1 
ATOM   2457 C  C     . TYR B 1 23  ? 7.270   -4.969  6.033   1.00 21.61 ? 23  TYR B C     1 
ATOM   2458 O  O     . TYR B 1 23  ? 7.612   -4.863  7.213   1.00 18.92 ? 23  TYR B O     1 
ATOM   2459 C  CB    . TYR B 1 23  ? 9.009   -5.620  4.336   1.00 21.22 ? 23  TYR B CB    1 
ATOM   2460 C  CG    . TYR B 1 23  ? 9.990   -6.245  5.301   1.00 24.13 ? 23  TYR B CG    1 
ATOM   2461 C  CD1   . TYR B 1 23  ? 9.579   -7.199  6.226   1.00 26.87 ? 23  TYR B CD1   1 
ATOM   2462 C  CD2   . TYR B 1 23  ? 11.338  -5.901  5.270   1.00 22.24 ? 23  TYR B CD2   1 
ATOM   2463 C  CE1   . TYR B 1 23  ? 10.477  -7.780  7.102   1.00 25.51 ? 23  TYR B CE1   1 
ATOM   2464 C  CE2   . TYR B 1 23  ? 12.241  -6.470  6.145   1.00 25.43 ? 23  TYR B CE2   1 
ATOM   2465 C  CZ    . TYR B 1 23  ? 11.807  -7.411  7.057   1.00 28.87 ? 23  TYR B CZ    1 
ATOM   2466 O  OH    . TYR B 1 23  ? 12.715  -7.977  7.924   1.00 29.74 ? 23  TYR B OH    1 
ATOM   2467 N  N     . PRO B 1 24  ? 6.098   -5.498  5.659   1.00 19.90 ? 24  PRO B N     1 
ATOM   2468 C  CA    . PRO B 1 24  ? 5.108   -5.922  6.652   1.00 18.99 ? 24  PRO B CA    1 
ATOM   2469 C  C     . PRO B 1 24  ? 5.343   -7.328  7.191   1.00 22.46 ? 24  PRO B C     1 
ATOM   2470 O  O     . PRO B 1 24  ? 6.233   -8.039  6.708   1.00 19.76 ? 24  PRO B O     1 
ATOM   2471 C  CB    . PRO B 1 24  ? 3.801   -5.891  5.859   1.00 18.85 ? 24  PRO B CB    1 
ATOM   2472 C  CG    . PRO B 1 24  ? 4.217   -6.205  4.451   1.00 22.73 ? 24  PRO B CG    1 
ATOM   2473 C  CD    . PRO B 1 24  ? 5.563   -5.544  4.282   1.00 22.23 ? 24  PRO B CD    1 
ATOM   2474 N  N     . GLU B 1 25  ? 4.547   -7.686  8.201   1.00 19.08 ? 25  GLU B N     1 
ATOM   2475 C  CA    . GLU B 1 25  ? 4.491   -9.031  8.787   1.00 24.49 ? 25  GLU B CA    1 
ATOM   2476 C  C     . GLU B 1 25  ? 5.648   -9.390  9.721   1.00 20.66 ? 25  GLU B C     1 
ATOM   2477 O  O     . GLU B 1 25  ? 5.425   -9.823  10.850  1.00 25.42 ? 25  GLU B O     1 
ATOM   2478 C  CB    . GLU B 1 25  ? 4.304   -10.105 7.707   1.00 23.41 ? 25  GLU B CB    1 
ATOM   2479 C  CG    . GLU B 1 25  ? 3.915   -11.484 8.252   1.00 26.48 ? 25  GLU B CG    1 
ATOM   2480 C  CD    . GLU B 1 25  ? 2.442   -11.584 8.637   1.00 36.01 ? 25  GLU B CD    1 
ATOM   2481 O  OE1   . GLU B 1 25  ? 1.693   -10.604 8.424   1.00 29.97 ? 25  GLU B OE1   1 
ATOM   2482 O  OE2   . GLU B 1 25  ? 2.029   -12.654 9.148   1.00 34.21 ? 25  GLU B OE2   1 
ATOM   2483 N  N     . GLY B 1 26  ? 6.878   -9.216  9.250   1.00 21.92 ? 26  GLY B N     1 
ATOM   2484 C  CA    . GLY B 1 26  ? 8.047   -9.588  10.028  1.00 20.65 ? 26  GLY B CA    1 
ATOM   2485 C  C     . GLY B 1 26  ? 8.447   -8.563  11.076  1.00 19.96 ? 26  GLY B C     1 
ATOM   2486 O  O     . GLY B 1 26  ? 7.994   -7.415  11.044  1.00 24.21 ? 26  GLY B O     1 
ATOM   2487 N  N     . LYS B 1 27  ? 9.295   -8.974  12.017  1.00 19.93 ? 27  LYS B N     1 
ATOM   2488 C  CA    . LYS B 1 27  ? 9.782   -8.038  13.022  1.00 22.36 ? 27  LYS B CA    1 
ATOM   2489 C  C     . LYS B 1 27  ? 10.810  -7.120  12.385  1.00 20.78 ? 27  LYS B C     1 
ATOM   2490 O  O     . LYS B 1 27  ? 11.811  -7.586  11.836  1.00 20.57 ? 27  LYS B O     1 
ATOM   2491 C  CB    . LYS B 1 27  ? 10.439  -8.786  14.184  1.00 23.48 ? 27  LYS B CB    1 
ATOM   2492 C  CG    . LYS B 1 27  ? 9.591   -9.880  14.828  1.00 23.30 ? 27  LYS B CG    1 
ATOM   2493 C  CD    . LYS B 1 27  ? 10.470  -10.711 15.759  1.00 21.93 ? 27  LYS B CD    1 
ATOM   2494 C  CE    . LYS B 1 27  ? 9.846   -12.055 16.120  1.00 20.35 ? 27  LYS B CE    1 
ATOM   2495 N  NZ    . LYS B 1 27  ? 10.829  -12.929 16.856  1.00 21.01 ? 27  LYS B NZ    1 
ATOM   2496 N  N     . LEU B 1 28  ? 10.575  -5.815  12.443  1.00 17.65 ? 28  LEU B N     1 
ATOM   2497 C  CA    . LEU B 1 28  ? 11.599  -4.879  11.989  1.00 19.87 ? 28  LEU B CA    1 
ATOM   2498 C  C     . LEU B 1 28  ? 12.455  -4.470  13.178  1.00 22.82 ? 28  LEU B C     1 
ATOM   2499 O  O     . LEU B 1 28  ? 11.979  -3.779  14.077  1.00 21.87 ? 28  LEU B O     1 
ATOM   2500 C  CB    . LEU B 1 28  ? 10.958  -3.650  11.345  1.00 20.12 ? 28  LEU B CB    1 
ATOM   2501 C  CG    . LEU B 1 28  ? 9.962   -3.984  10.233  1.00 20.61 ? 28  LEU B CG    1 
ATOM   2502 C  CD1   . LEU B 1 28  ? 9.277   -2.720  9.718   1.00 21.24 ? 28  LEU B CD1   1 
ATOM   2503 C  CD2   . LEU B 1 28  ? 10.649  -4.728  9.096   1.00 20.33 ? 28  LEU B CD2   1 
ATOM   2504 N  N     . ARG B 1 29  ? 13.709  -4.913  13.186  1.00 21.86 ? 29  ARG B N     1 
ATOM   2505 C  CA    . ARG B 1 29  ? 14.628  -4.586  14.275  1.00 21.26 ? 29  ARG B CA    1 
ATOM   2506 C  C     . ARG B 1 29  ? 15.080  -3.141  14.152  1.00 22.76 ? 29  ARG B C     1 
ATOM   2507 O  O     . ARG B 1 29  ? 15.709  -2.749  13.163  1.00 23.13 ? 29  ARG B O     1 
ATOM   2508 C  CB    . ARG B 1 29  ? 15.828  -5.531  14.286  1.00 28.86 ? 29  ARG B CB    1 
ATOM   2509 C  CG    . ARG B 1 29  ? 15.478  -6.958  14.684  1.00 45.81 ? 29  ARG B CG    1 
ATOM   2510 C  CD    . ARG B 1 29  ? 16.736  -7.770  14.966  1.00 62.00 ? 29  ARG B CD    1 
ATOM   2511 N  NE    . ARG B 1 29  ? 17.566  -7.144  15.994  1.00 72.34 ? 29  ARG B NE    1 
ATOM   2512 C  CZ    . ARG B 1 29  ? 18.606  -7.731  16.579  1.00 77.95 ? 29  ARG B CZ    1 
ATOM   2513 N  NH1   . ARG B 1 29  ? 18.946  -8.967  16.242  1.00 81.29 ? 29  ARG B NH1   1 
ATOM   2514 N  NH2   . ARG B 1 29  ? 19.302  -7.083  17.505  1.00 80.28 ? 29  ARG B NH2   1 
ATOM   2515 N  N     . CYS B 1 30  ? 14.741  -2.355  15.167  1.00 20.41 ? 30  CYS B N     1 
ATOM   2516 C  CA    . CYS B 1 30  ? 14.994  -0.924  15.161  1.00 17.86 ? 30  CYS B CA    1 
ATOM   2517 C  C     . CYS B 1 30  ? 16.002  -0.573  16.234  1.00 20.33 ? 30  CYS B C     1 
ATOM   2518 O  O     . CYS B 1 30  ? 16.042  -1.200  17.296  1.00 22.69 ? 30  CYS B O     1 
ATOM   2519 C  CB    . CYS B 1 30  ? 13.699  -0.155  15.421  1.00 22.92 ? 30  CYS B CB    1 
ATOM   2520 S  SG    . CYS B 1 30  ? 12.428  -0.312  14.145  1.00 22.75 ? 30  CYS B SG    1 
ATOM   2521 N  N     . THR B 1 31  ? 16.817  0.435   15.949  1.00 19.44 ? 31  THR B N     1 
ATOM   2522 C  CA    . THR B 1 31  ? 17.880  0.843   16.857  1.00 20.37 ? 31  THR B CA    1 
ATOM   2523 C  C     . THR B 1 31  ? 17.341  1.500   18.127  1.00 24.63 ? 31  THR B C     1 
ATOM   2524 O  O     . THR B 1 31  ? 16.204  1.991   18.154  1.00 23.33 ? 31  THR B O     1 
ATOM   2525 C  CB    . THR B 1 31  ? 18.842  1.815   16.154  1.00 26.17 ? 31  THR B CB    1 
ATOM   2526 O  OG1   . THR B 1 31  ? 18.099  2.926   15.632  1.00 21.01 ? 31  THR B OG1   1 
ATOM   2527 C  CG2   . THR B 1 31  ? 19.544  1.118   15.003  1.00 27.23 ? 31  THR B CG2   1 
ATOM   2528 N  N     . ALA B 1 32  ? 18.169  1.513   19.174  1.00 20.54 ? 32  ALA B N     1 
ATOM   2529 C  CA    . ALA B 1 32  ? 17.841  2.236   20.400  1.00 24.00 ? 32  ALA B CA    1 
ATOM   2530 C  C     . ALA B 1 32  ? 17.443  3.665   20.036  1.00 22.69 ? 32  ALA B C     1 
ATOM   2531 O  O     . ALA B 1 32  ? 18.225  4.395   19.414  1.00 24.56 ? 32  ALA B O     1 
ATOM   2532 C  CB    . ALA B 1 32  ? 19.029  2.239   21.352  1.00 29.45 ? 32  ALA B CB    1 
ATOM   2533 N  N     . PRO B 1 33  ? 16.217  4.059   20.407  1.00 21.51 ? 33  PRO B N     1 
ATOM   2534 C  CA    . PRO B 1 33  ? 15.689  5.342   19.933  1.00 23.17 ? 33  PRO B CA    1 
ATOM   2535 C  C     . PRO B 1 33  ? 16.382  6.543   20.554  1.00 24.74 ? 33  PRO B C     1 
ATOM   2536 O  O     . PRO B 1 33  ? 16.853  6.484   21.693  1.00 27.53 ? 33  PRO B O     1 
ATOM   2537 C  CB    . PRO B 1 33  ? 14.211  5.301   20.356  1.00 24.05 ? 33  PRO B CB    1 
ATOM   2538 C  CG    . PRO B 1 33  ? 14.164  4.312   21.494  1.00 27.88 ? 33  PRO B CG    1 
ATOM   2539 C  CD    . PRO B 1 33  ? 15.216  3.283   21.164  1.00 26.78 ? 33  PRO B CD    1 
ATOM   2540 N  N     . VAL B 1 34  ? 16.449  7.622   19.780  1.00 21.88 ? 34  VAL B N     1 
ATOM   2541 C  CA    . VAL B 1 34  ? 16.864  8.912   20.297  1.00 26.36 ? 34  VAL B CA    1 
ATOM   2542 C  C     . VAL B 1 34  ? 15.593  9.679   20.615  1.00 22.53 ? 34  VAL B C     1 
ATOM   2543 O  O     . VAL B 1 34  ? 14.725  9.830   19.754  1.00 23.38 ? 34  VAL B O     1 
ATOM   2544 C  CB    . VAL B 1 34  ? 17.681  9.692   19.266  1.00 27.17 ? 34  VAL B CB    1 
ATOM   2545 C  CG1   . VAL B 1 34  ? 18.013  11.086  19.804  1.00 32.87 ? 34  VAL B CG1   1 
ATOM   2546 C  CG2   . VAL B 1 34  ? 18.956  8.927   18.924  1.00 39.43 ? 34  VAL B CG2   1 
ATOM   2547 N  N     . PHE B 1 35  ? 15.470  10.148  21.852  1.00 22.03 ? 35  PHE B N     1 
ATOM   2548 C  CA    . PHE B 1 35  ? 14.258  10.847  22.260  1.00 25.66 ? 35  PHE B CA    1 
ATOM   2549 C  C     . PHE B 1 35  ? 14.349  12.339  21.954  1.00 27.55 ? 35  PHE B C     1 
ATOM   2550 O  O     . PHE B 1 35  ? 15.407  12.949  22.105  1.00 26.11 ? 35  PHE B O     1 
ATOM   2551 C  CB    . PHE B 1 35  ? 13.981  10.611  23.748  1.00 25.89 ? 35  PHE B CB    1 
ATOM   2552 C  CG    . PHE B 1 35  ? 13.778  9.162   24.099  1.00 24.81 ? 35  PHE B CG    1 
ATOM   2553 C  CD1   . PHE B 1 35  ? 12.683  8.465   23.605  1.00 27.86 ? 35  PHE B CD1   1 
ATOM   2554 C  CD2   . PHE B 1 35  ? 14.678  8.495   24.914  1.00 34.68 ? 35  PHE B CD2   1 
ATOM   2555 C  CE1   . PHE B 1 35  ? 12.492  7.130   23.915  1.00 31.17 ? 35  PHE B CE1   1 
ATOM   2556 C  CE2   . PHE B 1 35  ? 14.493  7.157   25.231  1.00 38.00 ? 35  PHE B CE2   1 
ATOM   2557 C  CZ    . PHE B 1 35  ? 13.399  6.474   24.731  1.00 33.24 ? 35  PHE B CZ    1 
ATOM   2558 N  N     . GLU B 1 36  ? 13.235  12.916  21.514  1.00 23.45 ? 36  GLU B N     1 
ATOM   2559 C  CA    . GLU B 1 36  ? 13.179  14.337  21.197  1.00 24.90 ? 36  GLU B CA    1 
ATOM   2560 C  C     . GLU B 1 36  ? 11.832  14.922  21.609  1.00 25.88 ? 36  GLU B C     1 
ATOM   2561 O  O     . GLU B 1 36  ? 10.829  14.199  21.671  1.00 25.36 ? 36  GLU B O     1 
ATOM   2562 C  CB    . GLU B 1 36  ? 13.417  14.562  19.704  1.00 38.13 ? 36  GLU B CB    1 
ATOM   2563 C  CG    . GLU B 1 36  ? 12.597  13.652  18.813  1.00 38.73 ? 36  GLU B CG    1 
ATOM   2564 C  CD    . GLU B 1 36  ? 12.761  13.978  17.342  1.00 52.23 ? 36  GLU B CD    1 
ATOM   2565 O  OE1   . GLU B 1 36  ? 13.700  13.445  16.711  1.00 45.89 ? 36  GLU B OE1   1 
ATOM   2566 O  OE2   . GLU B 1 36  ? 11.946  14.770  16.821  1.00 55.93 ? 36  GLU B OE2   1 
ATOM   2567 N  N     . PRO B 1 37  ? 11.806  16.228  21.916  1.00 26.68 ? 37  PRO B N     1 
ATOM   2568 C  CA    . PRO B 1 37  ? 10.536  16.855  22.294  1.00 21.22 ? 37  PRO B CA    1 
ATOM   2569 C  C     . PRO B 1 37  ? 9.568   16.891  21.121  1.00 23.25 ? 37  PRO B C     1 
ATOM   2570 O  O     . PRO B 1 37  ? 9.977   17.157  19.980  1.00 27.18 ? 37  PRO B O     1 
ATOM   2571 C  CB    . PRO B 1 37  ? 10.945  18.285  22.670  1.00 23.48 ? 37  PRO B CB    1 
ATOM   2572 C  CG    . PRO B 1 37  ? 12.440  18.203  22.965  1.00 30.33 ? 37  PRO B CG    1 
ATOM   2573 C  CD    . PRO B 1 37  ? 12.939  17.168  22.005  1.00 27.00 ? 37  PRO B CD    1 
ATOM   2574 N  N     . GLY B 1 38  ? 8.296   16.633  21.401  1.00 24.31 ? 38  GLY B N     1 
ATOM   2575 C  CA    . GLY B 1 38  ? 7.277   16.670  20.373  1.00 25.65 ? 38  GLY B CA    1 
ATOM   2576 C  C     . GLY B 1 38  ? 6.079   17.509  20.783  1.00 22.18 ? 38  GLY B C     1 
ATOM   2577 O  O     . GLY B 1 38  ? 5.829   17.725  21.967  1.00 21.37 ? 38  GLY B O     1 
ATOM   2578 N  N     . GLY B 1 39  ? 5.332   17.977  19.795  1.00 22.78 ? 39  GLY B N     1 
ATOM   2579 C  CA    . GLY B 1 39  ? 4.179   18.814  20.063  1.00 24.55 ? 39  GLY B CA    1 
ATOM   2580 C  C     . GLY B 1 39  ? 4.334   20.168  19.405  1.00 25.90 ? 39  GLY B C     1 
ATOM   2581 O  O     . GLY B 1 39  ? 5.445   20.712  19.316  1.00 22.86 ? 39  GLY B O     1 
ATOM   2582 N  N     . GLY B 1 40  ? 3.212   20.718  18.948  1.00 19.21 ? 40  GLY B N     1 
ATOM   2583 C  CA    . GLY B 1 40  ? 3.218   21.962  18.198  1.00 19.45 ? 40  GLY B CA    1 
ATOM   2584 C  C     . GLY B 1 40  ? 3.856   23.134  18.921  1.00 21.99 ? 40  GLY B C     1 
ATOM   2585 O  O     . GLY B 1 40  ? 4.854   23.679  18.457  1.00 22.74 ? 40  GLY B O     1 
ATOM   2586 N  N     . GLY B 1 41  ? 3.280   23.524  20.055  1.00 21.96 ? 41  GLY B N     1 
ATOM   2587 C  CA    . GLY B 1 41  ? 3.778   24.667  20.799  1.00 18.98 ? 41  GLY B CA    1 
ATOM   2588 C  C     . GLY B 1 41  ? 5.200   24.455  21.286  1.00 23.88 ? 41  GLY B C     1 
ATOM   2589 O  O     . GLY B 1 41  ? 5.996   25.383  21.327  1.00 18.93 ? 41  GLY B O     1 
ATOM   2590 N  N     . ILE B 1 42  ? 5.525   23.221  21.647  1.00 21.28 ? 42  ILE B N     1 
ATOM   2591 C  CA    . ILE B 1 42  ? 6.873   22.908  22.095  1.00 21.34 ? 42  ILE B CA    1 
ATOM   2592 C  C     . ILE B 1 42  ? 7.881   23.120  20.979  1.00 21.96 ? 42  ILE B C     1 
ATOM   2593 O  O     . ILE B 1 42  ? 8.906   23.773  21.185  1.00 21.65 ? 42  ILE B O     1 
ATOM   2594 C  CB    . ILE B 1 42  ? 6.957   21.486  22.670  1.00 21.22 ? 42  ILE B CB    1 
ATOM   2595 C  CG1   . ILE B 1 42  ? 6.406   21.501  24.099  1.00 22.26 ? 42  ILE B CG1   1 
ATOM   2596 C  CG2   . ILE B 1 42  ? 8.401   20.975  22.656  1.00 25.12 ? 42  ILE B CG2   1 
ATOM   2597 C  CD1   . ILE B 1 42  ? 6.240   20.127  24.719  1.00 24.30 ? 42  ILE B CD1   1 
ATOM   2598 N  N     . ASN B 1 43  ? 7.584   22.600  19.792  1.00 18.72 ? 43  ASN B N     1 
ATOM   2599 C  CA    . ASN B 1 43  ? 8.473   22.817  18.655  1.00 18.14 ? 43  ASN B CA    1 
ATOM   2600 C  C     . ASN B 1 43  ? 8.523   24.279  18.216  1.00 18.91 ? 43  ASN B C     1 
ATOM   2601 O  O     . ASN B 1 43  ? 9.556   24.745  17.741  1.00 19.65 ? 43  ASN B O     1 
ATOM   2602 C  CB    . ASN B 1 43  ? 8.137   21.879  17.497  1.00 19.51 ? 43  ASN B CB    1 
ATOM   2603 C  CG    . ASN B 1 43  ? 8.624   20.468  17.748  1.00 33.27 ? 43  ASN B CG    1 
ATOM   2604 O  OD1   . ASN B 1 43  ? 9.646   20.270  18.397  1.00 32.78 ? 43  ASN B OD1   1 
ATOM   2605 N  ND2   . ASN B 1 43  ? 7.892   19.481  17.241  1.00 44.46 ? 43  ASN B ND2   1 
ATOM   2606 N  N     . VAL B 1 44  ? 7.422   25.007  18.387  1.00 18.46 ? 44  VAL B N     1 
ATOM   2607 C  CA    . VAL B 1 44  ? 7.448   26.445  18.116  1.00 16.90 ? 44  VAL B CA    1 
ATOM   2608 C  C     . VAL B 1 44  ? 8.440   27.146  19.041  1.00 19.14 ? 44  VAL B C     1 
ATOM   2609 O  O     . VAL B 1 44  ? 9.238   27.979  18.597  1.00 21.48 ? 44  VAL B O     1 
ATOM   2610 C  CB    . VAL B 1 44  ? 6.051   27.098  18.262  1.00 19.49 ? 44  VAL B CB    1 
ATOM   2611 C  CG1   . VAL B 1 44  ? 6.163   28.629  18.204  1.00 20.02 ? 44  VAL B CG1   1 
ATOM   2612 C  CG2   . VAL B 1 44  ? 5.133   26.614  17.173  1.00 18.39 ? 44  VAL B CG2   1 
ATOM   2613 N  N     . ALA B 1 45  ? 8.402   26.807  20.328  1.00 19.02 ? 45  ALA B N     1 
ATOM   2614 C  CA    . ALA B 1 45  ? 9.353   27.377  21.279  1.00 19.91 ? 45  ALA B CA    1 
ATOM   2615 C  C     . ALA B 1 45  ? 10.799  26.995  20.937  1.00 21.39 ? 45  ALA B C     1 
ATOM   2616 O  O     . ALA B 1 45  ? 11.723  27.802  21.101  1.00 23.26 ? 45  ALA B O     1 
ATOM   2617 C  CB    . ALA B 1 45  ? 9.008   26.954  22.703  1.00 20.65 ? 45  ALA B CB    1 
ATOM   2618 N  N     . ARG B 1 46  ? 11.000  25.766  20.468  1.00 20.19 ? 46  ARG B N     1 
ATOM   2619 C  CA    . ARG B 1 46  ? 12.341  25.317  20.082  1.00 23.57 ? 46  ARG B CA    1 
ATOM   2620 C  C     . ARG B 1 46  ? 12.845  26.077  18.857  1.00 20.94 ? 46  ARG B C     1 
ATOM   2621 O  O     . ARG B 1 46  ? 14.013  26.482  18.799  1.00 21.87 ? 46  ARG B O     1 
ATOM   2622 C  CB    . ARG B 1 46  ? 12.355  23.810  19.811  1.00 23.46 ? 46  ARG B CB    1 
ATOM   2623 C  CG    . ARG B 1 46  ? 12.090  22.947  21.041  1.00 23.58 ? 46  ARG B CG    1 
ATOM   2624 C  CD    . ARG B 1 46  ? 11.983  21.476  20.662  1.00 25.36 ? 46  ARG B CD    1 
ATOM   2625 N  NE    . ARG B 1 46  ? 13.267  20.940  20.214  1.00 30.00 ? 46  ARG B NE    1 
ATOM   2626 C  CZ    . ARG B 1 46  ? 13.408  20.053  19.234  1.00 37.32 ? 46  ARG B CZ    1 
ATOM   2627 N  NH1   . ARG B 1 46  ? 12.343  19.590  18.589  1.00 35.38 ? 46  ARG B NH1   1 
ATOM   2628 N  NH2   . ARG B 1 46  ? 14.617  19.628  18.897  1.00 42.62 ? 46  ARG B NH2   1 
ATOM   2629 N  N     . ALA B 1 47  ? 11.965  26.260  17.875  1.00 19.94 ? 47  ALA B N     1 
ATOM   2630 C  CA    . ALA B 1 47  ? 12.310  27.013  16.674  1.00 21.08 ? 47  ALA B CA    1 
ATOM   2631 C  C     . ALA B 1 47  ? 12.706  28.437  17.050  1.00 19.17 ? 47  ALA B C     1 
ATOM   2632 O  O     . ALA B 1 47  ? 13.699  28.966  16.555  1.00 23.32 ? 47  ALA B O     1 
ATOM   2633 C  CB    . ALA B 1 47  ? 11.147  27.023  15.693  1.00 20.56 ? 47  ALA B CB    1 
ATOM   2634 N  N     . ILE B 1 48  ? 11.926  29.050  17.933  1.00 17.09 ? 48  ILE B N     1 
ATOM   2635 C  CA    . ILE B 1 48  ? 12.220  30.407  18.388  1.00 17.78 ? 48  ILE B CA    1 
ATOM   2636 C  C     . ILE B 1 48  ? 13.603  30.479  19.041  1.00 24.03 ? 48  ILE B C     1 
ATOM   2637 O  O     . ILE B 1 48  ? 14.351  31.426  18.808  1.00 22.45 ? 48  ILE B O     1 
ATOM   2638 C  CB    . ILE B 1 48  ? 11.118  30.947  19.327  1.00 23.14 ? 48  ILE B CB    1 
ATOM   2639 C  CG1   . ILE B 1 48  ? 9.860   31.268  18.508  1.00 21.80 ? 48  ILE B CG1   1 
ATOM   2640 C  CG2   . ILE B 1 48  ? 11.599  32.179  20.080  1.00 27.21 ? 48  ILE B CG2   1 
ATOM   2641 C  CD1   . ILE B 1 48  ? 8.638   31.621  19.349  1.00 20.11 ? 48  ILE B CD1   1 
ATOM   2642 N  N     . ALA B 1 49  ? 13.947  29.465  19.832  1.00 24.40 ? 49  ALA B N     1 
ATOM   2643 C  CA    . ALA B 1 49  ? 15.273  29.400  20.449  1.00 25.09 ? 49  ALA B CA    1 
ATOM   2644 C  C     . ALA B 1 49  ? 16.360  29.354  19.380  1.00 25.39 ? 49  ALA B C     1 
ATOM   2645 O  O     . ALA B 1 49  ? 17.366  30.052  19.489  1.00 25.73 ? 49  ALA B O     1 
ATOM   2646 C  CB    . ALA B 1 49  ? 15.378  28.197  21.364  1.00 26.60 ? 49  ALA B CB    1 
ATOM   2647 N  N     . HIS B 1 50  ? 16.151  28.535  18.350  1.00 25.67 ? 50  HIS B N     1 
ATOM   2648 C  CA    . HIS B 1 50  ? 17.106  28.436  17.244  1.00 27.25 ? 50  HIS B CA    1 
ATOM   2649 C  C     . HIS B 1 50  ? 17.308  29.784  16.560  1.00 26.97 ? 50  HIS B C     1 
ATOM   2650 O  O     . HIS B 1 50  ? 18.408  30.117  16.118  1.00 29.01 ? 50  HIS B O     1 
ATOM   2651 C  CB    . HIS B 1 50  ? 16.631  27.411  16.217  1.00 24.91 ? 50  HIS B CB    1 
ATOM   2652 C  CG    . HIS B 1 50  ? 16.655  26.004  16.719  1.00 32.73 ? 50  HIS B CG    1 
ATOM   2653 N  ND1   . HIS B 1 50  ? 16.308  24.928  15.933  1.00 37.19 ? 50  HIS B ND1   1 
ATOM   2654 C  CD2   . HIS B 1 50  ? 16.987  25.497  17.928  1.00 36.15 ? 50  HIS B CD2   1 
ATOM   2655 C  CE1   . HIS B 1 50  ? 16.426  23.816  16.637  1.00 43.32 ? 50  HIS B CE1   1 
ATOM   2656 N  NE2   . HIS B 1 50  ? 16.836  24.134  17.851  1.00 46.52 ? 50  HIS B NE2   1 
ATOM   2657 N  N     . LEU B 1 51  ? 16.239  30.564  16.483  1.00 19.28 ? 51  LEU B N     1 
ATOM   2658 C  CA    . LEU B 1 51  ? 16.284  31.834  15.771  1.00 19.42 ? 51  LEU B CA    1 
ATOM   2659 C  C     . LEU B 1 51  ? 16.811  32.972  16.627  1.00 26.76 ? 51  LEU B C     1 
ATOM   2660 O  O     . LEU B 1 51  ? 16.903  34.111  16.167  1.00 31.07 ? 51  LEU B O     1 
ATOM   2661 C  CB    . LEU B 1 51  ? 14.904  32.168  15.196  1.00 21.88 ? 51  LEU B CB    1 
ATOM   2662 C  CG    . LEU B 1 51  ? 14.416  31.157  14.150  1.00 25.41 ? 51  LEU B CG    1 
ATOM   2663 C  CD1   . LEU B 1 51  ? 13.030  31.516  13.616  1.00 25.06 ? 51  LEU B CD1   1 
ATOM   2664 C  CD2   . LEU B 1 51  ? 15.413  31.040  13.006  1.00 22.57 ? 51  LEU B CD2   1 
ATOM   2665 N  N     . GLY B 1 52  ? 17.149  32.666  17.876  1.00 29.54 ? 52  GLY B N     1 
ATOM   2666 C  CA    . GLY B 1 52  ? 17.791  33.645  18.739  1.00 32.31 ? 52  GLY B CA    1 
ATOM   2667 C  C     . GLY B 1 52  ? 16.885  34.355  19.726  1.00 29.45 ? 52  GLY B C     1 
ATOM   2668 O  O     . GLY B 1 52  ? 17.319  35.272  20.425  1.00 28.27 ? 52  GLY B O     1 
ATOM   2669 N  N     . GLY B 1 53  ? 15.626  33.938  19.784  1.00 27.12 ? 53  GLY B N     1 
ATOM   2670 C  CA    . GLY B 1 53  ? 14.680  34.516  20.719  1.00 26.39 ? 53  GLY B CA    1 
ATOM   2671 C  C     . GLY B 1 53  ? 14.384  33.561  21.856  1.00 27.82 ? 53  GLY B C     1 
ATOM   2672 O  O     . GLY B 1 53  ? 15.046  32.531  22.001  1.00 28.06 ? 53  GLY B O     1 
ATOM   2673 N  N     . SER B 1 54  ? 13.385  33.897  22.663  1.00 27.00 ? 54  SER B N     1 
ATOM   2674 C  CA    . SER B 1 54  ? 13.032  33.067  23.808  1.00 33.19 ? 54  SER B CA    1 
ATOM   2675 C  C     . SER B 1 54  ? 11.522  32.924  23.933  1.00 32.19 ? 54  SER B C     1 
ATOM   2676 O  O     . SER B 1 54  ? 10.788  33.909  23.886  1.00 30.30 ? 54  SER B O     1 
ATOM   2677 C  CB    . SER B 1 54  ? 13.611  33.653  25.099  1.00 42.36 ? 54  SER B CB    1 
ATOM   2678 O  OG    . SER B 1 54  ? 13.392  32.786  26.200  1.00 46.63 ? 54  SER B OG    1 
ATOM   2679 N  N     . ALA B 1 55  ? 11.065  31.688  24.081  1.00 26.18 ? 55  ALA B N     1 
ATOM   2680 C  CA    . ALA B 1 55  ? 9.649   31.420  24.297  1.00 25.98 ? 55  ALA B CA    1 
ATOM   2681 C  C     . ALA B 1 55  ? 9.505   30.370  25.387  1.00 28.37 ? 55  ALA B C     1 
ATOM   2682 O  O     . ALA B 1 55  ? 10.206  29.356  25.374  1.00 29.76 ? 55  ALA B O     1 
ATOM   2683 C  CB    . ALA B 1 55  ? 8.985   30.945  23.007  1.00 23.94 ? 55  ALA B CB    1 
ATOM   2684 N  N     . THR B 1 56  ? 8.598   30.615  26.326  1.00 24.68 ? 56  THR B N     1 
ATOM   2685 C  CA    . THR B 1 56  ? 8.344   29.675  27.408  1.00 24.21 ? 56  THR B CA    1 
ATOM   2686 C  C     . THR B 1 56  ? 7.257   28.697  26.984  1.00 26.63 ? 56  THR B C     1 
ATOM   2687 O  O     . THR B 1 56  ? 6.150   29.106  26.641  1.00 26.37 ? 56  THR B O     1 
ATOM   2688 C  CB    . THR B 1 56  ? 7.855   30.395  28.676  1.00 26.35 ? 56  THR B CB    1 
ATOM   2689 O  OG1   . THR B 1 56  ? 8.870   31.294  29.142  1.00 30.38 ? 56  THR B OG1   1 
ATOM   2690 C  CG2   . THR B 1 56  ? 7.532   29.382  29.765  1.00 29.17 ? 56  THR B CG2   1 
ATOM   2691 N  N     . ALA B 1 57  ? 7.567   27.406  27.021  1.00 24.41 ? 57  ALA B N     1 
ATOM   2692 C  CA    . ALA B 1 57  ? 6.598   26.384  26.636  1.00 22.71 ? 57  ALA B CA    1 
ATOM   2693 C  C     . ALA B 1 57  ? 5.759   25.922  27.824  1.00 22.84 ? 57  ALA B C     1 
ATOM   2694 O  O     . ALA B 1 57  ? 6.296   25.415  28.812  1.00 27.70 ? 57  ALA B O     1 
ATOM   2695 C  CB    . ALA B 1 57  ? 7.303   25.193  25.993  1.00 22.14 ? 57  ALA B CB    1 
ATOM   2696 N  N     . ILE B 1 58  ? 4.442   26.097  27.713  1.00 24.35 ? 58  ILE B N     1 
ATOM   2697 C  CA    . ILE B 1 58  ? 3.498   25.610  28.717  1.00 25.46 ? 58  ILE B CA    1 
ATOM   2698 C  C     . ILE B 1 58  ? 2.881   24.306  28.220  1.00 24.46 ? 58  ILE B C     1 
ATOM   2699 O  O     . ILE B 1 58  ? 2.403   24.238  27.086  1.00 23.92 ? 58  ILE B O     1 
ATOM   2700 C  CB    . ILE B 1 58  ? 2.357   26.627  28.970  1.00 28.16 ? 58  ILE B CB    1 
ATOM   2701 C  CG1   . ILE B 1 58  ? 2.926   27.999  29.348  1.00 28.71 ? 58  ILE B CG1   1 
ATOM   2702 C  CG2   . ILE B 1 58  ? 1.412   26.123  30.059  1.00 28.35 ? 58  ILE B CG2   1 
ATOM   2703 C  CD1   . ILE B 1 58  ? 1.902   29.127  29.287  1.00 26.84 ? 58  ILE B CD1   1 
ATOM   2704 N  N     . PHE B 1 59  ? 2.884   23.275  29.063  1.00 24.83 ? 59  PHE B N     1 
ATOM   2705 C  CA    . PHE B 1 59  ? 2.337   21.976  28.664  1.00 25.91 ? 59  PHE B CA    1 
ATOM   2706 C  C     . PHE B 1 59  ? 2.194   21.025  29.848  1.00 19.68 ? 59  PHE B C     1 
ATOM   2707 O  O     . PHE B 1 59  ? 2.898   21.169  30.847  1.00 23.63 ? 59  PHE B O     1 
ATOM   2708 C  CB    . PHE B 1 59  ? 3.210   21.332  27.574  1.00 24.62 ? 59  PHE B CB    1 
ATOM   2709 C  CG    . PHE B 1 59  ? 4.622   21.049  28.007  1.00 25.86 ? 59  PHE B CG    1 
ATOM   2710 C  CD1   . PHE B 1 59  ? 4.974   19.800  28.513  1.00 22.83 ? 59  PHE B CD1   1 
ATOM   2711 C  CD2   . PHE B 1 59  ? 5.603   22.024  27.897  1.00 26.58 ? 59  PHE B CD2   1 
ATOM   2712 C  CE1   . PHE B 1 59  ? 6.282   19.534  28.915  1.00 26.89 ? 59  PHE B CE1   1 
ATOM   2713 C  CE2   . PHE B 1 59  ? 6.906   21.769  28.291  1.00 27.31 ? 59  PHE B CE2   1 
ATOM   2714 C  CZ    . PHE B 1 59  ? 7.251   20.519  28.801  1.00 27.29 ? 59  PHE B CZ    1 
ATOM   2715 N  N     . PRO B 1 60  ? 1.275   20.046  29.739  1.00 25.80 ? 60  PRO B N     1 
ATOM   2716 C  CA    . PRO B 1 60  ? 1.182   19.008  30.770  1.00 27.08 ? 60  PRO B CA    1 
ATOM   2717 C  C     . PRO B 1 60  ? 2.262   17.954  30.566  1.00 27.83 ? 60  PRO B C     1 
ATOM   2718 O  O     . PRO B 1 60  ? 2.598   17.624  29.428  1.00 30.40 ? 60  PRO B O     1 
ATOM   2719 C  CB    . PRO B 1 60  ? -0.198  18.396  30.526  1.00 26.34 ? 60  PRO B CB    1 
ATOM   2720 C  CG    . PRO B 1 60  ? -0.443  18.599  29.058  1.00 26.44 ? 60  PRO B CG    1 
ATOM   2721 C  CD    . PRO B 1 60  ? 0.223   19.909  28.713  1.00 25.17 ? 60  PRO B CD    1 
ATOM   2722 N  N     . ALA B 1 61  ? 2.813   17.449  31.664  1.00 27.26 ? 61  ALA B N     1 
ATOM   2723 C  CA    . ALA B 1 61  ? 3.807   16.387  31.606  1.00 24.55 ? 61  ALA B CA    1 
ATOM   2724 C  C     . ALA B 1 61  ? 3.449   15.308  32.621  1.00 30.18 ? 61  ALA B C     1 
ATOM   2725 O  O     . ALA B 1 61  ? 3.098   15.611  33.758  1.00 32.80 ? 61  ALA B O     1 
ATOM   2726 C  CB    . ALA B 1 61  ? 5.196   16.942  31.890  1.00 32.36 ? 61  ALA B CB    1 
ATOM   2727 N  N     . GLY B 1 62  ? 3.535   14.047  32.208  1.00 29.15 ? 62  GLY B N     1 
ATOM   2728 C  CA    . GLY B 1 62  ? 3.193   12.948  33.094  1.00 28.84 ? 62  GLY B CA    1 
ATOM   2729 C  C     . GLY B 1 62  ? 4.177   11.794  33.028  1.00 32.15 ? 62  GLY B C     1 
ATOM   2730 O  O     . GLY B 1 62  ? 4.662   11.440  31.955  1.00 28.11 ? 62  GLY B O     1 
ATOM   2731 N  N     . GLY B 1 63  ? 4.471   11.206  34.183  1.00 32.51 ? 63  GLY B N     1 
ATOM   2732 C  CA    . GLY B 1 63  ? 5.321   10.029  34.247  1.00 33.52 ? 63  GLY B CA    1 
ATOM   2733 C  C     . GLY B 1 63  ? 6.771   10.273  33.875  1.00 34.08 ? 63  GLY B C     1 
ATOM   2734 O  O     . GLY B 1 63  ? 7.202   11.414  33.698  1.00 28.05 ? 63  GLY B O     1 
ATOM   2735 N  N     . ALA B 1 64  ? 7.527   9.186   33.753  1.00 33.09 ? 64  ALA B N     1 
ATOM   2736 C  CA    . ALA B 1 64  ? 8.946   9.261   33.415  1.00 30.51 ? 64  ALA B CA    1 
ATOM   2737 C  C     . ALA B 1 64  ? 9.177   9.846   32.023  1.00 27.18 ? 64  ALA B C     1 
ATOM   2738 O  O     . ALA B 1 64  ? 10.170  10.535  31.788  1.00 29.81 ? 64  ALA B O     1 
ATOM   2739 C  CB    . ALA B 1 64  ? 9.591   7.884   33.531  1.00 28.18 ? 64  ALA B CB    1 
ATOM   2740 N  N     . THR B 1 65  ? 8.265   9.563   31.097  1.00 30.25 ? 65  THR B N     1 
ATOM   2741 C  CA    . THR B 1 65  ? 8.378   10.113  29.752  1.00 29.99 ? 65  THR B CA    1 
ATOM   2742 C  C     . THR B 1 65  ? 8.251   11.632  29.804  1.00 26.92 ? 65  THR B C     1 
ATOM   2743 O  O     . THR B 1 65  ? 9.000   12.349  29.138  1.00 25.53 ? 65  THR B O     1 
ATOM   2744 C  CB    . THR B 1 65  ? 7.339   9.508   28.782  1.00 30.08 ? 65  THR B CB    1 
ATOM   2745 O  OG1   . THR B 1 65  ? 6.046   9.520   29.392  1.00 26.78 ? 65  THR B OG1   1 
ATOM   2746 C  CG2   . THR B 1 65  ? 7.705   8.071   28.430  1.00 28.52 ? 65  THR B CG2   1 
ATOM   2747 N  N     . GLY B 1 66  ? 7.319   12.117  30.619  1.00 24.40 ? 66  GLY B N     1 
ATOM   2748 C  CA    . GLY B 1 66  ? 7.133   13.546  30.798  1.00 28.37 ? 66  GLY B CA    1 
ATOM   2749 C  C     . GLY B 1 66  ? 8.361   14.206  31.394  1.00 28.30 ? 66  GLY B C     1 
ATOM   2750 O  O     . GLY B 1 66  ? 8.751   15.304  30.986  1.00 27.92 ? 66  GLY B O     1 
ATOM   2751 N  N     . GLU B 1 67  ? 8.974   13.532  32.362  1.00 25.36 ? 67  GLU B N     1 
ATOM   2752 C  CA    . GLU B 1 67  ? 10.169  14.046  33.018  1.00 30.06 ? 67  GLU B CA    1 
ATOM   2753 C  C     . GLU B 1 67  ? 11.313  14.146  32.021  1.00 30.70 ? 67  GLU B C     1 
ATOM   2754 O  O     . GLU B 1 67  ? 12.100  15.085  32.066  1.00 29.56 ? 67  GLU B O     1 
ATOM   2755 C  CB    . GLU B 1 67  ? 10.577  13.144  34.186  1.00 28.81 ? 67  GLU B CB    1 
ATOM   2756 C  CG    . GLU B 1 67  ? 9.553   13.085  35.312  1.00 42.53 ? 67  GLU B CG    1 
ATOM   2757 C  CD    . GLU B 1 67  ? 9.889   12.028  36.349  1.00 58.43 ? 67  GLU B CD    1 
ATOM   2758 O  OE1   . GLU B 1 67  ? 8.951   11.379  36.861  1.00 61.57 ? 67  GLU B OE1   1 
ATOM   2759 O  OE2   . GLU B 1 67  ? 11.089  11.850  36.652  1.00 61.65 ? 67  GLU B OE2   1 
ATOM   2760 N  N     . HIS B 1 68  ? 11.400  13.179  31.114  1.00 28.10 ? 68  HIS B N     1 
ATOM   2761 C  CA    . HIS B 1 68  ? 12.480  13.190  30.135  1.00 29.65 ? 68  HIS B CA    1 
ATOM   2762 C  C     . HIS B 1 68  ? 12.231  14.287  29.107  1.00 27.94 ? 68  HIS B C     1 
ATOM   2763 O  O     . HIS B 1 68  ? 13.169  14.908  28.618  1.00 26.78 ? 68  HIS B O     1 
ATOM   2764 C  CB    . HIS B 1 68  ? 12.629  11.834  29.451  1.00 31.40 ? 68  HIS B CB    1 
ATOM   2765 C  CG    . HIS B 1 68  ? 13.934  11.666  28.734  1.00 36.34 ? 68  HIS B CG    1 
ATOM   2766 N  ND1   . HIS B 1 68  ? 15.150  11.828  29.361  1.00 42.69 ? 68  HIS B ND1   1 
ATOM   2767 C  CD2   . HIS B 1 68  ? 14.212  11.366  27.444  1.00 35.15 ? 68  HIS B CD2   1 
ATOM   2768 C  CE1   . HIS B 1 68  ? 16.123  11.630  28.488  1.00 48.06 ? 68  HIS B CE1   1 
ATOM   2769 N  NE2   . HIS B 1 68  ? 15.578  11.348  27.316  1.00 41.84 ? 68  HIS B NE2   1 
ATOM   2770 N  N     . LEU B 1 69  ? 10.962  14.521  28.785  1.00 27.31 ? 69  LEU B N     1 
ATOM   2771 C  CA    . LEU B 1 69  ? 10.591  15.609  27.887  1.00 22.39 ? 69  LEU B CA    1 
ATOM   2772 C  C     . LEU B 1 69  ? 11.054  16.946  28.449  1.00 29.08 ? 69  LEU B C     1 
ATOM   2773 O  O     . LEU B 1 69  ? 11.647  17.758  27.735  1.00 26.84 ? 69  LEU B O     1 
ATOM   2774 C  CB    . LEU B 1 69  ? 9.072   15.619  27.649  1.00 25.25 ? 69  LEU B CB    1 
ATOM   2775 C  CG    . LEU B 1 69  ? 8.443   16.793  26.890  1.00 28.80 ? 69  LEU B CG    1 
ATOM   2776 C  CD1   . LEU B 1 69  ? 9.024   16.944  25.498  1.00 24.14 ? 69  LEU B CD1   1 
ATOM   2777 C  CD2   . LEU B 1 69  ? 6.926   16.624  26.800  1.00 26.87 ? 69  LEU B CD2   1 
ATOM   2778 N  N     . VAL B 1 70  ? 10.787  17.164  29.733  1.00 26.56 ? 70  VAL B N     1 
ATOM   2779 C  CA    . VAL B 1 70  ? 11.191  18.391  30.403  1.00 23.89 ? 70  VAL B CA    1 
ATOM   2780 C  C     . VAL B 1 70  ? 12.714  18.473  30.464  1.00 27.87 ? 70  VAL B C     1 
ATOM   2781 O  O     . VAL B 1 70  ? 13.305  19.545  30.301  1.00 29.11 ? 70  VAL B O     1 
ATOM   2782 C  CB    . VAL B 1 70  ? 10.600  18.460  31.822  1.00 29.95 ? 70  VAL B CB    1 
ATOM   2783 C  CG1   . VAL B 1 70  ? 11.236  19.587  32.625  1.00 32.51 ? 70  VAL B CG1   1 
ATOM   2784 C  CG2   . VAL B 1 70  ? 9.091   18.632  31.751  1.00 30.17 ? 70  VAL B CG2   1 
ATOM   2785 N  N     . SER B 1 71  ? 13.344  17.324  30.676  1.00 27.69 ? 71  SER B N     1 
ATOM   2786 C  CA    . SER B 1 71  ? 14.797  17.265  30.769  1.00 32.38 ? 71  SER B CA    1 
ATOM   2787 C  C     . SER B 1 71  ? 15.450  17.636  29.439  1.00 31.31 ? 71  SER B C     1 
ATOM   2788 O  O     . SER B 1 71  ? 16.477  18.320  29.409  1.00 33.60 ? 71  SER B O     1 
ATOM   2789 C  CB    . SER B 1 71  ? 15.246  15.873  31.208  1.00 31.70 ? 71  SER B CB    1 
ATOM   2790 O  OG    . SER B 1 71  ? 16.600  15.895  31.610  1.00 46.32 ? 71  SER B OG    1 
ATOM   2791 N  N     . LEU B 1 72  ? 14.854  17.180  28.342  1.00 27.00 ? 72  LEU B N     1 
ATOM   2792 C  CA    . LEU B 1 72  ? 15.369  17.499  27.015  1.00 24.94 ? 72  LEU B CA    1 
ATOM   2793 C  C     . LEU B 1 72  ? 15.288  18.991  26.732  1.00 28.79 ? 72  LEU B C     1 
ATOM   2794 O  O     . LEU B 1 72  ? 16.206  19.573  26.156  1.00 28.87 ? 72  LEU B O     1 
ATOM   2795 C  CB    . LEU B 1 72  ? 14.615  16.715  25.936  1.00 26.55 ? 72  LEU B CB    1 
ATOM   2796 C  CG    . LEU B 1 72  ? 14.966  15.228  25.906  1.00 36.50 ? 72  LEU B CG    1 
ATOM   2797 C  CD1   . LEU B 1 72  ? 13.998  14.473  25.012  1.00 34.94 ? 72  LEU B CD1   1 
ATOM   2798 C  CD2   . LEU B 1 72  ? 16.405  15.030  25.441  1.00 37.63 ? 72  LEU B CD2   1 
ATOM   2799 N  N     . LEU B 1 73  ? 14.185  19.613  27.134  1.00 24.74 ? 73  LEU B N     1 
ATOM   2800 C  CA    . LEU B 1 73  ? 14.011  21.038  26.887  1.00 25.42 ? 73  LEU B CA    1 
ATOM   2801 C  C     . LEU B 1 73  ? 14.983  21.872  27.718  1.00 27.84 ? 73  LEU B C     1 
ATOM   2802 O  O     . LEU B 1 73  ? 15.449  22.916  27.267  1.00 28.75 ? 73  LEU B O     1 
ATOM   2803 C  CB    . LEU B 1 73  ? 12.560  21.457  27.134  1.00 25.05 ? 73  LEU B CB    1 
ATOM   2804 C  CG    . LEU B 1 73  ? 11.603  20.882  26.085  1.00 24.16 ? 73  LEU B CG    1 
ATOM   2805 C  CD1   . LEU B 1 73  ? 10.152  21.140  26.461  1.00 26.58 ? 73  LEU B CD1   1 
ATOM   2806 C  CD2   . LEU B 1 73  ? 11.918  21.451  24.703  1.00 25.26 ? 73  LEU B CD2   1 
ATOM   2807 N  N     . ALA B 1 74  ? 15.290  21.406  28.926  1.00 29.59 ? 74  ALA B N     1 
ATOM   2808 C  CA    . ALA B 1 74  ? 16.275  22.073  29.775  1.00 32.60 ? 74  ALA B CA    1 
ATOM   2809 C  C     . ALA B 1 74  ? 17.650  22.097  29.105  1.00 32.38 ? 74  ALA B C     1 
ATOM   2810 O  O     . ALA B 1 74  ? 18.357  23.106  29.154  1.00 37.94 ? 74  ALA B O     1 
ATOM   2811 C  CB    . ALA B 1 74  ? 16.355  21.396  31.135  1.00 33.79 ? 74  ALA B CB    1 
ATOM   2812 N  N     . ASP B 1 75  ? 18.022  20.982  28.481  1.00 32.31 ? 75  ASP B N     1 
ATOM   2813 C  CA    . ASP B 1 75  ? 19.306  20.873  27.794  1.00 37.02 ? 75  ASP B CA    1 
ATOM   2814 C  C     . ASP B 1 75  ? 19.376  21.750  26.544  1.00 39.72 ? 75  ASP B C     1 
ATOM   2815 O  O     . ASP B 1 75  ? 20.461  22.128  26.101  1.00 43.32 ? 75  ASP B O     1 
ATOM   2816 C  CB    . ASP B 1 75  ? 19.593  19.416  27.425  1.00 40.39 ? 75  ASP B CB    1 
ATOM   2817 C  CG    . ASP B 1 75  ? 19.667  18.513  28.642  1.00 46.70 ? 75  ASP B CG    1 
ATOM   2818 O  OD1   . ASP B 1 75  ? 19.752  19.043  29.771  1.00 46.34 ? 75  ASP B OD1   1 
ATOM   2819 O  OD2   . ASP B 1 75  ? 19.647  17.275  28.468  1.00 51.60 ? 75  ASP B OD2   1 
ATOM   2820 N  N     . GLU B 1 76  ? 18.216  22.064  25.975  1.00 36.05 ? 76  GLU B N     1 
ATOM   2821 C  CA    . GLU B 1 76  ? 18.147  22.930  24.802  1.00 34.96 ? 76  GLU B CA    1 
ATOM   2822 C  C     . GLU B 1 76  ? 17.926  24.379  25.215  1.00 36.57 ? 76  GLU B C     1 
ATOM   2823 O  O     . GLU B 1 76  ? 17.740  25.255  24.368  1.00 35.46 ? 76  GLU B O     1 
ATOM   2824 C  CB    . GLU B 1 76  ? 17.025  22.482  23.873  1.00 36.25 ? 76  GLU B CB    1 
ATOM   2825 C  CG    . GLU B 1 76  ? 17.217  21.089  23.311  1.00 36.64 ? 76  GLU B CG    1 
ATOM   2826 C  CD    . GLU B 1 76  ? 16.069  20.668  22.423  1.00 43.56 ? 76  GLU B CD    1 
ATOM   2827 O  OE1   . GLU B 1 76  ? 15.171  21.503  22.184  1.00 39.05 ? 76  GLU B OE1   1 
ATOM   2828 O  OE2   . GLU B 1 76  ? 16.063  19.503  21.970  1.00 49.47 ? 76  GLU B OE2   1 
ATOM   2829 N  N     . ASN B 1 77  ? 17.942  24.611  26.524  1.00 33.94 ? 77  ASN B N     1 
ATOM   2830 C  CA    . ASN B 1 77  ? 17.739  25.936  27.101  1.00 37.96 ? 77  ASN B CA    1 
ATOM   2831 C  C     . ASN B 1 77  ? 16.406  26.561  26.707  1.00 36.86 ? 77  ASN B C     1 
ATOM   2832 O  O     . ASN B 1 77  ? 16.321  27.769  26.484  1.00 35.49 ? 77  ASN B O     1 
ATOM   2833 C  CB    . ASN B 1 77  ? 18.904  26.870  26.757  1.00 43.20 ? 77  ASN B CB    1 
ATOM   2834 C  CG    . ASN B 1 77  ? 20.244  26.311  27.196  1.00 53.17 ? 77  ASN B CG    1 
ATOM   2835 O  OD1   . ASN B 1 77  ? 21.171  26.183  26.392  1.00 57.27 ? 77  ASN B OD1   1 
ATOM   2836 N  ND2   . ASN B 1 77  ? 20.353  25.969  28.478  1.00 48.65 ? 77  ASN B ND2   1 
ATOM   2837 N  N     . VAL B 1 78  ? 15.370  25.730  26.623  1.00 30.01 ? 78  VAL B N     1 
ATOM   2838 C  CA    . VAL B 1 78  ? 14.016  26.206  26.370  1.00 28.72 ? 78  VAL B CA    1 
ATOM   2839 C  C     . VAL B 1 78  ? 13.255  26.258  27.690  1.00 27.86 ? 78  VAL B C     1 
ATOM   2840 O  O     . VAL B 1 78  ? 13.017  25.219  28.311  1.00 31.09 ? 78  VAL B O     1 
ATOM   2841 C  CB    . VAL B 1 78  ? 13.266  25.279  25.402  1.00 28.10 ? 78  VAL B CB    1 
ATOM   2842 C  CG1   . VAL B 1 78  ? 11.813  25.727  25.245  1.00 31.72 ? 78  VAL B CG1   1 
ATOM   2843 C  CG2   . VAL B 1 78  ? 13.980  25.227  24.052  1.00 31.44 ? 78  VAL B CG2   1 
ATOM   2844 N  N     . PRO B 1 79  ? 12.891  27.472  28.135  1.00 26.61 ? 79  PRO B N     1 
ATOM   2845 C  CA    . PRO B 1 79  ? 12.169  27.628  29.402  1.00 31.14 ? 79  PRO B CA    1 
ATOM   2846 C  C     . PRO B 1 79  ? 10.788  27.004  29.319  1.00 31.62 ? 79  PRO B C     1 
ATOM   2847 O  O     . PRO B 1 79  ? 10.155  27.027  28.259  1.00 26.78 ? 79  PRO B O     1 
ATOM   2848 C  CB    . PRO B 1 79  ? 12.070  29.150  29.580  1.00 36.06 ? 79  PRO B CB    1 
ATOM   2849 C  CG    . PRO B 1 79  ? 12.332  29.727  28.225  1.00 43.27 ? 79  PRO B CG    1 
ATOM   2850 C  CD    . PRO B 1 79  ? 13.243  28.768  27.529  1.00 36.64 ? 79  PRO B CD    1 
ATOM   2851 N  N     . VAL B 1 80  ? 10.341  26.422  30.426  1.00 27.42 ? 80  VAL B N     1 
ATOM   2852 C  CA    . VAL B 1 80  ? 9.057   25.744  30.450  1.00 28.51 ? 80  VAL B CA    1 
ATOM   2853 C  C     . VAL B 1 80  ? 8.243   26.116  31.677  1.00 29.11 ? 80  VAL B C     1 
ATOM   2854 O  O     . VAL B 1 80  ? 8.767   26.634  32.669  1.00 29.12 ? 80  VAL B O     1 
ATOM   2855 C  CB    . VAL B 1 80  ? 9.213   24.205  30.428  1.00 28.10 ? 80  VAL B CB    1 
ATOM   2856 C  CG1   . VAL B 1 80  ? 10.107  23.758  29.283  1.00 29.45 ? 80  VAL B CG1   1 
ATOM   2857 C  CG2   . VAL B 1 80  ? 9.777   23.703  31.752  1.00 26.14 ? 80  VAL B CG2   1 
ATOM   2858 N  N     . ALA B 1 81  ? 6.950   25.844  31.587  1.00 28.66 ? 81  ALA B N     1 
ATOM   2859 C  CA    . ALA B 1 81  ? 6.042   25.928  32.717  1.00 31.04 ? 81  ALA B CA    1 
ATOM   2860 C  C     . ALA B 1 81  ? 5.120   24.730  32.560  1.00 30.14 ? 81  ALA B C     1 
ATOM   2861 O  O     . ALA B 1 81  ? 4.297   24.683  31.646  1.00 30.51 ? 81  ALA B O     1 
ATOM   2862 C  CB    . ALA B 1 81  ? 5.252   27.218  32.667  1.00 32.33 ? 81  ALA B CB    1 
ATOM   2863 N  N     . THR B 1 82  ? 5.279   23.743  33.430  1.00 29.40 ? 82  THR B N     1 
ATOM   2864 C  CA    . THR B 1 82  ? 4.559   22.489  33.262  1.00 30.11 ? 82  THR B CA    1 
ATOM   2865 C  C     . THR B 1 82  ? 3.499   22.257  34.331  1.00 29.91 ? 82  THR B C     1 
ATOM   2866 O  O     . THR B 1 82  ? 3.567   22.803  35.439  1.00 29.44 ? 82  THR B O     1 
ATOM   2867 C  CB    . THR B 1 82  ? 5.514   21.283  33.256  1.00 29.21 ? 82  THR B CB    1 
ATOM   2868 O  OG1   . THR B 1 82  ? 6.212   21.224  34.505  1.00 33.63 ? 82  THR B OG1   1 
ATOM   2869 C  CG2   . THR B 1 82  ? 6.522   21.406  32.125  1.00 32.82 ? 82  THR B CG2   1 
ATOM   2870 N  N     . VAL B 1 83  ? 2.520   21.434  33.972  1.00 31.50 ? 83  VAL B N     1 
ATOM   2871 C  CA    . VAL B 1 83  ? 1.506   20.954  34.898  1.00 33.69 ? 83  VAL B CA    1 
ATOM   2872 C  C     . VAL B 1 83  ? 1.642   19.445  34.964  1.00 32.31 ? 83  VAL B C     1 
ATOM   2873 O  O     . VAL B 1 83  ? 1.646   18.777  33.931  1.00 29.73 ? 83  VAL B O     1 
ATOM   2874 C  CB    . VAL B 1 83  ? 0.092   21.302  34.409  1.00 31.26 ? 83  VAL B CB    1 
ATOM   2875 C  CG1   . VAL B 1 83  ? -0.956  20.468  35.160  1.00 30.98 ? 83  VAL B CG1   1 
ATOM   2876 C  CG2   . VAL B 1 83  ? -0.169  22.788  34.575  1.00 29.06 ? 83  VAL B CG2   1 
ATOM   2877 N  N     . GLU B 1 84  ? 1.769   18.908  36.171  1.00 31.92 ? 84  GLU B N     1 
ATOM   2878 C  CA    . GLU B 1 84  ? 1.876   17.466  36.332  1.00 33.81 ? 84  GLU B CA    1 
ATOM   2879 C  C     . GLU B 1 84  ? 0.528   16.825  36.005  1.00 35.74 ? 84  GLU B C     1 
ATOM   2880 O  O     . GLU B 1 84  ? -0.511  17.228  36.539  1.00 37.26 ? 84  GLU B O     1 
ATOM   2881 C  CB    . GLU B 1 84  ? 2.312   17.118  37.757  1.00 42.68 ? 84  GLU B CB    1 
ATOM   2882 C  CG    . GLU B 1 84  ? 3.072   15.802  37.877  1.00 45.98 ? 84  GLU B CG    1 
ATOM   2883 C  CD    . GLU B 1 84  ? 3.847   15.694  39.182  1.00 68.06 ? 84  GLU B CD    1 
ATOM   2884 O  OE1   . GLU B 1 84  ? 3.288   16.045  40.245  1.00 68.50 ? 84  GLU B OE1   1 
ATOM   2885 O  OE2   . GLU B 1 84  ? 5.022   15.267  39.139  1.00 76.73 ? 84  GLU B OE2   1 
ATOM   2886 N  N     . ALA B 1 85  ? 0.546   15.841  35.110  1.00 32.45 ? 85  ALA B N     1 
ATOM   2887 C  CA    . ALA B 1 85  ? -0.674  15.152  34.703  1.00 30.45 ? 85  ALA B CA    1 
ATOM   2888 C  C     . ALA B 1 85  ? -0.635  13.689  35.128  1.00 35.63 ? 85  ALA B C     1 
ATOM   2889 O  O     . ALA B 1 85  ? 0.439   13.089  35.207  1.00 38.10 ? 85  ALA B O     1 
ATOM   2890 C  CB    . ALA B 1 85  ? -0.865  15.261  33.198  1.00 28.79 ? 85  ALA B CB    1 
ATOM   2891 N  N     . LYS B 1 86  ? -1.808  13.118  35.390  1.00 37.15 ? 86  LYS B N     1 
ATOM   2892 C  CA    . LYS B 1 86  ? -1.912  11.719  35.799  1.00 39.92 ? 86  LYS B CA    1 
ATOM   2893 C  C     . LYS B 1 86  ? -1.503  10.759  34.682  1.00 37.21 ? 86  LYS B C     1 
ATOM   2894 O  O     . LYS B 1 86  ? -0.734  9.825   34.909  1.00 40.23 ? 86  LYS B O     1 
ATOM   2895 C  CB    . LYS B 1 86  ? -3.340  11.398  36.243  1.00 48.45 ? 86  LYS B CB    1 
ATOM   2896 C  CG    . LYS B 1 86  ? -3.816  12.182  37.446  1.00 56.58 ? 86  LYS B CG    1 
ATOM   2897 C  CD    . LYS B 1 86  ? -3.475  11.480  38.744  1.00 67.30 ? 86  LYS B CD    1 
ATOM   2898 C  CE    . LYS B 1 86  ? -3.622  12.434  39.912  1.00 72.62 ? 86  LYS B CE    1 
ATOM   2899 N  NZ    . LYS B 1 86  ? -2.716  13.602  39.734  1.00 74.85 ? 86  LYS B NZ    1 
ATOM   2900 N  N     . ASP B 1 87  ? -2.036  10.985  33.484  1.00 33.38 ? 87  ASP B N     1 
ATOM   2901 C  CA    . ASP B 1 87  ? -1.772  10.115  32.341  1.00 33.11 ? 87  ASP B CA    1 
ATOM   2902 C  C     . ASP B 1 87  ? -0.392  10.410  31.754  1.00 32.22 ? 87  ASP B C     1 
ATOM   2903 O  O     . ASP B 1 87  ? -0.030  11.574  31.558  1.00 32.57 ? 87  ASP B O     1 
ATOM   2904 C  CB    . ASP B 1 87  ? -2.860  10.294  31.283  1.00 33.87 ? 87  ASP B CB    1 
ATOM   2905 C  CG    . ASP B 1 87  ? -2.890  9.160   30.283  1.00 39.02 ? 87  ASP B CG    1 
ATOM   2906 O  OD1   . ASP B 1 87  ? -2.267  8.111   30.556  1.00 41.84 ? 87  ASP B OD1   1 
ATOM   2907 O  OD2   . ASP B 1 87  ? -3.545  9.317   29.231  1.00 34.46 ? 87  ASP B OD2   1 
ATOM   2908 N  N     . TRP B 1 88  ? 0.379   9.362   31.473  1.00 27.15 ? 88  TRP B N     1 
ATOM   2909 C  CA    . TRP B 1 88  ? 1.781   9.542   31.092  1.00 28.01 ? 88  TRP B CA    1 
ATOM   2910 C  C     . TRP B 1 88  ? 1.950   10.157  29.705  1.00 27.01 ? 88  TRP B C     1 
ATOM   2911 O  O     . TRP B 1 88  ? 1.169   9.881   28.794  1.00 27.32 ? 88  TRP B O     1 
ATOM   2912 C  CB    . TRP B 1 88  ? 2.569   8.224   31.214  1.00 26.13 ? 88  TRP B CB    1 
ATOM   2913 C  CG    . TRP B 1 88  ? 2.366   7.224   30.083  1.00 33.69 ? 88  TRP B CG    1 
ATOM   2914 C  CD1   . TRP B 1 88  ? 2.971   7.232   28.851  1.00 33.93 ? 88  TRP B CD1   1 
ATOM   2915 C  CD2   . TRP B 1 88  ? 1.526   6.057   30.107  1.00 35.99 ? 88  TRP B CD2   1 
ATOM   2916 N  NE1   . TRP B 1 88  ? 2.545   6.153   28.107  1.00 37.36 ? 88  TRP B NE1   1 
ATOM   2917 C  CE2   . TRP B 1 88  ? 1.666   5.423   28.850  1.00 38.13 ? 88  TRP B CE2   1 
ATOM   2918 C  CE3   . TRP B 1 88  ? 0.673   5.503   31.061  1.00 36.57 ? 88  TRP B CE3   1 
ATOM   2919 C  CZ2   . TRP B 1 88  ? 0.971   4.251   28.536  1.00 40.79 ? 88  TRP B CZ2   1 
ATOM   2920 C  CZ3   . TRP B 1 88  ? -0.011  4.341   30.742  1.00 50.95 ? 88  TRP B CZ3   1 
ATOM   2921 C  CH2   . TRP B 1 88  ? 0.141   3.728   29.489  1.00 50.46 ? 88  TRP B CH2   1 
ATOM   2922 N  N     . THR B 1 89  ? 2.972   10.996  29.558  1.00 23.66 ? 89  THR B N     1 
ATOM   2923 C  CA    . THR B 1 89  ? 3.253   11.651  28.279  1.00 23.57 ? 89  THR B CA    1 
ATOM   2924 C  C     . THR B 1 89  ? 3.458   10.621  27.172  1.00 24.86 ? 89  THR B C     1 
ATOM   2925 O  O     . THR B 1 89  ? 4.297   9.725   27.283  1.00 30.13 ? 89  THR B O     1 
ATOM   2926 C  CB    . THR B 1 89  ? 4.481   12.575  28.383  1.00 25.43 ? 89  THR B CB    1 
ATOM   2927 O  OG1   . THR B 1 89  ? 4.200   13.620  29.321  1.00 25.65 ? 89  THR B OG1   1 
ATOM   2928 C  CG2   . THR B 1 89  ? 4.811   13.196  27.029  1.00 25.30 ? 89  THR B CG2   1 
ATOM   2929 N  N     . ARG B 1 90  ? 2.672   10.747  26.108  1.00 25.18 ? 90  ARG B N     1 
ATOM   2930 C  CA    . ARG B 1 90  ? 2.656   9.740   25.056  1.00 25.06 ? 90  ARG B CA    1 
ATOM   2931 C  C     . ARG B 1 90  ? 3.828   9.900   24.090  1.00 28.03 ? 90  ARG B C     1 
ATOM   2932 O  O     . ARG B 1 90  ? 4.534   10.908  24.110  1.00 25.38 ? 90  ARG B O     1 
ATOM   2933 C  CB    . ARG B 1 90  ? 1.326   9.776   24.300  1.00 25.77 ? 90  ARG B CB    1 
ATOM   2934 C  CG    . ARG B 1 90  ? 0.134   9.333   25.146  1.00 24.97 ? 90  ARG B CG    1 
ATOM   2935 C  CD    . ARG B 1 90  ? 0.243   7.865   25.527  1.00 24.79 ? 90  ARG B CD    1 
ATOM   2936 N  NE    . ARG B 1 90  ? -1.029  7.324   26.004  1.00 27.77 ? 90  ARG B NE    1 
ATOM   2937 C  CZ    . ARG B 1 90  ? -1.394  7.266   27.279  1.00 37.29 ? 90  ARG B CZ    1 
ATOM   2938 N  NH1   . ARG B 1 90  ? -2.577  6.752   27.604  1.00 39.72 ? 90  ARG B NH1   1 
ATOM   2939 N  NH2   . ARG B 1 90  ? -0.582  7.721   28.232  1.00 30.49 ? 90  ARG B NH2   1 
ATOM   2940 N  N     . GLN B 1 91  ? 4.024   8.890   23.252  1.00 27.07 ? 91  GLN B N     1 
ATOM   2941 C  CA    . GLN B 1 91  ? 5.161   8.850   22.348  1.00 26.52 ? 91  GLN B CA    1 
ATOM   2942 C  C     . GLN B 1 91  ? 4.714   8.593   20.918  1.00 31.15 ? 91  GLN B C     1 
ATOM   2943 O  O     . GLN B 1 91  ? 3.938   7.669   20.654  1.00 33.48 ? 91  GLN B O     1 
ATOM   2944 C  CB    . GLN B 1 91  ? 6.121   7.740   22.778  1.00 28.48 ? 91  GLN B CB    1 
ATOM   2945 C  CG    . GLN B 1 91  ? 6.474   7.771   24.256  1.00 42.47 ? 91  GLN B CG    1 
ATOM   2946 C  CD    . GLN B 1 91  ? 7.297   6.571   24.682  1.00 59.20 ? 91  GLN B CD    1 
ATOM   2947 O  OE1   . GLN B 1 91  ? 6.767   5.602   25.234  1.00 65.75 ? 91  GLN B OE1   1 
ATOM   2948 N  NE2   . GLN B 1 91  ? 8.601   6.629   24.429  1.00 53.92 ? 91  GLN B NE2   1 
ATOM   2949 N  N     . ASN B 1 92  ? 5.190   9.431   20.004  1.00 21.42 ? 92  ASN B N     1 
ATOM   2950 C  CA    . ASN B 1 92  ? 5.083   9.159   18.580  1.00 17.28 ? 92  ASN B CA    1 
ATOM   2951 C  C     . ASN B 1 92  ? 6.387   8.551   18.087  1.00 18.21 ? 92  ASN B C     1 
ATOM   2952 O  O     . ASN B 1 92  ? 7.422   8.669   18.743  1.00 24.11 ? 92  ASN B O     1 
ATOM   2953 C  CB    . ASN B 1 92  ? 4.776   10.436  17.802  1.00 20.52 ? 92  ASN B CB    1 
ATOM   2954 C  CG    . ASN B 1 92  ? 3.407   11.004  18.135  1.00 25.63 ? 92  ASN B CG    1 
ATOM   2955 O  OD1   . ASN B 1 92  ? 2.482   10.258  18.430  1.00 26.10 ? 92  ASN B OD1   1 
ATOM   2956 N  ND2   . ASN B 1 92  ? 3.285   12.327  18.108  1.00 24.97 ? 92  ASN B ND2   1 
ATOM   2957 N  N     . LEU B 1 93  ? 6.333   7.914   16.923  1.00 21.01 ? 93  LEU B N     1 
ATOM   2958 C  CA    . LEU B 1 93  ? 7.486   7.208   16.400  1.00 20.93 ? 93  LEU B CA    1 
ATOM   2959 C  C     . LEU B 1 93  ? 7.909   7.715   15.023  1.00 19.64 ? 93  LEU B C     1 
ATOM   2960 O  O     . LEU B 1 93  ? 7.092   7.828   14.102  1.00 20.86 ? 93  LEU B O     1 
ATOM   2961 C  CB    . LEU B 1 93  ? 7.203   5.704   16.333  1.00 17.75 ? 93  LEU B CB    1 
ATOM   2962 C  CG    . LEU B 1 93  ? 8.379   4.806   15.947  1.00 21.52 ? 93  LEU B CG    1 
ATOM   2963 C  CD1   . LEU B 1 93  ? 9.488   4.849   16.991  1.00 22.24 ? 93  LEU B CD1   1 
ATOM   2964 C  CD2   . LEU B 1 93  ? 7.906   3.365   15.716  1.00 20.10 ? 93  LEU B CD2   1 
ATOM   2965 N  N     . HIS B 1 94  ? 9.203   7.997   14.901  1.00 14.54 ? 94  HIS B N     1 
ATOM   2966 C  CA    . HIS B 1 94  ? 9.831   8.394   13.647  1.00 15.83 ? 94  HIS B CA    1 
ATOM   2967 C  C     . HIS B 1 94  ? 10.811  7.298   13.264  1.00 20.31 ? 94  HIS B C     1 
ATOM   2968 O  O     . HIS B 1 94  ? 11.742  6.986   14.017  1.00 21.62 ? 94  HIS B O     1 
ATOM   2969 C  CB    . HIS B 1 94  ? 10.575  9.731   13.825  1.00 19.34 ? 94  HIS B CB    1 
ATOM   2970 C  CG    . HIS B 1 94  ? 11.295  10.200  12.595  1.00 23.17 ? 94  HIS B CG    1 
ATOM   2971 N  ND1   . HIS B 1 94  ? 12.579  9.801   12.285  1.00 32.17 ? 94  HIS B ND1   1 
ATOM   2972 C  CD2   . HIS B 1 94  ? 10.918  11.049  11.609  1.00 22.63 ? 94  HIS B CD2   1 
ATOM   2973 C  CE1   . HIS B 1 94  ? 12.957  10.377  11.155  1.00 29.92 ? 94  HIS B CE1   1 
ATOM   2974 N  NE2   . HIS B 1 94  ? 11.967  11.138  10.725  1.00 24.01 ? 94  HIS B NE2   1 
ATOM   2975 N  N     . VAL B 1 95  ? 10.595  6.693   12.101  1.00 19.20 ? 95  VAL B N     1 
ATOM   2976 C  CA    . VAL B 1 95  ? 11.450  5.602   11.654  1.00 19.97 ? 95  VAL B CA    1 
ATOM   2977 C  C     . VAL B 1 95  ? 12.196  5.978   10.387  1.00 20.67 ? 95  VAL B C     1 
ATOM   2978 O  O     . VAL B 1 95  ? 11.580  6.309   9.372   1.00 21.73 ? 95  VAL B O     1 
ATOM   2979 C  CB    . VAL B 1 95  ? 10.631  4.331   11.353  1.00 20.73 ? 95  VAL B CB    1 
ATOM   2980 C  CG1   . VAL B 1 95  ? 11.558  3.165   10.947  1.00 18.99 ? 95  VAL B CG1   1 
ATOM   2981 C  CG2   . VAL B 1 95  ? 9.786   3.948   12.550  1.00 20.91 ? 95  VAL B CG2   1 
ATOM   2982 N  N     . HIS B 1 96  ? 13.524  5.918   10.446  1.00 18.64 ? 96  HIS B N     1 
ATOM   2983 C  CA    . HIS B 1 96  ? 14.345  6.120   9.261   1.00 20.83 ? 96  HIS B CA    1 
ATOM   2984 C  C     . HIS B 1 96  ? 14.712  4.770   8.669   1.00 20.64 ? 96  HIS B C     1 
ATOM   2985 O  O     . HIS B 1 96  ? 15.250  3.918   9.366   1.00 21.77 ? 96  HIS B O     1 
ATOM   2986 C  CB    . HIS B 1 96  ? 15.623  6.865   9.624   1.00 21.84 ? 96  HIS B CB    1 
ATOM   2987 C  CG    . HIS B 1 96  ? 16.509  7.134   8.449   1.00 27.39 ? 96  HIS B CG    1 
ATOM   2988 N  ND1   . HIS B 1 96  ? 16.397  8.273   7.680   1.00 23.92 ? 96  HIS B ND1   1 
ATOM   2989 C  CD2   . HIS B 1 96  ? 17.509  6.406   7.902   1.00 24.45 ? 96  HIS B CD2   1 
ATOM   2990 C  CE1   . HIS B 1 96  ? 17.299  8.239   6.713   1.00 28.04 ? 96  HIS B CE1   1 
ATOM   2991 N  NE2   . HIS B 1 96  ? 17.986  7.113   6.825   1.00 30.28 ? 96  HIS B NE2   1 
ATOM   2992 N  N     . VAL B 1 97  ? 14.428  4.578   7.383   1.00 18.37 ? 97  VAL B N     1 
ATOM   2993 C  CA    . VAL B 1 97  ? 14.744  3.327   6.710   1.00 18.15 ? 97  VAL B CA    1 
ATOM   2994 C  C     . VAL B 1 97  ? 16.056  3.497   5.960   1.00 21.27 ? 97  VAL B C     1 
ATOM   2995 O  O     . VAL B 1 97  ? 16.138  4.271   4.998   1.00 22.43 ? 97  VAL B O     1 
ATOM   2996 C  CB    . VAL B 1 97  ? 13.631  2.933   5.720   1.00 20.28 ? 97  VAL B CB    1 
ATOM   2997 C  CG1   . VAL B 1 97  ? 13.996  1.634   5.018   1.00 26.46 ? 97  VAL B CG1   1 
ATOM   2998 C  CG2   . VAL B 1 97  ? 12.297  2.811   6.444   1.00 21.39 ? 97  VAL B CG2   1 
ATOM   2999 N  N     . GLU B 1 98  ? 17.084  2.787   6.411   1.00 20.64 ? 98  GLU B N     1 
ATOM   3000 C  CA    . GLU B 1 98  ? 18.438  3.009   5.909   1.00 22.44 ? 98  GLU B CA    1 
ATOM   3001 C  C     . GLU B 1 98  ? 18.596  2.763   4.403   1.00 25.12 ? 98  GLU B C     1 
ATOM   3002 O  O     . GLU B 1 98  ? 19.237  3.550   3.706   1.00 26.98 ? 98  GLU B O     1 
ATOM   3003 C  CB    . GLU B 1 98  ? 19.454  2.190   6.724   1.00 24.73 ? 98  GLU B CB    1 
ATOM   3004 C  CG    . GLU B 1 98  ? 20.898  2.658   6.559   1.00 40.96 ? 98  GLU B CG    1 
ATOM   3005 C  CD    . GLU B 1 98  ? 21.091  4.126   6.925   1.00 54.54 ? 98  GLU B CD    1 
ATOM   3006 O  OE1   . GLU B 1 98  ? 20.415  4.612   7.860   1.00 46.28 ? 98  GLU B OE1   1 
ATOM   3007 O  OE2   . GLU B 1 98  ? 21.922  4.796   6.271   1.00 63.11 ? 98  GLU B OE2   1 
ATOM   3008 N  N     . ALA B 1 99  ? 18.009  1.680   3.900   1.00 23.45 ? 99  ALA B N     1 
ATOM   3009 C  CA    . ALA B 1 99  ? 18.179  1.298   2.496   1.00 24.43 ? 99  ALA B CA    1 
ATOM   3010 C  C     . ALA B 1 99  ? 17.625  2.316   1.494   1.00 22.64 ? 99  ALA B C     1 
ATOM   3011 O  O     . ALA B 1 99  ? 18.164  2.466   0.394   1.00 26.03 ? 99  ALA B O     1 
ATOM   3012 C  CB    . ALA B 1 99  ? 17.580  -0.082  2.242   1.00 31.06 ? 99  ALA B CB    1 
ATOM   3013 N  N     . SER B 1 100 ? 16.554  3.005   1.877   1.00 24.66 ? 100 SER B N     1 
ATOM   3014 C  CA    . SER B 1 100 ? 15.864  3.927   0.979   1.00 25.99 ? 100 SER B CA    1 
ATOM   3015 C  C     . SER B 1 100 ? 16.068  5.404   1.338   1.00 29.92 ? 100 SER B C     1 
ATOM   3016 O  O     . SER B 1 100 ? 15.849  6.287   0.506   1.00 29.22 ? 100 SER B O     1 
ATOM   3017 C  CB    . SER B 1 100 ? 14.368  3.616   0.981   1.00 24.79 ? 100 SER B CB    1 
ATOM   3018 O  OG    . SER B 1 100 ? 13.829  3.789   2.280   1.00 23.06 ? 100 SER B OG    1 
ATOM   3019 N  N     . GLY B 1 101 ? 16.472  5.670   2.577   1.00 23.10 ? 101 GLY B N     1 
ATOM   3020 C  CA    . GLY B 1 101 ? 16.604  7.033   3.063   1.00 24.47 ? 101 GLY B CA    1 
ATOM   3021 C  C     . GLY B 1 101 ? 15.267  7.687   3.379   1.00 25.20 ? 101 GLY B C     1 
ATOM   3022 O  O     . GLY B 1 101 ? 15.201  8.880   3.673   1.00 27.35 ? 101 GLY B O     1 
ATOM   3023 N  N     . GLU B 1 102 ? 14.196  6.902   3.316   1.00 23.44 ? 102 GLU B N     1 
ATOM   3024 C  CA    . GLU B 1 102 ? 12.859  7.401   3.609   1.00 21.77 ? 102 GLU B CA    1 
ATOM   3025 C  C     . GLU B 1 102 ? 12.620  7.450   5.111   1.00 24.17 ? 102 GLU B C     1 
ATOM   3026 O  O     . GLU B 1 102 ? 13.256  6.724   5.876   1.00 22.59 ? 102 GLU B O     1 
ATOM   3027 C  CB    . GLU B 1 102 ? 11.802  6.508   2.959   1.00 23.52 ? 102 GLU B CB    1 
ATOM   3028 C  CG    . GLU B 1 102 ? 11.900  6.425   1.437   1.00 29.69 ? 102 GLU B CG    1 
ATOM   3029 C  CD    . GLU B 1 102 ? 10.871  5.481   0.838   1.00 50.07 ? 102 GLU B CD    1 
ATOM   3030 O  OE1   . GLU B 1 102 ? 10.336  4.632   1.586   1.00 58.37 ? 102 GLU B OE1   1 
ATOM   3031 O  OE2   . GLU B 1 102 ? 10.596  5.589   -0.377  1.00 49.98 ? 102 GLU B OE2   1 
ATOM   3032 N  N     . GLN B 1 103 ? 11.701  8.310   5.531   1.00 20.54 ? 103 GLN B N     1 
ATOM   3033 C  CA    . GLN B 1 103 ? 11.319  8.367   6.933   1.00 22.93 ? 103 GLN B CA    1 
ATOM   3034 C  C     . GLN B 1 103 ? 9.818   8.148   7.058   1.00 22.95 ? 103 GLN B C     1 
ATOM   3035 O  O     . GLN B 1 103 ? 9.037   8.598   6.214   1.00 21.89 ? 103 GLN B O     1 
ATOM   3036 C  CB    . GLN B 1 103 ? 11.717  9.706   7.554   1.00 30.14 ? 103 GLN B CB    1 
ATOM   3037 C  CG    . GLN B 1 103 ? 10.991  10.890  6.959   1.00 28.21 ? 103 GLN B CG    1 
ATOM   3038 C  CD    . GLN B 1 103 ? 11.560  12.219  7.417   1.00 29.84 ? 103 GLN B CD    1 
ATOM   3039 O  OE1   . GLN B 1 103 ? 12.032  12.352  8.547   1.00 29.77 ? 103 GLN B OE1   1 
ATOM   3040 N  NE2   . GLN B 1 103 ? 11.511  13.214  6.538   1.00 27.66 ? 103 GLN B NE2   1 
ATOM   3041 N  N     . TYR B 1 104 ? 9.421   7.431   8.102   1.00 19.69 ? 104 TYR B N     1 
ATOM   3042 C  CA    . TYR B 1 104 ? 8.014   7.169   8.358   1.00 18.88 ? 104 TYR B CA    1 
ATOM   3043 C  C     . TYR B 1 104 ? 7.656   7.743   9.708   1.00 20.66 ? 104 TYR B C     1 
ATOM   3044 O  O     . TYR B 1 104 ? 8.424   7.627   10.667  1.00 22.13 ? 104 TYR B O     1 
ATOM   3045 C  CB    . TYR B 1 104 ? 7.732   5.667   8.312   1.00 16.21 ? 104 TYR B CB    1 
ATOM   3046 C  CG    . TYR B 1 104 ? 7.867   5.097   6.918   1.00 20.71 ? 104 TYR B CG    1 
ATOM   3047 C  CD1   . TYR B 1 104 ? 6.753   4.928   6.109   1.00 18.18 ? 104 TYR B CD1   1 
ATOM   3048 C  CD2   . TYR B 1 104 ? 9.112   4.768   6.394   1.00 22.90 ? 104 TYR B CD2   1 
ATOM   3049 C  CE1   . TYR B 1 104 ? 6.868   4.426   4.827   1.00 16.66 ? 104 TYR B CE1   1 
ATOM   3050 C  CE2   . TYR B 1 104 ? 9.236   4.265   5.105   1.00 21.97 ? 104 TYR B CE2   1 
ATOM   3051 C  CZ    . TYR B 1 104 ? 8.106   4.100   4.329   1.00 21.88 ? 104 TYR B CZ    1 
ATOM   3052 O  OH    . TYR B 1 104 ? 8.200   3.606   3.044   1.00 28.82 ? 104 TYR B OH    1 
ATOM   3053 N  N     . ARG B 1 105 ? 6.485   8.365   9.788   1.00 18.31 ? 105 ARG B N     1 
ATOM   3054 C  CA    . ARG B 1 105 ? 6.116   9.095   10.989  1.00 15.74 ? 105 ARG B CA    1 
ATOM   3055 C  C     . ARG B 1 105 ? 4.748   8.643   11.474  1.00 22.22 ? 105 ARG B C     1 
ATOM   3056 O  O     . ARG B 1 105 ? 3.736   8.879   10.808  1.00 19.17 ? 105 ARG B O     1 
ATOM   3057 C  CB    . ARG B 1 105 ? 6.075   10.596  10.687  1.00 23.38 ? 105 ARG B CB    1 
ATOM   3058 C  CG    . ARG B 1 105 ? 7.339   11.139  10.058  1.00 25.60 ? 105 ARG B CG    1 
ATOM   3059 C  CD    . ARG B 1 105 ? 7.042   12.390  9.254   1.00 34.57 ? 105 ARG B CD    1 
ATOM   3060 N  NE    . ARG B 1 105 ? 6.687   13.537  10.086  1.00 28.12 ? 105 ARG B NE    1 
ATOM   3061 C  CZ    . ARG B 1 105 ? 6.229   14.694  9.609   1.00 20.12 ? 105 ARG B CZ    1 
ATOM   3062 N  NH1   . ARG B 1 105 ? 6.059   14.864  8.305   1.00 20.01 ? 105 ARG B NH1   1 
ATOM   3063 N  NH2   . ARG B 1 105 ? 5.953   15.690  10.441  1.00 19.79 ? 105 ARG B NH2   1 
ATOM   3064 N  N     . PHE B 1 106 ? 4.718   7.988   12.628  1.00 18.23 ? 106 PHE B N     1 
ATOM   3065 C  CA    . PHE B 1 106 ? 3.466   7.481   13.164  1.00 17.08 ? 106 PHE B CA    1 
ATOM   3066 C  C     . PHE B 1 106 ? 3.005   8.379   14.300  1.00 18.70 ? 106 PHE B C     1 
ATOM   3067 O  O     . PHE B 1 106 ? 3.635   8.445   15.363  1.00 18.68 ? 106 PHE B O     1 
ATOM   3068 C  CB    . PHE B 1 106 ? 3.634   6.021   13.593  1.00 16.71 ? 106 PHE B CB    1 
ATOM   3069 C  CG    . PHE B 1 106 ? 4.146   5.140   12.483  1.00 19.88 ? 106 PHE B CG    1 
ATOM   3070 C  CD1   . PHE B 1 106 ? 5.504   4.899   12.343  1.00 19.06 ? 106 PHE B CD1   1 
ATOM   3071 C  CD2   . PHE B 1 106 ? 3.273   4.582   11.556  1.00 20.92 ? 106 PHE B CD2   1 
ATOM   3072 C  CE1   . PHE B 1 106 ? 5.986   4.096   11.308  1.00 19.50 ? 106 PHE B CE1   1 
ATOM   3073 C  CE2   . PHE B 1 106 ? 3.742   3.775   10.525  1.00 22.39 ? 106 PHE B CE2   1 
ATOM   3074 C  CZ    . PHE B 1 106 ? 5.102   3.537   10.395  1.00 21.50 ? 106 PHE B CZ    1 
ATOM   3075 N  N     . VAL B 1 107 ? 1.902   9.084   14.055  1.00 16.89 ? 107 VAL B N     1 
ATOM   3076 C  CA    . VAL B 1 107 ? 1.416   10.098  14.977  1.00 19.19 ? 107 VAL B CA    1 
ATOM   3077 C  C     . VAL B 1 107 ? 0.141   9.666   15.690  1.00 24.47 ? 107 VAL B C     1 
ATOM   3078 O  O     . VAL B 1 107 ? -0.925  9.535   15.078  1.00 21.48 ? 107 VAL B O     1 
ATOM   3079 C  CB    . VAL B 1 107 ? 1.184   11.438  14.256  1.00 21.72 ? 107 VAL B CB    1 
ATOM   3080 C  CG1   . VAL B 1 107 ? 0.750   12.504  15.252  1.00 25.02 ? 107 VAL B CG1   1 
ATOM   3081 C  CG2   . VAL B 1 107 ? 2.452   11.873  13.529  1.00 24.81 ? 107 VAL B CG2   1 
ATOM   3082 N  N     . MET B 1 108 ? 0.266   9.454   16.996  1.00 20.66 ? 108 MET B N     1 
ATOM   3083 C  CA    . MET B 1 108 ? -0.853  9.025   17.823  1.00 20.84 ? 108 MET B CA    1 
ATOM   3084 C  C     . MET B 1 108 ? -1.312  10.182  18.709  1.00 23.54 ? 108 MET B C     1 
ATOM   3085 O  O     . MET B 1 108 ? -0.601  11.182  18.834  1.00 25.31 ? 108 MET B O     1 
ATOM   3086 C  CB    . MET B 1 108 ? -0.425  7.818   18.661  1.00 21.58 ? 108 MET B CB    1 
ATOM   3087 C  CG    . MET B 1 108 ? -0.450  6.514   17.874  1.00 22.36 ? 108 MET B CG    1 
ATOM   3088 S  SD    . MET B 1 108 ? 0.567   5.208   18.576  1.00 29.12 ? 108 MET B SD    1 
ATOM   3089 C  CE    . MET B 1 108 ? 2.222   5.824   18.224  1.00 27.92 ? 108 MET B CE    1 
ATOM   3090 N  N     . PRO B 1 109 ? -2.510  10.065  19.313  1.00 24.53 ? 109 PRO B N     1 
ATOM   3091 C  CA    . PRO B 1 109 ? -2.976  11.160  20.169  1.00 29.09 ? 109 PRO B CA    1 
ATOM   3092 C  C     . PRO B 1 109 ? -2.094  11.383  21.399  1.00 26.02 ? 109 PRO B C     1 
ATOM   3093 O  O     . PRO B 1 109 ? -1.308  10.510  21.804  1.00 22.51 ? 109 PRO B O     1 
ATOM   3094 C  CB    . PRO B 1 109 ? -4.365  10.687  20.613  1.00 31.59 ? 109 PRO B CB    1 
ATOM   3095 C  CG    . PRO B 1 109 ? -4.808  9.764   19.538  1.00 38.03 ? 109 PRO B CG    1 
ATOM   3096 C  CD    . PRO B 1 109 ? -3.559  9.051   19.104  1.00 27.13 ? 109 PRO B CD    1 
ATOM   3097 N  N     . GLY B 1 110 ? -2.223  12.566  21.987  1.00 24.26 ? 110 GLY B N     1 
ATOM   3098 C  CA    . GLY B 1 110 ? -1.527  12.865  23.221  1.00 27.22 ? 110 GLY B CA    1 
ATOM   3099 C  C     . GLY B 1 110 ? -2.238  12.235  24.403  1.00 23.78 ? 110 GLY B C     1 
ATOM   3100 O  O     . GLY B 1 110 ? -3.318  11.656  24.259  1.00 25.27 ? 110 GLY B O     1 
ATOM   3101 N  N     . ALA B 1 111 ? -1.629  12.345  25.579  1.00 23.03 ? 111 ALA B N     1 
ATOM   3102 C  CA    . ALA B 1 111 ? -2.211  11.791  26.794  1.00 24.50 ? 111 ALA B CA    1 
ATOM   3103 C  C     . ALA B 1 111 ? -3.489  12.530  27.173  1.00 22.35 ? 111 ALA B C     1 
ATOM   3104 O  O     . ALA B 1 111 ? -3.695  13.677  26.781  1.00 23.20 ? 111 ALA B O     1 
ATOM   3105 C  CB    . ALA B 1 111 ? -1.215  11.846  27.936  1.00 26.18 ? 111 ALA B CB    1 
ATOM   3106 N  N     . ALA B 1 112 ? -4.345  11.872  27.943  1.00 27.27 ? 112 ALA B N     1 
ATOM   3107 C  CA    . ALA B 1 112 ? -5.580  12.503  28.402  1.00 28.05 ? 112 ALA B CA    1 
ATOM   3108 C  C     . ALA B 1 112 ? -5.296  13.613  29.413  1.00 30.46 ? 112 ALA B C     1 
ATOM   3109 O  O     . ALA B 1 112 ? -4.276  13.594  30.107  1.00 30.47 ? 112 ALA B O     1 
ATOM   3110 C  CB    . ALA B 1 112 ? -6.527  11.471  28.999  1.00 32.65 ? 112 ALA B CB    1 
ATOM   3111 N  N     . LEU B 1 113 ? -6.201  14.584  29.474  1.00 27.70 ? 113 LEU B N     1 
ATOM   3112 C  CA    . LEU B 1 113 ? -6.192  15.600  30.521  1.00 30.61 ? 113 LEU B CA    1 
ATOM   3113 C  C     . LEU B 1 113 ? -7.510  15.510  31.282  1.00 29.65 ? 113 LEU B C     1 
ATOM   3114 O  O     . LEU B 1 113 ? -8.565  15.335  30.673  1.00 40.80 ? 113 LEU B O     1 
ATOM   3115 C  CB    . LEU B 1 113 ? -6.055  17.001  29.922  1.00 30.46 ? 113 LEU B CB    1 
ATOM   3116 C  CG    . LEU B 1 113 ? -4.669  17.455  29.461  1.00 35.26 ? 113 LEU B CG    1 
ATOM   3117 C  CD1   . LEU B 1 113 ? -4.757  18.758  28.675  1.00 32.27 ? 113 LEU B CD1   1 
ATOM   3118 C  CD2   . LEU B 1 113 ? -3.759  17.624  30.661  1.00 39.95 ? 113 LEU B CD2   1 
ATOM   3119 N  N     . ASN B 1 114 ? -7.459  15.608  32.607  1.00 30.82 ? 114 ASN B N     1 
ATOM   3120 C  CA    . ASN B 1 114 ? -8.697  15.739  33.371  1.00 35.14 ? 114 ASN B CA    1 
ATOM   3121 C  C     . ASN B 1 114 ? -9.024  17.218  33.552  1.00 38.14 ? 114 ASN B C     1 
ATOM   3122 O  O     . ASN B 1 114 ? -8.230  18.082  33.171  1.00 31.05 ? 114 ASN B O     1 
ATOM   3123 C  CB    . ASN B 1 114 ? -8.650  14.981  34.706  1.00 41.91 ? 114 ASN B CB    1 
ATOM   3124 C  CG    . ASN B 1 114 ? -7.521  15.439  35.608  1.00 41.66 ? 114 ASN B CG    1 
ATOM   3125 O  OD1   . ASN B 1 114 ? -7.208  16.626  35.682  1.00 40.44 ? 114 ASN B OD1   1 
ATOM   3126 N  ND2   . ASN B 1 114 ? -6.905  14.492  36.306  1.00 43.56 ? 114 ASN B ND2   1 
ATOM   3127 N  N     . GLU B 1 115 ? -10.185 17.520  34.117  1.00 35.90 ? 115 GLU B N     1 
ATOM   3128 C  CA    . GLU B 1 115 ? -10.603 18.913  34.217  1.00 41.58 ? 115 GLU B CA    1 
ATOM   3129 C  C     . GLU B 1 115 ? -9.696  19.749  35.120  1.00 35.41 ? 115 GLU B C     1 
ATOM   3130 O  O     . GLU B 1 115 ? -9.501  20.941  34.880  1.00 39.44 ? 115 GLU B O     1 
ATOM   3131 C  CB    . GLU B 1 115 ? -12.064 19.011  34.649  1.00 44.55 ? 115 GLU B CB    1 
ATOM   3132 C  CG    . GLU B 1 115 ? -13.000 18.327  33.675  1.00 53.66 ? 115 GLU B CG    1 
ATOM   3133 C  CD    . GLU B 1 115 ? -14.442 18.709  33.891  1.00 66.86 ? 115 GLU B CD    1 
ATOM   3134 O  OE1   . GLU B 1 115 ? -15.324 18.023  33.333  1.00 70.83 ? 115 GLU B OE1   1 
ATOM   3135 O  OE2   . GLU B 1 115 ? -14.692 19.698  34.613  1.00 74.44 ? 115 GLU B OE2   1 
ATOM   3136 N  N     . ASP B 1 116 ? -9.132  19.120  36.146  1.00 37.35 ? 116 ASP B N     1 
ATOM   3137 C  CA    . ASP B 1 116 ? -8.270  19.828  37.087  1.00 39.88 ? 116 ASP B CA    1 
ATOM   3138 C  C     . ASP B 1 116 ? -6.940  20.208  36.440  1.00 39.24 ? 116 ASP B C     1 
ATOM   3139 O  O     . ASP B 1 116 ? -6.419  21.304  36.659  1.00 39.36 ? 116 ASP B O     1 
ATOM   3140 C  CB    . ASP B 1 116 ? -8.034  18.990  38.345  1.00 45.61 ? 116 ASP B CB    1 
ATOM   3141 C  CG    . ASP B 1 116 ? -7.065  19.648  39.312  1.00 57.38 ? 116 ASP B CG    1 
ATOM   3142 O  OD1   . ASP B 1 116 ? -7.410  20.712  39.872  1.00 59.88 ? 116 ASP B OD1   1 
ATOM   3143 O  OD2   . ASP B 1 116 ? -5.962  19.097  39.520  1.00 60.01 ? 116 ASP B OD2   1 
ATOM   3144 N  N     . GLU B 1 117 ? -6.393  19.301  35.641  1.00 33.91 ? 117 GLU B N     1 
ATOM   3145 C  CA    . GLU B 1 117 ? -5.148  19.575  34.938  1.00 33.97 ? 117 GLU B CA    1 
ATOM   3146 C  C     . GLU B 1 117 ? -5.328  20.679  33.903  1.00 35.10 ? 117 GLU B C     1 
ATOM   3147 O  O     . GLU B 1 117 ? -4.432  21.501  33.700  1.00 33.53 ? 117 GLU B O     1 
ATOM   3148 C  CB    . GLU B 1 117 ? -4.606  18.300  34.293  1.00 32.38 ? 117 GLU B CB    1 
ATOM   3149 C  CG    . GLU B 1 117 ? -4.128  17.293  35.317  1.00 38.46 ? 117 GLU B CG    1 
ATOM   3150 C  CD    . GLU B 1 117 ? -4.195  15.866  34.819  1.00 38.42 ? 117 GLU B CD    1 
ATOM   3151 O  OE1   . GLU B 1 117 ? -3.877  14.956  35.614  1.00 34.93 ? 117 GLU B OE1   1 
ATOM   3152 O  OE2   . GLU B 1 117 ? -4.565  15.654  33.643  1.00 36.66 ? 117 GLU B OE2   1 
ATOM   3153 N  N     . PHE B 1 118 ? -6.485  20.705  33.249  1.00 35.23 ? 118 PHE B N     1 
ATOM   3154 C  CA    . PHE B 1 118 ? -6.740  21.761  32.279  1.00 32.93 ? 118 PHE B CA    1 
ATOM   3155 C  C     . PHE B 1 118 ? -6.888  23.092  33.006  1.00 33.00 ? 118 PHE B C     1 
ATOM   3156 O  O     . PHE B 1 118 ? -6.414  24.122  32.525  1.00 35.93 ? 118 PHE B O     1 
ATOM   3157 C  CB    . PHE B 1 118 ? -7.974  21.471  31.424  1.00 28.25 ? 118 PHE B CB    1 
ATOM   3158 C  CG    . PHE B 1 118 ? -8.208  22.493  30.345  1.00 33.01 ? 118 PHE B CG    1 
ATOM   3159 C  CD1   . PHE B 1 118 ? -8.972  23.625  30.593  1.00 32.20 ? 118 PHE B CD1   1 
ATOM   3160 C  CD2   . PHE B 1 118 ? -7.643  22.332  29.090  1.00 33.83 ? 118 PHE B CD2   1 
ATOM   3161 C  CE1   . PHE B 1 118 ? -9.176  24.570  29.605  1.00 34.34 ? 118 PHE B CE1   1 
ATOM   3162 C  CE2   . PHE B 1 118 ? -7.843  23.272  28.095  1.00 35.00 ? 118 PHE B CE2   1 
ATOM   3163 C  CZ    . PHE B 1 118 ? -8.611  24.394  28.352  1.00 31.04 ? 118 PHE B CZ    1 
ATOM   3164 N  N     . ARG B 1 119 ? -7.536  23.067  34.169  1.00 34.17 ? 119 ARG B N     1 
ATOM   3165 C  CA    . ARG B 1 119 ? -7.706  24.282  34.964  1.00 39.78 ? 119 ARG B CA    1 
ATOM   3166 C  C     . ARG B 1 119 ? -6.349  24.865  35.368  1.00 39.04 ? 119 ARG B C     1 
ATOM   3167 O  O     . ARG B 1 119 ? -6.160  26.083  35.359  1.00 38.68 ? 119 ARG B O     1 
ATOM   3168 C  CB    . ARG B 1 119 ? -8.551  24.014  36.212  1.00 42.55 ? 119 ARG B CB    1 
ATOM   3169 C  CG    . ARG B 1 119 ? -8.748  25.247  37.083  1.00 46.27 ? 119 ARG B CG    1 
ATOM   3170 C  CD    . ARG B 1 119 ? -9.262  24.886  38.466  1.00 54.74 ? 119 ARG B CD    1 
ATOM   3171 N  NE    . ARG B 1 119 ? -8.430  23.875  39.113  1.00 59.04 ? 119 ARG B NE    1 
ATOM   3172 C  CZ    . ARG B 1 119 ? -7.271  24.128  39.717  1.00 59.91 ? 119 ARG B CZ    1 
ATOM   3173 N  NH1   . ARG B 1 119 ? -6.794  25.365  39.757  1.00 61.20 ? 119 ARG B NH1   1 
ATOM   3174 N  NH2   . ARG B 1 119 ? -6.586  23.141  40.278  1.00 58.16 ? 119 ARG B NH2   1 
ATOM   3175 N  N     . GLN B 1 120 ? -5.407  23.993  35.720  1.00 33.44 ? 120 GLN B N     1 
ATOM   3176 C  CA    . GLN B 1 120 ? -4.070  24.438  36.098  1.00 32.36 ? 120 GLN B CA    1 
ATOM   3177 C  C     . GLN B 1 120 ? -3.359  25.052  34.903  1.00 32.88 ? 120 GLN B C     1 
ATOM   3178 O  O     . GLN B 1 120 ? -2.653  26.054  35.034  1.00 35.38 ? 120 GLN B O     1 
ATOM   3179 C  CB    . GLN B 1 120 ? -3.235  23.277  36.640  1.00 30.77 ? 120 GLN B CB    1 
ATOM   3180 C  CG    . GLN B 1 120 ? -3.694  22.730  37.975  1.00 42.22 ? 120 GLN B CG    1 
ATOM   3181 C  CD    . GLN B 1 120 ? -2.836  21.570  38.438  1.00 48.73 ? 120 GLN B CD    1 
ATOM   3182 O  OE1   . GLN B 1 120 ? -3.338  20.472  38.678  1.00 55.08 ? 120 GLN B OE1   1 
ATOM   3183 N  NE2   . GLN B 1 120 ? -1.533  21.806  38.562  1.00 37.64 ? 120 GLN B NE2   1 
ATOM   3184 N  N     . LEU B 1 121 ? -3.538  24.434  33.739  1.00 31.64 ? 121 LEU B N     1 
ATOM   3185 C  CA    . LEU B 1 121 ? -2.950  24.944  32.509  1.00 30.04 ? 121 LEU B CA    1 
ATOM   3186 C  C     . LEU B 1 121 ? -3.502  26.325  32.174  1.00 34.29 ? 121 LEU B C     1 
ATOM   3187 O  O     . LEU B 1 121 ? -2.749  27.226  31.804  1.00 31.84 ? 121 LEU B O     1 
ATOM   3188 C  CB    . LEU B 1 121 ? -3.180  23.964  31.355  1.00 31.09 ? 121 LEU B CB    1 
ATOM   3189 C  CG    . LEU B 1 121 ? -2.279  22.727  31.402  1.00 32.47 ? 121 LEU B CG    1 
ATOM   3190 C  CD1   . LEU B 1 121 ? -2.772  21.655  30.443  1.00 29.35 ? 121 LEU B CD1   1 
ATOM   3191 C  CD2   . LEU B 1 121 ? -0.839  23.113  31.079  1.00 28.51 ? 121 LEU B CD2   1 
ATOM   3192 N  N     . GLU B 1 122 ? -4.814  26.493  32.322  1.00 30.99 ? 122 GLU B N     1 
ATOM   3193 C  CA    . GLU B 1 122 ? -5.444  27.787  32.080  1.00 30.68 ? 122 GLU B CA    1 
ATOM   3194 C  C     . GLU B 1 122 ? -4.917  28.823  33.067  1.00 26.67 ? 122 GLU B C     1 
ATOM   3195 O  O     . GLU B 1 122 ? -4.710  29.987  32.714  1.00 34.21 ? 122 GLU B O     1 
ATOM   3196 C  CB    . GLU B 1 122 ? -6.968  27.674  32.176  1.00 38.14 ? 122 GLU B CB    1 
ATOM   3197 C  CG    . GLU B 1 122 ? -7.702  29.002  32.010  1.00 48.85 ? 122 GLU B CG    1 
ATOM   3198 C  CD    . GLU B 1 122 ? -9.162  28.823  31.627  1.00 55.48 ? 122 GLU B CD    1 
ATOM   3199 O  OE1   . GLU B 1 122 ? -9.573  27.669  31.383  1.00 56.43 ? 122 GLU B OE1   1 
ATOM   3200 O  OE2   . GLU B 1 122 ? -9.896  29.834  31.565  1.00 55.89 ? 122 GLU B OE2   1 
ATOM   3201 N  N     . GLU B 1 123 ? -4.698  28.385  34.305  1.00 28.70 ? 123 GLU B N     1 
ATOM   3202 C  CA    . GLU B 1 123 ? -4.143  29.243  35.348  1.00 32.79 ? 123 GLU B CA    1 
ATOM   3203 C  C     . GLU B 1 123 ? -2.748  29.736  34.960  1.00 37.79 ? 123 GLU B C     1 
ATOM   3204 O  O     . GLU B 1 123 ? -2.422  30.912  35.146  1.00 34.88 ? 123 GLU B O     1 
ATOM   3205 C  CB    . GLU B 1 123 ? -4.101  28.495  36.684  1.00 38.29 ? 123 GLU B CB    1 
ATOM   3206 C  CG    . GLU B 1 123 ? -3.238  29.148  37.749  1.00 51.43 ? 123 GLU B CG    1 
ATOM   3207 C  CD    . GLU B 1 123 ? -3.331  28.438  39.086  1.00 63.94 ? 123 GLU B CD    1 
ATOM   3208 O  OE1   . GLU B 1 123 ? -2.589  27.453  39.297  1.00 60.82 ? 123 GLU B OE1   1 
ATOM   3209 O  OE2   . GLU B 1 123 ? -4.155  28.866  39.925  1.00 69.49 ? 123 GLU B OE2   1 
ATOM   3210 N  N     . GLN B 1 124 ? -1.932  28.834  34.420  1.00 35.58 ? 124 GLN B N     1 
ATOM   3211 C  CA    . GLN B 1 124 ? -0.603  29.198  33.935  1.00 34.72 ? 124 GLN B CA    1 
ATOM   3212 C  C     . GLN B 1 124 ? -0.706  30.238  32.825  1.00 35.39 ? 124 GLN B C     1 
ATOM   3213 O  O     . GLN B 1 124 ? 0.019   31.233  32.821  1.00 33.77 ? 124 GLN B O     1 
ATOM   3214 C  CB    . GLN B 1 124 ? 0.149   27.961  33.431  1.00 35.38 ? 124 GLN B CB    1 
ATOM   3215 C  CG    . GLN B 1 124 ? 0.652   27.054  34.543  1.00 45.99 ? 124 GLN B CG    1 
ATOM   3216 C  CD    . GLN B 1 124 ? 1.634   27.753  35.471  1.00 51.04 ? 124 GLN B CD    1 
ATOM   3217 O  OE1   . GLN B 1 124 ? 2.485   28.526  35.028  1.00 53.23 ? 124 GLN B OE1   1 
ATOM   3218 N  NE2   . GLN B 1 124 ? 1.513   27.489  36.767  1.00 58.57 ? 124 GLN B NE2   1 
ATOM   3219 N  N     . VAL B 1 125 ? -1.617  30.002  31.887  1.00 29.51 ? 125 VAL B N     1 
ATOM   3220 C  CA    . VAL B 1 125 ? -1.844  30.929  30.784  1.00 24.15 ? 125 VAL B CA    1 
ATOM   3221 C  C     . VAL B 1 125 ? -2.276  32.315  31.272  1.00 30.22 ? 125 VAL B C     1 
ATOM   3222 O  O     . VAL B 1 125 ? -1.830  33.331  30.743  1.00 29.96 ? 125 VAL B O     1 
ATOM   3223 C  CB    . VAL B 1 125 ? -2.872  30.357  29.775  1.00 27.57 ? 125 VAL B CB    1 
ATOM   3224 C  CG1   . VAL B 1 125 ? -3.400  31.433  28.843  1.00 29.87 ? 125 VAL B CG1   1 
ATOM   3225 C  CG2   . VAL B 1 125 ? -2.244  29.223  28.976  1.00 28.04 ? 125 VAL B CG2   1 
ATOM   3226 N  N     . LEU B 1 126 ? -3.132  32.363  32.288  1.00 30.60 ? 126 LEU B N     1 
ATOM   3227 C  CA    . LEU B 1 126 ? -3.649  33.649  32.756  1.00 28.61 ? 126 LEU B CA    1 
ATOM   3228 C  C     . LEU B 1 126 ? -2.659  34.411  33.643  1.00 34.44 ? 126 LEU B C     1 
ATOM   3229 O  O     . LEU B 1 126 ? -2.932  35.536  34.074  1.00 38.65 ? 126 LEU B O     1 
ATOM   3230 C  CB    . LEU B 1 126 ? -5.005  33.478  33.449  1.00 34.23 ? 126 LEU B CB    1 
ATOM   3231 C  CG    . LEU B 1 126 ? -6.128  32.931  32.558  1.00 35.44 ? 126 LEU B CG    1 
ATOM   3232 C  CD1   . LEU B 1 126 ? -7.465  33.004  33.271  1.00 45.26 ? 126 LEU B CD1   1 
ATOM   3233 C  CD2   . LEU B 1 126 ? -6.185  33.663  31.228  1.00 34.21 ? 126 LEU B CD2   1 
ATOM   3234 N  N     . GLU B 1 127 ? -1.511  33.796  33.914  1.00 32.56 ? 127 GLU B N     1 
ATOM   3235 C  CA    . GLU B 1 127 ? -0.436  34.483  34.623  1.00 41.06 ? 127 GLU B CA    1 
ATOM   3236 C  C     . GLU B 1 127 ? 0.400   35.303  33.641  1.00 40.82 ? 127 GLU B C     1 
ATOM   3237 O  O     . GLU B 1 127 ? 1.221   36.130  34.043  1.00 39.93 ? 127 GLU B O     1 
ATOM   3238 C  CB    . GLU B 1 127 ? 0.445   33.485  35.381  1.00 42.53 ? 127 GLU B CB    1 
ATOM   3239 C  CG    . GLU B 1 127 ? -0.247  32.811  36.554  1.00 47.61 ? 127 GLU B CG    1 
ATOM   3240 C  CD    . GLU B 1 127 ? 0.679   31.895  37.332  1.00 60.67 ? 127 GLU B CD    1 
ATOM   3241 O  OE1   . GLU B 1 127 ? 1.868   31.790  36.960  1.00 66.65 ? 127 GLU B OE1   1 
ATOM   3242 O  OE2   . GLU B 1 127 ? 0.217   31.280  38.318  1.00 62.90 ? 127 GLU B OE2   1 
ATOM   3243 N  N     . ILE B 1 128 ? 0.181   35.064  32.351  1.00 35.91 ? 128 ILE B N     1 
ATOM   3244 C  CA    . ILE B 1 128 ? 0.851   35.817  31.296  1.00 28.17 ? 128 ILE B CA    1 
ATOM   3245 C  C     . ILE B 1 128 ? 0.369   37.265  31.301  1.00 35.53 ? 128 ILE B C     1 
ATOM   3246 O  O     . ILE B 1 128 ? -0.834  37.525  31.372  1.00 36.74 ? 128 ILE B O     1 
ATOM   3247 C  CB    . ILE B 1 128 ? 0.574   35.201  29.912  1.00 27.65 ? 128 ILE B CB    1 
ATOM   3248 C  CG1   . ILE B 1 128 ? 1.129   33.776  29.833  1.00 23.66 ? 128 ILE B CG1   1 
ATOM   3249 C  CG2   . ILE B 1 128 ? 1.174   36.055  28.813  1.00 27.86 ? 128 ILE B CG2   1 
ATOM   3250 C  CD1   . ILE B 1 128 ? 0.803   33.071  28.524  1.00 24.14 ? 128 ILE B CD1   1 
ATOM   3251 N  N     . GLU B 1 129 ? 1.310   38.203  31.225  1.00 34.37 ? 129 GLU B N     1 
ATOM   3252 C  CA    . GLU B 1 129 ? 0.988   39.623  31.304  1.00 41.96 ? 129 GLU B CA    1 
ATOM   3253 C  C     . GLU B 1 129 ? 0.348   40.154  30.023  1.00 42.94 ? 129 GLU B C     1 
ATOM   3254 O  O     . GLU B 1 129 ? 0.507   39.573  28.945  1.00 31.54 ? 129 GLU B O     1 
ATOM   3255 C  CB    . GLU B 1 129 ? 2.240   40.438  31.646  1.00 48.95 ? 129 GLU B CB    1 
ATOM   3256 C  CG    . GLU B 1 129 ? 3.318   40.432  30.569  1.00 53.16 ? 129 GLU B CG    1 
ATOM   3257 C  CD    . GLU B 1 129 ? 4.248   39.229  30.650  1.00 62.97 ? 129 GLU B CD    1 
ATOM   3258 O  OE1   . GLU B 1 129 ? 3.834   38.166  31.167  1.00 57.51 ? 129 GLU B OE1   1 
ATOM   3259 O  OE2   . GLU B 1 129 ? 5.403   39.356  30.194  1.00 65.46 ? 129 GLU B OE2   1 
ATOM   3260 N  N     . SER B 1 130 ? -0.381  41.260  30.149  1.00 37.95 ? 130 SER B N     1 
ATOM   3261 C  CA    . SER B 1 130 ? -1.008  41.897  28.997  1.00 38.51 ? 130 SER B CA    1 
ATOM   3262 C  C     . SER B 1 130 ? 0.045   42.326  27.979  1.00 39.22 ? 130 SER B C     1 
ATOM   3263 O  O     . SER B 1 130 ? 1.143   42.748  28.347  1.00 38.83 ? 130 SER B O     1 
ATOM   3264 C  CB    . SER B 1 130 ? -1.842  43.105  29.426  1.00 36.20 ? 130 SER B CB    1 
ATOM   3265 O  OG    . SER B 1 130 ? -2.411  43.750  28.299  1.00 39.11 ? 130 SER B OG    1 
ATOM   3266 N  N     . GLY B 1 131 ? -0.291  42.201  26.700  1.00 40.21 ? 131 GLY B N     1 
ATOM   3267 C  CA    . GLY B 1 131 ? 0.628   42.559  25.636  1.00 32.28 ? 131 GLY B CA    1 
ATOM   3268 C  C     . GLY B 1 131 ? 1.493   41.409  25.159  1.00 31.94 ? 131 GLY B C     1 
ATOM   3269 O  O     . GLY B 1 131 ? 1.978   41.422  24.024  1.00 33.25 ? 131 GLY B O     1 
ATOM   3270 N  N     . ALA B 1 132 ? 1.685   40.406  26.012  1.00 27.39 ? 132 ALA B N     1 
ATOM   3271 C  CA    . ALA B 1 132 ? 2.515   39.265  25.643  1.00 25.72 ? 132 ALA B CA    1 
ATOM   3272 C  C     . ALA B 1 132 ? 1.804   38.380  24.626  1.00 28.35 ? 132 ALA B C     1 
ATOM   3273 O  O     . ALA B 1 132 ? 0.594   38.501  24.412  1.00 27.86 ? 132 ALA B O     1 
ATOM   3274 C  CB    . ALA B 1 132 ? 2.912   38.470  26.865  1.00 31.58 ? 132 ALA B CB    1 
ATOM   3275 N  N     . ILE B 1 133 ? 2.562   37.487  24.003  1.00 27.12 ? 133 ILE B N     1 
ATOM   3276 C  CA    . ILE B 1 133 ? 2.036   36.663  22.927  1.00 22.52 ? 133 ILE B CA    1 
ATOM   3277 C  C     . ILE B 1 133 ? 1.950   35.201  23.361  1.00 23.12 ? 133 ILE B C     1 
ATOM   3278 O  O     . ILE B 1 133 ? 2.886   34.667  23.967  1.00 26.01 ? 133 ILE B O     1 
ATOM   3279 C  CB    . ILE B 1 133 ? 2.906   36.816  21.658  1.00 24.72 ? 133 ILE B CB    1 
ATOM   3280 C  CG1   . ILE B 1 133 ? 2.878   38.270  21.181  1.00 32.53 ? 133 ILE B CG1   1 
ATOM   3281 C  CG2   . ILE B 1 133 ? 2.440   35.892  20.541  1.00 25.66 ? 133 ILE B CG2   1 
ATOM   3282 C  CD1   . ILE B 1 133 ? 3.969   38.600  20.184  1.00 35.48 ? 133 ILE B CD1   1 
ATOM   3283 N  N     . LEU B 1 134 ? 0.817   34.567  23.064  1.00 21.81 ? 134 LEU B N     1 
ATOM   3284 C  CA    . LEU B 1 134 ? 0.638   33.139  23.331  1.00 18.40 ? 134 LEU B CA    1 
ATOM   3285 C  C     . LEU B 1 134 ? 0.381   32.393  22.035  1.00 19.00 ? 134 LEU B C     1 
ATOM   3286 O  O     . LEU B 1 134 ? -0.572  32.706  21.317  1.00 22.02 ? 134 LEU B O     1 
ATOM   3287 C  CB    . LEU B 1 134 ? -0.537  32.906  24.285  1.00 25.77 ? 134 LEU B CB    1 
ATOM   3288 C  CG    . LEU B 1 134 ? -0.913  31.437  24.505  1.00 25.36 ? 134 LEU B CG    1 
ATOM   3289 C  CD1   . LEU B 1 134 ? 0.201   30.713  25.253  1.00 24.16 ? 134 LEU B CD1   1 
ATOM   3290 C  CD2   . LEU B 1 134 ? -2.240  31.319  25.258  1.00 24.65 ? 134 LEU B CD2   1 
ATOM   3291 N  N     . VAL B 1 135 ? 1.239   31.416  21.731  1.00 22.58 ? 135 VAL B N     1 
ATOM   3292 C  CA    . VAL B 1 135 ? 1.043   30.570  20.560  1.00 21.55 ? 135 VAL B CA    1 
ATOM   3293 C  C     . VAL B 1 135 ? 0.405   29.252  20.984  1.00 23.79 ? 135 VAL B C     1 
ATOM   3294 O  O     . VAL B 1 135 ? 1.027   28.439  21.667  1.00 23.12 ? 135 VAL B O     1 
ATOM   3295 C  CB    . VAL B 1 135 ? 2.365   30.268  19.833  1.00 19.12 ? 135 VAL B CB    1 
ATOM   3296 C  CG1   . VAL B 1 135 ? 2.091   29.454  18.567  1.00 19.83 ? 135 VAL B CG1   1 
ATOM   3297 C  CG2   . VAL B 1 135 ? 3.090   31.554  19.491  1.00 19.49 ? 135 VAL B CG2   1 
ATOM   3298 N  N     . ILE B 1 136 ? -0.843  29.048  20.584  1.00 21.60 ? 136 ILE B N     1 
ATOM   3299 C  CA    . ILE B 1 136 ? -1.534  27.800  20.863  1.00 20.53 ? 136 ILE B CA    1 
ATOM   3300 C  C     . ILE B 1 136 ? -1.391  26.890  19.648  1.00 20.93 ? 136 ILE B C     1 
ATOM   3301 O  O     . ILE B 1 136 ? -1.982  27.152  18.601  1.00 23.02 ? 136 ILE B O     1 
ATOM   3302 C  CB    . ILE B 1 136 ? -3.023  28.067  21.123  1.00 20.04 ? 136 ILE B CB    1 
ATOM   3303 C  CG1   . ILE B 1 136 ? -3.169  29.148  22.195  1.00 22.84 ? 136 ILE B CG1   1 
ATOM   3304 C  CG2   . ILE B 1 136 ? -3.732  26.789  21.520  1.00 22.02 ? 136 ILE B CG2   1 
ATOM   3305 C  CD1   . ILE B 1 136 ? -4.586  29.630  22.381  1.00 33.05 ? 136 ILE B CD1   1 
ATOM   3306 N  N     . SER B 1 137 ? -0.615  25.818  19.777  1.00 19.74 ? 137 SER B N     1 
ATOM   3307 C  CA    . SER B 1 137 ? -0.309  25.002  18.603  1.00 16.75 ? 137 SER B CA    1 
ATOM   3308 C  C     . SER B 1 137 ? -0.350  23.505  18.884  1.00 19.47 ? 137 SER B C     1 
ATOM   3309 O  O     . SER B 1 137 ? 0.228   23.034  19.865  1.00 20.55 ? 137 SER B O     1 
ATOM   3310 C  CB    . SER B 1 137 ? 1.061   25.395  18.022  1.00 18.60 ? 137 SER B CB    1 
ATOM   3311 O  OG    . SER B 1 137 ? 1.453   24.514  16.978  1.00 20.48 ? 137 SER B OG    1 
ATOM   3312 N  N     . GLY B 1 138 ? -1.038  22.768  18.013  1.00 20.50 ? 138 GLY B N     1 
ATOM   3313 C  CA    . GLY B 1 138 ? -1.070  21.322  18.105  1.00 19.59 ? 138 GLY B CA    1 
ATOM   3314 C  C     . GLY B 1 138 ? -2.472  20.766  18.198  1.00 27.12 ? 138 GLY B C     1 
ATOM   3315 O  O     . GLY B 1 138 ? -3.455  21.512  18.156  1.00 23.83 ? 138 GLY B O     1 
ATOM   3316 N  N     . SER B 1 139 ? -2.558  19.445  18.328  1.00 22.03 ? 139 SER B N     1 
ATOM   3317 C  CA    . SER B 1 139 ? -3.838  18.766  18.417  1.00 24.84 ? 139 SER B CA    1 
ATOM   3318 C  C     . SER B 1 139 ? -4.461  18.926  19.798  1.00 25.23 ? 139 SER B C     1 
ATOM   3319 O  O     . SER B 1 139 ? -3.787  19.306  20.763  1.00 25.28 ? 139 SER B O     1 
ATOM   3320 C  CB    . SER B 1 139 ? -3.669  17.282  18.098  1.00 27.25 ? 139 SER B CB    1 
ATOM   3321 O  OG    . SER B 1 139 ? -2.838  16.654  19.058  1.00 27.45 ? 139 SER B OG    1 
ATOM   3322 N  N     . LEU B 1 140 ? -5.758  18.639  19.876  1.00 22.03 ? 140 LEU B N     1 
ATOM   3323 C  CA    . LEU B 1 140 ? -6.485  18.641  21.134  1.00 20.44 ? 140 LEU B CA    1 
ATOM   3324 C  C     . LEU B 1 140 ? -6.510  17.219  21.695  1.00 23.68 ? 140 LEU B C     1 
ATOM   3325 O  O     . LEU B 1 140 ? -7.004  16.296  21.044  1.00 24.86 ? 140 LEU B O     1 
ATOM   3326 C  CB    . LEU B 1 140 ? -7.918  19.118  20.905  1.00 22.73 ? 140 LEU B CB    1 
ATOM   3327 C  CG    . LEU B 1 140 ? -8.759  19.371  22.155  1.00 28.36 ? 140 LEU B CG    1 
ATOM   3328 C  CD1   . LEU B 1 140 ? -8.314  20.647  22.852  1.00 25.42 ? 140 LEU B CD1   1 
ATOM   3329 C  CD2   . LEU B 1 140 ? -10.234 19.441  21.786  1.00 25.87 ? 140 LEU B CD2   1 
ATOM   3330 N  N     . PRO B 1 141 ? -5.983  17.040  22.911  1.00 26.62 ? 141 PRO B N     1 
ATOM   3331 C  CA    . PRO B 1 141 ? -5.906  15.717  23.541  1.00 28.06 ? 141 PRO B CA    1 
ATOM   3332 C  C     . PRO B 1 141 ? -7.275  15.269  24.040  1.00 28.49 ? 141 PRO B C     1 
ATOM   3333 O  O     . PRO B 1 141 ? -8.180  16.101  24.147  1.00 26.21 ? 141 PRO B O     1 
ATOM   3334 C  CB    . PRO B 1 141 ? -4.991  15.975  24.738  1.00 32.77 ? 141 PRO B CB    1 
ATOM   3335 C  CG    . PRO B 1 141 ? -5.297  17.391  25.118  1.00 31.95 ? 141 PRO B CG    1 
ATOM   3336 C  CD    . PRO B 1 141 ? -5.475  18.102  23.798  1.00 24.57 ? 141 PRO B CD    1 
ATOM   3337 N  N     . PRO B 1 142 ? -7.429  13.969  24.344  1.00 27.32 ? 142 PRO B N     1 
ATOM   3338 C  CA    . PRO B 1 142 ? -8.664  13.482  24.972  1.00 32.61 ? 142 PRO B CA    1 
ATOM   3339 C  C     . PRO B 1 142 ? -8.891  14.130  26.335  1.00 33.15 ? 142 PRO B C     1 
ATOM   3340 O  O     . PRO B 1 142 ? -7.927  14.473  27.024  1.00 29.19 ? 142 PRO B O     1 
ATOM   3341 C  CB    . PRO B 1 142 ? -8.394  11.987  25.170  1.00 36.20 ? 142 PRO B CB    1 
ATOM   3342 C  CG    . PRO B 1 142 ? -7.334  11.645  24.185  1.00 34.60 ? 142 PRO B CG    1 
ATOM   3343 C  CD    . PRO B 1 142 ? -6.492  12.877  24.025  1.00 30.62 ? 142 PRO B CD    1 
ATOM   3344 N  N     . GLY B 1 143 ? -10.153 14.293  26.719  1.00 33.23 ? 143 GLY B N     1 
ATOM   3345 C  CA    . GLY B 1 143 ? -10.481 14.834  28.026  1.00 31.15 ? 143 GLY B CA    1 
ATOM   3346 C  C     . GLY B 1 143 ? -10.808 16.316  28.039  1.00 38.98 ? 143 GLY B C     1 
ATOM   3347 O  O     . GLY B 1 143 ? -11.248 16.847  29.064  1.00 38.00 ? 143 GLY B O     1 
ATOM   3348 N  N     . VAL B 1 144 ? -10.599 16.988  26.909  1.00 32.87 ? 144 VAL B N     1 
ATOM   3349 C  CA    . VAL B 1 144 ? -10.866 18.421  26.813  1.00 34.80 ? 144 VAL B CA    1 
ATOM   3350 C  C     . VAL B 1 144 ? -12.031 18.731  25.875  1.00 33.16 ? 144 VAL B C     1 
ATOM   3351 O  O     . VAL B 1 144 ? -11.939 18.507  24.667  1.00 34.35 ? 144 VAL B O     1 
ATOM   3352 C  CB    . VAL B 1 144 ? -9.646  19.198  26.299  1.00 30.57 ? 144 VAL B CB    1 
ATOM   3353 C  CG1   . VAL B 1 144 ? -9.901  20.699  26.410  1.00 30.92 ? 144 VAL B CG1   1 
ATOM   3354 C  CG2   . VAL B 1 144 ? -8.387  18.802  27.064  1.00 29.52 ? 144 VAL B CG2   1 
ATOM   3355 N  N     . LYS B 1 145 ? -13.118 19.258  26.428  1.00 37.26 ? 145 LYS B N     1 
ATOM   3356 C  CA    . LYS B 1 145 ? -14.237 19.703  25.603  1.00 34.18 ? 145 LYS B CA    1 
ATOM   3357 C  C     . LYS B 1 145 ? -13.825 20.892  24.741  1.00 35.03 ? 145 LYS B C     1 
ATOM   3358 O  O     . LYS B 1 145 ? -13.045 21.745  25.174  1.00 31.57 ? 145 LYS B O     1 
ATOM   3359 C  CB    . LYS B 1 145 ? -15.452 20.065  26.464  1.00 43.92 ? 145 LYS B CB    1 
ATOM   3360 C  CG    . LYS B 1 145 ? -16.495 18.965  26.534  1.00 50.42 ? 145 LYS B CG    1 
ATOM   3361 C  CD    . LYS B 1 145 ? -16.884 18.662  27.968  1.00 63.89 ? 145 LYS B CD    1 
ATOM   3362 C  CE    . LYS B 1 145 ? -17.669 17.363  28.059  1.00 70.01 ? 145 LYS B CE    1 
ATOM   3363 N  NZ    . LYS B 1 145 ? -17.685 16.821  29.448  1.00 73.71 ? 145 LYS B NZ    1 
ATOM   3364 N  N     . LEU B 1 146 ? -14.346 20.935  23.519  1.00 32.39 ? 146 LEU B N     1 
ATOM   3365 C  CA    . LEU B 1 146 ? -14.016 22.000  22.576  1.00 32.98 ? 146 LEU B CA    1 
ATOM   3366 C  C     . LEU B 1 146 ? -14.232 23.404  23.138  1.00 29.75 ? 146 LEU B C     1 
ATOM   3367 O  O     . LEU B 1 146 ? -13.431 24.305  22.891  1.00 35.85 ? 146 LEU B O     1 
ATOM   3368 C  CB    . LEU B 1 146 ? -14.811 21.827  21.280  1.00 34.60 ? 146 LEU B CB    1 
ATOM   3369 C  CG    . LEU B 1 146 ? -14.336 20.688  20.379  1.00 32.21 ? 146 LEU B CG    1 
ATOM   3370 C  CD1   . LEU B 1 146 ? -15.344 20.409  19.276  1.00 42.52 ? 146 LEU B CD1   1 
ATOM   3371 C  CD2   . LEU B 1 146 ? -12.979 21.025  19.789  1.00 28.56 ? 146 LEU B CD2   1 
ATOM   3372 N  N     . GLU B 1 147 ? -15.307 23.594  23.897  1.00 34.32 ? 147 GLU B N     1 
ATOM   3373 C  CA    . GLU B 1 147 ? -15.621 24.926  24.401  1.00 38.99 ? 147 GLU B CA    1 
ATOM   3374 C  C     . GLU B 1 147 ? -14.651 25.378  25.489  1.00 34.07 ? 147 GLU B C     1 
ATOM   3375 O  O     . GLU B 1 147 ? -14.499 26.577  25.720  1.00 39.69 ? 147 GLU B O     1 
ATOM   3376 C  CB    . GLU B 1 147 ? -17.071 25.015  24.886  1.00 43.74 ? 147 GLU B CB    1 
ATOM   3377 C  CG    . GLU B 1 147 ? -17.400 24.130  26.069  1.00 55.00 ? 147 GLU B CG    1 
ATOM   3378 C  CD    . GLU B 1 147 ? -18.876 24.173  26.429  1.00 74.21 ? 147 GLU B CD    1 
ATOM   3379 O  OE1   . GLU B 1 147 ? -19.559 25.152  26.054  1.00 76.96 ? 147 GLU B OE1   1 
ATOM   3380 O  OE2   . GLU B 1 147 ? -19.356 23.222  27.082  1.00 80.36 ? 147 GLU B OE2   1 
ATOM   3381 N  N     . LYS B 1 148 ? -13.989 24.425  26.146  1.00 38.14 ? 148 LYS B N     1 
ATOM   3382 C  CA    . LYS B 1 148 ? -12.972 24.766  27.142  1.00 36.04 ? 148 LYS B CA    1 
ATOM   3383 C  C     . LYS B 1 148 ? -11.787 25.472  26.486  1.00 30.27 ? 148 LYS B C     1 
ATOM   3384 O  O     . LYS B 1 148 ? -11.193 26.380  27.065  1.00 32.26 ? 148 LYS B O     1 
ATOM   3385 C  CB    . LYS B 1 148 ? -12.491 23.525  27.902  1.00 34.46 ? 148 LYS B CB    1 
ATOM   3386 C  CG    . LYS B 1 148 ? -13.558 22.863  28.761  1.00 46.45 ? 148 LYS B CG    1 
ATOM   3387 C  CD    . LYS B 1 148 ? -14.175 23.844  29.751  1.00 53.48 ? 148 LYS B CD    1 
ATOM   3388 C  CE    . LYS B 1 148 ? -13.776 23.534  31.188  1.00 65.64 ? 148 LYS B CE    1 
ATOM   3389 N  NZ    . LYS B 1 148 ? -12.453 24.114  31.552  1.00 70.40 ? 148 LYS B NZ    1 
ATOM   3390 N  N     . LEU B 1 149 ? -11.447 25.047  25.274  1.00 30.62 ? 149 LEU B N     1 
ATOM   3391 C  CA    . LEU B 1 149 ? -10.373 25.685  24.526  1.00 27.26 ? 149 LEU B CA    1 
ATOM   3392 C  C     . LEU B 1 149 ? -10.776 27.103  24.147  1.00 30.90 ? 149 LEU B C     1 
ATOM   3393 O  O     . LEU B 1 149 ? -9.984  28.038  24.266  1.00 31.95 ? 149 LEU B O     1 
ATOM   3394 C  CB    . LEU B 1 149 ? -10.039 24.881  23.268  1.00 30.91 ? 149 LEU B CB    1 
ATOM   3395 C  CG    . LEU B 1 149 ? -9.015  25.516  22.322  1.00 30.32 ? 149 LEU B CG    1 
ATOM   3396 C  CD1   . LEU B 1 149 ? -7.653  25.634  23.001  1.00 30.39 ? 149 LEU B CD1   1 
ATOM   3397 C  CD2   . LEU B 1 149 ? -8.908  24.725  21.026  1.00 32.50 ? 149 LEU B CD2   1 
ATOM   3398 N  N     . THR B 1 150 ? -12.017 27.256  23.695  1.00 27.50 ? 150 THR B N     1 
ATOM   3399 C  CA    . THR B 1 150 ? -12.531 28.568  23.308  1.00 27.11 ? 150 THR B CA    1 
ATOM   3400 C  C     . THR B 1 150 ? -12.581 29.515  24.508  1.00 30.05 ? 150 THR B C     1 
ATOM   3401 O  O     . THR B 1 150 ? -12.215 30.690  24.403  1.00 34.71 ? 150 THR B O     1 
ATOM   3402 C  CB    . THR B 1 150 ? -13.930 28.457  22.678  1.00 31.12 ? 150 THR B CB    1 
ATOM   3403 O  OG1   . THR B 1 150 ? -13.881 27.555  21.564  1.00 34.53 ? 150 THR B OG1   1 
ATOM   3404 C  CG2   . THR B 1 150 ? -14.407 29.821  22.197  1.00 38.74 ? 150 THR B CG2   1 
ATOM   3405 N  N     . GLN B 1 151 ? -13.031 28.993  25.645  1.00 33.23 ? 151 GLN B N     1 
ATOM   3406 C  CA    . GLN B 1 151 ? -13.090 29.763  26.882  1.00 35.60 ? 151 GLN B CA    1 
ATOM   3407 C  C     . GLN B 1 151 ? -11.707 30.187  27.368  1.00 31.72 ? 151 GLN B C     1 
ATOM   3408 O  O     . GLN B 1 151 ? -11.549 31.280  27.912  1.00 30.06 ? 151 GLN B O     1 
ATOM   3409 C  CB    . GLN B 1 151 ? -13.822 28.975  27.969  1.00 37.71 ? 151 GLN B CB    1 
ATOM   3410 C  CG    . GLN B 1 151 ? -15.317 28.869  27.726  1.00 46.98 ? 151 GLN B CG    1 
ATOM   3411 C  CD    . GLN B 1 151 ? -15.985 27.839  28.612  1.00 54.57 ? 151 GLN B CD    1 
ATOM   3412 O  OE1   . GLN B 1 151 ? -15.337 27.203  29.445  1.00 55.33 ? 151 GLN B OE1   1 
ATOM   3413 N  NE2   . GLN B 1 151 ? -17.292 27.666  28.434  1.00 54.39 ? 151 GLN B NE2   1 
ATOM   3414 N  N     . LEU B 1 152 ? -10.711 29.324  27.177  1.00 25.89 ? 152 LEU B N     1 
ATOM   3415 C  CA    . LEU B 1 152 ? -9.336  29.663  27.542  1.00 29.76 ? 152 LEU B CA    1 
ATOM   3416 C  C     . LEU B 1 152 ? -8.844  30.837  26.698  1.00 26.99 ? 152 LEU B C     1 
ATOM   3417 O  O     . LEU B 1 152 ? -8.283  31.800  27.216  1.00 29.82 ? 152 LEU B O     1 
ATOM   3418 C  CB    . LEU B 1 152 ? -8.407  28.452  27.363  1.00 29.05 ? 152 LEU B CB    1 
ATOM   3419 C  CG    . LEU B 1 152 ? -6.909  28.633  27.660  1.00 33.05 ? 152 LEU B CG    1 
ATOM   3420 C  CD1   . LEU B 1 152 ? -6.298  27.331  28.163  1.00 35.76 ? 152 LEU B CD1   1 
ATOM   3421 C  CD2   . LEU B 1 152 ? -6.147  29.102  26.432  1.00 35.89 ? 152 LEU B CD2   1 
ATOM   3422 N  N     . ILE B 1 153 ? -9.049  30.741  25.391  1.00 29.13 ? 153 ILE B N     1 
ATOM   3423 C  CA    . ILE B 1 153 ? -8.647  31.804  24.477  1.00 27.99 ? 153 ILE B CA    1 
ATOM   3424 C  C     . ILE B 1 153 ? -9.364  33.114  24.780  1.00 29.66 ? 153 ILE B C     1 
ATOM   3425 O  O     . ILE B 1 153 ? -8.739  34.175  24.790  1.00 30.00 ? 153 ILE B O     1 
ATOM   3426 C  CB    . ILE B 1 153 ? -8.863  31.383  23.014  1.00 28.61 ? 153 ILE B CB    1 
ATOM   3427 C  CG1   . ILE B 1 153 ? -8.061  30.111  22.739  1.00 35.23 ? 153 ILE B CG1   1 
ATOM   3428 C  CG2   . ILE B 1 153 ? -8.443  32.497  22.058  1.00 30.89 ? 153 ILE B CG2   1 
ATOM   3429 C  CD1   . ILE B 1 153 ? -8.283  29.512  21.374  1.00 34.79 ? 153 ILE B CD1   1 
ATOM   3430 N  N     . SER B 1 154 ? -10.665 33.034  25.053  1.00 24.34 ? 154 SER B N     1 
ATOM   3431 C  CA    . SER B 1 154 ? -11.442 34.222  25.405  1.00 30.05 ? 154 SER B CA    1 
ATOM   3432 C  C     . SER B 1 154 ? -10.915 34.884  26.674  1.00 35.27 ? 154 SER B C     1 
ATOM   3433 O  O     . SER B 1 154 ? -10.785 36.107  26.735  1.00 34.77 ? 154 SER B O     1 
ATOM   3434 C  CB    . SER B 1 154 ? -12.920 33.875  25.588  1.00 33.50 ? 154 SER B CB    1 
ATOM   3435 O  OG    . SER B 1 154 ? -13.535 33.612  24.345  1.00 40.61 ? 154 SER B OG    1 
ATOM   3436 N  N     . ALA B 1 155 ? -10.623 34.072  27.685  1.00 34.59 ? 155 ALA B N     1 
ATOM   3437 C  CA    . ALA B 1 155 ? -10.099 34.580  28.950  1.00 33.92 ? 155 ALA B CA    1 
ATOM   3438 C  C     . ALA B 1 155 ? -8.752  35.257  28.729  1.00 30.67 ? 155 ALA B C     1 
ATOM   3439 O  O     . ALA B 1 155 ? -8.472  36.312  29.303  1.00 35.53 ? 155 ALA B O     1 
ATOM   3440 C  CB    . ALA B 1 155 ? -9.962  33.451  29.961  1.00 29.76 ? 155 ALA B CB    1 
ATOM   3441 N  N     . ALA B 1 156 ? -7.921  34.635  27.897  1.00 27.86 ? 156 ALA B N     1 
ATOM   3442 C  CA    . ALA B 1 156 ? -6.601  35.166  27.577  1.00 27.98 ? 156 ALA B CA    1 
ATOM   3443 C  C     . ALA B 1 156 ? -6.706  36.538  26.916  1.00 29.91 ? 156 ALA B C     1 
ATOM   3444 O  O     . ALA B 1 156 ? -6.048  37.496  27.332  1.00 33.29 ? 156 ALA B O     1 
ATOM   3445 C  CB    . ALA B 1 156 ? -5.854  34.200  26.672  1.00 23.88 ? 156 ALA B CB    1 
ATOM   3446 N  N     . GLN B 1 157 ? -7.532  36.623  25.879  1.00 34.72 ? 157 GLN B N     1 
ATOM   3447 C  CA    . GLN B 1 157 ? -7.734  37.871  25.157  1.00 32.03 ? 157 GLN B CA    1 
ATOM   3448 C  C     . GLN B 1 157 ? -8.332  38.953  26.049  1.00 39.09 ? 157 GLN B C     1 
ATOM   3449 O  O     . GLN B 1 157 ? -8.040  40.137  25.880  1.00 34.72 ? 157 GLN B O     1 
ATOM   3450 C  CB    . GLN B 1 157 ? -8.653  37.641  23.960  1.00 30.84 ? 157 GLN B CB    1 
ATOM   3451 C  CG    . GLN B 1 157 ? -8.071  36.761  22.877  1.00 27.50 ? 157 GLN B CG    1 
ATOM   3452 C  CD    . GLN B 1 157 ? -9.095  36.468  21.800  1.00 33.58 ? 157 GLN B CD    1 
ATOM   3453 O  OE1   . GLN B 1 157 ? -10.270 36.259  22.094  1.00 47.11 ? 157 GLN B OE1   1 
ATOM   3454 N  NE2   . GLN B 1 157 ? -8.665  36.479  20.551  1.00 30.16 ? 157 GLN B NE2   1 
ATOM   3455 N  N     . LYS B 1 158 ? -9.177  38.538  26.991  1.00 34.40 ? 158 LYS B N     1 
ATOM   3456 C  CA    . LYS B 1 158 ? -9.825  39.467  27.913  1.00 43.37 ? 158 LYS B CA    1 
ATOM   3457 C  C     . LYS B 1 158 ? -8.822  40.279  28.725  1.00 41.73 ? 158 LYS B C     1 
ATOM   3458 O  O     . LYS B 1 158 ? -9.076  41.439  29.057  1.00 43.75 ? 158 LYS B O     1 
ATOM   3459 C  CB    . LYS B 1 158 ? -10.760 38.719  28.863  1.00 45.15 ? 158 LYS B CB    1 
ATOM   3460 C  CG    . LYS B 1 158 ? -12.199 38.646  28.395  1.00 57.16 ? 158 LYS B CG    1 
ATOM   3461 C  CD    . LYS B 1 158 ? -13.135 38.461  29.578  1.00 62.64 ? 158 LYS B CD    1 
ATOM   3462 C  CE    . LYS B 1 158 ? -12.880 39.516  30.646  1.00 64.31 ? 158 LYS B CE    1 
ATOM   3463 N  NZ    . LYS B 1 158 ? -13.923 39.508  31.711  1.00 63.53 ? 158 LYS B NZ    1 
ATOM   3464 N  N     . GLN B 1 159 ? -7.688  39.667  29.052  1.00 38.47 ? 159 GLN B N     1 
ATOM   3465 C  CA    . GLN B 1 159 ? -6.659  40.364  29.814  1.00 42.14 ? 159 GLN B CA    1 
ATOM   3466 C  C     . GLN B 1 159 ? -5.450  40.736  28.960  1.00 39.60 ? 159 GLN B C     1 
ATOM   3467 O  O     . GLN B 1 159 ? -4.336  40.879  29.467  1.00 36.40 ? 159 GLN B O     1 
ATOM   3468 C  CB    . GLN B 1 159 ? -6.237  39.563  31.047  1.00 43.27 ? 159 GLN B CB    1 
ATOM   3469 C  CG    . GLN B 1 159 ? -5.911  38.106  30.783  1.00 40.10 ? 159 GLN B CG    1 
ATOM   3470 C  CD    . GLN B 1 159 ? -5.411  37.389  32.026  1.00 45.53 ? 159 GLN B CD    1 
ATOM   3471 O  OE1   . GLN B 1 159 ? -6.196  36.848  32.806  1.00 46.08 ? 159 GLN B OE1   1 
ATOM   3472 N  NE2   . GLN B 1 159 ? -4.097  37.389  32.219  1.00 50.90 ? 159 GLN B NE2   1 
ATOM   3473 N  N     . GLY B 1 160 ? -5.681  40.893  27.662  1.00 36.15 ? 160 GLY B N     1 
ATOM   3474 C  CA    . GLY B 1 160 ? -4.688  41.484  26.784  1.00 33.34 ? 160 GLY B CA    1 
ATOM   3475 C  C     . GLY B 1 160 ? -3.649  40.560  26.181  1.00 29.04 ? 160 GLY B C     1 
ATOM   3476 O  O     . GLY B 1 160 ? -2.709  41.029  25.538  1.00 27.98 ? 160 GLY B O     1 
ATOM   3477 N  N     . ILE B 1 161 ? -3.806  39.253  26.369  1.00 31.56 ? 161 ILE B N     1 
ATOM   3478 C  CA    . ILE B 1 161 ? -2.876  38.308  25.759  1.00 28.61 ? 161 ILE B CA    1 
ATOM   3479 C  C     . ILE B 1 161 ? -3.174  38.146  24.268  1.00 30.54 ? 161 ILE B C     1 
ATOM   3480 O  O     . ILE B 1 161 ? -4.316  37.912  23.867  1.00 26.11 ? 161 ILE B O     1 
ATOM   3481 C  CB    . ILE B 1 161 ? -2.883  36.939  26.475  1.00 25.81 ? 161 ILE B CB    1 
ATOM   3482 C  CG1   . ILE B 1 161 ? -2.567  37.128  27.961  1.00 32.23 ? 161 ILE B CG1   1 
ATOM   3483 C  CG2   . ILE B 1 161 ? -1.877  35.986  25.824  1.00 26.67 ? 161 ILE B CG2   1 
ATOM   3484 C  CD1   . ILE B 1 161 ? -2.903  35.932  28.829  1.00 31.26 ? 161 ILE B CD1   1 
ATOM   3485 N  N     . ARG B 1 162 ? -2.136  38.295  23.453  1.00 27.87 ? 162 ARG B N     1 
ATOM   3486 C  CA    . ARG B 1 162 ? -2.268  38.235  22.005  1.00 28.49 ? 162 ARG B CA    1 
ATOM   3487 C  C     . ARG B 1 162 ? -2.083  36.795  21.539  1.00 26.92 ? 162 ARG B C     1 
ATOM   3488 O  O     . ARG B 1 162 ? -1.028  36.196  21.739  1.00 27.62 ? 162 ARG B O     1 
ATOM   3489 C  CB    . ARG B 1 162 ? -1.249  39.172  21.361  1.00 26.55 ? 162 ARG B CB    1 
ATOM   3490 C  CG    . ARG B 1 162 ? -1.303  40.578  21.951  1.00 28.94 ? 162 ARG B CG    1 
ATOM   3491 C  CD    . ARG B 1 162 ? -0.220  41.470  21.394  1.00 33.75 ? 162 ARG B CD    1 
ATOM   3492 N  NE    . ARG B 1 162 ? -0.403  41.720  19.969  1.00 37.77 ? 162 ARG B NE    1 
ATOM   3493 C  CZ    . ARG B 1 162 ? 0.547   42.192  19.171  1.00 40.99 ? 162 ARG B CZ    1 
ATOM   3494 N  NH1   . ARG B 1 162 ? 1.751   42.454  19.661  1.00 38.23 ? 162 ARG B NH1   1 
ATOM   3495 N  NH2   . ARG B 1 162 ? 0.294   42.392  17.882  1.00 35.42 ? 162 ARG B NH2   1 
ATOM   3496 N  N     . CYS B 1 163 ? -3.117  36.236  20.924  1.00 24.14 ? 163 CYS B N     1 
ATOM   3497 C  CA    . CYS B 1 163 ? -3.122  34.811  20.622  1.00 21.90 ? 163 CYS B CA    1 
ATOM   3498 C  C     . CYS B 1 163 ? -2.829  34.486  19.157  1.00 23.81 ? 163 CYS B C     1 
ATOM   3499 O  O     . CYS B 1 163 ? -3.366  35.115  18.235  1.00 25.28 ? 163 CYS B O     1 
ATOM   3500 C  CB    . CYS B 1 163 ? -4.455  34.187  21.051  1.00 26.22 ? 163 CYS B CB    1 
ATOM   3501 S  SG    . CYS B 1 163 ? -4.772  34.253  22.839  1.00 27.92 ? 163 CYS B SG    1 
ATOM   3502 N  N     . ILE B 1 164 ? -1.959  33.498  18.965  1.00 24.68 ? 164 ILE B N     1 
ATOM   3503 C  CA    . ILE B 1 164 ? -1.629  32.968  17.653  1.00 20.06 ? 164 ILE B CA    1 
ATOM   3504 C  C     . ILE B 1 164 ? -2.046  31.508  17.678  1.00 22.89 ? 164 ILE B C     1 
ATOM   3505 O  O     . ILE B 1 164 ? -1.817  30.817  18.670  1.00 21.78 ? 164 ILE B O     1 
ATOM   3506 C  CB    . ILE B 1 164 ? -0.119  33.077  17.383  1.00 21.82 ? 164 ILE B CB    1 
ATOM   3507 C  CG1   . ILE B 1 164 ? 0.287   34.551  17.285  1.00 25.01 ? 164 ILE B CG1   1 
ATOM   3508 C  CG2   . ILE B 1 164 ? 0.278   32.327  16.105  1.00 19.96 ? 164 ILE B CG2   1 
ATOM   3509 C  CD1   . ILE B 1 164 ? 1.769   34.759  16.990  1.00 30.14 ? 164 ILE B CD1   1 
ATOM   3510 N  N     . VAL B 1 165 ? -2.671  31.044  16.603  1.00 17.58 ? 165 VAL B N     1 
ATOM   3511 C  CA    . VAL B 1 165 ? -3.237  29.694  16.582  1.00 18.21 ? 165 VAL B CA    1 
ATOM   3512 C  C     . VAL B 1 165 ? -2.736  28.884  15.395  1.00 17.85 ? 165 VAL B C     1 
ATOM   3513 O  O     . VAL B 1 165 ? -2.733  29.367  14.263  1.00 19.11 ? 165 VAL B O     1 
ATOM   3514 C  CB    . VAL B 1 165 ? -4.784  29.738  16.558  1.00 21.60 ? 165 VAL B CB    1 
ATOM   3515 C  CG1   . VAL B 1 165 ? -5.371  28.350  16.307  1.00 27.31 ? 165 VAL B CG1   1 
ATOM   3516 C  CG2   . VAL B 1 165 ? -5.316  30.308  17.860  1.00 22.60 ? 165 VAL B CG2   1 
ATOM   3517 N  N     . ASP B 1 166 ? -2.297  27.654  15.667  1.00 19.97 ? 166 ASP B N     1 
ATOM   3518 C  CA    . ASP B 1 166 ? -1.966  26.685  14.629  1.00 16.62 ? 166 ASP B CA    1 
ATOM   3519 C  C     . ASP B 1 166 ? -2.558  25.348  15.045  1.00 17.72 ? 166 ASP B C     1 
ATOM   3520 O  O     . ASP B 1 166 ? -2.043  24.686  15.936  1.00 21.62 ? 166 ASP B O     1 
ATOM   3521 C  CB    . ASP B 1 166 ? -0.445  26.564  14.459  1.00 17.10 ? 166 ASP B CB    1 
ATOM   3522 C  CG    . ASP B 1 166 ? -0.051  25.652  13.313  1.00 21.64 ? 166 ASP B CG    1 
ATOM   3523 O  OD1   . ASP B 1 166 ? 1.166   25.525  13.059  1.00 25.05 ? 166 ASP B OD1   1 
ATOM   3524 O  OD2   . ASP B 1 166 ? -0.944  25.052  12.668  1.00 27.36 ? 166 ASP B OD2   1 
ATOM   3525 N  N     . SER B 1 167 ? -3.653  24.951  14.410  1.00 17.49 ? 167 SER B N     1 
ATOM   3526 C  CA    . SER B 1 167 ? -4.275  23.684  14.762  1.00 19.99 ? 167 SER B CA    1 
ATOM   3527 C  C     . SER B 1 167 ? -5.035  23.130  13.565  1.00 20.27 ? 167 SER B C     1 
ATOM   3528 O  O     . SER B 1 167 ? -4.839  23.579  12.430  1.00 21.67 ? 167 SER B O     1 
ATOM   3529 C  CB    . SER B 1 167 ? -5.198  23.854  15.980  1.00 22.75 ? 167 SER B CB    1 
ATOM   3530 O  OG    . SER B 1 167 ? -5.572  22.594  16.522  1.00 23.74 ? 167 SER B OG    1 
ATOM   3531 N  N     . SER B 1 168 ? -5.887  22.144  13.805  1.00 19.47 ? 168 SER B N     1 
ATOM   3532 C  CA    . SER B 1 168 ? -6.657  21.562  12.715  1.00 20.31 ? 168 SER B CA    1 
ATOM   3533 C  C     . SER B 1 168 ? -8.011  21.070  13.199  1.00 20.43 ? 168 SER B C     1 
ATOM   3534 O  O     . SER B 1 168 ? -8.269  21.020  14.405  1.00 22.81 ? 168 SER B O     1 
ATOM   3535 C  CB    . SER B 1 168 ? -5.888  20.403  12.081  1.00 28.31 ? 168 SER B CB    1 
ATOM   3536 O  OG    . SER B 1 168 ? -5.706  19.361  13.022  1.00 29.47 ? 168 SER B OG    1 
ATOM   3537 N  N     . GLY B 1 169 ? -8.871  20.716  12.245  1.00 21.92 ? 169 GLY B N     1 
ATOM   3538 C  CA    . GLY B 1 169 ? -10.149 20.094  12.541  1.00 25.41 ? 169 GLY B CA    1 
ATOM   3539 C  C     . GLY B 1 169 ? -11.023 20.923  13.459  1.00 27.72 ? 169 GLY B C     1 
ATOM   3540 O  O     . GLY B 1 169 ? -11.037 22.153  13.390  1.00 24.95 ? 169 GLY B O     1 
ATOM   3541 N  N     . GLU B 1 170 ? -11.751 20.244  14.337  1.00 26.46 ? 170 GLU B N     1 
ATOM   3542 C  CA    . GLU B 1 170 ? -12.701 20.927  15.205  1.00 25.46 ? 170 GLU B CA    1 
ATOM   3543 C  C     . GLU B 1 170 ? -12.002 21.871  16.173  1.00 20.37 ? 170 GLU B C     1 
ATOM   3544 O  O     . GLU B 1 170 ? -12.565 22.898  16.552  1.00 27.90 ? 170 GLU B O     1 
ATOM   3545 C  CB    . GLU B 1 170 ? -13.562 19.913  15.956  1.00 24.88 ? 170 GLU B CB    1 
ATOM   3546 C  CG    . GLU B 1 170 ? -14.495 19.134  15.056  1.00 32.22 ? 170 GLU B CG    1 
ATOM   3547 C  CD    . GLU B 1 170 ? -15.278 18.081  15.816  1.00 52.56 ? 170 GLU B CD    1 
ATOM   3548 O  OE1   . GLU B 1 170 ? -16.280 17.574  15.267  1.00 63.61 ? 170 GLU B OE1   1 
ATOM   3549 O  OE2   . GLU B 1 170 ? -14.888 17.758  16.959  1.00 51.47 ? 170 GLU B OE2   1 
ATOM   3550 N  N     . ALA B 1 171 ? -10.772 21.535  16.562  1.00 20.92 ? 171 ALA B N     1 
ATOM   3551 C  CA    . ALA B 1 171 ? -10.011 22.399  17.468  1.00 22.07 ? 171 ALA B CA    1 
ATOM   3552 C  C     . ALA B 1 171 ? -9.747  23.773  16.845  1.00 19.69 ? 171 ALA B C     1 
ATOM   3553 O  O     . ALA B 1 171 ? -9.933  24.804  17.492  1.00 24.94 ? 171 ALA B O     1 
ATOM   3554 C  CB    . ALA B 1 171 ? -8.704  21.738  17.874  1.00 23.64 ? 171 ALA B CB    1 
ATOM   3555 N  N     . LEU B 1 172 ? -9.303  23.777  15.593  1.00 21.13 ? 172 LEU B N     1 
ATOM   3556 C  CA    . LEU B 1 172 ? -9.018  25.021  14.889  1.00 21.10 ? 172 LEU B CA    1 
ATOM   3557 C  C     . LEU B 1 172 ? -10.271 25.877  14.734  1.00 20.32 ? 172 LEU B C     1 
ATOM   3558 O  O     . LEU B 1 172 ? -10.235 27.088  14.955  1.00 22.86 ? 172 LEU B O     1 
ATOM   3559 C  CB    . LEU B 1 172 ? -8.409  24.735  13.512  1.00 21.04 ? 172 LEU B CB    1 
ATOM   3560 C  CG    . LEU B 1 172 ? -8.131  25.980  12.663  1.00 22.14 ? 172 LEU B CG    1 
ATOM   3561 C  CD1   . LEU B 1 172 ? -7.213  26.932  13.404  1.00 25.96 ? 172 LEU B CD1   1 
ATOM   3562 C  CD2   . LEU B 1 172 ? -7.540  25.607  11.304  1.00 24.78 ? 172 LEU B CD2   1 
ATOM   3563 N  N     . SER B 1 173 ? -11.378 25.250  14.341  1.00 20.36 ? 173 SER B N     1 
ATOM   3564 C  CA    . SER B 1 173 ? -12.650 25.960  14.214  1.00 22.97 ? 173 SER B CA    1 
ATOM   3565 C  C     . SER B 1 173 ? -13.070 26.568  15.556  1.00 29.49 ? 173 SER B C     1 
ATOM   3566 O  O     . SER B 1 173 ? -13.501 27.721  15.622  1.00 29.25 ? 173 SER B O     1 
ATOM   3567 C  CB    . SER B 1 173 ? -13.736 25.019  13.684  1.00 31.38 ? 173 SER B CB    1 
ATOM   3568 O  OG    . SER B 1 173 ? -14.980 25.689  13.582  1.00 48.41 ? 173 SER B OG    1 
ATOM   3569 N  N     . ALA B 1 174 ? -12.912 25.790  16.623  1.00 29.67 ? 174 ALA B N     1 
ATOM   3570 C  CA    . ALA B 1 174 ? -13.251 26.238  17.972  1.00 31.86 ? 174 ALA B CA    1 
ATOM   3571 C  C     . ALA B 1 174 ? -12.341 27.371  18.440  1.00 34.10 ? 174 ALA B C     1 
ATOM   3572 O  O     . ALA B 1 174 ? -12.797 28.316  19.088  1.00 39.58 ? 174 ALA B O     1 
ATOM   3573 C  CB    . ALA B 1 174 ? -13.185 25.068  18.952  1.00 31.45 ? 174 ALA B CB    1 
ATOM   3574 N  N     . ALA B 1 175 ? -11.055 27.272  18.111  1.00 28.45 ? 175 ALA B N     1 
ATOM   3575 C  CA    . ALA B 1 175 ? -10.089 28.296  18.500  1.00 25.41 ? 175 ALA B CA    1 
ATOM   3576 C  C     . ALA B 1 175 ? -10.403 29.627  17.819  1.00 33.67 ? 175 ALA B C     1 
ATOM   3577 O  O     . ALA B 1 175 ? -10.053 30.693  18.329  1.00 39.37 ? 175 ALA B O     1 
ATOM   3578 C  CB    . ALA B 1 175 ? -8.668  27.849  18.174  1.00 25.50 ? 175 ALA B CB    1 
ATOM   3579 N  N     . LEU B 1 176 ? -11.065 29.554  16.667  1.00 29.77 ? 176 LEU B N     1 
ATOM   3580 C  CA    . LEU B 1 176 ? -11.405 30.743  15.888  1.00 31.10 ? 176 LEU B CA    1 
ATOM   3581 C  C     . LEU B 1 176 ? -12.854 31.180  16.092  1.00 34.68 ? 176 LEU B C     1 
ATOM   3582 O  O     . LEU B 1 176 ? -13.301 32.156  15.490  1.00 38.32 ? 176 LEU B O     1 
ATOM   3583 C  CB    . LEU B 1 176 ? -11.155 30.496  14.400  1.00 31.90 ? 176 LEU B CB    1 
ATOM   3584 C  CG    . LEU B 1 176 ? -9.746  30.742  13.854  1.00 39.61 ? 176 LEU B CG    1 
ATOM   3585 C  CD1   . LEU B 1 176 ? -9.708  30.471  12.369  1.00 36.79 ? 176 LEU B CD1   1 
ATOM   3586 C  CD2   . LEU B 1 176 ? -9.326  32.167  14.114  1.00 49.43 ? 176 LEU B CD2   1 
ATOM   3587 N  N     . ALA B 1 177 ? -13.580 30.456  16.939  1.00 36.91 ? 177 ALA B N     1 
ATOM   3588 C  CA    . ALA B 1 177 ? -15.010 30.704  17.135  1.00 37.50 ? 177 ALA B CA    1 
ATOM   3589 C  C     . ALA B 1 177 ? -15.307 32.116  17.637  1.00 38.49 ? 177 ALA B C     1 
ATOM   3590 O  O     . ALA B 1 177 ? -16.250 32.766  17.178  1.00 41.69 ? 177 ALA B O     1 
ATOM   3591 C  CB    . ALA B 1 177 ? -15.610 29.662  18.080  1.00 36.20 ? 177 ALA B CB    1 
ATOM   3592 N  N     . ILE B 1 178 ? -14.503 32.583  18.586  1.00 37.57 ? 178 ILE B N     1 
ATOM   3593 C  CA    . ILE B 1 178 ? -14.724 33.890  19.193  1.00 42.45 ? 178 ILE B CA    1 
ATOM   3594 C  C     . ILE B 1 178 ? -14.092 35.008  18.376  1.00 35.81 ? 178 ILE B C     1 
ATOM   3595 O  O     . ILE B 1 178 ? -14.588 36.136  18.363  1.00 53.72 ? 178 ILE B O     1 
ATOM   3596 C  CB    . ILE B 1 178 ? -14.178 33.937  20.619  1.00 52.79 ? 178 ILE B CB    1 
ATOM   3597 C  CG1   . ILE B 1 178 ? -12.891 33.116  20.700  1.00 57.25 ? 178 ILE B CG1   1 
ATOM   3598 C  CG2   . ILE B 1 178 ? -15.217 33.404  21.594  1.00 55.67 ? 178 ILE B CG2   1 
ATOM   3599 C  CD1   . ILE B 1 178 ? -11.896 33.635  21.698  1.00 40.05 ? 178 ILE B CD1   1 
ATOM   3600 N  N     . GLY B 1 179 ? -12.989 34.696  17.706  1.00 31.69 ? 179 GLY B N     1 
ATOM   3601 C  CA    . GLY B 1 179 ? -12.368 35.648  16.808  1.00 31.37 ? 179 GLY B CA    1 
ATOM   3602 C  C     . GLY B 1 179 ? -11.331 36.535  17.465  1.00 32.76 ? 179 GLY B C     1 
ATOM   3603 O  O     . GLY B 1 179 ? -10.954 36.323  18.620  1.00 31.83 ? 179 GLY B O     1 
ATOM   3604 N  N     . ASN B 1 180 ? -10.878 37.533  16.710  1.00 28.00 ? 180 ASN B N     1 
ATOM   3605 C  CA    . ASN B 1 180 ? -9.834  38.455  17.144  1.00 32.01 ? 180 ASN B CA    1 
ATOM   3606 C  C     . ASN B 1 180 ? -8.509  37.755  17.406  1.00 26.70 ? 180 ASN B C     1 
ATOM   3607 O  O     . ASN B 1 180 ? -7.664  38.256  18.145  1.00 28.76 ? 180 ASN B O     1 
ATOM   3608 C  CB    . ASN B 1 180 ? -10.276 39.253  18.372  1.00 34.31 ? 180 ASN B CB    1 
ATOM   3609 C  CG    . ASN B 1 180 ? -11.628 39.899  18.181  1.00 54.51 ? 180 ASN B CG    1 
ATOM   3610 O  OD1   . ASN B 1 180 ? -11.809 40.730  17.290  1.00 57.90 ? 180 ASN B OD1   1 
ATOM   3611 N  ND2   . ASN B 1 180 ? -12.592 39.519  19.018  1.00 57.24 ? 180 ASN B ND2   1 
ATOM   3612 N  N     . ILE B 1 181 ? -8.336  36.583  16.805  1.00 24.34 ? 181 ILE B N     1 
ATOM   3613 C  CA    . ILE B 1 181 ? -7.046  35.913  16.838  1.00 23.08 ? 181 ILE B CA    1 
ATOM   3614 C  C     . ILE B 1 181 ? -6.052  36.759  16.049  1.00 24.66 ? 181 ILE B C     1 
ATOM   3615 O  O     . ILE B 1 181 ? -6.371  37.251  14.964  1.00 27.23 ? 181 ILE B O     1 
ATOM   3616 C  CB    . ILE B 1 181 ? -7.147  34.501  16.239  1.00 22.08 ? 181 ILE B CB    1 
ATOM   3617 C  CG1   . ILE B 1 181 ? -8.135  33.665  17.056  1.00 26.91 ? 181 ILE B CG1   1 
ATOM   3618 C  CG2   . ILE B 1 181 ? -5.784  33.815  16.196  1.00 29.92 ? 181 ILE B CG2   1 
ATOM   3619 C  CD1   . ILE B 1 181 ? -7.721  33.474  18.499  1.00 31.34 ? 181 ILE B CD1   1 
ATOM   3620 N  N     . GLU B 1 182 ? -4.854  36.946  16.594  1.00 24.65 ? 182 GLU B N     1 
ATOM   3621 C  CA    . GLU B 1 182 ? -3.857  37.801  15.944  1.00 26.46 ? 182 GLU B CA    1 
ATOM   3622 C  C     . GLU B 1 182 ? -3.348  37.209  14.641  1.00 23.13 ? 182 GLU B C     1 
ATOM   3623 O  O     . GLU B 1 182 ? -3.171  37.920  13.650  1.00 25.01 ? 182 GLU B O     1 
ATOM   3624 C  CB    . GLU B 1 182 ? -2.683  38.085  16.890  1.00 23.49 ? 182 GLU B CB    1 
ATOM   3625 C  CG    . GLU B 1 182 ? -3.059  38.933  18.103  1.00 32.27 ? 182 GLU B CG    1 
ATOM   3626 C  CD    . GLU B 1 182 ? -2.827  40.413  17.873  1.00 34.14 ? 182 GLU B CD    1 
ATOM   3627 O  OE1   . GLU B 1 182 ? -3.181  41.219  18.762  1.00 37.45 ? 182 GLU B OE1   1 
ATOM   3628 O  OE2   . GLU B 1 182 ? -2.286  40.767  16.804  1.00 34.24 ? 182 GLU B OE2   1 
ATOM   3629 N  N     . LEU B 1 183 ? -3.106  35.904  14.649  1.00 20.37 ? 183 LEU B N     1 
ATOM   3630 C  CA    . LEU B 1 183 ? -2.515  35.229  13.511  1.00 19.32 ? 183 LEU B CA    1 
ATOM   3631 C  C     . LEU B 1 183 ? -2.933  33.770  13.540  1.00 20.94 ? 183 LEU B C     1 
ATOM   3632 O  O     . LEU B 1 183 ? -2.887  33.134  14.585  1.00 23.15 ? 183 LEU B O     1 
ATOM   3633 C  CB    . LEU B 1 183 ? -0.989  35.337  13.586  1.00 22.55 ? 183 LEU B CB    1 
ATOM   3634 C  CG    . LEU B 1 183 ? -0.155  34.511  12.611  1.00 25.33 ? 183 LEU B CG    1 
ATOM   3635 C  CD1   . LEU B 1 183 ? -0.479  34.894  11.182  1.00 23.70 ? 183 LEU B CD1   1 
ATOM   3636 C  CD2   . LEU B 1 183 ? 1.334   34.688  12.900  1.00 26.58 ? 183 LEU B CD2   1 
ATOM   3637 N  N     . VAL B 1 184 ? -3.368  33.257  12.397  1.00 18.04 ? 184 VAL B N     1 
ATOM   3638 C  CA    . VAL B 1 184 ? -3.603  31.826  12.245  1.00 17.33 ? 184 VAL B CA    1 
ATOM   3639 C  C     . VAL B 1 184 ? -2.837  31.334  11.017  1.00 17.70 ? 184 VAL B C     1 
ATOM   3640 O  O     . VAL B 1 184 ? -2.769  32.027  9.999   1.00 18.49 ? 184 VAL B O     1 
ATOM   3641 C  CB    . VAL B 1 184 ? -5.113  31.507  12.120  1.00 20.65 ? 184 VAL B CB    1 
ATOM   3642 C  CG1   . VAL B 1 184 ? -5.710  32.187  10.886  1.00 22.21 ? 184 VAL B CG1   1 
ATOM   3643 C  CG2   . VAL B 1 184 ? -5.357  30.002  12.090  1.00 23.37 ? 184 VAL B CG2   1 
ATOM   3644 N  N     . LYS B 1 185 ? -2.240  30.146  11.115  1.00 16.05 ? 185 LYS B N     1 
ATOM   3645 C  CA    . LYS B 1 185 ? -1.489  29.580  9.987   1.00 16.81 ? 185 LYS B CA    1 
ATOM   3646 C  C     . LYS B 1 185 ? -2.040  28.228  9.559   1.00 21.60 ? 185 LYS B C     1 
ATOM   3647 O  O     . LYS B 1 185 ? -1.463  27.188  9.883   1.00 18.71 ? 185 LYS B O     1 
ATOM   3648 C  CB    . LYS B 1 185 ? 0.017   29.426  10.298  1.00 17.28 ? 185 LYS B CB    1 
ATOM   3649 C  CG    . LYS B 1 185 ? 0.846   29.064  9.045   1.00 18.42 ? 185 LYS B CG    1 
ATOM   3650 C  CD    . LYS B 1 185 ? 2.048   28.155  9.337   1.00 22.59 ? 185 LYS B CD    1 
ATOM   3651 C  CE    . LYS B 1 185 ? 1.638   26.725  9.724   1.00 17.35 ? 185 LYS B CE    1 
ATOM   3652 N  NZ    . LYS B 1 185 ? 0.826   26.026  8.679   1.00 14.86 ? 185 LYS B NZ    1 
ATOM   3653 N  N     . PRO B 1 186 ? -3.160  28.227  8.822   1.00 15.92 ? 186 PRO B N     1 
ATOM   3654 C  CA    . PRO B 1 186 ? -3.590  26.938  8.280   1.00 16.80 ? 186 PRO B CA    1 
ATOM   3655 C  C     . PRO B 1 186 ? -2.730  26.576  7.082   1.00 18.84 ? 186 PRO B C     1 
ATOM   3656 O  O     . PRO B 1 186 ? -2.314  27.470  6.342   1.00 17.37 ? 186 PRO B O     1 
ATOM   3657 C  CB    . PRO B 1 186 ? -5.002  27.231  7.782   1.00 18.82 ? 186 PRO B CB    1 
ATOM   3658 C  CG    . PRO B 1 186 ? -4.956  28.697  7.398   1.00 20.44 ? 186 PRO B CG    1 
ATOM   3659 C  CD    . PRO B 1 186 ? -4.054  29.333  8.426   1.00 18.88 ? 186 PRO B CD    1 
ATOM   3660 N  N     . ASN B 1 187 ? -2.465  25.289  6.883   1.00 18.07 ? 187 ASN B N     1 
ATOM   3661 C  CA    . ASN B 1 187 ? -1.998  24.861  5.567   1.00 19.08 ? 187 ASN B CA    1 
ATOM   3662 C  C     . ASN B 1 187 ? -3.220  24.743  4.654   1.00 19.05 ? 187 ASN B C     1 
ATOM   3663 O  O     . ASN B 1 187 ? -4.336  25.088  5.063   1.00 18.81 ? 187 ASN B O     1 
ATOM   3664 C  CB    . ASN B 1 187 ? -1.171  23.570  5.620   1.00 15.90 ? 187 ASN B CB    1 
ATOM   3665 C  CG    . ASN B 1 187 ? -1.971  22.350  6.068   1.00 19.49 ? 187 ASN B CG    1 
ATOM   3666 O  OD1   . ASN B 1 187 ? -3.208  22.321  6.031   1.00 16.37 ? 187 ASN B OD1   1 
ATOM   3667 N  ND2   . ASN B 1 187 ? -1.249  21.310  6.463   1.00 16.44 ? 187 ASN B ND2   1 
ATOM   3668 N  N     . GLN B 1 188 ? -3.022  24.275  3.428   1.00 15.53 ? 188 GLN B N     1 
ATOM   3669 C  CA    . GLN B 1 188 ? -4.113  24.252  2.458   1.00 17.65 ? 188 GLN B CA    1 
ATOM   3670 C  C     . GLN B 1 188 ? -5.255  23.342  2.873   1.00 16.59 ? 188 GLN B C     1 
ATOM   3671 O  O     . GLN B 1 188 ? -6.428  23.722  2.772   1.00 19.21 ? 188 GLN B O     1 
ATOM   3672 C  CB    . GLN B 1 188 ? -3.601  23.857  1.074   1.00 18.85 ? 188 GLN B CB    1 
ATOM   3673 C  CG    . GLN B 1 188 ? -2.756  24.927  0.433   1.00 24.51 ? 188 GLN B CG    1 
ATOM   3674 C  CD    . GLN B 1 188 ? -1.972  24.399  -0.740  1.00 37.83 ? 188 GLN B CD    1 
ATOM   3675 O  OE1   . GLN B 1 188 ? -0.896  23.810  -0.570  1.00 26.54 ? 188 GLN B OE1   1 
ATOM   3676 N  NE2   . GLN B 1 188 ? -2.511  24.589  -1.944  1.00 28.60 ? 188 GLN B NE2   1 
ATOM   3677 N  N     . LYS B 1 189 ? -4.919  22.148  3.349   1.00 16.65 ? 189 LYS B N     1 
ATOM   3678 C  CA    . LYS B 1 189 ? -5.944  21.221  3.814   1.00 17.30 ? 189 LYS B CA    1 
ATOM   3679 C  C     . LYS B 1 189 ? -6.702  21.794  5.001   1.00 21.23 ? 189 LYS B C     1 
ATOM   3680 O  O     . LYS B 1 189 ? -7.939  21.704  5.070   1.00 20.96 ? 189 LYS B O     1 
ATOM   3681 C  CB    . LYS B 1 189 ? -5.328  19.865  4.178   1.00 25.10 ? 189 LYS B CB    1 
ATOM   3682 C  CG    . LYS B 1 189 ? -5.185  18.941  2.985   1.00 38.28 ? 189 LYS B CG    1 
ATOM   3683 C  CD    . LYS B 1 189 ? -4.624  17.584  3.378   1.00 46.65 ? 189 LYS B CD    1 
ATOM   3684 C  CE    . LYS B 1 189 ? -4.443  16.704  2.146   1.00 56.65 ? 189 LYS B CE    1 
ATOM   3685 N  NZ    . LYS B 1 189 ? -3.410  15.650  2.355   1.00 55.45 ? 189 LYS B NZ    1 
ATOM   3686 N  N     . GLU B 1 190 ? -5.952  22.389  5.925   1.00 18.03 ? 190 GLU B N     1 
ATOM   3687 C  CA    . GLU B 1 190 ? -6.529  23.026  7.104   1.00 18.22 ? 190 GLU B CA    1 
ATOM   3688 C  C     . GLU B 1 190 ? -7.442  24.202  6.751   1.00 20.25 ? 190 GLU B C     1 
ATOM   3689 O  O     . GLU B 1 190 ? -8.516  24.360  7.348   1.00 19.89 ? 190 GLU B O     1 
ATOM   3690 C  CB    . GLU B 1 190 ? -5.412  23.439  8.075   1.00 17.63 ? 190 GLU B CB    1 
ATOM   3691 C  CG    . GLU B 1 190 ? -4.789  22.233  8.777   1.00 18.97 ? 190 GLU B CG    1 
ATOM   3692 C  CD    . GLU B 1 190 ? -3.389  22.476  9.325   1.00 20.27 ? 190 GLU B CD    1 
ATOM   3693 O  OE1   . GLU B 1 190 ? -2.858  23.612  9.229   1.00 15.86 ? 190 GLU B OE1   1 
ATOM   3694 O  OE2   . GLU B 1 190 ? -2.813  21.498  9.859   1.00 19.91 ? 190 GLU B OE2   1 
ATOM   3695 N  N     . LEU B 1 191 ? -7.034  25.010  5.775   1.00 17.10 ? 191 LEU B N     1 
ATOM   3696 C  CA    . LEU B 1 191 ? -7.864  26.123  5.309   1.00 21.28 ? 191 LEU B CA    1 
ATOM   3697 C  C     . LEU B 1 191 ? -9.178  25.619  4.724   1.00 18.37 ? 191 LEU B C     1 
ATOM   3698 O  O     . LEU B 1 191 ? -10.249 26.142  5.040   1.00 20.97 ? 191 LEU B O     1 
ATOM   3699 C  CB    . LEU B 1 191 ? -7.139  26.938  4.245   1.00 18.79 ? 191 LEU B CB    1 
ATOM   3700 C  CG    . LEU B 1 191 ? -7.925  28.145  3.722   1.00 20.77 ? 191 LEU B CG    1 
ATOM   3701 C  CD1   . LEU B 1 191 ? -8.179  29.127  4.853   1.00 19.76 ? 191 LEU B CD1   1 
ATOM   3702 C  CD2   . LEU B 1 191 ? -7.179  28.823  2.581   1.00 20.05 ? 191 LEU B CD2   1 
ATOM   3703 N  N     . SER B 1 192 ? -9.083  24.620  3.846   1.00 18.48 ? 192 SER B N     1 
ATOM   3704 C  CA    . SER B 1 192 ? -10.263 24.037  3.197   1.00 19.87 ? 192 SER B CA    1 
ATOM   3705 C  C     . SER B 1 192 ? -11.270 23.513  4.218   1.00 24.93 ? 192 SER B C     1 
ATOM   3706 O  O     . SER B 1 192 ? -12.476 23.734  4.093   1.00 23.16 ? 192 SER B O     1 
ATOM   3707 C  CB    . SER B 1 192 ? -9.850  22.908  2.249   1.00 21.67 ? 192 SER B CB    1 
ATOM   3708 O  OG    . SER B 1 192 ? -10.985 22.225  1.747   1.00 31.82 ? 192 SER B OG    1 
ATOM   3709 N  N     . ALA B 1 193 ? -10.773 22.805  5.224   1.00 25.20 ? 193 ALA B N     1 
ATOM   3710 C  CA    . ALA B 1 193 ? -11.638 22.271  6.266   1.00 28.16 ? 193 ALA B CA    1 
ATOM   3711 C  C     . ALA B 1 193 ? -12.282 23.396  7.075   1.00 25.43 ? 193 ALA B C     1 
ATOM   3712 O  O     . ALA B 1 193 ? -13.465 23.330  7.420   1.00 24.46 ? 193 ALA B O     1 
ATOM   3713 C  CB    . ALA B 1 193 ? -10.858 21.333  7.178   1.00 22.58 ? 193 ALA B CB    1 
ATOM   3714 N  N     . LEU B 1 194 ? -11.498 24.424  7.378   1.00 22.77 ? 194 LEU B N     1 
ATOM   3715 C  CA    . LEU B 1 194 ? -11.980 25.566  8.156   1.00 25.84 ? 194 LEU B CA    1 
ATOM   3716 C  C     . LEU B 1 194 ? -13.120 26.324  7.468   1.00 29.85 ? 194 LEU B C     1 
ATOM   3717 O  O     . LEU B 1 194 ? -14.131 26.640  8.103   1.00 29.44 ? 194 LEU B O     1 
ATOM   3718 C  CB    . LEU B 1 194 ? -10.825 26.515  8.474   1.00 28.17 ? 194 LEU B CB    1 
ATOM   3719 C  CG    . LEU B 1 194 ? -11.122 27.722  9.362   1.00 25.31 ? 194 LEU B CG    1 
ATOM   3720 C  CD1   . LEU B 1 194 ? -11.523 27.281  10.763  1.00 24.46 ? 194 LEU B CD1   1 
ATOM   3721 C  CD2   . LEU B 1 194 ? -9.898  28.609  9.409   1.00 27.86 ? 194 LEU B CD2   1 
ATOM   3722 N  N     . VAL B 1 195 ? -12.978 26.607  6.177   1.00 24.95 ? 195 VAL B N     1 
ATOM   3723 C  CA    . VAL B 1 195 ? -14.052 27.299  5.455   1.00 25.13 ? 195 VAL B CA    1 
ATOM   3724 C  C     . VAL B 1 195 ? -15.083 26.322  4.894   1.00 30.54 ? 195 VAL B C     1 
ATOM   3725 O  O     . VAL B 1 195 ? -16.069 26.724  4.275   1.00 26.49 ? 195 VAL B O     1 
ATOM   3726 C  CB    . VAL B 1 195 ? -13.525 28.244  4.346   1.00 21.93 ? 195 VAL B CB    1 
ATOM   3727 C  CG1   . VAL B 1 195 ? -12.646 29.324  4.951   1.00 32.59 ? 195 VAL B CG1   1 
ATOM   3728 C  CG2   . VAL B 1 195 ? -12.777 27.473  3.255   1.00 24.57 ? 195 VAL B CG2   1 
ATOM   3729 N  N     . ASN B 1 196 ? -14.845 25.037  5.132   1.00 23.16 ? 196 ASN B N     1 
ATOM   3730 C  CA    . ASN B 1 196 ? -15.766 23.975  4.744   1.00 23.98 ? 196 ASN B CA    1 
ATOM   3731 C  C     . ASN B 1 196 ? -16.122 23.968  3.260   1.00 25.43 ? 196 ASN B C     1 
ATOM   3732 O  O     . ASN B 1 196 ? -17.296 23.858  2.898   1.00 26.08 ? 196 ASN B O     1 
ATOM   3733 C  CB    . ASN B 1 196 ? -17.049 24.027  5.584   1.00 30.84 ? 196 ASN B CB    1 
ATOM   3734 C  CG    . ASN B 1 196 ? -17.818 22.721  5.547   1.00 39.62 ? 196 ASN B CG    1 
ATOM   3735 O  OD1   . ASN B 1 196 ? -17.224 21.646  5.445   1.00 31.09 ? 196 ASN B OD1   1 
ATOM   3736 N  ND2   . ASN B 1 196 ? -19.142 22.806  5.617   1.00 36.27 ? 196 ASN B ND2   1 
ATOM   3737 N  N     . ARG B 1 197 ? -15.110 24.095  2.406   1.00 27.03 ? 197 ARG B N     1 
ATOM   3738 C  CA    . ARG B 1 197 ? -15.319 23.948  0.971   1.00 27.20 ? 197 ARG B CA    1 
ATOM   3739 C  C     . ARG B 1 197 ? -14.023 23.592  0.256   1.00 29.28 ? 197 ARG B C     1 
ATOM   3740 O  O     . ARG B 1 197 ? -12.927 23.861  0.760   1.00 23.96 ? 197 ARG B O     1 
ATOM   3741 C  CB    . ARG B 1 197 ? -15.968 25.205  0.362   1.00 24.52 ? 197 ARG B CB    1 
ATOM   3742 C  CG    . ARG B 1 197 ? -15.118 26.457  0.437   1.00 33.28 ? 197 ARG B CG    1 
ATOM   3743 C  CD    . ARG B 1 197 ? -15.713 27.577  -0.406  1.00 35.44 ? 197 ARG B CD    1 
ATOM   3744 N  NE    . ARG B 1 197 ? -14.860 28.765  -0.398  1.00 35.14 ? 197 ARG B NE    1 
ATOM   3745 C  CZ    . ARG B 1 197 ? -14.891 29.689  0.555   1.00 32.65 ? 197 ARG B CZ    1 
ATOM   3746 N  NH1   . ARG B 1 197 ? -15.735 29.561  1.573   1.00 40.18 ? 197 ARG B NH1   1 
ATOM   3747 N  NH2   . ARG B 1 197 ? -14.084 30.740  0.493   1.00 37.95 ? 197 ARG B NH2   1 
ATOM   3748 N  N     . GLU B 1 198 ? -14.144 22.966  -0.910  1.00 27.47 ? 198 GLU B N     1 
ATOM   3749 C  CA    . GLU B 1 198 ? -12.961 22.609  -1.690  1.00 28.87 ? 198 GLU B CA    1 
ATOM   3750 C  C     . GLU B 1 198 ? -12.392 23.859  -2.349  1.00 27.94 ? 198 GLU B C     1 
ATOM   3751 O  O     . GLU B 1 198 ? -13.141 24.720  -2.820  1.00 37.49 ? 198 GLU B O     1 
ATOM   3752 C  CB    . GLU B 1 198 ? -13.300 21.571  -2.765  1.00 36.56 ? 198 GLU B CB    1 
ATOM   3753 C  CG    . GLU B 1 198 ? -13.949 20.296  -2.246  1.00 56.91 ? 198 GLU B CG    1 
ATOM   3754 C  CD    . GLU B 1 198 ? -12.951 19.298  -1.690  1.00 72.82 ? 198 GLU B CD    1 
ATOM   3755 O  OE1   . GLU B 1 198 ? -11.730 19.534  -1.813  1.00 81.70 ? 198 GLU B OE1   1 
ATOM   3756 O  OE2   . GLU B 1 198 ? -13.393 18.271  -1.131  1.00 80.06 ? 198 GLU B OE2   1 
ATOM   3757 N  N     . LEU B 1 199 ? -11.068 23.957  -2.380  1.00 24.33 ? 199 LEU B N     1 
ATOM   3758 C  CA    . LEU B 1 199 ? -10.408 25.112  -2.977  1.00 24.29 ? 199 LEU B CA    1 
ATOM   3759 C  C     . LEU B 1 199 ? -9.726  24.682  -4.275  1.00 35.49 ? 199 LEU B C     1 
ATOM   3760 O  O     . LEU B 1 199 ? -8.528  24.393  -4.301  1.00 35.64 ? 199 LEU B O     1 
ATOM   3761 C  CB    . LEU B 1 199 ? -9.401  25.703  -1.990  1.00 23.07 ? 199 LEU B CB    1 
ATOM   3762 C  CG    . LEU B 1 199 ? -9.979  25.921  -0.587  1.00 29.08 ? 199 LEU B CG    1 
ATOM   3763 C  CD1   . LEU B 1 199 ? -8.920  26.429  0.382   1.00 32.76 ? 199 LEU B CD1   1 
ATOM   3764 C  CD2   . LEU B 1 199 ? -11.175 26.871  -0.638  1.00 26.00 ? 199 LEU B CD2   1 
ATOM   3765 N  N     . THR B 1 200 ? -10.499 24.645  -5.356  1.00 28.26 ? 200 THR B N     1 
ATOM   3766 C  CA    . THR B 1 200 ? -10.029 24.057  -6.606  1.00 29.31 ? 200 THR B CA    1 
ATOM   3767 C  C     . THR B 1 200 ? -9.666  25.088  -7.674  1.00 31.61 ? 200 THR B C     1 
ATOM   3768 O  O     . THR B 1 200 ? -8.989  24.762  -8.649  1.00 33.31 ? 200 THR B O     1 
ATOM   3769 C  CB    . THR B 1 200 ? -11.078 23.088  -7.190  1.00 34.68 ? 200 THR B CB    1 
ATOM   3770 O  OG1   . THR B 1 200 ? -12.282 23.804  -7.488  1.00 30.35 ? 200 THR B OG1   1 
ATOM   3771 C  CG2   . THR B 1 200 ? -11.388 21.974  -6.195  1.00 41.83 ? 200 THR B CG2   1 
ATOM   3772 N  N     . GLN B 1 201 ? -10.124 26.325  -7.501  1.00 26.25 ? 201 GLN B N     1 
ATOM   3773 C  CA    . GLN B 1 201 ? -9.889  27.371  -8.500  1.00 22.94 ? 201 GLN B CA    1 
ATOM   3774 C  C     . GLN B 1 201 ? -8.676  28.206  -8.104  1.00 26.50 ? 201 GLN B C     1 
ATOM   3775 O  O     . GLN B 1 201 ? -8.354  28.281  -6.923  1.00 23.28 ? 201 GLN B O     1 
ATOM   3776 C  CB    . GLN B 1 201 ? -11.125 28.259  -8.632  1.00 23.91 ? 201 GLN B CB    1 
ATOM   3777 C  CG    . GLN B 1 201 ? -12.392 27.472  -8.918  1.00 28.22 ? 201 GLN B CG    1 
ATOM   3778 C  CD    . GLN B 1 201 ? -12.241 26.549  -10.113 1.00 29.12 ? 201 GLN B CD    1 
ATOM   3779 O  OE1   . GLN B 1 201 ? -12.078 27.004  -11.245 1.00 37.73 ? 201 GLN B OE1   1 
ATOM   3780 N  NE2   . GLN B 1 201 ? -12.295 25.240  -9.866  1.00 38.16 ? 201 GLN B NE2   1 
ATOM   3781 N  N     . PRO B 1 202 ? -8.003  28.834  -9.088  1.00 25.06 ? 202 PRO B N     1 
ATOM   3782 C  CA    . PRO B 1 202 ? -6.772  29.582  -8.794  1.00 22.70 ? 202 PRO B CA    1 
ATOM   3783 C  C     . PRO B 1 202 ? -6.870  30.583  -7.643  1.00 21.52 ? 202 PRO B C     1 
ATOM   3784 O  O     . PRO B 1 202 ? -5.931  30.663  -6.855  1.00 21.40 ? 202 PRO B O     1 
ATOM   3785 C  CB    . PRO B 1 202 ? -6.490  30.312  -10.108 1.00 22.18 ? 202 PRO B CB    1 
ATOM   3786 C  CG    . PRO B 1 202 ? -7.017  29.376  -11.153 1.00 28.47 ? 202 PRO B CG    1 
ATOM   3787 C  CD    . PRO B 1 202 ? -8.263  28.754  -10.539 1.00 26.65 ? 202 PRO B CD    1 
ATOM   3788 N  N     . ASP B 1 203 ? -7.976  31.313  -7.536  1.00 23.27 ? 203 ASP B N     1 
ATOM   3789 C  CA    . ASP B 1 203 ? -8.092  32.357  -6.520  1.00 22.40 ? 203 ASP B CA    1 
ATOM   3790 C  C     . ASP B 1 203 ? -8.781  31.937  -5.223  1.00 21.76 ? 203 ASP B C     1 
ATOM   3791 O  O     . ASP B 1 203 ? -9.005  32.773  -4.344  1.00 22.59 ? 203 ASP B O     1 
ATOM   3792 C  CB    . ASP B 1 203 ? -8.803  33.582  -7.101  1.00 32.07 ? 203 ASP B CB    1 
ATOM   3793 C  CG    . ASP B 1 203 ? -7.846  34.717  -7.395  1.00 57.38 ? 203 ASP B CG    1 
ATOM   3794 O  OD1   . ASP B 1 203 ? -7.294  35.288  -6.426  1.00 62.82 ? 203 ASP B OD1   1 
ATOM   3795 O  OD2   . ASP B 1 203 ? -7.649  35.042  -8.586  1.00 57.48 ? 203 ASP B OD2   1 
ATOM   3796 N  N     . ASP B 1 204 ? -9.109  30.653  -5.100  1.00 23.68 ? 204 ASP B N     1 
ATOM   3797 C  CA    . ASP B 1 204 ? -9.879  30.153  -3.956  1.00 20.06 ? 204 ASP B CA    1 
ATOM   3798 C  C     . ASP B 1 204 ? -9.167  30.284  -2.610  1.00 20.22 ? 204 ASP B C     1 
ATOM   3799 O  O     . ASP B 1 204 ? -9.788  30.631  -1.612  1.00 20.98 ? 204 ASP B O     1 
ATOM   3800 C  CB    . ASP B 1 204 ? -10.272 28.691  -4.175  1.00 20.89 ? 204 ASP B CB    1 
ATOM   3801 C  CG    . ASP B 1 204 ? -11.460 28.533  -5.105  1.00 25.17 ? 204 ASP B CG    1 
ATOM   3802 O  OD1   . ASP B 1 204 ? -11.816 27.375  -5.407  1.00 28.43 ? 204 ASP B OD1   1 
ATOM   3803 O  OD2   . ASP B 1 204 ? -12.045 29.555  -5.525  1.00 33.45 ? 204 ASP B OD2   1 
ATOM   3804 N  N     . VAL B 1 205 ? -7.873  29.983  -2.572  1.00 19.05 ? 205 VAL B N     1 
ATOM   3805 C  CA    . VAL B 1 205 ? -7.121  30.112  -1.327  1.00 20.67 ? 205 VAL B CA    1 
ATOM   3806 C  C     . VAL B 1 205 ? -7.123  31.559  -0.839  1.00 19.34 ? 205 VAL B C     1 
ATOM   3807 O  O     . VAL B 1 205 ? -7.403  31.828  0.334   1.00 17.14 ? 205 VAL B O     1 
ATOM   3808 C  CB    . VAL B 1 205 ? -5.676  29.595  -1.474  1.00 18.40 ? 205 VAL B CB    1 
ATOM   3809 C  CG1   . VAL B 1 205 ? -4.816  30.029  -0.284  1.00 18.21 ? 205 VAL B CG1   1 
ATOM   3810 C  CG2   . VAL B 1 205 ? -5.679  28.085  -1.594  1.00 16.46 ? 205 VAL B CG2   1 
ATOM   3811 N  N     . ARG B 1 206 ? -6.833  32.488  -1.743  1.00 17.68 ? 206 ARG B N     1 
ATOM   3812 C  CA    . ARG B 1 206 ? -6.837  33.904  -1.388  1.00 18.28 ? 206 ARG B CA    1 
ATOM   3813 C  C     . ARG B 1 206 ? -8.193  34.346  -0.861  1.00 20.88 ? 206 ARG B C     1 
ATOM   3814 O  O     . ARG B 1 206 ? -8.280  34.998  0.183   1.00 22.77 ? 206 ARG B O     1 
ATOM   3815 C  CB    . ARG B 1 206 ? -6.463  34.775  -2.589  1.00 19.63 ? 206 ARG B CB    1 
ATOM   3816 C  CG    . ARG B 1 206 ? -6.328  36.244  -2.234  1.00 23.60 ? 206 ARG B CG    1 
ATOM   3817 C  CD    . ARG B 1 206 ? -6.623  37.146  -3.430  1.00 41.11 ? 206 ARG B CD    1 
ATOM   3818 N  NE    . ARG B 1 206 ? -7.969  37.703  -3.349  1.00 55.84 ? 206 ARG B NE    1 
ATOM   3819 C  CZ    . ARG B 1 206 ? -8.867  37.658  -4.326  1.00 55.03 ? 206 ARG B CZ    1 
ATOM   3820 N  NH1   . ARG B 1 206 ? -8.571  37.083  -5.482  1.00 60.13 ? 206 ARG B NH1   1 
ATOM   3821 N  NH2   . ARG B 1 206 ? -10.063 38.195  -4.144  1.00 50.53 ? 206 ARG B NH2   1 
ATOM   3822 N  N     . LYS B 1 207 ? -9.244  33.977  -1.586  1.00 20.52 ? 207 LYS B N     1 
ATOM   3823 C  CA    . LYS B 1 207 ? -10.607 34.355  -1.221  1.00 19.39 ? 207 LYS B CA    1 
ATOM   3824 C  C     . LYS B 1 207 ? -11.025 33.762  0.121   1.00 23.23 ? 207 LYS B C     1 
ATOM   3825 O  O     . LYS B 1 207 ? -11.675 34.429  0.929   1.00 22.46 ? 207 LYS B O     1 
ATOM   3826 C  CB    . LYS B 1 207 ? -11.598 33.941  -2.312  1.00 22.17 ? 207 LYS B CB    1 
ATOM   3827 C  CG    . LYS B 1 207 ? -11.489 34.771  -3.581  1.00 27.82 ? 207 LYS B CG    1 
ATOM   3828 C  CD    . LYS B 1 207 ? -12.573 34.410  -4.582  1.00 35.80 ? 207 LYS B CD    1 
ATOM   3829 C  CE    . LYS B 1 207 ? -12.560 35.364  -5.768  1.00 47.51 ? 207 LYS B CE    1 
ATOM   3830 N  NZ    . LYS B 1 207 ? -13.599 35.029  -6.782  1.00 53.66 ? 207 LYS B NZ    1 
ATOM   3831 N  N     . ALA B 1 208 ? -10.649 32.508  0.354   1.00 19.64 ? 208 ALA B N     1 
ATOM   3832 C  CA    . ALA B 1 208 ? -10.953 31.848  1.621   1.00 21.86 ? 208 ALA B CA    1 
ATOM   3833 C  C     . ALA B 1 208 ? -10.227 32.531  2.781   1.00 19.45 ? 208 ALA B C     1 
ATOM   3834 O  O     . ALA B 1 208 ? -10.805 32.752  3.840   1.00 20.69 ? 208 ALA B O     1 
ATOM   3835 C  CB    . ALA B 1 208 ? -10.587 30.370  1.551   1.00 21.38 ? 208 ALA B CB    1 
ATOM   3836 N  N     . ALA B 1 209 ? -8.956  32.869  2.578   1.00 19.23 ? 209 ALA B N     1 
ATOM   3837 C  CA    . ALA B 1 209 ? -8.200  33.580  3.605   1.00 18.68 ? 209 ALA B CA    1 
ATOM   3838 C  C     . ALA B 1 209 ? -8.833  34.937  3.915   1.00 23.22 ? 209 ALA B C     1 
ATOM   3839 O  O     . ALA B 1 209 ? -8.988  35.307  5.083   1.00 21.56 ? 209 ALA B O     1 
ATOM   3840 C  CB    . ALA B 1 209 ? -6.733  33.742  3.184   1.00 15.89 ? 209 ALA B CB    1 
ATOM   3841 N  N     . GLN B 1 210 ? -9.199  35.672  2.868   1.00 21.04 ? 210 GLN B N     1 
ATOM   3842 C  CA    . GLN B 1 210 ? -9.831  36.977  3.036   1.00 25.26 ? 210 GLN B CA    1 
ATOM   3843 C  C     . GLN B 1 210 ? -11.171 36.856  3.750   1.00 26.05 ? 210 GLN B C     1 
ATOM   3844 O  O     . GLN B 1 210 ? -11.553 37.742  4.515   1.00 29.05 ? 210 GLN B O     1 
ATOM   3845 C  CB    . GLN B 1 210 ? -10.033 37.658  1.681   1.00 24.49 ? 210 GLN B CB    1 
ATOM   3846 C  CG    . GLN B 1 210 ? -8.757  38.129  1.022   1.00 29.44 ? 210 GLN B CG    1 
ATOM   3847 C  CD    . GLN B 1 210 ? -9.018  38.815  -0.302  1.00 38.61 ? 210 GLN B CD    1 
ATOM   3848 O  OE1   . GLN B 1 210 ? -9.774  38.314  -1.135  1.00 33.60 ? 210 GLN B OE1   1 
ATOM   3849 N  NE2   . GLN B 1 210 ? -8.396  39.973  -0.501  1.00 43.91 ? 210 GLN B NE2   1 
ATOM   3850 N  N     . GLU B 1 211 ? -11.884 35.763  3.489   1.00 20.94 ? 211 GLU B N     1 
ATOM   3851 C  CA    . GLU B 1 211 ? -13.179 35.522  4.131   1.00 28.65 ? 211 GLU B CA    1 
ATOM   3852 C  C     . GLU B 1 211 ? -13.016 35.433  5.646   1.00 25.04 ? 211 GLU B C     1 
ATOM   3853 O  O     . GLU B 1 211 ? -13.845 35.938  6.404   1.00 25.35 ? 211 GLU B O     1 
ATOM   3854 C  CB    . GLU B 1 211 ? -13.800 34.233  3.591   1.00 30.55 ? 211 GLU B CB    1 
ATOM   3855 C  CG    . GLU B 1 211 ? -15.048 33.775  4.333   1.00 44.08 ? 211 GLU B CG    1 
ATOM   3856 C  CD    . GLU B 1 211 ? -15.537 32.417  3.860   1.00 55.41 ? 211 GLU B CD    1 
ATOM   3857 O  OE1   . GLU B 1 211 ? -15.307 32.082  2.678   1.00 55.45 ? 211 GLU B OE1   1 
ATOM   3858 O  OE2   . GLU B 1 211 ? -16.143 31.682  4.672   1.00 58.26 ? 211 GLU B OE2   1 
ATOM   3859 N  N     . ILE B 1 212 ? -11.931 34.796  6.077   1.00 22.31 ? 212 ILE B N     1 
ATOM   3860 C  CA    . ILE B 1 212 ? -11.647 34.644  7.501   1.00 19.37 ? 212 ILE B CA    1 
ATOM   3861 C  C     . ILE B 1 212 ? -11.314 36.003  8.131   1.00 31.36 ? 212 ILE B C     1 
ATOM   3862 O  O     . ILE B 1 212 ? -11.803 36.331  9.216   1.00 29.47 ? 212 ILE B O     1 
ATOM   3863 C  CB    . ILE B 1 212 ? -10.495 33.650  7.732   1.00 19.93 ? 212 ILE B CB    1 
ATOM   3864 C  CG1   . ILE B 1 212 ? -10.931 32.243  7.309   1.00 22.41 ? 212 ILE B CG1   1 
ATOM   3865 C  CG2   . ILE B 1 212 ? -10.073 33.645  9.199   1.00 22.62 ? 212 ILE B CG2   1 
ATOM   3866 C  CD1   . ILE B 1 212 ? -9.782  31.304  7.090   1.00 30.76 ? 212 ILE B CD1   1 
ATOM   3867 N  N     . VAL B 1 213 ? -10.492 36.795  7.449   1.00 27.25 ? 213 VAL B N     1 
ATOM   3868 C  CA    . VAL B 1 213 ? -10.141 38.120  7.958   1.00 22.46 ? 213 VAL B CA    1 
ATOM   3869 C  C     . VAL B 1 213 ? -11.368 39.020  8.027   1.00 28.96 ? 213 VAL B C     1 
ATOM   3870 O  O     . VAL B 1 213 ? -11.607 39.684  9.036   1.00 30.81 ? 213 VAL B O     1 
ATOM   3871 C  CB    . VAL B 1 213 ? -9.057  38.804  7.109   1.00 25.63 ? 213 VAL B CB    1 
ATOM   3872 C  CG1   . VAL B 1 213 ? -8.837  40.239  7.595   1.00 23.38 ? 213 VAL B CG1   1 
ATOM   3873 C  CG2   . VAL B 1 213 ? -7.762  38.008  7.168   1.00 25.45 ? 213 VAL B CG2   1 
ATOM   3874 N  N     . ASN B 1 214 ? -12.147 39.032  6.951   1.00 24.78 ? 214 ASN B N     1 
ATOM   3875 C  CA    . ASN B 1 214 ? -13.324 39.889  6.877   1.00 27.27 ? 214 ASN B CA    1 
ATOM   3876 C  C     . ASN B 1 214 ? -14.371 39.547  7.931   1.00 28.37 ? 214 ASN B C     1 
ATOM   3877 O  O     . ASN B 1 214 ? -15.111 40.419  8.384   1.00 31.39 ? 214 ASN B O     1 
ATOM   3878 C  CB    . ASN B 1 214 ? -13.940 39.842  5.475   1.00 32.45 ? 214 ASN B CB    1 
ATOM   3879 C  CG    . ASN B 1 214 ? -13.036 40.459  4.419   1.00 43.84 ? 214 ASN B CG    1 
ATOM   3880 O  OD1   . ASN B 1 214 ? -12.101 41.196  4.736   1.00 47.31 ? 214 ASN B OD1   1 
ATOM   3881 N  ND2   . ASN B 1 214 ? -13.316 40.162  3.154   1.00 50.20 ? 214 ASN B ND2   1 
ATOM   3882 N  N     . SER B 1 215 ? -14.416 38.278  8.330   1.00 26.85 ? 215 SER B N     1 
ATOM   3883 C  CA    . SER B 1 215 ? -15.367 37.817  9.336   1.00 28.28 ? 215 SER B CA    1 
ATOM   3884 C  C     . SER B 1 215 ? -14.973 38.260  10.743  1.00 34.55 ? 215 SER B C     1 
ATOM   3885 O  O     . SER B 1 215 ? -15.795 38.230  11.659  1.00 36.14 ? 215 SER B O     1 
ATOM   3886 C  CB    . SER B 1 215 ? -15.470 36.294  9.306   1.00 33.91 ? 215 SER B CB    1 
ATOM   3887 O  OG    . SER B 1 215 ? -14.300 35.701  9.842   1.00 35.09 ? 215 SER B OG    1 
ATOM   3888 N  N     . GLY B 1 216 ? -13.716 38.656  10.919  1.00 34.15 ? 216 GLY B N     1 
ATOM   3889 C  CA    . GLY B 1 216 ? -13.230 39.079  12.222  1.00 31.09 ? 216 GLY B CA    1 
ATOM   3890 C  C     . GLY B 1 216 ? -12.647 37.936  13.034  1.00 26.01 ? 216 GLY B C     1 
ATOM   3891 O  O     . GLY B 1 216 ? -12.239 38.123  14.180  1.00 29.94 ? 216 GLY B O     1 
ATOM   3892 N  N     . LYS B 1 217 ? -12.600 36.745  12.444  1.00 22.92 ? 217 LYS B N     1 
ATOM   3893 C  CA    . LYS B 1 217 ? -12.067 35.582  13.152  1.00 23.22 ? 217 LYS B CA    1 
ATOM   3894 C  C     . LYS B 1 217 ? -10.568 35.694  13.418  1.00 27.54 ? 217 LYS B C     1 
ATOM   3895 O  O     . LYS B 1 217 ? -10.082 35.265  14.462  1.00 26.15 ? 217 LYS B O     1 
ATOM   3896 C  CB    . LYS B 1 217 ? -12.375 34.289  12.393  1.00 25.84 ? 217 LYS B CB    1 
ATOM   3897 C  CG    . LYS B 1 217 ? -13.833 33.851  12.497  1.00 38.18 ? 217 LYS B CG    1 
ATOM   3898 C  CD    . LYS B 1 217 ? -14.119 32.701  11.541  1.00 44.96 ? 217 LYS B CD    1 
ATOM   3899 C  CE    . LYS B 1 217 ? -15.559 32.225  11.646  1.00 51.85 ? 217 LYS B CE    1 
ATOM   3900 N  NZ    . LYS B 1 217 ? -15.646 30.928  12.369  1.00 60.37 ? 217 LYS B NZ    1 
ATOM   3901 N  N     . ALA B 1 218 ? -9.840  36.269  12.468  1.00 25.92 ? 218 ALA B N     1 
ATOM   3902 C  CA    . ALA B 1 218 ? -8.401  36.451  12.618  1.00 23.28 ? 218 ALA B CA    1 
ATOM   3903 C  C     . ALA B 1 218 ? -7.983  37.758  11.967  1.00 23.44 ? 218 ALA B C     1 
ATOM   3904 O  O     . ALA B 1 218 ? -8.527  38.132  10.933  1.00 27.65 ? 218 ALA B O     1 
ATOM   3905 C  CB    . ALA B 1 218 ? -7.640  35.286  11.992  1.00 26.43 ? 218 ALA B CB    1 
ATOM   3906 N  N     . LYS B 1 219 ? -7.009  38.441  12.566  1.00 23.97 ? 219 LYS B N     1 
ATOM   3907 C  CA    . LYS B 1 219 ? -6.491  39.685  11.999  1.00 21.08 ? 219 LYS B CA    1 
ATOM   3908 C  C     . LYS B 1 219 ? -5.571  39.397  10.819  1.00 25.19 ? 219 LYS B C     1 
ATOM   3909 O  O     . LYS B 1 219 ? -5.497  40.181  9.873   1.00 22.34 ? 219 LYS B O     1 
ATOM   3910 C  CB    . LYS B 1 219 ? -5.713  40.487  13.043  1.00 21.64 ? 219 LYS B CB    1 
ATOM   3911 C  CG    . LYS B 1 219 ? -6.535  41.050  14.189  1.00 39.01 ? 219 LYS B CG    1 
ATOM   3912 C  CD    . LYS B 1 219 ? -5.739  42.147  14.894  1.00 46.73 ? 219 LYS B CD    1 
ATOM   3913 C  CE    . LYS B 1 219 ? -6.250  42.413  16.302  1.00 59.05 ? 219 LYS B CE    1 
ATOM   3914 N  NZ    . LYS B 1 219 ? -7.311  41.452  16.710  1.00 64.40 ? 219 LYS B NZ    1 
ATOM   3915 N  N     . ARG B 1 220 ? -4.866  38.269  10.898  1.00 21.42 ? 220 ARG B N     1 
ATOM   3916 C  CA    . ARG B 1 220 ? -3.900  37.873  9.887   1.00 24.69 ? 220 ARG B CA    1 
ATOM   3917 C  C     . ARG B 1 220 ? -4.057  36.391  9.630   1.00 18.62 ? 220 ARG B C     1 
ATOM   3918 O  O     . ARG B 1 220 ? -4.073  35.591  10.565  1.00 20.70 ? 220 ARG B O     1 
ATOM   3919 C  CB    . ARG B 1 220 ? -2.468  38.122  10.370  1.00 19.34 ? 220 ARG B CB    1 
ATOM   3920 C  CG    . ARG B 1 220 ? -2.179  39.549  10.827  1.00 20.04 ? 220 ARG B CG    1 
ATOM   3921 C  CD    . ARG B 1 220 ? -0.803  39.620  11.498  1.00 22.89 ? 220 ARG B CD    1 
ATOM   3922 N  NE    . ARG B 1 220 ? -0.559  40.927  12.110  1.00 25.48 ? 220 ARG B NE    1 
ATOM   3923 C  CZ    . ARG B 1 220 ? -1.058  41.313  13.284  1.00 37.57 ? 220 ARG B CZ    1 
ATOM   3924 N  NH1   . ARG B 1 220 ? -1.838  40.496  13.985  1.00 32.68 ? 220 ARG B NH1   1 
ATOM   3925 N  NH2   . ARG B 1 220 ? -0.780  42.523  13.759  1.00 38.91 ? 220 ARG B NH2   1 
ATOM   3926 N  N     . VAL B 1 221 ? -4.177  36.031  8.362   1.00 17.10 ? 221 VAL B N     1 
ATOM   3927 C  CA    . VAL B 1 221 ? -4.208  34.633  7.980   1.00 16.50 ? 221 VAL B CA    1 
ATOM   3928 C  C     . VAL B 1 221 ? -3.031  34.382  7.068   1.00 16.18 ? 221 VAL B C     1 
ATOM   3929 O  O     . VAL B 1 221 ? -2.894  35.026  6.030   1.00 20.03 ? 221 VAL B O     1 
ATOM   3930 C  CB    . VAL B 1 221 ? -5.491  34.279  7.226   1.00 20.03 ? 221 VAL B CB    1 
ATOM   3931 C  CG1   . VAL B 1 221 ? -5.440  32.827  6.758   1.00 19.23 ? 221 VAL B CG1   1 
ATOM   3932 C  CG2   . VAL B 1 221 ? -6.710  34.520  8.109   1.00 19.47 ? 221 VAL B CG2   1 
ATOM   3933 N  N     . VAL B 1 222 ? -2.166  33.463  7.467   1.00 17.53 ? 222 VAL B N     1 
ATOM   3934 C  CA    . VAL B 1 222 ? -1.059  33.074  6.611   1.00 16.25 ? 222 VAL B CA    1 
ATOM   3935 C  C     . VAL B 1 222 ? -1.302  31.641  6.195   1.00 16.02 ? 222 VAL B C     1 
ATOM   3936 O  O     . VAL B 1 222 ? -1.122  30.720  6.993   1.00 16.94 ? 222 VAL B O     1 
ATOM   3937 C  CB    . VAL B 1 222 ? 0.285   33.208  7.336   1.00 17.40 ? 222 VAL B CB    1 
ATOM   3938 C  CG1   . VAL B 1 222 ? 1.417   32.713  6.435   1.00 18.31 ? 222 VAL B CG1   1 
ATOM   3939 C  CG2   . VAL B 1 222 ? 0.496   34.672  7.716   1.00 18.82 ? 222 VAL B CG2   1 
ATOM   3940 N  N     . VAL B 1 223 ? -1.754  31.456  4.957   1.00 15.67 ? 223 VAL B N     1 
ATOM   3941 C  CA    . VAL B 1 223 ? -1.982  30.114  4.441   1.00 17.11 ? 223 VAL B CA    1 
ATOM   3942 C  C     . VAL B 1 223 ? -0.656  29.576  3.953   1.00 16.70 ? 223 VAL B C     1 
ATOM   3943 O  O     . VAL B 1 223 ? -0.084  30.098  2.995   1.00 17.58 ? 223 VAL B O     1 
ATOM   3944 C  CB    . VAL B 1 223 ? -2.936  30.109  3.253   1.00 15.75 ? 223 VAL B CB    1 
ATOM   3945 C  CG1   . VAL B 1 223 ? -3.286  28.665  2.882   1.00 16.83 ? 223 VAL B CG1   1 
ATOM   3946 C  CG2   . VAL B 1 223 ? -4.192  30.907  3.578   1.00 18.75 ? 223 VAL B CG2   1 
ATOM   3947 N  N     . SER B 1 224 ? -0.155  28.531  4.591   1.00 14.37 ? 224 SER B N     1 
ATOM   3948 C  CA    . SER B 1 224 ? 1.130   27.995  4.159   1.00 14.72 ? 224 SER B CA    1 
ATOM   3949 C  C     . SER B 1 224 ? 0.902   26.951  3.066   1.00 18.09 ? 224 SER B C     1 
ATOM   3950 O  O     . SER B 1 224 ? -0.064  26.180  3.119   1.00 16.27 ? 224 SER B O     1 
ATOM   3951 C  CB    . SER B 1 224 ? 1.926   27.446  5.354   1.00 14.72 ? 224 SER B CB    1 
ATOM   3952 O  OG    . SER B 1 224 ? 1.313   26.307  5.931   1.00 18.70 ? 224 SER B OG    1 
ATOM   3953 N  N     . LEU B 1 225 ? 1.784   26.941  2.070   1.00 14.42 ? 225 LEU B N     1 
ATOM   3954 C  CA    . LEU B 1 225 ? 1.540   26.218  0.830   1.00 13.51 ? 225 LEU B CA    1 
ATOM   3955 C  C     . LEU B 1 225 ? 2.649   25.217  0.491   1.00 13.63 ? 225 LEU B C     1 
ATOM   3956 O  O     . LEU B 1 225 ? 2.898   24.933  -0.694  1.00 14.33 ? 225 LEU B O     1 
ATOM   3957 C  CB    . LEU B 1 225 ? 1.415   27.223  -0.314  1.00 15.82 ? 225 LEU B CB    1 
ATOM   3958 C  CG    . LEU B 1 225 ? 0.428   28.369  -0.088  1.00 15.30 ? 225 LEU B CG    1 
ATOM   3959 C  CD1   . LEU B 1 225 ? 0.597   29.437  -1.172  1.00 18.45 ? 225 LEU B CD1   1 
ATOM   3960 C  CD2   . LEU B 1 225 ? -0.993  27.840  -0.092  1.00 18.88 ? 225 LEU B CD2   1 
ATOM   3961 N  N     . GLY B 1 226 ? 3.321   24.701  1.516   1.00 16.30 ? 226 GLY B N     1 
ATOM   3962 C  CA    . GLY B 1 226 ? 4.366   23.714  1.289   1.00 20.87 ? 226 GLY B CA    1 
ATOM   3963 C  C     . GLY B 1 226 ? 5.457   24.317  0.429   1.00 15.15 ? 226 GLY B C     1 
ATOM   3964 O  O     . GLY B 1 226 ? 5.927   25.413  0.734   1.00 15.54 ? 226 GLY B O     1 
ATOM   3965 N  N     . PRO B 1 227 ? 5.835   23.640  -0.670  1.00 15.60 ? 227 PRO B N     1 
ATOM   3966 C  CA    . PRO B 1 227 ? 6.950   24.141  -1.490  1.00 16.22 ? 227 PRO B CA    1 
ATOM   3967 C  C     . PRO B 1 227 ? 6.631   25.459  -2.201  1.00 14.80 ? 227 PRO B C     1 
ATOM   3968 O  O     . PRO B 1 227 ? 7.545   26.144  -2.662  1.00 16.62 ? 227 PRO B O     1 
ATOM   3969 C  CB    . PRO B 1 227 ? 7.178   23.013  -2.513  1.00 20.41 ? 227 PRO B CB    1 
ATOM   3970 C  CG    . PRO B 1 227 ? 5.866   22.279  -2.578  1.00 21.81 ? 227 PRO B CG    1 
ATOM   3971 C  CD    . PRO B 1 227 ? 5.296   22.362  -1.176  1.00 17.17 ? 227 PRO B CD    1 
ATOM   3972 N  N     . GLN B 1 228 ? 5.351   25.815  -2.277  1.00 16.35 ? 228 GLN B N     1 
ATOM   3973 C  CA    . GLN B 1 228 ? 4.969   27.067  -2.917  1.00 16.85 ? 228 GLN B CA    1 
ATOM   3974 C  C     . GLN B 1 228 ? 5.065   28.259  -1.976  1.00 18.80 ? 228 GLN B C     1 
ATOM   3975 O  O     . GLN B 1 228 ? 4.784   29.392  -2.375  1.00 19.77 ? 228 GLN B O     1 
ATOM   3976 C  CB    . GLN B 1 228 ? 3.563   26.955  -3.512  1.00 14.28 ? 228 GLN B CB    1 
ATOM   3977 C  CG    . GLN B 1 228 ? 3.504   25.966  -4.662  1.00 17.55 ? 228 GLN B CG    1 
ATOM   3978 C  CD    . GLN B 1 228 ? 2.119   25.825  -5.245  1.00 24.93 ? 228 GLN B CD    1 
ATOM   3979 O  OE1   . GLN B 1 228 ? 1.122   26.103  -4.578  1.00 23.22 ? 228 GLN B OE1   1 
ATOM   3980 N  NE2   . GLN B 1 228 ? 2.047   25.396  -6.499  1.00 22.15 ? 228 GLN B NE2   1 
ATOM   3981 N  N     . GLY B 1 229 ? 5.484   28.014  -0.738  1.00 14.27 ? 229 GLY B N     1 
ATOM   3982 C  CA    . GLY B 1 229 ? 5.699   29.105  0.202   1.00 14.81 ? 229 GLY B CA    1 
ATOM   3983 C  C     . GLY B 1 229 ? 4.459   29.429  1.008   1.00 17.98 ? 229 GLY B C     1 
ATOM   3984 O  O     . GLY B 1 229 ? 3.906   28.563  1.673   1.00 16.48 ? 229 GLY B O     1 
ATOM   3985 N  N     . ALA B 1 230 ? 4.013   30.679  0.964   1.00 14.99 ? 230 ALA B N     1 
ATOM   3986 C  CA    . ALA B 1 230 ? 2.827   31.042  1.737   1.00 15.89 ? 230 ALA B CA    1 
ATOM   3987 C  C     . ALA B 1 230 ? 2.108   32.248  1.167   1.00 18.67 ? 230 ALA B C     1 
ATOM   3988 O  O     . ALA B 1 230 ? 2.695   33.070  0.469   1.00 19.12 ? 230 ALA B O     1 
ATOM   3989 C  CB    . ALA B 1 230 ? 3.190   31.285  3.206   1.00 16.89 ? 230 ALA B CB    1 
ATOM   3990 N  N     . LEU B 1 231 ? 0.821   32.350  1.479   1.00 15.27 ? 231 LEU B N     1 
ATOM   3991 C  CA    . LEU B 1 231 ? 0.066   33.547  1.148   1.00 17.42 ? 231 LEU B CA    1 
ATOM   3992 C  C     . LEU B 1 231 ? -0.398  34.197  2.445   1.00 22.36 ? 231 LEU B C     1 
ATOM   3993 O  O     . LEU B 1 231 ? -1.126  33.581  3.226   1.00 22.86 ? 231 LEU B O     1 
ATOM   3994 C  CB    . LEU B 1 231 ? -1.150  33.199  0.292   1.00 16.66 ? 231 LEU B CB    1 
ATOM   3995 C  CG    . LEU B 1 231 ? -1.991  34.427  -0.069  1.00 21.90 ? 231 LEU B CG    1 
ATOM   3996 C  CD1   . LEU B 1 231 ? -1.337  35.189  -1.212  1.00 32.30 ? 231 LEU B CD1   1 
ATOM   3997 C  CD2   . LEU B 1 231 ? -3.403  34.029  -0.421  1.00 28.62 ? 231 LEU B CD2   1 
ATOM   3998 N  N     . GLY B 1 232 ? 0.027   35.436  2.680   1.00 17.39 ? 232 GLY B N     1 
ATOM   3999 C  CA    . GLY B 1 232 ? -0.381  36.143  3.878   1.00 19.94 ? 232 GLY B CA    1 
ATOM   4000 C  C     . GLY B 1 232 ? -1.469  37.146  3.570   1.00 21.11 ? 232 GLY B C     1 
ATOM   4001 O  O     . GLY B 1 232 ? -1.397  37.868  2.577   1.00 20.89 ? 232 GLY B O     1 
ATOM   4002 N  N     . VAL B 1 233 ? -2.495  37.185  4.411   1.00 17.03 ? 233 VAL B N     1 
ATOM   4003 C  CA    . VAL B 1 233 ? -3.611  38.094  4.169   1.00 20.76 ? 233 VAL B CA    1 
ATOM   4004 C  C     . VAL B 1 233 ? -3.946  38.915  5.403   1.00 23.39 ? 233 VAL B C     1 
ATOM   4005 O  O     . VAL B 1 233 ? -4.071  38.376  6.511   1.00 19.84 ? 233 VAL B O     1 
ATOM   4006 C  CB    . VAL B 1 233 ? -4.857  37.340  3.638   1.00 28.37 ? 233 VAL B CB    1 
ATOM   4007 C  CG1   . VAL B 1 233 ? -6.056  38.268  3.536   1.00 28.07 ? 233 VAL B CG1   1 
ATOM   4008 C  CG2   . VAL B 1 233 ? -4.551  36.722  2.274   1.00 24.00 ? 233 VAL B CG2   1 
ATOM   4009 N  N     . ASP B 1 234 ? -4.050  40.224  5.168   1.00 22.68 ? 234 ASP B N     1 
ATOM   4010 C  CA    . ASP B 1 234 ? -4.426  41.251  6.127   1.00 32.29 ? 234 ASP B CA    1 
ATOM   4011 C  C     . ASP B 1 234 ? -5.727  41.863  5.665   1.00 22.10 ? 234 ASP B C     1 
ATOM   4012 O  O     . ASP B 1 234 ? -6.243  41.519  4.606   1.00 32.27 ? 234 ASP B O     1 
ATOM   4013 C  CB    . ASP B 1 234 ? -3.413  42.390  6.045   1.00 35.36 ? 234 ASP B CB    1 
ATOM   4014 C  CG    . ASP B 1 234 ? -2.664  42.581  7.314   1.00 46.17 ? 234 ASP B CG    1 
ATOM   4015 O  OD1   . ASP B 1 234 ? -3.114  42.064  8.359   1.00 67.63 ? 234 ASP B OD1   1 
ATOM   4016 O  OD2   . ASP B 1 234 ? -1.621  43.251  7.262   1.00 34.43 ? 234 ASP B OD2   1 
ATOM   4017 N  N     . SER B 1 235 ? -6.229  42.827  6.428   1.00 24.24 ? 235 SER B N     1 
ATOM   4018 C  CA    . SER B 1 235 ? -7.377  43.594  5.982   1.00 24.70 ? 235 SER B CA    1 
ATOM   4019 C  C     . SER B 1 235 ? -6.986  44.540  4.845   1.00 30.14 ? 235 SER B C     1 
ATOM   4020 O  O     . SER B 1 235 ? -7.855  45.112  4.185   1.00 31.60 ? 235 SER B O     1 
ATOM   4021 C  CB    . SER B 1 235 ? -7.977  44.398  7.138   1.00 33.47 ? 235 SER B CB    1 
ATOM   4022 O  OG    . SER B 1 235 ? -7.052  45.361  7.614   1.00 31.61 ? 235 SER B OG    1 
ATOM   4023 N  N     . GLU B 1 236 ? -5.683  44.703  4.610   1.00 27.02 ? 236 GLU B N     1 
ATOM   4024 C  CA    . GLU B 1 236 ? -5.210  45.671  3.617   1.00 27.42 ? 236 GLU B CA    1 
ATOM   4025 C  C     . GLU B 1 236 ? -4.244  45.072  2.603   1.00 24.19 ? 236 GLU B C     1 
ATOM   4026 O  O     . GLU B 1 236 ? -3.905  45.709  1.604   1.00 25.97 ? 236 GLU B O     1 
ATOM   4027 C  CB    . GLU B 1 236 ? -4.552  46.879  4.298   1.00 28.47 ? 236 GLU B CB    1 
ATOM   4028 C  CG    . GLU B 1 236 ? -5.514  47.747  5.093   1.00 30.81 ? 236 GLU B CG    1 
ATOM   4029 C  CD    . GLU B 1 236 ? -4.825  48.911  5.779   1.00 41.70 ? 236 GLU B CD    1 
ATOM   4030 O  OE1   . GLU B 1 236 ? -3.670  49.231  5.411   1.00 39.07 ? 236 GLU B OE1   1 
ATOM   4031 O  OE2   . GLU B 1 236 ? -5.443  49.506  6.688   1.00 39.00 ? 236 GLU B OE2   1 
ATOM   4032 N  N     . ASN B 1 237 ? -3.801  43.846  2.848   1.00 22.79 ? 237 ASN B N     1 
ATOM   4033 C  CA    . ASN B 1 237 ? -2.769  43.275  2.005   1.00 22.04 ? 237 ASN B CA    1 
ATOM   4034 C  C     . ASN B 1 237 ? -2.886  41.778  1.769   1.00 20.55 ? 237 ASN B C     1 
ATOM   4035 O  O     . ASN B 1 237 ? -3.392  41.034  2.609   1.00 26.63 ? 237 ASN B O     1 
ATOM   4036 C  CB    . ASN B 1 237 ? -1.395  43.566  2.597   1.00 22.45 ? 237 ASN B CB    1 
ATOM   4037 C  CG    . ASN B 1 237 ? -0.971  44.997  2.396   1.00 26.34 ? 237 ASN B CG    1 
ATOM   4038 O  OD1   . ASN B 1 237 ? -0.823  45.753  3.356   1.00 35.77 ? 237 ASN B OD1   1 
ATOM   4039 N  ND2   . ASN B 1 237 ? -0.769  45.381  1.141   1.00 30.56 ? 237 ASN B ND2   1 
ATOM   4040 N  N     . CYS B 1 238 ? -2.404  41.369  0.599   1.00 22.14 ? 238 CYS B N     1 
ATOM   4041 C  CA    A CYS B 1 238 ? -2.352  39.969  0.219   0.48 19.06 ? 238 CYS B CA    1 
ATOM   4042 C  CA    B CYS B 1 238 ? -2.359  39.963  0.192   0.52 23.74 ? 238 CYS B CA    1 
ATOM   4043 C  C     . CYS B 1 238 ? -1.005  39.725  -0.441  1.00 18.93 ? 238 CYS B C     1 
ATOM   4044 O  O     . CYS B 1 238 ? -0.728  40.246  -1.522  1.00 26.46 ? 238 CYS B O     1 
ATOM   4045 C  CB    A CYS B 1 238 ? -3.478  39.653  -0.761  0.48 25.80 ? 238 CYS B CB    1 
ATOM   4046 C  CB    B CYS B 1 238 ? -3.429  39.659  -0.862  0.52 24.63 ? 238 CYS B CB    1 
ATOM   4047 S  SG    A CYS B 1 238 ? -3.467  37.960  -1.331  0.48 29.27 ? 238 CYS B SG    1 
ATOM   4048 S  SG    B CYS B 1 238 ? -5.135  39.577  -0.284  0.52 29.87 ? 238 CYS B SG    1 
ATOM   4049 N  N     . ILE B 1 239 ? -0.149  38.951  0.210   1.00 20.76 ? 239 ILE B N     1 
ATOM   4050 C  CA    . ILE B 1 239 ? 1.179   38.749  -0.364  1.00 23.83 ? 239 ILE B CA    1 
ATOM   4051 C  C     . ILE B 1 239 ? 1.585   37.293  -0.438  1.00 25.98 ? 239 ILE B C     1 
ATOM   4052 O  O     . ILE B 1 239 ? 1.450   36.549  0.540   1.00 23.43 ? 239 ILE B O     1 
ATOM   4053 C  CB    . ILE B 1 239 ? 2.253   39.519  0.404   1.00 28.61 ? 239 ILE B CB    1 
ATOM   4054 C  CG1   . ILE B 1 239 ? 2.190   39.166  1.881   1.00 27.06 ? 239 ILE B CG1   1 
ATOM   4055 C  CG2   . ILE B 1 239 ? 2.072   41.030  0.229   1.00 35.44 ? 239 ILE B CG2   1 
ATOM   4056 C  CD1   . ILE B 1 239 ? 3.504   38.801  2.443   1.00 43.24 ? 239 ILE B CD1   1 
ATOM   4057 N  N     . GLN B 1 240 ? 2.085   36.876  -1.598  1.00 22.44 ? 240 GLN B N     1 
ATOM   4058 C  CA    . GLN B 1 240 ? 2.616   35.528  -1.681  1.00 17.72 ? 240 GLN B CA    1 
ATOM   4059 C  C     . GLN B 1 240 ? 4.133   35.569  -1.689  1.00 22.17 ? 240 GLN B C     1 
ATOM   4060 O  O     . GLN B 1 240 ? 4.757   36.406  -2.351  1.00 21.33 ? 240 GLN B O     1 
ATOM   4061 C  CB    . GLN B 1 240 ? 2.085   34.712  -2.873  1.00 30.02 ? 240 GLN B CB    1 
ATOM   4062 C  CG    . GLN B 1 240 ? 2.567   33.237  -2.793  1.00 34.49 ? 240 GLN B CG    1 
ATOM   4063 C  CD    . GLN B 1 240 ? 1.936   32.303  -3.818  1.00 44.24 ? 240 GLN B CD    1 
ATOM   4064 O  OE1   . GLN B 1 240 ? 0.995   32.671  -4.522  1.00 44.42 ? 240 GLN B OE1   1 
ATOM   4065 N  NE2   . GLN B 1 240 ? 2.458   31.074  -3.898  1.00 31.91 ? 240 GLN B NE2   1 
ATOM   4066 N  N     . VAL B 1 241 ? 4.713   34.669  -0.915  1.00 17.37 ? 241 VAL B N     1 
ATOM   4067 C  CA    . VAL B 1 241 ? 6.156   34.540  -0.842  1.00 17.61 ? 241 VAL B CA    1 
ATOM   4068 C  C     . VAL B 1 241 ? 6.510   33.110  -1.211  1.00 21.66 ? 241 VAL B C     1 
ATOM   4069 O  O     . VAL B 1 241 ? 5.973   32.168  -0.634  1.00 20.92 ? 241 VAL B O     1 
ATOM   4070 C  CB    . VAL B 1 241 ? 6.671   34.842  0.562   1.00 19.79 ? 241 VAL B CB    1 
ATOM   4071 C  CG1   . VAL B 1 241 ? 8.194   34.598  0.618   1.00 19.94 ? 241 VAL B CG1   1 
ATOM   4072 C  CG2   . VAL B 1 241 ? 6.336   36.283  0.945   1.00 20.48 ? 241 VAL B CG2   1 
ATOM   4073 N  N     . VAL B 1 242 ? 7.404   32.949  -2.182  1.00 16.74 ? 242 VAL B N     1 
ATOM   4074 C  CA    . VAL B 1 242 ? 7.795   31.623  -2.651  1.00 21.17 ? 242 VAL B CA    1 
ATOM   4075 C  C     . VAL B 1 242 ? 9.242   31.397  -2.230  1.00 19.15 ? 242 VAL B C     1 
ATOM   4076 O  O     . VAL B 1 242 ? 10.060  32.302  -2.355  1.00 19.26 ? 242 VAL B O     1 
ATOM   4077 C  CB    . VAL B 1 242 ? 7.669   31.548  -4.183  1.00 22.94 ? 242 VAL B CB    1 
ATOM   4078 C  CG1   . VAL B 1 242 ? 7.947   30.145  -4.706  1.00 19.11 ? 242 VAL B CG1   1 
ATOM   4079 C  CG2   . VAL B 1 242 ? 6.283   32.000  -4.589  1.00 31.54 ? 242 VAL B CG2   1 
ATOM   4080 N  N     . PRO B 1 243 ? 9.553   30.198  -1.701  1.00 19.21 ? 243 PRO B N     1 
ATOM   4081 C  CA    . PRO B 1 243 ? 10.911  29.882  -1.245  1.00 16.30 ? 243 PRO B CA    1 
ATOM   4082 C  C     . PRO B 1 243 ? 11.858  29.811  -2.429  1.00 18.73 ? 243 PRO B C     1 
ATOM   4083 O  O     . PRO B 1 243 ? 11.423  29.668  -3.569  1.00 19.02 ? 243 PRO B O     1 
ATOM   4084 C  CB    . PRO B 1 243 ? 10.764  28.472  -0.648  1.00 18.07 ? 243 PRO B CB    1 
ATOM   4085 C  CG    . PRO B 1 243 ? 9.287   28.244  -0.489  1.00 22.30 ? 243 PRO B CG    1 
ATOM   4086 C  CD    . PRO B 1 243 ? 8.652   29.042  -1.571  1.00 21.20 ? 243 PRO B CD    1 
ATOM   4087 N  N     . PRO B 1 244 ? 13.163  29.889  -2.161  1.00 20.31 ? 244 PRO B N     1 
ATOM   4088 C  CA    . PRO B 1 244 ? 14.147  29.726  -3.232  1.00 22.01 ? 244 PRO B CA    1 
ATOM   4089 C  C     . PRO B 1 244 ? 14.148  28.285  -3.753  1.00 22.16 ? 244 PRO B C     1 
ATOM   4090 O  O     . PRO B 1 244 ? 13.737  27.367  -3.038  1.00 24.23 ? 244 PRO B O     1 
ATOM   4091 C  CB    . PRO B 1 244 ? 15.472  30.050  -2.535  1.00 26.62 ? 244 PRO B CB    1 
ATOM   4092 C  CG    . PRO B 1 244 ? 15.230  29.772  -1.094  1.00 23.99 ? 244 PRO B CG    1 
ATOM   4093 C  CD    . PRO B 1 244 ? 13.788  30.101  -0.844  1.00 25.14 ? 244 PRO B CD    1 
ATOM   4094 N  N     . PRO B 1 245 ? 14.612  28.090  -4.995  1.00 18.70 ? 245 PRO B N     1 
ATOM   4095 C  CA    . PRO B 1 245 ? 14.607  26.776  -5.640  1.00 23.99 ? 245 PRO B CA    1 
ATOM   4096 C  C     . PRO B 1 245 ? 15.770  25.921  -5.159  1.00 23.08 ? 245 PRO B C     1 
ATOM   4097 O  O     . PRO B 1 245 ? 16.738  25.695  -5.889  1.00 27.21 ? 245 PRO B O     1 
ATOM   4098 C  CB    . PRO B 1 245 ? 14.751  27.120  -7.119  1.00 25.46 ? 245 PRO B CB    1 
ATOM   4099 C  CG    . PRO B 1 245 ? 15.490  28.407  -7.136  1.00 25.51 ? 245 PRO B CG    1 
ATOM   4100 C  CD    . PRO B 1 245 ? 15.083  29.152  -5.904  1.00 20.39 ? 245 PRO B CD    1 
ATOM   4101 N  N     . VAL B 1 246 ? 15.657  25.468  -3.918  1.00 26.54 ? 246 VAL B N     1 
ATOM   4102 C  CA    . VAL B 1 246 ? 16.627  24.575  -3.314  1.00 28.86 ? 246 VAL B CA    1 
ATOM   4103 C  C     . VAL B 1 246 ? 15.866  23.339  -2.860  1.00 30.89 ? 246 VAL B C     1 
ATOM   4104 O  O     . VAL B 1 246 ? 14.736  23.442  -2.375  1.00 31.15 ? 246 VAL B O     1 
ATOM   4105 C  CB    . VAL B 1 246 ? 17.336  25.249  -2.132  1.00 19.92 ? 246 VAL B CB    1 
ATOM   4106 C  CG1   . VAL B 1 246 ? 18.324  24.279  -1.473  1.00 29.49 ? 246 VAL B CG1   1 
ATOM   4107 C  CG2   . VAL B 1 246 ? 18.045  26.520  -2.612  1.00 26.94 ? 246 VAL B CG2   1 
ATOM   4108 N  N     . LYS B 1 247 ? 16.472  22.173  -3.053  1.00 34.53 ? 247 LYS B N     1 
ATOM   4109 C  CA    . LYS B 1 247 ? 15.804  20.911  -2.776  1.00 36.58 ? 247 LYS B CA    1 
ATOM   4110 C  C     . LYS B 1 247 ? 15.537  20.714  -1.288  1.00 31.08 ? 247 LYS B C     1 
ATOM   4111 O  O     . LYS B 1 247 ? 16.383  21.015  -0.441  1.00 29.09 ? 247 LYS B O     1 
ATOM   4112 C  CB    . LYS B 1 247 ? 16.635  19.740  -3.312  1.00 36.59 ? 247 LYS B CB    1 
ATOM   4113 C  CG    . LYS B 1 247 ? 15.975  18.375  -3.151  1.00 46.52 ? 247 LYS B CG    1 
ATOM   4114 C  CD    . LYS B 1 247 ? 16.910  17.248  -3.566  1.00 61.09 ? 247 LYS B CD    1 
ATOM   4115 C  CE    . LYS B 1 247 ? 18.195  17.275  -2.754  1.00 68.70 ? 247 LYS B CE    1 
ATOM   4116 N  NZ    . LYS B 1 247 ? 18.655  15.905  -2.389  1.00 73.78 ? 247 LYS B NZ    1 
ATOM   4117 N  N     . SER B 1 248 ? 14.351  20.204  -0.976  1.00 24.82 ? 248 SER B N     1 
ATOM   4118 C  CA    . SER B 1 248 ? 14.010  19.859  0.398   1.00 22.50 ? 248 SER B CA    1 
ATOM   4119 C  C     . SER B 1 248 ? 14.597  18.486  0.729   1.00 26.61 ? 248 SER B C     1 
ATOM   4120 O  O     . SER B 1 248 ? 14.527  17.567  -0.085  1.00 31.82 ? 248 SER B O     1 
ATOM   4121 C  CB    . SER B 1 248 ? 12.489  19.840  0.570   1.00 25.45 ? 248 SER B CB    1 
ATOM   4122 O  OG    . SER B 1 248 ? 12.124  19.241  1.801   1.00 31.60 ? 248 SER B OG    1 
ATOM   4123 N  N     . GLN B 1 249 ? 15.205  18.357  1.905   1.00 26.32 ? 249 GLN B N     1 
ATOM   4124 C  CA    . GLN B 1 249 ? 15.769  17.081  2.338   1.00 27.09 ? 249 GLN B CA    1 
ATOM   4125 C  C     . GLN B 1 249 ? 14.740  16.347  3.187   1.00 26.17 ? 249 GLN B C     1 
ATOM   4126 O  O     . GLN B 1 249 ? 14.602  15.125  3.112   1.00 29.73 ? 249 GLN B O     1 
ATOM   4127 C  CB    . GLN B 1 249 ? 17.042  17.312  3.150   1.00 33.09 ? 249 GLN B CB    1 
ATOM   4128 C  CG    . GLN B 1 249 ? 18.142  18.030  2.384   1.00 38.35 ? 249 GLN B CG    1 
ATOM   4129 C  CD    . GLN B 1 249 ? 18.752  17.169  1.293   1.00 43.13 ? 249 GLN B CD    1 
ATOM   4130 O  OE1   . GLN B 1 249 ? 18.731  15.937  1.372   1.00 40.79 ? 249 GLN B OE1   1 
ATOM   4131 N  NE2   . GLN B 1 249 ? 19.301  17.813  0.269   1.00 40.70 ? 249 GLN B NE2   1 
ATOM   4132 N  N     . SER B 1 250 ? 14.036  17.111  4.016   1.00 24.95 ? 250 SER B N     1 
ATOM   4133 C  CA    . SER B 1 250 ? 13.008  16.578  4.903   1.00 22.07 ? 250 SER B CA    1 
ATOM   4134 C  C     . SER B 1 250 ? 12.088  17.700  5.369   1.00 28.98 ? 250 SER B C     1 
ATOM   4135 O  O     . SER B 1 250 ? 12.549  18.701  5.908   1.00 26.45 ? 250 SER B O     1 
ATOM   4136 C  CB    . SER B 1 250 ? 13.639  15.895  6.115   1.00 29.63 ? 250 SER B CB    1 
ATOM   4137 O  OG    . SER B 1 250 ? 12.690  15.732  7.152   1.00 24.66 ? 250 SER B OG    1 
ATOM   4138 N  N     . THR B 1 251 ? 10.789  17.523  5.163   1.00 20.15 ? 251 THR B N     1 
ATOM   4139 C  CA    . THR B 1 251 ? 9.818   18.566  5.472   1.00 21.27 ? 251 THR B CA    1 
ATOM   4140 C  C     . THR B 1 251 ? 9.352   18.599  6.928   1.00 22.86 ? 251 THR B C     1 
ATOM   4141 O  O     . THR B 1 251 ? 8.624   19.504  7.320   1.00 20.83 ? 251 THR B O     1 
ATOM   4142 C  CB    . THR B 1 251 ? 8.582   18.470  4.557   1.00 25.61 ? 251 THR B CB    1 
ATOM   4143 O  OG1   . THR B 1 251 ? 7.977   17.180  4.702   1.00 28.67 ? 251 THR B OG1   1 
ATOM   4144 C  CG2   . THR B 1 251 ? 8.977   18.675  3.109   1.00 28.99 ? 251 THR B CG2   1 
ATOM   4145 N  N     . VAL B 1 252 ? 9.761   17.619  7.727   1.00 18.94 ? 252 VAL B N     1 
ATOM   4146 C  CA    . VAL B 1 252 ? 9.315   17.562  9.129   1.00 17.93 ? 252 VAL B CA    1 
ATOM   4147 C  C     . VAL B 1 252 ? 9.609   18.860  9.895   1.00 23.36 ? 252 VAL B C     1 
ATOM   4148 O  O     . VAL B 1 252 ? 10.680  19.355  9.832   1.00 25.87 ? 252 VAL B O     1 
ATOM   4149 C  CB    . VAL B 1 252 ? 10.005  16.402  9.871   1.00 20.48 ? 252 VAL B CB    1 
ATOM   4150 C  CG1   . VAL B 1 252 ? 9.650   16.433  11.355  1.00 22.41 ? 252 VAL B CG1   1 
ATOM   4151 C  CG2   . VAL B 1 252 ? 9.620   15.071  9.242   1.00 23.27 ? 252 VAL B CG2   1 
ATOM   4152 N  N     . GLY B 1 253 ? 8.676   19.451  10.615  1.00 19.86 ? 253 GLY B N     1 
ATOM   4153 C  CA    . GLY B 1 253 ? 9.056   20.631  11.373  1.00 23.51 ? 253 GLY B CA    1 
ATOM   4154 C  C     . GLY B 1 253 ? 9.018   21.949  10.610  1.00 19.87 ? 253 GLY B C     1 
ATOM   4155 O  O     . GLY B 1 253 ? 9.334   22.992  11.171  1.00 17.28 ? 253 GLY B O     1 
ATOM   4156 N  N     . ALA B 1 254 ? 8.634   21.916  9.339   1.00 16.99 ? 254 ALA B N     1 
ATOM   4157 C  CA    . ALA B 1 254 ? 8.544   23.159  8.573   1.00 17.19 ? 254 ALA B CA    1 
ATOM   4158 C  C     . ALA B 1 254 ? 7.461   24.078  9.123   1.00 17.32 ? 254 ALA B C     1 
ATOM   4159 O  O     . ALA B 1 254 ? 7.674   25.283  9.246   1.00 14.49 ? 254 ALA B O     1 
ATOM   4160 C  CB    . ALA B 1 254 ? 8.288   22.879  7.118   1.00 19.33 ? 254 ALA B CB    1 
ATOM   4161 N  N     . GLY B 1 255 ? 6.299   23.515  9.445   1.00 17.68 ? 255 GLY B N     1 
ATOM   4162 C  CA    . GLY B 1 255 ? 5.198   24.317  9.951   1.00 15.01 ? 255 GLY B CA    1 
ATOM   4163 C  C     . GLY B 1 255 ? 5.521   25.026  11.260  1.00 19.20 ? 255 GLY B C     1 
ATOM   4164 O  O     . GLY B 1 255 ? 5.285   26.234  11.407  1.00 16.76 ? 255 GLY B O     1 
ATOM   4165 N  N     . ASP B 1 256 ? 6.063   24.286  12.222  1.00 16.45 ? 256 ASP B N     1 
ATOM   4166 C  CA    . ASP B 1 256 ? 6.405   24.880  13.515  1.00 18.19 ? 256 ASP B CA    1 
ATOM   4167 C  C     . ASP B 1 256 ? 7.514   25.918  13.395  1.00 16.72 ? 256 ASP B C     1 
ATOM   4168 O  O     . ASP B 1 256 ? 7.494   26.938  14.087  1.00 18.42 ? 256 ASP B O     1 
ATOM   4169 C  CB    . ASP B 1 256 ? 6.800   23.805  14.528  1.00 19.94 ? 256 ASP B CB    1 
ATOM   4170 C  CG    . ASP B 1 256 ? 5.667   22.842  14.818  1.00 28.82 ? 256 ASP B CG    1 
ATOM   4171 O  OD1   . ASP B 1 256 ? 5.939   21.653  15.091  1.00 25.64 ? 256 ASP B OD1   1 
ATOM   4172 O  OD2   . ASP B 1 256 ? 4.503   23.270  14.759  1.00 25.33 ? 256 ASP B OD2   1 
ATOM   4173 N  N     . SER B 1 257 ? 8.480   25.657  12.517  1.00 17.45 ? 257 SER B N     1 
ATOM   4174 C  CA    . SER B 1 257 ? 9.553   26.621  12.276  1.00 17.47 ? 257 SER B CA    1 
ATOM   4175 C  C     . SER B 1 257 ? 8.990   27.931  11.730  1.00 18.64 ? 257 SER B C     1 
ATOM   4176 O  O     . SER B 1 257 ? 9.345   29.003  12.199  1.00 18.29 ? 257 SER B O     1 
ATOM   4177 C  CB    . SER B 1 257 ? 10.587  26.052  11.310  1.00 18.52 ? 257 SER B CB    1 
ATOM   4178 O  OG    . SER B 1 257 ? 11.280  24.966  11.908  1.00 19.27 ? 257 SER B OG    1 
ATOM   4179 N  N     . MET B 1 258 ? 8.118   27.833  10.730  1.00 17.69 ? 258 MET B N     1 
ATOM   4180 C  CA    . MET B 1 258 ? 7.456   29.012  10.181  1.00 17.09 ? 258 MET B CA    1 
ATOM   4181 C  C     . MET B 1 258 ? 6.674   29.781  11.249  1.00 18.60 ? 258 MET B C     1 
ATOM   4182 O  O     . MET B 1 258 ? 6.773   31.003  11.344  1.00 17.30 ? 258 MET B O     1 
ATOM   4183 C  CB    . MET B 1 258 ? 6.531   28.622  9.025   1.00 14.57 ? 258 MET B CB    1 
ATOM   4184 C  CG    . MET B 1 258 ? 5.528   29.713  8.680   1.00 13.22 ? 258 MET B CG    1 
ATOM   4185 S  SD    . MET B 1 258 ? 4.635   29.309  7.177   1.00 19.05 ? 258 MET B SD    1 
ATOM   4186 C  CE    . MET B 1 258 ? 5.683   30.030  5.926   1.00 19.69 ? 258 MET B CE    1 
ATOM   4187 N  N     . VAL B 1 259 ? 5.916   29.066  12.070  1.00 16.77 ? 259 VAL B N     1 
ATOM   4188 C  CA    . VAL B 1 259 ? 5.137   29.729  13.114  1.00 18.17 ? 259 VAL B CA    1 
ATOM   4189 C  C     . VAL B 1 259 ? 6.018   30.448  14.142  1.00 18.49 ? 259 VAL B C     1 
ATOM   4190 O  O     . VAL B 1 259 ? 5.718   31.577  14.534  1.00 18.81 ? 259 VAL B O     1 
ATOM   4191 C  CB    . VAL B 1 259 ? 4.139   28.762  13.786  1.00 16.50 ? 259 VAL B CB    1 
ATOM   4192 C  CG1   . VAL B 1 259 ? 3.549   29.383  15.052  1.00 19.04 ? 259 VAL B CG1   1 
ATOM   4193 C  CG2   . VAL B 1 259 ? 3.031   28.409  12.805  1.00 17.39 ? 259 VAL B CG2   1 
ATOM   4194 N  N     . GLY B 1 260 ? 7.106   29.809  14.565  1.00 18.42 ? 260 GLY B N     1 
ATOM   4195 C  CA    . GLY B 1 260 ? 8.021   30.448  15.501  1.00 19.03 ? 260 GLY B CA    1 
ATOM   4196 C  C     . GLY B 1 260 ? 8.610   31.723  14.918  1.00 19.24 ? 260 GLY B C     1 
ATOM   4197 O  O     . GLY B 1 260 ? 8.702   32.755  15.591  1.00 18.57 ? 260 GLY B O     1 
ATOM   4198 N  N     . ALA B 1 261 ? 9.014   31.645  13.652  1.00 18.23 ? 261 ALA B N     1 
ATOM   4199 C  CA    . ALA B 1 261 ? 9.554   32.801  12.937  1.00 15.69 ? 261 ALA B CA    1 
ATOM   4200 C  C     . ALA B 1 261 ? 8.534   33.938  12.840  1.00 18.38 ? 261 ALA B C     1 
ATOM   4201 O  O     . ALA B 1 261 ? 8.850   35.107  13.101  1.00 20.59 ? 261 ALA B O     1 
ATOM   4202 C  CB    . ALA B 1 261 ? 10.006  32.382  11.551  1.00 14.86 ? 261 ALA B CB    1 
ATOM   4203 N  N     . MET B 1 262 ? 7.309   33.606  12.447  1.00 17.75 ? 262 MET B N     1 
ATOM   4204 C  CA    . MET B 1 262 ? 6.287   34.639  12.312  1.00 18.14 ? 262 MET B CA    1 
ATOM   4205 C  C     . MET B 1 262 ? 5.915   35.260  13.652  1.00 18.86 ? 262 MET B C     1 
ATOM   4206 O  O     . MET B 1 262 ? 5.665   36.466  13.731  1.00 21.87 ? 262 MET B O     1 
ATOM   4207 C  CB    . MET B 1 262 ? 5.061   34.130  11.560  1.00 15.24 ? 262 MET B CB    1 
ATOM   4208 C  CG    . MET B 1 262 ? 5.403   33.753  10.132  1.00 16.35 ? 262 MET B CG    1 
ATOM   4209 S  SD    . MET B 1 262 ? 3.976   33.518  9.059   1.00 21.56 ? 262 MET B SD    1 
ATOM   4210 C  CE    . MET B 1 262 ? 3.070   32.224  9.920   1.00 24.20 ? 262 MET B CE    1 
ATOM   4211 N  N     . THR B 1 263 ? 5.916   34.438  14.698  1.00 20.80 ? 263 THR B N     1 
ATOM   4212 C  CA    . THR B 1 263 ? 5.650   34.902  16.056  1.00 21.11 ? 263 THR B CA    1 
ATOM   4213 C  C     . THR B 1 263 ? 6.665   35.954  16.485  1.00 21.86 ? 263 THR B C     1 
ATOM   4214 O  O     . THR B 1 263 ? 6.299   36.976  17.066  1.00 21.93 ? 263 THR B O     1 
ATOM   4215 C  CB    . THR B 1 263 ? 5.681   33.727  17.059  1.00 22.43 ? 263 THR B CB    1 
ATOM   4216 O  OG1   . THR B 1 263 ? 4.665   32.776  16.712  1.00 20.53 ? 263 THR B OG1   1 
ATOM   4217 C  CG2   . THR B 1 263 ? 5.449   34.225  18.482  1.00 20.09 ? 263 THR B CG2   1 
ATOM   4218 N  N     . LEU B 1 264 ? 7.941   35.700  16.198  1.00 22.39 ? 264 LEU B N     1 
ATOM   4219 C  CA    . LEU B 1 264 ? 9.001   36.660  16.509  1.00 21.13 ? 264 LEU B CA    1 
ATOM   4220 C  C     . LEU B 1 264 ? 8.796   37.968  15.751  1.00 30.64 ? 264 LEU B C     1 
ATOM   4221 O  O     . LEU B 1 264 ? 9.010   39.050  16.302  1.00 27.17 ? 264 LEU B O     1 
ATOM   4222 C  CB    . LEU B 1 264 ? 10.377  36.074  16.181  1.00 23.73 ? 264 LEU B CB    1 
ATOM   4223 C  CG    . LEU B 1 264 ? 10.949  35.050  17.167  1.00 26.65 ? 264 LEU B CG    1 
ATOM   4224 C  CD1   . LEU B 1 264 ? 12.171  34.355  16.583  1.00 24.91 ? 264 LEU B CD1   1 
ATOM   4225 C  CD2   . LEU B 1 264 ? 11.308  35.706  18.501  1.00 29.87 ? 264 LEU B CD2   1 
ATOM   4226 N  N     . LYS B 1 265 ? 8.373   37.877  14.491  1.00 23.82 ? 265 LYS B N     1 
ATOM   4227 C  CA    . LYS B 1 265 ? 8.136   39.094  13.710  1.00 23.65 ? 265 LYS B CA    1 
ATOM   4228 C  C     . LYS B 1 265 ? 6.904   39.821  14.218  1.00 24.91 ? 265 LYS B C     1 
ATOM   4229 O  O     . LYS B 1 265 ? 6.857   41.055  14.230  1.00 25.86 ? 265 LYS B O     1 
ATOM   4230 C  CB    . LYS B 1 265 ? 8.020   38.792  12.213  1.00 25.21 ? 265 LYS B CB    1 
ATOM   4231 C  CG    . LYS B 1 265 ? 9.363   38.477  11.543  1.00 22.99 ? 265 LYS B CG    1 
ATOM   4232 C  CD    . LYS B 1 265 ? 10.277  39.699  11.541  1.00 28.39 ? 265 LYS B CD    1 
ATOM   4233 C  CE    . LYS B 1 265 ? 11.642  39.352  10.951  1.00 28.46 ? 265 LYS B CE    1 
ATOM   4234 N  NZ    . LYS B 1 265 ? 12.527  40.550  10.811  1.00 35.07 ? 265 LYS B NZ    1 
ATOM   4235 N  N     . LEU B 1 266 ? 5.909   39.060  14.657  1.00 24.11 ? 266 LEU B N     1 
ATOM   4236 C  CA    . LEU B 1 266 ? 4.728   39.666  15.262  1.00 23.99 ? 266 LEU B CA    1 
ATOM   4237 C  C     . LEU B 1 266 ? 5.121   40.407  16.541  1.00 32.71 ? 266 LEU B C     1 
ATOM   4238 O  O     . LEU B 1 266 ? 4.617   41.498  16.822  1.00 31.92 ? 266 LEU B O     1 
ATOM   4239 C  CB    . LEU B 1 266 ? 3.657   38.600  15.529  1.00 26.18 ? 266 LEU B CB    1 
ATOM   4240 C  CG    . LEU B 1 266 ? 2.227   39.080  15.804  1.00 39.53 ? 266 LEU B CG    1 
ATOM   4241 C  CD1   . LEU B 1 266 ? 1.993   39.294  17.284  1.00 44.11 ? 266 LEU B CD1   1 
ATOM   4242 C  CD2   . LEU B 1 266 ? 1.908   40.352  15.030  1.00 39.98 ? 266 LEU B CD2   1 
ATOM   4243 N  N     . ALA B 1 267 ? 6.048   39.830  17.301  1.00 29.70 ? 267 ALA B N     1 
ATOM   4244 C  CA    . ALA B 1 267 ? 6.530   40.461  18.530  1.00 29.94 ? 267 ALA B CA    1 
ATOM   4245 C  C     . ALA B 1 267 ? 7.285   41.761  18.252  1.00 25.59 ? 267 ALA B C     1 
ATOM   4246 O  O     . ALA B 1 267 ? 7.322   42.668  19.092  1.00 34.24 ? 267 ALA B O     1 
ATOM   4247 C  CB    . ALA B 1 267 ? 7.401   39.488  19.315  1.00 29.12 ? 267 ALA B CB    1 
ATOM   4248 N  N     . GLU B 1 268 ? 7.876   41.848  17.065  1.00 27.48 ? 268 GLU B N     1 
ATOM   4249 C  CA    . GLU B 1 268 ? 8.646   43.019  16.661  1.00 30.64 ? 268 GLU B CA    1 
ATOM   4250 C  C     . GLU B 1 268 ? 7.773   44.032  15.932  1.00 33.45 ? 268 GLU B C     1 
ATOM   4251 O  O     . GLU B 1 268 ? 8.266   45.055  15.456  1.00 36.81 ? 268 GLU B O     1 
ATOM   4252 C  CB    . GLU B 1 268 ? 9.798   42.597  15.749  1.00 30.78 ? 268 GLU B CB    1 
ATOM   4253 C  CG    . GLU B 1 268 ? 10.811  41.679  16.407  1.00 40.62 ? 268 GLU B CG    1 
ATOM   4254 C  CD    . GLU B 1 268 ? 11.764  41.049  15.406  1.00 51.25 ? 268 GLU B CD    1 
ATOM   4255 O  OE1   . GLU B 1 268 ? 12.474  40.092  15.781  1.00 62.98 ? 268 GLU B OE1   1 
ATOM   4256 O  OE2   . GLU B 1 268 ? 11.801  41.508  14.244  1.00 47.84 ? 268 GLU B OE2   1 
ATOM   4257 N  N     . ASN B 1 269 ? 6.479   43.732  15.847  1.00 35.74 ? 269 ASN B N     1 
ATOM   4258 C  CA    . ASN B 1 269 ? 5.527   44.551  15.100  1.00 33.91 ? 269 ASN B CA    1 
ATOM   4259 C  C     . ASN B 1 269 ? 5.939   44.757  13.648  1.00 37.45 ? 269 ASN B C     1 
ATOM   4260 O  O     . ASN B 1 269 ? 5.783   45.845  13.097  1.00 37.24 ? 269 ASN B O     1 
ATOM   4261 C  CB    . ASN B 1 269 ? 5.306   45.904  15.781  1.00 42.90 ? 269 ASN B CB    1 
ATOM   4262 C  CG    . ASN B 1 269 ? 3.921   46.037  16.365  1.00 66.06 ? 269 ASN B CG    1 
ATOM   4263 O  OD1   . ASN B 1 269 ? 2.937   46.154  15.633  1.00 75.24 ? 269 ASN B OD1   1 
ATOM   4264 N  ND2   . ASN B 1 269 ? 3.832   46.024  17.691  1.00 74.40 ? 269 ASN B ND2   1 
ATOM   4265 N  N     . ALA B 1 270 ? 6.461   43.700  13.034  1.00 32.11 ? 270 ALA B N     1 
ATOM   4266 C  CA    . ALA B 1 270 ? 6.904   43.767  11.650  1.00 26.23 ? 270 ALA B CA    1 
ATOM   4267 C  C     . ALA B 1 270 ? 5.712   43.896  10.700  1.00 26.44 ? 270 ALA B C     1 
ATOM   4268 O  O     . ALA B 1 270 ? 4.564   43.670  11.090  1.00 26.48 ? 270 ALA B O     1 
ATOM   4269 C  CB    . ALA B 1 270 ? 7.735   42.542  11.305  1.00 25.12 ? 270 ALA B CB    1 
ATOM   4270 N  N     . SER B 1 271 ? 5.994   44.269  9.455   1.00 30.22 ? 271 SER B N     1 
ATOM   4271 C  CA    . SER B 1 271 ? 4.966   44.369  8.425   1.00 31.29 ? 271 SER B CA    1 
ATOM   4272 C  C     . SER B 1 271 ? 4.515   42.966  8.052   1.00 26.00 ? 271 SER B C     1 
ATOM   4273 O  O     . SER B 1 271 ? 5.194   41.981  8.368   1.00 26.55 ? 271 SER B O     1 
ATOM   4274 C  CB    . SER B 1 271 ? 5.532   45.041  7.179   1.00 26.62 ? 271 SER B CB    1 
ATOM   4275 O  OG    . SER B 1 271 ? 6.496   44.199  6.564   1.00 29.19 ? 271 SER B OG    1 
ATOM   4276 N  N     . LEU B 1 272 ? 3.376   42.867  7.373   1.00 23.06 ? 272 LEU B N     1 
ATOM   4277 C  CA    . LEU B 1 272 ? 2.890   41.556  6.940   1.00 21.01 ? 272 LEU B CA    1 
ATOM   4278 C  C     . LEU B 1 272 ? 3.897   40.890  6.009   1.00 24.30 ? 272 LEU B C     1 
ATOM   4279 O  O     . LEU B 1 272 ? 4.198   39.704  6.151   1.00 21.40 ? 272 LEU B O     1 
ATOM   4280 C  CB    . LEU B 1 272 ? 1.528   41.678  6.251   1.00 26.53 ? 272 LEU B CB    1 
ATOM   4281 C  CG    . LEU B 1 272 ? 0.907   40.347  5.817   1.00 26.49 ? 272 LEU B CG    1 
ATOM   4282 C  CD1   . LEU B 1 272 ? 0.551   39.501  7.025   1.00 28.50 ? 272 LEU B CD1   1 
ATOM   4283 C  CD2   . LEU B 1 272 ? -0.318  40.592  4.939   1.00 25.94 ? 272 LEU B CD2   1 
ATOM   4284 N  N     . GLU B 1 273 ? 4.437   41.662  5.073   1.00 21.69 ? 273 GLU B N     1 
ATOM   4285 C  CA    . GLU B 1 273 ? 5.439   41.138  4.145   1.00 20.31 ? 273 GLU B CA    1 
ATOM   4286 C  C     . GLU B 1 273 ? 6.691   40.606  4.849   1.00 23.32 ? 273 GLU B C     1 
ATOM   4287 O  O     . GLU B 1 273 ? 7.191   39.515  4.520   1.00 25.08 ? 273 GLU B O     1 
ATOM   4288 C  CB    . GLU B 1 273 ? 5.812   42.200  3.116   1.00 27.21 ? 273 GLU B CB    1 
ATOM   4289 C  CG    . GLU B 1 273 ? 6.672   41.671  1.992   1.00 38.72 ? 273 GLU B CG    1 
ATOM   4290 C  CD    . GLU B 1 273 ? 6.869   42.702  0.909   1.00 42.83 ? 273 GLU B CD    1 
ATOM   4291 O  OE1   . GLU B 1 273 ? 7.568   43.700  1.173   1.00 40.93 ? 273 GLU B OE1   1 
ATOM   4292 O  OE2   . GLU B 1 273 ? 6.308   42.523  -0.194  1.00 49.27 ? 273 GLU B OE2   1 
ATOM   4293 N  N     . GLU B 1 274 ? 7.195   41.362  5.820   1.00 21.79 ? 274 GLU B N     1 
ATOM   4294 C  CA    . GLU B 1 274 ? 8.370   40.931  6.576   1.00 23.40 ? 274 GLU B CA    1 
ATOM   4295 C  C     . GLU B 1 274 ? 8.062   39.650  7.359   1.00 24.00 ? 274 GLU B C     1 
ATOM   4296 O  O     . GLU B 1 274 ? 8.847   38.696  7.356   1.00 22.36 ? 274 GLU B O     1 
ATOM   4297 C  CB    . GLU B 1 274 ? 8.848   42.042  7.516   1.00 26.91 ? 274 GLU B CB    1 
ATOM   4298 C  CG    . GLU B 1 274 ? 10.038  41.647  8.367   1.00 45.82 ? 274 GLU B CG    1 
ATOM   4299 C  CD    . GLU B 1 274 ? 10.765  42.843  8.945   1.00 50.32 ? 274 GLU B CD    1 
ATOM   4300 O  OE1   . GLU B 1 274 ? 10.544  43.970  8.442   1.00 42.01 ? 274 GLU B OE1   1 
ATOM   4301 O  OE2   . GLU B 1 274 ? 11.554  42.652  9.897   1.00 48.70 ? 274 GLU B OE2   1 
ATOM   4302 N  N     . MET B 1 275 ? 6.899   39.627  8.005   1.00 22.25 ? 275 MET B N     1 
ATOM   4303 C  CA    . MET B 1 275 ? 6.450   38.460  8.759   1.00 20.10 ? 275 MET B CA    1 
ATOM   4304 C  C     . MET B 1 275 ? 6.368   37.205  7.890   1.00 20.29 ? 275 MET B C     1 
ATOM   4305 O  O     . MET B 1 275 ? 6.880   36.142  8.259   1.00 20.18 ? 275 MET B O     1 
ATOM   4306 C  CB    . MET B 1 275 ? 5.077   38.737  9.382   1.00 24.16 ? 275 MET B CB    1 
ATOM   4307 C  CG    . MET B 1 275 ? 4.555   37.593  10.235  1.00 23.34 ? 275 MET B CG    1 
ATOM   4308 S  SD    . MET B 1 275 ? 2.914   37.918  10.902  1.00 27.42 ? 275 MET B SD    1 
ATOM   4309 C  CE    . MET B 1 275 ? 3.211   39.486  11.713  1.00 30.20 ? 275 MET B CE    1 
ATOM   4310 N  N     . VAL B 1 276 ? 5.720   37.317  6.734   1.00 19.03 ? 276 VAL B N     1 
ATOM   4311 C  CA    . VAL B 1 276 ? 5.564   36.145  5.876   1.00 17.08 ? 276 VAL B CA    1 
ATOM   4312 C  C     . VAL B 1 276 ? 6.894   35.698  5.282   1.00 19.63 ? 276 VAL B C     1 
ATOM   4313 O  O     . VAL B 1 276 ? 7.175   34.498  5.186   1.00 19.27 ? 276 VAL B O     1 
ATOM   4314 C  CB    . VAL B 1 276 ? 4.522   36.374  4.769   1.00 19.43 ? 276 VAL B CB    1 
ATOM   4315 C  CG1   . VAL B 1 276 ? 4.415   35.139  3.868   1.00 18.37 ? 276 VAL B CG1   1 
ATOM   4316 C  CG2   . VAL B 1 276 ? 3.163   36.712  5.392   1.00 24.61 ? 276 VAL B CG2   1 
ATOM   4317 N  N     . ARG B 1 277 ? 7.720   36.661  4.896   1.00 17.41 ? 277 ARG B N     1 
ATOM   4318 C  CA    . ARG B 1 277 ? 9.032   36.332  4.356   1.00 18.74 ? 277 ARG B CA    1 
ATOM   4319 C  C     . ARG B 1 277 ? 9.884   35.604  5.394   1.00 23.18 ? 277 ARG B C     1 
ATOM   4320 O  O     . ARG B 1 277 ? 10.555  34.622  5.079   1.00 17.99 ? 277 ARG B O     1 
ATOM   4321 C  CB    . ARG B 1 277 ? 9.734   37.595  3.866   1.00 21.10 ? 277 ARG B CB    1 
ATOM   4322 C  CG    . ARG B 1 277 ? 9.291   38.036  2.484   1.00 21.12 ? 277 ARG B CG    1 
ATOM   4323 C  CD    . ARG B 1 277 ? 9.886   39.388  2.143   1.00 22.75 ? 277 ARG B CD    1 
ATOM   4324 N  NE    . ARG B 1 277 ? 9.541   39.818  0.790   1.00 24.58 ? 277 ARG B NE    1 
ATOM   4325 C  CZ    . ARG B 1 277 ? 9.831   41.025  0.316   1.00 37.01 ? 277 ARG B CZ    1 
ATOM   4326 N  NH1   . ARG B 1 277 ? 10.458  41.890  1.095   1.00 30.89 ? 277 ARG B NH1   1 
ATOM   4327 N  NH2   . ARG B 1 277 ? 9.497   41.365  -0.923  1.00 40.42 ? 277 ARG B NH2   1 
ATOM   4328 N  N     . PHE B 1 278 ? 9.849   36.064  6.640   1.00 21.01 ? 278 PHE B N     1 
ATOM   4329 C  CA    . PHE B 1 278 ? 10.651  35.406  7.672   1.00 20.57 ? 278 PHE B CA    1 
ATOM   4330 C  C     . PHE B 1 278 ? 10.080  34.013  7.977   1.00 18.70 ? 278 PHE B C     1 
ATOM   4331 O  O     . PHE B 1 278 ? 10.823  33.059  8.226   1.00 15.39 ? 278 PHE B O     1 
ATOM   4332 C  CB    . PHE B 1 278 ? 10.725  36.272  8.928   1.00 20.82 ? 278 PHE B CB    1 
ATOM   4333 C  CG    . PHE B 1 278 ? 11.842  35.896  9.865   1.00 20.98 ? 278 PHE B CG    1 
ATOM   4334 C  CD1   . PHE B 1 278 ? 13.158  35.895  9.426   1.00 22.44 ? 278 PHE B CD1   1 
ATOM   4335 C  CD2   . PHE B 1 278 ? 11.577  35.572  11.189  1.00 19.94 ? 278 PHE B CD2   1 
ATOM   4336 C  CE1   . PHE B 1 278 ? 14.202  35.558  10.289  1.00 21.11 ? 278 PHE B CE1   1 
ATOM   4337 C  CE2   . PHE B 1 278 ? 12.607  35.244  12.062  1.00 23.78 ? 278 PHE B CE2   1 
ATOM   4338 C  CZ    . PHE B 1 278 ? 13.925  35.235  11.609  1.00 22.92 ? 278 PHE B CZ    1 
ATOM   4339 N  N     . GLY B 1 279 ? 8.756   33.896  7.918   1.00 16.17 ? 279 GLY B N     1 
ATOM   4340 C  CA    . GLY B 1 279 ? 8.103   32.611  8.085   1.00 18.81 ? 279 GLY B CA    1 
ATOM   4341 C  C     . GLY B 1 279 ? 8.487   31.613  7.007   1.00 19.03 ? 279 GLY B C     1 
ATOM   4342 O  O     . GLY B 1 279 ? 8.790   30.461  7.313   1.00 15.63 ? 279 GLY B O     1 
ATOM   4343 N  N     . VAL B 1 280 ? 8.463   32.037  5.745   1.00 15.99 ? 280 VAL B N     1 
ATOM   4344 C  CA    . VAL B 1 280 ? 8.895   31.159  4.655   1.00 15.68 ? 280 VAL B CA    1 
ATOM   4345 C  C     . VAL B 1 280 ? 10.380  30.811  4.798   1.00 16.64 ? 280 VAL B C     1 
ATOM   4346 O  O     . VAL B 1 280 ? 10.790  29.658  4.583   1.00 15.30 ? 280 VAL B O     1 
ATOM   4347 C  CB    . VAL B 1 280 ? 8.590   31.767  3.259   1.00 13.84 ? 280 VAL B CB    1 
ATOM   4348 C  CG1   . VAL B 1 280 ? 9.284   30.970  2.156   1.00 15.20 ? 280 VAL B CG1   1 
ATOM   4349 C  CG2   . VAL B 1 280 ? 7.069   31.796  3.005   1.00 15.52 ? 280 VAL B CG2   1 
ATOM   4350 N  N     . ALA B 1 281 ? 11.184  31.797  5.178   1.00 14.61 ? 281 ALA B N     1 
ATOM   4351 C  CA    . ALA B 1 281 ? 12.617  31.550  5.356   1.00 15.50 ? 281 ALA B CA    1 
ATOM   4352 C  C     . ALA B 1 281 ? 12.863  30.439  6.382   1.00 17.15 ? 281 ALA B C     1 
ATOM   4353 O  O     . ALA B 1 281 ? 13.625  29.509  6.128   1.00 19.40 ? 281 ALA B O     1 
ATOM   4354 C  CB    . ALA B 1 281 ? 13.354  32.836  5.750   1.00 16.73 ? 281 ALA B CB    1 
ATOM   4355 N  N     . ALA B 1 282 ? 12.201  30.521  7.532   1.00 17.23 ? 282 ALA B N     1 
ATOM   4356 C  CA    . ALA B 1 282 ? 12.402  29.520  8.581   1.00 19.50 ? 282 ALA B CA    1 
ATOM   4357 C  C     . ALA B 1 282 ? 11.769  28.181  8.238   1.00 21.49 ? 282 ALA B C     1 
ATOM   4358 O  O     . ALA B 1 282 ? 12.340  27.125  8.514   1.00 17.19 ? 282 ALA B O     1 
ATOM   4359 C  CB    . ALA B 1 282 ? 11.874  30.029  9.923   1.00 18.43 ? 282 ALA B CB    1 
ATOM   4360 N  N     . GLY B 1 283 ? 10.578  28.207  7.654   1.00 15.97 ? 283 GLY B N     1 
ATOM   4361 C  CA    . GLY B 1 283 ? 9.950   26.953  7.263   1.00 12.56 ? 283 GLY B CA    1 
ATOM   4362 C  C     . GLY B 1 283 ? 10.797  26.215  6.234   1.00 16.51 ? 283 GLY B C     1 
ATOM   4363 O  O     . GLY B 1 283 ? 11.016  25.008  6.341   1.00 16.30 ? 283 GLY B O     1 
ATOM   4364 N  N     . SER B 1 284 ? 11.272  26.941  5.225   1.00 17.11 ? 284 SER B N     1 
ATOM   4365 C  CA    . SER B 1 284 ? 12.070  26.325  4.172   1.00 18.21 ? 284 SER B CA    1 
ATOM   4366 C  C     . SER B 1 284 ? 13.463  25.969  4.678   1.00 16.99 ? 284 SER B C     1 
ATOM   4367 O  O     . SER B 1 284 ? 14.045  24.967  4.255   1.00 16.70 ? 284 SER B O     1 
ATOM   4368 C  CB    . SER B 1 284 ? 12.118  27.216  2.928   1.00 20.38 ? 284 SER B CB    1 
ATOM   4369 O  OG    . SER B 1 284 ? 10.811  27.340  2.378   1.00 17.95 ? 284 SER B OG    1 
ATOM   4370 N  N     . ALA B 1 285 ? 13.987  26.765  5.605   1.00 16.66 ? 285 ALA B N     1 
ATOM   4371 C  CA    . ALA B 1 285 ? 15.248  26.412  6.253   1.00 17.57 ? 285 ALA B CA    1 
ATOM   4372 C  C     . ALA B 1 285 ? 15.129  25.073  6.968   1.00 16.00 ? 285 ALA B C     1 
ATOM   4373 O  O     . ALA B 1 285 ? 16.070  24.273  6.969   1.00 17.47 ? 285 ALA B O     1 
ATOM   4374 C  CB    . ALA B 1 285 ? 15.681  27.501  7.230   1.00 20.29 ? 285 ALA B CB    1 
ATOM   4375 N  N     . ALA B 1 286 ? 13.968  24.828  7.559   1.00 16.43 ? 286 ALA B N     1 
ATOM   4376 C  CA    . ALA B 1 286 ? 13.721  23.566  8.229   1.00 19.17 ? 286 ALA B CA    1 
ATOM   4377 C  C     . ALA B 1 286 ? 13.850  22.413  7.247   1.00 18.60 ? 286 ALA B C     1 
ATOM   4378 O  O     . ALA B 1 286 ? 14.379  21.363  7.597   1.00 24.38 ? 286 ALA B O     1 
ATOM   4379 C  CB    . ALA B 1 286 ? 12.353  23.560  8.875   1.00 18.50 ? 286 ALA B CB    1 
ATOM   4380 N  N     . THR B 1 287 ? 13.367  22.601  6.020   1.00 15.42 ? 287 THR B N     1 
ATOM   4381 C  CA    . THR B 1 287 ? 13.426  21.500  5.051   1.00 19.51 ? 287 THR B CA    1 
ATOM   4382 C  C     . THR B 1 287 ? 14.844  21.097  4.611   1.00 19.58 ? 287 THR B C     1 
ATOM   4383 O  O     . THR B 1 287 ? 15.053  20.023  4.039   1.00 19.57 ? 287 THR B O     1 
ATOM   4384 C  CB    . THR B 1 287 ? 12.547  21.782  3.808   1.00 20.72 ? 287 THR B CB    1 
ATOM   4385 O  OG1   . THR B 1 287 ? 13.182  22.762  2.977   1.00 18.66 ? 287 THR B OG1   1 
ATOM   4386 C  CG2   . THR B 1 287 ? 11.163  22.284  4.231   1.00 17.61 ? 287 THR B CG2   1 
ATOM   4387 N  N     . LEU B 1 288 ? 15.822  21.953  4.891   1.00 19.42 ? 288 LEU B N     1 
ATOM   4388 C  CA    . LEU B 1 288 ? 17.198  21.694  4.468   1.00 21.52 ? 288 LEU B CA    1 
ATOM   4389 C  C     . LEU B 1 288 ? 17.893  20.633  5.318   1.00 23.63 ? 288 LEU B C     1 
ATOM   4390 O  O     . LEU B 1 288 ? 18.926  20.086  4.933   1.00 25.71 ? 288 LEU B O     1 
ATOM   4391 C  CB    . LEU B 1 288 ? 18.019  22.983  4.505   1.00 19.72 ? 288 LEU B CB    1 
ATOM   4392 C  CG    . LEU B 1 288 ? 17.503  24.113  3.617   1.00 21.29 ? 288 LEU B CG    1 
ATOM   4393 C  CD1   . LEU B 1 288 ? 18.395  25.342  3.726   1.00 27.14 ? 288 LEU B CD1   1 
ATOM   4394 C  CD2   . LEU B 1 288 ? 17.379  23.653  2.167   1.00 27.93 ? 288 LEU B CD2   1 
ATOM   4395 N  N     . ASN B 1 289 ? 17.317  20.371  6.488   1.00 23.59 ? 289 ASN B N     1 
ATOM   4396 C  CA    . ASN B 1 289 ? 17.900  19.469  7.476   1.00 24.84 ? 289 ASN B CA    1 
ATOM   4397 C  C     . ASN B 1 289 ? 17.217  18.108  7.528   1.00 33.81 ? 289 ASN B C     1 
ATOM   4398 O  O     . ASN B 1 289 ? 15.997  18.011  7.449   1.00 43.01 ? 289 ASN B O     1 
ATOM   4399 C  CB    . ASN B 1 289 ? 17.858  20.103  8.868   1.00 25.76 ? 289 ASN B CB    1 
ATOM   4400 C  CG    . ASN B 1 289 ? 18.609  21.413  8.935   1.00 27.75 ? 289 ASN B CG    1 
ATOM   4401 O  OD1   . ASN B 1 289 ? 19.611  21.599  8.253   1.00 33.20 ? 289 ASN B OD1   1 
ATOM   4402 N  ND2   . ASN B 1 289 ? 18.127  22.329  9.763   1.00 30.03 ? 289 ASN B ND2   1 
ATOM   4403 N  N     . GLN B 1 290 ? 18.018  17.063  7.685   1.00 30.40 ? 290 GLN B N     1 
ATOM   4404 C  CA    . GLN B 1 290 ? 17.506  15.701  7.734   1.00 27.91 ? 290 GLN B CA    1 
ATOM   4405 C  C     . GLN B 1 290 ? 16.589  15.465  8.925   1.00 29.68 ? 290 GLN B C     1 
ATOM   4406 O  O     . GLN B 1 290 ? 16.702  16.124  9.954   1.00 27.31 ? 290 GLN B O     1 
ATOM   4407 C  CB    . GLN B 1 290 ? 18.665  14.705  7.783   1.00 30.87 ? 290 GLN B CB    1 
ATOM   4408 C  CG    . GLN B 1 290 ? 19.556  14.733  6.559   1.00 43.87 ? 290 GLN B CG    1 
ATOM   4409 C  CD    . GLN B 1 290 ? 18.832  14.290  5.308   1.00 51.89 ? 290 GLN B CD    1 
ATOM   4410 O  OE1   . GLN B 1 290 ? 17.882  13.511  5.370   1.00 54.52 ? 290 GLN B OE1   1 
ATOM   4411 N  NE2   . GLN B 1 290 ? 19.280  14.782  4.161   1.00 51.04 ? 290 GLN B NE2   1 
ATOM   4412 N  N     . GLY B 1 291 ? 15.686  14.505  8.777   1.00 28.03 ? 291 GLY B N     1 
ATOM   4413 C  CA    . GLY B 1 291 ? 14.816  14.106  9.860   1.00 33.81 ? 291 GLY B CA    1 
ATOM   4414 C  C     . GLY B 1 291 ? 14.012  15.241  10.456  1.00 44.99 ? 291 GLY B C     1 
ATOM   4415 O  O     . GLY B 1 291 ? 13.461  16.072  9.739   1.00 66.36 ? 291 GLY B O     1 
ATOM   4416 N  N     . THR B 1 292 ? 13.953  15.270  11.781  1.00 32.91 ? 292 THR B N     1 
ATOM   4417 C  CA    . THR B 1 292 ? 13.064  16.164  12.509  1.00 27.10 ? 292 THR B CA    1 
ATOM   4418 C  C     . THR B 1 292 ? 13.679  17.501  12.924  1.00 28.77 ? 292 THR B C     1 
ATOM   4419 O  O     . THR B 1 292 ? 13.019  18.305  13.576  1.00 30.81 ? 292 THR B O     1 
ATOM   4420 C  CB    . THR B 1 292 ? 12.526  15.472  13.772  1.00 27.68 ? 292 THR B CB    1 
ATOM   4421 O  OG1   . THR B 1 292 ? 13.615  15.195  14.660  1.00 29.00 ? 292 THR B OG1   1 
ATOM   4422 C  CG2   . THR B 1 292 ? 11.838  14.168  13.407  1.00 29.09 ? 292 THR B CG2   1 
ATOM   4423 N  N     . ARG B 1 293 ? 14.932  17.737  12.553  1.00 30.57 ? 293 ARG B N     1 
ATOM   4424 C  CA    . ARG B 1 293 ? 15.617  18.970  12.922  1.00 26.70 ? 293 ARG B CA    1 
ATOM   4425 C  C     . ARG B 1 293 ? 14.898  20.201  12.389  1.00 35.94 ? 293 ARG B C     1 
ATOM   4426 O  O     . ARG B 1 293 ? 14.503  20.249  11.227  1.00 38.62 ? 293 ARG B O     1 
ATOM   4427 C  CB    . ARG B 1 293 ? 17.064  18.951  12.423  1.00 28.40 ? 293 ARG B CB    1 
ATOM   4428 C  CG    . ARG B 1 293 ? 17.772  17.626  12.637  1.00 43.73 ? 293 ARG B CG    1 
ATOM   4429 C  CD    . ARG B 1 293 ? 19.252  17.817  12.925  1.00 67.56 ? 293 ARG B CD    1 
ATOM   4430 N  NE    . ARG B 1 293 ? 19.789  19.018  12.294  1.00 78.09 ? 293 ARG B NE    1 
ATOM   4431 C  CZ    . ARG B 1 293 ? 20.084  20.137  12.947  1.00 86.07 ? 293 ARG B CZ    1 
ATOM   4432 N  NH1   . ARG B 1 293 ? 19.893  20.215  14.257  1.00 87.65 ? 293 ARG B NH1   1 
ATOM   4433 N  NH2   . ARG B 1 293 ? 20.570  21.182  12.290  1.00 87.27 ? 293 ARG B NH2   1 
ATOM   4434 N  N     . LEU B 1 294 ? 14.735  21.196  13.252  1.00 23.94 ? 294 LEU B N     1 
ATOM   4435 C  CA    . LEU B 1 294 ? 14.062  22.426  12.876  1.00 22.65 ? 294 LEU B CA    1 
ATOM   4436 C  C     . LEU B 1 294 ? 14.997  23.371  12.133  1.00 22.83 ? 294 LEU B C     1 
ATOM   4437 O  O     . LEU B 1 294 ? 16.108  23.007  11.762  1.00 26.16 ? 294 LEU B O     1 
ATOM   4438 C  CB    . LEU B 1 294 ? 13.489  23.121  14.110  1.00 22.87 ? 294 LEU B CB    1 
ATOM   4439 C  CG    . LEU B 1 294 ? 12.570  22.268  14.984  1.00 24.84 ? 294 LEU B CG    1 
ATOM   4440 C  CD1   . LEU B 1 294 ? 12.304  22.951  16.309  1.00 24.38 ? 294 LEU B CD1   1 
ATOM   4441 C  CD2   . LEU B 1 294 ? 11.269  21.976  14.257  1.00 32.10 ? 294 LEU B CD2   1 
ATOM   4442 N  N     . CYS B 1 295 ? 14.527  24.592  11.923  1.00 21.28 ? 295 CYS B N     1 
ATOM   4443 C  CA    . CYS B 1 295 ? 15.293  25.615  11.217  1.00 24.01 ? 295 CYS B CA    1 
ATOM   4444 C  C     . CYS B 1 295 ? 16.533  26.039  11.988  1.00 23.33 ? 295 CYS B C     1 
ATOM   4445 O  O     . CYS B 1 295 ? 16.528  26.061  13.218  1.00 25.49 ? 295 CYS B O     1 
ATOM   4446 C  CB    . CYS B 1 295 ? 14.419  26.854  10.983  1.00 21.07 ? 295 CYS B CB    1 
ATOM   4447 S  SG    . CYS B 1 295 ? 13.670  27.556  12.484  1.00 23.70 ? 295 CYS B SG    1 
ATOM   4448 N  N     . SER B 1 296 ? 17.597  26.376  11.262  1.00 22.01 ? 296 SER B N     1 
ATOM   4449 C  CA    . SER B 1 296 ? 18.790  26.936  11.883  1.00 23.06 ? 296 SER B CA    1 
ATOM   4450 C  C     . SER B 1 296 ? 18.811  28.439  11.643  1.00 22.58 ? 296 SER B C     1 
ATOM   4451 O  O     . SER B 1 296 ? 18.251  28.926  10.654  1.00 23.77 ? 296 SER B O     1 
ATOM   4452 C  CB    . SER B 1 296 ? 20.062  26.307  11.306  1.00 27.28 ? 296 SER B CB    1 
ATOM   4453 O  OG    . SER B 1 296 ? 20.390  26.907  10.063  1.00 28.43 ? 296 SER B OG    1 
ATOM   4454 N  N     . HIS B 1 297 ? 19.450  29.169  12.549  1.00 23.54 ? 297 HIS B N     1 
ATOM   4455 C  CA    . HIS B 1 297 ? 19.531  30.625  12.448  1.00 23.39 ? 297 HIS B CA    1 
ATOM   4456 C  C     . HIS B 1 297 ? 20.149  31.057  11.126  1.00 26.94 ? 297 HIS B C     1 
ATOM   4457 O  O     . HIS B 1 297 ? 19.598  31.902  10.410  1.00 24.96 ? 297 HIS B O     1 
ATOM   4458 C  CB    . HIS B 1 297 ? 20.353  31.195  13.606  1.00 30.60 ? 297 HIS B CB    1 
ATOM   4459 C  CG    . HIS B 1 297 ? 20.601  32.671  13.501  1.00 36.03 ? 297 HIS B CG    1 
ATOM   4460 N  ND1   . HIS B 1 297 ? 21.632  33.200  12.756  1.00 38.12 ? 297 HIS B ND1   1 
ATOM   4461 C  CD2   . HIS B 1 297 ? 19.946  33.725  14.042  1.00 42.23 ? 297 HIS B CD2   1 
ATOM   4462 C  CE1   . HIS B 1 297 ? 21.604  34.520  12.845  1.00 46.53 ? 297 HIS B CE1   1 
ATOM   4463 N  NE2   . HIS B 1 297 ? 20.589  34.863  13.619  1.00 43.13 ? 297 HIS B NE2   1 
ATOM   4464 N  N     . ASP B 1 298 ? 21.296  30.471  10.808  1.00 25.73 ? 298 ASP B N     1 
ATOM   4465 C  CA    . ASP B 1 298 ? 22.044  30.851  9.617   1.00 24.25 ? 298 ASP B CA    1 
ATOM   4466 C  C     . ASP B 1 298 ? 21.308  30.560  8.308   1.00 22.92 ? 298 ASP B C     1 
ATOM   4467 O  O     . ASP B 1 298 ? 21.294  31.409  7.416   1.00 22.59 ? 298 ASP B O     1 
ATOM   4468 C  CB    . ASP B 1 298 ? 23.448  30.227  9.634   1.00 25.68 ? 298 ASP B CB    1 
ATOM   4469 C  CG    . ASP B 1 298 ? 24.343  30.840  10.703  1.00 41.76 ? 298 ASP B CG    1 
ATOM   4470 O  OD1   . ASP B 1 298 ? 23.938  31.857  11.310  1.00 35.86 ? 298 ASP B OD1   1 
ATOM   4471 O  OD2   . ASP B 1 298 ? 25.455  30.314  10.933  1.00 37.22 ? 298 ASP B OD2   1 
ATOM   4472 N  N     . ASP B 1 299 ? 20.689  29.385  8.186   1.00 22.48 ? 299 ASP B N     1 
ATOM   4473 C  CA    . ASP B 1 299 ? 19.911  29.079  6.976   1.00 21.58 ? 299 ASP B CA    1 
ATOM   4474 C  C     . ASP B 1 299 ? 18.705  30.010  6.814   1.00 25.26 ? 299 ASP B C     1 
ATOM   4475 O  O     . ASP B 1 299 ? 18.373  30.434  5.707   1.00 20.05 ? 299 ASP B O     1 
ATOM   4476 C  CB    . ASP B 1 299 ? 19.437  27.620  6.966   1.00 23.52 ? 299 ASP B CB    1 
ATOM   4477 C  CG    . ASP B 1 299 ? 20.567  26.629  6.744   1.00 33.31 ? 299 ASP B CG    1 
ATOM   4478 O  OD1   . ASP B 1 299 ? 21.587  26.999  6.122   1.00 27.50 ? 299 ASP B OD1   1 
ATOM   4479 O  OD2   . ASP B 1 299 ? 20.421  25.465  7.188   1.00 28.79 ? 299 ASP B OD2   1 
ATOM   4480 N  N     . THR B 1 300 ? 18.047  30.324  7.922   1.00 20.20 ? 300 THR B N     1 
ATOM   4481 C  CA    . THR B 1 300 ? 16.876  31.190  7.872   1.00 19.79 ? 300 THR B CA    1 
ATOM   4482 C  C     . THR B 1 300 ? 17.307  32.588  7.450   1.00 19.58 ? 300 THR B C     1 
ATOM   4483 O  O     . THR B 1 300 ? 16.688  33.208  6.590   1.00 20.03 ? 300 THR B O     1 
ATOM   4484 C  CB    . THR B 1 300 ? 16.172  31.252  9.237   1.00 19.47 ? 300 THR B CB    1 
ATOM   4485 O  OG1   . THR B 1 300 ? 15.817  29.922  9.641   1.00 19.77 ? 300 THR B OG1   1 
ATOM   4486 C  CG2   . THR B 1 300 ? 14.926  32.114  9.157   1.00 19.00 ? 300 THR B CG2   1 
ATOM   4487 N  N     . GLN B 1 301 ? 18.393  33.067  8.044   1.00 20.45 ? 301 GLN B N     1 
ATOM   4488 C  CA    . GLN B 1 301 ? 18.921  34.383  7.702   1.00 20.87 ? 301 GLN B CA    1 
ATOM   4489 C  C     . GLN B 1 301 ? 19.271  34.466  6.214   1.00 22.08 ? 301 GLN B C     1 
ATOM   4490 O  O     . GLN B 1 301 ? 18.982  35.466  5.553   1.00 22.08 ? 301 GLN B O     1 
ATOM   4491 C  CB    . GLN B 1 301 ? 20.159  34.689  8.550   1.00 22.68 ? 301 GLN B CB    1 
ATOM   4492 C  CG    . GLN B 1 301 ? 20.838  36.005  8.210   1.00 37.26 ? 301 GLN B CG    1 
ATOM   4493 C  CD    . GLN B 1 301 ? 22.061  36.266  9.073   1.00 60.95 ? 301 GLN B CD    1 
ATOM   4494 O  OE1   . GLN B 1 301 ? 22.690  35.332  9.578   1.00 63.21 ? 301 GLN B OE1   1 
ATOM   4495 N  NE2   . GLN B 1 301 ? 22.400  37.539  9.254   1.00 68.55 ? 301 GLN B NE2   1 
ATOM   4496 N  N     . LYS B 1 302 ? 19.887  33.410  5.689   1.00 21.11 ? 302 LYS B N     1 
ATOM   4497 C  CA    . LYS B 1 302 ? 20.306  33.399  4.289   1.00 23.13 ? 302 LYS B CA    1 
ATOM   4498 C  C     . LYS B 1 302 ? 19.106  33.455  3.353   1.00 20.86 ? 302 LYS B C     1 
ATOM   4499 O  O     . LYS B 1 302 ? 19.094  34.218  2.383   1.00 21.92 ? 302 LYS B O     1 
ATOM   4500 C  CB    . LYS B 1 302 ? 21.162  32.172  3.972   1.00 22.46 ? 302 LYS B CB    1 
ATOM   4501 C  CG    . LYS B 1 302 ? 21.813  32.242  2.605   1.00 27.41 ? 302 LYS B CG    1 
ATOM   4502 C  CD    . LYS B 1 302 ? 22.554  30.956  2.285   1.00 38.16 ? 302 LYS B CD    1 
ATOM   4503 C  CE    . LYS B 1 302 ? 23.479  30.546  3.418   1.00 30.41 ? 302 LYS B CE    1 
ATOM   4504 N  NZ    . LYS B 1 302 ? 24.109  29.215  3.139   1.00 32.19 ? 302 LYS B NZ    1 
ATOM   4505 N  N     . ILE B 1 303 ? 18.083  32.664  3.655   1.00 19.81 ? 303 ILE B N     1 
ATOM   4506 C  CA    . ILE B 1 303 ? 16.899  32.636  2.804   1.00 19.25 ? 303 ILE B CA    1 
ATOM   4507 C  C     . ILE B 1 303 ? 16.135  33.944  2.932   1.00 20.81 ? 303 ILE B C     1 
ATOM   4508 O  O     . ILE B 1 303 ? 15.613  34.469  1.946   1.00 22.59 ? 303 ILE B O     1 
ATOM   4509 C  CB    . ILE B 1 303 ? 15.999  31.438  3.133   1.00 19.93 ? 303 ILE B CB    1 
ATOM   4510 C  CG1   . ILE B 1 303 ? 16.749  30.138  2.838   1.00 19.48 ? 303 ILE B CG1   1 
ATOM   4511 C  CG2   . ILE B 1 303 ? 14.686  31.504  2.341   1.00 20.72 ? 303 ILE B CG2   1 
ATOM   4512 C  CD1   . ILE B 1 303 ? 16.080  28.891  3.413   1.00 21.69 ? 303 ILE B CD1   1 
ATOM   4513 N  N     . TYR B 1 304 ? 16.080  34.483  4.144   1.00 19.73 ? 304 TYR B N     1 
ATOM   4514 C  CA    . TYR B 1 304 ? 15.397  35.755  4.357   1.00 18.83 ? 304 TYR B CA    1 
ATOM   4515 C  C     . TYR B 1 304 ? 16.059  36.896  3.575   1.00 23.94 ? 304 TYR B C     1 
ATOM   4516 O  O     . TYR B 1 304 ? 15.372  37.767  3.036   1.00 22.83 ? 304 TYR B O     1 
ATOM   4517 C  CB    . TYR B 1 304 ? 15.327  36.096  5.846   1.00 19.95 ? 304 TYR B CB    1 
ATOM   4518 C  CG    . TYR B 1 304 ? 14.628  37.410  6.115   1.00 20.07 ? 304 TYR B CG    1 
ATOM   4519 C  CD1   . TYR B 1 304 ? 13.252  37.517  5.999   1.00 19.85 ? 304 TYR B CD1   1 
ATOM   4520 C  CD2   . TYR B 1 304 ? 15.344  38.539  6.483   1.00 27.19 ? 304 TYR B CD2   1 
ATOM   4521 C  CE1   . TYR B 1 304 ? 12.603  38.720  6.243   1.00 26.97 ? 304 TYR B CE1   1 
ATOM   4522 C  CE2   . TYR B 1 304 ? 14.708  39.741  6.727   1.00 36.31 ? 304 TYR B CE2   1 
ATOM   4523 C  CZ    . TYR B 1 304 ? 13.338  39.825  6.606   1.00 36.10 ? 304 TYR B CZ    1 
ATOM   4524 O  OH    . TYR B 1 304 ? 12.702  41.023  6.852   1.00 41.69 ? 304 TYR B OH    1 
ATOM   4525 N  N     . ALA B 1 305 ? 17.389  36.888  3.507   1.00 24.97 ? 305 ALA B N     1 
ATOM   4526 C  CA    . ALA B 1 305 ? 18.097  37.894  2.721   1.00 25.92 ? 305 ALA B CA    1 
ATOM   4527 C  C     . ALA B 1 305 ? 17.751  37.762  1.239   1.00 23.89 ? 305 ALA B C     1 
ATOM   4528 O  O     . ALA B 1 305 ? 17.588  38.764  0.543   1.00 28.18 ? 305 ALA B O     1 
ATOM   4529 C  CB    . ALA B 1 305 ? 19.604  37.796  2.940   1.00 28.87 ? 305 ALA B CB    1 
ATOM   4530 N  N     . TYR B 1 306 ? 17.618  36.524  0.768   1.00 23.88 ? 306 TYR B N     1 
ATOM   4531 C  CA    . TYR B 1 306 ? 17.255  36.258  -0.625  1.00 22.24 ? 306 TYR B CA    1 
ATOM   4532 C  C     . TYR B 1 306 ? 15.838  36.746  -0.914  1.00 28.66 ? 306 TYR B C     1 
ATOM   4533 O  O     . TYR B 1 306 ? 15.581  37.348  -1.954  1.00 27.74 ? 306 TYR B O     1 
ATOM   4534 C  CB    . TYR B 1 306 ? 17.372  34.760  -0.929  1.00 21.98 ? 306 TYR B CB    1 
ATOM   4535 C  CG    . TYR B 1 306 ? 16.707  34.331  -2.224  1.00 27.64 ? 306 TYR B CG    1 
ATOM   4536 C  CD1   . TYR B 1 306 ? 17.358  34.473  -3.445  1.00 35.49 ? 306 TYR B CD1   1 
ATOM   4537 C  CD2   . TYR B 1 306 ? 15.433  33.771  -2.221  1.00 33.24 ? 306 TYR B CD2   1 
ATOM   4538 C  CE1   . TYR B 1 306 ? 16.756  34.078  -4.628  1.00 37.78 ? 306 TYR B CE1   1 
ATOM   4539 C  CE2   . TYR B 1 306 ? 14.822  33.374  -3.401  1.00 34.76 ? 306 TYR B CE2   1 
ATOM   4540 C  CZ    . TYR B 1 306 ? 15.490  33.527  -4.598  1.00 34.85 ? 306 TYR B CZ    1 
ATOM   4541 O  OH    . TYR B 1 306 ? 14.881  33.130  -5.766  1.00 40.93 ? 306 TYR B OH    1 
ATOM   4542 N  N     . LEU B 1 307 ? 14.923  36.489  0.017   1.00 21.62 ? 307 LEU B N     1 
ATOM   4543 C  CA    . LEU B 1 307 ? 13.514  36.837  -0.170  1.00 23.15 ? 307 LEU B CA    1 
ATOM   4544 C  C     . LEU B 1 307 ? 13.310  38.341  -0.122  1.00 30.32 ? 307 LEU B C     1 
ATOM   4545 O  O     . LEU B 1 307 ? 12.332  38.867  -0.657  1.00 29.99 ? 307 LEU B O     1 
ATOM   4546 C  CB    . LEU B 1 307 ? 12.653  36.178  0.905   1.00 19.25 ? 307 LEU B CB    1 
ATOM   4547 C  CG    . LEU B 1 307 ? 12.570  34.659  0.797   1.00 21.48 ? 307 LEU B CG    1 
ATOM   4548 C  CD1   . LEU B 1 307 ? 11.779  34.094  1.961   1.00 21.85 ? 307 LEU B CD1   1 
ATOM   4549 C  CD2   . LEU B 1 307 ? 11.933  34.278  -0.527  1.00 22.95 ? 307 LEU B CD2   1 
ATOM   4550 N  N     . SER B 1 308 ? 14.241  39.020  0.535   1.00 22.22 ? 308 SER B N     1 
ATOM   4551 C  CA    . SER B 1 308 ? 14.178  40.462  0.695   1.00 33.16 ? 308 SER B CA    1 
ATOM   4552 C  C     . SER B 1 308 ? 14.946  41.129  -0.432  1.00 37.73 ? 308 SER B C     1 
ATOM   4553 O  O     . SER B 1 308 ? 15.170  42.337  -0.403  1.00 36.99 ? 308 SER B O     1 
ATOM   4554 C  CB    . SER B 1 308 ? 14.771  40.869  2.043   1.00 35.00 ? 308 SER B CB    1 
ATOM   4555 O  OG    . SER B 1 308 ? 14.113  40.206  3.105   1.00 40.10 ? 308 SER B OG    1 
ATOM   4556 N  N     . ARG B 1 309 ? 15.341  40.336  -1.421  1.00 43.49 ? 309 ARG B N     1 
ATOM   4557 C  CA    . ARG B 1 309 ? 16.061  40.847  -2.580  1.00 53.11 ? 309 ARG B CA    1 
ATOM   4558 C  C     . ARG B 1 309 ? 17.566  40.825  -2.349  1.00 63.81 ? 309 ARG B C     1 
ATOM   4559 O  O     . ARG B 1 309 ? 18.267  39.957  -2.867  1.00 69.35 ? 309 ARG B O     1 
ATOM   4560 C  CB    . ARG B 1 309 ? 15.595  42.264  -2.920  1.00 20.00 ? 309 ARG B CB    1 
HETATM 4561 MG MG    . MG  C 2 .   ? 11.105  -16.787 18.032  1.00 25.17 ? 310 MG  A MG    1 
HETATM 4562 MG MG    . MG  D 2 .   ? 10.142  -15.617 13.503  1.00 23.31 ? 311 MG  A MG    1 
HETATM 4563 P  PG    . ATP E 3 .   ? 8.535   -15.794 16.241  1.00 17.63 ? 313 ATP A PG    1 
HETATM 4564 O  O1G   . ATP E 3 .   ? 9.387   -15.645 17.452  1.00 16.36 ? 313 ATP A O1G   1 
HETATM 4565 O  O2G   . ATP E 3 .   ? 7.121   -15.471 16.716  1.00 15.88 ? 313 ATP A O2G   1 
HETATM 4566 O  O3G   . ATP E 3 .   ? 8.943   -14.908 15.115  1.00 19.75 ? 313 ATP A O3G   1 
HETATM 4567 P  PB    . ATP E 3 .   ? 9.796   -18.103 15.468  1.00 18.74 ? 313 ATP A PB    1 
HETATM 4568 O  O1B   . ATP E 3 .   ? 10.559  -17.484 14.257  1.00 16.74 ? 313 ATP A O1B   1 
HETATM 4569 O  O2B   . ATP E 3 .   ? 10.670  -18.309 16.723  1.00 17.93 ? 313 ATP A O2B   1 
HETATM 4570 O  O3B   . ATP E 3 .   ? 8.468   -17.289 15.811  1.00 15.99 ? 313 ATP A O3B   1 
HETATM 4571 P  PA    . ATP E 3 .   ? 8.540   -20.113 13.834  1.00 17.07 ? 313 ATP A PA    1 
HETATM 4572 O  O1A   . ATP E 3 .   ? 8.422   -19.065 12.767  1.00 16.55 ? 313 ATP A O1A   1 
HETATM 4573 O  O2A   . ATP E 3 .   ? 9.226   -21.394 13.355  1.00 17.17 ? 313 ATP A O2A   1 
HETATM 4574 O  O3A   . ATP E 3 .   ? 9.282   -19.556 15.079  1.00 14.62 ? 313 ATP A O3A   1 
HETATM 4575 O  "O5'" . ATP E 3 .   ? 7.055   -20.412 14.376  1.00 18.61 ? 313 ATP A "O5'" 1 
HETATM 4576 C  "C5'" . ATP E 3 .   ? 6.850   -21.470 15.249  1.00 20.38 ? 313 ATP A "C5'" 1 
HETATM 4577 C  "C4'" . ATP E 3 .   ? 5.805   -22.431 14.901  1.00 17.33 ? 313 ATP A "C4'" 1 
HETATM 4578 O  "O4'" . ATP E 3 .   ? 4.629   -21.691 14.507  1.00 15.49 ? 313 ATP A "O4'" 1 
HETATM 4579 C  "C3'" . ATP E 3 .   ? 6.136   -23.216 13.701  1.00 19.31 ? 313 ATP A "C3'" 1 
HETATM 4580 O  "O3'" . ATP E 3 .   ? 6.913   -24.312 14.006  1.00 17.19 ? 313 ATP A "O3'" 1 
HETATM 4581 C  "C2'" . ATP E 3 .   ? 4.809   -23.572 13.170  1.00 20.59 ? 313 ATP A "C2'" 1 
HETATM 4582 O  "O2'" . ATP E 3 .   ? 4.239   -24.551 13.939  1.00 19.73 ? 313 ATP A "O2'" 1 
HETATM 4583 C  "C1'" . ATP E 3 .   ? 4.051   -22.319 13.386  1.00 15.43 ? 313 ATP A "C1'" 1 
HETATM 4584 N  N9    . ATP E 3 .   ? 4.121   -21.438 12.222  1.00 16.36 ? 313 ATP A N9    1 
HETATM 4585 C  C8    . ATP E 3 .   ? 4.945   -20.385 12.069  1.00 19.83 ? 313 ATP A C8    1 
HETATM 4586 N  N7    . ATP E 3 .   ? 4.695   -19.841 10.852  1.00 17.30 ? 313 ATP A N7    1 
HETATM 4587 C  C5    . ATP E 3 .   ? 3.720   -20.548 10.244  1.00 18.10 ? 313 ATP A C5    1 
HETATM 4588 C  C6    . ATP E 3 .   ? 3.070   -20.441 9.010   1.00 21.70 ? 313 ATP A C6    1 
HETATM 4589 N  N6    . ATP E 3 .   ? 3.427   -19.358 8.034   1.00 19.59 ? 313 ATP A N6    1 
HETATM 4590 N  N1    . ATP E 3 .   ? 2.115   -21.338 8.709   1.00 16.90 ? 313 ATP A N1    1 
HETATM 4591 C  C2    . ATP E 3 .   ? 1.781   -22.318 9.566   1.00 17.83 ? 313 ATP A C2    1 
HETATM 4592 N  N3    . ATP E 3 .   ? 2.384   -22.439 10.752  1.00 17.78 ? 313 ATP A N3    1 
HETATM 4593 C  C4    . ATP E 3 .   ? 3.347   -21.574 11.116  1.00 17.97 ? 313 ATP A C4    1 
HETATM 4594 K  K     . K   F 4 .   ? -1.427  -14.086 15.370  1.00 20.75 ? 314 K   A K     1 
HETATM 4595 MG MG    . MG  G 2 .   ? 2.157   19.467  6.589   1.00 21.99 ? 312 MG  A MG    1 
HETATM 4596 P  PG    A ATP H 3 .   ? -0.564  17.939  7.756   0.62 21.00 ? 315 ATP A PG    1 
HETATM 4597 P  PG    B ATP H 3 .   ? -0.532  17.959  7.765   0.38 21.22 ? 315 ATP A PG    1 
HETATM 4598 O  O1G   A ATP H 3 .   ? 0.363   19.110  7.695   0.62 15.95 ? 315 ATP A O1G   1 
HETATM 4599 O  O1G   B ATP H 3 .   ? -0.972  17.866  9.192   0.38 19.62 ? 315 ATP A O1G   1 
HETATM 4600 O  O2G   A ATP H 3 .   ? -0.895  17.710  9.231   0.62 18.39 ? 315 ATP A O2G   1 
HETATM 4601 O  O2G   B ATP H 3 .   ? -1.798  18.158  6.918   0.38 22.62 ? 315 ATP A O2G   1 
HETATM 4602 O  O3G   A ATP H 3 .   ? -1.834  18.177  6.976   0.62 20.72 ? 315 ATP A O3G   1 
HETATM 4603 O  O3G   B ATP H 3 .   ? 0.436   19.098  7.586   0.38 21.18 ? 315 ATP A O3G   1 
HETATM 4604 P  PB    A ATP H 3 .   ? 1.304   16.430  6.254   0.62 22.49 ? 315 ATP A PB    1 
HETATM 4605 P  PB    B ATP H 3 .   ? 1.165   16.363  6.276   0.38 29.54 ? 315 ATP A PB    1 
HETATM 4606 O  O1B   A ATP H 3 .   ? 1.749   14.914  6.379   0.62 25.98 ? 315 ATP A O1B   1 
HETATM 4607 O  O1B   B ATP H 3 .   ? 2.346   17.379  6.554   0.38 18.38 ? 315 ATP A O1B   1 
HETATM 4608 O  O2B   A ATP H 3 .   ? 2.536   17.347  6.353   0.62 14.70 ? 315 ATP A O2B   1 
HETATM 4609 O  O2B   B ATP H 3 .   ? 1.700   14.913  6.292   0.38 28.51 ? 315 ATP A O2B   1 
HETATM 4610 O  O3B   A ATP H 3 .   ? 0.172   16.641  7.355   0.62 27.84 ? 315 ATP A O3B   1 
HETATM 4611 O  O3B   B ATP H 3 .   ? 0.070   16.585  7.406   0.38 26.85 ? 315 ATP A O3B   1 
HETATM 4612 P  PA    A ATP H 3 .   ? -0.006  15.635  3.956   0.62 33.53 ? 315 ATP A PA    1 
HETATM 4613 P  PA    B ATP H 3 .   ? -0.068  15.655  3.980   0.38 32.62 ? 315 ATP A PA    1 
HETATM 4614 O  O1A   A ATP H 3 .   ? -0.744  14.627  4.811   0.62 30.78 ? 315 ATP A O1A   1 
HETATM 4615 O  O1A   B ATP H 3 .   ? -0.841  14.683  4.841   0.38 32.27 ? 315 ATP A O1A   1 
HETATM 4616 O  O2A   A ATP H 3 .   ? -0.965  16.315  2.962   0.62 32.86 ? 315 ATP A O2A   1 
HETATM 4617 O  O2A   B ATP H 3 .   ? -0.971  16.301  2.917   0.38 32.54 ? 315 ATP A O2A   1 
HETATM 4618 O  O3A   A ATP H 3 .   ? 0.641   16.683  4.854   0.62 31.07 ? 315 ATP A O3A   1 
HETATM 4619 O  O3A   B ATP H 3 .   ? 0.535   16.721  4.889   0.38 32.49 ? 315 ATP A O3A   1 
HETATM 4620 O  "O5'" A ATP H 3 .   ? 1.157   14.868  3.145   0.62 36.32 ? 315 ATP A "O5'" 1 
HETATM 4621 O  "O5'" B ATP H 3 .   ? 1.131   14.834  3.285   0.38 36.81 ? 315 ATP A "O5'" 1 
HETATM 4622 C  "C5'" A ATP H 3 .   ? 2.413   15.422  3.008   0.62 36.04 ? 315 ATP A "C5'" 1 
HETATM 4623 C  "C5'" B ATP H 3 .   ? 0.854   13.839  2.370   0.38 37.30 ? 315 ATP A "C5'" 1 
HETATM 4624 C  "C4'" A ATP H 3 .   ? 3.380   14.611  2.285   0.62 38.92 ? 315 ATP A "C4'" 1 
HETATM 4625 C  "C4'" B ATP H 3 .   ? 1.837   13.662  1.314   0.38 41.67 ? 315 ATP A "C4'" 1 
HETATM 4626 O  "O4'" A ATP H 3 .   ? 3.072   13.224  2.548   0.62 38.48 ? 315 ATP A "O4'" 1 
HETATM 4627 O  "O4'" B ATP H 3 .   ? 1.949   14.908  0.593   0.38 42.90 ? 315 ATP A "O4'" 1 
HETATM 4628 C  "C3'" A ATP H 3 .   ? 3.190   14.787  0.842   0.62 43.98 ? 315 ATP A "C3'" 1 
HETATM 4629 C  "C3'" B ATP H 3 .   ? 3.146   13.439  1.934   0.38 41.16 ? 315 ATP A "C3'" 1 
HETATM 4630 O  "O3'" A ATP H 3 .   ? 4.071   15.721  0.354   0.62 48.98 ? 315 ATP A "O3'" 1 
HETATM 4631 O  "O3'" B ATP H 3 .   ? 3.423   12.096  2.007   0.38 42.94 ? 315 ATP A "O3'" 1 
HETATM 4632 C  "C2'" A ATP H 3 .   ? 3.447   13.466  0.263   0.62 47.04 ? 315 ATP A "C2'" 1 
HETATM 4633 C  "C2'" B ATP H 3 .   ? 4.098   14.143  1.073   0.38 45.17 ? 315 ATP A "C2'" 1 
HETATM 4634 O  "O2'" A ATP H 3 .   ? 4.778   13.353  -0.014  0.62 51.92 ? 315 ATP A "O2'" 1 
HETATM 4635 O  "O2'" B ATP H 3 .   ? 4.542   13.291  0.104   0.38 50.36 ? 315 ATP A "O2'" 1 
HETATM 4636 C  "C1'" A ATP H 3 .   ? 3.084   12.511  1.332   0.62 40.97 ? 315 ATP A "C1'" 1 
HETATM 4637 C  "C1'" B ATP H 3 .   ? 3.312   15.248  0.474   0.38 43.86 ? 315 ATP A "C1'" 1 
HETATM 4638 N  N9    A ATP H 3 .   ? 1.784   11.886  1.115   0.62 35.69 ? 315 ATP A N9    1 
HETATM 4639 N  N9    B ATP H 3 .   ? 3.581   16.521  1.139   0.38 37.39 ? 315 ATP A N9    1 
HETATM 4640 C  C8    A ATP H 3 .   ? 0.622   12.352  1.608   0.62 31.68 ? 315 ATP A C8    1 
HETATM 4641 C  C8    B ATP H 3 .   ? 2.869   17.025  2.162   0.38 37.41 ? 315 ATP A C8    1 
HETATM 4642 N  N7    A ATP H 3 .   ? -0.367  11.516  1.217   0.62 31.94 ? 315 ATP A N7    1 
HETATM 4643 N  N7    B ATP H 3 .   ? 3.417   18.213  2.514   0.38 33.98 ? 315 ATP A N7    1 
HETATM 4644 C  C5    A ATP H 3 .   ? 0.169   10.525  0.480   0.62 25.51 ? 315 ATP A C5    1 
HETATM 4645 C  C5    B ATP H 3 .   ? 4.473   18.460  1.712   0.38 29.78 ? 315 ATP A C5    1 
HETATM 4646 C  C6    A ATP H 3 .   ? -0.372  9.406   -0.164  0.62 34.07 ? 315 ATP A C6    1 
HETATM 4647 C  C6    B ATP H 3 .   ? 5.393   19.514  1.620   0.38 15.66 ? 315 ATP A C6    1 
HETATM 4648 N  N6    A ATP H 3 .   ? -1.851  9.141   -0.105  0.62 35.47 ? 315 ATP A N6    1 
HETATM 4649 N  N6    B ATP H 3 .   ? 5.299   20.685  2.550   0.38 13.68 ? 315 ATP A N6    1 
HETATM 4650 N  N1    A ATP H 3 .   ? 0.458   8.584   -0.835  0.62 39.62 ? 315 ATP A N1    1 
HETATM 4651 N  N1    B ATP H 3 .   ? 6.355   19.450  0.681   0.38 21.45 ? 315 ATP A N1    1 
HETATM 4652 C  C2    A ATP H 3 .   ? 1.783   8.830   -0.884  0.62 41.43 ? 315 ATP A C2    1 
HETATM 4653 C  C2    B ATP H 3 .   ? 6.439   18.397  -0.153  0.38 10.97 ? 315 ATP A C2    1 
HETATM 4654 N  N3    A ATP H 3 .   ? 2.327   9.891   -0.273  0.62 36.85 ? 315 ATP A N3    1 
HETATM 4655 N  N3    B ATP H 3 .   ? 5.572   17.378  -0.089  0.38 26.54 ? 315 ATP A N3    1 
HETATM 4656 C  C4    A ATP H 3 .   ? 1.554   10.751  0.409   0.62 34.38 ? 315 ATP A C4    1 
HETATM 4657 C  C4    B ATP H 3 .   ? 4.587   17.376  0.826   0.38 30.38 ? 315 ATP A C4    1 
HETATM 4658 P  PG    A ATP I 3 .   ? 12.860  -13.676 13.871  0.58 19.71 ? 312 ATP B PG    1 
HETATM 4659 P  PG    B ATP I 3 .   ? 12.797  -13.664 13.806  0.42 20.88 ? 312 ATP B PG    1 
HETATM 4660 O  O1G   A ATP I 3 .   ? 12.015  -14.845 14.255  0.58 14.18 ? 312 ATP B O1G   1 
HETATM 4661 O  O1G   B ATP I 3 .   ? 13.293  -12.991 15.047  0.42 20.49 ? 312 ATP B O1G   1 
HETATM 4662 O  O2G   A ATP I 3 .   ? 13.191  -12.921 15.160  0.58 21.02 ? 312 ATP B O2G   1 
HETATM 4663 O  O2G   B ATP I 3 .   ? 14.028  -14.136 13.017  0.42 21.63 ? 312 ATP B O2G   1 
HETATM 4664 O  O3G   A ATP I 3 .   ? 14.129  -14.129 13.191  0.58 18.56 ? 312 ATP B O3G   1 
HETATM 4665 O  O3G   B ATP I 3 .   ? 11.908  -14.817 14.175  0.42 21.75 ? 312 ATP B O3G   1 
HETATM 4666 P  PB    A ATP I 3 .   ? 10.894  -12.846 12.005  0.58 22.09 ? 312 ATP B PB    1 
HETATM 4667 P  PB    B ATP I 3 .   ? 10.962  -12.787 11.905  0.42 29.21 ? 312 ATP B PB    1 
HETATM 4668 O  O1B   A ATP I 3 .   ? 10.472  -11.379 11.563  0.58 23.53 ? 312 ATP B O1B   1 
HETATM 4669 O  O1B   B ATP I 3 .   ? 9.825   -13.664 12.568  0.42 15.13 ? 312 ATP B O1B   1 
HETATM 4670 O  O2B   A ATP I 3 .   ? 9.679   -13.592 12.573  0.58 22.10 ? 312 ATP B O2B   1 
HETATM 4671 O  O2B   B ATP I 3 .   ? 10.398  -11.420 11.450  0.42 26.46 ? 312 ATP B O2B   1 
HETATM 4672 O  O3B   A ATP I 3 .   ? 12.065  -12.632 13.062  0.58 24.41 ? 312 ATP B O3B   1 
HETATM 4673 O  O3B   B ATP I 3 .   ? 12.106  -12.561 12.986  0.42 24.50 ? 312 ATP B O3B   1 
HETATM 4674 P  PA    A ATP I 3 .   ? 12.080  -13.037 9.509   0.58 37.44 ? 312 ATP B PA    1 
HETATM 4675 P  PA    B ATP I 3 .   ? 12.191  -12.991 9.485   0.42 36.87 ? 312 ATP B PA    1 
HETATM 4676 O  O1A   A ATP I 3 .   ? 12.814  -11.752 9.838   0.58 35.13 ? 312 ATP B O1A   1 
HETATM 4677 O  O1A   B ATP I 3 .   ? 12.989  -11.787 9.936   0.42 36.14 ? 312 ATP B O1A   1 
HETATM 4678 O  O2A   A ATP I 3 .   ? 13.028  -14.051 8.851   0.58 34.82 ? 312 ATP B O2A   1 
HETATM 4679 O  O2A   B ATP I 3 .   ? 13.083  -14.027 8.787   0.42 34.07 ? 312 ATP B O2A   1 
HETATM 4680 O  O3A   A ATP I 3 .   ? 11.477  -13.631 10.778  0.58 28.13 ? 312 ATP B O3A   1 
HETATM 4681 O  O3A   B ATP I 3 .   ? 11.525  -13.614 10.705  0.42 31.32 ? 312 ATP B O3A   1 
HETATM 4682 O  "O5'" A ATP I 3 .   ? 10.902  -12.679 8.471   0.58 41.80 ? 312 ATP B "O5'" 1 
HETATM 4683 O  "O5'" B ATP I 3 .   ? 11.054  -12.453 8.479   0.42 44.17 ? 312 ATP B "O5'" 1 
HETATM 4684 C  "C5'" A ATP I 3 .   ? 9.615   -13.140 8.648   0.58 34.84 ? 312 ATP B "C5'" 1 
HETATM 4685 C  "C5'" B ATP I 3 .   ? 11.406  -11.926 7.251   0.42 39.32 ? 312 ATP B "C5'" 1 
HETATM 4686 C  "C4'" A ATP I 3 .   ? 8.647   -12.650 7.680   0.58 36.89 ? 312 ATP B "C4'" 1 
HETATM 4687 C  "C4'" B ATP I 3 .   ? 10.503  -12.227 6.150   0.42 37.84 ? 312 ATP B "C4'" 1 
HETATM 4688 O  "O4'" A ATP I 3 .   ? 8.987   -11.278 7.388   0.58 37.08 ? 312 ATP B "O4'" 1 
HETATM 4689 O  "O4'" B ATP I 3 .   ? 10.278  -13.651 6.164   0.42 35.07 ? 312 ATP B "O4'" 1 
HETATM 4690 C  "C3'" A ATP I 3 .   ? 8.810   -13.362 6.409   0.58 39.84 ? 312 ATP B "C3'" 1 
HETATM 4691 C  "C3'" B ATP I 3 .   ? 9.219   -11.569 6.411   0.42 38.40 ? 312 ATP B "C3'" 1 
HETATM 4692 O  "O3'" A ATP I 3 .   ? 7.947   -14.429 6.339   0.58 43.06 ? 312 ATP B "O3'" 1 
HETATM 4693 O  "O3'" B ATP I 3 .   ? 8.935   -10.666 5.414   0.42 38.82 ? 312 ATP B "O3'" 1 
HETATM 4694 C  "C2'" A ATP I 3 .   ? 8.501   -12.359 5.389   0.58 43.93 ? 312 ATP B "C2'" 1 
HETATM 4695 C  "C2'" B ATP I 3 .   ? 8.198   -12.624 6.468   0.42 41.59 ? 312 ATP B "C2'" 1 
HETATM 4696 O  "O2'" A ATP I 3 .   ? 7.151   -12.347 5.188   0.58 52.26 ? 312 ATP B "O2'" 1 
HETATM 4697 O  "O2'" B ATP I 3 .   ? 7.267   -12.416 5.490   0.42 48.48 ? 312 ATP B "O2'" 1 
HETATM 4698 C  "C1'" A ATP I 3 .   ? 8.923   -11.077 5.997   0.58 38.57 ? 312 ATP B "C1'" 1 
HETATM 4699 C  "C1'" B ATP I 3 .   ? 8.899   -13.914 6.257   0.42 39.62 ? 312 ATP B "C1'" 1 
HETATM 4700 N  N9    A ATP I 3 .   ? 10.215  -10.617 5.499   0.58 33.92 ? 312 ATP B N9    1 
HETATM 4701 N  N9    B ATP I 3 .   ? 8.636   -14.852 7.347   0.42 30.25 ? 312 ATP B N9    1 
HETATM 4702 C  C8    A ATP I 3 .   ? 11.407  -10.884 6.062   0.58 34.05 ? 312 ATP B C8    1 
HETATM 4703 C  C8    B ATP I 3 .   ? 9.352   -14.936 8.483   0.42 35.26 ? 312 ATP B C8    1 
HETATM 4704 N  N7    A ATP I 3 .   ? 12.367  -10.283 5.320   0.58 33.23 ? 312 ATP B N7    1 
HETATM 4705 N  N7    B ATP I 3 .   ? 8.812   -15.912 9.251   0.42 32.64 ? 312 ATP B N7    1 
HETATM 4706 C  C5    A ATP I 3 .   ? 11.784  -9.634  4.292   0.58 30.38 ? 312 ATP B C5    1 
HETATM 4707 C  C5    B ATP I 3 .   ? 7.759   -16.445 8.596   0.42 27.32 ? 312 ATP B C5    1 
HETATM 4708 C  C6    A ATP I 3 .   ? 12.268  -8.856  3.232   0.58 34.53 ? 312 ATP B C6    1 
HETATM 4709 C  C6    B ATP I 3 .   ? 6.845   -17.464 8.894   0.42 19.02 ? 312 ATP B C6    1 
HETATM 4710 N  N6    A ATP I 3 .   ? 13.742  -8.603  3.071   0.58 38.43 ? 312 ATP B N6    1 
HETATM 4711 N  N6    B ATP I 3 .   ? 6.939   -18.208 10.187  0.42 14.08 ? 312 ATP B N6    1 
HETATM 4712 N  N1    A ATP I 3 .   ? 11.387  -8.339  2.354   0.58 36.07 ? 312 ATP B N1    1 
HETATM 4713 N  N1    B ATP I 3 .   ? 5.884   -17.758 8.000   0.42 22.62 ? 312 ATP B N1    1 
HETATM 4714 C  C2    A ATP I 3 .   ? 10.065  -8.559  2.487   0.58 36.92 ? 312 ATP B C2    1 
HETATM 4715 C  C2    B ATP I 3 .   ? 5.797   -17.090 6.838   0.42 17.07 ? 312 ATP B C2    1 
HETATM 4716 N  N3    A ATP I 3 .   ? 9.576   -9.295  3.493   0.58 30.99 ? 312 ATP B N3    1 
HETATM 4717 N  N3    B ATP I 3 .   ? 6.659   -16.113 6.521   0.42 23.70 ? 312 ATP B N3    1 
HETATM 4718 C  C4    A ATP I 3 .   ? 10.399  -9.844  4.400   0.58 28.08 ? 312 ATP B C4    1 
HETATM 4719 C  C4    B ATP I 3 .   ? 7.639   -15.768 7.372   0.42 22.47 ? 312 ATP B C4    1 
HETATM 4720 MG MG    . MG  J 2 .   ? 1.186   22.383  10.301  1.00 23.82 ? 311 MG  B MG    1 
HETATM 4721 P  PG    . ATP K 3 .   ? 3.777   20.778  9.099   1.00 17.45 ? 313 ATP B PG    1 
HETATM 4722 O  O1G   . ATP K 3 .   ? 2.919   21.094  10.263  1.00 14.42 ? 313 ATP B O1G   1 
HETATM 4723 O  O2G   . ATP K 3 .   ? 5.215   20.654  9.652   1.00 16.47 ? 313 ATP B O2G   1 
HETATM 4724 O  O3G   . ATP K 3 .   ? 3.369   19.529  8.390   1.00 16.71 ? 313 ATP B O3G   1 
HETATM 4725 P  PB    . ATP K 3 .   ? 2.483   22.635  7.492   1.00 17.22 ? 313 ATP B PB    1 
HETATM 4726 O  O1B   . ATP K 3 .   ? 1.788   21.577  6.581   1.00 15.23 ? 313 ATP B O1B   1 
HETATM 4727 O  O2B   . ATP K 3 .   ? 1.553   23.269  8.534   1.00 17.79 ? 313 ATP B O2B   1 
HETATM 4728 O  O3B   . ATP K 3 .   ? 3.805   21.993  8.126   1.00 15.31 ? 313 ATP B O3B   1 
HETATM 4729 P  PA    . ATP K 3 .   ? 3.757   23.819  5.198   1.00 14.80 ? 313 ATP B PA    1 
HETATM 4730 O  O1A   . ATP K 3 .   ? 3.881   22.443  4.574   1.00 15.95 ? 313 ATP B O1A   1 
HETATM 4731 O  O2A   . ATP K 3 .   ? 3.066   24.815  4.259   1.00 18.39 ? 313 ATP B O2A   1 
HETATM 4732 O  O3A   . ATP K 3 .   ? 3.022   23.789  6.555   1.00 14.03 ? 313 ATP B O3A   1 
HETATM 4733 O  "O5'" . ATP K 3 .   ? 5.245   24.284  5.593   1.00 17.61 ? 313 ATP B "O5'" 1 
HETATM 4734 C  "C5'" . ATP K 3 .   ? 5.471   25.593  6.005   1.00 15.56 ? 313 ATP B "C5'" 1 
HETATM 4735 C  "C4'" . ATP K 3 .   ? 6.531   26.321  5.302   1.00 18.00 ? 313 ATP B "C4'" 1 
HETATM 4736 O  "O4'" . ATP K 3 .   ? 7.688   25.466  5.184   1.00 16.72 ? 313 ATP B "O4'" 1 
HETATM 4737 C  "C3'" . ATP K 3 .   ? 6.178   26.608  3.903   1.00 19.44 ? 313 ATP B "C3'" 1 
HETATM 4738 O  "O3'" . ATP K 3 .   ? 5.412   27.754  3.786   1.00 17.58 ? 313 ATP B "O3'" 1 
HETATM 4739 C  "C2'" . ATP K 3 .   ? 7.489   26.729  3.252   1.00 22.17 ? 313 ATP B "C2'" 1 
HETATM 4740 O  "O2'" . ATP K 3 .   ? 8.058   27.951  3.535   1.00 18.15 ? 313 ATP B "O2'" 1 
HETATM 4741 C  "C1'" . ATP K 3 .   ? 8.272   25.654  3.908   1.00 15.04 ? 313 ATP B "C1'" 1 
HETATM 4742 N  N9    . ATP K 3 .   ? 8.196   24.405  3.147   1.00 15.49 ? 313 ATP B N9    1 
HETATM 4743 C  C8    . ATP K 3 .   ? 7.357   23.386  3.413   1.00 15.90 ? 313 ATP B C8    1 
HETATM 4744 N  N7    . ATP K 3 .   ? 7.573   22.423  2.489   1.00 13.60 ? 313 ATP B N7    1 
HETATM 4745 C  C5    . ATP K 3 .   ? 8.559   22.813  1.656   1.00 13.94 ? 313 ATP B C5    1 
HETATM 4746 C  C6    . ATP K 3 .   ? 9.181   22.240  0.538   1.00 19.75 ? 313 ATP B C6    1 
HETATM 4747 N  N6    . ATP K 3 .   ? 8.816   20.871  0.032   1.00 19.59 ? 313 ATP B N6    1 
HETATM 4748 N  N1    . ATP K 3 .   ? 10.143  22.934  -0.081  1.00 19.82 ? 313 ATP B N1    1 
HETATM 4749 C  C2    . ATP K 3 .   ? 10.508  24.164  0.338   1.00 24.88 ? 313 ATP B C2    1 
HETATM 4750 N  N3    . ATP K 3 .   ? 9.928   24.740  1.391   1.00 15.63 ? 313 ATP B N3    1 
HETATM 4751 C  C4    . ATP K 3 .   ? 8.957   24.097  2.069   1.00 15.43 ? 313 ATP B C4    1 
HETATM 4752 K  K     . K   L 4 .   ? 13.671  18.777  8.808   1.00 19.50 ? 314 K   B K     1 
HETATM 4753 O  O     . HOH M 5 .   ? 5.385   8.680   7.041   1.00 17.84 ? 316 HOH A O     1 
HETATM 4754 O  O     . HOH M 5 .   ? -7.796  -17.620 23.206  1.00 57.01 ? 317 HOH A O     1 
HETATM 4755 O  O     . HOH M 5 .   ? 2.214   -25.650 36.424  1.00 38.98 ? 318 HOH A O     1 
HETATM 4756 O  O     . HOH M 5 .   ? 16.127  -19.564 20.331  1.00 20.46 ? 319 HOH A O     1 
HETATM 4757 O  O     . HOH M 5 .   ? 10.474  -18.892 11.062  1.00 21.40 ? 320 HOH A O     1 
HETATM 4758 O  O     . HOH M 5 .   ? 20.129  -27.179 -0.877  1.00 41.34 ? 321 HOH A O     1 
HETATM 4759 O  O     . HOH M 5 .   ? -5.768  -20.082 17.628  1.00 22.16 ? 322 HOH A O     1 
HETATM 4760 O  O     . HOH M 5 .   ? 6.214   -15.350 19.289  1.00 24.51 ? 323 HOH A O     1 
HETATM 4761 O  O     . HOH M 5 .   ? 8.515   -13.229 32.158  1.00 20.39 ? 324 HOH A O     1 
HETATM 4762 O  O     . HOH M 5 .   ? -0.050  -2.222  38.135  1.00 41.13 ? 325 HOH A O     1 
HETATM 4763 O  O     . HOH M 5 .   ? 5.907   -13.068 16.786  1.00 20.17 ? 326 HOH A O     1 
HETATM 4764 O  O     . HOH M 5 .   ? 11.423  -2.496  28.846  1.00 26.57 ? 327 HOH A O     1 
HETATM 4765 O  O     . HOH M 5 .   ? 1.924   18.163  13.591  1.00 47.65 ? 328 HOH A O     1 
HETATM 4766 O  O     . HOH M 5 .   ? 12.196  -10.148 22.882  1.00 29.26 ? 329 HOH A O     1 
HETATM 4767 O  O     . HOH M 5 .   ? 2.625   -22.236 4.043   1.00 33.83 ? 330 HOH A O     1 
HETATM 4768 O  O     . HOH M 5 .   ? 13.753  -10.692 27.167  1.00 21.95 ? 331 HOH A O     1 
HETATM 4769 O  O     . HOH M 5 .   ? 9.493   -17.956 23.546  1.00 21.72 ? 332 HOH A O     1 
HETATM 4770 O  O     . HOH M 5 .   ? 16.845  0.499   34.990  1.00 28.90 ? 333 HOH A O     1 
HETATM 4771 O  O     . HOH M 5 .   ? 19.001  -27.674 6.326   1.00 22.41 ? 334 HOH A O     1 
HETATM 4772 O  O     . HOH M 5 .   ? 12.618  -20.718 10.941  1.00 21.57 ? 335 HOH A O     1 
HETATM 4773 O  O     . HOH M 5 .   ? 16.267  -5.585  24.356  1.00 27.18 ? 336 HOH A O     1 
HETATM 4774 O  O     . HOH M 5 .   ? 10.543  -3.004  31.794  1.00 26.97 ? 337 HOH A O     1 
HETATM 4775 O  O     . HOH M 5 .   ? 13.580  1.187   23.203  1.00 29.07 ? 338 HOH A O     1 
HETATM 4776 O  O     . HOH M 5 .   ? -0.203  20.996  9.404   1.00 16.13 ? 339 HOH A O     1 
HETATM 4777 O  O     . HOH M 5 .   ? 16.386  0.067   40.923  1.00 44.47 ? 340 HOH A O     1 
HETATM 4778 O  O     . HOH M 5 .   ? -5.063  -0.483  28.269  1.00 42.60 ? 341 HOH A O     1 
HETATM 4779 O  O     . HOH M 5 .   ? 11.569  -4.898  24.648  1.00 59.36 ? 342 HOH A O     1 
HETATM 4780 O  O     . HOH M 5 .   ? -2.255  6.687   6.985   1.00 25.54 ? 343 HOH A O     1 
HETATM 4781 O  O     . HOH M 5 .   ? -1.051  18.936  11.678  1.00 63.94 ? 344 HOH A O     1 
HETATM 4782 O  O     . HOH M 5 .   ? -1.616  13.385  7.678   1.00 48.39 ? 345 HOH A O     1 
HETATM 4783 O  O     . HOH M 5 .   ? -4.863  4.801   23.814  1.00 30.05 ? 346 HOH A O     1 
HETATM 4784 O  O     . HOH M 5 .   ? -2.536  -2.638  15.262  1.00 27.98 ? 347 HOH A O     1 
HETATM 4785 O  O     . HOH M 5 .   ? 5.270   9.995   0.389   1.00 37.86 ? 348 HOH A O     1 
HETATM 4786 O  O     . HOH M 5 .   ? 12.238  -44.395 19.381  1.00 61.49 ? 349 HOH A O     1 
HETATM 4787 O  O     . HOH M 5 .   ? 24.018  -15.958 42.078  1.00 46.30 ? 350 HOH A O     1 
HETATM 4788 O  O     . HOH M 5 .   ? 17.890  -30.854 7.984   1.00 25.87 ? 351 HOH A O     1 
HETATM 4789 O  O     . HOH M 5 .   ? 2.882   -16.857 41.288  1.00 48.59 ? 352 HOH A O     1 
HETATM 4790 O  O     . HOH M 5 .   ? 14.434  -18.370 10.630  1.00 21.40 ? 353 HOH A O     1 
HETATM 4791 O  O     . HOH M 5 .   ? 29.506  -17.982 24.463  1.00 55.94 ? 354 HOH A O     1 
HETATM 4792 O  O     . HOH M 5 .   ? -0.285  -4.974  -0.232  1.00 37.23 ? 355 HOH A O     1 
HETATM 4793 O  O     . HOH M 5 .   ? 8.846   2.380   38.798  1.00 57.64 ? 356 HOH A O     1 
HETATM 4794 O  O     . HOH M 5 .   ? 29.263  -16.287 28.354  1.00 50.15 ? 357 HOH A O     1 
HETATM 4795 O  O     . HOH M 5 .   ? 7.087   -13.009 13.255  1.00 31.25 ? 358 HOH A O     1 
HETATM 4796 O  O     . HOH M 5 .   ? 11.659  -10.040 25.467  1.00 23.64 ? 359 HOH A O     1 
HETATM 4797 O  O     . HOH M 5 .   ? 6.023   -15.186 14.089  1.00 27.38 ? 360 HOH A O     1 
HETATM 4798 O  O     . HOH M 5 .   ? 12.864  12.917  3.456   1.00 35.73 ? 361 HOH A O     1 
HETATM 4799 O  O     . HOH M 5 .   ? 3.844   -34.083 10.484  1.00 35.11 ? 362 HOH A O     1 
HETATM 4800 O  O     . HOH M 5 .   ? 25.712  -33.705 13.822  1.00 40.25 ? 363 HOH A O     1 
HETATM 4801 O  O     . HOH M 5 .   ? 14.599  -12.978 28.909  1.00 23.79 ? 364 HOH A O     1 
HETATM 4802 O  O     . HOH M 5 .   ? 6.954   -6.778  21.298  1.00 44.29 ? 365 HOH A O     1 
HETATM 4803 O  O     . HOH M 5 .   ? -7.796  2.901   3.957   1.00 47.51 ? 366 HOH A O     1 
HETATM 4804 O  O     . HOH M 5 .   ? -0.949  -10.866 37.871  1.00 34.29 ? 367 HOH A O     1 
HETATM 4805 O  O     . HOH M 5 .   ? 21.906  -5.873  44.030  0.50 44.28 ? 368 HOH A O     1 
HETATM 4806 O  O     . HOH M 5 .   ? -0.816  2.319   1.753   1.00 32.85 ? 369 HOH A O     1 
HETATM 4807 O  O     . HOH M 5 .   ? 0.155   -18.070 32.991  1.00 25.82 ? 370 HOH A O     1 
HETATM 4808 O  O     . HOH M 5 .   ? 17.422  -11.864 27.689  1.00 32.25 ? 371 HOH A O     1 
HETATM 4809 O  O     . HOH M 5 .   ? 19.037  -21.917 4.283   1.00 49.77 ? 372 HOH A O     1 
HETATM 4810 O  O     . HOH M 5 .   ? 24.200  -7.389  35.094  1.00 33.45 ? 373 HOH A O     1 
HETATM 4811 O  O     . HOH M 5 .   ? 19.114  -35.612 25.094  1.00 34.51 ? 374 HOH A O     1 
HETATM 4812 O  O     . HOH M 5 .   ? 6.487   -6.506  18.751  1.00 37.62 ? 375 HOH A O     1 
HETATM 4813 O  O     . HOH M 5 .   ? 0.562   -11.699 40.175  1.00 34.51 ? 376 HOH A O     1 
HETATM 4814 O  O     . HOH M 5 .   ? -3.111  -6.483  12.227  1.00 24.83 ? 377 HOH A O     1 
HETATM 4815 O  O     . HOH M 5 .   ? 10.839  10.189  3.347   1.00 23.58 ? 378 HOH A O     1 
HETATM 4816 O  O     . HOH M 5 .   ? 6.397   -9.556  22.266  1.00 33.15 ? 379 HOH A O     1 
HETATM 4817 O  O     . HOH M 5 .   ? 21.205  -20.392 7.027   1.00 38.99 ? 380 HOH A O     1 
HETATM 4818 O  O     . HOH M 5 .   ? 23.359  -6.240  27.317  1.00 37.36 ? 381 HOH A O     1 
HETATM 4819 O  O     . HOH M 5 .   ? 0.325   12.396  5.618   1.00 28.85 ? 382 HOH A O     1 
HETATM 4820 O  O     . HOH M 5 .   ? 12.271  -1.419  33.293  1.00 29.19 ? 383 HOH A O     1 
HETATM 4821 O  O     . HOH M 5 .   ? 14.618  -2.666  32.901  1.00 33.66 ? 384 HOH A O     1 
HETATM 4822 O  O     . HOH M 5 .   ? 4.902   -1.959  38.151  1.00 50.90 ? 385 HOH A O     1 
HETATM 4823 O  O     . HOH M 5 .   ? 11.669  -5.390  22.390  1.00 27.47 ? 386 HOH A O     1 
HETATM 4824 O  O     . HOH M 5 .   ? 18.105  -27.120 32.585  1.00 28.22 ? 387 HOH A O     1 
HETATM 4825 O  O     . HOH M 5 .   ? -7.366  -4.160  6.762   1.00 36.01 ? 388 HOH A O     1 
HETATM 4826 O  O     . HOH M 5 .   ? 14.291  -4.341  30.403  1.00 26.66 ? 389 HOH A O     1 
HETATM 4827 O  O     . HOH M 5 .   ? 6.327   -0.297  37.281  1.00 36.70 ? 390 HOH A O     1 
HETATM 4828 O  O     . HOH M 5 .   ? 0.925   -29.042 5.222   1.00 23.48 ? 391 HOH A O     1 
HETATM 4829 O  O     . HOH M 5 .   ? 15.475  2.738   24.530  1.00 26.36 ? 392 HOH A O     1 
HETATM 4830 O  O     . HOH M 5 .   ? 21.448  -16.282 11.000  1.00 33.41 ? 393 HOH A O     1 
HETATM 4831 O  O     . HOH M 5 .   ? 3.954   -20.553 38.531  1.00 36.27 ? 394 HOH A O     1 
HETATM 4832 O  O     . HOH M 5 .   ? 10.951  1.946   22.757  1.00 34.34 ? 395 HOH A O     1 
HETATM 4833 O  O     . HOH M 5 .   ? 25.085  -28.300 9.774   1.00 29.42 ? 396 HOH A O     1 
HETATM 4834 O  O     . HOH M 5 .   ? 21.163  1.738   33.565  1.00 45.36 ? 397 HOH A O     1 
HETATM 4835 O  O     . HOH M 5 .   ? 10.863  -6.882  43.883  1.00 43.61 ? 398 HOH A O     1 
HETATM 4836 O  O     . HOH M 5 .   ? -7.892  -20.049 24.469  1.00 29.94 ? 399 HOH A O     1 
HETATM 4837 O  O     . HOH M 5 .   ? 21.951  -22.824 45.128  1.00 38.71 ? 400 HOH A O     1 
HETATM 4838 O  O     . HOH M 5 .   ? 17.950  2.660   27.953  1.00 41.83 ? 401 HOH A O     1 
HETATM 4839 O  O     . HOH M 5 .   ? 24.389  -7.888  37.956  1.00 32.33 ? 402 HOH A O     1 
HETATM 4840 O  O     . HOH M 5 .   ? 16.921  0.822   25.992  1.00 35.67 ? 403 HOH A O     1 
HETATM 4841 O  O     . HOH M 5 .   ? 18.629  -28.499 35.416  1.00 50.68 ? 404 HOH A O     1 
HETATM 4842 O  O     . HOH M 5 .   ? 2.212   -11.474 20.332  1.00 36.26 ? 405 HOH A O     1 
HETATM 4843 O  O     . HOH M 5 .   ? 26.879  -22.663 2.175   1.00 31.98 ? 406 HOH A O     1 
HETATM 4844 O  O     . HOH M 5 .   ? 19.483  -10.223 22.335  1.00 35.21 ? 407 HOH A O     1 
HETATM 4845 O  O     . HOH M 5 .   ? 13.237  -26.431 46.441  1.00 44.02 ? 408 HOH A O     1 
HETATM 4846 O  O     . HOH M 5 .   ? 22.572  -32.591 3.115   1.00 31.21 ? 409 HOH A O     1 
HETATM 4847 O  O     . HOH M 5 .   ? -4.381  -27.532 26.037  1.00 41.90 ? 410 HOH A O     1 
HETATM 4848 O  O     . HOH M 5 .   ? -10.451 -21.786 22.716  1.00 30.01 ? 411 HOH A O     1 
HETATM 4849 O  O     . HOH M 5 .   ? -2.539  -32.646 24.778  1.00 50.58 ? 412 HOH A O     1 
HETATM 4850 O  O     . HOH M 5 .   ? 17.513  -23.339 7.257   1.00 35.37 ? 413 HOH A O     1 
HETATM 4851 O  O     . HOH M 5 .   ? 9.477   -7.049  24.035  1.00 37.75 ? 414 HOH A O     1 
HETATM 4852 O  O     . HOH M 5 .   ? 26.705  -19.922 1.585   1.00 57.27 ? 415 HOH A O     1 
HETATM 4853 O  O     . HOH M 5 .   ? 0.570   -1.535  3.164   1.00 37.61 ? 416 HOH A O     1 
HETATM 4854 O  O     . HOH M 5 .   ? 12.774  -23.404 5.385   1.00 37.98 ? 417 HOH A O     1 
HETATM 4855 O  O     . HOH M 5 .   ? 18.977  -38.068 17.267  1.00 45.06 ? 418 HOH A O     1 
HETATM 4856 O  O     . HOH M 5 .   ? 6.997   -11.680 19.173  1.00 35.92 ? 419 HOH A O     1 
HETATM 4857 O  O     . HOH M 5 .   ? 7.828   -12.000 22.121  1.00 30.67 ? 420 HOH A O     1 
HETATM 4858 O  O     . HOH M 5 .   ? -0.268  -24.552 8.011   1.00 34.08 ? 421 HOH A O     1 
HETATM 4859 O  O     . HOH M 5 .   ? 3.010   6.033   23.990  1.00 35.77 ? 422 HOH A O     1 
HETATM 4860 O  O     . HOH M 5 .   ? -5.467  -14.994 29.837  1.00 45.33 ? 423 HOH A O     1 
HETATM 4861 O  O     . HOH M 5 .   ? -3.409  -13.348 22.639  1.00 34.41 ? 424 HOH A O     1 
HETATM 4862 O  O     . HOH M 5 .   ? 16.178  -14.291 27.135  1.00 28.34 ? 425 HOH A O     1 
HETATM 4863 O  O     . HOH M 5 .   ? 15.313  -4.461  18.339  1.00 50.18 ? 426 HOH A O     1 
HETATM 4864 O  O     . HOH M 5 .   ? 0.107   -35.236 9.620   1.00 46.47 ? 427 HOH A O     1 
HETATM 4865 O  O     . HOH M 5 .   ? 10.911  -1.746  23.500  1.00 36.21 ? 428 HOH A O     1 
HETATM 4866 O  O     . HOH M 5 .   ? -10.707 -32.559 16.339  1.00 50.96 ? 429 HOH A O     1 
HETATM 4867 O  O     . HOH M 5 .   ? 2.875   -23.343 37.238  1.00 35.26 ? 430 HOH A O     1 
HETATM 4868 O  O     . HOH M 5 .   ? -2.852  10.254  7.968   1.00 34.82 ? 431 HOH A O     1 
HETATM 4869 O  O     . HOH M 5 .   ? 26.246  -6.881  33.707  1.00 36.03 ? 432 HOH A O     1 
HETATM 4870 O  O     . HOH M 5 .   ? 14.627  -9.657  44.231  1.00 39.14 ? 433 HOH A O     1 
HETATM 4871 O  O     . HOH M 5 .   ? 1.750   -36.104 12.223  1.00 52.80 ? 434 HOH A O     1 
HETATM 4872 O  O     . HOH M 5 .   ? 14.540  -15.478 19.947  1.00 28.21 ? 435 HOH A O     1 
HETATM 4873 O  O     . HOH M 5 .   ? -8.201  -18.066 10.597  1.00 29.39 ? 436 HOH A O     1 
HETATM 4874 O  O     . HOH M 5 .   ? -2.266  -6.324  0.564   1.00 33.51 ? 437 HOH A O     1 
HETATM 4875 O  O     . HOH M 5 .   ? 26.872  -28.676 4.691   1.00 50.13 ? 438 HOH A O     1 
HETATM 4876 O  O     . HOH M 5 .   ? 10.838  3.301   37.786  1.00 39.53 ? 439 HOH A O     1 
HETATM 4877 O  O     . HOH M 5 .   ? 7.309   -27.482 41.020  1.00 35.38 ? 440 HOH A O     1 
HETATM 4878 O  O     . HOH M 5 .   ? 16.955  -16.707 46.071  1.00 35.01 ? 441 HOH A O     1 
HETATM 4879 O  O     . HOH M 5 .   ? 4.627   -38.827 26.385  1.00 55.76 ? 442 HOH A O     1 
HETATM 4880 O  O     . HOH M 5 .   ? 10.616  -12.328 21.914  1.00 24.05 ? 443 HOH A O     1 
HETATM 4881 O  O     . HOH M 5 .   ? 14.622  -2.216  42.461  1.00 40.84 ? 444 HOH A O     1 
HETATM 4882 O  O     . HOH M 5 .   ? 9.689   -37.531 11.765  1.00 40.80 ? 445 HOH A O     1 
HETATM 4883 O  O     . HOH M 5 .   ? 3.560   -19.727 3.616   1.00 40.64 ? 446 HOH A O     1 
HETATM 4884 O  O     . HOH M 5 .   ? 11.143  -15.076 22.396  1.00 35.89 ? 447 HOH A O     1 
HETATM 4885 O  O     . HOH M 5 .   ? 0.264   -25.214 34.451  1.00 31.57 ? 448 HOH A O     1 
HETATM 4886 O  O     . HOH M 5 .   ? -6.176  7.215   11.538  1.00 32.00 ? 449 HOH A O     1 
HETATM 4887 O  O     . HOH M 5 .   ? -2.355  -17.953 34.120  1.00 35.22 ? 450 HOH A O     1 
HETATM 4888 O  O     . HOH M 5 .   ? -8.841  -32.242 14.169  1.00 27.82 ? 451 HOH A O     1 
HETATM 4889 O  O     . HOH M 5 .   ? 6.886   5.319   31.928  1.00 44.27 ? 452 HOH A O     1 
HETATM 4890 O  O     . HOH M 5 .   ? 21.516  -17.135 17.370  1.00 40.08 ? 453 HOH A O     1 
HETATM 4891 O  O     . HOH M 5 .   ? -5.349  -0.431  25.709  1.00 34.63 ? 454 HOH A O     1 
HETATM 4892 O  O     . HOH M 5 .   ? -1.452  -36.746 23.669  1.00 48.10 ? 455 HOH A O     1 
HETATM 4893 O  O     . HOH M 5 .   ? 10.878  -21.892 6.911   1.00 32.80 ? 456 HOH A O     1 
HETATM 4894 O  O     . HOH M 5 .   ? -0.128  -8.508  37.742  1.00 30.85 ? 457 HOH A O     1 
HETATM 4895 O  O     . HOH M 5 .   ? 22.507  -5.550  34.619  1.00 32.63 ? 458 HOH A O     1 
HETATM 4896 O  O     . HOH M 5 .   ? 11.560  16.220  1.501   1.00 37.22 ? 459 HOH A O     1 
HETATM 4897 O  O     . HOH M 5 .   ? 31.751  -15.878 34.559  1.00 57.99 ? 460 HOH A O     1 
HETATM 4898 O  O     . HOH M 5 .   ? -5.590  -0.801  17.568  1.00 34.69 ? 461 HOH A O     1 
HETATM 4899 O  O     . HOH M 5 .   ? -6.499  1.660   17.682  1.00 33.53 ? 462 HOH A O     1 
HETATM 4900 O  O     . HOH M 5 .   ? 12.430  6.047   34.516  1.00 40.66 ? 463 HOH A O     1 
HETATM 4901 O  O     . HOH M 5 .   ? -4.962  -3.363  15.293  1.00 43.75 ? 464 HOH A O     1 
HETATM 4902 O  O     . HOH M 5 .   ? -3.197  -9.198  10.947  1.00 41.31 ? 465 HOH A O     1 
HETATM 4903 O  O     . HOH M 5 .   ? -1.530  -21.920 9.341   1.00 35.41 ? 466 HOH A O     1 
HETATM 4904 O  O     . HOH M 5 .   ? -7.112  8.597   13.682  1.00 43.71 ? 467 HOH A O     1 
HETATM 4905 O  O     . HOH M 5 .   ? 15.568  -5.765  20.398  1.00 44.77 ? 468 HOH A O     1 
HETATM 4906 O  O     . HOH M 5 .   ? -4.742  -5.660  25.636  1.00 47.04 ? 469 HOH A O     1 
HETATM 4907 O  O     . HOH M 5 .   ? 25.286  -2.638  42.121  1.00 45.03 ? 470 HOH A O     1 
HETATM 4908 O  O     . HOH M 5 .   ? 10.671  -39.414 23.466  1.00 35.61 ? 471 HOH A O     1 
HETATM 4909 O  O     . HOH M 5 .   ? 9.401   -39.371 20.959  1.00 37.00 ? 472 HOH A O     1 
HETATM 4910 O  O     . HOH M 5 .   ? 6.727   -13.466 10.570  1.00 39.46 ? 473 HOH A O     1 
HETATM 4911 O  O     . HOH M 5 .   ? -6.484  1.707   24.737  1.00 49.62 ? 474 HOH A O     1 
HETATM 4912 O  O     . HOH M 5 .   ? -8.367  -1.409  0.209   1.00 39.89 ? 475 HOH A O     1 
HETATM 4913 O  O     . HOH M 5 .   ? 24.768  -35.789 13.053  1.00 47.38 ? 476 HOH A O     1 
HETATM 4914 O  O     . HOH M 5 .   ? 4.658   -13.220 20.721  1.00 37.22 ? 477 HOH A O     1 
HETATM 4915 O  O     . HOH M 5 .   ? 22.070  -11.054 21.934  1.00 38.60 ? 478 HOH A O     1 
HETATM 4916 O  O     . HOH M 5 .   ? 9.742   3.564   24.436  1.00 37.95 ? 479 HOH A O     1 
HETATM 4917 O  O     . HOH M 5 .   ? -3.194  -14.464 28.593  1.00 39.83 ? 480 HOH A O     1 
HETATM 4918 O  O     . HOH M 5 .   ? -4.735  -34.753 5.477   1.00 44.21 ? 481 HOH A O     1 
HETATM 4919 O  O     . HOH M 5 .   ? 27.109  -21.419 23.665  1.00 49.87 ? 482 HOH A O     1 
HETATM 4920 O  O     . HOH M 5 .   ? 18.991  2.310   34.800  1.00 39.97 ? 483 HOH A O     1 
HETATM 4921 O  O     . HOH M 5 .   ? -4.348  -23.917 35.480  1.00 56.68 ? 484 HOH A O     1 
HETATM 4922 O  O     . HOH M 5 .   ? 25.738  -27.786 33.158  1.00 40.66 ? 485 HOH A O     1 
HETATM 4923 O  O     . HOH M 5 .   ? 20.600  -32.071 34.346  1.00 49.94 ? 486 HOH A O     1 
HETATM 4924 O  O     . HOH M 5 .   ? -0.433  -32.066 6.902   1.00 41.25 ? 487 HOH A O     1 
HETATM 4925 O  O     . HOH M 5 .   ? 20.891  -17.226 8.199   1.00 49.37 ? 488 HOH A O     1 
HETATM 4926 O  O     . HOH M 5 .   ? -4.326  -7.290  27.602  1.00 53.39 ? 489 HOH A O     1 
HETATM 4927 O  O     . HOH M 5 .   ? 18.728  -14.564 14.366  1.00 47.30 ? 490 HOH A O     1 
HETATM 4928 O  O     . HOH M 5 .   ? -4.613  -18.556 33.754  1.00 41.95 ? 491 HOH A O     1 
HETATM 4929 O  O     . HOH M 5 .   ? 27.587  -4.204  40.665  1.00 39.67 ? 492 HOH A O     1 
HETATM 4930 O  O     . HOH M 5 .   ? 27.850  -19.367 18.827  1.00 49.86 ? 493 HOH A O     1 
HETATM 4931 O  O     . HOH M 5 .   ? 24.334  -16.288 10.954  1.00 49.71 ? 494 HOH A O     1 
HETATM 4932 O  O     . HOH M 5 .   ? 24.047  -16.748 17.884  1.00 38.90 ? 495 HOH A O     1 
HETATM 4933 O  O     . HOH M 5 .   ? -8.483  7.033   17.813  1.00 34.21 ? 496 HOH A O     1 
HETATM 4934 O  O     . HOH M 5 .   ? 3.538   -5.221  18.798  1.00 46.19 ? 497 HOH A O     1 
HETATM 4935 O  O     . HOH M 5 .   ? 22.276  -32.577 29.806  1.00 60.68 ? 498 HOH A O     1 
HETATM 4936 O  O     . HOH M 5 .   ? 0.673   -14.721 7.392   1.00 38.93 ? 499 HOH A O     1 
HETATM 4937 O  O     . HOH M 5 .   ? 13.393  -7.418  21.564  1.00 35.39 ? 500 HOH A O     1 
HETATM 4938 O  O     . HOH M 5 .   ? 2.735   -2.179  39.459  1.00 44.55 ? 501 HOH A O     1 
HETATM 4939 O  O     . HOH M 5 .   ? 1.024   -37.218 19.856  1.00 42.69 ? 502 HOH A O     1 
HETATM 4940 O  O     . HOH M 5 .   ? 4.939   8.326   -1.273  1.00 48.52 ? 503 HOH A O     1 
HETATM 4941 O  O     . HOH M 5 .   ? 17.501  -19.195 47.127  1.00 41.51 ? 504 HOH A O     1 
HETATM 4942 O  O     . HOH M 5 .   ? 2.379   15.906  14.439  1.00 47.79 ? 505 HOH A O     1 
HETATM 4943 O  O     . HOH M 5 .   ? 13.510  -39.389 22.938  1.00 55.38 ? 506 HOH A O     1 
HETATM 4944 O  O     . HOH M 5 .   ? -9.297  3.606   6.314   1.00 50.17 ? 507 HOH A O     1 
HETATM 4945 O  O     . HOH M 5 .   ? -5.149  -21.274 32.327  1.00 38.84 ? 508 HOH A O     1 
HETATM 4946 O  O     . HOH M 5 .   ? 20.353  -14.793 15.976  1.00 28.96 ? 509 HOH A O     1 
HETATM 4947 O  O     . HOH M 5 .   ? 31.685  -20.471 9.587   1.00 62.07 ? 510 HOH A O     1 
HETATM 4948 O  O     . HOH M 5 .   ? 13.428  -7.381  44.463  1.00 46.31 ? 511 HOH A O     1 
HETATM 4949 O  O     . HOH M 5 .   ? -5.307  -2.781  33.033  1.00 50.33 ? 512 HOH A O     1 
HETATM 4950 O  O     . HOH M 5 .   ? 23.702  -1.268  39.954  1.00 33.38 ? 513 HOH A O     1 
HETATM 4951 O  O     . HOH M 5 .   ? -1.985  15.309  9.986   1.00 35.02 ? 514 HOH A O     1 
HETATM 4952 O  O     . HOH M 5 .   ? 12.266  -4.041  43.259  1.00 44.47 ? 515 HOH A O     1 
HETATM 4953 O  O     . HOH M 5 .   ? 8.744   -14.064 19.656  1.00 41.47 ? 516 HOH A O     1 
HETATM 4954 O  O     . HOH M 5 .   ? 24.853  -1.090  37.095  1.00 51.26 ? 517 HOH A O     1 
HETATM 4955 O  O     . HOH M 5 .   ? 0.805   -21.659 6.277   1.00 28.73 ? 518 HOH A O     1 
HETATM 4956 O  O     . HOH M 5 .   ? -6.162  -16.440 21.638  1.00 38.82 ? 519 HOH A O     1 
HETATM 4957 O  O     . HOH M 5 .   ? 15.906  6.248   32.615  1.00 52.05 ? 520 HOH A O     1 
HETATM 4958 O  O     . HOH M 5 .   ? 18.245  -13.714 49.203  1.00 56.64 ? 521 HOH A O     1 
HETATM 4959 O  O     . HOH M 5 .   ? 20.675  -28.562 -3.221  1.00 60.86 ? 522 HOH A O     1 
HETATM 4960 O  O     . HOH M 5 .   ? 8.966   -29.255 41.481  1.00 50.27 ? 523 HOH A O     1 
HETATM 4961 O  O     . HOH M 5 .   ? -6.566  -19.192 8.159   1.00 40.57 ? 524 HOH A O     1 
HETATM 4962 O  O     . HOH M 5 .   ? 1.309   -33.219 8.817   1.00 46.90 ? 525 HOH A O     1 
HETATM 4963 O  O     . HOH M 5 .   ? 4.768   3.484   21.221  1.00 46.31 ? 526 HOH A O     1 
HETATM 4964 O  O     . HOH M 5 .   ? 28.055  -15.476 23.662  1.00 45.95 ? 527 HOH A O     1 
HETATM 4965 O  O     . HOH M 5 .   ? -7.457  4.555   10.985  1.00 41.97 ? 528 HOH A O     1 
HETATM 4966 O  O     . HOH M 5 .   ? -1.323  18.765  4.230   1.00 23.63 ? 529 HOH A O     1 
HETATM 4967 O  O     . HOH M 5 .   ? 11.658  -15.208 19.415  1.00 63.85 ? 532 HOH A O     1 
HETATM 4968 O  O     . HOH M 5 .   ? 12.785  -18.083 18.678  1.00 15.69 ? 533 HOH A O     1 
HETATM 4969 O  O     . HOH M 5 .   ? 9.888   -17.579 19.776  1.00 17.21 ? 535 HOH A O     1 
HETATM 4970 O  O     . HOH M 5 .   ? 1.050   19.497  4.582   1.00 18.43 ? 536 HOH A O     1 
HETATM 4971 O  O     . HOH M 5 .   ? 11.424  -35.593 26.069  1.00 49.60 ? 537 HOH A O     1 
HETATM 4972 O  O     . HOH M 5 .   ? -1.368  -29.826 28.038  1.00 53.15 ? 540 HOH A O     1 
HETATM 4973 O  O     . HOH M 5 .   ? 22.467  -33.644 25.626  1.00 41.72 ? 541 HOH A O     1 
HETATM 4974 O  O     . HOH M 5 .   ? 9.790   -16.532 42.262  1.00 48.89 ? 542 HOH A O     1 
HETATM 4975 O  O     . HOH M 5 .   ? -2.475  8.895   6.171   1.00 42.35 ? 545 HOH A O     1 
HETATM 4976 O  O     . HOH M 5 .   ? 17.230  5.070   26.327  1.00 45.46 ? 546 HOH A O     1 
HETATM 4977 O  O     . HOH M 5 .   ? 5.764   -18.668 4.196   1.00 59.46 ? 547 HOH A O     1 
HETATM 4978 O  O     . HOH M 5 .   ? 15.664  -10.132 7.580   1.00 49.51 ? 552 HOH A O     1 
HETATM 4979 O  O     . HOH M 5 .   ? 25.255  -31.131 0.372   1.00 36.24 ? 553 HOH A O     1 
HETATM 4980 O  O     . HOH M 5 .   ? 10.914  -31.728 37.343  1.00 42.87 ? 555 HOH A O     1 
HETATM 4981 O  O     . HOH M 5 .   ? 22.214  -0.216  32.635  1.00 44.64 ? 556 HOH A O     1 
HETATM 4982 O  O     . HOH M 5 .   ? 5.648   -9.052  42.482  1.00 43.11 ? 558 HOH A O     1 
HETATM 4983 O  O     . HOH M 5 .   ? -9.275  -24.175 13.368  1.00 51.17 ? 559 HOH A O     1 
HETATM 4984 O  O     . HOH M 5 .   ? -9.028  -18.825 15.285  1.00 47.03 ? 560 HOH A O     1 
HETATM 4985 O  O     . HOH M 5 .   ? 29.111  -31.440 18.859  1.00 40.44 ? 566 HOH A O     1 
HETATM 4986 O  O     . HOH M 5 .   ? 3.593   -6.442  40.786  1.00 52.32 ? 567 HOH A O     1 
HETATM 4987 O  O     . HOH M 5 .   ? 30.649  -11.220 29.142  1.00 47.58 ? 569 HOH A O     1 
HETATM 4988 O  O     . HOH M 5 .   ? -1.831  -8.426  8.683   1.00 42.83 ? 570 HOH A O     1 
HETATM 4989 O  O     . HOH M 5 .   ? 15.558  -24.509 43.643  1.00 46.29 ? 572 HOH A O     1 
HETATM 4990 O  O     . HOH M 5 .   ? 10.988  9.669   0.671   1.00 58.64 ? 578 HOH A O     1 
HETATM 4991 O  O     . HOH M 5 .   ? 0.163   3.045   34.527  1.00 34.72 ? 579 HOH A O     1 
HETATM 4992 O  O     . HOH M 5 .   ? -7.445  5.774   2.170   1.00 37.30 ? 580 HOH A O     1 
HETATM 4993 O  O     . HOH M 5 .   ? 15.168  -31.547 38.493  1.00 48.60 ? 581 HOH A O     1 
HETATM 4994 O  O     . HOH M 5 .   ? 6.470   -9.165  18.208  1.00 47.73 ? 584 HOH A O     1 
HETATM 4995 O  O     . HOH M 5 .   ? -2.603  0.805   34.811  1.00 49.49 ? 587 HOH A O     1 
HETATM 4996 O  O     . HOH M 5 .   ? 22.910  -33.101 0.390   1.00 39.38 ? 590 HOH A O     1 
HETATM 4997 O  O     . HOH M 5 .   ? 18.694  -4.946  23.335  1.00 48.87 ? 594 HOH A O     1 
HETATM 4998 O  O     . HOH M 5 .   ? 23.842  -10.179 18.705  1.00 50.72 ? 596 HOH A O     1 
HETATM 4999 O  O     . HOH M 5 .   ? 1.996   -9.217  22.697  1.00 42.15 ? 598 HOH A O     1 
HETATM 5000 O  O     . HOH M 5 .   ? 26.445  -18.833 38.575  1.00 42.27 ? 602 HOH A O     1 
HETATM 5001 O  O     . HOH M 5 .   ? -5.402  9.995   15.312  1.00 43.24 ? 604 HOH A O     1 
HETATM 5002 O  O     . HOH M 5 .   ? 3.343   16.226  16.955  1.00 52.18 ? 606 HOH A O     1 
HETATM 5003 O  O     . HOH M 5 .   ? 2.163   4.824   22.182  1.00 58.07 ? 608 HOH A O     1 
HETATM 5004 O  O     . HOH M 5 .   ? -0.236  -19.275 4.750   1.00 43.91 ? 609 HOH A O     1 
HETATM 5005 O  O     . HOH M 5 .   ? -2.905  -6.561  17.133  1.00 49.32 ? 611 HOH A O     1 
HETATM 5006 O  O     . HOH M 5 .   ? 20.180  -2.978  22.920  1.00 41.93 ? 613 HOH A O     1 
HETATM 5007 O  O     . HOH M 5 .   ? 10.374  5.084   36.045  1.00 61.28 ? 614 HOH A O     1 
HETATM 5008 O  O     . HOH M 5 .   ? 5.331   -4.631  17.675  1.00 45.78 ? 616 HOH A O     1 
HETATM 5009 O  O     . HOH M 5 .   ? -8.055  2.570   21.200  1.00 53.54 ? 619 HOH A O     1 
HETATM 5010 O  O     . HOH M 5 .   ? -7.664  10.481  17.553  1.00 48.87 ? 620 HOH A O     1 
HETATM 5011 O  O     . HOH M 5 .   ? 29.270  -26.266 26.097  1.00 61.70 ? 622 HOH A O     1 
HETATM 5012 O  O     . HOH M 5 .   ? 8.543   6.736   37.152  1.00 48.40 ? 623 HOH A O     1 
HETATM 5013 O  O     . HOH M 5 .   ? 3.875   -7.369  16.835  1.00 37.65 ? 624 HOH A O     1 
HETATM 5014 O  O     . HOH M 5 .   ? 30.110  -24.686 15.096  1.00 53.26 ? 625 HOH A O     1 
HETATM 5015 O  O     . HOH M 5 .   ? -3.040  -32.979 4.468   1.00 41.69 ? 629 HOH A O     1 
HETATM 5016 O  O     . HOH M 5 .   ? 18.247  -13.623 27.026  1.00 40.84 ? 631 HOH A O     1 
HETATM 5017 O  O     . HOH M 5 .   ? 19.962  -29.566 33.751  1.00 56.77 ? 633 HOH A O     1 
HETATM 5018 O  O     . HOH M 5 .   ? 19.651  -19.995 45.632  1.00 42.06 ? 634 HOH A O     1 
HETATM 5019 O  O     . HOH M 5 .   ? -6.635  -37.704 16.730  1.00 53.70 ? 637 HOH A O     1 
HETATM 5020 O  O     . HOH M 5 .   ? 14.201  -23.055 45.950  1.00 52.93 ? 639 HOH A O     1 
HETATM 5021 O  O     . HOH M 5 .   ? 10.754  -29.336 44.936  1.00 46.87 ? 644 HOH A O     1 
HETATM 5022 O  O     . HOH M 5 .   ? 2.319   -18.533 5.760   1.00 40.26 ? 649 HOH A O     1 
HETATM 5023 O  O     . HOH M 5 .   ? 17.479  -36.990 25.801  1.00 58.20 ? 656 HOH A O     1 
HETATM 5024 O  O     . HOH M 5 .   ? 1.241   -20.707 38.650  1.00 58.00 ? 665 HOH A O     1 
HETATM 5025 O  O     . HOH M 5 .   ? 18.005  -35.125 7.799   1.00 47.56 ? 668 HOH A O     1 
HETATM 5026 O  O     . HOH M 5 .   ? -9.580  3.440   12.129  1.00 53.68 ? 675 HOH A O     1 
HETATM 5027 O  O     . HOH M 5 .   ? 7.061   3.378   20.537  1.00 57.80 ? 680 HOH A O     1 
HETATM 5028 O  O     . HOH M 5 .   ? -3.169  16.155  6.267   1.00 42.47 ? 682 HOH A O     1 
HETATM 5029 O  O     . HOH M 5 .   ? 8.239   -16.432 12.628  1.00 30.00 ? 686 HOH A O     1 
HETATM 5030 O  O     . HOH N 5 .   ? -0.536  23.799  10.413  1.00 15.26 ? 310 HOH B O     1 
HETATM 5031 O  O     . HOH N 5 .   ? 10.356  16.829  35.646  1.00 56.19 ? 315 HOH B O     1 
HETATM 5032 O  O     . HOH N 5 .   ? -9.425  22.015  -1.235  1.00 33.50 ? 316 HOH B O     1 
HETATM 5033 O  O     . HOH N 5 .   ? 6.776   -5.426  9.805   1.00 17.55 ? 317 HOH B O     1 
HETATM 5034 O  O     . HOH N 5 .   ? 2.391   23.815  11.640  1.00 16.47 ? 318 HOH B O     1 
HETATM 5035 O  O     . HOH N 5 .   ? 17.221  8.901   12.839  1.00 43.33 ? 319 HOH B O     1 
HETATM 5036 O  O     . HOH N 5 .   ? 2.959   25.535  15.106  1.00 22.09 ? 320 HOH B O     1 
HETATM 5037 O  O     . HOH N 5 .   ? -3.999  13.130  32.865  1.00 29.15 ? 321 HOH B O     1 
HETATM 5038 O  O     . HOH N 5 .   ? 19.140  24.824  31.142  1.00 51.18 ? 322 HOH B O     1 
HETATM 5039 O  O     . HOH N 5 .   ? 23.502  33.356  7.283   1.00 44.05 ? 323 HOH B O     1 
HETATM 5040 O  O     . HOH N 5 .   ? 7.609   16.443  34.927  1.00 56.92 ? 324 HOH B O     1 
HETATM 5041 O  O     . HOH N 5 .   ? 1.727   21.781  3.068   1.00 17.85 ? 325 HOH B O     1 
HETATM 5042 O  O     . HOH N 5 .   ? 14.888  11.973  32.273  1.00 58.50 ? 326 HOH B O     1 
HETATM 5043 O  O     . HOH N 5 .   ? -14.814 29.251  13.782  1.00 46.36 ? 327 HOH B O     1 
HETATM 5044 O  O     . HOH N 5 .   ? 18.163  25.005  8.657   1.00 22.33 ? 328 HOH B O     1 
HETATM 5045 O  O     . HOH N 5 .   ? 1.206   13.214  25.844  1.00 23.92 ? 329 HOH B O     1 
HETATM 5046 O  O     . HOH N 5 .   ? -5.486  31.905  -4.353  1.00 23.08 ? 330 HOH B O     1 
HETATM 5047 O  O     . HOH N 5 .   ? -0.308  23.378  2.232   1.00 22.12 ? 331 HOH B O     1 
HETATM 5048 O  O     . HOH N 5 .   ? 11.271  34.394  -4.120  1.00 46.65 ? 332 HOH B O     1 
HETATM 5049 O  O     . HOH N 5 .   ? -6.412  46.158  0.337   1.00 47.60 ? 333 HOH B O     1 
HETATM 5050 O  O     . HOH N 5 .   ? -2.755  43.454  24.171  1.00 43.86 ? 334 HOH B O     1 
HETATM 5051 O  O     . HOH N 5 .   ? -15.301 23.254  16.504  1.00 36.42 ? 335 HOH B O     1 
HETATM 5052 O  O     . HOH N 5 .   ? 5.544   13.150  14.648  1.00 41.57 ? 336 HOH B O     1 
HETATM 5053 O  O     . HOH N 5 .   ? -3.429  13.236  16.884  1.00 43.30 ? 337 HOH B O     1 
HETATM 5054 O  O     . HOH N 5 .   ? -1.422  18.014  38.685  1.00 43.10 ? 338 HOH B O     1 
HETATM 5055 O  O     . HOH N 5 .   ? -6.525  11.229  33.246  1.00 43.62 ? 339 HOH B O     1 
HETATM 5056 O  O     . HOH N 5 .   ? -1.323  20.343  21.293  1.00 18.94 ? 340 HOH B O     1 
HETATM 5057 O  O     . HOH N 5 .   ? 11.412  28.669  -6.289  1.00 21.14 ? 341 HOH B O     1 
HETATM 5058 O  O     . HOH N 5 .   ? 0.661   21.463  12.225  1.00 62.23 ? 342 HOH B O     1 
HETATM 5059 O  O     . HOH N 5 .   ? 15.803  24.249  20.497  1.00 52.11 ? 343 HOH B O     1 
HETATM 5060 O  O     . HOH N 5 .   ? 6.293   18.419  10.609  1.00 19.95 ? 344 HOH B O     1 
HETATM 5061 O  O     . HOH N 5 .   ? 4.059   24.559  24.883  1.00 20.92 ? 345 HOH B O     1 
HETATM 5062 O  O     . HOH N 5 .   ? -9.329  19.538  4.051   1.00 25.50 ? 346 HOH B O     1 
HETATM 5063 O  O     . HOH N 5 .   ? 0.422   14.058  30.455  1.00 32.92 ? 347 HOH B O     1 
HETATM 5064 O  O     . HOH N 5 .   ? -3.779  25.932  11.512  1.00 20.22 ? 348 HOH B O     1 
HETATM 5065 O  O     . HOH N 5 .   ? -13.422 36.273  0.330   1.00 31.08 ? 349 HOH B O     1 
HETATM 5066 O  O     . HOH N 5 .   ? -2.128  21.105  2.987   1.00 19.22 ? 350 HOH B O     1 
HETATM 5067 O  O     . HOH N 5 .   ? 2.070   15.023  28.341  1.00 26.77 ? 351 HOH B O     1 
HETATM 5068 O  O     . HOH N 5 .   ? 6.055   21.456  12.027  1.00 21.59 ? 352 HOH B O     1 
HETATM 5069 O  O     . HOH N 5 .   ? -12.124 13.490  24.864  1.00 52.03 ? 353 HOH B O     1 
HETATM 5070 O  O     . HOH N 5 .   ? 14.222  -3.565  8.897   1.00 23.75 ? 354 HOH B O     1 
HETATM 5071 O  O     . HOH N 5 .   ? -3.826  14.606  20.735  1.00 24.50 ? 355 HOH B O     1 
HETATM 5072 O  O     . HOH N 5 .   ? -9.635  18.769  16.388  1.00 30.70 ? 356 HOH B O     1 
HETATM 5073 O  O     . HOH N 5 .   ? -1.806  15.838  26.838  1.00 24.23 ? 357 HOH B O     1 
HETATM 5074 O  O     . HOH N 5 .   ? 0.799   19.013  20.006  1.00 29.71 ? 358 HOH B O     1 
HETATM 5075 O  O     . HOH N 5 .   ? 0.902   14.164  20.912  1.00 50.46 ? 359 HOH B O     1 
HETATM 5076 O  O     . HOH N 5 .   ? -2.009  23.053  22.069  1.00 25.34 ? 360 HOH B O     1 
HETATM 5077 O  O     . HOH N 5 .   ? -10.718 16.358  23.592  1.00 36.70 ? 361 HOH B O     1 
HETATM 5078 O  O     . HOH N 5 .   ? -9.040  22.752  9.581   1.00 26.34 ? 362 HOH B O     1 
HETATM 5079 O  O     . HOH N 5 .   ? -11.469 23.167  10.861  1.00 28.56 ? 363 HOH B O     1 
HETATM 5080 O  O     . HOH N 5 .   ? 2.395   39.387  -3.514  1.00 41.01 ? 364 HOH B O     1 
HETATM 5081 O  O     . HOH N 5 .   ? 12.902  -1.741  2.275   1.00 27.12 ? 365 HOH B O     1 
HETATM 5082 O  O     . HOH N 5 .   ? 1.230   -8.202  6.991   1.00 25.02 ? 366 HOH B O     1 
HETATM 5083 O  O     . HOH N 5 .   ? 14.588  18.811  33.917  1.00 39.17 ? 367 HOH B O     1 
HETATM 5084 O  O     . HOH N 5 .   ? -6.603  28.370  -4.704  1.00 25.46 ? 368 HOH B O     1 
HETATM 5085 O  O     . HOH N 5 .   ? 17.814  7.427   15.644  1.00 33.97 ? 369 HOH B O     1 
HETATM 5086 O  O     . HOH N 5 .   ? 17.718  11.149  25.878  1.00 46.63 ? 370 HOH B O     1 
HETATM 5087 O  O     . HOH N 5 .   ? 18.836  23.597  13.157  1.00 49.85 ? 371 HOH B O     1 
HETATM 5088 O  O     . HOH N 5 .   ? 17.702  31.692  21.538  1.00 33.73 ? 372 HOH B O     1 
HETATM 5089 O  O     . HOH N 5 .   ? 2.859   47.491  7.400   1.00 47.24 ? 373 HOH B O     1 
HETATM 5090 O  O     . HOH N 5 .   ? 8.556   35.373  -3.333  1.00 29.42 ? 374 HOH B O     1 
HETATM 5091 O  O     . HOH N 5 .   ? -2.093  22.296  12.723  1.00 28.39 ? 375 HOH B O     1 
HETATM 5092 O  O     . HOH N 5 .   ? -15.059 21.156  7.534   1.00 42.06 ? 376 HOH B O     1 
HETATM 5093 O  O     . HOH N 5 .   ? -4.556  9.210   24.558  1.00 29.17 ? 377 HOH B O     1 
HETATM 5094 O  O     . HOH N 5 .   ? 15.300  10.633  8.667   1.00 28.96 ? 378 HOH B O     1 
HETATM 5095 O  O     . HOH N 5 .   ? 0.574   22.533  15.273  1.00 32.35 ? 379 HOH B O     1 
HETATM 5096 O  O     . HOH N 5 .   ? -12.697 30.280  -1.796  1.00 34.07 ? 380 HOH B O     1 
HETATM 5097 O  O     . HOH N 5 .   ? 21.225  35.088  0.728   1.00 28.11 ? 381 HOH B O     1 
HETATM 5098 O  O     . HOH N 5 .   ? -3.880  23.685  19.951  1.00 30.59 ? 382 HOH B O     1 
HETATM 5099 O  O     . HOH N 5 .   ? -10.075 31.618  -9.676  1.00 30.87 ? 383 HOH B O     1 
HETATM 5100 O  O     . HOH N 5 .   ? -1.870  15.116  29.666  1.00 31.90 ? 384 HOH B O     1 
HETATM 5101 O  O     . HOH N 5 .   ? 20.482  27.715  14.849  1.00 29.35 ? 385 HOH B O     1 
HETATM 5102 O  O     . HOH N 5 .   ? 14.110  -10.290 14.958  1.00 31.51 ? 386 HOH B O     1 
HETATM 5103 O  O     . HOH N 5 .   ? 5.949   17.328  16.965  1.00 29.07 ? 387 HOH B O     1 
HETATM 5104 O  O     . HOH N 5 .   ? 0.058   18.200  17.384  1.00 33.98 ? 388 HOH B O     1 
HETATM 5105 O  O     . HOH N 5 .   ? -8.978  42.898  10.435  1.00 40.27 ? 389 HOH B O     1 
HETATM 5106 O  O     . HOH N 5 .   ? 1.333   7.007   21.817  1.00 31.82 ? 390 HOH B O     1 
HETATM 5107 O  O     . HOH N 5 .   ? 17.773  34.196  11.349  1.00 37.94 ? 391 HOH B O     1 
HETATM 5108 O  O     . HOH N 5 .   ? -8.437  20.213  9.369   1.00 26.85 ? 392 HOH B O     1 
HETATM 5109 O  O     . HOH N 5 .   ? -0.748  23.965  -4.001  1.00 37.94 ? 393 HOH B O     1 
HETATM 5110 O  O     . HOH N 5 .   ? -9.761  18.627  30.588  1.00 32.49 ? 394 HOH B O     1 
HETATM 5111 O  O     . HOH N 5 .   ? -3.757  32.751  36.819  1.00 43.74 ? 395 HOH B O     1 
HETATM 5112 O  O     . HOH N 5 .   ? -13.728 19.257  29.268  1.00 35.56 ? 396 HOH B O     1 
HETATM 5113 O  O     . HOH N 5 .   ? 13.855  24.445  30.729  1.00 29.62 ? 397 HOH B O     1 
HETATM 5114 O  O     . HOH N 5 .   ? 8.854   33.756  27.745  1.00 36.78 ? 398 HOH B O     1 
HETATM 5115 O  O     . HOH N 5 .   ? -6.423  18.889  8.044   1.00 36.77 ? 399 HOH B O     1 
HETATM 5116 O  O     . HOH N 5 .   ? -0.598  43.124  9.683   1.00 44.52 ? 400 HOH B O     1 
HETATM 5117 O  O     . HOH N 5 .   ? 3.546   44.401  4.095   1.00 31.45 ? 401 HOH B O     1 
HETATM 5118 O  O     . HOH N 5 .   ? 18.304  -2.286  13.291  1.00 38.48 ? 402 HOH B O     1 
HETATM 5119 O  O     . HOH N 5 .   ? 19.102  26.933  20.007  1.00 49.52 ? 403 HOH B O     1 
HETATM 5120 O  O     . HOH N 5 .   ? 9.595   22.003  -4.815  1.00 27.20 ? 404 HOH B O     1 
HETATM 5121 O  O     . HOH N 5 .   ? 22.805  28.622  12.606  1.00 27.90 ? 405 HOH B O     1 
HETATM 5122 O  O     . HOH N 5 .   ? -11.562 17.412  14.068  1.00 32.70 ? 406 HOH B O     1 
HETATM 5123 O  O     . HOH N 5 .   ? 17.227  4.506   23.680  1.00 27.98 ? 407 HOH B O     1 
HETATM 5124 O  O     . HOH N 5 .   ? 4.424   19.562  15.930  1.00 28.05 ? 408 HOH B O     1 
HETATM 5125 O  O     . HOH N 5 .   ? 5.947   15.310  13.398  1.00 36.83 ? 409 HOH B O     1 
HETATM 5126 O  O     . HOH N 5 .   ? -7.222  18.024  17.461  1.00 36.59 ? 410 HOH B O     1 
HETATM 5127 O  O     . HOH N 5 .   ? -17.238 29.001  3.526   1.00 42.81 ? 411 HOH B O     1 
HETATM 5128 O  O     . HOH N 5 .   ? 11.490  22.427  -2.427  1.00 25.85 ? 412 HOH B O     1 
HETATM 5129 O  O     . HOH N 5 .   ? 15.498  12.717  6.556   1.00 39.52 ? 413 HOH B O     1 
HETATM 5130 O  O     . HOH N 5 .   ? 6.348   6.956   35.195  1.00 38.14 ? 414 HOH B O     1 
HETATM 5131 O  O     . HOH N 5 .   ? 1.419   22.903  -1.888  1.00 32.35 ? 415 HOH B O     1 
HETATM 5132 O  O     . HOH N 5 .   ? -1.237  7.822   22.091  1.00 27.72 ? 416 HOH B O     1 
HETATM 5133 O  O     . HOH N 5 .   ? 18.546  18.176  31.653  1.00 44.59 ? 417 HOH B O     1 
HETATM 5134 O  O     . HOH N 5 .   ? 13.512  -15.798 10.927  1.00 24.38 ? 418 HOH B O     1 
HETATM 5135 O  O     . HOH N 5 .   ? 17.960  25.115  21.625  1.00 41.87 ? 419 HOH B O     1 
HETATM 5136 O  O     . HOH N 5 .   ? -9.506  12.674  31.141  1.00 46.32 ? 420 HOH B O     1 
HETATM 5137 O  O     . HOH N 5 .   ? 19.784  25.006  14.823  1.00 43.21 ? 421 HOH B O     1 
HETATM 5138 O  O     . HOH N 5 .   ? 2.387   43.488  22.223  1.00 42.19 ? 422 HOH B O     1 
HETATM 5139 O  O     . HOH N 5 .   ? 6.759   -9.145  4.172   1.00 34.61 ? 423 HOH B O     1 
HETATM 5140 O  O     . HOH N 5 .   ? -4.984  5.336   26.296  1.00 43.08 ? 424 HOH B O     1 
HETATM 5141 O  O     . HOH N 5 .   ? -19.220 25.980  2.858   1.00 37.43 ? 425 HOH B O     1 
HETATM 5142 O  O     . HOH N 5 .   ? 11.565  24.675  34.784  1.00 44.15 ? 426 HOH B O     1 
HETATM 5143 O  O     . HOH N 5 .   ? 7.455   20.002  14.157  1.00 35.63 ? 427 HOH B O     1 
HETATM 5144 O  O     . HOH N 5 .   ? -16.552 26.160  20.620  1.00 48.73 ? 428 HOH B O     1 
HETATM 5145 O  O     . HOH N 5 .   ? 12.642  10.160  33.099  1.00 34.75 ? 429 HOH B O     1 
HETATM 5146 O  O     . HOH N 5 .   ? 19.743  -0.211  11.677  1.00 40.73 ? 430 HOH B O     1 
HETATM 5147 O  O     . HOH N 5 .   ? 9.643   37.606  -1.552  1.00 44.38 ? 431 HOH B O     1 
HETATM 5148 O  O     . HOH N 5 .   ? 0.102   7.440   34.533  1.00 46.00 ? 432 HOH B O     1 
HETATM 5149 O  O     . HOH N 5 .   ? -10.222 40.776  11.182  1.00 32.23 ? 433 HOH B O     1 
HETATM 5150 O  O     . HOH N 5 .   ? 11.675  -9.464  9.675   1.00 28.62 ? 434 HOH B O     1 
HETATM 5151 O  O     . HOH N 5 .   ? 13.971  -9.419  12.303  1.00 41.69 ? 435 HOH B O     1 
HETATM 5152 O  O     . HOH N 5 .   ? 12.301  4.589   -2.001  1.00 34.46 ? 436 HOH B O     1 
HETATM 5153 O  O     . HOH N 5 .   ? 8.653   19.775  -4.175  1.00 34.12 ? 437 HOH B O     1 
HETATM 5154 O  O     . HOH N 5 .   ? 2.089   45.295  6.499   1.00 33.40 ? 438 HOH B O     1 
HETATM 5155 O  O     . HOH N 5 .   ? 21.505  23.298  6.459   1.00 41.75 ? 439 HOH B O     1 
HETATM 5156 O  O     . HOH N 5 .   ? 18.799  38.266  6.681   1.00 45.18 ? 440 HOH B O     1 
HETATM 5157 O  O     . HOH N 5 .   ? 6.146   19.203  7.305   1.00 28.17 ? 441 HOH B O     1 
HETATM 5158 O  O     . HOH N 5 .   ? 17.280  11.332  10.604  1.00 45.98 ? 442 HOH B O     1 
HETATM 5159 O  O     . HOH N 5 .   ? 16.019  20.576  15.852  1.00 32.29 ? 443 HOH B O     1 
HETATM 5160 O  O     . HOH N 5 .   ? 1.629   19.863  15.856  1.00 31.07 ? 444 HOH B O     1 
HETATM 5161 O  O     . HOH N 5 .   ? 20.775  0.208   19.086  1.00 29.12 ? 445 HOH B O     1 
HETATM 5162 O  O     . HOH N 5 .   ? -17.940 22.014  23.468  1.00 44.18 ? 446 HOH B O     1 
HETATM 5163 O  O     . HOH N 5 .   ? -6.397  42.621  9.650   1.00 31.85 ? 447 HOH B O     1 
HETATM 5164 O  O     . HOH N 5 .   ? 3.271   21.916  13.319  1.00 44.30 ? 448 HOH B O     1 
HETATM 5165 O  O     . HOH N 5 .   ? -3.112  15.566  38.200  1.00 51.13 ? 449 HOH B O     1 
HETATM 5166 O  O     . HOH N 5 .   ? 6.094   14.264  34.456  1.00 35.80 ? 450 HOH B O     1 
HETATM 5167 O  O     . HOH N 5 .   ? 19.404  -3.006  15.800  1.00 52.48 ? 451 HOH B O     1 
HETATM 5168 O  O     . HOH N 5 .   ? 5.072   17.058  7.286   1.00 31.46 ? 452 HOH B O     1 
HETATM 5169 O  O     . HOH N 5 .   ? -16.484 36.823  5.789   1.00 43.62 ? 453 HOH B O     1 
HETATM 5170 O  O     . HOH N 5 .   ? -9.311  40.574  3.237   1.00 62.80 ? 454 HOH B O     1 
HETATM 5171 O  O     . HOH N 5 .   ? 12.381  29.261  23.540  1.00 27.23 ? 455 HOH B O     1 
HETATM 5172 O  O     . HOH N 5 .   ? 16.521  25.060  32.124  1.00 59.41 ? 456 HOH B O     1 
HETATM 5173 O  O     . HOH N 5 .   ? -15.927 36.688  20.366  1.00 57.18 ? 457 HOH B O     1 
HETATM 5174 O  O     . HOH N 5 .   ? -15.514 25.663  10.440  1.00 52.25 ? 458 HOH B O     1 
HETATM 5175 O  O     . HOH N 5 .   ? 16.521  17.291  22.831  1.00 45.22 ? 459 HOH B O     1 
HETATM 5176 O  O     . HOH N 5 .   ? 12.183  36.487  22.155  1.00 31.87 ? 460 HOH B O     1 
HETATM 5177 O  O     . HOH N 5 .   ? 5.852   7.346   31.643  1.00 40.89 ? 461 HOH B O     1 
HETATM 5178 O  O     . HOH N 5 .   ? 5.560   18.016  13.256  1.00 34.53 ? 462 HOH B O     1 
HETATM 5179 O  O     . HOH N 5 .   ? 16.304  -14.186 14.677  1.00 46.26 ? 463 HOH B O     1 
HETATM 5180 O  O     . HOH N 5 .   ? -5.031  21.904  21.521  1.00 29.27 ? 464 HOH B O     1 
HETATM 5181 O  O     . HOH N 5 .   ? 9.941   35.587  25.846  1.00 38.09 ? 465 HOH B O     1 
HETATM 5182 O  O     . HOH N 5 .   ? -6.399  13.880  20.139  1.00 41.23 ? 466 HOH B O     1 
HETATM 5183 O  O     . HOH N 5 .   ? 11.430  2.689   2.355   1.00 39.38 ? 467 HOH B O     1 
HETATM 5184 O  O     . HOH N 5 .   ? -2.995  7.011   24.070  1.00 31.62 ? 468 HOH B O     1 
HETATM 5185 O  O     . HOH N 5 .   ? 19.641  6.289   4.636   1.00 37.12 ? 469 HOH B O     1 
HETATM 5186 O  O     . HOH N 5 .   ? 5.451   41.229  27.396  1.00 42.79 ? 470 HOH B O     1 
HETATM 5187 O  O     . HOH N 5 .   ? -16.336 34.637  14.736  1.00 55.33 ? 471 HOH B O     1 
HETATM 5188 O  O     . HOH N 5 .   ? -5.159  44.277  29.114  1.00 48.36 ? 472 HOH B O     1 
HETATM 5189 O  O     . HOH N 5 .   ? 4.135   7.625   36.884  1.00 43.41 ? 473 HOH B O     1 
HETATM 5190 O  O     . HOH N 5 .   ? 2.864   15.636  19.682  1.00 35.68 ? 474 HOH B O     1 
HETATM 5191 O  O     . HOH N 5 .   ? -8.561  19.176  1.440   1.00 48.77 ? 475 HOH B O     1 
HETATM 5192 O  O     . HOH N 5 .   ? 20.621  1.448   -0.292  1.00 36.03 ? 476 HOH B O     1 
HETATM 5193 O  O     . HOH N 5 .   ? -11.651 20.468  30.805  1.00 48.55 ? 477 HOH B O     1 
HETATM 5194 O  O     . HOH N 5 .   ? 17.814  -6.344  11.052  1.00 42.95 ? 478 HOH B O     1 
HETATM 5195 O  O     . HOH N 5 .   ? 12.533  19.407  -3.143  1.00 41.93 ? 479 HOH B O     1 
HETATM 5196 O  O     . HOH N 5 .   ? 9.482   -18.988 8.313   1.00 41.76 ? 480 HOH B O     1 
HETATM 5197 O  O     . HOH N 5 .   ? 18.750  5.222   16.739  1.00 38.34 ? 481 HOH B O     1 
HETATM 5198 O  O     . HOH N 5 .   ? 15.016  29.723  24.414  1.00 35.49 ? 482 HOH B O     1 
HETATM 5199 O  O     . HOH N 5 .   ? 13.041  45.532  22.308  1.00 61.62 ? 483 HOH B O     1 
HETATM 5200 O  O     . HOH N 5 .   ? 11.428  41.815  3.929   1.00 39.85 ? 484 HOH B O     1 
HETATM 5201 O  O     . HOH N 5 .   ? 5.512   5.371   19.728  1.00 46.08 ? 485 HOH B O     1 
HETATM 5202 O  O     . HOH N 5 .   ? 18.155  36.417  10.454  1.00 47.63 ? 486 HOH B O     1 
HETATM 5203 O  O     . HOH N 5 .   ? -12.323 37.995  -1.326  1.00 37.38 ? 487 HOH B O     1 
HETATM 5204 O  O     . HOH N 5 .   ? 17.811  10.052  23.547  1.00 34.32 ? 488 HOH B O     1 
HETATM 5205 O  O     . HOH N 5 .   ? 24.031  26.590  11.706  1.00 53.51 ? 489 HOH B O     1 
HETATM 5206 O  O     . HOH N 5 .   ? 16.819  34.982  13.636  1.00 33.69 ? 490 HOH B O     1 
HETATM 5207 O  O     . HOH N 5 .   ? 12.778  16.515  34.246  1.00 36.66 ? 491 HOH B O     1 
HETATM 5208 O  O     . HOH N 5 .   ? -10.443 31.104  -12.235 1.00 39.48 ? 492 HOH B O     1 
HETATM 5209 O  O     . HOH N 5 .   ? -0.868  45.162  5.831   1.00 32.30 ? 493 HOH B O     1 
HETATM 5210 O  O     . HOH N 5 .   ? 13.790  23.618  0.242   1.00 28.56 ? 494 HOH B O     1 
HETATM 5211 O  O     . HOH N 5 .   ? -3.250  11.040  15.469  1.00 41.98 ? 495 HOH B O     1 
HETATM 5212 O  O     . HOH N 5 .   ? 19.696  -4.387  4.225   1.00 48.17 ? 496 HOH B O     1 
HETATM 5213 O  O     . HOH N 5 .   ? 22.813  26.114  9.440   1.00 43.03 ? 497 HOH B O     1 
HETATM 5214 O  O     . HOH N 5 .   ? 2.918   43.012  13.135  1.00 38.55 ? 498 HOH B O     1 
HETATM 5215 O  O     . HOH N 5 .   ? -2.455  20.560  14.949  1.00 31.44 ? 499 HOH B O     1 
HETATM 5216 O  O     . HOH N 5 .   ? 10.527  37.541  24.011  1.00 38.58 ? 500 HOH B O     1 
HETATM 5217 O  O     . HOH N 5 .   ? 0.569   13.645  18.753  1.00 29.31 ? 501 HOH B O     1 
HETATM 5218 O  O     . HOH N 5 .   ? 20.925  17.602  8.067   1.00 42.53 ? 502 HOH B O     1 
HETATM 5219 O  O     . HOH N 5 .   ? -6.999  21.882  -4.657  1.00 38.02 ? 503 HOH B O     1 
HETATM 5220 O  O     . HOH N 5 .   ? 12.665  0.000   0.000   0.50 51.05 ? 504 HOH B O     1 
HETATM 5221 O  O     . HOH N 5 .   ? -2.709  39.435  31.205  1.00 51.60 ? 505 HOH B O     1 
HETATM 5222 O  O     . HOH N 5 .   ? 25.151  34.344  5.511   1.00 57.95 ? 506 HOH B O     1 
HETATM 5223 O  O     . HOH N 5 .   ? -16.180 18.690  22.657  1.00 42.36 ? 507 HOH B O     1 
HETATM 5224 O  O     . HOH N 5 .   ? 14.549  6.241   -2.126  1.00 38.36 ? 508 HOH B O     1 
HETATM 5225 O  O     . HOH N 5 .   ? -0.920  15.243  17.509  1.00 33.23 ? 509 HOH B O     1 
HETATM 5226 O  O     . HOH N 5 .   ? -2.317  43.943  15.866  1.00 46.13 ? 510 HOH B O     1 
HETATM 5227 O  O     . HOH N 5 .   ? -13.344 35.196  29.576  1.00 51.78 ? 511 HOH B O     1 
HETATM 5228 O  O     . HOH N 5 .   ? 12.117  31.934  -5.400  1.00 40.54 ? 512 HOH B O     1 
HETATM 5229 O  O     . HOH N 5 .   ? -13.616 32.683  29.221  1.00 39.82 ? 513 HOH B O     1 
HETATM 5230 O  O     . HOH N 5 .   ? 14.045  11.050  4.957   1.00 34.37 ? 514 HOH B O     1 
HETATM 5231 O  O     . HOH N 5 .   ? 18.681  8.697   10.819  1.00 42.20 ? 515 HOH B O     1 
HETATM 5232 O  O     . HOH N 5 .   ? 5.443   16.497  4.508   1.00 33.08 ? 516 HOH B O     1 
HETATM 5233 O  O     . HOH N 5 .   ? 7.890   45.482  4.599   1.00 41.83 ? 517 HOH B O     1 
HETATM 5234 O  O     . HOH N 5 .   ? -14.436 27.247  -6.117  1.00 42.73 ? 518 HOH B O     1 
HETATM 5235 O  O     . HOH N 5 .   ? -7.827  11.677  20.625  1.00 42.25 ? 519 HOH B O     1 
HETATM 5236 O  O     . HOH N 5 .   ? -19.141 22.495  1.124   1.00 56.38 ? 520 HOH B O     1 
HETATM 5237 O  O     . HOH N 5 .   ? -10.365 18.352  9.235   1.00 35.86 ? 521 HOH B O     1 
HETATM 5238 O  O     . HOH N 5 .   ? 14.495  -6.022  8.848   1.00 35.21 ? 522 HOH B O     1 
HETATM 5239 O  O     . HOH N 5 .   ? 1.404   42.411  10.608  1.00 43.20 ? 523 HOH B O     1 
HETATM 5240 O  O     . HOH N 5 .   ? 12.829  22.151  31.410  1.00 36.58 ? 524 HOH B O     1 
HETATM 5241 O  O     . HOH N 5 .   ? -0.913  -10.741 8.049   1.00 40.46 ? 525 HOH B O     1 
HETATM 5242 O  O     . HOH N 5 .   ? 18.713  21.080  -0.102  1.00 51.31 ? 526 HOH B O     1 
HETATM 5243 O  O     . HOH N 5 .   ? -4.085  35.700  36.955  1.00 47.38 ? 527 HOH B O     1 
HETATM 5244 O  O     . HOH N 5 .   ? -5.424  24.588  -2.302  1.00 29.59 ? 528 HOH B O     1 
HETATM 5245 O  O     . HOH N 5 .   ? 1.460   10.667  21.084  1.00 38.06 ? 529 HOH B O     1 
HETATM 5246 O  O     . HOH N 5 .   ? 7.046   24.312  35.715  1.00 36.79 ? 530 HOH B O     1 
HETATM 5247 O  O     . HOH N 5 .   ? 11.075  -16.416 11.556  1.00 18.24 ? 531 HOH B O     1 
HETATM 5248 O  O     . HOH N 5 .   ? 14.684  8.085   12.891  1.00 28.23 ? 532 HOH B O     1 
HETATM 5249 O  O     . HOH N 5 .   ? 14.811  39.269  10.254  1.00 53.15 ? 533 HOH B O     1 
HETATM 5250 O  O     . HOH N 5 .   ? 12.502  -15.762 16.553  1.00 19.18 ? 534 HOH B O     1 
HETATM 5251 O  O     . HOH N 5 .   ? -11.139 17.386  18.354  1.00 38.61 ? 535 HOH B O     1 
HETATM 5252 O  O     . HOH N 5 .   ? -2.648  6.190   32.527  1.00 46.54 ? 536 HOH B O     1 
HETATM 5253 O  O     . HOH N 5 .   ? 1.479   20.605  38.540  1.00 37.07 ? 537 HOH B O     1 
HETATM 5254 O  O     . HOH N 5 .   ? 18.776  41.131  1.161   1.00 42.41 ? 538 HOH B O     1 
HETATM 5255 O  O     . HOH N 5 .   ? 14.168  37.643  14.999  1.00 50.90 ? 539 HOH B O     1 
HETATM 5256 O  O     . HOH N 5 .   ? 17.811  15.173  29.373  1.00 47.76 ? 540 HOH B O     1 
HETATM 5257 O  O     . HOH N 5 .   ? -5.664  37.537  20.269  1.00 30.23 ? 541 HOH B O     1 
HETATM 5258 O  O     . HOH N 5 .   ? 12.432  26.135  32.522  1.00 32.30 ? 542 HOH B O     1 
HETATM 5259 O  O     . HOH N 5 .   ? 13.346  25.995  -0.514  1.00 42.75 ? 543 HOH B O     1 
HETATM 5260 O  O     . HOH N 5 .   ? -9.029  37.035  31.829  1.00 40.41 ? 544 HOH B O     1 
HETATM 5261 O  O     . HOH N 5 .   ? 14.891  -6.155  11.077  1.00 41.69 ? 545 HOH B O     1 
HETATM 5262 O  O     . HOH N 5 .   ? 10.006  19.169  -2.061  1.00 39.57 ? 548 HOH B O     1 
HETATM 5263 O  O     . HOH N 5 .   ? 20.382  -0.908  4.587   1.00 50.09 ? 549 HOH B O     1 
HETATM 5264 O  O     . HOH N 5 .   ? 15.663  32.223  -7.763  1.00 52.60 ? 550 HOH B O     1 
HETATM 5265 O  O     . HOH N 5 .   ? 10.227  18.251  14.298  1.00 39.86 ? 551 HOH B O     1 
HETATM 5266 O  O     . HOH N 5 .   ? -6.062  36.934  35.456  1.00 49.75 ? 554 HOH B O     1 
HETATM 5267 O  O     . HOH N 5 .   ? 3.510   19.733  12.683  1.00 39.91 ? 557 HOH B O     1 
HETATM 5268 O  O     . HOH N 5 .   ? 5.300   14.057  17.207  1.00 38.11 ? 563 HOH B O     1 
HETATM 5269 O  O     . HOH N 5 .   ? 15.108  12.466  12.954  1.00 50.72 ? 564 HOH B O     1 
HETATM 5270 O  O     . HOH N 5 .   ? 8.735   -3.102  1.209   1.00 45.84 ? 565 HOH B O     1 
HETATM 5271 O  O     . HOH N 5 .   ? -14.063 24.772  -5.647  1.00 50.02 ? 568 HOH B O     1 
HETATM 5272 O  O     . HOH N 5 .   ? -1.023  42.241  32.904  1.00 46.95 ? 571 HOH B O     1 
HETATM 5273 O  O     . HOH N 5 .   ? -12.570 37.780  25.328  1.00 43.76 ? 573 HOH B O     1 
HETATM 5274 O  O     . HOH N 5 .   ? 16.930  35.536  23.594  1.00 47.64 ? 575 HOH B O     1 
HETATM 5275 O  O     . HOH N 5 .   ? -12.706 29.416  -11.646 1.00 45.59 ? 576 HOH B O     1 
HETATM 5276 O  O     . HOH N 5 .   ? 15.314  -13.362 16.548  1.00 41.05 ? 582 HOH B O     1 
HETATM 5277 O  O     . HOH N 5 .   ? -12.175 15.593  35.377  1.00 54.29 ? 585 HOH B O     1 
HETATM 5278 O  O     . HOH N 5 .   ? 20.149  16.196  25.788  1.00 50.38 ? 588 HOH B O     1 
HETATM 5279 O  O     . HOH N 5 .   ? -1.137  38.868  34.811  1.00 63.70 ? 589 HOH B O     1 
HETATM 5280 O  O     . HOH N 5 .   ? 15.431  -12.229 11.362  1.00 57.20 ? 591 HOH B O     1 
HETATM 5281 O  O     . HOH N 5 .   ? 3.460   43.127  27.329  1.00 42.57 ? 592 HOH B O     1 
HETATM 5282 O  O     . HOH N 5 .   ? 10.261  17.143  17.469  1.00 50.84 ? 593 HOH B O     1 
HETATM 5283 O  O     . HOH N 5 .   ? -11.349 22.167  33.206  1.00 41.55 ? 595 HOH B O     1 
HETATM 5284 O  O     . HOH N 5 .   ? -10.156 37.691  -7.526  1.00 73.54 ? 597 HOH B O     1 
HETATM 5285 O  O     . HOH N 5 .   ? 20.460  7.205   9.333   1.00 52.53 ? 601 HOH B O     1 
HETATM 5286 O  O     . HOH N 5 .   ? 9.599   44.259  -1.978  1.00 54.39 ? 603 HOH B O     1 
HETATM 5287 O  O     . HOH N 5 .   ? 18.039  -3.266  18.131  1.00 50.38 ? 605 HOH B O     1 
HETATM 5288 O  O     . HOH N 5 .   ? 2.190   43.404  16.020  1.00 45.38 ? 610 HOH B O     1 
HETATM 5289 O  O     . HOH N 5 .   ? 18.618  14.455  11.495  1.00 45.48 ? 612 HOH B O     1 
HETATM 5290 O  O     . HOH N 5 .   ? -1.080  26.288  37.489  1.00 45.82 ? 615 HOH B O     1 
HETATM 5291 O  O     . HOH N 5 .   ? -11.143 11.565  28.634  1.00 61.94 ? 617 HOH B O     1 
HETATM 5292 O  O     . HOH N 5 .   ? -12.077 31.693  -7.341  1.00 42.36 ? 618 HOH B O     1 
HETATM 5293 O  O     . HOH N 5 .   ? -10.219 40.207  13.784  1.00 57.12 ? 621 HOH B O     1 
HETATM 5294 O  O     . HOH N 5 .   ? 19.715  37.157  14.541  1.00 48.77 ? 626 HOH B O     1 
HETATM 5295 O  O     . HOH N 5 .   ? 11.867  -11.707 19.336  1.00 48.96 ? 627 HOH B O     1 
HETATM 5296 O  O     . HOH N 5 .   ? 20.391  38.147  -2.453  1.00 55.58 ? 628 HOH B O     1 
HETATM 5297 O  O     . HOH N 5 .   ? -13.764 36.694  23.274  1.00 48.94 ? 630 HOH B O     1 
HETATM 5298 O  O     . HOH N 5 .   ? -10.666 44.214  3.712   1.00 50.53 ? 635 HOH B O     1 
HETATM 5299 O  O     . HOH N 5 .   ? -0.089  12.598  39.360  1.00 61.28 ? 636 HOH B O     1 
HETATM 5300 O  O     . HOH N 5 .   ? 11.734  44.385  0.000   0.50 43.73 ? 640 HOH B O     1 
HETATM 5301 O  O     . HOH N 5 .   ? 16.863  14.765  21.412  1.00 40.03 ? 645 HOH B O     1 
HETATM 5302 O  O     . HOH N 5 .   ? 3.646   43.732  18.439  1.00 46.75 ? 646 HOH B O     1 
HETATM 5303 O  O     . HOH N 5 .   ? -10.558 35.342  33.399  1.00 53.47 ? 647 HOH B O     1 
HETATM 5304 O  O     . HOH N 5 .   ? 17.610  10.516  3.889   1.00 52.90 ? 651 HOH B O     1 
HETATM 5305 O  O     . HOH N 5 .   ? -12.558 38.749  -4.145  1.00 49.65 ? 652 HOH B O     1 
HETATM 5306 O  O     . HOH N 5 .   ? -10.319 16.557  37.418  1.00 53.56 ? 653 HOH B O     1 
HETATM 5307 O  O     . HOH N 5 .   ? 21.830  26.762  2.522   1.00 62.76 ? 658 HOH B O     1 
HETATM 5308 O  O     . HOH N 5 .   ? -12.405 15.203  31.174  1.00 49.78 ? 660 HOH B O     1 
HETATM 5309 O  O     . HOH N 5 .   ? -8.001  24.874  -11.382 1.00 46.25 ? 661 HOH B O     1 
HETATM 5310 O  O     . HOH N 5 .   ? -10.909 42.762  5.941   1.00 45.16 ? 662 HOH B O     1 
HETATM 5311 O  O     . HOH N 5 .   ? 7.258   33.501  32.821  1.00 48.77 ? 663 HOH B O     1 
HETATM 5312 O  O     . HOH N 5 .   ? -12.752 37.367  21.293  1.00 53.71 ? 666 HOH B O     1 
HETATM 5313 O  O     . HOH N 5 .   ? 3.987   19.954  5.427   1.00 71.76 ? 669 HOH B O     1 
HETATM 5314 O  O     . HOH N 5 .   ? 0.082   24.524  38.692  1.00 54.66 ? 672 HOH B O     1 
HETATM 5315 O  O     . HOH N 5 .   ? 3.213   12.345  36.842  1.00 56.10 ? 673 HOH B O     1 
HETATM 5316 O  O     . HOH N 5 .   ? 20.504  32.270  17.390  1.00 48.79 ? 674 HOH B O     1 
HETATM 5317 O  O     . HOH N 5 .   ? -15.114 20.604  3.241   1.00 64.53 ? 676 HOH B O     1 
HETATM 5318 O  O     . HOH N 5 .   ? 16.537  37.528  -5.446  1.00 57.05 ? 683 HOH B O     1 
HETATM 5319 O  O     . HOH N 5 .   ? -11.327 43.714  8.170   1.00 51.55 ? 684 HOH B O     1 
HETATM 5320 O  O     . HOH N 5 .   ? 23.189  31.929  15.791  1.00 47.39 ? 685 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 0.7686 0.9614 0.8752 -0.0473 -0.0794 0.2220  1   MET A N   
2    C CA  . MET A 1   ? 0.7167 0.8948 0.8074 -0.0390 -0.0775 0.2037  1   MET A CA  
3    C C   . MET A 1   ? 0.7335 0.9182 0.8030 -0.0235 -0.0638 0.1929  1   MET A C   
4    O O   . MET A 1   ? 0.7869 0.9959 0.8537 -0.0146 -0.0504 0.2038  1   MET A O   
5    C CB  . MET A 1   ? 0.5945 0.7824 0.6968 -0.0394 -0.0726 0.2079  1   MET A CB  
6    C CG  . MET A 1   ? 0.4933 0.6631 0.5825 -0.0335 -0.0721 0.1869  1   MET A CG  
7    S SD  . MET A 1   ? 0.9573 1.1418 1.0552 -0.0296 -0.0609 0.1890  1   MET A SD  
8    C CE  . MET A 1   ? 0.9310 1.0981 1.0458 -0.0455 -0.0804 0.1960  1   MET A CE  
9    N N   . VAL A 2   ? 0.6284 0.7888 0.6825 -0.0196 -0.0658 0.1682  2   VAL A N   
10   C CA  . VAL A 2   ? 0.4991 0.6585 0.5339 -0.0066 -0.0541 0.1524  2   VAL A CA  
11   C C   . VAL A 2   ? 0.4036 0.5701 0.4344 0.0025  -0.0414 0.1448  2   VAL A C   
12   O O   . VAL A 2   ? 0.4529 0.6217 0.4955 -0.0020 -0.0420 0.1480  2   VAL A O   
13   C CB  . VAL A 2   ? 0.4696 0.6026 0.4931 -0.0066 -0.0618 0.1314  2   VAL A CB  
14   C CG1 . VAL A 2   ? 0.5374 0.6629 0.5615 -0.0131 -0.0738 0.1377  2   VAL A CG1 
15   C CG2 . VAL A 2   ? 0.3693 0.4853 0.3974 -0.0108 -0.0679 0.1196  2   VAL A CG2 
16   N N   . ARG A 3   ? 0.3536 0.5214 0.3666 0.0153  -0.0315 0.1345  3   ARG A N   
17   C CA  . ARG A 3   ? 0.4036 0.5751 0.4102 0.0251  -0.0210 0.1263  3   ARG A CA  
18   C C   . ARG A 3   ? 0.3346 0.4850 0.3405 0.0223  -0.0255 0.1066  3   ARG A C   
19   O O   . ARG A 3   ? 0.3454 0.4783 0.3491 0.0178  -0.0339 0.0957  3   ARG A O   
20   C CB  . ARG A 3   ? 0.3228 0.4985 0.3072 0.0412  -0.0117 0.1219  3   ARG A CB  
21   C CG  . ARG A 3   ? 0.4803 0.6803 0.4632 0.0473  -0.0044 0.1430  3   ARG A CG  
22   C CD  . ARG A 3   ? 0.6471 0.8517 0.6047 0.0675  0.0068  0.1385  3   ARG A CD  
23   N NE  . ARG A 3   ? 0.7899 0.9885 0.7423 0.0748  0.0115  0.1260  3   ARG A NE  
24   C CZ  . ARG A 3   ? 0.8520 1.0486 0.7807 0.0933  0.0191  0.1185  3   ARG A CZ  
25   N NH1 . ARG A 3   ? 0.8690 1.0689 0.7749 0.1079  0.0235  0.1218  3   ARG A NH1 
26   N NH2 . ARG A 3   ? 0.8576 1.0468 0.7835 0.0981  0.0211  0.1075  3   ARG A NH2 
27   N N   . ILE A 4   ? 0.2437 0.3977 0.2520 0.0257  -0.0194 0.1033  4   ILE A N   
28   C CA  . ILE A 4   ? 0.2313 0.3688 0.2404 0.0233  -0.0224 0.0872  4   ILE A CA  
29   C C   . ILE A 4   ? 0.2996 0.4343 0.2959 0.0345  -0.0153 0.0756  4   ILE A C   
30   O O   . ILE A 4   ? 0.2978 0.4456 0.2898 0.0431  -0.0068 0.0815  4   ILE A O   
31   C CB  . ILE A 4   ? 0.2810 0.4205 0.3061 0.0148  -0.0251 0.0934  4   ILE A CB  
32   C CG1 . ILE A 4   ? 0.2904 0.4279 0.3266 0.0037  -0.0359 0.1050  4   ILE A CG1 
33   C CG2 . ILE A 4   ? 0.2741 0.3976 0.2985 0.0135  -0.0273 0.0778  4   ILE A CG2 
34   C CD1 . ILE A 4   ? 0.3089 0.4490 0.3603 -0.0046 -0.0409 0.1156  4   ILE A CD1 
35   N N   . TYR A 5   ? 0.2550 0.3725 0.2454 0.0347  -0.0198 0.0599  5   TYR A N   
36   C CA  . TYR A 5   ? 0.2779 0.3880 0.2576 0.0431  -0.0173 0.0484  5   TYR A CA  
37   C C   . TYR A 5   ? 0.2626 0.3626 0.2518 0.0369  -0.0208 0.0393  5   TYR A C   
38   O O   . TYR A 5   ? 0.2340 0.3289 0.2325 0.0288  -0.0258 0.0383  5   TYR A O   
39   C CB  . TYR A 5   ? 0.2658 0.3644 0.2292 0.0497  -0.0216 0.0402  5   TYR A CB  
40   C CG  . TYR A 5   ? 0.2604 0.3677 0.2098 0.0584  -0.0177 0.0485  5   TYR A CG  
41   C CD1 . TYR A 5   ? 0.2918 0.4050 0.2454 0.0531  -0.0198 0.0577  5   TYR A CD1 
42   C CD2 . TYR A 5   ? 0.3571 0.4659 0.2874 0.0734  -0.0121 0.0474  5   TYR A CD2 
43   C CE1 . TYR A 5   ? 0.3271 0.4504 0.2684 0.0613  -0.0156 0.0672  5   TYR A CE1 
44   C CE2 . TYR A 5   ? 0.3803 0.4984 0.2954 0.0838  -0.0072 0.0560  5   TYR A CE2 
45   C CZ  . TYR A 5   ? 0.3766 0.5032 0.2983 0.0773  -0.0085 0.0665  5   TYR A CZ  
46   O OH  . TYR A 5   ? 0.4345 0.5721 0.3413 0.0879  -0.0030 0.0766  5   TYR A OH  
47   N N   . THR A 6   ? 0.2166 0.3135 0.2022 0.0418  -0.0183 0.0330  6   THR A N   
48   C CA  . THR A 6   ? 0.2325 0.3204 0.2265 0.0366  -0.0216 0.0249  6   THR A CA  
49   C C   . THR A 6   ? 0.2584 0.3342 0.2433 0.0420  -0.0259 0.0148  6   THR A C   
50   O O   . THR A 6   ? 0.2835 0.3561 0.2526 0.0517  -0.0256 0.0128  6   THR A O   
51   C CB  . THR A 6   ? 0.2403 0.3340 0.2438 0.0337  -0.0172 0.0281  6   THR A CB  
52   O OG1 . THR A 6   ? 0.2755 0.3713 0.2711 0.0419  -0.0130 0.0266  6   THR A OG1 
53   C CG2 . THR A 6   ? 0.2488 0.3530 0.2610 0.0284  -0.0156 0.0399  6   THR A CG2 
54   N N   . LEU A 7   ? 0.2491 0.3177 0.2432 0.0364  -0.0308 0.0095  7   LEU A N   
55   C CA  . LEU A 7   ? 0.2736 0.3301 0.2636 0.0389  -0.0380 0.0021  7   LEU A CA  
56   C C   . LEU A 7   ? 0.2545 0.3103 0.2563 0.0345  -0.0382 0.0004  7   LEU A C   
57   O O   . LEU A 7   ? 0.2613 0.3225 0.2770 0.0280  -0.0364 0.0028  7   LEU A O   
58   C CB  . LEU A 7   ? 0.2703 0.3204 0.2630 0.0359  -0.0460 0.0000  7   LEU A CB  
59   C CG  . LEU A 7   ? 0.2821 0.3189 0.2743 0.0361  -0.0567 -0.0054 7   LEU A CG  
60   C CD1 . LEU A 7   ? 0.3017 0.3256 0.2716 0.0463  -0.0613 -0.0104 7   LEU A CD1 
61   C CD2 . LEU A 7   ? 0.2735 0.3074 0.2736 0.0318  -0.0645 -0.0051 7   LEU A CD2 
62   N N   . THR A 8   ? 0.2369 0.2853 0.2315 0.0392  -0.0408 -0.0035 8   THR A N   
63   C CA  . THR A 8   ? 0.1976 0.2448 0.2028 0.0351  -0.0418 -0.0044 8   THR A CA  
64   C C   . THR A 8   ? 0.2735 0.3054 0.2756 0.0360  -0.0542 -0.0092 8   THR A C   
65   O O   . THR A 8   ? 0.2812 0.3013 0.2671 0.0441  -0.0589 -0.0140 8   THR A O   
66   C CB  . THR A 8   ? 0.2795 0.3309 0.2801 0.0393  -0.0349 -0.0035 8   THR A CB  
67   O OG1 . THR A 8   ? 0.2617 0.3263 0.2655 0.0381  -0.0260 0.0028  8   THR A OG1 
68   C CG2 . THR A 8   ? 0.2826 0.3335 0.2953 0.0340  -0.0356 -0.0037 8   THR A CG2 
69   N N   . LEU A 9   ? 0.2244 0.2561 0.2420 0.0284  -0.0606 -0.0072 9   LEU A N   
70   C CA  . LEU A 9   ? 0.2492 0.2662 0.2677 0.0271  -0.0754 -0.0093 9   LEU A CA  
71   C C   . LEU A 9   ? 0.2941 0.3060 0.3170 0.0254  -0.0790 -0.0095 9   LEU A C   
72   O O   . LEU A 9   ? 0.2659 0.2602 0.2828 0.0267  -0.0933 -0.0126 9   LEU A O   
73   C CB  . LEU A 9   ? 0.2564 0.2784 0.2940 0.0191  -0.0812 -0.0039 9   LEU A CB  
74   C CG  . LEU A 9   ? 0.2791 0.3027 0.3121 0.0207  -0.0809 -0.0042 9   LEU A CG  
75   C CD1 . LEU A 9   ? 0.2990 0.3315 0.3543 0.0135  -0.0847 0.0027  9   LEU A CD1 
76   C CD2 . LEU A 9   ? 0.3083 0.3126 0.3189 0.0278  -0.0915 -0.0106 9   LEU A CD2 
77   N N   . ALA A 10  ? 0.2673 0.2923 0.2993 0.0227  -0.0678 -0.0063 10  ALA A N   
78   C CA  . ALA A 10  ? 0.2606 0.2821 0.2968 0.0211  -0.0700 -0.0061 10  ALA A CA  
79   C C   . ALA A 10  ? 0.2601 0.2861 0.2865 0.0267  -0.0591 -0.0082 10  ALA A C   
80   O O   . ALA A 10  ? 0.2675 0.3053 0.3043 0.0226  -0.0502 -0.0042 10  ALA A O   
81   C CB  . ALA A 10  ? 0.2639 0.2974 0.3241 0.0115  -0.0686 0.0020  10  ALA A CB  
82   N N   . PRO A 11  ? 0.2704 0.2873 0.2760 0.0373  -0.0599 -0.0138 11  PRO A N   
83   C CA  . PRO A 11  ? 0.2177 0.2414 0.2165 0.0433  -0.0498 -0.0137 11  PRO A CA  
84   C C   . PRO A 11  ? 0.2571 0.2732 0.2577 0.0431  -0.0542 -0.0155 11  PRO A C   
85   O O   . PRO A 11  ? 0.2917 0.2953 0.2968 0.0389  -0.0666 -0.0169 11  PRO A O   
86   C CB  . PRO A 11  ? 0.2743 0.2914 0.2495 0.0570  -0.0498 -0.0178 11  PRO A CB  
87   C CG  . PRO A 11  ? 0.3073 0.3039 0.2723 0.0593  -0.0652 -0.0236 11  PRO A CG  
88   C CD  . PRO A 11  ? 0.2702 0.2709 0.2567 0.0455  -0.0698 -0.0194 11  PRO A CD  
89   N N   . SER A 12  ? 0.2954 0.3192 0.2939 0.0471  -0.0452 -0.0143 12  SER A N   
90   C CA  . SER A 12  ? 0.3301 0.3455 0.3278 0.0486  -0.0496 -0.0166 12  SER A CA  
91   C C   . SER A 12  ? 0.2859 0.3063 0.2722 0.0598  -0.0414 -0.0171 12  SER A C   
92   O O   . SER A 12  ? 0.3164 0.3524 0.3027 0.0627  -0.0302 -0.0123 12  SER A O   
93   C CB  . SER A 12  ? 0.3637 0.3865 0.3825 0.0361  -0.0480 -0.0115 12  SER A CB  
94   O OG  . SER A 12  ? 0.3192 0.3588 0.3463 0.0324  -0.0355 -0.0061 12  SER A OG  
95   N N   . LEU A 13  ? 0.2869 0.2943 0.2644 0.0663  -0.0478 -0.0217 13  LEU A N   
96   C CA  . LEU A 13  ? 0.3035 0.3176 0.2743 0.0764  -0.0398 -0.0209 13  LEU A CA  
97   C C   . LEU A 13  ? 0.3267 0.3451 0.3149 0.0661  -0.0386 -0.0176 13  LEU A C   
98   O O   . LEU A 13  ? 0.3581 0.3616 0.3468 0.0636  -0.0492 -0.0213 13  LEU A O   
99   C CB  . LEU A 13  ? 0.3513 0.3459 0.2968 0.0937  -0.0482 -0.0291 13  LEU A CB  
100  C CG  . LEU A 13  ? 0.3492 0.3525 0.2871 0.1071  -0.0391 -0.0276 13  LEU A CG  
101  C CD1 . LEU A 13  ? 0.3493 0.3761 0.2856 0.1148  -0.0236 -0.0197 13  LEU A CD1 
102  C CD2 . LEU A 13  ? 0.3701 0.3488 0.2812 0.1249  -0.0502 -0.0374 13  LEU A CD2 
103  N N   . ASP A 14  ? 0.2840 0.3213 0.2862 0.0596  -0.0273 -0.0101 14  ASP A N   
104  C CA  . ASP A 14  ? 0.2848 0.3253 0.3024 0.0493  -0.0264 -0.0068 14  ASP A CA  
105  C C   . ASP A 14  ? 0.3097 0.3512 0.3247 0.0561  -0.0240 -0.0065 14  ASP A C   
106  O O   . ASP A 14  ? 0.3480 0.3984 0.3557 0.0671  -0.0172 -0.0044 14  ASP A O   
107  C CB  . ASP A 14  ? 0.2836 0.3387 0.3149 0.0394  -0.0186 0.0003  14  ASP A CB  
108  C CG  . ASP A 14  ? 0.3761 0.4301 0.4114 0.0327  -0.0212 0.0001  14  ASP A CG  
109  O OD1 . ASP A 14  ? 0.3485 0.3915 0.3819 0.0318  -0.0300 -0.0038 14  ASP A OD1 
110  O OD2 . ASP A 14  ? 0.3480 0.4113 0.3885 0.0285  -0.0158 0.0046  14  ASP A OD2 
111  N N   . SER A 15  ? 0.2651 0.2989 0.2868 0.0501  -0.0294 -0.0075 15  SER A N   
112  C CA  . SER A 15  ? 0.2773 0.3116 0.2986 0.0550  -0.0278 -0.0070 15  SER A CA  
113  C C   . SER A 15  ? 0.2490 0.2951 0.2865 0.0442  -0.0215 0.0002  15  SER A C   
114  O O   . SER A 15  ? 0.2542 0.2984 0.3009 0.0329  -0.0237 0.0018  15  SER A O   
115  C CB  . SER A 15  ? 0.3747 0.3891 0.3909 0.0559  -0.0405 -0.0131 15  SER A CB  
116  O OG  . SER A 15  ? 0.4512 0.4495 0.4480 0.0685  -0.0491 -0.0208 15  SER A OG  
117  N N   . ALA A 16  ? 0.2145 0.2729 0.2552 0.0483  -0.0141 0.0055  16  ALA A N   
118  C CA  . ALA A 16  ? 0.2307 0.2961 0.2846 0.0389  -0.0110 0.0120  16  ALA A CA  
119  C C   . ALA A 16  ? 0.2591 0.3210 0.3138 0.0427  -0.0129 0.0115  16  ALA A C   
120  O O   . ALA A 16  ? 0.2670 0.3342 0.3167 0.0546  -0.0099 0.0123  16  ALA A O   
121  C CB  . ALA A 16  ? 0.2501 0.3318 0.3108 0.0380  -0.0038 0.0210  16  ALA A CB  
122  N N   . THR A 17  ? 0.2075 0.2613 0.2679 0.0338  -0.0175 0.0109  17  THR A N   
123  C CA  . THR A 17  ? 0.2264 0.2749 0.2878 0.0362  -0.0206 0.0101  17  THR A CA  
124  C C   . THR A 17  ? 0.2277 0.2788 0.2998 0.0260  -0.0196 0.0159  17  THR A C   
125  O O   . THR A 17  ? 0.2270 0.2803 0.3033 0.0174  -0.0179 0.0191  17  THR A O   
126  C CB  . THR A 17  ? 0.2802 0.3108 0.3349 0.0371  -0.0311 0.0028  17  THR A CB  
127  O OG1 . THR A 17  ? 0.2845 0.3089 0.3386 0.0411  -0.0349 0.0017  17  THR A OG1 
128  C CG2 . THR A 17  ? 0.2369 0.2627 0.2989 0.0240  -0.0352 0.0043  17  THR A CG2 
129  N N   . ILE A 18  ? 0.1903 0.2395 0.2649 0.0283  -0.0214 0.0168  18  ILE A N   
130  C CA  . ILE A 18  ? 0.1881 0.2380 0.2712 0.0200  -0.0215 0.0222  18  ILE A CA  
131  C C   . ILE A 18  ? 0.1779 0.2151 0.2604 0.0174  -0.0284 0.0190  18  ILE A C   
132  O O   . ILE A 18  ? 0.2293 0.2595 0.3066 0.0250  -0.0328 0.0140  18  ILE A O   
133  C CB  . ILE A 18  ? 0.2192 0.2820 0.3098 0.0243  -0.0174 0.0296  18  ILE A CB  
134  C CG1 . ILE A 18  ? 0.2499 0.3264 0.3436 0.0253  -0.0118 0.0355  18  ILE A CG1 
135  C CG2 . ILE A 18  ? 0.2757 0.3359 0.3740 0.0157  -0.0201 0.0349  18  ILE A CG2 
136  C CD1 . ILE A 18  ? 0.2809 0.3749 0.3847 0.0314  -0.0074 0.0457  18  ILE A CD1 
137  N N   . THR A 19  ? 0.2415 0.2745 0.3278 0.0075  -0.0300 0.0220  19  THR A N   
138  C CA  . THR A 19  ? 0.3243 0.3469 0.4115 0.0037  -0.0362 0.0212  19  THR A CA  
139  C C   . THR A 19  ? 0.2947 0.3171 0.3855 -0.0032 -0.0354 0.0269  19  THR A C   
140  O O   . THR A 19  ? 0.2137 0.2399 0.3038 -0.0065 -0.0317 0.0302  19  THR A O   
141  C CB  . THR A 19  ? 0.2399 0.2551 0.3259 -0.0008 -0.0413 0.0193  19  THR A CB  
142  O OG1 . THR A 19  ? 0.2883 0.2929 0.3759 -0.0029 -0.0497 0.0189  19  THR A OG1 
143  C CG2 . THR A 19  ? 0.2558 0.2754 0.3436 -0.0085 -0.0372 0.0242  19  THR A CG2 
144  N N   . PRO A 20  ? 0.2384 0.2479 0.3084 0.0044  -0.0547 0.0032  20  PRO A N   
145  C CA  . PRO A 20  ? 0.2441 0.2528 0.3105 0.0014  -0.0582 0.0074  20  PRO A CA  
146  C C   . PRO A 20  ? 0.2742 0.2712 0.3316 -0.0024 -0.0581 0.0073  20  PRO A C   
147  O O   . PRO A 20  ? 0.2801 0.2763 0.3324 -0.0065 -0.0608 0.0093  20  PRO A O   
148  C CB  . PRO A 20  ? 0.3191 0.3284 0.3884 0.0062  -0.0595 0.0096  20  PRO A CB  
149  C CG  . PRO A 20  ? 0.3893 0.4040 0.4654 0.0115  -0.0570 0.0074  20  PRO A CG  
150  C CD  . PRO A 20  ? 0.3071 0.3171 0.3816 0.0104  -0.0539 0.0026  20  PRO A CD  
151  N N   . GLN A 21  ? 0.2495 0.2371 0.3051 -0.0011 -0.0551 0.0053  21  GLN A N   
152  C CA  . GLN A 21  ? 0.3043 0.2807 0.3517 -0.0037 -0.0541 0.0060  21  GLN A CA  
153  C C   . GLN A 21  ? 0.2516 0.2224 0.2999 -0.0042 -0.0500 0.0026  21  GLN A C   
154  O O   . GLN A 21  ? 0.2812 0.2551 0.3360 -0.0017 -0.0485 -0.0004 21  GLN A O   
155  C CB  . GLN A 21  ? 0.3009 0.2704 0.3454 -0.0011 -0.0547 0.0090  21  GLN A CB  
156  C CG  . GLN A 21  ? 0.3217 0.2969 0.3657 0.0000  -0.0593 0.0125  21  GLN A CG  
157  C CD  . GLN A 21  ? 0.3378 0.3099 0.3726 -0.0038 -0.0627 0.0148  21  GLN A CD  
158  O OE1 . GLN A 21  ? 0.4108 0.3752 0.4383 -0.0067 -0.0610 0.0140  21  GLN A OE1 
159  N NE2 . GLN A 21  ? 0.3510 0.3289 0.3860 -0.0036 -0.0677 0.0177  21  GLN A NE2 
160  N N   . ILE A 22  ? 0.2649 0.2276 0.3065 -0.0070 -0.0483 0.0032  22  ILE A N   
161  C CA  . ILE A 22  ? 0.1996 0.1569 0.2430 -0.0073 -0.0444 0.0008  22  ILE A CA  
162  C C   . ILE A 22  ? 0.3157 0.2619 0.3551 -0.0069 -0.0420 0.0033  22  ILE A C   
163  O O   . ILE A 22  ? 0.3174 0.2580 0.3479 -0.0081 -0.0423 0.0064  22  ILE A O   
164  C CB  . ILE A 22  ? 0.2726 0.2318 0.3139 -0.0106 -0.0432 -0.0012 22  ILE A CB  
165  C CG1 . ILE A 22  ? 0.2772 0.2322 0.3222 -0.0106 -0.0397 -0.0036 22  ILE A CG1 
166  C CG2 . ILE A 22  ? 0.3213 0.2762 0.3527 -0.0138 -0.0440 0.0014  22  ILE A CG2 
167  C CD1 . ILE A 22  ? 0.2937 0.2529 0.3390 -0.0125 -0.0387 -0.0062 22  ILE A CD1 
168  N N   . TYR A 23  ? 0.2808 0.2235 0.3268 -0.0049 -0.0397 0.0022  23  TYR A N   
169  C CA  . TYR A 23  ? 0.2756 0.2083 0.3203 -0.0042 -0.0366 0.0050  23  TYR A CA  
170  C C   . TYR A 23  ? 0.2951 0.2261 0.3497 -0.0035 -0.0344 0.0021  23  TYR A C   
171  O O   . TYR A 23  ? 0.2586 0.1955 0.3195 -0.0026 -0.0361 -0.0019 23  TYR A O   
172  C CB  . TYR A 23  ? 0.3095 0.2391 0.3517 -0.0012 -0.0379 0.0086  23  TYR A CB  
173  C CG  . TYR A 23  ? 0.2886 0.2241 0.3377 0.0020  -0.0403 0.0070  23  TYR A CG  
174  C CD1 . TYR A 23  ? 0.2925 0.2251 0.3498 0.0044  -0.0388 0.0053  23  TYR A CD1 
175  C CD2 . TYR A 23  ? 0.2708 0.2145 0.3183 0.0027  -0.0442 0.0074  23  TYR A CD2 
176  C CE1 . TYR A 23  ? 0.2913 0.2282 0.3537 0.0079  -0.0408 0.0038  23  TYR A CE1 
177  C CE2 . TYR A 23  ? 0.3454 0.2948 0.3992 0.0063  -0.0459 0.0065  23  TYR A CE2 
178  C CZ  . TYR A 23  ? 0.3242 0.2698 0.3847 0.0092  -0.0440 0.0046  23  TYR A CZ  
179  O OH  . TYR A 23  ? 0.3404 0.2907 0.4059 0.0134  -0.0455 0.0036  23  TYR A OH  
180  N N   . PRO A 24  ? 0.2331 0.1559 0.2890 -0.0040 -0.0307 0.0043  24  PRO A N   
181  C CA  . PRO A 24  ? 0.2068 0.1280 0.2734 -0.0042 -0.0292 0.0016  24  PRO A CA  
182  C C   . PRO A 24  ? 0.2370 0.1543 0.3102 -0.0014 -0.0295 0.0018  24  PRO A C   
183  O O   . PRO A 24  ? 0.2638 0.1795 0.3330 0.0011  -0.0303 0.0046  24  PRO A O   
184  C CB  . PRO A 24  ? 0.2778 0.1923 0.3436 -0.0061 -0.0247 0.0050  24  PRO A CB  
185  C CG  . PRO A 24  ? 0.2727 0.1817 0.3279 -0.0049 -0.0233 0.0105  24  PRO A CG  
186  C CD  . PRO A 24  ? 0.2974 0.2125 0.3451 -0.0046 -0.0276 0.0093  24  PRO A CD  
187  N N   . GLU A 25  ? 0.2139 0.1295 0.2971 -0.0018 -0.0292 -0.0014 25  GLU A N   
188  C CA  . GLU A 25  ? 0.2361 0.1460 0.3271 0.0003  -0.0292 -0.0017 25  GLU A CA  
189  C C   . GLU A 25  ? 0.3416 0.2551 0.4338 0.0037  -0.0329 -0.0055 25  GLU A C   
190  O O   . GLU A 25  ? 0.3278 0.2401 0.4274 0.0046  -0.0345 -0.0100 25  GLU A O   
191  C CB  . GLU A 25  ? 0.3111 0.2125 0.4003 0.0013  -0.0257 0.0048  25  GLU A CB  
192  C CG  . GLU A 25  ? 0.3907 0.2845 0.4898 0.0025  -0.0245 0.0053  25  GLU A CG  
193  C CD  . GLU A 25  ? 0.4549 0.3455 0.5648 -0.0008 -0.0228 0.0042  25  GLU A CD  
194  O OE1 . GLU A 25  ? 0.3946 0.2888 0.5038 -0.0037 -0.0219 0.0037  25  GLU A OE1 
195  O OE2 . GLU A 25  ? 0.3394 0.2236 0.4590 -0.0006 -0.0224 0.0039  25  GLU A OE2 
196  N N   . GLY A 26  ? 0.2671 0.1850 0.3522 0.0059  -0.0343 -0.0036 26  GLY A N   
197  C CA  . GLY A 26  ? 0.2600 0.1819 0.3462 0.0099  -0.0371 -0.0060 26  GLY A CA  
198  C C   . GLY A 26  ? 0.2612 0.1919 0.3481 0.0103  -0.0396 -0.0114 26  GLY A C   
199  O O   . GLY A 26  ? 0.2807 0.2156 0.3660 0.0073  -0.0395 -0.0129 26  GLY A O   
200  N N   . LYS A 27  ? 0.2412 0.1745 0.3301 0.0146  -0.0415 -0.0142 27  LYS A N   
201  C CA  . LYS A 27  ? 0.2079 0.1498 0.2963 0.0162  -0.0434 -0.0186 27  LYS A CA  
202  C C   . LYS A 27  ? 0.2788 0.2305 0.3619 0.0159  -0.0440 -0.0156 27  LYS A C   
203  O O   . LYS A 27  ? 0.2509 0.2046 0.3322 0.0181  -0.0445 -0.0118 27  LYS A O   
204  C CB  . LYS A 27  ? 0.2130 0.1541 0.3043 0.0218  -0.0448 -0.0221 27  LYS A CB  
205  C CG  . LYS A 27  ? 0.2972 0.2272 0.3941 0.0224  -0.0448 -0.0250 27  LYS A CG  
206  C CD  . LYS A 27  ? 0.3789 0.3068 0.4766 0.0286  -0.0460 -0.0273 27  LYS A CD  
207  C CE  . LYS A 27  ? 0.2414 0.1565 0.3445 0.0291  -0.0458 -0.0283 27  LYS A CE  
208  N NZ  . LYS A 27  ? 0.2445 0.1568 0.3470 0.0359  -0.0466 -0.0300 27  LYS A NZ  
209  N N   . LEU A 28  ? 0.2035 0.1612 0.2844 0.0131  -0.0441 -0.0170 28  LEU A N   
210  C CA  . LEU A 28  ? 0.2049 0.1721 0.2821 0.0126  -0.0450 -0.0144 28  LEU A CA  
211  C C   . LEU A 28  ? 0.1978 0.1735 0.2770 0.0169  -0.0459 -0.0173 28  LEU A C   
212  O O   . LEU A 28  ? 0.2593 0.2369 0.3392 0.0173  -0.0457 -0.0216 28  LEU A O   
213  C CB  . LEU A 28  ? 0.2162 0.1848 0.2895 0.0075  -0.0443 -0.0138 28  LEU A CB  
214  C CG  . LEU A 28  ? 0.2417 0.2012 0.3124 0.0041  -0.0426 -0.0111 28  LEU A CG  
215  C CD1 . LEU A 28  ? 0.2693 0.2295 0.3360 -0.0002 -0.0415 -0.0110 28  LEU A CD1 
216  C CD2 . LEU A 28  ? 0.2493 0.2063 0.3161 0.0046  -0.0433 -0.0060 28  LEU A CD2 
217  N N   . ARG A 29  ? 0.2059 0.1865 0.2858 0.0205  -0.0467 -0.0147 29  ARG A N   
218  C CA  . ARG A 29  ? 0.2228 0.2119 0.3046 0.0256  -0.0469 -0.0163 29  ARG A CA  
219  C C   . ARG A 29  ? 0.2863 0.2857 0.3669 0.0232  -0.0468 -0.0151 29  ARG A C   
220  O O   . ARG A 29  ? 0.2638 0.2681 0.3436 0.0203  -0.0477 -0.0106 29  ARG A O   
221  C CB  . ARG A 29  ? 0.3277 0.3199 0.4115 0.0304  -0.0474 -0.0130 29  ARG A CB  
222  C CG  . ARG A 29  ? 0.5260 0.5084 0.6113 0.0344  -0.0471 -0.0147 29  ARG A CG  
223  C CD  . ARG A 29  ? 0.6936 0.6805 0.7809 0.0406  -0.0473 -0.0117 29  ARG A CD  
224  N NE  . ARG A 29  ? 0.8300 0.8216 0.9184 0.0469  -0.0465 -0.0148 29  ARG A NE  
225  C CZ  . ARG A 29  ? 0.9148 0.9188 1.0046 0.0499  -0.0460 -0.0124 29  ARG A CZ  
226  N NH1 . ARG A 29  ? 0.9268 0.9399 1.0181 0.0465  -0.0470 -0.0069 29  ARG A NH1 
227  N NH2 . ARG A 29  ? 0.8913 0.8984 0.9811 0.0566  -0.0446 -0.0152 29  ARG A NH2 
228  N N   . CYS A 30  ? 0.2605 0.2625 0.3408 0.0246  -0.0459 -0.0191 30  CYS A N   
229  C CA  . CYS A 30  ? 0.2234 0.2343 0.3026 0.0226  -0.0452 -0.0182 30  CYS A CA  
230  C C   . CYS A 30  ? 0.2530 0.2736 0.3342 0.0285  -0.0442 -0.0181 30  CYS A C   
231  O O   . CYS A 30  ? 0.2778 0.2962 0.3593 0.0345  -0.0438 -0.0215 30  CYS A O   
232  C CB  . CYS A 30  ? 0.2307 0.2378 0.3076 0.0198  -0.0446 -0.0222 30  CYS A CB  
233  S SG  . CYS A 30  ? 0.2751 0.2724 0.3498 0.0129  -0.0448 -0.0209 30  CYS A SG  
234  N N   . THR A 31  ? 0.2854 0.3163 0.3679 0.0271  -0.0437 -0.0142 31  THR A N   
235  C CA  . THR A 31  ? 0.2626 0.3040 0.3478 0.0329  -0.0419 -0.0130 31  THR A CA  
236  C C   . THR A 31  ? 0.2759 0.3171 0.3578 0.0366  -0.0401 -0.0179 31  THR A C   
237  O O   . THR A 31  ? 0.2513 0.2868 0.3298 0.0333  -0.0404 -0.0215 31  THR A O   
238  C CB  . THR A 31  ? 0.2718 0.3247 0.3607 0.0298  -0.0418 -0.0070 31  THR A CB  
239  O OG1 . THR A 31  ? 0.2575 0.3091 0.3436 0.0235  -0.0418 -0.0073 31  THR A OG1 
240  C CG2 . THR A 31  ? 0.2493 0.3036 0.3416 0.0274  -0.0444 -0.0021 31  THR A CG2 
241  N N   . ALA A 32  ? 0.3012 0.3489 0.3838 0.0440  -0.0381 -0.0180 32  ALA A N   
242  C CA  . ALA A 32  ? 0.2233 0.2717 0.3016 0.0488  -0.0362 -0.0223 32  ALA A CA  
243  C C   . ALA A 32  ? 0.2477 0.3009 0.3250 0.0437  -0.0352 -0.0208 32  ALA A C   
244  O O   . ALA A 32  ? 0.2483 0.3105 0.3295 0.0410  -0.0341 -0.0151 32  ALA A O   
245  C CB  . ALA A 32  ? 0.3441 0.4006 0.4232 0.0576  -0.0335 -0.0207 32  ALA A CB  
246  N N   . PRO A 33  ? 0.2490 0.2960 0.3216 0.0424  -0.0357 -0.0258 33  PRO A N   
247  C CA  . PRO A 33  ? 0.2778 0.3275 0.3492 0.0370  -0.0349 -0.0243 33  PRO A CA  
248  C C   . PRO A 33  ? 0.2469 0.3072 0.3181 0.0405  -0.0315 -0.0215 33  PRO A C   
249  O O   . PRO A 33  ? 0.3000 0.3637 0.3692 0.0484  -0.0296 -0.0230 33  PRO A O   
250  C CB  . PRO A 33  ? 0.2900 0.3307 0.3569 0.0362  -0.0364 -0.0307 33  PRO A CB  
251  C CG  . PRO A 33  ? 0.3154 0.3519 0.3802 0.0436  -0.0373 -0.0358 33  PRO A CG  
252  C CD  . PRO A 33  ? 0.2894 0.3266 0.3580 0.0457  -0.0375 -0.0329 33  PRO A CD  
253  N N   . VAL A 34  ? 0.2420 0.3069 0.3148 0.0348  -0.0305 -0.0173 34  VAL A N   
254  C CA  . VAL A 34  ? 0.2828 0.3565 0.3552 0.0369  -0.0269 -0.0145 34  VAL A CA  
255  C C   . VAL A 34  ? 0.2896 0.3581 0.3558 0.0359  -0.0268 -0.0188 34  VAL A C   
256  O O   . VAL A 34  ? 0.2508 0.3127 0.3158 0.0294  -0.0286 -0.0199 34  VAL A O   
257  C CB  . VAL A 34  ? 0.2925 0.3735 0.3707 0.0309  -0.0262 -0.0074 34  VAL A CB  
258  C CG1 . VAL A 34  ? 0.3809 0.4694 0.4587 0.0322  -0.0222 -0.0046 34  VAL A CG1 
259  C CG2 . VAL A 34  ? 0.4123 0.5002 0.4978 0.0323  -0.0265 -0.0027 34  VAL A CG2 
260  N N   . PHE A 35  ? 0.2691 0.3403 0.3307 0.0427  -0.0246 -0.0212 35  PHE A N   
261  C CA  . PHE A 35  ? 0.2305 0.2973 0.2861 0.0425  -0.0249 -0.0255 35  PHE A CA  
262  C C   . PHE A 35  ? 0.2970 0.3697 0.3524 0.0398  -0.0216 -0.0210 35  PHE A C   
263  O O   . PHE A 35  ? 0.3002 0.3819 0.3586 0.0418  -0.0182 -0.0156 35  PHE A O   
264  C CB  . PHE A 35  ? 0.2416 0.3067 0.2909 0.0515  -0.0250 -0.0312 35  PHE A CB  
265  C CG  . PHE A 35  ? 0.3415 0.3992 0.3907 0.0541  -0.0285 -0.0362 35  PHE A CG  
266  C CD1 . PHE A 35  ? 0.2787 0.3267 0.3285 0.0492  -0.0325 -0.0405 35  PHE A CD1 
267  C CD2 . PHE A 35  ? 0.4304 0.4904 0.4792 0.0616  -0.0274 -0.0363 35  PHE A CD2 
268  C CE1 . PHE A 35  ? 0.3522 0.3928 0.4026 0.0512  -0.0355 -0.0448 35  PHE A CE1 
269  C CE2 . PHE A 35  ? 0.4740 0.5261 0.5225 0.0640  -0.0306 -0.0410 35  PHE A CE2 
270  C CZ  . PHE A 35  ? 0.3703 0.4124 0.4197 0.0586  -0.0348 -0.0452 35  PHE A CZ  
271  N N   . GLU A 36  ? 0.2532 0.3207 0.3055 0.0352  -0.0226 -0.0228 36  GLU A N   
272  C CA  . GLU A 36  ? 0.3036 0.3752 0.3549 0.0327  -0.0195 -0.0190 36  GLU A CA  
273  C C   . GLU A 36  ? 0.2179 0.2847 0.2630 0.0333  -0.0200 -0.0233 36  GLU A C   
274  O O   . GLU A 36  ? 0.2763 0.3357 0.3199 0.0325  -0.0235 -0.0285 36  GLU A O   
275  C CB  . GLU A 36  ? 0.3819 0.4524 0.4375 0.0238  -0.0199 -0.0141 36  GLU A CB  
276  C CG  . GLU A 36  ? 0.5203 0.5809 0.5738 0.0177  -0.0227 -0.0169 36  GLU A CG  
277  C CD  . GLU A 36  ? 0.7067 0.7647 0.7635 0.0102  -0.0242 -0.0131 36  GLU A CD  
278  O OE1 . GLU A 36  ? 0.6882 0.7520 0.7500 0.0096  -0.0242 -0.0090 36  GLU A OE1 
279  O OE2 . GLU A 36  ? 0.7907 0.8407 0.8449 0.0052  -0.0256 -0.0142 36  GLU A OE2 
280  N N   . PRO A 37  ? 0.2990 0.3702 0.3410 0.0350  -0.0166 -0.0209 37  PRO A N   
281  C CA  . PRO A 37  ? 0.3038 0.3714 0.3400 0.0357  -0.0170 -0.0244 37  PRO A CA  
282  C C   . PRO A 37  ? 0.2958 0.3564 0.3332 0.0276  -0.0187 -0.0244 37  PRO A C   
283  O O   . PRO A 37  ? 0.3616 0.4216 0.4020 0.0214  -0.0178 -0.0199 37  PRO A O   
284  C CB  . PRO A 37  ? 0.3074 0.3820 0.3412 0.0387  -0.0121 -0.0198 37  PRO A CB  
285  C CG  . PRO A 37  ? 0.3529 0.4352 0.3900 0.0429  -0.0093 -0.0159 37  PRO A CG  
286  C CD  . PRO A 37  ? 0.2856 0.3661 0.3296 0.0374  -0.0119 -0.0147 37  PRO A CD  
287  N N   . GLY A 38  ? 0.3155 0.3706 0.3503 0.0279  -0.0214 -0.0295 38  GLY A N   
288  C CA  . GLY A 38  ? 0.3077 0.3563 0.3433 0.0212  -0.0224 -0.0293 38  GLY A CA  
289  C C   . GLY A 38  ? 0.2691 0.3170 0.3005 0.0228  -0.0219 -0.0312 38  GLY A C   
290  O O   . GLY A 38  ? 0.2660 0.3169 0.2940 0.0292  -0.0225 -0.0345 38  GLY A O   
291  N N   . GLY A 39  ? 0.2318 0.2756 0.2629 0.0175  -0.0209 -0.0291 39  GLY A N   
292  C CA  . GLY A 39  ? 0.2749 0.3181 0.3027 0.0188  -0.0203 -0.0303 39  GLY A CA  
293  C C   . GLY A 39  ? 0.2708 0.3145 0.2954 0.0163  -0.0160 -0.0251 39  GLY A C   
294  O O   . GLY A 39  ? 0.2738 0.3213 0.2981 0.0163  -0.0133 -0.0211 39  GLY A O   
295  N N   . GLY A 40  ? 0.2146 0.2546 0.2374 0.0144  -0.0153 -0.0249 40  GLY A N   
296  C CA  . GLY A 40  ? 0.2534 0.2918 0.2727 0.0116  -0.0113 -0.0202 40  GLY A CA  
297  C C   . GLY A 40  ? 0.2248 0.2693 0.2406 0.0159  -0.0078 -0.0174 40  GLY A C   
298  O O   . GLY A 40  ? 0.2349 0.2806 0.2510 0.0135  -0.0052 -0.0129 40  GLY A O   
299  N N   . GLY A 41  ? 0.2083 0.2569 0.2211 0.0221  -0.0081 -0.0200 41  GLY A N   
300  C CA  . GLY A 41  ? 0.2498 0.3042 0.2583 0.0273  -0.0044 -0.0173 41  GLY A CA  
301  C C   . GLY A 41  ? 0.2508 0.3109 0.2611 0.0298  -0.0032 -0.0155 41  GLY A C   
302  O O   . GLY A 41  ? 0.2283 0.2921 0.2377 0.0308  0.0012  -0.0104 41  GLY A O   
303  N N   . ILE A 42  ? 0.2229 0.2835 0.2363 0.0310  -0.0068 -0.0193 42  ILE A N   
304  C CA  . ILE A 42  ? 0.2365 0.3026 0.2520 0.0337  -0.0055 -0.0174 42  ILE A CA  
305  C C   . ILE A 42  ? 0.2332 0.2993 0.2537 0.0271  -0.0031 -0.0114 42  ILE A C   
306  O O   . ILE A 42  ? 0.2484 0.3204 0.2704 0.0288  0.0005  -0.0066 42  ILE A O   
307  C CB  . ILE A 42  ? 0.2054 0.2708 0.2231 0.0361  -0.0100 -0.0227 42  ILE A CB  
308  C CG1 . ILE A 42  ? 0.2428 0.3099 0.2548 0.0445  -0.0120 -0.0281 42  ILE A CG1 
309  C CG2 . ILE A 42  ? 0.2318 0.3017 0.2536 0.0367  -0.0086 -0.0197 42  ILE A CG2 
310  C CD1 . ILE A 42  ? 0.2730 0.3374 0.2864 0.0467  -0.0171 -0.0344 42  ILE A CD1 
311  N N   . ASN A 43  ? 0.2096 0.2689 0.2325 0.0198  -0.0053 -0.0114 43  ASN A N   
312  C CA  . ASN A 43  ? 0.1999 0.2581 0.2268 0.0131  -0.0042 -0.0064 43  ASN A CA  
313  C C   . ASN A 43  ? 0.2257 0.2835 0.2504 0.0109  0.0000  -0.0013 43  ASN A C   
314  O O   . ASN A 43  ? 0.2373 0.2977 0.2659 0.0078  0.0017  0.0037  43  ASN A O   
315  C CB  . ASN A 43  ? 0.2162 0.2664 0.2447 0.0067  -0.0078 -0.0081 43  ASN A CB  
316  C CG  . ASN A 43  ? 0.4109 0.4624 0.4437 0.0075  -0.0111 -0.0106 43  ASN A CG  
317  O OD1 . ASN A 43  ? 0.4466 0.5049 0.4828 0.0104  -0.0105 -0.0090 43  ASN A OD1 
318  N ND2 . ASN A 43  ? 0.5840 0.6291 0.6169 0.0054  -0.0143 -0.0142 43  ASN A ND2 
319  N N   . VAL A 44  ? 0.2069 0.2617 0.2262 0.0125  0.0014  -0.0023 44  VAL A N   
320  C CA  . VAL A 44  ? 0.1948 0.2491 0.2113 0.0116  0.0058  0.0025  44  VAL A CA  
321  C C   . VAL A 44  ? 0.2605 0.3239 0.2785 0.0167  0.0097  0.0064  44  VAL A C   
322  O O   . VAL A 44  ? 0.2379 0.3026 0.2587 0.0137  0.0129  0.0122  44  VAL A O   
323  C CB  . VAL A 44  ? 0.2139 0.2643 0.2240 0.0140  0.0068  0.0005  44  VAL A CB  
324  C CG1 . VAL A 44  ? 0.2039 0.2547 0.2107 0.0148  0.0120  0.0057  44  VAL A CG1 
325  C CG2 . VAL A 44  ? 0.2322 0.2735 0.2414 0.0084  0.0044  -0.0016 44  VAL A CG2 
326  N N   . ALA A 45  ? 0.2389 0.3083 0.2553 0.0245  0.0094  0.0033  45  ALA A N   
327  C CA  . ALA A 45  ? 0.2220 0.3003 0.2389 0.0309  0.0135  0.0070  45  ALA A CA  
328  C C   . ALA A 45  ? 0.2206 0.3038 0.2460 0.0279  0.0142  0.0114  45  ALA A C   
329  O O   . ALA A 45  ? 0.2722 0.3612 0.3009 0.0288  0.0188  0.0177  45  ALA A O   
330  C CB  . ALA A 45  ? 0.2463 0.3285 0.2581 0.0403  0.0123  0.0020  45  ALA A CB  
331  N N   . ARG A 46  ? 0.1981 0.2792 0.2275 0.0244  0.0097  0.0084  46  ARG A N   
332  C CA  . ARG A 46  ? 0.2766 0.3625 0.3146 0.0213  0.0095  0.0124  46  ARG A CA  
333  C C   . ARG A 46  ? 0.2878 0.3712 0.3306 0.0128  0.0105  0.0181  46  ARG A C   
334  O O   . ARG A 46  ? 0.2297 0.3198 0.2796 0.0116  0.0130  0.0242  46  ARG A O   
335  C CB  . ARG A 46  ? 0.2397 0.3230 0.2801 0.0198  0.0043  0.0078  46  ARG A CB  
336  C CG  . ARG A 46  ? 0.2725 0.3579 0.3091 0.0281  0.0029  0.0023  46  ARG A CG  
337  C CD  . ARG A 46  ? 0.2844 0.3656 0.3234 0.0260  -0.0022 -0.0023 46  ARG A CD  
338  N NE  . ARG A 46  ? 0.3207 0.4070 0.3673 0.0246  -0.0025 0.0011  46  ARG A NE  
339  C CZ  . ARG A 46  ? 0.4003 0.4829 0.4513 0.0185  -0.0062 0.0010  46  ARG A CZ  
340  N NH1 . ARG A 46  ? 0.3652 0.4386 0.4133 0.0133  -0.0093 -0.0022 46  ARG A NH1 
341  N NH2 . ARG A 46  ? 0.3898 0.4781 0.4479 0.0179  -0.0065 0.0045  46  ARG A NH2 
342  N N   . ALA A 47  ? 0.2248 0.2984 0.2635 0.0069  0.0085  0.0163  47  ALA A N   
343  C CA  . ALA A 47  ? 0.2178 0.2867 0.2591 -0.0012 0.0089  0.0209  47  ALA A CA  
344  C C   . ALA A 47  ? 0.2592 0.3321 0.3012 0.0004  0.0146  0.0267  47  ALA A C   
345  O O   . ALA A 47  ? 0.2260 0.3008 0.2747 -0.0045 0.0158  0.0325  47  ALA A O   
346  C CB  . ALA A 47  ? 0.2346 0.2915 0.2693 -0.0061 0.0064  0.0175  47  ALA A CB  
347  N N   . ILE A 48  ? 0.2015 0.2758 0.2369 0.0074  0.0180  0.0255  48  ILE A N   
348  C CA  . ILE A 48  ? 0.2754 0.3532 0.3103 0.0100  0.0240  0.0313  48  ILE A CA  
349  C C   . ILE A 48  ? 0.2713 0.3605 0.3147 0.0129  0.0273  0.0370  48  ILE A C   
350  O O   . ILE A 48  ? 0.2689 0.3606 0.3179 0.0101  0.0310  0.0439  48  ILE A O   
351  C CB  . ILE A 48  ? 0.2322 0.3097 0.2575 0.0179  0.0265  0.0285  48  ILE A CB  
352  C CG1 . ILE A 48  ? 0.2533 0.3200 0.2722 0.0138  0.0252  0.0260  48  ILE A CG1 
353  C CG2 . ILE A 48  ? 0.2625 0.3469 0.2877 0.0236  0.0333  0.0347  48  ILE A CG2 
354  C CD1 . ILE A 48  ? 0.2571 0.3232 0.2672 0.0210  0.0260  0.0222  48  ILE A CD1 
355  N N   . ALA A 49  ? 0.2627 0.3585 0.3076 0.0185  0.0260  0.0343  49  ALA A N   
356  C CA  . ALA A 49  ? 0.2741 0.3810 0.3275 0.0218  0.0292  0.0398  49  ALA A CA  
357  C C   . ALA A 49  ? 0.2562 0.3644 0.3214 0.0126  0.0274  0.0449  49  ALA A C   
358  O O   . ALA A 49  ? 0.2811 0.3966 0.3549 0.0119  0.0316  0.0526  49  ALA A O   
359  C CB  . ALA A 49  ? 0.2777 0.3894 0.3296 0.0291  0.0273  0.0352  49  ALA A CB  
360  N N   . HIS A 50  ? 0.2429 0.3443 0.3090 0.0056  0.0211  0.0410  50  HIS A N   
361  C CA  . HIS A 50  ? 0.2823 0.3838 0.3585 -0.0035 0.0180  0.0450  50  HIS A CA  
362  C C   . HIS A 50  ? 0.3316 0.4296 0.4104 -0.0097 0.0204  0.0506  50  HIS A C   
363  O O   . HIS A 50  ? 0.2756 0.3785 0.3655 -0.0147 0.0205  0.0568  50  HIS A O   
364  C CB  . HIS A 50  ? 0.2539 0.3463 0.3274 -0.0095 0.0109  0.0393  50  HIS A CB  
365  C CG  . HIS A 50  ? 0.2909 0.3867 0.3646 -0.0051 0.0079  0.0349  50  HIS A CG  
366  N ND1 . HIS A 50  ? 0.4797 0.5843 0.5538 0.0041  0.0110  0.0346  50  HIS A ND1 
367  C CD2 . HIS A 50  ? 0.3936 0.4844 0.4668 -0.0084 0.0022  0.0305  50  HIS A CD2 
368  C CE1 . HIS A 50  ? 0.5530 0.6576 0.6270 0.0060  0.0072  0.0302  50  HIS A CE1 
369  N NE2 . HIS A 50  ? 0.5140 0.6105 0.5878 -0.0015 0.0020  0.0278  50  HIS A NE2 
370  N N   . LEU A 51  ? 0.2285 0.3178 0.2975 -0.0094 0.0221  0.0485  51  LEU A N   
371  C CA  . LEU A 51  ? 0.2435 0.3271 0.3134 -0.0153 0.0243  0.0532  51  LEU A CA  
372  C C   . LEU A 51  ? 0.3091 0.4008 0.3827 -0.0103 0.0320  0.0603  51  LEU A C   
373  O O   . LEU A 51  ? 0.3244 0.4118 0.3990 -0.0143 0.0348  0.0649  51  LEU A O   
374  C CB  . LEU A 51  ? 0.2456 0.3154 0.3034 -0.0174 0.0230  0.0484  51  LEU A CB  
375  C CG  . LEU A 51  ? 0.2743 0.3349 0.3282 -0.0227 0.0161  0.0424  51  LEU A CG  
376  C CD1 . LEU A 51  ? 0.2631 0.3109 0.3053 -0.0237 0.0160  0.0387  51  LEU A CD1 
377  C CD2 . LEU A 51  ? 0.2674 0.3261 0.3294 -0.0318 0.0114  0.0451  51  LEU A CD2 
378  N N   . GLY A 52  ? 0.2966 0.3993 0.3716 -0.0014 0.0355  0.0613  52  GLY A N   
379  C CA  . GLY A 52  ? 0.3891 0.5009 0.4685 0.0041  0.0432  0.0689  52  GLY A CA  
380  C C   . GLY A 52  ? 0.3926 0.5037 0.4602 0.0135  0.0484  0.0676  52  GLY A C   
381  O O   . GLY A 52  ? 0.3651 0.4831 0.4345 0.0191  0.0554  0.0740  52  GLY A O   
382  N N   . GLY A 53  ? 0.2969 0.4001 0.3528 0.0154  0.0450  0.0597  53  GLY A N   
383  C CA  . GLY A 53  ? 0.2650 0.3674 0.3094 0.0241  0.0487  0.0576  53  GLY A CA  
384  C C   . GLY A 53  ? 0.2845 0.3927 0.3234 0.0338  0.0476  0.0524  53  GLY A C   
385  O O   . GLY A 53  ? 0.3278 0.4417 0.3726 0.0345  0.0455  0.0516  53  GLY A O   
386  N N   . SER A 54  ? 0.2862 0.3926 0.3137 0.0415  0.0489  0.0487  54  SER A N   
387  C CA  . SER A 54  ? 0.3013 0.4116 0.3220 0.0509  0.0471  0.0428  54  SER A CA  
388  C C   . SER A 54  ? 0.2988 0.4019 0.3087 0.0531  0.0432  0.0352  54  SER A C   
389  O O   . SER A 54  ? 0.3715 0.4707 0.3760 0.0535  0.0456  0.0367  54  SER A O   
390  C CB  . SER A 54  ? 0.4264 0.5458 0.4445 0.0617  0.0540  0.0478  54  SER A CB  
391  O OG  . SER A 54  ? 0.5200 0.6427 0.5316 0.0708  0.0518  0.0420  54  SER A OG  
392  N N   . ALA A 55  ? 0.2810 0.3824 0.2887 0.0543  0.0372  0.0275  55  ALA A N   
393  C CA  . ALA A 55  ? 0.2659 0.3616 0.2652 0.0564  0.0330  0.0203  55  ALA A CA  
394  C C   . ALA A 55  ? 0.3160 0.4142 0.3111 0.0638  0.0290  0.0135  55  ALA A C   
395  O O   . ALA A 55  ? 0.3180 0.4183 0.3182 0.0629  0.0268  0.0120  55  ALA A O   
396  C CB  . ALA A 55  ? 0.2813 0.3682 0.2835 0.0465  0.0283  0.0173  55  ALA A CB  
397  N N   . THR A 56  ? 0.2819 0.3796 0.2675 0.0712  0.0278  0.0092  56  THR A N   
398  C CA  . THR A 56  ? 0.2949 0.3937 0.2752 0.0785  0.0233  0.0020  56  THR A CA  
399  C C   . THR A 56  ? 0.2826 0.3747 0.2640 0.0735  0.0157  -0.0057 56  THR A C   
400  O O   . THR A 56  ? 0.2976 0.3856 0.2768 0.0711  0.0141  -0.0073 56  THR A O   
401  C CB  . THR A 56  ? 0.2842 0.3860 0.2531 0.0898  0.0251  0.0009  56  THR A CB  
402  O OG1 . THR A 56  ? 0.2768 0.3851 0.2449 0.0951  0.0329  0.0086  56  THR A OG1 
403  C CG2 . THR A 56  ? 0.2981 0.3995 0.2608 0.0972  0.0195  -0.0074 56  THR A CG2 
404  N N   . ALA A 57  ? 0.2929 0.3840 0.2781 0.0723  0.0115  -0.0099 57  ALA A N   
405  C CA  . ALA A 57  ? 0.3057 0.3906 0.2933 0.0675  0.0046  -0.0166 57  ALA A CA  
406  C C   . ALA A 57  ? 0.2912 0.3751 0.2717 0.0749  -0.0005 -0.0244 57  ALA A C   
407  O O   . ALA A 57  ? 0.2907 0.3768 0.2675 0.0819  -0.0016 -0.0273 57  ALA A O   
408  C CB  . ALA A 57  ? 0.2799 0.3633 0.2753 0.0621  0.0024  -0.0172 57  ALA A CB  
409  N N   . ILE A 58  ? 0.2683 0.3488 0.2471 0.0734  -0.0039 -0.0277 58  ILE A N   
410  C CA  . ILE A 58  ? 0.2788 0.3580 0.2524 0.0790  -0.0102 -0.0354 58  ILE A CA  
411  C C   . ILE A 58  ? 0.2292 0.3029 0.2102 0.0726  -0.0165 -0.0407 58  ILE A C   
412  O O   . ILE A 58  ? 0.2669 0.3374 0.2544 0.0644  -0.0164 -0.0387 58  ILE A O   
413  C CB  . ILE A 58  ? 0.2677 0.3475 0.2361 0.0817  -0.0104 -0.0354 58  ILE A CB  
414  C CG1 . ILE A 58  ? 0.3045 0.3893 0.2662 0.0873  -0.0031 -0.0290 58  ILE A CG1 
415  C CG2 . ILE A 58  ? 0.3247 0.4037 0.2881 0.0876  -0.0178 -0.0436 58  ILE A CG2 
416  C CD1 . ILE A 58  ? 0.3513 0.4365 0.3084 0.0891  -0.0022 -0.0275 58  ILE A CD1 
417  N N   . PHE A 59  ? 0.2732 0.3453 0.2528 0.0765  -0.0218 -0.0472 59  PHE A N   
418  C CA  . PHE A 59  ? 0.2488 0.3153 0.2358 0.0708  -0.0277 -0.0521 59  PHE A CA  
419  C C   . PHE A 59  ? 0.3029 0.3670 0.2862 0.0769  -0.0342 -0.0602 59  PHE A C   
420  O O   . PHE A 59  ? 0.3107 0.3771 0.2857 0.0854  -0.0333 -0.0615 59  PHE A O   
421  C CB  . PHE A 59  ? 0.2260 0.2908 0.2207 0.0638  -0.0252 -0.0484 59  PHE A CB  
422  C CG  . PHE A 59  ? 0.2685 0.3365 0.2612 0.0683  -0.0222 -0.0465 59  PHE A CG  
423  C CD1 . PHE A 59  ? 0.2528 0.3184 0.2458 0.0712  -0.0260 -0.0514 59  PHE A CD1 
424  C CD2 . PHE A 59  ? 0.3273 0.4008 0.3186 0.0696  -0.0154 -0.0394 59  PHE A CD2 
425  C CE1 . PHE A 59  ? 0.2928 0.3617 0.2842 0.0760  -0.0228 -0.0493 59  PHE A CE1 
426  C CE2 . PHE A 59  ? 0.3410 0.4185 0.3319 0.0738  -0.0122 -0.0369 59  PHE A CE2 
427  C CZ  . PHE A 59  ? 0.2934 0.3689 0.2841 0.0773  -0.0158 -0.0418 59  PHE A CZ  
428  N N   . PRO A 60  ? 0.2303 0.2894 0.2197 0.0726  -0.0408 -0.0655 60  PRO A N   
429  C CA  . PRO A 60  ? 0.2479 0.3029 0.2351 0.0770  -0.0476 -0.0735 60  PRO A CA  
430  C C   . PRO A 60  ? 0.2886 0.3410 0.2789 0.0759  -0.0465 -0.0733 60  PRO A C   
431  O O   . PRO A 60  ? 0.2915 0.3430 0.2899 0.0685  -0.0437 -0.0690 60  PRO A O   
432  C CB  . PRO A 60  ? 0.2564 0.3073 0.2520 0.0710  -0.0540 -0.0776 60  PRO A CB  
433  C CG  . PRO A 60  ? 0.2947 0.3459 0.2989 0.0619  -0.0495 -0.0711 60  PRO A CG  
434  C CD  . PRO A 60  ? 0.2673 0.3238 0.2658 0.0638  -0.0419 -0.0642 60  PRO A CD  
435  N N   . ALA A 61  ? 0.2953 0.3462 0.2786 0.0838  -0.0487 -0.0779 61  ALA A N   
436  C CA  . ALA A 61  ? 0.3127 0.3607 0.2984 0.0839  -0.0481 -0.0782 61  ALA A CA  
437  C C   . ALA A 61  ? 0.3059 0.3469 0.2881 0.0885  -0.0556 -0.0873 61  ALA A C   
438  O O   . ALA A 61  ? 0.3335 0.3737 0.3062 0.0960  -0.0593 -0.0925 61  ALA A O   
439  C CB  . ALA A 61  ? 0.2983 0.3522 0.2782 0.0900  -0.0410 -0.0729 61  ALA A CB  
440  N N   . GLY A 62  ? 0.3276 0.3629 0.3170 0.0842  -0.0581 -0.0892 62  GLY A N   
441  C CA  . GLY A 62  ? 0.3260 0.3530 0.3132 0.0876  -0.0655 -0.0978 62  GLY A CA  
442  C C   . GLY A 62  ? 0.3055 0.3282 0.2949 0.0882  -0.0646 -0.0981 62  GLY A C   
443  O O   . GLY A 62  ? 0.2941 0.3179 0.2921 0.0818  -0.0609 -0.0926 62  GLY A O   
444  N N   . GLY A 63  ? 0.4089 0.4260 0.3897 0.0965  -0.0682 -0.1045 63  GLY A N   
445  C CA  . GLY A 63  ? 0.4357 0.4475 0.4177 0.0981  -0.0679 -0.1055 63  GLY A CA  
446  C C   . GLY A 63  ? 0.4285 0.4474 0.4097 0.1010  -0.0594 -0.0979 63  GLY A C   
447  O O   . GLY A 63  ? 0.4182 0.4459 0.3965 0.1027  -0.0536 -0.0920 63  GLY A O   
448  N N   . ALA A 64  ? 0.4270 0.4419 0.4113 0.1014  -0.0588 -0.0977 64  ALA A N   
449  C CA  . ALA A 64  ? 0.3740 0.3956 0.3587 0.1044  -0.0515 -0.0906 64  ALA A CA  
450  C C   . ALA A 64  ? 0.3267 0.3562 0.3216 0.0953  -0.0465 -0.0818 64  ALA A C   
451  O O   . ALA A 64  ? 0.3395 0.3777 0.3347 0.0973  -0.0401 -0.0748 64  ALA A O   
452  C CB  . ALA A 64  ? 0.3778 0.3927 0.3638 0.1068  -0.0527 -0.0928 64  ALA A CB  
453  N N   . THR A 65  ? 0.3686 0.3949 0.3720 0.0856  -0.0496 -0.0820 65  THR A N   
454  C CA  . THR A 65  ? 0.2970 0.3292 0.3086 0.0771  -0.0455 -0.0744 65  THR A CA  
455  C C   . THR A 65  ? 0.3090 0.3488 0.3164 0.0780  -0.0420 -0.0708 65  THR A C   
456  O O   . THR A 65  ? 0.3223 0.3693 0.3325 0.0757  -0.0365 -0.0635 65  THR A O   
457  C CB  . THR A 65  ? 0.3228 0.3491 0.3433 0.0674  -0.0492 -0.0754 65  THR A CB  
458  O OG1 . THR A 65  ? 0.3679 0.3892 0.3867 0.0674  -0.0548 -0.0819 65  THR A OG1 
459  C CG2 . THR A 65  ? 0.3310 0.3511 0.3570 0.0655  -0.0509 -0.0763 65  THR A CG2 
460  N N   . GLY A 66  ? 0.3068 0.3448 0.3080 0.0814  -0.0453 -0.0760 66  GLY A N   
461  C CA  . GLY A 66  ? 0.3117 0.3563 0.3076 0.0838  -0.0420 -0.0730 66  GLY A CA  
462  C C   . GLY A 66  ? 0.3030 0.3544 0.2918 0.0924  -0.0361 -0.0691 66  GLY A C   
463  O O   . GLY A 66  ? 0.3081 0.3671 0.2971 0.0918  -0.0305 -0.0624 66  GLY A O   
464  N N   . GLU A 67  ? 0.3257 0.3744 0.3085 0.1007  -0.0371 -0.0729 67  GLU A N   
465  C CA  . GLU A 67  ? 0.3380 0.3932 0.3144 0.1099  -0.0309 -0.0688 67  GLU A CA  
466  C C   . GLU A 67  ? 0.3306 0.3936 0.3165 0.1051  -0.0246 -0.0595 67  GLU A C   
467  O O   . GLU A 67  ? 0.3539 0.4254 0.3388 0.1082  -0.0182 -0.0527 67  GLU A O   
468  C CB  . GLU A 67  ? 0.4553 0.5048 0.4237 0.1195  -0.0331 -0.0746 67  GLU A CB  
469  C CG  . GLU A 67  ? 0.5661 0.6084 0.5223 0.1267  -0.0391 -0.0837 67  GLU A CG  
470  C CD  . GLU A 67  ? 0.7308 0.7665 0.6778 0.1369  -0.0408 -0.0893 67  GLU A CD  
471  O OE1 . GLU A 67  ? 0.8448 0.8699 0.7894 0.1369  -0.0486 -0.0980 67  GLU A OE1 
472  O OE2 . GLU A 67  ? 0.7561 0.7970 0.6987 0.1449  -0.0343 -0.0847 67  GLU A OE2 
473  N N   . HIS A 68  ? 0.3544 0.4141 0.3497 0.0977  -0.0267 -0.0589 68  HIS A N   
474  C CA  . HIS A 68  ? 0.3606 0.4270 0.3652 0.0929  -0.0221 -0.0507 68  HIS A CA  
475  C C   . HIS A 68  ? 0.3009 0.3724 0.3104 0.0851  -0.0193 -0.0448 68  HIS A C   
476  O O   . HIS A 68  ? 0.3234 0.4031 0.3371 0.0842  -0.0140 -0.0372 68  HIS A O   
477  C CB  . HIS A 68  ? 0.3267 0.3876 0.3390 0.0873  -0.0254 -0.0519 68  HIS A CB  
478  C CG  . HIS A 68  ? 0.3374 0.4052 0.3575 0.0855  -0.0213 -0.0444 68  HIS A CG  
479  N ND1 . HIS A 68  ? 0.4931 0.5683 0.5116 0.0936  -0.0164 -0.0404 68  HIS A ND1 
480  C CD2 . HIS A 68  ? 0.3762 0.4451 0.4058 0.0768  -0.0215 -0.0400 68  HIS A CD2 
481  C CE1 . HIS A 68  ? 0.5195 0.6006 0.5475 0.0895  -0.0141 -0.0337 68  HIS A CE1 
482  N NE2 . HIS A 68  ? 0.4433 0.5204 0.4775 0.0794  -0.0174 -0.0336 68  HIS A NE2 
483  N N   . LEU A 69  ? 0.3039 0.3702 0.3133 0.0794  -0.0230 -0.0482 69  LEU A N   
484  C CA  . LEU A 69  ? 0.2583 0.3279 0.2705 0.0728  -0.0206 -0.0434 69  LEU A CA  
485  C C   . LEU A 69  ? 0.3342 0.4115 0.3409 0.0788  -0.0150 -0.0390 69  LEU A C   
486  O O   . LEU A 69  ? 0.2960 0.3792 0.3072 0.0752  -0.0103 -0.0317 69  LEU A O   
487  C CB  . LEU A 69  ? 0.2685 0.3315 0.2800 0.0682  -0.0253 -0.0483 69  LEU A CB  
488  C CG  . LEU A 69  ? 0.2705 0.3355 0.2830 0.0626  -0.0230 -0.0443 69  LEU A CG  
489  C CD1 . LEU A 69  ? 0.2894 0.3557 0.3096 0.0543  -0.0203 -0.0378 69  LEU A CD1 
490  C CD2 . LEU A 69  ? 0.3170 0.3759 0.3290 0.0594  -0.0277 -0.0494 69  LEU A CD2 
491  N N   . VAL A 70  ? 0.3212 0.3978 0.3181 0.0881  -0.0158 -0.0436 70  VAL A N   
492  C CA  . VAL A 70  ? 0.2894 0.3727 0.2795 0.0954  -0.0103 -0.0398 70  VAL A CA  
493  C C   . VAL A 70  ? 0.3081 0.3996 0.3016 0.0990  -0.0038 -0.0324 70  VAL A C   
494  O O   . VAL A 70  ? 0.3451 0.4439 0.3403 0.0992  0.0021  -0.0251 70  VAL A O   
495  C CB  . VAL A 70  ? 0.2897 0.3697 0.2670 0.1058  -0.0132 -0.0469 70  VAL A CB  
496  C CG1 . VAL A 70  ? 0.3682 0.4553 0.3374 0.1152  -0.0067 -0.0423 70  VAL A CG1 
497  C CG2 . VAL A 70  ? 0.2591 0.3330 0.2344 0.1020  -0.0193 -0.0529 70  VAL A CG2 
498  N N   . SER A 71  ? 0.3149 0.4053 0.3104 0.1018  -0.0050 -0.0340 71  SER A N   
499  C CA  . SER A 71  ? 0.3382 0.4369 0.3381 0.1057  0.0009  -0.0270 71  SER A CA  
500  C C   . SER A 71  ? 0.3352 0.4399 0.3481 0.0958  0.0036  -0.0188 71  SER A C   
501  O O   . SER A 71  ? 0.3755 0.4895 0.3929 0.0976  0.0097  -0.0107 71  SER A O   
502  C CB  . SER A 71  ? 0.4414 0.5367 0.4404 0.1109  -0.0014 -0.0309 71  SER A CB  
503  O OG  . SER A 71  ? 0.6372 0.7412 0.6430 0.1134  0.0041  -0.0235 71  SER A OG  
504  N N   . LEU A 72  ? 0.3029 0.4020 0.3217 0.0856  -0.0011 -0.0207 72  LEU A N   
505  C CA  . LEU A 72  ? 0.3182 0.4210 0.3478 0.0759  0.0002  -0.0139 72  LEU A CA  
506  C C   . LEU A 72  ? 0.3014 0.4086 0.3313 0.0731  0.0043  -0.0085 72  LEU A C   
507  O O   . LEU A 72  ? 0.3267 0.4408 0.3644 0.0696  0.0081  -0.0008 72  LEU A O   
508  C CB  . LEU A 72  ? 0.3172 0.4117 0.3507 0.0665  -0.0057 -0.0176 72  LEU A CB  
509  C CG  . LEU A 72  ? 0.3804 0.4712 0.4169 0.0670  -0.0092 -0.0207 72  LEU A CG  
510  C CD1 . LEU A 72  ? 0.4899 0.5720 0.5292 0.0583  -0.0144 -0.0242 72  LEU A CD1 
511  C CD2 . LEU A 72  ? 0.4160 0.5152 0.4608 0.0672  -0.0062 -0.0138 72  LEU A CD2 
512  N N   . LEU A 73  ? 0.2619 0.3647 0.2836 0.0747  0.0034  -0.0124 73  LEU A N   
513  C CA  . LEU A 73  ? 0.3019 0.4078 0.3228 0.0727  0.0075  -0.0075 73  LEU A CA  
514  C C   . LEU A 73  ? 0.3061 0.4212 0.3253 0.0810  0.0145  -0.0014 73  LEU A C   
515  O O   . LEU A 73  ? 0.3435 0.4638 0.3674 0.0779  0.0192  0.0060  73  LEU A O   
516  C CB  . LEU A 73  ? 0.3094 0.4087 0.3220 0.0728  0.0045  -0.0132 73  LEU A CB  
517  C CG  . LEU A 73  ? 0.2843 0.3755 0.3004 0.0633  -0.0009 -0.0169 73  LEU A CG  
518  C CD1 . LEU A 73  ? 0.2892 0.3747 0.2983 0.0647  -0.0043 -0.0231 73  LEU A CD1 
519  C CD2 . LEU A 73  ? 0.2637 0.3555 0.2869 0.0539  0.0012  -0.0106 73  LEU A CD2 
520  N N   . ALA A 74  ? 0.3138 0.4302 0.3261 0.0916  0.0152  -0.0044 74  ALA A N   
521  C CA  . ALA A 74  ? 0.3855 0.5107 0.3955 0.1010  0.0225  0.0015  74  ALA A CA  
522  C C   . ALA A 74  ? 0.3553 0.4893 0.3786 0.0973  0.0266  0.0104  74  ALA A C   
523  O O   . ALA A 74  ? 0.3897 0.5317 0.4171 0.0986  0.0332  0.0187  74  ALA A O   
524  C CB  . ALA A 74  ? 0.3923 0.5158 0.3917 0.1133  0.0219  -0.0041 74  ALA A CB  
525  N N   . ASP A 75  ? 0.3827 0.5152 0.4131 0.0928  0.0227  0.0088  75  ASP A N   
526  C CA  . ASP A 75  ? 0.4076 0.5486 0.4515 0.0888  0.0252  0.0168  75  ASP A CA  
527  C C   . ASP A 75  ? 0.4344 0.5772 0.4877 0.0775  0.0258  0.0228  75  ASP A C   
528  O O   . ASP A 75  ? 0.5121 0.6637 0.5766 0.0747  0.0293  0.0312  75  ASP A O   
529  C CB  . ASP A 75  ? 0.4511 0.5889 0.4993 0.0865  0.0201  0.0130  75  ASP A CB  
530  C CG  . ASP A 75  ? 0.5379 0.6747 0.5784 0.0982  0.0205  0.0086  75  ASP A CG  
531  O OD1 . ASP A 75  ? 0.5574 0.6982 0.5907 0.1085  0.0256  0.0100  75  ASP A OD1 
532  O OD2 . ASP A 75  ? 0.5503 0.6821 0.5917 0.0974  0.0158  0.0039  75  ASP A OD2 
533  N N   . GLU A 76  ? 0.3033 0.6974 0.4612 0.0699  0.0076  0.0543  76  GLU A N   
534  C CA  . GLU A 76  ? 0.2653 0.6572 0.4278 0.0481  0.0033  0.0624  76  GLU A CA  
535  C C   . GLU A 76  ? 0.2346 0.6336 0.3940 0.0420  0.0092  0.0666  76  GLU A C   
536  O O   . GLU A 76  ? 0.3184 0.7131 0.4778 0.0244  0.0061  0.0729  76  GLU A O   
537  C CB  . GLU A 76  ? 0.2800 0.6350 0.4298 0.0373  -0.0039 0.0534  76  GLU A CB  
538  C CG  . GLU A 76  ? 0.3281 0.6743 0.4810 0.0401  -0.0106 0.0508  76  GLU A CG  
539  C CD  . GLU A 76  ? 0.4369 0.7484 0.5782 0.0291  -0.0173 0.0440  76  GLU A CD  
540  O OE1 . GLU A 76  ? 0.3731 0.6668 0.5030 0.0211  -0.0162 0.0407  76  GLU A OE1 
541  O OE2 . GLU A 76  ? 0.4645 0.7670 0.6078 0.0292  -0.0233 0.0425  76  GLU A OE2 
542  N N   . ASN A 77  ? 0.1982 0.6012 0.3503 0.0565  0.0171  0.0625  77  ASN A N   
543  C CA  . ASN A 77  ? 0.2763 0.6826 0.4226 0.0533  0.0232  0.0653  77  ASN A CA  
544  C C   . ASN A 77  ? 0.3080 0.6981 0.4460 0.0426  0.0223  0.0596  77  ASN A C   
545  O O   . ASN A 77  ? 0.3105 0.7021 0.4459 0.0317  0.0244  0.0654  77  ASN A O   
546  C CB  . ASN A 77  ? 0.4530 0.8782 0.6088 0.0432  0.0237  0.0810  77  ASN A CB  
547  C CG  . ASN A 77  ? 0.5281 0.9721 0.6899 0.0566  0.0274  0.0874  77  ASN A CG  
548  O OD1 . ASN A 77  ? 0.4956 0.9396 0.6493 0.0741  0.0333  0.0814  77  ASN A OD1 
549  N ND2 . ASN A 77  ? 0.5711 1.0300 0.7457 0.0483  0.0236  0.1000  77  ASN A ND2 
550  N N   . VAL A 78  ? 0.2245 0.5868 0.3513 0.0446  0.0183  0.0474  78  VAL A N   
551  C CA  . VAL A 78  ? 0.1934 0.5282 0.3049 0.0363  0.0176  0.0400  78  VAL A CA  
552  C C   . VAL A 78  ? 0.2795 0.6096 0.3806 0.0506  0.0231  0.0301  78  VAL A C   
553  O O   . VAL A 78  ? 0.2596 0.5825 0.3568 0.0639  0.0218  0.0216  78  VAL A O   
554  C CB  . VAL A 78  ? 0.2133 0.5194 0.3183 0.0298  0.0098  0.0337  78  VAL A CB  
555  C CG1 . VAL A 78  ? 0.1658 0.4457 0.2555 0.0234  0.0100  0.0271  78  VAL A CG1 
556  C CG2 . VAL A 78  ? 0.2770 0.5850 0.3901 0.0162  0.0035  0.0431  78  VAL A CG2 
557  N N   . PRO A 79  ? 0.2973 0.6303 0.3927 0.0480  0.0286  0.0313  79  PRO A N   
558  C CA  . PRO A 79  ? 0.3338 0.6613 0.4182 0.0610  0.0333  0.0220  79  PRO A CA  
559  C C   . PRO A 79  ? 0.2745 0.5712 0.3464 0.0604  0.0281  0.0106  79  PRO A C   
560  O O   . PRO A 79  ? 0.2606 0.5402 0.3296 0.0471  0.0240  0.0111  79  PRO A O   
561  C CB  . PRO A 79  ? 0.2934 0.6287 0.3746 0.0544  0.0394  0.0272  79  PRO A CB  
562  C CG  . PRO A 79  ? 0.4179 0.7495 0.5026 0.0352  0.0358  0.0358  79  PRO A CG  
563  C CD  . PRO A 79  ? 0.3708 0.7107 0.4681 0.0329  0.0303  0.0413  79  PRO A CD  
564  N N   . VAL A 80  ? 0.2601 0.5492 0.3240 0.0748  0.0280  0.0011  80  VAL A N   
565  C CA  . VAL A 80  ? 0.2852 0.5465 0.3383 0.0738  0.0223  -0.0087 80  VAL A CA  
566  C C   . VAL A 80  ? 0.2952 0.5491 0.3359 0.0826  0.0245  -0.0162 80  VAL A C   
567  O O   . VAL A 80  ? 0.2803 0.5491 0.3190 0.0930  0.0305  -0.0156 80  VAL A O   
568  C CB  . VAL A 80  ? 0.2776 0.5279 0.3312 0.0807  0.0153  -0.0142 80  VAL A CB  
569  C CG1 . VAL A 80  ? 0.2523 0.5107 0.3183 0.0734  0.0126  -0.0069 80  VAL A CG1 
570  C CG2 . VAL A 80  ? 0.3392 0.5954 0.3874 0.1001  0.0167  -0.0193 80  VAL A CG2 
571  N N   . ALA A 81  ? 0.2278 0.4589 0.2603 0.0783  0.0195  -0.0226 81  ALA A N   
572  C CA  . ALA A 81  ? 0.3036 0.5240 0.3238 0.0860  0.0190  -0.0304 81  ALA A CA  
573  C C   . ALA A 81  ? 0.3541 0.5506 0.3697 0.0844  0.0095  -0.0369 81  ALA A C   
574  O O   . ALA A 81  ? 0.3600 0.5456 0.3779 0.0723  0.0067  -0.0348 81  ALA A O   
575  C CB  . ALA A 81  ? 0.3771 0.5980 0.3932 0.0780  0.0239  -0.0279 81  ALA A CB  
576  N N   . THR A 82  ? 0.3035 0.4913 0.3118 0.0969  0.0045  -0.0440 82  THR A N   
577  C CA  . THR A 82  ? 0.3008 0.4665 0.3059 0.0949  -0.0055 -0.0492 82  THR A CA  
578  C C   . THR A 82  ? 0.3302 0.4773 0.3217 0.0993  -0.0118 -0.0568 82  THR A C   
579  O O   . THR A 82  ? 0.3349 0.4850 0.3170 0.1081  -0.0089 -0.0599 82  THR A O   
580  C CB  . THR A 82  ? 0.2990 0.4640 0.3057 0.1039  -0.0093 -0.0510 82  THR A CB  
581  O OG1 . THR A 82  ? 0.3800 0.5500 0.3771 0.1214  -0.0072 -0.0551 82  THR A OG1 
582  C CG2 . THR A 82  ? 0.2884 0.4710 0.3098 0.0977  -0.0049 -0.0427 82  THR A CG2 
583  N N   . VAL A 83  ? 0.3281 0.4560 0.3189 0.0924  -0.0208 -0.0589 83  VAL A N   
584  C CA  . VAL A 83  ? 0.3939 0.5016 0.3726 0.0952  -0.0299 -0.0655 83  VAL A CA  
585  C C   . VAL A 83  ? 0.3207 0.4114 0.2954 0.0996  -0.0398 -0.0699 83  VAL A C   
586  O O   . VAL A 83  ? 0.3310 0.4204 0.3155 0.0924  -0.0416 -0.0665 83  VAL A O   
587  C CB  . VAL A 83  ? 0.3891 0.4898 0.3716 0.0814  -0.0326 -0.0620 83  VAL A CB  
588  C CG1 . VAL A 83  ? 0.4001 0.4787 0.3728 0.0818  -0.0449 -0.0672 83  VAL A CG1 
589  C CG2 . VAL A 83  ? 0.3494 0.4640 0.3322 0.0787  -0.0233 -0.0585 83  VAL A CG2 
590  N N   . GLU A 84  ? 0.3759 0.4520 0.3346 0.1119  -0.0465 -0.0775 84  GLU A N   
591  C CA  . GLU A 84  ? 0.4210 0.4778 0.3728 0.1168  -0.0566 -0.0821 84  GLU A CA  
592  C C   . GLU A 84  ? 0.4164 0.4531 0.3691 0.1040  -0.0681 -0.0819 84  GLU A C   
593  O O   . GLU A 84  ? 0.4594 0.4871 0.4059 0.1001  -0.0730 -0.0831 84  GLU A O   
594  C CB  . GLU A 84  ? 0.4541 0.4986 0.3847 0.1353  -0.0605 -0.0901 84  GLU A CB  
595  C CG  . GLU A 84  ? 0.5970 0.6264 0.5195 0.1443  -0.0676 -0.0942 84  GLU A CG  
596  C CD  . GLU A 84  ? 0.8160 0.8421 0.7191 0.1663  -0.0658 -0.0998 84  GLU A CD  
597  O OE1 . GLU A 84  ? 0.8866 0.9148 0.7786 0.1742  -0.0623 -0.1021 84  GLU A OE1 
598  O OE2 . GLU A 84  ? 0.8786 0.9000 0.7767 0.1766  -0.0674 -0.1015 84  GLU A OE2 
599  N N   . ALA A 85  ? 0.3593 0.3903 0.3206 0.0973  -0.0721 -0.0795 85  ALA A N   
600  C CA  . ALA A 85  ? 0.3480 0.3624 0.3125 0.0848  -0.0824 -0.0774 85  ALA A CA  
601  C C   . ALA A 85  ? 0.4143 0.4038 0.3673 0.0897  -0.0954 -0.0830 85  ALA A C   
602  O O   . ALA A 85  ? 0.4618 0.4497 0.4091 0.1008  -0.0946 -0.0868 85  ALA A O   
603  C CB  . ALA A 85  ? 0.3434 0.3691 0.3263 0.0717  -0.0770 -0.0688 85  ALA A CB  
604  N N   . LYS A 86  ? 0.3884 0.3587 0.3378 0.0812  -0.1076 -0.0828 86  LYS A N   
605  C CA  . LYS A 86  ? 0.3867 0.3295 0.3231 0.0840  -0.1220 -0.0878 86  LYS A CA  
606  C C   . LYS A 86  ? 0.4161 0.3575 0.3625 0.0804  -0.1225 -0.0850 86  LYS A C   
607  O O   . LYS A 86  ? 0.4713 0.3985 0.4065 0.0899  -0.1278 -0.0904 86  LYS A O   
608  C CB  . LYS A 86  ? 0.4854 0.4096 0.4176 0.0734  -0.1359 -0.0863 86  LYS A CB  
609  C CG  . LYS A 86  ? 0.6279 0.5479 0.5463 0.0778  -0.1385 -0.0902 86  LYS A CG  
610  C CD  . LYS A 86  ? 0.8217 0.7153 0.7122 0.0925  -0.1488 -0.1005 86  LYS A CD  
611  C CE  . LYS A 86  ? 0.9019 0.7916 0.7767 0.0992  -0.1500 -0.1049 86  LYS A CE  
612  N NZ  . LYS A 86  ? 0.8882 0.8030 0.7653 0.1105  -0.1328 -0.1060 86  LYS A NZ  
613  N N   . ASP A 87  ? 0.3738 0.3290 0.3397 0.0675  -0.1170 -0.0764 87  ASP A N   
614  C CA  . ASP A 87  ? 0.4382 0.3923 0.4142 0.0631  -0.1171 -0.0729 87  ASP A CA  
615  C C   . ASP A 87  ? 0.4255 0.3976 0.4064 0.0714  -0.1055 -0.0735 87  ASP A C   
616  O O   . ASP A 87  ? 0.3924 0.3856 0.3800 0.0717  -0.0942 -0.0707 87  ASP A O   
617  C CB  . ASP A 87  ? 0.3978 0.3585 0.3906 0.0473  -0.1153 -0.0628 87  ASP A CB  
618  C CG  . ASP A 87  ? 0.4766 0.4280 0.4764 0.0416  -0.1200 -0.0592 87  ASP A CG  
619  O OD1 . ASP A 87  ? 0.4918 0.4276 0.4825 0.0483  -0.1273 -0.0649 87  ASP A OD1 
620  O OD2 . ASP A 87  ? 0.4563 0.4151 0.4697 0.0311  -0.1161 -0.0503 87  ASP A OD2 
621  N N   . TRP A 88  ? 0.3708 0.3349 0.3484 0.0779  -0.1087 -0.0765 88  TRP A N   
622  C CA  . TRP A 88  ? 0.3414 0.3229 0.3230 0.0870  -0.0992 -0.0767 88  TRP A CA  
623  C C   . TRP A 88  ? 0.3454 0.3462 0.3455 0.0769  -0.0899 -0.0684 88  TRP A C   
624  O O   . TRP A 88  ? 0.3351 0.3302 0.3436 0.0652  -0.0923 -0.0633 88  TRP A O   
625  C CB  . TRP A 88  ? 0.4129 0.3803 0.3850 0.0977  -0.1054 -0.0819 88  TRP A CB  
626  C CG  . TRP A 88  ? 0.4776 0.4363 0.4584 0.0891  -0.1099 -0.0784 88  TRP A CG  
627  C CD1 . TRP A 88  ? 0.4974 0.4705 0.4924 0.0851  -0.1033 -0.0731 88  TRP A CD1 
628  C CD2 . TRP A 88  ? 0.5027 0.4356 0.4777 0.0834  -0.1226 -0.0797 88  TRP A CD2 
629  N NE1 . TRP A 88  ? 0.5537 0.5114 0.5517 0.0782  -0.1104 -0.0714 88  TRP A NE1 
630  C CE2 . TRP A 88  ? 0.5126 0.4464 0.4992 0.0769  -0.1220 -0.0750 88  TRP A CE2 
631  C CE3 . TRP A 88  ? 0.4824 0.3908 0.4430 0.0826  -0.1351 -0.0837 88  TRP A CE3 
632  C CZ2 . TRP A 88  ? 0.6656 0.5780 0.6508 0.0700  -0.1326 -0.0740 88  TRP A CZ2 
633  C CZ3 . TRP A 88  ? 0.6834 0.5704 0.6429 0.0748  -0.1466 -0.0824 88  TRP A CZ3 
634  C CH2 . TRP A 88  ? 0.7011 0.5909 0.6733 0.0687  -0.1448 -0.0774 88  TRP A CH2 
635  N N   . THR A 89  ? 0.3350 0.3579 0.3404 0.0817  -0.0795 -0.0666 89  THR A N   
636  C CA  . THR A 89  ? 0.3040 0.3438 0.3240 0.0727  -0.0714 -0.0588 89  THR A CA  
637  C C   . THR A 89  ? 0.2767 0.3089 0.3028 0.0684  -0.0751 -0.0564 89  THR A C   
638  O O   . THR A 89  ? 0.3038 0.3326 0.3268 0.0772  -0.0782 -0.0598 89  THR A O   
639  C CB  . THR A 89  ? 0.3337 0.3977 0.3574 0.0796  -0.0617 -0.0570 89  THR A CB  
640  O OG1 . THR A 89  ? 0.3071 0.3785 0.3259 0.0820  -0.0573 -0.0582 89  THR A OG1 
641  C CG2 . THR A 89  ? 0.2615 0.3397 0.2982 0.0696  -0.0554 -0.0488 89  THR A CG2 
642  N N   . ARG A 90  ? 0.2625 0.2915 0.2961 0.0558  -0.0745 -0.0502 90  ARG A N   
643  C CA  . ARG A 90  ? 0.2515 0.2708 0.2900 0.0508  -0.0784 -0.0474 90  ARG A CA  
644  C C   . ARG A 90  ? 0.3100 0.3429 0.3558 0.0509  -0.0729 -0.0436 90  ARG A C   
645  O O   . ARG A 90  ? 0.2842 0.3350 0.3331 0.0517  -0.0657 -0.0412 90  ARG A O   
646  C CB  . ARG A 90  ? 0.3264 0.3370 0.3689 0.0386  -0.0793 -0.0411 90  ARG A CB  
647  C CG  . ARG A 90  ? 0.2701 0.2661 0.3078 0.0365  -0.0872 -0.0430 90  ARG A CG  
648  C CD  . ARG A 90  ? 0.3143 0.2921 0.3456 0.0417  -0.0979 -0.0487 90  ARG A CD  
649  N NE  . ARG A 90  ? 0.3661 0.3275 0.3945 0.0359  -0.1073 -0.0478 90  ARG A NE  
650  C CZ  . ARG A 90  ? 0.3932 0.3450 0.4114 0.0395  -0.1144 -0.0531 90  ARG A CZ  
651  N NH1 . ARG A 90  ? 0.4305 0.3675 0.4475 0.0322  -0.1242 -0.0508 90  ARG A NH1 
652  N NH2 . ARG A 90  ? 0.4266 0.3834 0.4355 0.0505  -0.1121 -0.0602 90  ARG A NH2 
653  N N   . GLN A 91  ? 0.2626 0.2864 0.3109 0.0496  -0.0770 -0.0427 91  GLN A N   
654  C CA  . GLN A 91  ? 0.3171 0.3518 0.3719 0.0500  -0.0740 -0.0393 91  GLN A CA  
655  C C   . GLN A 91  ? 0.3283 0.3547 0.3872 0.0396  -0.0743 -0.0330 91  GLN A C   
656  O O   . GLN A 91  ? 0.3657 0.3749 0.4230 0.0368  -0.0796 -0.0332 91  GLN A O   
657  C CB  . GLN A 91  ? 0.3305 0.3626 0.3829 0.0611  -0.0787 -0.0443 91  GLN A CB  
658  C CG  . GLN A 91  ? 0.4252 0.4615 0.4696 0.0744  -0.0790 -0.0508 91  GLN A CG  
659  C CD  . GLN A 91  ? 0.5367 0.5814 0.5813 0.0867  -0.0792 -0.0525 91  GLN A CD  
660  O OE1 . GLN A 91  ? 0.6029 0.6352 0.6371 0.0978  -0.0844 -0.0587 91  GLN A OE1 
661  N NE2 . GLN A 91  ? 0.5820 0.6471 0.6373 0.0848  -0.0738 -0.0462 91  GLN A NE2 
662  N N   . ASN A 92  ? 0.2048 0.2423 0.2680 0.0340  -0.0689 -0.0271 92  ASN A N   
663  C CA  . ASN A 92  ? 0.2088 0.2372 0.2733 0.0262  -0.0697 -0.0214 92  ASN A CA  
664  C C   . ASN A 92  ? 0.2864 0.3199 0.3550 0.0296  -0.0722 -0.0211 92  ASN A C   
665  O O   . ASN A 92  ? 0.2691 0.3181 0.3411 0.0370  -0.0714 -0.0234 92  ASN A O   
666  C CB  . ASN A 92  ? 0.2461 0.2778 0.3088 0.0175  -0.0637 -0.0145 92  ASN A CB  
667  C CG  . ASN A 92  ? 0.2702 0.2959 0.3288 0.0141  -0.0611 -0.0134 92  ASN A CG  
668  O OD1 . ASN A 92  ? 0.2714 0.2860 0.3293 0.0150  -0.0649 -0.0153 92  ASN A OD1 
669  N ND2 . ASN A 92  ? 0.3220 0.3552 0.3778 0.0101  -0.0550 -0.0096 92  ASN A ND2 
670  N N   . LEU A 93  ? 0.2460 0.2673 0.3145 0.0251  -0.0751 -0.0179 93  LEU A N   
671  C CA  . LEU A 93  ? 0.2499 0.2745 0.3223 0.0282  -0.0785 -0.0176 93  LEU A CA  
672  C C   . LEU A 93  ? 0.2675 0.2920 0.3403 0.0198  -0.0778 -0.0103 93  LEU A C   
673  O O   . LEU A 93  ? 0.2410 0.2496 0.3079 0.0130  -0.0776 -0.0065 93  LEU A O   
674  C CB  . LEU A 93  ? 0.2186 0.2262 0.2891 0.0324  -0.0848 -0.0216 93  LEU A CB  
675  C CG  . LEU A 93  ? 0.3226 0.3334 0.3968 0.0375  -0.0886 -0.0221 93  LEU A CG  
676  C CD1 . LEU A 93  ? 0.2996 0.3304 0.3776 0.0479  -0.0874 -0.0252 93  LEU A CD1 
677  C CD2 . LEU A 93  ? 0.2804 0.2710 0.3510 0.0403  -0.0947 -0.0254 93  LEU A CD2 
678  N N   . HIS A 94  ? 0.1895 0.2312 0.2683 0.0206  -0.0778 -0.0077 94  HIS A N   
679  C CA  . HIS A 94  ? 0.2000 0.2417 0.2788 0.0124  -0.0792 -0.0006 94  HIS A CA  
680  C C   . HIS A 94  ? 0.1964 0.2392 0.2804 0.0166  -0.0848 -0.0009 94  HIS A C   
681  O O   . HIS A 94  ? 0.2429 0.3030 0.3346 0.0249  -0.0852 -0.0028 94  HIS A O   
682  C CB  . HIS A 94  ? 0.2500 0.3129 0.3332 0.0086  -0.0760 0.0044  94  HIS A CB  
683  C CG  . HIS A 94  ? 0.3185 0.3812 0.4009 -0.0009 -0.0792 0.0123  94  HIS A CG  
684  N ND1 . HIS A 94  ? 0.3305 0.4047 0.4214 -0.0001 -0.0840 0.0156  94  HIS A ND1 
685  C CD2 . HIS A 94  ? 0.3163 0.3679 0.3891 -0.0113 -0.0790 0.0180  94  HIS A CD2 
686  C CE1 . HIS A 94  ? 0.2985 0.3682 0.3855 -0.0108 -0.0875 0.0231  94  HIS A CE1 
687  N NE2 . HIS A 94  ? 0.3108 0.3654 0.3856 -0.0175 -0.0846 0.0243  94  HIS A NE2 
688  N N   . VAL A 95  ? 0.2031 0.2273 0.2819 0.0121  -0.0887 0.0013  95  VAL A N   
689  C CA  . VAL A 95  ? 0.2033 0.2269 0.2862 0.0159  -0.0943 0.0011  95  VAL A CA  
690  C C   . VAL A 95  ? 0.2295 0.2527 0.3118 0.0073  -0.0980 0.0087  95  VAL A C   
691  O O   . VAL A 95  ? 0.2403 0.2443 0.3122 -0.0004 -0.0987 0.0122  95  VAL A O   
692  C CB  . VAL A 95  ? 0.2348 0.2351 0.3120 0.0190  -0.0972 -0.0030 95  VAL A CB  
693  C CG1 . VAL A 95  ? 0.2962 0.2964 0.3774 0.0240  -0.1029 -0.0038 95  VAL A CG1 
694  C CG2 . VAL A 95  ? 0.2198 0.2167 0.2960 0.0254  -0.0954 -0.0097 95  VAL A CG2 
695  N N   . HIS A 96  ? 0.2066 0.2502 0.2991 0.0091  -0.1007 0.0118  96  HIS A N   
696  C CA  . HIS A 96  ? 0.2203 0.2632 0.3128 0.0007  -0.1065 0.0193  96  HIS A CA  
697  C C   . HIS A 96  ? 0.2758 0.3081 0.3686 0.0050  -0.1122 0.0177  96  HIS A C   
698  O O   . HIS A 96  ? 0.2648 0.3083 0.3656 0.0153  -0.1126 0.0138  96  HIS A O   
699  C CB  . HIS A 96  ? 0.2466 0.3198 0.3519 -0.0012 -0.1071 0.0259  96  HIS A CB  
700  C CG  . HIS A 96  ? 0.2921 0.3651 0.3978 -0.0115 -0.1146 0.0347  96  HIS A CG  
701  N ND1 . HIS A 96  ? 0.3513 0.4135 0.4472 -0.0244 -0.1168 0.0409  96  HIS A ND1 
702  C CD2 . HIS A 96  ? 0.2856 0.3654 0.3985 -0.0108 -0.1213 0.0385  96  HIS A CD2 
703  C CE1 . HIS A 96  ? 0.3774 0.4392 0.4742 -0.0320 -0.1253 0.0481  96  HIS A CE1 
704  N NE2 . HIS A 96  ? 0.3195 0.3931 0.4277 -0.0241 -0.1281 0.0470  96  HIS A NE2 
705  N N   . VAL A 97  ? 0.2495 0.2591 0.3318 -0.0021 -0.1166 0.0207  97  VAL A N   
706  C CA  . VAL A 97  ? 0.2809 0.2791 0.3625 0.0011  -0.1225 0.0199  97  VAL A CA  
707  C C   . VAL A 97  ? 0.2607 0.2703 0.3478 -0.0049 -0.1296 0.0276  97  VAL A C   
708  O O   . VAL A 97  ? 0.2696 0.2695 0.3483 -0.0158 -0.1333 0.0339  97  VAL A O   
709  C CB  . VAL A 97  ? 0.3346 0.2996 0.4006 -0.0013 -0.1230 0.0186  97  VAL A CB  
710  C CG1 . VAL A 97  ? 0.2842 0.2383 0.3499 0.0033  -0.1285 0.0170  97  VAL A CG1 
711  C CG2 . VAL A 97  ? 0.3103 0.2669 0.3727 0.0029  -0.1164 0.0131  97  VAL A CG2 
712  N N   . GLU A 98  ? 0.3271 0.1982 0.3565 -0.0087 -0.1419 0.0445  98  GLU A N   
713  C CA  A GLU A 98  ? 0.3486 0.2202 0.3844 -0.0112 -0.1512 0.0499  98  GLU A CA  
714  C CA  B GLU A 98  ? 0.3630 0.2347 0.3987 -0.0113 -0.1511 0.0499  98  GLU A CA  
715  C C   . GLU A 98  ? 0.3838 0.2310 0.4016 -0.0162 -0.1594 0.0549  98  GLU A C   
716  O O   . GLU A 98  ? 0.4246 0.2676 0.4389 -0.0204 -0.1658 0.0599  98  GLU A O   
717  C CB  A GLU A 98  ? 0.2942 0.1781 0.3506 -0.0068 -0.1550 0.0485  98  GLU A CB  
718  C CB  B GLU A 98  ? 0.3501 0.2350 0.4070 -0.0069 -0.1549 0.0487  98  GLU A CB  
719  C CG  A GLU A 98  ? 0.2825 0.1925 0.3574 -0.0014 -0.1485 0.0450  98  GLU A CG  
720  C CG  B GLU A 98  ? 0.5248 0.4253 0.5980 -0.0077 -0.1598 0.0537  98  GLU A CG  
721  C CD  A GLU A 98  ? 0.4860 0.4076 0.5800 0.0047  -0.1514 0.0428  98  GLU A CD  
722  C CD  B GLU A 98  ? 0.5968 0.5222 0.6833 -0.0044 -0.1514 0.0519  98  GLU A CD  
723  O OE1 A GLU A 98  ? 0.5263 0.4682 0.6374 0.0075  -0.1508 0.0445  98  GLU A OE1 
724  O OE1 B GLU A 98  ? 0.4766 0.4032 0.5548 -0.0074 -0.1471 0.0533  98  GLU A OE1 
725  O OE2 A GLU A 98  ? 0.4554 0.3661 0.5477 0.0070  -0.1540 0.0395  98  GLU A OE2 
726  O OE2 B GLU A 98  ? 0.6246 0.5678 0.7288 0.0019  -0.1492 0.0492  98  GLU A OE2 
727  N N   . ALA A 99  ? 0.3584 0.1888 0.3641 -0.0160 -0.1597 0.0537  99  ALA A N   
728  C CA  . ALA A 99  ? 0.3906 0.2038 0.3788 -0.0206 -0.1640 0.0552  99  ALA A CA  
729  C C   . ALA A 99  ? 0.3895 0.1936 0.3569 -0.0242 -0.1606 0.0557  99  ALA A C   
730  O O   . ALA A 99  ? 0.4190 0.2142 0.3754 -0.0281 -0.1656 0.0566  99  ALA A O   
731  C CB  . ALA A 99  ? 0.4883 0.2917 0.4692 -0.0196 -0.1620 0.0529  99  ALA A CB  
732  N N   . SER A 100 ? 0.4085 0.2143 0.3705 -0.0224 -0.1526 0.0547  100 SER A N   
733  C CA  . SER A 100 ? 0.4733 0.2701 0.4150 -0.0244 -0.1483 0.0545  100 SER A CA  
734  C C   . SER A 100 ? 0.4758 0.2811 0.4226 -0.0254 -0.1484 0.0563  100 SER A C   
735  O O   . SER A 100 ? 0.5198 0.3177 0.4520 -0.0277 -0.1477 0.0563  100 SER A O   
736  C CB  . SER A 100 ? 0.4892 0.2803 0.4190 -0.0216 -0.1385 0.0526  100 SER A CB  
737  O OG  . SER A 100 ? 0.4413 0.2433 0.3849 -0.0185 -0.1343 0.0521  100 SER A OG  
738  N N   . GLY A 101 ? 0.4431 0.2642 0.4104 -0.0232 -0.1491 0.0579  101 GLY A N   
739  C CA  . GLY A 101 ? 0.4368 0.2717 0.4110 -0.0240 -0.1467 0.0590  101 GLY A CA  
740  C C   . GLY A 101 ? 0.4055 0.2431 0.3714 -0.0217 -0.1358 0.0556  101 GLY A C   
741  O O   . GLY A 101 ? 0.4161 0.2630 0.3844 -0.0224 -0.1330 0.0563  101 GLY A O   
742  N N   . GLU A 102 ? 0.3986 0.2283 0.3555 -0.0192 -0.1301 0.0525  102 GLU A N   
743  C CA  . GLU A 102 ? 0.3675 0.1994 0.3172 -0.0169 -0.1200 0.0497  102 GLU A CA  
744  C C   . GLU A 102 ? 0.3657 0.2207 0.3341 -0.0137 -0.1132 0.0452  102 GLU A C   
745  O O   . GLU A 102 ? 0.3941 0.2598 0.3783 -0.0121 -0.1150 0.0431  102 GLU A O   
746  C CB  . GLU A 102 ? 0.4425 0.2579 0.3766 -0.0158 -0.1165 0.0494  102 GLU A CB  
747  C CG  . GLU A 102 ? 0.6000 0.3940 0.5113 -0.0177 -0.1201 0.0521  102 GLU A CG  
748  C CD  . GLU A 102 ? 0.8687 0.6518 0.7662 -0.0160 -0.1141 0.0514  102 GLU A CD  
749  O OE1 . GLU A 102 ? 0.9468 0.7328 0.8529 -0.0147 -0.1119 0.0512  102 GLU A OE1 
750  O OE2 . GLU A 102 ? 0.9425 0.7140 0.8207 -0.0159 -0.1119 0.0512  102 GLU A OE2 
751  N N   . GLN A 103 ? 0.2964 0.1581 0.2622 -0.0123 -0.1059 0.0436  103 GLN A N   
752  C CA  . GLN A 103 ? 0.2933 0.1748 0.2737 -0.0090 -0.0996 0.0391  103 GLN A CA  
753  C C   . GLN A 103 ? 0.3646 0.2432 0.3387 -0.0071 -0.0922 0.0365  103 GLN A C   
754  O O   . GLN A 103 ? 0.3411 0.2077 0.2998 -0.0077 -0.0894 0.0387  103 GLN A O   
755  C CB  . GLN A 103 ? 0.3154 0.2115 0.3018 -0.0091 -0.0979 0.0399  103 GLN A CB  
756  C CG  . GLN A 103 ? 0.3565 0.2433 0.3276 -0.0107 -0.0959 0.0426  103 GLN A CG  
757  C CD  . GLN A 103 ? 0.4302 0.3299 0.4075 -0.0117 -0.0958 0.0447  103 GLN A CD  
758  O OE1 . GLN A 103 ? 0.4112 0.3305 0.4034 -0.0096 -0.0931 0.0427  103 GLN A OE1 
759  N NE2 . GLN A 103 ? 0.3849 0.2731 0.3499 -0.0146 -0.0988 0.0488  103 GLN A NE2 
760  N N   . TYR A 104 ? 0.2861 0.1752 0.2721 -0.0046 -0.0894 0.0321  104 TYR A N   
761  C CA  . TYR A 104 ? 0.2566 0.1452 0.2406 -0.0033 -0.0831 0.0301  104 TYR A CA  
762  C C   . TYR A 104 ? 0.3179 0.2246 0.3129 -0.0006 -0.0790 0.0257  104 TYR A C   
763  O O   . TYR A 104 ? 0.2797 0.1987 0.2869 0.0014  -0.0810 0.0224  104 TYR A O   
764  C CB  . TYR A 104 ? 0.2756 0.1570 0.2627 -0.0036 -0.0850 0.0293  104 TYR A CB  
765  C CG  . TYR A 104 ? 0.3019 0.1638 0.2747 -0.0060 -0.0880 0.0342  104 TYR A CG  
766  C CD1 . TYR A 104 ? 0.3356 0.1864 0.2956 -0.0065 -0.0830 0.0372  104 TYR A CD1 
767  C CD2 . TYR A 104 ? 0.3056 0.1604 0.2770 -0.0075 -0.0957 0.0362  104 TYR A CD2 
768  C CE1 . TYR A 104 ? 0.3397 0.1721 0.2842 -0.0080 -0.0852 0.0416  104 TYR A CE1 
769  C CE2 . TYR A 104 ? 0.3595 0.1951 0.3159 -0.0096 -0.0991 0.0406  104 TYR A CE2 
770  C CZ  . TYR A 104 ? 0.3840 0.2080 0.3259 -0.0097 -0.0937 0.0431  104 TYR A CZ  
771  O OH  . TYR A 104 ? 0.4287 0.2330 0.3534 -0.0111 -0.0968 0.0474  104 TYR A OH  
772  N N   . ARG A 105 ? 0.2521 0.1605 0.2425 0.0001  -0.0731 0.0256  105 ARG A N   
773  C CA  . ARG A 105 ? 0.2351 0.1594 0.2333 0.0025  -0.0697 0.0221  105 ARG A CA  
774  C C   . ARG A 105 ? 0.2486 0.1753 0.2504 0.0035  -0.0658 0.0198  105 ARG A C   
775  O O   . ARG A 105 ? 0.2803 0.2012 0.2746 0.0030  -0.0615 0.0226  105 ARG A O   
776  C CB  . ARG A 105 ? 0.3103 0.2360 0.3004 0.0022  -0.0673 0.0249  105 ARG A CB  
777  C CG  . ARG A 105 ? 0.3117 0.2349 0.2992 0.0002  -0.0721 0.0283  105 ARG A CG  
778  C CD  . ARG A 105 ? 0.3789 0.2951 0.3538 -0.0012 -0.0711 0.0323  105 ARG A CD  
779  N NE  . ARG A 105 ? 0.3380 0.2672 0.3162 0.0006  -0.0670 0.0312  105 ARG A NE  
780  C CZ  . ARG A 105 ? 0.3150 0.2397 0.2833 0.0005  -0.0649 0.0338  105 ARG A CZ  
781  N NH1 . ARG A 105 ? 0.3457 0.2526 0.2992 -0.0009 -0.0664 0.0372  105 ARG A NH1 
782  N NH2 . ARG A 105 ? 0.3012 0.2383 0.2734 0.0021  -0.0617 0.0328  105 ARG A NH2 
783  N N   . PHE A 106 ? 0.2345 0.1697 0.2481 0.0053  -0.0675 0.0148  106 PHE A N   
784  C CA  . PHE A 106 ? 0.2296 0.1670 0.2486 0.0055  -0.0655 0.0127  106 PHE A CA  
785  C C   . PHE A 106 ? 0.2903 0.2417 0.3141 0.0081  -0.0634 0.0090  106 PHE A C   
786  O O   . PHE A 106 ? 0.2775 0.2383 0.3074 0.0110  -0.0658 0.0042  106 PHE A O   
787  C CB  . PHE A 106 ? 0.2417 0.1757 0.2694 0.0053  -0.0703 0.0098  106 PHE A CB  
788  C CG  . PHE A 106 ? 0.2372 0.1570 0.2596 0.0028  -0.0729 0.0138  106 PHE A CG  
789  C CD1 . PHE A 106 ? 0.2523 0.1698 0.2748 0.0034  -0.0775 0.0135  106 PHE A CD1 
790  C CD2 . PHE A 106 ? 0.2421 0.1514 0.2592 -0.0001 -0.0705 0.0187  106 PHE A CD2 
791  C CE1 . PHE A 106 ? 0.2693 0.1730 0.2862 0.0010  -0.0808 0.0174  106 PHE A CE1 
792  C CE2 . PHE A 106 ? 0.2548 0.1501 0.2649 -0.0022 -0.0729 0.0227  106 PHE A CE2 
793  C CZ  . PHE A 106 ? 0.3012 0.1931 0.3109 -0.0018 -0.0786 0.0219  106 PHE A CZ  
794  N N   . VAL A 107 ? 0.2709 0.2235 0.2910 0.0078  -0.0588 0.0114  107 VAL A N   
795  C CA  . VAL A 107 ? 0.2363 0.2010 0.2587 0.0101  -0.0568 0.0090  107 VAL A CA  
796  C C   . VAL A 107 ? 0.2896 0.2585 0.3202 0.0101  -0.0566 0.0069  107 VAL A C   
797  O O   . VAL A 107 ? 0.2727 0.2375 0.3029 0.0084  -0.0534 0.0109  107 VAL A O   
798  C CB  . VAL A 107 ? 0.2639 0.2276 0.2764 0.0101  -0.0524 0.0134  107 VAL A CB  
799  C CG1 . VAL A 107 ? 0.3404 0.3165 0.3553 0.0125  -0.0508 0.0112  107 VAL A CG1 
800  C CG2 . VAL A 107 ? 0.3303 0.2886 0.3351 0.0092  -0.0539 0.0161  107 VAL A CG2 
801  N N   . MET A 108 ? 0.3147 0.2918 0.3529 0.0123  -0.0603 0.0007  108 MET A N   
802  C CA  . MET A 108 ? 0.2996 0.2802 0.3464 0.0120  -0.0623 -0.0019 108 MET A CA  
803  C C   . MET A 108 ? 0.2850 0.2769 0.3316 0.0147  -0.0613 -0.0043 108 MET A C   
804  O O   . MET A 108 ? 0.2630 0.2600 0.3032 0.0169  -0.0593 -0.0044 108 MET A O   
805  C CB  . MET A 108 ? 0.2709 0.2491 0.3249 0.0127  -0.0689 -0.0077 108 MET A CB  
806  C CG  . MET A 108 ? 0.2899 0.2565 0.3464 0.0091  -0.0706 -0.0045 108 MET A CG  
807  S SD  . MET A 108 ? 0.3828 0.3442 0.4454 0.0108  -0.0788 -0.0111 108 MET A SD  
808  C CE  . MET A 108 ? 0.3886 0.3532 0.4444 0.0148  -0.0776 -0.0124 108 MET A CE  
809  N N   . PRO A 109 ? 0.2860 0.2817 0.3399 0.0141  -0.0630 -0.0054 109 PRO A N   
810  C CA  . PRO A 109 ? 0.3064 0.3121 0.3596 0.0166  -0.0626 -0.0073 109 PRO A CA  
811  C C   . PRO A 109 ? 0.2451 0.2569 0.2957 0.0209  -0.0662 -0.0144 109 PRO A C   
812  O O   . PRO A 109 ? 0.2669 0.2756 0.3192 0.0222  -0.0702 -0.0191 109 PRO A O   
813  C CB  . PRO A 109 ? 0.3212 0.3286 0.3850 0.0145  -0.0656 -0.0072 109 PRO A CB  
814  C CG  . PRO A 109 ? 0.2598 0.2587 0.3283 0.0103  -0.0640 -0.0019 109 PRO A CG  
815  C CD  . PRO A 109 ? 0.2329 0.2241 0.2964 0.0106  -0.0653 -0.0038 109 PRO A CD  
816  N N   . GLY A 110 ? 0.2484 0.2687 0.2943 0.0235  -0.0646 -0.0150 110 GLY A N   
817  C CA  . GLY A 110 ? 0.2332 0.2605 0.2754 0.0283  -0.0672 -0.0212 110 GLY A CA  
818  C C   . GLY A 110 ? 0.2760 0.3035 0.3234 0.0298  -0.0742 -0.0279 110 GLY A C   
819  O O   . GLY A 110 ? 0.3038 0.3276 0.3591 0.0263  -0.0770 -0.0267 110 GLY A O   
820  N N   . ALA A 111 ? 0.2756 0.3071 0.3182 0.0351  -0.0771 -0.0347 111 ALA A N   
821  C CA  . ALA A 111 ? 0.2649 0.2952 0.3094 0.0374  -0.0849 -0.0420 111 ALA A CA  
822  C C   . ALA A 111 ? 0.3031 0.3374 0.3500 0.0355  -0.0866 -0.0402 111 ALA A C   
823  O O   . ALA A 111 ? 0.2551 0.2955 0.2989 0.0348  -0.0813 -0.0348 111 ALA A O   
824  C CB  . ALA A 111 ? 0.2867 0.3214 0.3222 0.0449  -0.0864 -0.0494 111 ALA A CB  
825  N N   . ALA A 112 ? 0.2600 0.2905 0.3128 0.0347  -0.0949 -0.0446 112 ALA A N   
826  C CA  . ALA A 112 ? 0.3310 0.3658 0.3878 0.0330  -0.0982 -0.0432 112 ALA A CA  
827  C C   . ALA A 112 ? 0.3036 0.3457 0.3486 0.0387  -0.0986 -0.0469 112 ALA A C   
828  O O   . ALA A 112 ? 0.2801 0.3227 0.3149 0.0444  -0.0989 -0.0528 112 ALA A O   
829  C CB  . ALA A 112 ? 0.3425 0.3708 0.4094 0.0301  -0.1085 -0.0467 112 ALA A CB  
830  N N   . LEU A 113 ? 0.2729 0.3211 0.3193 0.0375  -0.0982 -0.0429 113 LEU A N   
831  C CA  . LEU A 113 ? 0.3734 0.4281 0.4089 0.0423  -0.0994 -0.0457 113 LEU A CA  
832  C C   . LEU A 113 ? 0.3477 0.4026 0.3895 0.0408  -0.1084 -0.0473 113 LEU A C   
833  O O   . LEU A 113 ? 0.3578 0.4142 0.4122 0.0358  -0.1083 -0.0412 113 LEU A O   
834  C CB  . LEU A 113 ? 0.4434 0.5054 0.4738 0.0424  -0.0906 -0.0383 113 LEU A CB  
835  C CG  . LEU A 113 ? 0.4742 0.5393 0.4939 0.0454  -0.0830 -0.0370 113 LEU A CG  
836  C CD1 . LEU A 113 ? 0.3775 0.4479 0.3939 0.0442  -0.0764 -0.0290 113 LEU A CD1 
837  C CD2 . LEU A 113 ? 0.4631 0.5314 0.4709 0.0521  -0.0855 -0.0441 113 LEU A CD2 
838  N N   . ASN A 114 ? 0.3095 0.3628 0.3427 0.0453  -0.1164 -0.0552 114 ASN A N   
839  C CA  . ASN A 114 ? 0.3425 0.3961 0.3810 0.0437  -0.1261 -0.0564 114 ASN A CA  
840  C C   . ASN A 114 ? 0.3140 0.3765 0.3458 0.0457  -0.1232 -0.0524 114 ASN A C   
841  O O   . ASN A 114 ? 0.3319 0.3997 0.3544 0.0483  -0.1141 -0.0492 114 ASN A O   
842  C CB  . ASN A 114 ? 0.4350 0.4800 0.4677 0.0470  -0.1384 -0.0669 114 ASN A CB  
843  C CG  . ASN A 114 ? 0.5062 0.5515 0.5174 0.0560  -0.1375 -0.0742 114 ASN A CG  
844  O OD1 . ASN A 114 ? 0.4651 0.5188 0.4662 0.0592  -0.1313 -0.0713 114 ASN A OD1 
845  N ND2 . ASN A 114 ? 0.4651 0.5012 0.4692 0.0603  -0.1436 -0.0835 114 ASN A ND2 
846  N N   . GLU A 115 ? 0.3287 0.3929 0.3661 0.0443  -0.1315 -0.0522 115 GLU A N   
847  C CA  . GLU A 115 ? 0.3535 0.4259 0.3862 0.0459  -0.1295 -0.0477 115 GLU A CA  
848  C C   . GLU A 115 ? 0.3613 0.4351 0.3723 0.0531  -0.1289 -0.0526 115 GLU A C   
849  O O   . GLU A 115 ? 0.3505 0.4309 0.3539 0.0549  -0.1218 -0.0476 115 GLU A O   
850  C CB  . GLU A 115 ? 0.3225 0.3967 0.3678 0.0426  -0.1395 -0.0461 115 GLU A CB  
851  C CG  . GLU A 115 ? 0.4110 0.4879 0.4788 0.0359  -0.1372 -0.0381 115 GLU A CG  
852  C CD  . GLU A 115 ? 0.6120 0.6918 0.6954 0.0323  -0.1481 -0.0362 115 GLU A CD  
853  O OE1 . GLU A 115 ? 0.6933 0.7681 0.7724 0.0334  -0.1606 -0.0433 115 GLU A OE1 
854  O OE2 . GLU A 115 ? 0.7049 0.7919 0.8048 0.0287  -0.1443 -0.0276 115 GLU A OE2 
855  N N   . ASP A 116 ? 0.3538 0.4211 0.3542 0.0574  -0.1362 -0.0622 116 ASP A N   
856  C CA  . ASP A 116 ? 0.3323 0.4012 0.3109 0.0652  -0.1349 -0.0671 116 ASP A CA  
857  C C   . ASP A 116 ? 0.3449 0.4194 0.3164 0.0675  -0.1216 -0.0633 116 ASP A C   
858  O O   . ASP A 116 ? 0.3669 0.4484 0.3267 0.0708  -0.1159 -0.0599 116 ASP A O   
859  C CB  . ASP A 116 ? 0.4360 0.4952 0.4040 0.0704  -0.1445 -0.0787 116 ASP A CB  
860  C CG  . ASP A 116 ? 0.5239 0.5853 0.4680 0.0798  -0.1413 -0.0837 116 ASP A CG  
861  O OD1 . ASP A 116 ? 0.6108 0.6794 0.5453 0.0819  -0.1386 -0.0798 116 ASP A OD1 
862  O OD2 . ASP A 116 ? 0.6878 0.7438 0.6226 0.0855  -0.1414 -0.0912 116 ASP A OD2 
863  N N   . GLU A 117 ? 0.3369 0.4081 0.3161 0.0654  -0.1173 -0.0634 117 GLU A N   
864  C CA  . GLU A 117 ? 0.3304 0.4064 0.3054 0.0668  -0.1058 -0.0595 117 GLU A CA  
865  C C   . GLU A 117 ? 0.3122 0.3952 0.2908 0.0630  -0.0976 -0.0490 117 GLU A C   
866  O O   . GLU A 117 ? 0.3258 0.4150 0.2952 0.0654  -0.0901 -0.0453 117 GLU A O   
867  C CB  . GLU A 117 ? 0.3779 0.4478 0.3622 0.0646  -0.1044 -0.0613 117 GLU A CB  
868  C CG  . GLU A 117 ? 0.3957 0.4587 0.3725 0.0706  -0.1104 -0.0719 117 GLU A CG  
869  C CD  . GLU A 117 ? 0.3283 0.3819 0.3174 0.0670  -0.1139 -0.0744 117 GLU A CD  
870  O OE1 . GLU A 117 ? 0.4233 0.4693 0.4073 0.0717  -0.1199 -0.0833 117 GLU A OE1 
871  O OE2 . GLU A 117 ? 0.3794 0.4326 0.3824 0.0599  -0.1109 -0.0675 117 GLU A OE2 
872  N N   . PHE A 118 ? 0.2954 0.3773 0.2872 0.0573  -0.0992 -0.0440 118 PHE A N   
873  C CA  . PHE A 118 ? 0.2803 0.3669 0.2746 0.0545  -0.0921 -0.0346 118 PHE A CA  
874  C C   . PHE A 118 ? 0.2974 0.3900 0.2799 0.0579  -0.0925 -0.0326 118 PHE A C   
875  O O   . PHE A 118 ? 0.2971 0.3937 0.2738 0.0581  -0.0855 -0.0264 118 PHE A O   
876  C CB  . PHE A 118 ? 0.2918 0.3764 0.3024 0.0491  -0.0933 -0.0299 118 PHE A CB  
877  C CG  . PHE A 118 ? 0.3405 0.4278 0.3528 0.0471  -0.0859 -0.0209 118 PHE A CG  
878  C CD1 . PHE A 118 ? 0.3523 0.4440 0.3635 0.0480  -0.0873 -0.0170 118 PHE A CD1 
879  C CD2 . PHE A 118 ? 0.3952 0.4795 0.4091 0.0448  -0.0782 -0.0166 118 PHE A CD2 
880  C CE1 . PHE A 118 ? 0.3685 0.4612 0.3802 0.0470  -0.0810 -0.0092 118 PHE A CE1 
881  C CE2 . PHE A 118 ? 0.4000 0.4845 0.4136 0.0436  -0.0722 -0.0089 118 PHE A CE2 
882  C CZ  . PHE A 118 ? 0.4070 0.4955 0.4194 0.0449  -0.0735 -0.0053 118 PHE A CZ  
883  N N   . ARG A 119 ? 0.3140 0.4063 0.2929 0.0603  -0.1014 -0.0376 119 ARG A N   
884  C CA  . ARG A 119 ? 0.3055 0.4028 0.2715 0.0641  -0.1029 -0.0362 119 ARG A CA  
885  C C   . ARG A 119 ? 0.3002 0.4012 0.2488 0.0694  -0.0971 -0.0375 119 ARG A C   
886  O O   . ARG A 119 ? 0.3025 0.4091 0.2415 0.0710  -0.0932 -0.0323 119 ARG A O   
887  C CB  . ARG A 119 ? 0.3163 0.4111 0.2809 0.0658  -0.1150 -0.0421 119 ARG A CB  
888  C CG  . ARG A 119 ? 0.3393 0.4347 0.3204 0.0610  -0.1201 -0.0376 119 ARG A CG  
889  C CD  . ARG A 119 ? 0.3811 0.4744 0.3607 0.0624  -0.1334 -0.0428 119 ARG A CD  
890  N NE  . ARG A 119 ? 0.4695 0.5552 0.4524 0.0621  -0.1416 -0.0513 119 ARG A NE  
891  C CZ  . ARG A 119 ? 0.3422 0.4250 0.3439 0.0568  -0.1484 -0.0513 119 ARG A CZ  
892  N NH1 . ARG A 119 ? 0.3740 0.4623 0.3931 0.0521  -0.1473 -0.0432 119 ARG A NH1 
893  N NH2 . ARG A 119 ? 0.3917 0.4660 0.3949 0.0565  -0.1565 -0.0590 119 ARG A NH2 
894  N N   . GLN A 120 ? 0.3217 0.4202 0.2671 0.0722  -0.0964 -0.0439 120 GLN A N   
895  C CA  . GLN A 120 ? 0.3634 0.4673 0.2948 0.0776  -0.0896 -0.0444 120 GLN A CA  
896  C C   . GLN A 120 ? 0.3207 0.4301 0.2559 0.0741  -0.0792 -0.0350 120 GLN A C   
897  O O   . GLN A 120 ? 0.3639 0.4807 0.2887 0.0767  -0.0733 -0.0305 120 GLN A O   
898  C CB  . GLN A 120 ? 0.3118 0.4116 0.2411 0.0818  -0.0910 -0.0533 120 GLN A CB  
899  C CG  . GLN A 120 ? 0.3666 0.4604 0.2856 0.0875  -0.1012 -0.0636 120 GLN A CG  
900  C CD  . GLN A 120 ? 0.4608 0.5491 0.3764 0.0925  -0.1025 -0.0725 120 GLN A CD  
901  O OE1 . GLN A 120 ? 0.4264 0.5205 0.3342 0.0978  -0.0947 -0.0727 120 GLN A OE1 
902  N NE2 . GLN A 120 ? 0.4494 0.5269 0.3720 0.0910  -0.1125 -0.0796 120 GLN A NE2 
903  N N   . LEU A 121 ? 0.3182 0.4234 0.2678 0.0682  -0.0773 -0.0316 121 LEU A N   
904  C CA  . LEU A 121 ? 0.3228 0.4304 0.2760 0.0644  -0.0691 -0.0229 121 LEU A CA  
905  C C   . LEU A 121 ? 0.2996 0.4099 0.2496 0.0626  -0.0678 -0.0151 121 LEU A C   
906  O O   . LEU A 121 ? 0.3185 0.4332 0.2632 0.0620  -0.0620 -0.0083 121 LEU A O   
907  C CB  . LEU A 121 ? 0.3098 0.4105 0.2772 0.0591  -0.0683 -0.0218 121 LEU A CB  
908  C CG  . LEU A 121 ? 0.3237 0.4217 0.2943 0.0602  -0.0678 -0.0273 121 LEU A CG  
909  C CD1 . LEU A 121 ? 0.3269 0.4166 0.3109 0.0553  -0.0697 -0.0277 121 LEU A CD1 
910  C CD2 . LEU A 121 ? 0.3657 0.4689 0.3328 0.0608  -0.0603 -0.0229 121 LEU A CD2 
911  N N   . GLU A 122 ? 0.2975 0.4051 0.2517 0.0616  -0.0737 -0.0158 122 GLU A N   
912  C CA  . GLU A 122 ? 0.3185 0.4279 0.2699 0.0608  -0.0739 -0.0092 122 GLU A CA  
913  C C   . GLU A 122 ? 0.3430 0.4590 0.2784 0.0651  -0.0731 -0.0078 122 GLU A C   
914  O O   . GLU A 122 ? 0.3334 0.4519 0.2638 0.0641  -0.0694 0.0000  122 GLU A O   
915  C CB  . GLU A 122 ? 0.3928 0.4998 0.3524 0.0601  -0.0816 -0.0113 122 GLU A CB  
916  C CG  . GLU A 122 ? 0.6525 0.7593 0.6168 0.0581  -0.0809 -0.0038 122 GLU A CG  
917  C CD  . GLU A 122 ? 0.7222 0.8273 0.7009 0.0564  -0.0867 -0.0050 122 GLU A CD  
918  O OE1 . GLU A 122 ? 0.6731 0.7766 0.6587 0.0558  -0.0916 -0.0113 122 GLU A OE1 
919  O OE2 . GLU A 122 ? 0.8023 0.9080 0.7861 0.0558  -0.0866 0.0007  122 GLU A OE2 
920  N N   . GLU A 123 ? 0.2742 0.3921 0.2004 0.0702  -0.0767 -0.0154 123 GLU A N   
921  C CA  . GLU A 123 ? 0.3483 0.4726 0.2574 0.0753  -0.0754 -0.0146 123 GLU A CA  
922  C C   . GLU A 123 ? 0.3710 0.5019 0.2759 0.0750  -0.0657 -0.0078 123 GLU A C   
923  O O   . GLU A 123 ? 0.3856 0.5220 0.2812 0.0757  -0.0625 -0.0009 123 GLU A O   
924  C CB  . GLU A 123 ? 0.4366 0.5600 0.3355 0.0818  -0.0808 -0.0251 123 GLU A CB  
925  C CG  . GLU A 123 ? 0.4880 0.6174 0.3667 0.0883  -0.0798 -0.0249 123 GLU A CG  
926  C CD  . GLU A 123 ? 0.5583 0.6841 0.4249 0.0955  -0.0866 -0.0362 123 GLU A CD  
927  O OE1 . GLU A 123 ? 0.5221 0.6422 0.3953 0.0961  -0.0895 -0.0440 123 GLU A OE1 
928  O OE2 . GLU A 123 ? 0.6481 0.7756 0.4976 0.1007  -0.0895 -0.0374 123 GLU A OE2 
929  N N   . GLN A 124 ? 0.3600 0.4904 0.2728 0.0736  -0.0614 -0.0092 124 GLN A N   
930  C CA  . GLN A 124 ? 0.4032 0.5403 0.3155 0.0724  -0.0529 -0.0023 124 GLN A CA  
931  C C   . GLN A 124 ? 0.3656 0.5013 0.2819 0.0663  -0.0503 0.0085  124 GLN A C   
932  O O   . GLN A 124 ? 0.4014 0.5437 0.3118 0.0658  -0.0456 0.0164  124 GLN A O   
933  C CB  . GLN A 124 ? 0.4133 0.5486 0.3353 0.0715  -0.0504 -0.0058 124 GLN A CB  
934  C CG  . GLN A 124 ? 0.5331 0.6714 0.4490 0.0788  -0.0508 -0.0150 124 GLN A CG  
935  C CD  . GLN A 124 ? 0.5967 0.7465 0.4986 0.0850  -0.0455 -0.0127 124 GLN A CD  
936  O OE1 . GLN A 124 ? 0.7389 0.8897 0.6279 0.0921  -0.0484 -0.0194 124 GLN A OE1 
937  N NE2 . GLN A 124 ? 0.6108 0.7691 0.5147 0.0825  -0.0380 -0.0029 124 GLN A NE2 
938  N N   . VAL A 125 ? 0.3620 0.4890 0.2883 0.0619  -0.0533 0.0090  125 VAL A N   
939  C CA  . VAL A 125 ? 0.3409 0.4638 0.2703 0.0569  -0.0515 0.0180  125 VAL A CA  
940  C C   . VAL A 125 ? 0.3473 0.4730 0.2671 0.0580  -0.0529 0.0237  125 VAL A C   
941  O O   . VAL A 125 ? 0.3650 0.4911 0.2819 0.0552  -0.0499 0.0326  125 VAL A O   
942  C CB  . VAL A 125 ? 0.3039 0.4170 0.2446 0.0537  -0.0542 0.0167  125 VAL A CB  
943  C CG1 . VAL A 125 ? 0.3495 0.4570 0.2903 0.0504  -0.0533 0.0251  125 VAL A CG1 
944  C CG2 . VAL A 125 ? 0.2856 0.3948 0.2350 0.0514  -0.0520 0.0137  125 VAL A CG2 
945  N N   . LEU A 126 ? 0.3238 0.4506 0.2383 0.0620  -0.0583 0.0187  126 LEU A N   
946  C CA  . LEU A 126 ? 0.3940 0.5227 0.2992 0.0633  -0.0606 0.0238  126 LEU A CA  
947  C C   . LEU A 126 ? 0.3466 0.4845 0.2376 0.0663  -0.0568 0.0276  126 LEU A C   
948  O O   . LEU A 126 ? 0.4037 0.5436 0.2851 0.0674  -0.0584 0.0327  126 LEU A O   
949  C CB  . LEU A 126 ? 0.4016 0.5277 0.3071 0.0660  -0.0688 0.0180  126 LEU A CB  
950  C CG  . LEU A 126 ? 0.4618 0.5807 0.3828 0.0628  -0.0715 0.0167  126 LEU A CG  
951  C CD1 . LEU A 126 ? 0.5063 0.6244 0.4303 0.0649  -0.0800 0.0123  126 LEU A CD1 
952  C CD2 . LEU A 126 ? 0.3808 0.4949 0.3057 0.0591  -0.0679 0.0256  126 LEU A CD2 
953  N N   . GLU A 127 ? 0.3879 0.5317 0.2778 0.0678  -0.0516 0.0257  127 GLU A N   
954  C CA  . GLU A 127 ? 0.5171 0.6715 0.3958 0.0704  -0.0460 0.0311  127 GLU A CA  
955  C C   . GLU A 127 ? 0.4454 0.6019 0.3293 0.0643  -0.0404 0.0428  127 GLU A C   
956  O O   . GLU A 127 ? 0.4770 0.6428 0.3538 0.0648  -0.0356 0.0504  127 GLU A O   
957  C CB  . GLU A 127 ? 0.5003 0.6615 0.3753 0.0761  -0.0428 0.0237  127 GLU A CB  
958  C CG  . GLU A 127 ? 0.6832 0.8421 0.5486 0.0830  -0.0490 0.0126  127 GLU A CG  
959  C CD  . GLU A 127 ? 0.8593 1.0225 0.7207 0.0895  -0.0463 0.0043  127 GLU A CD  
960  O OE1 . GLU A 127 ? 0.9111 1.0813 0.7774 0.0890  -0.0388 0.0080  127 GLU A OE1 
961  O OE2 . GLU A 127 ? 0.9321 1.0910 0.7854 0.0952  -0.0523 -0.0059 127 GLU A OE2 
962  N N   . ILE A 128 ? 0.3775 0.5250 0.2734 0.0587  -0.0415 0.0445  128 ILE A N   
963  C CA  . ILE A 128 ? 0.4482 0.5941 0.3488 0.0524  -0.0384 0.0552  128 ILE A CA  
964  C C   . ILE A 128 ? 0.4795 0.6236 0.3722 0.0508  -0.0403 0.0639  128 ILE A C   
965  O O   . ILE A 128 ? 0.4074 0.5457 0.2968 0.0526  -0.0454 0.0613  128 ILE A O   
966  C CB  . ILE A 128 ? 0.3738 0.5078 0.2863 0.0476  -0.0400 0.0538  128 ILE A CB  
967  C CG1 . ILE A 128 ? 0.3589 0.4948 0.2791 0.0486  -0.0379 0.0467  128 ILE A CG1 
968  C CG2 . ILE A 128 ? 0.3450 0.4737 0.2600 0.0412  -0.0390 0.0644  128 ILE A CG2 
969  C CD1 . ILE A 128 ? 0.3268 0.4506 0.2571 0.0452  -0.0400 0.0435  128 ILE A CD1 
970  N N   . GLU A 129 ? 0.4090 0.5584 0.2994 0.0473  -0.0367 0.0748  129 GLU A N   
971  C CA  . GLU A 129 ? 0.5001 0.6477 0.3826 0.0455  -0.0386 0.0842  129 GLU A CA  
972  C C   . GLU A 129 ? 0.4967 0.6285 0.3839 0.0410  -0.0435 0.0873  129 GLU A C   
973  O O   . GLU A 129 ? 0.4837 0.6073 0.3802 0.0380  -0.0438 0.0851  129 GLU A O   
974  C CB  . GLU A 129 ? 0.5085 0.6665 0.3885 0.0423  -0.0334 0.0961  129 GLU A CB  
975  C CG  . GLU A 129 ? 0.5438 0.7004 0.4357 0.0357  -0.0311 0.1017  129 GLU A CG  
976  C CD  . GLU A 129 ? 0.6376 0.8058 0.5357 0.0381  -0.0255 0.0969  129 GLU A CD  
977  O OE1 . GLU A 129 ? 0.5019 0.6686 0.4015 0.0429  -0.0261 0.0850  129 GLU A OE1 
978  O OE2 . GLU A 129 ? 0.8262 1.0052 0.7284 0.0353  -0.0207 0.1057  129 GLU A OE2 
979  N N   . SER A 130 ? 0.4176 0.5449 0.2976 0.0413  -0.0473 0.0922  130 SER A N   
980  C CA  . SER A 130 ? 0.4369 0.5490 0.3197 0.0382  -0.0518 0.0959  130 SER A CA  
981  C C   . SER A 130 ? 0.4904 0.5969 0.3770 0.0312  -0.0505 0.1052  130 SER A C   
982  O O   . SER A 130 ? 0.4845 0.5997 0.3688 0.0281  -0.0476 0.1136  130 SER A O   
983  C CB  . SER A 130 ? 0.5160 0.6252 0.3896 0.0403  -0.0563 0.1004  130 SER A CB  
984  O OG  . SER A 130 ? 0.5735 0.6684 0.4479 0.0369  -0.0599 0.1069  130 SER A OG  
985  N N   . GLY A 131 ? 0.4249 0.5169 0.3173 0.0288  -0.0529 0.1038  131 GLY A N   
986  C CA  . GLY A 131 ? 0.4626 0.5460 0.3577 0.0221  -0.0537 0.1119  131 GLY A CA  
987  C C   . GLY A 131 ? 0.3638 0.4500 0.2676 0.0193  -0.0504 0.1090  131 GLY A C   
988  O O   . GLY A 131 ? 0.4498 0.5254 0.3569 0.0142  -0.0523 0.1130  131 GLY A O   
989  N N   . ALA A 132 ? 0.3808 0.4806 0.2876 0.0230  -0.0462 0.1018  132 ALA A N   
990  C CA  . ALA A 132 ? 0.3347 0.4376 0.2502 0.0213  -0.0433 0.0981  132 ALA A CA  
991  C C   . ALA A 132 ? 0.3359 0.4250 0.2560 0.0219  -0.0455 0.0904  132 ALA A C   
992  O O   . ALA A 132 ? 0.3772 0.4581 0.2948 0.0251  -0.0480 0.0861  132 ALA A O   
993  C CB  . ALA A 132 ? 0.3358 0.4557 0.2521 0.0261  -0.0386 0.0923  132 ALA A CB  
994  N N   . ILE A 133 ? 0.3173 0.4046 0.2444 0.0189  -0.0443 0.0891  133 ILE A N   
995  C CA  . ILE A 133 ? 0.3620 0.4359 0.2926 0.0190  -0.0459 0.0830  133 ILE A CA  
996  C C   . ILE A 133 ? 0.3564 0.4378 0.2932 0.0226  -0.0432 0.0731  133 ILE A C   
997  O O   . ILE A 133 ? 0.3577 0.4514 0.2984 0.0228  -0.0402 0.0725  133 ILE A O   
998  C CB  . ILE A 133 ? 0.3315 0.3942 0.2643 0.0127  -0.0481 0.0888  133 ILE A CB  
999  C CG1 . ILE A 133 ? 0.3942 0.4452 0.3200 0.0093  -0.0524 0.0977  133 ILE A CG1 
1000 C CG2 . ILE A 133 ? 0.2915 0.3410 0.2266 0.0131  -0.0490 0.0823  133 ILE A CG2 
1001 C CD1 . ILE A 133 ? 0.4147 0.4550 0.3418 0.0023  -0.0561 0.1049  133 ILE A CD1 
1002 N N   . LEU A 134 ? 0.3168 0.3909 0.2547 0.0257  -0.0442 0.0659  134 LEU A N   
1003 C CA  . LEU A 134 ? 0.2948 0.3727 0.2391 0.0283  -0.0428 0.0569  134 LEU A CA  
1004 C C   . LEU A 134 ? 0.3201 0.3843 0.2680 0.0265  -0.0435 0.0546  134 LEU A C   
1005 O O   . LEU A 134 ? 0.3203 0.3736 0.2659 0.0273  -0.0448 0.0548  134 LEU A O   
1006 C CB  . LEU A 134 ? 0.2518 0.3348 0.1955 0.0335  -0.0438 0.0504  134 LEU A CB  
1007 C CG  . LEU A 134 ? 0.3105 0.3951 0.2612 0.0357  -0.0436 0.0413  134 LEU A CG  
1008 C CD1 . LEU A 134 ? 0.3238 0.4186 0.2762 0.0364  -0.0414 0.0388  134 LEU A CD1 
1009 C CD2 . LEU A 134 ? 0.3187 0.4061 0.2701 0.0398  -0.0463 0.0356  134 LEU A CD2 
1010 N N   . VAL A 135 ? 0.2378 0.3027 0.1910 0.0246  -0.0424 0.0526  135 VAL A N   
1011 C CA  . VAL A 135 ? 0.2199 0.2721 0.1756 0.0232  -0.0429 0.0502  135 VAL A CA  
1012 C C   . VAL A 135 ? 0.3358 0.3912 0.2977 0.0263  -0.0420 0.0417  135 VAL A C   
1013 O O   . VAL A 135 ? 0.3090 0.3731 0.2756 0.0270  -0.0412 0.0379  135 VAL A O   
1014 C CB  . VAL A 135 ? 0.2681 0.3165 0.2257 0.0185  -0.0435 0.0540  135 VAL A CB  
1015 C CG1 . VAL A 135 ? 0.2910 0.3243 0.2485 0.0173  -0.0445 0.0518  135 VAL A CG1 
1016 C CG2 . VAL A 135 ? 0.2737 0.3196 0.2267 0.0144  -0.0454 0.0633  135 VAL A CG2 
1017 N N   . ILE A 136 ? 0.2799 0.3284 0.2424 0.0282  -0.0423 0.0391  136 ILE A N   
1018 C CA  . ILE A 136 ? 0.2523 0.3025 0.2219 0.0301  -0.0421 0.0322  136 ILE A CA  
1019 C C   . ILE A 136 ? 0.3244 0.3630 0.2956 0.0279  -0.0413 0.0321  136 ILE A C   
1020 O O   . ILE A 136 ? 0.2611 0.2885 0.2285 0.0278  -0.0406 0.0348  136 ILE A O   
1021 C CB  . ILE A 136 ? 0.2559 0.3073 0.2274 0.0333  -0.0428 0.0303  136 ILE A CB  
1022 C CG1 . ILE A 136 ? 0.2865 0.3473 0.2541 0.0355  -0.0444 0.0313  136 ILE A CG1 
1023 C CG2 . ILE A 136 ? 0.3128 0.3672 0.2934 0.0344  -0.0436 0.0239  136 ILE A CG2 
1024 C CD1 . ILE A 136 ? 0.4067 0.4625 0.3692 0.0365  -0.0449 0.0365  136 ILE A CD1 
1025 N N   . SER A 137 ? 0.2420 0.2825 0.2177 0.0265  -0.0414 0.0291  137 SER A N   
1026 C CA  . SER A 137 ? 0.2257 0.2549 0.2016 0.0241  -0.0411 0.0297  137 SER A CA  
1027 C C   . SER A 137 ? 0.2696 0.3007 0.2534 0.0245  -0.0414 0.0239  137 SER A C   
1028 O O   . SER A 137 ? 0.2489 0.2896 0.2372 0.0256  -0.0424 0.0201  137 SER A O   
1029 C CB  . SER A 137 ? 0.2293 0.2551 0.2016 0.0205  -0.0423 0.0345  137 SER A CB  
1030 O OG  . SER A 137 ? 0.2547 0.2699 0.2272 0.0182  -0.0430 0.0344  137 SER A OG  
1031 N N   . GLY A 138 ? 0.2845 0.3060 0.2694 0.0239  -0.0406 0.0235  138 GLY A N   
1032 C CA  . GLY A 138 ? 0.2280 0.2489 0.2200 0.0234  -0.0413 0.0192  138 GLY A CA  
1033 C C   . GLY A 138 ? 0.2740 0.2951 0.2719 0.0247  -0.0406 0.0172  138 GLY A C   
1034 O O   . GLY A 138 ? 0.2843 0.3069 0.2812 0.0265  -0.0392 0.0190  138 GLY A O   
1035 N N   . SER A 139 ? 0.2536 0.2735 0.2585 0.0238  -0.0417 0.0139  139 SER A N   
1036 C CA  . SER A 139 ? 0.3141 0.3346 0.3269 0.0241  -0.0415 0.0129  139 SER A CA  
1037 C C   . SER A 139 ? 0.3659 0.3974 0.3854 0.0259  -0.0446 0.0089  139 SER A C   
1038 O O   . SER A 139 ? 0.2841 0.3224 0.3011 0.0276  -0.0468 0.0059  139 SER A O   
1039 C CB  . SER A 139 ? 0.3025 0.3175 0.3209 0.0218  -0.0427 0.0111  139 SER A CB  
1040 O OG  . SER A 139 ? 0.3133 0.3328 0.3353 0.0221  -0.0467 0.0058  139 SER A OG  
1041 N N   . LEU A 140 ? 0.2725 0.3058 0.3004 0.0258  -0.0448 0.0094  140 LEU A N   
1042 C CA  . LEU A 140 ? 0.2534 0.2957 0.2888 0.0270  -0.0492 0.0057  140 LEU A CA  
1043 C C   . LEU A 140 ? 0.2949 0.3366 0.3393 0.0252  -0.0540 0.0010  140 LEU A C   
1044 O O   . LEU A 140 ? 0.3170 0.3539 0.3682 0.0226  -0.0530 0.0032  140 LEU A O   
1045 C CB  . LEU A 140 ? 0.3199 0.3655 0.3613 0.0277  -0.0475 0.0099  140 LEU A CB  
1046 C CG  . LEU A 140 ? 0.3253 0.3803 0.3739 0.0288  -0.0531 0.0069  140 LEU A CG  
1047 C CD1 . LEU A 140 ? 0.3456 0.4051 0.3842 0.0318  -0.0542 0.0055  140 LEU A CD1 
1048 C CD2 . LEU A 140 ? 0.4093 0.4684 0.4690 0.0288  -0.0519 0.0115  140 LEU A CD2 
1049 N N   . PRO A 141 ? 0.2691 0.3150 0.3125 0.0269  -0.0592 -0.0054 141 PRO A N   
1050 C CA  . PRO A 141 ? 0.3078 0.3511 0.3580 0.0259  -0.0649 -0.0108 141 PRO A CA  
1051 C C   . PRO A 141 ? 0.2594 0.3051 0.3216 0.0241  -0.0699 -0.0112 141 PRO A C   
1052 O O   . PRO A 141 ? 0.3051 0.3567 0.3694 0.0248  -0.0696 -0.0086 141 PRO A O   
1053 C CB  . PRO A 141 ? 0.2851 0.3324 0.3278 0.0300  -0.0683 -0.0175 141 PRO A CB  
1054 C CG  . PRO A 141 ? 0.2997 0.3543 0.3360 0.0324  -0.0666 -0.0156 141 PRO A CG  
1055 C CD  . PRO A 141 ? 0.2774 0.3298 0.3121 0.0304  -0.0600 -0.0078 141 PRO A CD  
1056 N N   . PRO A 142 ? 0.3225 0.3634 0.3931 0.0216  -0.0749 -0.0140 142 PRO A N   
1057 C CA  . PRO A 142 ? 0.3442 0.3872 0.4279 0.0190  -0.0813 -0.0141 142 PRO A CA  
1058 C C   . PRO A 142 ? 0.3213 0.3698 0.4022 0.0221  -0.0881 -0.0197 142 PRO A C   
1059 O O   . PRO A 142 ? 0.3355 0.3839 0.4049 0.0263  -0.0895 -0.0257 142 PRO A O   
1060 C CB  . PRO A 142 ? 0.4017 0.4364 0.4913 0.0164  -0.0869 -0.0177 142 PRO A CB  
1061 C CG  . PRO A 142 ? 0.4201 0.4487 0.5023 0.0167  -0.0810 -0.0165 142 PRO A CG  
1062 C CD  . PRO A 142 ? 0.3489 0.3819 0.4180 0.0209  -0.0757 -0.0167 142 PRO A CD  
1063 N N   . GLY A 143 ? 0.3691 0.4228 0.4605 0.0203  -0.0921 -0.0174 143 GLY A N   
1064 C CA  . GLY A 143 ? 0.3933 0.4509 0.4823 0.0228  -0.1002 -0.0226 143 GLY A CA  
1065 C C   . GLY A 143 ? 0.4079 0.4736 0.4907 0.0259  -0.0965 -0.0196 143 GLY A C   
1066 O O   . GLY A 143 ? 0.4438 0.5132 0.5247 0.0279  -0.1032 -0.0228 143 GLY A O   
1067 N N   . VAL A 144 ? 0.3459 0.4131 0.4248 0.0264  -0.0867 -0.0134 144 VAL A N   
1068 C CA  . VAL A 144 ? 0.3828 0.4561 0.4551 0.0293  -0.0831 -0.0100 144 VAL A CA  
1069 C C   . VAL A 144 ? 0.4259 0.5030 0.5088 0.0279  -0.0782 -0.0016 144 VAL A C   
1070 O O   . VAL A 144 ? 0.3952 0.4687 0.4783 0.0269  -0.0705 0.0032  144 VAL A O   
1071 C CB  . VAL A 144 ? 0.3763 0.4477 0.4329 0.0321  -0.0764 -0.0097 144 VAL A CB  
1072 C CG1 . VAL A 144 ? 0.3420 0.4188 0.3914 0.0351  -0.0742 -0.0064 144 VAL A CG1 
1073 C CG2 . VAL A 144 ? 0.4270 0.4961 0.4742 0.0344  -0.0797 -0.0172 144 VAL A CG2 
1074 N N   . LYS A 145 ? 0.4411 0.5254 0.5324 0.0282  -0.0827 0.0000  145 LYS A N   
1075 C CA  . LYS A 145 ? 0.4386 0.5282 0.5404 0.0282  -0.0778 0.0081  145 LYS A CA  
1076 C C   . LYS A 145 ? 0.4061 0.4945 0.4952 0.0320  -0.0695 0.0119  145 LYS A C   
1077 O O   . LYS A 145 ? 0.3865 0.4742 0.4619 0.0347  -0.0704 0.0090  145 LYS A O   
1078 C CB  . LYS A 145 ? 0.3767 0.4751 0.4909 0.0280  -0.0856 0.0090  145 LYS A CB  
1079 C CG  . LYS A 145 ? 0.4937 0.5933 0.6248 0.0232  -0.0940 0.0077  145 LYS A CG  
1080 C CD  . LYS A 145 ? 0.6523 0.7606 0.7960 0.0228  -0.1029 0.0090  145 LYS A CD  
1081 C CE  . LYS A 145 ? 0.7161 0.8269 0.8813 0.0169  -0.1100 0.0110  145 LYS A CE  
1082 N NZ  . LYS A 145 ? 0.7776 0.8781 0.9387 0.0139  -0.1148 0.0045  145 LYS A NZ  
1083 N N   . LEU A 146 ? 0.4271 0.7808 0.6461 -0.0453 -0.0305 -0.1717 146 LEU A N   
1084 C CA  . LEU A 146 ? 0.3225 0.6751 0.5351 -0.0306 -0.0356 -0.1591 146 LEU A CA  
1085 C C   . LEU A 146 ? 0.2667 0.6379 0.4719 -0.0100 -0.0449 -0.1595 146 LEU A C   
1086 O O   . LEU A 146 ? 0.3900 0.7532 0.5844 0.0044  -0.0511 -0.1473 146 LEU A O   
1087 C CB  . LEU A 146 ? 0.3377 0.6928 0.5559 -0.0366 -0.0293 -0.1585 146 LEU A CB  
1088 C CG  . LEU A 146 ? 0.3089 0.6413 0.5300 -0.0563 -0.0196 -0.1548 146 LEU A CG  
1089 C CD1 . LEU A 146 ? 0.3498 0.6913 0.5762 -0.0636 -0.0121 -0.1587 146 LEU A CD1 
1090 C CD2 . LEU A 146 ? 0.2297 0.5349 0.4414 -0.0525 -0.0215 -0.1383 146 LEU A CD2 
1091 N N   . GLU A 147 ? 0.3359 0.7305 0.5458 -0.0089 -0.0457 -0.1734 147 GLU A N   
1092 C CA  . GLU A 147 ? 0.3897 0.8020 0.5916 0.0100  -0.0545 -0.1751 147 GLU A CA  
1093 C C   . GLU A 147 ? 0.3655 0.7690 0.5544 0.0196  -0.0611 -0.1683 147 GLU A C   
1094 O O   . GLU A 147 ? 0.3437 0.7498 0.5199 0.0371  -0.0684 -0.1614 147 GLU A O   
1095 C CB  . GLU A 147 ? 0.5505 0.9909 0.7613 0.0077  -0.0537 -0.1933 147 GLU A CB  
1096 C CG  . GLU A 147 ? 0.6661 1.1086 0.8851 -0.0085 -0.0482 -0.2058 147 GLU A CG  
1097 C CD  . GLU A 147 ? 0.7981 1.2706 1.0251 -0.0087 -0.0482 -0.2243 147 GLU A CD  
1098 O OE1 . GLU A 147 ? 0.8405 1.3322 1.0632 0.0077  -0.0555 -0.2267 147 GLU A OE1 
1099 O OE2 . GLU A 147 ? 0.8279 1.3041 1.0652 -0.0253 -0.0407 -0.2365 147 GLU A OE2 
1100 N N   . LYS A 148 ? 0.3422 0.7342 0.5334 0.0081  -0.0581 -0.1703 148 LYS A N   
1101 C CA  . LYS A 148 ? 0.3395 0.7241 0.5192 0.0155  -0.0633 -0.1653 148 LYS A CA  
1102 C C   . LYS A 148 ? 0.2811 0.6447 0.4493 0.0241  -0.0661 -0.1474 148 LYS A C   
1103 O O   . LYS A 148 ? 0.2941 0.6547 0.4480 0.0366  -0.0718 -0.1403 148 LYS A O   
1104 C CB  . LYS A 148 ? 0.3846 0.7620 0.5711 0.0006  -0.0589 -0.1739 148 LYS A CB  
1105 C CG  . LYS A 148 ? 0.4618 0.8585 0.6585 -0.0081 -0.0557 -0.1920 148 LYS A CG  
1106 C CD  . LYS A 148 ? 0.5394 0.9605 0.7294 0.0061  -0.0626 -0.1988 148 LYS A CD  
1107 C CE  . LYS A 148 ? 0.6338 1.0505 0.8125 0.0127  -0.0673 -0.1964 148 LYS A CE  
1108 N NZ  . LYS A 148 ? 0.6990 1.1071 0.8603 0.0292  -0.0739 -0.1804 148 LYS A NZ  
1109 N N   . LEU A 149 ? 0.2389 0.5881 0.4129 0.0170  -0.0616 -0.1403 149 LEU A N   
1110 C CA  . LEU A 149 ? 0.2752 0.6059 0.4397 0.0251  -0.0636 -0.1240 149 LEU A CA  
1111 C C   . LEU A 149 ? 0.2289 0.5648 0.3818 0.0429  -0.0687 -0.1165 149 LEU A C   
1112 O O   . LEU A 149 ? 0.2747 0.5992 0.4124 0.0551  -0.0729 -0.1047 149 LEU A O   
1113 C CB  . LEU A 149 ? 0.3197 0.6296 0.4899 0.0128  -0.0560 -0.1179 149 LEU A CB  
1114 C CG  . LEU A 149 ? 0.3250 0.6048 0.4798 0.0198  -0.0547 -0.0988 149 LEU A CG  
1115 C CD1 . LEU A 149 ? 0.2530 0.5132 0.3949 0.0230  -0.0558 -0.0910 149 LEU A CD1 
1116 C CD2 . LEU A 149 ? 0.3670 0.6257 0.5249 0.0073  -0.0466 -0.0934 149 LEU A CD2 
1117 N N   . THR A 150 ? 0.2674 0.6195 0.4270 0.0441  -0.0680 -0.1240 150 THR A N   
1118 C CA  . THR A 150 ? 0.2377 0.5954 0.3873 0.0612  -0.0732 -0.1193 150 THR A CA  
1119 C C   . THR A 150 ? 0.2164 0.5799 0.3510 0.0745  -0.0802 -0.1190 150 THR A C   
1120 O O   . THR A 150 ? 0.3061 0.6585 0.4238 0.0890  -0.0848 -0.1072 150 THR A O   
1121 C CB  . THR A 150 ? 0.2699 0.6481 0.4317 0.0593  -0.0712 -0.1310 150 THR A CB  
1122 O OG1 . THR A 150 ? 0.2848 0.6566 0.4577 0.0479  -0.0641 -0.1297 150 THR A OG1 
1123 C CG2 . THR A 150 ? 0.3266 0.7112 0.4781 0.0783  -0.0775 -0.1280 150 THR A CG2 
1124 N N   . GLN A 151 ? 0.2620 0.6415 0.4017 0.0689  -0.0806 -0.1318 151 GLN A N   
1125 C CA  . GLN A 151 ? 0.2993 0.6872 0.4255 0.0801  -0.0869 -0.1334 151 GLN A CA  
1126 C C   . GLN A 151 ? 0.2658 0.6339 0.3753 0.0852  -0.0889 -0.1202 151 GLN A C   
1127 O O   . GLN A 151 ? 0.3100 0.6763 0.4013 0.0992  -0.0942 -0.1135 151 GLN A O   
1128 C CB  . GLN A 151 ? 0.4295 0.8379 0.5662 0.0709  -0.0857 -0.1508 151 GLN A CB  
1129 C CG  . GLN A 151 ? 0.6119 1.0450 0.7612 0.0699  -0.0852 -0.1654 151 GLN A CG  
1130 C CD  . GLN A 151 ? 0.7409 1.1907 0.9040 0.0560  -0.0812 -0.1831 151 GLN A CD  
1131 O OE1 . GLN A 151 ? 0.7540 1.2000 0.9146 0.0512  -0.0809 -0.1854 151 GLN A OE1 
1132 N NE2 . GLN A 151 ? 0.7600 1.2279 0.9378 0.0491  -0.0776 -0.1962 151 GLN A NE2 
1133 N N   . LEU A 152 ? 0.2452 0.5986 0.3603 0.0736  -0.0844 -0.1167 152 LEU A N   
1134 C CA  . LEU A 152 ? 0.3225 0.6594 0.4235 0.0771  -0.0856 -0.1061 152 LEU A CA  
1135 C C   . LEU A 152 ? 0.3113 0.6303 0.3958 0.0899  -0.0876 -0.0890 152 LEU A C   
1136 O O   . LEU A 152 ? 0.2628 0.5745 0.3274 0.1004  -0.0909 -0.0805 152 LEU A O   
1137 C CB  . LEU A 152 ? 0.3371 0.6622 0.4496 0.0624  -0.0806 -0.1072 152 LEU A CB  
1138 C CG  . LEU A 152 ? 0.3819 0.6881 0.4808 0.0639  -0.0797 -0.0977 152 LEU A CG  
1139 C CD1 . LEU A 152 ? 0.4492 0.7501 0.5578 0.0498  -0.0749 -0.1067 152 LEU A CD1 
1140 C CD2 . LEU A 152 ? 0.3472 0.6227 0.4369 0.0650  -0.0748 -0.0803 152 LEU A CD2 
1141 N N   . ILE A 153 ? 0.2698 0.5810 0.3617 0.0884  -0.0848 -0.0843 153 ILE A N   
1142 C CA  . ILE A 153 ? 0.3063 0.5982 0.3840 0.0992  -0.0856 -0.0689 153 ILE A CA  
1143 C C   . ILE A 153 ? 0.2785 0.5739 0.3407 0.1151  -0.0908 -0.0663 153 ILE A C   
1144 O O   . ILE A 153 ? 0.3316 0.6092 0.3732 0.1256  -0.0927 -0.0535 153 ILE A O   
1145 C CB  . ILE A 153 ? 0.2837 0.5681 0.3741 0.0932  -0.0810 -0.0662 153 ILE A CB  
1146 C CG1 . ILE A 153 ? 0.3333 0.5983 0.4292 0.0777  -0.0736 -0.0631 153 ILE A CG1 
1147 C CG2 . ILE A 153 ? 0.2605 0.5264 0.3366 0.1054  -0.0818 -0.0525 153 ILE A CG2 
1148 C CD1 . ILE A 153 ? 0.4460 0.7055 0.5559 0.0663  -0.0673 -0.0647 153 ILE A CD1 
1149 N N   . SER A 154 ? 0.2528 0.5705 0.3245 0.1166  -0.0931 -0.0788 154 SER A N   
1150 C CA  A SER A 154 ? 0.2786 0.6026 0.3374 0.1323  -0.0989 -0.0785 154 SER A CA  
1151 C CA  B SER A 154 ? 0.2780 0.6015 0.3365 0.1323  -0.0989 -0.0782 154 SER A CA  
1152 C C   . SER A 154 ? 0.2856 0.6073 0.3247 0.1398  -0.1030 -0.0746 154 SER A C   
1153 O O   . SER A 154 ? 0.3896 0.6989 0.4080 0.1534  -0.1066 -0.0644 154 SER A O   
1154 C CB  A SER A 154 ? 0.3012 0.6540 0.3759 0.1311  -0.1005 -0.0954 154 SER A CB  
1155 C CB  B SER A 154 ? 0.2511 0.6030 0.3253 0.1317  -0.1006 -0.0947 154 SER A CB  
1156 O OG  A SER A 154 ? 0.3784 0.7365 0.4732 0.1198  -0.0952 -0.1016 154 SER A OG  
1157 O OG  B SER A 154 ? 0.2731 0.6306 0.3352 0.1484  -0.1069 -0.0943 154 SER A OG  
1158 N N   . ALA A 155 ? 0.2909 0.6242 0.3361 0.1303  -0.1020 -0.0831 155 ALA A N   
1159 C CA  . ALA A 155 ? 0.3567 0.6915 0.3847 0.1355  -0.1053 -0.0816 155 ALA A CA  
1160 C C   . ALA A 155 ? 0.4095 0.7171 0.4162 0.1398  -0.1040 -0.0642 155 ALA A C   
1161 O O   . ALA A 155 ? 0.5181 0.8182 0.5018 0.1508  -0.1073 -0.0563 155 ALA A O   
1162 C CB  . ALA A 155 ? 0.3982 0.7490 0.4395 0.1226  -0.1032 -0.0952 155 ALA A CB  
1163 N N   . ALA A 156 ? 0.2753 0.5678 0.2889 0.1308  -0.0990 -0.0583 156 ALA A N   
1164 C CA  . ALA A 156 ? 0.2984 0.5657 0.2935 0.1331  -0.0967 -0.0427 156 ALA A CA  
1165 C C   . ALA A 156 ? 0.3480 0.5940 0.3236 0.1457  -0.0976 -0.0286 156 ALA A C   
1166 O O   . ALA A 156 ? 0.4148 0.6442 0.3656 0.1525  -0.0977 -0.0174 156 ALA A O   
1167 C CB  . ALA A 156 ? 0.3035 0.5613 0.3130 0.1211  -0.0914 -0.0408 156 ALA A CB  
1168 N N   . GLN A 157 ? 0.3069 0.5528 0.2933 0.1482  -0.0977 -0.0297 157 GLN A N   
1169 C CA  . GLN A 157 ? 0.3850 0.6096 0.3555 0.1596  -0.0983 -0.0179 157 GLN A CA  
1170 C C   . GLN A 157 ? 0.4156 0.6413 0.3665 0.1737  -0.1041 -0.0161 157 GLN A C   
1171 O O   . GLN A 157 ? 0.4792 0.6800 0.4076 0.1822  -0.1039 -0.0029 157 GLN A O   
1172 C CB  . GLN A 157 ? 0.3941 0.6211 0.3822 0.1588  -0.0971 -0.0215 157 GLN A CB  
1173 C CG  . GLN A 157 ? 0.3522 0.5695 0.3537 0.1469  -0.0909 -0.0187 157 GLN A CG  
1174 C CD  . GLN A 157 ? 0.4343 0.6498 0.4484 0.1471  -0.0890 -0.0198 157 GLN A CD  
1175 O OE1 . GLN A 157 ? 0.5156 0.7123 0.5299 0.1435  -0.0845 -0.0116 157 GLN A OE1 
1176 N NE2 . GLN A 157 ? 0.4583 0.6945 0.4831 0.1511  -0.0923 -0.0307 157 GLN A NE2 
1177 N N   . LYS A 158 ? 0.3828 0.6362 0.3417 0.1758  -0.1089 -0.0294 158 LYS A N   
1178 C CA  . LYS A 158 ? 0.4782 0.7360 0.4198 0.1900  -0.1153 -0.0290 158 LYS A CA  
1179 C C   . LYS A 158 ? 0.6208 0.8588 0.5332 0.1943  -0.1152 -0.0163 158 LYS A C   
1180 O O   . LYS A 158 ? 0.7004 0.9286 0.5919 0.2069  -0.1193 -0.0096 158 LYS A O   
1181 C CB  . LYS A 158 ? 0.5151 0.8080 0.4710 0.1895  -0.1198 -0.0467 158 LYS A CB  
1182 C CG  . LYS A 158 ? 0.6115 0.9249 0.5910 0.1886  -0.1209 -0.0596 158 LYS A CG  
1183 C CD  . LYS A 158 ? 0.7026 1.0501 0.6950 0.1870  -0.1244 -0.0774 158 LYS A CD  
1184 C CE  . LYS A 158 ? 0.7381 1.1070 0.7568 0.1809  -0.1229 -0.0919 158 LYS A CE  
1185 N NZ  . LYS A 158 ? 0.6645 1.0640 0.6992 0.1726  -0.1232 -0.1101 158 LYS A NZ  
1186 N N   . GLN A 159 ? 0.5164 0.7483 0.4267 0.1836  -0.1102 -0.0131 159 GLN A N   
1187 C CA  . GLN A 159 ? 0.6301 0.8456 0.5127 0.1854  -0.1088 -0.0023 159 GLN A CA  
1188 C C   . GLN A 159 ? 0.5433 0.7269 0.4133 0.1802  -0.1014 0.0127  159 GLN A C   
1189 O O   . GLN A 159 ? 0.6021 0.7762 0.4561 0.1752  -0.0974 0.0188  159 GLN A O   
1190 C CB  . GLN A 159 ? 0.5638 0.8014 0.4504 0.1780  -0.1091 -0.0126 159 GLN A CB  
1191 C CG  . GLN A 159 ? 0.4684 0.7166 0.3794 0.1637  -0.1050 -0.0211 159 GLN A CG  
1192 C CD  . GLN A 159 ? 0.4927 0.7628 0.4087 0.1565  -0.1054 -0.0332 159 GLN A CD  
1193 O OE1 . GLN A 159 ? 0.5383 0.8337 0.4682 0.1562  -0.1092 -0.0477 159 GLN A OE1 
1194 N NE2 . GLN A 159 ? 0.5032 0.7638 0.4075 0.1503  -0.1010 -0.0282 159 GLN A NE2 
1195 N N   . GLY A 160 ? 0.4110 0.5792 0.2884 0.1807  -0.0992 0.0178  160 GLY A N   
1196 C CA  . GLY A 160 ? 0.4803 0.6153 0.3435 0.1775  -0.0922 0.0326  160 GLY A CA  
1197 C C   . GLY A 160 ? 0.3932 0.5261 0.2682 0.1646  -0.0859 0.0330  160 GLY A C   
1198 O O   . GLY A 160 ? 0.5046 0.6111 0.3662 0.1608  -0.0793 0.0449  160 GLY A O   
1199 N N   . ILE A 161 ? 0.3835 0.5432 0.2837 0.1574  -0.0877 0.0197  161 ILE A N   
1200 C CA  . ILE A 161 ? 0.3299 0.4852 0.2460 0.1431  -0.0807 0.0185  161 ILE A CA  
1201 C C   . ILE A 161 ? 0.4114 0.5559 0.3422 0.1412  -0.0782 0.0209  161 ILE A C   
1202 O O   . ILE A 161 ? 0.4055 0.5669 0.3512 0.1465  -0.0837 0.0135  161 ILE A O   
1203 C CB  . ILE A 161 ? 0.3052 0.4865 0.2441 0.1327  -0.0810 0.0028  161 ILE A CB  
1204 C CG1 . ILE A 161 ? 0.3825 0.5750 0.3069 0.1340  -0.0829 -0.0007 161 ILE A CG1 
1205 C CG2 . ILE A 161 ? 0.2693 0.4391 0.2258 0.1162  -0.0719 0.0017  161 ILE A CG2 
1206 C CD1 . ILE A 161 ? 0.3789 0.5992 0.3241 0.1263  -0.0849 -0.0179 161 ILE A CD1 
1207 N N   . ARG A 162 ? 0.3523 0.4699 0.2789 0.1331  -0.0696 0.0304  162 ARG A N   
1208 C CA  . ARG A 162 ? 0.3552 0.4604 0.2926 0.1310  -0.0667 0.0333  162 ARG A CA  
1209 C C   . ARG A 162 ? 0.3054 0.4206 0.2697 0.1166  -0.0629 0.0242  162 ARG A C   
1210 O O   . ARG A 162 ? 0.2966 0.4058 0.2646 0.1050  -0.0572 0.0239  162 ARG A O   
1211 C CB  . ARG A 162 ? 0.3634 0.4350 0.2826 0.1292  -0.0595 0.0472  162 ARG A CB  
1212 C CG  . ARG A 162 ? 0.4357 0.4913 0.3247 0.1432  -0.0625 0.0579  162 ARG A CG  
1213 C CD  . ARG A 162 ? 0.5790 0.6006 0.4489 0.1375  -0.0533 0.0707  162 ARG A CD  
1214 N NE  . ARG A 162 ? 0.6122 0.6150 0.4865 0.1373  -0.0502 0.0751  162 ARG A NE  
1215 C CZ  . ARG A 162 ? 0.7026 0.6779 0.5676 0.1293  -0.0414 0.0834  162 ARG A CZ  
1216 N NH1 . ARG A 162 ? 0.7096 0.6737 0.5609 0.1203  -0.0342 0.0882  162 ARG A NH1 
1217 N NH2 . ARG A 162 ? 0.7936 0.7540 0.6635 0.1297  -0.0393 0.0859  162 ARG A NH2 
1218 N N   . CYS A 163 ? 0.2842 0.4146 0.2666 0.1176  -0.0662 0.0164  163 CYS A N   
1219 C CA  . CYS A 163 ? 0.2653 0.4057 0.2710 0.1041  -0.0631 0.0073  163 CYS A CA  
1220 C C   . CYS A 163 ? 0.2822 0.4067 0.2961 0.0969  -0.0576 0.0113  163 CYS A C   
1221 O O   . CYS A 163 ? 0.3202 0.4399 0.3325 0.1035  -0.0585 0.0145  163 CYS A O   
1222 C CB  . CYS A 163 ? 0.2747 0.4455 0.2963 0.1061  -0.0690 -0.0063 163 CYS A CB  
1223 S SG  . CYS A 163 ? 0.3151 0.5088 0.3308 0.1113  -0.0754 -0.0145 163 CYS A SG  
1224 N N   . ILE A 164 ? 0.2253 0.3421 0.2477 0.0838  -0.0523 0.0106  164 ILE A N   
1225 C CA  . ILE A 164 ? 0.1864 0.2903 0.2171 0.0757  -0.0476 0.0132  164 ILE A CA  
1226 C C   . ILE A 164 ? 0.3035 0.4200 0.3527 0.0655  -0.0472 0.0035  164 ILE A C   
1227 O O   . ILE A 164 ? 0.2272 0.3511 0.2812 0.0606  -0.0476 -0.0024 164 ILE A O   
1228 C CB  . ILE A 164 ? 0.2138 0.2958 0.2369 0.0697  -0.0422 0.0214  164 ILE A CB  
1229 C CG1 . ILE A 164 ? 0.2715 0.3379 0.2748 0.0780  -0.0412 0.0313  164 ILE A CG1 
1230 C CG2 . ILE A 164 ? 0.2349 0.3059 0.2672 0.0607  -0.0383 0.0228  164 ILE A CG2 
1231 C CD1 . ILE A 164 ? 0.3086 0.3563 0.3041 0.0712  -0.0352 0.0379  164 ILE A CD1 
1232 N N   . VAL A 165 ? 0.2146 0.3330 0.2733 0.0620  -0.0458 0.0013  165 VAL A N   
1233 C CA  . VAL A 165 ? 0.1627 0.2919 0.2370 0.0515  -0.0446 -0.0078 165 VAL A CA  
1234 C C   . VAL A 165 ? 0.1931 0.3057 0.2710 0.0414  -0.0396 -0.0040 165 VAL A C   
1235 O O   . VAL A 165 ? 0.2188 0.3225 0.2931 0.0433  -0.0377 0.0014  165 VAL A O   
1236 C CB  . VAL A 165 ? 0.2154 0.3687 0.2995 0.0550  -0.0473 -0.0173 165 VAL A CB  
1237 C CG1 . VAL A 165 ? 0.2935 0.4559 0.3927 0.0416  -0.0443 -0.0269 165 VAL A CG1 
1238 C CG2 . VAL A 165 ? 0.2296 0.4018 0.3100 0.0660  -0.0537 -0.0222 165 VAL A CG2 
1239 N N   . ASP A 166 ? 0.1771 0.2848 0.2611 0.0312  -0.0377 -0.0069 166 ASP A N   
1240 C CA  . ASP A 166 ? 0.1865 0.2795 0.2731 0.0216  -0.0339 -0.0040 166 ASP A CA  
1241 C C   . ASP A 166 ? 0.1998 0.2983 0.2964 0.0113  -0.0326 -0.0124 166 ASP A C   
1242 O O   . ASP A 166 ? 0.2296 0.3248 0.3283 0.0081  -0.0334 -0.0154 166 ASP A O   
1243 C CB  . ASP A 166 ? 0.1784 0.2513 0.2583 0.0205  -0.0330 0.0039  166 ASP A CB  
1244 C CG  . ASP A 166 ? 0.2395 0.2968 0.3199 0.0124  -0.0304 0.0076  166 ASP A CG  
1245 O OD1 . ASP A 166 ? 0.2396 0.2827 0.3159 0.0119  -0.0304 0.0130  166 ASP A OD1 
1246 O OD2 . ASP A 166 ? 0.2944 0.3545 0.3788 0.0064  -0.0283 0.0048  166 ASP A OD2 
1247 N N   . SER A 167 ? 0.1691 0.2762 0.2720 0.0058  -0.0301 -0.0171 167 SER A N   
1248 C CA  . SER A 167 ? 0.1936 0.3050 0.3052 -0.0058 -0.0276 -0.0256 167 SER A CA  
1249 C C   . SER A 167 ? 0.2483 0.3585 0.3621 -0.0146 -0.0225 -0.0262 167 SER A C   
1250 O O   . SER A 167 ? 0.2228 0.3242 0.3304 -0.0123 -0.0211 -0.0189 167 SER A O   
1251 C CB  . SER A 167 ? 0.2939 0.4310 0.4145 -0.0035 -0.0303 -0.0375 167 SER A CB  
1252 O OG  . SER A 167 ? 0.2185 0.3570 0.3471 -0.0157 -0.0277 -0.0463 167 SER A OG  
1253 N N   . SER A 168 ? 0.1710 0.2898 0.2931 -0.0256 -0.0190 -0.0354 168 SER A N   
1254 C CA  . SER A 168 ? 0.1631 0.2816 0.2866 -0.0359 -0.0128 -0.0367 168 SER A CA  
1255 C C   . SER A 168 ? 0.2695 0.4113 0.4059 -0.0451 -0.0093 -0.0509 168 SER A C   
1256 O O   . SER A 168 ? 0.2281 0.3845 0.3723 -0.0440 -0.0122 -0.0597 168 SER A O   
1257 C CB  . SER A 168 ? 0.3205 0.4091 0.4342 -0.0461 -0.0091 -0.0286 168 SER A CB  
1258 O OG  . SER A 168 ? 0.3852 0.4641 0.5008 -0.0543 -0.0085 -0.0326 168 SER A OG  
1259 N N   . GLY A 169 ? 0.3422 0.4883 0.4808 -0.0549 -0.0027 -0.0538 169 GLY A N   
1260 C CA  . GLY A 169 ? 0.3715 0.5402 0.5231 -0.0665 0.0024  -0.0681 169 GLY A CA  
1261 C C   . GLY A 169 ? 0.3341 0.5392 0.4999 -0.0567 -0.0026 -0.0805 169 GLY A C   
1262 O O   . GLY A 169 ? 0.2972 0.5126 0.4620 -0.0407 -0.0084 -0.0775 169 GLY A O   
1263 N N   . GLU A 170 ? 0.2866 0.5101 0.4647 -0.0664 -0.0005 -0.0945 170 GLU A N   
1264 C CA  . GLU A 170 ? 0.2985 0.5605 0.4914 -0.0583 -0.0057 -0.1086 170 GLU A CA  
1265 C C   . GLU A 170 ? 0.2522 0.5159 0.4404 -0.0408 -0.0160 -0.1047 170 GLU A C   
1266 O O   . GLU A 170 ? 0.3362 0.6266 0.5301 -0.0270 -0.0226 -0.1105 170 GLU A O   
1267 C CB  . GLU A 170 ? 0.3638 0.6436 0.5708 -0.0747 -0.0007 -0.1253 170 GLU A CB  
1268 C CG  . GLU A 170 ? 0.5378 0.8158 0.7486 -0.0948 0.0111  -0.1301 170 GLU A CG  
1269 C CD  . GLU A 170 ? 0.7396 1.0289 0.9588 -0.1094 0.0167  -0.1451 170 GLU A CD  
1270 O OE1 . GLU A 170 ? 0.8325 1.1441 1.0579 -0.1112 0.0208  -0.1556 170 GLU A OE1 
1271 O OE2 . GLU A 170 ? 0.7960 1.0674 1.0122 -0.1173 0.0173  -0.1455 170 GLU A OE2 
1272 N N   . ALA A 171 ? 0.3041 0.5392 0.4809 -0.0411 -0.0173 -0.0949 171 ALA A N   
1273 C CA  . ALA A 171 ? 0.3126 0.5466 0.4829 -0.0264 -0.0255 -0.0904 171 ALA A CA  
1274 C C   . ALA A 171 ? 0.2568 0.4891 0.4179 -0.0095 -0.0302 -0.0798 171 ALA A C   
1275 O O   . ALA A 171 ? 0.3161 0.5626 0.4752 0.0047  -0.0372 -0.0808 171 ALA A O   
1276 C CB  . ALA A 171 ? 0.2948 0.4986 0.4560 -0.0311 -0.0248 -0.0828 171 ALA A CB  
1277 N N   . LEU A 172 ? 0.2708 0.4844 0.4250 -0.0111 -0.0261 -0.0698 172 LEU A N   
1278 C CA  . LEU A 172 ? 0.2457 0.4545 0.3910 0.0034  -0.0295 -0.0602 172 LEU A CA  
1279 C C   . LEU A 172 ? 0.2742 0.5131 0.4280 0.0136  -0.0328 -0.0689 172 LEU A C   
1280 O O   . LEU A 172 ? 0.3234 0.5673 0.4714 0.0299  -0.0393 -0.0656 172 LEU A O   
1281 C CB  . LEU A 172 ? 0.2966 0.4806 0.4337 -0.0020 -0.0241 -0.0496 172 LEU A CB  
1282 C CG  . LEU A 172 ? 0.3732 0.5488 0.5010 0.0109  -0.0263 -0.0401 172 LEU A CG  
1283 C CD1 . LEU A 172 ? 0.3222 0.4857 0.4391 0.0221  -0.0317 -0.0317 172 LEU A CD1 
1284 C CD2 . LEU A 172 ? 0.3153 0.4695 0.4364 0.0033  -0.0207 -0.0321 172 LEU A CD2 
1285 N N   . SER A 173 ? 0.2209 0.4796 0.3883 0.0042  -0.0282 -0.0804 173 SER A N   
1286 C CA  . SER A 173 ? 0.2691 0.5609 0.4478 0.0138  -0.0314 -0.0914 173 SER A CA  
1287 C C   . SER A 173 ? 0.1839 0.4997 0.3672 0.0247  -0.0403 -0.0998 173 SER A C   
1288 O O   . SER A 173 ? 0.2721 0.6045 0.4552 0.0421  -0.0475 -0.1016 173 SER A O   
1289 C CB  . SER A 173 ? 0.2970 0.6087 0.4913 -0.0012 -0.0236 -0.1044 173 SER A CB  
1290 O OG  . SER A 173 ? 0.3951 0.6850 0.5830 -0.0111 -0.0155 -0.0966 173 SER A OG  
1291 N N   . ALA A 174 ? 0.2924 0.6090 0.4787 0.0150  -0.0399 -0.1050 174 ALA A N   
1292 C CA  . ALA A 174 ? 0.3563 0.6942 0.5450 0.0233  -0.0474 -0.1137 174 ALA A CA  
1293 C C   . ALA A 174 ? 0.3582 0.6840 0.5305 0.0407  -0.0555 -0.1019 174 ALA A C   
1294 O O   . ALA A 174 ? 0.3844 0.7190 0.5484 0.0537  -0.0616 -0.1036 174 ALA A O   
1295 C CB  . ALA A 174 ? 0.3012 0.6399 0.4965 0.0073  -0.0441 -0.1225 174 ALA A CB  
1296 N N   . ALA A 175 ? 0.3449 0.6365 0.5034 0.0388  -0.0524 -0.0868 175 ALA A N   
1297 C CA  . ALA A 175 ? 0.3927 0.6675 0.5334 0.0521  -0.0575 -0.0746 175 ALA A CA  
1298 C C   . ALA A 175 ? 0.3228 0.5984 0.4554 0.0692  -0.0618 -0.0682 175 ALA A C   
1299 O O   . ALA A 175 ? 0.4979 0.7685 0.6164 0.0832  -0.0678 -0.0613 175 ALA A O   
1300 C CB  . ALA A 175 ? 0.3787 0.6187 0.5090 0.0440  -0.0522 -0.0620 175 ALA A CB  
1301 N N   . LEU A 176 ? 0.3355 0.6158 0.4762 0.0678  -0.0585 -0.0704 176 LEU A N   
1302 C CA  . LEU A 176 ? 0.3448 0.6239 0.4791 0.0837  -0.0619 -0.0654 176 LEU A CA  
1303 C C   . LEU A 176 ? 0.4269 0.7319 0.5679 0.0916  -0.0655 -0.0773 176 LEU A C   
1304 O O   . LEU A 176 ? 0.4162 0.7183 0.5513 0.1040  -0.0677 -0.0748 176 LEU A O   
1305 C CB  . LEU A 176 ? 0.4359 0.6966 0.5703 0.0765  -0.0543 -0.0594 176 LEU A CB  
1306 C CG  . LEU A 176 ? 0.4855 0.7089 0.6035 0.0743  -0.0507 -0.0433 176 LEU A CG  
1307 C CD1 . LEU A 176 ? 0.4761 0.6868 0.5985 0.0584  -0.0421 -0.0418 176 LEU A CD1 
1308 C CD2 . LEU A 176 ? 0.4912 0.7019 0.5961 0.0909  -0.0541 -0.0346 176 LEU A CD2 
1309 N N   . ALA A 177 ? 0.4322 0.7582 0.5834 0.0833  -0.0653 -0.0903 177 ALA A N   
1310 C CA  . ALA A 177 ? 0.4750 0.8246 0.6320 0.0885  -0.0676 -0.1030 177 ALA A CA  
1311 C C   . ALA A 177 ? 0.4301 0.7775 0.5705 0.1081  -0.0762 -0.0990 177 ALA A C   
1312 O O   . ALA A 177 ? 0.4397 0.7989 0.5805 0.1186  -0.0793 -0.1046 177 ALA A O   
1313 C CB  . ALA A 177 ? 0.5044 0.8751 0.6748 0.0744  -0.0648 -0.1180 177 ALA A CB  
1314 N N   . ILE A 178 ? 0.2662 0.5981 0.3915 0.1128  -0.0797 -0.0893 178 ILE A N   
1315 C CA  . ILE A 178 ? 0.3503 0.6784 0.4574 0.1297  -0.0871 -0.0848 178 ILE A CA  
1316 C C   . ILE A 178 ? 0.3579 0.6622 0.4496 0.1432  -0.0888 -0.0713 178 ILE A C   
1317 O O   . ILE A 178 ? 0.3384 0.6418 0.4181 0.1581  -0.0944 -0.0699 178 ILE A O   
1318 C CB  . ILE A 178 ? 0.4815 0.8014 0.5764 0.1288  -0.0893 -0.0795 178 ILE A CB  
1319 C CG1 . ILE A 178 ? 0.5294 0.8613 0.6396 0.1113  -0.0852 -0.0889 178 ILE A CG1 
1320 C CG2 . ILE A 178 ? 0.5127 0.8413 0.5941 0.1427  -0.0966 -0.0818 178 ILE A CG2 
1321 C CD1 . ILE A 178 ? 0.5203 0.8331 0.6327 0.1004  -0.0801 -0.0802 178 ILE A CD1 
1322 N N   . GLY A 179 ? 0.3490 0.6330 0.4403 0.1378  -0.0838 -0.0615 179 GLY A N   
1323 C CA  . GLY A 179 ? 0.3360 0.5945 0.4129 0.1486  -0.0840 -0.0489 179 GLY A CA  
1324 C C   . GLY A 179 ? 0.3673 0.5992 0.4206 0.1549  -0.0858 -0.0344 179 GLY A C   
1325 O O   . GLY A 179 ? 0.3609 0.5965 0.4087 0.1525  -0.0877 -0.0345 179 GLY A O   
1326 N N   . ASN A 180 ? 0.3445 0.5496 0.3839 0.1624  -0.0846 -0.0227 180 ASN A N   
1327 C CA  . ASN A 180 ? 0.3483 0.5243 0.3635 0.1674  -0.0847 -0.0082 180 ASN A CA  
1328 C C   . ASN A 180 ? 0.3604 0.5263 0.3738 0.1560  -0.0806 -0.0020 180 ASN A C   
1329 O O   . ASN A 180 ? 0.4004 0.5511 0.3957 0.1578  -0.0808 0.0066  180 ASN A O   
1330 C CB  . ASN A 180 ? 0.3774 0.5568 0.3769 0.1786  -0.0911 -0.0082 180 ASN A CB  
1331 C CG  . ASN A 180 ? 0.5478 0.7323 0.5454 0.1924  -0.0958 -0.0123 180 ASN A CG  
1332 O OD1 . ASN A 180 ? 0.5493 0.7164 0.5431 0.1975  -0.0941 -0.0073 180 ASN A OD1 
1333 N ND2 . ASN A 180 ? 0.6500 0.8588 0.6505 0.1988  -0.1019 -0.0224 180 ASN A ND2 
1334 N N   . ILE A 181 ? 0.3436 0.5185 0.3756 0.1443  -0.0766 -0.0067 181 ILE A N   
1335 C CA  . ILE A 181 ? 0.2706 0.4343 0.3024 0.1332  -0.0723 -0.0012 181 ILE A CA  
1336 C C   . ILE A 181 ? 0.2970 0.4255 0.3110 0.1342  -0.0675 0.0132  181 ILE A C   
1337 O O   . ILE A 181 ? 0.3323 0.4501 0.3455 0.1388  -0.0660 0.0160  181 ILE A O   
1338 C CB  . ILE A 181 ? 0.3503 0.5218 0.4029 0.1163  -0.0661 -0.0087 181 ILE A CB  
1339 C CG1 . ILE A 181 ? 0.4239 0.6296 0.4950 0.1132  -0.0695 -0.0241 181 ILE A CG1 
1340 C CG2 . ILE A 181 ? 0.3200 0.4719 0.3700 0.1016  -0.0596 -0.0028 181 ILE A CG2 
1341 C CD1 . ILE A 181 ? 0.4577 0.6758 0.5264 0.1129  -0.0735 -0.0285 181 ILE A CD1 
1342 N N   . GLU A 182 ? 0.2788 0.3902 0.2791 0.1294  -0.0645 0.0211  182 GLU A N   
1343 C CA  . GLU A 182 ? 0.3149 0.3939 0.2982 0.1288  -0.0593 0.0338  182 GLU A CA  
1344 C C   . GLU A 182 ? 0.2767 0.3435 0.2703 0.1169  -0.0522 0.0348  182 GLU A C   
1345 O O   . GLU A 182 ? 0.3156 0.3620 0.3012 0.1196  -0.0493 0.0412  182 GLU A O   
1346 C CB  . GLU A 182 ? 0.3479 0.4154 0.3168 0.1240  -0.0565 0.0400  182 GLU A CB  
1347 C CG  . GLU A 182 ? 0.5076 0.5799 0.4585 0.1367  -0.0627 0.0423  182 GLU A CG  
1348 C CD  . GLU A 182 ? 0.6358 0.6825 0.5629 0.1481  -0.0629 0.0535  182 GLU A CD  
1349 O OE1 . GLU A 182 ? 0.6788 0.7299 0.5968 0.1578  -0.0679 0.0520  182 GLU A OE1 
1350 O OE2 . GLU A 182 ? 0.6571 0.6774 0.5758 0.1436  -0.0563 0.0622  182 GLU A OE2 
1351 N N   . LEU A 183 ? 0.2586 0.3367 0.2686 0.1038  -0.0497 0.0282  183 LEU A N   
1352 C CA  . LEU A 183 ? 0.3036 0.3705 0.3216 0.0921  -0.0438 0.0293  183 LEU A CA  
1353 C C   . LEU A 183 ? 0.2385 0.3229 0.2750 0.0814  -0.0432 0.0202  183 LEU A C   
1354 O O   . LEU A 183 ? 0.2412 0.3368 0.2824 0.0774  -0.0447 0.0155  183 LEU A O   
1355 C CB  . LEU A 183 ? 0.2233 0.2692 0.2321 0.0844  -0.0388 0.0372  183 LEU A CB  
1356 C CG  . LEU A 183 ? 0.3040 0.3402 0.3208 0.0719  -0.0337 0.0379  183 LEU A CG  
1357 C CD1 . LEU A 183 ? 0.3249 0.3498 0.3402 0.0736  -0.0314 0.0405  183 LEU A CD1 
1358 C CD2 . LEU A 183 ? 0.3727 0.3952 0.3829 0.0652  -0.0299 0.0429  183 LEU A CD2 
1359 N N   . VAL A 184 ? 0.2356 0.3208 0.2814 0.0763  -0.0405 0.0175  184 VAL A N   
1360 C CA  . VAL A 184 ? 0.1699 0.2651 0.2300 0.0639  -0.0383 0.0107  184 VAL A CA  
1361 C C   . VAL A 184 ? 0.1975 0.2745 0.2569 0.0543  -0.0331 0.0157  184 VAL A C   
1362 O O   . VAL A 184 ? 0.2217 0.2878 0.2756 0.0577  -0.0313 0.0200  184 VAL A O   
1363 C CB  . VAL A 184 ? 0.2390 0.3587 0.3120 0.0654  -0.0399 0.0001  184 VAL A CB  
1364 C CG1 . VAL A 184 ? 0.2483 0.3662 0.3210 0.0712  -0.0385 0.0006  184 VAL A CG1 
1365 C CG2 . VAL A 184 ? 0.2425 0.3706 0.3282 0.0509  -0.0367 -0.0069 184 VAL A CG2 
1366 N N   . LYS A 185 ? 0.1866 0.2597 0.2508 0.0432  -0.0312 0.0150  185 LYS A N   
1367 C CA  . LYS A 185 ? 0.1720 0.2293 0.2350 0.0347  -0.0275 0.0194  185 LYS A CA  
1368 C C   . LYS A 185 ? 0.1772 0.2396 0.2487 0.0241  -0.0253 0.0144  185 LYS A C   
1369 O O   . LYS A 185 ? 0.2057 0.2624 0.2793 0.0165  -0.0251 0.0143  185 LYS A O   
1370 C CB  . LYS A 185 ? 0.2155 0.2573 0.2730 0.0316  -0.0272 0.0252  185 LYS A CB  
1371 C CG  . LYS A 185 ? 0.1810 0.2078 0.2362 0.0251  -0.0245 0.0297  185 LYS A CG  
1372 C CD  . LYS A 185 ? 0.1857 0.2031 0.2414 0.0193  -0.0250 0.0317  185 LYS A CD  
1373 C CE  . LYS A 185 ? 0.1891 0.2103 0.2517 0.0128  -0.0261 0.0273  185 LYS A CE  
1374 N NZ  . LYS A 185 ? 0.1854 0.2074 0.2500 0.0066  -0.0240 0.0256  185 LYS A NZ  
1375 N N   . PRO A 186 ? 0.1626 0.2352 0.2386 0.0236  -0.0234 0.0100  186 PRO A N   
1376 C CA  . PRO A 186 ? 0.1500 0.2234 0.2309 0.0116  -0.0197 0.0067  186 PRO A CA  
1377 C C   . PRO A 186 ? 0.2060 0.2599 0.2791 0.0059  -0.0172 0.0138  186 PRO A C   
1378 O O   . PRO A 186 ? 0.1612 0.2072 0.2282 0.0113  -0.0170 0.0183  186 PRO A O   
1379 C CB  . PRO A 186 ? 0.1564 0.2490 0.2446 0.0131  -0.0177 -0.0010 186 PRO A CB  
1380 C CG  . PRO A 186 ? 0.1745 0.2661 0.2577 0.0264  -0.0199 0.0019  186 PRO A CG  
1381 C CD  . PRO A 186 ? 0.1914 0.2738 0.2676 0.0336  -0.0241 0.0077  186 PRO A CD  
1382 N N   . ASN A 187 ? 0.1693 0.2144 0.2415 -0.0046 -0.0154 0.0147  187 ASN A N   
1383 C CA  . ASN A 187 ? 0.1650 0.1958 0.2294 -0.0103 -0.0129 0.0199  187 ASN A CA  
1384 C C   . ASN A 187 ? 0.1860 0.2271 0.2523 -0.0150 -0.0080 0.0150  187 ASN A C   
1385 O O   . ASN A 187 ? 0.1804 0.2406 0.2554 -0.0122 -0.0070 0.0075  187 ASN A O   
1386 C CB  . ASN A 187 ? 0.1909 0.2052 0.2503 -0.0181 -0.0137 0.0241  187 ASN A CB  
1387 C CG  . ASN A 187 ? 0.1807 0.1975 0.2436 -0.0277 -0.0112 0.0194  187 ASN A CG  
1388 O OD1 . ASN A 187 ? 0.1904 0.2226 0.2596 -0.0313 -0.0075 0.0125  187 ASN A OD1 
1389 N ND2 . ASN A 187 ? 0.1817 0.1828 0.2407 -0.0321 -0.0130 0.0226  187 ASN A ND2 
1390 N N   . GLN A 188 ? 0.2114 0.2418 0.2697 -0.0216 -0.0049 0.0185  188 GLN A N   
1391 C CA  . GLN A 188 ? 0.1934 0.2344 0.2528 -0.0264 0.0008  0.0134  188 GLN A CA  
1392 C C   . GLN A 188 ? 0.2448 0.2986 0.3111 -0.0360 0.0051  0.0061  188 GLN A C   
1393 O O   . GLN A 188 ? 0.2223 0.2967 0.2975 -0.0357 0.0084  -0.0026 188 GLN A O   
1394 C CB  . GLN A 188 ? 0.2563 0.2829 0.3035 -0.0322 0.0032  0.0187  188 GLN A CB  
1395 C CG  . GLN A 188 ? 0.2581 0.2771 0.3007 -0.0236 0.0005  0.0228  188 GLN A CG  
1396 C CD  . GLN A 188 ? 0.3713 0.3748 0.4014 -0.0291 0.0010  0.0285  188 GLN A CD  
1397 O OE1 . GLN A 188 ? 0.3257 0.3152 0.3501 -0.0299 -0.0032 0.0346  188 GLN A OE1 
1398 N NE2 . GLN A 188 ? 0.3141 0.3214 0.3400 -0.0327 0.0057  0.0258  188 GLN A NE2 
1399 N N   . LYS A 189 ? 0.2113 0.2530 0.2740 -0.0446 0.0051  0.0087  189 LYS A N   
1400 C CA  . LYS A 189 ? 0.2680 0.3186 0.3364 -0.0560 0.0101  0.0016  189 LYS A CA  
1401 C C   . LYS A 189 ? 0.2441 0.3183 0.3280 -0.0503 0.0080  -0.0080 189 LYS A C   
1402 O O   . LYS A 189 ? 0.2078 0.3029 0.3015 -0.0556 0.0125  -0.0181 189 LYS A O   
1403 C CB  . LYS A 189 ? 0.2997 0.3275 0.3592 -0.0654 0.0101  0.0071  189 LYS A CB  
1404 C CG  . LYS A 189 ? 0.5424 0.5504 0.5856 -0.0746 0.0138  0.0143  189 LYS A CG  
1405 C CD  . LYS A 189 ? 0.7130 0.6984 0.7469 -0.0847 0.0148  0.0185  189 LYS A CD  
1406 C CE  . LYS A 189 ? 0.8115 0.7735 0.8253 -0.0906 0.0162  0.0282  189 LYS A CE  
1407 N NZ  . LYS A 189 ? 0.8630 0.7989 0.8650 -0.0994 0.0167  0.0333  189 LYS A NZ  
1408 N N   . GLU A 190 ? 0.1763 0.2484 0.2621 -0.0397 0.0012  -0.0054 190 GLU A N   
1409 C CA  . GLU A 190 ? 0.2378 0.3314 0.3358 -0.0326 -0.0021 -0.0136 190 GLU A CA  
1410 C C   . GLU A 190 ? 0.2456 0.3615 0.3506 -0.0230 -0.0024 -0.0197 190 GLU A C   
1411 O O   . GLU A 190 ? 0.1783 0.3187 0.2953 -0.0214 -0.0027 -0.0301 190 GLU A O   
1412 C CB  . GLU A 190 ? 0.2216 0.3061 0.3170 -0.0238 -0.0087 -0.0086 190 GLU A CB  
1413 C CG  . GLU A 190 ? 0.2382 0.3068 0.3312 -0.0320 -0.0090 -0.0068 190 GLU A CG  
1414 C CD  . GLU A 190 ? 0.2235 0.2767 0.3107 -0.0246 -0.0143 0.0006  190 GLU A CD  
1415 O OE1 . GLU A 190 ? 0.1809 0.2353 0.2652 -0.0144 -0.0171 0.0046  190 GLU A OE1 
1416 O OE2 . GLU A 190 ? 0.2226 0.2621 0.3079 -0.0294 -0.0152 0.0020  190 GLU A OE2 
1417 N N   . LEU A 191 ? 0.1810 0.2888 0.2791 -0.0162 -0.0026 -0.0139 191 LEU A N   
1418 C CA  . LEU A 191 ? 0.2399 0.3656 0.3437 -0.0061 -0.0029 -0.0195 191 LEU A CA  
1419 C C   . LEU A 191 ? 0.1995 0.3448 0.3122 -0.0151 0.0038  -0.0299 191 LEU A C   
1420 O O   . LEU A 191 ? 0.1738 0.3455 0.2989 -0.0094 0.0031  -0.0406 191 LEU A O   
1421 C CB  . LEU A 191 ? 0.1968 0.3062 0.2904 0.0014  -0.0035 -0.0116 191 LEU A CB  
1422 C CG  . LEU A 191 ? 0.1835 0.3069 0.2816 0.0126  -0.0036 -0.0172 191 LEU A CG  
1423 C CD1 . LEU A 191 ? 0.2002 0.3373 0.3038 0.0276  -0.0102 -0.0207 191 LEU A CD1 
1424 C CD2 . LEU A 191 ? 0.1947 0.2987 0.2818 0.0165  -0.0028 -0.0100 191 LEU A CD2 
1425 N N   . SER A 192 ? 0.1927 0.3258 0.2985 -0.0293 0.0103  -0.0272 192 SER A N   
1426 C CA  . SER A 192 ? 0.1871 0.3369 0.2992 -0.0409 0.0184  -0.0366 192 SER A CA  
1427 C C   . SER A 192 ? 0.2795 0.4524 0.4061 -0.0471 0.0199  -0.0483 192 SER A C   
1428 O O   . SER A 192 ? 0.1907 0.3919 0.3305 -0.0479 0.0233  -0.0609 192 SER A O   
1429 C CB  . SER A 192 ? 0.2487 0.3770 0.3469 -0.0563 0.0249  -0.0298 192 SER A CB  
1430 O OG  . SER A 192 ? 0.3566 0.5006 0.4596 -0.0697 0.0342  -0.0391 192 SER A OG  
1431 N N   . ALA A 193 ? 0.2319 0.3943 0.3571 -0.0515 0.0172  -0.0455 193 ALA A N   
1432 C CA  . ALA A 193 ? 0.2622 0.4453 0.4009 -0.0590 0.0188  -0.0575 193 ALA A CA  
1433 C C   . ALA A 193 ? 0.2931 0.5058 0.4461 -0.0437 0.0120  -0.0669 193 ALA A C   
1434 O O   . ALA A 193 ? 0.2953 0.5382 0.4638 -0.0471 0.0141  -0.0813 193 ALA A O   
1435 C CB  . ALA A 193 ? 0.2867 0.4494 0.4198 -0.0665 0.0174  -0.0526 193 ALA A CB  
1436 N N   . LEU A 194 ? 0.2186 0.4225 0.3655 -0.0269 0.0039  -0.0590 194 LEU A N   
1437 C CA  . LEU A 194 ? 0.2216 0.4479 0.3771 -0.0100 -0.0038 -0.0651 194 LEU A CA  
1438 C C   . LEU A 194 ? 0.2518 0.5051 0.4182 -0.0027 -0.0028 -0.0754 194 LEU A C   
1439 O O   . LEU A 194 ? 0.2220 0.5067 0.4031 0.0020  -0.0056 -0.0885 194 LEU A O   
1440 C CB  . LEU A 194 ? 0.1773 0.3830 0.3200 0.0048  -0.0111 -0.0526 194 LEU A CB  
1441 C CG  . LEU A 194 ? 0.2975 0.5201 0.4435 0.0236  -0.0196 -0.0559 194 LEU A CG  
1442 C CD1 . LEU A 194 ? 0.3463 0.5931 0.5037 0.0224  -0.0230 -0.0669 194 LEU A CD1 
1443 C CD2 . LEU A 194 ? 0.3703 0.5678 0.5008 0.0345  -0.0246 -0.0424 194 LEU A CD2 
1444 N N   . VAL A 195 ? 0.2503 0.4930 0.4102 -0.0012 0.0008  -0.0706 195 VAL A N   
1445 C CA  . VAL A 195 ? 0.2772 0.5450 0.4479 0.0060  0.0024  -0.0813 195 VAL A CA  
1446 C C   . VAL A 195 ? 0.3044 0.5926 0.4863 -0.0115 0.0125  -0.0936 195 VAL A C   
1447 O O   . VAL A 195 ? 0.2543 0.5684 0.4481 -0.0076 0.0151  -0.1052 195 VAL A O   
1448 C CB  . VAL A 195 ? 0.2643 0.5140 0.4241 0.0159  0.0023  -0.0731 195 VAL A CB  
1449 C CG1 . VAL A 195 ? 0.3189 0.5510 0.4684 0.0336  -0.0069 -0.0627 195 VAL A CG1 
1450 C CG2 . VAL A 195 ? 0.2579 0.4817 0.4048 0.0007  0.0098  -0.0641 195 VAL A CG2 
1451 N N   . ASN A 196 ? 0.2242 0.5003 0.4020 -0.0307 0.0186  -0.0912 196 ASN A N   
1452 C CA  . ASN A 196 ? 0.2997 0.5901 0.4849 -0.0507 0.0297  -0.1015 196 ASN A CA  
1453 C C   . ASN A 196 ? 0.3464 0.6378 0.5282 -0.0560 0.0381  -0.1028 196 ASN A C   
1454 O O   . ASN A 196 ? 0.3498 0.6715 0.5458 -0.0618 0.0446  -0.1176 196 ASN A O   
1455 C CB  . ASN A 196 ? 0.3259 0.6571 0.5335 -0.0520 0.0295  -0.1203 196 ASN A CB  
1456 C CG  . ASN A 196 ? 0.4213 0.7626 0.6351 -0.0769 0.0418  -0.1302 196 ASN A CG  
1457 O OD1 . ASN A 196 ? 0.4269 0.7390 0.6257 -0.0932 0.0488  -0.1207 196 ASN A OD1 
1458 N ND2 . ASN A 196 ? 0.3812 0.7534 0.6090 -0.0779 0.0433  -0.1468 196 ASN A ND2 
1459 N N   . ARG A 197 ? 0.2985 0.5587 0.4620 -0.0543 0.0380  -0.0885 197 ARG A N   
1460 C CA  . ARG A 197 ? 0.3750 0.6316 0.5315 -0.0621 0.0467  -0.0885 197 ARG A CA  
1461 C C   . ARG A 197 ? 0.3530 0.5703 0.4865 -0.0668 0.0470  -0.0714 197 ARG A C   
1462 O O   . ARG A 197 ? 0.3084 0.5035 0.4333 -0.0579 0.0389  -0.0599 197 ARG A O   
1463 C CB  . ARG A 197 ? 0.4243 0.7021 0.5904 -0.0460 0.0448  -0.0968 197 ARG A CB  
1464 C CG  . ARG A 197 ? 0.3663 0.6284 0.5262 -0.0244 0.0341  -0.0875 197 ARG A CG  
1465 C CD  . ARG A 197 ? 0.3571 0.6352 0.5242 -0.0095 0.0334  -0.0956 197 ARG A CD  
1466 N NE  . ARG A 197 ? 0.3585 0.6188 0.5182 0.0106  0.0238  -0.0867 197 ARG A NE  
1467 C CZ  . ARG A 197 ? 0.3296 0.6000 0.4965 0.0278  0.0145  -0.0889 197 ARG A CZ  
1468 N NH1 . ARG A 197 ? 0.4806 0.7815 0.6638 0.0283  0.0126  -0.1007 197 ARG A NH1 
1469 N NH2 . ARG A 197 ? 0.4077 0.6575 0.5645 0.0443  0.0072  -0.0795 197 ARG A NH2 
1470 N N   . GLU A 198 ? 0.3157 0.5255 0.4389 -0.0812 0.0564  -0.0703 198 GLU A N   
1471 C CA  . GLU A 198 ? 0.4452 0.6212 0.5463 -0.0843 0.0562  -0.0554 198 GLU A CA  
1472 C C   . GLU A 198 ? 0.4206 0.5922 0.5195 -0.0667 0.0502  -0.0519 198 GLU A C   
1473 O O   . GLU A 198 ? 0.4999 0.6936 0.6098 -0.0583 0.0515  -0.0620 198 GLU A O   
1474 C CB  . GLU A 198 ? 0.5877 0.7591 0.6769 -0.1029 0.0678  -0.0559 198 GLU A CB  
1475 C CG  . GLU A 198 ? 0.7575 0.9141 0.8377 -0.1220 0.0733  -0.0521 198 GLU A CG  
1476 C CD  . GLU A 198 ? 0.8993 1.0207 0.9640 -0.1195 0.0656  -0.0363 198 GLU A CD  
1477 O OE1 . GLU A 198 ? 0.8821 0.9806 0.9291 -0.1176 0.0635  -0.0252 198 GLU A OE1 
1478 O OE2 . GLU A 198 ? 0.9656 1.0838 1.0365 -0.1191 0.0614  -0.0359 198 GLU A OE2 
1479 N N   . LEU A 199 ? 0.2963 0.4399 0.3818 -0.0610 0.0437  -0.0385 199 LEU A N   
1480 C CA  . LEU A 199 ? 0.2345 0.3706 0.3166 -0.0462 0.0386  -0.0348 199 LEU A CA  
1481 C C   . LEU A 199 ? 0.3216 0.4383 0.3861 -0.0536 0.0423  -0.0279 199 LEU A C   
1482 O O   . LEU A 199 ? 0.3794 0.4716 0.4309 -0.0537 0.0379  -0.0164 199 LEU A O   
1483 C CB  . LEU A 199 ? 0.2434 0.3650 0.3244 -0.0341 0.0288  -0.0264 199 LEU A CB  
1484 C CG  . LEU A 199 ? 0.2847 0.4237 0.3802 -0.0265 0.0242  -0.0322 199 LEU A CG  
1485 C CD1 . LEU A 199 ? 0.3245 0.4461 0.4152 -0.0177 0.0158  -0.0226 199 LEU A CD1 
1486 C CD2 . LEU A 199 ? 0.2950 0.4594 0.4042 -0.0138 0.0234  -0.0435 199 LEU A CD2 
1487 N N   . THR A 200 ? 0.2704 0.4003 0.3350 -0.0596 0.0503  -0.0358 200 THR A N   
1488 C CA  . THR A 200 ? 0.2972 0.4124 0.3438 -0.0700 0.0555  -0.0308 200 THR A CA  
1489 C C   . THR A 200 ? 0.3043 0.4170 0.3474 -0.0603 0.0545  -0.0323 200 THR A C   
1490 O O   . THR A 200 ? 0.3661 0.4651 0.3932 -0.0667 0.0569  -0.0275 200 THR A O   
1491 C CB  . THR A 200 ? 0.4362 0.5665 0.4818 -0.0866 0.0670  -0.0388 200 THR A CB  
1492 O OG1 . THR A 200 ? 0.3256 0.4873 0.3897 -0.0811 0.0712  -0.0543 200 THR A OG1 
1493 C CG2 . THR A 200 ? 0.5367 0.6643 0.5824 -0.0995 0.0694  -0.0368 200 THR A CG2 
1494 N N   . GLN A 201 ? 0.2316 0.3569 0.2887 -0.0449 0.0510  -0.0391 201 GLN A N   
1495 C CA  . GLN A 201 ? 0.2372 0.3591 0.2921 -0.0351 0.0505  -0.0419 201 GLN A CA  
1496 C C   . GLN A 201 ? 0.2439 0.3443 0.2945 -0.0231 0.0416  -0.0326 201 GLN A C   
1497 O O   . GLN A 201 ? 0.2466 0.3436 0.3021 -0.0177 0.0356  -0.0278 201 GLN A O   
1498 C CB  . GLN A 201 ? 0.2226 0.3712 0.2945 -0.0253 0.0532  -0.0567 201 GLN A CB  
1499 C CG  . GLN A 201 ? 0.2273 0.4024 0.3070 -0.0378 0.0628  -0.0681 201 GLN A CG  
1500 C CD  . GLN A 201 ? 0.3239 0.4925 0.3874 -0.0543 0.0716  -0.0669 201 GLN A CD  
1501 O OE1 . GLN A 201 ? 0.3374 0.5023 0.3920 -0.0707 0.0765  -0.0627 201 GLN A OE1 
1502 N NE2 . GLN A 201 ? 0.2863 0.4523 0.3445 -0.0499 0.0737  -0.0705 201 GLN A NE2 
1503 N N   . PRO A 202 ? 0.2630 0.3494 0.3044 -0.0199 0.0412  -0.0307 202 PRO A N   
1504 C CA  . PRO A 202 ? 0.2211 0.2857 0.2568 -0.0118 0.0342  -0.0219 202 PRO A CA  
1505 C C   . PRO A 202 ? 0.2141 0.2796 0.2600 0.0028  0.0284  -0.0217 202 PRO A C   
1506 O O   . PRO A 202 ? 0.2432 0.2951 0.2861 0.0049  0.0229  -0.0129 202 PRO A O   
1507 C CB  . PRO A 202 ? 0.2303 0.2873 0.2592 -0.0096 0.0367  -0.0256 202 PRO A CB  
1508 C CG  . PRO A 202 ? 0.3010 0.3685 0.3240 -0.0222 0.0442  -0.0307 202 PRO A CG  
1509 C CD  . PRO A 202 ? 0.3347 0.4251 0.3696 -0.0254 0.0480  -0.0372 202 PRO A CD  
1510 N N   . ASP A 203 ? 0.2179 0.2998 0.2752 0.0132  0.0294  -0.0314 203 ASP A N   
1511 C CA  . ASP A 203 ? 0.2128 0.2947 0.2772 0.0288  0.0233  -0.0310 203 ASP A CA  
1512 C C   . ASP A 203 ? 0.2407 0.3400 0.3156 0.0296  0.0204  -0.0324 203 ASP A C   
1513 O O   . ASP A 203 ? 0.2235 0.3252 0.3035 0.0430  0.0148  -0.0324 203 ASP A O   
1514 C CB  . ASP A 203 ? 0.3715 0.4606 0.4423 0.0429  0.0240  -0.0407 203 ASP A CB  
1515 C CG  . ASP A 203 ? 0.6092 0.6723 0.6708 0.0530  0.0210  -0.0354 203 ASP A CG  
1516 O OD1 . ASP A 203 ? 0.6944 0.7480 0.7551 0.0640  0.0152  -0.0300 203 ASP A OD1 
1517 O OD2 . ASP A 203 ? 0.6215 0.6733 0.6760 0.0492  0.0248  -0.0369 203 ASP A OD2 
1518 N N   . ASP A 204 ? 0.2199 0.3567 0.3107 0.0347  0.0100  -0.0535 204 ASP A N   
1519 C CA  . ASP A 204 ? 0.2163 0.3780 0.3223 0.0270  0.0067  -0.0526 204 ASP A CA  
1520 C C   . ASP A 204 ? 0.2334 0.3779 0.3355 0.0252  -0.0020 -0.0495 204 ASP A C   
1521 O O   . ASP A 204 ? 0.1937 0.3539 0.3047 0.0293  -0.0077 -0.0504 204 ASP A O   
1522 C CB  . ASP A 204 ? 0.1709 0.3486 0.2826 0.0084  0.0112  -0.0510 204 ASP A CB  
1523 C CG  . ASP A 204 ? 0.3133 0.5258 0.4366 0.0108  0.0201  -0.0532 204 ASP A CG  
1524 O OD1 . ASP A 204 ? 0.3080 0.5332 0.4346 -0.0049 0.0254  -0.0504 204 ASP A OD1 
1525 O OD2 . ASP A 204 ? 0.2846 0.5118 0.4129 0.0289  0.0222  -0.0572 204 ASP A OD2 
1526 N N   . VAL A 205 ? 0.1819 0.2962 0.2706 0.0200  -0.0030 -0.0454 205 VAL A N   
1527 C CA  . VAL A 205 ? 0.1619 0.2605 0.2447 0.0202  -0.0091 -0.0418 205 VAL A CA  
1528 C C   . VAL A 205 ? 0.2121 0.3078 0.2943 0.0360  -0.0131 -0.0408 205 VAL A C   
1529 O O   . VAL A 205 ? 0.1891 0.2907 0.2724 0.0395  -0.0186 -0.0406 205 VAL A O   
1530 C CB  . VAL A 205 ? 0.1846 0.2559 0.2553 0.0139  -0.0081 -0.0365 205 VAL A CB  
1531 C CG1 . VAL A 205 ? 0.2347 0.2916 0.2988 0.0197  -0.0123 -0.0316 205 VAL A CG1 
1532 C CG2 . VAL A 205 ? 0.1952 0.2659 0.2637 -0.0015 -0.0065 -0.0365 205 VAL A CG2 
1533 N N   . ARG A 206 ? 0.2030 0.2875 0.2811 0.0455  -0.0113 -0.0404 206 ARG A N   
1534 C CA  . ARG A 206 ? 0.2593 0.3363 0.3346 0.0604  -0.0155 -0.0383 206 ARG A CA  
1535 C C   . ARG A 206 ? 0.2461 0.3498 0.3318 0.0705  -0.0185 -0.0429 206 ARG A C   
1536 O O   . ARG A 206 ? 0.2426 0.3469 0.3270 0.0782  -0.0242 -0.0405 206 ARG A O   
1537 C CB  . ARG A 206 ? 0.3295 0.3860 0.3966 0.0678  -0.0144 -0.0380 206 ARG A CB  
1538 C CG  . ARG A 206 ? 0.4218 0.4612 0.4823 0.0804  -0.0197 -0.0331 206 ARG A CG  
1539 C CD  . ARG A 206 ? 0.4971 0.5231 0.5507 0.0926  -0.0205 -0.0369 206 ARG A CD  
1540 N NE  . ARG A 206 ? 0.7374 0.7879 0.7985 0.1068  -0.0201 -0.0441 206 ARG A NE  
1541 C CZ  . ARG A 206 ? 0.8178 0.8725 0.8769 0.1168  -0.0169 -0.0515 206 ARG A CZ  
1542 N NH1 . ARG A 206 ? 0.7953 0.8275 0.8420 0.1134  -0.0148 -0.0537 206 ARG A NH1 
1543 N NH2 . ARG A 206 ? 0.8756 0.9582 0.9444 0.1311  -0.0161 -0.0569 206 ARG A NH2 
1544 N N   . LYS A 207 ? 0.2142 0.3422 0.3105 0.0712  -0.0146 -0.0488 207 LYS A N   
1545 C CA  . LYS A 207 ? 0.1944 0.3549 0.3049 0.0808  -0.0173 -0.0526 207 LYS A CA  
1546 C C   . LYS A 207 ? 0.2173 0.3941 0.3354 0.0721  -0.0241 -0.0519 207 LYS A C   
1547 O O   . LYS A 207 ? 0.2613 0.4500 0.3835 0.0822  -0.0312 -0.0521 207 LYS A O   
1548 C CB  . LYS A 207 ? 0.2290 0.4177 0.3513 0.0818  -0.0099 -0.0576 207 LYS A CB  
1549 C CG  . LYS A 207 ? 0.2794 0.4544 0.3919 0.0985  -0.0055 -0.0607 207 LYS A CG  
1550 C CD  . LYS A 207 ? 0.4051 0.6066 0.5251 0.1001  0.0041  -0.0654 207 LYS A CD  
1551 C CE  . LYS A 207 ? 0.5333 0.7126 0.6366 0.1178  0.0076  -0.0699 207 LYS A CE  
1552 N NZ  . LYS A 207 ? 0.6211 0.8191 0.7245 0.1191  0.0187  -0.0743 207 LYS A NZ  
1553 N N   . ALA A 208 ? 0.1774 0.3522 0.2950 0.0537  -0.0231 -0.0512 208 ALA A N   
1554 C CA  . ALA A 208 ? 0.2017 0.3842 0.3215 0.0441  -0.0311 -0.0515 208 ALA A CA  
1555 C C   . ALA A 208 ? 0.2106 0.3708 0.3153 0.0527  -0.0377 -0.0485 208 ALA A C   
1556 O O   . ALA A 208 ? 0.2067 0.3779 0.3127 0.0561  -0.0466 -0.0499 208 ALA A O   
1557 C CB  . ALA A 208 ? 0.1960 0.3704 0.3125 0.0240  -0.0290 -0.0510 208 ALA A CB  
1558 N N   . ALA A 209 ? 0.1883 0.3185 0.2785 0.0557  -0.0336 -0.0436 209 ALA A N   
1559 C CA  . ALA A 209 ? 0.1925 0.3032 0.2682 0.0642  -0.0374 -0.0386 209 ALA A CA  
1560 C C   . ALA A 209 ? 0.2928 0.4111 0.3697 0.0812  -0.0422 -0.0378 209 ALA A C   
1561 O O   . ALA A 209 ? 0.3171 0.4355 0.3864 0.0875  -0.0491 -0.0365 209 ALA A O   
1562 C CB  . ALA A 209 ? 0.1956 0.2790 0.2606 0.0634  -0.0313 -0.0317 209 ALA A CB  
1563 N N   . GLN A 210 ? 0.2834 0.4061 0.3672 0.0898  -0.0391 -0.0388 210 GLN A N   
1564 C CA  A GLN A 210 ? 0.3330 0.4605 0.4171 0.1080  -0.0438 -0.0382 210 GLN A CA  
1565 C CA  B GLN A 210 ? 0.3272 0.4540 0.4107 0.1079  -0.0440 -0.0379 210 GLN A CA  
1566 C C   . GLN A 210 ? 0.3212 0.4814 0.4174 0.1116  -0.0518 -0.0429 210 GLN A C   
1567 O O   . GLN A 210 ? 0.3404 0.5024 0.4319 0.1246  -0.0592 -0.0409 210 GLN A O   
1568 C CB  A GLN A 210 ? 0.3658 0.4912 0.4535 0.1171  -0.0391 -0.0405 210 GLN A CB  
1569 C CB  B GLN A 210 ? 0.3701 0.4911 0.4554 0.1179  -0.0396 -0.0393 210 GLN A CB  
1570 C CG  A GLN A 210 ? 0.3428 0.4311 0.4155 0.1186  -0.0361 -0.0345 210 GLN A CG  
1571 C CG  B GLN A 210 ? 0.3734 0.4833 0.4510 0.1377  -0.0447 -0.0361 210 GLN A CG  
1572 C CD  A GLN A 210 ? 0.3428 0.4240 0.4149 0.1248  -0.0320 -0.0390 210 GLN A CD  
1573 C CD  B GLN A 210 ? 0.4233 0.4994 0.4830 0.1381  -0.0462 -0.0259 210 GLN A CD  
1574 O OE1 A GLN A 210 ? 0.3144 0.4179 0.3968 0.1228  -0.0274 -0.0460 210 GLN A OE1 
1575 O OE1 B GLN A 210 ? 0.4898 0.5414 0.5423 0.1303  -0.0418 -0.0214 210 GLN A OE1 
1576 N NE2 A GLN A 210 ? 0.4021 0.4507 0.4603 0.1320  -0.0338 -0.0345 210 GLN A NE2 
1577 N NE2 B GLN A 210 ? 0.3170 0.3934 0.3697 0.1469  -0.0526 -0.0213 210 GLN A NE2 
1578 N N   . GLU A 211 ? 0.2702 0.4569 0.3823 0.0993  -0.0508 -0.0484 211 GLU A N   
1579 C CA  . GLU A 211 ? 0.2819 0.5052 0.4105 0.0985  -0.0591 -0.0525 211 GLU A CA  
1580 C C   . GLU A 211 ? 0.2997 0.5154 0.4164 0.0960  -0.0701 -0.0517 211 GLU A C   
1581 O O   . GLU A 211 ? 0.3549 0.5890 0.4759 0.1051  -0.0804 -0.0528 211 GLU A O   
1582 C CB  . GLU A 211 ? 0.3595 0.6077 0.5055 0.0802  -0.0550 -0.0560 211 GLU A CB  
1583 C CG  . GLU A 211 ? 0.5932 0.8876 0.7636 0.0771  -0.0620 -0.0591 211 GLU A CG  
1584 C CD  . GLU A 211 ? 0.7204 1.0357 0.9061 0.0548  -0.0577 -0.0601 211 GLU A CD  
1585 O OE1 . GLU A 211 ? 0.6667 0.9740 0.8508 0.0501  -0.0457 -0.0593 211 GLU A OE1 
1586 O OE2 . GLU A 211 ? 0.7928 1.1310 0.9909 0.0411  -0.0673 -0.0611 211 GLU A OE2 
1587 N N   . ILE A 212 ? 0.3044 0.4925 0.4043 0.0852  -0.0683 -0.0499 212 ILE A N   
1588 C CA  . ILE A 212 ? 0.3194 0.4949 0.4020 0.0843  -0.0775 -0.0498 212 ILE A CA  
1589 C C   . ILE A 212 ? 0.2855 0.4462 0.3518 0.1033  -0.0804 -0.0443 212 ILE A C   
1590 O O   . ILE A 212 ? 0.3467 0.5115 0.4041 0.1094  -0.0912 -0.0453 212 ILE A O   
1591 C CB  . ILE A 212 ? 0.2825 0.4306 0.3493 0.0717  -0.0730 -0.0490 212 ILE A CB  
1592 C CG1 . ILE A 212 ? 0.2643 0.4243 0.3441 0.0519  -0.0723 -0.0537 212 ILE A CG1 
1593 C CG2 . ILE A 212 ? 0.2983 0.4290 0.3415 0.0750  -0.0812 -0.0493 212 ILE A CG2 
1594 C CD1 . ILE A 212 ? 0.3663 0.4982 0.4318 0.0412  -0.0665 -0.0523 212 ILE A CD1 
1595 N N   . VAL A 213 ? 0.2828 0.4247 0.3437 0.1117  -0.0716 -0.0379 213 VAL A N   
1596 C CA  . VAL A 213 ? 0.2916 0.4176 0.3371 0.1283  -0.0736 -0.0304 213 VAL A CA  
1597 C C   . VAL A 213 ? 0.3606 0.5083 0.4157 0.1430  -0.0820 -0.0325 213 VAL A C   
1598 O O   . VAL A 213 ? 0.3783 0.5251 0.4215 0.1518  -0.0900 -0.0303 213 VAL A O   
1599 C CB  . VAL A 213 ? 0.3272 0.4272 0.3665 0.1309  -0.0637 -0.0222 213 VAL A CB  
1600 C CG1 . VAL A 213 ? 0.3700 0.4535 0.3942 0.1468  -0.0663 -0.0129 213 VAL A CG1 
1601 C CG2 . VAL A 213 ? 0.3157 0.3979 0.3466 0.1182  -0.0562 -0.0188 213 VAL A CG2 
1602 N N   . ASN A 214 ? 0.3703 0.5357 0.4445 0.1445  -0.0786 -0.0364 214 ASN A N   
1603 C CA  . ASN A 214 ? 0.4519 0.6335 0.5335 0.1539  -0.0818 -0.0374 214 ASN A CA  
1604 C C   . ASN A 214 ? 0.4737 0.6834 0.5630 0.1513  -0.0933 -0.0414 214 ASN A C   
1605 O O   . ASN A 214 ? 0.4257 0.6398 0.5117 0.1617  -0.0991 -0.0394 214 ASN A O   
1606 C CB  . ASN A 214 ? 0.4292 0.6258 0.5282 0.1544  -0.0740 -0.0412 214 ASN A CB  
1607 C CG  . ASN A 214 ? 0.5131 0.6778 0.6005 0.1603  -0.0656 -0.0375 214 ASN A CG  
1608 O OD1 . ASN A 214 ? 0.5006 0.6337 0.5693 0.1645  -0.0660 -0.0303 214 ASN A OD1 
1609 N ND2 . ASN A 214 ? 0.4856 0.6583 0.5832 0.1600  -0.0582 -0.0418 214 ASN A ND2 
1610 N N   . SER A 215 ? 0.3813 0.6083 0.4802 0.1365  -0.0979 -0.0469 215 SER A N   
1611 C CA  . SER A 215 ? 0.4484 0.7003 0.5549 0.1299  -0.1107 -0.0510 215 SER A CA  
1612 C C   . SER A 215 ? 0.4860 0.7179 0.5664 0.1357  -0.1210 -0.0493 215 SER A C   
1613 O O   . SER A 215 ? 0.4368 0.6835 0.5182 0.1332  -0.1333 -0.0519 215 SER A O   
1614 C CB  . SER A 215 ? 0.4364 0.7081 0.5588 0.1087  -0.1133 -0.0571 215 SER A CB  
1615 O OG  . SER A 215 ? 0.4334 0.6740 0.5350 0.0991  -0.1120 -0.0576 215 SER A OG  
1616 N N   . GLY A 216 ? 0.4153 0.6137 0.4719 0.1429  -0.1157 -0.0440 216 GLY A N   
1617 C CA  . GLY A 216 ? 0.4864 0.6632 0.5141 0.1499  -0.1221 -0.0408 216 GLY A CA  
1618 C C   . GLY A 216 ? 0.4796 0.6457 0.4916 0.1395  -0.1277 -0.0457 216 GLY A C   
1619 O O   . GLY A 216 ? 0.4856 0.6346 0.4703 0.1459  -0.1339 -0.0446 216 GLY A O   
1620 N N   . LYS A 217 ? 0.4140 0.5835 0.4394 0.1213  -0.1224 -0.0504 217 LYS A N   
1621 C CA  . LYS A 217 ? 0.3509 0.5025 0.3596 0.1077  -0.1252 -0.0553 217 LYS A CA  
1622 C C   . LYS A 217 ? 0.3192 0.4353 0.3003 0.1138  -0.1144 -0.0491 217 LYS A C   
1623 O O   . LYS A 217 ? 0.3807 0.4776 0.3352 0.1152  -0.1191 -0.0514 217 LYS A O   
1624 C CB  . LYS A 217 ? 0.4063 0.5689 0.4360 0.0866  -0.1220 -0.0603 217 LYS A CB  
1625 C CG  . LYS A 217 ? 0.5382 0.7378 0.5932 0.0759  -0.1346 -0.0664 217 LYS A CG  
1626 C CD  . LYS A 217 ? 0.6551 0.8630 0.7278 0.0533  -0.1305 -0.0694 217 LYS A CD  
1627 C CE  . LYS A 217 ? 0.6953 0.9404 0.7923 0.0388  -0.1445 -0.0740 217 LYS A CE  
1628 N NZ  . LYS A 217 ? 0.7412 0.9690 0.8210 0.0226  -0.1598 -0.0801 217 LYS A NZ  
1629 N N   . ALA A 218 ? 0.3435 0.4519 0.3309 0.1178  -0.1001 -0.0411 218 ALA A N   
1630 C CA  . ALA A 218 ? 0.3271 0.4083 0.2941 0.1231  -0.0890 -0.0328 218 ALA A CA  
1631 C C   . ALA A 218 ? 0.3612 0.4376 0.3305 0.1349  -0.0812 -0.0216 218 ALA A C   
1632 O O   . ALA A 218 ? 0.3877 0.4760 0.3771 0.1353  -0.0801 -0.0216 218 ALA A O   
1633 C CB  . ALA A 218 ? 0.3013 0.3720 0.2728 0.1091  -0.0796 -0.0340 218 ALA A CB  
1634 N N   . LYS A 219 ? 0.3818 0.4400 0.3292 0.1448  -0.0760 -0.0118 219 LYS A N   
1635 C CA  . LYS A 219 ? 0.3708 0.4198 0.3184 0.1532  -0.0689 0.0010  219 LYS A CA  
1636 C C   . LYS A 219 ? 0.3738 0.4154 0.3357 0.1428  -0.0574 0.0055  219 LYS A C   
1637 O O   . LYS A 219 ? 0.3700 0.4083 0.3430 0.1439  -0.0549 0.0102  219 LYS A O   
1638 C CB  . LYS A 219 ? 0.3429 0.3772 0.2633 0.1650  -0.0659 0.0123  219 LYS A CB  
1639 C CG  . LYS A 219 ? 0.4507 0.4892 0.3532 0.1766  -0.0776 0.0093  219 LYS A CG  
1640 C CD  . LYS A 219 ? 0.6411 0.6639 0.5183 0.1849  -0.0702 0.0219  219 LYS A CD  
1641 C CE  . LYS A 219 ? 0.7345 0.7591 0.5931 0.1942  -0.0804 0.0182  219 LYS A CE  
1642 N NZ  . LYS A 219 ? 0.8188 0.8444 0.6592 0.1958  -0.0894 0.0067  219 LYS A NZ  
1643 N N   . ARG A 220 ? 0.3070 0.3439 0.2665 0.1335  -0.0516 0.0035  220 ARG A N   
1644 C CA  . ARG A 220 ? 0.3263 0.3569 0.2980 0.1232  -0.0419 0.0076  220 ARG A CA  
1645 C C   . ARG A 220 ? 0.2716 0.3070 0.2507 0.1105  -0.0423 -0.0030 220 ARG A C   
1646 O O   . ARG A 220 ? 0.3554 0.3890 0.3217 0.1100  -0.0460 -0.0090 220 ARG A O   
1647 C CB  . ARG A 220 ? 0.3433 0.3617 0.3028 0.1264  -0.0323 0.0211  220 ARG A CB  
1648 C CG  . ARG A 220 ? 0.3861 0.3984 0.3338 0.1382  -0.0314 0.0341  220 ARG A CG  
1649 C CD  . ARG A 220 ? 0.4739 0.4804 0.4091 0.1413  -0.0209 0.0479  220 ARG A CD  
1650 N NE  . ARG A 220 ? 0.5002 0.5015 0.4202 0.1525  -0.0198 0.0613  220 ARG A NE  
1651 C CZ  . ARG A 220 ? 0.5970 0.5986 0.4947 0.1646  -0.0240 0.0596  220 ARG A CZ  
1652 N NH1 . ARG A 220 ? 0.4662 0.4718 0.3537 0.1676  -0.0312 0.0450  220 ARG A NH1 
1653 N NH2 . ARG A 220 ? 0.6380 0.6343 0.5240 0.1693  -0.0209 0.0709  220 ARG A NH2 
1654 N N   . VAL A 221 ? 0.2527 0.2912 0.2497 0.1006  -0.0390 -0.0053 221 VAL A N   
1655 C CA  . VAL A 221 ? 0.2079 0.2488 0.2116 0.0875  -0.0381 -0.0129 221 VAL A CA  
1656 C C   . VAL A 221 ? 0.2430 0.2737 0.2518 0.0812  -0.0291 -0.0061 221 VAL A C   
1657 O O   . VAL A 221 ? 0.2618 0.2908 0.2804 0.0804  -0.0264 -0.0019 221 VAL A O   
1658 C CB  . VAL A 221 ? 0.2700 0.3288 0.2911 0.0805  -0.0428 -0.0225 221 VAL A CB  
1659 C CG1 . VAL A 221 ? 0.2789 0.3378 0.3061 0.0653  -0.0404 -0.0277 221 VAL A CG1 
1660 C CG2 . VAL A 221 ? 0.2620 0.3354 0.2814 0.0852  -0.0535 -0.0289 221 VAL A CG2 
1661 N N   . VAL A 222 ? 0.2232 0.2454 0.2238 0.0775  -0.0255 -0.0049 222 VAL A N   
1662 C CA  . VAL A 222 ? 0.2020 0.2179 0.2094 0.0708  -0.0185 0.0011  222 VAL A CA  
1663 C C   . VAL A 222 ? 0.2131 0.2279 0.2233 0.0593  -0.0195 -0.0072 222 VAL A C   
1664 O O   . VAL A 222 ? 0.2946 0.3026 0.2926 0.0591  -0.0212 -0.0110 222 VAL A O   
1665 C CB  . VAL A 222 ? 0.2176 0.2267 0.2152 0.0778  -0.0120 0.0122  222 VAL A CB  
1666 C CG1 . VAL A 222 ? 0.2407 0.2468 0.2481 0.0701  -0.0063 0.0187  222 VAL A CG1 
1667 C CG2 . VAL A 222 ? 0.3115 0.3215 0.3063 0.0872  -0.0104 0.0227  222 VAL A CG2 
1668 N N   . VAL A 223 ? 0.2073 0.2265 0.2308 0.0503  -0.0188 -0.0099 223 VAL A N   
1669 C CA  . VAL A 223 ? 0.2244 0.2422 0.2500 0.0384  -0.0189 -0.0157 223 VAL A CA  
1670 C C   . VAL A 223 ? 0.2276 0.2341 0.2518 0.0355  -0.0137 -0.0087 223 VAL A C   
1671 O O   . VAL A 223 ? 0.2123 0.2181 0.2444 0.0340  -0.0109 -0.0032 223 VAL A O   
1672 C CB  . VAL A 223 ? 0.2210 0.2508 0.2597 0.0310  -0.0193 -0.0213 223 VAL A CB  
1673 C CG1 . VAL A 223 ? 0.1938 0.2231 0.2327 0.0177  -0.0193 -0.0260 223 VAL A CG1 
1674 C CG2 . VAL A 223 ? 0.2720 0.3182 0.3164 0.0367  -0.0241 -0.0263 223 VAL A CG2 
1675 N N   . SER A 224 ? 0.1845 0.1811 0.1976 0.0351  -0.0136 -0.0091 224 SER A N   
1676 C CA  . SER A 224 ? 0.2320 0.2207 0.2449 0.0341  -0.0092 -0.0020 224 SER A CA  
1677 C C   . SER A 224 ? 0.2460 0.2311 0.2628 0.0213  -0.0099 -0.0057 224 SER A C   
1678 O O   . SER A 224 ? 0.2070 0.1911 0.2207 0.0135  -0.0132 -0.0134 224 SER A O   
1679 C CB  . SER A 224 ? 0.2254 0.2047 0.2231 0.0438  -0.0076 0.0006  224 SER A CB  
1680 O OG  . SER A 224 ? 0.2443 0.2113 0.2277 0.0407  -0.0126 -0.0085 224 SER A OG  
1681 N N   . LEU A 225 ? 0.1843 0.1682 0.2080 0.0183  -0.0072 0.0007  225 LEU A N   
1682 C CA  . LEU A 225 ? 0.1520 0.1337 0.1788 0.0072  -0.0076 -0.0019 225 LEU A CA  
1683 C C   . LEU A 225 ? 0.1559 0.1276 0.1785 0.0052  -0.0070 0.0036  225 LEU A C   
1684 O O   . LEU A 225 ? 0.1912 0.1611 0.2170 -0.0017 -0.0074 0.0054  225 LEU A O   
1685 C CB  . LEU A 225 ? 0.1847 0.1722 0.2213 0.0057  -0.0073 -0.0006 225 LEU A CB  
1686 C CG  . LEU A 225 ? 0.2840 0.2809 0.3251 0.0106  -0.0082 -0.0050 225 LEU A CG  
1687 C CD1 . LEU A 225 ? 0.2082 0.2036 0.2547 0.0112  -0.0087 -0.0033 225 LEU A CD1 
1688 C CD2 . LEU A 225 ? 0.2831 0.2890 0.3242 0.0058  -0.0090 -0.0143 225 LEU A CD2 
1689 N N   . GLY A 226 ? 0.2257 0.1901 0.2392 0.0127  -0.0065 0.0061  226 GLY A N   
1690 C CA  . GLY A 226 ? 0.2373 0.1930 0.2465 0.0139  -0.0062 0.0116  226 GLY A CA  
1691 C C   . GLY A 226 ? 0.2016 0.1670 0.2246 0.0144  -0.0051 0.0216  226 GLY A C   
1692 O O   . GLY A 226 ? 0.2190 0.1951 0.2507 0.0203  -0.0030 0.0277  226 GLY A O   
1693 N N   . PRO A 227 ? 0.2269 0.1880 0.2512 0.0071  -0.0075 0.0238  227 PRO A N   
1694 C CA  . PRO A 227 ? 0.2131 0.1828 0.2506 0.0056  -0.0091 0.0332  227 PRO A CA  
1695 C C   . PRO A 227 ? 0.1877 0.1626 0.2343 0.0000  -0.0107 0.0325  227 PRO A C   
1696 O O   . PRO A 227 ? 0.2334 0.2143 0.2913 -0.0019 -0.0132 0.0409  227 PRO A O   
1697 C CB  . PRO A 227 ? 0.2298 0.1901 0.2616 -0.0016 -0.0129 0.0331  227 PRO A CB  
1698 C CG  . PRO A 227 ? 0.2370 0.1860 0.2556 -0.0083 -0.0125 0.0229  227 PRO A CG  
1699 C CD  . PRO A 227 ? 0.2632 0.2111 0.2764 -0.0016 -0.0097 0.0182  227 PRO A CD  
1700 N N   . GLN A 228 ? 0.1940 0.1667 0.2361 -0.0025 -0.0100 0.0231  228 GLN A N   
1701 C CA  . GLN A 228 ? 0.1438 0.1184 0.1915 -0.0045 -0.0116 0.0216  228 GLN A CA  
1702 C C   . GLN A 228 ? 0.1722 0.1535 0.2260 0.0033  -0.0099 0.0265  228 GLN A C   
1703 O O   . GLN A 228 ? 0.2085 0.1882 0.2658 0.0029  -0.0120 0.0266  228 GLN A O   
1704 C CB  . GLN A 228 ? 0.1864 0.1592 0.2279 -0.0084 -0.0111 0.0102  228 GLN A CB  
1705 C CG  . GLN A 228 ? 0.1876 0.1535 0.2225 -0.0168 -0.0126 0.0074  228 GLN A CG  
1706 C CD  . GLN A 228 ? 0.2581 0.2271 0.2873 -0.0202 -0.0098 -0.0022 228 GLN A CD  
1707 O OE1 . GLN A 228 ? 0.2931 0.2711 0.3250 -0.0172 -0.0073 -0.0071 228 GLN A OE1 
1708 N NE2 . GLN A 228 ? 0.2662 0.2297 0.2874 -0.0264 -0.0102 -0.0044 228 GLN A NE2 
1709 N N   . GLY A 229 ? 0.2094 0.1759 0.2019 0.0045  -0.0334 0.0056  229 GLY A N   
1710 C CA  . GLY A 229 ? 0.2044 0.1646 0.1996 0.0057  -0.0318 0.0076  229 GLY A CA  
1711 C C   . GLY A 229 ? 0.2373 0.1967 0.2292 0.0072  -0.0322 0.0096  229 GLY A C   
1712 O O   . GLY A 229 ? 0.2260 0.1877 0.2133 0.0062  -0.0323 0.0112  229 GLY A O   
1713 N N   . ALA A 230 ? 0.2219 0.1775 0.2168 0.0098  -0.0331 0.0093  230 ALA A N   
1714 C CA  . ALA A 230 ? 0.2271 0.1824 0.2199 0.0125  -0.0357 0.0110  230 ALA A CA  
1715 C C   . ALA A 230 ? 0.2459 0.1991 0.2454 0.0170  -0.0386 0.0086  230 ALA A C   
1716 O O   . ALA A 230 ? 0.2727 0.2199 0.2768 0.0177  -0.0376 0.0074  230 ALA A O   
1717 C CB  . ALA A 230 ? 0.2336 0.1808 0.2177 0.0115  -0.0353 0.0167  230 ALA A CB  
1718 N N   . LEU A 231 ? 0.2359 0.1943 0.2380 0.0204  -0.0424 0.0070  231 LEU A N   
1719 C CA  . LEU A 231 ? 0.2640 0.2199 0.2745 0.0266  -0.0470 0.0048  231 LEU A CA  
1720 C C   . LEU A 231 ? 0.2816 0.2297 0.2850 0.0304  -0.0530 0.0110  231 LEU A C   
1721 O O   . LEU A 231 ? 0.3440 0.2996 0.3441 0.0301  -0.0552 0.0110  231 LEU A O   
1722 C CB  . LEU A 231 ? 0.3022 0.2733 0.3250 0.0281  -0.0474 -0.0047 231 LEU A CB  
1723 C CG  . LEU A 231 ? 0.3726 0.3430 0.4093 0.0354  -0.0523 -0.0097 231 LEU A CG  
1724 C CD1 . LEU A 231 ? 0.5491 0.5235 0.5960 0.0341  -0.0478 -0.0179 231 LEU A CD1 
1725 C CD2 . LEU A 231 ? 0.3931 0.3766 0.4393 0.0392  -0.0568 -0.0155 231 LEU A CD2 
1726 N N   . GLY A 232 ? 0.2760 0.2081 0.2755 0.0334  -0.0556 0.0165  232 GLY A N   
1727 C CA  . GLY A 232 ? 0.3115 0.2328 0.2998 0.0368  -0.0622 0.0239  232 GLY A CA  
1728 C C   . GLY A 232 ? 0.3346 0.2524 0.3325 0.0462  -0.0714 0.0226  232 GLY A C   
1729 O O   . GLY A 232 ? 0.3218 0.2330 0.3297 0.0492  -0.0711 0.0201  232 GLY A O   
1730 N N   . VAL A 233 ? 0.3381 0.2606 0.3345 0.0512  -0.0802 0.0234  233 VAL A N   
1731 C CA  . VAL A 233 ? 0.4326 0.3539 0.4409 0.0618  -0.0912 0.0211  233 VAL A CA  
1732 C C   . VAL A 233 ? 0.4099 0.3159 0.4013 0.0668  -0.1022 0.0315  233 VAL A C   
1733 O O   . VAL A 233 ? 0.3558 0.2645 0.3318 0.0629  -0.1032 0.0354  233 VAL A O   
1734 C CB  . VAL A 233 ? 0.4873 0.4341 0.5165 0.0648  -0.0934 0.0083  233 VAL A CB  
1735 C CG1 . VAL A 233 ? 0.6071 0.5552 0.6509 0.0769  -0.1065 0.0048  233 VAL A CG1 
1736 C CG2 . VAL A 233 ? 0.5382 0.4966 0.5819 0.0603  -0.0833 -0.0016 233 VAL A CG2 
1737 N N   . ASP A 234 ? 0.3851 0.2736 0.3784 0.0751  -0.1105 0.0359  234 ASP A N   
1738 C CA  . ASP A 234 ? 0.5130 0.3828 0.4891 0.0814  -0.1233 0.0470  234 ASP A CA  
1739 C C   . ASP A 234 ? 0.4527 0.3276 0.4499 0.0955  -0.1378 0.0413  234 ASP A C   
1740 O O   . ASP A 234 ? 0.4301 0.3240 0.4550 0.0987  -0.1357 0.0280  234 ASP A O   
1741 C CB  . ASP A 234 ? 0.6145 0.4526 0.5732 0.0790  -0.1205 0.0587  234 ASP A CB  
1742 C CG  . ASP A 234 ? 0.7391 0.5623 0.6656 0.0696  -0.1161 0.0703  234 ASP A CG  
1743 O OD1 . ASP A 234 ? 0.9164 0.7514 0.8324 0.0674  -0.1189 0.0705  234 ASP A OD1 
1744 O OD2 . ASP A 234 ? 0.6809 0.4810 0.5931 0.0638  -0.1092 0.0781  234 ASP A OD2 
1745 N N   . SER A 235 ? 0.5306 0.3878 0.5146 0.1038  -0.1527 0.0511  235 SER A N   
1746 C CA  . SER A 235 ? 0.5665 0.4239 0.5716 0.1191  -0.1683 0.0468  235 SER A CA  
1747 C C   . SER A 235 ? 0.5936 0.4321 0.6101 0.1225  -0.1648 0.0471  235 SER A C   
1748 O O   . SER A 235 ? 0.6251 0.4698 0.6668 0.1318  -0.1702 0.0384  235 SER A O   
1749 C CB  . SER A 235 ? 0.6276 0.4746 0.6130 0.1235  -0.1810 0.0568  235 SER A CB  
1750 O OG  . SER A 235 ? 0.6459 0.4608 0.6012 0.1185  -0.1778 0.0729  235 SER A OG  
1751 N N   . GLU A 236 ? 0.5188 0.3377 0.5178 0.1125  -0.1525 0.0550  236 GLU A N   
1752 C CA  . GLU A 236 ? 0.5958 0.3925 0.6019 0.1143  -0.1488 0.0565  236 GLU A CA  
1753 C C   . GLU A 236 ? 0.5842 0.3912 0.6013 0.1036  -0.1305 0.0474  236 GLU A C   
1754 O O   . GLU A 236 ? 0.5997 0.3991 0.6334 0.1058  -0.1269 0.0419  236 GLU A O   
1755 C CB  . GLU A 236 ? 0.7674 0.5315 0.7417 0.1093  -0.1474 0.0736  236 GLU A CB  
1756 C CG  . GLU A 236 ? 0.9590 0.7168 0.9200 0.1162  -0.1605 0.0820  236 GLU A CG  
1757 C CD  . GLU A 236 ? 1.1226 0.8514 1.0461 0.1081  -0.1574 0.0993  236 GLU A CD  
1758 O OE1 . GLU A 236 ? 1.1613 0.8742 1.0722 0.0973  -0.1442 0.1038  236 GLU A OE1 
1759 O OE2 . GLU A 236 ? 1.1854 0.9080 1.0923 0.1121  -0.1678 0.1075  236 GLU A OE2 
1760 N N   . ASN A 237 ? 0.4535 0.2772 0.4616 0.0923  -0.1197 0.0454  237 ASN A N   
1761 C CA  . ASN A 237 ? 0.4844 0.3155 0.4987 0.0821  -0.1040 0.0388  237 ASN A CA  
1762 C C   . ASN A 237 ? 0.4037 0.2664 0.4291 0.0768  -0.0969 0.0274  237 ASN A C   
1763 O O   . ASN A 237 ? 0.4131 0.2912 0.4356 0.0774  -0.1010 0.0265  237 ASN A O   
1764 C CB  . ASN A 237 ? 0.5821 0.3937 0.5710 0.0710  -0.0947 0.0498  237 ASN A CB  
1765 C CG  . ASN A 237 ? 0.7269 0.5043 0.7050 0.0728  -0.0972 0.0600  237 ASN A CG  
1766 O OD1 . ASN A 237 ? 0.7910 0.5468 0.7429 0.0710  -0.1009 0.0734  237 ASN A OD1 
1767 N ND2 . ASN A 237 ? 0.7518 0.5227 0.7486 0.0755  -0.0946 0.0535  237 ASN A ND2 
1768 N N   . CYS A 238 ? 0.3858 0.2571 0.4229 0.0711  -0.0863 0.0188  238 CYS A N   
1769 C CA  . CYS A 238 ? 0.3889 0.2854 0.4322 0.0646  -0.0785 0.0097  238 CYS A CA  
1770 C C   . CYS A 238 ? 0.4016 0.2951 0.4416 0.0555  -0.0673 0.0086  238 CYS A C   
1771 O O   . CYS A 238 ? 0.4788 0.3652 0.5291 0.0561  -0.0645 0.0040  238 CYS A O   
1772 C CB  . CYS A 238 ? 0.4673 0.3839 0.5353 0.0696  -0.0800 -0.0047 238 CYS A CB  
1773 S SG  . CYS A 238 ? 0.5487 0.4925 0.6203 0.0601  -0.0696 -0.0150 238 CYS A SG  
1774 N N   . ILE A 239 ? 0.3517 0.2508 0.3789 0.0473  -0.0613 0.0118  239 ILE A N   
1775 C CA  . ILE A 239 ? 0.4073 0.3054 0.4330 0.0394  -0.0521 0.0101  239 ILE A CA  
1776 C C   . ILE A 239 ? 0.4776 0.3941 0.5014 0.0336  -0.0475 0.0062  239 ILE A C   
1777 O O   . ILE A 239 ? 0.3622 0.2858 0.3787 0.0331  -0.0493 0.0091  239 ILE A O   
1778 C CB  . ILE A 239 ? 0.3961 0.2741 0.4061 0.0346  -0.0489 0.0199  239 ILE A CB  
1779 C CG1 . ILE A 239 ? 0.4200 0.2965 0.4127 0.0330  -0.0510 0.0283  239 ILE A CG1 
1780 C CG2 . ILE A 239 ? 0.5446 0.3994 0.5547 0.0386  -0.0518 0.0243  239 ILE A CG2 
1781 C CD1 . ILE A 239 ? 0.5751 0.4437 0.5547 0.0242  -0.0432 0.0330  239 ILE A CD1 
1782 N N   . GLN A 240 ? 0.3807 0.3042 0.4105 0.0291  -0.0419 -0.0003 240 GLN A N   
1783 C CA  . GLN A 240 ? 0.2678 0.2041 0.2930 0.0236  -0.0383 -0.0018 240 GLN A CA  
1784 C C   . GLN A 240 ? 0.2662 0.1960 0.2874 0.0181  -0.0337 0.0003  240 GLN A C   
1785 O O   . GLN A 240 ? 0.2948 0.2176 0.3220 0.0171  -0.0313 -0.0026 240 GLN A O   
1786 C CB  . GLN A 240 ? 0.4549 0.4072 0.4881 0.0224  -0.0368 -0.0116 240 GLN A CB  
1787 C CG  . GLN A 240 ? 0.6173 0.5791 0.6422 0.0169  -0.0345 -0.0110 240 GLN A CG  
1788 C CD  . GLN A 240 ? 0.6494 0.6253 0.6759 0.0145  -0.0330 -0.0186 240 GLN A CD  
1789 O OE1 . GLN A 240 ? 0.6494 0.6312 0.6853 0.0166  -0.0327 -0.0261 240 GLN A OE1 
1790 N NE2 . GLN A 240 ? 0.4125 0.3930 0.4295 0.0099  -0.0317 -0.0168 240 GLN A NE2 
1791 N N   . VAL A 241 ? 0.2524 0.1852 0.2653 0.0146  -0.0322 0.0042  241 VAL A N   
1792 C CA  . VAL A 241 ? 0.2378 0.1680 0.2502 0.0097  -0.0279 0.0044  241 VAL A CA  
1793 C C   . VAL A 241 ? 0.2395 0.1827 0.2519 0.0077  -0.0282 0.0015  241 VAL A C   
1794 O O   . VAL A 241 ? 0.2975 0.2453 0.3040 0.0081  -0.0297 0.0043  241 VAL A O   
1795 C CB  . VAL A 241 ? 0.2487 0.1678 0.2515 0.0073  -0.0255 0.0115  241 VAL A CB  
1796 C CG1 . VAL A 241 ? 0.3067 0.2269 0.3124 0.0017  -0.0203 0.0092  241 VAL A CG1 
1797 C CG2 . VAL A 241 ? 0.2902 0.1923 0.2890 0.0088  -0.0259 0.0160  241 VAL A CG2 
1798 N N   . VAL A 242 ? 0.2217 0.1701 0.2406 0.0055  -0.0274 -0.0041 242 VAL A N   
1799 C CA  . VAL A 242 ? 0.2583 0.2171 0.2760 0.0043  -0.0296 -0.0062 242 VAL A CA  
1800 C C   . VAL A 242 ? 0.2099 0.1685 0.2319 0.0020  -0.0283 -0.0066 242 VAL A C   
1801 O O   . VAL A 242 ? 0.2870 0.2421 0.3165 -0.0002 -0.0252 -0.0100 242 VAL A O   
1802 C CB  . VAL A 242 ? 0.3011 0.2681 0.3222 0.0038  -0.0313 -0.0134 242 VAL A CB  
1803 C CG1 . VAL A 242 ? 0.2663 0.2416 0.2806 0.0027  -0.0350 -0.0136 242 VAL A CG1 
1804 C CG2 . VAL A 242 ? 0.3290 0.2963 0.3508 0.0058  -0.0308 -0.0157 242 VAL A CG2 
1805 N N   . PRO A 243 ? 0.2465 0.2087 0.2652 0.0023  -0.0304 -0.0042 243 PRO A N   
1806 C CA  . PRO A 243 ? 0.2341 0.1983 0.2607 0.0010  -0.0297 -0.0064 243 PRO A CA  
1807 C C   . PRO A 243 ? 0.2263 0.1987 0.2619 0.0007  -0.0331 -0.0136 243 PRO A C   
1808 O O   . PRO A 243 ? 0.2283 0.2052 0.2602 0.0015  -0.0369 -0.0156 243 PRO A O   
1809 C CB  . PRO A 243 ? 0.2914 0.2574 0.3131 0.0028  -0.0329 -0.0026 243 PRO A CB  
1810 C CG  . PRO A 243 ? 0.2920 0.2561 0.3022 0.0037  -0.0337 0.0020  243 PRO A CG  
1811 C CD  . PRO A 243 ? 0.2769 0.2418 0.2866 0.0037  -0.0334 -0.0004 243 PRO A CD  
1812 N N   . PRO A 244 ? 0.2177 0.1934 0.2656 -0.0009 -0.0317 -0.0185 244 PRO A N   
1813 C CA  . PRO A 244 ? 0.2419 0.2278 0.3000 -0.0007 -0.0367 -0.0264 244 PRO A CA  
1814 C C   . PRO A 244 ? 0.2241 0.2159 0.2768 0.0036  -0.0464 -0.0244 244 PRO A C   
1815 O O   . PRO A 244 ? 0.2766 0.2642 0.3219 0.0057  -0.0477 -0.0179 244 PRO A O   
1816 C CB  . PRO A 244 ? 0.2613 0.2500 0.3358 -0.0035 -0.0321 -0.0327 244 PRO A CB  
1817 C CG  . PRO A 244 ? 0.3127 0.2940 0.3828 -0.0043 -0.0265 -0.0270 244 PRO A CG  
1818 C CD  . PRO A 244 ? 0.2796 0.2507 0.3329 -0.0038 -0.0248 -0.0185 244 PRO A CD  
1819 N N   . PRO A 245 ? 0.2828 0.2833 0.3377 0.0043  -0.0534 -0.0299 245 PRO A N   
1820 C CA  . PRO A 245 ? 0.3373 0.3407 0.3824 0.0080  -0.0638 -0.0267 245 PRO A CA  
1821 C C   . PRO A 245 ? 0.3443 0.3516 0.4009 0.0123  -0.0704 -0.0279 245 PRO A C   
1822 O O   . PRO A 245 ? 0.3815 0.3983 0.4475 0.0144  -0.0785 -0.0344 245 PRO A O   
1823 C CB  . PRO A 245 ? 0.3497 0.3611 0.3924 0.0065  -0.0687 -0.0333 245 PRO A CB  
1824 C CG  . PRO A 245 ? 0.3383 0.3544 0.3990 0.0032  -0.0626 -0.0429 245 PRO A CG  
1825 C CD  . PRO A 245 ? 0.2692 0.2754 0.3330 0.0012  -0.0518 -0.0390 245 PRO A CD  
1826 N N   . VAL A 246 ? 0.3141 0.3147 0.3714 0.0137  -0.0671 -0.0228 246 VAL A N   
1827 C CA  . VAL A 246 ? 0.3598 0.3628 0.4293 0.0185  -0.0727 -0.0241 246 VAL A CA  
1828 C C   . VAL A 246 ? 0.4333 0.4259 0.4875 0.0218  -0.0772 -0.0141 246 VAL A C   
1829 O O   . VAL A 246 ? 0.4319 0.4163 0.4725 0.0190  -0.0707 -0.0077 246 VAL A O   
1830 C CB  . VAL A 246 ? 0.4044 0.4087 0.4912 0.0161  -0.0628 -0.0292 246 VAL A CB  
1831 C CG1 . VAL A 246 ? 0.4243 0.4330 0.5279 0.0214  -0.0682 -0.0331 246 VAL A CG1 
1832 C CG2 . VAL A 246 ? 0.5360 0.5474 0.6358 0.0109  -0.0563 -0.0385 246 VAL A CG2 
1833 N N   . LYS A 247 ? 0.3810 0.3738 0.4383 0.0279  -0.0886 -0.0131 247 LYS A N   
1834 C CA  . LYS A 247 ? 0.4377 0.4179 0.4793 0.0309  -0.0938 -0.0032 247 LYS A CA  
1835 C C   . LYS A 247 ? 0.4190 0.3921 0.4659 0.0307  -0.0860 -0.0010 247 LYS A C   
1836 O O   . LYS A 247 ? 0.4280 0.4063 0.4958 0.0326  -0.0834 -0.0078 247 LYS A O   
1837 C CB  . LYS A 247 ? 0.4245 0.4043 0.4684 0.0385  -0.1096 -0.0022 247 LYS A CB  
1838 C CG  . LYS A 247 ? 0.5746 0.5375 0.5986 0.0410  -0.1159 0.0095  247 LYS A CG  
1839 C CD  . LYS A 247 ? 0.7730 0.7332 0.8015 0.0502  -0.1332 0.0108  247 LYS A CD  
1840 C CE  . LYS A 247 ? 0.7865 0.7383 0.8295 0.0563  -0.1348 0.0120  247 LYS A CE  
1841 N NZ  . LYS A 247 ? 0.7985 0.7550 0.8614 0.0671  -0.1506 0.0073  247 LYS A NZ  
1842 N N   . SER A 248 ? 0.3954 0.3576 0.4238 0.0277  -0.0818 0.0072  248 SER A N   
1843 C CA  . SER A 248 ? 0.3003 0.2555 0.3313 0.0270  -0.0752 0.0091  248 SER A CA  
1844 C C   . SER A 248 ? 0.3992 0.3465 0.4356 0.0336  -0.0840 0.0114  248 SER A C   
1845 O O   . SER A 248 ? 0.4614 0.4007 0.4847 0.0365  -0.0941 0.0180  248 SER A O   
1846 C CB  . SER A 248 ? 0.3673 0.3148 0.3784 0.0216  -0.0687 0.0158  248 SER A CB  
1847 O OG  . SER A 248 ? 0.4230 0.3623 0.4341 0.0212  -0.0648 0.0183  248 SER A OG  
1848 N N   . GLN A 249 ? 0.3297 0.2786 0.3850 0.0357  -0.0804 0.0058  249 GLN A N   
1849 C CA  . GLN A 249 ? 0.3192 0.2597 0.3833 0.0426  -0.0879 0.0068  249 GLN A CA  
1850 C C   . GLN A 249 ? 0.3665 0.2922 0.4170 0.0396  -0.0826 0.0136  249 GLN A C   
1851 O O   . GLN A 249 ? 0.3810 0.2923 0.4244 0.0435  -0.0901 0.0203  249 GLN A O   
1852 C CB  . GLN A 249 ? 0.4372 0.3883 0.5316 0.0461  -0.0858 -0.0053 249 GLN A CB  
1853 C CG  . GLN A 249 ? 0.4673 0.4337 0.5792 0.0494  -0.0920 -0.0137 249 GLN A CG  
1854 C CD  . GLN A 249 ? 0.6667 0.6298 0.7771 0.0583  -0.1102 -0.0098 249 GLN A CD  
1855 O OE1 . GLN A 249 ? 0.7052 0.6773 0.8145 0.0590  -0.1170 -0.0118 249 GLN A OE1 
1856 N NE2 . GLN A 249 ? 0.6109 0.5602 0.7206 0.0650  -0.1186 -0.0044 249 GLN A NE2 
1857 N N   . SER A 250 ? 0.3491 0.2776 0.3958 0.0326  -0.0700 0.0119  250 SER A N   
1858 C CA  . SER A 250 ? 0.3181 0.2355 0.3533 0.0286  -0.0642 0.0165  250 SER A CA  
1859 C C   . SER A 250 ? 0.2971 0.2210 0.3238 0.0210  -0.0534 0.0154  250 SER A C   
1860 O O   . SER A 250 ? 0.3844 0.3184 0.4203 0.0193  -0.0480 0.0092  250 SER A O   
1861 C CB  . SER A 250 ? 0.3605 0.2731 0.4126 0.0319  -0.0628 0.0114  250 SER A CB  
1862 O OG  . SER A 250 ? 0.3815 0.2889 0.4267 0.0261  -0.0535 0.0117  250 SER A OG  
1863 N N   . THR A 251 ? 0.2603 0.1785 0.2693 0.0162  -0.0506 0.0212  251 THR A N   
1864 C CA  . THR A 251 ? 0.2533 0.1787 0.2556 0.0106  -0.0427 0.0199  251 THR A CA  
1865 C C   . THR A 251 ? 0.2442 0.1698 0.2490 0.0069  -0.0347 0.0163  251 THR A C   
1866 O O   . THR A 251 ? 0.3064 0.2378 0.3063 0.0031  -0.0296 0.0150  251 THR A O   
1867 C CB  . THR A 251 ? 0.3471 0.2704 0.3320 0.0069  -0.0431 0.0252  251 THR A CB  
1868 O OG1 . THR A 251 ? 0.4266 0.3378 0.4026 0.0053  -0.0440 0.0299  251 THR A OG1 
1869 C CG2 . THR A 251 ? 0.3830 0.3095 0.3639 0.0089  -0.0494 0.0269  251 THR A CG2 
1870 N N   . VAL A 252 ? 0.2733 0.1920 0.2854 0.0083  -0.0343 0.0144  252 VAL A N   
1871 C CA  . VAL A 252 ? 0.2382 0.1570 0.2520 0.0041  -0.0267 0.0099  252 VAL A CA  
1872 C C   . VAL A 252 ? 0.3467 0.2756 0.3642 0.0014  -0.0204 0.0041  252 VAL A C   
1873 O O   . VAL A 252 ? 0.3455 0.2792 0.3736 0.0035  -0.0203 0.0002  252 VAL A O   
1874 C CB  . VAL A 252 ? 0.2995 0.2100 0.3256 0.0070  -0.0272 0.0064  252 VAL A CB  
1875 C CG1 . VAL A 252 ? 0.3156 0.2275 0.3435 0.0018  -0.0185 -0.0001 252 VAL A CG1 
1876 C CG2 . VAL A 252 ? 0.3503 0.2460 0.3689 0.0090  -0.0334 0.0138  252 VAL A CG2 
1877 N N   . GLY A 253 ? 0.2829 0.2151 0.2912 -0.0037 -0.0152 0.0033  253 GLY A N   
1878 C CA  . GLY A 253 ? 0.2505 0.1890 0.2593 -0.0066 -0.0097 -0.0011 253 GLY A CA  
1879 C C   . GLY A 253 ? 0.2247 0.1673 0.2273 -0.0066 -0.0109 0.0022  253 GLY A C   
1880 O O   . GLY A 253 ? 0.2203 0.1651 0.2196 -0.0098 -0.0063 0.0002  253 GLY A O   
1881 N N   . ALA A 254 ? 0.1797 0.1948 0.2388 0.0129  -0.0150 0.0181  254 ALA A N   
1882 C CA  . ALA A 254 ? 0.1651 0.1836 0.2189 0.0114  -0.0134 0.0197  254 ALA A CA  
1883 C C   . ALA A 254 ? 0.1956 0.2157 0.2506 0.0089  -0.0129 0.0196  254 ALA A C   
1884 O O   . ALA A 254 ? 0.1831 0.2060 0.2341 0.0077  -0.0130 0.0186  254 ALA A O   
1885 C CB  . ALA A 254 ? 0.1965 0.2105 0.2449 0.0130  -0.0117 0.0244  254 ALA A CB  
1886 N N   . GLY A 255 ? 0.2250 0.2434 0.2870 0.0077  -0.0133 0.0215  255 GLY A N   
1887 C CA  . GLY A 255 ? 0.2182 0.2396 0.2845 0.0057  -0.0147 0.0220  255 GLY A CA  
1888 C C   . GLY A 255 ? 0.1900 0.2123 0.2513 0.0047  -0.0189 0.0170  255 GLY A C   
1889 O O   . GLY A 255 ? 0.1949 0.2194 0.2522 0.0044  -0.0197 0.0177  255 GLY A O   
1890 N N   . ASP A 256 ? 0.1954 0.2146 0.2552 0.0052  -0.0213 0.0121  256 ASP A N   
1891 C CA  . ASP A 256 ? 0.2339 0.2527 0.2847 0.0056  -0.0241 0.0068  256 ASP A CA  
1892 C C   . ASP A 256 ? 0.1758 0.1996 0.2176 0.0068  -0.0194 0.0070  256 ASP A C   
1893 O O   . ASP A 256 ? 0.2301 0.2550 0.2628 0.0063  -0.0199 0.0065  256 ASP A O   
1894 C CB  . ASP A 256 ? 0.2300 0.2419 0.2794 0.0074  -0.0272 0.0002  256 ASP A CB  
1895 C CG  . ASP A 256 ? 0.2574 0.2627 0.3174 0.0040  -0.0336 0.0005  256 ASP A CG  
1896 O OD1 . ASP A 256 ? 0.3039 0.3005 0.3669 0.0049  -0.0355 -0.0026 256 ASP A OD1 
1897 O OD2 . ASP A 256 ? 0.3039 0.3127 0.3711 0.0004  -0.0369 0.0042  256 ASP A OD2 
1898 N N   . SER A 257 ? 0.1899 0.2169 0.2349 0.0078  -0.0155 0.0086  257 SER A N   
1899 C CA  . SER A 257 ? 0.1951 0.2281 0.2367 0.0070  -0.0118 0.0100  257 SER A CA  
1900 C C   . SER A 257 ? 0.1923 0.2240 0.2306 0.0039  -0.0123 0.0145  257 SER A C   
1901 O O   . SER A 257 ? 0.1964 0.2299 0.2286 0.0021  -0.0107 0.0162  257 SER A O   
1902 C CB  . SER A 257 ? 0.1674 0.2041 0.2157 0.0081  -0.0106 0.0108  257 SER A CB  
1903 O OG  . SER A 257 ? 0.2114 0.2499 0.2635 0.0124  -0.0098 0.0069  257 SER A OG  
1904 N N   . MET A 258 ? 0.1899 0.2175 0.2315 0.0040  -0.0137 0.0170  258 MET A N   
1905 C CA  . MET A 258 ? 0.2148 0.2392 0.2536 0.0032  -0.0142 0.0205  258 MET A CA  
1906 C C   . MET A 258 ? 0.2348 0.2587 0.2698 0.0028  -0.0171 0.0213  258 MET A C   
1907 O O   . MET A 258 ? 0.2137 0.2352 0.2426 0.0017  -0.0173 0.0243  258 MET A O   
1908 C CB  . MET A 258 ? 0.1960 0.2170 0.2388 0.0055  -0.0135 0.0224  258 MET A CB  
1909 C CG  . MET A 258 ? 0.2012 0.2189 0.2431 0.0071  -0.0139 0.0253  258 MET A CG  
1910 S SD  . MET A 258 ? 0.2184 0.2330 0.2628 0.0121  -0.0096 0.0273  258 MET A SD  
1911 C CE  . MET A 258 ? 0.2668 0.2707 0.2979 0.0125  -0.0098 0.0254  258 MET A CE  
1912 N N   . VAL A 259 ? 0.2026 0.2277 0.2412 0.0036  -0.0204 0.0191  259 VAL A N   
1913 C CA  . VAL A 259 ? 0.1801 0.2044 0.2140 0.0035  -0.0259 0.0194  259 VAL A CA  
1914 C C   . VAL A 259 ? 0.2494 0.2728 0.2679 0.0030  -0.0248 0.0183  259 VAL A C   
1915 O O   . VAL A 259 ? 0.2350 0.2558 0.2446 0.0029  -0.0271 0.0219  259 VAL A O   
1916 C CB  . VAL A 259 ? 0.1822 0.2068 0.2239 0.0031  -0.0320 0.0164  259 VAL A CB  
1917 C CG1 . VAL A 259 ? 0.2190 0.2419 0.2527 0.0031  -0.0403 0.0153  259 VAL A CG1 
1918 C CG2 . VAL A 259 ? 0.1987 0.2268 0.2575 0.0032  -0.0315 0.0204  259 VAL A CG2 
1919 N N   . GLY A 260 ? 0.2405 0.2660 0.2559 0.0035  -0.0205 0.0143  260 GLY A N   
1920 C CA  . GLY A 260 ? 0.2634 0.2908 0.2654 0.0040  -0.0162 0.0139  260 GLY A CA  
1921 C C   . GLY A 260 ? 0.2348 0.2633 0.2344 0.0008  -0.0121 0.0212  260 GLY A C   
1922 O O   . GLY A 260 ? 0.2662 0.2927 0.2526 0.0001  -0.0112 0.0250  260 GLY A O   
1923 N N   . ALA A 261 ? 0.2028 0.2326 0.2138 -0.0014 -0.0104 0.0234  261 ALA A N   
1924 C CA  . ALA A 261 ? 0.2348 0.2628 0.2456 -0.0055 -0.0082 0.0296  261 ALA A CA  
1925 C C   . ALA A 261 ? 0.2524 0.2710 0.2566 -0.0056 -0.0127 0.0344  261 ALA A C   
1926 O O   . ALA A 261 ? 0.2559 0.2706 0.2526 -0.0085 -0.0113 0.0405  261 ALA A O   
1927 C CB  . ALA A 261 ? 0.2323 0.2606 0.2544 -0.0073 -0.0083 0.0290  261 ALA A CB  
1928 N N   . MET A 262 ? 0.2486 0.2639 0.2575 -0.0022 -0.0177 0.0327  262 MET A N   
1929 C CA  . MET A 262 ? 0.2061 0.2139 0.2120 -0.0004 -0.0223 0.0372  262 MET A CA  
1930 C C   . MET A 262 ? 0.2832 0.2898 0.2765 0.0004  -0.0261 0.0397  262 MET A C   
1931 O O   . MET A 262 ? 0.3139 0.3131 0.2996 0.0006  -0.0287 0.0460  262 MET A O   
1932 C CB  . MET A 262 ? 0.1982 0.2062 0.2156 0.0039  -0.0251 0.0355  262 MET A CB  
1933 C CG  . MET A 262 ? 0.2010 0.2062 0.2242 0.0043  -0.0213 0.0340  262 MET A CG  
1934 S SD  . MET A 262 ? 0.2526 0.2570 0.2858 0.0110  -0.0211 0.0341  262 MET A SD  
1935 C CE  . MET A 262 ? 0.2556 0.2723 0.3008 0.0112  -0.0229 0.0324  262 MET A CE  
1936 N N   . THR A 263 ? 0.2946 0.3064 0.2834 0.0012  -0.0271 0.0347  263 THR A N   
1937 C CA  . THR A 263 ? 0.2590 0.2682 0.2307 0.0027  -0.0315 0.0354  263 THR A CA  
1938 C C   . THR A 263 ? 0.3241 0.3307 0.2795 0.0004  -0.0250 0.0416  263 THR A C   
1939 O O   . THR A 263 ? 0.3619 0.3617 0.3024 0.0011  -0.0286 0.0477  263 THR A O   
1940 C CB  . THR A 263 ? 0.2752 0.2875 0.2428 0.0043  -0.0335 0.0267  263 THR A CB  
1941 O OG1 . THR A 263 ? 0.2776 0.2917 0.2617 0.0050  -0.0403 0.0228  263 THR A OG1 
1942 C CG2 . THR A 263 ? 0.2662 0.2733 0.2101 0.0065  -0.0384 0.0261  263 THR A CG2 
1943 N N   . LEU A 264 ? 0.2822 0.2948 0.2416 -0.0025 -0.0153 0.0412  264 LEU A N   
1944 C CA  . LEU A 264 ? 0.2867 0.2999 0.2361 -0.0061 -0.0070 0.0487  264 LEU A CA  
1945 C C   . LEU A 264 ? 0.3168 0.3202 0.2672 -0.0099 -0.0091 0.0584  264 LEU A C   
1946 O O   . LEU A 264 ? 0.3987 0.3964 0.3342 -0.0117 -0.0072 0.0671  264 LEU A O   
1947 C CB  . LEU A 264 ? 0.2796 0.3044 0.2412 -0.0089 0.0027  0.0468  264 LEU A CB  
1948 C CG  . LEU A 264 ? 0.3674 0.4006 0.3225 -0.0041 0.0082  0.0396  264 LEU A CG  
1949 C CD1 . LEU A 264 ? 0.3276 0.3736 0.3016 -0.0053 0.0156  0.0372  264 LEU A CD1 
1950 C CD2 . LEU A 264 ? 0.3870 0.4198 0.3184 -0.0025 0.0148  0.0441  264 LEU A CD2 
1951 N N   . LYS A 265 ? 0.2869 0.2865 0.2530 -0.0107 -0.0129 0.0570  265 LYS A N   
1952 C CA  . LYS A 265 ? 0.3249 0.3114 0.2915 -0.0128 -0.0161 0.0643  265 LYS A CA  
1953 C C   . LYS A 265 ? 0.3572 0.3344 0.3124 -0.0078 -0.0240 0.0686  265 LYS A C   
1954 O O   . LYS A 265 ? 0.4031 0.3684 0.3495 -0.0093 -0.0254 0.0779  265 LYS A O   
1955 C CB  . LYS A 265 ? 0.3297 0.3122 0.3117 -0.0124 -0.0186 0.0598  265 LYS A CB  
1956 C CG  . LYS A 265 ? 0.3774 0.3641 0.3696 -0.0188 -0.0138 0.0585  265 LYS A CG  
1957 C CD  . LYS A 265 ? 0.4144 0.3967 0.4038 -0.0270 -0.0101 0.0678  265 LYS A CD  
1958 C CE  . LYS A 265 ? 0.4341 0.4208 0.4382 -0.0345 -0.0083 0.0668  265 LYS A CE  
1959 N NZ  . LYS A 265 ? 0.5212 0.5065 0.5274 -0.0443 -0.0040 0.0773  265 LYS A NZ  
1960 N N   . LEU A 266 ? 0.3469 0.3294 0.3036 -0.0021 -0.0300 0.0626  266 LEU A N   
1961 C CA  . LEU A 266 ? 0.3831 0.3597 0.3324 0.0031  -0.0399 0.0662  266 LEU A CA  
1962 C C   . LEU A 266 ? 0.4661 0.4380 0.3904 0.0023  -0.0401 0.0728  266 LEU A C   
1963 O O   . LEU A 266 ? 0.4522 0.4134 0.3656 0.0044  -0.0460 0.0814  266 LEU A O   
1964 C CB  . LEU A 266 ? 0.4409 0.4265 0.4007 0.0075  -0.0469 0.0583  266 LEU A CB  
1965 C CG  . LEU A 266 ? 0.6315 0.6156 0.5994 0.0134  -0.0581 0.0608  266 LEU A CG  
1966 C CD1 . LEU A 266 ? 0.6749 0.6570 0.6254 0.0155  -0.0684 0.0630  266 LEU A CD1 
1967 C CD2 . LEU A 266 ? 0.6969 0.6700 0.6687 0.0161  -0.0580 0.0680  266 LEU A CD2 
1968 N N   . ALA A 267 ? 0.4263 0.4056 0.3401 0.0002  -0.0329 0.0692  267 ALA A N   
1969 C CA  . ALA A 267 ? 0.4215 0.3971 0.3078 0.0003  -0.0302 0.0750  267 ALA A CA  
1970 C C   . ALA A 267 ? 0.5205 0.4883 0.4000 -0.0050 -0.0226 0.0883  267 ALA A C   
1971 O O   . ALA A 267 ? 0.5442 0.5042 0.3996 -0.0044 -0.0222 0.0975  267 ALA A O   
1972 C CB  . ALA A 267 ? 0.3774 0.3629 0.2553 0.0009  -0.0220 0.0672  267 ALA A CB  
1973 N N   . GLU A 268 ? 0.4620 0.4305 0.3618 -0.0106 -0.0173 0.0897  268 GLU A N   
1974 C CA  . GLU A 268 ? 0.5262 0.4861 0.4247 -0.0178 -0.0113 0.1022  268 GLU A CA  
1975 C C   . GLU A 268 ? 0.4526 0.3942 0.3533 -0.0161 -0.0212 0.1084  268 GLU A C   
1976 O O   . GLU A 268 ? 0.5353 0.4645 0.4369 -0.0221 -0.0191 0.1184  268 GLU A O   
1977 C CB  . GLU A 268 ? 0.5550 0.5238 0.4750 -0.0254 -0.0027 0.1000  268 GLU A CB  
1978 C CG  . GLU A 268 ? 0.6099 0.5977 0.5306 -0.0266 0.0087  0.0959  268 GLU A CG  
1979 C CD  . GLU A 268 ? 0.7052 0.7043 0.6518 -0.0317 0.0129  0.0906  268 GLU A CD  
1980 O OE1 . GLU A 268 ? 0.6570 0.6724 0.6086 -0.0302 0.0203  0.0849  268 GLU A OE1 
1981 O OE2 . GLU A 268 ? 0.7307 0.7212 0.6914 -0.0364 0.0079  0.0918  268 GLU A OE2 
1982 N N   . ASN A 269 ? 0.4448 0.3848 0.3482 -0.0079 -0.0322 0.1024  269 ASN A N   
1983 C CA  . ASN A 269 ? 0.4901 0.4153 0.3993 -0.0031 -0.0417 0.1062  269 ASN A CA  
1984 C C   . ASN A 269 ? 0.4710 0.3872 0.3973 -0.0068 -0.0392 0.1052  269 ASN A C   
1985 O O   . ASN A 269 ? 0.5221 0.4195 0.4467 -0.0067 -0.0429 0.1128  269 ASN A O   
1986 C CB  . ASN A 269 ? 0.6520 0.5617 0.5398 -0.0015 -0.0467 0.1199  269 ASN A CB  
1987 C CG  . ASN A 269 ? 0.8548 0.7546 0.7471 0.0081  -0.0600 0.1215  269 ASN A CG  
1988 O OD1 . ASN A 269 ? 0.9324 0.8159 0.8313 0.0094  -0.0624 0.1266  269 ASN A OD1 
1989 N ND2 . ASN A 269 ? 0.9442 0.8536 0.8345 0.0152  -0.0692 0.1169  269 ASN A ND2 
1990 N N   . ALA A 270 ? 0.3828 0.3105 0.3239 -0.0095 -0.0341 0.0954  270 ALA A N   
1991 C CA  . ALA A 270 ? 0.4410 0.3601 0.3952 -0.0130 -0.0330 0.0925  270 ALA A CA  
1992 C C   . ALA A 270 ? 0.4358 0.3448 0.3978 -0.0037 -0.0397 0.0877  270 ALA A C   
1993 O O   . ALA A 270 ? 0.4532 0.3682 0.4169 0.0051  -0.0444 0.0856  270 ALA A O   
1994 C CB  . ALA A 270 ? 0.4549 0.3896 0.4205 -0.0179 -0.0266 0.0840  270 ALA A CB  
1995 N N   . SER A 271 ? 0.4155 0.3095 0.3827 -0.0055 -0.0403 0.0857  271 SER A N   
1996 C CA  . SER A 271 ? 0.4747 0.3580 0.4476 0.0047  -0.0443 0.0799  271 SER A CA  
1997 C C   . SER A 271 ? 0.4386 0.3401 0.4217 0.0098  -0.0412 0.0693  271 SER A C   
1998 O O   . SER A 271 ? 0.3809 0.2983 0.3667 0.0042  -0.0368 0.0657  271 SER A O   
1999 C CB  . SER A 271 ? 0.4840 0.3443 0.4561 0.0010  -0.0460 0.0784  271 SER A CB  
2000 O OG  . SER A 271 ? 0.4495 0.3174 0.4269 -0.0063 -0.0426 0.0712  271 SER A OG  
2001 N N   . LEU A 272 ? 0.3860 0.2852 0.3753 0.0211  -0.0426 0.0651  272 LEU A N   
2002 C CA  . LEU A 272 ? 0.3380 0.2532 0.3372 0.0258  -0.0382 0.0569  272 LEU A CA  
2003 C C   . LEU A 272 ? 0.3662 0.2793 0.3631 0.0201  -0.0343 0.0501  272 LEU A C   
2004 O O   . LEU A 272 ? 0.3683 0.2973 0.3699 0.0176  -0.0306 0.0460  272 LEU A O   
2005 C CB  . LEU A 272 ? 0.4228 0.3351 0.4297 0.0394  -0.0382 0.0548  272 LEU A CB  
2006 C CG  . LEU A 272 ? 0.4297 0.3582 0.4474 0.0447  -0.0318 0.0483  272 LEU A CG  
2007 C CD1 . LEU A 272 ? 0.4618 0.4139 0.4914 0.0428  -0.0326 0.0502  272 LEU A CD1 
2008 C CD2 . LEU A 272 ? 0.3732 0.2955 0.3963 0.0587  -0.0288 0.0460  272 LEU A CD2 
2009 N N   . GLU A 273 ? 0.3895 0.2813 0.3792 0.0177  -0.0366 0.0492  273 GLU A N   
2010 C CA  . GLU A 273 ? 0.3935 0.2808 0.3802 0.0119  -0.0361 0.0427  273 GLU A CA  
2011 C C   . GLU A 273 ? 0.3315 0.2346 0.3225 0.0001  -0.0345 0.0447  273 GLU A C   
2012 O O   . GLU A 273 ? 0.3745 0.2890 0.3686 -0.0014 -0.0323 0.0393  273 GLU A O   
2013 C CB  . GLU A 273 ? 0.5312 0.3900 0.5095 0.0099  -0.0416 0.0416  273 GLU A CB  
2014 C CG  . GLU A 273 ? 0.5912 0.4448 0.5672 0.0014  -0.0445 0.0356  273 GLU A CG  
2015 C CD  . GLU A 273 ? 0.7301 0.5527 0.6949 0.0041  -0.0510 0.0295  273 GLU A CD  
2016 O OE1 . GLU A 273 ? 0.7066 0.5117 0.6709 -0.0057 -0.0574 0.0332  273 GLU A OE1 
2017 O OE2 . GLU A 273 ? 0.6817 0.4968 0.6377 0.0160  -0.0492 0.0210  273 GLU A OE2 
2018 N N   . GLU A 274 ? 0.3151 0.2188 0.3056 -0.0074 -0.0350 0.0531  274 GLU A N   
2019 C CA  . GLU A 274 ? 0.3396 0.2591 0.3347 -0.0174 -0.0316 0.0558  274 GLU A CA  
2020 C C   . GLU A 274 ? 0.3305 0.2721 0.3294 -0.0135 -0.0272 0.0524  274 GLU A C   
2021 O O   . GLU A 274 ? 0.2978 0.2528 0.3025 -0.0172 -0.0244 0.0491  274 GLU A O   
2022 C CB  . GLU A 274 ? 0.4224 0.3379 0.4136 -0.0244 -0.0308 0.0670  274 GLU A CB  
2023 C CG  . GLU A 274 ? 0.6246 0.5560 0.6217 -0.0346 -0.0252 0.0710  274 GLU A CG  
2024 C CD  . GLU A 274 ? 0.7737 0.6966 0.7676 -0.0437 -0.0236 0.0834  274 GLU A CD  
2025 O OE1 . GLU A 274 ? 0.8297 0.7296 0.8201 -0.0452 -0.0292 0.0874  274 GLU A OE1 
2026 O OE2 . GLU A 274 ? 0.7679 0.7062 0.7623 -0.0487 -0.0161 0.0895  274 GLU A OE2 
2027 N N   . MET A 275 ? 0.2995 0.2440 0.2964 -0.0057 -0.0279 0.0532  275 MET A N   
2028 C CA  . MET A 275 ? 0.2809 0.2431 0.2819 -0.0025 -0.0258 0.0498  275 MET A CA  
2029 C C   . MET A 275 ? 0.2909 0.2592 0.2989 0.0004  -0.0237 0.0422  275 MET A C   
2030 O O   . MET A 275 ? 0.2844 0.2651 0.2963 -0.0018 -0.0211 0.0392  275 MET A O   
2031 C CB  . MET A 275 ? 0.3256 0.2886 0.3261 0.0046  -0.0295 0.0523  275 MET A CB  
2032 C CG  . MET A 275 ? 0.3286 0.3074 0.3336 0.0063  -0.0297 0.0490  275 MET A CG  
2033 S SD  . MET A 275 ? 0.3834 0.3647 0.3937 0.0141  -0.0369 0.0516  275 MET A SD  
2034 C CE  . MET A 275 ? 0.5279 0.5074 0.5519 0.0218  -0.0340 0.0488  275 MET A CE  
2035 N N   . VAL A 276 ? 0.2784 0.2370 0.2865 0.0063  -0.0243 0.0394  276 VAL A N   
2036 C CA  . VAL A 276 ? 0.2640 0.2270 0.2750 0.0100  -0.0214 0.0336  276 VAL A CA  
2037 C C   . VAL A 276 ? 0.2816 0.2430 0.2900 0.0039  -0.0220 0.0303  276 VAL A C   
2038 O O   . VAL A 276 ? 0.2458 0.2168 0.2573 0.0039  -0.0201 0.0274  276 VAL A O   
2039 C CB  . VAL A 276 ? 0.2811 0.2340 0.2901 0.0197  -0.0201 0.0315  276 VAL A CB  
2040 C CG1 . VAL A 276 ? 0.2708 0.2265 0.2782 0.0234  -0.0157 0.0267  276 VAL A CG1 
2041 C CG2 . VAL A 276 ? 0.3030 0.2631 0.3210 0.0263  -0.0198 0.0353  276 VAL A CG2 
2042 N N   . ARG A 277 ? 0.2584 0.2078 0.2628 -0.0017 -0.0257 0.0315  277 ARG A N   
2043 C CA  . ARG A 277 ? 0.2917 0.2415 0.2975 -0.0088 -0.0284 0.0291  277 ARG A CA  
2044 C C   . ARG A 277 ? 0.3203 0.2900 0.3355 -0.0137 -0.0254 0.0307  277 ARG A C   
2045 O O   . ARG A 277 ? 0.3011 0.2784 0.3201 -0.0141 -0.0260 0.0273  277 ARG A O   
2046 C CB  . ARG A 277 ? 0.3301 0.2647 0.3343 -0.0163 -0.0337 0.0315  277 ARG A CB  
2047 C CG  . ARG A 277 ? 0.3153 0.2258 0.3083 -0.0117 -0.0386 0.0270  277 ARG A CG  
2048 C CD  . ARG A 277 ? 0.3368 0.2313 0.3305 -0.0220 -0.0460 0.0287  277 ARG A CD  
2049 N NE  . ARG A 277 ? 0.6075 0.4734 0.5888 -0.0173 -0.0513 0.0250  277 ARG A NE  
2050 C CZ  . ARG A 277 ? 0.8543 0.7053 0.8225 -0.0098 -0.0546 0.0155  277 ARG A CZ  
2051 N NH1 . ARG A 277 ? 0.9285 0.7909 0.8940 -0.0067 -0.0533 0.0100  277 ARG A NH1 
2052 N NH2 . ARG A 277 ? 0.9345 0.7575 0.8903 -0.0045 -0.0590 0.0116  277 ARG A NH2 
2053 N N   . PHE A 278 ? 0.2523 0.2294 0.2696 -0.0162 -0.0223 0.0360  278 PHE A N   
2054 C CA  . PHE A 278 ? 0.2917 0.2863 0.3156 -0.0191 -0.0181 0.0369  278 PHE A CA  
2055 C C   . PHE A 278 ? 0.2016 0.2049 0.2268 -0.0126 -0.0163 0.0322  278 PHE A C   
2056 O O   . PHE A 278 ? 0.2134 0.2276 0.2448 -0.0129 -0.0147 0.0298  278 PHE A O   
2057 C CB  . PHE A 278 ? 0.3045 0.3020 0.3244 -0.0217 -0.0146 0.0434  278 PHE A CB  
2058 C CG  . PHE A 278 ? 0.2636 0.2775 0.2889 -0.0250 -0.0086 0.0448  278 PHE A CG  
2059 C CD1 . PHE A 278 ? 0.3134 0.3350 0.3509 -0.0314 -0.0075 0.0461  278 PHE A CD1 
2060 C CD2 . PHE A 278 ? 0.2547 0.2761 0.2730 -0.0212 -0.0044 0.0446  278 PHE A CD2 
2061 C CE1 . PHE A 278 ? 0.3134 0.3527 0.3587 -0.0330 -0.0003 0.0478  278 PHE A CE1 
2062 C CE2 . PHE A 278 ? 0.2469 0.2826 0.2682 -0.0222 0.0028  0.0451  278 PHE A CE2 
2063 C CZ  . PHE A 278 ? 0.3103 0.3562 0.3463 -0.0276 0.0058  0.0471  278 PHE A CZ  
2064 N N   . GLY A 279 ? 0.2262 0.2247 0.2477 -0.0067 -0.0170 0.0314  279 GLY A N   
2065 C CA  . GLY A 279 ? 0.2203 0.2256 0.2455 -0.0020 -0.0158 0.0282  279 GLY A CA  
2066 C C   . GLY A 279 ? 0.2434 0.2484 0.2703 -0.0005 -0.0157 0.0249  279 GLY A C   
2067 O O   . GLY A 279 ? 0.2180 0.2305 0.2493 0.0002  -0.0147 0.0231  279 GLY A O   
2068 N N   . VAL A 280 ? 0.1949 0.1890 0.2161 0.0006  -0.0176 0.0240  280 VAL A N   
2069 C CA  . VAL A 280 ? 0.1925 0.1840 0.2103 0.0025  -0.0188 0.0209  280 VAL A CA  
2070 C C   . VAL A 280 ? 0.2217 0.2205 0.2452 -0.0027 -0.0220 0.0201  280 VAL A C   
2071 O O   . VAL A 280 ? 0.1924 0.1959 0.2176 -0.0007 -0.0227 0.0188  280 VAL A O   
2072 C CB  . VAL A 280 ? 0.2086 0.1840 0.2146 0.0056  -0.0210 0.0186  280 VAL A CB  
2073 C CG1 . VAL A 280 ? 0.2222 0.1927 0.2203 0.0060  -0.0252 0.0150  280 VAL A CG1 
2074 C CG2 . VAL A 280 ? 0.2401 0.2125 0.2431 0.0136  -0.0156 0.0193  280 VAL A CG2 
2075 N N   . ALA A 281 ? 0.2204 0.2208 0.2485 -0.0092 -0.0237 0.0220  281 ALA A N   
2076 C CA  . ALA A 281 ? 0.1898 0.2013 0.2287 -0.0142 -0.0258 0.0223  281 ALA A CA  
2077 C C   . ALA A 281 ? 0.1781 0.2043 0.2248 -0.0112 -0.0213 0.0220  281 ALA A C   
2078 O O   . ALA A 281 ? 0.2077 0.2412 0.2612 -0.0100 -0.0236 0.0205  281 ALA A O   
2079 C CB  . ALA A 281 ? 0.2103 0.2233 0.2557 -0.0225 -0.0261 0.0264  281 ALA A CB  
2080 N N   . ALA A 282 ? 0.1892 0.2183 0.2339 -0.0093 -0.0162 0.0229  282 ALA A N   
2081 C CA  . ALA A 282 ? 0.1676 0.2066 0.2169 -0.0058 -0.0126 0.0211  282 ALA A CA  
2082 C C   . ALA A 282 ? 0.2400 0.2754 0.2881 -0.0005 -0.0141 0.0186  282 ALA A C   
2083 O O   . ALA A 282 ? 0.1941 0.2350 0.2480 0.0024  -0.0141 0.0169  282 ALA A O   
2084 C CB  . ALA A 282 ? 0.1695 0.2095 0.2133 -0.0054 -0.0087 0.0219  282 ALA A CB  
2085 N N   . GLY A 283 ? 0.1745 0.2008 0.2162 0.0012  -0.0147 0.0193  283 GLY A N   
2086 C CA  . GLY A 283 ? 0.1647 0.1876 0.2058 0.0053  -0.0145 0.0191  283 GLY A CA  
2087 C C   . GLY A 283 ? 0.2199 0.2418 0.2600 0.0068  -0.0176 0.0188  283 GLY A C   
2088 O O   . GLY A 283 ? 0.2065 0.2296 0.2496 0.0097  -0.0180 0.0189  283 GLY A O   
2089 N N   . SER A 284 ? 0.2025 0.2203 0.2377 0.0048  -0.0213 0.0185  284 SER A N   
2090 C CA  . SER A 284 ? 0.1882 0.2037 0.2201 0.0062  -0.0269 0.0179  284 SER A CA  
2091 C C   . SER A 284 ? 0.1915 0.2197 0.2374 0.0047  -0.0301 0.0174  284 SER A C   
2092 O O   . SER A 284 ? 0.2026 0.2321 0.2499 0.0080  -0.0345 0.0177  284 SER A O   
2093 C CB  . SER A 284 ? 0.1988 0.2033 0.2194 0.0046  -0.0318 0.0162  284 SER A CB  
2094 O OG  . SER A 284 ? 0.2429 0.2363 0.2504 0.0088  -0.0273 0.0164  284 SER A OG  
2095 N N   . ALA A 285 ? 0.1786 0.2165 0.2348 0.0007  -0.0273 0.0175  285 ALA A N   
2096 C CA  . ALA A 285 ? 0.1680 0.2212 0.2401 0.0007  -0.0273 0.0175  285 ALA A CA  
2097 C C   . ALA A 285 ? 0.2282 0.2835 0.3026 0.0077  -0.0245 0.0162  285 ALA A C   
2098 O O   . ALA A 285 ? 0.1958 0.2586 0.2802 0.0115  -0.0275 0.0160  285 ALA A O   
2099 C CB  . ALA A 285 ? 0.2225 0.2856 0.3024 -0.0041 -0.0215 0.0189  285 ALA A CB  
2100 N N   . ALA A 286 ? 0.1750 0.2229 0.2416 0.0095  -0.0201 0.0155  286 ALA A N   
2101 C CA  . ALA A 286 ? 0.2004 0.2460 0.2686 0.0151  -0.0188 0.0140  286 ALA A CA  
2102 C C   . ALA A 286 ? 0.1955 0.2353 0.2620 0.0186  -0.0241 0.0162  286 ALA A C   
2103 O O   . ALA A 286 ? 0.2789 0.3223 0.3531 0.0233  -0.0260 0.0156  286 ALA A O   
2104 C CB  . ALA A 286 ? 0.1763 0.2135 0.2378 0.0147  -0.0159 0.0132  286 ALA A CB  
2105 N N   . THR A 287 ? 0.1949 0.2259 0.2505 0.0173  -0.0265 0.0188  287 THR A N   
2106 C CA  . THR A 287 ? 0.2596 0.2832 0.3086 0.0215  -0.0310 0.0219  287 THR A CA  
2107 C C   . THR A 287 ? 0.2383 0.2686 0.2943 0.0240  -0.0390 0.0218  287 THR A C   
2108 O O   . THR A 287 ? 0.2433 0.2674 0.2939 0.0287  -0.0439 0.0249  287 THR A O   
2109 C CB  . THR A 287 ? 0.2912 0.3036 0.3230 0.0210  -0.0309 0.0243  287 THR A CB  
2110 O OG1 . THR A 287 ? 0.2722 0.2849 0.2990 0.0184  -0.0369 0.0220  287 THR A OG1 
2111 C CG2 . THR A 287 ? 0.2916 0.3009 0.3210 0.0189  -0.0232 0.0248  287 THR A CG2 
2112 N N   . LEU A 288 ? 0.2143 0.2581 0.2834 0.0209  -0.0407 0.0194  288 LEU A N   
2113 C CA  . LEU A 288 ? 0.2059 0.2601 0.2872 0.0225  -0.0493 0.0198  288 LEU A CA  
2114 C C   . LEU A 288 ? 0.3318 0.3951 0.4286 0.0298  -0.0481 0.0197  288 LEU A C   
2115 O O   . LEU A 288 ? 0.3093 0.3796 0.4164 0.0341  -0.0561 0.0211  288 LEU A O   
2116 C CB  . LEU A 288 ? 0.2156 0.2827 0.3095 0.0152  -0.0511 0.0187  288 LEU A CB  
2117 C CG  . LEU A 288 ? 0.2710 0.3264 0.3500 0.0085  -0.0535 0.0180  288 LEU A CG  
2118 C CD1 . LEU A 288 ? 0.2967 0.3634 0.3907 -0.0001 -0.0554 0.0179  288 LEU A CD1 
2119 C CD2 . LEU A 288 ? 0.3637 0.4052 0.4251 0.0109  -0.0636 0.0180  288 LEU A CD2 
2120 N N   . ASN A 289 ? 0.3565 0.3492 0.4715 0.0853  -0.0306 0.0088  289 ASN A N   
2121 C CA  . ASN A 289 ? 0.4508 0.4452 0.5832 0.0931  -0.0296 0.0001  289 ASN A CA  
2122 C C   . ASN A 289 ? 0.6137 0.5812 0.7312 0.1032  -0.0362 0.0077  289 ASN A C   
2123 O O   . ASN A 289 ? 0.7503 0.6992 0.8433 0.1023  -0.0391 0.0196  289 ASN A O   
2124 C CB  . ASN A 289 ? 0.4021 0.4053 0.5392 0.0823  -0.0141 -0.0074 289 ASN A CB  
2125 C CG  . ASN A 289 ? 0.4900 0.5177 0.6406 0.0720  -0.0067 -0.0147 289 ASN A CG  
2126 O OD1 . ASN A 289 ? 0.4638 0.5081 0.6353 0.0762  -0.0123 -0.0203 289 ASN A OD1 
2127 N ND2 . ASN A 289 ? 0.3327 0.3616 0.4710 0.0578  0.0048  -0.0143 289 ASN A ND2 
2128 N N   . GLN A 290 ? 0.3825 0.3467 0.5155 0.1128  -0.0379 0.0007  290 GLN A N   
2129 C CA  . GLN A 290 ? 0.3952 0.3309 0.5137 0.1215  -0.0434 0.0083  290 GLN A CA  
2130 C C   . GLN A 290 ? 0.3920 0.3159 0.5014 0.1134  -0.0308 0.0081  290 GLN A C   
2131 O O   . GLN A 290 ? 0.3652 0.3035 0.4831 0.1043  -0.0195 -0.0009 290 GLN A O   
2132 C CB  . GLN A 290 ? 0.5064 0.4404 0.6473 0.1381  -0.0550 0.0018  290 GLN A CB  
2133 N N   . GLY A 291 ? 0.4132 0.3095 0.5032 0.1156  -0.0329 0.0184  291 GLY A N   
2134 C CA  . GLY A 291 ? 0.4666 0.3485 0.5522 0.1104  -0.0244 0.0169  291 GLY A CA  
2135 C C   . GLY A 291 ? 0.5630 0.4496 0.6383 0.0937  -0.0140 0.0189  291 GLY A C   
2136 O O   . GLY A 291 ? 0.8258 0.7050 0.8859 0.0876  -0.0135 0.0306  291 GLY A O   
2137 N N   . THR A 292 ? 0.3450 0.2423 0.4283 0.0864  -0.0057 0.0075  292 THR A N   
2138 C CA  . THR A 292 ? 0.3526 0.2526 0.4247 0.0702  0.0011  0.0095  292 THR A CA  
2139 C C   . THR A 292 ? 0.3743 0.2983 0.4508 0.0613  0.0067  0.0021  292 THR A C   
2140 O O   . THR A 292 ? 0.3516 0.2776 0.4174 0.0477  0.0104  0.0037  292 THR A O   
2141 C CB  . THR A 292 ? 0.3765 0.2604 0.4438 0.0650  0.0055  0.0039  292 THR A CB  
2142 O OG1 . THR A 292 ? 0.3827 0.2716 0.4619 0.0702  0.0106  -0.0122 292 THR A OG1 
2143 C CG2 . THR A 292 ? 0.4760 0.3334 0.5374 0.0707  0.0012  0.0128  292 THR A CG2 
2144 N N   . ARG A 293 ? 0.3019 0.2430 0.3945 0.0685  0.0063  -0.0054 293 ARG A N   
2145 C CA  . ARG A 293 ? 0.3525 0.3158 0.4520 0.0602  0.0140  -0.0143 293 ARG A CA  
2146 C C   . ARG A 293 ? 0.3207 0.2923 0.4091 0.0486  0.0135  -0.0051 293 ARG A C   
2147 O O   . ARG A 293 ? 0.4738 0.4480 0.5633 0.0526  0.0068  0.0029  293 ARG A O   
2148 C CB  . ARG A 293 ? 0.4148 0.3956 0.5403 0.0713  0.0124  -0.0235 293 ARG A CB  
2149 C CG  . ARG A 293 ? 0.5246 0.4987 0.6675 0.0849  0.0119  -0.0334 293 ARG A CG  
2150 C CD  . ARG A 293 ? 0.7262 0.7171 0.8989 0.0980  0.0048  -0.0392 293 ARG A CD  
2151 N NE  . ARG A 293 ? 0.8851 0.9035 1.0734 0.0902  0.0127  -0.0473 293 ARG A NE  
2152 C CZ  . ARG A 293 ? 0.9506 0.9877 1.1614 0.0958  0.0050  -0.0489 293 ARG A CZ  
2153 N NH1 . ARG A 293 ? 0.9589 0.9891 1.1759 0.1098  -0.0126 -0.0427 293 ARG A NH1 
2154 N NH2 . ARG A 293 ? 0.9431 1.0042 1.1684 0.0865  0.0142  -0.0564 293 ARG A NH2 
2155 N N   . LEU A 294 ? 0.2948 0.2694 0.3716 0.0344  0.0201  -0.0065 294 LEU A N   
2156 C CA  . LEU A 294 ? 0.2458 0.2252 0.3133 0.0244  0.0178  0.0037  294 LEU A CA  
2157 C C   . LEU A 294 ? 0.2503 0.2484 0.3296 0.0249  0.0184  0.0019  294 LEU A C   
2158 O O   . LEU A 294 ? 0.2991 0.3082 0.3969 0.0340  0.0186  -0.0064 294 LEU A O   
2159 C CB  . LEU A 294 ? 0.3284 0.3033 0.3780 0.0089  0.0219  0.0037  294 LEU A CB  
2160 C CG  . LEU A 294 ? 0.3301 0.2867 0.3702 0.0080  0.0203  0.0032  294 LEU A CG  
2161 C CD1 . LEU A 294 ? 0.3282 0.2786 0.3478 -0.0075 0.0234  -0.0002 294 LEU A CD1 
2162 C CD2 . LEU A 294 ? 0.3093 0.2547 0.3496 0.0109  0.0117  0.0169  294 LEU A CD2 
2163 N N   . CYS A 295 ? 0.2380 0.2392 0.3091 0.0150  0.0175  0.0098  295 CYS A N   
2164 C CA  . CYS A 295 ? 0.2811 0.2976 0.3615 0.0126  0.0183  0.0086  295 CYS A CA  
2165 C C   . CYS A 295 ? 0.2483 0.2802 0.3386 0.0072  0.0290  -0.0044 295 CYS A C   
2166 O O   . CYS A 295 ? 0.2535 0.2819 0.3327 -0.0011 0.0377  -0.0098 295 CYS A O   
2167 C CB  . CYS A 295 ? 0.2672 0.2799 0.3350 0.0017  0.0162  0.0197  295 CYS A CB  
2168 S SG  . CYS A 295 ? 0.2920 0.2964 0.3381 -0.0150 0.0206  0.0218  295 CYS A SG  
2169 N N   . SER A 296 ? 0.2184 0.2670 0.3296 0.0113  0.0289  -0.0101 296 SER A N   
2170 C CA  . SER A 296 ? 0.2238 0.2899 0.3491 0.0043  0.0411  -0.0221 296 SER A CA  
2171 C C   . SER A 296 ? 0.2217 0.2928 0.3404 -0.0095 0.0439  -0.0166 296 SER A C   
2172 O O   . SER A 296 ? 0.2651 0.3317 0.3798 -0.0087 0.0342  -0.0067 296 SER A O   
2173 C CB  . SER A 296 ? 0.2734 0.3572 0.4331 0.0167  0.0388  -0.0329 296 SER A CB  
2174 O OG  . SER A 296 ? 0.2765 0.3669 0.4461 0.0201  0.0276  -0.0280 296 SER A OG  
2175 N N   . HIS A 297 ? 0.2338 0.3122 0.3502 -0.0224 0.0583  -0.0235 297 HIS A N   
2176 C CA  . HIS A 297 ? 0.2474 0.3281 0.3561 -0.0369 0.0622  -0.0180 297 HIS A CA  
2177 C C   . HIS A 297 ? 0.2227 0.3173 0.3559 -0.0331 0.0552  -0.0180 297 HIS A C   
2178 O O   . HIS A 297 ? 0.2363 0.3236 0.3598 -0.0382 0.0486  -0.0077 297 HIS A O   
2179 C CB  . HIS A 297 ? 0.2864 0.3728 0.3894 -0.0517 0.0816  -0.0270 297 HIS A CB  
2180 C CG  . HIS A 297 ? 0.4454 0.5330 0.5413 -0.0674 0.0869  -0.0215 297 HIS A CG  
2181 N ND1 . HIS A 297 ? 0.4930 0.5998 0.6183 -0.0690 0.0902  -0.0271 297 HIS A ND1 
2182 C CD2 . HIS A 297 ? 0.5984 0.6686 0.6614 -0.0826 0.0880  -0.0104 297 HIS A CD2 
2183 C CE1 . HIS A 297 ? 0.5711 0.6717 0.6814 -0.0849 0.0949  -0.0198 297 HIS A CE1 
2184 N NE2 . HIS A 297 ? 0.6124 0.6900 0.6840 -0.0930 0.0933  -0.0091 297 HIS A NE2 
2185 N N   . ASP A 298 ? 0.2599 0.3735 0.4258 -0.0240 0.0559  -0.0299 298 ASP A N   
2186 C CA  . ASP A 298 ? 0.2684 0.3966 0.4593 -0.0219 0.0483  -0.0321 298 ASP A CA  
2187 C C   . ASP A 298 ? 0.2250 0.3411 0.4076 -0.0117 0.0297  -0.0223 298 ASP A C   
2188 O O   . ASP A 298 ? 0.2185 0.3342 0.4013 -0.0164 0.0240  -0.0180 298 ASP A O   
2189 C CB  . ASP A 298 ? 0.2333 0.3858 0.4653 -0.0139 0.0509  -0.0475 298 ASP A CB  
2190 C CG  . ASP A 298 ? 0.3949 0.5624 0.6402 -0.0259 0.0732  -0.0591 298 ASP A CG  
2191 O OD1 . ASP A 298 ? 0.3129 0.4696 0.5303 -0.0418 0.0859  -0.0542 298 ASP A OD1 
2192 O OD2 . ASP A 298 ? 0.4394 0.6285 0.7232 -0.0196 0.0783  -0.0731 298 ASP A OD2 
2193 N N   . ASP A 299 ? 0.1987 0.3032 0.3728 0.0014  0.0214  -0.0192 299 ASP A N   
2194 C CA  . ASP A 299 ? 0.2209 0.3108 0.3824 0.0103  0.0068  -0.0099 299 ASP A CA  
2195 C C   . ASP A 299 ? 0.2535 0.3273 0.3898 0.0012  0.0078  0.0025  299 ASP A C   
2196 O O   . ASP A 299 ? 0.2307 0.2978 0.3620 0.0021  0.0004  0.0077  299 ASP A O   
2197 C CB  . ASP A 299 ? 0.2174 0.2954 0.3723 0.0243  0.0004  -0.0081 299 ASP A CB  
2198 C CG  . ASP A 299 ? 0.3212 0.4114 0.5022 0.0368  -0.0059 -0.0184 299 ASP A CG  
2199 O OD1 . ASP A 299 ? 0.3611 0.4687 0.5661 0.0369  -0.0104 -0.0256 299 ASP A OD1 
2200 O OD2 . ASP A 299 ? 0.2968 0.3787 0.4762 0.0466  -0.0075 -0.0191 299 ASP A OD2 
2201 N N   . THR A 300 ? 0.2038 0.2704 0.3247 -0.0074 0.0162  0.0066  300 THR A N   
2202 C CA  . THR A 300 ? 0.2103 0.2620 0.3111 -0.0155 0.0153  0.0188  300 THR A CA  
2203 C C   . THR A 300 ? 0.2156 0.2716 0.3200 -0.0262 0.0170  0.0202  300 THR A C   
2204 O O   . THR A 300 ? 0.2219 0.2678 0.3203 -0.0268 0.0113  0.0281  300 THR A O   
2205 C CB  . THR A 300 ? 0.2264 0.2691 0.3094 -0.0237 0.0212  0.0225  300 THR A CB  
2206 O OG1 . THR A 300 ? 0.2054 0.2427 0.2863 -0.0142 0.0194  0.0207  300 THR A OG1 
2207 C CG2 . THR A 300 ? 0.2622 0.2901 0.3290 -0.0310 0.0168  0.0360  300 THR A CG2 
2208 N N   . GLN A 301 ? 0.2155 0.2860 0.3312 -0.0350 0.0262  0.0117  301 GLN A N   
2209 C CA  . GLN A 301 ? 0.2644 0.3391 0.3854 -0.0467 0.0292  0.0123  301 GLN A CA  
2210 C C   . GLN A 301 ? 0.2717 0.3498 0.4072 -0.0399 0.0188  0.0103  301 GLN A C   
2211 O O   . GLN A 301 ? 0.2241 0.2934 0.3544 -0.0459 0.0159  0.0162  301 GLN A O   
2212 C CB  . GLN A 301 ? 0.2242 0.3158 0.3588 -0.0572 0.0433  0.0018  301 GLN A CB  
2213 C CG  . GLN A 301 ? 0.4590 0.5561 0.6030 -0.0703 0.0475  0.0014  301 GLN A CG  
2214 C CD  . GLN A 301 ? 0.6873 0.7974 0.8392 -0.0844 0.0659  -0.0069 301 GLN A CD  
2215 O OE1 . GLN A 301 ? 0.7562 0.8782 0.9179 -0.0811 0.0752  -0.0171 301 GLN A OE1 
2216 N NE2 . GLN A 301 ? 0.7814 0.8876 0.9286 -0.1006 0.0727  -0.0029 301 GLN A NE2 
2217 N N   . LYS A 302 ? 0.2028 0.2914 0.3550 -0.0274 0.0122  0.0020  302 LYS A N   
2218 C CA  . LYS A 302 ? 0.1930 0.2834 0.3555 -0.0210 0.0000  -0.0010 302 LYS A CA  
2219 C C   . LYS A 302 ? 0.1983 0.2663 0.3382 -0.0158 -0.0076 0.0090  302 LYS A C   
2220 O O   . LYS A 302 ? 0.2250 0.2866 0.3630 -0.0189 -0.0123 0.0100  302 LYS A O   
2221 C CB  . LYS A 302 ? 0.2320 0.3347 0.4133 -0.0075 -0.0083 -0.0103 302 LYS A CB  
2222 C CG  . LYS A 302 ? 0.2668 0.3705 0.4563 -0.0013 -0.0238 -0.0143 302 LYS A CG  
2223 C CD  . LYS A 302 ? 0.3707 0.4796 0.5716 0.0142  -0.0360 -0.0200 302 LYS A CD  
2224 C CE  . LYS A 302 ? 0.3439 0.4782 0.5797 0.0146  -0.0301 -0.0311 302 LYS A CE  
2225 N NZ  . LYS A 302 ? 0.4148 0.5537 0.6659 0.0309  -0.0443 -0.0363 302 LYS A NZ  
2226 N N   . ILE A 303 ? 0.2144 0.2702 0.3385 -0.0082 -0.0078 0.0155  303 ILE A N   
2227 C CA  . ILE A 303 ? 0.2274 0.2631 0.3332 -0.0034 -0.0116 0.0245  303 ILE A CA  
2228 C C   . ILE A 303 ? 0.2288 0.2552 0.3278 -0.0142 -0.0071 0.0326  303 ILE A C   
2229 O O   . ILE A 303 ? 0.2207 0.2356 0.3148 -0.0137 -0.0100 0.0355  303 ILE A O   
2230 C CB  . ILE A 303 ? 0.2098 0.2355 0.3041 0.0054  -0.0112 0.0298  303 ILE A CB  
2231 C CG1 . ILE A 303 ? 0.2573 0.2866 0.3557 0.0175  -0.0179 0.0234  303 ILE A CG1 
2232 C CG2 . ILE A 303 ? 0.1958 0.2023 0.2754 0.0084  -0.0116 0.0390  303 ILE A CG2 
2233 C CD1 . ILE A 303 ? 0.2749 0.2959 0.3652 0.0247  -0.0163 0.0271  303 ILE A CD1 
2234 N N   . TYR A 304 ? 0.2022 0.2317 0.2997 -0.0240 -0.0003 0.0360  304 TYR A N   
2235 C CA  . TYR A 304 ? 0.2786 0.2974 0.3687 -0.0345 0.0017  0.0451  304 TYR A CA  
2236 C C   . TYR A 304 ? 0.3318 0.3513 0.4294 -0.0418 0.0011  0.0424  304 TYR A C   
2237 O O   . TYR A 304 ? 0.2858 0.2911 0.3791 -0.0438 -0.0011 0.0490  304 TYR A O   
2238 C CB  . TYR A 304 ? 0.2362 0.2561 0.3179 -0.0452 0.0078  0.0488  304 TYR A CB  
2239 C CG  . TYR A 304 ? 0.2584 0.2644 0.3297 -0.0561 0.0072  0.0600  304 TYR A CG  
2240 C CD1 . TYR A 304 ? 0.2930 0.2841 0.3580 -0.0527 0.0011  0.0710  304 TYR A CD1 
2241 C CD2 . TYR A 304 ? 0.4179 0.4250 0.4875 -0.0701 0.0124  0.0598  304 TYR A CD2 
2242 C CE1 . TYR A 304 ? 0.3335 0.3108 0.3914 -0.0615 -0.0022 0.0820  304 TYR A CE1 
2243 C CE2 . TYR A 304 ? 0.5224 0.5131 0.5801 -0.0801 0.0102  0.0715  304 TYR A CE2 
2244 C CZ  . TYR A 304 ? 0.4446 0.4203 0.4967 -0.0751 0.0017  0.0828  304 TYR A CZ  
2245 O OH  . TYR A 304 ? 0.5708 0.5294 0.6135 -0.0840 -0.0030 0.0950  304 TYR A OH  
2246 N N   . ALA A 305 ? 0.2897 0.3256 0.4015 -0.0457 0.0032  0.0321  305 ALA A N   
2247 C CA  . ALA A 305 ? 0.3064 0.3442 0.4285 -0.0535 0.0021  0.0281  305 ALA A CA  
2248 C C   . ALA A 305 ? 0.3435 0.3697 0.4629 -0.0448 -0.0072 0.0269  305 ALA A C   
2249 O O   . ALA A 305 ? 0.3284 0.3427 0.4461 -0.0506 -0.0083 0.0293  305 ALA A O   
2250 C CB  . ALA A 305 ? 0.3066 0.3676 0.4510 -0.0579 0.0052  0.0157  305 ALA A CB  
2251 N N   . TYR A 306 ? 0.2747 0.3017 0.3914 -0.0314 -0.0133 0.0231  306 TYR A N   
2252 C CA  . TYR A 306 ? 0.3099 0.3224 0.4167 -0.0231 -0.0207 0.0216  306 TYR A CA  
2253 C C   . TYR A 306 ? 0.3091 0.3005 0.4022 -0.0220 -0.0169 0.0315  306 TYR A C   
2254 O O   . TYR A 306 ? 0.3175 0.2954 0.4067 -0.0231 -0.0184 0.0305  306 TYR A O   
2255 C CB  . TYR A 306 ? 0.2672 0.2809 0.3681 -0.0095 -0.0272 0.0178  306 TYR A CB  
2256 C CG  . TYR A 306 ? 0.3233 0.3167 0.4045 -0.0008 -0.0321 0.0182  306 TYR A CG  
2257 C CD1 . TYR A 306 ? 0.4232 0.4124 0.5012 -0.0001 -0.0418 0.0098  306 TYR A CD1 
2258 C CD2 . TYR A 306 ? 0.3767 0.3544 0.4419 0.0060  -0.0266 0.0262  306 TYR A CD2 
2259 C CE1 . TYR A 306 ? 0.4684 0.4357 0.5222 0.0070  -0.0450 0.0093  306 TYR A CE1 
2260 C CE2 . TYR A 306 ? 0.4730 0.4307 0.5182 0.0131  -0.0276 0.0258  306 TYR A CE2 
2261 C CZ  . TYR A 306 ? 0.4469 0.3983 0.4837 0.0135  -0.0364 0.0172  306 TYR A CZ  
2262 O OH  . TYR A 306 ? 0.5135 0.4417 0.5244 0.0196  -0.0361 0.0161  306 TYR A OH  
2263 N N   . LEU A 307 ? 0.2384 0.2270 0.3266 -0.0198 -0.0122 0.0402  307 LEU A N   
2264 C CA  . LEU A 307 ? 0.2844 0.2560 0.3667 -0.0181 -0.0093 0.0497  307 LEU A CA  
2265 C C   . LEU A 307 ? 0.3018 0.2658 0.3888 -0.0287 -0.0082 0.0549  307 LEU A C   
2266 O O   . LEU A 307 ? 0.3674 0.3157 0.4542 -0.0265 -0.0073 0.0602  307 LEU A O   
2267 C CB  . LEU A 307 ? 0.2916 0.2642 0.3717 -0.0152 -0.0067 0.0576  307 LEU A CB  
2268 C CG  . LEU A 307 ? 0.2695 0.2449 0.3440 -0.0048 -0.0070 0.0547  307 LEU A CG  
2269 C CD1 . LEU A 307 ? 0.2624 0.2398 0.3370 -0.0053 -0.0049 0.0617  307 LEU A CD1 
2270 C CD2 . LEU A 307 ? 0.3087 0.2692 0.3743 0.0047  -0.0060 0.0542  307 LEU A CD2 
2271 N N   . SER A 308 ? 0.2759 0.2501 0.3681 -0.0402 -0.0073 0.0533  308 SER A N   
2272 C CA  . SER A 308 ? 0.3076 0.2723 0.4011 -0.0519 -0.0062 0.0599  308 SER A CA  
2273 C C   . SER A 308 ? 0.3555 0.3176 0.4555 -0.0580 -0.0075 0.0524  308 SER A C   
2274 O O   . SER A 308 ? 0.4703 0.4222 0.5716 -0.0685 -0.0065 0.0574  308 SER A O   
2275 C CB  . SER A 308 ? 0.3494 0.3222 0.4396 -0.0636 -0.0023 0.0644  308 SER A CB  
2276 O OG  . SER A 308 ? 0.4259 0.3984 0.5082 -0.0596 -0.0026 0.0712  308 SER A OG  
2277 N N   . ARG A 309 ? 0.3595 0.3288 0.4627 -0.0518 -0.0110 0.0409  309 ARG A N   
2278 C CA  . ARG A 309 ? 0.4455 0.4156 0.5567 -0.0584 -0.0144 0.0314  309 ARG A CA  
2279 C C   . ARG A 309 ? 0.5380 0.4845 0.6454 -0.0605 -0.0151 0.0338  309 ARG A C   
2280 O O   . ARG A 309 ? 0.4747 0.4050 0.5751 -0.0540 -0.0131 0.0415  309 ARG A O   
2281 C CB  . ARG A 309 ? 0.4203 0.3998 0.5326 -0.0496 -0.0219 0.0194  309 ARG A CB  
2282 C CG  . ARG A 309 ? 0.4232 0.3835 0.5186 -0.0377 -0.0254 0.0178  309 ARG A CG  
2283 C CD  . ARG A 309 ? 0.4522 0.4194 0.5420 -0.0287 -0.0343 0.0085  309 ARG A CD  
2284 N NE  . ARG A 309 ? 0.5034 0.4484 0.5709 -0.0195 -0.0365 0.0061  309 ARG A NE  
2285 C CZ  . ARG A 309 ? 0.4645 0.3971 0.5171 -0.0102 -0.0299 0.0126  309 ARG A CZ  
2286 N NH1 . ARG A 309 ? 0.4358 0.3764 0.4948 -0.0085 -0.0234 0.0221  309 ARG A NH1 
2287 N NH2 . ARG A 309 ? 0.5126 0.4238 0.5434 -0.0033 -0.0293 0.0091  309 ARG A NH2 
2288 N N   . MET B 1   ? 0.8901 0.8105 1.1003 -0.0875 0.1273  -0.1857 1   MET B N   
2289 C CA  . MET B 1   ? 0.7458 0.6617 0.9351 -0.0826 0.1228  -0.1713 1   MET B CA  
2290 C C   . MET B 1   ? 0.7515 0.6639 0.9156 -0.0779 0.1095  -0.1748 1   MET B C   
2291 O O   . MET B 1   ? 0.8232 0.7451 0.9850 -0.0774 0.0947  -0.1897 1   MET B O   
2292 C CB  . MET B 1   ? 0.6850 0.6146 0.8820 -0.0825 0.1135  -0.1695 1   MET B CB  
2293 C CG  . MET B 1   ? 0.6092 0.5351 0.7867 -0.0780 0.1081  -0.1559 1   MET B CG  
2294 S SD  . MET B 1   ? 0.9993 0.9407 1.1853 -0.0780 0.0975  -0.1540 1   MET B SD  
2295 C CE  . MET B 1   ? 0.7943 0.7370 1.0076 -0.0817 0.1145  -0.1543 1   MET B CE  
2296 N N   . VAL B 2   ? 0.6506 0.5492 0.7953 -0.0734 0.1155  -0.1608 2   VAL B N   
2297 C CA  . VAL B 2   ? 0.5448 0.4382 0.6645 -0.0674 0.1061  -0.1624 2   VAL B CA  
2298 C C   . VAL B 2   ? 0.4132 0.3196 0.5254 -0.0646 0.0882  -0.1647 2   VAL B C   
2299 O O   . VAL B 2   ? 0.4588 0.3753 0.5836 -0.0672 0.0850  -0.1610 2   VAL B O   
2300 C CB  . VAL B 2   ? 0.6337 0.5083 0.7373 -0.0626 0.1198  -0.1453 2   VAL B CB  
2301 C CG1 . VAL B 2   ? 0.6504 0.5125 0.7598 -0.0644 0.1375  -0.1426 2   VAL B CG1 
2302 C CG2 . VAL B 2   ? 0.4840 0.3576 0.5896 -0.0618 0.1238  -0.1285 2   VAL B CG2 
2303 N N   . ARG B 3   ? 0.3635 0.2694 0.4542 -0.0584 0.0774  -0.1705 3   ARG B N   
2304 C CA  . ARG B 3   ? 0.3960 0.3167 0.4774 -0.0536 0.0601  -0.1695 3   ARG B CA  
2305 C C   . ARG B 3   ? 0.3502 0.2715 0.4225 -0.0490 0.0619  -0.1448 3   ARG B C   
2306 O O   . ARG B 3   ? 0.3810 0.2906 0.4466 -0.0468 0.0741  -0.1291 3   ARG B O   
2307 C CB  . ARG B 3   ? 0.5000 0.4242 0.5584 -0.0452 0.0469  -0.1785 3   ARG B CB  
2308 C CG  . ARG B 3   ? 0.6356 0.5659 0.7024 -0.0482 0.0391  -0.2012 3   ARG B CG  
2309 C CD  . ARG B 3   ? 0.8170 0.7478 0.8568 -0.0384 0.0268  -0.2113 3   ARG B CD  
2310 N NE  . ARG B 3   ? 0.9592 0.9094 0.9963 -0.0338 0.0068  -0.2188 3   ARG B NE  
2311 C CZ  . ARG B 3   ? 1.0178 0.9718 1.0301 -0.0233 -0.0065 -0.2265 3   ARG B CZ  
2312 N NH1 . ARG B 3   ? 1.0228 0.9619 1.0103 -0.0164 -0.0016 -0.2285 3   ARG B NH1 
2313 N NH2 . ARG B 3   ? 1.0305 1.0027 1.0419 -0.0185 -0.0238 -0.2310 3   ARG B NH2 
2314 N N   . ILE B 4   ? 0.3539 0.2894 0.4273 -0.0476 0.0495  -0.1423 4   ILE B N   
2315 C CA  . ILE B 4   ? 0.3304 0.2681 0.3979 -0.0443 0.0494  -0.1217 4   ILE B CA  
2316 C C   . ILE B 4   ? 0.3048 0.2521 0.3546 -0.0358 0.0351  -0.1173 4   ILE B C   
2317 O O   . ILE B 4   ? 0.3342 0.2929 0.3845 -0.0345 0.0223  -0.1301 4   ILE B O   
2318 C CB  . ILE B 4   ? 0.3452 0.2890 0.4325 -0.0508 0.0509  -0.1208 4   ILE B CB  
2319 C CG1 . ILE B 4   ? 0.3572 0.2899 0.4623 -0.0583 0.0673  -0.1244 4   ILE B CG1 
2320 C CG2 . ILE B 4   ? 0.2757 0.2219 0.3556 -0.0471 0.0493  -0.1012 4   ILE B CG2 
2321 C CD1 . ILE B 4   ? 0.3703 0.3074 0.4958 -0.0644 0.0706  -0.1258 4   ILE B CD1 
2322 N N   . TYR B 5   ? 0.2844 0.2271 0.3199 -0.0296 0.0377  -0.0990 5   TYR B N   
2323 C CA  . TYR B 5   ? 0.3197 0.2693 0.3397 -0.0212 0.0272  -0.0917 5   TYR B CA  
2324 C C   . TYR B 5   ? 0.3139 0.2656 0.3372 -0.0212 0.0285  -0.0739 5   TYR B C   
2325 O O   . TYR B 5   ? 0.2956 0.2410 0.3266 -0.0250 0.0383  -0.0650 5   TYR B O   
2326 C CB  . TYR B 5   ? 0.3284 0.2690 0.3273 -0.0125 0.0299  -0.0873 5   TYR B CB  
2327 C CG  . TYR B 5   ? 0.3561 0.2932 0.3484 -0.0116 0.0282  -0.1057 5   TYR B CG  
2328 C CD1 . TYR B 5   ? 0.3360 0.2622 0.3354 -0.0172 0.0395  -0.1127 5   TYR B CD1 
2329 C CD2 . TYR B 5   ? 0.4270 0.3715 0.4057 -0.0046 0.0153  -0.1166 5   TYR B CD2 
2330 C CE1 . TYR B 5   ? 0.4268 0.3495 0.4212 -0.0169 0.0376  -0.1313 5   TYR B CE1 
2331 C CE2 . TYR B 5   ? 0.3735 0.3156 0.3454 -0.0034 0.0120  -0.1353 5   TYR B CE2 
2332 C CZ  . TYR B 5   ? 0.4499 0.3810 0.4303 -0.0101 0.0231  -0.1432 5   TYR B CZ  
2333 O OH  . TYR B 5   ? 0.5165 0.4446 0.4909 -0.0094 0.0196  -0.1634 5   TYR B OH  
2334 N N   . THR B 6   ? 0.2522 0.2125 0.2698 -0.0165 0.0187  -0.0692 6   THR B N   
2335 C CA  . THR B 6   ? 0.2834 0.2454 0.3034 -0.0160 0.0191  -0.0532 6   THR B CA  
2336 C C   . THR B 6   ? 0.3046 0.2664 0.3098 -0.0068 0.0158  -0.0433 6   THR B C   
2337 O O   . THR B 6   ? 0.2847 0.2479 0.2772 -0.0003 0.0104  -0.0498 6   THR B O   
2338 C CB  . THR B 6   ? 0.3155 0.2874 0.3478 -0.0207 0.0124  -0.0563 6   THR B CB  
2339 O OG1 . THR B 6   ? 0.2986 0.2799 0.3255 -0.0160 0.0012  -0.0621 6   THR B OG1 
2340 C CG2 . THR B 6   ? 0.2256 0.1974 0.2733 -0.0291 0.0165  -0.0679 6   THR B CG2 
2341 N N   . LEU B 7   ? 0.2725 0.2320 0.2793 -0.0056 0.0197  -0.0276 7   LEU B N   
2342 C CA  . LEU B 7   ? 0.2919 0.2504 0.2887 0.0027  0.0188  -0.0169 7   LEU B CA  
2343 C C   . LEU B 7   ? 0.3057 0.2706 0.3112 0.0013  0.0144  -0.0081 7   LEU B C   
2344 O O   . LEU B 7   ? 0.2565 0.2220 0.2734 -0.0042 0.0167  -0.0023 7   LEU B O   
2345 C CB  . LEU B 7   ? 0.2811 0.2296 0.2737 0.0062  0.0293  -0.0058 7   LEU B CB  
2346 C CG  . LEU B 7   ? 0.3098 0.2556 0.2952 0.0147  0.0314  0.0071  7   LEU B CG  
2347 C CD1 . LEU B 7   ? 0.3132 0.2572 0.2796 0.0240  0.0280  0.0012  7   LEU B CD1 
2348 C CD2 . LEU B 7   ? 0.2774 0.2146 0.2647 0.0167  0.0427  0.0188  7   LEU B CD2 
2349 N N   . THR B 8   ? 0.2720 0.2413 0.2714 0.0069  0.0082  -0.0076 8   THR B N   
2350 C CA  . THR B 8   ? 0.2787 0.2529 0.2860 0.0062  0.0045  0.0000  8   THR B CA  
2351 C C   . THR B 8   ? 0.3337 0.3041 0.3335 0.0152  0.0074  0.0110  8   THR B C   
2352 O O   . THR B 8   ? 0.2883 0.2592 0.2758 0.0231  0.0043  0.0085  8   THR B O   
2353 C CB  . THR B 8   ? 0.2634 0.2464 0.2733 0.0046  -0.0046 -0.0096 8   THR B CB  
2354 O OG1 . THR B 8   ? 0.2451 0.2307 0.2621 -0.0028 -0.0057 -0.0211 8   THR B OG1 
2355 C CG2 . THR B 8   ? 0.2674 0.2541 0.2872 0.0021  -0.0072 -0.0026 8   THR B CG2 
2356 N N   . LEU B 9   ? 0.2536 0.2201 0.2613 0.0147  0.0137  0.0233  9   LEU B N   
2357 C CA  . LEU B 9   ? 0.2809 0.2427 0.2849 0.0230  0.0189  0.0347  9   LEU B CA  
2358 C C   . LEU B 9   ? 0.3124 0.2787 0.3225 0.0239  0.0144  0.0379  9   LEU B C   
2359 O O   . LEU B 9   ? 0.3041 0.2665 0.3082 0.0324  0.0180  0.0448  9   LEU B O   
2360 C CB  . LEU B 9   ? 0.2900 0.2471 0.3044 0.0220  0.0275  0.0464  9   LEU B CB  
2361 C CG  . LEU B 9   ? 0.3637 0.3143 0.3720 0.0226  0.0344  0.0457  9   LEU B CG  
2362 C CD1 . LEU B 9   ? 0.3377 0.2858 0.3599 0.0219  0.0423  0.0584  9   LEU B CD1 
2363 C CD2 . LEU B 9   ? 0.3783 0.3212 0.3652 0.0325  0.0381  0.0429  9   LEU B CD2 
2364 N N   . ALA B 10  ? 0.2640 0.2373 0.2853 0.0157  0.0078  0.0330  10  ALA B N   
2365 C CA  . ALA B 10  ? 0.2560 0.2331 0.2837 0.0158  0.0037  0.0348  10  ALA B CA  
2366 C C   . ALA B 10  ? 0.3071 0.2911 0.3328 0.0128  -0.0049 0.0232  10  ALA B C   
2367 O O   . ALA B 10  ? 0.2779 0.2659 0.3141 0.0051  -0.0086 0.0200  10  ALA B O   
2368 C CB  . ALA B 10  ? 0.2954 0.2736 0.3415 0.0092  0.0045  0.0415  10  ALA B CB  
2369 N N   . PRO B 11  ? 0.3168 0.3024 0.3290 0.0196  -0.0081 0.0168  11  PRO B N   
2370 C CA  . PRO B 11  ? 0.2898 0.2835 0.3029 0.0173  -0.0163 0.0057  11  PRO B CA  
2371 C C   . PRO B 11  ? 0.3088 0.3049 0.3256 0.0202  -0.0188 0.0097  11  PRO B C   
2372 O O   . PRO B 11  ? 0.3114 0.3024 0.3296 0.0243  -0.0136 0.0205  11  PRO B O   
2373 C CB  . PRO B 11  ? 0.3038 0.2990 0.3013 0.0250  -0.0194 -0.0023 11  PRO B CB  
2374 C CG  . PRO B 11  ? 0.3257 0.3126 0.3102 0.0353  -0.0129 0.0079  11  PRO B CG  
2375 C CD  . PRO B 11  ? 0.2858 0.2661 0.2810 0.0306  -0.0045 0.0193  11  PRO B CD  
2376 N N   . SER B 12  ? 0.2574 0.2610 0.2778 0.0181  -0.0255 0.0012  12  SER B N   
2377 C CA  . SER B 12  ? 0.2823 0.2879 0.3052 0.0218  -0.0274 0.0046  12  SER B CA  
2378 C C   . SER B 12  ? 0.2761 0.2912 0.2972 0.0245  -0.0353 -0.0058 12  SER B C   
2379 O O   . SER B 12  ? 0.2936 0.3142 0.3168 0.0202  -0.0394 -0.0167 12  SER B O   
2380 C CB  . SER B 12  ? 0.3434 0.3471 0.3810 0.0133  -0.0258 0.0084  12  SER B CB  
2381 O OG  . SER B 12  ? 0.3620 0.3697 0.4070 0.0042  -0.0292 -0.0001 12  SER B OG  
2382 N N   . LEU B 13  ? 0.2754 0.2921 0.2940 0.0321  -0.0367 -0.0021 13  LEU B N   
2383 C CA  . LEU B 13  ? 0.2727 0.2994 0.2933 0.0347  -0.0442 -0.0106 13  LEU B CA  
2384 C C   . LEU B 13  ? 0.2878 0.3138 0.3221 0.0281  -0.0427 -0.0082 13  LEU B C   
2385 O O   . LEU B 13  ? 0.3310 0.3520 0.3656 0.0324  -0.0389 0.0006  13  LEU B O   
2386 C CB  . LEU B 13  ? 0.2708 0.2999 0.2772 0.0498  -0.0466 -0.0075 13  LEU B CB  
2387 C CG  . LEU B 13  ? 0.3546 0.3960 0.3647 0.0536  -0.0552 -0.0159 13  LEU B CG  
2388 C CD1 . LEU B 13  ? 0.3481 0.4000 0.3609 0.0499  -0.0635 -0.0312 13  LEU B CD1 
2389 C CD2 . LEU B 13  ? 0.3309 0.3733 0.3267 0.0701  -0.0565 -0.0097 13  LEU B CD2 
2390 N N   . ASP B 14  ? 0.2578 0.2871 0.3032 0.0179  -0.0447 -0.0160 14  ASP B N   
2391 C CA  . ASP B 14  ? 0.2776 0.3042 0.3337 0.0113  -0.0427 -0.0142 14  ASP B CA  
2392 C C   . ASP B 14  ? 0.2837 0.3169 0.3444 0.0151  -0.0462 -0.0177 14  ASP B C   
2393 O O   . ASP B 14  ? 0.2889 0.3319 0.3493 0.0193  -0.0519 -0.0254 14  ASP B O   
2394 C CB  . ASP B 14  ? 0.2490 0.2739 0.3126 0.0001  -0.0414 -0.0192 14  ASP B CB  
2395 C CG  . ASP B 14  ? 0.3569 0.3747 0.4175 -0.0033 -0.0372 -0.0137 14  ASP B CG  
2396 O OD1 . ASP B 14  ? 0.3221 0.3355 0.3780 0.0017  -0.0345 -0.0052 14  ASP B OD1 
2397 O OD2 . ASP B 14  ? 0.3743 0.3908 0.4380 -0.0103 -0.0358 -0.0172 14  ASP B OD2 
2398 N N   . SER B 15  ? 0.2715 0.2994 0.3371 0.0141  -0.0430 -0.0123 15  SER B N   
2399 C CA  . SER B 15  ? 0.2400 0.2726 0.3111 0.0173  -0.0449 -0.0147 15  SER B CA  
2400 C C   . SER B 15  ? 0.2215 0.2521 0.3028 0.0075  -0.0435 -0.0195 15  SER B C   
2401 O O   . SER B 15  ? 0.2319 0.2535 0.3147 0.0009  -0.0397 -0.0162 15  SER B O   
2402 C CB  . SER B 15  ? 0.3330 0.3597 0.4013 0.0251  -0.0408 -0.0048 15  SER B CB  
2403 O OG  . SER B 15  ? 0.4272 0.4559 0.4841 0.0371  -0.0415 -0.0001 15  SER B OG  
2404 N N   . ALA B 16  ? 0.2210 0.2600 0.3094 0.0070  -0.0465 -0.0276 16  ALA B N   
2405 C CA  . ALA B 16  ? 0.2226 0.2588 0.3198 -0.0006 -0.0437 -0.0317 16  ALA B CA  
2406 C C   . ALA B 16  ? 0.1986 0.2368 0.3009 0.0045  -0.0433 -0.0307 16  ALA B C   
2407 O O   . ALA B 16  ? 0.2114 0.2604 0.3174 0.0115  -0.0475 -0.0337 16  ALA B O   
2408 C CB  . ALA B 16  ? 0.2738 0.3167 0.3784 -0.0057 -0.0449 -0.0414 16  ALA B CB  
2409 N N   . THR B 17  ? 0.1936 0.2215 0.2966 0.0013  -0.0385 -0.0268 17  THR B N   
2410 C CA  . THR B 17  ? 0.1788 0.2061 0.2864 0.0060  -0.0365 -0.0250 17  THR B CA  
2411 C C   . THR B 17  ? 0.2384 0.2577 0.3504 -0.0010 -0.0319 -0.0282 17  THR B C   
2412 O O   . THR B 17  ? 0.2569 0.2695 0.3660 -0.0089 -0.0303 -0.0305 17  THR B O   
2413 C CB  . THR B 17  ? 0.1864 0.2067 0.2889 0.0121  -0.0337 -0.0156 17  THR B CB  
2414 O OG1 . THR B 17  ? 0.2029 0.2222 0.3102 0.0175  -0.0307 -0.0136 17  THR B OG1 
2415 C CG2 . THR B 17  ? 0.1880 0.1955 0.2883 0.0047  -0.0300 -0.0122 17  THR B CG2 
2416 N N   . ILE B 18  ? 0.2191 0.2387 0.3370 0.0029  -0.0294 -0.0282 18  ILE B N   
2417 C CA  . ILE B 18  ? 0.1804 0.1919 0.3016 -0.0022 -0.0242 -0.0314 18  ILE B CA  
2418 C C   . ILE B 18  ? 0.2204 0.2220 0.3409 0.0008  -0.0197 -0.0265 18  ILE B C   
2419 O O   . ILE B 18  ? 0.2149 0.2201 0.3372 0.0091  -0.0197 -0.0214 18  ILE B O   
2420 C CB  . ILE B 18  ? 0.1668 0.1884 0.2994 -0.0007 -0.0239 -0.0375 18  ILE B CB  
2421 C CG1 . ILE B 18  ? 0.2409 0.2721 0.3773 -0.0040 -0.0277 -0.0435 18  ILE B CG1 
2422 C CG2 . ILE B 18  ? 0.2240 0.2353 0.3586 -0.0052 -0.0167 -0.0402 18  ILE B CG2 
2423 C CD1 . ILE B 18  ? 0.3110 0.3558 0.4634 -0.0017 -0.0288 -0.0501 18  ILE B CD1 
2424 N N   . THR B 19  ? 0.2259 0.2143 0.3429 -0.0055 -0.0155 -0.0281 19  THR B N   
2425 C CA  . THR B 19  ? 0.2607 0.2379 0.3781 -0.0040 -0.0104 -0.0253 19  THR B CA  
2426 C C   . THR B 19  ? 0.2632 0.2302 0.3783 -0.0092 -0.0058 -0.0310 19  THR B C   
2427 O O   . THR B 19  ? 0.2473 0.2122 0.3569 -0.0149 -0.0068 -0.0354 19  THR B O   
2428 C CB  . THR B 19  ? 0.2667 0.2359 0.3806 -0.0060 -0.0107 -0.0208 19  THR B CB  
2429 O OG1 . THR B 19  ? 0.2651 0.2251 0.3829 -0.0028 -0.0049 -0.0173 19  THR B OG1 
2430 C CG2 . THR B 19  ? 0.2610 0.2223 0.3686 -0.0152 -0.0126 -0.0252 19  THR B CG2 
2431 N N   . PRO B 20  ? 0.2574 0.2388 0.3204 0.0203  -0.0185 -0.0111 20  PRO B N   
2432 C CA  . PRO B 20  ? 0.2388 0.2179 0.3019 0.0212  -0.0137 -0.0174 20  PRO B CA  
2433 C C   . PRO B 20  ? 0.3039 0.2728 0.3563 0.0201  -0.0120 -0.0181 20  PRO B C   
2434 O O   . PRO B 20  ? 0.3344 0.3017 0.3812 0.0192  -0.0062 -0.0222 20  PRO B O   
2435 C CB  . PRO B 20  ? 0.2895 0.2691 0.3630 0.0261  -0.0170 -0.0193 20  PRO B CB  
2436 C CG  . PRO B 20  ? 0.3678 0.3528 0.4478 0.0275  -0.0227 -0.0146 20  PRO B CG  
2437 C CD  . PRO B 20  ? 0.3236 0.3065 0.3950 0.0242  -0.0243 -0.0084 20  PRO B CD  
2438 N N   . GLN B 21  ? 0.2625 0.2247 0.3124 0.0202  -0.0170 -0.0140 21  GLN B N   
2439 C CA  . GLN B 21  ? 0.2219 0.1742 0.2633 0.0198  -0.0172 -0.0151 21  GLN B CA  
2440 C C   . GLN B 21  ? 0.2345 0.1834 0.2723 0.0172  -0.0210 -0.0091 21  GLN B C   
2441 O O   . GLN B 21  ? 0.3015 0.2547 0.3441 0.0167  -0.0238 -0.0038 21  GLN B O   
2442 C CB  . GLN B 21  ? 0.2896 0.2357 0.3356 0.0238  -0.0204 -0.0182 21  GLN B CB  
2443 C CG  . GLN B 21  ? 0.3570 0.3066 0.4082 0.0273  -0.0169 -0.0244 21  GLN B CG  
2444 C CD  . GLN B 21  ? 0.3664 0.3127 0.4080 0.0277  -0.0106 -0.0302 21  GLN B CD  
2445 O OE1 . GLN B 21  ? 0.3505 0.2902 0.3808 0.0259  -0.0099 -0.0300 21  GLN B OE1 
2446 N NE2 . GLN B 21  ? 0.3492 0.3001 0.3953 0.0303  -0.0057 -0.0354 21  GLN B NE2 
2447 N N   . ILE B 22  ? 0.2252 0.1667 0.2547 0.0160  -0.0211 -0.0100 22  ILE B N   
2448 C CA  . ILE B 22  ? 0.2522 0.1906 0.2805 0.0139  -0.0249 -0.0047 22  ILE B CA  
2449 C C   . ILE B 22  ? 0.3426 0.2712 0.3711 0.0152  -0.0294 -0.0063 22  ILE B C   
2450 O O   . ILE B 22  ? 0.3104 0.2330 0.3323 0.0167  -0.0285 -0.0119 22  ILE B O   
2451 C CB  . ILE B 22  ? 0.3125 0.2525 0.3319 0.0106  -0.0219 -0.0032 22  ILE B CB  
2452 C CG1 . ILE B 22  ? 0.3146 0.2528 0.3348 0.0087  -0.0256 0.0024  22  ILE B CG1 
2453 C CG2 . ILE B 22  ? 0.3088 0.2432 0.3175 0.0106  -0.0185 -0.0084 22  ILE B CG2 
2454 C CD1 . ILE B 22  ? 0.3645 0.3062 0.3783 0.0059  -0.0231 0.0047  22  ILE B CD1 
2455 N N   . TYR B 23  ? 0.2872 0.2143 0.3236 0.0147  -0.0342 -0.0012 23  TYR B N   
2456 C CA  . TYR B 23  ? 0.2866 0.2049 0.3267 0.0155  -0.0395 -0.0021 23  TYR B CA  
2457 C C   . TYR B 23  ? 0.2843 0.2036 0.3333 0.0134  -0.0429 0.0058  23  TYR B C   
2458 O O   . TYR B 23  ? 0.2468 0.1729 0.2993 0.0130  -0.0414 0.0112  23  TYR B O   
2459 C CB  . TYR B 23  ? 0.2824 0.1964 0.3274 0.0194  -0.0415 -0.0071 23  TYR B CB  
2460 C CG  . TYR B 23  ? 0.3144 0.2339 0.3685 0.0212  -0.0415 -0.0044 23  TYR B CG  
2461 C CD1 . TYR B 23  ? 0.3461 0.2644 0.4105 0.0211  -0.0458 0.0019  23  TYR B CD1 
2462 C CD2 . TYR B 23  ? 0.2888 0.2144 0.3418 0.0232  -0.0372 -0.0080 23  TYR B CD2 
2463 C CE1 . TYR B 23  ? 0.3250 0.2475 0.3966 0.0233  -0.0464 0.0046  23  TYR B CE1 
2464 C CE2 . TYR B 23  ? 0.3245 0.2553 0.3863 0.0253  -0.0381 -0.0059 23  TYR B CE2 
2465 C CZ  . TYR B 23  ? 0.3659 0.2948 0.4361 0.0256  -0.0429 0.0004  23  TYR B CZ  
2466 O OH  . TYR B 23  ? 0.3729 0.3062 0.4507 0.0284  -0.0443 0.0026  23  TYR B OH  
2467 N N   . PRO B 24  ? 0.2635 0.1762 0.3165 0.0123  -0.0473 0.0065  24  PRO B N   
2468 C CA  . PRO B 24  ? 0.2485 0.1623 0.3109 0.0099  -0.0495 0.0146  24  PRO B CA  
2469 C C   . PRO B 24  ? 0.2893 0.2002 0.3639 0.0112  -0.0528 0.0181  24  PRO B C   
2470 O O   . PRO B 24  ? 0.2557 0.1631 0.3320 0.0144  -0.0544 0.0134  24  PRO B O   
2471 C CB  . PRO B 24  ? 0.2485 0.1562 0.3116 0.0081  -0.0531 0.0126  24  PRO B CB  
2472 C CG  . PRO B 24  ? 0.3019 0.2021 0.3598 0.0111  -0.0556 0.0035  24  PRO B CG  
2473 C CD  . PRO B 24  ? 0.2974 0.2019 0.3454 0.0131  -0.0501 -0.0001 24  PRO B CD  
2474 N N   . GLU B 25  ? 0.2433 0.1556 0.3260 0.0090  -0.0535 0.0266  25  GLU B N   
2475 C CA  . GLU B 25  ? 0.3090 0.2173 0.4041 0.0096  -0.0567 0.0319  25  GLU B CA  
2476 C C   . GLU B 25  ? 0.2590 0.1712 0.3547 0.0124  -0.0553 0.0354  25  GLU B C   
2477 O O   . GLU B 25  ? 0.3171 0.2308 0.4179 0.0120  -0.0549 0.0442  25  GLU B O   
2478 C CB  . GLU B 25  ? 0.2963 0.1943 0.3989 0.0108  -0.0625 0.0261  25  GLU B CB  
2479 C CG  . GLU B 25  ? 0.3322 0.2243 0.4498 0.0103  -0.0663 0.0322  25  GLU B CG  
2480 C CD  . GLU B 25  ? 0.4500 0.3413 0.5769 0.0058  -0.0671 0.0388  25  GLU B CD  
2481 O OE1 . GLU B 25  ? 0.3739 0.2691 0.4957 0.0035  -0.0653 0.0379  25  GLU B OE1 
2482 O OE2 . GLU B 25  ? 0.4244 0.3110 0.5645 0.0047  -0.0694 0.0450  25  GLU B OE2 
2483 N N   . GLY B 26  ? 0.2763 0.1900 0.3666 0.0156  -0.0545 0.0288  26  GLY B N   
2484 C CA  . GLY B 26  ? 0.2583 0.1759 0.3503 0.0189  -0.0541 0.0308  26  GLY B CA  
2485 C C   . GLY B 26  ? 0.2486 0.1762 0.3335 0.0186  -0.0501 0.0346  26  GLY B C   
2486 O O   . GLY B 26  ? 0.3036 0.2356 0.3808 0.0160  -0.0469 0.0341  26  GLY B O   
2487 N N   . LYS B 27  ? 0.2465 0.1773 0.3336 0.0215  -0.0509 0.0383  27  LYS B N   
2488 C CA  . LYS B 27  ? 0.2763 0.2166 0.3566 0.0220  -0.0481 0.0409  27  LYS B CA  
2489 C C   . LYS B 27  ? 0.2562 0.2021 0.3314 0.0228  -0.0457 0.0321  27  LYS B C   
2490 O O   . LYS B 27  ? 0.2524 0.1976 0.3315 0.0257  -0.0468 0.0265  27  LYS B O   
2491 C CB  . LYS B 27  ? 0.2889 0.2306 0.3727 0.0257  -0.0506 0.0469  27  LYS B CB  
2492 C CG  . LYS B 27  ? 0.2868 0.2218 0.3768 0.0255  -0.0528 0.0564  27  LYS B CG  
2493 C CD  . LYS B 27  ? 0.2685 0.2032 0.3614 0.0303  -0.0559 0.0610  27  LYS B CD  
2494 C CE  . LYS B 27  ? 0.2488 0.1742 0.3501 0.0305  -0.0585 0.0693  27  LYS B CE  
2495 N NZ  . LYS B 27  ? 0.2568 0.1805 0.3610 0.0360  -0.0623 0.0728  27  LYS B NZ  
2496 N N   . LEU B 28  ? 0.2174 0.1687 0.2845 0.0202  -0.0421 0.0310  28  LEU B N   
2497 C CA  . LEU B 28  ? 0.2450 0.2020 0.3081 0.0206  -0.0392 0.0237  28  LEU B CA  
2498 C C   . LEU B 28  ? 0.2796 0.2452 0.3422 0.0225  -0.0395 0.0256  28  LEU B C   
2499 O O   . LEU B 28  ? 0.2681 0.2377 0.3253 0.0213  -0.0386 0.0301  28  LEU B O   
2500 C CB  . LEU B 28  ? 0.2507 0.2081 0.3056 0.0169  -0.0355 0.0209  28  LEU B CB  
2501 C CG  . LEU B 28  ? 0.2600 0.2087 0.3142 0.0153  -0.0362 0.0192  28  LEU B CG  
2502 C CD1 . LEU B 28  ? 0.2710 0.2199 0.3163 0.0121  -0.0330 0.0172  28  LEU B CD1 
2503 C CD2 . LEU B 28  ? 0.2570 0.2008 0.3145 0.0177  -0.0371 0.0125  28  LEU B CD2 
2504 N N   . ARG B 29  ? 0.2645 0.2330 0.3329 0.0260  -0.0410 0.0220  29  ARG B N   
2505 C CA  . ARG B 29  ? 0.2540 0.2308 0.3231 0.0285  -0.0425 0.0228  29  ARG B CA  
2506 C C   . ARG B 29  ? 0.2720 0.2561 0.3367 0.0261  -0.0388 0.0176  29  ARG B C   
2507 O O   . ARG B 29  ? 0.2756 0.2609 0.3424 0.0252  -0.0357 0.0106  29  ARG B O   
2508 C CB  . ARG B 29  ? 0.3467 0.3247 0.4251 0.0331  -0.0458 0.0200  29  ARG B CB  
2509 C CG  . ARG B 29  ? 0.5623 0.5331 0.6453 0.0360  -0.0503 0.0262  29  ARG B CG  
2510 C CD  . ARG B 29  ? 0.7637 0.7367 0.8553 0.0414  -0.0543 0.0240  29  ARG B CD  
2511 N NE  . ARG B 29  ? 0.8919 0.8744 0.9824 0.0436  -0.0560 0.0240  29  ARG B NE  
2512 C CZ  . ARG B 29  ? 0.9597 0.9455 1.0567 0.0488  -0.0607 0.0235  29  ARG B CZ  
2513 N NH1 . ARG B 29  ? 1.0011 0.9812 1.1062 0.0523  -0.0637 0.0232  29  ARG B NH1 
2514 N NH2 . ARG B 29  ? 0.9867 0.9811 1.0823 0.0508  -0.0629 0.0228  29  ARG B NH2 
2515 N N   . CYS B 30  ? 0.2428 0.2312 0.3013 0.0254  -0.0390 0.0212  30  CYS B N   
2516 C CA  . CYS B 30  ? 0.2100 0.2043 0.2642 0.0228  -0.0360 0.0170  30  CYS B CA  
2517 C C   . CYS B 30  ? 0.2378 0.2406 0.2941 0.0256  -0.0390 0.0158  30  CYS B C   
2518 O O   . CYS B 30  ? 0.2675 0.2712 0.3234 0.0292  -0.0434 0.0208  30  CYS B O   
2519 C CB  . CYS B 30  ? 0.2779 0.2703 0.3228 0.0197  -0.0339 0.0210  30  CYS B CB  
2520 S SG  . CYS B 30  ? 0.2797 0.2628 0.3218 0.0162  -0.0310 0.0215  30  CYS B SG  
2521 N N   . THR B 31  ? 0.2237 0.2325 0.2823 0.0240  -0.0369 0.0092  31  THR B N   
2522 C CA  . THR B 31  ? 0.2312 0.2487 0.2941 0.0264  -0.0403 0.0063  31  THR B CA  
2523 C C   . THR B 31  ? 0.2874 0.3073 0.3410 0.0271  -0.0429 0.0102  31  THR B C   
2524 O O   . THR B 31  ? 0.2752 0.2914 0.3199 0.0246  -0.0403 0.0137  31  THR B O   
2525 C CB  . THR B 31  ? 0.3007 0.3237 0.3701 0.0236  -0.0367 -0.0019 31  THR B CB  
2526 O OG1 . THR B 31  ? 0.2387 0.2589 0.3006 0.0188  -0.0318 -0.0025 31  THR B OG1 
2527 C CG2 . THR B 31  ? 0.3113 0.3332 0.3900 0.0241  -0.0340 -0.0060 31  THR B CG2 
2528 N N   . ALA B 32  ? 0.2327 0.2590 0.2886 0.0310  -0.0482 0.0092  32  ALA B N   
2529 C CA  . ALA B 32  ? 0.2786 0.3081 0.3252 0.0325  -0.0510 0.0113  32  ALA B CA  
2530 C C   . ALA B 32  ? 0.2632 0.2935 0.3056 0.0276  -0.0467 0.0075  32  ALA B C   
2531 O O   . ALA B 32  ? 0.2831 0.3171 0.3330 0.0248  -0.0448 0.0005  32  ALA B O   
2532 C CB  . ALA B 32  ? 0.3435 0.3805 0.3948 0.0372  -0.0577 0.0079  32  ALA B CB  
2533 N N   . PRO B 33  ? 0.2531 0.2799 0.2842 0.0266  -0.0448 0.0124  33  PRO B N   
2534 C CA  . PRO B 33  ? 0.2759 0.3018 0.3028 0.0220  -0.0404 0.0093  33  PRO B CA  
2535 C C   . PRO B 33  ? 0.2935 0.3258 0.3207 0.0220  -0.0428 0.0033  33  PRO B C   
2536 O O   . PRO B 33  ? 0.3278 0.3648 0.3533 0.0263  -0.0484 0.0031  33  PRO B O   
2537 C CB  . PRO B 33  ? 0.2922 0.3136 0.3080 0.0220  -0.0387 0.0164  33  PRO B CB  
2538 C CG  . PRO B 33  ? 0.3416 0.3637 0.3539 0.0273  -0.0429 0.0227  33  PRO B CG  
2539 C CD  . PRO B 33  ? 0.3240 0.3468 0.3466 0.0293  -0.0458 0.0212  33  PRO B CD  
2540 N N   . VAL B 34  ? 0.2568 0.2886 0.2861 0.0173  -0.0388 -0.0017 34  VAL B N   
2541 C CA  . VAL B 34  ? 0.3121 0.3483 0.3412 0.0164  -0.0405 -0.0073 34  VAL B CA  
2542 C C   . VAL B 34  ? 0.2690 0.3013 0.2856 0.0155  -0.0385 -0.0044 34  VAL B C   
2543 O O   . VAL B 34  ? 0.2829 0.3093 0.2962 0.0122  -0.0335 -0.0021 34  VAL B O   
2544 C CB  . VAL B 34  ? 0.3186 0.3559 0.3580 0.0116  -0.0367 -0.0140 34  VAL B CB  
2545 C CG1 . VAL B 34  ? 0.3895 0.4302 0.4294 0.0101  -0.0385 -0.0196 34  VAL B CG1 
2546 C CG2 . VAL B 34  ? 0.4676 0.5097 0.5208 0.0127  -0.0379 -0.0172 34  VAL B CG2 
2547 N N   . PHE B 35  ? 0.2640 0.2996 0.2736 0.0189  -0.0427 -0.0047 35  PHE B N   
2548 C CA  . PHE B 35  ? 0.3149 0.3475 0.3126 0.0189  -0.0409 -0.0020 35  PHE B CA  
2549 C C   . PHE B 35  ? 0.3387 0.3708 0.3372 0.0152  -0.0394 -0.0084 35  PHE B C   
2550 O O   . PHE B 35  ? 0.3166 0.3528 0.3225 0.0145  -0.0423 -0.0152 35  PHE B O   
2551 C CB  . PHE B 35  ? 0.3202 0.3558 0.3078 0.0250  -0.0454 0.0012  35  PHE B CB  
2552 C CG  . PHE B 35  ? 0.3073 0.3421 0.2931 0.0286  -0.0464 0.0088  35  PHE B CG  
2553 C CD1 . PHE B 35  ? 0.3486 0.3782 0.3319 0.0271  -0.0417 0.0160  35  PHE B CD1 
2554 C CD2 . PHE B 35  ? 0.4306 0.4695 0.4177 0.0336  -0.0524 0.0088  35  PHE B CD2 
2555 C CE1 . PHE B 35  ? 0.3912 0.4192 0.3740 0.0301  -0.0425 0.0232  35  PHE B CE1 
2556 C CE2 . PHE B 35  ? 0.4739 0.5109 0.4592 0.0370  -0.0533 0.0163  35  PHE B CE2 
2557 C CZ  . PHE B 35  ? 0.4160 0.4474 0.3995 0.0350  -0.0481 0.0237  35  PHE B CZ  
2558 N N   . GLU B 36  ? 0.2907 0.3176 0.2826 0.0128  -0.0350 -0.0064 36  GLU B N   
2559 C CA  . GLU B 36  ? 0.3099 0.3347 0.3015 0.0094  -0.0333 -0.0116 36  GLU B CA  
2560 C C   . GLU B 36  ? 0.3272 0.3490 0.3073 0.0106  -0.0318 -0.0089 36  GLU B C   
2561 O O   . GLU B 36  ? 0.3231 0.3430 0.2975 0.0122  -0.0298 -0.0023 36  GLU B O   
2562 C CB  . GLU B 36  ? 0.4766 0.4967 0.4753 0.0038  -0.0282 -0.0132 36  GLU B CB  
2563 C CG  . GLU B 36  ? 0.4868 0.5018 0.4831 0.0029  -0.0242 -0.0073 36  GLU B CG  
2564 C CD  . GLU B 36  ? 0.6583 0.6677 0.6585 -0.0018 -0.0192 -0.0091 36  GLU B CD  
2565 O OE1 . GLU B 36  ? 0.5748 0.5855 0.5834 -0.0029 -0.0180 -0.0108 36  GLU B OE1 
2566 O OE2 . GLU B 36  ? 0.7090 0.7127 0.7035 -0.0039 -0.0163 -0.0087 36  GLU B OE2 
2567 N N   . PRO B 37  ? 0.3383 0.3596 0.3159 0.0100  -0.0328 -0.0140 37  PRO B N   
2568 C CA  . PRO B 37  ? 0.2736 0.2921 0.2407 0.0115  -0.0312 -0.0121 37  PRO B CA  
2569 C C   . PRO B 37  ? 0.3017 0.3136 0.2681 0.0079  -0.0257 -0.0085 37  PRO B C   
2570 O O   . PRO B 37  ? 0.3509 0.3587 0.3233 0.0034  -0.0232 -0.0105 37  PRO B O   
2571 C CB  . PRO B 37  ? 0.3022 0.3207 0.2694 0.0109  -0.0338 -0.0197 37  PRO B CB  
2572 C CG  . PRO B 37  ? 0.3840 0.4077 0.3606 0.0109  -0.0384 -0.0251 37  PRO B CG  
2573 C CD  . PRO B 37  ? 0.3391 0.3626 0.3242 0.0081  -0.0357 -0.0220 37  PRO B CD  
2574 N N   . GLY B 38  ? 0.3178 0.3288 0.2770 0.0101  -0.0238 -0.0032 38  GLY B N   
2575 C CA  . GLY B 38  ? 0.3370 0.3421 0.2956 0.0074  -0.0197 -0.0001 38  GLY B CA  
2576 C C   . GLY B 38  ? 0.2959 0.2998 0.2471 0.0092  -0.0185 0.0003  38  GLY B C   
2577 O O   . GLY B 38  ? 0.2862 0.2944 0.2314 0.0134  -0.0201 0.0002  38  GLY B O   
2578 N N   . GLY B 39  ? 0.3056 0.3034 0.2567 0.0065  -0.0158 0.0007  39  GLY B N   
2579 C CA  . GLY B 39  ? 0.3303 0.3267 0.2757 0.0083  -0.0147 0.0007  39  GLY B CA  
2580 C C   . GLY B 39  ? 0.3497 0.3397 0.2947 0.0056  -0.0146 -0.0047 39  GLY B C   
2581 O O   . GLY B 39  ? 0.3105 0.2995 0.2586 0.0036  -0.0160 -0.0095 39  GLY B O   
2582 N N   . GLY B 40  ? 0.2674 0.2530 0.2096 0.0057  -0.0129 -0.0037 40  GLY B N   
2583 C CA  . GLY B 40  ? 0.2733 0.2511 0.2145 0.0033  -0.0126 -0.0076 40  GLY B CA  
2584 C C   . GLY B 40  ? 0.3059 0.2838 0.2458 0.0039  -0.0148 -0.0139 40  GLY B C   
2585 O O   . GLY B 40  ? 0.3154 0.2896 0.2591 0.0005  -0.0151 -0.0176 40  GLY B O   
2586 N N   . GLY B 41  ? 0.3057 0.2878 0.2407 0.0084  -0.0162 -0.0152 41  GLY B N   
2587 C CA  . GLY B 41  ? 0.2688 0.2506 0.2019 0.0098  -0.0191 -0.0220 41  GLY B CA  
2588 C C   . GLY B 41  ? 0.3280 0.3139 0.2654 0.0088  -0.0221 -0.0256 41  GLY B C   
2589 O O   . GLY B 41  ? 0.2651 0.2484 0.2059 0.0070  -0.0244 -0.0317 41  GLY B O   
2590 N N   . ILE B 42  ? 0.2926 0.2850 0.2311 0.0101  -0.0224 -0.0219 42  ILE B N   
2591 C CA  . ILE B 42  ? 0.2902 0.2872 0.2336 0.0097  -0.0258 -0.0251 42  ILE B CA  
2592 C C   . ILE B 42  ? 0.2963 0.2889 0.2492 0.0037  -0.0247 -0.0274 42  ILE B C   
2593 O O   . ILE B 42  ? 0.2903 0.2833 0.2489 0.0021  -0.0275 -0.0334 42  ILE B O   
2594 C CB  . ILE B 42  ? 0.2868 0.2906 0.2290 0.0127  -0.0263 -0.0200 42  ILE B CB  
2595 C CG1 . ILE B 42  ? 0.3014 0.3106 0.2339 0.0192  -0.0283 -0.0197 42  ILE B CG1 
2596 C CG2 . ILE B 42  ? 0.3323 0.3396 0.2825 0.0110  -0.0291 -0.0224 42  ILE B CG2 
2597 C CD1 . ILE B 42  ? 0.3263 0.3411 0.2557 0.0227  -0.0279 -0.0131 42  ILE B CD1 
2598 N N   . ASN B 43  ? 0.2560 0.2443 0.2109 0.0005  -0.0206 -0.0228 43  ASN B N   
2599 C CA  . ASN B 43  ? 0.2477 0.2313 0.2101 -0.0049 -0.0183 -0.0244 43  ASN B CA  
2600 C C   . ASN B 43  ? 0.2598 0.2359 0.2229 -0.0078 -0.0174 -0.0285 43  ASN B C   
2601 O O   . ASN B 43  ? 0.2673 0.2413 0.2381 -0.0119 -0.0166 -0.0318 43  ASN B O   
2602 C CB  . ASN B 43  ? 0.2660 0.2465 0.2287 -0.0068 -0.0143 -0.0188 43  ASN B CB  
2603 C CG  . ASN B 43  ? 0.4369 0.4240 0.4032 -0.0054 -0.0152 -0.0160 43  ASN B CG  
2604 O OD1 . ASN B 43  ? 0.4269 0.4199 0.3986 -0.0048 -0.0180 -0.0190 43  ASN B OD1 
2605 N ND2 . ASN B 43  ? 0.5798 0.5657 0.5439 -0.0048 -0.0134 -0.0106 43  ASN B ND2 
2606 N N   . VAL B 44  ? 0.2579 0.2298 0.2136 -0.0057 -0.0175 -0.0284 44  VAL B N   
2607 C CA  . VAL B 44  ? 0.2407 0.2048 0.1968 -0.0078 -0.0175 -0.0326 44  VAL B CA  
2608 C C   . VAL B 44  ? 0.2660 0.2335 0.2276 -0.0078 -0.0218 -0.0397 44  VAL B C   
2609 O O   . VAL B 44  ? 0.2949 0.2576 0.2636 -0.0122 -0.0213 -0.0434 44  VAL B O   
2610 C CB  . VAL B 44  ? 0.2778 0.2375 0.2253 -0.0046 -0.0176 -0.0317 44  VAL B CB  
2611 C CG1 . VAL B 44  ? 0.2869 0.2387 0.2350 -0.0060 -0.0187 -0.0369 44  VAL B CG1 
2612 C CG2 . VAL B 44  ? 0.2667 0.2215 0.2104 -0.0053 -0.0141 -0.0257 44  VAL B CG2 
2613 N N   . ALA B 45  ? 0.2629 0.2385 0.2214 -0.0029 -0.0261 -0.0417 45  ALA B N   
2614 C CA  . ALA B 45  ? 0.2712 0.2507 0.2345 -0.0021 -0.0315 -0.0492 45  ALA B CA  
2615 C C   . ALA B 45  ? 0.2846 0.2675 0.2605 -0.0063 -0.0319 -0.0511 45  ALA B C   
2616 O O   . ALA B 45  ? 0.3056 0.2879 0.2904 -0.0089 -0.0347 -0.0575 45  ALA B O   
2617 C CB  . ALA B 45  ? 0.2807 0.2681 0.2359 0.0049  -0.0359 -0.0502 45  ALA B CB  
2618 N N   . ARG B 46  ? 0.2676 0.2543 0.2453 -0.0070 -0.0292 -0.0458 46  ARG B N   
2619 C CA  . ARG B 46  ? 0.3050 0.2955 0.2952 -0.0106 -0.0290 -0.0474 46  ARG B CA  
2620 C C   . ARG B 46  ? 0.2714 0.2544 0.2698 -0.0173 -0.0240 -0.0482 46  ARG B C   
2621 O O   . ARG B 46  ? 0.2783 0.2632 0.2893 -0.0208 -0.0248 -0.0529 46  ARG B O   
2622 C CB  . ARG B 46  ? 0.3022 0.2974 0.2918 -0.0093 -0.0271 -0.0415 46  ARG B CB  
2623 C CG  . ARG B 46  ? 0.3033 0.3062 0.2865 -0.0030 -0.0317 -0.0401 46  ARG B CG  
2624 C CD  . ARG B 46  ? 0.3251 0.3307 0.3079 -0.0022 -0.0294 -0.0336 46  ARG B CD  
2625 N NE  . ARG B 46  ? 0.3785 0.3878 0.3735 -0.0049 -0.0293 -0.0353 46  ARG B NE  
2626 C CZ  . ARG B 46  ? 0.4704 0.4786 0.4689 -0.0070 -0.0251 -0.0312 46  ARG B CZ  
2627 N NH1 . ARG B 46  ? 0.4500 0.4532 0.4410 -0.0069 -0.0213 -0.0253 46  ARG B NH1 
2628 N NH2 . ARG B 46  ? 0.5323 0.5445 0.5424 -0.0089 -0.0250 -0.0334 46  ARG B NH2 
2629 N N   . ALA B 47  ? 0.2639 0.2385 0.2554 -0.0188 -0.0189 -0.0434 47  ALA B N   
2630 C CA  . ALA B 47  ? 0.2797 0.2455 0.2759 -0.0246 -0.0135 -0.0430 47  ALA B CA  
2631 C C   . ALA B 47  ? 0.2549 0.2168 0.2568 -0.0268 -0.0159 -0.0492 47  ALA B C   
2632 O O   . ALA B 47  ? 0.3042 0.2641 0.3176 -0.0320 -0.0135 -0.0516 47  ALA B O   
2633 C CB  . ALA B 47  ? 0.2797 0.2365 0.2649 -0.0245 -0.0091 -0.0371 47  ALA B CB  
2634 N N   . ILE B 48  ? 0.2313 0.1921 0.2259 -0.0228 -0.0205 -0.0519 48  ILE B N   
2635 C CA  . ILE B 48  ? 0.2399 0.1963 0.2393 -0.0242 -0.0238 -0.0586 48  ILE B CA  
2636 C C   . ILE B 48  ? 0.3117 0.2757 0.3255 -0.0260 -0.0282 -0.0653 48  ILE B C   
2637 O O   . ILE B 48  ? 0.2893 0.2492 0.3144 -0.0307 -0.0281 -0.0696 48  ILE B O   
2638 C CB  . ILE B 48  ? 0.3120 0.2670 0.3001 -0.0184 -0.0283 -0.0609 48  ILE B CB  
2639 C CG1 . ILE B 48  ? 0.3017 0.2472 0.2795 -0.0180 -0.0240 -0.0555 48  ILE B CG1 
2640 C CG2 . ILE B 48  ? 0.3623 0.3152 0.3564 -0.0187 -0.0338 -0.0696 48  ILE B CG2 
2641 C CD1 . ILE B 48  ? 0.2840 0.2294 0.2507 -0.0117 -0.0273 -0.0568 48  ILE B CD1 
2642 N N   . ALA B 49  ? 0.3127 0.2875 0.3268 -0.0221 -0.0322 -0.0661 49  ALA B N   
2643 C CA  . ALA B 49  ? 0.3141 0.2970 0.3422 -0.0231 -0.0372 -0.0725 49  ALA B CA  
2644 C C   . ALA B 49  ? 0.3128 0.2953 0.3565 -0.0302 -0.0316 -0.0716 49  ALA B C   
2645 O O   . ALA B 49  ? 0.3116 0.2953 0.3706 -0.0341 -0.0336 -0.0776 49  ALA B O   
2646 C CB  . ALA B 49  ? 0.3310 0.3246 0.3549 -0.0173 -0.0419 -0.0720 49  ALA B CB  
2647 N N   . HIS B 50  ? 0.3179 0.2990 0.3584 -0.0317 -0.0245 -0.0644 50  HIS B N   
2648 C CA  . HIS B 50  ? 0.3339 0.3144 0.3872 -0.0379 -0.0177 -0.0628 50  HIS B CA  
2649 C C   . HIS B 50  ? 0.3316 0.3020 0.3911 -0.0439 -0.0135 -0.0641 50  HIS B C   
2650 O O   . HIS B 50  ? 0.3516 0.3233 0.4274 -0.0494 -0.0103 -0.0663 50  HIS B O   
2651 C CB  . HIS B 50  ? 0.3077 0.2861 0.3525 -0.0376 -0.0109 -0.0549 50  HIS B CB  
2652 C CG  . HIS B 50  ? 0.4045 0.3924 0.4468 -0.0329 -0.0140 -0.0532 50  HIS B CG  
2653 N ND1 . HIS B 50  ? 0.4631 0.4504 0.4994 -0.0320 -0.0093 -0.0470 50  HIS B ND1 
2654 C CD2 . HIS B 50  ? 0.4438 0.4412 0.4884 -0.0285 -0.0215 -0.0568 50  HIS B CD2 
2655 C CE1 . HIS B 50  ? 0.5381 0.5340 0.5740 -0.0277 -0.0136 -0.0466 50  HIS B CE1 
2656 N NE2 . HIS B 50  ? 0.5750 0.5771 0.6153 -0.0254 -0.0209 -0.0522 50  HIS B NE2 
2657 N N   . LEU B 51  ? 0.2415 0.2020 0.2889 -0.0428 -0.0134 -0.0626 51  LEU B N   
2658 C CA  . LEU B 51  ? 0.2460 0.1949 0.2971 -0.0480 -0.0091 -0.0626 51  LEU B CA  
2659 C C   . LEU B 51  ? 0.3353 0.2839 0.3976 -0.0496 -0.0154 -0.0709 51  LEU B C   
2660 O O   . LEU B 51  ? 0.3915 0.3302 0.4588 -0.0541 -0.0127 -0.0716 51  LEU B O   
2661 C CB  . LEU B 51  ? 0.2868 0.2244 0.3203 -0.0460 -0.0063 -0.0570 51  LEU B CB  
2662 C CG  . LEU B 51  ? 0.3353 0.2713 0.3589 -0.0453 0.0000  -0.0490 51  LEU B CG  
2663 C CD1 . LEU B 51  ? 0.3400 0.2650 0.3470 -0.0429 0.0016  -0.0442 51  LEU B CD1 
2664 C CD2 . LEU B 51  ? 0.2968 0.2309 0.3297 -0.0511 0.0082  -0.0463 51  LEU B CD2 
2665 N N   . GLY B 52  ? 0.3658 0.3247 0.4319 -0.0456 -0.0239 -0.0773 52  GLY B N   
2666 C CA  . GLY B 52  ? 0.3964 0.3563 0.4748 -0.0467 -0.0311 -0.0866 52  GLY B CA  
2667 C C   . GLY B 52  ? 0.3654 0.3213 0.4321 -0.0412 -0.0384 -0.0911 52  GLY B C   
2668 O O   . GLY B 52  ? 0.3480 0.3029 0.4234 -0.0418 -0.0448 -0.0994 52  GLY B O   
2669 N N   . GLY B 53  ? 0.3430 0.2967 0.3906 -0.0358 -0.0374 -0.0861 53  GLY B N   
2670 C CA  . GLY B 53  ? 0.3388 0.2898 0.3742 -0.0298 -0.0434 -0.0900 53  GLY B CA  
2671 C C   . GLY B 53  ? 0.3565 0.3184 0.3820 -0.0221 -0.0490 -0.0912 53  GLY B C   
2672 O O   . GLY B 53  ? 0.3549 0.3263 0.3850 -0.0217 -0.0496 -0.0900 53  GLY B O   
2673 N N   . SER B 54  ? 0.3512 0.3116 0.3631 -0.0157 -0.0528 -0.0932 54  SER B N   
2674 C CA  . SER B 54  ? 0.4302 0.4000 0.4309 -0.0079 -0.0576 -0.0939 54  SER B CA  
2675 C C   . SER B 54  ? 0.4242 0.3915 0.4074 -0.0025 -0.0548 -0.0888 54  SER B C   
2676 O O   . SER B 54  ? 0.4046 0.3638 0.3829 -0.0016 -0.0547 -0.0907 54  SER B O   
2677 C CB  . SER B 54  ? 0.5441 0.5178 0.5475 -0.0040 -0.0675 -0.1046 54  SER B CB  
2678 O OG  . SER B 54  ? 0.5990 0.5820 0.5909 0.0038  -0.0720 -0.1047 54  SER B OG  
2679 N N   . ALA B 55  ? 0.3486 0.3227 0.3233 0.0011  -0.0526 -0.0823 55  ALA B N   
2680 C CA  . ALA B 55  ? 0.3512 0.3248 0.3110 0.0064  -0.0499 -0.0774 55  ALA B CA  
2681 C C   . ALA B 55  ? 0.3810 0.3649 0.3319 0.0131  -0.0526 -0.0758 55  ALA B C   
2682 O O   . ALA B 55  ? 0.3950 0.3853 0.3503 0.0122  -0.0529 -0.0732 55  ALA B O   
2683 C CB  . ALA B 55  ? 0.3273 0.2962 0.2860 0.0027  -0.0422 -0.0684 55  ALA B CB  
2684 N N   . THR B 56  ? 0.3381 0.3233 0.2764 0.0200  -0.0543 -0.0773 56  THR B N   
2685 C CA  . THR B 56  ? 0.3327 0.3268 0.2604 0.0270  -0.0560 -0.0750 56  THR B CA  
2686 C C   . THR B 56  ? 0.3649 0.3607 0.2863 0.0278  -0.0490 -0.0647 56  THR B C   
2687 O O   . THR B 56  ? 0.3645 0.3560 0.2815 0.0285  -0.0450 -0.0622 56  THR B O   
2688 C CB  . THR B 56  ? 0.3633 0.3585 0.2793 0.0348  -0.0605 -0.0815 56  THR B CB  
2689 O OG1 . THR B 56  ? 0.4128 0.4064 0.3350 0.0344  -0.0683 -0.0921 56  THR B OG1 
2690 C CG2 . THR B 56  ? 0.4004 0.4042 0.3036 0.0423  -0.0610 -0.0778 56  THR B CG2 
2691 N N   . ALA B 57  ? 0.3346 0.3364 0.2565 0.0280  -0.0479 -0.0589 57  ALA B N   
2692 C CA  . ALA B 57  ? 0.3139 0.3174 0.2316 0.0285  -0.0417 -0.0491 57  ALA B CA  
2693 C C   . ALA B 57  ? 0.3180 0.3275 0.2225 0.0363  -0.0412 -0.0462 57  ALA B C   
2694 O O   . ALA B 57  ? 0.3792 0.3944 0.2787 0.0408  -0.0450 -0.0471 57  ALA B O   
2695 C CB  . ALA B 57  ? 0.3032 0.3093 0.2287 0.0246  -0.0403 -0.0439 57  ALA B CB  
2696 N N   . ILE B 58  ? 0.3394 0.3474 0.2385 0.0381  -0.0364 -0.0425 58  ILE B N   
2697 C CA  . ILE B 58  ? 0.3553 0.3691 0.2429 0.0451  -0.0338 -0.0382 58  ILE B CA  
2698 C C   . ILE B 58  ? 0.3409 0.3573 0.2311 0.0433  -0.0281 -0.0277 58  ILE B C   
2699 O O   . ILE B 58  ? 0.3330 0.3453 0.2304 0.0384  -0.0246 -0.0243 58  ILE B O   
2700 C CB  . ILE B 58  ? 0.3923 0.4039 0.2739 0.0487  -0.0316 -0.0410 58  ILE B CB  
2701 C CG1 . ILE B 58  ? 0.4010 0.4084 0.2814 0.0501  -0.0376 -0.0520 58  ILE B CG1 
2702 C CG2 . ILE B 58  ? 0.3963 0.4148 0.2662 0.0562  -0.0280 -0.0365 58  ILE B CG2 
2703 C CD1 . ILE B 58  ? 0.3798 0.3827 0.2573 0.0523  -0.0358 -0.0555 58  ILE B CD1 
2704 N N   . PHE B 59  ? 0.3456 0.3683 0.2296 0.0474  -0.0274 -0.0225 59  PHE B N   
2705 C CA  . PHE B 59  ? 0.3575 0.3824 0.2447 0.0457  -0.0224 -0.0124 59  PHE B CA  
2706 C C   . PHE B 59  ? 0.2796 0.3109 0.1573 0.0518  -0.0212 -0.0067 59  PHE B C   
2707 O O   . PHE B 59  ? 0.3315 0.3653 0.2009 0.0566  -0.0258 -0.0106 59  PHE B O   
2708 C CB  . PHE B 59  ? 0.3382 0.3602 0.2369 0.0391  -0.0236 -0.0110 59  PHE B CB  
2709 C CG  . PHE B 59  ? 0.3529 0.3770 0.2525 0.0396  -0.0294 -0.0145 59  PHE B CG  
2710 C CD1 . PHE B 59  ? 0.3138 0.3422 0.2115 0.0419  -0.0299 -0.0088 59  PHE B CD1 
2711 C CD2 . PHE B 59  ? 0.3616 0.3832 0.2650 0.0378  -0.0345 -0.0236 59  PHE B CD2 
2712 C CE1 . PHE B 59  ? 0.3640 0.3946 0.2632 0.0429  -0.0359 -0.0124 59  PHE B CE1 
2713 C CE2 . PHE B 59  ? 0.3690 0.3934 0.2753 0.0383  -0.0403 -0.0274 59  PHE B CE2 
2714 C CZ  . PHE B 59  ? 0.3679 0.3970 0.2719 0.0411  -0.0412 -0.0219 59  PHE B CZ  
2715 N N   . PRO B 60  ? 0.3559 0.3895 0.2349 0.0516  -0.0152 0.0028  60  PRO B N   
2716 C CA  . PRO B 60  ? 0.3731 0.4118 0.2439 0.0567  -0.0133 0.0099  60  PRO B CA  
2717 C C   . PRO B 60  ? 0.3812 0.4195 0.2567 0.0544  -0.0168 0.0127  60  PRO B C   
2718 O O   . PRO B 60  ? 0.4109 0.4458 0.2983 0.0481  -0.0173 0.0131  60  PRO B O   
2719 C CB  . PRO B 60  ? 0.3620 0.4025 0.2363 0.0559  -0.0054 0.0189  60  PRO B CB  
2720 C CG  . PRO B 60  ? 0.3604 0.3960 0.2482 0.0486  -0.0049 0.0177  60  PRO B CG  
2721 C CD  . PRO B 60  ? 0.3457 0.3771 0.2335 0.0473  -0.0100 0.0073  60  PRO B CD  
2722 N N   . ALA B 61  ? 0.3762 0.4178 0.2419 0.0600  -0.0195 0.0143  61  ALA B N   
2723 C CA  . ALA B 61  ? 0.3405 0.3821 0.2100 0.0591  -0.0231 0.0174  61  ALA B CA  
2724 C C   . ALA B 61  ? 0.4141 0.4588 0.2737 0.0647  -0.0201 0.0269  61  ALA B C   
2725 O O   . ALA B 61  ? 0.4512 0.4986 0.2963 0.0716  -0.0192 0.0272  61  ALA B O   
2726 C CB  . ALA B 61  ? 0.4398 0.4814 0.3085 0.0603  -0.0318 0.0079  61  ALA B CB  
2727 N N   . GLY B 62  ? 0.3991 0.4426 0.2659 0.0619  -0.0185 0.0348  62  GLY B N   
2728 C CA  . GLY B 62  ? 0.3973 0.4426 0.2560 0.0666  -0.0153 0.0450  62  GLY B CA  
2729 C C   . GLY B 62  ? 0.4383 0.4820 0.3011 0.0663  -0.0196 0.0487  62  GLY B C   
2730 O O   . GLY B 62  ? 0.3835 0.4246 0.2601 0.0604  -0.0215 0.0472  62  GLY B O   
2731 N N   . GLY B 63  ? 0.4468 0.4918 0.2967 0.0732  -0.0211 0.0535  63  GLY B N   
2732 C CA  . GLY B 63  ? 0.4593 0.5025 0.3118 0.0740  -0.0251 0.0581  63  GLY B CA  
2733 C C   . GLY B 63  ? 0.4641 0.5072 0.3234 0.0729  -0.0344 0.0487  63  GLY B C   
2734 O O   . GLY B 63  ? 0.3869 0.4314 0.2475 0.0719  -0.0383 0.0383  63  GLY B O   
2735 N N   . ALA B 64  ? 0.4503 0.4918 0.3150 0.0730  -0.0379 0.0525  64  ALA B N   
2736 C CA  . ALA B 64  ? 0.4146 0.4569 0.2876 0.0721  -0.0465 0.0442  64  ALA B CA  
2737 C C   . ALA B 64  ? 0.3672 0.4087 0.2569 0.0639  -0.0459 0.0369  64  ALA B C   
2738 O O   . ALA B 64  ? 0.3980 0.4413 0.2935 0.0627  -0.0517 0.0272  64  ALA B O   
2739 C CB  . ALA B 64  ? 0.3848 0.4252 0.2609 0.0742  -0.0495 0.0507  64  ALA B CB  
2740 N N   . THR B 65  ? 0.4044 0.4430 0.3020 0.0582  -0.0390 0.0416  65  THR B N   
2741 C CA  . THR B 65  ? 0.3972 0.4341 0.3083 0.0508  -0.0379 0.0355  65  THR B CA  
2742 C C   . THR B 65  ? 0.3590 0.3973 0.2664 0.0502  -0.0384 0.0270  65  THR B C   
2743 O O   . THR B 65  ? 0.3387 0.3769 0.2544 0.0466  -0.0413 0.0187  65  THR B O   
2744 C CB  . THR B 65  ? 0.3969 0.4300 0.3159 0.0456  -0.0311 0.0421  65  THR B CB  
2745 O OG1 . THR B 65  ? 0.3578 0.3915 0.2683 0.0478  -0.0254 0.0488  65  THR B OG1 
2746 C CG2 . THR B 65  ? 0.3755 0.4061 0.3022 0.0449  -0.0318 0.0482  65  THR B CG2 
2747 N N   . GLY B 66  ? 0.3307 0.3703 0.2260 0.0540  -0.0353 0.0291  66  GLY B N   
2748 C CA  . GLY B 66  ? 0.3824 0.4228 0.2729 0.0545  -0.0361 0.0211  66  GLY B CA  
2749 C C   . GLY B 66  ? 0.3815 0.4243 0.2693 0.0577  -0.0444 0.0118  66  GLY B C   
2750 O O   . GLY B 66  ? 0.3752 0.4175 0.2682 0.0548  -0.0469 0.0028  66  GLY B O   
2751 N N   . GLU B 67  ? 0.3460 0.3911 0.2263 0.0637  -0.0491 0.0139  67  GLU B N   
2752 C CA  . GLU B 67  ? 0.4054 0.4533 0.2835 0.0675  -0.0583 0.0050  67  GLU B CA  
2753 C C   . GLU B 67  ? 0.4075 0.4555 0.3035 0.0616  -0.0622 -0.0016 67  GLU B C   
2754 O O   . GLU B 67  ? 0.3910 0.4407 0.2915 0.0610  -0.0678 -0.0115 67  GLU B O   
2755 C CB  . GLU B 67  ? 0.3928 0.4426 0.2591 0.0756  -0.0628 0.0097  67  GLU B CB  
2756 C CG  . GLU B 67  ? 0.5732 0.6232 0.4197 0.0826  -0.0588 0.0161  67  GLU B CG  
2757 C CD  . GLU B 67  ? 0.7784 0.8288 0.6127 0.0903  -0.0620 0.0231  67  GLU B CD  
2758 O OE1 . GLU B 67  ? 0.8222 0.8714 0.6457 0.0935  -0.0554 0.0336  67  GLU B OE1 
2759 O OE2 . GLU B 67  ? 0.8182 0.8701 0.6543 0.0932  -0.0711 0.0182  67  GLU B OE2 
2760 N N   . HIS B 68  ? 0.3715 0.4179 0.2784 0.0571  -0.0590 0.0039  68  HIS B N   
2761 C CA  . HIS B 68  ? 0.3853 0.4320 0.3091 0.0518  -0.0616 -0.0018 68  HIS B CA  
2762 C C   . HIS B 68  ? 0.3619 0.4061 0.2937 0.0449  -0.0578 -0.0072 68  HIS B C   
2763 O O   . HIS B 68  ? 0.3432 0.3885 0.2860 0.0415  -0.0608 -0.0151 68  HIS B O   
2764 C CB  . HIS B 68  ? 0.4052 0.4504 0.3375 0.0497  -0.0593 0.0052  68  HIS B CB  
2765 C CG  . HIS B 68  ? 0.4618 0.5090 0.4098 0.0465  -0.0630 -0.0006 68  HIS B CG  
2766 N ND1 . HIS B 68  ? 0.5396 0.5916 0.4909 0.0500  -0.0712 -0.0072 68  HIS B ND1 
2767 C CD2 . HIS B 68  ? 0.4429 0.4882 0.4045 0.0405  -0.0594 -0.0010 68  HIS B CD2 
2768 C CE1 . HIS B 68  ? 0.6016 0.6552 0.5692 0.0459  -0.0721 -0.0112 68  HIS B CE1 
2769 N NE2 . HIS B 68  ? 0.5224 0.5717 0.4956 0.0403  -0.0647 -0.0075 68  HIS B NE2 
2770 N N   . LEU B 69  ? 0.3568 0.3976 0.2834 0.0431  -0.0511 -0.0028 69  LEU B N   
2771 C CA  . LEU B 69  ? 0.2939 0.3313 0.2256 0.0375  -0.0477 -0.0074 69  LEU B CA  
2772 C C   . LEU B 69  ? 0.3789 0.4176 0.3083 0.0389  -0.0525 -0.0169 69  LEU B C   
2773 O O   . LEU B 69  ? 0.3477 0.3849 0.2872 0.0340  -0.0533 -0.0236 69  LEU B O   
2774 C CB  . LEU B 69  ? 0.3332 0.3674 0.2587 0.0368  -0.0407 -0.0010 69  LEU B CB  
2775 C CG  . LEU B 69  ? 0.3789 0.4091 0.3063 0.0326  -0.0373 -0.0049 69  LEU B CG  
2776 C CD1 . LEU B 69  ? 0.3168 0.3433 0.2570 0.0257  -0.0360 -0.0077 69  LEU B CD1 
2777 C CD2 . LEU B 69  ? 0.3569 0.3853 0.2787 0.0330  -0.0312 0.0019  69  LEU B CD2 
2778 N N   . VAL B 70  ? 0.3507 0.3919 0.2667 0.0458  -0.0556 -0.0176 70  VAL B N   
2779 C CA  . VAL B 70  ? 0.3177 0.3599 0.2302 0.0482  -0.0612 -0.0272 70  VAL B CA  
2780 C C   . VAL B 70  ? 0.3634 0.4089 0.2866 0.0476  -0.0690 -0.0347 70  VAL B C   
2781 O O   . VAL B 70  ? 0.3768 0.4218 0.3075 0.0449  -0.0725 -0.0438 70  VAL B O   
2782 C CB  . VAL B 70  ? 0.3999 0.4442 0.2938 0.0569  -0.0631 -0.0260 70  VAL B CB  
2783 C CG1 . VAL B 70  ? 0.4332 0.4789 0.3233 0.0606  -0.0710 -0.0371 70  VAL B CG1 
2784 C CG2 . VAL B 70  ? 0.4063 0.4482 0.2917 0.0572  -0.0551 -0.0202 70  VAL B CG2 
2785 N N   . SER B 71  ? 0.3594 0.4080 0.2848 0.0498  -0.0717 -0.0310 71  SER B N   
2786 C CA  . SER B 71  ? 0.4135 0.4663 0.3504 0.0498  -0.0794 -0.0377 71  SER B CA  
2787 C C   . SER B 71  ? 0.3939 0.4456 0.3501 0.0412  -0.0768 -0.0417 71  SER B C   
2788 O O   . SER B 71  ? 0.4183 0.4726 0.3859 0.0393  -0.0819 -0.0505 71  SER B O   
2789 C CB  . SER B 71  ? 0.4045 0.4603 0.3395 0.0544  -0.0823 -0.0319 71  SER B CB  
2790 O OG  . SER B 71  ? 0.5852 0.6460 0.5287 0.0565  -0.0915 -0.0393 71  SER B OG  
2791 N N   . LEU B 72  ? 0.3393 0.3872 0.2993 0.0362  -0.0686 -0.0353 72  LEU B N   
2792 C CA  . LEU B 72  ? 0.3086 0.3546 0.2844 0.0284  -0.0648 -0.0380 72  LEU B CA  
2793 C C   . LEU B 72  ? 0.3575 0.4003 0.3361 0.0245  -0.0641 -0.0448 72  LEU B C   
2794 O O   . LEU B 72  ? 0.3537 0.3970 0.3464 0.0197  -0.0648 -0.0509 72  LEU B O   
2795 C CB  . LEU B 72  ? 0.3303 0.3718 0.3066 0.0247  -0.0567 -0.0297 72  LEU B CB  
2796 C CG  . LEU B 72  ? 0.4546 0.4986 0.4337 0.0269  -0.0572 -0.0240 72  LEU B CG  
2797 C CD1 . LEU B 72  ? 0.4371 0.4761 0.4143 0.0243  -0.0500 -0.0159 72  LEU B CD1 
2798 C CD2 . LEU B 72  ? 0.4621 0.5101 0.4575 0.0246  -0.0601 -0.0293 72  LEU B CD2 
2799 N N   . LEU B 73  ? 0.3116 0.3509 0.2775 0.0265  -0.0623 -0.0437 73  LEU B N   
2800 C CA  . LEU B 73  ? 0.3210 0.3560 0.2887 0.0233  -0.0618 -0.0499 73  LEU B CA  
2801 C C   . LEU B 73  ? 0.3491 0.3875 0.3212 0.0253  -0.0703 -0.0601 73  LEU B C   
2802 O O   . LEU B 73  ? 0.3581 0.3940 0.3404 0.0205  -0.0708 -0.0666 73  LEU B O   
2803 C CB  . LEU B 73  ? 0.3226 0.3533 0.2758 0.0257  -0.0580 -0.0464 73  LEU B CB  
2804 C CG  . LEU B 73  ? 0.3131 0.3395 0.2655 0.0223  -0.0497 -0.0380 73  LEU B CG  
2805 C CD1 . LEU B 73  ? 0.3488 0.3729 0.2881 0.0256  -0.0463 -0.0341 73  LEU B CD1 
2806 C CD2 . LEU B 73  ? 0.3248 0.3460 0.2889 0.0146  -0.0457 -0.0398 73  LEU B CD2 
2807 N N   . ALA B 74  ? 0.3720 0.4157 0.3366 0.0324  -0.0773 -0.0614 74  ALA B N   
2808 C CA  . ALA B 74  ? 0.4074 0.4550 0.3764 0.0351  -0.0870 -0.0716 74  ALA B CA  
2809 C C   . ALA B 74  ? 0.3962 0.4471 0.3871 0.0295  -0.0892 -0.0767 74  ALA B C   
2810 O O   . ALA B 74  ? 0.4628 0.5140 0.4646 0.0268  -0.0937 -0.0858 74  ALA B O   
2811 C CB  . ALA B 74  ? 0.4253 0.4777 0.3807 0.0445  -0.0940 -0.0710 74  ALA B CB  
2812 N N   . ASP B 75  ? 0.3920 0.4455 0.3900 0.0276  -0.0859 -0.0710 75  ASP B N   
2813 C CA  . ASP B 75  ? 0.4433 0.5008 0.4625 0.0226  -0.0868 -0.0750 75  ASP B CA  
2814 C C   . ASP B 75  ? 0.4750 0.5276 0.5067 0.0137  -0.0796 -0.0767 75  ASP B C   
2815 O O   . ASP B 75  ? 0.5134 0.5689 0.5637 0.0090  -0.0806 -0.0823 75  ASP B O   
2816 C CB  . ASP B 75  ? 0.4838 0.5447 0.5062 0.0235  -0.0845 -0.0682 75  ASP B CB  
2817 C CG  . ASP B 75  ? 0.5659 0.6311 0.5772 0.0323  -0.0919 -0.0662 75  ASP B CG  
2818 O OD1 . ASP B 75  ? 0.5634 0.6304 0.5668 0.0377  -0.0998 -0.0716 75  ASP B OD1 
2819 O OD2 . ASP B 75  ? 0.6280 0.6944 0.6380 0.0342  -0.0900 -0.0592 75  ASP B OD2 
2820 N N   . GLU B 76  ? 0.3567 0.4948 0.5181 0.0149  -0.0984 -0.1251 76  GLU B N   
2821 C CA  . GLU B 76  ? 0.3394 0.4752 0.5137 0.0029  -0.0835 -0.1271 76  GLU B CA  
2822 C C   . GLU B 76  ? 0.3622 0.4949 0.5323 -0.0024 -0.0823 -0.1337 76  GLU B C   
2823 O O   . GLU B 76  ? 0.3483 0.4754 0.5237 -0.0120 -0.0701 -0.1351 76  GLU B O   
2824 C CB  . GLU B 76  ? 0.3655 0.4876 0.5244 0.0003  -0.0710 -0.1132 76  GLU B CB  
2825 C CG  . GLU B 76  ? 0.3686 0.4918 0.5318 0.0044  -0.0707 -0.1068 76  GLU B CG  
2826 C CD  . GLU B 76  ? 0.4661 0.5750 0.6138 0.0019  -0.0599 -0.0939 76  GLU B CD  
2827 O OE1 . GLU B 76  ? 0.4163 0.5153 0.5521 -0.0031 -0.0526 -0.0906 76  GLU B OE1 
2828 O OE2 . GLU B 76  ? 0.5416 0.6487 0.6893 0.0054  -0.0595 -0.0875 76  GLU B OE2 
2829 N N   . ASN B 77  ? 0.3324 0.4665 0.4905 0.0044  -0.0952 -0.1378 77  ASN B N   
2830 C CA  . ASN B 77  ? 0.3869 0.5171 0.5382 0.0010  -0.0963 -0.1446 77  ASN B CA  
2831 C C   . ASN B 77  ? 0.3851 0.4999 0.5155 -0.0035 -0.0835 -0.1352 77  ASN B C   
2832 O O   . ASN B 77  ? 0.3683 0.4789 0.5014 -0.0108 -0.0777 -0.1407 77  ASN B O   
2833 C CB  . ASN B 77  ? 0.4406 0.5798 0.6210 -0.0071 -0.0945 -0.1581 77  ASN B CB  
2834 C CG  . ASN B 77  ? 0.5569 0.7076 0.7556 -0.0010 -0.1041 -0.1641 77  ASN B CG  
2835 O OD1 . ASN B 77  ? 0.5979 0.7559 0.8221 -0.0055 -0.0975 -0.1678 77  ASN B OD1 
2836 N ND2 . ASN B 77  ? 0.5045 0.6554 0.6887 0.0097  -0.1195 -0.1652 77  ASN B ND2 
2837 N N   . VAL B 78  ? 0.3079 0.4141 0.4184 0.0011  -0.0795 -0.1214 78  VAL B N   
2838 C CA  . VAL B 78  ? 0.3025 0.3952 0.3936 -0.0013 -0.0693 -0.1123 78  VAL B CA  
2839 C C   . VAL B 78  ? 0.3024 0.3889 0.3673 0.0069  -0.0753 -0.1086 78  VAL B C   
2840 O O   . VAL B 78  ? 0.3480 0.4334 0.3999 0.0152  -0.0805 -0.1017 78  VAL B O   
2841 C CB  . VAL B 78  ? 0.2978 0.3844 0.3853 -0.0020 -0.0604 -0.0997 78  VAL B CB  
2842 C CG1 . VAL B 78  ? 0.3541 0.4281 0.4232 -0.0032 -0.0518 -0.0909 78  VAL B CG1 
2843 C CG2 . VAL B 78  ? 0.3318 0.4214 0.4413 -0.0096 -0.0531 -0.1029 78  VAL B CG2 
2844 N N   . PRO B 79  ? 0.2914 0.3724 0.3474 0.0049  -0.0740 -0.1134 79  PRO B N   
2845 C CA  . PRO B 79  ? 0.3600 0.4335 0.3896 0.0128  -0.0782 -0.1108 79  PRO B CA  
2846 C C   . PRO B 79  ? 0.3751 0.4395 0.3869 0.0159  -0.0694 -0.0962 79  PRO B C   
2847 O O   . PRO B 79  ? 0.3127 0.3740 0.3308 0.0102  -0.0591 -0.0901 79  PRO B O   
2848 C CB  . PRO B 79  ? 0.4246 0.4934 0.4523 0.0081  -0.0762 -0.1193 79  PRO B CB  
2849 C CG  . PRO B 79  ? 0.5084 0.5784 0.5571 -0.0028 -0.0668 -0.1222 79  PRO B CG  
2850 C CD  . PRO B 79  ? 0.4140 0.4943 0.4837 -0.0045 -0.0686 -0.1226 79  PRO B CD  
2851 N N   . VAL B 80  ? 0.3309 0.3903 0.3208 0.0250  -0.0735 -0.0908 80  VAL B N   
2852 C CA  . VAL B 80  ? 0.3522 0.4038 0.3273 0.0279  -0.0647 -0.0772 80  VAL B CA  
2853 C C   . VAL B 80  ? 0.3720 0.4137 0.3204 0.0346  -0.0633 -0.0749 80  VAL B C   
2854 O O   . VAL B 80  ? 0.3767 0.4164 0.3134 0.0393  -0.0719 -0.0830 80  VAL B O   
2855 C CB  . VAL B 80  ? 0.3468 0.3997 0.3211 0.0325  -0.0675 -0.0690 80  VAL B CB  
2856 C CG1 . VAL B 80  ? 0.3524 0.4147 0.3520 0.0271  -0.0692 -0.0719 80  VAL B CG1 
2857 C CG2 . VAL B 80  ? 0.3288 0.3792 0.2853 0.0427  -0.0792 -0.0712 80  VAL B CG2 
2858 N N   . ALA B 81  ? 0.3714 0.4066 0.3109 0.0351  -0.0523 -0.0641 81  ALA B N   
2859 C CA  . ALA B 81  ? 0.4134 0.4385 0.3275 0.0419  -0.0478 -0.0594 81  ALA B CA  
2860 C C   . ALA B 81  ? 0.4042 0.4259 0.3149 0.0434  -0.0394 -0.0458 81  ALA B C   
2861 O O   . ALA B 81  ? 0.4040 0.4275 0.3279 0.0380  -0.0304 -0.0401 81  ALA B O   
2862 C CB  . ALA B 81  ? 0.4317 0.4530 0.3436 0.0390  -0.0401 -0.0623 81  ALA B CB  
2863 N N   . THR B 82  ? 0.4026 0.4185 0.2958 0.0509  -0.0430 -0.0408 82  THR B N   
2864 C CA  . THR B 82  ? 0.4135 0.4256 0.3050 0.0518  -0.0357 -0.0282 82  THR B CA  
2865 C C   . THR B 82  ? 0.4235 0.4231 0.2900 0.0577  -0.0259 -0.0201 82  THR B C   
2866 O O   . THR B 82  ? 0.4280 0.4193 0.2714 0.0641  -0.0277 -0.0240 82  THR B O   
2867 C CB  . THR B 82  ? 0.4015 0.4148 0.2937 0.0553  -0.0454 -0.0266 82  THR B CB  
2868 O OG1 . THR B 82  ? 0.4676 0.4737 0.3363 0.0646  -0.0554 -0.0309 82  THR B OG1 
2869 C CG2 . THR B 82  ? 0.4339 0.4599 0.3531 0.0491  -0.0526 -0.0340 82  THR B CG2 
2870 N N   . VAL B 83  ? 0.4426 0.4401 0.3143 0.0554  -0.0151 -0.0091 83  VAL B N   
2871 C CA  . VAL B 83  ? 0.4811 0.4666 0.3323 0.0602  -0.0035 0.0002  83  VAL B CA  
2872 C C   . VAL B 83  ? 0.4674 0.4470 0.3134 0.0625  -0.0040 0.0094  83  VAL B C   
2873 O O   . VAL B 83  ? 0.4252 0.4118 0.2927 0.0569  -0.0045 0.0129  83  VAL B O   
2874 C CB  . VAL B 83  ? 0.4445 0.4331 0.3103 0.0547  0.0114  0.0052  83  VAL B CB  
2875 C CG1 . VAL B 83  ? 0.4493 0.4270 0.3009 0.0579  0.0253  0.0165  83  VAL B CG1 
2876 C CG2 . VAL B 83  ? 0.4162 0.4069 0.2811 0.0544  0.0133  -0.0030 83  VAL B CG2 
2877 N N   . GLU B 84  ? 0.4775 0.4423 0.2930 0.0711  -0.0042 0.0132  84  GLU B N   
2878 C CA  . GLU B 84  ? 0.5075 0.4632 0.3139 0.0742  -0.0042 0.0225  84  GLU B CA  
2879 C C   . GLU B 84  ? 0.5295 0.4827 0.3456 0.0688  0.0129  0.0340  84  GLU B C   
2880 O O   . GLU B 84  ? 0.5532 0.5009 0.3615 0.0689  0.0268  0.0374  84  GLU B O   
2881 C CB  . GLU B 84  ? 0.6393 0.5762 0.4063 0.0857  -0.0085 0.0238  84  GLU B CB  
2882 C CG  . GLU B 84  ? 0.6871 0.6159 0.4442 0.0910  -0.0177 0.0283  84  GLU B CG  
2883 C CD  . GLU B 84  ? 0.9851 0.8968 0.7041 0.1037  -0.0285 0.0254  84  GLU B CD  
2884 O OE1 . GLU B 84  ? 1.0059 0.9018 0.6948 0.1093  -0.0205 0.0277  84  GLU B OE1 
2885 O OE2 . GLU B 84  ? 1.0942 1.0079 0.8133 0.1086  -0.0455 0.0204  84  GLU B OE2 
2886 N N   . ALA B 85  ? 0.4803 0.4377 0.3151 0.0641  0.0120  0.0392  85  ALA B N   
2887 C CA  . ALA B 85  ? 0.4509 0.4069 0.2991 0.0582  0.0264  0.0492  85  ALA B CA  
2888 C C   . ALA B 85  ? 0.5266 0.4678 0.3593 0.0616  0.0288  0.0594  85  ALA B C   
2889 O O   . ALA B 85  ? 0.5626 0.4998 0.3854 0.0665  0.0163  0.0580  85  ALA B O   
2890 C CB  . ALA B 85  ? 0.4126 0.3844 0.2967 0.0490  0.0242  0.0469  85  ALA B CB  
2891 N N   . LYS B 86  ? 0.5489 0.4819 0.3809 0.0589  0.0451  0.0692  86  LYS B N   
2892 C CA  . LYS B 86  ? 0.5945 0.5109 0.4115 0.0612  0.0501  0.0798  86  LYS B CA  
2893 C C   . LYS B 86  ? 0.5510 0.4732 0.3896 0.0565  0.0417  0.0816  86  LYS B C   
2894 O O   . LYS B 86  ? 0.5979 0.5094 0.4211 0.0617  0.0340  0.0847  86  LYS B O   
2895 C CB  . LYS B 86  ? 0.7053 0.6132 0.5222 0.0576  0.0716  0.0893  86  LYS B CB  
2896 C CG  . LYS B 86  ? 0.8200 0.7182 0.6116 0.0630  0.0829  0.0890  86  LYS B CG  
2897 C CD  . LYS B 86  ? 0.9794 0.8510 0.7266 0.0727  0.0860  0.0957  86  LYS B CD  
2898 C CE  . LYS B 86  ? 1.0602 0.9216 0.7773 0.0801  0.0921  0.0924  86  LYS B CE  
2899 N NZ  . LYS B 86  ? 1.0833 0.9579 0.8027 0.0831  0.0747  0.0793  86  LYS B NZ  
2900 N N   . ASP B 87  ? 0.4858 0.4236 0.3588 0.0474  0.0431  0.0796  87  ASP B N   
2901 C CA  . ASP B 87  ? 0.4739 0.4164 0.3678 0.0425  0.0363  0.0812  87  ASP B CA  
2902 C C   . ASP B 87  ? 0.4584 0.4099 0.3560 0.0451  0.0187  0.0720  87  ASP B C   
2903 O O   . ASP B 87  ? 0.4571 0.4199 0.3607 0.0448  0.0135  0.0628  87  ASP B O   
2904 C CB  . ASP B 87  ? 0.4686 0.4226 0.3957 0.0327  0.0431  0.0816  87  ASP B CB  
2905 C CG  . ASP B 87  ? 0.5283 0.4815 0.4729 0.0277  0.0397  0.0858  87  ASP B CG  
2906 O OD1 . ASP B 87  ? 0.5729 0.5144 0.5025 0.0315  0.0357  0.0904  87  ASP B OD1 
2907 O OD2 . ASP B 87  ? 0.4582 0.4211 0.4302 0.0204  0.0403  0.0841  87  ASP B OD2 
2908 N N   . TRP B 88  ? 0.3969 0.3430 0.2918 0.0475  0.0104  0.0742  88  TRP B N   
2909 C CA  . TRP B 88  ? 0.4045 0.3582 0.3015 0.0513  -0.0055 0.0655  88  TRP B CA  
2910 C C   . TRP B 88  ? 0.3766 0.3467 0.3029 0.0440  -0.0099 0.0581  88  TRP B C   
2911 O O   . TRP B 88  ? 0.3733 0.3460 0.3186 0.0368  -0.0045 0.0615  88  TRP B O   
2912 C CB  . TRP B 88  ? 0.3881 0.3310 0.2738 0.0570  -0.0131 0.0697  88  TRP B CB  
2913 C CG  . TRP B 88  ? 0.4774 0.4203 0.3825 0.0512  -0.0126 0.0741  88  TRP B CG  
2914 C CD1 . TRP B 88  ? 0.4692 0.4235 0.3964 0.0476  -0.0206 0.0681  88  TRP B CD1 
2915 C CD2 . TRP B 88  ? 0.5117 0.4411 0.4145 0.0485  -0.0036 0.0852  88  TRP B CD2 
2916 N NE1 . TRP B 88  ? 0.5113 0.4596 0.4487 0.0434  -0.0179 0.0746  88  TRP B NE1 
2917 C CE2 . TRP B 88  ? 0.5303 0.4640 0.4544 0.0436  -0.0080 0.0848  88  TRP B CE2 
2918 C CE3 . TRP B 88  ? 0.5305 0.4437 0.4152 0.0496  0.0085  0.0951  88  TRP B CE3 
2919 C CZ2 . TRP B 88  ? 0.5662 0.4889 0.4948 0.0396  -0.0019 0.0937  88  TRP B CZ2 
2920 C CZ3 . TRP B 88  ? 0.7141 0.6169 0.6047 0.0450  0.0158  0.1042  88  TRP B CZ3 
2921 C CH2 . TRP B 88  ? 0.6988 0.6067 0.6117 0.0400  0.0099  0.1032  88  TRP B CH2 
2922 N N   . THR B 89  ? 0.3299 0.3099 0.2592 0.0460  -0.0197 0.0478  89  THR B N   
2923 C CA  . THR B 89  ? 0.3163 0.3094 0.2699 0.0396  -0.0233 0.0404  89  THR B CA  
2924 C C   . THR B 89  ? 0.3281 0.3204 0.2959 0.0365  -0.0260 0.0432  89  THR B C   
2925 O O   . THR B 89  ? 0.3982 0.3864 0.3602 0.0414  -0.0329 0.0441  89  THR B O   
2926 C CB  . THR B 89  ? 0.3366 0.3389 0.2907 0.0424  -0.0331 0.0288  89  THR B CB  
2927 O OG1 . THR B 89  ? 0.3436 0.3459 0.2851 0.0446  -0.0305 0.0256  89  THR B OG1 
2928 C CG2 . THR B 89  ? 0.3236 0.3366 0.3009 0.0355  -0.0349 0.0218  89  THR B CG2 
2929 N N   . ARG B 90  ? 0.3254 0.3206 0.3109 0.0290  -0.0212 0.0444  90  ARG B N   
2930 C CA  . ARG B 90  ? 0.3211 0.3128 0.3182 0.0259  -0.0229 0.0478  90  ARG B CA  
2931 C C   . ARG B 90  ? 0.3532 0.3514 0.3605 0.0256  -0.0310 0.0397  90  ARG B C   
2932 O O   . ARG B 90  ? 0.3162 0.3227 0.3254 0.0261  -0.0342 0.0312  90  ARG B O   
2933 C CB  . ARG B 90  ? 0.3256 0.3165 0.3371 0.0186  -0.0158 0.0517  90  ARG B CB  
2934 C CG  . ARG B 90  ? 0.3195 0.3036 0.3255 0.0181  -0.0062 0.0605  90  ARG B CG  
2935 C CD  . ARG B 90  ? 0.3243 0.2966 0.3209 0.0208  -0.0058 0.0687  90  ARG B CD  
2936 N NE  . ARG B 90  ? 0.3643 0.3293 0.3617 0.0177  0.0052  0.0775  90  ARG B NE  
2937 C CZ  . ARG B 90  ? 0.4929 0.4508 0.4730 0.0212  0.0134  0.0827  90  ARG B CZ  
2938 N NH1 . ARG B 90  ? 0.5245 0.4759 0.5088 0.0172  0.0252  0.0905  90  ARG B NH1 
2939 N NH2 . ARG B 90  ? 0.4145 0.3709 0.3731 0.0285  0.0100  0.0798  90  ARG B NH2 
2940 N N   . GLN B 91  ? 0.3404 0.3338 0.3543 0.0246  -0.0334 0.0423  91  GLN B N   
2941 C CA  . GLN B 91  ? 0.3291 0.3268 0.3518 0.0250  -0.0396 0.0354  91  GLN B CA  
2942 C C   . GLN B 91  ? 0.3850 0.3786 0.4199 0.0191  -0.0380 0.0361  91  GLN B C   
2943 O O   . GLN B 91  ? 0.4172 0.4021 0.4529 0.0174  -0.0361 0.0433  91  GLN B O   
2944 C CB  . GLN B 91  ? 0.3575 0.3515 0.3731 0.0321  -0.0460 0.0368  91  GLN B CB  
2945 C CG  . GLN B 91  ? 0.5405 0.5339 0.5394 0.0395  -0.0491 0.0375  91  GLN B CG  
2946 C CD  . GLN B 91  ? 0.7575 0.7444 0.7475 0.0476  -0.0563 0.0399  91  GLN B CD  
2947 O OE1 . GLN B 91  ? 0.8492 0.8231 0.8258 0.0502  -0.0541 0.0490  91  GLN B OE1 
2948 N NE2 . GLN B 91  ? 0.6853 0.6804 0.6832 0.0516  -0.0645 0.0314  91  GLN B NE2 
2949 N N   . ASN B 92  ? 0.2573 0.2558 0.3007 0.0161  -0.0386 0.0284  92  ASN B N   
2950 C CA  . ASN B 92  ? 0.2043 0.1966 0.2555 0.0122  -0.0384 0.0277  92  ASN B CA  
2951 C C   . ASN B 92  ? 0.2152 0.2076 0.2690 0.0154  -0.0423 0.0236  92  ASN B C   
2952 O O   . ASN B 92  ? 0.2874 0.2878 0.3407 0.0199  -0.0454 0.0191  92  ASN B O   
2953 C CB  . ASN B 92  ? 0.2433 0.2370 0.2993 0.0072  -0.0355 0.0222  92  ASN B CB  
2954 C CG  . ASN B 92  ? 0.3082 0.3015 0.3642 0.0043  -0.0320 0.0258  92  ASN B CG  
2955 O OD1 . ASN B 92  ? 0.3154 0.3046 0.3718 0.0040  -0.0308 0.0330  92  ASN B OD1 
2956 N ND2 . ASN B 92  ? 0.2982 0.2958 0.3549 0.0022  -0.0298 0.0206  92  ASN B ND2 
2957 N N   . LEU B 93  ? 0.2527 0.2361 0.3096 0.0136  -0.0425 0.0245  93  LEU B N   
2958 C CA  . LEU B 93  ? 0.2512 0.2334 0.3108 0.0171  -0.0451 0.0211  93  LEU B CA  
2959 C C   . LEU B 93  ? 0.2346 0.2129 0.2988 0.0136  -0.0421 0.0148  93  LEU B C   
2960 O O   . LEU B 93  ? 0.2541 0.2222 0.3163 0.0096  -0.0404 0.0166  93  LEU B O   
2961 C CB  . LEU B 93  ? 0.2157 0.1872 0.2714 0.0197  -0.0479 0.0285  93  LEU B CB  
2962 C CG  . LEU B 93  ? 0.2634 0.2330 0.3211 0.0249  -0.0511 0.0257  93  LEU B CG  
2963 C CD1 . LEU B 93  ? 0.2684 0.2497 0.3271 0.0315  -0.0550 0.0218  93  LEU B CD1 
2964 C CD2 . LEU B 93  ? 0.2518 0.2075 0.3045 0.0264  -0.0534 0.0333  93  LEU B CD2 
2965 N N   . HIS B 94  ? 0.1653 0.1512 0.2358 0.0157  -0.0415 0.0073  94  HIS B N   
2966 C CA  . HIS B 94  ? 0.1818 0.1633 0.2562 0.0130  -0.0368 0.0009  94  HIS B CA  
2967 C C   . HIS B 94  ? 0.2378 0.2175 0.3162 0.0178  -0.0382 -0.0006 94  HIS B C   
2968 O O   . HIS B 94  ? 0.2483 0.2393 0.3337 0.0229  -0.0417 -0.0036 94  HIS B O   
2969 C CB  . HIS B 94  ? 0.2202 0.2130 0.3018 0.0106  -0.0329 -0.0078 94  HIS B CB  
2970 C CG  . HIS B 94  ? 0.2692 0.2566 0.3545 0.0074  -0.0257 -0.0145 94  HIS B CG  
2971 N ND1 . HIS B 94  ? 0.3781 0.3705 0.4737 0.0101  -0.0236 -0.0204 94  HIS B ND1 
2972 C CD2 . HIS B 94  ? 0.2682 0.2444 0.3473 0.0022  -0.0195 -0.0162 94  HIS B CD2 
2973 C CE1 . HIS B 94  ? 0.3524 0.3366 0.4480 0.0060  -0.0149 -0.0253 94  HIS B CE1 
2974 N NE2 . HIS B 94  ? 0.2850 0.2582 0.3690 0.0014  -0.0125 -0.0227 94  HIS B NE2 
2975 N N   . VAL B 95  ? 0.2304 0.1952 0.3038 0.0170  -0.0363 0.0011  95  VAL B N   
2976 C CA  . VAL B 95  ? 0.2406 0.2015 0.3166 0.0219  -0.0371 -0.0001 95  VAL B CA  
2977 C C   . VAL B 95  ? 0.2509 0.2056 0.3289 0.0201  -0.0293 -0.0070 95  VAL B C   
2978 O O   . VAL B 95  ? 0.2726 0.2123 0.3406 0.0160  -0.0256 -0.0063 95  VAL B O   
2979 C CB  . VAL B 95  ? 0.2584 0.2041 0.3252 0.0235  -0.0415 0.0080  95  VAL B CB  
2980 C CG1 . VAL B 95  ? 0.2372 0.1782 0.3060 0.0295  -0.0426 0.0066  95  VAL B CG1 
2981 C CG2 . VAL B 95  ? 0.2606 0.2096 0.3244 0.0243  -0.0468 0.0156  95  VAL B CG2 
2982 N N   . HIS B 96  ? 0.2174 0.1827 0.3080 0.0234  -0.0267 -0.0141 96  HIS B N   
2983 C CA  . HIS B 96  ? 0.2463 0.2053 0.3398 0.0222  -0.0173 -0.0207 96  HIS B CA  
2984 C C   . HIS B 96  ? 0.2481 0.1969 0.3391 0.0279  -0.0183 -0.0192 96  HIS B C   
2985 O O   . HIS B 96  ? 0.2568 0.2146 0.3559 0.0342  -0.0244 -0.0189 96  HIS B O   
2986 C CB  . HIS B 96  ? 0.2464 0.2242 0.3594 0.0221  -0.0126 -0.0304 96  HIS B CB  
2987 C CG  . HIS B 96  ? 0.3169 0.2888 0.4349 0.0202  -0.0003 -0.0376 96  HIS B CG  
2988 N ND1 . HIS B 96  ? 0.2779 0.2410 0.3901 0.0132  0.0100  -0.0407 96  HIS B ND1 
2989 C CD2 . HIS B 96  ? 0.2767 0.2484 0.4037 0.0245  0.0042  -0.0421 96  HIS B CD2 
2990 C CE1 . HIS B 96  ? 0.3306 0.2877 0.4472 0.0130  0.0213  -0.0467 96  HIS B CE1 
2991 N NE2 . HIS B 96  ? 0.3535 0.3166 0.4803 0.0198  0.0183  -0.0478 96  HIS B NE2 
2992 N N   . VAL B 97  ? 0.2306 0.1589 0.3085 0.0262  -0.0130 -0.0185 97  VAL B N   
2993 C CA  . VAL B 97  ? 0.2336 0.1493 0.3068 0.0315  -0.0133 -0.0175 97  VAL B CA  
2994 C C   . VAL B 97  ? 0.2695 0.1868 0.3520 0.0330  -0.0021 -0.0264 97  VAL B C   
2995 O O   . VAL B 97  ? 0.2902 0.1965 0.3654 0.0286  0.0083  -0.0300 97  VAL B O   
2996 C CB  . VAL B 97  ? 0.2763 0.1662 0.3280 0.0295  -0.0150 -0.0120 97  VAL B CB  
2997 C CG1 . VAL B 97  ? 0.3614 0.2369 0.4071 0.0353  -0.0155 -0.0115 97  VAL B CG1 
2998 C CG2 . VAL B 97  ? 0.2921 0.1819 0.3387 0.0272  -0.0249 -0.0039 97  VAL B CG2 
2999 N N   . GLU B 98  ? 0.2654 0.1811 0.3378 0.0787  0.0429  -0.0144 98  GLU B N   
3000 C CA  . GLU B 98  ? 0.2796 0.2071 0.3658 0.0844  0.0510  -0.0175 98  GLU B CA  
3001 C C   . GLU B 98  ? 0.3225 0.2347 0.3974 0.0834  0.0627  -0.0264 98  GLU B C   
3002 O O   . GLU B 98  ? 0.3424 0.2634 0.4193 0.0814  0.0696  -0.0304 98  GLU B O   
3003 C CB  . GLU B 98  ? 0.2989 0.2348 0.4061 0.0968  0.0506  -0.0124 98  GLU B CB  
3004 C CG  . GLU B 98  ? 0.4900 0.4470 0.6192 0.1023  0.0561  -0.0141 98  GLU B CG  
3005 C CD  . GLU B 98  ? 0.6527 0.6318 0.7878 0.0954  0.0507  -0.0132 98  GLU B CD  
3006 O OE1 . GLU B 98  ? 0.5482 0.5322 0.6780 0.0910  0.0397  -0.0083 98  GLU B OE1 
3007 O OE2 . GLU B 98  ? 0.7539 0.7449 0.8990 0.0941  0.0583  -0.0175 98  GLU B OE2 
3008 N N   . ALA B 99  ? 0.3135 0.2017 0.3757 0.0845  0.0654  -0.0296 99  ALA B N   
3009 C CA  . ALA B 99  ? 0.3364 0.2068 0.3851 0.0847  0.0765  -0.0386 99  ALA B CA  
3010 C C   . ALA B 99  ? 0.3221 0.1880 0.3503 0.0744  0.0776  -0.0442 99  ALA B C   
3011 O O   . ALA B 99  ? 0.3698 0.2297 0.3896 0.0748  0.0883  -0.0507 99  ALA B O   
3012 C CB  . ALA B 99  ? 0.4326 0.2766 0.4710 0.0873  0.0773  -0.0412 99  ALA B CB  
3013 N N   . SER B 100 ? 0.3498 0.2178 0.3695 0.0657  0.0668  -0.0415 100 SER B N   
3014 C CA  . SER B 100 ? 0.3756 0.2371 0.3747 0.0563  0.0654  -0.0461 100 SER B CA  
3015 C C   . SER B 100 ? 0.4165 0.2989 0.4216 0.0515  0.0619  -0.0425 100 SER B C   
3016 O O   . SER B 100 ? 0.4139 0.2925 0.4037 0.0452  0.0633  -0.0459 100 SER B O   
3017 C CB  . SER B 100 ? 0.3705 0.2164 0.3550 0.0496  0.0554  -0.0469 100 SER B CB  
3018 O OG  . SER B 100 ? 0.3402 0.1989 0.3372 0.0481  0.0458  -0.0394 100 SER B OG  
3019 N N   . GLY B 101 ? 0.3164 0.2193 0.3421 0.0544  0.0570  -0.0358 101 GLY B N   
3020 C CA  . GLY B 101 ? 0.3252 0.2472 0.3573 0.0496  0.0522  -0.0327 101 GLY B CA  
3021 C C   . GLY B 101 ? 0.3394 0.2586 0.3596 0.0416  0.0413  -0.0311 101 GLY B C   
3022 O O   . GLY B 101 ? 0.3619 0.2933 0.3838 0.0369  0.0371  -0.0294 101 GLY B O   
3023 N N   . GLU B 102 ? 0.3258 0.2291 0.3357 0.0400  0.0370  -0.0320 102 GLU B N   
3024 C CA  . GLU B 102 ? 0.3081 0.2092 0.3097 0.0330  0.0272  -0.0308 102 GLU B CA  
3025 C C   . GLU B 102 ? 0.3293 0.2445 0.3447 0.0344  0.0203  -0.0237 102 GLU B C   
3026 O O   . GLU B 102 ? 0.3035 0.2238 0.3311 0.0411  0.0219  -0.0196 102 GLU B O   
3027 C CB  . GLU B 102 ? 0.3421 0.2216 0.3300 0.0301  0.0251  -0.0349 102 GLU B CB  
3028 C CG  . GLU B 102 ? 0.4323 0.2944 0.4013 0.0284  0.0306  -0.0427 102 GLU B CG  
3029 C CD  . GLU B 102 ? 0.7021 0.5423 0.6581 0.0255  0.0270  -0.0476 102 GLU B CD  
3030 O OE1 . GLU B 102 ? 0.8049 0.6429 0.7701 0.0261  0.0234  -0.0447 102 GLU B OE1 
3031 O OE2 . GLU B 102 ? 0.7128 0.5375 0.6489 0.0223  0.0276  -0.0543 102 GLU B OE2 
3032 N N   . GLN B 103 ? 0.2826 0.2032 0.2948 0.0286  0.0128  -0.0223 103 GLN B N   
3033 C CA  . GLN B 103 ? 0.3062 0.2376 0.3275 0.0294  0.0070  -0.0161 103 GLN B CA  
3034 C C   . GLN B 103 ? 0.3114 0.2340 0.3267 0.0241  0.0018  -0.0160 103 GLN B C   
3035 O O   . GLN B 103 ? 0.3036 0.2189 0.3093 0.0183  -0.0008 -0.0206 103 GLN B O   
3036 C CB  . GLN B 103 ? 0.3896 0.3390 0.4164 0.0282  0.0035  -0.0142 103 GLN B CB  
3037 C CG  . GLN B 103 ? 0.3688 0.3171 0.3859 0.0210  0.0000  -0.0177 103 GLN B CG  
3038 C CD  . GLN B 103 ? 0.3826 0.3463 0.4048 0.0198  -0.0022 -0.0168 103 GLN B CD  
3039 O OE1 . GLN B 103 ? 0.3740 0.3507 0.4064 0.0229  -0.0047 -0.0130 103 GLN B OE1 
3040 N NE2 . GLN B 103 ? 0.3586 0.3195 0.3727 0.0150  -0.0017 -0.0203 103 GLN B NE2 
3041 N N   . TYR B 104 ? 0.2680 0.1910 0.2893 0.0260  0.0004  -0.0106 104 TYR B N   
3042 C CA  . TYR B 104 ? 0.2603 0.1770 0.2799 0.0207  -0.0032 -0.0099 104 TYR B CA  
3043 C C   . TYR B 104 ? 0.2767 0.2068 0.3015 0.0207  -0.0064 -0.0041 104 TYR B C   
3044 O O   . TYR B 104 ? 0.2911 0.2292 0.3204 0.0263  -0.0057 0.0012  104 TYR B O   
3045 C CB  . TYR B 104 ? 0.2314 0.1324 0.2520 0.0220  -0.0002 -0.0088 104 TYR B CB  
3046 C CG  . TYR B 104 ? 0.2964 0.1812 0.3091 0.0211  0.0025  -0.0160 104 TYR B CG  
3047 C CD1 . TYR B 104 ? 0.2707 0.1432 0.2768 0.0143  -0.0010 -0.0215 104 TYR B CD1 
3048 C CD2 . TYR B 104 ? 0.3256 0.2074 0.3371 0.0273  0.0084  -0.0180 104 TYR B CD2 
3049 C CE1 . TYR B 104 ? 0.2605 0.1165 0.2560 0.0135  0.0006  -0.0288 104 TYR B CE1 
3050 C CE2 . TYR B 104 ? 0.3225 0.1881 0.3241 0.0269  0.0119  -0.0253 104 TYR B CE2 
3051 C CZ  . TYR B 104 ? 0.3292 0.1811 0.3212 0.0198  0.0077  -0.0307 104 TYR B CZ  
3052 O OH  . TYR B 104 ? 0.4275 0.2614 0.4062 0.0193  0.0103  -0.0386 104 TYR B OH  
3053 N N   . ARG B 105 ? 0.2465 0.1788 0.2704 0.0148  -0.0103 -0.0053 105 ARG B N   
3054 C CA  . ARG B 105 ? 0.2086 0.1536 0.2357 0.0146  -0.0125 -0.0012 105 ARG B CA  
3055 C C   . ARG B 105 ? 0.2908 0.2320 0.3213 0.0105  -0.0124 0.0010  105 ARG B C   
3056 O O   . ARG B 105 ? 0.2529 0.1909 0.2847 0.0048  -0.0151 -0.0035 105 ARG B O   
3057 C CB  . ARG B 105 ? 0.3031 0.2575 0.3277 0.0120  -0.0166 -0.0051 105 ARG B CB  
3058 C CG  . ARG B 105 ? 0.3309 0.2886 0.3531 0.0143  -0.0158 -0.0077 105 ARG B CG  
3059 C CD  . ARG B 105 ? 0.4460 0.4047 0.4629 0.0099  -0.0192 -0.0126 105 ARG B CD  
3060 N NE  . ARG B 105 ? 0.3600 0.3298 0.3788 0.0087  -0.0230 -0.0117 105 ARG B NE  
3061 C CZ  . ARG B 105 ? 0.2596 0.2302 0.2746 0.0052  -0.0268 -0.0151 105 ARG B CZ  
3062 N NH1 . ARG B 105 ? 0.2640 0.2247 0.2717 0.0024  -0.0277 -0.0191 105 ARG B NH1 
3063 N NH2 . ARG B 105 ? 0.2517 0.2315 0.2687 0.0049  -0.0297 -0.0145 105 ARG B NH2 
3064 N N   . PHE B 106 ? 0.2395 0.1810 0.2720 0.0132  -0.0092 0.0079  106 PHE B N   
3065 C CA  . PHE B 106 ? 0.2248 0.1625 0.2617 0.0089  -0.0069 0.0108  106 PHE B CA  
3066 C C   . PHE B 106 ? 0.2411 0.1913 0.2780 0.0089  -0.0069 0.0138  106 PHE B C   
3067 O O   . PHE B 106 ? 0.2411 0.1960 0.2728 0.0140  -0.0057 0.0193  106 PHE B O   
3068 C CB  . PHE B 106 ? 0.2241 0.1495 0.2614 0.0113  -0.0019 0.0169  106 PHE B CB  
3069 C CG  . PHE B 106 ? 0.2690 0.1808 0.3057 0.0122  -0.0014 0.0130  106 PHE B CG  
3070 C CD1 . PHE B 106 ? 0.2599 0.1709 0.2934 0.0195  -0.0007 0.0138  106 PHE B CD1 
3071 C CD2 . PHE B 106 ? 0.2849 0.1852 0.3248 0.0058  -0.0019 0.0079  106 PHE B CD2 
3072 C CE1 . PHE B 106 ? 0.2702 0.1681 0.3025 0.0209  0.0011  0.0096  106 PHE B CE1 
3073 C CE2 . PHE B 106 ? 0.3093 0.1953 0.3461 0.0068  -0.0013 0.0035  106 PHE B CE2 
3074 C CZ  . PHE B 106 ? 0.3000 0.1845 0.3325 0.0146  0.0009  0.0043  106 PHE B CZ  
3075 N N   . VAL B 107 ? 0.2148 0.1699 0.2569 0.0036  -0.0088 0.0098  107 VAL B N   
3076 C CA  . VAL B 107 ? 0.2401 0.2069 0.2823 0.0037  -0.0085 0.0108  107 VAL B CA  
3077 C C   . VAL B 107 ? 0.3046 0.2712 0.3541 -0.0001 -0.0029 0.0141  107 VAL B C   
3078 O O   . VAL B 107 ? 0.2634 0.2288 0.3240 -0.0057 -0.0036 0.0106  107 VAL B O   
3079 C CB  . VAL B 107 ? 0.2694 0.2433 0.3126 0.0017  -0.0146 0.0038  107 VAL B CB  
3080 C CG1 . VAL B 107 ? 0.3076 0.2925 0.3504 0.0027  -0.0140 0.0042  107 VAL B CG1 
3081 C CG2 . VAL B 107 ? 0.3110 0.2845 0.3473 0.0045  -0.0185 0.0009  107 VAL B CG2 
3082 N N   . MET B 108 ? 0.2578 0.2259 0.3014 0.0032  0.0026  0.0211  108 MET B N   
3083 C CA  . MET B 108 ? 0.2584 0.2260 0.3073 -0.0001 0.0104  0.0255  108 MET B CA  
3084 C C   . MET B 108 ? 0.2896 0.2689 0.3359 0.0011  0.0123  0.0247  108 MET B C   
3085 O O   . MET B 108 ? 0.3126 0.2984 0.3505 0.0051  0.0072  0.0219  108 MET B O   
3086 C CB  . MET B 108 ? 0.2741 0.2310 0.3149 0.0028  0.0167  0.0348  108 MET B CB  
3087 C CG  . MET B 108 ? 0.2863 0.2294 0.3337 -0.0002 0.0176  0.0356  108 MET B CG  
3088 S SD  . MET B 108 ? 0.3809 0.3093 0.4161 0.0062  0.0214  0.0456  108 MET B SD  
3089 C CE  . MET B 108 ? 0.3667 0.3010 0.3930 0.0145  0.0125  0.0425  108 MET B CE  
3090 N N   . PRO B 109 ? 0.2986 0.2805 0.3530 -0.0025 0.0202  0.0268  109 PRO B N   
3091 C CA  . PRO B 109 ? 0.3538 0.3460 0.4053 -0.0007 0.0233  0.0254  109 PRO B CA  
3092 C C   . PRO B 109 ? 0.3225 0.3137 0.3525 0.0059  0.0251  0.0305  109 PRO B C   
3093 O O   . PRO B 109 ? 0.2847 0.2670 0.3034 0.0089  0.0260  0.0372  109 PRO B O   
3094 C CB  . PRO B 109 ? 0.3805 0.3741 0.4457 -0.0058 0.0338  0.0279  109 PRO B CB  
3095 C CG  . PRO B 109 ? 0.4586 0.4464 0.5401 -0.0120 0.0316  0.0264  109 PRO B CG  
3096 C CD  . PRO B 109 ? 0.3283 0.3048 0.3977 -0.0090 0.0264  0.0288  109 PRO B CD  
3097 N N   . GLY B 110 ? 0.2994 0.2990 0.3235 0.0084  0.0249  0.0270  110 GLY B N   
3098 C CA  . GLY B 110 ? 0.3444 0.3428 0.3470 0.0142  0.0261  0.0307  110 GLY B CA  
3099 C C   . GLY B 110 ? 0.3050 0.2985 0.3000 0.0141  0.0388  0.0382  110 GLY B C   
3100 O O   . GLY B 110 ? 0.3193 0.3121 0.3289 0.0089  0.0474  0.0399  110 GLY B O   
3101 N N   . ALA B 111 ? 0.3045 0.2942 0.2763 0.0196  0.0400  0.0426  111 ALA B N   
3102 C CA  . ALA B 111 ? 0.3298 0.3126 0.2885 0.0203  0.0528  0.0505  111 ALA B CA  
3103 C C   . ALA B 111 ? 0.2974 0.2879 0.2638 0.0177  0.0630  0.0463  111 ALA B C   
3104 O O   . ALA B 111 ? 0.3021 0.3026 0.2768 0.0178  0.0582  0.0373  111 ALA B O   
3105 C CB  . ALA B 111 ? 0.3631 0.3394 0.2922 0.0275  0.0496  0.0554  111 ALA B CB  
3106 N N   . ALA B 112 ? 0.3622 0.3475 0.3263 0.0155  0.0778  0.0531  112 ALA B N   
3107 C CA  . ALA B 112 ? 0.3668 0.3599 0.3392 0.0135  0.0899  0.0496  112 ALA B CA  
3108 C C   . ALA B 112 ? 0.4049 0.3994 0.3532 0.0199  0.0903  0.0459  112 ALA B C   
3109 O O   . ALA B 112 ? 0.4170 0.4032 0.3375 0.0254  0.0848  0.0494  112 ALA B O   
3110 C CB  . ALA B 112 ? 0.4259 0.4127 0.4021 0.0090  0.1074  0.0583  112 ALA B CB  
3111 N N   . LEU B 113 ? 0.3628 0.3674 0.3224 0.0195  0.0960  0.0384  113 LEU B N   
3112 C CA  . LEU B 113 ? 0.4070 0.4115 0.3445 0.0251  0.1000  0.0344  113 LEU B CA  
3113 C C   . LEU B 113 ? 0.3926 0.3990 0.3349 0.0235  0.1204  0.0363  113 LEU B C   
3114 O O   . LEU B 113 ? 0.5202 0.5360 0.4940 0.0182  0.1271  0.0346  113 LEU B O   
3115 C CB  . LEU B 113 ? 0.3988 0.4130 0.3454 0.0272  0.0888  0.0225  113 LEU B CB  
3116 C CG  . LEU B 113 ? 0.4637 0.4762 0.3997 0.0299  0.0703  0.0191  113 LEU B CG  
3117 C CD1 . LEU B 113 ? 0.4180 0.4393 0.3687 0.0301  0.0612  0.0080  113 LEU B CD1 
3118 C CD2 . LEU B 113 ? 0.5381 0.5414 0.4384 0.0357  0.0680  0.0214  113 LEU B CD2 
3119 N N   . ASN B 114 ? 0.4207 0.4183 0.3321 0.0279  0.1305  0.0398  114 ASN B N   
3120 C CA  . ASN B 114 ? 0.4734 0.4737 0.3881 0.0272  0.1514  0.0401  114 ASN B CA  
3121 C C   . ASN B 114 ? 0.5084 0.5171 0.4235 0.0318  0.1511  0.0280  114 ASN B C   
3122 O O   . ASN B 114 ? 0.4201 0.4303 0.3295 0.0352  0.1347  0.0206  114 ASN B O   
3123 C CB  . ASN B 114 ? 0.5757 0.5602 0.4564 0.0290  0.1660  0.0509  114 ASN B CB  
3124 C CG  . ASN B 114 ? 0.5913 0.5636 0.4281 0.0368  0.1570  0.0508  114 ASN B CG  
3125 O OD1 . ASN B 114 ? 0.5769 0.5535 0.4061 0.0413  0.1486  0.0406  114 ASN B OD1 
3126 N ND2 . ASN B 114 ? 0.6304 0.5867 0.4381 0.0385  0.1581  0.0622  114 ASN B ND2 
3127 N N   . GLU B 115 ? 0.4757 0.4896 0.3988 0.0319  0.1696  0.0258  115 GLU B N   
3128 C CA  . GLU B 115 ? 0.5434 0.5654 0.4711 0.0367  0.1702  0.0138  115 GLU B CA  
3129 C C   . GLU B 115 ? 0.4830 0.4935 0.3690 0.0441  0.1641  0.0094  115 GLU B C   
3130 O O   . GLU B 115 ? 0.5322 0.5467 0.4197 0.0479  0.1545  -0.0013 115 GLU B O   
3131 C CB  . GLU B 115 ? 0.5715 0.6023 0.5189 0.0357  0.1929  0.0124  115 GLU B CB  
3132 C CG  . GLU B 115 ? 0.6669 0.7115 0.6606 0.0280  0.1965  0.0147  115 GLU B CG  
3133 C CD  . GLU B 115 ? 0.8198 0.8783 0.8423 0.0277  0.2152  0.0101  115 GLU B CD  
3134 O OE1 . GLU B 115 ? 0.8541 0.9236 0.9136 0.0208  0.2217  0.0130  115 GLU B OE1 
3135 O OE2 . GLU B 115 ? 0.9201 0.9788 0.9295 0.0345  0.2232  0.0031  115 GLU B OE2 
3136 N N   . ASP B 116 ? 0.5251 0.5205 0.3736 0.0462  0.1687  0.0177  116 ASP B N   
3137 C CA  . ASP B 116 ? 0.5752 0.5585 0.3815 0.0530  0.1622  0.0138  116 ASP B CA  
3138 C C   . ASP B 116 ? 0.5685 0.5515 0.3708 0.0541  0.1366  0.0099  116 ASP B C   
3139 O O   . ASP B 116 ? 0.5755 0.5567 0.3632 0.0583  0.1268  0.0004  116 ASP B O   
3140 C CB  . ASP B 116 ? 0.6670 0.6331 0.4327 0.0552  0.1729  0.0245  116 ASP B CB  
3141 C CG  . ASP B 116 ? 0.8359 0.7886 0.5558 0.0623  0.1633  0.0206  116 ASP B CG  
3142 O OD1 . ASP B 116 ? 0.8719 0.8237 0.5794 0.0666  0.1689  0.0106  116 ASP B OD1 
3143 O OD2 . ASP B 116 ? 0.8802 0.8230 0.5770 0.0638  0.1498  0.0271  116 ASP B OD2 
3144 N N   . GLU B 117 ? 0.4959 0.4803 0.3121 0.0499  0.1266  0.0170  117 GLU B N   
3145 C CA  . GLU B 117 ? 0.4961 0.4817 0.3129 0.0504  0.1042  0.0139  117 GLU B CA  
3146 C C   . GLU B 117 ? 0.4970 0.4949 0.3418 0.0491  0.0952  0.0024  117 GLU B C   
3147 O O   . GLU B 117 ? 0.4796 0.4771 0.3171 0.0511  0.0799  -0.0043 117 GLU B O   
3148 C CB  . GLU B 117 ? 0.4732 0.4573 0.2999 0.0467  0.0979  0.0239  117 GLU B CB  
3149 C CG  . GLU B 117 ? 0.5658 0.5352 0.3604 0.0493  0.1020  0.0354  117 GLU B CG  
3150 C CD  . GLU B 117 ? 0.5615 0.5279 0.3703 0.0449  0.1053  0.0467  117 GLU B CD  
3151 O OE1 . GLU B 117 ? 0.5302 0.4830 0.3140 0.0470  0.1096  0.0574  117 GLU B OE1 
3152 O OE2 . GLU B 117 ? 0.5244 0.5006 0.3679 0.0395  0.1032  0.0448  117 GLU B OE2 
3153 N N   . PHE B 118 ? 0.4844 0.4926 0.3615 0.0457  0.1044  0.0005  118 PHE B N   
3154 C CA  . PHE B 118 ? 0.4435 0.4618 0.3459 0.0452  0.0960  -0.0097 118 PHE B CA  
3155 C C   . PHE B 118 ? 0.4504 0.4662 0.3372 0.0509  0.0983  -0.0198 118 PHE B C   
3156 O O   . PHE B 118 ? 0.4862 0.5031 0.3757 0.0523  0.0855  -0.0282 118 PHE B O   
3157 C CB  . PHE B 118 ? 0.3673 0.3975 0.3086 0.0409  0.1038  -0.0096 118 PHE B CB  
3158 C CG  . PHE B 118 ? 0.4163 0.4554 0.3826 0.0409  0.0933  -0.0189 118 PHE B CG  
3159 C CD1 . PHE B 118 ? 0.4023 0.4458 0.3754 0.0450  0.0990  -0.0278 118 PHE B CD1 
3160 C CD2 . PHE B 118 ? 0.4208 0.4624 0.4022 0.0372  0.0780  -0.0187 118 PHE B CD2 
3161 C CE1 . PHE B 118 ? 0.4201 0.4698 0.4148 0.0457  0.0887  -0.0356 118 PHE B CE1 
3162 C CE2 . PHE B 118 ? 0.4271 0.4746 0.4282 0.0374  0.0683  -0.0263 118 PHE B CE2 
3163 C CZ  . PHE B 118 ? 0.3734 0.4248 0.3813 0.0417  0.0731  -0.0345 118 PHE B CZ  
3164 N N   . ARG B 119 ? 0.4728 0.4837 0.3418 0.0541  0.1153  -0.0190 119 ARG B N   
3165 C CA  . ARG B 119 ? 0.5514 0.5579 0.4021 0.0601  0.1193  -0.0290 119 ARG B CA  
3166 C C   . ARG B 119 ? 0.5562 0.5521 0.3751 0.0629  0.1027  -0.0331 119 ARG B C   
3167 O O   . ARG B 119 ? 0.5533 0.5476 0.3686 0.0658  0.0957  -0.0439 119 ARG B O   
3168 C CB  . ARG B 119 ? 0.5945 0.5955 0.4268 0.0631  0.1419  -0.0264 119 ARG B CB  
3169 C CG  . ARG B 119 ? 0.6509 0.6455 0.4615 0.0698  0.1473  -0.0375 119 ARG B CG  
3170 C CD  . ARG B 119 ? 0.7717 0.7563 0.5518 0.0732  0.1685  -0.0338 119 ARG B CD  
3171 N NE  . ARG B 119 ? 0.8415 0.8135 0.5881 0.0723  0.1657  -0.0229 119 ARG B NE  
3172 C CZ  . ARG B 119 ? 0.8696 0.8285 0.5783 0.0756  0.1517  -0.0245 119 ARG B CZ  
3173 N NH1 . ARG B 119 ? 0.8899 0.8462 0.5893 0.0790  0.1396  -0.0369 119 ARG B NH1 
3174 N NH2 . ARG B 119 ? 0.8603 0.8084 0.5412 0.0754  0.1490  -0.0136 119 ARG B NH2 
3175 N N   . GLN B 120 ? 0.4950 0.4834 0.2921 0.0621  0.0961  -0.0247 120 GLN B N   
3176 C CA  . GLN B 120 ? 0.4931 0.4733 0.2630 0.0644  0.0790  -0.0280 120 GLN B CA  
3177 C C   . GLN B 120 ? 0.4897 0.4772 0.2824 0.0614  0.0607  -0.0337 120 GLN B C   
3178 O O   . GLN B 120 ? 0.5263 0.5103 0.3077 0.0630  0.0488  -0.0423 120 GLN B O   
3179 C CB  . GLN B 120 ? 0.4836 0.4556 0.2298 0.0647  0.0750  -0.0168 120 GLN B CB  
3180 C CG  . GLN B 120 ? 0.6435 0.6037 0.3570 0.0683  0.0910  -0.0106 120 GLN B CG  
3181 C CD  . GLN B 120 ? 0.7367 0.6876 0.4273 0.0691  0.0853  0.0014  120 GLN B CD  
3182 O OE1 . GLN B 120 ? 0.8190 0.7659 0.5079 0.0678  0.0984  0.0125  120 GLN B OE1 
3183 N NE2 . GLN B 120 ? 0.6029 0.5502 0.2771 0.0713  0.0654  -0.0007 120 GLN B NE2 
3184 N N   . LEU B 121 ? 0.4605 0.4574 0.2843 0.0567  0.0587  -0.0287 121 LEU B N   
3185 C CA  . LEU B 121 ? 0.4308 0.4340 0.2765 0.0535  0.0435  -0.0331 121 LEU B CA  
3186 C C   . LEU B 121 ? 0.4798 0.4855 0.3376 0.0548  0.0430  -0.0444 121 LEU B C   
3187 O O   . LEU B 121 ? 0.4495 0.4536 0.3066 0.0543  0.0298  -0.0511 121 LEU B O   
3188 C CB  . LEU B 121 ? 0.4320 0.4429 0.3062 0.0485  0.0433  -0.0258 121 LEU B CB  
3189 C CG  . LEU B 121 ? 0.4537 0.4613 0.3187 0.0472  0.0383  -0.0158 121 LEU B CG  
3190 C CD1 . LEU B 121 ? 0.4039 0.4168 0.2946 0.0426  0.0423  -0.0087 121 LEU B CD1 
3191 C CD2 . LEU B 121 ? 0.4058 0.4127 0.2646 0.0471  0.0203  -0.0185 121 LEU B CD2 
3192 N N   . GLU B 122 ? 0.4328 0.4421 0.3026 0.0565  0.0577  -0.0463 122 GLU B N   
3193 C CA  . GLU B 122 ? 0.4244 0.4353 0.3061 0.0591  0.0585  -0.0569 122 GLU B CA  
3194 C C   . GLU B 122 ? 0.3872 0.3871 0.2389 0.0636  0.0554  -0.0658 122 GLU B C   
3195 O O   . GLU B 122 ? 0.4824 0.4796 0.3380 0.0645  0.0468  -0.0748 122 GLU B O   
3196 C CB  . GLU B 122 ? 0.5100 0.5281 0.4112 0.0609  0.0762  -0.0570 122 GLU B CB  
3197 C CG  . GLU B 122 ? 0.6407 0.6603 0.5549 0.0652  0.0781  -0.0679 122 GLU B CG  
3198 C CD  . GLU B 122 ? 0.7097 0.7415 0.6569 0.0658  0.0911  -0.0674 122 GLU B CD  
3199 O OE1 . GLU B 122 ? 0.7145 0.7536 0.6760 0.0617  0.0974  -0.0588 122 GLU B OE1 
3200 O OE2 . GLU B 122 ? 0.7099 0.7438 0.6698 0.0705  0.0946  -0.0759 122 GLU B OE2 
3201 N N   . GLU B 123 ? 0.4262 0.4180 0.2464 0.0662  0.0620  -0.0630 123 GLU B N   
3202 C CA  . GLU B 123 ? 0.4931 0.4728 0.2799 0.0704  0.0582  -0.0713 123 GLU B CA  
3203 C C   . GLU B 123 ? 0.5593 0.5361 0.3406 0.0676  0.0368  -0.0749 123 GLU B C   
3204 O O   . GLU B 123 ? 0.5275 0.4976 0.3000 0.0691  0.0295  -0.0855 123 GLU B O   
3205 C CB  . GLU B 123 ? 0.5775 0.5481 0.3291 0.0734  0.0680  -0.0657 123 GLU B CB  
3206 C CG  . GLU B 123 ? 0.7618 0.7186 0.4738 0.0770  0.0594  -0.0727 123 GLU B CG  
3207 C CD  . GLU B 123 ? 0.9364 0.8824 0.6106 0.0808  0.0704  -0.0670 123 GLU B CD  
3208 O OE1 . GLU B 123 ? 0.9022 0.8459 0.5629 0.0796  0.0638  -0.0572 123 GLU B OE1 
3209 O OE2 . GLU B 123 ? 1.0147 0.9536 0.6720 0.0855  0.0861  -0.0722 123 GLU B OE2 
3210 N N   . GLN B 124 ? 0.5275 0.5090 0.3154 0.0635  0.0273  -0.0662 124 GLN B N   
3211 C CA  . GLN B 124 ? 0.5164 0.4979 0.3050 0.0603  0.0080  -0.0687 124 GLN B CA  
3212 C C   . GLN B 124 ? 0.5151 0.5001 0.3293 0.0575  0.0018  -0.0760 124 GLN B C   
3213 O O   . GLN B 124 ? 0.4982 0.4783 0.3066 0.0565  -0.0095 -0.0841 124 GLN B O   
3214 C CB  . GLN B 124 ? 0.5201 0.5077 0.3165 0.0570  0.0016  -0.0577 124 GLN B CB  
3215 C CG  . GLN B 124 ? 0.6663 0.6478 0.4334 0.0599  0.0019  -0.0507 124 GLN B CG  
3216 C CD  . GLN B 124 ? 0.7426 0.7157 0.4809 0.0623  -0.0104 -0.0577 124 GLN B CD  
3217 O OE1 . GLN B 124 ? 0.7671 0.7423 0.5130 0.0595  -0.0247 -0.0644 124 GLN B OE1 
3218 N NE2 . GLN B 124 ? 0.8527 0.8157 0.5570 0.0670  -0.0049 -0.0563 124 GLN B NE2 
3219 N N   . VAL B 125 ? 0.4288 0.4216 0.2708 0.0562  0.0089  -0.0729 125 VAL B N   
3220 C CA  . VAL B 125 ? 0.3523 0.3473 0.2178 0.0543  0.0036  -0.0785 125 VAL B CA  
3221 C C   . VAL B 125 ? 0.4346 0.4213 0.2923 0.0584  0.0056  -0.0901 125 VAL B C   
3222 O O   . VAL B 125 ? 0.4310 0.4133 0.2940 0.0567  -0.0044 -0.0966 125 VAL B O   
3223 C CB  . VAL B 125 ? 0.3827 0.3871 0.2779 0.0529  0.0107  -0.0730 125 VAL B CB  
3224 C CG1 . VAL B 125 ? 0.4049 0.4095 0.3207 0.0532  0.0073  -0.0794 125 VAL B CG1 
3225 C CG2 . VAL B 125 ? 0.3833 0.3936 0.2886 0.0479  0.0048  -0.0636 125 VAL B CG2 
3226 N N   . LEU B 126 ? 0.4449 0.4284 0.2894 0.0637  0.0192  -0.0928 126 LEU B N   
3227 C CA  . LEU B 126 ? 0.4247 0.3998 0.2626 0.0686  0.0230  -0.1044 126 LEU B CA  
3228 C C   . LEU B 126 ? 0.5131 0.4752 0.3202 0.0693  0.0137  -0.1127 126 LEU B C   
3229 O O   . LEU B 126 ? 0.5726 0.5250 0.3708 0.0731  0.0153  -0.1235 126 LEU B O   
3230 C CB  . LEU B 126 ? 0.4951 0.4722 0.3331 0.0745  0.0427  -0.1050 126 LEU B CB  
3231 C CG  . LEU B 126 ? 0.4942 0.4848 0.3674 0.0739  0.0514  -0.0991 126 LEU B CG  
3232 C CD1 . LEU B 126 ? 0.6168 0.6098 0.4932 0.0800  0.0712  -0.1019 126 LEU B CD1 
3233 C CD2 . LEU B 126 ? 0.4686 0.4621 0.3693 0.0721  0.0405  -0.1020 126 LEU B CD2 
3234 N N   . GLU B 127 ? 0.4945 0.4563 0.2862 0.0658  0.0036  -0.1081 127 GLU B N   
3235 C CA  . GLU B 127 ? 0.6141 0.5654 0.3805 0.0652  -0.0089 -0.1159 127 GLU B CA  
3236 C C   . GLU B 127 ? 0.6054 0.5566 0.3890 0.0595  -0.0243 -0.1202 127 GLU B C   
3237 O O   . GLU B 127 ? 0.6000 0.5433 0.3739 0.0562  -0.0343 -0.1261 127 GLU B O   
3238 C CB  . GLU B 127 ? 0.6404 0.5918 0.3836 0.0646  -0.0143 -0.1091 127 GLU B CB  
3239 C CG  . GLU B 127 ? 0.7150 0.6617 0.4324 0.0703  0.0004  -0.1056 127 GLU B CG  
3240 C CD  . GLU B 127 ? 0.8888 0.8336 0.5827 0.0696  -0.0067 -0.0980 127 GLU B CD  
3241 O OE1 . GLU B 127 ? 0.9607 0.9097 0.6620 0.0647  -0.0231 -0.0958 127 GLU B OE1 
3242 O OE2 . GLU B 127 ? 0.9263 0.8658 0.5980 0.0731  0.0048  -0.0932 127 GLU B OE2 
3243 N N   . ILE B 128 ? 0.5285 0.4462 0.3898 0.0289  0.0143  -0.0984 128 ILE B N   
3244 C CA  . ILE B 128 ? 0.4289 0.3364 0.3052 0.0245  0.0078  -0.1004 128 ILE B CA  
3245 C C   . ILE B 128 ? 0.5307 0.4204 0.3989 0.0305  0.0095  -0.1114 128 ILE B C   
3246 O O   . ILE B 128 ? 0.5461 0.4376 0.4121 0.0398  0.0189  -0.1137 128 ILE B O   
3247 C CB  . ILE B 128 ? 0.4109 0.3282 0.3114 0.0228  0.0114  -0.0906 128 ILE B CB  
3248 C CG1 . ILE B 128 ? 0.3525 0.2847 0.2618 0.0169  0.0093  -0.0804 128 ILE B CG1 
3249 C CG2 . ILE B 128 ? 0.4143 0.3183 0.3260 0.0187  0.0068  -0.0924 128 ILE B CG2 
3250 C CD1 . ILE B 128 ? 0.3488 0.2895 0.2788 0.0156  0.0132  -0.0715 128 ILE B CD1 
3251 N N   . GLU B 129 ? 0.5226 0.3953 0.3881 0.0252  0.0004  -0.1183 129 GLU B N   
3252 C CA  . GLU B 129 ? 0.6291 0.4805 0.4846 0.0303  0.0005  -0.1294 129 GLU B CA  
3253 C C   . GLU B 129 ? 0.6384 0.4838 0.5093 0.0343  0.0051  -0.1265 129 GLU B C   
3254 O O   . GLU B 129 ? 0.4852 0.3390 0.3742 0.0300  0.0054  -0.1167 129 GLU B O   
3255 C CB  . GLU B 129 ? 0.7260 0.5598 0.5742 0.0217  -0.0115 -0.1376 129 GLU B CB  
3256 C CG  . GLU B 129 ? 0.7725 0.6053 0.6422 0.0104  -0.0177 -0.1318 129 GLU B CG  
3257 C CD  . GLU B 129 ? 0.8866 0.7384 0.7674 0.0023  -0.0230 -0.1238 129 GLU B CD  
3258 O OE1 . GLU B 129 ? 0.8136 0.6817 0.6897 0.0061  -0.0197 -0.1184 129 GLU B OE1 
3259 O OE2 . GLU B 129 ? 0.9140 0.7641 0.8091 -0.0080 -0.0301 -0.1228 129 GLU B OE2 
3260 N N   . SER B 130 ? 0.5835 0.4128 0.4456 0.0433  0.0081  -0.1353 130 SER B N   
3261 C CA  . SER B 130 ? 0.5899 0.4097 0.4637 0.0485  0.0106  -0.1331 130 SER B CA  
3262 C C   . SER B 130 ? 0.6010 0.4061 0.4832 0.0378  0.0033  -0.1296 130 SER B C   
3263 O O   . SER B 130 ? 0.6018 0.3955 0.4782 0.0286  -0.0038 -0.1344 130 SER B O   
3264 C CB  . SER B 130 ? 0.5707 0.3725 0.4324 0.0606  0.0138  -0.1445 130 SER B CB  
3265 O OG  . SER B 130 ? 0.6077 0.3982 0.4801 0.0664  0.0142  -0.1419 130 SER B OG  
3266 N N   . GLY B 131 ? 0.6087 0.4145 0.5046 0.0386  0.0053  -0.1210 131 GLY B N   
3267 C CA  . GLY B 131 ? 0.5107 0.3024 0.4133 0.0286  0.0010  -0.1163 131 GLY B CA  
3268 C C   . GLY B 131 ? 0.4963 0.3055 0.4118 0.0178  0.0004  -0.1069 131 GLY B C   
3269 O O   . GLY B 131 ? 0.5123 0.3152 0.4359 0.0115  0.0005  -0.1003 131 GLY B O   
3270 N N   . ALA B 132 ? 0.4315 0.2614 0.3477 0.0163  0.0004  -0.1062 132 ALA B N   
3271 C CA  . ALA B 132 ? 0.4005 0.2470 0.3297 0.0074  -0.0005 -0.0979 132 ALA B CA  
3272 C C   . ALA B 132 ? 0.4263 0.2848 0.3660 0.0107  0.0050  -0.0880 132 ALA B C   
3273 O O   . ALA B 132 ? 0.4205 0.2795 0.3586 0.0202  0.0088  -0.0876 132 ALA B O   
3274 C CB  . ALA B 132 ? 0.4709 0.3330 0.3959 0.0056  -0.0035 -0.0994 132 ALA B CB  
3275 N N   . ILE B 133 ? 0.4036 0.2719 0.3549 0.0031  0.0050  -0.0806 133 ILE B N   
3276 C CA  . ILE B 133 ? 0.3399 0.2161 0.2997 0.0047  0.0092  -0.0719 133 ILE B CA  
3277 C C   . ILE B 133 ? 0.3378 0.2365 0.3040 0.0045  0.0105  -0.0667 133 ILE B C   
3278 O O   . ILE B 133 ? 0.3707 0.2775 0.3399 -0.0011 0.0076  -0.0665 133 ILE B O   
3279 C CB  . ILE B 133 ? 0.3693 0.2349 0.3352 -0.0033 0.0099  -0.0673 133 ILE B CB  
3280 C CG1 . ILE B 133 ? 0.4795 0.3197 0.4369 -0.0031 0.0090  -0.0710 133 ILE B CG1 
3281 C CG2 . ILE B 133 ? 0.3771 0.2493 0.3485 -0.0020 0.0135  -0.0590 133 ILE B CG2 
3282 C CD1 . ILE B 133 ? 0.5198 0.3472 0.4812 -0.0133 0.0108  -0.0675 133 ILE B CD1 
3283 N N   . LEU B 134 ? 0.3172 0.2254 0.2862 0.0106  0.0142  -0.0625 134 LEU B N   
3284 C CA  . LEU B 134 ? 0.2656 0.1926 0.2410 0.0098  0.0161  -0.0565 134 LEU B CA  
3285 C C   . LEU B 134 ? 0.2694 0.1988 0.2539 0.0085  0.0178  -0.0494 134 LEU B C   
3286 O O   . LEU B 134 ? 0.3088 0.2341 0.2939 0.0135  0.0186  -0.0488 134 LEU B O   
3287 C CB  . LEU B 134 ? 0.3566 0.2946 0.3279 0.0170  0.0198  -0.0580 134 LEU B CB  
3288 C CG  . LEU B 134 ? 0.3434 0.2989 0.3211 0.0159  0.0228  -0.0509 134 LEU B CG  
3289 C CD1 . LEU B 134 ? 0.3278 0.2878 0.3024 0.0101  0.0196  -0.0488 134 LEU B CD1 
3290 C CD2 . LEU B 134 ? 0.3313 0.2977 0.3074 0.0226  0.0288  -0.0520 134 LEU B CD2 
3291 N N   . VAL B 135 ? 0.3105 0.2457 0.3018 0.0024  0.0175  -0.0446 135 VAL B N   
3292 C CA  . VAL B 135 ? 0.2948 0.2314 0.2925 0.0010  0.0193  -0.0385 135 VAL B CA  
3293 C C   . VAL B 135 ? 0.3162 0.2685 0.3191 0.0023  0.0206  -0.0340 135 VAL B C   
3294 O O   . VAL B 135 ? 0.3042 0.2647 0.3096 -0.0006 0.0201  -0.0318 135 VAL B O   
3295 C CB  . VAL B 135 ? 0.2639 0.1959 0.2665 -0.0060 0.0198  -0.0363 135 VAL B CB  
3296 C CG1 . VAL B 135 ? 0.2728 0.2029 0.2777 -0.0066 0.0221  -0.0312 135 VAL B CG1 
3297 C CG2 . VAL B 135 ? 0.2751 0.1916 0.2737 -0.0092 0.0196  -0.0403 135 VAL B CG2 
3298 N N   . ILE B 136 ? 0.2864 0.2425 0.2918 0.0064  0.0217  -0.0324 136 ILE B N   
3299 C CA  . ILE B 136 ? 0.2660 0.2360 0.2782 0.0062  0.0234  -0.0277 136 ILE B CA  
3300 C C   . ILE B 136 ? 0.2704 0.2374 0.2876 0.0027  0.0224  -0.0232 136 ILE B C   
3301 O O   . ILE B 136 ? 0.2989 0.2595 0.3162 0.0045  0.0205  -0.0233 136 ILE B O   
3302 C CB  . ILE B 136 ? 0.2557 0.2339 0.2718 0.0122  0.0253  -0.0291 136 ILE B CB  
3303 C CG1 . ILE B 136 ? 0.2939 0.2714 0.3024 0.0170  0.0272  -0.0353 136 ILE B CG1 
3304 C CG2 . ILE B 136 ? 0.2730 0.2662 0.2975 0.0104  0.0283  -0.0240 136 ILE B CG2 
3305 C CD1 . ILE B 136 ? 0.4189 0.4038 0.4329 0.0245  0.0301  -0.0381 136 ILE B CD1 
3306 N N   . SER B 137 ? 0.2532 0.2235 0.2735 -0.0016 0.0229  -0.0195 137 SER B N   
3307 C CA  . SER B 137 ? 0.2163 0.1808 0.2393 -0.0046 0.0226  -0.0165 137 SER B CA  
3308 C C   . SER B 137 ? 0.2462 0.2183 0.2753 -0.0071 0.0231  -0.0116 137 SER B C   
3309 O O   . SER B 137 ? 0.2575 0.2354 0.2878 -0.0081 0.0235  -0.0097 137 SER B O   
3310 C CB  . SER B 137 ? 0.2440 0.1982 0.2645 -0.0075 0.0235  -0.0181 137 SER B CB  
3311 O OG  . SER B 137 ? 0.2693 0.2179 0.2911 -0.0099 0.0249  -0.0157 137 SER B OG  
3312 N N   . GLY B 138 ? 0.2589 0.2291 0.2909 -0.0082 0.0222  -0.0095 138 GLY B N   
3313 C CA  . GLY B 138 ? 0.2446 0.2180 0.2819 -0.0112 0.0224  -0.0050 138 GLY B CA  
3314 C C   . GLY B 138 ? 0.3350 0.3164 0.3789 -0.0120 0.0217  -0.0028 138 GLY B C   
3315 O O   . GLY B 138 ? 0.2910 0.2773 0.3372 -0.0094 0.0208  -0.0051 138 GLY B O   
3316 N N   . SER B 139 ? 0.2686 0.2512 0.3172 -0.0157 0.0220  0.0016  139 SER B N   
3317 C CA  . SER B 139 ? 0.2985 0.2890 0.3562 -0.0185 0.0217  0.0043  139 SER B CA  
3318 C C   . SER B 139 ? 0.2976 0.3022 0.3588 -0.0181 0.0265  0.0068  139 SER B C   
3319 O O   . SER B 139 ? 0.3003 0.3063 0.3539 -0.0161 0.0291  0.0072  139 SER B O   
3320 C CB  . SER B 139 ? 0.3303 0.3142 0.3908 -0.0234 0.0206  0.0083  139 SER B CB  
3321 O OG  . SER B 139 ? 0.3339 0.3174 0.3916 -0.0240 0.0234  0.0128  139 SER B OG  
3322 N N   . LEU B 140 ? 0.2497 0.2650 0.3224 -0.0203 0.0277  0.0082  140 LEU B N   
3323 C CA  . LEU B 140 ? 0.2235 0.2527 0.3003 -0.0207 0.0347  0.0110  140 LEU B CA  
3324 C C   . LEU B 140 ? 0.2641 0.2929 0.3427 -0.0274 0.0378  0.0187  140 LEU B C   
3325 O O   . LEU B 140 ? 0.2763 0.3034 0.3649 -0.0329 0.0353  0.0209  140 LEU B O   
3326 C CB  . LEU B 140 ? 0.2427 0.2859 0.3351 -0.0195 0.0355  0.0082  140 LEU B CB  
3327 C CG  . LEU B 140 ? 0.3067 0.3664 0.4046 -0.0185 0.0451  0.0095  140 LEU B CG  
3328 C CD1 . LEU B 140 ? 0.2741 0.3328 0.3588 -0.0109 0.0481  0.0046  140 LEU B CD1 
3329 C CD2 . LEU B 140 ? 0.2620 0.3380 0.3830 -0.0189 0.0456  0.0079  140 LEU B CD2 
3330 N N   . PRO B 141 ? 0.3051 0.3337 0.3726 -0.0272 0.0426  0.0229  141 PRO B N   
3331 C CA  . PRO B 141 ? 0.3253 0.3501 0.3906 -0.0330 0.0454  0.0315  141 PRO B CA  
3332 C C   . PRO B 141 ? 0.3227 0.3603 0.3996 -0.0386 0.0531  0.0357  141 PRO B C   
3333 O O   . PRO B 141 ? 0.2862 0.3379 0.3718 -0.0362 0.0573  0.0316  141 PRO B O   
3334 C CB  . PRO B 141 ? 0.3922 0.4135 0.4394 -0.0295 0.0471  0.0337  141 PRO B CB  
3335 C CG  . PRO B 141 ? 0.3799 0.4103 0.4236 -0.0240 0.0500  0.0270  141 PRO B CG  
3336 C CD  . PRO B 141 ? 0.2829 0.3133 0.3374 -0.0215 0.0449  0.0198  141 PRO B CD  
3337 N N   . PRO B 142 ? 0.3091 0.3416 0.3874 -0.0458 0.0555  0.0440  142 PRO B N   
3338 C CA  . PRO B 142 ? 0.3684 0.4130 0.4576 -0.0526 0.0650  0.0493  142 PRO B CA  
3339 C C   . PRO B 142 ? 0.3761 0.4300 0.4535 -0.0495 0.0756  0.0509  142 PRO B C   
3340 O O   . PRO B 142 ? 0.3359 0.3814 0.3919 -0.0444 0.0745  0.0513  142 PRO B O   
3341 C CB  . PRO B 142 ? 0.4199 0.4504 0.5053 -0.0603 0.0648  0.0589  142 PRO B CB  
3342 C CG  . PRO B 142 ? 0.4064 0.4203 0.4878 -0.0577 0.0537  0.0560  142 PRO B CG  
3343 C CD  . PRO B 142 ? 0.3590 0.3737 0.4309 -0.0482 0.0497  0.0484  142 PRO B CD  
3344 N N   . GLY B 143 ? 0.3665 0.4380 0.4581 -0.0525 0.0858  0.0513  143 GLY B N   
3345 C CA  . GLY B 143 ? 0.3414 0.4213 0.4208 -0.0498 0.0983  0.0526  143 GLY B CA  
3346 C C   . GLY B 143 ? 0.4355 0.5277 0.5177 -0.0403 0.1003  0.0423  143 GLY B C   
3347 O O   . GLY B 143 ? 0.4230 0.5238 0.4972 -0.0374 0.1119  0.0415  143 GLY B O   
3348 N N   . VAL B 144 ? 0.3552 0.4466 0.4472 -0.0354 0.0893  0.0344  144 VAL B N   
3349 C CA  . VAL B 144 ? 0.3761 0.4757 0.4706 -0.0259 0.0895  0.0247  144 VAL B CA  
3350 C C   . VAL B 144 ? 0.3401 0.4555 0.4645 -0.0252 0.0874  0.0200  144 VAL B C   
3351 O O   . VAL B 144 ? 0.3534 0.4637 0.4880 -0.0268 0.0760  0.0185  144 VAL B O   
3352 C CB  . VAL B 144 ? 0.3327 0.4169 0.4118 -0.0195 0.0782  0.0189  144 VAL B CB  
3353 C CG1 . VAL B 144 ? 0.3360 0.4253 0.4137 -0.0099 0.0795  0.0096  144 VAL B CG1 
3354 C CG2 . VAL B 144 ? 0.3330 0.4020 0.3866 -0.0204 0.0766  0.0233  144 VAL B CG2 
3355 N N   . LYS B 145 ? 0.3811 0.5155 0.5192 -0.0221 0.0981  0.0173  145 LYS B N   
3356 C CA  . LYS B 145 ? 0.3262 0.4777 0.4949 -0.0193 0.0950  0.0119  145 LYS B CA  
3357 C C   . LYS B 145 ? 0.3413 0.4841 0.5054 -0.0093 0.0830  0.0034  145 LYS B C   
3358 O O   . LYS B 145 ? 0.3088 0.4402 0.4506 -0.0025 0.0834  -0.0004 145 LYS B O   
3359 C CB  . LYS B 145 ? 0.4358 0.6112 0.6219 -0.0169 0.1106  0.0103  145 LYS B CB  
3360 C CG  . LYS B 145 ? 0.5029 0.6962 0.7166 -0.0279 0.1182  0.0168  145 LYS B CG  
3361 C CD  . LYS B 145 ? 0.6728 0.8752 0.8796 -0.0314 0.1389  0.0220  145 LYS B CD  
3362 C CE  . LYS B 145 ? 0.7389 0.9531 0.9681 -0.0456 0.1464  0.0309  145 LYS B CE  
3363 N NZ  . LYS B 145 ? 0.7924 1.0052 1.0029 -0.0513 0.1655  0.0391  145 LYS B NZ  
3364 N N   . LEU B 146 ? 0.3000 0.4466 0.4842 -0.0089 0.0719  0.0008  146 LEU B N   
3365 C CA  . LEU B 146 ? 0.3128 0.4486 0.4917 -0.0001 0.0599  -0.0060 146 LEU B CA  
3366 C C   . LEU B 146 ? 0.2718 0.4117 0.4469 0.0117  0.0652  -0.0130 146 LEU B C   
3367 O O   . LEU B 146 ? 0.3610 0.4840 0.5172 0.0180  0.0595  -0.0172 146 LEU B O   
3368 C CB  . LEU B 146 ? 0.3236 0.4655 0.5257 -0.0010 0.0475  -0.0076 146 LEU B CB  
3369 C CG  . LEU B 146 ? 0.2991 0.4277 0.4972 -0.0106 0.0379  -0.0033 146 LEU B CG  
3370 C CD1 . LEU B 146 ? 0.4182 0.5559 0.6413 -0.0126 0.0263  -0.0050 146 LEU B CD1 
3371 C CD2 . LEU B 146 ? 0.2710 0.3737 0.4406 -0.0080 0.0305  -0.0045 146 LEU B CD2 
3372 N N   . GLU B 147 ? 0.3163 0.4778 0.5098 0.0147  0.0768  -0.0146 147 GLU B N   
3373 C CA  . GLU B 147 ? 0.3747 0.5401 0.5666 0.0271  0.0822  -0.0224 147 GLU B CA  
3374 C C   . GLU B 147 ? 0.3282 0.4790 0.4874 0.0295  0.0900  -0.0239 147 GLU B C   
3375 O O   . GLU B 147 ? 0.4053 0.5489 0.5540 0.0395  0.0903  -0.0312 147 GLU B O   
3376 C CB  . GLU B 147 ? 0.4147 0.6091 0.6380 0.0306  0.0936  -0.0245 147 GLU B CB  
3377 C CG  . GLU B 147 ? 0.5524 0.7603 0.7771 0.0225  0.1115  -0.0189 147 GLU B CG  
3378 C CD  . GLU B 147 ? 0.7732 1.0124 1.0342 0.0250  0.1239  -0.0209 147 GLU B CD  
3379 O OE1 . GLU B 147 ? 0.7981 1.0477 1.0785 0.0366  0.1206  -0.0286 147 GLU B OE1 
3380 O OE2 . GLU B 147 ? 0.8429 1.0963 1.1140 0.0153  0.1372  -0.0146 147 GLU B OE2 
3381 N N   . LYS B 148 ? 0.3873 0.5321 0.5297 0.0203  0.0951  -0.0170 148 LYS B N   
3382 C CA  . LYS B 148 ? 0.3767 0.5062 0.4864 0.0218  0.0993  -0.0181 148 LYS B CA  
3383 C C   . LYS B 148 ? 0.3169 0.4243 0.4090 0.0249  0.0859  -0.0219 148 LYS B C   
3384 O O   . LYS B 148 ? 0.3525 0.4487 0.4245 0.0305  0.0867  -0.0275 148 LYS B O   
3385 C CB  . LYS B 148 ? 0.3623 0.4888 0.4581 0.0117  0.1051  -0.0089 148 LYS B CB  
3386 C CG  . LYS B 148 ? 0.5040 0.6495 0.6115 0.0076  0.1214  -0.0042 148 LYS B CG  
3387 C CD  . LYS B 148 ? 0.5916 0.7462 0.6943 0.0167  0.1352  -0.0113 148 LYS B CD  
3388 C CE  . LYS B 148 ? 0.7583 0.9057 0.8299 0.0142  0.1474  -0.0076 148 LYS B CE  
3389 N NZ  . LYS B 148 ? 0.8378 0.9620 0.8750 0.0179  0.1386  -0.0112 148 LYS B NZ  
3390 N N   . LEU B 149 ? 0.3211 0.4217 0.4205 0.0207  0.0741  -0.0191 149 LEU B N   
3391 C CA  . LEU B 149 ? 0.2900 0.3705 0.3751 0.0227  0.0630  -0.0221 149 LEU B CA  
3392 C C   . LEU B 149 ? 0.3361 0.4134 0.4244 0.0331  0.0598  -0.0302 149 LEU B C   
3393 O O   . LEU B 149 ? 0.3605 0.4222 0.4314 0.0370  0.0569  -0.0349 149 LEU B O   
3394 C CB  . LEU B 149 ? 0.3363 0.4103 0.4279 0.0164  0.0529  -0.0175 149 LEU B CB  
3395 C CG  . LEU B 149 ? 0.3397 0.3936 0.4187 0.0179  0.0429  -0.0201 149 LEU B CG  
3396 C CD1 . LEU B 149 ? 0.3518 0.3933 0.4097 0.0159  0.0438  -0.0202 149 LEU B CD1 
3397 C CD2 . LEU B 149 ? 0.3672 0.4154 0.4524 0.0126  0.0345  -0.0165 149 LEU B CD2 
3398 N N   . THR B 150 ? 0.2804 0.3724 0.3922 0.0376  0.0598  -0.0318 150 THR B N   
3399 C CA  . THR B 150 ? 0.2745 0.3638 0.3918 0.0489  0.0560  -0.0391 150 THR B CA  
3400 C C   . THR B 150 ? 0.3155 0.4045 0.4216 0.0568  0.0661  -0.0459 150 THR B C   
3401 O O   . THR B 150 ? 0.3839 0.4570 0.4779 0.0641  0.0621  -0.0521 150 THR B O   
3402 C CB  . THR B 150 ? 0.3083 0.4170 0.4570 0.0528  0.0534  -0.0393 150 THR B CB  
3403 O OG1 . THR B 150 ? 0.3496 0.4565 0.5059 0.0450  0.0430  -0.0338 150 THR B OG1 
3404 C CG2 . THR B 150 ? 0.4050 0.5083 0.5587 0.0658  0.0473  -0.0463 150 THR B CG2 
3405 N N   . GLN B 151 ? 0.3499 0.4544 0.4581 0.0549  0.0795  -0.0447 151 GLN B N   
3406 C CA  . GLN B 151 ? 0.3851 0.4886 0.4788 0.0619  0.0907  -0.0514 151 GLN B CA  
3407 C C   . GLN B 151 ? 0.3548 0.4348 0.4155 0.0599  0.0870  -0.0536 151 GLN B C   
3408 O O   . GLN B 151 ? 0.3422 0.4116 0.3885 0.0676  0.0891  -0.0619 151 GLN B O   
3409 C CB  . GLN B 151 ? 0.4032 0.5269 0.5028 0.0587  0.1070  -0.0482 151 GLN B CB  
3410 C CG  . GLN B 151 ? 0.4998 0.6498 0.6354 0.0628  0.1136  -0.0489 151 GLN B CG  
3411 C CD  . GLN B 151 ? 0.5862 0.7566 0.7308 0.0558  0.1297  -0.0431 151 GLN B CD  
3412 O OE1 . GLN B 151 ? 0.6063 0.7691 0.7268 0.0485  0.1359  -0.0381 151 GLN B OE1 
3413 N NE2 . GLN B 151 ? 0.5633 0.7597 0.7434 0.0578  0.1364  -0.0434 151 GLN B NE2 
3414 N N   . LEU B 152 ? 0.2872 0.3592 0.3374 0.0498  0.0811  -0.0467 152 LEU B N   
3415 C CA  . LEU B 152 ? 0.3517 0.4037 0.3755 0.0471  0.0756  -0.0485 152 LEU B CA  
3416 C C   . LEU B 152 ? 0.3234 0.3579 0.3442 0.0517  0.0656  -0.0544 152 LEU B C   
3417 O O   . LEU B 152 ? 0.3699 0.3901 0.3732 0.0553  0.0645  -0.0614 152 LEU B O   
3418 C CB  . LEU B 152 ? 0.3453 0.3943 0.3642 0.0363  0.0707  -0.0397 152 LEU B CB  
3419 C CG  . LEU B 152 ? 0.4089 0.4406 0.4062 0.0326  0.0635  -0.0406 152 LEU B CG  
3420 C CD1 . LEU B 152 ? 0.4449 0.4788 0.4351 0.0246  0.0637  -0.0322 152 LEU B CD1 
3421 C CD2 . LEU B 152 ? 0.4481 0.4665 0.4491 0.0313  0.0527  -0.0418 152 LEU B CD2 
3422 N N   . ILE B 153 ? 0.3456 0.3794 0.3817 0.0511  0.0579  -0.0515 153 ILE B N   
3423 C CA  . ILE B 153 ? 0.3386 0.3540 0.3708 0.0549  0.0488  -0.0554 153 ILE B CA  
3424 C C   . ILE B 153 ? 0.3610 0.3726 0.3935 0.0668  0.0513  -0.0641 153 ILE B C   
3425 O O   . ILE B 153 ? 0.3767 0.3686 0.3947 0.0696  0.0475  -0.0697 153 ILE B O   
3426 C CB  . ILE B 153 ? 0.3422 0.3570 0.3879 0.0525  0.0405  -0.0501 153 ILE B CB  
3427 C CG1 . ILE B 153 ? 0.4265 0.4422 0.4699 0.0414  0.0386  -0.0426 153 ILE B CG1 
3428 C CG2 . ILE B 153 ? 0.3810 0.3739 0.4189 0.0562  0.0319  -0.0530 153 ILE B CG2 
3429 C CD1 . ILE B 153 ? 0.4177 0.4326 0.4717 0.0382  0.0313  -0.0377 153 ILE B CD1 
3430 N N   . SER B 154 ? 0.2813 0.3119 0.3316 0.0736  0.0583  -0.0656 154 SER B N   
3431 C CA  . SER B 154 ? 0.3530 0.3823 0.4065 0.0866  0.0621  -0.0745 154 SER B CA  
3432 C C   . SER B 154 ? 0.4307 0.4491 0.4604 0.0891  0.0690  -0.0821 154 SER B C   
3433 O O   . SER B 154 ? 0.4335 0.4344 0.4532 0.0968  0.0665  -0.0901 154 SER B O   
3434 C CB  . SER B 154 ? 0.3786 0.4350 0.4592 0.0929  0.0704  -0.0746 154 SER B CB  
3435 O OG  . SER B 154 ? 0.4587 0.5223 0.5621 0.0936  0.0610  -0.0703 154 SER B OG  
3436 N N   . ALA B 155 ? 0.4228 0.4497 0.4418 0.0825  0.0770  -0.0797 155 ALA B N   
3437 C CA  . ALA B 155 ? 0.4267 0.4428 0.4194 0.0841  0.0826  -0.0867 155 ALA B CA  
3438 C C   . ALA B 155 ? 0.4007 0.3909 0.3738 0.0799  0.0711  -0.0897 155 ALA B C   
3439 O O   . ALA B 155 ? 0.4734 0.4472 0.4294 0.0851  0.0709  -0.0992 155 ALA B O   
3440 C CB  . ALA B 155 ? 0.3733 0.4013 0.3560 0.0767  0.0912  -0.0813 155 ALA B CB  
3441 N N   . ALA B 156 ? 0.3652 0.3519 0.3416 0.0703  0.0620  -0.0819 156 ALA B N   
3442 C CA  . ALA B 156 ? 0.3783 0.3436 0.3411 0.0646  0.0520  -0.0835 156 ALA B CA  
3443 C C   . ALA B 156 ? 0.4091 0.3555 0.3719 0.0715  0.0469  -0.0900 156 ALA B C   
3444 O O   . ALA B 156 ? 0.4636 0.3909 0.4102 0.0720  0.0437  -0.0975 156 ALA B O   
3445 C CB  . ALA B 156 ? 0.3230 0.2906 0.2938 0.0543  0.0454  -0.0739 156 ALA B CB  
3446 N N   . GLN B 157 ? 0.4627 0.4133 0.4432 0.0766  0.0451  -0.0870 157 GLN B N   
3447 C CA  . GLN B 157 ? 0.4350 0.3664 0.4155 0.0842  0.0395  -0.0915 157 GLN B CA  
3448 C C   . GLN B 157 ? 0.5290 0.4538 0.5024 0.0959  0.0449  -0.1027 157 GLN B C   
3449 O O   . GLN B 157 ? 0.4850 0.3858 0.4483 0.1001  0.0402  -0.1088 157 GLN B O   
3450 C CB  . GLN B 157 ? 0.4105 0.3500 0.4112 0.0887  0.0356  -0.0859 157 GLN B CB  
3451 C CG  . GLN B 157 ? 0.3669 0.3068 0.3713 0.0783  0.0293  -0.0762 157 GLN B CG  
3452 C CD  . GLN B 157 ? 0.4348 0.3837 0.4575 0.0832  0.0246  -0.0715 157 GLN B CD  
3453 O OE1 . GLN B 157 ? 0.5938 0.5623 0.6339 0.0905  0.0287  -0.0729 157 GLN B OE1 
3454 N NE2 . GLN B 157 ? 0.3975 0.3320 0.4164 0.0792  0.0161  -0.0662 157 GLN B NE2 
3455 N N   . LYS B 158 ? 0.4613 0.4061 0.4396 0.1012  0.0556  -0.1053 158 LYS B N   
3456 C CA  . LYS B 158 ? 0.5785 0.5193 0.5500 0.1134  0.0634  -0.1166 158 LYS B CA  
3457 C C   . LYS B 158 ? 0.5754 0.4916 0.5185 0.1111  0.0612  -0.1254 158 LYS B C   
3458 O O   . LYS B 158 ? 0.6095 0.5090 0.5439 0.1209  0.0623  -0.1357 158 LYS B O   
3459 C CB  . LYS B 158 ? 0.5896 0.5572 0.5688 0.1170  0.0777  -0.1169 158 LYS B CB  
3460 C CG  . LYS B 158 ? 0.7244 0.7133 0.7340 0.1273  0.0828  -0.1160 158 LYS B CG  
3461 C CD  . LYS B 158 ? 0.7861 0.7949 0.7991 0.1343  0.1001  -0.1213 158 LYS B CD  
3462 C CE  . LYS B 158 ? 0.8227 0.8119 0.8088 0.1419  0.1059  -0.1341 158 LYS B CE  
3463 N NZ  . LYS B 158 ? 0.8058 0.8129 0.7953 0.1515  0.1246  -0.1407 158 LYS B NZ  
3464 N N   . GLN B 159 ? 0.5394 0.4533 0.4688 0.0983  0.0575  -0.1216 159 GLN B N   
3465 C CA  . GLN B 159 ? 0.6018 0.4937 0.5058 0.0944  0.0531  -0.1298 159 GLN B CA  
3466 C C   . GLN B 159 ? 0.5766 0.4492 0.4789 0.0845  0.0406  -0.1270 159 GLN B C   
3467 O O   . GLN B 159 ? 0.5450 0.4061 0.4320 0.0761  0.0349  -0.1301 159 GLN B O   
3468 C CB  . GLN B 159 ? 0.6185 0.5201 0.5055 0.0886  0.0575  -0.1298 159 GLN B CB  
3469 C CG  . GLN B 159 ? 0.5684 0.4896 0.4655 0.0784  0.0567  -0.1170 159 GLN B CG  
3470 C CD  . GLN B 159 ? 0.6424 0.5685 0.5191 0.0731  0.0592  -0.1166 159 GLN B CD  
3471 O OE1 . GLN B 159 ? 0.6461 0.5863 0.5185 0.0770  0.0706  -0.1158 159 GLN B OE1 
3472 N NE2 . GLN B 159 ? 0.7185 0.6328 0.5827 0.0641  0.0484  -0.1169 159 GLN B NE2 
3473 N N   . GLY B 160 ? 0.5288 0.3980 0.4469 0.0855  0.0364  -0.1211 160 GLY B N   
3474 C CA  . GLY B 160 ? 0.5014 0.3486 0.4167 0.0778  0.0270  -0.1192 160 GLY B CA  
3475 C C   . GLY B 160 ? 0.4429 0.2966 0.3637 0.0640  0.0225  -0.1096 160 GLY B C   
3476 O O   . GLY B 160 ? 0.4360 0.2725 0.3545 0.0562  0.0163  -0.1082 160 GLY B O   
3477 N N   . ILE B 161 ? 0.4642 0.3421 0.3929 0.0607  0.0261  -0.1027 161 ILE B N   
3478 C CA  . ILE B 161 ? 0.4224 0.3069 0.3579 0.0491  0.0224  -0.0938 161 ILE B CA  
3479 C C   . ILE B 161 ? 0.4431 0.3259 0.3913 0.0490  0.0205  -0.0860 161 ILE B C   
3480 O O   . ILE B 161 ? 0.3803 0.2731 0.3385 0.0565  0.0230  -0.0836 161 ILE B O   
3481 C CB  . ILE B 161 ? 0.3785 0.2859 0.3162 0.0456  0.0263  -0.0888 161 ILE B CB  
3482 C CG1 . ILE B 161 ? 0.4662 0.3723 0.3862 0.0459  0.0273  -0.0962 161 ILE B CG1 
3483 C CG2 . ILE B 161 ? 0.3851 0.2976 0.3305 0.0348  0.0222  -0.0803 161 ILE B CG2 
3484 C CD1 . ILE B 161 ? 0.4480 0.3740 0.3656 0.0455  0.0331  -0.0918 161 ILE B CD1 
3485 N N   . ARG B 162 ? 0.4138 0.2838 0.3614 0.0402  0.0159  -0.0826 162 ARG B N   
3486 C CA  . ARG B 162 ? 0.4219 0.2851 0.3755 0.0393  0.0139  -0.0756 162 ARG B CA  
3487 C C   . ARG B 162 ? 0.3927 0.2740 0.3562 0.0333  0.0152  -0.0671 162 ARG B C   
3488 O O   . ARG B 162 ? 0.3998 0.2857 0.3641 0.0244  0.0151  -0.0651 162 ARG B O   
3489 C CB  . ARG B 162 ? 0.4082 0.2464 0.3542 0.0325  0.0106  -0.0761 162 ARG B CB  
3490 C CG  . ARG B 162 ? 0.4489 0.2667 0.3841 0.0371  0.0087  -0.0853 162 ARG B CG  
3491 C CD  . ARG B 162 ? 0.5203 0.3131 0.4489 0.0282  0.0059  -0.0856 162 ARG B CD  
3492 N NE  . ARG B 162 ? 0.5766 0.3545 0.5038 0.0285  0.0053  -0.0783 162 ARG B NE  
3493 C CZ  . ARG B 162 ? 0.6253 0.3839 0.5481 0.0188  0.0053  -0.0748 162 ARG B CZ  
3494 N NH1 . ARG B 162 ? 0.5913 0.3461 0.5152 0.0078  0.0053  -0.0783 162 ARG B NH1 
3495 N NH2 . ARG B 162 ? 0.5617 0.3052 0.4790 0.0199  0.0051  -0.0676 162 ARG B NH2 
3496 N N   . CYS B 163 ? 0.3513 0.2426 0.3233 0.0384  0.0157  -0.0627 163 CYS B N   
3497 C CA  . CYS B 163 ? 0.3141 0.2228 0.2953 0.0336  0.0170  -0.0557 163 CYS B CA  
3498 C C   . CYS B 163 ? 0.3411 0.2408 0.3227 0.0294  0.0141  -0.0494 163 CYS B C   
3499 O O   . CYS B 163 ? 0.3651 0.2519 0.3435 0.0340  0.0107  -0.0486 163 CYS B O   
3500 C CB  . CYS B 163 ? 0.3584 0.2873 0.3504 0.0403  0.0199  -0.0552 163 CYS B CB  
3501 S SG  . CYS B 163 ? 0.3768 0.3185 0.3655 0.0442  0.0264  -0.0614 163 CYS B SG  
3502 N N   . ILE B 164 ? 0.3493 0.2549 0.3335 0.0210  0.0156  -0.0451 164 ILE B N   
3503 C CA  . ILE B 164 ? 0.2933 0.1921 0.2766 0.0166  0.0147  -0.0395 164 ILE B CA  
3504 C C   . ILE B 164 ? 0.3199 0.2370 0.3130 0.0153  0.0155  -0.0354 164 ILE B C   
3505 O O   . ILE B 164 ? 0.2993 0.2306 0.2978 0.0132  0.0180  -0.0354 164 ILE B O   
3506 C CB  . ILE B 164 ? 0.3202 0.2092 0.2997 0.0078  0.0170  -0.0388 164 ILE B CB  
3507 C CG1 . ILE B 164 ? 0.3706 0.2390 0.3408 0.0075  0.0163  -0.0425 164 ILE B CG1 
3508 C CG2 . ILE B 164 ? 0.2988 0.1827 0.2768 0.0032  0.0186  -0.0333 164 ILE B CG2 
3509 C CD1 . ILE B 164 ? 0.4387 0.2981 0.4083 -0.0023 0.0194  -0.0420 164 ILE B CD1 
3510 N N   . VAL B 165 ? 0.2531 0.1681 0.2469 0.0165  0.0128  -0.0318 165 VAL B N   
3511 C CA  . VAL B 165 ? 0.2524 0.1832 0.2563 0.0152  0.0126  -0.0284 165 VAL B CA  
3512 C C   . VAL B 165 ? 0.2520 0.1747 0.2515 0.0100  0.0118  -0.0245 165 VAL B C   
3513 O O   . VAL B 165 ? 0.2770 0.1831 0.2659 0.0108  0.0090  -0.0238 165 VAL B O   
3514 C CB  . VAL B 165 ? 0.2890 0.2297 0.3021 0.0221  0.0090  -0.0290 165 VAL B CB  
3515 C CG1 . VAL B 165 ? 0.3532 0.3074 0.3772 0.0189  0.0078  -0.0252 165 VAL B CG1 
3516 C CG2 . VAL B 165 ? 0.2959 0.2481 0.3148 0.0274  0.0125  -0.0332 165 VAL B CG2 
3517 N N   . ASP B 166 ? 0.2736 0.2059 0.2793 0.0052  0.0144  -0.0220 166 ASP B N   
3518 C CA  . ASP B 166 ? 0.2342 0.1603 0.2369 0.0012  0.0142  -0.0192 166 ASP B CA  
3519 C C   . ASP B 166 ? 0.2393 0.1804 0.2534 -0.0004 0.0136  -0.0167 166 ASP B C   
3520 O O   . ASP B 166 ? 0.2836 0.2340 0.3038 -0.0030 0.0170  -0.0153 166 ASP B O   
3521 C CB  . ASP B 166 ? 0.2441 0.1629 0.2428 -0.0038 0.0195  -0.0189 166 ASP B CB  
3522 C CG  . ASP B 166 ? 0.3063 0.2162 0.2997 -0.0069 0.0209  -0.0170 166 ASP B CG  
3523 O OD1 . ASP B 166 ? 0.3516 0.2563 0.3437 -0.0104 0.0265  -0.0170 166 ASP B OD1 
3524 O OD2 . ASP B 166 ? 0.3799 0.2883 0.3713 -0.0059 0.0165  -0.0160 166 ASP B OD2 
3525 N N   . SER B 167 ? 0.2349 0.1774 0.2521 0.0008  0.0084  -0.0160 167 SER B N   
3526 C CA  . SER B 167 ? 0.2582 0.2138 0.2875 -0.0020 0.0079  -0.0136 167 SER B CA  
3527 C C   . SER B 167 ? 0.2641 0.2137 0.2925 -0.0030 0.0008  -0.0134 167 SER B C   
3528 O O   . SER B 167 ? 0.2920 0.2250 0.3065 -0.0017 -0.0029 -0.0146 167 SER B O   
3529 C CB  . SER B 167 ? 0.2825 0.2569 0.3250 0.0005  0.0097  -0.0136 167 SER B CB  
3530 O OG  . SER B 167 ? 0.2876 0.2738 0.3408 -0.0040 0.0117  -0.0101 167 SER B OG  
3531 N N   . SER B 168 ? 0.2453 0.2070 0.2873 -0.0057 -0.0013 -0.0117 168 SER B N   
3532 C CA  . SER B 168 ? 0.2575 0.2141 0.3002 -0.0075 -0.0099 -0.0122 168 SER B CA  
3533 C C   . SER B 168 ? 0.2452 0.2213 0.3097 -0.0089 -0.0131 -0.0114 168 SER B C   
3534 O O   . SER B 168 ? 0.2656 0.2583 0.3429 -0.0092 -0.0064 -0.0097 168 SER B O   
3535 C CB  . SER B 168 ? 0.3662 0.3098 0.3998 -0.0128 -0.0090 -0.0114 168 SER B CB  
3536 O OG  . SER B 168 ? 0.3737 0.3274 0.4185 -0.0172 -0.0037 -0.0083 168 SER B OG  
3537 N N   . GLY B 169 ? 0.2635 0.2374 0.3319 -0.0101 -0.0232 -0.0128 169 GLY B N   
3538 C CA  . GLY B 169 ? 0.2933 0.2861 0.3859 -0.0133 -0.0271 -0.0121 169 GLY B CA  
3539 C C   . GLY B 169 ? 0.3092 0.3235 0.4207 -0.0081 -0.0238 -0.0126 169 GLY B C   
3540 O O   . GLY B 169 ? 0.2768 0.2885 0.3826 -0.0001 -0.0250 -0.0149 169 GLY B O   
3541 N N   . GLU B 170 ? 0.2790 0.3137 0.4125 -0.0127 -0.0186 -0.0103 170 GLU B N   
3542 C CA  . GLU B 170 ? 0.2521 0.3094 0.4060 -0.0078 -0.0138 -0.0112 170 GLU B CA  
3543 C C   . GLU B 170 ? 0.1920 0.2481 0.3338 -0.0017 -0.0035 -0.0117 170 GLU B C   
3544 O O   . GLU B 170 ? 0.2816 0.3475 0.4311 0.0062  -0.0019 -0.0148 170 GLU B O   
3545 C CB  . GLU B 170 ? 0.2292 0.3078 0.4082 -0.0155 -0.0079 -0.0079 170 GLU B CB  
3546 C CG  . GLU B 170 ? 0.3144 0.3980 0.5117 -0.0215 -0.0195 -0.0086 170 GLU B CG  
3547 C CD  . GLU B 170 ? 0.5570 0.6603 0.7797 -0.0312 -0.0124 -0.0047 170 GLU B CD  
3548 O OE1 . GLU B 170 ? 0.6856 0.7998 0.9315 -0.0363 -0.0212 -0.0058 170 GLU B OE1 
3549 O OE2 . GLU B 170 ? 0.5432 0.6504 0.7622 -0.0341 0.0016  -0.0002 170 GLU B OE2 
3550 N N   . ALA B 171 ? 0.2092 0.2530 0.3326 -0.0050 0.0025  -0.0093 171 ALA B N   
3551 C CA  . ALA B 171 ? 0.2290 0.2700 0.3396 -0.0002 0.0104  -0.0104 171 ALA B CA  
3552 C C   . ALA B 171 ? 0.2070 0.2354 0.3059 0.0079  0.0053  -0.0150 171 ALA B C   
3553 O O   . ALA B 171 ? 0.2719 0.3047 0.3710 0.0145  0.0091  -0.0181 171 ALA B O   
3554 C CB  . ALA B 171 ? 0.2575 0.2878 0.3529 -0.0052 0.0151  -0.0071 171 ALA B CB  
3555 N N   . LEU B 172 ? 0.2352 0.2458 0.3220 0.0072  -0.0029 -0.0154 172 LEU B N   
3556 C CA  . LEU B 172 ? 0.2447 0.2395 0.3176 0.0137  -0.0078 -0.0184 172 LEU B CA  
3557 C C   . LEU B 172 ? 0.2275 0.2310 0.3134 0.0219  -0.0138 -0.0213 172 LEU B C   
3558 O O   . LEU B 172 ? 0.2632 0.2616 0.3438 0.0293  -0.0130 -0.0242 172 LEU B O   
3559 C CB  . LEU B 172 ? 0.2568 0.2303 0.3125 0.0107  -0.0145 -0.0176 172 LEU B CB  
3560 C CG  . LEU B 172 ? 0.2831 0.2368 0.3213 0.0165  -0.0194 -0.0194 172 LEU B CG  
3561 C CD1 . LEU B 172 ? 0.3363 0.2843 0.3656 0.0185  -0.0114 -0.0206 172 LEU B CD1 
3562 C CD2 . LEU B 172 ? 0.3305 0.2623 0.3487 0.0130  -0.0240 -0.0183 172 LEU B CD2 
3563 N N   . SER B 173 ? 0.2175 0.2341 0.3220 0.0208  -0.0204 -0.0209 173 SER B N   
3564 C CA  . SER B 173 ? 0.2402 0.2693 0.3631 0.0291  -0.0270 -0.0237 173 SER B CA  
3565 C C   . SER B 173 ? 0.3122 0.3594 0.4490 0.0346  -0.0160 -0.0260 173 SER B C   
3566 O O   . SER B 173 ? 0.3083 0.3552 0.4478 0.0448  -0.0178 -0.0297 173 SER B O   
3567 C CB  . SER B 173 ? 0.3345 0.3782 0.4796 0.0249  -0.0357 -0.0230 173 SER B CB  
3568 O OG  . SER B 173 ? 0.5376 0.5966 0.7052 0.0335  -0.0426 -0.0259 173 SER B OG  
3569 N N   . ALA B 174 ? 0.3080 0.3685 0.4509 0.0283  -0.0044 -0.0239 174 ALA B N   
3570 C CA  . ALA B 174 ? 0.3276 0.4039 0.4792 0.0325  0.0079  -0.0259 174 ALA B CA  
3571 C C   . ALA B 174 ? 0.3688 0.4290 0.4980 0.0383  0.0120  -0.0293 174 ALA B C   
3572 O O   . ALA B 174 ? 0.4347 0.5008 0.5683 0.0470  0.0167  -0.0338 174 ALA B O   
3573 C CB  . ALA B 174 ? 0.3161 0.4057 0.4733 0.0233  0.0189  -0.0216 174 ALA B CB  
3574 N N   . ALA B 175 ? 0.3115 0.3514 0.4180 0.0335  0.0103  -0.0274 175 ALA B N   
3575 C CA  . ALA B 175 ? 0.2851 0.3088 0.3716 0.0369  0.0132  -0.0305 175 ALA B CA  
3576 C C   . ALA B 175 ? 0.3952 0.4062 0.4779 0.0464  0.0061  -0.0345 175 ALA B C   
3577 O O   . ALA B 175 ? 0.4738 0.4755 0.5464 0.0517  0.0091  -0.0387 175 ALA B O   
3578 C CB  . ALA B 175 ? 0.2978 0.3050 0.3660 0.0291  0.0126  -0.0275 175 ALA B CB  
3579 N N   . LEU B 176 ? 0.3639 0.3795 0.3878 0.0196  0.1139  -0.0011 176 LEU B N   
3580 C CA  . LEU B 176 ? 0.3733 0.3939 0.4143 0.0310  0.1159  -0.0019 176 LEU B CA  
3581 C C   . LEU B 176 ? 0.4038 0.4481 0.4657 0.0388  0.1289  0.0023  176 LEU B C   
3582 O O   . LEU B 176 ? 0.4423 0.4927 0.5211 0.0496  0.1312  0.0030  176 LEU B O   
3583 C CB  . LEU B 176 ? 0.3773 0.4024 0.4323 0.0281  0.1023  0.0026  176 LEU B CB  
3584 C CG  . LEU B 176 ? 0.4866 0.4902 0.5283 0.0268  0.0916  -0.0029 176 LEU B CG  
3585 C CD1 . LEU B 176 ? 0.4432 0.4553 0.4993 0.0239  0.0804  0.0021  176 LEU B CD1 
3586 C CD2 . LEU B 176 ? 0.6184 0.6064 0.6534 0.0368  0.0967  -0.0096 176 LEU B CD2 
3587 N N   . ALA B 177 ? 0.4278 0.4859 0.4889 0.0334  0.1374  0.0058  177 ALA B N   
3588 C CA  . ALA B 177 ? 0.4182 0.5046 0.5022 0.0396  0.1503  0.0110  177 ALA B CA  
3589 C C   . ALA B 177 ? 0.4316 0.5138 0.5169 0.0562  0.1641  0.0038  177 ALA B C   
3590 O O   . ALA B 177 ? 0.4570 0.5585 0.5684 0.0670  0.1697  0.0075  177 ALA B O   
3591 C CB  . ALA B 177 ? 0.3988 0.4990 0.4778 0.0291  0.1579  0.0157  177 ALA B CB  
3592 N N   . ILE B 178 ? 0.4383 0.4943 0.4949 0.0583  0.1690  -0.0064 178 ILE B N   
3593 C CA  . ILE B 178 ? 0.5045 0.5513 0.5570 0.0733  0.1827  -0.0152 178 ILE B CA  
3594 C C   . ILE B 178 ? 0.4263 0.4533 0.4811 0.0826  0.1752  -0.0196 178 ILE B C   
3595 O O   . ILE B 178 ? 0.6503 0.6758 0.7152 0.0974  0.1840  -0.0230 178 ILE B O   
3596 C CB  . ILE B 178 ? 0.6538 0.6800 0.6718 0.0706  0.1915  -0.0249 178 ILE B CB  
3597 C CG1 . ILE B 178 ? 0.7252 0.7314 0.7188 0.0562  0.1768  -0.0257 178 ILE B CG1 
3598 C CG2 . ILE B 178 ? 0.6824 0.7311 0.7018 0.0686  0.2073  -0.0220 178 ILE B CG2 
3599 C CD1 . ILE B 178 ? 0.5289 0.5048 0.4880 0.0558  0.1785  -0.0371 178 ILE B CD1 
3600 N N   . GLY B 179 ? 0.3824 0.3938 0.4277 0.0740  0.1592  -0.0193 179 GLY B N   
3601 C CA  . GLY B 179 ? 0.3829 0.3779 0.4313 0.0800  0.1509  -0.0214 179 GLY B CA  
3602 C C   . GLY B 179 ? 0.4206 0.3823 0.4418 0.0825  0.1521  -0.0331 179 GLY B C   
3603 O O   . GLY B 179 ? 0.4208 0.3708 0.4178 0.0781  0.1575  -0.0400 179 GLY B O   
3604 N N   . ASN B 180 ? 0.3642 0.3106 0.3889 0.0884  0.1462  -0.0346 180 ASN B N   
3605 C CA  . ASN B 180 ? 0.4339 0.3475 0.4347 0.0893  0.1450  -0.0449 180 ASN B CA  
3606 C C   . ASN B 180 ? 0.3785 0.2793 0.3568 0.0749  0.1343  -0.0480 180 ASN B C   
3607 O O   . ASN B 180 ? 0.4207 0.2972 0.3748 0.0726  0.1343  -0.0572 180 ASN B O   
3608 C CB  . ASN B 180 ? 0.4720 0.3727 0.4589 0.0990  0.1610  -0.0550 180 ASN B CB  
3609 C CG  . ASN B 180 ? 0.7145 0.6305 0.7262 0.1151  0.1729  -0.0521 180 ASN B CG  
3610 O OD1 . ASN B 180 ? 0.7531 0.6655 0.7814 0.1241  0.1693  -0.0487 180 ASN B OD1 
3611 N ND2 . ASN B 180 ? 0.7418 0.6762 0.7569 0.1190  0.1871  -0.0527 180 ASN B ND2 
3612 N N   . ILE B 181 ? 0.3405 0.2574 0.3269 0.0653  0.1248  -0.0405 181 ILE B N   
3613 C CA  . ILE B 181 ? 0.3334 0.2400 0.3034 0.0534  0.1131  -0.0422 181 ILE B CA  
3614 C C   . ILE B 181 ? 0.3595 0.2497 0.3279 0.0532  0.1041  -0.0445 181 ILE B C   
3615 O O   . ILE B 181 ? 0.3841 0.2800 0.3704 0.0580  0.1015  -0.0394 181 ILE B O   
3616 C CB  . ILE B 181 ? 0.3106 0.2368 0.2916 0.0449  0.1052  -0.0339 181 ILE B CB  
3617 C CG1 . ILE B 181 ? 0.3663 0.3080 0.3482 0.0433  0.1141  -0.0307 181 ILE B CG1 
3618 C CG2 . ILE B 181 ? 0.4181 0.3339 0.3848 0.0347  0.0931  -0.0357 181 ILE B CG2 
3619 C CD1 . ILE B 181 ? 0.4359 0.3641 0.3909 0.0393  0.1192  -0.0371 181 ILE B CD1 
3620 N N   . GLU B 182 ? 0.3729 0.2436 0.3200 0.0470  0.0991  -0.0514 182 GLU B N   
3621 C CA  . GLU B 182 ? 0.4020 0.2570 0.3465 0.0452  0.0911  -0.0536 182 GLU B CA  
3622 C C   . GLU B 182 ? 0.3508 0.2186 0.3095 0.0396  0.0799  -0.0464 182 GLU B C   
3623 O O   . GLU B 182 ? 0.3724 0.2375 0.3403 0.0413  0.0761  -0.0436 182 GLU B O   
3624 C CB  . GLU B 182 ? 0.3800 0.2137 0.2990 0.0383  0.0877  -0.0624 182 GLU B CB  
3625 C CG  . GLU B 182 ? 0.5034 0.3185 0.4041 0.0437  0.0986  -0.0714 182 GLU B CG  
3626 C CD  . GLU B 182 ? 0.5360 0.3282 0.4331 0.0484  0.0996  -0.0765 182 GLU B CD  
3627 O OE1 . GLU B 182 ? 0.5888 0.3630 0.4713 0.0542  0.1090  -0.0850 182 GLU B OE1 
3628 O OE2 . GLU B 182 ? 0.5340 0.3252 0.4419 0.0459  0.0912  -0.0722 182 GLU B OE2 
3629 N N   . LEU B 183 ? 0.3116 0.1920 0.2704 0.0327  0.0748  -0.0437 183 LEU B N   
3630 C CA  . LEU B 183 ? 0.2914 0.1823 0.2602 0.0272  0.0646  -0.0389 183 LEU B CA  
3631 C C   . LEU B 183 ? 0.3052 0.2118 0.2787 0.0234  0.0629  -0.0346 183 LEU B C   
3632 O O   . LEU B 183 ? 0.3381 0.2419 0.2996 0.0205  0.0647  -0.0367 183 LEU B O   
3633 C CB  . LEU B 183 ? 0.3403 0.2195 0.2969 0.0202  0.0563  -0.0434 183 LEU B CB  
3634 C CG  . LEU B 183 ? 0.3697 0.2594 0.3335 0.0143  0.0466  -0.0405 183 LEU B CG  
3635 C CD1 . LEU B 183 ? 0.3409 0.2393 0.3202 0.0163  0.0451  -0.0350 183 LEU B CD1 
3636 C CD2 . LEU B 183 ? 0.3921 0.2725 0.3452 0.0081  0.0398  -0.0452 183 LEU B CD2 
3637 N N   . VAL B 184 ? 0.2580 0.1797 0.2476 0.0229  0.0590  -0.0284 184 VAL B N   
3638 C CA  . VAL B 184 ? 0.2439 0.1775 0.2372 0.0176  0.0552  -0.0247 184 VAL B CA  
3639 C C   . VAL B 184 ? 0.2454 0.1832 0.2439 0.0133  0.0454  -0.0234 184 VAL B C   
3640 O O   . VAL B 184 ? 0.2519 0.1922 0.2583 0.0151  0.0435  -0.0217 184 VAL B O   
3641 C CB  . VAL B 184 ? 0.2756 0.2258 0.2832 0.0201  0.0608  -0.0184 184 VAL B CB  
3642 C CG1 . VAL B 184 ? 0.2863 0.2464 0.3112 0.0245  0.0598  -0.0135 184 VAL B CG1 
3643 C CG2 . VAL B 184 ? 0.3066 0.2657 0.3155 0.0128  0.0566  -0.0148 184 VAL B CG2 
3644 N N   . LYS B 185 ? 0.2263 0.1640 0.2195 0.0080  0.0395  -0.0244 185 LYS B N   
3645 C CA  . LYS B 185 ? 0.2333 0.1749 0.2306 0.0047  0.0315  -0.0246 185 LYS B CA  
3646 C C   . LYS B 185 ? 0.2896 0.2393 0.2918 0.0009  0.0279  -0.0214 185 LYS B C   
3647 O O   . LYS B 185 ? 0.2569 0.2016 0.2525 -0.0021 0.0234  -0.0232 185 LYS B O   
3648 C CB  . LYS B 185 ? 0.2454 0.1780 0.2330 0.0026  0.0262  -0.0299 185 LYS B CB  
3649 C CG  . LYS B 185 ? 0.2561 0.1945 0.2491 0.0008  0.0200  -0.0310 185 LYS B CG  
3650 C CD  . LYS B 185 ? 0.3119 0.2468 0.2996 -0.0009 0.0140  -0.0349 185 LYS B CD  
3651 C CE  . LYS B 185 ? 0.2468 0.1801 0.2322 -0.0023 0.0114  -0.0335 185 LYS B CE  
3652 N NZ  . LYS B 185 ? 0.2104 0.1509 0.2032 -0.0038 0.0104  -0.0309 185 LYS B NZ  
3653 N N   . PRO B 186 ? 0.2099 0.1714 0.2237 0.0009  0.0291  -0.0162 186 PRO B N   
3654 C CA  . PRO B 186 ? 0.2178 0.1855 0.2351 -0.0044 0.0242  -0.0138 186 PRO B CA  
3655 C C   . PRO B 186 ? 0.2440 0.2112 0.2605 -0.0064 0.0171  -0.0169 186 PRO B C   
3656 O O   . PRO B 186 ? 0.2239 0.1932 0.2427 -0.0041 0.0169  -0.0176 186 PRO B O   
3657 C CB  . PRO B 186 ? 0.2338 0.2164 0.2649 -0.0041 0.0268  -0.0071 186 PRO B CB  
3658 C CG  . PRO B 186 ? 0.2523 0.2362 0.2883 0.0022  0.0299  -0.0066 186 PRO B CG  
3659 C CD  . PRO B 186 ? 0.2412 0.2105 0.2656 0.0056  0.0338  -0.0122 186 PRO B CD  
3660 N N   . ASN B 187 ? 0.2368 0.2005 0.2494 -0.0105 0.0118  -0.0188 187 ASN B N   
3661 C CA  . ASN B 187 ? 0.2488 0.2146 0.2616 -0.0124 0.0063  -0.0216 187 ASN B CA  
3662 C C   . ASN B 187 ? 0.2419 0.2193 0.2628 -0.0164 0.0046  -0.0164 187 ASN B C   
3663 O O   . ASN B 187 ? 0.2336 0.2188 0.2622 -0.0166 0.0080  -0.0104 187 ASN B O   
3664 C CB  . ASN B 187 ? 0.2144 0.1700 0.2197 -0.0139 0.0012  -0.0268 187 ASN B CB  
3665 C CG  . ASN B 187 ? 0.2621 0.2127 0.2656 -0.0190 -0.0012 -0.0241 187 ASN B CG  
3666 O OD1 . ASN B 187 ? 0.2179 0.1765 0.2274 -0.0231 0.0000  -0.0184 187 ASN B OD1 
3667 N ND2 . ASN B 187 ? 0.2303 0.1681 0.2264 -0.0189 -0.0052 -0.0277 187 ASN B ND2 
3668 N N   . GLN B 188 ? 0.1971 0.1766 0.2162 -0.0196 -0.0006 -0.0187 188 GLN B N   
3669 C CA  . GLN B 188 ? 0.2179 0.2091 0.2435 -0.0242 -0.0037 -0.0136 188 GLN B CA  
3670 C C   . GLN B 188 ? 0.2021 0.1962 0.2320 -0.0302 -0.0055 -0.0093 188 GLN B C   
3671 O O   . GLN B 188 ? 0.2269 0.2349 0.2680 -0.0319 -0.0049 -0.0020 188 GLN B O   
3672 C CB  . GLN B 188 ? 0.2354 0.2266 0.2542 -0.0274 -0.0090 -0.0181 188 GLN B CB  
3673 C CG  . GLN B 188 ? 0.3067 0.3007 0.3237 -0.0235 -0.0070 -0.0194 188 GLN B CG  
3674 C CD  . GLN B 188 ? 0.4793 0.4716 0.4866 -0.0260 -0.0102 -0.0260 188 GLN B CD  
3675 O OE1 . GLN B 188 ? 0.3412 0.3251 0.3422 -0.0238 -0.0094 -0.0337 188 GLN B OE1 
3676 N NE2 . GLN B 188 ? 0.3598 0.3609 0.3658 -0.0305 -0.0138 -0.0229 188 GLN B NE2 
3677 N N   . LYS B 189 ? 0.2098 0.1913 0.2317 -0.0334 -0.0080 -0.0132 189 LYS B N   
3678 C CA  . LYS B 189 ? 0.2168 0.1991 0.2415 -0.0408 -0.0098 -0.0086 189 LYS B CA  
3679 C C   . LYS B 189 ? 0.2611 0.2516 0.2941 -0.0388 -0.0025 -0.0020 189 LYS B C   
3680 O O   . LYS B 189 ? 0.2496 0.2535 0.2931 -0.0437 -0.0018 0.0050  189 LYS B O   
3681 C CB  . LYS B 189 ? 0.3258 0.2890 0.3389 -0.0440 -0.0140 -0.0137 189 LYS B CB  
3682 C CG  . LYS B 189 ? 0.4973 0.4535 0.5036 -0.0494 -0.0216 -0.0189 189 LYS B CG  
3683 C CD  . LYS B 189 ? 0.6142 0.5487 0.6094 -0.0513 -0.0258 -0.0238 189 LYS B CD  
3684 C CE  . LYS B 189 ? 0.7468 0.6720 0.7336 -0.0557 -0.0326 -0.0309 189 LYS B CE  
3685 N NZ  . LYS B 189 ? 0.7430 0.6450 0.7187 -0.0520 -0.0355 -0.0388 189 LYS B NZ  
3686 N N   . GLU B 190 ? 0.2246 0.2078 0.2527 -0.0318 0.0030  -0.0046 190 GLU B N   
3687 C CA  . GLU B 190 ? 0.2238 0.2123 0.2562 -0.0287 0.0112  -0.0003 190 GLU B CA  
3688 C C   . GLU B 190 ? 0.2388 0.2449 0.2857 -0.0245 0.0159  0.0048  190 GLU B C   
3689 O O   . GLU B 190 ? 0.2271 0.2451 0.2835 -0.0249 0.0215  0.0105  190 GLU B O   
3690 C CB  . GLU B 190 ? 0.2246 0.1996 0.2458 -0.0227 0.0147  -0.0054 190 GLU B CB  
3691 C CG  . GLU B 190 ? 0.2507 0.2102 0.2597 -0.0264 0.0108  -0.0075 190 GLU B CG  
3692 C CD  . GLU B 190 ? 0.2750 0.2216 0.2734 -0.0210 0.0099  -0.0134 190 GLU B CD  
3693 O OE1 . GLU B 190 ? 0.2181 0.1669 0.2176 -0.0154 0.0129  -0.0162 190 GLU B OE1 
3694 O OE2 . GLU B 190 ? 0.2778 0.2117 0.2671 -0.0228 0.0056  -0.0146 190 GLU B OE2 
3695 N N   . LEU B 191 ? 0.1974 0.2058 0.2466 -0.0205 0.0137  0.0032  191 LEU B N   
3696 C CA  . LEU B 191 ? 0.2406 0.2640 0.3038 -0.0159 0.0164  0.0089  191 LEU B CA  
3697 C C   . LEU B 191 ? 0.1932 0.2347 0.2699 -0.0221 0.0127  0.0163  191 LEU B C   
3698 O O   . LEU B 191 ? 0.2160 0.2730 0.3076 -0.0191 0.0175  0.0228  191 LEU B O   
3699 C CB  . LEU B 191 ? 0.2107 0.2316 0.2715 -0.0126 0.0130  0.0070  191 LEU B CB  
3700 C CG  . LEU B 191 ? 0.2270 0.2606 0.3015 -0.0071 0.0146  0.0139  191 LEU B CG  
3701 C CD1 . LEU B 191 ? 0.2136 0.2448 0.2923 0.0017  0.0243  0.0144  191 LEU B CD1 
3702 C CD2 . LEU B 191 ? 0.2207 0.2507 0.2905 -0.0061 0.0101  0.0131  191 LEU B CD2 
3703 N N   . SER B 192 ? 0.1968 0.2367 0.2686 -0.0306 0.0039  0.0150  192 SER B N   
3704 C CA  . SER B 192 ? 0.2054 0.2614 0.2883 -0.0390 -0.0019 0.0216  192 SER B CA  
3705 C C   . SER B 192 ? 0.2632 0.3286 0.3553 -0.0432 0.0027  0.0270  192 SER B C   
3706 O O   . SER B 192 ? 0.2277 0.3147 0.3376 -0.0449 0.0032  0.0352  192 SER B O   
3707 C CB  . SER B 192 ? 0.2353 0.2819 0.3062 -0.0484 -0.0118 0.0169  192 SER B CB  
3708 O OG  . SER B 192 ? 0.3565 0.4165 0.4360 -0.0587 -0.0182 0.0228  192 SER B OG  
3709 N N   . ALA B 193 ? 0.2756 0.3259 0.3560 -0.0453 0.0058  0.0232  193 ALA B N   
3710 C CA  . ALA B 193 ? 0.3087 0.3665 0.3949 -0.0504 0.0109  0.0286  193 ALA B CA  
3711 C C   . ALA B 193 ? 0.2649 0.3376 0.3638 -0.0412 0.0225  0.0327  193 ALA B C   
3712 O O   . ALA B 193 ? 0.2407 0.3336 0.3552 -0.0442 0.0268  0.0402  193 ALA B O   
3713 C CB  . ALA B 193 ? 0.2513 0.2870 0.3196 -0.0539 0.0112  0.0241  193 ALA B CB  
3714 N N   . LEU B 194 ? 0.2365 0.2994 0.3291 -0.0302 0.0277  0.0276  194 LEU B N   
3715 C CA  . LEU B 194 ? 0.2695 0.3413 0.3709 -0.0200 0.0392  0.0294  194 LEU B CA  
3716 C C   . LEU B 194 ? 0.3042 0.4006 0.4293 -0.0155 0.0400  0.0368  194 LEU B C   
3717 O O   . LEU B 194 ? 0.2883 0.4023 0.4281 -0.0120 0.0487  0.0418  194 LEU B O   
3718 C CB  . LEU B 194 ? 0.3098 0.3628 0.3978 -0.0105 0.0425  0.0218  194 LEU B CB  
3719 C CG  . LEU B 194 ? 0.2717 0.3265 0.3633 0.0005  0.0544  0.0209  194 LEU B CG  
3720 C CD1 . LEU B 194 ? 0.2626 0.3182 0.3485 -0.0016 0.0638  0.0210  194 LEU B CD1 
3721 C CD2 . LEU B 194 ? 0.3154 0.3499 0.3932 0.0071  0.0544  0.0135  194 LEU B CD2 
3722 N N   . VAL B 195 ? 0.2400 0.3389 0.3692 -0.0154 0.0310  0.0381  195 VAL B N   
3723 C CA  . VAL B 195 ? 0.2269 0.3493 0.3788 -0.0113 0.0296  0.0465  195 VAL B CA  
3724 C C   . VAL B 195 ? 0.2840 0.4273 0.4492 -0.0232 0.0221  0.0540  195 VAL B C   
3725 O O   . VAL B 195 ? 0.2179 0.3845 0.4040 -0.0217 0.0191  0.0624  195 VAL B O   
3726 C CB  . VAL B 195 ? 0.1886 0.3055 0.3392 -0.0052 0.0235  0.0463  195 VAL B CB  
3727 C CG1 . VAL B 195 ? 0.3334 0.4314 0.4736 0.0060  0.0312  0.0401  195 VAL B CG1 
3728 C CG2 . VAL B 195 ? 0.2302 0.3371 0.3664 -0.0151 0.0116  0.0430  195 VAL B CG2 
3729 N N   . ASN B 196 ? 0.1976 0.3317 0.3507 -0.0353 0.0184  0.0513  196 ASN B N   
3730 C CA  . ASN B 196 ? 0.1997 0.3494 0.3622 -0.0492 0.0112  0.0577  196 ASN B CA  
3731 C C   . ASN B 196 ? 0.2118 0.3729 0.3816 -0.0543 -0.0016 0.0617  196 ASN B C   
3732 O O   . ASN B 196 ? 0.2045 0.3917 0.3947 -0.0597 -0.0055 0.0707  196 ASN B O   
3733 C CB  . ASN B 196 ? 0.2705 0.4465 0.4547 -0.0495 0.0201  0.0661  196 ASN B CB  
3734 C CG  . ASN B 196 ? 0.3764 0.5633 0.5656 -0.0668 0.0142  0.0716  196 ASN B CG  
3735 O OD1 . ASN B 196 ? 0.2815 0.4477 0.4520 -0.0775 0.0073  0.0670  196 ASN B OD1 
3736 N ND2 . ASN B 196 ? 0.3143 0.5339 0.5299 -0.0696 0.0166  0.0817  196 ASN B ND2 
3737 N N   . ARG B 197 ? 0.2437 0.3866 0.3968 -0.0531 -0.0082 0.0552  197 ARG B N   
3738 C CA  . ARG B 197 ? 0.2433 0.3932 0.3969 -0.0599 -0.0210 0.0578  197 ARG B CA  
3739 C C   . ARG B 197 ? 0.2866 0.4111 0.4148 -0.0621 -0.0267 0.0477  197 ARG B C   
3740 O O   . ARG B 197 ? 0.2301 0.3352 0.3449 -0.0547 -0.0205 0.0402  197 ARG B O   
3741 C CB  . ARG B 197 ? 0.1962 0.3669 0.3687 -0.0509 -0.0221 0.0663  197 ARG B CB  
3742 C CG  . ARG B 197 ? 0.3134 0.4711 0.4799 -0.0364 -0.0158 0.0629  197 ARG B CG  
3743 C CD  . ARG B 197 ? 0.3299 0.5045 0.5123 -0.0292 -0.0201 0.0721  197 ARG B CD  
3744 N NE  . ARG B 197 ? 0.3338 0.4927 0.5085 -0.0169 -0.0151 0.0691  197 ARG B NE  
3745 C CZ  . ARG B 197 ? 0.3007 0.4567 0.4832 -0.0040 -0.0038 0.0688  197 ARG B CZ  
3746 N NH1 . ARG B 197 ? 0.3864 0.5560 0.5844 -0.0010 0.0047  0.0712  197 ARG B NH1 
3747 N NH2 . ARG B 197 ? 0.3763 0.5156 0.5501 0.0052  -0.0007 0.0660  197 ARG B NH2 
3748 N N   . GLU B 198 ? 0.2656 0.3910 0.3871 -0.0726 -0.0383 0.0474  198 GLU B N   
3749 C CA  . GLU B 198 ? 0.2986 0.4021 0.3963 -0.0744 -0.0429 0.0374  198 GLU B CA  
3750 C C   . GLU B 198 ? 0.2872 0.3915 0.3829 -0.0646 -0.0418 0.0379  198 GLU B C   
3751 O O   . GLU B 198 ? 0.3970 0.5201 0.5074 -0.0616 -0.0444 0.0472  198 GLU B O   
3752 C CB  . GLU B 198 ? 0.3991 0.5022 0.4878 -0.0890 -0.0554 0.0359  198 GLU B CB  
3753 C CG  . GLU B 198 ? 0.6568 0.7582 0.7473 -0.1013 -0.0584 0.0365  198 GLU B CG  
3754 C CD  . GLU B 198 ? 0.8746 0.9467 0.9455 -0.1026 -0.0559 0.0257  198 GLU B CD  
3755 O OE1 . GLU B 198 ? 0.9977 1.0527 1.0540 -0.0942 -0.0524 0.0170  198 GLU B OE1 
3756 O OE2 . GLU B 198 ? 0.9681 1.0348 1.0389 -0.1121 -0.0576 0.0265  198 GLU B OE2 
3757 N N   . LEU B 199 ? 0.2539 0.3383 0.3322 -0.0599 -0.0383 0.0286  199 LEU B N   
3758 C CA  . LEU B 199 ? 0.2551 0.3382 0.3296 -0.0521 -0.0369 0.0290  199 LEU B CA  
3759 C C   . LEU B 199 ? 0.4058 0.4813 0.4612 -0.0587 -0.0440 0.0230  199 LEU B C   
3760 O O   . LEU B 199 ? 0.4185 0.4776 0.4582 -0.0571 -0.0409 0.0132  199 LEU B O   
3761 C CB  . LEU B 199 ? 0.2456 0.3147 0.3163 -0.0420 -0.0266 0.0237  199 LEU B CB  
3762 C CG  . LEU B 199 ? 0.3160 0.3888 0.4002 -0.0364 -0.0186 0.0269  199 LEU B CG  
3763 C CD1 . LEU B 199 ? 0.3703 0.4273 0.4471 -0.0281 -0.0098 0.0206  199 LEU B CD1 
3764 C CD2 . LEU B 199 ? 0.2631 0.3564 0.3682 -0.0316 -0.0178 0.0381  199 LEU B CD2 
3765 N N   . THR B 200 ? 0.3094 0.3981 0.3662 -0.0661 -0.0535 0.0290  200 THR B N   
3766 C CA  . THR B 200 ? 0.3318 0.4138 0.3681 -0.0745 -0.0608 0.0228  200 THR B CA  
3767 C C   . THR B 200 ? 0.3615 0.4484 0.3910 -0.0722 -0.0630 0.0268  200 THR B C   
3768 O O   . THR B 200 ? 0.3923 0.4718 0.4017 -0.0772 -0.0659 0.0201  200 THR B O   
3769 C CB  . THR B 200 ? 0.3969 0.4874 0.4334 -0.0879 -0.0719 0.0252  200 THR B CB  
3770 O OG1 . THR B 200 ? 0.3277 0.4422 0.3832 -0.0888 -0.0778 0.0391  200 THR B OG1 
3771 C CG2 . THR B 200 ? 0.4885 0.5718 0.5291 -0.0923 -0.0702 0.0215  200 THR B CG2 
3772 N N   . GLN B 201 ? 0.2845 0.3830 0.3300 -0.0646 -0.0614 0.0378  201 GLN B N   
3773 C CA  . GLN B 201 ? 0.2430 0.3457 0.2829 -0.0629 -0.0645 0.0441  201 GLN B CA  
3774 C C   . GLN B 201 ? 0.2944 0.3838 0.3287 -0.0540 -0.0546 0.0401  201 GLN B C   
3775 O O   . GLN B 201 ? 0.2538 0.3355 0.2954 -0.0469 -0.0461 0.0361  201 GLN B O   
3776 C CB  . GLN B 201 ? 0.2417 0.3638 0.3029 -0.0596 -0.0699 0.0596  201 GLN B CB  
3777 C CG  . GLN B 201 ? 0.2873 0.4265 0.3584 -0.0689 -0.0800 0.0648  201 GLN B CG  
3778 C CD  . GLN B 201 ? 0.3072 0.4436 0.3558 -0.0828 -0.0899 0.0595  201 GLN B CD  
3779 O OE1 . GLN B 201 ? 0.4196 0.5585 0.4556 -0.0862 -0.0963 0.0634  201 GLN B OE1 
3780 N NE2 . GLN B 201 ? 0.4262 0.5558 0.4679 -0.0913 -0.0912 0.0503  201 GLN B NE2 
3781 N N   . PRO B 202 ? 0.2816 0.3686 0.3021 -0.0553 -0.0560 0.0414  202 PRO B N   
3782 C CA  . PRO B 202 ? 0.2577 0.3327 0.2720 -0.0492 -0.0472 0.0375  202 PRO B CA  
3783 C C   . PRO B 202 ? 0.2383 0.3098 0.2695 -0.0384 -0.0403 0.0421  202 PRO B C   
3784 O O   . PRO B 202 ? 0.2416 0.3014 0.2700 -0.0342 -0.0323 0.0345  202 PRO B O   
3785 C CB  . PRO B 202 ? 0.2543 0.3326 0.2558 -0.0534 -0.0518 0.0440  202 PRO B CB  
3786 C CG  . PRO B 202 ? 0.3354 0.4214 0.3251 -0.0641 -0.0612 0.0428  202 PRO B CG  
3787 C CD  . PRO B 202 ? 0.3036 0.3982 0.3106 -0.0645 -0.0659 0.0457  202 PRO B CD  
3788 N N   . ASP B 203 ? 0.2516 0.3329 0.2998 -0.0337 -0.0436 0.0538  203 ASP B N   
3789 C CA  . ASP B 203 ? 0.2374 0.3137 0.3000 -0.0226 -0.0366 0.0576  203 ASP B CA  
3790 C C   . ASP B 203 ? 0.2231 0.3024 0.3012 -0.0174 -0.0314 0.0552  203 ASP B C   
3791 O O   . ASP B 203 ? 0.2310 0.3067 0.3207 -0.0077 -0.0250 0.0578  203 ASP B O   
3792 C CB  . ASP B 203 ? 0.3543 0.4372 0.4270 -0.0177 -0.0416 0.0719  203 ASP B CB  
3793 C CG  . ASP B 203 ? 0.6829 0.7515 0.7456 -0.0153 -0.0388 0.0739  203 ASP B CG  
3794 O OD1 . ASP B 203 ? 0.7557 0.8107 0.8206 -0.0086 -0.0304 0.0695  203 ASP B OD1 
3795 O OD2 . ASP B 203 ? 0.6872 0.7579 0.7389 -0.0211 -0.0453 0.0802  203 ASP B OD2 
3796 N N   . ASP B 204 ? 0.2466 0.3148 0.3382 0.0062  -0.0235 0.0276  204 ASP B N   
3797 C CA  . ASP B 204 ? 0.1950 0.2664 0.3009 0.0023  -0.0181 0.0192  204 ASP B CA  
3798 C C   . ASP B 204 ? 0.2048 0.2559 0.3075 0.0009  -0.0095 0.0196  204 ASP B C   
3799 O O   . ASP B 204 ? 0.2116 0.2615 0.3240 0.0034  -0.0054 0.0174  204 ASP B O   
3800 C CB  . ASP B 204 ? 0.2012 0.2828 0.3098 -0.0072 -0.0164 0.0087  204 ASP B CB  
3801 C CG  . ASP B 204 ? 0.2423 0.3505 0.3634 -0.0060 -0.0251 0.0027  204 ASP B CG  
3802 O OD1 . ASP B 204 ? 0.2790 0.3968 0.4045 -0.0146 -0.0245 -0.0076 204 ASP B OD1 
3803 O OD2 . ASP B 204 ? 0.3416 0.4610 0.4684 0.0040  -0.0328 0.0075  204 ASP B OD2 
3804 N N   . VAL B 205 ? 0.1993 0.2361 0.2883 -0.0021 -0.0069 0.0214  205 VAL B N   
3805 C CA  . VAL B 205 ? 0.2270 0.2466 0.3119 -0.0017 -0.0011 0.0204  205 VAL B CA  
3806 C C   . VAL B 205 ? 0.2103 0.2234 0.3012 0.0052  -0.0022 0.0248  205 VAL B C   
3807 O O   . VAL B 205 ? 0.1833 0.1900 0.2778 0.0079  0.0017  0.0215  205 VAL B O   
3808 C CB  . VAL B 205 ? 0.2059 0.2153 0.2778 -0.0047 0.0000  0.0204  205 VAL B CB  
3809 C CG1 . VAL B 205 ? 0.2093 0.2042 0.2785 -0.0018 0.0027  0.0190  205 VAL B CG1 
3810 C CG2 . VAL B 205 ? 0.1835 0.1936 0.2484 -0.0105 0.0031  0.0146  205 VAL B CG2 
3811 N N   . ARG B 206 ? 0.1893 0.2023 0.2800 0.0085  -0.0065 0.0323  206 ARG B N   
3812 C CA  . ARG B 206 ? 0.1982 0.2017 0.2948 0.0148  -0.0067 0.0369  206 ARG B CA  
3813 C C   . ARG B 206 ? 0.2247 0.2355 0.3332 0.0211  -0.0072 0.0350  206 ARG B C   
3814 O O   . ARG B 206 ? 0.2501 0.2515 0.3634 0.0247  -0.0042 0.0324  206 ARG B O   
3815 C CB  . ARG B 206 ? 0.2177 0.2178 0.3103 0.0177  -0.0095 0.0471  206 ARG B CB  
3816 C CG  . ARG B 206 ? 0.2713 0.2561 0.3694 0.0233  -0.0079 0.0519  206 ARG B CG  
3817 C CD  . ARG B 206 ? 0.4952 0.4776 0.5892 0.0302  -0.0104 0.0640  206 ARG B CD  
3818 N NE  . ARG B 206 ? 0.6768 0.6662 0.7786 0.0406  -0.0147 0.0654  206 ARG B NE  
3819 C CZ  . ARG B 206 ? 0.6627 0.6665 0.7617 0.0481  -0.0213 0.0702  206 ARG B CZ  
3820 N NH1 . ARG B 206 ? 0.7291 0.7404 0.8152 0.0462  -0.0243 0.0742  206 ARG B NH1 
3821 N NH2 . ARG B 206 ? 0.5994 0.6117 0.7088 0.0586  -0.0255 0.0699  206 ARG B NH2 
3822 N N   . LYS B 207 ? 0.2121 0.2412 0.3262 0.0227  -0.0113 0.0349  207 LYS B N   
3823 C CA  . LYS B 207 ? 0.1887 0.2302 0.3180 0.0291  -0.0122 0.0321  207 LYS B CA  
3824 C C   . LYS B 207 ? 0.2353 0.2764 0.3708 0.0255  -0.0040 0.0232  207 LYS B C   
3825 O O   . LYS B 207 ? 0.2227 0.2631 0.3677 0.0316  -0.0010 0.0213  207 LYS B O   
3826 C CB  . LYS B 207 ? 0.2135 0.2793 0.3497 0.0309  -0.0195 0.0310  207 LYS B CB  
3827 C CG  . LYS B 207 ? 0.2875 0.3539 0.4158 0.0395  -0.0279 0.0412  207 LYS B CG  
3828 C CD  . LYS B 207 ? 0.3771 0.4707 0.5123 0.0440  -0.0374 0.0382  207 LYS B CD  
3829 C CE  . LYS B 207 ? 0.5300 0.6220 0.6532 0.0566  -0.0459 0.0498  207 LYS B CE  
3830 N NZ  . LYS B 207 ? 0.5968 0.7176 0.7246 0.0634  -0.0578 0.0457  207 LYS B NZ  
3831 N N   . ALA B 208 ? 0.1928 0.2325 0.3211 0.0165  0.0005  0.0183  208 ALA B N   
3832 C CA  . ALA B 208 ? 0.2224 0.2571 0.3510 0.0134  0.0104  0.0117  208 ALA B CA  
3833 C C   . ALA B 208 ? 0.2016 0.2163 0.3211 0.0182  0.0139  0.0119  208 ALA B C   
3834 O O   . ALA B 208 ? 0.2171 0.2290 0.3399 0.0219  0.0203  0.0082  208 ALA B O   
3835 C CB  . ALA B 208 ? 0.2202 0.2525 0.3396 0.0038  0.0148  0.0079  208 ALA B CB  
3836 N N   . ALA B 209 ? 0.2066 0.2086 0.3153 0.0181  0.0099  0.0151  209 ALA B N   
3837 C CA  . ALA B 209 ? 0.2073 0.1927 0.3096 0.0224  0.0112  0.0129  209 ALA B CA  
3838 C C   . ALA B 209 ? 0.2617 0.2455 0.3751 0.0304  0.0104  0.0136  209 ALA B C   
3839 O O   . ALA B 209 ? 0.2439 0.2195 0.3556 0.0351  0.0145  0.0084  209 ALA B O   
3840 C CB  . ALA B 209 ? 0.1776 0.1540 0.2723 0.0197  0.0068  0.0147  209 ALA B CB  
3841 N N   . GLN B 210 ? 0.2289 0.2192 0.3515 0.0331  0.0052  0.0202  210 GLN B N   
3842 C CA  . GLN B 210 ? 0.2799 0.2670 0.4127 0.0422  0.0042  0.0219  210 GLN B CA  
3843 C C   . GLN B 210 ? 0.2825 0.2813 0.4258 0.0471  0.0089  0.0167  210 GLN B C   
3844 O O   . GLN B 210 ? 0.3211 0.3132 0.4696 0.0547  0.0114  0.0139  210 GLN B O   
3845 C CB  . GLN B 210 ? 0.2674 0.2586 0.4044 0.0461  -0.0021 0.0316  210 GLN B CB  
3846 C CG  . GLN B 210 ? 0.3380 0.3140 0.4664 0.0426  -0.0038 0.0379  210 GLN B CG  
3847 C CD  . GLN B 210 ? 0.4541 0.4310 0.5819 0.0483  -0.0082 0.0492  210 GLN B CD  
3848 O OE1 . GLN B 210 ? 0.3845 0.3794 0.5127 0.0507  -0.0129 0.0519  210 GLN B OE1 
3849 N NE2 . GLN B 210 ? 0.5285 0.4852 0.6548 0.0509  -0.0066 0.0555  210 GLN B NE2 
3850 N N   . GLU B 211 ? 0.2104 0.2271 0.3583 0.0422  0.0109  0.0144  211 GLU B N   
3851 C CA  . GLU B 211 ? 0.2988 0.3296 0.4602 0.0446  0.0175  0.0086  211 GLU B CA  
3852 C C   . GLU B 211 ? 0.2609 0.2773 0.4131 0.0457  0.0276  0.0027  211 GLU B C   
3853 O O   . GLU B 211 ? 0.2610 0.2804 0.4219 0.0524  0.0333  -0.0013 211 GLU B O   
3854 C CB  . GLU B 211 ? 0.3138 0.3644 0.4826 0.0359  0.0193  0.0055  211 GLU B CB  
3855 C CG  . GLU B 211 ? 0.4751 0.5402 0.6595 0.0349  0.0296  -0.0019 211 GLU B CG  
3856 C CD  . GLU B 211 ? 0.6105 0.6918 0.8030 0.0234  0.0330  -0.0066 211 GLU B CD  
3857 O OE1 . GLU B 211 ? 0.6079 0.6983 0.8006 0.0196  0.0235  -0.0048 211 GLU B OE1 
3858 O OE2 . GLU B 211 ? 0.6440 0.7276 0.8420 0.0179  0.0462  -0.0124 211 GLU B OE2 
3859 N N   . ILE B 212 ? 0.2379 0.2389 0.3710 0.0405  0.0294  0.0018  212 ILE B N   
3860 C CA  . ILE B 212 ? 0.2106 0.1964 0.3290 0.0433  0.0374  -0.0035 212 ILE B CA  
3861 C C   . ILE B 212 ? 0.3672 0.3401 0.4842 0.0524  0.0344  -0.0062 212 ILE B C   
3862 O O   . ILE B 212 ? 0.3457 0.3139 0.4602 0.0589  0.0413  -0.0116 212 ILE B O   
3863 C CB  . ILE B 212 ? 0.2290 0.2022 0.3262 0.0380  0.0378  -0.0038 212 ILE B CB  
3864 C CG1 . ILE B 212 ? 0.2575 0.2392 0.3548 0.0292  0.0436  -0.0027 212 ILE B CG1 
3865 C CG2 . ILE B 212 ? 0.2752 0.2313 0.3529 0.0442  0.0434  -0.0093 212 ILE B CG2 
3866 C CD1 . ILE B 212 ? 0.3724 0.3439 0.4525 0.0244  0.0413  -0.0014 212 ILE B CD1 
3867 N N   . VAL B 213 ? 0.3167 0.2830 0.4356 0.0524  0.0252  -0.0029 213 VAL B N   
3868 C CA  . VAL B 213 ? 0.2603 0.2124 0.3807 0.0594  0.0226  -0.0063 213 VAL B CA  
3869 C C   . VAL B 213 ? 0.3356 0.2934 0.4712 0.0683  0.0250  -0.0062 213 VAL B C   
3870 O O   . VAL B 213 ? 0.3625 0.3114 0.4968 0.0757  0.0289  -0.0130 213 VAL B O   
3871 C CB  . VAL B 213 ? 0.3029 0.2458 0.4252 0.0560  0.0147  -0.0021 213 VAL B CB  
3872 C CG1 . VAL B 213 ? 0.2781 0.2048 0.4055 0.0623  0.0135  -0.0064 213 VAL B CG1 
3873 C CG2 . VAL B 213 ? 0.3063 0.2449 0.4158 0.0486  0.0123  -0.0044 213 VAL B CG2 
3874 N N   . ASN B 214 ? 0.2727 0.2462 0.4225 0.0688  0.0221  0.0006  214 ASN B N   
3875 C CA  . ASN B 214 ? 0.2960 0.2779 0.4624 0.0791  0.0228  0.0010  214 ASN B CA  
3876 C C   . ASN B 214 ? 0.3046 0.2969 0.4765 0.0830  0.0330  -0.0067 214 ASN B C   
3877 O O   . ASN B 214 ? 0.3394 0.3320 0.5213 0.0934  0.0357  -0.0099 214 ASN B O   
3878 C CB  . ASN B 214 ? 0.3513 0.3515 0.5302 0.0802  0.0158  0.0091  214 ASN B CB  
3879 C CG  . ASN B 214 ? 0.5021 0.4891 0.6745 0.0796  0.0078  0.0184  214 ASN B CG  
3880 O OD1 . ASN B 214 ? 0.5561 0.5203 0.7210 0.0794  0.0080  0.0183  214 ASN B OD1 
3881 N ND2 . ASN B 214 ? 0.5768 0.5782 0.7522 0.0792  0.0014  0.0256  214 ASN B ND2 
3882 N N   . SER B 215 ? 0.2855 0.2844 0.4501 0.0748  0.0399  -0.0094 215 SER B N   
3883 C CA  . SER B 215 ? 0.2998 0.3069 0.4677 0.0766  0.0529  -0.0158 215 SER B CA  
3884 C C   . SER B 215 ? 0.3920 0.3786 0.5422 0.0831  0.0594  -0.0224 215 SER B C   
3885 O O   . SER B 215 ? 0.4104 0.4007 0.5622 0.0881  0.0711  -0.0277 215 SER B O   
3886 C CB  . SER B 215 ? 0.3699 0.3853 0.5333 0.0651  0.0602  -0.0157 215 SER B CB  
3887 O OG  . SER B 215 ? 0.4005 0.3954 0.5373 0.0610  0.0611  -0.0156 215 SER B OG  
3888 N N   . GLY B 216 ? 0.3992 0.3655 0.5327 0.0831  0.0522  -0.0231 216 GLY B N   
3889 C CA  . GLY B 216 ? 0.3728 0.3205 0.4881 0.0898  0.0555  -0.0314 216 GLY B CA  
3890 C C   . GLY B 216 ? 0.3197 0.2592 0.4094 0.0863  0.0612  -0.0337 216 GLY B C   
3891 O O   . GLY B 216 ? 0.3808 0.3060 0.4506 0.0931  0.0637  -0.0411 216 GLY B O   
3892 N N   . LYS B 217 ? 0.2784 0.2259 0.3667 0.0769  0.0630  -0.0276 217 LYS B N   
3893 C CA  . LYS B 217 ? 0.2942 0.2313 0.3567 0.0747  0.0692  -0.0281 217 LYS B CA  
3894 C C   . LYS B 217 ? 0.3606 0.2823 0.4036 0.0765  0.0584  -0.0314 217 LYS B C   
3895 O O   . LYS B 217 ? 0.3561 0.2646 0.3730 0.0822  0.0616  -0.0356 217 LYS B O   
3896 C CB  . LYS B 217 ? 0.3223 0.2697 0.3898 0.0638  0.0739  -0.0215 217 LYS B CB  
3897 C CG  . LYS B 217 ? 0.4684 0.4305 0.5516 0.0611  0.0883  -0.0214 217 LYS B CG  
3898 C CD  . LYS B 217 ? 0.5466 0.5210 0.6408 0.0486  0.0904  -0.0171 217 LYS B CD  
3899 C CE  . LYS B 217 ? 0.6215 0.6129 0.7358 0.0440  0.1054  -0.0191 217 LYS B CE  
3900 N NZ  . LYS B 217 ? 0.7397 0.7180 0.8360 0.0382  0.1225  -0.0181 217 LYS B NZ  
3901 N N   . ALA B 218 ? 0.3351 0.2590 0.3908 0.0723  0.0459  -0.0296 218 ALA B N   
3902 C CA  . ALA B 218 ? 0.3090 0.2224 0.3533 0.0726  0.0355  -0.0343 218 ALA B CA  
3903 C C   . ALA B 218 ? 0.3050 0.2174 0.3682 0.0713  0.0263  -0.0356 218 ALA B C   
3904 O O   . ALA B 218 ? 0.3493 0.2699 0.4313 0.0677  0.0255  -0.0282 218 ALA B O   
3905 C CB  . ALA B 218 ? 0.3505 0.2664 0.3873 0.0652  0.0327  -0.0291 218 ALA B CB  
3906 N N   . LYS B 219 ? 0.3171 0.2188 0.3749 0.0746  0.0194  -0.0453 219 LYS B N   
3907 C CA  . LYS B 219 ? 0.2761 0.1728 0.3521 0.0719  0.0125  -0.0473 219 LYS B CA  
3908 C C   . LYS B 219 ? 0.3237 0.2252 0.4081 0.0616  0.0069  -0.0407 219 LYS B C   
3909 O O   . LYS B 219 ? 0.2827 0.1824 0.3836 0.0573  0.0051  -0.0352 219 LYS B O   
3910 C CB  . LYS B 219 ? 0.2890 0.1738 0.3596 0.0771  0.0072  -0.0627 219 LYS B CB  
3911 C CG  . LYS B 219 ? 0.5141 0.3916 0.5766 0.0881  0.0124  -0.0710 219 LYS B CG  
3912 C CD  . LYS B 219 ? 0.6152 0.4805 0.6797 0.0913  0.0052  -0.0872 219 LYS B CD  
3913 C CE  . LYS B 219 ? 0.7797 0.6378 0.8263 0.1040  0.0088  -0.0992 219 LYS B CE  
3914 N NZ  . LYS B 219 ? 0.8510 0.7151 0.8809 0.1098  0.0201  -0.0914 219 LYS B NZ  
3915 N N   . ARG B 220 ? 0.2789 0.1849 0.3501 0.0590  0.0049  -0.0411 220 ARG B N   
3916 C CA  . ARG B 220 ? 0.3164 0.2280 0.3936 0.0502  0.0003  -0.0366 220 ARG B CA  
3917 C C   . ARG B 220 ? 0.2414 0.1605 0.3056 0.0483  0.0035  -0.0302 220 ARG B C   
3918 O O   . ARG B 220 ? 0.2752 0.1910 0.3203 0.0539  0.0058  -0.0341 220 ARG B O   
3919 C CB  . ARG B 220 ? 0.2499 0.1585 0.3266 0.0497  -0.0075 -0.0485 220 ARG B CB  
3920 C CG  . ARG B 220 ? 0.2576 0.1568 0.3470 0.0508  -0.0107 -0.0590 220 ARG B CG  
3921 C CD  . ARG B 220 ? 0.2934 0.1939 0.3824 0.0510  -0.0194 -0.0746 220 ARG B CD  
3922 N NE  . ARG B 220 ? 0.3255 0.2165 0.4260 0.0521  -0.0226 -0.0882 220 ARG B NE  
3923 C CZ  . ARG B 220 ? 0.4851 0.3686 0.5739 0.0622  -0.0231 -0.0984 220 ARG B CZ  
3924 N NH1 . ARG B 220 ? 0.4310 0.3151 0.4956 0.0720  -0.0193 -0.0953 220 ARG B NH1 
3925 N NH2 . ARG B 220 ? 0.5011 0.3752 0.6021 0.0623  -0.0263 -0.1122 220 ARG B NH2 
3926 N N   . VAL B 221 ? 0.2166 0.1437 0.2894 0.0409  0.0040  -0.0203 221 VAL B N   
3927 C CA  . VAL B 221 ? 0.2104 0.1436 0.2730 0.0375  0.0066  -0.0155 221 VAL B CA  
3928 C C   . VAL B 221 ? 0.2037 0.1410 0.2700 0.0312  0.0015  -0.0139 221 VAL B C   
3929 O O   . VAL B 221 ? 0.2468 0.1875 0.3267 0.0260  -0.0001 -0.0085 221 VAL B O   
3930 C CB  . VAL B 221 ? 0.2497 0.1920 0.3193 0.0344  0.0119  -0.0072 221 VAL B CB  
3931 C CG1 . VAL B 221 ? 0.2410 0.1879 0.3016 0.0292  0.0146  -0.0039 221 VAL B CG1 
3932 C CG2 . VAL B 221 ? 0.2431 0.1842 0.3126 0.0403  0.0186  -0.0094 221 VAL B CG2 
3933 N N   . VAL B 222 ? 0.2255 0.1618 0.2788 0.0327  -0.0004 -0.0182 222 VAL B N   
3934 C CA  . VAL B 222 ? 0.2060 0.1483 0.2632 0.0273  -0.0041 -0.0173 222 VAL B CA  
3935 C C   . VAL B 222 ? 0.2064 0.1508 0.2513 0.0257  -0.0003 -0.0123 222 VAL B C   
3936 O O   . VAL B 222 ? 0.2260 0.1640 0.2535 0.0314  0.0010  -0.0155 222 VAL B O   
3937 C CB  . VAL B 222 ? 0.2213 0.1631 0.2769 0.0313  -0.0109 -0.0284 222 VAL B CB  
3938 C CG1 . VAL B 222 ? 0.2278 0.1784 0.2894 0.0260  -0.0134 -0.0279 222 VAL B CG1 
3939 C CG2 . VAL B 222 ? 0.2352 0.1740 0.3058 0.0311  -0.0142 -0.0353 222 VAL B CG2 
3940 N N   . VAL B 223 ? 0.1972 0.1487 0.2495 0.0187  0.0017  -0.0045 223 VAL B N   
3941 C CA  . VAL B 223 ? 0.2179 0.1714 0.2609 0.0157  0.0052  -0.0014 223 VAL B CA  
3942 C C   . VAL B 223 ? 0.2129 0.1688 0.2529 0.0145  0.0019  -0.0033 223 VAL B C   
3943 O O   . VAL B 223 ? 0.2179 0.1811 0.2688 0.0098  -0.0004 -0.0011 223 VAL B O   
3944 C CB  . VAL B 223 ? 0.1945 0.1574 0.2466 0.0095  0.0069  0.0054  223 VAL B CB  
3945 C CG1 . VAL B 223 ? 0.2108 0.1746 0.2539 0.0058  0.0110  0.0057  223 VAL B CG1 
3946 C CG2 . VAL B 223 ? 0.2289 0.1937 0.2899 0.0115  0.0087  0.0069  223 VAL B CG2 
3947 N N   . SER B 224 ? 0.1908 0.1400 0.2153 0.0195  0.0026  -0.0072 224 SER B N   
3948 C CA  . SER B 224 ? 0.1944 0.1476 0.2174 0.0201  -0.0008 -0.0101 224 SER B CA  
3949 C C   . SER B 224 ? 0.2377 0.1929 0.2566 0.0145  0.0032  -0.0056 224 SER B C   
3950 O O   . SER B 224 ? 0.2196 0.1685 0.2302 0.0129  0.0087  -0.0031 224 SER B O   
3951 C CB  . SER B 224 ? 0.2019 0.1475 0.2098 0.0311  -0.0040 -0.0171 224 SER B CB  
3952 O OG  . SER B 224 ? 0.2641 0.1955 0.2509 0.0359  0.0021  -0.0147 224 SER B OG  
3953 N N   . LEU B 225 ? 0.1858 0.1503 0.2118 0.0109  0.0012  -0.0055 225 LEU B N   
3954 C CA  . LEU B 225 ? 0.1735 0.1422 0.1975 0.0049  0.0042  -0.0018 225 LEU B CA  
3955 C C   . LEU B 225 ? 0.1773 0.1464 0.1942 0.0075  0.0043  -0.0056 225 LEU B C   
3956 O O   . LEU B 225 ? 0.1831 0.1595 0.2018 0.0028  0.0057  -0.0040 225 LEU B O   
3957 C CB  . LEU B 225 ? 0.1949 0.1742 0.2318 -0.0015 0.0034  0.0036  225 LEU B CB  
3958 C CG  . LEU B 225 ? 0.1855 0.1647 0.2310 -0.0024 0.0027  0.0077  225 LEU B CG  
3959 C CD1 . LEU B 225 ? 0.2200 0.2057 0.2754 -0.0063 0.0023  0.0140  225 LEU B CD1 
3960 C CD2 . LEU B 225 ? 0.2325 0.2111 0.2739 -0.0037 0.0048  0.0094  225 LEU B CD2 
3961 N N   . GLY B 226 ? 0.2167 0.1784 0.2244 0.0165  0.0025  -0.0108 226 GLY B N   
3962 C CA  . GLY B 226 ? 0.2769 0.2386 0.2776 0.0217  0.0021  -0.0149 226 GLY B CA  
3963 C C   . GLY B 226 ? 0.1930 0.1720 0.2105 0.0183  -0.0001 -0.0171 226 GLY B C   
3964 O O   . GLY B 226 ? 0.1902 0.1776 0.2225 0.0176  -0.0036 -0.0196 226 GLY B O   
3965 N N   . PRO B 227 ? 0.1977 0.1814 0.2136 0.0154  0.0032  -0.0167 227 PRO B N   
3966 C CA  . PRO B 227 ? 0.1949 0.1950 0.2262 0.0125  0.0037  -0.0188 227 PRO B CA  
3967 C C   . PRO B 227 ? 0.1699 0.1774 0.2149 0.0028  0.0059  -0.0126 227 PRO B C   
3968 O O   . PRO B 227 ? 0.1840 0.2030 0.2443 -0.0005 0.0079  -0.0139 227 PRO B O   
3969 C CB  . PRO B 227 ? 0.2513 0.2516 0.2727 0.0122  0.0081  -0.0191 227 PRO B CB  
3970 C CG  . PRO B 227 ? 0.2791 0.2649 0.2846 0.0098  0.0102  -0.0155 227 PRO B CG  
3971 C CD  . PRO B 227 ? 0.2262 0.1998 0.2265 0.0148  0.0077  -0.0155 227 PRO B CD  
3972 N N   . GLN B 228 ? 0.1935 0.1942 0.2337 -0.0011 0.0062  -0.0060 228 GLN B N   
3973 C CA  . GLN B 228 ? 0.1953 0.1998 0.2453 -0.0076 0.0080  0.0010  228 GLN B CA  
3974 C C   . GLN B 228 ? 0.2160 0.2187 0.2795 -0.0071 0.0053  -0.0006 228 GLN B C   
3975 O O   . GLN B 228 ? 0.2256 0.2279 0.2978 -0.0117 0.0072  0.0053  228 GLN B O   
3976 C CB  . GLN B 228 ? 0.1670 0.1681 0.2076 -0.0104 0.0083  0.0078  228 GLN B CB  
3977 C CG  . GLN B 228 ? 0.2110 0.2157 0.2401 -0.0122 0.0106  0.0082  228 GLN B CG  
3978 C CD  . GLN B 228 ? 0.3066 0.3117 0.3289 -0.0148 0.0091  0.0120  228 GLN B CD  
3979 O OE1 . GLN B 228 ? 0.2851 0.2867 0.3105 -0.0144 0.0068  0.0129  228 GLN B OE1 
3980 N NE2 . GLN B 228 ? 0.2723 0.2834 0.2860 -0.0168 0.0101  0.0131  228 GLN B NE2 
3981 N N   . GLY B 229 ? 0.2008 0.1328 0.2087 0.0070  -0.0013 -0.0094 229 GLY B N   
3982 C CA  . GLY B 229 ? 0.2018 0.1369 0.2239 0.0069  0.0005  -0.0090 229 GLY B CA  
3983 C C   . GLY B 229 ? 0.2399 0.1747 0.2686 0.0067  -0.0025 -0.0083 229 GLY B C   
3984 O O   . GLY B 229 ? 0.2215 0.1564 0.2482 0.0069  -0.0053 -0.0107 229 GLY B O   
3985 N N   . ALA B 230 ? 0.1990 0.1338 0.2367 0.0067  -0.0017 -0.0043 230 ALA B N   
3986 C CA  . ALA B 230 ? 0.2078 0.1433 0.2527 0.0082  -0.0031 -0.0035 230 ALA B CA  
3987 C C   . ALA B 230 ? 0.2406 0.1753 0.2936 0.0091  -0.0027 0.0037  230 ALA B C   
3988 O O   . ALA B 230 ? 0.2461 0.1785 0.3017 0.0081  -0.0010 0.0072  230 ALA B O   
3989 C CB  . ALA B 230 ? 0.2185 0.1538 0.2693 0.0094  -0.0009 -0.0104 230 ALA B CB  
3990 N N   . LEU B 231 ? 0.1947 0.1324 0.2530 0.0113  -0.0042 0.0071  231 LEU B N   
3991 C CA  . LEU B 231 ? 0.2186 0.1557 0.2877 0.0139  -0.0032 0.0143  231 LEU B CA  
3992 C C   . LEU B 231 ? 0.2785 0.2138 0.3574 0.0189  0.0004  0.0098  231 LEU B C   
3993 O O   . LEU B 231 ? 0.2827 0.2241 0.3616 0.0207  -0.0001 0.0080  231 LEU B O   
3994 C CB  . LEU B 231 ? 0.2066 0.1512 0.2752 0.0129  -0.0078 0.0243  231 LEU B CB  
3995 C CG  . LEU B 231 ? 0.2680 0.2138 0.3503 0.0165  -0.0068 0.0339  231 LEU B CG  
3996 C CD1 . LEU B 231 ? 0.4009 0.3431 0.4833 0.0141  -0.0066 0.0399  231 LEU B CD1 
3997 C CD2 . LEU B 231 ? 0.3484 0.3052 0.4337 0.0165  -0.0113 0.0436  231 LEU B CD2 
3998 N N   . GLY B 232 ? 0.2159 0.1425 0.3025 0.0209  0.0041  0.0079  232 GLY B N   
3999 C CA  . GLY B 232 ? 0.2473 0.1693 0.3409 0.0262  0.0082  0.0019  232 GLY B CA  
4000 C C   . GLY B 232 ? 0.2586 0.1789 0.3647 0.0324  0.0102  0.0098  232 GLY B C   
4001 O O   . GLY B 232 ? 0.2552 0.1714 0.3670 0.0316  0.0093  0.0179  232 GLY B O   
4002 N N   . VAL B 233 ? 0.2036 0.1285 0.3149 0.0388  0.0131  0.0086  233 VAL B N   
4003 C CA  . VAL B 233 ? 0.2461 0.1713 0.3713 0.0464  0.0159  0.0170  233 VAL B CA  
4004 C C   . VAL B 233 ? 0.2802 0.1976 0.4109 0.0550  0.0231  0.0082  233 VAL B C   
4005 O O   . VAL B 233 ? 0.2354 0.1582 0.3601 0.0565  0.0254  -0.0002 233 VAL B O   
4006 C CB  . VAL B 233 ? 0.3353 0.2784 0.4643 0.0472  0.0123  0.0291  233 VAL B CB  
4007 C CG1 . VAL B 233 ? 0.3247 0.2712 0.4707 0.0564  0.0158  0.0388  233 VAL B CG1 
4008 C CG2 . VAL B 233 ? 0.2808 0.2283 0.4029 0.0388  0.0052  0.0374  233 VAL B CG2 
4009 N N   . ASP B 234 ? 0.2721 0.1760 0.4135 0.0602  0.0265  0.0104  234 ASP B N   
4010 C CA  . ASP B 234 ? 0.3959 0.2876 0.5435 0.0699  0.0340  0.0026  234 ASP B CA  
4011 C C   . ASP B 234 ? 0.2594 0.1562 0.4241 0.0800  0.0371  0.0153  234 ASP B C   
4012 O O   . ASP B 234 ? 0.3818 0.2916 0.5527 0.0778  0.0323  0.0302  234 ASP B O   
4013 C CB  . ASP B 234 ? 0.4425 0.3102 0.5907 0.0673  0.0345  -0.0035 234 ASP B CB  
4014 C CG  . ASP B 234 ? 0.5875 0.4436 0.7233 0.0653  0.0371  -0.0210 234 ASP B CG  
4015 O OD1 . ASP B 234 ? 0.8584 0.7220 0.9891 0.0698  0.0410  -0.0290 234 ASP B OD1 
4016 O OD2 . ASP B 234 ? 0.4455 0.2869 0.5759 0.0585  0.0345  -0.0259 234 ASP B OD2 
4017 N N   . SER B 235 ? 0.2883 0.1758 0.4568 0.0896  0.0440  0.0093  235 SER B N   
4018 C CA  . SER B 235 ? 0.2879 0.1804 0.4700 0.0983  0.0465  0.0211  235 SER B CA  
4019 C C   . SER B 235 ? 0.3586 0.2396 0.5468 0.0943  0.0424  0.0299  235 SER B C   
4020 O O   . SER B 235 ? 0.3709 0.2578 0.5720 0.0993  0.0427  0.0429  235 SER B O   
4021 C CB  . SER B 235 ? 0.4019 0.2876 0.5823 0.1093  0.0547  0.0108  235 SER B CB  
4022 O OG  . SER B 235 ? 0.3903 0.2507 0.5602 0.1071  0.0554  -0.0028 235 SER B OG  
4023 N N   . GLU B 236 ? 0.3269 0.1933 0.5065 0.0848  0.0386  0.0239  236 GLU B N   
4024 C CA  . GLU B 236 ? 0.3337 0.1891 0.5189 0.0806  0.0352  0.0319  236 GLU B CA  
4025 C C   . GLU B 236 ? 0.2926 0.1517 0.4749 0.0691  0.0285  0.0385  236 GLU B C   
4026 O O   . GLU B 236 ? 0.3144 0.1698 0.5024 0.0649  0.0252  0.0484  236 GLU B O   
4027 C CB  . GLU B 236 ? 0.3572 0.1882 0.5365 0.0809  0.0375  0.0195  236 GLU B CB  
4028 C CG  . GLU B 236 ? 0.3882 0.2116 0.5708 0.0933  0.0440  0.0145  236 GLU B CG  
4029 C CD  . GLU B 236 ? 0.5380 0.3343 0.7121 0.0930  0.0452  0.0015  236 GLU B CD  
4030 O OE1 . GLU B 236 ? 0.5101 0.2945 0.6799 0.0827  0.0403  0.0004  236 GLU B OE1 
4031 O OE2 . GLU B 236 ? 0.5077 0.2951 0.6792 0.1031  0.0508  -0.0072 236 GLU B OE2 
4032 N N   . ASN B 237 ? 0.2752 0.1421 0.4488 0.0644  0.0267  0.0333  237 ASN B N   
4033 C CA  . ASN B 237 ? 0.2669 0.1364 0.4342 0.0537  0.0210  0.0370  237 ASN B CA  
4034 C C   . ASN B 237 ? 0.2453 0.1352 0.4004 0.0486  0.0170  0.0381  237 ASN B C   
4035 O O   . ASN B 237 ? 0.3211 0.2192 0.4714 0.0516  0.0186  0.0316  237 ASN B O   
4036 C CB  . ASN B 237 ? 0.2801 0.1340 0.4390 0.0473  0.0212  0.0239  237 ASN B CB  
4037 C CG  . ASN B 237 ? 0.3331 0.1711 0.4965 0.0459  0.0213  0.0250  237 ASN B CG  
4038 O OD1 . ASN B 237 ? 0.4587 0.2824 0.6180 0.0481  0.0241  0.0136  237 ASN B OD1 
4039 N ND2 . ASN B 237 ? 0.3833 0.2237 0.5540 0.0418  0.0178  0.0393  237 ASN B ND2 
4040 N N   . CYS B 238 ? 0.2646 0.1619 0.4146 0.0408  0.0118  0.0465  238 CYS B N   
4041 C CA  A CYS B 238 ? 0.2251 0.1375 0.3616 0.0350  0.0075  0.0469  238 CYS B CA  
4042 C CA  B CYS B 238 ? 0.2843 0.1969 0.4207 0.0349  0.0074  0.0471  238 CYS B CA  
4043 C C   . CYS B 238 ? 0.2275 0.1379 0.3538 0.0265  0.0052  0.0453  238 CYS B C   
4044 O O   . CYS B 238 ? 0.3218 0.2325 0.4512 0.0233  0.0034  0.0555  238 CYS B O   
4045 C CB  A CYS B 238 ? 0.3041 0.2314 0.4446 0.0353  0.0034  0.0617  238 CYS B CB  
4046 C CB  B CYS B 238 ? 0.2894 0.2168 0.4295 0.0348  0.0031  0.0623  238 CYS B CB  
4047 S SG  A CYS B 238 ? 0.3494 0.2912 0.4715 0.0273  -0.0029 0.0617  238 CYS B SG  
4048 S SG  B CYS B 238 ? 0.3480 0.2867 0.5001 0.0437  0.0045  0.0681  238 CYS B SG  
4049 N N   . ILE B 239 ? 0.2547 0.1646 0.3696 0.0231  0.0056  0.0337  239 ILE B N   
4050 C CA  . ILE B 239 ? 0.2963 0.2058 0.4033 0.0162  0.0046  0.0327  239 ILE B CA  
4051 C C   . ILE B 239 ? 0.3255 0.2442 0.4176 0.0128  0.0027  0.0278  239 ILE B C   
4052 O O   . ILE B 239 ? 0.2942 0.2142 0.3818 0.0143  0.0031  0.0191  239 ILE B O   
4053 C CB  . ILE B 239 ? 0.3597 0.2570 0.4703 0.0144  0.0071  0.0246  239 ILE B CB  
4054 C CG1 . ILE B 239 ? 0.3424 0.2363 0.4496 0.0171  0.0091  0.0114  239 ILE B CG1 
4055 C CG2 . ILE B 239 ? 0.4457 0.3303 0.5705 0.0163  0.0083  0.0305  239 ILE B CG2 
4056 C CD1 . ILE B 239 ? 0.5498 0.4429 0.6501 0.0117  0.0089  0.0028  239 ILE B CD1 
4057 N N   . GLN B 240 ? 0.2813 0.2059 0.3653 0.0086  0.0009  0.0334  240 GLN B N   
4058 C CA  . GLN B 240 ? 0.2245 0.1546 0.2940 0.0062  -0.0001 0.0275  240 GLN B CA  
4059 C C   . GLN B 240 ? 0.2821 0.2112 0.3490 0.0034  0.0026  0.0235  240 GLN B C   
4060 O O   . GLN B 240 ? 0.2699 0.1989 0.3415 0.0010  0.0038  0.0299  240 GLN B O   
4061 C CB  . GLN B 240 ? 0.3817 0.3193 0.4398 0.0040  -0.0037 0.0337  240 GLN B CB  
4062 C CG  . GLN B 240 ? 0.4429 0.3819 0.4855 0.0027  -0.0044 0.0254  240 GLN B CG  
4063 C CD  . GLN B 240 ? 0.5698 0.5128 0.5983 0.0000  -0.0089 0.0288  240 GLN B CD  
4064 O OE1 . GLN B 240 ? 0.5702 0.5173 0.6004 -0.0016 -0.0124 0.0380  240 GLN B OE1 
4065 N NE2 . GLN B 240 ? 0.4190 0.3600 0.4333 -0.0008 -0.0091 0.0214  240 GLN B NE2 
4066 N N   . VAL B 241 ? 0.2230 0.1529 0.2839 0.0036  0.0034  0.0144  241 VAL B N   
4067 C CA  . VAL B 241 ? 0.2259 0.1579 0.2852 0.0014  0.0059  0.0113  241 VAL B CA  
4068 C C   . VAL B 241 ? 0.2799 0.2171 0.3258 0.0023  0.0061  0.0080  241 VAL B C   
4069 O O   . VAL B 241 ? 0.2726 0.2089 0.3135 0.0040  0.0042  0.0028  241 VAL B O   
4070 C CB  . VAL B 241 ? 0.2527 0.1806 0.3186 0.0010  0.0067  0.0035  241 VAL B CB  
4071 C CG1 . VAL B 241 ? 0.2529 0.1863 0.3183 -0.0018 0.0086  0.0020  241 VAL B CG1 
4072 C CG2 . VAL B 241 ? 0.2606 0.1793 0.3381 0.0005  0.0069  0.0049  241 VAL B CG2 
4073 N N   . VAL B 242 ? 0.2177 0.1603 0.2581 0.0013  0.0085  0.0114  242 VAL B N   
4074 C CA  . VAL B 242 ? 0.2774 0.2230 0.3041 0.0034  0.0098  0.0077  242 VAL B CA  
4075 C C   . VAL B 242 ? 0.2489 0.1997 0.2789 0.0043  0.0139  0.0048  242 VAL B C   
4076 O O   . VAL B 242 ? 0.2457 0.2014 0.2846 0.0019  0.0161  0.0096  242 VAL B O   
4077 C CB  . VAL B 242 ? 0.3023 0.2516 0.3178 0.0026  0.0104  0.0137  242 VAL B CB  
4078 C CG1 . VAL B 242 ? 0.2597 0.2084 0.2580 0.0053  0.0118  0.0080  242 VAL B CG1 
4079 C CG2 . VAL B 242 ? 0.4120 0.3588 0.4277 0.0006  0.0056  0.0193  242 VAL B CG2 
4080 N N   . PRO B 243 ? 0.2516 0.2020 0.2762 0.0074  0.0144  -0.0018 243 PRO B N   
4081 C CA  . PRO B 243 ? 0.2109 0.1682 0.2403 0.0090  0.0181  -0.0034 243 PRO B CA  
4082 C C   . PRO B 243 ? 0.2406 0.2061 0.2651 0.0110  0.0237  0.0011  243 PRO B C   
4083 O O   . PRO B 243 ? 0.2484 0.2126 0.2615 0.0118  0.0245  0.0030  243 PRO B O   
4084 C CB  . PRO B 243 ? 0.2368 0.1901 0.2596 0.0129  0.0170  -0.0102 243 PRO B CB  
4085 C CG  . PRO B 243 ? 0.2951 0.2397 0.3126 0.0117  0.0118  -0.0123 243 PRO B CG  
4086 C CD  . PRO B 243 ? 0.2825 0.2263 0.2968 0.0094  0.0112  -0.0068 243 PRO B CD  
4087 N N   . PRO B 244 ? 0.2542 0.2300 0.2873 0.0117  0.0276  0.0033  244 PRO B N   
4088 C CA  . PRO B 244 ? 0.2734 0.2602 0.3027 0.0149  0.0343  0.0080  244 PRO B CA  
4089 C C   . PRO B 244 ? 0.2818 0.2647 0.2954 0.0227  0.0378  0.0018  244 PRO B C   
4090 O O   . PRO B 244 ? 0.3121 0.2860 0.3224 0.0252  0.0350  -0.0051 244 PRO B O   
4091 C CB  . PRO B 244 ? 0.3223 0.3219 0.3673 0.0137  0.0365  0.0119  244 PRO B CB  
4092 C CG  . PRO B 244 ? 0.2889 0.2826 0.3400 0.0123  0.0316  0.0060  244 PRO B CG  
4093 C CD  . PRO B 244 ? 0.3097 0.2893 0.3561 0.0094  0.0259  0.0020  244 PRO B CD  
4094 N N   . PRO B 245 ? 0.2394 0.2285 0.2426 0.0264  0.0440  0.0042  245 PRO B N   
4095 C CA  . PRO B 245 ? 0.3146 0.2971 0.2997 0.0340  0.0480  -0.0029 245 PRO B CA  
4096 C C   . PRO B 245 ? 0.2991 0.2877 0.2901 0.0420  0.0540  -0.0051 245 PRO B C   
4097 O O   . PRO B 245 ? 0.3487 0.3481 0.3369 0.0484  0.0627  -0.0027 245 PRO B O   
4098 C CB  . PRO B 245 ? 0.3351 0.3247 0.3077 0.0345  0.0530  0.0014  245 PRO B CB  
4099 C CG  . PRO B 245 ? 0.3243 0.3307 0.3141 0.0298  0.0549  0.0128  245 PRO B CG  
4100 C CD  . PRO B 245 ? 0.2555 0.2571 0.2622 0.0230  0.0473  0.0140  245 PRO B CD  
4101 N N   . VAL B 246 ? 0.3418 0.3249 0.3418 0.0420  0.0496  -0.0086 246 VAL B N   
4102 C CA  . VAL B 246 ? 0.3672 0.3551 0.3744 0.0494  0.0538  -0.0098 246 VAL B CA  
4103 C C   . VAL B 246 ? 0.4021 0.3716 0.3998 0.0526  0.0497  -0.0185 246 VAL B C   
4104 O O   . VAL B 246 ? 0.4098 0.3686 0.4051 0.0464  0.0417  -0.0212 246 VAL B O   
4105 C CB  . VAL B 246 ? 0.2420 0.2435 0.2713 0.0448  0.0514  -0.0034 246 VAL B CB  
4106 C CG1 . VAL B 246 ? 0.3578 0.3664 0.3962 0.0524  0.0551  -0.0029 246 VAL B CG1 
4107 C CG2 . VAL B 246 ? 0.3222 0.3403 0.3612 0.0399  0.0542  0.0061  246 VAL B CG2 
4108 N N   . LYS B 247 ? 0.4512 0.4169 0.4438 0.0625  0.0554  -0.0224 247 LYS B N   
4109 C CA  . LYS B 247 ? 0.4872 0.4331 0.4696 0.0658  0.0517  -0.0304 247 LYS B CA  
4110 C C   . LYS B 247 ? 0.4130 0.3583 0.4097 0.0619  0.0444  -0.0289 247 LYS B C   
4111 O O   . LYS B 247 ? 0.3768 0.3373 0.3913 0.0621  0.0454  -0.0229 247 LYS B O   
4112 C CB  . LYS B 247 ? 0.4915 0.4323 0.4665 0.0787  0.0605  -0.0347 247 LYS B CB  
4113 C CG  . LYS B 247 ? 0.6294 0.5458 0.5924 0.0821  0.0566  -0.0434 247 LYS B CG  
4114 C CD  . LYS B 247 ? 0.8176 0.7278 0.7759 0.0964  0.0661  -0.0477 247 LYS B CD  
4115 C CE  . LYS B 247 ? 0.8990 0.8297 0.8816 0.1030  0.0715  -0.0389 247 LYS B CE  
4116 N NZ  . LYS B 247 ? 0.9664 0.8852 0.9518 0.1145  0.0746  -0.0418 247 LYS B NZ  
4117 N N   . SER B 248 ? 0.3418 0.2709 0.3304 0.0578  0.0367  -0.0337 248 SER B N   
4118 C CA  . SER B 248 ? 0.3089 0.2372 0.3087 0.0546  0.0300  -0.0323 248 SER B CA  
4119 C C   . SER B 248 ? 0.3627 0.2840 0.3642 0.0633  0.0323  -0.0339 248 SER B C   
4120 O O   . SER B 248 ? 0.4388 0.3441 0.4260 0.0695  0.0350  -0.0399 248 SER B O   
4121 C CB  . SER B 248 ? 0.3531 0.2692 0.3447 0.0468  0.0212  -0.0351 248 SER B CB  
4122 O OG  . SER B 248 ? 0.4290 0.3431 0.4286 0.0448  0.0154  -0.0339 248 SER B OG  
4123 N N   . GLN B 249 ? 0.3495 0.2823 0.3683 0.0639  0.0311  -0.0284 249 GLN B N   
4124 C CA  . GLN B 249 ? 0.3593 0.2868 0.3832 0.0723  0.0326  -0.0278 249 GLN B CA  
4125 C C   . GLN B 249 ? 0.3522 0.2671 0.3750 0.0674  0.0234  -0.0287 249 GLN B C   
4126 O O   . GLN B 249 ? 0.4046 0.3027 0.4222 0.0726  0.0225  -0.0315 249 GLN B O   
4127 C CB  . GLN B 249 ? 0.4208 0.3708 0.4655 0.0752  0.0358  -0.0190 249 GLN B CB  
4128 C CG  . GLN B 249 ? 0.4806 0.4468 0.5297 0.0795  0.0448  -0.0157 249 GLN B CG  
4129 C CD  . GLN B 249 ? 0.5468 0.5048 0.5873 0.0929  0.0546  -0.0193 249 GLN B CD  
4130 O OE1 . GLN B 249 ? 0.5232 0.4660 0.5605 0.1008  0.0553  -0.0226 249 GLN B OE1 
4131 N NE2 . GLN B 249 ? 0.5142 0.4816 0.5505 0.0957  0.0624  -0.0188 249 GLN B NE2 
4132 N N   . SER B 250 ? 0.3325 0.2554 0.3602 0.0574  0.0167  -0.0262 250 SER B N   
4133 C CA  . SER B 250 ? 0.2988 0.2136 0.3260 0.0518  0.0081  -0.0258 250 SER B CA  
4134 C C   . SER B 250 ? 0.3839 0.3062 0.4110 0.0420  0.0034  -0.0253 250 SER B C   
4135 O O   . SER B 250 ? 0.3441 0.2816 0.3791 0.0392  0.0052  -0.0230 250 SER B O   
4136 C CB  . SER B 250 ? 0.3870 0.3098 0.4289 0.0541  0.0061  -0.0193 250 SER B CB  
4137 O OG  . SER B 250 ? 0.3225 0.2471 0.3673 0.0462  -0.0021 -0.0164 250 SER B OG  
4138 N N   . THR B 251 ? 0.2786 0.1900 0.2970 0.0367  -0.0026 -0.0273 251 THR B N   
4139 C CA  . THR B 251 ? 0.2901 0.2089 0.3092 0.0291  -0.0058 -0.0267 251 THR B CA  
4140 C C   . THR B 251 ? 0.3032 0.2330 0.3322 0.0242  -0.0107 -0.0225 251 THR B C   
4141 O O   . THR B 251 ? 0.2747 0.2115 0.3051 0.0193  -0.0122 -0.0223 251 THR B O   
4142 C CB  . THR B 251 ? 0.3538 0.2597 0.3597 0.0255  -0.0094 -0.0294 251 THR B CB  
4143 O OG1 . THR B 251 ? 0.3985 0.2914 0.3996 0.0244  -0.0152 -0.0293 251 THR B OG1 
4144 C CG2 . THR B 251 ? 0.4028 0.3013 0.3973 0.0291  -0.0044 -0.0335 251 THR B CG2 
4145 N N   . VAL B 252 ? 0.2508 0.1824 0.2864 0.0261  -0.0127 -0.0190 252 VAL B N   
4146 C CA  . VAL B 252 ? 0.2316 0.1747 0.2749 0.0211  -0.0175 -0.0143 252 VAL B CA  
4147 C C   . VAL B 252 ? 0.2926 0.2528 0.3420 0.0176  -0.0158 -0.0143 252 VAL B C   
4148 O O   . VAL B 252 ? 0.3205 0.2877 0.3746 0.0195  -0.0120 -0.0145 252 VAL B O   
4149 C CB  . VAL B 252 ? 0.2605 0.2057 0.3121 0.0242  -0.0193 -0.0087 252 VAL B CB  
4150 C CG1 . VAL B 252 ? 0.2771 0.2380 0.3363 0.0186  -0.0240 -0.0030 252 VAL B CG1 
4151 C CG2 . VAL B 252 ? 0.3047 0.2295 0.3500 0.0272  -0.0220 -0.0091 252 VAL B CG2 
4152 N N   . GLY B 253 ? 0.2462 0.2131 0.2954 0.0124  -0.0184 -0.0143 253 GLY B N   
4153 C CA  . GLY B 253 ? 0.2866 0.2668 0.3400 0.0093  -0.0167 -0.0159 253 GLY B CA  
4154 C C   . GLY B 253 ? 0.2426 0.2193 0.2929 0.0088  -0.0129 -0.0207 253 GLY B C   
4155 O O   . GLY B 253 ? 0.2065 0.1906 0.2594 0.0059  -0.0117 -0.0229 253 GLY B O   
4156 N N   . ALA B 254 ? 0.2122 0.1770 0.2565 0.0112  -0.0114 -0.0222 254 ALA B N   
4157 C CA  . ALA B 254 ? 0.2162 0.1783 0.2586 0.0105  -0.0083 -0.0250 254 ALA B CA  
4158 C C   . ALA B 254 ? 0.2169 0.1814 0.2596 0.0075  -0.0093 -0.0265 254 ALA B C   
4159 O O   . ALA B 254 ? 0.1797 0.1460 0.2248 0.0060  -0.0070 -0.0289 254 ALA B O   
4160 C CB  . ALA B 254 ? 0.2497 0.2003 0.2844 0.0131  -0.0071 -0.0254 254 ALA B CB  
4161 N N   . GLY B 255 ? 0.2222 0.1865 0.2629 0.0067  -0.0125 -0.0246 255 GLY B N   
4162 C CA  . GLY B 255 ? 0.1869 0.1550 0.2286 0.0054  -0.0124 -0.0253 255 GLY B CA  
4163 C C   . GLY B 255 ? 0.2357 0.2133 0.2807 0.0038  -0.0110 -0.0285 255 GLY B C   
4164 O O   . GLY B 255 ? 0.2048 0.1815 0.2504 0.0038  -0.0082 -0.0322 255 GLY B O   
4165 N N   . ASP B 256 ? 0.1976 0.1835 0.2440 0.0022  -0.0130 -0.0270 256 ASP B N   
4166 C CA  . ASP B 256 ? 0.2160 0.2120 0.2631 -0.0005 -0.0125 -0.0303 256 ASP B CA  
4167 C C   . ASP B 256 ? 0.1977 0.1914 0.2460 -0.0023 -0.0104 -0.0347 256 ASP B C   
4168 O O   . ASP B 256 ? 0.2194 0.2145 0.2658 -0.0046 -0.0090 -0.0401 256 ASP B O   
4169 C CB  . ASP B 256 ? 0.2339 0.2411 0.2826 -0.0025 -0.0160 -0.0259 256 ASP B CB  
4170 C CG  . ASP B 256 ? 0.3453 0.3561 0.3937 -0.0022 -0.0187 -0.0204 256 ASP B CG  
4171 O OD1 . ASP B 256 ? 0.3030 0.3171 0.3541 -0.0028 -0.0224 -0.0144 256 ASP B OD1 
4172 O OD2 . ASP B 256 ? 0.3017 0.3122 0.3484 -0.0013 -0.0174 -0.0212 256 ASP B OD2 
4173 N N   . SER B 257 ? 0.2074 0.1974 0.2584 -0.0013 -0.0100 -0.0324 257 SER B N   
4174 C CA  . SER B 257 ? 0.2069 0.1962 0.2607 -0.0037 -0.0083 -0.0346 257 SER B CA  
4175 C C   . SER B 257 ? 0.2255 0.2049 0.2778 -0.0038 -0.0057 -0.0387 257 SER B C   
4176 O O   . SER B 257 ? 0.2213 0.1995 0.2741 -0.0075 -0.0054 -0.0429 257 SER B O   
4177 C CB  . SER B 257 ? 0.2190 0.2080 0.2766 -0.0013 -0.0071 -0.0302 257 SER B CB  
4178 O OG  . SER B 257 ? 0.2242 0.2225 0.2854 -0.0008 -0.0092 -0.0259 257 SER B OG  
4179 N N   . MET B 258 ? 0.2167 0.1883 0.2673 -0.0001 -0.0045 -0.0369 258 MET B N   
4180 C CA  . MET B 258 ? 0.2119 0.1749 0.2627 0.0007  -0.0022 -0.0388 258 MET B CA  
4181 C C   . MET B 258 ? 0.2314 0.1944 0.2811 0.0004  -0.0013 -0.0440 258 MET B C   
4182 O O   . MET B 258 ? 0.2168 0.1729 0.2677 -0.0008 0.0004  -0.0481 258 MET B O   
4183 C CB  . MET B 258 ? 0.1824 0.1401 0.2312 0.0041  -0.0021 -0.0346 258 MET B CB  
4184 C CG  . MET B 258 ? 0.1667 0.1183 0.2173 0.0058  -0.0003 -0.0348 258 MET B CG  
4185 S SD  . MET B 258 ? 0.2427 0.1902 0.2909 0.0080  -0.0014 -0.0282 258 MET B SD  
4186 C CE  . MET B 258 ? 0.2522 0.1945 0.3013 0.0068  0.0006  -0.0261 258 MET B CE  
4187 N N   . VAL B 259 ? 0.2065 0.1769 0.2539 0.0016  -0.0024 -0.0438 259 VAL B N   
4188 C CA  . VAL B 259 ? 0.2242 0.1966 0.2694 0.0025  -0.0003 -0.0490 259 VAL B CA  
4189 C C   . VAL B 259 ? 0.2292 0.2022 0.2712 -0.0020 -0.0003 -0.0563 259 VAL B C   
4190 O O   . VAL B 259 ? 0.2364 0.2021 0.2763 -0.0014 0.0024  -0.0630 259 VAL B O   
4191 C CB  . VAL B 259 ? 0.1999 0.1833 0.2436 0.0044  -0.0013 -0.0456 259 VAL B CB  
4192 C CG1 . VAL B 259 ? 0.2316 0.2204 0.2715 0.0055  0.0018  -0.0515 259 VAL B CG1 
4193 C CG2 . VAL B 259 ? 0.2111 0.1921 0.2577 0.0079  -0.0015 -0.0392 259 VAL B CG2 
4194 N N   . GLY B 260 ? 0.2256 0.2067 0.2675 -0.0065 -0.0037 -0.0548 260 GLY B N   
4195 C CA  . GLY B 260 ? 0.2337 0.2169 0.2724 -0.0127 -0.0052 -0.0606 260 GLY B CA  
4196 C C   . GLY B 260 ? 0.2401 0.2101 0.2809 -0.0154 -0.0043 -0.0643 260 GLY B C   
4197 O O   . GLY B 260 ? 0.2353 0.1986 0.2715 -0.0188 -0.0040 -0.0724 260 GLY B O   
4198 N N   . ALA B 261 ? 0.2265 0.1925 0.2738 -0.0142 -0.0040 -0.0583 261 ALA B N   
4199 C CA  . ALA B 261 ? 0.1967 0.1515 0.2479 -0.0169 -0.0034 -0.0591 261 ALA B CA  
4200 C C   . ALA B 261 ? 0.2361 0.1763 0.2860 -0.0136 -0.0002 -0.0643 261 ALA B C   
4201 O O   . ALA B 261 ? 0.2680 0.1971 0.3174 -0.0175 -0.0004 -0.0699 261 ALA B O   
4202 C CB  . ALA B 261 ? 0.1838 0.1396 0.2411 -0.0149 -0.0027 -0.0506 261 ALA B CB  
4203 N N   . MET B 262 ? 0.2283 0.1679 0.2784 -0.0065 0.0025  -0.0619 262 MET B N   
4204 C CA  . MET B 262 ? 0.2368 0.1643 0.2880 -0.0017 0.0061  -0.0651 262 MET B CA  
4205 C C   . MET B 262 ? 0.2494 0.1733 0.2939 -0.0014 0.0081  -0.0755 262 MET B C   
4206 O O   . MET B 262 ? 0.2924 0.2013 0.3371 0.0000  0.0106  -0.0813 262 MET B O   
4207 C CB  . MET B 262 ? 0.1980 0.1286 0.2523 0.0053  0.0080  -0.0584 262 MET B CB  
4208 C CG  . MET B 262 ? 0.2107 0.1413 0.2692 0.0047  0.0064  -0.0497 262 MET B CG  
4209 S SD  . MET B 262 ? 0.2755 0.2065 0.3372 0.0108  0.0074  -0.0415 262 MET B SD  
4210 C CE  . MET B 262 ? 0.3058 0.2500 0.3635 0.0131  0.0063  -0.0411 262 MET B CE  
4211 N N   . THR B 263 ? 0.2718 0.2087 0.3098 -0.0027 0.0070  -0.0779 263 THR B N   
4212 C CA  . THR B 263 ? 0.2790 0.2154 0.3076 -0.0030 0.0089  -0.0883 263 THR B CA  
4213 C C   . THR B 263 ? 0.2942 0.2182 0.3182 -0.0107 0.0066  -0.0969 263 THR B C   
4214 O O   . THR B 263 ? 0.3016 0.2123 0.3194 -0.0093 0.0096  -0.1072 263 THR B O   
4215 C CB  . THR B 263 ? 0.2913 0.2471 0.3140 -0.0051 0.0068  -0.0871 263 THR B CB  
4216 O OG1 . THR B 263 ? 0.2624 0.2284 0.2894 0.0011  0.0082  -0.0789 263 THR B OG1 
4217 C CG2 . THR B 263 ? 0.2652 0.2222 0.2758 -0.0060 0.0089  -0.0982 263 THR B CG2 
4218 N N   . LEU B 264 ? 0.2984 0.2266 0.3257 -0.0189 0.0012  -0.0927 264 LEU B N   
4219 C CA  . LEU B 264 ? 0.2867 0.2046 0.3114 -0.0282 -0.0025 -0.0986 264 LEU B CA  
4220 C C   . LEU B 264 ? 0.4130 0.3087 0.4426 -0.0268 -0.0004 -0.1009 264 LEU B C   
4221 O O   . LEU B 264 ? 0.3763 0.2559 0.4000 -0.0312 -0.0012 -0.1106 264 LEU B O   
4222 C CB  . LEU B 264 ? 0.3136 0.2438 0.3444 -0.0363 -0.0082 -0.0903 264 LEU B CB  
4223 C CG  . LEU B 264 ? 0.3453 0.2956 0.3717 -0.0409 -0.0121 -0.0888 264 LEU B CG  
4224 C CD1 . LEU B 264 ? 0.3155 0.2790 0.3519 -0.0453 -0.0160 -0.0778 264 LEU B CD1 
4225 C CD2 . LEU B 264 ? 0.3911 0.3388 0.4051 -0.0494 -0.0155 -0.0997 264 LEU B CD2 
4226 N N   . LYS B 265 ? 0.3238 0.2177 0.3636 -0.0209 0.0020  -0.0917 265 LYS B N   
4227 C CA  . LYS B 265 ? 0.3260 0.2002 0.3723 -0.0191 0.0038  -0.0915 265 LYS B CA  
4228 C C   . LYS B 265 ? 0.3479 0.2085 0.3901 -0.0106 0.0094  -0.1001 265 LYS B C   
4229 O O   . LYS B 265 ? 0.3668 0.2063 0.4096 -0.0109 0.0105  -0.1059 265 LYS B O   
4230 C CB  . LYS B 265 ? 0.3408 0.2189 0.3981 -0.0156 0.0045  -0.0785 265 LYS B CB  
4231 C CG  . LYS B 265 ? 0.3081 0.1948 0.3707 -0.0236 0.0002  -0.0704 265 LYS B CG  
4232 C CD  . LYS B 265 ? 0.3799 0.2529 0.4459 -0.0326 -0.0031 -0.0723 265 LYS B CD  
4233 C CE  . LYS B 265 ? 0.3744 0.2602 0.4469 -0.0405 -0.0069 -0.0630 265 LYS B CE  
4234 N NZ  . LYS B 265 ? 0.4602 0.3341 0.5381 -0.0505 -0.0109 -0.0621 265 LYS B NZ  
4235 N N   . LEU B 266 ? 0.3350 0.2077 0.3735 -0.0029 0.0133  -0.1004 266 LEU B N   
4236 C CA  . LEU B 266 ? 0.3376 0.2016 0.3724 0.0064  0.0198  -0.1083 266 LEU B CA  
4237 C C   . LEU B 266 ? 0.4565 0.3085 0.4777 0.0020  0.0199  -0.1239 266 LEU B C   
4238 O O   . LEU B 266 ? 0.4539 0.2880 0.4710 0.0071  0.0237  -0.1305 266 LEU B O   
4239 C CB  . LEU B 266 ? 0.3590 0.2427 0.3932 0.0142  0.0233  -0.1039 266 LEU B CB  
4240 C CG  . LEU B 266 ? 0.5287 0.4089 0.5643 0.0264  0.0312  -0.1067 266 LEU B CG  
4241 C CD1 . LEU B 266 ? 0.5913 0.4720 0.6128 0.0282  0.0353  -0.1202 266 LEU B CD1 
4242 C CD2 . LEU B 266 ? 0.5385 0.3971 0.5834 0.0315  0.0342  -0.1063 266 LEU B CD2 
4243 N N   . ALA B 267 ? 0.4176 0.2809 0.4299 -0.0077 0.0146  -0.1269 267 ALA B N   
4244 C CA  . ALA B 267 ? 0.4289 0.2827 0.4260 -0.0143 0.0131  -0.1415 267 ALA B CA  
4245 C C   . ALA B 267 ? 0.3819 0.2122 0.3781 -0.0211 0.0089  -0.1434 267 ALA B C   
4246 O O   . ALA B 267 ? 0.5015 0.3162 0.4832 -0.0226 0.0084  -0.1531 267 ALA B O   
4247 C CB  . ALA B 267 ? 0.4140 0.2889 0.4034 -0.0240 0.0070  -0.1405 267 ALA B CB  
4248 N N   . GLU B 268 ? 0.4018 0.2299 0.4124 -0.0250 0.0054  -0.1329 268 GLU B N   
4249 C CA  . GLU B 268 ? 0.4478 0.2565 0.4597 -0.0324 0.0007  -0.1313 268 GLU B CA  
4250 C C   . GLU B 268 ? 0.4879 0.2778 0.5051 -0.0226 0.0053  -0.1277 268 GLU B C   
4251 O O   . GLU B 268 ? 0.5354 0.3080 0.5553 -0.0276 0.0020  -0.1249 268 GLU B O   
4252 C CB  . GLU B 268 ? 0.4417 0.2605 0.4674 -0.0422 -0.0051 -0.1207 268 GLU B CB  
4253 C CG  . GLU B 268 ? 0.5607 0.3992 0.5833 -0.0527 -0.0108 -0.1218 268 GLU B CG  
4254 C CD  . GLU B 268 ? 0.6853 0.5407 0.7213 -0.0574 -0.0145 -0.1064 268 GLU B CD  
4255 O OE1 . GLU B 268 ? 0.8271 0.7038 0.8621 -0.0621 -0.0180 -0.1022 268 GLU B OE1 
4256 O OE2 . GLU B 268 ? 0.6406 0.4887 0.6883 -0.0559 -0.0136 -0.0980 268 GLU B OE2 
4257 N N   . ASN B 269 ? 0.5145 0.3093 0.5342 -0.0093 0.0128  -0.1269 269 ASN B N   
4258 C CA  . ASN B 269 ? 0.4930 0.2748 0.5205 0.0012  0.0175  -0.1215 269 ASN B CA  
4259 C C   . ASN B 269 ? 0.5330 0.3135 0.5764 -0.0020 0.0145  -0.1078 269 ASN B C   
4260 O O   . ASN B 269 ? 0.5346 0.2980 0.5824 -0.0001 0.0146  -0.1041 269 ASN B O   
4261 C CB  . ASN B 269 ? 0.6193 0.3757 0.6350 0.0038  0.0186  -0.1311 269 ASN B CB  
4262 C CG  . ASN B 269 ? 0.9146 0.6699 0.9255 0.0186  0.0272  -0.1368 269 ASN B CG  
4263 O OD1 . ASN B 269 ? 1.0262 0.7833 1.0491 0.0294  0.0321  -0.1287 269 ASN B OD1 
4264 N ND2 . ASN B 269 ? 1.0266 0.7803 1.0199 0.0193  0.0290  -0.1501 269 ASN B ND2 
4265 N N   . ALA B 270 ? 0.4566 0.2553 0.5083 -0.0067 0.0120  -0.1003 270 ALA B N   
4266 C CA  . ALA B 270 ? 0.3768 0.1772 0.4426 -0.0099 0.0095  -0.0872 270 ALA B CA  
4267 C C   . ALA B 270 ? 0.3760 0.1767 0.4518 0.0012  0.0141  -0.0779 270 ALA B C   
4268 O O   . ALA B 270 ? 0.3761 0.1802 0.4498 0.0114  0.0192  -0.0806 270 ALA B O   
4269 C CB  . ALA B 270 ? 0.3548 0.1743 0.4255 -0.0164 0.0063  -0.0826 270 ALA B CB  
4270 N N   . SER B 271 ? 0.4208 0.2194 0.5080 -0.0011 0.0122  -0.0660 271 SER B N   
4271 C CA  . SER B 271 ? 0.4301 0.2311 0.5277 0.0076  0.0152  -0.0550 271 SER B CA  
4272 C C   . SER B 271 ? 0.3557 0.1763 0.4560 0.0112  0.0165  -0.0505 271 SER B C   
4273 O O   . SER B 271 ? 0.3606 0.1939 0.4544 0.0059  0.0143  -0.0532 271 SER B O   
4274 C CB  . SER B 271 ? 0.3690 0.1652 0.4774 0.0024  0.0121  -0.0427 271 SER B CB  
4275 O OG  . SER B 271 ? 0.3960 0.2052 0.5079 -0.0054 0.0090  -0.0369 271 SER B OG  
4276 N N   . LEU B 272 ? 0.3144 0.1397 0.4221 0.0198  0.0193  -0.0421 272 LEU B N   
4277 C CA  . LEU B 272 ? 0.2821 0.1284 0.3878 0.0220  0.0189  -0.0357 272 LEU B CA  
4278 C C   . LEU B 272 ? 0.3208 0.1778 0.4245 0.0139  0.0145  -0.0282 272 LEU B C   
4279 O O   . LEU B 272 ? 0.2820 0.1531 0.3780 0.0117  0.0130  -0.0293 272 LEU B O   
4280 C CB  . LEU B 272 ? 0.3477 0.1980 0.4625 0.0309  0.0212  -0.0257 272 LEU B CB  
4281 C CG  . LEU B 272 ? 0.3413 0.2126 0.4526 0.0320  0.0196  -0.0189 272 LEU B CG  
4282 C CD1 . LEU B 272 ? 0.3665 0.2467 0.4696 0.0344  0.0213  -0.0279 272 LEU B CD1 
4283 C CD2 . LEU B 272 ? 0.3293 0.2054 0.4510 0.0385  0.0203  -0.0063 272 LEU B CD2 
4284 N N   . GLU B 273 ? 0.2876 0.1378 0.3986 0.0099  0.0128  -0.0202 273 GLU B N   
4285 C CA  . GLU B 273 ? 0.2671 0.1283 0.3764 0.0030  0.0099  -0.0127 273 GLU B CA  
4286 C C   . GLU B 273 ? 0.3058 0.1721 0.4081 -0.0040 0.0081  -0.0200 273 GLU B C   
4287 O O   . GLU B 273 ? 0.3249 0.2061 0.4218 -0.0057 0.0073  -0.0176 273 GLU B O   
4288 C CB  . GLU B 273 ? 0.3537 0.2073 0.4730 -0.0005 0.0087  -0.0021 273 GLU B CB  
4289 C CG  . GLU B 273 ? 0.4953 0.3632 0.6128 -0.0060 0.0070  0.0076  273 GLU B CG  
4290 C CD  . GLU B 273 ? 0.5454 0.4086 0.6732 -0.0090 0.0060  0.0203  273 GLU B CD  
4291 O OE1 . GLU B 273 ? 0.5231 0.3740 0.6580 -0.0146 0.0045  0.0200  273 GLU B OE1 
4292 O OE2 . GLU B 273 ? 0.6238 0.4956 0.7525 -0.0066 0.0060  0.0311  273 GLU B OE2 
4293 N N   . GLU B 274 ? 0.2906 0.1444 0.3931 -0.0080 0.0074  -0.0287 274 GLU B N   
4294 C CA  . GLU B 274 ? 0.3108 0.1706 0.4077 -0.0155 0.0048  -0.0348 274 GLU B CA  
4295 C C   . GLU B 274 ? 0.3171 0.1902 0.4047 -0.0120 0.0056  -0.0409 274 GLU B C   
4296 O O   . GLU B 274 ? 0.2927 0.1799 0.3771 -0.0152 0.0041  -0.0393 274 GLU B O   
4297 C CB  . GLU B 274 ? 0.3610 0.2033 0.4581 -0.0214 0.0028  -0.0438 274 GLU B CB  
4298 C CG  . GLU B 274 ? 0.5997 0.4497 0.6914 -0.0303 -0.0009 -0.0494 274 GLU B CG  
4299 C CD  . GLU B 274 ? 0.6621 0.4947 0.7550 -0.0398 -0.0049 -0.0551 274 GLU B CD  
4300 O OE1 . GLU B 274 ? 0.5604 0.3751 0.6606 -0.0402 -0.0049 -0.0522 274 GLU B OE1 
4301 O OE2 . GLU B 274 ? 0.6423 0.4789 0.7290 -0.0474 -0.0085 -0.0618 274 GLU B OE2 
4302 N N   . MET B 275 ? 0.2973 0.1663 0.3817 -0.0049 0.0083  -0.0469 275 MET B N   
4303 C CA  . MET B 275 ? 0.2684 0.1502 0.3451 -0.0016 0.0090  -0.0512 275 MET B CA  
4304 C C   . MET B 275 ? 0.2661 0.1629 0.3418 0.0001  0.0082  -0.0427 275 MET B C   
4305 O O   . MET B 275 ? 0.2626 0.1708 0.3333 -0.0019 0.0066  -0.0439 275 MET B O   
4306 C CB  . MET B 275 ? 0.3218 0.1987 0.3975 0.0067  0.0129  -0.0561 275 MET B CB  
4307 C CG  . MET B 275 ? 0.3091 0.2001 0.3776 0.0096  0.0135  -0.0595 275 MET B CG  
4308 S SD  . MET B 275 ? 0.3610 0.2506 0.4302 0.0201  0.0192  -0.0630 275 MET B SD  
4309 C CE  . MET B 275 ? 0.4043 0.2717 0.4716 0.0198  0.0220  -0.0754 275 MET B CE  
4310 N N   . VAL B 276 ? 0.2488 0.1451 0.3290 0.0036  0.0090  -0.0342 276 VAL B N   
4311 C CA  . VAL B 276 ? 0.2214 0.1294 0.2980 0.0048  0.0079  -0.0275 276 VAL B CA  
4312 C C   . VAL B 276 ? 0.2523 0.1664 0.3272 -0.0002 0.0066  -0.0243 276 VAL B C   
4313 O O   . VAL B 276 ? 0.2466 0.1699 0.3158 0.0001  0.0059  -0.0240 276 VAL B O   
4314 C CB  . VAL B 276 ? 0.2502 0.1574 0.3305 0.0087  0.0082  -0.0187 276 VAL B CB  
4315 C CG1 . VAL B 276 ? 0.2356 0.1530 0.3092 0.0085  0.0063  -0.0132 276 VAL B CG1 
4316 C CG2 . VAL B 276 ? 0.3155 0.2201 0.3993 0.0150  0.0101  -0.0204 276 VAL B CG2 
4317 N N   . ARG B 277 ? 0.2240 0.1330 0.3045 -0.0046 0.0066  -0.0216 277 ARG B N   
4318 C CA  . ARG B 277 ? 0.2380 0.1552 0.3187 -0.0090 0.0062  -0.0175 277 ARG B CA  
4319 C C   . ARG B 277 ? 0.2926 0.2175 0.3705 -0.0116 0.0051  -0.0233 277 ARG B C   
4320 O O   . ARG B 277 ? 0.2242 0.1599 0.2995 -0.0111 0.0056  -0.0208 277 ARG B O   
4321 C CB  . ARG B 277 ? 0.2670 0.1784 0.3562 -0.0144 0.0058  -0.0123 277 ARG B CB  
4322 C CG  . ARG B 277 ? 0.2666 0.1770 0.3589 -0.0128 0.0068  -0.0021 277 ARG B CG  
4323 C CD  . ARG B 277 ? 0.2864 0.1892 0.3888 -0.0186 0.0058  0.0037  277 ARG B CD  
4324 N NE  . ARG B 277 ? 0.3080 0.2122 0.4139 -0.0177 0.0065  0.0153  277 ARG B NE  
4325 C CZ  . ARG B 277 ? 0.4644 0.3614 0.5803 -0.0221 0.0054  0.0231  277 ARG B CZ  
4326 N NH1 . ARG B 277 ? 0.3884 0.2745 0.5109 -0.0280 0.0033  0.0192  277 ARG B NH1 
4327 N NH2 . ARG B 277 ? 0.5054 0.4059 0.6243 -0.0215 0.0058  0.0350  277 ARG B NH2 
4328 N N   . PHE B 278 ? 0.2671 0.1864 0.3449 -0.0140 0.0037  -0.0312 278 PHE B N   
4329 C CA  . PHE B 278 ? 0.2593 0.1877 0.3345 -0.0174 0.0018  -0.0356 278 PHE B CA  
4330 C C   . PHE B 278 ? 0.2348 0.1718 0.3038 -0.0121 0.0022  -0.0369 278 PHE B C   
4331 O O   . PHE B 278 ? 0.1896 0.1374 0.2577 -0.0128 0.0013  -0.0356 278 PHE B O   
4332 C CB  . PHE B 278 ? 0.2656 0.1857 0.3396 -0.0222 -0.0002 -0.0443 278 PHE B CB  
4333 C CG  . PHE B 278 ? 0.2647 0.1949 0.3377 -0.0288 -0.0036 -0.0467 278 PHE B CG  
4334 C CD1 . PHE B 278 ? 0.2779 0.2172 0.3575 -0.0345 -0.0053 -0.0398 278 PHE B CD1 
4335 C CD2 . PHE B 278 ? 0.2529 0.1857 0.3189 -0.0296 -0.0050 -0.0546 278 PHE B CD2 
4336 C CE1 . PHE B 278 ? 0.2568 0.2079 0.3373 -0.0410 -0.0089 -0.0403 278 PHE B CE1 
4337 C CE2 . PHE B 278 ? 0.2982 0.2421 0.3634 -0.0365 -0.0089 -0.0555 278 PHE B CE2 
4338 C CZ  . PHE B 278 ? 0.2816 0.2347 0.3547 -0.0422 -0.0111 -0.0480 278 PHE B CZ  
4339 N N   . GLY B 279 ? 0.2053 0.1376 0.2713 -0.0068 0.0034  -0.0381 279 GLY B N   
4340 C CA  . GLY B 279 ? 0.2382 0.1775 0.2991 -0.0027 0.0030  -0.0377 279 GLY B CA  
4341 C C   . GLY B 279 ? 0.2399 0.1842 0.2989 -0.0009 0.0031  -0.0318 279 GLY B C   
4342 O O   . GLY B 279 ? 0.1955 0.1466 0.2516 0.0000  0.0021  -0.0318 279 GLY B O   
4343 N N   . VAL B 280 ? 0.2024 0.1430 0.2622 -0.0003 0.0045  -0.0267 280 VAL B N   
4344 C CA  . VAL B 280 ? 0.1985 0.1432 0.2541 0.0016  0.0054  -0.0223 280 VAL B CA  
4345 C C   . VAL B 280 ? 0.2070 0.1598 0.2653 0.0000  0.0066  -0.0216 280 VAL B C   
4346 O O   . VAL B 280 ? 0.1899 0.1472 0.2442 0.0031  0.0074  -0.0210 280 VAL B O   
4347 C CB  . VAL B 280 ? 0.1766 0.1178 0.2315 0.0020  0.0067  -0.0164 280 VAL B CB  
4348 C CG1 . VAL B 280 ? 0.1943 0.1403 0.2429 0.0036  0.0088  -0.0130 280 VAL B CG1 
4349 C CG2 . VAL B 280 ? 0.2004 0.1366 0.2526 0.0042  0.0050  -0.0151 280 VAL B CG2 
4350 N N   . ALA B 281 ? 0.1785 0.1328 0.2440 -0.0047 0.0065  -0.0212 281 ALA B N   
4351 C CA  . ALA B 281 ? 0.1845 0.1494 0.2550 -0.0070 0.0072  -0.0187 281 ALA B CA  
4352 C C   . ALA B 281 ? 0.2035 0.1754 0.2728 -0.0056 0.0056  -0.0217 281 ALA B C   
4353 O O   . ALA B 281 ? 0.2290 0.2091 0.2992 -0.0024 0.0074  -0.0186 281 ALA B O   
4354 C CB  . ALA B 281 ? 0.1973 0.1622 0.2760 -0.0145 0.0056  -0.0178 281 ALA B CB  
4355 N N   . ALA B 282 ? 0.2061 0.1751 0.2736 -0.0074 0.0027  -0.0271 282 ALA B N   
4356 C CA  . ALA B 282 ? 0.2324 0.2093 0.2992 -0.0069 0.0006  -0.0286 282 ALA B CA  
4357 C C   . ALA B 282 ? 0.2598 0.2354 0.3212 -0.0007 0.0010  -0.0276 282 ALA B C   
4358 O O   . ALA B 282 ? 0.2026 0.1850 0.2655 0.0015  0.0006  -0.0254 282 ALA B O   
4359 C CB  . ALA B 282 ? 0.2199 0.1955 0.2848 -0.0109 -0.0024 -0.0346 282 ALA B CB  
4360 N N   . GLY B 283 ? 0.1947 0.1613 0.2506 0.0018  0.0013  -0.0287 283 GLY B N   
4361 C CA  . GLY B 283 ? 0.1546 0.1181 0.2045 0.0061  0.0006  -0.0278 283 GLY B CA  
4362 C C   . GLY B 283 ? 0.2052 0.1689 0.2532 0.0099  0.0034  -0.0250 283 GLY B C   
4363 O O   . GLY B 283 ? 0.2031 0.1670 0.2493 0.0133  0.0029  -0.0245 283 GLY B O   
4364 N N   . SER B 284 ? 0.2128 0.1760 0.2612 0.0099  0.0067  -0.0230 284 SER B N   
4365 C CA  . SER B 284 ? 0.2274 0.1919 0.2726 0.0145  0.0107  -0.0207 284 SER B CA  
4366 C C   . SER B 284 ? 0.2052 0.1813 0.2591 0.0159  0.0128  -0.0180 284 SER B C   
4367 O O   . SER B 284 ? 0.2017 0.1790 0.2537 0.0220  0.0160  -0.0171 284 SER B O   
4368 C CB  . SER B 284 ? 0.2561 0.2194 0.2989 0.0137  0.0138  -0.0179 284 SER B CB  
4369 O OG  . SER B 284 ? 0.2312 0.1850 0.2660 0.0131  0.0115  -0.0190 284 SER B OG  
4370 N N   . ALA B 285 ? 0.1951 0.1795 0.2583 0.0104  0.0109  -0.0169 285 ALA B N   
4371 C CA  . ALA B 285 ? 0.1989 0.1968 0.2717 0.0104  0.0113  -0.0130 285 ALA B CA  
4372 C C   . ALA B 285 ? 0.1791 0.1776 0.2513 0.0145  0.0095  -0.0136 285 ALA B C   
4373 O O   . ALA B 285 ? 0.1931 0.1997 0.2711 0.0193  0.0118  -0.0095 285 ALA B O   
4374 C CB  . ALA B 285 ? 0.2284 0.2336 0.3091 0.0017  0.0077  -0.0126 285 ALA B CB  
4375 N N   . ALA B 286 ? 0.1890 0.1797 0.2554 0.0129  0.0054  -0.0177 286 ALA B N   
4376 C CA  . ALA B 286 ? 0.2239 0.2144 0.2900 0.0159  0.0029  -0.0170 286 ALA B CA  
4377 C C   . ALA B 286 ? 0.2209 0.2035 0.2824 0.0239  0.0065  -0.0164 286 ALA B C   
4378 O O   . ALA B 286 ? 0.2907 0.2780 0.3577 0.0285  0.0076  -0.0131 286 ALA B O   
4379 C CB  . ALA B 286 ? 0.2194 0.2037 0.2799 0.0129  -0.0015 -0.0202 286 ALA B CB  
4380 N N   . THR B 287 ? 0.1876 0.1589 0.2392 0.0259  0.0088  -0.0194 287 THR B N   
4381 C CA  . THR B 287 ? 0.2458 0.2065 0.2890 0.0332  0.0118  -0.0210 287 THR B CA  
4382 C C   . THR B 287 ? 0.2423 0.2106 0.2912 0.0406  0.0185  -0.0179 287 THR B C   
4383 O O   . THR B 287 ? 0.2470 0.2063 0.2901 0.0483  0.0217  -0.0196 287 THR B O   
4384 C CB  . THR B 287 ? 0.2697 0.2183 0.2993 0.0327  0.0125  -0.0247 287 THR B CB  
4385 O OG1 . THR B 287 ? 0.2411 0.1964 0.2716 0.0327  0.0175  -0.0229 287 THR B OG1 
4386 C CG2 . THR B 287 ? 0.2326 0.1769 0.2596 0.0260  0.0065  -0.0259 287 THR B CG2 
4387 N N   . LEU B 288 ? 0.2310 0.2157 0.2913 0.0383  0.0206  -0.0131 288 LEU B N   
4388 C CA  . LEU B 288 ? 0.2511 0.2473 0.3192 0.0451  0.0274  -0.0082 288 LEU B CA  
4389 C C   . LEU B 288 ? 0.2721 0.2749 0.3507 0.0504  0.0271  -0.0040 288 LEU B C   
4390 O O   . LEU B 288 ? 0.2939 0.3040 0.3788 0.0590  0.0335  0.0001  288 LEU B O   
4391 C CB  . LEU B 288 ? 0.2191 0.2324 0.2978 0.0393  0.0287  -0.0027 288 LEU B CB  
4392 C CG  . LEU B 288 ? 0.2431 0.2515 0.3144 0.0345  0.0295  -0.0046 288 LEU B CG  
4393 C CD1 . LEU B 288 ? 0.3078 0.3321 0.3912 0.0279  0.0299  0.0019  288 LEU B CD1 
4394 C CD2 . LEU B 288 ? 0.3343 0.3343 0.3927 0.0420  0.0359  -0.0071 288 LEU B CD2 
4395 N N   . ASN B 289 ? 0.2824 0.2232 0.3909 0.0556  -0.0384 -0.0176 289 ASN B N   
4396 C CA  . ASN B 289 ? 0.2935 0.2358 0.4144 0.0607  -0.0469 -0.0061 289 ASN B CA  
4397 C C   . ASN B 289 ? 0.4194 0.3326 0.5328 0.0657  -0.0486 -0.0055 289 ASN B C   
4398 O O   . ASN B 289 ? 0.5475 0.4416 0.6449 0.0620  -0.0450 -0.0143 289 ASN B O   
4399 C CB  . ASN B 289 ? 0.3021 0.2582 0.4186 0.0478  -0.0572 0.0025  289 ASN B CB  
4400 C CG  . ASN B 289 ? 0.3153 0.2982 0.4409 0.0424  -0.0565 0.0014  289 ASN B CG  
4401 O OD1 . ASN B 289 ? 0.3729 0.3703 0.5183 0.0509  -0.0516 0.0006  289 ASN B OD1 
4402 N ND2 . ASN B 289 ? 0.3469 0.3354 0.4586 0.0279  -0.0597 0.0007  289 ASN B ND2 
4403 N N   . GLN B 290 ? 0.3732 0.2823 0.4996 0.0740  -0.0548 0.0051  290 GLN B N   
4404 C CA  . GLN B 290 ? 0.3539 0.2322 0.4742 0.0784  -0.0564 0.0065  290 GLN B CA  
4405 C C   . GLN B 290 ? 0.3845 0.2538 0.4895 0.0648  -0.0657 0.0152  290 GLN B C   
4406 O O   . GLN B 290 ? 0.3496 0.2369 0.4511 0.0553  -0.0722 0.0229  290 GLN B O   
4407 C CB  . GLN B 290 ? 0.3847 0.2595 0.5286 0.0955  -0.0577 0.0151  290 GLN B CB  
4408 C CG  . GLN B 290 ? 0.5427 0.4215 0.7027 0.1108  -0.0441 0.0055  290 GLN B CG  
4409 C CD  . GLN B 290 ? 0.6610 0.5099 0.8006 0.1126  -0.0329 -0.0112 290 GLN B CD  
4410 O OE1 . GLN B 290 ? 0.7093 0.5298 0.8325 0.1074  -0.0368 -0.0133 290 GLN B OE1 
4411 N NE2 . GLN B 290 ? 0.6485 0.5031 0.7877 0.1186  -0.0193 -0.0229 290 GLN B NE2 
4412 N N   . GLY B 291 ? 0.3768 0.2169 0.4715 0.0629  -0.0655 0.0133  291 GLY B N   
4413 C CA  . GLY B 291 ? 0.4576 0.2855 0.5416 0.0522  -0.0728 0.0245  291 GLY B CA  
4414 C C   . GLY B 291 ? 0.6009 0.4392 0.6694 0.0345  -0.0722 0.0231  291 GLY B C   
4415 O O   . GLY B 291 ? 0.8757 0.7080 0.9378 0.0277  -0.0668 0.0123  291 GLY B O   
4416 N N   . THR B 292 ? 0.4450 0.2980 0.5076 0.0271  -0.0778 0.0340  292 THR B N   
4417 C CA  . THR B 292 ? 0.3744 0.2345 0.4209 0.0106  -0.0747 0.0329  292 THR B CA  
4418 C C   . THR B 292 ? 0.3873 0.2742 0.4315 0.0062  -0.0749 0.0306  292 THR B C   
4419 O O   . THR B 292 ? 0.4157 0.3085 0.4464 -0.0067 -0.0706 0.0282  292 THR B O   
4420 C CB  . THR B 292 ? 0.3913 0.2377 0.4227 0.0010  -0.0789 0.0474  292 THR B CB  
4421 O OG1 . THR B 292 ? 0.4061 0.2593 0.4364 0.0053  -0.0901 0.0619  292 THR B OG1 
4422 C CG2 . THR B 292 ? 0.4180 0.2352 0.4520 0.0027  -0.0783 0.0499  292 THR B CG2 
4423 N N   . ARG B 293 ? 0.4000 0.3025 0.4591 0.0165  -0.0786 0.0309  293 ARG B N   
4424 C CA  . ARG B 293 ? 0.3425 0.2702 0.4019 0.0115  -0.0812 0.0302  293 ARG B CA  
4425 C C   . ARG B 293 ? 0.4576 0.3949 0.5130 0.0040  -0.0712 0.0163  293 ARG B C   
4426 O O   . ARG B 293 ? 0.4886 0.4255 0.5533 0.0101  -0.0641 0.0068  293 ARG B O   
4427 C CB  . ARG B 293 ? 0.3505 0.2943 0.4342 0.0248  -0.0864 0.0338  293 ARG B CB  
4428 C CG  . ARG B 293 ? 0.5440 0.4790 0.6384 0.0354  -0.0964 0.0484  293 ARG B CG  
4429 C CD  . ARG B 293 ? 0.8289 0.7869 0.9510 0.0461  -0.1041 0.0556  293 ARG B CD  
4430 N NE  . ARG B 293 ? 0.9507 0.9323 1.0842 0.0446  -0.0976 0.0451  293 ARG B NE  
4431 C CZ  . ARG B 293 ? 1.0437 1.0485 1.1779 0.0348  -0.1052 0.0475  293 ARG B CZ  
4432 N NH1 . ARG B 293 ? 1.0673 1.0751 1.1880 0.0253  -0.1204 0.0595  293 ARG B NH1 
4433 N NH2 . ARG B 293 ? 1.0489 1.0721 1.1950 0.0333  -0.0979 0.0380  293 ARG B NH2 
4434 N N   . LEU B 294 ? 0.3080 0.2529 0.3486 -0.0092 -0.0704 0.0152  294 LEU B N   
4435 C CA  . LEU B 294 ? 0.2902 0.2407 0.3297 -0.0150 -0.0600 0.0025  294 LEU B CA  
4436 C C   . LEU B 294 ? 0.2815 0.2494 0.3366 -0.0097 -0.0586 -0.0036 294 LEU B C   
4437 O O   . LEU B 294 ? 0.3156 0.2923 0.3860 -0.0001 -0.0638 0.0008  294 LEU B O   
4438 C CB  . LEU B 294 ? 0.2996 0.2504 0.3188 -0.0300 -0.0566 0.0013  294 LEU B CB  
4439 C CG  . LEU B 294 ? 0.3355 0.2696 0.3387 -0.0365 -0.0553 0.0083  294 LEU B CG  
4440 C CD1 . LEU B 294 ? 0.3382 0.2722 0.3159 -0.0512 -0.0521 0.0087  294 LEU B CD1 
4441 C CD2 . LEU B 294 ? 0.4283 0.3514 0.4400 -0.0355 -0.0456 0.0023  294 LEU B CD2 
4442 N N   . CYS B 295 ? 0.2610 0.2334 0.3143 -0.0159 -0.0504 -0.0130 295 CYS B N   
4443 C CA  . CYS B 295 ? 0.2865 0.2732 0.3524 -0.0135 -0.0474 -0.0184 295 CYS B CA  
4444 C C   . CYS B 295 ? 0.2709 0.2746 0.3408 -0.0178 -0.0558 -0.0137 295 CYS B C   
4445 O O   . CYS B 295 ? 0.3034 0.3069 0.3581 -0.0276 -0.0624 -0.0100 295 CYS B O   
4446 C CB  . CYS B 295 ? 0.2512 0.2360 0.3132 -0.0206 -0.0377 -0.0278 295 CYS B CB  
4447 S SG  . CYS B 295 ? 0.2926 0.2731 0.3348 -0.0364 -0.0344 -0.0307 295 CYS B SG  
4448 N N   . SER B 296 ? 0.2426 0.2612 0.3323 -0.0115 -0.0557 -0.0138 296 SER B N   
4449 C CA  . SER B 296 ? 0.2461 0.2845 0.3457 -0.0171 -0.0642 -0.0100 296 SER B CA  
4450 C C   . SER B 296 ? 0.2376 0.2821 0.3383 -0.0261 -0.0570 -0.0190 296 SER B C   
4451 O O   . SER B 296 ? 0.2543 0.2920 0.3567 -0.0227 -0.0454 -0.0256 296 SER B O   
4452 C CB  . SER B 296 ? 0.2849 0.3389 0.4127 -0.0045 -0.0682 -0.0027 296 SER B CB  
4453 O OG  . SER B 296 ? 0.2921 0.3526 0.4355 0.0012  -0.0562 -0.0086 296 SER B OG  
4454 N N   . HIS B 297 ? 0.2466 0.3024 0.3453 -0.0382 -0.0649 -0.0188 297 HIS B N   
4455 C CA  . HIS B 297 ? 0.2435 0.3023 0.3430 -0.0485 -0.0587 -0.0276 297 HIS B CA  
4456 C C   . HIS B 297 ? 0.2764 0.3459 0.4012 -0.0407 -0.0502 -0.0283 297 HIS B C   
4457 O O   . HIS B 297 ? 0.2548 0.3157 0.3778 -0.0415 -0.0385 -0.0350 297 HIS B O   
4458 C CB  . HIS B 297 ? 0.3324 0.4027 0.4275 -0.0634 -0.0717 -0.0268 297 HIS B CB  
4459 C CG  . HIS B 297 ? 0.3992 0.4719 0.4980 -0.0749 -0.0663 -0.0359 297 HIS B CG  
4460 N ND1 . HIS B 297 ? 0.4098 0.5007 0.5378 -0.0737 -0.0653 -0.0341 297 HIS B ND1 
4461 C CD2 . HIS B 297 ? 0.4896 0.5472 0.5676 -0.0877 -0.0601 -0.0469 297 HIS B CD2 
4462 C CE1 . HIS B 297 ? 0.5191 0.6051 0.6437 -0.0863 -0.0601 -0.0430 297 HIS B CE1 
4463 N NE2 . HIS B 297 ? 0.4931 0.5581 0.5874 -0.0944 -0.0569 -0.0514 297 HIS B NE2 
4464 N N   . ASP B 298 ? 0.2469 0.3348 0.3961 -0.0328 -0.0554 -0.0203 298 ASP B N   
4465 C CA  . ASP B 298 ? 0.2158 0.3160 0.3897 -0.0262 -0.0456 -0.0201 298 ASP B CA  
4466 C C   . ASP B 298 ? 0.2063 0.2908 0.3738 -0.0143 -0.0313 -0.0236 298 ASP B C   
4467 O O   . ASP B 298 ? 0.2016 0.2848 0.3720 -0.0151 -0.0202 -0.0272 298 ASP B O   
4468 C CB  . ASP B 298 ? 0.2148 0.3403 0.4206 -0.0195 -0.0529 -0.0105 298 ASP B CB  
4469 C CG  . ASP B 298 ? 0.4078 0.5534 0.6253 -0.0340 -0.0680 -0.0070 298 ASP B CG  
4470 O OD1 . ASP B 298 ? 0.3420 0.4798 0.5408 -0.0496 -0.0700 -0.0141 298 ASP B OD1 
4471 O OD2 . ASP B 298 ? 0.3331 0.5018 0.5793 -0.0299 -0.0782 0.0027  298 ASP B OD2 
4472 N N   . ASP B 299 ? 0.2086 0.2798 0.3656 -0.0045 -0.0323 -0.0222 299 ASP B N   
4473 C CA  . ASP B 299 ? 0.2064 0.2605 0.3531 0.0046  -0.0215 -0.0265 299 ASP B CA  
4474 C C   . ASP B 299 ? 0.2639 0.3031 0.3927 -0.0030 -0.0167 -0.0330 299 ASP B C   
4475 O O   . ASP B 299 ? 0.2016 0.2335 0.3268 0.0003  -0.0079 -0.0358 299 ASP B O   
4476 C CB  . ASP B 299 ? 0.2382 0.2785 0.3770 0.0144  -0.0252 -0.0245 299 ASP B CB  
4477 C CG  . ASP B 299 ? 0.3519 0.4024 0.5112 0.0267  -0.0260 -0.0185 299 ASP B CG  
4478 O OD1 . ASP B 299 ? 0.2664 0.3327 0.4457 0.0308  -0.0187 -0.0175 299 ASP B OD1 
4479 O OD2 . ASP B 299 ? 0.2982 0.3402 0.4555 0.0325  -0.0329 -0.0143 299 ASP B OD2 
4480 N N   . THR B 300 ? 0.2051 0.2395 0.3228 -0.0131 -0.0221 -0.0350 300 THR B N   
4481 C CA  . THR B 300 ? 0.2083 0.2294 0.3143 -0.0191 -0.0165 -0.0410 300 THR B CA  
4482 C C   . THR B 300 ? 0.2012 0.2274 0.3152 -0.0247 -0.0099 -0.0436 300 THR B C   
4483 O O   . THR B 300 ? 0.2108 0.2276 0.3228 -0.0229 -0.0028 -0.0455 300 THR B O   
4484 C CB  . THR B 300 ? 0.2107 0.2256 0.3033 -0.0289 -0.0204 -0.0434 300 THR B CB  
4485 O OG1 . THR B 300 ? 0.2189 0.2282 0.3042 -0.0246 -0.0262 -0.0392 300 THR B OG1 
4486 C CG2 . THR B 300 ? 0.2113 0.2131 0.2976 -0.0331 -0.0121 -0.0497 300 THR B CG2 
4487 N N   . GLN B 301 ? 0.2039 0.2448 0.3282 -0.0321 -0.0136 -0.0425 301 GLN B N   
4488 C CA  . GLN B 301 ? 0.2043 0.2500 0.3385 -0.0392 -0.0076 -0.0444 301 GLN B CA  
4489 C C   . GLN B 301 ? 0.2161 0.2636 0.3594 -0.0302 0.0018  -0.0408 301 GLN B C   
4490 O O   . GLN B 301 ? 0.2191 0.2585 0.3614 -0.0328 0.0098  -0.0419 301 GLN B O   
4491 C CB  . GLN B 301 ? 0.2167 0.2810 0.3639 -0.0492 -0.0157 -0.0429 301 GLN B CB  
4492 C CG  . GLN B 301 ? 0.3948 0.4650 0.5558 -0.0583 -0.0100 -0.0444 301 GLN B CG  
4493 C CD  . GLN B 301 ? 0.6831 0.7734 0.8593 -0.0699 -0.0207 -0.0429 301 GLN B CD  
4494 O OE1 . GLN B 301 ? 0.7039 0.8096 0.8881 -0.0670 -0.0319 -0.0372 301 GLN B OE1 
4495 N NE2 . GLN B 301 ? 0.7779 0.8673 0.9594 -0.0838 -0.0186 -0.0473 301 GLN B NE2 
4496 N N   . LYS B 302 ? 0.1984 0.2546 0.3491 -0.0196 0.0018  -0.0363 302 LYS B N   
4497 C CA  . LYS B 302 ? 0.2223 0.2792 0.3775 -0.0112 0.0129  -0.0337 302 LYS B CA  
4498 C C   . LYS B 302 ? 0.2078 0.2430 0.3418 -0.0065 0.0176  -0.0358 302 LYS B C   
4499 O O   . LYS B 302 ? 0.2243 0.2540 0.3546 -0.0068 0.0261  -0.0343 302 LYS B O   
4500 C CB  . LYS B 302 ? 0.2062 0.2741 0.3730 0.0004  0.0138  -0.0301 302 LYS B CB  
4501 C CG  . LYS B 302 ? 0.2663 0.3369 0.4381 0.0077  0.0286  -0.0282 302 LYS B CG  
4502 C CD  . LYS B 302 ? 0.3963 0.4741 0.5795 0.0211  0.0321  -0.0264 302 LYS B CD  
4503 C CE  . LYS B 302 ? 0.2810 0.3818 0.4927 0.0201  0.0216  -0.0215 302 LYS B CE  
4504 N NZ  . LYS B 302 ? 0.2974 0.4027 0.5230 0.0355  0.0248  -0.0191 302 LYS B NZ  
4505 N N   . ILE B 303 ? 0.2031 0.2260 0.3237 -0.0031 0.0110  -0.0383 303 ILE B N   
4506 C CA  . ILE B 303 ? 0.2077 0.2122 0.3114 0.0006  0.0121  -0.0397 303 ILE B CA  
4507 C C   . ILE B 303 ? 0.2301 0.2275 0.3332 -0.0072 0.0134  -0.0404 303 ILE B C   
4508 O O   . ILE B 303 ? 0.2586 0.2456 0.3540 -0.0053 0.0166  -0.0383 303 ILE B O   
4509 C CB  . ILE B 303 ? 0.2228 0.2174 0.3171 0.0046  0.0044  -0.0418 303 ILE B CB  
4510 C CG1 . ILE B 303 ? 0.2162 0.2129 0.3111 0.0140  0.0044  -0.0410 303 ILE B CG1 
4511 C CG2 . ILE B 303 ? 0.2429 0.2207 0.3237 0.0061  0.0026  -0.0428 303 ILE B CG2 
4512 C CD1 . ILE B 303 ? 0.2492 0.2366 0.3382 0.0166  -0.0038 -0.0420 303 ILE B CD1 
4513 N N   . TYR B 304 ? 0.2127 0.2144 0.3226 -0.0159 0.0111  -0.0433 304 TYR B N   
4514 C CA  . TYR B 304 ? 0.2037 0.1966 0.3152 -0.0227 0.0144  -0.0454 304 TYR B CA  
4515 C C   . TYR B 304 ? 0.2662 0.2595 0.3839 -0.0255 0.0219  -0.0420 304 TYR B C   
4516 O O   . TYR B 304 ? 0.2567 0.2377 0.3732 -0.0257 0.0253  -0.0401 304 TYR B O   
4517 C CB  . TYR B 304 ? 0.2166 0.2114 0.3299 -0.0324 0.0124  -0.0511 304 TYR B CB  
4518 C CG  . TYR B 304 ? 0.2213 0.2041 0.3370 -0.0387 0.0185  -0.0552 304 TYR B CG  
4519 C CD1 . TYR B 304 ? 0.2228 0.1935 0.3379 -0.0350 0.0204  -0.0562 304 TYR B CD1 
4520 C CD2 . TYR B 304 ? 0.3093 0.2927 0.4310 -0.0484 0.0223  -0.0581 304 TYR B CD2 
4521 C CE1 . TYR B 304 ? 0.3148 0.2738 0.4363 -0.0388 0.0274  -0.0597 304 TYR B CE1 
4522 C CE2 . TYR B 304 ? 0.4288 0.3976 0.5532 -0.0535 0.0291  -0.0627 304 TYR B CE2 
4523 C CZ  . TYR B 304 ? 0.4301 0.3866 0.5550 -0.0477 0.0323  -0.0634 304 TYR B CZ  
4524 O OH  . TYR B 304 ? 0.5037 0.4451 0.6354 -0.0509 0.0405  -0.0677 304 TYR B OH  
4525 N N   . ALA B 305 ? 0.2714 0.2791 0.3982 -0.0276 0.0244  -0.0398 305 ALA B N   
4526 C CA  . ALA B 305 ? 0.2806 0.2897 0.4145 -0.0310 0.0331  -0.0354 305 ALA B CA  
4527 C C   . ALA B 305 ? 0.2629 0.2614 0.3834 -0.0223 0.0384  -0.0295 305 ALA B C   
4528 O O   . ALA B 305 ? 0.3214 0.3099 0.4395 -0.0248 0.0440  -0.0248 305 ALA B O   
4529 C CB  . ALA B 305 ? 0.3050 0.3354 0.4564 -0.0350 0.0350  -0.0336 305 ALA B CB  
4530 N N   . TYR B 306 ? 0.2665 0.2649 0.3761 -0.0128 0.0359  -0.0298 306 TYR B N   
4531 C CA  . TYR B 306 ? 0.2564 0.2422 0.3463 -0.0055 0.0393  -0.0259 306 TYR B CA  
4532 C C   . TYR B 306 ? 0.3471 0.3155 0.4264 -0.0055 0.0327  -0.0242 306 TYR B C   
4533 O O   . TYR B 306 ? 0.3432 0.3003 0.4104 -0.0048 0.0353  -0.0178 306 TYR B O   
4534 C CB  . TYR B 306 ? 0.2564 0.2427 0.3361 0.0038  0.0374  -0.0291 306 TYR B CB  
4535 C CG  . TYR B 306 ? 0.3431 0.3114 0.3956 0.0099  0.0370  -0.0279 306 TYR B CG  
4536 C CD1 . TYR B 306 ? 0.4490 0.4129 0.4864 0.0126  0.0483  -0.0243 306 TYR B CD1 
4537 C CD2 . TYR B 306 ? 0.4221 0.3778 0.4629 0.0119  0.0252  -0.0304 306 TYR B CD2 
4538 C CE1 . TYR B 306 ? 0.4948 0.4399 0.5008 0.0167  0.0467  -0.0239 306 TYR B CE1 
4539 C CE2 . TYR B 306 ? 0.4558 0.3948 0.4702 0.0156  0.0218  -0.0297 306 TYR B CE2 
4540 C CZ  . TYR B 306 ? 0.4657 0.3983 0.4601 0.0179  0.0319  -0.0267 306 TYR B CZ  
4541 O OH  . TYR B 306 ? 0.5598 0.4734 0.5218 0.0201  0.0273  -0.0265 306 TYR B OH  
4542 N N   . LEU B 307 ? 0.2566 0.2234 0.3414 -0.0065 0.0244  -0.0288 307 LEU B N   
4543 C CA  . LEU B 307 ? 0.2812 0.2351 0.3634 -0.0055 0.0180  -0.0271 307 LEU B CA  
4544 C C   . LEU B 307 ? 0.3705 0.3181 0.4633 -0.0105 0.0224  -0.0233 307 LEU B C   
4545 O O   . LEU B 307 ? 0.3702 0.3065 0.4626 -0.0082 0.0185  -0.0180 307 LEU B O   
4546 C CB  . LEU B 307 ? 0.2287 0.1845 0.3181 -0.0060 0.0114  -0.0331 307 LEU B CB  
4547 C CG  . LEU B 307 ? 0.2601 0.2168 0.3391 -0.0009 0.0053  -0.0357 307 LEU B CG  
4548 C CD1 . LEU B 307 ? 0.2615 0.2201 0.3485 -0.0032 0.0007  -0.0402 307 LEU B CD1 
4549 C CD2 . LEU B 307 ? 0.2882 0.2331 0.3507 0.0041  -0.0005 -0.0322 307 LEU B CD2 
4550 N N   . SER B 308 ? 0.2619 0.2165 0.3659 -0.0175 0.0296  -0.0256 308 SER B N   
4551 C CA  . SER B 308 ? 0.3996 0.3458 0.5146 -0.0236 0.0350  -0.0236 308 SER B CA  
4552 C C   . SER B 308 ? 0.4604 0.4030 0.5702 -0.0247 0.0419  -0.0144 308 SER B C   
4553 O O   . SER B 308 ? 0.4505 0.3855 0.5694 -0.0309 0.0479  -0.0114 308 SER B O   
4554 C CB  . SER B 308 ? 0.4163 0.3696 0.5438 -0.0332 0.0382  -0.0323 308 SER B CB  
4555 O OG  . SER B 308 ? 0.4802 0.4359 0.6077 -0.0330 0.0333  -0.0402 308 SER B OG  
4556 N N   . ARG B 309 ? 0.5378 0.4835 0.6312 -0.0191 0.0423  -0.0102 309 ARG B N   
4557 C CA  . ARG B 309 ? 0.6641 0.6064 0.7473 -0.0199 0.0514  -0.0011 309 ARG B CA  
4558 C C   . ARG B 309 ? 0.7896 0.7444 0.8905 -0.0287 0.0620  -0.0016 309 ARG B C   
4559 O O   . ARG B 309 ? 0.8507 0.8237 0.9604 -0.0292 0.0641  -0.0067 309 ARG B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  HIS 50  50  50  HIS HIS A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  HIS 68  68  68  HIS HIS A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  HIS 94  94  94  HIS HIS A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 GLN 159 159 159 GLN GLN A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 CYS 163 163 163 CYS CYS A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 ASN 180 180 180 ASN ASN A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 GLU 182 182 182 GLU GLU A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 GLN 188 188 188 GLN GLN A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 GLU 190 190 190 GLU GLU A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 GLN 201 201 201 GLN GLN A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 VAL 221 221 221 VAL VAL A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 PRO 227 227 227 PRO PRO A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 CYS 238 238 238 CYS CYS A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 GLN 240 240 240 GLN GLN A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 PRO 245 245 245 PRO PRO A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 MET 258 258 258 MET MET A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 ALA 261 261 261 ALA ALA A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 ASN 269 269 269 ASN ASN A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 MET 275 275 275 MET MET A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 ALA 282 282 282 ALA ALA A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 GLN 290 290 290 GLN GLN A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 CYS 295 295 295 CYS CYS A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 ASP 298 298 298 ASP ASP A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 GLN 301 301 301 GLN GLN A . n 
A 1 302 LYS 302 302 302 LYS LYS A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 TYR 304 304 304 TYR TYR A . n 
A 1 305 ALA 305 305 305 ALA ALA A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   VAL 2   2   2   VAL VAL B . n 
B 1 3   ARG 3   3   3   ARG ARG B . n 
B 1 4   ILE 4   4   4   ILE ILE B . n 
B 1 5   TYR 5   5   5   TYR TYR B . n 
B 1 6   THR 6   6   6   THR THR B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   THR 8   8   8   THR THR B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  PRO 11  11  11  PRO PRO B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  THR 19  19  19  THR THR B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  ILE 22  22  22  ILE ILE B . n 
B 1 23  TYR 23  23  23  TYR TYR B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  ARG 29  29  29  ARG ARG B . n 
B 1 30  CYS 30  30  30  CYS CYS B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  PRO 33  33  33  PRO PRO B . n 
B 1 34  VAL 34  34  34  VAL VAL B . n 
B 1 35  PHE 35  35  35  PHE PHE B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  PRO 37  37  37  PRO PRO B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  GLY 39  39  39  GLY GLY B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  ASN 43  43  43  ASN ASN B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ILE 48  48  48  ILE ILE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  HIS 50  50  50  HIS HIS B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  GLY 53  53  53  GLY GLY B . n 
B 1 54  SER 54  54  54  SER SER B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  ALA 57  57  57  ALA ALA B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  PHE 59  59  59  PHE PHE B . n 
B 1 60  PRO 60  60  60  PRO PRO B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  THR 65  65  65  THR THR B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  HIS 68  68  68  HIS HIS B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  ALA 74  74  74  ALA ALA B . n 
B 1 75  ASP 75  75  75  ASP ASP B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  ASN 77  77  77  ASN ASN B . n 
B 1 78  VAL 78  78  78  VAL VAL B . n 
B 1 79  PRO 79  79  79  PRO PRO B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  TRP 88  88  88  TRP TRP B . n 
B 1 89  THR 89  89  89  THR THR B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLN 91  91  91  GLN GLN B . n 
B 1 92  ASN 92  92  92  ASN ASN B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  HIS 94  94  94  HIS HIS B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  HIS 96  96  96  HIS HIS B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 GLY 101 101 101 GLY GLY B . n 
B 1 102 GLU 102 102 102 GLU GLU B . n 
B 1 103 GLN 103 103 103 GLN GLN B . n 
B 1 104 TYR 104 104 104 TYR TYR B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 MET 108 108 108 MET MET B . n 
B 1 109 PRO 109 109 109 PRO PRO B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 PHE 118 118 118 PHE PHE B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 GLN 120 120 120 GLN GLN B . n 
B 1 121 LEU 121 121 121 LEU LEU B . n 
B 1 122 GLU 122 122 122 GLU GLU B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 GLN 124 124 124 GLN GLN B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 SER 130 130 130 SER SER B . n 
B 1 131 GLY 131 131 131 GLY GLY B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 SER 139 139 139 SER SER B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 PRO 141 141 141 PRO PRO B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 LYS 145 145 145 LYS LYS B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 ALA 156 156 156 ALA ALA B . n 
B 1 157 GLN 157 157 157 GLN GLN B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 GLN 159 159 159 GLN GLN B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 ILE 161 161 161 ILE ILE B . n 
B 1 162 ARG 162 162 162 ARG ARG B . n 
B 1 163 CYS 163 163 163 CYS CYS B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 SER 168 168 168 SER SER B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 SER 173 173 173 SER SER B . n 
B 1 174 ALA 174 174 174 ALA ALA B . n 
B 1 175 ALA 175 175 175 ALA ALA B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 ILE 178 178 178 ILE ILE B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 ASN 180 180 180 ASN ASN B . n 
B 1 181 ILE 181 181 181 ILE ILE B . n 
B 1 182 GLU 182 182 182 GLU GLU B . n 
B 1 183 LEU 183 183 183 LEU LEU B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 LYS 185 185 185 LYS LYS B . n 
B 1 186 PRO 186 186 186 PRO PRO B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 GLN 188 188 188 GLN GLN B . n 
B 1 189 LYS 189 189 189 LYS LYS B . n 
B 1 190 GLU 190 190 190 GLU GLU B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 ASN 196 196 196 ASN ASN B . n 
B 1 197 ARG 197 197 197 ARG ARG B . n 
B 1 198 GLU 198 198 198 GLU GLU B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 THR 200 200 200 THR THR B . n 
B 1 201 GLN 201 201 201 GLN GLN B . n 
B 1 202 PRO 202 202 202 PRO PRO B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 GLN 210 210 210 GLN GLN B . n 
B 1 211 GLU 211 211 211 GLU GLU B . n 
B 1 212 ILE 212 212 212 ILE ILE B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ASN 214 214 214 ASN ASN B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 LYS 217 217 217 LYS LYS B . n 
B 1 218 ALA 218 218 218 ALA ALA B . n 
B 1 219 LYS 219 219 219 LYS LYS B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 VAL 221 221 221 VAL VAL B . n 
B 1 222 VAL 222 222 222 VAL VAL B . n 
B 1 223 VAL 223 223 223 VAL VAL B . n 
B 1 224 SER 224 224 224 SER SER B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 GLY 226 226 226 GLY GLY B . n 
B 1 227 PRO 227 227 227 PRO PRO B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 GLY 229 229 229 GLY GLY B . n 
B 1 230 ALA 230 230 230 ALA ALA B . n 
B 1 231 LEU 231 231 231 LEU LEU B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 GLU 236 236 236 GLU GLU B . n 
B 1 237 ASN 237 237 237 ASN ASN B . n 
B 1 238 CYS 238 238 238 CYS CYS B . n 
B 1 239 ILE 239 239 239 ILE ILE B . n 
B 1 240 GLN 240 240 240 GLN GLN B . n 
B 1 241 VAL 241 241 241 VAL VAL B . n 
B 1 242 VAL 242 242 242 VAL VAL B . n 
B 1 243 PRO 243 243 243 PRO PRO B . n 
B 1 244 PRO 244 244 244 PRO PRO B . n 
B 1 245 PRO 245 245 245 PRO PRO B . n 
B 1 246 VAL 246 246 246 VAL VAL B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 GLN 249 249 249 GLN GLN B . n 
B 1 250 SER 250 250 250 SER SER B . n 
B 1 251 THR 251 251 251 THR THR B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 GLY 253 253 253 GLY GLY B . n 
B 1 254 ALA 254 254 254 ALA ALA B . n 
B 1 255 GLY 255 255 255 GLY GLY B . n 
B 1 256 ASP 256 256 256 ASP ASP B . n 
B 1 257 SER 257 257 257 SER SER B . n 
B 1 258 MET 258 258 258 MET MET B . n 
B 1 259 VAL 259 259 259 VAL VAL B . n 
B 1 260 GLY 260 260 260 GLY GLY B . n 
B 1 261 ALA 261 261 261 ALA ALA B . n 
B 1 262 MET 262 262 262 MET MET B . n 
B 1 263 THR 263 263 263 THR THR B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 LYS 265 265 265 LYS LYS B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 ALA 267 267 267 ALA ALA B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 ASN 269 269 269 ASN ASN B . n 
B 1 270 ALA 270 270 270 ALA ALA B . n 
B 1 271 SER 271 271 271 SER SER B . n 
B 1 272 LEU 272 272 272 LEU LEU B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 GLU 274 274 274 GLU GLU B . n 
B 1 275 MET 275 275 275 MET MET B . n 
B 1 276 VAL 276 276 276 VAL VAL B . n 
B 1 277 ARG 277 277 277 ARG ARG B . n 
B 1 278 PHE 278 278 278 PHE PHE B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 VAL 280 280 280 VAL VAL B . n 
B 1 281 ALA 281 281 281 ALA ALA B . n 
B 1 282 ALA 282 282 282 ALA ALA B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 SER 284 284 284 SER SER B . n 
B 1 285 ALA 285 285 285 ALA ALA B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 THR 287 287 287 THR THR B . n 
B 1 288 LEU 288 288 288 LEU LEU B . n 
B 1 289 ASN 289 289 289 ASN ASN B . n 
B 1 290 GLN 290 290 290 GLN GLN B . n 
B 1 291 GLY 291 291 291 GLY GLY B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 ARG 293 293 293 ARG ARG B . n 
B 1 294 LEU 294 294 294 LEU LEU B . n 
B 1 295 CYS 295 295 295 CYS CYS B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 HIS 297 297 297 HIS HIS B . n 
B 1 298 ASP 298 298 298 ASP ASP B . n 
B 1 299 ASP 299 299 299 ASP ASP B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 GLN 301 301 301 GLN GLN B . n 
B 1 302 LYS 302 302 302 LYS LYS B . n 
B 1 303 ILE 303 303 303 ILE ILE B . n 
B 1 304 TYR 304 304 304 TYR TYR B . n 
B 1 305 ALA 305 305 305 ALA ALA B . n 
B 1 306 TYR 306 306 306 TYR TYR B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 SER 308 308 308 SER SER B . n 
B 1 309 ARG 309 309 309 ARG ARG B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    tetrameric 4 
2 software_defined_assembly PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D,E,F,G,H,I,J,K,L,M,N 
2 1   A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 7120  ? 
2 MORE         -77   ? 
2 'SSA (A^2)'  24710 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 368 ? M HOH . 
2 1 B HOH 504 ? N HOH . 
3 1 B HOH 640 ? N HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O2B ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? M HOH .   ? A HOH 339 ? 1_555 92.0  ? 
2   O2B ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O1G ? K ATP .   ? B ATP 313 ? 1_555 95.8  ? 
3   O   ? M HOH .   ? A HOH 339 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O1G ? K ATP .   ? B ATP 313 ? 1_555 97.2  ? 
4   O2B ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 342 ? 1_555 176.5 ? 
5   O   ? M HOH .   ? A HOH 339 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 342 ? 1_555 86.6  ? 
6   O1G ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 342 ? 1_555 87.5  ? 
7   O2B ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 310 ? 1_555 84.6  ? 
8   O   ? M HOH .   ? A HOH 339 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 310 ? 1_555 86.1  ? 
9   O1G ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 310 ? 1_555 176.6 ? 
10  O   ? N HOH .   ? B HOH 342 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 310 ? 1_555 92.1  ? 
11  O2B ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 318 ? 1_555 98.1  ? 
12  O   ? M HOH .   ? A HOH 339 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 318 ? 1_555 168.2 ? 
13  O1G ? K ATP .   ? B ATP 313 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 318 ? 1_555 87.8  ? 
14  O   ? N HOH .   ? B HOH 342 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 318 ? 1_555 82.9  ? 
15  O   ? N HOH .   ? B HOH 310 ? 1_555 MG ? J MG . ? B MG 311 ? 1_555 O   ? N HOH .   ? B HOH 318 ? 1_555 88.9  ? 
16  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O1B B H ATP .   ? A ATP 315 ? 1_555 84.4  ? 
17  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O1G A H ATP .   ? A ATP 315 ? 1_555 1.8   ? 
18  O1B B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O1G A H ATP .   ? A ATP 315 ? 1_555 85.3  ? 
19  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O1B ? K ATP .   ? B ATP 313 ? 1_555 92.0  ? 
20  O1B B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O1B ? K ATP .   ? B ATP 313 ? 1_555 175.1 ? 
21  O1G A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O1B ? K ATP .   ? B ATP 313 ? 1_555 91.3  ? 
22  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O2B A H ATP .   ? A ATP 315 ? 1_555 91.4  ? 
23  O1B B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O2B A H ATP .   ? A ATP 315 ? 1_555 7.3   ? 
24  O1G A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O2B A H ATP .   ? A ATP 315 ? 1_555 92.3  ? 
25  O1B ? K ATP .   ? B ATP 313 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O2B A H ATP .   ? A ATP 315 ? 1_555 173.5 ? 
26  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O3G ? K ATP .   ? B ATP 313 ? 1_555 94.1  ? 
27  O1B B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O3G ? K ATP .   ? B ATP 313 ? 1_555 89.5  ? 
28  O1G A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O3G ? K ATP .   ? B ATP 313 ? 1_555 92.5  ? 
29  O1B ? K ATP .   ? B ATP 313 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O3G ? K ATP .   ? B ATP 313 ? 1_555 94.1  ? 
30  O2B A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O3G ? K ATP .   ? B ATP 313 ? 1_555 91.2  ? 
31  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? N HOH .   ? B HOH 669 ? 1_555 176.9 ? 
32  O1B B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? N HOH .   ? B HOH 669 ? 1_555 97.8  ? 
33  O1G A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? N HOH .   ? B HOH 669 ? 1_555 176.9 ? 
34  O1B ? K ATP .   ? B ATP 313 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? N HOH .   ? B HOH 669 ? 1_555 85.6  ? 
35  O2B A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? N HOH .   ? B HOH 669 ? 1_555 90.8  ? 
36  O3G ? K ATP .   ? B ATP 313 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? N HOH .   ? B HOH 669 ? 1_555 88.2  ? 
37  O3G B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 91.3  ? 
38  O1B B H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 92.4  ? 
39  O1G A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 92.9  ? 
40  O1B ? K ATP .   ? B ATP 313 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 84.3  ? 
41  O2B A H ATP .   ? A ATP 315 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 90.1  ? 
42  O3G ? K ATP .   ? B ATP 313 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 174.4 ? 
43  O   ? N HOH .   ? B HOH 669 ? 1_555 MG ? G MG . ? A MG 312 ? 1_555 O   ? M HOH .   ? A HOH 536 ? 1_555 86.4  ? 
44  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1B ? E ATP .   ? A ATP 313 ? 1_555 93.4  ? 
45  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O3G ? E ATP .   ? A ATP 313 ? 1_555 96.1  ? 
46  O1B ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O3G ? E ATP .   ? A ATP 313 ? 1_555 98.0  ? 
47  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1G A I ATP .   ? B ATP 312 ? 1_555 2.2   ? 
48  O1B ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1G A I ATP .   ? B ATP 312 ? 1_555 91.2  ? 
49  O3G ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1G A I ATP .   ? B ATP 312 ? 1_555 96.1  ? 
50  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1B B I ATP .   ? B ATP 312 ? 1_555 85.2  ? 
51  O1B ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1B B I ATP .   ? B ATP 312 ? 1_555 175.1 ? 
52  O3G ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1B B I ATP .   ? B ATP 312 ? 1_555 86.8  ? 
53  O1G A I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O1B B I ATP .   ? B ATP 312 ? 1_555 87.4  ? 
54  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? M HOH .   ? A HOH 686 ? 1_555 176.0 ? 
55  O1B ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? M HOH .   ? A HOH 686 ? 1_555 89.2  ? 
56  O3G ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? M HOH .   ? A HOH 686 ? 1_555 86.5  ? 
57  O1G A I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? M HOH .   ? A HOH 686 ? 1_555 177.4 ? 
58  O1B B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? M HOH .   ? A HOH 686 ? 1_555 92.0  ? 
59  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O2B A I ATP .   ? B ATP 312 ? 1_555 87.8  ? 
60  O1B ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O2B A I ATP .   ? B ATP 312 ? 1_555 177.4 ? 
61  O3G ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O2B A I ATP .   ? B ATP 312 ? 1_555 84.2  ? 
62  O1G A I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O2B A I ATP .   ? B ATP 312 ? 1_555 90.0  ? 
63  O1B B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O2B A I ATP .   ? B ATP 312 ? 1_555 3.5   ? 
64  O   ? M HOH .   ? A HOH 686 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O2B A I ATP .   ? B ATP 312 ? 1_555 89.5  ? 
65  O3G B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 93.6  ? 
66  O1B ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 85.0  ? 
67  O3G ? E ATP .   ? A ATP 313 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 169.6 ? 
68  O1G A I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 93.8  ? 
69  O1B B I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 90.4  ? 
70  O   ? M HOH .   ? A HOH 686 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 83.6  ? 
71  O2B A I ATP .   ? B ATP 312 ? 1_555 MG ? D MG . ? A MG 311 ? 1_555 O   ? N HOH .   ? B HOH 531 ? 1_555 92.6  ? 
72  O2B ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O1G ? E ATP .   ? A ATP 313 ? 1_555 93.0  ? 
73  O2B ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 532 ? 1_555 177.4 ? 
74  O1G ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 532 ? 1_555 89.4  ? 
75  O2B ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 533 ? 1_555 85.0  ? 
76  O1G ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 533 ? 1_555 175.9 ? 
77  O   ? M HOH .   ? A HOH 532 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 533 ? 1_555 92.7  ? 
78  O2B ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 535 ? 1_555 96.8  ? 
79  O1G ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 535 ? 1_555 87.9  ? 
80  O   ? M HOH .   ? A HOH 532 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 535 ? 1_555 84.3  ? 
81  O   ? M HOH .   ? A HOH 533 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? M HOH .   ? A HOH 535 ? 1_555 88.8  ? 
82  O2B ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? N HOH .   ? B HOH 534 ? 1_555 92.8  ? 
83  O1G ? E ATP .   ? A ATP 313 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? N HOH .   ? B HOH 534 ? 1_555 94.4  ? 
84  O   ? M HOH .   ? A HOH 532 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? N HOH .   ? B HOH 534 ? 1_555 86.0  ? 
85  O   ? M HOH .   ? A HOH 533 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? N HOH .   ? B HOH 534 ? 1_555 89.3  ? 
86  O   ? M HOH .   ? A HOH 535 ? 1_555 MG ? C MG . ? A MG 310 ? 1_555 O   ? N HOH .   ? B HOH 534 ? 1_555 170.0 ? 
87  O   ? A ASN 289 ? A ASN 289 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A GLY 291 ? A GLY 291 ? 1_555 94.0  ? 
88  O   ? A ASN 289 ? A ASN 289 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A VAL 252 ? A VAL 252 ? 1_555 167.5 ? 
89  O   ? A GLY 291 ? A GLY 291 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A VAL 252 ? A VAL 252 ? 1_555 89.2  ? 
90  O   ? A ASN 289 ? A ASN 289 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ARG 293 ? A ARG 293 ? 1_555 108.2 ? 
91  O   ? A GLY 291 ? A GLY 291 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ARG 293 ? A ARG 293 ? 1_555 102.1 ? 
92  O   ? A VAL 252 ? A VAL 252 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ARG 293 ? A ARG 293 ? 1_555 82.9  ? 
93  O   ? A ASN 289 ? A ASN 289 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ALA 286 ? A ALA 286 ? 1_555 77.9  ? 
94  O   ? A GLY 291 ? A GLY 291 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ALA 286 ? A ALA 286 ? 1_555 171.6 ? 
95  O   ? A VAL 252 ? A VAL 252 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ALA 286 ? A ALA 286 ? 1_555 99.1  ? 
96  O   ? A ARG 293 ? A ARG 293 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A ALA 286 ? A ALA 286 ? 1_555 78.8  ? 
97  O   ? A ASN 289 ? A ASN 289 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A SER 250 ? A SER 250 ? 1_555 80.3  ? 
98  O   ? A GLY 291 ? A GLY 291 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A SER 250 ? A SER 250 ? 1_555 105.0 ? 
99  O   ? A VAL 252 ? A VAL 252 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A SER 250 ? A SER 250 ? 1_555 87.1  ? 
100 O   ? A ARG 293 ? A ARG 293 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A SER 250 ? A SER 250 ? 1_555 150.9 ? 
101 O   ? A ALA 286 ? A ALA 286 ? 1_555 K  ? F K  . ? A K  314 ? 1_555 O   ? A SER 250 ? A SER 250 ? 1_555 75.9  ? 
102 O   ? B ASN 289 ? B ASN 289 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B GLY 291 ? B GLY 291 ? 1_555 87.7  ? 
103 O   ? B ASN 289 ? B ASN 289 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B ALA 286 ? B ALA 286 ? 1_555 80.8  ? 
104 O   ? B GLY 291 ? B GLY 291 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B ALA 286 ? B ALA 286 ? 1_555 168.6 ? 
105 O   ? B ASN 289 ? B ASN 289 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B ARG 293 ? B ARG 293 ? 1_555 107.5 ? 
106 O   ? B GLY 291 ? B GLY 291 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B ARG 293 ? B ARG 293 ? 1_555 103.0 ? 
107 O   ? B ALA 286 ? B ALA 286 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B ARG 293 ? B ARG 293 ? 1_555 80.3  ? 
108 O   ? B ASN 289 ? B ASN 289 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B SER 250 ? B SER 250 ? 1_555 80.8  ? 
109 O   ? B GLY 291 ? B GLY 291 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B SER 250 ? B SER 250 ? 1_555 104.7 ? 
110 O   ? B ALA 286 ? B ALA 286 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B SER 250 ? B SER 250 ? 1_555 74.0  ? 
111 O   ? B ARG 293 ? B ARG 293 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B SER 250 ? B SER 250 ? 1_555 151.4 ? 
112 O   ? B ASN 289 ? B ASN 289 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B VAL 252 ? B VAL 252 ? 1_555 167.6 ? 
113 O   ? B GLY 291 ? B GLY 291 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B VAL 252 ? B VAL 252 ? 1_555 89.9  ? 
114 O   ? B ALA 286 ? B ALA 286 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B VAL 252 ? B VAL 252 ? 1_555 101.4 ? 
115 O   ? B ARG 293 ? B ARG 293 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B VAL 252 ? B VAL 252 ? 1_555 84.9  ? 
116 O   ? B SER 250 ? B SER 250 ? 1_555 K  ? L K  . ? B K  314 ? 1_555 O   ? B VAL 252 ? B VAL 252 ? 1_555 88.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-11-14 
2 'Structure model' 1 1 2013-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 XSCALE      .         ?               package 'Wolfgang Kabsch' ?                           'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 
2 PHASER      .         ?               program 'Randy J. Read'   cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/                                 ?          ? 
3 DM          .         ?               program 'Kevin Cowtan'    kowtan@ysbl.york.ac.uk      phasing           
http://www.ccp4.ac.uk/dist/html/dm.html                                     Fortran_77 ? 
4 PHENIX      1.7.2_869 ?               package 'Paul D. Adams'   PDAdams@lbl.gov             refinement        
http://www.phenix-online.org/                                               C++        ? 
5 PDB_EXTRACT 3.10      'June 10, 2010' package PDB               deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 
6 DNA         .         ?               ?       ?                 ?                           'data collection' ? ?          ? 
7 XDS         .         ?               ?       ?                 ?                           'data reduction'  ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 371 ? ? O A HOH 631 ? ? 2.05 
2 1 O A HOH 425 ? ? O A HOH 631 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 25 ? ? 77.25 -55.42 
2 1 GLU B 25 ? ? 76.64 -52.36 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 290 ? CG  ? A GLN 290 CG  
2  1 Y 1 A GLN 290 ? CD  ? A GLN 290 CD  
3  1 Y 1 A GLN 290 ? OE1 ? A GLN 290 OE1 
4  1 Y 1 A GLN 290 ? NE2 ? A GLN 290 NE2 
5  1 Y 1 B ARG 309 ? CG  ? B ARG 309 CG  
6  1 Y 1 B ARG 309 ? CD  ? B ARG 309 CD  
7  1 Y 1 B ARG 309 ? NE  ? B ARG 309 NE  
8  1 Y 1 B ARG 309 ? CZ  ? B ARG 309 CZ  
9  1 Y 1 B ARG 309 ? NH1 ? B ARG 309 NH1 
10 1 Y 1 B ARG 309 ? NH2 ? B ARG 309 NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'             MG  
3 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
4 'POTASSIUM ION'             K   
5 water                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1   310 310 MG  MG  A . 
D 2 MG  1   311 311 MG  MG  A . 
E 3 ATP 1   313 313 ATP ATP A . 
F 4 K   1   314 314 K   K   A . 
G 2 MG  1   312 310 MG  MG  A . 
H 3 ATP 1   315 312 ATP ATP A . 
I 3 ATP 1   312 312 ATP ATP B . 
J 2 MG  1   311 311 MG  MG  B . 
K 3 ATP 1   313 313 ATP ATP B . 
L 4 K   1   314 314 K   K   B . 
M 5 HOH 1   316 22  HOH HOH A . 
M 5 HOH 2   317 317 HOH HOH A . 
M 5 HOH 3   318 318 HOH HOH A . 
M 5 HOH 4   319 33  HOH HOH A . 
M 5 HOH 5   320 34  HOH HOH A . 
M 5 HOH 6   321 321 HOH HOH A . 
M 5 HOH 7   322 38  HOH HOH A . 
M 5 HOH 8   323 40  HOH HOH A . 
M 5 HOH 9   324 43  HOH HOH A . 
M 5 HOH 10  325 325 HOH HOH A . 
M 5 HOH 11  326 47  HOH HOH A . 
M 5 HOH 12  327 49  HOH HOH A . 
M 5 HOH 13  328 328 HOH HOH A . 
M 5 HOH 14  329 329 HOH HOH A . 
M 5 HOH 15  330 330 HOH HOH A . 
M 5 HOH 16  331 50  HOH HOH A . 
M 5 HOH 17  332 51  HOH HOH A . 
M 5 HOH 18  333 63  HOH HOH A . 
M 5 HOH 19  334 64  HOH HOH A . 
M 5 HOH 20  335 70  HOH HOH A . 
M 5 HOH 21  336 71  HOH HOH A . 
M 5 HOH 22  337 72  HOH HOH A . 
M 5 HOH 23  338 74  HOH HOH A . 
M 5 HOH 24  339 75  HOH HOH A . 
M 5 HOH 25  340 340 HOH HOH A . 
M 5 HOH 26  341 341 HOH HOH A . 
M 5 HOH 27  342 342 HOH HOH A . 
M 5 HOH 28  343 76  HOH HOH A . 
M 5 HOH 29  344 344 HOH HOH A . 
M 5 HOH 30  345 345 HOH HOH A . 
M 5 HOH 31  346 80  HOH HOH A . 
M 5 HOH 32  347 83  HOH HOH A . 
M 5 HOH 33  348 348 HOH HOH A . 
M 5 HOH 34  349 349 HOH HOH A . 
M 5 HOH 35  350 350 HOH HOH A . 
M 5 HOH 36  351 84  HOH HOH A . 
M 5 HOH 37  352 352 HOH HOH A . 
M 5 HOH 38  353 85  HOH HOH A . 
M 5 HOH 39  354 354 HOH HOH A . 
M 5 HOH 40  355 86  HOH HOH A . 
M 5 HOH 41  356 356 HOH HOH A . 
M 5 HOH 42  357 357 HOH HOH A . 
M 5 HOH 43  358 358 HOH HOH A . 
M 5 HOH 44  359 90  HOH HOH A . 
M 5 HOH 45  360 91  HOH HOH A . 
M 5 HOH 46  361 361 HOH HOH A . 
M 5 HOH 47  362 362 HOH HOH A . 
M 5 HOH 48  363 363 HOH HOH A . 
M 5 HOH 49  364 95  HOH HOH A . 
M 5 HOH 50  365 365 HOH HOH A . 
M 5 HOH 51  366 366 HOH HOH A . 
M 5 HOH 52  367 97  HOH HOH A . 
M 5 HOH 53  368 368 HOH HOH A . 
M 5 HOH 54  369 100 HOH HOH A . 
M 5 HOH 55  370 103 HOH HOH A . 
M 5 HOH 56  371 110 HOH HOH A . 
M 5 HOH 57  372 372 HOH HOH A . 
M 5 HOH 58  373 111 HOH HOH A . 
M 5 HOH 59  374 113 HOH HOH A . 
M 5 HOH 60  375 375 HOH HOH A . 
M 5 HOH 61  376 116 HOH HOH A . 
M 5 HOH 62  377 120 HOH HOH A . 
M 5 HOH 63  378 123 HOH HOH A . 
M 5 HOH 64  379 126 HOH HOH A . 
M 5 HOH 65  380 380 HOH HOH A . 
M 5 HOH 66  381 127 HOH HOH A . 
M 5 HOH 67  382 129 HOH HOH A . 
M 5 HOH 68  383 131 HOH HOH A . 
M 5 HOH 69  384 133 HOH HOH A . 
M 5 HOH 70  385 385 HOH HOH A . 
M 5 HOH 71  386 135 HOH HOH A . 
M 5 HOH 72  387 387 HOH HOH A . 
M 5 HOH 73  388 137 HOH HOH A . 
M 5 HOH 74  389 138 HOH HOH A . 
M 5 HOH 75  390 390 HOH HOH A . 
M 5 HOH 76  391 139 HOH HOH A . 
M 5 HOH 77  392 392 HOH HOH A . 
M 5 HOH 78  393 393 HOH HOH A . 
M 5 HOH 79  394 141 HOH HOH A . 
M 5 HOH 80  395 142 HOH HOH A . 
M 5 HOH 81  396 144 HOH HOH A . 
M 5 HOH 82  397 397 HOH HOH A . 
M 5 HOH 83  398 398 HOH HOH A . 
M 5 HOH 84  399 145 HOH HOH A . 
M 5 HOH 85  400 150 HOH HOH A . 
M 5 HOH 86  401 401 HOH HOH A . 
M 5 HOH 87  402 154 HOH HOH A . 
M 5 HOH 88  403 156 HOH HOH A . 
M 5 HOH 89  404 404 HOH HOH A . 
M 5 HOH 90  405 405 HOH HOH A . 
M 5 HOH 91  406 159 HOH HOH A . 
M 5 HOH 92  407 165 HOH HOH A . 
M 5 HOH 93  408 408 HOH HOH A . 
M 5 HOH 94  409 167 HOH HOH A . 
M 5 HOH 95  410 410 HOH HOH A . 
M 5 HOH 96  411 168 HOH HOH A . 
M 5 HOH 97  412 412 HOH HOH A . 
M 5 HOH 98  413 171 HOH HOH A . 
M 5 HOH 99  414 174 HOH HOH A . 
M 5 HOH 100 415 415 HOH HOH A . 
M 5 HOH 101 416 416 HOH HOH A . 
M 5 HOH 102 417 175 HOH HOH A . 
M 5 HOH 103 418 178 HOH HOH A . 
M 5 HOH 104 419 180 HOH HOH A . 
M 5 HOH 105 420 185 HOH HOH A . 
M 5 HOH 106 421 186 HOH HOH A . 
M 5 HOH 107 422 187 HOH HOH A . 
M 5 HOH 108 423 188 HOH HOH A . 
M 5 HOH 109 424 190 HOH HOH A . 
M 5 HOH 110 425 193 HOH HOH A . 
M 5 HOH 111 426 197 HOH HOH A . 
M 5 HOH 112 427 427 HOH HOH A . 
M 5 HOH 113 428 198 HOH HOH A . 
M 5 HOH 114 429 429 HOH HOH A . 
M 5 HOH 115 430 199 HOH HOH A . 
M 5 HOH 116 431 201 HOH HOH A . 
M 5 HOH 117 432 202 HOH HOH A . 
M 5 HOH 118 433 433 HOH HOH A . 
M 5 HOH 119 434 434 HOH HOH A . 
M 5 HOH 120 435 204 HOH HOH A . 
M 5 HOH 121 436 436 HOH HOH A . 
M 5 HOH 122 437 206 HOH HOH A . 
M 5 HOH 123 438 438 HOH HOH A . 
M 5 HOH 124 439 215 HOH HOH A . 
M 5 HOH 125 440 217 HOH HOH A . 
M 5 HOH 126 441 441 HOH HOH A . 
M 5 HOH 127 442 218 HOH HOH A . 
M 5 HOH 128 443 219 HOH HOH A . 
M 5 HOH 129 444 220 HOH HOH A . 
M 5 HOH 130 445 445 HOH HOH A . 
M 5 HOH 131 446 446 HOH HOH A . 
M 5 HOH 132 447 221 HOH HOH A . 
M 5 HOH 133 448 222 HOH HOH A . 
M 5 HOH 134 449 223 HOH HOH A . 
M 5 HOH 135 450 224 HOH HOH A . 
M 5 HOH 136 451 225 HOH HOH A . 
M 5 HOH 137 452 452 HOH HOH A . 
M 5 HOH 138 453 227 HOH HOH A . 
M 5 HOH 139 454 228 HOH HOH A . 
M 5 HOH 140 455 455 HOH HOH A . 
M 5 HOH 141 456 229 HOH HOH A . 
M 5 HOH 142 457 230 HOH HOH A . 
M 5 HOH 143 458 233 HOH HOH A . 
M 5 HOH 144 459 236 HOH HOH A . 
M 5 HOH 145 460 460 HOH HOH A . 
M 5 HOH 146 461 237 HOH HOH A . 
M 5 HOH 147 462 238 HOH HOH A . 
M 5 HOH 148 463 239 HOH HOH A . 
M 5 HOH 149 464 464 HOH HOH A . 
M 5 HOH 150 465 465 HOH HOH A . 
M 5 HOH 151 466 245 HOH HOH A . 
M 5 HOH 152 467 467 HOH HOH A . 
M 5 HOH 153 468 468 HOH HOH A . 
M 5 HOH 154 469 469 HOH HOH A . 
M 5 HOH 155 470 470 HOH HOH A . 
M 5 HOH 156 471 246 HOH HOH A . 
M 5 HOH 157 472 248 HOH HOH A . 
M 5 HOH 158 473 250 HOH HOH A . 
M 5 HOH 159 474 474 HOH HOH A . 
M 5 HOH 160 475 251 HOH HOH A . 
M 5 HOH 161 476 476 HOH HOH A . 
M 5 HOH 162 477 252 HOH HOH A . 
M 5 HOH 163 478 255 HOH HOH A . 
M 5 HOH 164 479 257 HOH HOH A . 
M 5 HOH 165 480 259 HOH HOH A . 
M 5 HOH 166 481 481 HOH HOH A . 
M 5 HOH 167 482 482 HOH HOH A . 
M 5 HOH 168 483 263 HOH HOH A . 
M 5 HOH 169 484 484 HOH HOH A . 
M 5 HOH 170 485 485 HOH HOH A . 
M 5 HOH 171 486 486 HOH HOH A . 
M 5 HOH 172 487 265 HOH HOH A . 
M 5 HOH 173 488 488 HOH HOH A . 
M 5 HOH 174 489 266 HOH HOH A . 
M 5 HOH 175 490 490 HOH HOH A . 
M 5 HOH 176 491 491 HOH HOH A . 
M 5 HOH 177 492 492 HOH HOH A . 
M 5 HOH 178 493 493 HOH HOH A . 
M 5 HOH 179 494 494 HOH HOH A . 
M 5 HOH 180 495 272 HOH HOH A . 
M 5 HOH 181 496 273 HOH HOH A . 
M 5 HOH 182 497 274 HOH HOH A . 
M 5 HOH 183 498 276 HOH HOH A . 
M 5 HOH 184 499 278 HOH HOH A . 
M 5 HOH 185 500 500 HOH HOH A . 
M 5 HOH 186 501 501 HOH HOH A . 
M 5 HOH 187 502 279 HOH HOH A . 
M 5 HOH 188 503 281 HOH HOH A . 
M 5 HOH 189 504 282 HOH HOH A . 
M 5 HOH 190 505 505 HOH HOH A . 
M 5 HOH 191 506 285 HOH HOH A . 
M 5 HOH 192 507 287 HOH HOH A . 
M 5 HOH 193 508 288 HOH HOH A . 
M 5 HOH 194 509 289 HOH HOH A . 
M 5 HOH 195 510 290 HOH HOH A . 
M 5 HOH 196 511 291 HOH HOH A . 
M 5 HOH 197 512 292 HOH HOH A . 
M 5 HOH 198 513 293 HOH HOH A . 
M 5 HOH 199 514 294 HOH HOH A . 
M 5 HOH 200 515 296 HOH HOH A . 
M 5 HOH 201 516 298 HOH HOH A . 
M 5 HOH 202 517 299 HOH HOH A . 
M 5 HOH 203 518 302 HOH HOH A . 
M 5 HOH 204 519 304 HOH HOH A . 
M 5 HOH 205 520 520 HOH HOH A . 
M 5 HOH 206 521 305 HOH HOH A . 
M 5 HOH 207 522 522 HOH HOH A . 
M 5 HOH 208 523 523 HOH HOH A . 
M 5 HOH 209 524 524 HOH HOH A . 
M 5 HOH 210 525 306 HOH HOH A . 
M 5 HOH 211 526 308 HOH HOH A . 
M 5 HOH 212 527 309 HOH HOH A . 
M 5 HOH 213 528 310 HOH HOH A . 
M 5 HOH 214 529 529 HOH HOH A . 
M 5 HOH 215 532 532 HOH HOH A . 
M 5 HOH 216 533 533 HOH HOH A . 
M 5 HOH 217 535 535 HOH HOH A . 
M 5 HOH 218 536 536 HOH HOH A . 
M 5 HOH 219 537 537 HOH HOH A . 
M 5 HOH 220 540 540 HOH HOH A . 
M 5 HOH 221 541 541 HOH HOH A . 
M 5 HOH 222 542 542 HOH HOH A . 
M 5 HOH 223 545 545 HOH HOH A . 
M 5 HOH 224 546 546 HOH HOH A . 
M 5 HOH 225 547 547 HOH HOH A . 
M 5 HOH 226 552 552 HOH HOH A . 
M 5 HOH 227 553 553 HOH HOH A . 
M 5 HOH 228 555 555 HOH HOH A . 
M 5 HOH 229 556 556 HOH HOH A . 
M 5 HOH 230 558 558 HOH HOH A . 
M 5 HOH 231 559 559 HOH HOH A . 
M 5 HOH 232 560 560 HOH HOH A . 
M 5 HOH 233 566 566 HOH HOH A . 
M 5 HOH 234 567 567 HOH HOH A . 
M 5 HOH 235 569 569 HOH HOH A . 
M 5 HOH 236 570 570 HOH HOH A . 
M 5 HOH 237 572 572 HOH HOH A . 
M 5 HOH 238 578 578 HOH HOH A . 
M 5 HOH 239 579 579 HOH HOH A . 
M 5 HOH 240 580 580 HOH HOH A . 
M 5 HOH 241 581 581 HOH HOH A . 
M 5 HOH 242 584 584 HOH HOH A . 
M 5 HOH 243 587 587 HOH HOH A . 
M 5 HOH 244 590 590 HOH HOH A . 
M 5 HOH 245 594 594 HOH HOH A . 
M 5 HOH 246 596 596 HOH HOH A . 
M 5 HOH 247 598 598 HOH HOH A . 
M 5 HOH 248 602 602 HOH HOH A . 
M 5 HOH 249 604 604 HOH HOH A . 
M 5 HOH 250 606 606 HOH HOH A . 
M 5 HOH 251 608 608 HOH HOH A . 
M 5 HOH 252 609 609 HOH HOH A . 
M 5 HOH 253 611 611 HOH HOH A . 
M 5 HOH 254 613 613 HOH HOH A . 
M 5 HOH 255 614 614 HOH HOH A . 
M 5 HOH 256 616 616 HOH HOH A . 
M 5 HOH 257 619 619 HOH HOH A . 
M 5 HOH 258 620 620 HOH HOH A . 
M 5 HOH 259 622 622 HOH HOH A . 
M 5 HOH 260 623 623 HOH HOH A . 
M 5 HOH 261 624 624 HOH HOH A . 
M 5 HOH 262 625 625 HOH HOH A . 
M 5 HOH 263 629 629 HOH HOH A . 
M 5 HOH 264 631 631 HOH HOH A . 
M 5 HOH 265 633 633 HOH HOH A . 
M 5 HOH 266 634 634 HOH HOH A . 
M 5 HOH 267 637 637 HOH HOH A . 
M 5 HOH 268 639 639 HOH HOH A . 
M 5 HOH 269 644 644 HOH HOH A . 
M 5 HOH 270 649 649 HOH HOH A . 
M 5 HOH 271 656 656 HOH HOH A . 
M 5 HOH 272 665 665 HOH HOH A . 
M 5 HOH 273 668 668 HOH HOH A . 
M 5 HOH 274 675 675 HOH HOH A . 
M 5 HOH 275 680 680 HOH HOH A . 
M 5 HOH 276 682 682 HOH HOH A . 
M 5 HOH 277 686 686 HOH HOH A . 
N 5 HOH 1   310 19  HOH HOH B . 
N 5 HOH 2   315 315 HOH HOH B . 
N 5 HOH 3   316 316 HOH HOH B . 
N 5 HOH 4   317 21  HOH HOH B . 
N 5 HOH 5   318 24  HOH HOH B . 
N 5 HOH 6   319 319 HOH HOH B . 
N 5 HOH 7   320 36  HOH HOH B . 
N 5 HOH 8   321 41  HOH HOH B . 
N 5 HOH 9   322 322 HOH HOH B . 
N 5 HOH 10  323 323 HOH HOH B . 
N 5 HOH 11  324 324 HOH HOH B . 
N 5 HOH 12  325 42  HOH HOH B . 
N 5 HOH 13  326 326 HOH HOH B . 
N 5 HOH 14  327 327 HOH HOH B . 
N 5 HOH 15  328 45  HOH HOH B . 
N 5 HOH 16  329 48  HOH HOH B . 
N 5 HOH 17  330 52  HOH HOH B . 
N 5 HOH 18  331 55  HOH HOH B . 
N 5 HOH 19  332 332 HOH HOH B . 
N 5 HOH 20  333 333 HOH HOH B . 
N 5 HOH 21  334 334 HOH HOH B . 
N 5 HOH 22  335 335 HOH HOH B . 
N 5 HOH 23  336 336 HOH HOH B . 
N 5 HOH 24  337 337 HOH HOH B . 
N 5 HOH 25  338 338 HOH HOH B . 
N 5 HOH 26  339 339 HOH HOH B . 
N 5 HOH 27  340 57  HOH HOH B . 
N 5 HOH 28  341 58  HOH HOH B . 
N 5 HOH 29  342 60  HOH HOH B . 
N 5 HOH 30  343 343 HOH HOH B . 
N 5 HOH 31  344 61  HOH HOH B . 
N 5 HOH 32  345 62  HOH HOH B . 
N 5 HOH 33  346 65  HOH HOH B . 
N 5 HOH 34  347 347 HOH HOH B . 
N 5 HOH 35  348 66  HOH HOH B . 
N 5 HOH 36  349 67  HOH HOH B . 
N 5 HOH 37  350 68  HOH HOH B . 
N 5 HOH 38  351 69  HOH HOH B . 
N 5 HOH 39  352 73  HOH HOH B . 
N 5 HOH 40  353 353 HOH HOH B . 
N 5 HOH 41  354 77  HOH HOH B . 
N 5 HOH 42  355 78  HOH HOH B . 
N 5 HOH 43  356 81  HOH HOH B . 
N 5 HOH 44  357 87  HOH HOH B . 
N 5 HOH 45  358 88  HOH HOH B . 
N 5 HOH 46  359 359 HOH HOH B . 
N 5 HOH 47  360 89  HOH HOH B . 
N 5 HOH 48  361 93  HOH HOH B . 
N 5 HOH 49  362 94  HOH HOH B . 
N 5 HOH 50  363 96  HOH HOH B . 
N 5 HOH 51  364 364 HOH HOH B . 
N 5 HOH 52  365 98  HOH HOH B . 
N 5 HOH 53  366 99  HOH HOH B . 
N 5 HOH 54  367 367 HOH HOH B . 
N 5 HOH 55  368 102 HOH HOH B . 
N 5 HOH 56  369 369 HOH HOH B . 
N 5 HOH 57  370 370 HOH HOH B . 
N 5 HOH 58  371 371 HOH HOH B . 
N 5 HOH 59  372 104 HOH HOH B . 
N 5 HOH 60  373 373 HOH HOH B . 
N 5 HOH 61  374 106 HOH HOH B . 
N 5 HOH 62  375 107 HOH HOH B . 
N 5 HOH 63  376 108 HOH HOH B . 
N 5 HOH 64  377 109 HOH HOH B . 
N 5 HOH 65  378 112 HOH HOH B . 
N 5 HOH 66  379 114 HOH HOH B . 
N 5 HOH 67  380 115 HOH HOH B . 
N 5 HOH 68  381 117 HOH HOH B . 
N 5 HOH 69  382 118 HOH HOH B . 
N 5 HOH 70  383 121 HOH HOH B . 
N 5 HOH 71  384 384 HOH HOH B . 
N 5 HOH 72  385 122 HOH HOH B . 
N 5 HOH 73  386 386 HOH HOH B . 
N 5 HOH 74  387 124 HOH HOH B . 
N 5 HOH 75  388 388 HOH HOH B . 
N 5 HOH 76  389 389 HOH HOH B . 
N 5 HOH 77  390 125 HOH HOH B . 
N 5 HOH 78  391 391 HOH HOH B . 
N 5 HOH 79  392 132 HOH HOH B . 
N 5 HOH 80  393 134 HOH HOH B . 
N 5 HOH 81  394 394 HOH HOH B . 
N 5 HOH 82  395 395 HOH HOH B . 
N 5 HOH 83  396 396 HOH HOH B . 
N 5 HOH 84  397 136 HOH HOH B . 
N 5 HOH 85  398 140 HOH HOH B . 
N 5 HOH 86  399 399 HOH HOH B . 
N 5 HOH 87  400 400 HOH HOH B . 
N 5 HOH 88  401 143 HOH HOH B . 
N 5 HOH 89  402 402 HOH HOH B . 
N 5 HOH 90  403 403 HOH HOH B . 
N 5 HOH 91  404 147 HOH HOH B . 
N 5 HOH 92  405 149 HOH HOH B . 
N 5 HOH 93  406 151 HOH HOH B . 
N 5 HOH 94  407 152 HOH HOH B . 
N 5 HOH 95  408 153 HOH HOH B . 
N 5 HOH 96  409 409 HOH HOH B . 
N 5 HOH 97  410 155 HOH HOH B . 
N 5 HOH 98  411 411 HOH HOH B . 
N 5 HOH 99  412 157 HOH HOH B . 
N 5 HOH 100 413 413 HOH HOH B . 
N 5 HOH 101 414 414 HOH HOH B . 
N 5 HOH 102 415 158 HOH HOH B . 
N 5 HOH 103 416 161 HOH HOH B . 
N 5 HOH 104 417 417 HOH HOH B . 
N 5 HOH 105 418 163 HOH HOH B . 
N 5 HOH 106 419 419 HOH HOH B . 
N 5 HOH 107 420 420 HOH HOH B . 
N 5 HOH 108 421 421 HOH HOH B . 
N 5 HOH 109 422 422 HOH HOH B . 
N 5 HOH 110 423 423 HOH HOH B . 
N 5 HOH 111 424 424 HOH HOH B . 
N 5 HOH 112 425 425 HOH HOH B . 
N 5 HOH 113 426 426 HOH HOH B . 
N 5 HOH 114 427 164 HOH HOH B . 
N 5 HOH 115 428 428 HOH HOH B . 
N 5 HOH 116 429 166 HOH HOH B . 
N 5 HOH 117 430 430 HOH HOH B . 
N 5 HOH 118 431 431 HOH HOH B . 
N 5 HOH 119 432 432 HOH HOH B . 
N 5 HOH 120 433 169 HOH HOH B . 
N 5 HOH 121 434 170 HOH HOH B . 
N 5 HOH 122 435 435 HOH HOH B . 
N 5 HOH 123 436 172 HOH HOH B . 
N 5 HOH 124 437 437 HOH HOH B . 
N 5 HOH 125 438 173 HOH HOH B . 
N 5 HOH 126 439 439 HOH HOH B . 
N 5 HOH 127 440 440 HOH HOH B . 
N 5 HOH 128 441 176 HOH HOH B . 
N 5 HOH 129 442 442 HOH HOH B . 
N 5 HOH 130 443 443 HOH HOH B . 
N 5 HOH 131 444 177 HOH HOH B . 
N 5 HOH 132 445 179 HOH HOH B . 
N 5 HOH 133 446 181 HOH HOH B . 
N 5 HOH 134 447 182 HOH HOH B . 
N 5 HOH 135 448 448 HOH HOH B . 
N 5 HOH 136 449 449 HOH HOH B . 
N 5 HOH 137 450 183 HOH HOH B . 
N 5 HOH 138 451 451 HOH HOH B . 
N 5 HOH 139 452 184 HOH HOH B . 
N 5 HOH 140 453 453 HOH HOH B . 
N 5 HOH 141 454 454 HOH HOH B . 
N 5 HOH 142 455 189 HOH HOH B . 
N 5 HOH 143 456 456 HOH HOH B . 
N 5 HOH 144 457 457 HOH HOH B . 
N 5 HOH 145 458 458 HOH HOH B . 
N 5 HOH 146 459 459 HOH HOH B . 
N 5 HOH 147 460 191 HOH HOH B . 
N 5 HOH 148 461 192 HOH HOH B . 
N 5 HOH 149 462 194 HOH HOH B . 
N 5 HOH 150 463 463 HOH HOH B . 
N 5 HOH 151 464 195 HOH HOH B . 
N 5 HOH 152 465 196 HOH HOH B . 
N 5 HOH 153 466 466 HOH HOH B . 
N 5 HOH 154 467 200 HOH HOH B . 
N 5 HOH 155 468 205 HOH HOH B . 
N 5 HOH 156 469 207 HOH HOH B . 
N 5 HOH 157 470 208 HOH HOH B . 
N 5 HOH 158 471 471 HOH HOH B . 
N 5 HOH 159 472 472 HOH HOH B . 
N 5 HOH 160 473 473 HOH HOH B . 
N 5 HOH 161 474 210 HOH HOH B . 
N 5 HOH 162 475 475 HOH HOH B . 
N 5 HOH 163 476 211 HOH HOH B . 
N 5 HOH 164 477 477 HOH HOH B . 
N 5 HOH 165 478 478 HOH HOH B . 
N 5 HOH 166 479 479 HOH HOH B . 
N 5 HOH 167 480 212 HOH HOH B . 
N 5 HOH 168 481 213 HOH HOH B . 
N 5 HOH 169 482 214 HOH HOH B . 
N 5 HOH 170 483 483 HOH HOH B . 
N 5 HOH 171 484 216 HOH HOH B . 
N 5 HOH 172 485 231 HOH HOH B . 
N 5 HOH 173 486 232 HOH HOH B . 
N 5 HOH 174 487 487 HOH HOH B . 
N 5 HOH 175 488 234 HOH HOH B . 
N 5 HOH 176 489 489 HOH HOH B . 
N 5 HOH 177 490 240 HOH HOH B . 
N 5 HOH 178 491 241 HOH HOH B . 
N 5 HOH 179 492 242 HOH HOH B . 
N 5 HOH 180 493 243 HOH HOH B . 
N 5 HOH 181 494 244 HOH HOH B . 
N 5 HOH 182 495 247 HOH HOH B . 
N 5 HOH 183 496 496 HOH HOH B . 
N 5 HOH 184 497 497 HOH HOH B . 
N 5 HOH 185 498 249 HOH HOH B . 
N 5 HOH 186 499 253 HOH HOH B . 
N 5 HOH 187 500 254 HOH HOH B . 
N 5 HOH 188 501 256 HOH HOH B . 
N 5 HOH 189 502 502 HOH HOH B . 
N 5 HOH 190 503 503 HOH HOH B . 
N 5 HOH 191 504 504 HOH HOH B . 
N 5 HOH 192 505 258 HOH HOH B . 
N 5 HOH 193 506 506 HOH HOH B . 
N 5 HOH 194 507 260 HOH HOH B . 
N 5 HOH 195 508 261 HOH HOH B . 
N 5 HOH 196 509 262 HOH HOH B . 
N 5 HOH 197 510 510 HOH HOH B . 
N 5 HOH 198 511 511 HOH HOH B . 
N 5 HOH 199 512 512 HOH HOH B . 
N 5 HOH 200 513 513 HOH HOH B . 
N 5 HOH 201 514 514 HOH HOH B . 
N 5 HOH 202 515 264 HOH HOH B . 
N 5 HOH 203 516 267 HOH HOH B . 
N 5 HOH 204 517 268 HOH HOH B . 
N 5 HOH 205 518 518 HOH HOH B . 
N 5 HOH 206 519 519 HOH HOH B . 
N 5 HOH 207 520 269 HOH HOH B . 
N 5 HOH 208 521 521 HOH HOH B . 
N 5 HOH 209 522 270 HOH HOH B . 
N 5 HOH 210 523 271 HOH HOH B . 
N 5 HOH 211 524 275 HOH HOH B . 
N 5 HOH 212 525 525 HOH HOH B . 
N 5 HOH 213 526 526 HOH HOH B . 
N 5 HOH 214 527 277 HOH HOH B . 
N 5 HOH 215 528 280 HOH HOH B . 
N 5 HOH 216 529 284 HOH HOH B . 
N 5 HOH 217 530 286 HOH HOH B . 
N 5 HOH 218 531 531 HOH HOH B . 
N 5 HOH 219 532 295 HOH HOH B . 
N 5 HOH 220 533 297 HOH HOH B . 
N 5 HOH 221 534 534 HOH HOH B . 
N 5 HOH 222 535 300 HOH HOH B . 
N 5 HOH 223 536 301 HOH HOH B . 
N 5 HOH 224 537 303 HOH HOH B . 
N 5 HOH 225 538 538 HOH HOH B . 
N 5 HOH 226 539 539 HOH HOH B . 
N 5 HOH 227 540 307 HOH HOH B . 
N 5 HOH 228 541 311 HOH HOH B . 
N 5 HOH 229 542 312 HOH HOH B . 
N 5 HOH 230 543 543 HOH HOH B . 
N 5 HOH 231 544 544 HOH HOH B . 
N 5 HOH 232 545 314 HOH HOH B . 
N 5 HOH 233 548 548 HOH HOH B . 
N 5 HOH 234 549 549 HOH HOH B . 
N 5 HOH 235 550 550 HOH HOH B . 
N 5 HOH 236 551 551 HOH HOH B . 
N 5 HOH 237 554 554 HOH HOH B . 
N 5 HOH 238 557 557 HOH HOH B . 
N 5 HOH 239 563 563 HOH HOH B . 
N 5 HOH 240 564 564 HOH HOH B . 
N 5 HOH 241 565 565 HOH HOH B . 
N 5 HOH 242 568 568 HOH HOH B . 
N 5 HOH 243 571 571 HOH HOH B . 
N 5 HOH 244 573 573 HOH HOH B . 
N 5 HOH 245 575 575 HOH HOH B . 
N 5 HOH 246 576 576 HOH HOH B . 
N 5 HOH 247 582 582 HOH HOH B . 
N 5 HOH 248 585 585 HOH HOH B . 
N 5 HOH 249 588 588 HOH HOH B . 
N 5 HOH 250 589 589 HOH HOH B . 
N 5 HOH 251 591 591 HOH HOH B . 
N 5 HOH 252 592 592 HOH HOH B . 
N 5 HOH 253 593 593 HOH HOH B . 
N 5 HOH 254 595 595 HOH HOH B . 
N 5 HOH 255 597 597 HOH HOH B . 
N 5 HOH 256 601 601 HOH HOH B . 
N 5 HOH 257 603 603 HOH HOH B . 
N 5 HOH 258 605 605 HOH HOH B . 
N 5 HOH 259 610 610 HOH HOH B . 
N 5 HOH 260 612 612 HOH HOH B . 
N 5 HOH 261 615 615 HOH HOH B . 
N 5 HOH 262 617 617 HOH HOH B . 
N 5 HOH 263 618 618 HOH HOH B . 
N 5 HOH 264 621 621 HOH HOH B . 
N 5 HOH 265 626 626 HOH HOH B . 
N 5 HOH 266 627 627 HOH HOH B . 
N 5 HOH 267 628 628 HOH HOH B . 
N 5 HOH 268 630 630 HOH HOH B . 
N 5 HOH 269 635 635 HOH HOH B . 
N 5 HOH 270 636 636 HOH HOH B . 
N 5 HOH 271 640 640 HOH HOH B . 
N 5 HOH 272 645 645 HOH HOH B . 
N 5 HOH 273 646 646 HOH HOH B . 
N 5 HOH 274 647 647 HOH HOH B . 
N 5 HOH 275 651 651 HOH HOH B . 
N 5 HOH 276 652 652 HOH HOH B . 
N 5 HOH 277 653 653 HOH HOH B . 
N 5 HOH 278 658 658 HOH HOH B . 
N 5 HOH 279 660 660 HOH HOH B . 
N 5 HOH 280 661 661 HOH HOH B . 
N 5 HOH 281 662 662 HOH HOH B . 
N 5 HOH 282 663 663 HOH HOH B . 
N 5 HOH 283 666 666 HOH HOH B . 
N 5 HOH 284 669 669 HOH HOH B . 
N 5 HOH 285 672 672 HOH HOH B . 
N 5 HOH 286 673 673 HOH HOH B . 
N 5 HOH 287 674 674 HOH HOH B . 
N 5 HOH 288 676 676 HOH HOH B . 
N 5 HOH 289 683 683 HOH HOH B . 
N 5 HOH 290 684 684 HOH HOH B . 
N 5 HOH 291 685 685 HOH HOH B . 
#