data_3UNE
# 
_entry.id   3UNE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UNE         
RCSB  RCSB068971   
WWPDB D_1000068971 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PMA '20S proteasome from Thermoplasma acidophilum' unspecified 
PDB 1RYP '20S proteasome from yeast'                    unspecified 
PDB 1IRU 'Constitutive 20S proteasome from bovine'      unspecified 
PDB 3UN4 .                                              unspecified 
PDB 3UN8 .                                              unspecified 
PDB 3UNB .                                              unspecified 
PDB 3UNF .                                              unspecified 
PDB 3UNH .                                              unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UNE 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huber, E.'      1 
'Basler, M.'     2 
'Schwab, R.'     3 
'Heinemeyer, W.' 4 
'Kirk, C.'       5 
'Groettrup, M.'  6 
'Groll, M.'      7 
# 
_citation.id                        primary 
_citation.title                     
'Immuno- and constitutive proteasome crystal structures reveal differences in substrate and inhibitor specificity.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            148 
_citation.page_first                727 
_citation.page_last                 738 
_citation.year                      2012 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22341445 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2011.12.030 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huber, E.M.'    1 
primary 'Basler, M.'     2 
primary 'Schwab, R.'     3 
primary 'Heinemeyer, W.' 4 
primary 'Kirk, C.J.'     5 
primary 'Groettrup, M.'  6 
primary 'Groll, M.'      7 
# 
_cell.entry_id           3UNE 
_cell.length_a           170.970 
_cell.length_b           201.300 
_cell.length_c           226.010 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.07 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UNE 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer nat 'Proteasome subunit alpha type-2' 25955.613 4   3.4.25.1 ? ? ? 
2  polymer nat 'Proteasome subunit alpha type-4' 29512.807 4   3.4.25.1 ? ? ? 
3  polymer nat 'Proteasome subunit alpha type-7' 27897.887 4   3.4.25.1 ? ? ? 
4  polymer nat 'Proteasome subunit alpha type-5' 26435.977 4   3.4.25.1 ? ? ? 
5  polymer nat 'Proteasome subunit alpha type-1' 29586.576 4   3.4.25.1 ? ? ? 
6  polymer nat 'Proteasome subunit alpha type-3' 28442.248 4   3.4.25.1 ? ? ? 
7  polymer nat 'Proteasome subunit alpha type-6' 27405.434 4   3.4.25.1 ? ? ? 
8  polymer nat 'Proteasome subunit beta type-7'  25280.010 4   3.4.25.1 ? ? ? 
9  polymer nat 'Proteasome subunit beta type-3'  22988.895 4   3.4.25.1 ? ? ? 
10 polymer nat 'Proteasome subunit beta type-2'  22935.377 4   3.4.25.1 ? ? ? 
11 polymer nat 'Proteasome subunit beta type-5'  22554.545 4   3.4.25.1 ? ? ? 
12 polymer nat 'Proteasome subunit beta type-1'  23576.969 4   3.4.25.1 ? ? ? 
13 polymer nat 'Proteasome subunit beta type-4'  24384.715 4   3.4.25.1 ? ? ? 
14 polymer nat 'Proteasome subunit beta type-6'  22014.920 4   3.4.25.1 ? ? ? 
15 water   nat water                             18.015    640 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Macropain subunit C3, Multicatalytic endopeptidase complex subunit C3, Proteasome component C3' 
2  'Macropain subunit C9, Multicatalytic endopeptidase complex subunit C9, Proteasome component C9, Proteasome subunit L' 
3  'Proteasome subunit RC6-1' 
4  'Macropain zeta chain, Multicatalytic endopeptidase complex zeta chain, Proteasome zeta chain' 
5  'Macropain subunit C2, Multicatalytic endopeptidase complex subunit C2, Proteasome component C2, Proteasome nu chain' 
6  'Macropain subunit C8, Multicatalytic endopeptidase complex subunit C8, Proteasome component C8, Proteasome subunit K' 
7  'Macropain iota chain, Multicatalytic endopeptidase complex iota chain, Proteasome iota chain' 
8  'Macropain chain Z, Multicatalytic endopeptidase complex chain Z, Proteasome subunit Z' 
9  'Proteasome chain 13, Proteasome component C10-II, Proteasome theta chain' 
10 'Macropain subunit C7-I, Multicatalytic endopeptidase complex subunit C7-I, Proteasome component C7-I' 
11 
;Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit X
;
12 'Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome component C5, Proteasome gamma chain' 
13 
;Proteasome beta chain, Low molecular mass protein 3, Macropain beta chain, Multicatalytic endopeptidase complex beta chain, Proteasome chain 3
;
14 
;Low molecular mass protein 19, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, Proteasome delta chain, Proteasome subunit Y
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MAKRGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
;
;MAKRGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
;
A,O,c,q ? 
2  'polypeptide(L)' no no 
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
;
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
;
B,P,d,r ? 
3  'polypeptide(L)' no no 
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
C,Q,e,s ? 
4  'polypeptide(L)' no no 
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
D,R,f,t ? 
5  'polypeptide(L)' no no 
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAAEEPAEKADEPMEH
;
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAAEEPAEKADEPMEH
;
E,S,g,u ? 
6  'polypeptide(L)' no no 
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
F,T,h,v ? 
7  'polypeptide(L)' no no 
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
G,U,i,w ? 
8  'polypeptide(L)' no no 
;TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTAN
RMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIA
AGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS
;
;TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTAN
RMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIA
AGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS
;
H,V,j,x ? 
9  'polypeptide(L)' no no 
;MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR
QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDP
EHLFETISQAMLNAVDRDAVSGMGVIVHVIEKDKITTRTLKARMD
;
;MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR
QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDP
EHLFETISQAMLNAVDRDAVSGMGVIVHVIEKDKITTRTLKARMD
;
I,W,k,y ? 
10 'polypeptide(L)' no no 
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPKRDS
;
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPKRDS
;
J,X,l,z ? 
11 'polypeptide(L)' no no 
;TTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS
KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAI
YQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP
;
;TTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS
KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAI
YQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP
;
K,Y,m,1 ? 
12 'polypeptide(L)' no no 
;RFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN
KAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN
VEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
;
;RFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN
KAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN
VEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
;
L,Z,n,2 ? 
13 'polypeptide(L)' no no 
;TQNPMVTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDG
HSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVL
SQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNWDIAHMISGFE
;
;TQNPMVTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDG
HSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVL
SQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNWDIAHMISGFE
;
M,a,o,3 ? 
14 'polypeptide(L)' no no 
;TTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAA
SLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANAL
ALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP
;
;TTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAA
SLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANAL
ALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP
;
N,b,p,4 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   ALA n 
1  3   LYS n 
1  4   ARG n 
1  5   GLY n 
1  6   TYR n 
1  7   SER n 
1  8   PHE n 
1  9   SER n 
1  10  LEU n 
1  11  THR n 
1  12  THR n 
1  13  PHE n 
1  14  SER n 
1  15  PRO n 
1  16  SER n 
1  17  GLY n 
1  18  LYS n 
1  19  LEU n 
1  20  VAL n 
1  21  GLN n 
1  22  ILE n 
1  23  GLU n 
1  24  TYR n 
1  25  ALA n 
1  26  LEU n 
1  27  ALA n 
1  28  ALA n 
1  29  VAL n 
1  30  ALA n 
1  31  GLY n 
1  32  GLY n 
1  33  ALA n 
1  34  PRO n 
1  35  SER n 
1  36  VAL n 
1  37  GLY n 
1  38  ILE n 
1  39  LYS n 
1  40  ALA n 
1  41  ALA n 
1  42  ASN n 
1  43  GLY n 
1  44  VAL n 
1  45  VAL n 
1  46  LEU n 
1  47  ALA n 
1  48  THR n 
1  49  GLU n 
1  50  LYS n 
1  51  LYS n 
1  52  GLN n 
1  53  LYS n 
1  54  SER n 
1  55  ILE n 
1  56  LEU n 
1  57  TYR n 
1  58  ASP n 
1  59  GLU n 
1  60  ARG n 
1  61  SER n 
1  62  VAL n 
1  63  HIS n 
1  64  LYS n 
1  65  VAL n 
1  66  GLU n 
1  67  PRO n 
1  68  ILE n 
1  69  THR n 
1  70  LYS n 
1  71  HIS n 
1  72  ILE n 
1  73  GLY n 
1  74  LEU n 
1  75  VAL n 
1  76  TYR n 
1  77  SER n 
1  78  GLY n 
1  79  MET n 
1  80  GLY n 
1  81  PRO n 
1  82  ASP n 
1  83  TYR n 
1  84  ARG n 
1  85  VAL n 
1  86  LEU n 
1  87  VAL n 
1  88  HIS n 
1  89  ARG n 
1  90  ALA n 
1  91  ARG n 
1  92  LYS n 
1  93  LEU n 
1  94  ALA n 
1  95  GLN n 
1  96  GLN n 
1  97  TYR n 
1  98  TYR n 
1  99  LEU n 
1  100 VAL n 
1  101 TYR n 
1  102 GLN n 
1  103 GLU n 
1  104 PRO n 
1  105 ILE n 
1  106 PRO n 
1  107 THR n 
1  108 ALA n 
1  109 GLN n 
1  110 LEU n 
1  111 VAL n 
1  112 GLN n 
1  113 ARG n 
1  114 VAL n 
1  115 ALA n 
1  116 SER n 
1  117 VAL n 
1  118 MET n 
1  119 GLN n 
1  120 GLU n 
1  121 TYR n 
1  122 THR n 
1  123 GLN n 
1  124 SER n 
1  125 GLY n 
1  126 GLY n 
1  127 VAL n 
1  128 ARG n 
1  129 PRO n 
1  130 PHE n 
1  131 GLY n 
1  132 VAL n 
1  133 SER n 
1  134 LEU n 
1  135 LEU n 
1  136 ILE n 
1  137 CYS n 
1  138 GLY n 
1  139 TRP n 
1  140 ASN n 
1  141 GLU n 
1  142 GLY n 
1  143 ARG n 
1  144 PRO n 
1  145 TYR n 
1  146 LEU n 
1  147 PHE n 
1  148 GLN n 
1  149 SER n 
1  150 ASP n 
1  151 PRO n 
1  152 SER n 
1  153 GLY n 
1  154 ALA n 
1  155 TYR n 
1  156 PHE n 
1  157 ALA n 
1  158 TRP n 
1  159 LYS n 
1  160 ALA n 
1  161 THR n 
1  162 ALA n 
1  163 MET n 
1  164 GLY n 
1  165 LYS n 
1  166 ASN n 
1  167 TYR n 
1  168 VAL n 
1  169 ASN n 
1  170 GLY n 
1  171 LYS n 
1  172 THR n 
1  173 PHE n 
1  174 LEU n 
1  175 GLU n 
1  176 LYS n 
1  177 ARG n 
1  178 TYR n 
1  179 ASN n 
1  180 GLU n 
1  181 ASP n 
1  182 LEU n 
1  183 GLU n 
1  184 LEU n 
1  185 GLU n 
1  186 ASP n 
1  187 ALA n 
1  188 ILE n 
1  189 HIS n 
1  190 THR n 
1  191 ALA n 
1  192 ILE n 
1  193 LEU n 
1  194 THR n 
1  195 LEU n 
1  196 LYS n 
1  197 GLU n 
1  198 SER n 
1  199 PHE n 
1  200 GLU n 
1  201 GLY n 
1  202 GLN n 
1  203 MET n 
1  204 THR n 
1  205 GLU n 
1  206 ASP n 
1  207 ASN n 
1  208 ILE n 
1  209 GLU n 
1  210 VAL n 
1  211 GLY n 
1  212 ILE n 
1  213 CYS n 
1  214 ASN n 
1  215 GLU n 
1  216 ALA n 
1  217 GLY n 
1  218 PHE n 
1  219 ARG n 
1  220 ARG n 
1  221 LEU n 
1  222 THR n 
1  223 PRO n 
1  224 THR n 
1  225 GLU n 
1  226 VAL n 
1  227 ARG n 
1  228 ASP n 
1  229 TYR n 
1  230 LEU n 
1  231 ALA n 
1  232 ALA n 
1  233 ILE n 
1  234 ALA n 
2  1   MET n 
2  2   SER n 
2  3   ARG n 
2  4   ARG n 
2  5   TYR n 
2  6   ASP n 
2  7   SER n 
2  8   ARG n 
2  9   THR n 
2  10  THR n 
2  11  ILE n 
2  12  PHE n 
2  13  SER n 
2  14  PRO n 
2  15  GLU n 
2  16  GLY n 
2  17  ARG n 
2  18  LEU n 
2  19  TYR n 
2  20  GLN n 
2  21  VAL n 
2  22  GLU n 
2  23  TYR n 
2  24  ALA n 
2  25  MET n 
2  26  GLU n 
2  27  ALA n 
2  28  ILE n 
2  29  GLY n 
2  30  HIS n 
2  31  ALA n 
2  32  GLY n 
2  33  THR n 
2  34  CYS n 
2  35  LEU n 
2  36  GLY n 
2  37  ILE n 
2  38  LEU n 
2  39  ALA n 
2  40  ASN n 
2  41  ASP n 
2  42  GLY n 
2  43  VAL n 
2  44  LEU n 
2  45  LEU n 
2  46  ALA n 
2  47  ALA n 
2  48  GLU n 
2  49  ARG n 
2  50  ARG n 
2  51  ASN n 
2  52  ILE n 
2  53  HIS n 
2  54  LYS n 
2  55  LEU n 
2  56  LEU n 
2  57  ASP n 
2  58  GLU n 
2  59  VAL n 
2  60  PHE n 
2  61  PHE n 
2  62  SER n 
2  63  GLU n 
2  64  LYS n 
2  65  ILE n 
2  66  TYR n 
2  67  LYS n 
2  68  LEU n 
2  69  ASN n 
2  70  GLU n 
2  71  ASP n 
2  72  MET n 
2  73  ALA n 
2  74  CYS n 
2  75  SER n 
2  76  VAL n 
2  77  ALA n 
2  78  GLY n 
2  79  ILE n 
2  80  THR n 
2  81  SER n 
2  82  ASP n 
2  83  ALA n 
2  84  ASN n 
2  85  VAL n 
2  86  LEU n 
2  87  THR n 
2  88  ASN n 
2  89  GLU n 
2  90  LEU n 
2  91  ARG n 
2  92  LEU n 
2  93  ILE n 
2  94  ALA n 
2  95  GLN n 
2  96  ARG n 
2  97  TYR n 
2  98  LEU n 
2  99  LEU n 
2  100 GLN n 
2  101 TYR n 
2  102 GLN n 
2  103 GLU n 
2  104 PRO n 
2  105 ILE n 
2  106 PRO n 
2  107 CYS n 
2  108 GLU n 
2  109 GLN n 
2  110 LEU n 
2  111 VAL n 
2  112 THR n 
2  113 ALA n 
2  114 LEU n 
2  115 CYS n 
2  116 ASP n 
2  117 ILE n 
2  118 LYS n 
2  119 GLN n 
2  120 ALA n 
2  121 TYR n 
2  122 THR n 
2  123 GLN n 
2  124 PHE n 
2  125 GLY n 
2  126 GLY n 
2  127 LYS n 
2  128 ARG n 
2  129 PRO n 
2  130 PHE n 
2  131 GLY n 
2  132 VAL n 
2  133 SER n 
2  134 LEU n 
2  135 LEU n 
2  136 TYR n 
2  137 ILE n 
2  138 GLY n 
2  139 TRP n 
2  140 ASP n 
2  141 LYS n 
2  142 HIS n 
2  143 TYR n 
2  144 GLY n 
2  145 PHE n 
2  146 GLN n 
2  147 LEU n 
2  148 TYR n 
2  149 GLN n 
2  150 SER n 
2  151 ASP n 
2  152 PRO n 
2  153 SER n 
2  154 GLY n 
2  155 ASN n 
2  156 TYR n 
2  157 GLY n 
2  158 GLY n 
2  159 TRP n 
2  160 LYS n 
2  161 ALA n 
2  162 THR n 
2  163 CYS n 
2  164 ILE n 
2  165 GLY n 
2  166 ASN n 
2  167 ASN n 
2  168 SER n 
2  169 ALA n 
2  170 ALA n 
2  171 ALA n 
2  172 VAL n 
2  173 SER n 
2  174 MET n 
2  175 LEU n 
2  176 LYS n 
2  177 GLN n 
2  178 ASP n 
2  179 TYR n 
2  180 LYS n 
2  181 GLU n 
2  182 GLY n 
2  183 GLU n 
2  184 MET n 
2  185 THR n 
2  186 LEU n 
2  187 LYS n 
2  188 SER n 
2  189 ALA n 
2  190 LEU n 
2  191 ALA n 
2  192 LEU n 
2  193 ALA n 
2  194 VAL n 
2  195 LYS n 
2  196 VAL n 
2  197 LEU n 
2  198 ASN n 
2  199 LYS n 
2  200 THR n 
2  201 MET n 
2  202 ASP n 
2  203 VAL n 
2  204 SER n 
2  205 LYS n 
2  206 LEU n 
2  207 SER n 
2  208 ALA n 
2  209 GLU n 
2  210 LYS n 
2  211 VAL n 
2  212 GLU n 
2  213 ILE n 
2  214 ALA n 
2  215 THR n 
2  216 LEU n 
2  217 THR n 
2  218 ARG n 
2  219 GLU n 
2  220 SER n 
2  221 GLY n 
2  222 LYS n 
2  223 THR n 
2  224 VAL n 
2  225 ILE n 
2  226 ARG n 
2  227 VAL n 
2  228 LEU n 
2  229 LYS n 
2  230 GLN n 
2  231 LYS n 
2  232 GLU n 
2  233 VAL n 
2  234 GLU n 
2  235 GLN n 
2  236 LEU n 
2  237 ILE n 
2  238 LYS n 
2  239 LYS n 
2  240 HIS n 
2  241 GLU n 
2  242 GLU n 
2  243 GLU n 
2  244 GLU n 
2  245 ALA n 
2  246 LYS n 
2  247 ALA n 
2  248 GLU n 
2  249 ARG n 
2  250 GLU n 
2  251 LYS n 
2  252 LYS n 
2  253 GLU n 
2  254 LYS n 
2  255 GLU n 
2  256 GLN n 
2  257 ARG n 
2  258 GLU n 
2  259 LYS n 
2  260 ASP n 
2  261 LYS n 
3  1   MET n 
3  2   SER n 
3  3   TYR n 
3  4   ASP n 
3  5   ARG n 
3  6   ALA n 
3  7   ILE n 
3  8   THR n 
3  9   VAL n 
3  10  PHE n 
3  11  SER n 
3  12  PRO n 
3  13  ASP n 
3  14  GLY n 
3  15  HIS n 
3  16  LEU n 
3  17  PHE n 
3  18  GLN n 
3  19  VAL n 
3  20  GLU n 
3  21  TYR n 
3  22  ALA n 
3  23  GLN n 
3  24  GLU n 
3  25  ALA n 
3  26  VAL n 
3  27  LYS n 
3  28  LYS n 
3  29  GLY n 
3  30  SER n 
3  31  THR n 
3  32  ALA n 
3  33  VAL n 
3  34  GLY n 
3  35  VAL n 
3  36  ARG n 
3  37  GLY n 
3  38  LYS n 
3  39  ASP n 
3  40  ILE n 
3  41  VAL n 
3  42  VAL n 
3  43  LEU n 
3  44  GLY n 
3  45  VAL n 
3  46  GLU n 
3  47  LYS n 
3  48  LYS n 
3  49  SER n 
3  50  VAL n 
3  51  ALA n 
3  52  LYS n 
3  53  LEU n 
3  54  GLN n 
3  55  ASP n 
3  56  GLU n 
3  57  ARG n 
3  58  THR n 
3  59  VAL n 
3  60  ARG n 
3  61  LYS n 
3  62  ILE n 
3  63  CYS n 
3  64  ALA n 
3  65  LEU n 
3  66  ASP n 
3  67  ASP n 
3  68  ASN n 
3  69  VAL n 
3  70  CYS n 
3  71  MET n 
3  72  ALA n 
3  73  PHE n 
3  74  ALA n 
3  75  GLY n 
3  76  LEU n 
3  77  THR n 
3  78  ALA n 
3  79  ASP n 
3  80  ALA n 
3  81  ARG n 
3  82  ILE n 
3  83  VAL n 
3  84  ILE n 
3  85  ASN n 
3  86  ARG n 
3  87  ALA n 
3  88  ARG n 
3  89  VAL n 
3  90  GLU n 
3  91  CYS n 
3  92  GLN n 
3  93  SER n 
3  94  HIS n 
3  95  ARG n 
3  96  LEU n 
3  97  THR n 
3  98  VAL n 
3  99  GLU n 
3  100 ASP n 
3  101 PRO n 
3  102 VAL n 
3  103 THR n 
3  104 VAL n 
3  105 GLU n 
3  106 TYR n 
3  107 ILE n 
3  108 THR n 
3  109 ARG n 
3  110 TYR n 
3  111 ILE n 
3  112 ALA n 
3  113 SER n 
3  114 LEU n 
3  115 LYS n 
3  116 GLN n 
3  117 ARG n 
3  118 TYR n 
3  119 THR n 
3  120 GLN n 
3  121 SER n 
3  122 ASN n 
3  123 GLY n 
3  124 ARG n 
3  125 ARG n 
3  126 PRO n 
3  127 PHE n 
3  128 GLY n 
3  129 ILE n 
3  130 SER n 
3  131 ALA n 
3  132 LEU n 
3  133 ILE n 
3  134 VAL n 
3  135 GLY n 
3  136 PHE n 
3  137 ASP n 
3  138 PHE n 
3  139 ASP n 
3  140 GLY n 
3  141 THR n 
3  142 PRO n 
3  143 ARG n 
3  144 LEU n 
3  145 TYR n 
3  146 GLN n 
3  147 THR n 
3  148 ASP n 
3  149 PRO n 
3  150 SER n 
3  151 GLY n 
3  152 THR n 
3  153 TYR n 
3  154 HIS n 
3  155 ALA n 
3  156 TRP n 
3  157 LYS n 
3  158 ALA n 
3  159 ASN n 
3  160 ALA n 
3  161 ILE n 
3  162 GLY n 
3  163 ARG n 
3  164 GLY n 
3  165 ALA n 
3  166 LYS n 
3  167 SER n 
3  168 VAL n 
3  169 ARG n 
3  170 GLU n 
3  171 PHE n 
3  172 LEU n 
3  173 GLU n 
3  174 LYS n 
3  175 ASN n 
3  176 TYR n 
3  177 THR n 
3  178 ASP n 
3  179 ASP n 
3  180 ALA n 
3  181 ILE n 
3  182 GLU n 
3  183 THR n 
3  184 ASP n 
3  185 ASP n 
3  186 LEU n 
3  187 THR n 
3  188 ILE n 
3  189 LYS n 
3  190 LEU n 
3  191 VAL n 
3  192 ILE n 
3  193 LYS n 
3  194 ALA n 
3  195 LEU n 
3  196 LEU n 
3  197 GLU n 
3  198 VAL n 
3  199 VAL n 
3  200 GLN n 
3  201 SER n 
3  202 GLY n 
3  203 GLY n 
3  204 LYS n 
3  205 ASN n 
3  206 ILE n 
3  207 GLU n 
3  208 LEU n 
3  209 ALA n 
3  210 VAL n 
3  211 MET n 
3  212 ARG n 
3  213 ARG n 
3  214 ASP n 
3  215 GLN n 
3  216 PRO n 
3  217 LEU n 
3  218 LYS n 
3  219 ILE n 
3  220 LEU n 
3  221 ASN n 
3  222 PRO n 
3  223 GLU n 
3  224 GLU n 
3  225 ILE n 
3  226 GLU n 
3  227 LYS n 
3  228 TYR n 
3  229 VAL n 
3  230 ALA n 
3  231 GLU n 
3  232 ILE n 
3  233 GLU n 
3  234 LYS n 
3  235 GLU n 
3  236 LYS n 
3  237 GLU n 
3  238 GLU n 
3  239 ASN n 
3  240 GLU n 
3  241 LYS n 
3  242 LYS n 
3  243 LYS n 
3  244 GLN n 
3  245 LYS n 
3  246 LYS n 
3  247 ALA n 
3  248 SER n 
4  1   MET n 
4  2   PHE n 
4  3   LEU n 
4  4   THR n 
4  5   ARG n 
4  6   SER n 
4  7   GLU n 
4  8   TYR n 
4  9   ASP n 
4  10  ARG n 
4  11  GLY n 
4  12  VAL n 
4  13  ASN n 
4  14  THR n 
4  15  PHE n 
4  16  SER n 
4  17  PRO n 
4  18  GLU n 
4  19  GLY n 
4  20  ARG n 
4  21  LEU n 
4  22  PHE n 
4  23  GLN n 
4  24  VAL n 
4  25  GLU n 
4  26  TYR n 
4  27  ALA n 
4  28  ILE n 
4  29  GLU n 
4  30  ALA n 
4  31  ILE n 
4  32  LYS n 
4  33  LEU n 
4  34  GLY n 
4  35  SER n 
4  36  THR n 
4  37  ALA n 
4  38  ILE n 
4  39  GLY n 
4  40  ILE n 
4  41  GLN n 
4  42  THR n 
4  43  SER n 
4  44  GLU n 
4  45  GLY n 
4  46  VAL n 
4  47  CYS n 
4  48  LEU n 
4  49  ALA n 
4  50  VAL n 
4  51  GLU n 
4  52  LYS n 
4  53  ARG n 
4  54  ILE n 
4  55  THR n 
4  56  SER n 
4  57  PRO n 
4  58  LEU n 
4  59  MET n 
4  60  GLU n 
4  61  PRO n 
4  62  SER n 
4  63  SER n 
4  64  ILE n 
4  65  GLU n 
4  66  LYS n 
4  67  ILE n 
4  68  VAL n 
4  69  GLU n 
4  70  ILE n 
4  71  ASP n 
4  72  ALA n 
4  73  HIS n 
4  74  ILE n 
4  75  GLY n 
4  76  CYS n 
4  77  ALA n 
4  78  MET n 
4  79  SER n 
4  80  GLY n 
4  81  LEU n 
4  82  ILE n 
4  83  ALA n 
4  84  ASP n 
4  85  ALA n 
4  86  LYS n 
4  87  THR n 
4  88  LEU n 
4  89  ILE n 
4  90  ASP n 
4  91  LYS n 
4  92  ALA n 
4  93  ARG n 
4  94  VAL n 
4  95  GLU n 
4  96  THR n 
4  97  GLN n 
4  98  ASN n 
4  99  HIS n 
4  100 TRP n 
4  101 PHE n 
4  102 THR n 
4  103 TYR n 
4  104 ASN n 
4  105 GLU n 
4  106 THR n 
4  107 MET n 
4  108 THR n 
4  109 VAL n 
4  110 GLU n 
4  111 SER n 
4  112 VAL n 
4  113 THR n 
4  114 GLN n 
4  115 ALA n 
4  116 VAL n 
4  117 SER n 
4  118 ASN n 
4  119 LEU n 
4  120 ALA n 
4  121 LEU n 
4  122 GLN n 
4  123 PHE n 
4  124 GLY n 
4  125 GLU n 
4  126 GLU n 
4  127 ASP n 
4  128 ALA n 
4  129 ASP n 
4  130 PRO n 
4  131 GLY n 
4  132 ALA n 
4  133 MET n 
4  134 SER n 
4  135 ARG n 
4  136 PRO n 
4  137 PHE n 
4  138 GLY n 
4  139 VAL n 
4  140 ALA n 
4  141 LEU n 
4  142 LEU n 
4  143 PHE n 
4  144 GLY n 
4  145 GLY n 
4  146 VAL n 
4  147 ASP n 
4  148 GLU n 
4  149 LYS n 
4  150 GLY n 
4  151 PRO n 
4  152 GLN n 
4  153 LEU n 
4  154 PHE n 
4  155 HIS n 
4  156 MET n 
4  157 ASP n 
4  158 PRO n 
4  159 SER n 
4  160 GLY n 
4  161 THR n 
4  162 PHE n 
4  163 VAL n 
4  164 GLN n 
4  165 CYS n 
4  166 ASP n 
4  167 ALA n 
4  168 ARG n 
4  169 ALA n 
4  170 ILE n 
4  171 GLY n 
4  172 SER n 
4  173 ALA n 
4  174 SER n 
4  175 GLU n 
4  176 GLY n 
4  177 ALA n 
4  178 GLN n 
4  179 SER n 
4  180 SER n 
4  181 LEU n 
4  182 GLN n 
4  183 GLU n 
4  184 VAL n 
4  185 TYR n 
4  186 HIS n 
4  187 LYS n 
4  188 SER n 
4  189 MET n 
4  190 THR n 
4  191 LEU n 
4  192 LYS n 
4  193 GLU n 
4  194 ALA n 
4  195 ILE n 
4  196 LYS n 
4  197 SER n 
4  198 SER n 
4  199 LEU n 
4  200 ILE n 
4  201 ILE n 
4  202 LEU n 
4  203 LYS n 
4  204 GLN n 
4  205 VAL n 
4  206 MET n 
4  207 GLU n 
4  208 GLU n 
4  209 LYS n 
4  210 LEU n 
4  211 ASN n 
4  212 ALA n 
4  213 THR n 
4  214 ASN n 
4  215 ILE n 
4  216 GLU n 
4  217 LEU n 
4  218 ALA n 
4  219 THR n 
4  220 VAL n 
4  221 GLN n 
4  222 PRO n 
4  223 GLY n 
4  224 GLN n 
4  225 ASN n 
4  226 PHE n 
4  227 HIS n 
4  228 MET n 
4  229 PHE n 
4  230 THR n 
4  231 LYS n 
4  232 GLU n 
4  233 GLU n 
4  234 LEU n 
4  235 GLU n 
4  236 GLU n 
4  237 VAL n 
4  238 ILE n 
4  239 LYS n 
4  240 ASP n 
4  241 ILE n 
5  1   MET n 
5  2   PHE n 
5  3   ARG n 
5  4   ASN n 
5  5   GLN n 
5  6   TYR n 
5  7   ASP n 
5  8   ASN n 
5  9   ASP n 
5  10  VAL n 
5  11  THR n 
5  12  VAL n 
5  13  TRP n 
5  14  SER n 
5  15  PRO n 
5  16  GLN n 
5  17  GLY n 
5  18  ARG n 
5  19  ILE n 
5  20  HIS n 
5  21  GLN n 
5  22  ILE n 
5  23  GLU n 
5  24  TYR n 
5  25  ALA n 
5  26  MET n 
5  27  GLU n 
5  28  ALA n 
5  29  VAL n 
5  30  LYS n 
5  31  GLN n 
5  32  GLY n 
5  33  SER n 
5  34  ALA n 
5  35  THR n 
5  36  VAL n 
5  37  GLY n 
5  38  LEU n 
5  39  LYS n 
5  40  SER n 
5  41  LYS n 
5  42  THR n 
5  43  HIS n 
5  44  ALA n 
5  45  VAL n 
5  46  LEU n 
5  47  VAL n 
5  48  ALA n 
5  49  LEU n 
5  50  LYS n 
5  51  ARG n 
5  52  ALA n 
5  53  GLN n 
5  54  SER n 
5  55  GLU n 
5  56  LEU n 
5  57  ALA n 
5  58  ALA n 
5  59  HIS n 
5  60  GLN n 
5  61  LYS n 
5  62  LYS n 
5  63  ILE n 
5  64  LEU n 
5  65  HIS n 
5  66  VAL n 
5  67  ASP n 
5  68  ASN n 
5  69  HIS n 
5  70  ILE n 
5  71  GLY n 
5  72  ILE n 
5  73  SER n 
5  74  ILE n 
5  75  ALA n 
5  76  GLY n 
5  77  LEU n 
5  78  THR n 
5  79  ALA n 
5  80  ASP n 
5  81  ALA n 
5  82  ARG n 
5  83  LEU n 
5  84  LEU n 
5  85  CYS n 
5  86  ASN n 
5  87  PHE n 
5  88  MET n 
5  89  ARG n 
5  90  GLN n 
5  91  GLU n 
5  92  CYS n 
5  93  LEU n 
5  94  ASP n 
5  95  SER n 
5  96  ARG n 
5  97  PHE n 
5  98  VAL n 
5  99  PHE n 
5  100 ASP n 
5  101 ARG n 
5  102 PRO n 
5  103 LEU n 
5  104 PRO n 
5  105 VAL n 
5  106 SER n 
5  107 ARG n 
5  108 LEU n 
5  109 VAL n 
5  110 SER n 
5  111 LEU n 
5  112 ILE n 
5  113 GLY n 
5  114 SER n 
5  115 LYS n 
5  116 THR n 
5  117 GLN n 
5  118 ILE n 
5  119 PRO n 
5  120 THR n 
5  121 GLN n 
5  122 ARG n 
5  123 TYR n 
5  124 GLY n 
5  125 ARG n 
5  126 ARG n 
5  127 PRO n 
5  128 TYR n 
5  129 GLY n 
5  130 VAL n 
5  131 GLY n 
5  132 LEU n 
5  133 LEU n 
5  134 ILE n 
5  135 ALA n 
5  136 GLY n 
5  137 TYR n 
5  138 ASP n 
5  139 ASP n 
5  140 MET n 
5  141 GLY n 
5  142 PRO n 
5  143 HIS n 
5  144 ILE n 
5  145 PHE n 
5  146 GLN n 
5  147 THR n 
5  148 CYS n 
5  149 PRO n 
5  150 SER n 
5  151 ALA n 
5  152 ASN n 
5  153 TYR n 
5  154 PHE n 
5  155 ASP n 
5  156 CYS n 
5  157 ARG n 
5  158 ALA n 
5  159 MET n 
5  160 SER n 
5  161 ILE n 
5  162 GLY n 
5  163 ALA n 
5  164 ARG n 
5  165 SER n 
5  166 GLN n 
5  167 SER n 
5  168 ALA n 
5  169 ARG n 
5  170 THR n 
5  171 TYR n 
5  172 LEU n 
5  173 GLU n 
5  174 ARG n 
5  175 HIS n 
5  176 MET n 
5  177 SER n 
5  178 GLU n 
5  179 PHE n 
5  180 MET n 
5  181 GLU n 
5  182 CYS n 
5  183 ASN n 
5  184 LEU n 
5  185 ASP n 
5  186 GLU n 
5  187 LEU n 
5  188 VAL n 
5  189 LYS n 
5  190 HIS n 
5  191 GLY n 
5  192 LEU n 
5  193 ARG n 
5  194 ALA n 
5  195 LEU n 
5  196 ARG n 
5  197 GLU n 
5  198 THR n 
5  199 LEU n 
5  200 PRO n 
5  201 ALA n 
5  202 GLU n 
5  203 GLN n 
5  204 ASP n 
5  205 LEU n 
5  206 THR n 
5  207 THR n 
5  208 LYS n 
5  209 ASN n 
5  210 VAL n 
5  211 SER n 
5  212 ILE n 
5  213 GLY n 
5  214 ILE n 
5  215 VAL n 
5  216 GLY n 
5  217 LYS n 
5  218 ASP n 
5  219 LEU n 
5  220 GLU n 
5  221 PHE n 
5  222 THR n 
5  223 ILE n 
5  224 TYR n 
5  225 ASP n 
5  226 ASP n 
5  227 ASP n 
5  228 ASP n 
5  229 VAL n 
5  230 SER n 
5  231 PRO n 
5  232 PHE n 
5  233 LEU n 
5  234 ASP n 
5  235 GLY n 
5  236 LEU n 
5  237 GLU n 
5  238 GLU n 
5  239 ARG n 
5  240 PRO n 
5  241 GLN n 
5  242 ARG n 
5  243 LYS n 
5  244 ALA n 
5  245 GLN n 
5  246 PRO n 
5  247 SER n 
5  248 GLN n 
5  249 ALA n 
5  250 ALA n 
5  251 GLU n 
5  252 GLU n 
5  253 PRO n 
5  254 ALA n 
5  255 GLU n 
5  256 LYS n 
5  257 ALA n 
5  258 ASP n 
5  259 GLU n 
5  260 PRO n 
5  261 MET n 
5  262 GLU n 
5  263 HIS n 
6  1   MET n 
6  2   SER n 
6  3   SER n 
6  4   ILE n 
6  5   GLY n 
6  6   THR n 
6  7   GLY n 
6  8   TYR n 
6  9   ASP n 
6  10  LEU n 
6  11  SER n 
6  12  ALA n 
6  13  SER n 
6  14  THR n 
6  15  PHE n 
6  16  SER n 
6  17  PRO n 
6  18  ASP n 
6  19  GLY n 
6  20  ARG n 
6  21  VAL n 
6  22  PHE n 
6  23  GLN n 
6  24  VAL n 
6  25  GLU n 
6  26  TYR n 
6  27  ALA n 
6  28  MET n 
6  29  LYS n 
6  30  ALA n 
6  31  VAL n 
6  32  GLU n 
6  33  ASN n 
6  34  SER n 
6  35  SER n 
6  36  THR n 
6  37  ALA n 
6  38  ILE n 
6  39  GLY n 
6  40  ILE n 
6  41  ARG n 
6  42  CYS n 
6  43  LYS n 
6  44  ASP n 
6  45  GLY n 
6  46  VAL n 
6  47  VAL n 
6  48  PHE n 
6  49  GLY n 
6  50  VAL n 
6  51  GLU n 
6  52  LYS n 
6  53  LEU n 
6  54  VAL n 
6  55  LEU n 
6  56  SER n 
6  57  LYS n 
6  58  LEU n 
6  59  TYR n 
6  60  GLU n 
6  61  GLU n 
6  62  GLY n 
6  63  SER n 
6  64  ASN n 
6  65  LYS n 
6  66  ARG n 
6  67  LEU n 
6  68  PHE n 
6  69  ASN n 
6  70  VAL n 
6  71  ASP n 
6  72  ARG n 
6  73  HIS n 
6  74  VAL n 
6  75  GLY n 
6  76  MET n 
6  77  ALA n 
6  78  VAL n 
6  79  ALA n 
6  80  GLY n 
6  81  LEU n 
6  82  LEU n 
6  83  ALA n 
6  84  ASP n 
6  85  ALA n 
6  86  ARG n 
6  87  SER n 
6  88  LEU n 
6  89  ALA n 
6  90  ASP n 
6  91  ILE n 
6  92  ALA n 
6  93  ARG n 
6  94  GLU n 
6  95  GLU n 
6  96  ALA n 
6  97  SER n 
6  98  ASN n 
6  99  PHE n 
6  100 ARG n 
6  101 SER n 
6  102 ASN n 
6  103 PHE n 
6  104 GLY n 
6  105 TYR n 
6  106 ASN n 
6  107 ILE n 
6  108 PRO n 
6  109 LEU n 
6  110 LYS n 
6  111 HIS n 
6  112 LEU n 
6  113 ALA n 
6  114 ASP n 
6  115 ARG n 
6  116 VAL n 
6  117 ALA n 
6  118 MET n 
6  119 TYR n 
6  120 VAL n 
6  121 HIS n 
6  122 ALA n 
6  123 TYR n 
6  124 THR n 
6  125 LEU n 
6  126 TYR n 
6  127 SER n 
6  128 ALA n 
6  129 VAL n 
6  130 ARG n 
6  131 PRO n 
6  132 PHE n 
6  133 GLY n 
6  134 CYS n 
6  135 SER n 
6  136 PHE n 
6  137 MET n 
6  138 LEU n 
6  139 GLY n 
6  140 SER n 
6  141 TYR n 
6  142 SER n 
6  143 ALA n 
6  144 ASN n 
6  145 ASP n 
6  146 GLY n 
6  147 ALA n 
6  148 GLN n 
6  149 LEU n 
6  150 TYR n 
6  151 MET n 
6  152 ILE n 
6  153 ASP n 
6  154 PRO n 
6  155 SER n 
6  156 GLY n 
6  157 VAL n 
6  158 SER n 
6  159 TYR n 
6  160 GLY n 
6  161 TYR n 
6  162 TRP n 
6  163 GLY n 
6  164 CYS n 
6  165 ALA n 
6  166 ILE n 
6  167 GLY n 
6  168 LYS n 
6  169 ALA n 
6  170 ARG n 
6  171 GLN n 
6  172 ALA n 
6  173 ALA n 
6  174 LYS n 
6  175 THR n 
6  176 GLU n 
6  177 ILE n 
6  178 GLU n 
6  179 LYS n 
6  180 LEU n 
6  181 GLN n 
6  182 MET n 
6  183 LYS n 
6  184 GLU n 
6  185 MET n 
6  186 THR n 
6  187 CYS n 
6  188 ARG n 
6  189 ASP n 
6  190 VAL n 
6  191 VAL n 
6  192 LYS n 
6  193 GLU n 
6  194 VAL n 
6  195 ALA n 
6  196 LYS n 
6  197 ILE n 
6  198 ILE n 
6  199 TYR n 
6  200 ILE n 
6  201 VAL n 
6  202 HIS n 
6  203 ASP n 
6  204 GLU n 
6  205 VAL n 
6  206 LYS n 
6  207 ASP n 
6  208 LYS n 
6  209 ALA n 
6  210 PHE n 
6  211 GLU n 
6  212 LEU n 
6  213 GLU n 
6  214 LEU n 
6  215 SER n 
6  216 TRP n 
6  217 VAL n 
6  218 GLY n 
6  219 GLU n 
6  220 LEU n 
6  221 THR n 
6  222 LYS n 
6  223 GLY n 
6  224 ARG n 
6  225 HIS n 
6  226 GLU n 
6  227 ILE n 
6  228 VAL n 
6  229 PRO n 
6  230 LYS n 
6  231 ASP n 
6  232 ILE n 
6  233 ARG n 
6  234 GLU n 
6  235 GLU n 
6  236 ALA n 
6  237 GLU n 
6  238 LYS n 
6  239 TYR n 
6  240 ALA n 
6  241 LYS n 
6  242 GLU n 
6  243 SER n 
6  244 LEU n 
6  245 LYS n 
6  246 GLU n 
6  247 GLU n 
6  248 ASP n 
6  249 GLU n 
6  250 SER n 
6  251 ASP n 
6  252 ASP n 
6  253 ASP n 
6  254 ASN n 
6  255 MET n 
7  1   MET n 
7  2   SER n 
7  3   ARG n 
7  4   GLY n 
7  5   SER n 
7  6   SER n 
7  7   ALA n 
7  8   GLY n 
7  9   PHE n 
7  10  ASP n 
7  11  ARG n 
7  12  HIS n 
7  13  ILE n 
7  14  THR n 
7  15  ILE n 
7  16  PHE n 
7  17  SER n 
7  18  PRO n 
7  19  GLU n 
7  20  GLY n 
7  21  ARG n 
7  22  LEU n 
7  23  TYR n 
7  24  GLN n 
7  25  VAL n 
7  26  GLU n 
7  27  TYR n 
7  28  ALA n 
7  29  PHE n 
7  30  LYS n 
7  31  ALA n 
7  32  ILE n 
7  33  ASN n 
7  34  GLN n 
7  35  GLY n 
7  36  GLY n 
7  37  LEU n 
7  38  THR n 
7  39  SER n 
7  40  VAL n 
7  41  ALA n 
7  42  VAL n 
7  43  ARG n 
7  44  GLY n 
7  45  LYS n 
7  46  ASP n 
7  47  CYS n 
7  48  ALA n 
7  49  VAL n 
7  50  ILE n 
7  51  VAL n 
7  52  THR n 
7  53  GLN n 
7  54  LYS n 
7  55  LYS n 
7  56  VAL n 
7  57  PRO n 
7  58  ASP n 
7  59  LYS n 
7  60  LEU n 
7  61  LEU n 
7  62  ASP n 
7  63  SER n 
7  64  SER n 
7  65  THR n 
7  66  VAL n 
7  67  THR n 
7  68  HIS n 
7  69  LEU n 
7  70  PHE n 
7  71  LYS n 
7  72  ILE n 
7  73  THR n 
7  74  GLU n 
7  75  SER n 
7  76  ILE n 
7  77  GLY n 
7  78  CYS n 
7  79  VAL n 
7  80  MET n 
7  81  THR n 
7  82  GLY n 
7  83  MET n 
7  84  THR n 
7  85  ALA n 
7  86  ASP n 
7  87  SER n 
7  88  ARG n 
7  89  SER n 
7  90  GLN n 
7  91  VAL n 
7  92  GLN n 
7  93  ARG n 
7  94  ALA n 
7  95  ARG n 
7  96  TYR n 
7  97  GLU n 
7  98  ALA n 
7  99  ALA n 
7  100 ASN n 
7  101 TRP n 
7  102 LYS n 
7  103 TYR n 
7  104 LYS n 
7  105 TYR n 
7  106 GLY n 
7  107 TYR n 
7  108 GLU n 
7  109 ILE n 
7  110 PRO n 
7  111 VAL n 
7  112 ASP n 
7  113 MET n 
7  114 LEU n 
7  115 CYS n 
7  116 LYS n 
7  117 ARG n 
7  118 ILE n 
7  119 ALA n 
7  120 ASP n 
7  121 ILE n 
7  122 SER n 
7  123 GLN n 
7  124 VAL n 
7  125 TYR n 
7  126 THR n 
7  127 GLN n 
7  128 ASN n 
7  129 ALA n 
7  130 GLU n 
7  131 MET n 
7  132 ARG n 
7  133 PRO n 
7  134 LEU n 
7  135 GLY n 
7  136 CYS n 
7  137 CYS n 
7  138 MET n 
7  139 ILE n 
7  140 LEU n 
7  141 ILE n 
7  142 GLY n 
7  143 ILE n 
7  144 ASP n 
7  145 GLU n 
7  146 GLU n 
7  147 GLN n 
7  148 GLY n 
7  149 PRO n 
7  150 GLN n 
7  151 VAL n 
7  152 TYR n 
7  153 LYS n 
7  154 CYS n 
7  155 ASP n 
7  156 PRO n 
7  157 ALA n 
7  158 GLY n 
7  159 TYR n 
7  160 TYR n 
7  161 CYS n 
7  162 GLY n 
7  163 PHE n 
7  164 LYS n 
7  165 ALA n 
7  166 THR n 
7  167 ALA n 
7  168 ALA n 
7  169 GLY n 
7  170 VAL n 
7  171 LYS n 
7  172 GLN n 
7  173 THR n 
7  174 GLU n 
7  175 SER n 
7  176 THR n 
7  177 SER n 
7  178 PHE n 
7  179 LEU n 
7  180 GLU n 
7  181 LYS n 
7  182 LYS n 
7  183 VAL n 
7  184 LYS n 
7  185 LYS n 
7  186 LYS n 
7  187 PHE n 
7  188 ASP n 
7  189 TRP n 
7  190 THR n 
7  191 PHE n 
7  192 GLU n 
7  193 GLN n 
7  194 THR n 
7  195 VAL n 
7  196 GLU n 
7  197 THR n 
7  198 ALA n 
7  199 ILE n 
7  200 THR n 
7  201 CYS n 
7  202 LEU n 
7  203 SER n 
7  204 THR n 
7  205 VAL n 
7  206 LEU n 
7  207 SER n 
7  208 ILE n 
7  209 ASP n 
7  210 PHE n 
7  211 LYS n 
7  212 PRO n 
7  213 SER n 
7  214 GLU n 
7  215 ILE n 
7  216 GLU n 
7  217 VAL n 
7  218 GLY n 
7  219 VAL n 
7  220 VAL n 
7  221 THR n 
7  222 VAL n 
7  223 GLU n 
7  224 ASN n 
7  225 PRO n 
7  226 LYS n 
7  227 PHE n 
7  228 ARG n 
7  229 ILE n 
7  230 LEU n 
7  231 THR n 
7  232 GLU n 
7  233 ALA n 
7  234 GLU n 
7  235 ILE n 
7  236 ASP n 
7  237 ALA n 
7  238 HIS n 
7  239 LEU n 
7  240 VAL n 
7  241 ALA n 
7  242 LEU n 
7  243 ALA n 
7  244 GLU n 
7  245 ARG n 
7  246 ASP n 
8  1   THR n 
8  2   THR n 
8  3   ILE n 
8  4   ALA n 
8  5   GLY n 
8  6   VAL n 
8  7   VAL n 
8  8   TYR n 
8  9   LYS n 
8  10  ASP n 
8  11  GLY n 
8  12  ILE n 
8  13  VAL n 
8  14  LEU n 
8  15  GLY n 
8  16  ALA n 
8  17  ASP n 
8  18  THR n 
8  19  ARG n 
8  20  ALA n 
8  21  THR n 
8  22  GLU n 
8  23  GLY n 
8  24  MET n 
8  25  VAL n 
8  26  VAL n 
8  27  ALA n 
8  28  ASP n 
8  29  LYS n 
8  30  ASN n 
8  31  CYS n 
8  32  SER n 
8  33  LYS n 
8  34  ILE n 
8  35  HIS n 
8  36  PHE n 
8  37  ILE n 
8  38  SER n 
8  39  PRO n 
8  40  ASN n 
8  41  ILE n 
8  42  TYR n 
8  43  CYS n 
8  44  CYS n 
8  45  GLY n 
8  46  ALA n 
8  47  GLY n 
8  48  THR n 
8  49  ALA n 
8  50  ALA n 
8  51  ASP n 
8  52  THR n 
8  53  ASP n 
8  54  MET n 
8  55  THR n 
8  56  THR n 
8  57  GLN n 
8  58  LEU n 
8  59  ILE n 
8  60  SER n 
8  61  SER n 
8  62  ASN n 
8  63  LEU n 
8  64  GLU n 
8  65  LEU n 
8  66  HIS n 
8  67  SER n 
8  68  LEU n 
8  69  THR n 
8  70  THR n 
8  71  GLY n 
8  72  ARG n 
8  73  LEU n 
8  74  PRO n 
8  75  ARG n 
8  76  VAL n 
8  77  VAL n 
8  78  THR n 
8  79  ALA n 
8  80  ASN n 
8  81  ARG n 
8  82  MET n 
8  83  LEU n 
8  84  LYS n 
8  85  GLN n 
8  86  MET n 
8  87  LEU n 
8  88  PHE n 
8  89  ARG n 
8  90  TYR n 
8  91  GLN n 
8  92  GLY n 
8  93  TYR n 
8  94  ILE n 
8  95  GLY n 
8  96  ALA n 
8  97  ALA n 
8  98  LEU n 
8  99  VAL n 
8  100 LEU n 
8  101 GLY n 
8  102 GLY n 
8  103 VAL n 
8  104 ASP n 
8  105 VAL n 
8  106 THR n 
8  107 GLY n 
8  108 PRO n 
8  109 HIS n 
8  110 LEU n 
8  111 TYR n 
8  112 SER n 
8  113 ILE n 
8  114 TYR n 
8  115 PRO n 
8  116 HIS n 
8  117 GLY n 
8  118 SER n 
8  119 THR n 
8  120 ASP n 
8  121 LYS n 
8  122 LEU n 
8  123 PRO n 
8  124 TYR n 
8  125 VAL n 
8  126 THR n 
8  127 MET n 
8  128 GLY n 
8  129 SER n 
8  130 GLY n 
8  131 SER n 
8  132 LEU n 
8  133 ALA n 
8  134 ALA n 
8  135 MET n 
8  136 ALA n 
8  137 VAL n 
8  138 PHE n 
8  139 GLU n 
8  140 ASP n 
8  141 LYS n 
8  142 PHE n 
8  143 ARG n 
8  144 PRO n 
8  145 ASP n 
8  146 MET n 
8  147 GLU n 
8  148 GLU n 
8  149 GLU n 
8  150 GLU n 
8  151 ALA n 
8  152 LYS n 
8  153 LYS n 
8  154 LEU n 
8  155 VAL n 
8  156 SER n 
8  157 GLU n 
8  158 ALA n 
8  159 ILE n 
8  160 ALA n 
8  161 ALA n 
8  162 GLY n 
8  163 ILE n 
8  164 PHE n 
8  165 ASN n 
8  166 ASP n 
8  167 LEU n 
8  168 GLY n 
8  169 SER n 
8  170 GLY n 
8  171 SER n 
8  172 ASN n 
8  173 ILE n 
8  174 ASP n 
8  175 LEU n 
8  176 CYS n 
8  177 VAL n 
8  178 ILE n 
8  179 SER n 
8  180 LYS n 
8  181 SER n 
8  182 LYS n 
8  183 LEU n 
8  184 ASP n 
8  185 PHE n 
8  186 LEU n 
8  187 ARG n 
8  188 PRO n 
8  189 PHE n 
8  190 SER n 
8  191 VAL n 
8  192 PRO n 
8  193 ASN n 
8  194 LYS n 
8  195 LYS n 
8  196 GLY n 
8  197 THR n 
8  198 ARG n 
8  199 LEU n 
8  200 GLY n 
8  201 ARG n 
8  202 TYR n 
8  203 ARG n 
8  204 CYS n 
8  205 GLU n 
8  206 LYS n 
8  207 GLY n 
8  208 THR n 
8  209 THR n 
8  210 ALA n 
8  211 VAL n 
8  212 LEU n 
8  213 THR n 
8  214 GLU n 
8  215 LYS n 
8  216 VAL n 
8  217 THR n 
8  218 PRO n 
8  219 LEU n 
8  220 GLU n 
8  221 ILE n 
8  222 GLU n 
8  223 VAL n 
8  224 LEU n 
8  225 GLU n 
8  226 GLU n 
8  227 THR n 
8  228 VAL n 
8  229 GLN n 
8  230 THR n 
8  231 MET n 
8  232 ASP n 
8  233 THR n 
8  234 SER n 
9  1   MET n 
9  2   SER n 
9  3   ILE n 
9  4   MET n 
9  5   SER n 
9  6   TYR n 
9  7   ASN n 
9  8   GLY n 
9  9   GLY n 
9  10  ALA n 
9  11  VAL n 
9  12  MET n 
9  13  ALA n 
9  14  MET n 
9  15  LYS n 
9  16  GLY n 
9  17  LYS n 
9  18  ASN n 
9  19  CYS n 
9  20  VAL n 
9  21  ALA n 
9  22  ILE n 
9  23  ALA n 
9  24  ALA n 
9  25  ASP n 
9  26  ARG n 
9  27  ARG n 
9  28  PHE n 
9  29  GLY n 
9  30  ILE n 
9  31  GLN n 
9  32  ALA n 
9  33  GLN n 
9  34  MET n 
9  35  VAL n 
9  36  THR n 
9  37  THR n 
9  38  ASP n 
9  39  PHE n 
9  40  GLN n 
9  41  LYS n 
9  42  ILE n 
9  43  PHE n 
9  44  PRO n 
9  45  MET n 
9  46  GLY n 
9  47  ASP n 
9  48  ARG n 
9  49  LEU n 
9  50  TYR n 
9  51  ILE n 
9  52  GLY n 
9  53  LEU n 
9  54  ALA n 
9  55  GLY n 
9  56  LEU n 
9  57  ALA n 
9  58  THR n 
9  59  ASP n 
9  60  VAL n 
9  61  GLN n 
9  62  THR n 
9  63  VAL n 
9  64  ALA n 
9  65  GLN n 
9  66  ARG n 
9  67  LEU n 
9  68  LYS n 
9  69  PHE n 
9  70  ARG n 
9  71  LEU n 
9  72  ASN n 
9  73  LEU n 
9  74  TYR n 
9  75  GLU n 
9  76  LEU n 
9  77  LYS n 
9  78  GLU n 
9  79  GLY n 
9  80  ARG n 
9  81  GLN n 
9  82  ILE n 
9  83  LYS n 
9  84  PRO n 
9  85  TYR n 
9  86  THR n 
9  87  LEU n 
9  88  MET n 
9  89  SER n 
9  90  MET n 
9  91  VAL n 
9  92  ALA n 
9  93  ASN n 
9  94  LEU n 
9  95  LEU n 
9  96  TYR n 
9  97  GLU n 
9  98  LYS n 
9  99  ARG n 
9  100 PHE n 
9  101 GLY n 
9  102 PRO n 
9  103 TYR n 
9  104 TYR n 
9  105 THR n 
9  106 GLU n 
9  107 PRO n 
9  108 VAL n 
9  109 ILE n 
9  110 ALA n 
9  111 GLY n 
9  112 LEU n 
9  113 ASP n 
9  114 PRO n 
9  115 LYS n 
9  116 THR n 
9  117 PHE n 
9  118 LYS n 
9  119 PRO n 
9  120 PHE n 
9  121 ILE n 
9  122 CYS n 
9  123 SER n 
9  124 LEU n 
9  125 ASP n 
9  126 LEU n 
9  127 ILE n 
9  128 GLY n 
9  129 CYS n 
9  130 PRO n 
9  131 MET n 
9  132 VAL n 
9  133 THR n 
9  134 ASP n 
9  135 ASP n 
9  136 PHE n 
9  137 VAL n 
9  138 VAL n 
9  139 SER n 
9  140 GLY n 
9  141 THR n 
9  142 CYS n 
9  143 SER n 
9  144 GLU n 
9  145 GLN n 
9  146 MET n 
9  147 TYR n 
9  148 GLY n 
9  149 MET n 
9  150 CYS n 
9  151 GLU n 
9  152 SER n 
9  153 LEU n 
9  154 TRP n 
9  155 GLU n 
9  156 PRO n 
9  157 ASN n 
9  158 MET n 
9  159 ASP n 
9  160 PRO n 
9  161 GLU n 
9  162 HIS n 
9  163 LEU n 
9  164 PHE n 
9  165 GLU n 
9  166 THR n 
9  167 ILE n 
9  168 SER n 
9  169 GLN n 
9  170 ALA n 
9  171 MET n 
9  172 LEU n 
9  173 ASN n 
9  174 ALA n 
9  175 VAL n 
9  176 ASP n 
9  177 ARG n 
9  178 ASP n 
9  179 ALA n 
9  180 VAL n 
9  181 SER n 
9  182 GLY n 
9  183 MET n 
9  184 GLY n 
9  185 VAL n 
9  186 ILE n 
9  187 VAL n 
9  188 HIS n 
9  189 VAL n 
9  190 ILE n 
9  191 GLU n 
9  192 LYS n 
9  193 ASP n 
9  194 LYS n 
9  195 ILE n 
9  196 THR n 
9  197 THR n 
9  198 ARG n 
9  199 THR n 
9  200 LEU n 
9  201 LYS n 
9  202 ALA n 
9  203 ARG n 
9  204 MET n 
9  205 ASP n 
10 1   MET n 
10 2   GLU n 
10 3   TYR n 
10 4   LEU n 
10 5   ILE n 
10 6   GLY n 
10 7   ILE n 
10 8   GLN n 
10 9   GLY n 
10 10  PRO n 
10 11  ASP n 
10 12  TYR n 
10 13  VAL n 
10 14  LEU n 
10 15  VAL n 
10 16  ALA n 
10 17  SER n 
10 18  ASP n 
10 19  ARG n 
10 20  VAL n 
10 21  ALA n 
10 22  ALA n 
10 23  SER n 
10 24  ASN n 
10 25  ILE n 
10 26  VAL n 
10 27  GLN n 
10 28  MET n 
10 29  LYS n 
10 30  ASP n 
10 31  ASP n 
10 32  HIS n 
10 33  ASP n 
10 34  LYS n 
10 35  MET n 
10 36  PHE n 
10 37  LYS n 
10 38  MET n 
10 39  SER n 
10 40  GLU n 
10 41  LYS n 
10 42  ILE n 
10 43  LEU n 
10 44  LEU n 
10 45  LEU n 
10 46  CYS n 
10 47  VAL n 
10 48  GLY n 
10 49  GLU n 
10 50  ALA n 
10 51  GLY n 
10 52  ASP n 
10 53  THR n 
10 54  VAL n 
10 55  GLN n 
10 56  PHE n 
10 57  ALA n 
10 58  GLU n 
10 59  TYR n 
10 60  ILE n 
10 61  GLN n 
10 62  LYS n 
10 63  ASN n 
10 64  VAL n 
10 65  GLN n 
10 66  LEU n 
10 67  TYR n 
10 68  LYS n 
10 69  MET n 
10 70  ARG n 
10 71  ASN n 
10 72  GLY n 
10 73  TYR n 
10 74  GLU n 
10 75  LEU n 
10 76  SER n 
10 77  PRO n 
10 78  THR n 
10 79  ALA n 
10 80  ALA n 
10 81  ALA n 
10 82  ASN n 
10 83  PHE n 
10 84  THR n 
10 85  ARG n 
10 86  ARG n 
10 87  ASN n 
10 88  LEU n 
10 89  ALA n 
10 90  ASP n 
10 91  CYS n 
10 92  LEU n 
10 93  ARG n 
10 94  SER n 
10 95  ARG n 
10 96  THR n 
10 97  PRO n 
10 98  TYR n 
10 99  HIS n 
10 100 VAL n 
10 101 ASN n 
10 102 LEU n 
10 103 LEU n 
10 104 LEU n 
10 105 ALA n 
10 106 GLY n 
10 107 TYR n 
10 108 ASP n 
10 109 GLU n 
10 110 HIS n 
10 111 GLU n 
10 112 GLY n 
10 113 PRO n 
10 114 ALA n 
10 115 LEU n 
10 116 TYR n 
10 117 TYR n 
10 118 MET n 
10 119 ASP n 
10 120 TYR n 
10 121 LEU n 
10 122 ALA n 
10 123 ALA n 
10 124 LEU n 
10 125 ALA n 
10 126 LYS n 
10 127 ALA n 
10 128 PRO n 
10 129 PHE n 
10 130 ALA n 
10 131 ALA n 
10 132 HIS n 
10 133 GLY n 
10 134 TYR n 
10 135 GLY n 
10 136 ALA n 
10 137 PHE n 
10 138 LEU n 
10 139 THR n 
10 140 LEU n 
10 141 SER n 
10 142 ILE n 
10 143 LEU n 
10 144 ASP n 
10 145 ARG n 
10 146 TYR n 
10 147 TYR n 
10 148 THR n 
10 149 PRO n 
10 150 THR n 
10 151 ILE n 
10 152 SER n 
10 153 ARG n 
10 154 GLU n 
10 155 ARG n 
10 156 ALA n 
10 157 VAL n 
10 158 GLU n 
10 159 LEU n 
10 160 LEU n 
10 161 ARG n 
10 162 LYS n 
10 163 CYS n 
10 164 LEU n 
10 165 GLU n 
10 166 GLU n 
10 167 LEU n 
10 168 GLN n 
10 169 LYS n 
10 170 ARG n 
10 171 PHE n 
10 172 ILE n 
10 173 LEU n 
10 174 ASN n 
10 175 LEU n 
10 176 PRO n 
10 177 THR n 
10 178 PHE n 
10 179 SER n 
10 180 VAL n 
10 181 ARG n 
10 182 VAL n 
10 183 ILE n 
10 184 ASP n 
10 185 LYS n 
10 186 ASP n 
10 187 GLY n 
10 188 ILE n 
10 189 HIS n 
10 190 ASN n 
10 191 LEU n 
10 192 GLU n 
10 193 ASN n 
10 194 ILE n 
10 195 ALA n 
10 196 PHE n 
10 197 PRO n 
10 198 LYS n 
10 199 ARG n 
10 200 ASP n 
10 201 SER n 
11 1   THR n 
11 2   THR n 
11 3   THR n 
11 4   LEU n 
11 5   ALA n 
11 6   PHE n 
11 7   LYS n 
11 8   PHE n 
11 9   LEU n 
11 10  HIS n 
11 11  GLY n 
11 12  VAL n 
11 13  ILE n 
11 14  VAL n 
11 15  ALA n 
11 16  ALA n 
11 17  ASP n 
11 18  SER n 
11 19  ARG n 
11 20  ALA n 
11 21  THR n 
11 22  ALA n 
11 23  GLY n 
11 24  ALA n 
11 25  TYR n 
11 26  ILE n 
11 27  ALA n 
11 28  SER n 
11 29  GLN n 
11 30  THR n 
11 31  VAL n 
11 32  LYS n 
11 33  LYS n 
11 34  VAL n 
11 35  ILE n 
11 36  GLU n 
11 37  ILE n 
11 38  ASN n 
11 39  PRO n 
11 40  TYR n 
11 41  LEU n 
11 42  LEU n 
11 43  GLY n 
11 44  THR n 
11 45  MET n 
11 46  ALA n 
11 47  GLY n 
11 48  GLY n 
11 49  ALA n 
11 50  ALA n 
11 51  ASP n 
11 52  CYS n 
11 53  SER n 
11 54  PHE n 
11 55  TRP n 
11 56  GLU n 
11 57  ARG n 
11 58  LEU n 
11 59  LEU n 
11 60  ALA n 
11 61  ARG n 
11 62  GLN n 
11 63  CYS n 
11 64  ARG n 
11 65  ILE n 
11 66  TYR n 
11 67  GLU n 
11 68  LEU n 
11 69  ARG n 
11 70  ASN n 
11 71  LYS n 
11 72  GLU n 
11 73  ARG n 
11 74  ILE n 
11 75  SER n 
11 76  VAL n 
11 77  ALA n 
11 78  ALA n 
11 79  ALA n 
11 80  SER n 
11 81  LYS n 
11 82  LEU n 
11 83  LEU n 
11 84  ALA n 
11 85  ASN n 
11 86  MET n 
11 87  VAL n 
11 88  TYR n 
11 89  GLN n 
11 90  TYR n 
11 91  LYS n 
11 92  GLY n 
11 93  MET n 
11 94  GLY n 
11 95  LEU n 
11 96  SER n 
11 97  MET n 
11 98  GLY n 
11 99  THR n 
11 100 MET n 
11 101 ILE n 
11 102 CYS n 
11 103 GLY n 
11 104 TRP n 
11 105 ASP n 
11 106 LYS n 
11 107 ARG n 
11 108 GLY n 
11 109 PRO n 
11 110 GLY n 
11 111 LEU n 
11 112 TYR n 
11 113 TYR n 
11 114 VAL n 
11 115 ASP n 
11 116 SER n 
11 117 GLU n 
11 118 GLY n 
11 119 ASN n 
11 120 ARG n 
11 121 ILE n 
11 122 SER n 
11 123 GLY n 
11 124 THR n 
11 125 ALA n 
11 126 PHE n 
11 127 SER n 
11 128 VAL n 
11 129 GLY n 
11 130 SER n 
11 131 GLY n 
11 132 SER n 
11 133 VAL n 
11 134 TYR n 
11 135 ALA n 
11 136 TYR n 
11 137 GLY n 
11 138 VAL n 
11 139 MET n 
11 140 ASP n 
11 141 ARG n 
11 142 GLY n 
11 143 TYR n 
11 144 SER n 
11 145 TYR n 
11 146 ASP n 
11 147 LEU n 
11 148 LYS n 
11 149 VAL n 
11 150 GLU n 
11 151 GLU n 
11 152 ALA n 
11 153 TYR n 
11 154 ASP n 
11 155 LEU n 
11 156 ALA n 
11 157 ARG n 
11 158 ARG n 
11 159 ALA n 
11 160 ILE n 
11 161 TYR n 
11 162 GLN n 
11 163 ALA n 
11 164 THR n 
11 165 TYR n 
11 166 ARG n 
11 167 ASP n 
11 168 ALA n 
11 169 TYR n 
11 170 SER n 
11 171 GLY n 
11 172 GLY n 
11 173 ALA n 
11 174 VAL n 
11 175 ASN n 
11 176 LEU n 
11 177 TYR n 
11 178 HIS n 
11 179 VAL n 
11 180 ARG n 
11 181 GLU n 
11 182 ASP n 
11 183 GLY n 
11 184 TRP n 
11 185 ILE n 
11 186 ARG n 
11 187 VAL n 
11 188 SER n 
11 189 SER n 
11 190 ASP n 
11 191 ASN n 
11 192 VAL n 
11 193 ALA n 
11 194 ASP n 
11 195 LEU n 
11 196 HIS n 
11 197 ASP n 
11 198 LYS n 
11 199 TYR n 
11 200 SER n 
11 201 SER n 
11 202 VAL n 
11 203 SER n 
11 204 VAL n 
11 205 PRO n 
12 1   ARG n 
12 2   PHE n 
12 3   SER n 
12 4   PRO n 
12 5   TYR n 
12 6   ALA n 
12 7   PHE n 
12 8   ASN n 
12 9   GLY n 
12 10  GLY n 
12 11  THR n 
12 12  VAL n 
12 13  LEU n 
12 14  ALA n 
12 15  ILE n 
12 16  ALA n 
12 17  GLY n 
12 18  GLU n 
12 19  ASP n 
12 20  PHE n 
12 21  SER n 
12 22  ILE n 
12 23  VAL n 
12 24  ALA n 
12 25  SER n 
12 26  ASP n 
12 27  THR n 
12 28  ARG n 
12 29  LEU n 
12 30  SER n 
12 31  GLU n 
12 32  GLY n 
12 33  PHE n 
12 34  SER n 
12 35  ILE n 
12 36  HIS n 
12 37  THR n 
12 38  ARG n 
12 39  ASP n 
12 40  SER n 
12 41  PRO n 
12 42  LYS n 
12 43  CYS n 
12 44  TYR n 
12 45  LYS n 
12 46  LEU n 
12 47  THR n 
12 48  ASP n 
12 49  LYS n 
12 50  THR n 
12 51  VAL n 
12 52  ILE n 
12 53  GLY n 
12 54  CYS n 
12 55  SER n 
12 56  GLY n 
12 57  PHE n 
12 58  HIS n 
12 59  GLY n 
12 60  ASP n 
12 61  CYS n 
12 62  LEU n 
12 63  THR n 
12 64  LEU n 
12 65  THR n 
12 66  LYS n 
12 67  ILE n 
12 68  ILE n 
12 69  GLU n 
12 70  ALA n 
12 71  ARG n 
12 72  LEU n 
12 73  LYS n 
12 74  MET n 
12 75  TYR n 
12 76  LYS n 
12 77  HIS n 
12 78  SER n 
12 79  ASN n 
12 80  ASN n 
12 81  LYS n 
12 82  ALA n 
12 83  MET n 
12 84  THR n 
12 85  THR n 
12 86  GLY n 
12 87  ALA n 
12 88  ILE n 
12 89  ALA n 
12 90  ALA n 
12 91  MET n 
12 92  LEU n 
12 93  SER n 
12 94  THR n 
12 95  ILE n 
12 96  LEU n 
12 97  TYR n 
12 98  SER n 
12 99  ARG n 
12 100 ARG n 
12 101 PHE n 
12 102 PHE n 
12 103 PRO n 
12 104 TYR n 
12 105 TYR n 
12 106 VAL n 
12 107 TYR n 
12 108 ASN n 
12 109 ILE n 
12 110 ILE n 
12 111 GLY n 
12 112 GLY n 
12 113 LEU n 
12 114 ASP n 
12 115 GLU n 
12 116 GLU n 
12 117 GLY n 
12 118 LYS n 
12 119 GLY n 
12 120 ALA n 
12 121 VAL n 
12 122 TYR n 
12 123 SER n 
12 124 PHE n 
12 125 ASP n 
12 126 PRO n 
12 127 VAL n 
12 128 GLY n 
12 129 SER n 
12 130 TYR n 
12 131 GLN n 
12 132 ARG n 
12 133 ASP n 
12 134 SER n 
12 135 PHE n 
12 136 LYS n 
12 137 ALA n 
12 138 GLY n 
12 139 GLY n 
12 140 SER n 
12 141 ALA n 
12 142 SER n 
12 143 ALA n 
12 144 MET n 
12 145 LEU n 
12 146 GLN n 
12 147 PRO n 
12 148 LEU n 
12 149 LEU n 
12 150 ASP n 
12 151 ASN n 
12 152 GLN n 
12 153 VAL n 
12 154 GLY n 
12 155 PHE n 
12 156 LYS n 
12 157 ASN n 
12 158 MET n 
12 159 GLN n 
12 160 ASN n 
12 161 VAL n 
12 162 GLU n 
12 163 HIS n 
12 164 VAL n 
12 165 PRO n 
12 166 LEU n 
12 167 THR n 
12 168 LEU n 
12 169 ASP n 
12 170 ARG n 
12 171 ALA n 
12 172 MET n 
12 173 ARG n 
12 174 LEU n 
12 175 VAL n 
12 176 LYS n 
12 177 ASP n 
12 178 VAL n 
12 179 PHE n 
12 180 ILE n 
12 181 SER n 
12 182 ALA n 
12 183 ALA n 
12 184 GLU n 
12 185 ARG n 
12 186 ASP n 
12 187 VAL n 
12 188 TYR n 
12 189 THR n 
12 190 GLY n 
12 191 ASP n 
12 192 ALA n 
12 193 LEU n 
12 194 ARG n 
12 195 ILE n 
12 196 CYS n 
12 197 ILE n 
12 198 VAL n 
12 199 THR n 
12 200 LYS n 
12 201 GLU n 
12 202 GLY n 
12 203 ILE n 
12 204 ARG n 
12 205 GLU n 
12 206 GLU n 
12 207 THR n 
12 208 VAL n 
12 209 PRO n 
12 210 LEU n 
12 211 ARG n 
12 212 LYS n 
12 213 ASP n 
13 1   THR n 
13 2   GLN n 
13 3   ASN n 
13 4   PRO n 
13 5   MET n 
13 6   VAL n 
13 7   THR n 
13 8   GLY n 
13 9   THR n 
13 10  SER n 
13 11  VAL n 
13 12  LEU n 
13 13  GLY n 
13 14  VAL n 
13 15  LYS n 
13 16  PHE n 
13 17  ASP n 
13 18  GLY n 
13 19  GLY n 
13 20  VAL n 
13 21  VAL n 
13 22  ILE n 
13 23  ALA n 
13 24  ALA n 
13 25  ASP n 
13 26  MET n 
13 27  LEU n 
13 28  GLY n 
13 29  SER n 
13 30  TYR n 
13 31  GLY n 
13 32  SER n 
13 33  LEU n 
13 34  ALA n 
13 35  ARG n 
13 36  PHE n 
13 37  ARG n 
13 38  ASN n 
13 39  ILE n 
13 40  SER n 
13 41  ARG n 
13 42  ILE n 
13 43  MET n 
13 44  ARG n 
13 45  VAL n 
13 46  ASN n 
13 47  ASP n 
13 48  SER n 
13 49  THR n 
13 50  MET n 
13 51  LEU n 
13 52  GLY n 
13 53  ALA n 
13 54  SER n 
13 55  GLY n 
13 56  ASP n 
13 57  TYR n 
13 58  ALA n 
13 59  ASP n 
13 60  PHE n 
13 61  GLN n 
13 62  TYR n 
13 63  LEU n 
13 64  LYS n 
13 65  GLN n 
13 66  VAL n 
13 67  LEU n 
13 68  GLY n 
13 69  GLN n 
13 70  MET n 
13 71  VAL n 
13 72  ILE n 
13 73  ASP n 
13 74  GLU n 
13 75  GLU n 
13 76  LEU n 
13 77  LEU n 
13 78  GLY n 
13 79  ASP n 
13 80  GLY n 
13 81  HIS n 
13 82  SER n 
13 83  TYR n 
13 84  SER n 
13 85  PRO n 
13 86  ARG n 
13 87  ALA n 
13 88  ILE n 
13 89  HIS n 
13 90  SER n 
13 91  TRP n 
13 92  LEU n 
13 93  THR n 
13 94  ARG n 
13 95  ALA n 
13 96  MET n 
13 97  TYR n 
13 98  SER n 
13 99  ARG n 
13 100 ARG n 
13 101 SER n 
13 102 LYS n 
13 103 MET n 
13 104 ASN n 
13 105 PRO n 
13 106 LEU n 
13 107 TRP n 
13 108 ASN n 
13 109 THR n 
13 110 MET n 
13 111 VAL n 
13 112 ILE n 
13 113 GLY n 
13 114 GLY n 
13 115 TYR n 
13 116 ALA n 
13 117 ASP n 
13 118 GLY n 
13 119 GLU n 
13 120 SER n 
13 121 PHE n 
13 122 LEU n 
13 123 GLY n 
13 124 TYR n 
13 125 VAL n 
13 126 ASP n 
13 127 MET n 
13 128 LEU n 
13 129 GLY n 
13 130 VAL n 
13 131 ALA n 
13 132 TYR n 
13 133 GLU n 
13 134 ALA n 
13 135 PRO n 
13 136 SER n 
13 137 LEU n 
13 138 ALA n 
13 139 THR n 
13 140 GLY n 
13 141 TYR n 
13 142 GLY n 
13 143 ALA n 
13 144 TYR n 
13 145 LEU n 
13 146 ALA n 
13 147 GLN n 
13 148 PRO n 
13 149 LEU n 
13 150 LEU n 
13 151 ARG n 
13 152 GLU n 
13 153 VAL n 
13 154 LEU n 
13 155 GLU n 
13 156 LYS n 
13 157 GLN n 
13 158 PRO n 
13 159 VAL n 
13 160 LEU n 
13 161 SER n 
13 162 GLN n 
13 163 THR n 
13 164 GLU n 
13 165 ALA n 
13 166 ARG n 
13 167 GLU n 
13 168 LEU n 
13 169 VAL n 
13 170 GLU n 
13 171 ARG n 
13 172 CYS n 
13 173 MET n 
13 174 ARG n 
13 175 VAL n 
13 176 LEU n 
13 177 TYR n 
13 178 TYR n 
13 179 ARG n 
13 180 ASP n 
13 181 ALA n 
13 182 ARG n 
13 183 SER n 
13 184 TYR n 
13 185 ASN n 
13 186 ARG n 
13 187 PHE n 
13 188 GLN n 
13 189 ILE n 
13 190 ALA n 
13 191 THR n 
13 192 VAL n 
13 193 THR n 
13 194 GLU n 
13 195 LYS n 
13 196 GLY n 
13 197 VAL n 
13 198 GLU n 
13 199 ILE n 
13 200 GLU n 
13 201 GLY n 
13 202 PRO n 
13 203 LEU n 
13 204 SER n 
13 205 ALA n 
13 206 GLN n 
13 207 THR n 
13 208 ASN n 
13 209 TRP n 
13 210 ASP n 
13 211 ILE n 
13 212 ALA n 
13 213 HIS n 
13 214 MET n 
13 215 ILE n 
13 216 SER n 
13 217 GLY n 
13 218 PHE n 
13 219 GLU n 
14 1   THR n 
14 2   THR n 
14 3   ILE n 
14 4   MET n 
14 5   ALA n 
14 6   VAL n 
14 7   GLN n 
14 8   PHE n 
14 9   ASN n 
14 10  GLY n 
14 11  GLY n 
14 12  VAL n 
14 13  VAL n 
14 14  LEU n 
14 15  GLY n 
14 16  ALA n 
14 17  ASP n 
14 18  SER n 
14 19  ARG n 
14 20  THR n 
14 21  THR n 
14 22  THR n 
14 23  GLY n 
14 24  SER n 
14 25  TYR n 
14 26  ILE n 
14 27  ALA n 
14 28  ASN n 
14 29  ARG n 
14 30  VAL n 
14 31  THR n 
14 32  ASP n 
14 33  LYS n 
14 34  LEU n 
14 35  THR n 
14 36  PRO n 
14 37  ILE n 
14 38  HIS n 
14 39  ASP n 
14 40  HIS n 
14 41  ILE n 
14 42  PHE n 
14 43  CYS n 
14 44  CYS n 
14 45  ARG n 
14 46  SER n 
14 47  GLY n 
14 48  SER n 
14 49  ALA n 
14 50  ALA n 
14 51  ASP n 
14 52  THR n 
14 53  GLN n 
14 54  ALA n 
14 55  VAL n 
14 56  ALA n 
14 57  ASP n 
14 58  ALA n 
14 59  VAL n 
14 60  THR n 
14 61  TYR n 
14 62  GLN n 
14 63  LEU n 
14 64  GLY n 
14 65  PHE n 
14 66  HIS n 
14 67  SER n 
14 68  ILE n 
14 69  GLU n 
14 70  LEU n 
14 71  ASN n 
14 72  GLU n 
14 73  PRO n 
14 74  PRO n 
14 75  LEU n 
14 76  VAL n 
14 77  HIS n 
14 78  THR n 
14 79  ALA n 
14 80  ALA n 
14 81  SER n 
14 82  LEU n 
14 83  PHE n 
14 84  LYS n 
14 85  GLU n 
14 86  MET n 
14 87  CYS n 
14 88  TYR n 
14 89  ARG n 
14 90  TYR n 
14 91  ARG n 
14 92  GLU n 
14 93  ASP n 
14 94  LEU n 
14 95  MET n 
14 96  ALA n 
14 97  GLY n 
14 98  ILE n 
14 99  ILE n 
14 100 ILE n 
14 101 ALA n 
14 102 GLY n 
14 103 TRP n 
14 104 ASP n 
14 105 PRO n 
14 106 GLN n 
14 107 GLU n 
14 108 GLY n 
14 109 GLY n 
14 110 GLN n 
14 111 VAL n 
14 112 TYR n 
14 113 SER n 
14 114 VAL n 
14 115 PRO n 
14 116 MET n 
14 117 GLY n 
14 118 GLY n 
14 119 MET n 
14 120 MET n 
14 121 VAL n 
14 122 ARG n 
14 123 GLN n 
14 124 SER n 
14 125 PHE n 
14 126 ALA n 
14 127 ILE n 
14 128 GLY n 
14 129 GLY n 
14 130 SER n 
14 131 GLY n 
14 132 SER n 
14 133 SER n 
14 134 TYR n 
14 135 ILE n 
14 136 TYR n 
14 137 GLY n 
14 138 TYR n 
14 139 VAL n 
14 140 ASP n 
14 141 ALA n 
14 142 THR n 
14 143 TYR n 
14 144 ARG n 
14 145 GLU n 
14 146 GLY n 
14 147 MET n 
14 148 THR n 
14 149 LYS n 
14 150 ASP n 
14 151 GLU n 
14 152 CYS n 
14 153 LEU n 
14 154 GLN n 
14 155 PHE n 
14 156 THR n 
14 157 ALA n 
14 158 ASN n 
14 159 ALA n 
14 160 LEU n 
14 161 ALA n 
14 162 LEU n 
14 163 ALA n 
14 164 MET n 
14 165 GLU n 
14 166 ARG n 
14 167 ASP n 
14 168 GLY n 
14 169 SER n 
14 170 SER n 
14 171 GLY n 
14 172 GLY n 
14 173 VAL n 
14 174 ILE n 
14 175 ARG n 
14 176 LEU n 
14 177 ALA n 
14 178 ALA n 
14 179 ILE n 
14 180 GLN n 
14 181 GLU n 
14 182 SER n 
14 183 GLY n 
14 184 VAL n 
14 185 GLU n 
14 186 ARG n 
14 187 GLN n 
14 188 VAL n 
14 189 LEU n 
14 190 LEU n 
14 191 GLY n 
14 192 ASP n 
14 193 GLN n 
14 194 ILE n 
14 195 PRO n 
14 196 LYS n 
14 197 PHE n 
14 198 THR n 
14 199 ILE n 
14 200 ALA n 
14 201 THR n 
14 202 LEU n 
14 203 PRO n 
14 204 PRO n 
14 205 PRO n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP PSA2_MOUSE P49722 1  
;MAKRGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
;
1  ? 
2  UNP PSA4_MOUSE Q9R1P0 2  
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
;
1  ? 
3  UNP PSA7_MOUSE Q9Z2U0 3  
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
1  ? 
4  UNP PSA5_MOUSE Q9Z2U1 4  
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
1  ? 
5  UNP PSA1_MOUSE Q9R1P4 5  
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAAEEPAEKADEPMEH
;
1  ? 
6  UNP PSA3_MOUSE O70435 6  
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
1  ? 
7  UNP PSA6_MOUSE Q9QUM9 7  
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
1  ? 
8  UNP PSB7_MOUSE P70195 8  
;TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTAN
RMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIA
AGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS
;
44 ? 
9  UNP PSB3_MOUSE Q9R1P1 9  
;MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR
QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDP
EHLFETISQAMLNAVDRDAVSGMGVIVHVIEKDKITTRTLKARMD
;
1  ? 
10 UNP PSB2_MOUSE Q9R1P3 10 
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPKRDS
;
1  ? 
11 UNP PSB5_MOUSE O55234 11 
;TTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS
KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAI
YQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP
;
60 ? 
12 UNP PSB1_MOUSE O09061 12 
;RFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN
KAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN
VEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
;
28 ? 
13 UNP PSB4_MOUSE P99026 13 
;TQNPMVTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDG
HSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVL
SQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNWDIAHMISGFE
;
46 ? 
14 UNP PSB6_MOUSE Q60692 14 
;TTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAA
SLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANAL
ALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP
;
34 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3UNE A 1 ? 234 ? P49722 1  ? 234 ? 0 233 
2  2  3UNE B 1 ? 261 ? Q9R1P0 1  ? 261 ? 1 261 
3  3  3UNE C 1 ? 248 ? Q9Z2U0 1  ? 248 ? 1 248 
4  4  3UNE D 1 ? 241 ? Q9Z2U1 1  ? 241 ? 1 241 
5  5  3UNE E 1 ? 263 ? Q9R1P4 1  ? 263 ? 1 263 
6  6  3UNE F 1 ? 255 ? O70435 1  ? 255 ? 0 254 
7  7  3UNE G 1 ? 246 ? Q9QUM9 1  ? 246 ? 1 246 
8  8  3UNE H 1 ? 234 ? P70195 44 ? 277 ? 1 234 
9  9  3UNE I 1 ? 205 ? Q9R1P1 1  ? 205 ? 0 204 
10 10 3UNE J 1 ? 201 ? Q9R1P3 1  ? 201 ? 1 201 
11 11 3UNE K 1 ? 205 ? O55234 60 ? 264 ? 1 205 
12 12 3UNE L 1 ? 213 ? O09061 28 ? 240 ? 1 213 
13 13 3UNE M 1 ? 219 ? P99026 46 ? 264 ? 1 219 
14 14 3UNE N 1 ? 205 ? Q60692 34 ? 238 ? 1 205 
15 1  3UNE O 1 ? 234 ? P49722 1  ? 234 ? 0 233 
16 2  3UNE P 1 ? 261 ? Q9R1P0 1  ? 261 ? 1 261 
17 3  3UNE Q 1 ? 248 ? Q9Z2U0 1  ? 248 ? 1 248 
18 4  3UNE R 1 ? 241 ? Q9Z2U1 1  ? 241 ? 1 241 
19 5  3UNE S 1 ? 263 ? Q9R1P4 1  ? 263 ? 1 263 
20 6  3UNE T 1 ? 255 ? O70435 1  ? 255 ? 0 254 
21 7  3UNE U 1 ? 246 ? Q9QUM9 1  ? 246 ? 1 246 
22 8  3UNE V 1 ? 234 ? P70195 44 ? 277 ? 1 234 
23 9  3UNE W 1 ? 205 ? Q9R1P1 1  ? 205 ? 0 204 
24 10 3UNE X 1 ? 201 ? Q9R1P3 1  ? 201 ? 1 201 
25 11 3UNE Y 1 ? 205 ? O55234 60 ? 264 ? 1 205 
26 12 3UNE Z 1 ? 213 ? O09061 28 ? 240 ? 1 213 
27 13 3UNE a 1 ? 219 ? P99026 46 ? 264 ? 1 219 
28 14 3UNE b 1 ? 205 ? Q60692 34 ? 238 ? 1 205 
29 1  3UNE c 1 ? 234 ? P49722 1  ? 234 ? 0 233 
30 2  3UNE d 1 ? 261 ? Q9R1P0 1  ? 261 ? 1 261 
31 3  3UNE e 1 ? 248 ? Q9Z2U0 1  ? 248 ? 1 248 
32 4  3UNE f 1 ? 241 ? Q9Z2U1 1  ? 241 ? 1 241 
33 5  3UNE g 1 ? 263 ? Q9R1P4 1  ? 263 ? 1 263 
34 6  3UNE h 1 ? 255 ? O70435 1  ? 255 ? 0 254 
35 7  3UNE i 1 ? 246 ? Q9QUM9 1  ? 246 ? 1 246 
36 8  3UNE j 1 ? 234 ? P70195 44 ? 277 ? 1 234 
37 9  3UNE k 1 ? 205 ? Q9R1P1 1  ? 205 ? 0 204 
38 10 3UNE l 1 ? 201 ? Q9R1P3 1  ? 201 ? 1 201 
39 11 3UNE m 1 ? 205 ? O55234 60 ? 264 ? 1 205 
40 12 3UNE n 1 ? 213 ? O09061 28 ? 240 ? 1 213 
41 13 3UNE o 1 ? 219 ? P99026 46 ? 264 ? 1 219 
42 14 3UNE p 1 ? 205 ? Q60692 34 ? 238 ? 1 205 
43 1  3UNE q 1 ? 234 ? P49722 1  ? 234 ? 0 233 
44 2  3UNE r 1 ? 261 ? Q9R1P0 1  ? 261 ? 1 261 
45 3  3UNE s 1 ? 248 ? Q9Z2U0 1  ? 248 ? 1 248 
46 4  3UNE t 1 ? 241 ? Q9Z2U1 1  ? 241 ? 1 241 
47 5  3UNE u 1 ? 263 ? Q9R1P4 1  ? 263 ? 1 263 
48 6  3UNE v 1 ? 255 ? O70435 1  ? 255 ? 0 254 
49 7  3UNE w 1 ? 246 ? Q9QUM9 1  ? 246 ? 1 246 
50 8  3UNE x 1 ? 234 ? P70195 44 ? 277 ? 1 234 
51 9  3UNE y 1 ? 205 ? Q9R1P1 1  ? 205 ? 0 204 
52 10 3UNE z 1 ? 201 ? Q9R1P3 1  ? 201 ? 1 201 
53 11 3UNE 1 1 ? 205 ? O55234 60 ? 264 ? 1 205 
54 12 3UNE 2 1 ? 213 ? O09061 28 ? 240 ? 1 213 
55 13 3UNE 3 1 ? 219 ? P99026 46 ? 264 ? 1 219 
56 14 3UNE 4 1 ? 205 ? Q60692 34 ? 238 ? 1 205 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3UNE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.2 M KAc, 40% MPD, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-05-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double-crystal fixed-exit monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3UNE 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            3.2 
_reflns.number_obs                   235050 
_reflns.number_all                   236232 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.2 
_reflns_shell.d_res_low              3.3 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.597 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3UNE 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     223279 
_refine.ls_number_reflns_all                     235031 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    98.14 
_refine.ls_R_factor_obs                          0.22174 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22044 
_refine.ls_R_factor_R_free                       0.24636 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  11752 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.934 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.B_iso_mean                               78.682 
_refine.aniso_B[1][1]                            -0.58 
_refine.aniso_B[2][2]                            2.37 
_refine.aniso_B[3][3]                            -4.16 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -3.82 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      'pdb entry 1IRU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.535 
_refine.overall_SU_ML                            0.458 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             61.794 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        97316 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             640 
_refine_hist.number_atoms_total               97956 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.004  0.020  ? 99076  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.753  1.965  ? 133844 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       3.411  5.000  ? 12468  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.960 23.822 ? 4364   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.390 15.000 ? 17400  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       10.053 15.000 ? 684    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.048  0.200  ? 15024  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 74248  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           0.442  3.000  ? 99076  'X-RAY DIFFRACTION' ? 
r_sphericity_free            27.425 5.000  ? 367    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          3.628  5.000  ? 97593  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.200 
_refine_ls_shell.d_res_low                        3.279 
_refine_ls_shell.number_reflns_R_work             12771 
_refine_ls_shell.R_factor_R_work                  0.316 
_refine_ls_shell.percent_reflns_obs               80.74 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             669 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3UNE 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000  0.000000  0.000000  0.000000  1.000000 0.000000  0.000000  0.000000 1.000000  0.00000   0.00000  0.00000    
2 given ? -0.998889 0.037819  0.028104  0.040888  0.992154 0.118148  -0.023415 0.119166 -0.992598 31.62780  -3.75722 49.05656   
3 given ? 0.997958  0.061723  -0.016453 -0.062690 0.995797 -0.066776 0.012262  0.067671 0.997632  -49.53659 13.97071 -109.84821 
4 given ? -0.999912 -0.010363 0.008241  -0.009947 0.998752 0.048934  -0.008737 0.048848 -0.998768 82.32807  -5.54937 158.71318  
# 
_struct.entry_id                  3UNE 
_struct.title                     'Mouse constitutive 20S proteasome' 
_struct.pdbx_descriptor           
;Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UNE 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            '20S proteasome comprises 28 subunits, Protease, Cytosol, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 1  ? 
P  N N 2  ? 
Q  N N 3  ? 
R  N N 4  ? 
S  N N 5  ? 
T  N N 6  ? 
U  N N 7  ? 
V  N N 8  ? 
W  N N 9  ? 
X  N N 10 ? 
Y  N N 11 ? 
Z  N N 12 ? 
AA N N 13 ? 
BA N N 14 ? 
CA N N 1  ? 
DA N N 2  ? 
EA N N 3  ? 
FA N N 4  ? 
GA N N 5  ? 
HA N N 6  ? 
IA N N 7  ? 
JA N N 8  ? 
KA N N 9  ? 
LA N N 10 ? 
MA N N 11 ? 
NA N N 12 ? 
OA N N 13 ? 
PA N N 14 ? 
QA N N 1  ? 
RA N N 2  ? 
SA N N 3  ? 
TA N N 4  ? 
UA N N 5  ? 
VA N N 6  ? 
WA N N 7  ? 
XA N N 8  ? 
YA N N 9  ? 
ZA N N 10 ? 
AB N N 11 ? 
BB N N 12 ? 
CB N N 13 ? 
DB N N 14 ? 
EB N N 15 ? 
FB N N 15 ? 
GB N N 15 ? 
HB N N 15 ? 
IB N N 15 ? 
JB N N 15 ? 
KB N N 15 ? 
LB N N 15 ? 
MB N N 15 ? 
NB N N 15 ? 
OB N N 15 ? 
PB N N 15 ? 
QB N N 15 ? 
RB N N 15 ? 
SB N N 15 ? 
TB N N 15 ? 
UB N N 15 ? 
VB N N 15 ? 
WB N N 15 ? 
XB N N 15 ? 
YB N N 15 ? 
ZB N N 15 ? 
AC N N 15 ? 
BC N N 15 ? 
CC N N 15 ? 
DC N N 15 ? 
EC N N 15 ? 
FC N N 15 ? 
GC N N 15 ? 
HC N N 15 ? 
IC N N 15 ? 
JC N N 15 ? 
KC N N 15 ? 
LC N N 15 ? 
MC N N 15 ? 
NC N N 15 ? 
OC N N 15 ? 
PC N N 15 ? 
QC N N 15 ? 
RC N N 15 ? 
SC N N 15 ? 
TC N N 15 ? 
UC N N 15 ? 
VC N N 15 ? 
WC N N 15 ? 
XC N N 15 ? 
YC N N 15 ? 
ZC N N 15 ? 
AD N N 15 ? 
BD N N 15 ? 
CD N N 15 ? 
DD N N 15 ? 
ED N N 15 ? 
FD N N 15 ? 
GD N N 15 ? 
HD N N 15 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   LEU A  19  ? GLY A  31  ? LEU A 18  GLY A 30  1 ? 13 
HELX_P HELX_P2   2   MET A  79  ? GLN A  102 ? MET A 78  GLN A 101 1 ? 24 
HELX_P HELX_P3   3   PRO A  106 ? TYR A  121 ? PRO A 105 TYR A 120 1 ? 16 
HELX_P HELX_P4   4   ASN A  166 ? TYR A  178 ? ASN A 165 TYR A 177 1 ? 13 
HELX_P HELX_P5   5   GLU A  183 ? LEU A  195 ? GLU A 182 LEU A 194 1 ? 13 
HELX_P HELX_P6   6   LYS A  196 ? PHE A  199 ? LYS A 195 PHE A 198 5 ? 4  
HELX_P HELX_P7   7   THR A  222 ? TYR A  229 ? THR A 221 TYR A 228 1 ? 8  
HELX_P HELX_P8   8   LEU B  18  ? GLY B  29  ? LEU B 18  GLY B 29  1 ? 12 
HELX_P HELX_P9   9   ILE B  79  ? GLN B  102 ? ILE B 79  GLN B 102 1 ? 24 
HELX_P HELX_P10  10  PRO B  106 ? PHE B  124 ? PRO B 106 PHE B 124 1 ? 19 
HELX_P HELX_P11  11  ASN B  167 ? TYR B  179 ? ASN B 167 TYR B 179 1 ? 13 
HELX_P HELX_P12  12  THR B  185 ? THR B  200 ? THR B 185 THR B 200 1 ? 16 
HELX_P HELX_P13  13  LYS B  229 ? ALA B  247 ? LYS B 229 ALA B 247 1 ? 19 
HELX_P HELX_P14  14  LEU C  16  ? GLY C  29  ? LEU C 16  GLY C 29  1 ? 14 
HELX_P HELX_P15  15  LEU C  76  ? VAL C  98  ? LEU C 76  VAL C 98  1 ? 23 
HELX_P HELX_P16  16  THR C  103 ? TYR C  118 ? THR C 103 TYR C 118 1 ? 16 
HELX_P HELX_P17  17  GLY C  164 ? TYR C  176 ? GLY C 164 TYR C 176 1 ? 13 
HELX_P HELX_P18  18  THR C  183 ? LEU C  196 ? THR C 183 LEU C 196 1 ? 14 
HELX_P HELX_P19  19  ASN C  221 ? GLU C  240 ? ASN C 221 GLU C 240 1 ? 20 
HELX_P HELX_P20  20  LEU D  21  ? LYS D  32  ? LEU D 21  LYS D 32  1 ? 12 
HELX_P HELX_P21  21  LEU D  81  ? ASN D  104 ? LEU D 81  ASN D 104 1 ? 24 
HELX_P HELX_P22  22  THR D  108 ? ASN D  118 ? THR D 108 ASN D 118 1 ? 11 
HELX_P HELX_P23  23  ALA D  173 ? GLU D  183 ? ALA D 173 GLU D 183 1 ? 11 
HELX_P HELX_P24  24  THR D  190 ? MET D  206 ? THR D 190 MET D 206 1 ? 17 
HELX_P HELX_P25  25  THR D  230 ? LYS D  239 ? THR D 230 LYS D 239 1 ? 10 
HELX_P HELX_P26  26  ILE E  19  ? GLY E  32  ? ILE E 19  GLY E 32  1 ? 14 
HELX_P HELX_P27  27  LEU E  77  ? PHE E  99  ? LEU E 77  PHE E 99  1 ? 23 
HELX_P HELX_P28  28  PRO E  104 ? THR E  116 ? PRO E 104 THR E 116 1 ? 13 
HELX_P HELX_P29  29  SER E  165 ? HIS E  175 ? SER E 165 HIS E 175 1 ? 11 
HELX_P HELX_P30  30  GLU E  178 ? CYS E  182 ? GLU E 178 CYS E 182 5 ? 5  
HELX_P HELX_P31  31  ASN E  183 ? LEU E  199 ? ASN E 183 LEU E 199 1 ? 17 
HELX_P HELX_P32  32  VAL E  229 ? ASP E  234 ? VAL E 229 ASP E 234 1 ? 6  
HELX_P HELX_P33  33  VAL F  21  ? ASN F  33  ? VAL F 20  ASN F 32  1 ? 13 
HELX_P HELX_P34  34  LEU F  81  ? PHE F  103 ? LEU F 80  PHE F 102 1 ? 23 
HELX_P HELX_P35  35  PRO F  108 ? ALA F  122 ? PRO F 107 ALA F 121 1 ? 15 
HELX_P HELX_P36  36  ALA F  169 ? GLU F  178 ? ALA F 168 GLU F 177 1 ? 10 
HELX_P HELX_P37  37  THR F  186 ? HIS F  202 ? THR F 185 HIS F 201 1 ? 17 
HELX_P HELX_P38  38  PRO F  229 ? SER F  243 ? PRO F 228 SER F 242 1 ? 15 
HELX_P HELX_P39  39  LEU G  22  ? ASN G  33  ? LEU G 22  ASN G 33  1 ? 12 
HELX_P HELX_P40  40  MET G  83  ? GLY G  106 ? MET G 83  GLY G 106 1 ? 24 
HELX_P HELX_P41  41  PRO G  110 ? ASN G  128 ? PRO G 110 ASN G 128 1 ? 19 
HELX_P HELX_P42  42  LYS G  171 ? LYS G  185 ? LYS G 171 LYS G 185 1 ? 15 
HELX_P HELX_P43  43  THR G  190 ? LEU G  206 ? THR G 190 LEU G 206 1 ? 17 
HELX_P HELX_P44  44  LEU G  230 ? ALA G  243 ? LEU G 230 ALA G 243 1 ? 14 
HELX_P HELX_P45  45  THR H  48  ? GLY H  71  ? THR H 48  GLY H 71  1 ? 24 
HELX_P HELX_P46  46  ARG H  75  ? TYR H  90  ? ARG H 75  TYR H 90  1 ? 16 
HELX_P HELX_P47  47  GLY H  130 ? PHE H  142 ? GLY H 130 PHE H 142 1 ? 13 
HELX_P HELX_P48  48  GLU H  147 ? ASP H  166 ? GLU H 147 ASP H 166 1 ? 20 
HELX_P HELX_P49  49  LEU I  56  ? GLU I  78  ? LEU I 55  GLU I 77  1 ? 23 
HELX_P HELX_P50  50  LYS I  83  ? GLU I  97  ? LYS I 82  GLU I 96  1 ? 15 
HELX_P HELX_P51  51  CYS I  142 ? TRP I  154 ? CYS I 141 TRP I 153 1 ? 13 
HELX_P HELX_P52  52  ASP I  159 ? ASP I  176 ? ASP I 158 ASP I 175 1 ? 18 
HELX_P HELX_P53  53  GLY J  51  ? GLY J  72  ? GLY J 51  GLY J 72  1 ? 22 
HELX_P HELX_P54  54  SER J  76  ? ARG J  93  ? SER J 76  ARG J 93  1 ? 18 
HELX_P HELX_P55  55  GLY J  135 ? TYR J  146 ? GLY J 135 TYR J 146 1 ? 12 
HELX_P HELX_P56  56  SER J  152 ? ARG J  170 ? SER J 152 ARG J 170 1 ? 19 
HELX_P HELX_P57  57  GLY K  48  ? LYS K  71  ? GLY K 48  LYS K 71  1 ? 24 
HELX_P HELX_P58  58  SER K  75  ? GLN K  89  ? SER K 75  GLN K 89  1 ? 15 
HELX_P HELX_P59  59  GLY K  131 ? GLY K  142 ? GLY K 131 GLY K 142 1 ? 12 
HELX_P HELX_P60  60  LYS K  148 ? ASP K  167 ? LYS K 148 ASP K 167 1 ? 20 
HELX_P HELX_P61  61  VAL K  192 ? SER K  201 ? VAL K 192 SER K 201 1 ? 10 
HELX_P HELX_P62  62  PHE L  57  ? ASN L  80  ? PHE L 57  ASN L 80  1 ? 24 
HELX_P HELX_P63  63  THR L  84  ? ARG L  99  ? THR L 84  ARG L 99  1 ? 16 
HELX_P HELX_P64  64  ALA L  141 ? VAL L  153 ? ALA L 141 VAL L 153 1 ? 13 
HELX_P HELX_P65  65  THR L  167 ? ASP L  186 ? THR L 167 ASP L 186 1 ? 20 
HELX_P HELX_P66  66  TYR M  57  ? GLY M  78  ? TYR M 57  GLY M 78  1 ? 22 
HELX_P HELX_P67  67  SER M  84  ? LYS M  102 ? SER M 84  LYS M 102 1 ? 19 
HELX_P HELX_P68  68  TYR M  141 ? GLN M  157 ? TYR M 141 GLN M 157 1 ? 17 
HELX_P HELX_P69  69  SER M  161 ? ASP M  180 ? SER M 161 ASP M 180 1 ? 20 
HELX_P HELX_P70  70  TRP M  209 ? HIS M  213 ? TRP M 209 HIS M 213 5 ? 5  
HELX_P HELX_P71  71  SER N  48  ? ASN N  71  ? SER N 48  ASN N 71  1 ? 24 
HELX_P HELX_P72  72  LEU N  75  ? TYR N  90  ? LEU N 75  TYR N 90  1 ? 16 
HELX_P HELX_P73  73  GLY N  131 ? TYR N  134 ? GLY N 131 TYR N 134 5 ? 4  
HELX_P HELX_P74  74  ILE N  135 ? TYR N  143 ? ILE N 135 TYR N 143 1 ? 9  
HELX_P HELX_P75  75  THR N  148 ? ASP N  167 ? THR N 148 ASP N 167 1 ? 20 
HELX_P HELX_P76  76  LEU O  19  ? GLY O  31  ? LEU O 18  GLY O 30  1 ? 13 
HELX_P HELX_P77  77  MET O  79  ? GLN O  102 ? MET O 78  GLN O 101 1 ? 24 
HELX_P HELX_P78  78  PRO O  106 ? TYR O  121 ? PRO O 105 TYR O 120 1 ? 16 
HELX_P HELX_P79  79  ASN O  166 ? TYR O  178 ? ASN O 165 TYR O 177 1 ? 13 
HELX_P HELX_P80  80  GLU O  183 ? LEU O  195 ? GLU O 182 LEU O 194 1 ? 13 
HELX_P HELX_P81  81  LYS O  196 ? PHE O  199 ? LYS O 195 PHE O 198 5 ? 4  
HELX_P HELX_P82  82  THR O  222 ? ALA O  231 ? THR O 221 ALA O 230 1 ? 10 
HELX_P HELX_P83  83  LEU P  18  ? GLY P  29  ? LEU P 18  GLY P 29  1 ? 12 
HELX_P HELX_P84  84  ILE P  79  ? GLN P  102 ? ILE P 79  GLN P 102 1 ? 24 
HELX_P HELX_P85  85  PRO P  106 ? PHE P  124 ? PRO P 106 PHE P 124 1 ? 19 
HELX_P HELX_P86  86  ASN P  167 ? TYR P  179 ? ASN P 167 TYR P 179 1 ? 13 
HELX_P HELX_P87  87  THR P  185 ? MET P  201 ? THR P 185 MET P 201 1 ? 17 
HELX_P HELX_P88  88  LYS P  229 ? LYS P  246 ? LYS P 229 LYS P 246 1 ? 18 
HELX_P HELX_P89  89  LEU Q  16  ? GLY Q  29  ? LEU Q 16  GLY Q 29  1 ? 14 
HELX_P HELX_P90  90  LEU Q  76  ? VAL Q  98  ? LEU Q 76  VAL Q 98  1 ? 23 
HELX_P HELX_P91  91  THR Q  103 ? TYR Q  118 ? THR Q 103 TYR Q 118 1 ? 16 
HELX_P HELX_P92  92  GLY Q  164 ? GLU Q  173 ? GLY Q 164 GLU Q 173 1 ? 10 
HELX_P HELX_P93  93  THR Q  183 ? LEU Q  196 ? THR Q 183 LEU Q 196 1 ? 14 
HELX_P HELX_P94  94  ASN Q  221 ? GLU Q  240 ? ASN Q 221 GLU Q 240 1 ? 20 
HELX_P HELX_P95  95  LEU R  21  ? LYS R  32  ? LEU R 21  LYS R 32  1 ? 12 
HELX_P HELX_P96  96  LEU R  81  ? ASN R  104 ? LEU R 81  ASN R 104 1 ? 24 
HELX_P HELX_P97  97  THR R  108 ? ASN R  118 ? THR R 108 ASN R 118 1 ? 11 
HELX_P HELX_P98  98  ALA R  173 ? GLU R  183 ? ALA R 173 GLU R 183 1 ? 11 
HELX_P HELX_P99  99  THR R  190 ? MET R  206 ? THR R 190 MET R 206 1 ? 17 
HELX_P HELX_P100 100 THR R  230 ? LYS R  239 ? THR R 230 LYS R 239 1 ? 10 
HELX_P HELX_P101 101 ILE S  19  ? GLY S  32  ? ILE S 19  GLY S 32  1 ? 14 
HELX_P HELX_P102 102 LEU S  77  ? PHE S  99  ? LEU S 77  PHE S 99  1 ? 23 
HELX_P HELX_P103 103 PRO S  104 ? THR S  116 ? PRO S 104 THR S 116 1 ? 13 
HELX_P HELX_P104 104 SER S  165 ? HIS S  175 ? SER S 165 HIS S 175 1 ? 11 
HELX_P HELX_P105 105 ASN S  183 ? LEU S  199 ? ASN S 183 LEU S 199 1 ? 17 
HELX_P HELX_P106 106 VAL S  229 ? ASP S  234 ? VAL S 229 ASP S 234 1 ? 6  
HELX_P HELX_P107 107 VAL T  21  ? SER T  34  ? VAL T 20  SER T 33  1 ? 14 
HELX_P HELX_P108 108 LEU T  81  ? PHE T  103 ? LEU T 80  PHE T 102 1 ? 23 
HELX_P HELX_P109 109 PRO T  108 ? ALA T  122 ? PRO T 107 ALA T 121 1 ? 15 
HELX_P HELX_P110 110 ALA T  169 ? GLU T  178 ? ALA T 168 GLU T 177 1 ? 10 
HELX_P HELX_P111 111 THR T  186 ? HIS T  202 ? THR T 185 HIS T 201 1 ? 17 
HELX_P HELX_P112 112 PRO T  229 ? SER T  243 ? PRO T 228 SER T 242 1 ? 15 
HELX_P HELX_P113 113 LEU U  22  ? ALA U  31  ? LEU U 22  ALA U 31  1 ? 10 
HELX_P HELX_P114 114 MET U  83  ? GLY U  106 ? MET U 83  GLY U 106 1 ? 24 
HELX_P HELX_P115 115 PRO U  110 ? ASN U  128 ? PRO U 110 ASN U 128 1 ? 19 
HELX_P HELX_P116 116 LYS U  171 ? LYS U  185 ? LYS U 171 LYS U 185 1 ? 15 
HELX_P HELX_P117 117 THR U  190 ? LEU U  206 ? THR U 190 LEU U 206 1 ? 17 
HELX_P HELX_P118 118 LEU U  230 ? ALA U  243 ? LEU U 230 ALA U 243 1 ? 14 
HELX_P HELX_P119 119 THR V  48  ? GLY V  71  ? THR V 48  GLY V 71  1 ? 24 
HELX_P HELX_P120 120 ARG V  75  ? TYR V  90  ? ARG V 75  TYR V 90  1 ? 16 
HELX_P HELX_P121 121 GLY V  130 ? PHE V  142 ? GLY V 130 PHE V 142 1 ? 13 
HELX_P HELX_P122 122 GLU V  147 ? ASP V  166 ? GLU V 147 ASP V 166 1 ? 20 
HELX_P HELX_P123 123 LEU W  56  ? GLU W  78  ? LEU W 55  GLU W 77  1 ? 23 
HELX_P HELX_P124 124 LYS W  83  ? GLU W  97  ? LYS W 82  GLU W 96  1 ? 15 
HELX_P HELX_P125 125 CYS W  142 ? TRP W  154 ? CYS W 141 TRP W 153 1 ? 13 
HELX_P HELX_P126 126 ASP W  159 ? ASP W  176 ? ASP W 158 ASP W 175 1 ? 18 
HELX_P HELX_P127 127 GLY X  51  ? GLY X  72  ? GLY X 51  GLY X 72  1 ? 22 
HELX_P HELX_P128 128 SER X  76  ? CYS X  91  ? SER X 76  CYS X 91  1 ? 16 
HELX_P HELX_P129 129 GLY X  135 ? TYR X  146 ? GLY X 135 TYR X 146 1 ? 12 
HELX_P HELX_P130 130 SER X  152 ? ARG X  170 ? SER X 152 ARG X 170 1 ? 19 
HELX_P HELX_P131 131 GLY Y  48  ? LYS Y  71  ? GLY Y 48  LYS Y 71  1 ? 24 
HELX_P HELX_P132 132 SER Y  75  ? GLN Y  89  ? SER Y 75  GLN Y 89  1 ? 15 
HELX_P HELX_P133 133 GLY Y  131 ? GLY Y  142 ? GLY Y 131 GLY Y 142 1 ? 12 
HELX_P HELX_P134 134 LYS Y  148 ? ASP Y  167 ? LYS Y 148 ASP Y 167 1 ? 20 
HELX_P HELX_P135 135 VAL Y  192 ? SER Y  201 ? VAL Y 192 SER Y 201 1 ? 10 
HELX_P HELX_P136 136 PHE Z  57  ? ASN Z  79  ? PHE Z 57  ASN Z 79  1 ? 23 
HELX_P HELX_P137 137 THR Z  84  ? ARG Z  99  ? THR Z 84  ARG Z 99  1 ? 16 
HELX_P HELX_P138 138 ALA Z  141 ? VAL Z  153 ? ALA Z 141 VAL Z 153 1 ? 13 
HELX_P HELX_P139 139 THR Z  167 ? ASP Z  186 ? THR Z 167 ASP Z 186 1 ? 20 
HELX_P HELX_P140 140 TYR AA 57  ? GLY AA 78  ? TYR a 57  GLY a 78  1 ? 22 
HELX_P HELX_P141 141 SER AA 84  ? LYS AA 102 ? SER a 84  LYS a 102 1 ? 19 
HELX_P HELX_P142 142 LEU AA 145 ? GLN AA 157 ? LEU a 145 GLN a 157 1 ? 13 
HELX_P HELX_P143 143 SER AA 161 ? ASP AA 180 ? SER a 161 ASP a 180 1 ? 20 
HELX_P HELX_P144 144 TRP AA 209 ? HIS AA 213 ? TRP a 209 HIS a 213 5 ? 5  
HELX_P HELX_P145 145 SER BA 48  ? ASN BA 71  ? SER b 48  ASN b 71  1 ? 24 
HELX_P HELX_P146 146 LEU BA 75  ? TYR BA 90  ? LEU b 75  TYR b 90  1 ? 16 
HELX_P HELX_P147 147 SER BA 130 ? TYR BA 134 ? SER b 130 TYR b 134 5 ? 5  
HELX_P HELX_P148 148 ILE BA 135 ? TYR BA 143 ? ILE b 135 TYR b 143 1 ? 9  
HELX_P HELX_P149 149 THR BA 148 ? ASP BA 167 ? THR b 148 ASP b 167 1 ? 20 
HELX_P HELX_P150 150 LEU CA 19  ? GLY CA 31  ? LEU c 18  GLY c 30  1 ? 13 
HELX_P HELX_P151 151 MET CA 79  ? GLN CA 102 ? MET c 78  GLN c 101 1 ? 24 
HELX_P HELX_P152 152 PRO CA 106 ? TYR CA 121 ? PRO c 105 TYR c 120 1 ? 16 
HELX_P HELX_P153 153 ASN CA 166 ? TYR CA 178 ? ASN c 165 TYR c 177 1 ? 13 
HELX_P HELX_P154 154 GLU CA 183 ? LYS CA 196 ? GLU c 182 LYS c 195 1 ? 14 
HELX_P HELX_P155 155 THR CA 222 ? LEU CA 230 ? THR c 221 LEU c 229 1 ? 9  
HELX_P HELX_P156 156 LEU DA 18  ? GLY DA 29  ? LEU d 18  GLY d 29  1 ? 12 
HELX_P HELX_P157 157 ILE DA 79  ? GLN DA 102 ? ILE d 79  GLN d 102 1 ? 24 
HELX_P HELX_P158 158 PRO DA 106 ? PHE DA 124 ? PRO d 106 PHE d 124 1 ? 19 
HELX_P HELX_P159 159 ASN DA 167 ? TYR DA 179 ? ASN d 167 TYR d 179 1 ? 13 
HELX_P HELX_P160 160 THR DA 185 ? THR DA 200 ? THR d 185 THR d 200 1 ? 16 
HELX_P HELX_P161 161 LYS DA 229 ? ALA DA 247 ? LYS d 229 ALA d 247 1 ? 19 
HELX_P HELX_P162 162 LEU EA 16  ? LYS EA 28  ? LEU e 16  LYS e 28  1 ? 13 
HELX_P HELX_P163 163 LEU EA 76  ? VAL EA 98  ? LEU e 76  VAL e 98  1 ? 23 
HELX_P HELX_P164 164 THR EA 103 ? TYR EA 118 ? THR e 103 TYR e 118 1 ? 16 
HELX_P HELX_P165 165 GLY EA 164 ? GLU EA 173 ? GLY e 164 GLU e 173 1 ? 10 
HELX_P HELX_P166 166 THR EA 183 ? LEU EA 196 ? THR e 183 LEU e 196 1 ? 14 
HELX_P HELX_P167 167 ASN EA 221 ? LYS EA 236 ? ASN e 221 LYS e 236 1 ? 16 
HELX_P HELX_P168 168 LEU FA 21  ? LYS FA 32  ? LEU f 21  LYS f 32  1 ? 12 
HELX_P HELX_P169 169 LEU FA 81  ? ASN FA 104 ? LEU f 81  ASN f 104 1 ? 24 
HELX_P HELX_P170 170 THR FA 108 ? ASN FA 118 ? THR f 108 ASN f 118 1 ? 11 
HELX_P HELX_P171 171 SER FA 174 ? GLU FA 183 ? SER f 174 GLU f 183 1 ? 10 
HELX_P HELX_P172 172 THR FA 190 ? MET FA 206 ? THR f 190 MET f 206 1 ? 17 
HELX_P HELX_P173 173 THR FA 230 ? LYS FA 239 ? THR f 230 LYS f 239 1 ? 10 
HELX_P HELX_P174 174 ILE GA 19  ? GLY GA 32  ? ILE g 19  GLY g 32  1 ? 14 
HELX_P HELX_P175 175 LEU GA 77  ? PHE GA 99  ? LEU g 77  PHE g 99  1 ? 23 
HELX_P HELX_P176 176 PRO GA 104 ? THR GA 116 ? PRO g 104 THR g 116 1 ? 13 
HELX_P HELX_P177 177 THR GA 116 ? ARG GA 122 ? THR g 116 ARG g 122 1 ? 7  
HELX_P HELX_P178 178 SER GA 165 ? HIS GA 175 ? SER g 165 HIS g 175 1 ? 11 
HELX_P HELX_P179 179 MET GA 176 ? PHE GA 179 ? MET g 176 PHE g 179 5 ? 4  
HELX_P HELX_P180 180 ASN GA 183 ? LEU GA 199 ? ASN g 183 LEU g 199 1 ? 17 
HELX_P HELX_P181 181 VAL GA 229 ? ASP GA 234 ? VAL g 229 ASP g 234 1 ? 6  
HELX_P HELX_P182 182 VAL HA 21  ? SER HA 34  ? VAL h 20  SER h 33  1 ? 14 
HELX_P HELX_P183 183 LEU HA 81  ? PHE HA 103 ? LEU h 80  PHE h 102 1 ? 23 
HELX_P HELX_P184 184 PRO HA 108 ? ALA HA 122 ? PRO h 107 ALA h 121 1 ? 15 
HELX_P HELX_P185 185 ALA HA 169 ? GLU HA 178 ? ALA h 168 GLU h 177 1 ? 10 
HELX_P HELX_P186 186 THR HA 186 ? HIS HA 202 ? THR h 185 HIS h 201 1 ? 17 
HELX_P HELX_P187 187 PRO HA 229 ? SER HA 243 ? PRO h 228 SER h 242 1 ? 15 
HELX_P HELX_P188 188 LEU IA 22  ? ASN IA 33  ? LEU i 22  ASN i 33  1 ? 12 
HELX_P HELX_P189 189 MET IA 83  ? TYR IA 105 ? MET i 83  TYR i 105 1 ? 23 
HELX_P HELX_P190 190 PRO IA 110 ? ASN IA 128 ? PRO i 110 ASN i 128 1 ? 19 
HELX_P HELX_P191 191 LYS IA 171 ? LYS IA 185 ? LYS i 171 LYS i 185 1 ? 15 
HELX_P HELX_P192 192 THR IA 190 ? VAL IA 205 ? THR i 190 VAL i 205 1 ? 16 
HELX_P HELX_P193 193 LEU IA 230 ? VAL IA 240 ? LEU i 230 VAL i 240 1 ? 11 
HELX_P HELX_P194 194 THR JA 48  ? GLY JA 71  ? THR j 48  GLY j 71  1 ? 24 
HELX_P HELX_P195 195 ARG JA 75  ? TYR JA 90  ? ARG j 75  TYR j 90  1 ? 16 
HELX_P HELX_P196 196 GLY JA 130 ? PHE JA 142 ? GLY j 130 PHE j 142 1 ? 13 
HELX_P HELX_P197 197 GLU JA 147 ? ASP JA 166 ? GLU j 147 ASP j 166 1 ? 20 
HELX_P HELX_P198 198 LEU KA 56  ? GLU KA 78  ? LEU k 55  GLU k 77  1 ? 23 
HELX_P HELX_P199 199 LYS KA 83  ? GLU KA 97  ? LYS k 82  GLU k 96  1 ? 15 
HELX_P HELX_P200 200 CYS KA 142 ? TRP KA 154 ? CYS k 141 TRP k 153 1 ? 13 
HELX_P HELX_P201 201 ASP KA 159 ? ASP KA 176 ? ASP k 158 ASP k 175 1 ? 18 
HELX_P HELX_P202 202 GLY LA 51  ? GLY LA 72  ? GLY l 51  GLY l 72  1 ? 22 
HELX_P HELX_P203 203 SER LA 76  ? CYS LA 91  ? SER l 76  CYS l 91  1 ? 16 
HELX_P HELX_P204 204 GLY LA 135 ? TYR LA 146 ? GLY l 135 TYR l 146 1 ? 12 
HELX_P HELX_P205 205 SER LA 152 ? ARG LA 170 ? SER l 152 ARG l 170 1 ? 19 
HELX_P HELX_P206 206 GLY MA 48  ? LYS MA 71  ? GLY m 48  LYS m 71  1 ? 24 
HELX_P HELX_P207 207 SER MA 75  ? GLN MA 89  ? SER m 75  GLN m 89  1 ? 15 
HELX_P HELX_P208 208 GLY MA 131 ? GLY MA 142 ? GLY m 131 GLY m 142 1 ? 12 
HELX_P HELX_P209 209 LYS MA 148 ? ASP MA 167 ? LYS m 148 ASP m 167 1 ? 20 
HELX_P HELX_P210 210 VAL MA 192 ? SER MA 201 ? VAL m 192 SER m 201 1 ? 10 
HELX_P HELX_P211 211 PHE NA 57  ? ASN NA 80  ? PHE n 57  ASN n 80  1 ? 24 
HELX_P HELX_P212 212 THR NA 84  ? ARG NA 99  ? THR n 84  ARG n 99  1 ? 16 
HELX_P HELX_P213 213 ALA NA 141 ? VAL NA 153 ? ALA n 141 VAL n 153 1 ? 13 
HELX_P HELX_P214 214 THR NA 167 ? ASP NA 186 ? THR n 167 ASP n 186 1 ? 20 
HELX_P HELX_P215 215 TYR OA 57  ? GLY OA 78  ? TYR o 57  GLY o 78  1 ? 22 
HELX_P HELX_P216 216 SER OA 84  ? LYS OA 102 ? SER o 84  LYS o 102 1 ? 19 
HELX_P HELX_P217 217 GLY OA 140 ? ALA OA 143 ? GLY o 140 ALA o 143 5 ? 4  
HELX_P HELX_P218 218 LEU OA 145 ? GLN OA 157 ? LEU o 145 GLN o 157 1 ? 13 
HELX_P HELX_P219 219 SER OA 161 ? ASP OA 180 ? SER o 161 ASP o 180 1 ? 20 
HELX_P HELX_P220 220 TRP OA 209 ? HIS OA 213 ? TRP o 209 HIS o 213 5 ? 5  
HELX_P HELX_P221 221 SER PA 48  ? ASN PA 71  ? SER p 48  ASN p 71  1 ? 24 
HELX_P HELX_P222 222 LEU PA 75  ? TYR PA 90  ? LEU p 75  TYR p 90  1 ? 16 
HELX_P HELX_P223 223 GLY PA 131 ? TYR PA 134 ? GLY p 131 TYR p 134 5 ? 4  
HELX_P HELX_P224 224 ILE PA 135 ? TYR PA 143 ? ILE p 135 TYR p 143 1 ? 9  
HELX_P HELX_P225 225 THR PA 148 ? ASP PA 167 ? THR p 148 ASP p 167 1 ? 20 
HELX_P HELX_P226 226 LEU QA 19  ? GLY QA 31  ? LEU q 18  GLY q 30  1 ? 13 
HELX_P HELX_P227 227 MET QA 79  ? GLN QA 102 ? MET q 78  GLN q 101 1 ? 24 
HELX_P HELX_P228 228 PRO QA 106 ? TYR QA 121 ? PRO q 105 TYR q 120 1 ? 16 
HELX_P HELX_P229 229 ASN QA 166 ? TYR QA 178 ? ASN q 165 TYR q 177 1 ? 13 
HELX_P HELX_P230 230 GLU QA 183 ? LEU QA 195 ? GLU q 182 LEU q 194 1 ? 13 
HELX_P HELX_P231 231 LYS QA 196 ? PHE QA 199 ? LYS q 195 PHE q 198 5 ? 4  
HELX_P HELX_P232 232 THR QA 222 ? ALA QA 231 ? THR q 221 ALA q 230 1 ? 10 
HELX_P HELX_P233 233 LEU RA 18  ? GLY RA 29  ? LEU r 18  GLY r 29  1 ? 12 
HELX_P HELX_P234 234 ILE RA 79  ? GLN RA 102 ? ILE r 79  GLN r 102 1 ? 24 
HELX_P HELX_P235 235 PRO RA 106 ? PHE RA 124 ? PRO r 106 PHE r 124 1 ? 19 
HELX_P HELX_P236 236 ASN RA 167 ? TYR RA 179 ? ASN r 167 TYR r 179 1 ? 13 
HELX_P HELX_P237 237 THR RA 185 ? MET RA 201 ? THR r 185 MET r 201 1 ? 17 
HELX_P HELX_P238 238 LYS RA 229 ? ALA RA 247 ? LYS r 229 ALA r 247 1 ? 19 
HELX_P HELX_P239 239 LEU SA 16  ? LYS SA 28  ? LEU s 16  LYS s 28  1 ? 13 
HELX_P HELX_P240 240 LEU SA 76  ? VAL SA 98  ? LEU s 76  VAL s 98  1 ? 23 
HELX_P HELX_P241 241 THR SA 103 ? TYR SA 118 ? THR s 103 TYR s 118 1 ? 16 
HELX_P HELX_P242 242 GLY SA 164 ? LYS SA 174 ? GLY s 164 LYS s 174 1 ? 11 
HELX_P HELX_P243 243 THR SA 183 ? LEU SA 196 ? THR s 183 LEU s 196 1 ? 14 
HELX_P HELX_P244 244 ASN SA 221 ? LYS SA 236 ? ASN s 221 LYS s 236 1 ? 16 
HELX_P HELX_P245 245 LEU TA 21  ? LYS TA 32  ? LEU t 21  LYS t 32  1 ? 12 
HELX_P HELX_P246 246 LEU TA 81  ? ASN TA 104 ? LEU t 81  ASN t 104 1 ? 24 
HELX_P HELX_P247 247 THR TA 108 ? ASN TA 118 ? THR t 108 ASN t 118 1 ? 11 
HELX_P HELX_P248 248 ALA TA 173 ? VAL TA 184 ? ALA t 173 VAL t 184 1 ? 12 
HELX_P HELX_P249 249 THR TA 190 ? MET TA 206 ? THR t 190 MET t 206 1 ? 17 
HELX_P HELX_P250 250 THR TA 230 ? LYS TA 239 ? THR t 230 LYS t 239 1 ? 10 
HELX_P HELX_P251 251 ILE UA 19  ? GLY UA 32  ? ILE u 19  GLY u 32  1 ? 14 
HELX_P HELX_P252 252 LEU UA 77  ? PHE UA 99  ? LEU u 77  PHE u 99  1 ? 23 
HELX_P HELX_P253 253 PRO UA 104 ? THR UA 116 ? PRO u 104 THR u 116 1 ? 13 
HELX_P HELX_P254 254 SER UA 165 ? HIS UA 175 ? SER u 165 HIS u 175 1 ? 11 
HELX_P HELX_P255 255 GLU UA 178 ? CYS UA 182 ? GLU u 178 CYS u 182 5 ? 5  
HELX_P HELX_P256 256 ASN UA 183 ? GLU UA 197 ? ASN u 183 GLU u 197 1 ? 15 
HELX_P HELX_P257 257 VAL UA 229 ? ASP UA 234 ? VAL u 229 ASP u 234 1 ? 6  
HELX_P HELX_P258 258 VAL VA 21  ? SER VA 34  ? VAL v 20  SER v 33  1 ? 14 
HELX_P HELX_P259 259 LEU VA 81  ? PHE VA 103 ? LEU v 80  PHE v 102 1 ? 23 
HELX_P HELX_P260 260 PRO VA 108 ? ALA VA 122 ? PRO v 107 ALA v 121 1 ? 15 
HELX_P HELX_P261 261 TYR VA 123 ? LEU VA 125 ? TYR v 122 LEU v 124 5 ? 3  
HELX_P HELX_P262 262 ALA VA 169 ? GLU VA 178 ? ALA v 168 GLU v 177 1 ? 10 
HELX_P HELX_P263 263 THR VA 186 ? HIS VA 202 ? THR v 185 HIS v 201 1 ? 17 
HELX_P HELX_P264 264 GLY VA 218 ? LYS VA 222 ? GLY v 217 LYS v 221 5 ? 5  
HELX_P HELX_P265 265 PRO VA 229 ? SER VA 243 ? PRO v 228 SER v 242 1 ? 15 
HELX_P HELX_P266 266 LEU WA 22  ? ALA WA 31  ? LEU w 22  ALA w 31  1 ? 10 
HELX_P HELX_P267 267 ILE WA 32  ? GLY WA 35  ? ILE w 32  GLY w 35  5 ? 4  
HELX_P HELX_P268 268 MET WA 83  ? GLY WA 106 ? MET w 83  GLY w 106 1 ? 24 
HELX_P HELX_P269 269 PRO WA 110 ? ASN WA 128 ? PRO w 110 ASN w 128 1 ? 19 
HELX_P HELX_P270 270 LYS WA 171 ? LYS WA 185 ? LYS w 171 LYS w 185 1 ? 15 
HELX_P HELX_P271 271 THR WA 190 ? LEU WA 206 ? THR w 190 LEU w 206 1 ? 17 
HELX_P HELX_P272 272 LEU WA 230 ? ALA WA 243 ? LEU w 230 ALA w 243 1 ? 14 
HELX_P HELX_P273 273 THR XA 48  ? GLY XA 71  ? THR x 48  GLY x 71  1 ? 24 
HELX_P HELX_P274 274 ARG XA 75  ? TYR XA 90  ? ARG x 75  TYR x 90  1 ? 16 
HELX_P HELX_P275 275 GLY XA 130 ? PHE XA 142 ? GLY x 130 PHE x 142 1 ? 13 
HELX_P HELX_P276 276 GLU XA 147 ? ASP XA 166 ? GLU x 147 ASP x 166 1 ? 20 
HELX_P HELX_P277 277 LEU YA 56  ? GLU YA 78  ? LEU y 55  GLU y 77  1 ? 23 
HELX_P HELX_P278 278 LYS YA 83  ? GLU YA 97  ? LYS y 82  GLU y 96  1 ? 15 
HELX_P HELX_P279 279 CYS YA 142 ? TRP YA 154 ? CYS y 141 TRP y 153 1 ? 13 
HELX_P HELX_P280 280 ASP YA 159 ? ASP YA 176 ? ASP y 158 ASP y 175 1 ? 18 
HELX_P HELX_P281 281 GLY ZA 51  ? GLY ZA 72  ? GLY z 51  GLY z 72  1 ? 22 
HELX_P HELX_P282 282 SER ZA 76  ? CYS ZA 91  ? SER z 76  CYS z 91  1 ? 16 
HELX_P HELX_P283 283 GLY ZA 135 ? TYR ZA 147 ? GLY z 135 TYR z 147 1 ? 13 
HELX_P HELX_P284 284 SER ZA 152 ? ARG ZA 170 ? SER z 152 ARG z 170 1 ? 19 
HELX_P HELX_P285 285 GLY AB 48  ? LYS AB 71  ? GLY 1 48  LYS 1 71  1 ? 24 
HELX_P HELX_P286 286 SER AB 75  ? GLN AB 89  ? SER 1 75  GLN 1 89  1 ? 15 
HELX_P HELX_P287 287 GLY AB 131 ? GLY AB 142 ? GLY 1 131 GLY 1 142 1 ? 12 
HELX_P HELX_P288 288 LYS AB 148 ? ASP AB 167 ? LYS 1 148 ASP 1 167 1 ? 20 
HELX_P HELX_P289 289 VAL AB 192 ? TYR AB 199 ? VAL 1 192 TYR 1 199 1 ? 8  
HELX_P HELX_P290 290 PHE BB 57  ? ASN BB 80  ? PHE 2 57  ASN 2 80  1 ? 24 
HELX_P HELX_P291 291 THR BB 84  ? ARG BB 99  ? THR 2 84  ARG 2 99  1 ? 16 
HELX_P HELX_P292 292 ALA BB 141 ? VAL BB 153 ? ALA 2 141 VAL 2 153 1 ? 13 
HELX_P HELX_P293 293 THR BB 167 ? ASP BB 186 ? THR 2 167 ASP 2 186 1 ? 20 
HELX_P HELX_P294 294 TYR CB 57  ? GLY CB 78  ? TYR 3 57  GLY 3 78  1 ? 22 
HELX_P HELX_P295 295 SER CB 84  ? LYS CB 102 ? SER 3 84  LYS 3 102 1 ? 19 
HELX_P HELX_P296 296 TYR CB 141 ? GLN CB 157 ? TYR 3 141 GLN 3 157 1 ? 17 
HELX_P HELX_P297 297 SER CB 161 ? ASP CB 180 ? SER 3 161 ASP 3 180 1 ? 20 
HELX_P HELX_P298 298 TRP CB 209 ? HIS CB 213 ? TRP 3 209 HIS 3 213 5 ? 5  
HELX_P HELX_P299 299 SER DB 48  ? ASN DB 71  ? SER 4 48  ASN 4 71  1 ? 24 
HELX_P HELX_P300 300 LEU DB 75  ? TYR DB 90  ? LEU 4 75  TYR 4 90  1 ? 16 
HELX_P HELX_P301 301 GLY DB 131 ? TYR DB 134 ? GLY 4 131 TYR 4 134 5 ? 4  
HELX_P HELX_P302 302 ILE DB 135 ? TYR DB 143 ? ILE 4 135 TYR 4 143 1 ? 9  
HELX_P HELX_P303 303 THR DB 148 ? ASP DB 167 ? THR 4 148 ASP 4 167 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? F  CYS 42 SG ? ? ? 1_555 F  CYS 187 SG ? ? F CYS 41 F CYS 186 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? L  CYS 54 SG ? ? ? 1_555 L  CYS 61  SG ? ? L CYS 54 L CYS 61  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf3 disulf ? ? T  CYS 42 SG ? ? ? 1_555 T  CYS 187 SG ? ? T CYS 41 T CYS 186 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ? ? Z  CYS 54 SG ? ? ? 1_555 Z  CYS 61  SG ? ? Z CYS 54 Z CYS 61  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf5 disulf ? ? HA CYS 42 SG ? ? ? 1_555 HA CYS 187 SG ? ? h CYS 41 h CYS 186 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf6 disulf ? ? NA CYS 54 SG ? ? ? 1_555 NA CYS 61  SG ? ? n CYS 54 n CYS 61  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf7 disulf ? ? VA CYS 42 SG ? ? ? 1_555 VA CYS 187 SG ? ? v CYS 41 v CYS 186 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf8 disulf ? ? BB CYS 54 SG ? ? ? 1_555 BB CYS 61  SG ? ? 2 CYS 54 2 CYS 61  1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 5 ? 
C  ? 5 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 5 ? 
G  ? 5 ? 
H  ? 5 ? 
I  ? 5 ? 
J  ? 5 ? 
K  ? 5 ? 
L  ? 5 ? 
M  ? 5 ? 
N  ? 5 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 5 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 5 ? 
U  ? 5 ? 
V  ? 2 ? 
W  ? 5 ? 
X  ? 5 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 5 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 5 ? 
AE ? 7 ? 
AF ? 5 ? 
AG ? 5 ? 
AH ? 2 ? 
AI ? 5 ? 
AJ ? 5 ? 
AK ? 5 ? 
AL ? 5 ? 
AM ? 5 ? 
AN ? 5 ? 
AO ? 5 ? 
AP ? 5 ? 
AQ ? 5 ? 
AR ? 5 ? 
AS ? 5 ? 
AT ? 5 ? 
AU ? 5 ? 
AV ? 5 ? 
AW ? 5 ? 
AX ? 5 ? 
AY ? 2 ? 
AZ ? 5 ? 
BA ? 6 ? 
BB ? 2 ? 
BC ? 5 ? 
BD ? 5 ? 
BE ? 2 ? 
BF ? 5 ? 
BG ? 5 ? 
BH ? 2 ? 
BI ? 5 ? 
BJ ? 5 ? 
BK ? 2 ? 
BL ? 5 ? 
BM ? 5 ? 
BN ? 7 ? 
BO ? 5 ? 
BP ? 5 ? 
BQ ? 2 ? 
BR ? 5 ? 
BS ? 5 ? 
BT ? 5 ? 
BU ? 5 ? 
BV ? 5 ? 
BW ? 5 ? 
BX ? 5 ? 
BY ? 5 ? 
BZ ? 5 ? 
CA ? 5 ? 
CB ? 5 ? 
CC ? 5 ? 
CD ? 5 ? 
CE ? 5 ? 
CF ? 5 ? 
CG ? 5 ? 
CH ? 2 ? 
CI ? 5 ? 
CJ ? 6 ? 
CK ? 2 ? 
CL ? 5 ? 
CM ? 5 ? 
CN ? 5 ? 
CO ? 2 ? 
CP ? 5 ? 
CQ ? 5 ? 
CR ? 2 ? 
CS ? 2 ? 
CT ? 3 ? 
CU ? 5 ? 
CV ? 2 ? 
CW ? 5 ? 
CX ? 5 ? 
CY ? 7 ? 
CZ ? 5 ? 
DA ? 5 ? 
DB ? 2 ? 
DC ? 5 ? 
DD ? 5 ? 
DE ? 5 ? 
DF ? 5 ? 
DG ? 5 ? 
DH ? 5 ? 
DI ? 5 ? 
DJ ? 5 ? 
DK ? 5 ? 
DL ? 5 ? 
DM ? 5 ? 
DN ? 5 ? 
DO ? 5 ? 
DP ? 5 ? 
DQ ? 5 ? 
DR ? 5 ? 
DS ? 2 ? 
DT ? 5 ? 
DU ? 6 ? 
DV ? 2 ? 
DW ? 5 ? 
DX ? 5 ? 
DY ? 2 ? 
DZ ? 5 ? 
EA ? 5 ? 
EB ? 2 ? 
EC ? 5 ? 
ED ? 5 ? 
EE ? 2 ? 
EF ? 5 ? 
EG ? 5 ? 
EH ? 7 ? 
EI ? 5 ? 
EJ ? 5 ? 
EK ? 2 ? 
EL ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? anti-parallel 
AE 6 7 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AI 4 5 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AR 4 5 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AT 4 5 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AU 4 5 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AV 4 5 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AW 4 5 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
AZ 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BF 4 5 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BI 4 5 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BJ 4 5 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BM 4 5 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? anti-parallel 
BN 5 6 ? anti-parallel 
BN 6 7 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BO 4 5 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BP 3 4 ? anti-parallel 
BP 4 5 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BR 4 5 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BS 3 4 ? anti-parallel 
BS 4 5 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? anti-parallel 
BT 4 5 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BU 3 4 ? anti-parallel 
BU 4 5 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BV 4 5 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BW 4 5 ? anti-parallel 
BX 1 2 ? anti-parallel 
BX 2 3 ? anti-parallel 
BX 3 4 ? anti-parallel 
BX 4 5 ? anti-parallel 
BY 1 2 ? anti-parallel 
BY 2 3 ? anti-parallel 
BY 3 4 ? anti-parallel 
BY 4 5 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
BZ 4 5 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CC 4 5 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CD 4 5 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CE 4 5 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CF 3 4 ? anti-parallel 
CF 4 5 ? anti-parallel 
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CG 3 4 ? anti-parallel 
CG 4 5 ? anti-parallel 
CH 1 2 ? anti-parallel 
CI 1 2 ? anti-parallel 
CI 2 3 ? anti-parallel 
CI 3 4 ? anti-parallel 
CI 4 5 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CJ 2 3 ? anti-parallel 
CJ 3 4 ? anti-parallel 
CJ 4 5 ? anti-parallel 
CJ 5 6 ? anti-parallel 
CK 1 2 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CL 4 5 ? anti-parallel 
CM 1 2 ? anti-parallel 
CM 2 3 ? anti-parallel 
CM 3 4 ? anti-parallel 
CM 4 5 ? anti-parallel 
CN 1 2 ? anti-parallel 
CN 2 3 ? anti-parallel 
CN 3 4 ? anti-parallel 
CN 4 5 ? anti-parallel 
CO 1 2 ? anti-parallel 
CP 1 2 ? anti-parallel 
CP 2 3 ? anti-parallel 
CP 3 4 ? anti-parallel 
CP 4 5 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CQ 2 3 ? anti-parallel 
CQ 3 4 ? anti-parallel 
CQ 4 5 ? anti-parallel 
CR 1 2 ? anti-parallel 
CS 1 2 ? anti-parallel 
CT 1 2 ? anti-parallel 
CT 2 3 ? anti-parallel 
CU 1 2 ? anti-parallel 
CU 2 3 ? anti-parallel 
CU 3 4 ? anti-parallel 
CU 4 5 ? anti-parallel 
CV 1 2 ? anti-parallel 
CW 1 2 ? anti-parallel 
CW 2 3 ? anti-parallel 
CW 3 4 ? anti-parallel 
CW 4 5 ? anti-parallel 
CX 1 2 ? anti-parallel 
CX 2 3 ? anti-parallel 
CX 3 4 ? anti-parallel 
CX 4 5 ? anti-parallel 
CY 1 2 ? anti-parallel 
CY 2 3 ? anti-parallel 
CY 3 4 ? anti-parallel 
CY 4 5 ? anti-parallel 
CY 5 6 ? anti-parallel 
CY 6 7 ? anti-parallel 
CZ 1 2 ? anti-parallel 
CZ 2 3 ? anti-parallel 
CZ 3 4 ? anti-parallel 
CZ 4 5 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DB 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DC 3 4 ? anti-parallel 
DC 4 5 ? anti-parallel 
DD 1 2 ? anti-parallel 
DD 2 3 ? anti-parallel 
DD 3 4 ? anti-parallel 
DD 4 5 ? anti-parallel 
DE 1 2 ? anti-parallel 
DE 2 3 ? anti-parallel 
DE 3 4 ? anti-parallel 
DE 4 5 ? anti-parallel 
DF 1 2 ? anti-parallel 
DF 2 3 ? anti-parallel 
DF 3 4 ? anti-parallel 
DF 4 5 ? anti-parallel 
DG 1 2 ? anti-parallel 
DG 2 3 ? anti-parallel 
DG 3 4 ? anti-parallel 
DG 4 5 ? anti-parallel 
DH 1 2 ? anti-parallel 
DH 2 3 ? anti-parallel 
DH 3 4 ? anti-parallel 
DH 4 5 ? anti-parallel 
DI 1 2 ? anti-parallel 
DI 2 3 ? anti-parallel 
DI 3 4 ? anti-parallel 
DI 4 5 ? anti-parallel 
DJ 1 2 ? anti-parallel 
DJ 2 3 ? anti-parallel 
DJ 3 4 ? anti-parallel 
DJ 4 5 ? anti-parallel 
DK 1 2 ? anti-parallel 
DK 2 3 ? anti-parallel 
DK 3 4 ? anti-parallel 
DK 4 5 ? anti-parallel 
DL 1 2 ? anti-parallel 
DL 2 3 ? anti-parallel 
DL 3 4 ? anti-parallel 
DL 4 5 ? anti-parallel 
DM 1 2 ? anti-parallel 
DM 2 3 ? anti-parallel 
DM 3 4 ? anti-parallel 
DM 4 5 ? anti-parallel 
DN 1 2 ? anti-parallel 
DN 2 3 ? anti-parallel 
DN 3 4 ? anti-parallel 
DN 4 5 ? anti-parallel 
DO 1 2 ? anti-parallel 
DO 2 3 ? anti-parallel 
DO 3 4 ? anti-parallel 
DO 4 5 ? anti-parallel 
DP 1 2 ? anti-parallel 
DP 2 3 ? anti-parallel 
DP 3 4 ? anti-parallel 
DP 4 5 ? anti-parallel 
DQ 1 2 ? anti-parallel 
DQ 2 3 ? anti-parallel 
DQ 3 4 ? anti-parallel 
DQ 4 5 ? anti-parallel 
DR 1 2 ? anti-parallel 
DR 2 3 ? anti-parallel 
DR 3 4 ? anti-parallel 
DR 4 5 ? anti-parallel 
DS 1 2 ? anti-parallel 
DT 1 2 ? anti-parallel 
DT 2 3 ? anti-parallel 
DT 3 4 ? anti-parallel 
DT 4 5 ? anti-parallel 
DU 1 2 ? anti-parallel 
DU 2 3 ? anti-parallel 
DU 3 4 ? anti-parallel 
DU 4 5 ? anti-parallel 
DU 5 6 ? anti-parallel 
DV 1 2 ? anti-parallel 
DW 1 2 ? anti-parallel 
DW 2 3 ? anti-parallel 
DW 3 4 ? anti-parallel 
DW 4 5 ? anti-parallel 
DX 1 2 ? anti-parallel 
DX 2 3 ? anti-parallel 
DX 3 4 ? anti-parallel 
DX 4 5 ? anti-parallel 
DY 1 2 ? anti-parallel 
DZ 1 2 ? anti-parallel 
DZ 2 3 ? anti-parallel 
DZ 3 4 ? anti-parallel 
DZ 4 5 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EA 4 5 ? anti-parallel 
EB 1 2 ? anti-parallel 
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? anti-parallel 
EC 4 5 ? anti-parallel 
ED 1 2 ? anti-parallel 
ED 2 3 ? anti-parallel 
ED 3 4 ? anti-parallel 
ED 4 5 ? anti-parallel 
EE 1 2 ? anti-parallel 
EF 1 2 ? anti-parallel 
EF 2 3 ? anti-parallel 
EF 3 4 ? anti-parallel 
EF 4 5 ? anti-parallel 
EG 1 2 ? anti-parallel 
EG 2 3 ? anti-parallel 
EG 3 4 ? anti-parallel 
EG 4 5 ? anti-parallel 
EH 1 2 ? anti-parallel 
EH 2 3 ? anti-parallel 
EH 3 4 ? anti-parallel 
EH 4 5 ? anti-parallel 
EH 5 6 ? anti-parallel 
EH 6 7 ? anti-parallel 
EI 1 2 ? anti-parallel 
EI 2 3 ? anti-parallel 
EI 3 4 ? anti-parallel 
EI 4 5 ? anti-parallel 
EJ 1 2 ? anti-parallel 
EJ 2 3 ? anti-parallel 
EJ 3 4 ? anti-parallel 
EJ 4 5 ? anti-parallel 
EK 1 2 ? anti-parallel 
EL 1 2 ? anti-parallel 
EL 2 3 ? anti-parallel 
EL 3 4 ? anti-parallel 
EL 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ALA A  160 ? ALA A  162 ? ALA A 159 ALA A 161 
A  2 SER A  35  ? LYS A  39  ? SER A 34  LYS A 38  
A  3 VAL A  44  ? GLU A  49  ? VAL A 43  GLU A 48  
A  4 ILE A  208 ? ASN A  214 ? ILE A 207 ASN A 213 
A  5 GLY A  217 ? ARG A  220 ? GLY A 216 ARG A 219 
B  1 GLU A  66  ? PRO A  67  ? GLU A 65  PRO A 66  
B  2 GLY A  73  ? GLY A  78  ? GLY A 72  GLY A 77  
B  3 VAL A  132 ? ASN A  140 ? VAL A 131 ASN A 139 
B  4 ARG A  143 ? SER A  149 ? ARG A 142 SER A 148 
B  5 TYR A  155 ? ALA A  157 ? TYR A 154 ALA A 156 
C  1 ALA B  161 ? ILE B  164 ? ALA B 161 ILE B 164 
C  2 CYS B  34  ? LEU B  38  ? CYS B 34  LEU B 38  
C  3 GLY B  42  ? GLU B  48  ? GLY B 42  GLU B 48  
C  4 VAL B  211 ? GLU B  219 ? VAL B 211 GLU B 219 
C  5 LYS B  222 ? VAL B  227 ? LYS B 222 VAL B 227 
D  1 ILE B  65  ? LYS B  67  ? ILE B 65  LYS B 67  
D  2 MET B  72  ? GLY B  78  ? MET B 72  GLY B 78  
D  3 VAL B  132 ? ASP B  140 ? VAL B 132 ASP B 140 
D  4 GLY B  144 ? SER B  150 ? GLY B 144 SER B 150 
D  5 TYR B  156 ? GLY B  158 ? TYR B 156 GLY B 158 
E  1 ALA C  158 ? ILE C  161 ? ALA C 158 ILE C 161 
E  2 ALA C  32  ? ARG C  36  ? ALA C 32  ARG C 36  
E  3 ILE C  40  ? VAL C  45  ? ILE C 40  VAL C 45  
E  4 GLU C  207 ? ARG C  212 ? GLU C 207 ARG C 212 
E  5 LYS C  218 ? ILE C  219 ? LYS C 218 ILE C 219 
F  1 ILE C  62  ? ALA C  64  ? ILE C 62  ALA C 64  
F  2 VAL C  69  ? GLY C  75  ? VAL C 69  GLY C 75  
F  3 ILE C  129 ? PHE C  136 ? ILE C 129 PHE C 136 
F  4 PRO C  142 ? GLN C  146 ? PRO C 142 GLN C 146 
F  5 HIS C  154 ? ALA C  155 ? HIS C 154 ALA C 155 
G  1 ALA D  167 ? ILE D  170 ? ALA D 167 ILE D 170 
G  2 ALA D  37  ? THR D  42  ? ALA D 37  THR D 42  
G  3 GLY D  45  ? GLU D  51  ? GLY D 45  GLU D 51  
G  4 ILE D  215 ? VAL D  220 ? ILE D 215 VAL D 220 
G  5 HIS D  227 ? MET D  228 ? HIS D 227 MET D 228 
H  1 ILE D  67  ? GLU D  69  ? ILE D 67  GLU D 69  
H  2 ILE D  74  ? GLY D  80  ? ILE D 74  GLY D 80  
H  3 VAL D  139 ? ASP D  147 ? VAL D 139 ASP D 147 
H  4 GLY D  150 ? MET D  156 ? GLY D 150 MET D 156 
H  5 VAL D  163 ? GLN D  164 ? VAL D 163 GLN D 164 
I  1 ALA E  158 ? ILE E  161 ? ALA E 158 ILE E 161 
I  2 THR E  35  ? LYS E  39  ? THR E 35  LYS E 39  
I  3 HIS E  43  ? LEU E  49  ? HIS E 43  LEU E 49  
I  4 VAL E  210 ? GLY E  216 ? VAL E 210 GLY E 216 
I  5 THR E  222 ? TYR E  224 ? THR E 222 TYR E 224 
J  1 ILE E  63  ? HIS E  65  ? ILE E 63  HIS E 65  
J  2 ILE E  70  ? GLY E  76  ? ILE E 70  GLY E 76  
J  3 VAL E  130 ? ASP E  138 ? VAL E 130 ASP E 138 
J  4 GLY E  141 ? THR E  147 ? GLY E 141 THR E 147 
J  5 TYR E  153 ? CYS E  156 ? TYR E 153 CYS E 156 
K  1 GLY F  163 ? ILE F  166 ? GLY F 162 ILE F 165 
K  2 ALA F  37  ? ARG F  41  ? ALA F 36  ARG F 40  
K  3 GLY F  45  ? LEU F  53  ? GLY F 44  LEU F 52  
K  4 PHE F  210 ? GLY F  218 ? PHE F 209 GLY F 217 
K  5 GLU F  226 ? ILE F  227 ? GLU F 225 ILE F 226 
L  1 LEU F  67  ? ASN F  69  ? LEU F 66  ASN F 68  
L  2 VAL F  74  ? GLY F  80  ? VAL F 73  GLY F 79  
L  3 CYS F  134 ? TYR F  141 ? CYS F 133 TYR F 140 
L  4 ALA F  147 ? ILE F  152 ? ALA F 146 ILE F 151 
L  5 SER F  158 ? GLY F  160 ? SER F 157 GLY F 159 
M  1 ALA G  165 ? GLY G  169 ? ALA G 165 GLY G 169 
M  2 THR G  38  ? ARG G  43  ? THR G 38  ARG G 43  
M  3 CYS G  47  ? GLN G  53  ? CYS G 47  GLN G 53  
M  4 ILE G  215 ? THR G  221 ? ILE G 215 THR G 221 
M  5 ARG G  228 ? ILE G  229 ? ARG G 228 ILE G 229 
N  1 LEU G  69  ? LYS G  71  ? LEU G 69  LYS G 71  
N  2 GLY G  77  ? GLY G  82  ? GLY G 77  GLY G 82  
N  3 CYS G  136 ? ASP G  144 ? CYS G 136 ASP G 144 
N  4 GLY G  148 ? CYS G  154 ? GLY G 148 CYS G 154 
N  5 TYR G  160 ? GLY G  162 ? TYR G 160 GLY G 162 
O  1 TYR H  124 ? GLY H  128 ? TYR H 124 GLY H 128 
O  2 THR H  2   ? VAL H  7   ? THR H 2   VAL H 7   
O  3 ILE H  12  ? ALA H  16  ? ILE H 12  ALA H 16  
O  4 ILE H  173 ? ILE H  178 ? ILE H 173 ILE H 178 
O  5 LEU H  183 ? SER H  190 ? LEU H 183 SER H 190 
P  1 ALA H  20  ? GLU H  22  ? ALA H 20  GLU H 22  
P  2 VAL H  25  ? ASP H  28  ? VAL H 25  ASP H 28  
Q  1 ILE H  34  ? PHE H  36  ? ILE H 34  PHE H 36  
Q  2 ILE H  41  ? GLY H  47  ? ILE H 41  GLY H 47  
Q  3 ALA H  96  ? VAL H  103 ? ALA H 96  VAL H 103 
Q  4 PRO H  108 ? ILE H  113 ? PRO H 108 ILE H 113 
Q  5 THR H  119 ? LYS H  121 ? THR H 119 LYS H 121 
R  1 VAL H  211 ? PRO H  218 ? VAL H 211 PRO H 218 
R  2 LYS I  194 ? LEU I  200 ? LYS I 193 LEU I 199 
R  3 VAL I  185 ? ILE I  190 ? VAL I 184 ILE I 189 
R  4 VAL I  20  ? ASP I  25  ? VAL I 19  ASP I 24  
R  5 ALA I  10  ? LYS I  15  ? ALA I 9   LYS I 14  
R  6 PHE I  136 ? GLY I  140 ? PHE I 135 GLY I 139 
S  1 PHE I  28  ? ILE I  30  ? PHE I 27  ILE I 29  
S  2 GLN I  33  ? THR I  36  ? GLN I 32  THR I 35  
T  1 ILE I  42  ? PRO I  44  ? ILE I 41  PRO I 43  
T  2 LEU I  49  ? GLY I  55  ? LEU I 48  GLY I 54  
T  3 THR I  105 ? LEU I  112 ? THR I 104 LEU I 111 
T  4 PRO I  119 ? SER I  123 ? PRO I 118 SER I 122 
T  5 MET I  131 ? VAL I  132 ? MET I 130 VAL I 131 
U  1 PHE J  129 ? HIS J  132 ? PHE J 129 HIS J 132 
U  2 LEU J  4   ? GLN J  8   ? LEU J 4   GLN J 8   
U  3 VAL J  13  ? ASP J  18  ? VAL J 13  ASP J 18  
U  4 THR J  177 ? ILE J  183 ? THR J 177 ILE J 183 
U  5 ILE J  188 ? ALA J  195 ? ILE J 188 ALA J 195 
V  1 ALA J  21  ? SER J  23  ? ALA J 21  SER J 23  
V  2 VAL J  26  ? LYS J  29  ? VAL J 26  LYS J 29  
W  1 MET J  35  ? LYS J  37  ? MET J 35  LYS J 37  
W  2 ILE J  42  ? GLY J  48  ? ILE J 42  GLY J 48  
W  3 VAL J  100 ? TYR J  107 ? VAL J 100 TYR J 107 
W  4 PRO J  113 ? MET J  118 ? PRO J 113 MET J 118 
W  5 LEU J  124 ? LYS J  126 ? LEU J 124 LYS J 126 
X  1 ALA K  125 ? GLY K  129 ? ALA K 125 GLY K 129 
X  2 THR K  2   ? LYS K  7   ? THR K 2   LYS K 7   
X  3 VAL K  12  ? ALA K  16  ? VAL K 12  ALA K 16  
X  4 ALA K  173 ? VAL K  179 ? ALA K 173 VAL K 179 
X  5 TRP K  184 ? ASN K  191 ? TRP K 184 ASN K 191 
Y  1 ALA K  20  ? ALA K  22  ? ALA K 20  ALA K 22  
Y  2 TYR K  25  ? SER K  28  ? TYR K 25  SER K 28  
Z  1 VAL K  34  ? GLU K  36  ? VAL K 34  GLU K 36  
Z  2 LEU K  41  ? THR K  44  ? LEU K 41  THR K 44  
Z  3 GLY K  98  ? TRP K  104 ? GLY K 98  TRP K 104 
Z  4 PRO K  109 ? ASP K  115 ? PRO K 109 ASP K 115 
Z  5 ARG K  120 ? SER K  122 ? ARG K 120 SER K 122 
AA 1 PHE L  135 ? GLY L  139 ? PHE L 135 GLY L 139 
AA 2 THR L  11  ? ALA L  16  ? THR L 11  ALA L 16  
AA 3 SER L  21  ? ASP L  26  ? SER L 21  ASP L 26  
AA 4 ALA L  192 ? VAL L  198 ? ALA L 192 VAL L 198 
AA 5 ILE L  203 ? PRO L  209 ? ILE L 203 PRO L 209 
AB 1 LEU L  29  ? GLU L  31  ? LEU L 29  GLU L 31  
AB 2 SER L  34  ? THR L  37  ? SER L 34  THR L 37  
AC 1 CYS L  43  ? LYS L  45  ? CYS L 43  LYS L 45  
AC 2 THR L  50  ? GLY L  56  ? THR L 50  GLY L 56  
AC 3 VAL L  106 ? LEU L  113 ? VAL L 106 LEU L 113 
AC 4 GLY L  119 ? PHE L  124 ? GLY L 119 PHE L 124 
AC 5 TYR L  130 ? ASP L  133 ? TYR L 130 ASP L 133 
AD 1 LEU M  33  ? PHE M  36  ? LEU M 33  PHE M 36  
AD 2 GLY M  28  ? TYR M  30  ? GLY M 28  TYR M 30  
AD 3 VAL M  6   ? GLY M  8   ? VAL M 6   GLY M 8   
AD 4 THR M  49  ? ASP M  56  ? THR M 49  ASP M 56  
AD 5 ILE M  42  ? ARG M  44  ? ILE M 42  ARG M 44  
AE 1 LEU M  33  ? PHE M  36  ? LEU M 33  PHE M 36  
AE 2 GLY M  28  ? TYR M  30  ? GLY M 28  TYR M 30  
AE 3 VAL M  6   ? GLY M  8   ? VAL M 6   GLY M 8   
AE 4 THR M  49  ? ASP M  56  ? THR M 49  ASP M 56  
AE 5 ASN M  108 ? ALA M  116 ? ASN M 108 ALA M 116 
AE 6 GLU M  119 ? VAL M  125 ? GLU M 119 VAL M 125 
AE 7 ALA M  131 ? GLU M  133 ? ALA M 131 GLU M 133 
AF 1 SER M  136 ? ALA M  138 ? SER M 136 ALA M 138 
AF 2 VAL M  11  ? PHE M  16  ? VAL M 11  PHE M 16  
AF 3 GLY M  19  ? ASP M  25  ? GLY M 19  ASP M 25  
AF 4 PHE M  187 ? VAL M  192 ? PHE M 187 VAL M 192 
AF 5 VAL M  197 ? ILE M  199 ? VAL M 197 ILE M 199 
AG 1 PHE N  125 ? GLY N  129 ? PHE N 125 GLY N 129 
AG 2 THR N  2   ? GLN N  7   ? THR N 2   GLN N 7   
AG 3 VAL N  12  ? ALA N  16  ? VAL N 12  ALA N 16  
AG 4 ILE N  174 ? ILE N  179 ? ILE N 174 ILE N 179 
AG 5 VAL N  184 ? LEU N  189 ? VAL N 184 LEU N 189 
AH 1 THR N  20  ? THR N  21  ? THR N 20  THR N 21  
AH 2 ILE N  26  ? ASN N  28  ? ILE N 26  ASN N 28  
AI 1 LEU N  34  ? PRO N  36  ? LEU N 34  PRO N 36  
AI 2 ILE N  41  ? CYS N  44  ? ILE N 41  CYS N 44  
AI 3 ILE N  98  ? ASP N  104 ? ILE N 98  ASP N 104 
AI 4 GLY N  108 ? VAL N  114 ? GLY N 108 VAL N 114 
AI 5 VAL N  121 ? ARG N  122 ? VAL N 121 ARG N 122 
AJ 1 ALA O  160 ? MET O  163 ? ALA O 159 MET O 162 
AJ 2 SER O  35  ? LYS O  39  ? SER O 34  LYS O 38  
AJ 3 VAL O  44  ? GLU O  49  ? VAL O 43  GLU O 48  
AJ 4 ILE O  208 ? ASN O  214 ? ILE O 207 ASN O 213 
AJ 5 GLY O  217 ? ARG O  220 ? GLY O 216 ARG O 219 
AK 1 GLU O  66  ? PRO O  67  ? GLU O 65  PRO O 66  
AK 2 ILE O  72  ? GLY O  78  ? ILE O 71  GLY O 77  
AK 3 VAL O  132 ? ASN O  140 ? VAL O 131 ASN O 139 
AK 4 ARG O  143 ? SER O  149 ? ARG O 142 SER O 148 
AK 5 TYR O  155 ? ALA O  157 ? TYR O 154 ALA O 156 
AL 1 ALA P  161 ? ILE P  164 ? ALA P 161 ILE P 164 
AL 2 CYS P  34  ? LEU P  38  ? CYS P 34  LEU P 38  
AL 3 GLY P  42  ? GLU P  48  ? GLY P 42  GLU P 48  
AL 4 VAL P  211 ? GLU P  219 ? VAL P 211 GLU P 219 
AL 5 LYS P  222 ? VAL P  227 ? LYS P 222 VAL P 227 
AM 1 ILE P  65  ? LYS P  67  ? ILE P 65  LYS P 67  
AM 2 MET P  72  ? GLY P  78  ? MET P 72  GLY P 78  
AM 3 VAL P  132 ? ASP P  140 ? VAL P 132 ASP P 140 
AM 4 GLY P  144 ? SER P  150 ? GLY P 144 SER P 150 
AM 5 TYR P  156 ? GLY P  158 ? TYR P 156 GLY P 158 
AN 1 ALA Q  158 ? ILE Q  161 ? ALA Q 158 ILE Q 161 
AN 2 THR Q  31  ? ARG Q  36  ? THR Q 31  ARG Q 36  
AN 3 VAL Q  41  ? GLU Q  46  ? VAL Q 41  GLU Q 46  
AN 4 GLU Q  207 ? MET Q  211 ? GLU Q 207 MET Q 211 
AN 5 LEU Q  217 ? ILE Q  219 ? LEU Q 217 ILE Q 219 
AO 1 ILE Q  62  ? ALA Q  64  ? ILE Q 62  ALA Q 64  
AO 2 VAL Q  69  ? GLY Q  75  ? VAL Q 69  GLY Q 75  
AO 3 ILE Q  129 ? PHE Q  136 ? ILE Q 129 PHE Q 136 
AO 4 PRO Q  142 ? GLN Q  146 ? PRO Q 142 GLN Q 146 
AO 5 HIS Q  154 ? ALA Q  155 ? HIS Q 154 ALA Q 155 
AP 1 ALA R  167 ? ILE R  170 ? ALA R 167 ILE R 170 
AP 2 ALA R  37  ? THR R  42  ? ALA R 37  THR R 42  
AP 3 GLY R  45  ? GLU R  51  ? GLY R 45  GLU R 51  
AP 4 ILE R  215 ? VAL R  220 ? ILE R 215 VAL R 220 
AP 5 HIS R  227 ? MET R  228 ? HIS R 227 MET R 228 
AQ 1 ILE R  67  ? GLU R  69  ? ILE R 67  GLU R 69  
AQ 2 ILE R  74  ? GLY R  80  ? ILE R 74  GLY R 80  
AQ 3 VAL R  139 ? ASP R  147 ? VAL R 139 ASP R 147 
AQ 4 GLY R  150 ? MET R  156 ? GLY R 150 MET R 156 
AQ 5 VAL R  163 ? GLN R  164 ? VAL R 163 GLN R 164 
AR 1 ALA S  158 ? ILE S  161 ? ALA S 158 ILE S 161 
AR 2 THR S  35  ? LYS S  39  ? THR S 35  LYS S 39  
AR 3 HIS S  43  ? LEU S  49  ? HIS S 43  LEU S 49  
AR 4 VAL S  210 ? GLY S  216 ? VAL S 210 GLY S 216 
AR 5 THR S  222 ? TYR S  224 ? THR S 222 TYR S 224 
AS 1 ILE S  63  ? HIS S  65  ? ILE S 63  HIS S 65  
AS 2 ILE S  70  ? GLY S  76  ? ILE S 70  GLY S 76  
AS 3 VAL S  130 ? TYR S  137 ? VAL S 130 TYR S 137 
AS 4 PRO S  142 ? THR S  147 ? PRO S 142 THR S 147 
AS 5 TYR S  153 ? CYS S  156 ? TYR S 153 CYS S 156 
AT 1 GLY T  163 ? ILE T  166 ? GLY T 162 ILE T 165 
AT 2 ALA T  37  ? CYS T  42  ? ALA T 36  CYS T 41  
AT 3 GLY T  45  ? LEU T  53  ? GLY T 44  LEU T 52  
AT 4 PHE T  210 ? TRP T  216 ? PHE T 209 TRP T 215 
AT 5 GLU T  226 ? ILE T  227 ? GLU T 225 ILE T 226 
AU 1 LEU T  67  ? ASN T  69  ? LEU T 66  ASN T 68  
AU 2 GLY T  75  ? GLY T  80  ? GLY T 74  GLY T 79  
AU 3 CYS T  134 ? SER T  142 ? CYS T 133 SER T 141 
AU 4 GLY T  146 ? ILE T  152 ? GLY T 145 ILE T 151 
AU 5 SER T  158 ? GLY T  160 ? SER T 157 GLY T 159 
AV 1 ALA U  165 ? GLY U  169 ? ALA U 165 GLY U 169 
AV 2 THR U  38  ? ARG U  43  ? THR U 38  ARG U 43  
AV 3 CYS U  47  ? GLN U  53  ? CYS U 47  GLN U 53  
AV 4 ILE U  215 ? THR U  221 ? ILE U 215 THR U 221 
AV 5 ARG U  228 ? ILE U  229 ? ARG U 228 ILE U 229 
AW 1 LEU U  69  ? LYS U  71  ? LEU U 69  LYS U 71  
AW 2 GLY U  77  ? GLY U  82  ? GLY U 77  GLY U 82  
AW 3 CYS U  136 ? ASP U  144 ? CYS U 136 ASP U 144 
AW 4 GLY U  148 ? CYS U  154 ? GLY U 148 CYS U 154 
AW 5 TYR U  160 ? PHE U  163 ? TYR U 160 PHE U 163 
AX 1 TYR V  124 ? GLY V  128 ? TYR V 124 GLY V 128 
AX 2 THR V  2   ? VAL V  7   ? THR V 2   VAL V 7   
AX 3 ILE V  12  ? ASP V  17  ? ILE V 12  ASP V 17  
AX 4 ILE V  173 ? ILE V  178 ? ILE V 173 ILE V 178 
AX 5 LEU V  183 ? SER V  190 ? LEU V 183 SER V 190 
AY 1 ALA V  20  ? GLU V  22  ? ALA V 20  GLU V 22  
AY 2 VAL V  25  ? ASP V  28  ? VAL V 25  ASP V 28  
AZ 1 ILE V  34  ? SER V  38  ? ILE V 34  SER V 38  
AZ 2 ILE V  41  ? GLY V  47  ? ILE V 41  GLY V 47  
AZ 3 ALA V  96  ? VAL V  103 ? ALA V 96  VAL V 103 
AZ 4 PRO V  108 ? ILE V  113 ? PRO V 108 ILE V 113 
AZ 5 THR V  119 ? LYS V  121 ? THR V 119 LYS V 121 
BA 1 VAL V  211 ? PRO V  218 ? VAL V 211 PRO V 218 
BA 2 LYS W  194 ? LEU W  200 ? LYS W 193 LEU W 199 
BA 3 VAL W  185 ? ILE W  190 ? VAL W 184 ILE W 189 
BA 4 VAL W  20  ? ASP W  25  ? VAL W 19  ASP W 24  
BA 5 ALA W  10  ? LYS W  15  ? ALA W 9   LYS W 14  
BA 6 PHE W  136 ? GLY W  140 ? PHE W 135 GLY W 139 
BB 1 PHE W  28  ? ILE W  30  ? PHE W 27  ILE W 29  
BB 2 GLN W  33  ? THR W  36  ? GLN W 32  THR W 35  
BC 1 ILE W  42  ? PRO W  44  ? ILE W 41  PRO W 43  
BC 2 LEU W  49  ? GLY W  55  ? LEU W 48  GLY W 54  
BC 3 THR W  105 ? LEU W  112 ? THR W 104 LEU W 111 
BC 4 PRO W  119 ? SER W  123 ? PRO W 118 SER W 122 
BC 5 MET W  131 ? VAL W  132 ? MET W 130 VAL W 131 
BD 1 PHE X  129 ? HIS X  132 ? PHE X 129 HIS X 132 
BD 2 LEU X  4   ? GLN X  8   ? LEU X 4   GLN X 8   
BD 3 VAL X  13  ? ASP X  18  ? VAL X 13  ASP X 18  
BD 4 THR X  177 ? ILE X  183 ? THR X 177 ILE X 183 
BD 5 ILE X  188 ? ALA X  195 ? ILE X 188 ALA X 195 
BE 1 ALA X  21  ? SER X  23  ? ALA X 21  SER X 23  
BE 2 VAL X  26  ? LYS X  29  ? VAL X 26  LYS X 29  
BF 1 MET X  35  ? LYS X  37  ? MET X 35  LYS X 37  
BF 2 ILE X  42  ? GLY X  48  ? ILE X 42  GLY X 48  
BF 3 VAL X  100 ? ASP X  108 ? VAL X 100 ASP X 108 
BF 4 GLY X  112 ? MET X  118 ? GLY X 112 MET X 118 
BF 5 LEU X  124 ? LYS X  126 ? LEU X 124 LYS X 126 
BG 1 ALA Y  125 ? GLY Y  129 ? ALA Y 125 GLY Y 129 
BG 2 THR Y  2   ? LYS Y  7   ? THR Y 2   LYS Y 7   
BG 3 VAL Y  12  ? ALA Y  16  ? VAL Y 12  ALA Y 16  
BG 4 ALA Y  173 ? VAL Y  179 ? ALA Y 173 VAL Y 179 
BG 5 TRP Y  184 ? ASN Y  191 ? TRP Y 184 ASN Y 191 
BH 1 ALA Y  20  ? ALA Y  22  ? ALA Y 20  ALA Y 22  
BH 2 TYR Y  25  ? SER Y  28  ? TYR Y 25  SER Y 28  
BI 1 VAL Y  34  ? GLU Y  36  ? VAL Y 34  GLU Y 36  
BI 2 LEU Y  41  ? THR Y  44  ? LEU Y 41  THR Y 44  
BI 3 GLY Y  98  ? TRP Y  104 ? GLY Y 98  TRP Y 104 
BI 4 PRO Y  109 ? ASP Y  115 ? PRO Y 109 ASP Y 115 
BI 5 ARG Y  120 ? SER Y  122 ? ARG Y 120 SER Y 122 
BJ 1 PHE Z  135 ? GLY Z  139 ? PHE Z 135 GLY Z 139 
BJ 2 THR Z  11  ? ALA Z  16  ? THR Z 11  ALA Z 16  
BJ 3 SER Z  21  ? ASP Z  26  ? SER Z 21  ASP Z 26  
BJ 4 ALA Z  192 ? VAL Z  198 ? ALA Z 192 VAL Z 198 
BJ 5 ILE Z  203 ? PRO Z  209 ? ILE Z 203 PRO Z 209 
BK 1 LEU Z  29  ? GLU Z  31  ? LEU Z 29  GLU Z 31  
BK 2 SER Z  34  ? THR Z  37  ? SER Z 34  THR Z 37  
BL 1 CYS Z  43  ? THR Z  47  ? CYS Z 43  THR Z 47  
BL 2 THR Z  50  ? GLY Z  56  ? THR Z 50  GLY Z 56  
BL 3 VAL Z  106 ? LEU Z  113 ? VAL Z 106 LEU Z 113 
BL 4 GLY Z  119 ? PHE Z  124 ? GLY Z 119 PHE Z 124 
BL 5 TYR Z  130 ? ASP Z  133 ? TYR Z 130 ASP Z 133 
BM 1 LEU AA 33  ? PHE AA 36  ? LEU a 33  PHE a 36  
BM 2 GLY AA 28  ? TYR AA 30  ? GLY a 28  TYR a 30  
BM 3 VAL AA 6   ? GLY AA 8   ? VAL a 6   GLY a 8   
BM 4 THR AA 49  ? ASP AA 56  ? THR a 49  ASP a 56  
BM 5 ILE AA 42  ? ARG AA 44  ? ILE a 42  ARG a 44  
BN 1 LEU AA 33  ? PHE AA 36  ? LEU a 33  PHE a 36  
BN 2 GLY AA 28  ? TYR AA 30  ? GLY a 28  TYR a 30  
BN 3 VAL AA 6   ? GLY AA 8   ? VAL a 6   GLY a 8   
BN 4 THR AA 49  ? ASP AA 56  ? THR a 49  ASP a 56  
BN 5 ASN AA 108 ? ALA AA 116 ? ASN a 108 ALA a 116 
BN 6 GLU AA 119 ? VAL AA 125 ? GLU a 119 VAL a 125 
BN 7 ALA AA 131 ? GLU AA 133 ? ALA a 131 GLU a 133 
BO 1 SER AA 136 ? ALA AA 138 ? SER a 136 ALA a 138 
BO 2 VAL AA 11  ? PHE AA 16  ? VAL a 11  PHE a 16  
BO 3 GLY AA 19  ? ASP AA 25  ? GLY a 19  ASP a 25  
BO 4 PHE AA 187 ? VAL AA 192 ? PHE a 187 VAL a 192 
BO 5 VAL AA 197 ? ILE AA 199 ? VAL a 197 ILE a 199 
BP 1 PHE BA 125 ? GLY BA 128 ? PHE b 125 GLY b 128 
BP 2 ILE BA 3   ? GLN BA 7   ? ILE b 3   GLN b 7   
BP 3 VAL BA 12  ? ALA BA 16  ? VAL b 12  ALA b 16  
BP 4 ILE BA 174 ? ILE BA 179 ? ILE b 174 ILE b 179 
BP 5 VAL BA 184 ? LEU BA 189 ? VAL b 184 LEU b 189 
BQ 1 THR BA 20  ? THR BA 22  ? THR b 20  THR b 22  
BQ 2 TYR BA 25  ? ASN BA 28  ? TYR b 25  ASN b 28  
BR 1 LEU BA 34  ? PRO BA 36  ? LEU b 34  PRO b 36  
BR 2 ILE BA 41  ? CYS BA 44  ? ILE b 41  CYS b 44  
BR 3 ILE BA 98  ? ASP BA 104 ? ILE b 98  ASP b 104 
BR 4 GLY BA 108 ? VAL BA 114 ? GLY b 108 VAL b 114 
BR 5 VAL BA 121 ? ARG BA 122 ? VAL b 121 ARG b 122 
BS 1 ALA CA 160 ? ALA CA 162 ? ALA c 159 ALA c 161 
BS 2 SER CA 35  ? LYS CA 39  ? SER c 34  LYS c 38  
BS 3 VAL CA 44  ? GLU CA 49  ? VAL c 43  GLU c 48  
BS 4 ILE CA 208 ? CYS CA 213 ? ILE c 207 CYS c 212 
BS 5 PHE CA 218 ? ARG CA 220 ? PHE c 217 ARG c 219 
BT 1 GLU CA 66  ? PRO CA 67  ? GLU c 65  PRO c 66  
BT 2 ILE CA 72  ? GLY CA 78  ? ILE c 71  GLY c 77  
BT 3 VAL CA 132 ? ASN CA 140 ? VAL c 131 ASN c 139 
BT 4 ARG CA 143 ? SER CA 149 ? ARG c 142 SER c 148 
BT 5 TYR CA 155 ? ALA CA 157 ? TYR c 154 ALA c 156 
BU 1 ALA DA 161 ? ILE DA 164 ? ALA d 161 ILE d 164 
BU 2 CYS DA 34  ? LEU DA 38  ? CYS d 34  LEU d 38  
BU 3 GLY DA 42  ? GLU DA 48  ? GLY d 42  GLU d 48  
BU 4 VAL DA 211 ? GLU DA 219 ? VAL d 211 GLU d 219 
BU 5 LYS DA 222 ? VAL DA 227 ? LYS d 222 VAL d 227 
BV 1 ILE DA 65  ? LYS DA 67  ? ILE d 65  LYS d 67  
BV 2 MET DA 72  ? GLY DA 78  ? MET d 72  GLY d 78  
BV 3 VAL DA 132 ? ASP DA 140 ? VAL d 132 ASP d 140 
BV 4 GLY DA 144 ? SER DA 150 ? GLY d 144 SER d 150 
BV 5 TYR DA 156 ? GLY DA 158 ? TYR d 156 GLY d 158 
BW 1 ALA EA 158 ? ILE EA 161 ? ALA e 158 ILE e 161 
BW 2 ALA EA 32  ? ARG EA 36  ? ALA e 32  ARG e 36  
BW 3 ILE EA 40  ? VAL EA 45  ? ILE e 40  VAL e 45  
BW 4 GLU EA 207 ? ARG EA 212 ? GLU e 207 ARG e 212 
BW 5 LEU EA 217 ? ILE EA 219 ? LEU e 217 ILE e 219 
BX 1 ILE EA 62  ? ALA EA 64  ? ILE e 62  ALA e 64  
BX 2 VAL EA 69  ? GLY EA 75  ? VAL e 69  GLY e 75  
BX 3 ILE EA 129 ? PHE EA 136 ? ILE e 129 PHE e 136 
BX 4 PRO EA 142 ? THR EA 147 ? PRO e 142 THR e 147 
BX 5 TYR EA 153 ? ALA EA 155 ? TYR e 153 ALA e 155 
BY 1 ALA FA 167 ? ILE FA 170 ? ALA f 167 ILE f 170 
BY 2 ALA FA 37  ? THR FA 42  ? ALA f 37  THR f 42  
BY 3 GLY FA 45  ? GLU FA 51  ? GLY f 45  GLU f 51  
BY 4 ILE FA 215 ? VAL FA 220 ? ILE f 215 VAL f 220 
BY 5 HIS FA 227 ? MET FA 228 ? HIS f 227 MET f 228 
BZ 1 ILE FA 67  ? GLU FA 69  ? ILE f 67  GLU f 69  
BZ 2 ILE FA 74  ? GLY FA 80  ? ILE f 74  GLY f 80  
BZ 3 VAL FA 139 ? VAL FA 146 ? VAL f 139 VAL f 146 
BZ 4 PRO FA 151 ? MET FA 156 ? PRO f 151 MET f 156 
BZ 5 VAL FA 163 ? GLN FA 164 ? VAL f 163 GLN f 164 
CA 1 ALA GA 158 ? ILE GA 161 ? ALA g 158 ILE g 161 
CA 2 THR GA 35  ? LYS GA 39  ? THR g 35  LYS g 39  
CA 3 HIS GA 43  ? LEU GA 49  ? HIS g 43  LEU g 49  
CA 4 VAL GA 210 ? GLY GA 216 ? VAL g 210 GLY g 216 
CA 5 THR GA 222 ? TYR GA 224 ? THR g 222 TYR g 224 
CB 1 ILE GA 63  ? HIS GA 65  ? ILE g 63  HIS g 65  
CB 2 ILE GA 70  ? GLY GA 76  ? ILE g 70  GLY g 76  
CB 3 VAL GA 130 ? ASP GA 138 ? VAL g 130 ASP g 138 
CB 4 GLY GA 141 ? THR GA 147 ? GLY g 141 THR g 147 
CB 5 TYR GA 153 ? CYS GA 156 ? TYR g 153 CYS g 156 
CC 1 GLY HA 163 ? ILE HA 166 ? GLY h 162 ILE h 165 
CC 2 ALA HA 37  ? ARG HA 41  ? ALA h 36  ARG h 40  
CC 3 VAL HA 46  ? VAL HA 54  ? VAL h 45  VAL h 53  
CC 4 ALA HA 209 ? TRP HA 216 ? ALA h 208 TRP h 215 
CC 5 GLU HA 226 ? ILE HA 227 ? GLU h 225 ILE h 226 
CD 1 LEU HA 67  ? ASN HA 69  ? LEU h 66  ASN h 68  
CD 2 VAL HA 74  ? GLY HA 80  ? VAL h 73  GLY h 79  
CD 3 CYS HA 134 ? TYR HA 141 ? CYS h 133 TYR h 140 
CD 4 ALA HA 147 ? ILE HA 152 ? ALA h 146 ILE h 151 
CD 5 SER HA 158 ? GLY HA 160 ? SER h 157 GLY h 159 
CE 1 ALA IA 165 ? GLY IA 169 ? ALA i 165 GLY i 169 
CE 2 THR IA 38  ? ARG IA 43  ? THR i 38  ARG i 43  
CE 3 CYS IA 47  ? GLN IA 53  ? CYS i 47  GLN i 53  
CE 4 ILE IA 215 ? THR IA 221 ? ILE i 215 THR i 221 
CE 5 ARG IA 228 ? ILE IA 229 ? ARG i 228 ILE i 229 
CF 1 LEU IA 69  ? LYS IA 71  ? LEU i 69  LYS i 71  
CF 2 GLY IA 77  ? GLY IA 82  ? GLY i 77  GLY i 82  
CF 3 CYS IA 136 ? ASP IA 144 ? CYS i 136 ASP i 144 
CF 4 GLY IA 148 ? CYS IA 154 ? GLY i 148 CYS i 154 
CF 5 TYR IA 160 ? PHE IA 163 ? TYR i 160 PHE i 163 
CG 1 TYR JA 124 ? GLY JA 128 ? TYR j 124 GLY j 128 
CG 2 THR JA 2   ? VAL JA 7   ? THR j 2   VAL j 7   
CG 3 ILE JA 12  ? ASP JA 17  ? ILE j 12  ASP j 17  
CG 4 ILE JA 173 ? SER JA 179 ? ILE j 173 SER j 179 
CG 5 LYS JA 182 ? SER JA 190 ? LYS j 182 SER j 190 
CH 1 ALA JA 20  ? GLU JA 22  ? ALA j 20  GLU j 22  
CH 2 VAL JA 25  ? ASP JA 28  ? VAL j 25  ASP j 28  
CI 1 ILE JA 34  ? PHE JA 36  ? ILE j 34  PHE j 36  
CI 2 ILE JA 41  ? GLY JA 47  ? ILE j 41  GLY j 47  
CI 3 ALA JA 96  ? VAL JA 103 ? ALA j 96  VAL j 103 
CI 4 PRO JA 108 ? ILE JA 113 ? PRO j 108 ILE j 113 
CI 5 THR JA 119 ? LYS JA 121 ? THR j 119 LYS j 121 
CJ 1 VAL JA 211 ? PRO JA 218 ? VAL j 211 PRO j 218 
CJ 2 LYS KA 194 ? LEU KA 200 ? LYS k 193 LEU k 199 
CJ 3 VAL KA 185 ? ILE KA 190 ? VAL k 184 ILE k 189 
CJ 4 VAL KA 20  ? ASP KA 25  ? VAL k 19  ASP k 24  
CJ 5 ALA KA 10  ? LYS KA 15  ? ALA k 9   LYS k 14  
CJ 6 PHE KA 136 ? GLY KA 140 ? PHE k 135 GLY k 139 
CK 1 PHE KA 28  ? ILE KA 30  ? PHE k 27  ILE k 29  
CK 2 GLN KA 33  ? THR KA 36  ? GLN k 32  THR k 35  
CL 1 ILE KA 42  ? PRO KA 44  ? ILE k 41  PRO k 43  
CL 2 LEU KA 49  ? GLY KA 55  ? LEU k 48  GLY k 54  
CL 3 THR KA 105 ? LEU KA 112 ? THR k 104 LEU k 111 
CL 4 PRO KA 119 ? SER KA 123 ? PRO k 118 SER k 122 
CL 5 MET KA 131 ? VAL KA 132 ? MET k 130 VAL k 131 
CM 1 PHE LA 129 ? HIS LA 132 ? PHE l 129 HIS l 132 
CM 2 LEU LA 4   ? GLN LA 8   ? LEU l 4   GLN l 8   
CM 3 VAL LA 13  ? ASP LA 18  ? VAL l 13  ASP l 18  
CM 4 THR LA 177 ? ASP LA 184 ? THR l 177 ASP l 184 
CM 5 GLY LA 187 ? ASN LA 190 ? GLY l 187 ASN l 190 
CN 1 PHE LA 129 ? HIS LA 132 ? PHE l 129 HIS l 132 
CN 2 LEU LA 4   ? GLN LA 8   ? LEU l 4   GLN l 8   
CN 3 VAL LA 13  ? ASP LA 18  ? VAL l 13  ASP l 18  
CN 4 THR LA 177 ? ASP LA 184 ? THR l 177 ASP l 184 
CN 5 ILE LA 194 ? ALA LA 195 ? ILE l 194 ALA l 195 
CO 1 ALA LA 21  ? SER LA 23  ? ALA l 21  SER l 23  
CO 2 VAL LA 26  ? LYS LA 29  ? VAL l 26  LYS l 29  
CP 1 MET LA 35  ? LYS LA 37  ? MET l 35  LYS l 37  
CP 2 ILE LA 42  ? GLY LA 48  ? ILE l 42  GLY l 48  
CP 3 VAL LA 100 ? TYR LA 107 ? VAL l 100 TYR l 107 
CP 4 PRO LA 113 ? MET LA 118 ? PRO l 113 MET l 118 
CP 5 LEU LA 124 ? LYS LA 126 ? LEU l 124 LYS l 126 
CQ 1 ALA MA 125 ? GLY MA 129 ? ALA m 125 GLY m 129 
CQ 2 THR MA 2   ? LYS MA 7   ? THR m 2   LYS m 7   
CQ 3 VAL MA 12  ? ALA MA 16  ? VAL m 12  ALA m 16  
CQ 4 ALA MA 173 ? VAL MA 179 ? ALA m 173 VAL m 179 
CQ 5 TRP MA 184 ? ASN MA 191 ? TRP m 184 ASN m 191 
CR 1 ALA MA 20  ? ALA MA 22  ? ALA m 20  ALA m 22  
CR 2 TYR MA 25  ? SER MA 28  ? TYR m 25  SER m 28  
CS 1 ILE MA 35  ? GLU MA 36  ? ILE m 35  GLU m 36  
CS 2 LEU MA 42  ? GLY MA 43  ? LEU m 42  GLY m 43  
CT 1 GLY MA 98  ? TRP MA 104 ? GLY m 98  TRP m 104 
CT 2 PRO MA 109 ? ASP MA 115 ? PRO m 109 ASP m 115 
CT 3 ARG MA 120 ? SER MA 122 ? ARG m 120 SER m 122 
CU 1 PHE NA 135 ? GLY NA 139 ? PHE n 135 GLY n 139 
CU 2 THR NA 11  ? ALA NA 16  ? THR n 11  ALA n 16  
CU 3 SER NA 21  ? ASP NA 26  ? SER n 21  ASP n 26  
CU 4 ALA NA 192 ? VAL NA 198 ? ALA n 192 VAL n 198 
CU 5 ILE NA 203 ? PRO NA 209 ? ILE n 203 PRO n 209 
CV 1 LEU NA 29  ? GLU NA 31  ? LEU n 29  GLU n 31  
CV 2 SER NA 34  ? THR NA 37  ? SER n 34  THR n 37  
CW 1 CYS NA 43  ? LYS NA 45  ? CYS n 43  LYS n 45  
CW 2 THR NA 50  ? GLY NA 56  ? THR n 50  GLY n 56  
CW 3 VAL NA 106 ? LEU NA 113 ? VAL n 106 LEU n 113 
CW 4 GLY NA 119 ? PHE NA 124 ? GLY n 119 PHE n 124 
CW 5 TYR NA 130 ? ASP NA 133 ? TYR n 130 ASP n 133 
CX 1 LEU OA 33  ? PHE OA 36  ? LEU o 33  PHE o 36  
CX 2 GLY OA 28  ? TYR OA 30  ? GLY o 28  TYR o 30  
CX 3 VAL OA 6   ? GLY OA 8   ? VAL o 6   GLY o 8   
CX 4 THR OA 49  ? ASP OA 56  ? THR o 49  ASP o 56  
CX 5 ILE OA 42  ? ARG OA 44  ? ILE o 42  ARG o 44  
CY 1 LEU OA 33  ? PHE OA 36  ? LEU o 33  PHE o 36  
CY 2 GLY OA 28  ? TYR OA 30  ? GLY o 28  TYR o 30  
CY 3 VAL OA 6   ? GLY OA 8   ? VAL o 6   GLY o 8   
CY 4 THR OA 49  ? ASP OA 56  ? THR o 49  ASP o 56  
CY 5 ASN OA 108 ? ALA OA 116 ? ASN o 108 ALA o 116 
CY 6 GLU OA 119 ? VAL OA 125 ? GLU o 119 VAL o 125 
CY 7 ALA OA 131 ? GLU OA 133 ? ALA o 131 GLU o 133 
CZ 1 SER OA 136 ? ALA OA 138 ? SER o 136 ALA o 138 
CZ 2 VAL OA 11  ? PHE OA 16  ? VAL o 11  PHE o 16  
CZ 3 GLY OA 19  ? ASP OA 25  ? GLY o 19  ASP o 25  
CZ 4 PHE OA 187 ? VAL OA 192 ? PHE o 187 VAL o 192 
CZ 5 VAL OA 197 ? ILE OA 199 ? VAL o 197 ILE o 199 
DA 1 PHE PA 125 ? GLY PA 129 ? PHE p 125 GLY p 129 
DA 2 THR PA 2   ? GLN PA 7   ? THR p 2   GLN p 7   
DA 3 VAL PA 12  ? ALA PA 16  ? VAL p 12  ALA p 16  
DA 4 ILE PA 174 ? ILE PA 179 ? ILE p 174 ILE p 179 
DA 5 VAL PA 184 ? LEU PA 189 ? VAL p 184 LEU p 189 
DB 1 THR PA 20  ? THR PA 21  ? THR p 20  THR p 21  
DB 2 ILE PA 26  ? ASN PA 28  ? ILE p 26  ASN p 28  
DC 1 LEU PA 34  ? PRO PA 36  ? LEU p 34  PRO p 36  
DC 2 ILE PA 41  ? CYS PA 44  ? ILE p 41  CYS p 44  
DC 3 ILE PA 98  ? ASP PA 104 ? ILE p 98  ASP p 104 
DC 4 GLY PA 108 ? VAL PA 114 ? GLY p 108 VAL p 114 
DC 5 VAL PA 121 ? ARG PA 122 ? VAL p 121 ARG p 122 
DD 1 ALA QA 160 ? ALA QA 162 ? ALA q 159 ALA q 161 
DD 2 SER QA 35  ? LYS QA 39  ? SER q 34  LYS q 38  
DD 3 VAL QA 44  ? GLU QA 49  ? VAL q 43  GLU q 48  
DD 4 ILE QA 208 ? CYS QA 213 ? ILE q 207 CYS q 212 
DD 5 PHE QA 218 ? ARG QA 220 ? PHE q 217 ARG q 219 
DE 1 GLU QA 66  ? PRO QA 67  ? GLU q 65  PRO q 66  
DE 2 GLY QA 73  ? GLY QA 78  ? GLY q 72  GLY q 77  
DE 3 VAL QA 132 ? ASN QA 140 ? VAL q 131 ASN q 139 
DE 4 ARG QA 143 ? SER QA 149 ? ARG q 142 SER q 148 
DE 5 TYR QA 155 ? ALA QA 157 ? TYR q 154 ALA q 156 
DF 1 ALA RA 161 ? ILE RA 164 ? ALA r 161 ILE r 164 
DF 2 CYS RA 34  ? LEU RA 38  ? CYS r 34  LEU r 38  
DF 3 GLY RA 42  ? GLU RA 48  ? GLY r 42  GLU r 48  
DF 4 VAL RA 211 ? GLU RA 219 ? VAL r 211 GLU r 219 
DF 5 LYS RA 222 ? VAL RA 227 ? LYS r 222 VAL r 227 
DG 1 ILE RA 65  ? ASN RA 69  ? ILE r 65  ASN r 69  
DG 2 MET RA 72  ? GLY RA 78  ? MET r 72  GLY r 78  
DG 3 VAL RA 132 ? ASP RA 140 ? VAL r 132 ASP r 140 
DG 4 GLY RA 144 ? SER RA 150 ? GLY r 144 SER r 150 
DG 5 TYR RA 156 ? GLY RA 158 ? TYR r 156 GLY r 158 
DH 1 ALA SA 158 ? ILE SA 161 ? ALA s 158 ILE s 161 
DH 2 THR SA 31  ? ARG SA 36  ? THR s 31  ARG s 36  
DH 3 VAL SA 41  ? GLU SA 46  ? VAL s 41  GLU s 46  
DH 4 GLU SA 207 ? MET SA 211 ? GLU s 207 MET s 211 
DH 5 LYS SA 218 ? ILE SA 219 ? LYS s 218 ILE s 219 
DI 1 ILE SA 62  ? ALA SA 64  ? ILE s 62  ALA s 64  
DI 2 VAL SA 69  ? GLY SA 75  ? VAL s 69  GLY s 75  
DI 3 ILE SA 129 ? PHE SA 136 ? ILE s 129 PHE s 136 
DI 4 PRO SA 142 ? GLN SA 146 ? PRO s 142 GLN s 146 
DI 5 HIS SA 154 ? ALA SA 155 ? HIS s 154 ALA s 155 
DJ 1 ALA TA 167 ? ILE TA 170 ? ALA t 167 ILE t 170 
DJ 2 ALA TA 37  ? THR TA 42  ? ALA t 37  THR t 42  
DJ 3 GLY TA 45  ? GLU TA 51  ? GLY t 45  GLU t 51  
DJ 4 ILE TA 215 ? VAL TA 220 ? ILE t 215 VAL t 220 
DJ 5 HIS TA 227 ? MET TA 228 ? HIS t 227 MET t 228 
DK 1 ILE TA 67  ? GLU TA 69  ? ILE t 67  GLU t 69  
DK 2 ILE TA 74  ? GLY TA 80  ? ILE t 74  GLY t 80  
DK 3 VAL TA 139 ? ASP TA 147 ? VAL t 139 ASP t 147 
DK 4 GLY TA 150 ? MET TA 156 ? GLY t 150 MET t 156 
DK 5 VAL TA 163 ? GLN TA 164 ? VAL t 163 GLN t 164 
DL 1 ALA UA 158 ? ILE UA 161 ? ALA u 158 ILE u 161 
DL 2 THR UA 35  ? LYS UA 39  ? THR u 35  LYS u 39  
DL 3 HIS UA 43  ? LEU UA 49  ? HIS u 43  LEU u 49  
DL 4 VAL UA 210 ? GLY UA 216 ? VAL u 210 GLY u 216 
DL 5 THR UA 222 ? TYR UA 224 ? THR u 222 TYR u 224 
DM 1 ILE UA 63  ? HIS UA 65  ? ILE u 63  HIS u 65  
DM 2 ILE UA 70  ? GLY UA 76  ? ILE u 70  GLY u 76  
DM 3 VAL UA 130 ? ASP UA 138 ? VAL u 130 ASP u 138 
DM 4 GLY UA 141 ? THR UA 147 ? GLY u 141 THR u 147 
DM 5 TYR UA 153 ? CYS UA 156 ? TYR u 153 CYS u 156 
DN 1 GLY VA 163 ? ILE VA 166 ? GLY v 162 ILE v 165 
DN 2 ALA VA 37  ? ARG VA 41  ? ALA v 36  ARG v 40  
DN 3 VAL VA 46  ? LEU VA 53  ? VAL v 45  LEU v 52  
DN 4 PHE VA 210 ? TRP VA 216 ? PHE v 209 TRP v 215 
DN 5 GLU VA 226 ? ILE VA 227 ? GLU v 225 ILE v 226 
DO 1 LEU VA 67  ? ASN VA 69  ? LEU v 66  ASN v 68  
DO 2 GLY VA 75  ? GLY VA 80  ? GLY v 74  GLY v 79  
DO 3 CYS VA 134 ? SER VA 140 ? CYS v 133 SER v 139 
DO 4 GLN VA 148 ? ILE VA 152 ? GLN v 147 ILE v 151 
DO 5 SER VA 158 ? GLY VA 160 ? SER v 157 GLY v 159 
DP 1 ALA WA 165 ? GLY WA 169 ? ALA w 165 GLY w 169 
DP 2 THR WA 38  ? ARG WA 43  ? THR w 38  ARG w 43  
DP 3 CYS WA 47  ? GLN WA 53  ? CYS w 47  GLN w 53  
DP 4 ILE WA 215 ? THR WA 221 ? ILE w 215 THR w 221 
DP 5 ARG WA 228 ? ILE WA 229 ? ARG w 228 ILE w 229 
DQ 1 LEU WA 69  ? LYS WA 71  ? LEU w 69  LYS w 71  
DQ 2 GLY WA 77  ? GLY WA 82  ? GLY w 77  GLY w 82  
DQ 3 CYS WA 136 ? ASP WA 144 ? CYS w 136 ASP w 144 
DQ 4 GLY WA 148 ? CYS WA 154 ? GLY w 148 CYS w 154 
DQ 5 TYR WA 160 ? PHE WA 163 ? TYR w 160 PHE w 163 
DR 1 TYR XA 124 ? GLY XA 128 ? TYR x 124 GLY x 128 
DR 2 THR XA 2   ? VAL XA 7   ? THR x 2   VAL x 7   
DR 3 ILE XA 12  ? ALA XA 16  ? ILE x 12  ALA x 16  
DR 4 ILE XA 173 ? SER XA 179 ? ILE x 173 SER x 179 
DR 5 LYS XA 182 ? SER XA 190 ? LYS x 182 SER x 190 
DS 1 ALA XA 20  ? THR XA 21  ? ALA x 20  THR x 21  
DS 2 VAL XA 26  ? ASP XA 28  ? VAL x 26  ASP x 28  
DT 1 ILE XA 34  ? SER XA 38  ? ILE x 34  SER x 38  
DT 2 ILE XA 41  ? GLY XA 47  ? ILE x 41  GLY x 47  
DT 3 ALA XA 96  ? VAL XA 103 ? ALA x 96  VAL x 103 
DT 4 PRO XA 108 ? ILE XA 113 ? PRO x 108 ILE x 113 
DT 5 THR XA 119 ? LYS XA 121 ? THR x 119 LYS x 121 
DU 1 VAL XA 211 ? PRO XA 218 ? VAL x 211 PRO x 218 
DU 2 LYS YA 194 ? LEU YA 200 ? LYS y 193 LEU y 199 
DU 3 VAL YA 185 ? ILE YA 190 ? VAL y 184 ILE y 189 
DU 4 VAL YA 20  ? ASP YA 25  ? VAL y 19  ASP y 24  
DU 5 ALA YA 10  ? LYS YA 15  ? ALA y 9   LYS y 14  
DU 6 PHE YA 136 ? GLY YA 140 ? PHE y 135 GLY y 139 
DV 1 PHE YA 28  ? ILE YA 30  ? PHE y 27  ILE y 29  
DV 2 GLN YA 33  ? THR YA 36  ? GLN y 32  THR y 35  
DW 1 ILE YA 42  ? PRO YA 44  ? ILE y 41  PRO y 43  
DW 2 LEU YA 49  ? GLY YA 55  ? LEU y 48  GLY y 54  
DW 3 THR YA 105 ? LEU YA 112 ? THR y 104 LEU y 111 
DW 4 PRO YA 119 ? SER YA 123 ? PRO y 118 SER y 122 
DW 5 MET YA 131 ? VAL YA 132 ? MET y 130 VAL y 131 
DX 1 PHE ZA 129 ? HIS ZA 132 ? PHE z 129 HIS z 132 
DX 2 LEU ZA 4   ? GLN ZA 8   ? LEU z 4   GLN z 8   
DX 3 VAL ZA 13  ? ASP ZA 18  ? VAL z 13  ASP z 18  
DX 4 THR ZA 177 ? ASP ZA 184 ? THR z 177 ASP z 184 
DX 5 GLY ZA 187 ? ALA ZA 195 ? GLY z 187 ALA z 195 
DY 1 ALA ZA 21  ? SER ZA 23  ? ALA z 21  SER z 23  
DY 2 VAL ZA 26  ? LYS ZA 29  ? VAL z 26  LYS z 29  
DZ 1 MET ZA 35  ? LYS ZA 37  ? MET z 35  LYS z 37  
DZ 2 ILE ZA 42  ? GLY ZA 48  ? ILE z 42  GLY z 48  
DZ 3 VAL ZA 100 ? TYR ZA 107 ? VAL z 100 TYR z 107 
DZ 4 PRO ZA 113 ? MET ZA 118 ? PRO z 113 MET z 118 
DZ 5 LEU ZA 124 ? LYS ZA 126 ? LEU z 124 LYS z 126 
EA 1 ALA AB 125 ? GLY AB 129 ? ALA 1 125 GLY 1 129 
EA 2 THR AB 2   ? LYS AB 7   ? THR 1 2   LYS 1 7   
EA 3 VAL AB 12  ? ALA AB 16  ? VAL 1 12  ALA 1 16  
EA 4 ALA AB 173 ? VAL AB 179 ? ALA 1 173 VAL 1 179 
EA 5 TRP AB 184 ? ASN AB 191 ? TRP 1 184 ASN 1 191 
EB 1 ALA AB 20  ? ALA AB 22  ? ALA 1 20  ALA 1 22  
EB 2 TYR AB 25  ? SER AB 28  ? TYR 1 25  SER 1 28  
EC 1 ILE AB 35  ? GLU AB 36  ? ILE 1 35  GLU 1 36  
EC 2 LEU AB 41  ? GLY AB 43  ? LEU 1 41  GLY 1 43  
EC 3 GLY AB 98  ? ASP AB 105 ? GLY 1 98  ASP 1 105 
EC 4 GLY AB 108 ? ASP AB 115 ? GLY 1 108 ASP 1 115 
EC 5 ARG AB 120 ? SER AB 122 ? ARG 1 120 SER 1 122 
ED 1 PHE BB 135 ? GLY BB 139 ? PHE 2 135 GLY 2 139 
ED 2 THR BB 11  ? ALA BB 16  ? THR 2 11  ALA 2 16  
ED 3 SER BB 21  ? ASP BB 26  ? SER 2 21  ASP 2 26  
ED 4 ALA BB 192 ? VAL BB 198 ? ALA 2 192 VAL 2 198 
ED 5 ILE BB 203 ? PRO BB 209 ? ILE 2 203 PRO 2 209 
EE 1 LEU BB 29  ? GLU BB 31  ? LEU 2 29  GLU 2 31  
EE 2 SER BB 34  ? THR BB 37  ? SER 2 34  THR 2 37  
EF 1 CYS BB 43  ? LYS BB 45  ? CYS 2 43  LYS 2 45  
EF 2 THR BB 50  ? GLY BB 53  ? THR 2 50  GLY 2 53  
EF 3 ILE BB 109 ? LEU BB 113 ? ILE 2 109 LEU 2 113 
EF 4 GLY BB 119 ? PHE BB 124 ? GLY 2 119 PHE 2 124 
EF 5 TYR BB 130 ? ASP BB 133 ? TYR 2 130 ASP 2 133 
EG 1 LEU CB 33  ? PHE CB 36  ? LEU 3 33  PHE 3 36  
EG 2 GLY CB 28  ? TYR CB 30  ? GLY 3 28  TYR 3 30  
EG 3 VAL CB 6   ? GLY CB 8   ? VAL 3 6   GLY 3 8   
EG 4 THR CB 49  ? ASP CB 56  ? THR 3 49  ASP 3 56  
EG 5 ILE CB 42  ? ARG CB 44  ? ILE 3 42  ARG 3 44  
EH 1 LEU CB 33  ? PHE CB 36  ? LEU 3 33  PHE 3 36  
EH 2 GLY CB 28  ? TYR CB 30  ? GLY 3 28  TYR 3 30  
EH 3 VAL CB 6   ? GLY CB 8   ? VAL 3 6   GLY 3 8   
EH 4 THR CB 49  ? ASP CB 56  ? THR 3 49  ASP 3 56  
EH 5 ASN CB 108 ? ALA CB 116 ? ASN 3 108 ALA 3 116 
EH 6 GLU CB 119 ? VAL CB 125 ? GLU 3 119 VAL 3 125 
EH 7 ALA CB 131 ? GLU CB 133 ? ALA 3 131 GLU 3 133 
EI 1 SER CB 136 ? ALA CB 138 ? SER 3 136 ALA 3 138 
EI 2 VAL CB 11  ? PHE CB 16  ? VAL 3 11  PHE 3 16  
EI 3 GLY CB 19  ? ASP CB 25  ? GLY 3 19  ASP 3 25  
EI 4 PHE CB 187 ? VAL CB 192 ? PHE 3 187 VAL 3 192 
EI 5 VAL CB 197 ? ILE CB 199 ? VAL 3 197 ILE 3 199 
EJ 1 PHE DB 125 ? GLY DB 129 ? PHE 4 125 GLY 4 129 
EJ 2 THR DB 2   ? GLN DB 7   ? THR 4 2   GLN 4 7   
EJ 3 VAL DB 12  ? ALA DB 16  ? VAL 4 12  ALA 4 16  
EJ 4 ILE DB 174 ? ILE DB 179 ? ILE 4 174 ILE 4 179 
EJ 5 VAL DB 184 ? LEU DB 189 ? VAL 4 184 LEU 4 189 
EK 1 THR DB 20  ? THR DB 21  ? THR 4 20  THR 4 21  
EK 2 ILE DB 26  ? ASN DB 28  ? ILE 4 26  ASN 4 28  
EL 1 LEU DB 34  ? PRO DB 36  ? LEU 4 34  PRO 4 36  
EL 2 ILE DB 41  ? CYS DB 44  ? ILE 4 41  CYS 4 44  
EL 3 ILE DB 98  ? ASP DB 104 ? ILE 4 98  ASP 4 104 
EL 4 GLY DB 108 ? VAL DB 114 ? GLY 4 108 VAL 4 114 
EL 5 VAL DB 121 ? ARG DB 122 ? VAL 4 121 ARG 4 122 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O THR A  161 ? O THR A 160 N GLY A  37  ? N GLY A 36  
A  2 3 N VAL A  36  ? N VAL A 35  O ALA A  47  ? O ALA A 46  
A  3 4 N VAL A  44  ? N VAL A 43  O CYS A  213 ? O CYS A 212 
A  4 5 N ILE A  212 ? N ILE A 211 O ARG A  219 ? O ARG A 218 
B  1 2 N GLU A  66  ? N GLU A 65  O LEU A  74  ? O LEU A 73  
B  2 3 N VAL A  75  ? N VAL A 74  O LEU A  135 ? O LEU A 134 
B  3 4 N LEU A  134 ? N LEU A 133 O SER A  149 ? O SER A 148 
B  4 5 N GLN A  148 ? N GLN A 147 O PHE A  156 ? O PHE A 155 
C  1 2 O ILE B  164 ? O ILE B 164 N CYS B  34  ? N CYS B 34  
C  2 3 N LEU B  35  ? N LEU B 35  O ALA B  46  ? O ALA B 46  
C  3 4 N ALA B  47  ? N ALA B 47  O GLU B  212 ? O GLU B 212 
C  4 5 N GLU B  219 ? N GLU B 219 O LYS B  222 ? O LYS B 222 
D  1 2 N TYR B  66  ? N TYR B 66  O CYS B  74  ? O CYS B 74  
D  2 3 N ALA B  73  ? N ALA B 73  O ILE B  137 ? O ILE B 137 
D  3 4 N GLY B  138 ? N GLY B 138 O GLN B  146 ? O GLN B 146 
D  4 5 N GLN B  149 ? N GLN B 149 O GLY B  157 ? O GLY B 157 
E  1 2 O ILE C  161 ? O ILE C 161 N ALA C  32  ? N ALA C 32  
E  2 3 N VAL C  33  ? N VAL C 33  O GLY C  44  ? O GLY C 44  
E  3 4 N VAL C  45  ? N VAL C 45  O GLU C  207 ? O GLU C 207 
E  4 5 N VAL C  210 ? N VAL C 210 O LYS C  218 ? O LYS C 218 
F  1 2 N CYS C  63  ? N CYS C 63  O MET C  71  ? O MET C 71  
F  2 3 N CYS C  70  ? N CYS C 70  O VAL C  134 ? O VAL C 134 
F  3 4 N ILE C  133 ? N ILE C 133 O TYR C  145 ? O TYR C 145 
F  4 5 N GLN C  146 ? N GLN C 146 O HIS C  154 ? O HIS C 154 
G  1 2 O ARG D  168 ? O ARG D 168 N GLY D  39  ? N GLY D 39  
G  2 3 N ILE D  38  ? N ILE D 38  O ALA D  49  ? O ALA D 49  
G  3 4 N VAL D  46  ? N VAL D 46  O VAL D  220 ? O VAL D 220 
G  4 5 N THR D  219 ? N THR D 219 O HIS D  227 ? O HIS D 227 
H  1 2 N VAL D  68  ? N VAL D 68  O CYS D  76  ? O CYS D 76  
H  2 3 N GLY D  75  ? N GLY D 75  O GLY D  144 ? O GLY D 144 
H  3 4 N GLY D  145 ? N GLY D 145 O GLN D  152 ? O GLN D 152 
H  4 5 N HIS D  155 ? N HIS D 155 O VAL D  163 ? O VAL D 163 
I  1 2 O MET E  159 ? O MET E 159 N GLY E  37  ? N GLY E 37  
I  2 3 N VAL E  36  ? N VAL E 36  O VAL E  47  ? O VAL E 47  
I  3 4 N LEU E  46  ? N LEU E 46  O GLY E  213 ? O GLY E 213 
I  4 5 N ILE E  212 ? N ILE E 212 O TYR E  224 ? O TYR E 224 
J  1 2 N LEU E  64  ? N LEU E 64  O ILE E  72  ? O ILE E 72  
J  2 3 N ALA E  75  ? N ALA E 75  O GLY E  131 ? O GLY E 131 
J  3 4 N ILE E  134 ? N ILE E 134 O PHE E  145 ? O PHE E 145 
J  4 5 N GLN E  146 ? N GLN E 146 O PHE E  154 ? O PHE E 154 
K  1 2 O ILE F  166 ? O ILE F 165 N ALA F  37  ? N ALA F 36  
K  2 3 N ILE F  38  ? N ILE F 37  O GLY F  49  ? O GLY F 48  
K  3 4 N VAL F  46  ? N VAL F 45  O VAL F  217 ? O VAL F 216 
K  4 5 N TRP F  216 ? N TRP F 215 O GLU F  226 ? O GLU F 225 
L  1 2 N PHE F  68  ? N PHE F 67  O MET F  76  ? O MET F 75  
L  2 3 N ALA F  77  ? N ALA F 76  O MET F  137 ? O MET F 136 
L  3 4 N LEU F  138 ? N LEU F 137 O TYR F  150 ? O TYR F 149 
L  4 5 N MET F  151 ? N MET F 150 O TYR F  159 ? O TYR F 158 
M  1 2 O ALA G  168 ? O ALA G 168 N SER G  39  ? N SER G 39  
M  2 3 N VAL G  40  ? N VAL G 40  O VAL G  51  ? O VAL G 51  
M  3 4 N THR G  52  ? N THR G 52  O GLU G  216 ? O GLU G 216 
M  4 5 N VAL G  219 ? N VAL G 219 O ARG G  228 ? O ARG G 228 
N  1 2 N PHE G  70  ? N PHE G 70  O CYS G  78  ? O CYS G 78  
N  2 3 N GLY G  77  ? N GLY G 77  O ILE G  141 ? O ILE G 141 
N  3 4 N ASP G  144 ? N ASP G 144 O GLY G  148 ? O GLY G 148 
N  4 5 N LYS G  153 ? N LYS G 153 O CYS G  161 ? O CYS G 161 
O  1 2 O MET H  127 ? O MET H 127 N ILE H  3   ? N ILE H 3   
O  2 3 N ALA H  4   ? N ALA H 4   O GLY H  15  ? O GLY H 15  
O  3 4 N ALA H  16  ? N ALA H 16  O ASP H  174 ? O ASP H 174 
O  4 5 N VAL H  177 ? N VAL H 177 O ASP H  184 ? O ASP H 184 
P  1 2 N GLU H  22  ? N GLU H 22  O VAL H  25  ? O VAL H 25  
Q  1 2 N HIS H  35  ? N HIS H 35  O CYS H  43  ? O CYS H 43  
Q  2 3 N ALA H  46  ? N ALA H 46  O ALA H  97  ? O ALA H 97  
Q  3 4 N LEU H  100 ? N LEU H 100 O TYR H  111 ? O TYR H 111 
Q  4 5 N SER H  112 ? N SER H 112 O ASP H  120 ? O ASP H 120 
R  1 2 N LYS H  215 ? N LYS H 215 O THR I  197 ? O THR I 196 
R  2 3 O THR I  196 ? O THR I 195 N VAL I  189 ? N VAL I 188 
R  3 4 O ILE I  190 ? O ILE I 189 N VAL I  20  ? N VAL I 19  
R  4 5 O ALA I  23  ? O ALA I 22  N MET I  12  ? N MET I 11  
R  5 6 N VAL I  11  ? N VAL I 10  O SER I  139 ? O SER I 138 
S  1 2 N PHE I  28  ? N PHE I 27  O VAL I  35  ? O VAL I 34  
T  1 2 N PHE I  43  ? N PHE I 42  O ILE I  51  ? O ILE I 50  
T  2 3 N GLY I  52  ? N GLY I 51  O VAL I  108 ? O VAL I 107 
T  3 4 N ILE I  109 ? N ILE I 108 O CYS I  122 ? O CYS I 121 
T  4 5 N SER I  123 ? N SER I 122 O MET I  131 ? O MET I 130 
U  1 2 O ALA J  130 ? O ALA J 130 N GLY J  6   ? N GLY J 6   
U  2 3 N ILE J  7   ? N ILE J 7   O LEU J  14  ? O LEU J 14  
U  3 4 N SER J  17  ? N SER J 17  O SER J  179 ? O SER J 179 
U  4 5 N VAL J  182 ? N VAL J 182 O HIS J  189 ? O HIS J 189 
V  1 2 N SER J  23  ? N SER J 23  O VAL J  26  ? O VAL J 26  
W  1 2 N PHE J  36  ? N PHE J 36  O LEU J  44  ? O LEU J 44  
W  2 3 N VAL J  47  ? N VAL J 47  O ASN J  101 ? O ASN J 101 
W  3 4 N LEU J  104 ? N LEU J 104 O TYR J  116 ? O TYR J 116 
W  4 5 N TYR J  117 ? N TYR J 117 O ALA J  125 ? O ALA J 125 
X  1 2 O VAL K  128 ? O VAL K 128 N THR K  3   ? N THR K 3   
X  2 3 N LEU K  4   ? N LEU K 4   O ALA K  15  ? O ALA K 15  
X  3 4 N ALA K  16  ? N ALA K 16  O ASN K  175 ? O ASN K 175 
X  4 5 N VAL K  174 ? N VAL K 174 O ASP K  190 ? O ASP K 190 
Y  1 2 N ALA K  20  ? N ALA K 20  O SER K  28  ? O SER K 28  
Z  1 2 N ILE K  35  ? N ILE K 35  O GLY K  43  ? O GLY K 43  
Z  2 3 N LEU K  42  ? N LEU K 42  O CYS K  102 ? O CYS K 102 
Z  3 4 N THR K  99  ? N THR K 99  O VAL K  114 ? O VAL K 114 
Z  4 5 N TYR K  113 ? N TYR K 113 O ILE K  121 ? O ILE K 121 
AA 1 2 O GLY L  138 ? O GLY L 138 N VAL L  12  ? N VAL L 12  
AA 2 3 N LEU L  13  ? N LEU L 13  O ALA L  24  ? O ALA L 24  
AA 3 4 N SER L  21  ? N SER L 21  O VAL L  198 ? O VAL L 198 
AA 4 5 N LEU L  193 ? N LEU L 193 O VAL L  208 ? O VAL L 208 
AB 1 2 N GLU L  31  ? N GLU L 31  O SER L  34  ? O SER L 34  
AC 1 2 N TYR L  44  ? N TYR L 44  O ILE L  52  ? O ILE L 52  
AC 2 3 N VAL L  51  ? N VAL L 51  O GLY L  111 ? O GLY L 111 
AC 3 4 N GLY L  112 ? N GLY L 112 O ALA L  120 ? O ALA L 120 
AC 4 5 N VAL L  121 ? N VAL L 121 O ASP L  133 ? O ASP L 133 
AD 1 2 O LEU M  33  ? O LEU M 33  N TYR M  30  ? N TYR M 30  
AD 2 3 O SER M  29  ? O SER M 29  N THR M  7   ? N THR M 7   
AD 3 4 N GLY M  8   ? N GLY M 8   O GLY M  55  ? O GLY M 55  
AD 4 5 O LEU M  51  ? O LEU M 51  N MET M  43  ? N MET M 43  
AE 1 2 O LEU M  33  ? O LEU M 33  N TYR M  30  ? N TYR M 30  
AE 2 3 O SER M  29  ? O SER M 29  N THR M  7   ? N THR M 7   
AE 3 4 N GLY M  8   ? N GLY M 8   O GLY M  55  ? O GLY M 55  
AE 4 5 N SER M  54  ? N SER M 54  O THR M  109 ? O THR M 109 
AE 5 6 N GLY M  114 ? N GLY M 114 O PHE M  121 ? O PHE M 121 
AE 6 7 N TYR M  124 ? N TYR M 124 O TYR M  132 ? O TYR M 132 
AF 1 2 O LEU M  137 ? O LEU M 137 N GLY M  13  ? N GLY M 13  
AF 2 3 N PHE M  16  ? N PHE M 16  O GLY M  19  ? O GLY M 19  
AF 3 4 N ILE M  22  ? N ILE M 22  O ALA M  190 ? O ALA M 190 
AF 4 5 N THR M  191 ? N THR M 191 O GLU M  198 ? O GLU M 198 
AG 1 2 O GLY N  128 ? O GLY N 128 N ILE N  3   ? N ILE N 3   
AG 2 3 N MET N  4   ? N MET N 4   O GLY N  15  ? O GLY N 15  
AG 3 4 N LEU N  14  ? N LEU N 14  O ALA N  177 ? O ALA N 177 
AG 4 5 N ALA N  178 ? N ALA N 178 O GLU N  185 ? O GLU N 185 
AH 1 2 N THR N  20  ? N THR N 20  O ALA N  27  ? O ALA N 27  
AI 1 2 N THR N  35  ? N THR N 35  O CYS N  43  ? O CYS N 43  
AI 2 3 N CYS N  44  ? N CYS N 44  O ILE N  99  ? O ILE N 99  
AI 3 4 N ILE N  100 ? N ILE N 100 O TYR N  112 ? O TYR N 112 
AI 4 5 N SER N  113 ? N SER N 113 O VAL N  121 ? O VAL N 121 
AJ 1 2 O MET O  163 ? O MET O 162 N SER O  35  ? N SER O 34  
AJ 2 3 N VAL O  36  ? N VAL O 35  O ALA O  47  ? O ALA O 46  
AJ 3 4 N LEU O  46  ? N LEU O 45  O GLY O  211 ? O GLY O 210 
AJ 4 5 N ILE O  212 ? N ILE O 211 O ARG O  219 ? O ARG O 218 
AK 1 2 N GLU O  66  ? N GLU O 65  O LEU O  74  ? O LEU O 73  
AK 2 3 N VAL O  75  ? N VAL O 74  O LEU O  135 ? O LEU O 134 
AK 3 4 N LEU O  134 ? N LEU O 133 O SER O  149 ? O SER O 148 
AK 4 5 N GLN O  148 ? N GLN O 147 O PHE O  156 ? O PHE O 155 
AL 1 2 O ILE P  164 ? O ILE P 164 N CYS P  34  ? N CYS P 34  
AL 2 3 N LEU P  35  ? N LEU P 35  O ALA P  46  ? O ALA P 46  
AL 3 4 N ALA P  47  ? N ALA P 47  O GLU P  212 ? O GLU P 212 
AL 4 5 N GLU P  219 ? N GLU P 219 O LYS P  222 ? O LYS P 222 
AM 1 2 N TYR P  66  ? N TYR P 66  O CYS P  74  ? O CYS P 74  
AM 2 3 N ALA P  77  ? N ALA P 77  O SER P  133 ? O SER P 133 
AM 3 4 N LEU P  134 ? N LEU P 134 O SER P  150 ? O SER P 150 
AM 4 5 N GLN P  149 ? N GLN P 149 O GLY P  157 ? O GLY P 157 
AN 1 2 O ILE Q  161 ? O ILE Q 161 N ALA Q  32  ? N ALA Q 32  
AN 2 3 N VAL Q  33  ? N VAL Q 33  O GLY Q  44  ? O GLY Q 44  
AN 3 4 N VAL Q  45  ? N VAL Q 45  O GLU Q  207 ? O GLU Q 207 
AN 4 5 N VAL Q  210 ? N VAL Q 210 O LYS Q  218 ? O LYS Q 218 
AO 1 2 N CYS Q  63  ? N CYS Q 63  O MET Q  71  ? O MET Q 71  
AO 2 3 N CYS Q  70  ? N CYS Q 70  O VAL Q  134 ? O VAL Q 134 
AO 3 4 N ILE Q  133 ? N ILE Q 133 O TYR Q  145 ? O TYR Q 145 
AO 4 5 N GLN Q  146 ? N GLN Q 146 O HIS Q  154 ? O HIS Q 154 
AP 1 2 O ARG R  168 ? O ARG R 168 N GLY R  39  ? N GLY R 39  
AP 2 3 N ILE R  38  ? N ILE R 38  O ALA R  49  ? O ALA R 49  
AP 3 4 N LEU R  48  ? N LEU R 48  O ALA R  218 ? O ALA R 218 
AP 4 5 N THR R  219 ? N THR R 219 O HIS R  227 ? O HIS R 227 
AQ 1 2 N VAL R  68  ? N VAL R 68  O CYS R  76  ? O CYS R 76  
AQ 2 3 N GLY R  75  ? N GLY R 75  O GLY R  144 ? O GLY R 144 
AQ 3 4 N GLY R  145 ? N GLY R 145 O GLN R  152 ? O GLN R 152 
AQ 4 5 N HIS R  155 ? N HIS R 155 O VAL R  163 ? O VAL R 163 
AR 1 2 O MET S  159 ? O MET S 159 N GLY S  37  ? N GLY S 37  
AR 2 3 N VAL S  36  ? N VAL S 36  O VAL S  47  ? O VAL S 47  
AR 3 4 N ALA S  44  ? N ALA S 44  O VAL S  215 ? O VAL S 215 
AR 4 5 N ILE S  212 ? N ILE S 212 O TYR S  224 ? O TYR S 224 
AS 1 2 N LEU S  64  ? N LEU S 64  O ILE S  72  ? O ILE S 72  
AS 2 3 N GLY S  71  ? N GLY S 71  O ALA S  135 ? O ALA S 135 
AS 3 4 N ILE S  134 ? N ILE S 134 O PHE S  145 ? O PHE S 145 
AS 4 5 N GLN S  146 ? N GLN S 146 O PHE S  154 ? O PHE S 154 
AT 1 2 O ILE T  166 ? O ILE T 165 N ALA T  37  ? N ALA T 36  
AT 2 3 N ILE T  38  ? N ILE T 37  O GLY T  49  ? O GLY T 48  
AT 3 4 N LYS T  52  ? N LYS T 51  O GLU T  211 ? O GLU T 210 
AT 4 5 N TRP T  216 ? N TRP T 215 O GLU T  226 ? O GLU T 225 
AU 1 2 N PHE T  68  ? N PHE T 67  O MET T  76  ? O MET T 75  
AU 2 3 N ALA T  79  ? N ALA T 78  O SER T  135 ? O SER T 134 
AU 3 4 N LEU T  138 ? N LEU T 137 O TYR T  150 ? O TYR T 149 
AU 4 5 N MET T  151 ? N MET T 150 O TYR T  159 ? O TYR T 158 
AV 1 2 O THR U  166 ? O THR U 166 N ALA U  41  ? N ALA U 41  
AV 2 3 N VAL U  42  ? N VAL U 42  O VAL U  49  ? O VAL U 49  
AV 3 4 N ILE U  50  ? N ILE U 50  O GLY U  218 ? O GLY U 218 
AV 4 5 N VAL U  219 ? N VAL U 219 O ARG U  228 ? O ARG U 228 
AW 1 2 N PHE U  70  ? N PHE U 70  O CYS U  78  ? O CYS U 78  
AW 2 3 N GLY U  77  ? N GLY U 77  O ILE U  141 ? O ILE U 141 
AW 3 4 N ASP U  144 ? N ASP U 144 O GLY U  148 ? O GLY U 148 
AW 4 5 N VAL U  151 ? N VAL U 151 O PHE U  163 ? O PHE U 163 
AX 1 2 O MET V  127 ? O MET V 127 N ILE V  3   ? N ILE V 3   
AX 2 3 N ALA V  4   ? N ALA V 4   O GLY V  15  ? O GLY V 15  
AX 3 4 N ALA V  16  ? N ALA V 16  O ASP V  174 ? O ASP V 174 
AX 4 5 N VAL V  177 ? N VAL V 177 O ASP V  184 ? O ASP V 184 
AY 1 2 N GLU V  22  ? N GLU V 22  O VAL V  25  ? O VAL V 25  
AZ 1 2 N HIS V  35  ? N HIS V 35  O CYS V  43  ? O CYS V 43  
AZ 2 3 N CYS V  44  ? N CYS V 44  O VAL V  99  ? O VAL V 99  
AZ 3 4 N LEU V  98  ? N LEU V 98  O ILE V  113 ? O ILE V 113 
AZ 4 5 N SER V  112 ? N SER V 112 O ASP V  120 ? O ASP V 120 
BA 1 2 N LYS V  215 ? N LYS V 215 O THR W  197 ? O THR W 196 
BA 2 3 O THR W  196 ? O THR W 195 N VAL W  189 ? N VAL W 188 
BA 3 4 O ILE W  190 ? O ILE W 189 N VAL W  20  ? N VAL W 19  
BA 4 5 O ALA W  23  ? O ALA W 22  N MET W  12  ? N MET W 11  
BA 5 6 N VAL W  11  ? N VAL W 10  O SER W  139 ? O SER W 138 
BB 1 2 N PHE W  28  ? N PHE W 27  O VAL W  35  ? O VAL W 34  
BC 1 2 N PHE W  43  ? N PHE W 42  O ILE W  51  ? O ILE W 50  
BC 2 3 N GLY W  52  ? N GLY W 51  O VAL W  108 ? O VAL W 107 
BC 3 4 N GLY W  111 ? N GLY W 110 O PHE W  120 ? O PHE W 119 
BC 4 5 N SER W  123 ? N SER W 122 O MET W  131 ? O MET W 130 
BD 1 2 O ALA X  130 ? O ALA X 130 N GLY X  6   ? N GLY X 6   
BD 2 3 N ILE X  7   ? N ILE X 7   O LEU X  14  ? O LEU X 14  
BD 3 4 N SER X  17  ? N SER X 17  O SER X  179 ? O SER X 179 
BD 4 5 N VAL X  182 ? N VAL X 182 O HIS X  189 ? O HIS X 189 
BE 1 2 N SER X  23  ? N SER X 23  O VAL X  26  ? O VAL X 26  
BF 1 2 N PHE X  36  ? N PHE X 36  O LEU X  44  ? O LEU X 44  
BF 2 3 N LEU X  43  ? N LEU X 43  O ALA X  105 ? O ALA X 105 
BF 3 4 N LEU X  104 ? N LEU X 104 O TYR X  116 ? O TYR X 116 
BF 4 5 N TYR X  117 ? N TYR X 117 O ALA X  125 ? O ALA X 125 
BG 1 2 O VAL Y  128 ? O VAL Y 128 N THR Y  3   ? N THR Y 3   
BG 2 3 N PHE Y  6   ? N PHE Y 6   O ILE Y  13  ? O ILE Y 13  
BG 3 4 N VAL Y  14  ? N VAL Y 14  O TYR Y  177 ? O TYR Y 177 
BG 4 5 N HIS Y  178 ? N HIS Y 178 O ILE Y  185 ? O ILE Y 185 
BH 1 2 N ALA Y  22  ? N ALA Y 22  O TYR Y  25  ? O TYR Y 25  
BI 1 2 N ILE Y  35  ? N ILE Y 35  O GLY Y  43  ? O GLY Y 43  
BI 2 3 N LEU Y  42  ? N LEU Y 42  O CYS Y  102 ? O CYS Y 102 
BI 3 4 N GLY Y  103 ? N GLY Y 103 O GLY Y  110 ? O GLY Y 110 
BI 4 5 N TYR Y  113 ? N TYR Y 113 O ILE Y  121 ? O ILE Y 121 
BJ 1 2 O GLY Z  138 ? O GLY Z 138 N VAL Z  12  ? N VAL Z 12  
BJ 2 3 N LEU Z  13  ? N LEU Z 13  O ALA Z  24  ? O ALA Z 24  
BJ 3 4 N VAL Z  23  ? N VAL Z 23  O CYS Z  196 ? O CYS Z 196 
BJ 4 5 N LEU Z  193 ? N LEU Z 193 O VAL Z  208 ? O VAL Z 208 
BK 1 2 N GLU Z  31  ? N GLU Z 31  O SER Z  34  ? O SER Z 34  
BL 1 2 N TYR Z  44  ? N TYR Z 44  O ILE Z  52  ? O ILE Z 52  
BL 2 3 N VAL Z  51  ? N VAL Z 51  O GLY Z  111 ? O GLY Z 111 
BL 3 4 N ILE Z  110 ? N ILE Z 110 O TYR Z  122 ? O TYR Z 122 
BL 4 5 N VAL Z  121 ? N VAL Z 121 O ASP Z  133 ? O ASP Z 133 
BM 1 2 O LEU AA 33  ? O LEU a 33  N TYR AA 30  ? N TYR a 30  
BM 2 3 O SER AA 29  ? O SER a 29  N THR AA 7   ? N THR a 7   
BM 3 4 N GLY AA 8   ? N GLY a 8   O GLY AA 55  ? O GLY a 55  
BM 4 5 O LEU AA 51  ? O LEU a 51  N MET AA 43  ? N MET a 43  
BN 1 2 O LEU AA 33  ? O LEU a 33  N TYR AA 30  ? N TYR a 30  
BN 2 3 O SER AA 29  ? O SER a 29  N THR AA 7   ? N THR a 7   
BN 3 4 N GLY AA 8   ? N GLY a 8   O GLY AA 55  ? O GLY a 55  
BN 4 5 N MET AA 50  ? N MET a 50  O GLY AA 113 ? O GLY a 113 
BN 5 6 N GLY AA 114 ? N GLY a 114 O PHE AA 121 ? O PHE a 121 
BN 6 7 N TYR AA 124 ? N TYR a 124 O TYR AA 132 ? O TYR a 132 
BO 1 2 O LEU AA 137 ? O LEU a 137 N GLY AA 13  ? N GLY a 13  
BO 2 3 N LEU AA 12  ? N LEU a 12  O ALA AA 23  ? O ALA a 23  
BO 3 4 N ILE AA 22  ? N ILE a 22  O ALA AA 190 ? O ALA a 190 
BO 4 5 N THR AA 191 ? N THR a 191 O GLU AA 198 ? O GLU a 198 
BP 1 2 O GLY BA 128 ? O GLY b 128 N ILE BA 3   ? N ILE b 3   
BP 2 3 N MET BA 4   ? N MET b 4   O GLY BA 15  ? O GLY b 15  
BP 3 4 N LEU BA 14  ? N LEU b 14  O ALA BA 177 ? O ALA b 177 
BP 4 5 N LEU BA 176 ? N LEU b 176 O GLN BA 187 ? O GLN b 187 
BQ 1 2 N THR BA 22  ? N THR b 22  O TYR BA 25  ? O TYR b 25  
BR 1 2 N THR BA 35  ? N THR b 35  O CYS BA 43  ? O CYS b 43  
BR 2 3 N PHE BA 42  ? N PHE b 42  O ALA BA 101 ? O ALA b 101 
BR 3 4 N ILE BA 100 ? N ILE b 100 O TYR BA 112 ? O TYR b 112 
BR 4 5 N SER BA 113 ? N SER b 113 O VAL BA 121 ? O VAL b 121 
BS 1 2 O THR CA 161 ? O THR c 160 N GLY CA 37  ? N GLY c 36  
BS 2 3 N VAL CA 36  ? N VAL c 35  O ALA CA 47  ? O ALA c 46  
BS 3 4 N LEU CA 46  ? N LEU c 45  O GLY CA 211 ? O GLY c 210 
BS 4 5 N ILE CA 212 ? N ILE c 211 O ARG CA 219 ? O ARG c 218 
BT 1 2 N GLU CA 66  ? N GLU c 65  O LEU CA 74  ? O LEU c 73  
BT 2 3 N VAL CA 75  ? N VAL c 74  O LEU CA 135 ? O LEU c 134 
BT 3 4 N LEU CA 134 ? N LEU c 133 O SER CA 149 ? O SER c 148 
BT 4 5 N GLN CA 148 ? N GLN c 147 O PHE CA 156 ? O PHE c 155 
BU 1 2 O ILE DA 164 ? O ILE d 164 N CYS DA 34  ? N CYS d 34  
BU 2 3 N LEU DA 35  ? N LEU d 35  O ALA DA 46  ? O ALA d 46  
BU 3 4 N LEU DA 45  ? N LEU d 45  O ALA DA 214 ? O ALA d 214 
BU 4 5 N GLU DA 219 ? N GLU d 219 O LYS DA 222 ? O LYS d 222 
BV 1 2 N TYR DA 66  ? N TYR d 66  O CYS DA 74  ? O CYS d 74  
BV 2 3 N ALA DA 73  ? N ALA d 73  O ILE DA 137 ? O ILE d 137 
BV 3 4 N LEU DA 134 ? N LEU d 134 O SER DA 150 ? O SER d 150 
BV 4 5 N GLN DA 149 ? N GLN d 149 O GLY DA 157 ? O GLY d 157 
BW 1 2 O ILE EA 161 ? O ILE e 161 N ALA EA 32  ? N ALA e 32  
BW 2 3 N VAL EA 33  ? N VAL e 33  O GLY EA 44  ? O GLY e 44  
BW 3 4 N VAL EA 45  ? N VAL e 45  O GLU EA 207 ? O GLU e 207 
BW 4 5 N VAL EA 210 ? N VAL e 210 O LYS EA 218 ? O LYS e 218 
BX 1 2 N CYS EA 63  ? N CYS e 63  O MET EA 71  ? O MET e 71  
BX 2 3 N CYS EA 70  ? N CYS e 70  O VAL EA 134 ? O VAL e 134 
BX 3 4 N ILE EA 133 ? N ILE e 133 O TYR EA 145 ? O TYR e 145 
BX 4 5 N GLN EA 146 ? N GLN e 146 O HIS EA 154 ? O HIS e 154 
BY 1 2 O ARG FA 168 ? O ARG f 168 N GLY FA 39  ? N GLY f 39  
BY 2 3 N ILE FA 38  ? N ILE f 38  O ALA FA 49  ? O ALA f 49  
BY 3 4 N VAL FA 46  ? N VAL f 46  O VAL FA 220 ? O VAL f 220 
BY 4 5 N THR FA 219 ? N THR f 219 O HIS FA 227 ? O HIS f 227 
BZ 1 2 N VAL FA 68  ? N VAL f 68  O CYS FA 76  ? O CYS f 76  
BZ 2 3 N GLY FA 75  ? N GLY f 75  O GLY FA 144 ? O GLY f 144 
BZ 3 4 N PHE FA 143 ? N PHE f 143 O PHE FA 154 ? O PHE f 154 
BZ 4 5 N HIS FA 155 ? N HIS f 155 O VAL FA 163 ? O VAL f 163 
CA 1 2 O MET GA 159 ? O MET g 159 N GLY GA 37  ? N GLY g 37  
CA 2 3 N VAL GA 36  ? N VAL g 36  O VAL GA 47  ? O VAL g 47  
CA 3 4 N ALA GA 48  ? N ALA g 48  O SER GA 211 ? O SER g 211 
CA 4 5 N ILE GA 212 ? N ILE g 212 O TYR GA 224 ? O TYR g 224 
CB 1 2 N LEU GA 64  ? N LEU g 64  O ILE GA 72  ? O ILE g 72  
CB 2 3 N ALA GA 75  ? N ALA g 75  O GLY GA 131 ? O GLY g 131 
CB 3 4 N ILE GA 134 ? N ILE g 134 O PHE GA 145 ? O PHE g 145 
CB 4 5 N GLN GA 146 ? N GLN g 146 O PHE GA 154 ? O PHE g 154 
CC 1 2 O CYS HA 164 ? O CYS h 163 N GLY HA 39  ? N GLY h 38  
CC 2 3 N ILE HA 38  ? N ILE h 37  O GLY HA 49  ? O GLY h 48  
CC 3 4 N VAL HA 54  ? N VAL h 53  O ALA HA 209 ? O ALA h 208 
CC 4 5 N TRP HA 216 ? N TRP h 215 O GLU HA 226 ? O GLU h 225 
CD 1 2 N PHE HA 68  ? N PHE h 67  O MET HA 76  ? O MET h 75  
CD 2 3 N GLY HA 75  ? N GLY h 74  O GLY HA 139 ? O GLY h 138 
CD 3 4 N LEU HA 138 ? N LEU h 137 O TYR HA 150 ? O TYR h 149 
CD 4 5 N MET HA 151 ? N MET h 150 O TYR HA 159 ? O TYR h 158 
CE 1 2 O THR IA 166 ? O THR i 166 N ALA IA 41  ? N ALA i 41  
CE 2 3 N VAL IA 42  ? N VAL i 42  O VAL IA 49  ? O VAL i 49  
CE 3 4 N ILE IA 50  ? N ILE i 50  O GLY IA 218 ? O GLY i 218 
CE 4 5 N VAL IA 219 ? N VAL i 219 O ARG IA 228 ? O ARG i 228 
CF 1 2 N PHE IA 70  ? N PHE i 70  O CYS IA 78  ? O CYS i 78  
CF 2 3 N GLY IA 77  ? N GLY i 77  O ILE IA 141 ? O ILE i 141 
CF 3 4 N ASP IA 144 ? N ASP i 144 O GLY IA 148 ? O GLY i 148 
CF 4 5 N VAL IA 151 ? N VAL i 151 O PHE IA 163 ? O PHE i 163 
CG 1 2 O MET JA 127 ? O MET j 127 N ILE JA 3   ? N ILE j 3   
CG 2 3 N ALA JA 4   ? N ALA j 4   O GLY JA 15  ? O GLY j 15  
CG 3 4 N ALA JA 16  ? N ALA j 16  O ASP JA 174 ? O ASP j 174 
CG 4 5 N VAL JA 177 ? N VAL j 177 O ASP JA 184 ? O ASP j 184 
CH 1 2 N GLU JA 22  ? N GLU j 22  O VAL JA 25  ? O VAL j 25  
CI 1 2 N HIS JA 35  ? N HIS j 35  O CYS JA 43  ? O CYS j 43  
CI 2 3 N ALA JA 46  ? N ALA j 46  O ALA JA 97  ? O ALA j 97  
CI 3 4 N LEU JA 98  ? N LEU j 98  O ILE JA 113 ? O ILE j 113 
CI 4 5 N SER JA 112 ? N SER j 112 O ASP JA 120 ? O ASP j 120 
CJ 1 2 N LYS JA 215 ? N LYS j 215 O THR KA 197 ? O THR k 196 
CJ 2 3 O THR KA 196 ? O THR k 195 N VAL KA 189 ? N VAL k 188 
CJ 3 4 O ILE KA 190 ? O ILE k 189 N VAL KA 20  ? N VAL k 19  
CJ 4 5 O ALA KA 23  ? O ALA k 22  N MET KA 12  ? N MET k 11  
CJ 5 6 N VAL KA 11  ? N VAL k 10  O SER KA 139 ? O SER k 138 
CK 1 2 N PHE KA 28  ? N PHE k 27  O VAL KA 35  ? O VAL k 34  
CL 1 2 N PHE KA 43  ? N PHE k 42  O ILE KA 51  ? O ILE k 50  
CL 2 3 N GLY KA 52  ? N GLY k 51  O VAL KA 108 ? O VAL k 107 
CL 3 4 N GLY KA 111 ? N GLY k 110 O PHE KA 120 ? O PHE k 119 
CL 4 5 N SER KA 123 ? N SER k 122 O MET KA 131 ? O MET k 130 
CM 1 2 O ALA LA 130 ? O ALA l 130 N GLY LA 6   ? N GLY l 6   
CM 2 3 N ILE LA 7   ? N ILE l 7   O LEU LA 14  ? O LEU l 14  
CM 3 4 N SER LA 17  ? N SER l 17  O SER LA 179 ? O SER l 179 
CM 4 5 N VAL LA 182 ? N VAL l 182 O HIS LA 189 ? O HIS l 189 
CN 1 2 O ALA LA 130 ? O ALA l 130 N GLY LA 6   ? N GLY l 6   
CN 2 3 N ILE LA 7   ? N ILE l 7   O LEU LA 14  ? O LEU l 14  
CN 3 4 N SER LA 17  ? N SER l 17  O SER LA 179 ? O SER l 179 
CN 4 5 N PHE LA 178 ? N PHE l 178 O ILE LA 194 ? O ILE l 194 
CO 1 2 N SER LA 23  ? N SER l 23  O VAL LA 26  ? O VAL l 26  
CP 1 2 N PHE LA 36  ? N PHE l 36  O LEU LA 44  ? O LEU l 44  
CP 2 3 N VAL LA 47  ? N VAL l 47  O ASN LA 101 ? O ASN l 101 
CP 3 4 N LEU LA 104 ? N LEU l 104 O TYR LA 116 ? O TYR l 116 
CP 4 5 N TYR LA 117 ? N TYR l 117 O ALA LA 125 ? O ALA l 125 
CQ 1 2 O VAL MA 128 ? O VAL m 128 N THR MA 3   ? N THR m 3   
CQ 2 3 N LEU MA 4   ? N LEU m 4   O ALA MA 15  ? O ALA m 15  
CQ 3 4 N ALA MA 16  ? N ALA m 16  O ASN MA 175 ? O ASN m 175 
CQ 4 5 N LEU MA 176 ? N LEU m 176 O SER MA 188 ? O SER m 188 
CR 1 2 N ALA MA 20  ? N ALA m 20  O SER MA 28  ? O SER m 28  
CS 1 2 N ILE MA 35  ? N ILE m 35  O GLY MA 43  ? O GLY m 43  
CT 1 2 N THR MA 99  ? N THR m 99  O VAL MA 114 ? O VAL m 114 
CT 2 3 N TYR MA 113 ? N TYR m 113 O ILE MA 121 ? O ILE m 121 
CU 1 2 O GLY NA 138 ? O GLY n 138 N VAL NA 12  ? N VAL n 12  
CU 2 3 N LEU NA 13  ? N LEU n 13  O ALA NA 24  ? O ALA n 24  
CU 3 4 N SER NA 21  ? N SER n 21  O VAL NA 198 ? O VAL n 198 
CU 4 5 N LEU NA 193 ? N LEU n 193 O VAL NA 208 ? O VAL n 208 
CV 1 2 N GLU NA 31  ? N GLU n 31  O SER NA 34  ? O SER n 34  
CW 1 2 N TYR NA 44  ? N TYR n 44  O ILE NA 52  ? O ILE n 52  
CW 2 3 N SER NA 55  ? N SER n 55  O TYR NA 107 ? O TYR n 107 
CW 3 4 N ILE NA 110 ? N ILE n 110 O TYR NA 122 ? O TYR n 122 
CW 4 5 N VAL NA 121 ? N VAL n 121 O ASP NA 133 ? O ASP n 133 
CX 1 2 O LEU OA 33  ? O LEU o 33  N TYR OA 30  ? N TYR o 30  
CX 2 3 O SER OA 29  ? O SER o 29  N THR OA 7   ? N THR o 7   
CX 3 4 N GLY OA 8   ? N GLY o 8   O GLY OA 55  ? O GLY o 55  
CX 4 5 O LEU OA 51  ? O LEU o 51  N MET OA 43  ? N MET o 43  
CY 1 2 O LEU OA 33  ? O LEU o 33  N TYR OA 30  ? N TYR o 30  
CY 2 3 O SER OA 29  ? O SER o 29  N THR OA 7   ? N THR o 7   
CY 3 4 N GLY OA 8   ? N GLY o 8   O GLY OA 55  ? O GLY o 55  
CY 4 5 N GLY OA 52  ? N GLY o 52  O VAL OA 111 ? O VAL o 111 
CY 5 6 N GLY OA 114 ? N GLY o 114 O PHE OA 121 ? O PHE o 121 
CY 6 7 N TYR OA 124 ? N TYR o 124 O TYR OA 132 ? O TYR o 132 
CZ 1 2 O LEU OA 137 ? O LEU o 137 N GLY OA 13  ? N GLY o 13  
CZ 2 3 N LEU OA 12  ? N LEU o 12  O ALA OA 23  ? O ALA o 23  
CZ 3 4 N ILE OA 22  ? N ILE o 22  O ALA OA 190 ? O ALA o 190 
CZ 4 5 N THR OA 191 ? N THR o 191 O GLU OA 198 ? O GLU o 198 
DA 1 2 O GLY PA 128 ? O GLY p 128 N ILE PA 3   ? N ILE p 3   
DA 2 3 N VAL PA 6   ? N VAL p 6   O VAL PA 13  ? O VAL p 13  
DA 3 4 N LEU PA 14  ? N LEU p 14  O ALA PA 177 ? O ALA p 177 
DA 4 5 N ALA PA 178 ? N ALA p 178 O GLU PA 185 ? O GLU p 185 
DB 1 2 N THR PA 20  ? N THR p 20  O ASN PA 28  ? O ASN p 28  
DC 1 2 N THR PA 35  ? N THR p 35  O CYS PA 43  ? O CYS p 43  
DC 2 3 N CYS PA 44  ? N CYS p 44  O ILE PA 99  ? O ILE p 99  
DC 3 4 N ILE PA 100 ? N ILE p 100 O TYR PA 112 ? O TYR p 112 
DC 4 5 N SER PA 113 ? N SER p 113 O VAL PA 121 ? O VAL p 121 
DD 1 2 O THR QA 161 ? O THR q 160 N GLY QA 37  ? N GLY q 36  
DD 2 3 N VAL QA 36  ? N VAL q 35  O ALA QA 47  ? O ALA q 46  
DD 3 4 N VAL QA 44  ? N VAL q 43  O CYS QA 213 ? O CYS q 212 
DD 4 5 N ILE QA 212 ? N ILE q 211 O ARG QA 219 ? O ARG q 218 
DE 1 2 N GLU QA 66  ? N GLU q 65  O LEU QA 74  ? O LEU q 73  
DE 2 3 N VAL QA 75  ? N VAL q 74  O LEU QA 135 ? O LEU q 134 
DE 3 4 N LEU QA 134 ? N LEU q 133 O SER QA 149 ? O SER q 148 
DE 4 5 N GLN QA 148 ? N GLN q 147 O PHE QA 156 ? O PHE q 155 
DF 1 2 O ILE RA 164 ? O ILE r 164 N CYS RA 34  ? N CYS r 34  
DF 2 3 N LEU RA 35  ? N LEU r 35  O ALA RA 46  ? O ALA r 46  
DF 3 4 N LEU RA 45  ? N LEU r 45  O ALA RA 214 ? O ALA r 214 
DF 4 5 N GLU RA 219 ? N GLU r 219 O LYS RA 222 ? O LYS r 222 
DG 1 2 N TYR RA 66  ? N TYR r 66  O CYS RA 74  ? O CYS r 74  
DG 2 3 N ALA RA 77  ? N ALA r 77  O SER RA 133 ? O SER r 133 
DG 3 4 N LEU RA 134 ? N LEU r 134 O SER RA 150 ? O SER r 150 
DG 4 5 N GLN RA 149 ? N GLN r 149 O GLY RA 157 ? O GLY r 157 
DH 1 2 O ILE SA 161 ? O ILE s 161 N ALA SA 32  ? N ALA s 32  
DH 2 3 N VAL SA 33  ? N VAL s 33  O GLY SA 44  ? O GLY s 44  
DH 3 4 N VAL SA 45  ? N VAL s 45  O GLU SA 207 ? O GLU s 207 
DH 4 5 N VAL SA 210 ? N VAL s 210 O LYS SA 218 ? O LYS s 218 
DI 1 2 N CYS SA 63  ? N CYS s 63  O MET SA 71  ? O MET s 71  
DI 2 3 N CYS SA 70  ? N CYS s 70  O VAL SA 134 ? O VAL s 134 
DI 3 4 N ILE SA 133 ? N ILE s 133 O TYR SA 145 ? O TYR s 145 
DI 4 5 N GLN SA 146 ? N GLN s 146 O HIS SA 154 ? O HIS s 154 
DJ 1 2 O ILE TA 170 ? O ILE t 170 N ALA TA 37  ? N ALA t 37  
DJ 2 3 N ILE TA 38  ? N ILE t 38  O ALA TA 49  ? O ALA t 49  
DJ 3 4 N LEU TA 48  ? N LEU t 48  O ALA TA 218 ? O ALA t 218 
DJ 4 5 N THR TA 219 ? N THR t 219 O HIS TA 227 ? O HIS t 227 
DK 1 2 N VAL TA 68  ? N VAL t 68  O CYS TA 76  ? O CYS t 76  
DK 2 3 N GLY TA 75  ? N GLY t 75  O GLY TA 144 ? O GLY t 144 
DK 3 4 N PHE TA 143 ? N PHE t 143 O PHE TA 154 ? O PHE t 154 
DK 4 5 N HIS TA 155 ? N HIS t 155 O VAL TA 163 ? O VAL t 163 
DL 1 2 O MET UA 159 ? O MET u 159 N GLY UA 37  ? N GLY u 37  
DL 2 3 N VAL UA 36  ? N VAL u 36  O VAL UA 47  ? O VAL u 47  
DL 3 4 N LEU UA 46  ? N LEU u 46  O GLY UA 213 ? O GLY u 213 
DL 4 5 N ILE UA 212 ? N ILE u 212 O TYR UA 224 ? O TYR u 224 
DM 1 2 N LEU UA 64  ? N LEU u 64  O ILE UA 72  ? O ILE u 72  
DM 2 3 N GLY UA 71  ? N GLY u 71  O ALA UA 135 ? O ALA u 135 
DM 3 4 N ILE UA 134 ? N ILE u 134 O PHE UA 145 ? O PHE u 145 
DM 4 5 N GLN UA 146 ? N GLN u 146 O PHE UA 154 ? O PHE u 154 
DN 1 2 O ILE VA 166 ? O ILE v 165 N ALA VA 37  ? N ALA v 36  
DN 2 3 N ILE VA 38  ? N ILE v 37  O GLY VA 49  ? O GLY v 48  
DN 3 4 N LYS VA 52  ? N LYS v 51  O GLU VA 211 ? O GLU v 210 
DN 4 5 N TRP VA 216 ? N TRP v 215 O GLU VA 226 ? O GLU v 225 
DO 1 2 N PHE VA 68  ? N PHE v 67  O MET VA 76  ? O MET v 75  
DO 2 3 N ALA VA 79  ? N ALA v 78  O SER VA 135 ? O SER v 134 
DO 3 4 N LEU VA 138 ? N LEU v 137 O TYR VA 150 ? O TYR v 149 
DO 4 5 N MET VA 151 ? N MET v 150 O TYR VA 159 ? O TYR v 158 
DP 1 2 O THR WA 166 ? O THR w 166 N ALA WA 41  ? N ALA w 41  
DP 2 3 N VAL WA 42  ? N VAL w 42  O VAL WA 49  ? O VAL w 49  
DP 3 4 N THR WA 52  ? N THR w 52  O GLU WA 216 ? O GLU w 216 
DP 4 5 N VAL WA 219 ? N VAL w 219 O ARG WA 228 ? O ARG w 228 
DQ 1 2 N PHE WA 70  ? N PHE w 70  O CYS WA 78  ? O CYS w 78  
DQ 2 3 N GLY WA 77  ? N GLY w 77  O ILE WA 141 ? O ILE w 141 
DQ 3 4 N LEU WA 140 ? N LEU w 140 O TYR WA 152 ? O TYR w 152 
DQ 4 5 N VAL WA 151 ? N VAL w 151 O PHE WA 163 ? O PHE w 163 
DR 1 2 O MET XA 127 ? O MET x 127 N ILE XA 3   ? N ILE x 3   
DR 2 3 N ALA XA 4   ? N ALA x 4   O GLY XA 15  ? O GLY x 15  
DR 3 4 N ALA XA 16  ? N ALA x 16  O ASP XA 174 ? O ASP x 174 
DR 4 5 N VAL XA 177 ? N VAL x 177 O ASP XA 184 ? O ASP x 184 
DS 1 2 N ALA XA 20  ? N ALA x 20  O ALA XA 27  ? O ALA x 27  
DT 1 2 N HIS XA 35  ? N HIS x 35  O CYS XA 43  ? O CYS x 43  
DT 2 3 N ALA XA 46  ? N ALA x 46  O ALA XA 97  ? O ALA x 97  
DT 3 4 N LEU XA 100 ? N LEU x 100 O TYR XA 111 ? O TYR x 111 
DT 4 5 N SER XA 112 ? N SER x 112 O ASP XA 120 ? O ASP x 120 
DU 1 2 N LYS XA 215 ? N LYS x 215 O THR YA 197 ? O THR y 196 
DU 2 3 O LEU YA 200 ? O LEU y 199 N VAL YA 185 ? N VAL y 184 
DU 3 4 O ILE YA 190 ? O ILE y 189 N VAL YA 20  ? N VAL y 19  
DU 4 5 O ALA YA 23  ? O ALA y 22  N MET YA 12  ? N MET y 11  
DU 5 6 N VAL YA 11  ? N VAL y 10  O SER YA 139 ? O SER y 138 
DV 1 2 N PHE YA 28  ? N PHE y 27  O VAL YA 35  ? O VAL y 34  
DW 1 2 N PHE YA 43  ? N PHE y 42  O ILE YA 51  ? O ILE y 50  
DW 2 3 N GLY YA 52  ? N GLY y 51  O VAL YA 108 ? O VAL y 107 
DW 3 4 N ILE YA 109 ? N ILE y 108 O CYS YA 122 ? O CYS y 121 
DW 4 5 N SER YA 123 ? N SER y 122 O MET YA 131 ? O MET y 130 
DX 1 2 O ALA ZA 130 ? O ALA z 130 N GLY ZA 6   ? N GLY z 6   
DX 2 3 N ILE ZA 7   ? N ILE z 7   O LEU ZA 14  ? O LEU z 14  
DX 3 4 N VAL ZA 13  ? N VAL z 13  O ILE ZA 183 ? O ILE z 183 
DX 4 5 N VAL ZA 182 ? N VAL z 182 O HIS ZA 189 ? O HIS z 189 
DY 1 2 N SER ZA 23  ? N SER z 23  O VAL ZA 26  ? O VAL z 26  
DZ 1 2 N PHE ZA 36  ? N PHE z 36  O LEU ZA 44  ? O LEU z 44  
DZ 2 3 N VAL ZA 47  ? N VAL z 47  O ASN ZA 101 ? O ASN z 101 
DZ 3 4 N LEU ZA 104 ? N LEU z 104 O TYR ZA 116 ? O TYR z 116 
DZ 4 5 N TYR ZA 117 ? N TYR z 117 O ALA ZA 125 ? O ALA z 125 
EA 1 2 O VAL AB 128 ? O VAL 1 128 N THR AB 3   ? N THR 1 3   
EA 2 3 N LEU AB 4   ? N LEU 1 4   O ALA AB 15  ? O ALA 1 15  
EA 3 4 N ALA AB 16  ? N ALA 1 16  O ASN AB 175 ? O ASN 1 175 
EA 4 5 N LEU AB 176 ? N LEU 1 176 O SER AB 188 ? O SER 1 188 
EB 1 2 N ALA AB 22  ? N ALA 1 22  O TYR AB 25  ? O TYR 1 25  
EC 1 2 N ILE AB 35  ? N ILE 1 35  O GLY AB 43  ? O GLY 1 43  
EC 2 3 N LEU AB 42  ? N LEU 1 42  O CYS AB 102 ? O CYS 1 102 
EC 3 4 N GLY AB 103 ? N GLY 1 103 O GLY AB 110 ? O GLY 1 110 
EC 4 5 N TYR AB 113 ? N TYR 1 113 O ILE AB 121 ? O ILE 1 121 
ED 1 2 O GLY BB 138 ? O GLY 2 138 N VAL BB 12  ? N VAL 2 12  
ED 2 3 N LEU BB 13  ? N LEU 2 13  O ALA BB 24  ? O ALA 2 24  
ED 3 4 N SER BB 21  ? N SER 2 21  O VAL BB 198 ? O VAL 2 198 
ED 4 5 N LEU BB 193 ? N LEU 2 193 O VAL BB 208 ? O VAL 2 208 
EE 1 2 N GLU BB 31  ? N GLU 2 31  O SER BB 34  ? O SER 2 34  
EF 1 2 N TYR BB 44  ? N TYR 2 44  O ILE BB 52  ? O ILE 2 52  
EF 2 3 N VAL BB 51  ? N VAL 2 51  O GLY BB 111 ? O GLY 2 111 
EF 3 4 N ILE BB 110 ? N ILE 2 110 O TYR BB 122 ? O TYR 2 122 
EF 4 5 N VAL BB 121 ? N VAL 2 121 O ASP BB 133 ? O ASP 2 133 
EG 1 2 O LEU CB 33  ? O LEU 3 33  N TYR CB 30  ? N TYR 3 30  
EG 2 3 O SER CB 29  ? O SER 3 29  N THR CB 7   ? N THR 3 7   
EG 3 4 N GLY CB 8   ? N GLY 3 8   O GLY CB 55  ? O GLY 3 55  
EG 4 5 O LEU CB 51  ? O LEU 3 51  N MET CB 43  ? N MET 3 43  
EH 1 2 O LEU CB 33  ? O LEU 3 33  N TYR CB 30  ? N TYR 3 30  
EH 2 3 O SER CB 29  ? O SER 3 29  N THR CB 7   ? N THR 3 7   
EH 3 4 N GLY CB 8   ? N GLY 3 8   O GLY CB 55  ? O GLY 3 55  
EH 4 5 N MET CB 50  ? N MET 3 50  O GLY CB 113 ? O GLY 3 113 
EH 5 6 N ILE CB 112 ? N ILE 3 112 O GLY CB 123 ? O GLY 3 123 
EH 6 7 N TYR CB 124 ? N TYR 3 124 O TYR CB 132 ? O TYR 3 132 
EI 1 2 O LEU CB 137 ? O LEU 3 137 N GLY CB 13  ? N GLY 3 13  
EI 2 3 N PHE CB 16  ? N PHE 3 16  O GLY CB 19  ? O GLY 3 19  
EI 3 4 N ILE CB 22  ? N ILE 3 22  O ALA CB 190 ? O ALA 3 190 
EI 4 5 N THR CB 191 ? N THR 3 191 O GLU CB 198 ? O GLU 3 198 
EJ 1 2 O GLY DB 128 ? O GLY 4 128 N ILE DB 3   ? N ILE 4 3   
EJ 2 3 N VAL DB 6   ? N VAL 4 6   O VAL DB 13  ? O VAL 4 13  
EJ 3 4 N LEU DB 14  ? N LEU 4 14  O ALA DB 177 ? O ALA 4 177 
EJ 4 5 N ALA DB 178 ? N ALA 4 178 O GLU DB 185 ? O GLU 4 185 
EK 1 2 N THR DB 20  ? N THR 4 20  O ALA DB 27  ? O ALA 4 27  
EL 1 2 N THR DB 35  ? N THR 4 35  O CYS DB 43  ? O CYS 4 43  
EL 2 3 N CYS DB 44  ? N CYS 4 44  O ILE DB 99  ? O ILE 4 99  
EL 3 4 N ILE DB 100 ? N ILE 4 100 O TYR DB 112 ? O TYR 4 112 
EL 4 5 N SER DB 113 ? N SER 4 113 O VAL DB 121 ? O VAL 4 121 
# 
_database_PDB_matrix.entry_id          3UNE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UNE 
_atom_sites.fract_transf_matrix[1][1]   0.005849 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001908 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004968 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004654 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A  1  2   ? -21.094 58.590  63.899  1.00 107.57 ? 1   ALA A N   1 
ATOM   2     C CA  . ALA A  1  2   ? -20.890 57.216  63.356  1.00 109.96 ? 1   ALA A CA  1 
ATOM   3     C C   . ALA A  1  2   ? -22.174 56.391  63.418  1.00 117.34 ? 1   ALA A C   1 
ATOM   4     O O   . ALA A  1  2   ? -22.923 56.465  64.395  1.00 115.69 ? 1   ALA A O   1 
ATOM   5     C CB  . ALA A  1  2   ? -19.767 56.513  64.105  1.00 109.29 ? 1   ALA A CB  1 
ATOM   6     N N   . LYS A  1  3   ? -22.418 55.608  62.368  1.00 126.67 ? 2   LYS A N   1 
ATOM   7     C CA  . LYS A  1  3   ? -23.612 54.764  62.276  1.00 131.30 ? 2   LYS A CA  1 
ATOM   8     C C   . LYS A  1  3   ? -23.296 53.357  61.759  1.00 139.16 ? 2   LYS A C   1 
ATOM   9     O O   . LYS A  1  3   ? -22.211 53.111  61.226  1.00 140.71 ? 2   LYS A O   1 
ATOM   10    C CB  . LYS A  1  3   ? -24.700 55.430  61.415  1.00 127.41 ? 2   LYS A CB  1 
ATOM   11    C CG  . LYS A  1  3   ? -24.352 55.636  59.944  1.00 134.41 ? 2   LYS A CG  1 
ATOM   12    C CD  . LYS A  1  3   ? -23.697 56.988  59.692  1.00 136.71 ? 2   LYS A CD  1 
ATOM   13    C CE  . LYS A  1  3   ? -23.462 57.233  58.209  1.00 137.29 ? 2   LYS A CE  1 
ATOM   14    N NZ  . LYS A  1  3   ? -24.724 57.510  57.468  1.00 137.12 ? 2   LYS A NZ  1 
ATOM   15    N N   . ARG A  1  4   ? -24.252 52.444  61.922  1.00 142.03 ? 3   ARG A N   1 
ATOM   16    C CA  . ARG A  1  4   ? -24.087 51.056  61.498  1.00 139.33 ? 3   ARG A CA  1 
ATOM   17    C C   . ARG A  1  4   ? -25.164 50.637  60.492  1.00 131.61 ? 3   ARG A C   1 
ATOM   18    O O   . ARG A  1  4   ? -24.882 50.487  59.301  1.00 129.94 ? 3   ARG A O   1 
ATOM   19    C CB  . ARG A  1  4   ? -24.082 50.121  62.714  1.00 141.41 ? 3   ARG A CB  1 
ATOM   20    C CG  . ARG A  1  4   ? -23.750 48.673  62.392  1.00 142.59 ? 3   ARG A CG  1 
ATOM   21    C CD  . ARG A  1  4   ? -23.891 47.790  63.621  1.00 145.08 ? 3   ARG A CD  1 
ATOM   22    N NE  . ARG A  1  4   ? -23.603 46.388  63.324  1.00 148.26 ? 3   ARG A NE  1 
ATOM   23    C CZ  . ARG A  1  4   ? -22.396 45.832  63.394  1.00 148.98 ? 3   ARG A CZ  1 
ATOM   24    N NH1 . ARG A  1  4   ? -21.340 46.554  63.750  1.00 151.00 ? 3   ARG A NH1 1 
ATOM   25    N NH2 . ARG A  1  4   ? -22.241 44.549  63.103  1.00 145.92 ? 3   ARG A NH2 1 
ATOM   26    N N   . GLY A  1  5   ? -26.390 50.452  60.979  1.00 119.24 ? 4   GLY A N   1 
ATOM   27    C CA  . GLY A  1  5   ? -27.503 50.004  60.145  1.00 105.44 ? 4   GLY A CA  1 
ATOM   28    C C   . GLY A  1  5   ? -28.055 48.662  60.588  1.00 94.21  ? 4   GLY A C   1 
ATOM   29    O O   . GLY A  1  5   ? -27.293 47.740  60.885  1.00 93.87  ? 4   GLY A O   1 
ATOM   30    N N   . TYR A  1  6   ? -29.383 48.556  60.632  1.00 87.57  ? 5   TYR A N   1 
ATOM   31    C CA  . TYR A  1  6   ? -30.052 47.312  61.019  1.00 83.34  ? 5   TYR A CA  1 
ATOM   32    C C   . TYR A  1  6   ? -30.002 46.280  59.897  1.00 82.18  ? 5   TYR A C   1 
ATOM   33    O O   . TYR A  1  6   ? -30.164 46.617  58.723  1.00 80.94  ? 5   TYR A O   1 
ATOM   34    C CB  . TYR A  1  6   ? -31.512 47.561  61.418  1.00 79.83  ? 5   TYR A CB  1 
ATOM   35    C CG  . TYR A  1  6   ? -31.724 48.572  62.528  1.00 79.45  ? 5   TYR A CG  1 
ATOM   36    C CD1 . TYR A  1  6   ? -32.674 49.583  62.397  1.00 79.34  ? 5   TYR A CD1 1 
ATOM   37    C CD2 . TYR A  1  6   ? -30.983 48.515  63.711  1.00 79.75  ? 5   TYR A CD2 1 
ATOM   38    C CE1 . TYR A  1  6   ? -32.880 50.509  63.408  1.00 79.05  ? 5   TYR A CE1 1 
ATOM   39    C CE2 . TYR A  1  6   ? -31.180 49.441  64.725  1.00 78.99  ? 5   TYR A CE2 1 
ATOM   40    C CZ  . TYR A  1  6   ? -32.129 50.434  64.569  1.00 78.42  ? 5   TYR A CZ  1 
ATOM   41    O OH  . TYR A  1  6   ? -32.330 51.354  65.572  1.00 78.54  ? 5   TYR A OH  1 
ATOM   42    N N   . SER A  1  7   ? -29.786 45.022  60.274  1.00 82.18  ? 6   SER A N   1 
ATOM   43    C CA  . SER A  1  7   ? -29.690 43.922  59.315  1.00 83.83  ? 6   SER A CA  1 
ATOM   44    C C   . SER A  1  7   ? -30.954 43.060  59.290  1.00 82.13  ? 6   SER A C   1 
ATOM   45    O O   . SER A  1  7   ? -31.161 42.278  58.358  1.00 82.52  ? 6   SER A O   1 
ATOM   46    C CB  . SER A  1  7   ? -28.467 43.056  59.623  1.00 87.00  ? 6   SER A CB  1 
ATOM   47    O OG  . SER A  1  7   ? -27.276 43.823  59.579  1.00 90.14  ? 6   SER A OG  1 
ATOM   48    N N   . PHE A  1  8   ? -31.791 43.214  60.314  1.00 79.16  ? 7   PHE A N   1 
ATOM   49    C CA  . PHE A  1  8   ? -33.030 42.445  60.443  1.00 76.40  ? 7   PHE A CA  1 
ATOM   50    C C   . PHE A  1  8   ? -34.197 43.075  59.682  1.00 74.68  ? 7   PHE A C   1 
ATOM   51    O O   . PHE A  1  8   ? -34.263 44.296  59.528  1.00 74.76  ? 7   PHE A O   1 
ATOM   52    C CB  . PHE A  1  8   ? -33.398 42.249  61.923  1.00 76.32  ? 7   PHE A CB  1 
ATOM   53    C CG  . PHE A  1  8   ? -33.496 43.531  62.708  1.00 76.36  ? 7   PHE A CG  1 
ATOM   54    C CD1 . PHE A  1  8   ? -34.696 44.233  62.778  1.00 76.89  ? 7   PHE A CD1 1 
ATOM   55    C CD2 . PHE A  1  8   ? -32.391 44.030  63.392  1.00 77.40  ? 7   PHE A CD2 1 
ATOM   56    C CE1 . PHE A  1  8   ? -34.788 45.413  63.501  1.00 79.03  ? 7   PHE A CE1 1 
ATOM   57    C CE2 . PHE A  1  8   ? -32.478 45.209  64.118  1.00 79.15  ? 7   PHE A CE2 1 
ATOM   58    C CZ  . PHE A  1  8   ? -33.678 45.900  64.173  1.00 79.81  ? 7   PHE A CZ  1 
ATOM   59    N N   . SER A  1  9   ? -35.114 42.230  59.216  1.00 74.23  ? 8   SER A N   1 
ATOM   60    C CA  . SER A  1  9   ? -36.308 42.683  58.506  1.00 74.94  ? 8   SER A CA  1 
ATOM   61    C C   . SER A  1  9   ? -37.344 43.273  59.457  1.00 75.13  ? 8   SER A C   1 
ATOM   62    O O   . SER A  1  9   ? -37.542 42.769  60.566  1.00 74.31  ? 8   SER A O   1 
ATOM   63    C CB  . SER A  1  9   ? -36.935 41.534  57.716  1.00 75.63  ? 8   SER A CB  1 
ATOM   64    O OG  . SER A  1  9   ? -36.094 41.126  56.654  1.00 76.90  ? 8   SER A OG  1 
ATOM   65    N N   . LEU A  1  10  ? -38.001 44.340  59.009  1.00 75.28  ? 9   LEU A N   1 
ATOM   66    C CA  . LEU A  1  10  ? -39.064 44.986  59.777  1.00 75.04  ? 9   LEU A CA  1 
ATOM   67    C C   . LEU A  1  10  ? -40.436 44.451  59.376  1.00 77.03  ? 9   LEU A C   1 
ATOM   68    O O   . LEU A  1  10  ? -41.378 44.477  60.172  1.00 77.49  ? 9   LEU A O   1 
ATOM   69    C CB  . LEU A  1  10  ? -39.015 46.506  59.598  1.00 73.04  ? 9   LEU A CB  1 
ATOM   70    C CG  . LEU A  1  10  ? -37.745 47.238  60.045  1.00 69.93  ? 9   LEU A CG  1 
ATOM   71    C CD1 . LEU A  1  10  ? -37.734 48.654  59.492  1.00 72.53  ? 9   LEU A CD1 1 
ATOM   72    C CD2 . LEU A  1  10  ? -37.597 47.247  61.561  1.00 71.29  ? 9   LEU A CD2 1 
ATOM   73    N N   . THR A  1  11  ? -40.537 43.977  58.137  1.00 77.32  ? 10  THR A N   1 
ATOM   74    C CA  . THR A  1  11  ? -41.750 43.347  57.632  1.00 78.93  ? 10  THR A CA  1 
ATOM   75    C C   . THR A  1  11  ? -41.683 41.846  57.912  1.00 81.37  ? 10  THR A C   1 
ATOM   76    O O   . THR A  1  11  ? -40.802 41.151  57.401  1.00 80.38  ? 10  THR A O   1 
ATOM   77    C CB  . THR A  1  11  ? -41.929 43.600  56.119  1.00 78.61  ? 10  THR A CB  1 
ATOM   78    O OG1 . THR A  1  11  ? -41.770 44.998  55.840  1.00 78.50  ? 10  THR A OG1 1 
ATOM   79    C CG2 . THR A  1  11  ? -43.305 43.143  55.645  1.00 79.56  ? 10  THR A CG2 1 
ATOM   80    N N   . THR A  1  12  ? -42.607 41.360  58.738  1.00 86.35  ? 11  THR A N   1 
ATOM   81    C CA  . THR A  1  12  ? -42.646 39.947  59.129  1.00 89.45  ? 11  THR A CA  1 
ATOM   82    C C   . THR A  1  12  ? -44.052 39.355  59.031  1.00 93.25  ? 11  THR A C   1 
ATOM   83    O O   . THR A  1  12  ? -45.043 40.088  58.965  1.00 95.60  ? 11  THR A O   1 
ATOM   84    C CB  . THR A  1  12  ? -42.102 39.727  60.558  1.00 91.46  ? 11  THR A CB  1 
ATOM   85    O OG1 . THR A  1  12  ? -42.663 40.702  61.447  1.00 93.02  ? 11  THR A OG1 1 
ATOM   86    C CG2 . THR A  1  12  ? -40.583 39.832  60.583  1.00 88.77  ? 11  THR A CG2 1 
ATOM   87    N N   . PHE A  1  13  ? -44.123 38.025  59.022  1.00 92.17  ? 12  PHE A N   1 
ATOM   88    C CA  . PHE A  1  13  ? -45.391 37.304  58.929  1.00 92.64  ? 12  PHE A CA  1 
ATOM   89    C C   . PHE A  1  13  ? -46.134 37.279  60.263  1.00 97.59  ? 12  PHE A C   1 
ATOM   90    O O   . PHE A  1  13  ? -45.540 37.022  61.313  1.00 98.25  ? 12  PHE A O   1 
ATOM   91    C CB  . PHE A  1  13  ? -45.161 35.871  58.439  1.00 84.76  ? 12  PHE A CB  1 
ATOM   92    C CG  . PHE A  1  13  ? -44.710 35.777  57.007  1.00 78.59  ? 12  PHE A CG  1 
ATOM   93    C CD1 . PHE A  1  13  ? -43.357 35.718  56.692  1.00 76.11  ? 12  PHE A CD1 1 
ATOM   94    C CD2 . PHE A  1  13  ? -45.640 35.733  55.973  1.00 77.08  ? 12  PHE A CD2 1 
ATOM   95    C CE1 . PHE A  1  13  ? -42.938 35.627  55.373  1.00 73.50  ? 12  PHE A CE1 1 
ATOM   96    C CE2 . PHE A  1  13  ? -45.227 35.642  54.652  1.00 74.19  ? 12  PHE A CE2 1 
ATOM   97    C CZ  . PHE A  1  13  ? -43.875 35.588  54.352  1.00 72.78  ? 12  PHE A CZ  1 
ATOM   98    N N   . SER A  1  14  ? -47.436 37.550  60.206  1.00 103.74 ? 13  SER A N   1 
ATOM   99    C CA  . SER A  1  14  ? -48.307 37.484  61.377  1.00 108.92 ? 13  SER A CA  1 
ATOM   100   C C   . SER A  1  14  ? -48.775 36.042  61.613  1.00 109.80 ? 13  SER A C   1 
ATOM   101   O O   . SER A  1  14  ? -48.651 35.203  60.716  1.00 108.70 ? 13  SER A O   1 
ATOM   102   C CB  . SER A  1  14  ? -49.510 38.416  61.192  1.00 112.30 ? 13  SER A CB  1 
ATOM   103   O OG  . SER A  1  14  ? -50.294 38.031  60.075  1.00 113.78 ? 13  SER A OG  1 
ATOM   104   N N   . PRO A  1  15  ? -49.303 35.744  62.822  1.00 110.12 ? 14  PRO A N   1 
ATOM   105   C CA  . PRO A  1  15  ? -49.866 34.417  63.108  1.00 109.82 ? 14  PRO A CA  1 
ATOM   106   C C   . PRO A  1  15  ? -50.992 34.002  62.155  1.00 111.56 ? 14  PRO A C   1 
ATOM   107   O O   . PRO A  1  15  ? -51.178 32.807  61.911  1.00 111.47 ? 14  PRO A O   1 
ATOM   108   C CB  . PRO A  1  15  ? -50.401 34.553  64.543  1.00 110.52 ? 14  PRO A CB  1 
ATOM   109   C CG  . PRO A  1  15  ? -50.396 36.015  64.846  1.00 110.94 ? 14  PRO A CG  1 
ATOM   110   C CD  . PRO A  1  15  ? -49.278 36.584  64.032  1.00 110.54 ? 14  PRO A CD  1 
ATOM   111   N N   . SER A  1  16  ? -51.725 34.981  61.627  1.00 113.88 ? 15  SER A N   1 
ATOM   112   C CA  . SER A  1  16  ? -52.791 34.731  60.656  1.00 116.77 ? 15  SER A CA  1 
ATOM   113   C C   . SER A  1  16  ? -52.233 34.327  59.291  1.00 116.06 ? 15  SER A C   1 
ATOM   114   O O   . SER A  1  16  ? -52.809 33.481  58.603  1.00 115.25 ? 15  SER A O   1 
ATOM   115   C CB  . SER A  1  16  ? -53.685 35.965  60.509  1.00 120.74 ? 15  SER A CB  1 
ATOM   116   O OG  . SER A  1  16  ? -54.273 36.325  61.747  1.00 124.59 ? 15  SER A OG  1 
ATOM   117   N N   . GLY A  1  17  ? -51.114 34.940  58.909  1.00 112.85 ? 16  GLY A N   1 
ATOM   118   C CA  . GLY A  1  17  ? -50.458 34.652  57.635  1.00 109.62 ? 16  GLY A CA  1 
ATOM   119   C C   . GLY A  1  17  ? -50.343 35.854  56.713  1.00 106.98 ? 16  GLY A C   1 
ATOM   120   O O   . GLY A  1  17  ? -49.984 35.711  55.544  1.00 104.64 ? 16  GLY A O   1 
ATOM   121   N N   . LYS A  1  18  ? -50.651 37.037  57.239  1.00 109.45 ? 17  LYS A N   1 
ATOM   122   C CA  . LYS A  1  18  ? -50.561 38.277  56.471  1.00 110.30 ? 17  LYS A CA  1 
ATOM   123   C C   . LYS A  1  18  ? -49.306 39.067  56.831  1.00 107.18 ? 17  LYS A C   1 
ATOM   124   O O   . LYS A  1  18  ? -48.907 39.117  57.996  1.00 109.51 ? 17  LYS A O   1 
ATOM   125   C CB  . LYS A  1  18  ? -51.799 39.152  56.697  1.00 115.21 ? 17  LYS A CB  1 
ATOM   126   C CG  . LYS A  1  18  ? -53.028 38.775  55.879  1.00 117.39 ? 17  LYS A CG  1 
ATOM   127   C CD  . LYS A  1  18  ? -54.025 37.947  56.679  1.00 118.86 ? 17  LYS A CD  1 
ATOM   128   C CE  . LYS A  1  18  ? -53.963 36.471  56.320  1.00 115.79 ? 17  LYS A CE  1 
ATOM   129   N NZ  . LYS A  1  18  ? -54.569 36.200  54.986  1.00 116.61 ? 17  LYS A NZ  1 
ATOM   130   N N   . LEU A  1  19  ? -48.689 39.680  55.824  1.00 100.49 ? 18  LEU A N   1 
ATOM   131   C CA  . LEU A  1  19  ? -47.559 40.579  56.046  1.00 93.97  ? 18  LEU A CA  1 
ATOM   132   C C   . LEU A  1  19  ? -48.080 41.938  56.506  1.00 93.32  ? 18  LEU A C   1 
ATOM   133   O O   . LEU A  1  19  ? -48.771 42.639  55.762  1.00 93.88  ? 18  LEU A O   1 
ATOM   134   C CB  . LEU A  1  19  ? -46.694 40.699  54.786  1.00 87.21  ? 18  LEU A CB  1 
ATOM   135   C CG  . LEU A  1  19  ? -45.845 39.471  54.430  1.00 81.46  ? 18  LEU A CG  1 
ATOM   136   C CD1 . LEU A  1  19  ? -45.535 39.432  52.942  1.00 79.26  ? 18  LEU A CD1 1 
ATOM   137   C CD2 . LEU A  1  19  ? -44.563 39.413  55.251  1.00 78.83  ? 18  LEU A CD2 1 
ATOM   138   N N   . VAL A  1  20  ? -47.740 42.292  57.743  1.00 92.12  ? 19  VAL A N   1 
ATOM   139   C CA  . VAL A  1  20  ? -48.352 43.422  58.449  1.00 91.25  ? 19  VAL A CA  1 
ATOM   140   C C   . VAL A  1  20  ? -48.002 44.787  57.844  1.00 90.63  ? 19  VAL A C   1 
ATOM   141   O O   . VAL A  1  20  ? -48.880 45.638  57.685  1.00 91.86  ? 19  VAL A O   1 
ATOM   142   C CB  . VAL A  1  20  ? -48.002 43.406  59.958  1.00 90.20  ? 19  VAL A CB  1 
ATOM   143   C CG1 . VAL A  1  20  ? -49.021 44.206  60.753  1.00 91.28  ? 19  VAL A CG1 1 
ATOM   144   C CG2 . VAL A  1  20  ? -47.946 41.978  60.486  1.00 89.62  ? 19  VAL A CG2 1 
ATOM   145   N N   . GLN A  1  21  ? -46.730 44.983  57.504  1.00 89.52  ? 20  GLN A N   1 
ATOM   146   C CA  . GLN A  1  21  ? -46.249 46.269  56.988  1.00 87.64  ? 20  GLN A CA  1 
ATOM   147   C C   . GLN A  1  21  ? -46.718 46.587  55.566  1.00 88.52  ? 20  GLN A C   1 
ATOM   148   O O   . GLN A  1  21  ? -46.901 47.757  55.219  1.00 88.24  ? 20  GLN A O   1 
ATOM   149   C CB  . GLN A  1  21  ? -44.722 46.353  57.078  1.00 83.63  ? 20  GLN A CB  1 
ATOM   150   C CG  . GLN A  1  21  ? -44.198 46.726  58.458  1.00 81.15  ? 20  GLN A CG  1 
ATOM   151   C CD  . GLN A  1  21  ? -44.508 48.163  58.842  1.00 78.52  ? 20  GLN A CD  1 
ATOM   152   O OE1 . GLN A  1  21  ? -44.339 49.086  58.043  1.00 77.72  ? 20  GLN A OE1 1 
ATOM   153   N NE2 . GLN A  1  21  ? -44.961 48.360  60.075  1.00 79.19  ? 20  GLN A NE2 1 
ATOM   154   N N   . ILE A  1  22  ? -46.907 45.549  54.754  1.00 88.67  ? 21  ILE A N   1 
ATOM   155   C CA  . ILE A  1  22  ? -47.371 45.713  53.373  1.00 89.28  ? 21  ILE A CA  1 
ATOM   156   C C   . ILE A  1  22  ? -48.840 46.144  53.324  1.00 91.56  ? 21  ILE A C   1 
ATOM   157   O O   . ILE A  1  22  ? -49.203 47.040  52.559  1.00 92.50  ? 21  ILE A O   1 
ATOM   158   C CB  . ILE A  1  22  ? -47.137 44.437  52.528  1.00 88.51  ? 21  ILE A CB  1 
ATOM   159   C CG1 . ILE A  1  22  ? -45.636 44.215  52.311  1.00 87.02  ? 21  ILE A CG1 1 
ATOM   160   C CG2 . ILE A  1  22  ? -47.857 44.533  51.187  1.00 89.13  ? 21  ILE A CG2 1 
ATOM   161   C CD1 . ILE A  1  22  ? -45.279 42.890  51.670  1.00 84.59  ? 21  ILE A CD1 1 
ATOM   162   N N   . GLU A  1  23  ? -49.670 45.509  54.151  1.00 94.00  ? 22  GLU A N   1 
ATOM   163   C CA  . GLU A  1  23  ? -51.097 45.828  54.227  1.00 98.14  ? 22  GLU A CA  1 
ATOM   164   C C   . GLU A  1  23  ? -51.351 47.246  54.738  1.00 96.28  ? 22  GLU A C   1 
ATOM   165   O O   . GLU A  1  23  ? -52.342 47.877  54.364  1.00 97.43  ? 22  GLU A O   1 
ATOM   166   C CB  . GLU A  1  23  ? -51.840 44.810  55.095  1.00 105.62 ? 22  GLU A CB  1 
ATOM   167   C CG  . GLU A  1  23  ? -51.975 43.433  54.459  1.00 111.37 ? 22  GLU A CG  1 
ATOM   168   C CD  . GLU A  1  23  ? -52.989 42.550  55.162  1.00 116.68 ? 22  GLU A CD  1 
ATOM   169   O OE1 . GLU A  1  23  ? -53.089 42.608  56.408  1.00 115.86 ? 22  GLU A OE1 1 
ATOM   170   O OE2 . GLU A  1  23  ? -53.690 41.789  54.462  1.00 119.41 ? 22  GLU A OE2 1 
ATOM   171   N N   . TYR A  1  24  ? -50.454 47.738  55.590  1.00 94.35  ? 23  TYR A N   1 
ATOM   172   C CA  . TYR A  1  24  ? -50.530 49.112  56.083  1.00 94.64  ? 23  TYR A CA  1 
ATOM   173   C C   . TYR A  1  24  ? -50.034 50.106  55.034  1.00 93.84  ? 23  TYR A C   1 
ATOM   174   O O   . TYR A  1  24  ? -50.482 51.254  54.997  1.00 94.07  ? 23  TYR A O   1 
ATOM   175   C CB  . TYR A  1  24  ? -49.746 49.280  57.389  1.00 94.53  ? 23  TYR A CB  1 
ATOM   176   C CG  . TYR A  1  24  ? -50.291 48.505  58.578  1.00 95.76  ? 23  TYR A CG  1 
ATOM   177   C CD1 . TYR A  1  24  ? -49.513 48.319  59.719  1.00 95.85  ? 23  TYR A CD1 1 
ATOM   178   C CD2 . TYR A  1  24  ? -51.576 47.954  58.562  1.00 97.95  ? 23  TYR A CD2 1 
ATOM   179   C CE1 . TYR A  1  24  ? -49.999 47.618  60.812  1.00 96.73  ? 23  TYR A CE1 1 
ATOM   180   C CE2 . TYR A  1  24  ? -52.067 47.245  59.649  1.00 98.54  ? 23  TYR A CE2 1 
ATOM   181   C CZ  . TYR A  1  24  ? -51.274 47.081  60.770  1.00 97.58  ? 23  TYR A CZ  1 
ATOM   182   O OH  . TYR A  1  24  ? -51.755 46.381  61.852  1.00 97.47  ? 23  TYR A OH  1 
ATOM   183   N N   . ALA A  1  25  ? -49.106 49.656  54.190  1.00 92.68  ? 24  ALA A N   1 
ATOM   184   C CA  . ALA A  1  25  ? -48.620 50.450  53.063  1.00 91.47  ? 24  ALA A CA  1 
ATOM   185   C C   . ALA A  1  25  ? -49.682 50.545  51.968  1.00 92.05  ? 24  ALA A C   1 
ATOM   186   O O   . ALA A  1  25  ? -49.747 51.540  51.243  1.00 92.00  ? 24  ALA A O   1 
ATOM   187   C CB  . ALA A  1  25  ? -47.330 49.863  52.512  1.00 89.87  ? 24  ALA A CB  1 
ATOM   188   N N   . LEU A  1  26  ? -50.507 49.505  51.860  1.00 92.23  ? 25  LEU A N   1 
ATOM   189   C CA  . LEU A  1  26  ? -51.652 49.497  50.949  1.00 91.40  ? 25  LEU A CA  1 
ATOM   190   C C   . LEU A  1  26  ? -52.786 50.378  51.475  1.00 93.38  ? 25  LEU A C   1 
ATOM   191   O O   . LEU A  1  26  ? -53.644 50.823  50.710  1.00 93.61  ? 25  LEU A O   1 
ATOM   192   C CB  . LEU A  1  26  ? -52.153 48.068  50.715  1.00 89.40  ? 25  LEU A CB  1 
ATOM   193   C CG  . LEU A  1  26  ? -51.304 47.135  49.844  1.00 87.02  ? 25  LEU A CG  1 
ATOM   194   C CD1 . LEU A  1  26  ? -51.704 45.685  50.072  1.00 88.58  ? 25  LEU A CD1 1 
ATOM   195   C CD2 . LEU A  1  26  ? -51.405 47.497  48.368  1.00 87.05  ? 25  LEU A CD2 1 
ATOM   196   N N   . ALA A  1  27  ? -52.784 50.617  52.785  1.00 93.61  ? 26  ALA A N   1 
ATOM   197   C CA  . ALA A  1  27  ? -53.726 51.538  53.412  1.00 95.99  ? 26  ALA A CA  1 
ATOM   198   C C   . ALA A  1  27  ? -53.276 52.983  53.209  1.00 97.32  ? 26  ALA A C   1 
ATOM   199   O O   . ALA A  1  27  ? -54.100 53.901  53.186  1.00 98.90  ? 26  ALA A O   1 
ATOM   200   C CB  . ALA A  1  27  ? -53.871 51.225  54.892  1.00 97.83  ? 26  ALA A CB  1 
ATOM   201   N N   . ALA A  1  28  ? -51.966 53.171  53.062  1.00 97.13  ? 27  ALA A N   1 
ATOM   202   C CA  . ALA A  1  28  ? -51.373 54.489  52.837  1.00 97.30  ? 27  ALA A CA  1 
ATOM   203   C C   . ALA A  1  28  ? -51.650 55.009  51.427  1.00 96.38  ? 27  ALA A C   1 
ATOM   204   O O   . ALA A  1  28  ? -51.851 56.210  51.231  1.00 96.32  ? 27  ALA A O   1 
ATOM   205   C CB  . ALA A  1  28  ? -49.876 54.449  53.105  1.00 95.70  ? 27  ALA A CB  1 
ATOM   206   N N   . VAL A  1  29  ? -51.656 54.100  50.452  1.00 94.36  ? 28  VAL A N   1 
ATOM   207   C CA  . VAL A  1  29  ? -51.923 54.455  49.057  1.00 93.12  ? 28  VAL A CA  1 
ATOM   208   C C   . VAL A  1  29  ? -53.415 54.727  48.816  1.00 96.68  ? 28  VAL A C   1 
ATOM   209   O O   . VAL A  1  29  ? -53.776 55.520  47.942  1.00 97.80  ? 28  VAL A O   1 
ATOM   210   C CB  . VAL A  1  29  ? -51.355 53.397  48.071  1.00 88.89  ? 28  VAL A CB  1 
ATOM   211   C CG1 . VAL A  1  29  ? -52.132 52.090  48.135  1.00 90.66  ? 28  VAL A CG1 1 
ATOM   212   C CG2 . VAL A  1  29  ? -51.337 53.935  46.650  1.00 88.26  ? 28  VAL A CG2 1 
ATOM   213   N N   . ALA A  1  30  ? -54.266 54.076  49.609  1.00 99.92  ? 29  ALA A N   1 
ATOM   214   C CA  . ALA A  1  30  ? -55.718 54.235  49.514  1.00 103.40 ? 29  ALA A CA  1 
ATOM   215   C C   . ALA A  1  30  ? -56.180 55.619  49.973  1.00 105.06 ? 29  ALA A C   1 
ATOM   216   O O   . ALA A  1  30  ? -57.220 56.110  49.530  1.00 110.36 ? 29  ALA A O   1 
ATOM   217   C CB  . ALA A  1  30  ? -56.422 53.146  50.310  1.00 103.83 ? 29  ALA A CB  1 
ATOM   218   N N   . GLY A  1  31  ? -55.401 56.237  50.858  1.00 103.08 ? 30  GLY A N   1 
ATOM   219   C CA  . GLY A  1  31  ? -55.690 57.583  51.348  1.00 104.24 ? 30  GLY A CA  1 
ATOM   220   C C   . GLY A  1  31  ? -54.918 58.667  50.618  1.00 101.23 ? 30  GLY A C   1 
ATOM   221   O O   . GLY A  1  31  ? -54.503 59.656  51.224  1.00 102.21 ? 30  GLY A O   1 
ATOM   222   N N   . GLY A  1  32  ? -54.728 58.479  49.313  1.00 100.94 ? 31  GLY A N   1 
ATOM   223   C CA  . GLY A  1  32  ? -54.027 59.449  48.473  1.00 101.10 ? 31  GLY A CA  1 
ATOM   224   C C   . GLY A  1  32  ? -54.905 60.007  47.367  1.00 104.60 ? 31  GLY A C   1 
ATOM   225   O O   . GLY A  1  32  ? -56.083 59.659  47.263  1.00 108.41 ? 31  GLY A O   1 
ATOM   226   N N   . ALA A  1  33  ? -54.323 60.873  46.540  1.00 106.41 ? 32  ALA A N   1 
ATOM   227   C CA  . ALA A  1  33  ? -55.042 61.500  45.431  1.00 109.38 ? 32  ALA A CA  1 
ATOM   228   C C   . ALA A  1  33  ? -55.360 60.491  44.324  1.00 109.72 ? 32  ALA A C   1 
ATOM   229   O O   . ALA A  1  33  ? -54.510 59.666  43.980  1.00 110.46 ? 32  ALA A O   1 
ATOM   230   C CB  . ALA A  1  33  ? -54.243 62.671  44.878  1.00 110.83 ? 32  ALA A CB  1 
ATOM   231   N N   . PRO A  1  34  ? -56.589 60.551  43.769  1.00 111.40 ? 33  PRO A N   1 
ATOM   232   C CA  . PRO A  1  34  ? -57.019 59.620  42.720  1.00 111.72 ? 33  PRO A CA  1 
ATOM   233   C C   . PRO A  1  34  ? -56.207 59.744  41.430  1.00 109.21 ? 33  PRO A C   1 
ATOM   234   O O   . PRO A  1  34  ? -55.856 60.853  41.017  1.00 108.70 ? 33  PRO A O   1 
ATOM   235   C CB  . PRO A  1  34  ? -58.482 60.011  42.472  1.00 114.64 ? 33  PRO A CB  1 
ATOM   236   C CG  . PRO A  1  34  ? -58.603 61.407  42.978  1.00 115.52 ? 33  PRO A CG  1 
ATOM   237   C CD  . PRO A  1  34  ? -57.671 61.479  44.149  1.00 113.93 ? 33  PRO A CD  1 
ATOM   238   N N   . SER A  1  35  ? -55.914 58.601  40.813  1.00 104.32 ? 34  SER A N   1 
ATOM   239   C CA  . SER A  1  35  ? -55.145 58.547  39.574  1.00 101.31 ? 34  SER A CA  1 
ATOM   240   C C   . SER A  1  35  ? -55.723 57.498  38.631  1.00 98.69  ? 34  SER A C   1 
ATOM   241   O O   . SER A  1  35  ? -55.985 56.366  39.039  1.00 98.96  ? 34  SER A O   1 
ATOM   242   C CB  . SER A  1  35  ? -53.678 58.233  39.871  1.00 99.77  ? 34  SER A CB  1 
ATOM   243   O OG  . SER A  1  35  ? -53.092 59.242  40.673  1.00 103.43 ? 34  SER A OG  1 
ATOM   244   N N   . VAL A  1  36  ? -55.917 57.881  37.372  1.00 100.90 ? 35  VAL A N   1 
ATOM   245   C CA  . VAL A  1  36  ? -56.532 56.997  36.382  1.00 105.07 ? 35  VAL A CA  1 
ATOM   246   C C   . VAL A  1  36  ? -55.611 56.743  35.179  1.00 105.87 ? 35  VAL A C   1 
ATOM   247   O O   . VAL A  1  36  ? -54.850 57.623  34.767  1.00 105.13 ? 35  VAL A O   1 
ATOM   248   C CB  . VAL A  1  36  ? -57.931 57.516  35.949  1.00 107.53 ? 35  VAL A CB  1 
ATOM   249   C CG1 . VAL A  1  36  ? -57.829 58.819  35.167  1.00 106.96 ? 35  VAL A CG1 1 
ATOM   250   C CG2 . VAL A  1  36  ? -58.692 56.460  35.156  1.00 108.56 ? 35  VAL A CG2 1 
ATOM   251   N N   . GLY A  1  37  ? -55.679 55.528  34.638  1.00 107.65 ? 36  GLY A N   1 
ATOM   252   C CA  . GLY A  1  37  ? -54.901 55.146  33.463  1.00 107.69 ? 36  GLY A CA  1 
ATOM   253   C C   . GLY A  1  37  ? -55.701 54.261  32.527  1.00 110.56 ? 36  GLY A C   1 
ATOM   254   O O   . GLY A  1  37  ? -56.253 53.245  32.950  1.00 110.45 ? 36  GLY A O   1 
ATOM   255   N N   . ILE A  1  38  ? -55.759 54.649  31.254  1.00 114.71 ? 37  ILE A N   1 
ATOM   256   C CA  . ILE A  1  38  ? -56.553 53.932  30.252  1.00 118.57 ? 37  ILE A CA  1 
ATOM   257   C C   . ILE A  1  38  ? -55.747 53.655  28.979  1.00 119.55 ? 37  ILE A C   1 
ATOM   258   O O   . ILE A  1  38  ? -55.143 54.565  28.405  1.00 119.24 ? 37  ILE A O   1 
ATOM   259   C CB  . ILE A  1  38  ? -57.852 54.700  29.896  1.00 121.27 ? 37  ILE A CB  1 
ATOM   260   C CG1 . ILE A  1  38  ? -58.710 54.926  31.149  1.00 118.85 ? 37  ILE A CG1 1 
ATOM   261   C CG2 . ILE A  1  38  ? -58.652 53.957  28.831  1.00 124.95 ? 37  ILE A CG2 1 
ATOM   262   C CD1 . ILE A  1  38  ? -59.767 56.001  31.001  1.00 120.06 ? 37  ILE A CD1 1 
ATOM   263   N N   . LYS A  1  39  ? -55.742 52.392  28.557  1.00 120.03 ? 38  LYS A N   1 
ATOM   264   C CA  . LYS A  1  39  ? -55.152 51.985  27.283  1.00 122.58 ? 38  LYS A CA  1 
ATOM   265   C C   . LYS A  1  39  ? -56.227 52.025  26.198  1.00 126.10 ? 38  LYS A C   1 
ATOM   266   O O   . LYS A  1  39  ? -57.368 51.621  26.434  1.00 128.64 ? 38  LYS A O   1 
ATOM   267   C CB  . LYS A  1  39  ? -54.562 50.576  27.392  1.00 119.17 ? 38  LYS A CB  1 
ATOM   268   C CG  . LYS A  1  39  ? -53.626 50.194  26.253  1.00 118.32 ? 38  LYS A CG  1 
ATOM   269   C CD  . LYS A  1  39  ? -53.319 48.703  26.237  1.00 117.22 ? 38  LYS A CD  1 
ATOM   270   C CE  . LYS A  1  39  ? -54.412 47.906  25.539  1.00 119.03 ? 38  LYS A CE  1 
ATOM   271   N NZ  . LYS A  1  39  ? -54.060 46.464  25.425  1.00 117.29 ? 38  LYS A NZ  1 
ATOM   272   N N   . ALA A  1  40  ? -55.859 52.508  25.014  1.00 126.46 ? 39  ALA A N   1 
ATOM   273   C CA  . ALA A  1  40  ? -56.828 52.736  23.940  1.00 128.39 ? 39  ALA A CA  1 
ATOM   274   C C   . ALA A  1  40  ? -56.518 51.992  22.634  1.00 128.84 ? 39  ALA A C   1 
ATOM   275   O O   . ALA A  1  40  ? -57.176 52.224  21.618  1.00 129.52 ? 39  ALA A O   1 
ATOM   276   C CB  . ALA A  1  40  ? -56.974 54.229  23.682  1.00 127.57 ? 39  ALA A CB  1 
ATOM   277   N N   . ALA A  1  41  ? -55.525 51.102  22.668  1.00 129.04 ? 40  ALA A N   1 
ATOM   278   C CA  . ALA A  1  41  ? -55.052 50.368  21.478  1.00 128.02 ? 40  ALA A CA  1 
ATOM   279   C C   . ALA A  1  41  ? -54.448 51.279  20.397  1.00 126.67 ? 40  ALA A C   1 
ATOM   280   O O   . ALA A  1  41  ? -53.886 50.798  19.409  1.00 129.28 ? 40  ALA A O   1 
ATOM   281   C CB  . ALA A  1  41  ? -56.152 49.481  20.900  1.00 128.65 ? 40  ALA A CB  1 
ATOM   282   N N   . ASN A  1  42  ? -54.567 52.589  20.603  1.00 122.76 ? 41  ASN A N   1 
ATOM   283   C CA  . ASN A  1  42  ? -53.979 53.599  19.726  1.00 118.82 ? 41  ASN A CA  1 
ATOM   284   C C   . ASN A  1  42  ? -53.018 54.499  20.502  1.00 117.12 ? 41  ASN A C   1 
ATOM   285   O O   . ASN A  1  42  ? -52.129 55.129  19.922  1.00 116.27 ? 41  ASN A O   1 
ATOM   286   C CB  . ASN A  1  42  ? -55.082 54.436  19.066  1.00 118.31 ? 41  ASN A CB  1 
ATOM   287   C CG  . ASN A  1  42  ? -54.540 55.446  18.068  1.00 117.41 ? 41  ASN A CG  1 
ATOM   288   O OD1 . ASN A  1  42  ? -54.794 56.645  18.185  1.00 118.01 ? 41  ASN A OD1 1 
ATOM   289   N ND2 . ASN A  1  42  ? -53.785 54.968  17.083  1.00 117.70 ? 41  ASN A ND2 1 
ATOM   290   N N   . GLY A  1  43  ? -53.208 54.546  21.818  1.00 118.28 ? 42  GLY A N   1 
ATOM   291   C CA  . GLY A  1  43  ? -52.361 55.328  22.714  1.00 116.59 ? 42  GLY A CA  1 
ATOM   292   C C   . GLY A  1  43  ? -52.689 55.088  24.176  1.00 116.34 ? 42  GLY A C   1 
ATOM   293   O O   . GLY A  1  43  ? -53.661 54.399  24.500  1.00 116.86 ? 42  GLY A O   1 
ATOM   294   N N   . VAL A  1  44  ? -51.871 55.654  25.060  1.00 114.00 ? 43  VAL A N   1 
ATOM   295   C CA  . VAL A  1  44  ? -52.071 55.524  26.504  1.00 114.44 ? 43  VAL A CA  1 
ATOM   296   C C   . VAL A  1  44  ? -52.284 56.897  27.140  1.00 114.24 ? 43  VAL A C   1 
ATOM   297   O O   . VAL A  1  44  ? -51.615 57.869  26.778  1.00 111.36 ? 43  VAL A O   1 
ATOM   298   C CB  . VAL A  1  44  ? -50.882 54.827  27.207  1.00 112.45 ? 43  VAL A CB  1 
ATOM   299   C CG1 . VAL A  1  44  ? -51.357 54.134  28.474  1.00 108.41 ? 43  VAL A CG1 1 
ATOM   300   C CG2 . VAL A  1  44  ? -50.205 53.818  26.291  1.00 113.71 ? 43  VAL A CG2 1 
ATOM   301   N N   . VAL A  1  45  ? -53.216 56.966  28.089  1.00 115.18 ? 44  VAL A N   1 
ATOM   302   C CA  . VAL A  1  45  ? -53.520 58.212  28.795  1.00 116.12 ? 44  VAL A CA  1 
ATOM   303   C C   . VAL A  1  45  ? -53.456 58.033  30.317  1.00 113.12 ? 44  VAL A C   1 
ATOM   304   O O   . VAL A  1  45  ? -54.029 57.090  30.869  1.00 110.97 ? 44  VAL A O   1 
ATOM   305   C CB  . VAL A  1  45  ? -54.876 58.819  28.340  1.00 118.48 ? 44  VAL A CB  1 
ATOM   306   C CG1 . VAL A  1  45  ? -56.040 57.875  28.627  1.00 120.33 ? 44  VAL A CG1 1 
ATOM   307   C CG2 . VAL A  1  45  ? -55.111 60.185  28.975  1.00 118.07 ? 44  VAL A CG2 1 
ATOM   308   N N   . LEU A  1  46  ? -52.737 58.937  30.978  1.00 110.98 ? 45  LEU A N   1 
ATOM   309   C CA  . LEU A  1  46  ? -52.608 58.928  32.433  1.00 108.09 ? 45  LEU A CA  1 
ATOM   310   C C   . LEU A  1  46  ? -52.981 60.288  33.017  1.00 104.95 ? 45  LEU A C   1 
ATOM   311   O O   . LEU A  1  46  ? -52.418 61.313  32.627  1.00 102.73 ? 45  LEU A O   1 
ATOM   312   C CB  . LEU A  1  46  ? -51.180 58.557  32.850  1.00 104.50 ? 45  LEU A CB  1 
ATOM   313   C CG  . LEU A  1  46  ? -50.653 57.128  32.680  1.00 102.21 ? 45  LEU A CG  1 
ATOM   314   C CD1 . LEU A  1  46  ? -49.151 57.107  32.911  1.00 97.20  ? 45  LEU A CD1 1 
ATOM   315   C CD2 . LEU A  1  46  ? -51.342 56.152  33.622  1.00 101.84 ? 45  LEU A CD2 1 
ATOM   316   N N   . ALA A  1  47  ? -53.929 60.285  33.950  1.00 104.49 ? 46  ALA A N   1 
ATOM   317   C CA  . ALA A  1  47  ? -54.390 61.510  34.599  1.00 105.32 ? 46  ALA A CA  1 
ATOM   318   C C   . ALA A  1  47  ? -54.417 61.364  36.118  1.00 105.52 ? 46  ALA A C   1 
ATOM   319   O O   . ALA A  1  47  ? -54.773 60.306  36.642  1.00 102.98 ? 46  ALA A O   1 
ATOM   320   C CB  . ALA A  1  47  ? -55.763 61.903  34.074  1.00 107.17 ? 46  ALA A CB  1 
ATOM   321   N N   . THR A  1  48  ? -54.037 62.433  36.815  1.00 109.12 ? 47  THR A N   1 
ATOM   322   C CA  . THR A  1  48  ? -53.999 62.440  38.280  1.00 114.93 ? 47  THR A CA  1 
ATOM   323   C C   . THR A  1  48  ? -54.510 63.755  38.872  1.00 118.09 ? 47  THR A C   1 
ATOM   324   O O   . THR A  1  48  ? -54.514 64.790  38.201  1.00 116.31 ? 47  THR A O   1 
ATOM   325   C CB  . THR A  1  48  ? -52.584 62.118  38.823  1.00 114.51 ? 47  THR A CB  1 
ATOM   326   O OG1 . THR A  1  48  ? -52.611 62.086  40.257  1.00 116.24 ? 47  THR A OG1 1 
ATOM   327   C CG2 . THR A  1  48  ? -51.554 63.152  38.357  1.00 113.84 ? 47  THR A CG2 1 
ATOM   328   N N   . GLU A  1  49  ? -54.944 63.701  40.130  1.00 122.97 ? 48  GLU A N   1 
ATOM   329   C CA  . GLU A  1  49  ? -55.411 64.884  40.846  1.00 130.69 ? 48  GLU A CA  1 
ATOM   330   C C   . GLU A  1  49  ? -54.224 65.694  41.359  1.00 132.21 ? 48  GLU A C   1 
ATOM   331   O O   . GLU A  1  49  ? -53.388 65.183  42.107  1.00 132.38 ? 48  GLU A O   1 
ATOM   332   C CB  . GLU A  1  49  ? -56.327 64.486  42.007  1.00 136.69 ? 48  GLU A CB  1 
ATOM   333   C CG  . GLU A  1  49  ? -57.085 65.648  42.633  1.00 143.24 ? 48  GLU A CG  1 
ATOM   334   C CD  . GLU A  1  49  ? -57.869 65.242  43.866  1.00 146.15 ? 48  GLU A CD  1 
ATOM   335   O OE1 . GLU A  1  49  ? -57.239 64.879  44.883  1.00 145.74 ? 48  GLU A OE1 1 
ATOM   336   O OE2 . GLU A  1  49  ? -59.116 65.296  43.823  1.00 147.59 ? 48  GLU A OE2 1 
ATOM   337   N N   . LYS A  1  50  ? -54.161 66.957  40.947  1.00 136.07 ? 49  LYS A N   1 
ATOM   338   C CA  . LYS A  1  50  ? -53.077 67.853  41.335  1.00 139.40 ? 49  LYS A CA  1 
ATOM   339   C C   . LYS A  1  50  ? -53.630 69.023  42.156  1.00 144.30 ? 49  LYS A C   1 
ATOM   340   O O   . LYS A  1  50  ? -53.432 70.193  41.813  1.00 146.45 ? 49  LYS A O   1 
ATOM   341   C CB  . LYS A  1  50  ? -52.336 68.348  40.088  1.00 136.48 ? 49  LYS A CB  1 
ATOM   342   C CG  . LYS A  1  50  ? -50.900 68.783  40.332  1.00 131.24 ? 49  LYS A CG  1 
ATOM   343   C CD  . LYS A  1  50  ? -50.269 69.306  39.053  1.00 125.34 ? 49  LYS A CD  1 
ATOM   344   C CE  . LYS A  1  50  ? -48.837 69.750  39.290  1.00 123.14 ? 49  LYS A CE  1 
ATOM   345   N NZ  . LYS A  1  50  ? -48.224 70.337  38.066  1.00 125.93 ? 49  LYS A NZ  1 
ATOM   346   N N   . LYS A  1  51  ? -54.332 68.691  43.238  1.00 145.77 ? 50  LYS A N   1 
ATOM   347   C CA  . LYS A  1  51  ? -54.938 69.692  44.113  1.00 145.19 ? 50  LYS A CA  1 
ATOM   348   C C   . LYS A  1  51  ? -53.877 70.345  44.995  1.00 143.53 ? 50  LYS A C   1 
ATOM   349   O O   . LYS A  1  51  ? -53.075 69.658  45.632  1.00 142.76 ? 50  LYS A O   1 
ATOM   350   C CB  . LYS A  1  51  ? -56.045 69.066  44.966  1.00 145.96 ? 50  LYS A CB  1 
ATOM   351   C CG  . LYS A  1  51  ? -57.039 70.068  45.533  1.00 150.77 ? 50  LYS A CG  1 
ATOM   352   C CD  . LYS A  1  51  ? -58.177 69.368  46.259  1.00 153.97 ? 50  LYS A CD  1 
ATOM   353   C CE  . LYS A  1  51  ? -59.270 70.344  46.668  1.00 158.36 ? 50  LYS A CE  1 
ATOM   354   N NZ  . LYS A  1  51  ? -58.843 71.259  47.763  1.00 161.17 ? 50  LYS A NZ  1 
ATOM   355   N N   . GLN A  1  52  ? -53.886 71.675  45.023  1.00 142.40 ? 51  GLN A N   1 
ATOM   356   C CA  . GLN A  1  52  ? -52.863 72.448  45.721  1.00 141.70 ? 51  GLN A CA  1 
ATOM   357   C C   . GLN A  1  52  ? -53.392 73.055  47.024  1.00 140.53 ? 51  GLN A C   1 
ATOM   358   O O   . GLN A  1  52  ? -52.617 73.345  47.939  1.00 140.78 ? 51  GLN A O   1 
ATOM   359   C CB  . GLN A  1  52  ? -52.318 73.540  44.798  1.00 141.77 ? 51  GLN A CB  1 
ATOM   360   C CG  . GLN A  1  52  ? -50.800 73.589  44.720  1.00 137.66 ? 51  GLN A CG  1 
ATOM   361   C CD  . GLN A  1  52  ? -50.197 72.388  44.010  1.00 135.80 ? 51  GLN A CD  1 
ATOM   362   O OE1 . GLN A  1  52  ? -50.653 71.986  42.939  1.00 135.76 ? 51  GLN A OE1 1 
ATOM   363   N NE2 . GLN A  1  52  ? -49.160 71.816  44.603  1.00 133.92 ? 51  GLN A NE2 1 
ATOM   364   N N   . LYS A  1  53  ? -54.711 73.248  47.079  1.00 140.19 ? 52  LYS A N   1 
ATOM   365   C CA  . LYS A  1  53  ? -55.461 73.669  48.282  1.00 138.47 ? 52  LYS A CA  1 
ATOM   366   C C   . LYS A  1  53  ? -54.896 74.839  49.110  1.00 133.79 ? 52  LYS A C   1 
ATOM   367   O O   . LYS A  1  53  ? -55.152 74.933  50.316  1.00 134.32 ? 52  LYS A O   1 
ATOM   368   C CB  . LYS A  1  53  ? -55.790 72.454  49.179  1.00 138.91 ? 52  LYS A CB  1 
ATOM   369   C CG  . LYS A  1  53  ? -54.612 71.840  49.927  1.00 137.35 ? 52  LYS A CG  1 
ATOM   370   C CD  . LYS A  1  53  ? -55.072 70.774  50.909  1.00 136.03 ? 52  LYS A CD  1 
ATOM   371   C CE  . LYS A  1  53  ? -53.976 70.414  51.901  1.00 131.61 ? 52  LYS A CE  1 
ATOM   372   N NZ  . LYS A  1  53  ? -52.865 69.639  51.284  1.00 129.61 ? 52  LYS A NZ  1 
ATOM   373   N N   . SER A  1  54  ? -54.157 75.740  48.463  1.00 129.61 ? 53  SER A N   1 
ATOM   374   C CA  . SER A  1  54  ? -53.604 76.915  49.149  1.00 126.17 ? 53  SER A CA  1 
ATOM   375   C C   . SER A  1  54  ? -53.363 78.120  48.237  1.00 128.52 ? 53  SER A C   1 
ATOM   376   O O   . SER A  1  54  ? -53.234 79.245  48.727  1.00 130.44 ? 53  SER A O   1 
ATOM   377   C CB  . SER A  1  54  ? -52.313 76.553  49.892  1.00 121.85 ? 53  SER A CB  1 
ATOM   378   O OG  . SER A  1  54  ? -51.810 77.663  50.618  1.00 120.02 ? 53  SER A OG  1 
ATOM   379   N N   . ILE A  1  55  ? -53.297 77.879  46.925  1.00 130.16 ? 54  ILE A N   1 
ATOM   380   C CA  . ILE A  1  55  ? -53.033 78.924  45.913  1.00 131.86 ? 54  ILE A CA  1 
ATOM   381   C C   . ILE A  1  55  ? -51.585 79.437  45.957  1.00 129.64 ? 54  ILE A C   1 
ATOM   382   O O   . ILE A  1  55  ? -50.971 79.659  44.909  1.00 129.81 ? 54  ILE A O   1 
ATOM   383   C CB  . ILE A  1  55  ? -54.059 80.096  45.978  1.00 134.00 ? 54  ILE A CB  1 
ATOM   384   C CG1 . ILE A  1  55  ? -55.498 79.594  45.756  1.00 135.52 ? 54  ILE A CG1 1 
ATOM   385   C CG2 . ILE A  1  55  ? -53.705 81.213  44.999  1.00 133.16 ? 54  ILE A CG2 1 
ATOM   386   C CD1 . ILE A  1  55  ? -55.783 79.009  44.385  1.00 136.16 ? 54  ILE A CD1 1 
ATOM   387   N N   . LEU A  1  56  ? -51.050 79.612  47.166  1.00 125.49 ? 55  LEU A N   1 
ATOM   388   C CA  . LEU A  1  56  ? -49.687 80.115  47.382  1.00 119.84 ? 55  LEU A CA  1 
ATOM   389   C C   . LEU A  1  56  ? -48.611 79.257  46.715  1.00 116.10 ? 55  LEU A C   1 
ATOM   390   O O   . LEU A  1  56  ? -47.577 79.773  46.284  1.00 114.32 ? 55  LEU A O   1 
ATOM   391   C CB  . LEU A  1  56  ? -49.389 80.234  48.882  1.00 116.56 ? 55  LEU A CB  1 
ATOM   392   C CG  . LEU A  1  56  ? -50.186 81.235  49.725  1.00 115.35 ? 55  LEU A CG  1 
ATOM   393   C CD1 . LEU A  1  56  ? -49.997 80.942  51.205  1.00 115.92 ? 55  LEU A CD1 1 
ATOM   394   C CD2 . LEU A  1  56  ? -49.793 82.670  49.408  1.00 116.20 ? 55  LEU A CD2 1 
ATOM   395   N N   . TYR A  1  57  ? -48.863 77.951  46.647  1.00 114.16 ? 56  TYR A N   1 
ATOM   396   C CA  . TYR A  1  57  ? -47.970 76.997  45.994  1.00 112.44 ? 56  TYR A CA  1 
ATOM   397   C C   . TYR A  1  57  ? -47.866 77.282  44.497  1.00 115.24 ? 56  TYR A C   1 
ATOM   398   O O   . TYR A  1  57  ? -48.849 77.676  43.865  1.00 118.08 ? 56  TYR A O   1 
ATOM   399   C CB  . TYR A  1  57  ? -48.492 75.569  46.184  1.00 111.31 ? 56  TYR A CB  1 
ATOM   400   C CG  . TYR A  1  57  ? -48.407 75.002  47.589  1.00 109.10 ? 56  TYR A CG  1 
ATOM   401   C CD1 . TYR A  1  57  ? -49.117 75.573  48.647  1.00 108.89 ? 56  TYR A CD1 1 
ATOM   402   C CD2 . TYR A  1  57  ? -47.645 73.864  47.851  1.00 108.37 ? 56  TYR A CD2 1 
ATOM   403   C CE1 . TYR A  1  57  ? -49.046 75.045  49.927  1.00 108.85 ? 56  TYR A CE1 1 
ATOM   404   C CE2 . TYR A  1  57  ? -47.570 73.327  49.127  1.00 109.65 ? 56  TYR A CE2 1 
ATOM   405   C CZ  . TYR A  1  57  ? -48.272 73.921  50.161  1.00 109.86 ? 56  TYR A CZ  1 
ATOM   406   O OH  . TYR A  1  57  ? -48.202 73.393  51.429  1.00 114.24 ? 56  TYR A OH  1 
ATOM   407   N N   . ASP A  1  58  ? -46.674 77.082  43.937  1.00 116.50 ? 57  ASP A N   1 
ATOM   408   C CA  . ASP A  1  58  ? -46.471 77.189  42.495  1.00 121.34 ? 57  ASP A CA  1 
ATOM   409   C C   . ASP A  1  58  ? -46.827 75.857  41.838  1.00 126.37 ? 57  ASP A C   1 
ATOM   410   O O   . ASP A  1  58  ? -46.201 74.830  42.114  1.00 125.68 ? 57  ASP A O   1 
ATOM   411   C CB  . ASP A  1  58  ? -45.028 77.594  42.172  1.00 119.31 ? 57  ASP A CB  1 
ATOM   412   C CG  . ASP A  1  58  ? -44.826 77.950  40.705  1.00 121.74 ? 57  ASP A CG  1 
ATOM   413   O OD1 . ASP A  1  58  ? -45.753 78.512  40.082  1.00 121.94 ? 57  ASP A OD1 1 
ATOM   414   O OD2 . ASP A  1  58  ? -43.729 77.676  40.177  1.00 121.90 ? 57  ASP A OD2 1 
ATOM   415   N N   . GLU A  1  59  ? -47.839 75.887  40.975  1.00 134.92 ? 58  GLU A N   1 
ATOM   416   C CA  . GLU A  1  59  ? -48.396 74.674  40.372  1.00 139.56 ? 58  GLU A CA  1 
ATOM   417   C C   . GLU A  1  59  ? -47.495 74.057  39.302  1.00 136.27 ? 58  GLU A C   1 
ATOM   418   O O   . GLU A  1  59  ? -47.451 72.834  39.154  1.00 135.53 ? 58  GLU A O   1 
ATOM   419   C CB  . GLU A  1  59  ? -49.789 74.948  39.791  1.00 148.52 ? 58  GLU A CB  1 
ATOM   420   C CG  . GLU A  1  59  ? -50.874 75.221  40.828  1.00 156.53 ? 58  GLU A CG  1 
ATOM   421   C CD  . GLU A  1  59  ? -50.886 76.656  41.332  1.00 159.64 ? 58  GLU A CD  1 
ATOM   422   O OE1 . GLU A  1  59  ? -50.391 77.556  40.619  1.00 162.24 ? 58  GLU A OE1 1 
ATOM   423   O OE2 . GLU A  1  59  ? -51.402 76.885  42.447  1.00 153.37 ? 58  GLU A OE2 1 
ATOM   424   N N   . ARG A  1  60  ? -46.780 74.906  38.567  1.00 134.72 ? 59  ARG A N   1 
ATOM   425   C CA  . ARG A  1  60  ? -45.938 74.461  37.453  1.00 132.03 ? 59  ARG A CA  1 
ATOM   426   C C   . ARG A  1  60  ? -44.551 73.962  37.880  1.00 123.39 ? 59  ARG A C   1 
ATOM   427   O O   . ARG A  1  60  ? -43.801 73.428  37.059  1.00 121.04 ? 59  ARG A O   1 
ATOM   428   C CB  . ARG A  1  60  ? -45.806 75.572  36.400  1.00 136.06 ? 59  ARG A CB  1 
ATOM   429   C CG  . ARG A  1  60  ? -45.160 76.855  36.905  1.00 141.36 ? 59  ARG A CG  1 
ATOM   430   C CD  . ARG A  1  60  ? -44.825 77.802  35.764  1.00 147.25 ? 59  ARG A CD  1 
ATOM   431   N NE  . ARG A  1  60  ? -46.014 78.436  35.196  1.00 152.47 ? 59  ARG A NE  1 
ATOM   432   C CZ  . ARG A  1  60  ? -45.997 79.305  34.189  1.00 155.64 ? 59  ARG A CZ  1 
ATOM   433   N NH1 . ARG A  1  60  ? -44.851 79.659  33.621  1.00 157.04 ? 59  ARG A NH1 1 
ATOM   434   N NH2 . ARG A  1  60  ? -47.133 79.826  33.748  1.00 155.52 ? 59  ARG A NH2 1 
ATOM   435   N N   . SER A  1  61  ? -44.222 74.136  39.159  1.00 117.38 ? 60  SER A N   1 
ATOM   436   C CA  . SER A  1  61  ? -42.897 73.794  39.680  1.00 113.19 ? 60  SER A CA  1 
ATOM   437   C C   . SER A  1  61  ? -42.669 72.285  39.798  1.00 108.87 ? 60  SER A C   1 
ATOM   438   O O   . SER A  1  61  ? -41.746 71.744  39.185  1.00 108.30 ? 60  SER A O   1 
ATOM   439   C CB  . SER A  1  61  ? -42.655 74.479  41.029  1.00 111.91 ? 60  SER A CB  1 
ATOM   440   O OG  . SER A  1  61  ? -43.594 74.047  41.999  1.00 112.06 ? 60  SER A OG  1 
ATOM   441   N N   . VAL A  1  62  ? -43.510 71.618  40.585  1.00 104.40 ? 61  VAL A N   1 
ATOM   442   C CA  . VAL A  1  62  ? -43.372 70.183  40.841  1.00 99.60  ? 61  VAL A CA  1 
ATOM   443   C C   . VAL A  1  62  ? -44.473 69.402  40.123  1.00 99.81  ? 61  VAL A C   1 
ATOM   444   O O   . VAL A  1  62  ? -45.653 69.747  40.218  1.00 102.87 ? 61  VAL A O   1 
ATOM   445   C CB  . VAL A  1  62  ? -43.386 69.869  42.356  1.00 96.98  ? 61  VAL A CB  1 
ATOM   446   C CG1 . VAL A  1  62  ? -43.130 68.390  42.614  1.00 97.14  ? 61  VAL A CG1 1 
ATOM   447   C CG2 . VAL A  1  62  ? -42.351 70.713  43.085  1.00 94.88  ? 61  VAL A CG2 1 
ATOM   448   N N   . HIS A  1  63  ? -44.074 68.354  39.407  1.00 97.89  ? 62  HIS A N   1 
ATOM   449   C CA  . HIS A  1  63  ? -45.002 67.541  38.624  1.00 98.06  ? 62  HIS A CA  1 
ATOM   450   C C   . HIS A  1  63  ? -45.189 66.171  39.210  1.00 97.73  ? 62  HIS A C   1 
ATOM   451   O O   . HIS A  1  63  ? -44.247 65.576  39.739  1.00 96.56  ? 62  HIS A O   1 
ATOM   452   C CB  . HIS A  1  63  ? -44.522 67.426  37.180  1.00 98.66  ? 62  HIS A CB  1 
ATOM   453   C CG  . HIS A  1  63  ? -44.355 68.756  36.484  1.00 100.04 ? 62  HIS A CG  1 
ATOM   454   N ND1 . HIS A  1  63  ? -45.385 69.410  35.917  1.00 101.89 ? 62  HIS A ND1 1 
ATOM   455   C CD2 . HIS A  1  63  ? -43.226 69.547  36.278  1.00 100.81 ? 62  HIS A CD2 1 
ATOM   456   C CE1 . HIS A  1  63  ? -44.942 70.560  35.376  1.00 103.83 ? 62  HIS A CE1 1 
ATOM   457   N NE2 . HIS A  1  63  ? -43.620 70.642  35.598  1.00 102.99 ? 62  HIS A NE2 1 
ATOM   458   N N   . LYS A  1  64  ? -46.416 65.664  39.117  1.00 97.82  ? 63  LYS A N   1 
ATOM   459   C CA  . LYS A  1  64  ? -46.742 64.311  39.569  1.00 97.03  ? 63  LYS A CA  1 
ATOM   460   C C   . LYS A  1  64  ? -46.563 63.302  38.436  1.00 93.94  ? 63  LYS A C   1 
ATOM   461   O O   . LYS A  1  64  ? -46.144 62.166  38.668  1.00 95.09  ? 63  LYS A O   1 
ATOM   462   C CB  . LYS A  1  64  ? -48.169 64.249  40.119  1.00 99.27  ? 63  LYS A CB  1 
ATOM   463   C CG  . LYS A  1  64  ? -48.394 65.094  41.366  1.00 102.78 ? 63  LYS A CG  1 
ATOM   464   C CD  . LYS A  1  64  ? -49.821 64.987  41.882  1.00 106.23 ? 63  LYS A CD  1 
ATOM   465   C CE  . LYS A  1  64  ? -50.024 63.739  42.728  1.00 106.83 ? 63  LYS A CE  1 
ATOM   466   N NZ  . LYS A  1  64  ? -51.400 63.665  43.288  1.00 111.85 ? 63  LYS A NZ  1 
ATOM   467   N N   . VAL A  1  65  ? -46.886 63.726  37.215  1.00 91.42  ? 64  VAL A N   1 
ATOM   468   C CA  . VAL A  1  65  ? -46.661 62.917  36.019  1.00 89.91  ? 64  VAL A CA  1 
ATOM   469   C C   . VAL A  1  65  ? -45.219 63.124  35.558  1.00 89.56  ? 64  VAL A C   1 
ATOM   470   O O   . VAL A  1  65  ? -44.847 64.219  35.126  1.00 93.08  ? 64  VAL A O   1 
ATOM   471   C CB  . VAL A  1  65  ? -47.640 63.282  34.880  1.00 90.01  ? 64  VAL A CB  1 
ATOM   472   C CG1 . VAL A  1  65  ? -47.504 62.305  33.719  1.00 89.24  ? 64  VAL A CG1 1 
ATOM   473   C CG2 . VAL A  1  65  ? -49.077 63.302  35.385  1.00 92.82  ? 64  VAL A CG2 1 
ATOM   474   N N   . GLU A  1  66  ? -44.413 62.070  35.659  1.00 88.46  ? 65  GLU A N   1 
ATOM   475   C CA  . GLU A  1  66  ? -42.989 62.149  35.340  1.00 89.42  ? 65  GLU A CA  1 
ATOM   476   C C   . GLU A  1  66  ? -42.588 61.188  34.219  1.00 87.88  ? 65  GLU A C   1 
ATOM   477   O O   . GLU A  1  66  ? -42.952 60.010  34.253  1.00 86.25  ? 65  GLU A O   1 
ATOM   478   C CB  . GLU A  1  66  ? -42.140 61.879  36.588  1.00 90.09  ? 65  GLU A CB  1 
ATOM   479   C CG  . GLU A  1  66  ? -42.235 62.945  37.674  1.00 92.81  ? 65  GLU A CG  1 
ATOM   480   C CD  . GLU A  1  66  ? -41.489 64.225  37.332  1.00 95.89  ? 65  GLU A CD  1 
ATOM   481   O OE1 . GLU A  1  66  ? -41.874 65.289  37.859  1.00 98.89  ? 65  GLU A OE1 1 
ATOM   482   O OE2 . GLU A  1  66  ? -40.519 64.174  36.546  1.00 98.03  ? 65  GLU A OE2 1 
ATOM   483   N N   . PRO A  1  67  ? -41.840 61.692  33.218  1.00 90.69  ? 66  PRO A N   1 
ATOM   484   C CA  . PRO A  1  67  ? -41.307 60.832  32.161  1.00 91.28  ? 66  PRO A CA  1 
ATOM   485   C C   . PRO A  1  67  ? -40.057 60.071  32.611  1.00 89.28  ? 66  PRO A C   1 
ATOM   486   O O   . PRO A  1  67  ? -39.249 60.601  33.378  1.00 88.40  ? 66  PRO A O   1 
ATOM   487   C CB  . PRO A  1  67  ? -40.965 61.820  31.043  1.00 93.38  ? 66  PRO A CB  1 
ATOM   488   C CG  . PRO A  1  67  ? -40.681 63.103  31.745  1.00 93.97  ? 66  PRO A CG  1 
ATOM   489   C CD  . PRO A  1  67  ? -41.535 63.117  32.982  1.00 92.48  ? 66  PRO A CD  1 
ATOM   490   N N   . ILE A  1  68  ? -39.916 58.836  32.135  1.00 86.38  ? 67  ILE A N   1 
ATOM   491   C CA  . ILE A  1  68  ? -38.767 57.987  32.466  1.00 84.43  ? 67  ILE A CA  1 
ATOM   492   C C   . ILE A  1  68  ? -37.783 57.948  31.296  1.00 85.21  ? 67  ILE A C   1 
ATOM   493   O O   . ILE A  1  68  ? -36.568 58.059  31.488  1.00 85.21  ? 67  ILE A O   1 
ATOM   494   C CB  . ILE A  1  68  ? -39.214 56.562  32.888  1.00 81.49  ? 67  ILE A CB  1 
ATOM   495   C CG1 . ILE A  1  68  ? -39.664 56.547  34.352  1.00 80.37  ? 67  ILE A CG1 1 
ATOM   496   C CG2 . ILE A  1  68  ? -38.096 55.544  32.716  1.00 81.46  ? 67  ILE A CG2 1 
ATOM   497   C CD1 . ILE A  1  68  ? -41.021 57.166  34.597  1.00 81.65  ? 67  ILE A CD1 1 
ATOM   498   N N   . THR A  1  69  ? -38.323 57.794  30.090  1.00 87.97  ? 68  THR A N   1 
ATOM   499   C CA  . THR A  1  69  ? -37.541 57.847  28.857  1.00 90.16  ? 68  THR A CA  1 
ATOM   500   C C   . THR A  1  69  ? -38.377 58.508  27.749  1.00 92.14  ? 68  THR A C   1 
ATOM   501   O O   . THR A  1  69  ? -39.353 59.205  28.042  1.00 92.52  ? 68  THR A O   1 
ATOM   502   C CB  . THR A  1  69  ? -37.007 56.448  28.451  1.00 91.07  ? 68  THR A CB  1 
ATOM   503   O OG1 . THR A  1  69  ? -36.216 56.554  27.260  1.00 92.50  ? 68  THR A OG1 1 
ATOM   504   C CG2 . THR A  1  69  ? -38.146 55.450  28.231  1.00 91.66  ? 68  THR A CG2 1 
ATOM   505   N N   . LYS A  1  70  ? -37.993 58.295  26.491  1.00 93.15  ? 69  LYS A N   1 
ATOM   506   C CA  . LYS A  1  70  ? -38.699 58.877  25.347  1.00 93.44  ? 69  LYS A CA  1 
ATOM   507   C C   . LYS A  1  70  ? -40.103 58.305  25.120  1.00 93.12  ? 69  LYS A C   1 
ATOM   508   O O   . LYS A  1  70  ? -40.916 58.919  24.425  1.00 93.68  ? 69  LYS A O   1 
ATOM   509   C CB  . LYS A  1  70  ? -37.862 58.740  24.067  1.00 94.07  ? 69  LYS A CB  1 
ATOM   510   C CG  . LYS A  1  70  ? -36.911 59.899  23.796  1.00 95.79  ? 69  LYS A CG  1 
ATOM   511   C CD  . LYS A  1  70  ? -35.586 59.745  24.528  1.00 98.07  ? 69  LYS A CD  1 
ATOM   512   C CE  . LYS A  1  70  ? -34.621 60.873  24.191  1.00 101.68 ? 69  LYS A CE  1 
ATOM   513   N NZ  . LYS A  1  70  ? -34.018 60.730  22.836  1.00 101.73 ? 69  LYS A NZ  1 
ATOM   514   N N   . HIS A  1  71  ? -40.388 57.145  25.711  1.00 92.76  ? 70  HIS A N   1 
ATOM   515   C CA  . HIS A  1  71  ? -41.659 56.454  25.475  1.00 93.67  ? 70  HIS A CA  1 
ATOM   516   C C   . HIS A  1  71  ? -42.356 55.938  26.714  1.00 91.06  ? 70  HIS A C   1 
ATOM   517   O O   . HIS A  1  71  ? -43.434 55.349  26.615  1.00 92.54  ? 70  HIS A O   1 
ATOM   518   C CB  . HIS A  1  71  ? -41.469 55.329  24.454  1.00 95.26  ? 70  HIS A CB  1 
ATOM   519   C CG  . HIS A  1  71  ? -40.643 54.170  24.962  1.00 95.55  ? 70  HIS A CG  1 
ATOM   520   N ND1 . HIS A  1  71  ? -39.316 54.259  25.165  1.00 94.68  ? 70  HIS A ND1 1 
ATOM   521   C CD2 . HIS A  1  71  ? -41.004 52.866  25.296  1.00 95.51  ? 70  HIS A CD2 1 
ATOM   522   C CE1 . HIS A  1  71  ? -38.851 53.079  25.616  1.00 93.68  ? 70  HIS A CE1 1 
ATOM   523   N NE2 . HIS A  1  71  ? -39.885 52.227  25.693  1.00 93.96  ? 70  HIS A NE2 1 
ATOM   524   N N   . ILE A  1  72  ? -41.763 56.156  27.887  1.00 86.54  ? 71  ILE A N   1 
ATOM   525   C CA  . ILE A  1  72  ? -42.336 55.662  29.148  1.00 82.80  ? 71  ILE A CA  1 
ATOM   526   C C   . ILE A  1  72  ? -42.537 56.779  30.177  1.00 81.02  ? 71  ILE A C   1 
ATOM   527   O O   . ILE A  1  72  ? -41.666 57.634  30.357  1.00 81.12  ? 71  ILE A O   1 
ATOM   528   C CB  . ILE A  1  72  ? -41.490 54.510  29.751  1.00 81.13  ? 71  ILE A CB  1 
ATOM   529   C CG1 . ILE A  1  72  ? -41.517 53.285  28.829  1.00 80.58  ? 71  ILE A CG1 1 
ATOM   530   C CG2 . ILE A  1  72  ? -41.991 54.124  31.139  1.00 81.67  ? 71  ILE A CG2 1 
ATOM   531   C CD1 . ILE A  1  72  ? -40.453 52.249  29.126  1.00 80.64  ? 71  ILE A CD1 1 
ATOM   532   N N   . GLY A  1  73  ? -43.694 56.759  30.842  1.00 80.31  ? 72  GLY A N   1 
ATOM   533   C CA  . GLY A  1  73  ? -44.017 57.715  31.904  1.00 81.85  ? 72  GLY A CA  1 
ATOM   534   C C   . GLY A  1  73  ? -44.608 57.069  33.147  1.00 81.18  ? 72  GLY A C   1 
ATOM   535   O O   . GLY A  1  73  ? -44.951 55.884  33.137  1.00 80.16  ? 72  GLY A O   1 
ATOM   536   N N   . LEU A  1  74  ? -44.728 57.854  34.216  1.00 83.03  ? 73  LEU A N   1 
ATOM   537   C CA  . LEU A  1  74  ? -45.252 57.365  35.496  1.00 83.75  ? 73  LEU A CA  1 
ATOM   538   C C   . LEU A  1  74  ? -46.275 58.287  36.151  1.00 83.86  ? 73  LEU A C   1 
ATOM   539   O O   . LEU A  1  74  ? -46.140 59.511  36.123  1.00 84.06  ? 73  LEU A O   1 
ATOM   540   C CB  . LEU A  1  74  ? -44.115 57.091  36.488  1.00 84.58  ? 73  LEU A CB  1 
ATOM   541   C CG  . LEU A  1  74  ? -43.692 55.639  36.732  1.00 85.89  ? 73  LEU A CG  1 
ATOM   542   C CD1 . LEU A  1  74  ? -42.433 55.586  37.584  1.00 85.55  ? 73  LEU A CD1 1 
ATOM   543   C CD2 . LEU A  1  74  ? -44.810 54.855  37.398  1.00 87.93  ? 73  LEU A CD2 1 
ATOM   544   N N   . VAL A  1  75  ? -47.295 57.670  36.742  1.00 82.98  ? 74  VAL A N   1 
ATOM   545   C CA  . VAL A  1  75  ? -48.299 58.355  37.553  1.00 83.66  ? 74  VAL A CA  1 
ATOM   546   C C   . VAL A  1  75  ? -48.506 57.521  38.819  1.00 82.34  ? 74  VAL A C   1 
ATOM   547   O O   . VAL A  1  75  ? -48.507 56.290  38.762  1.00 83.11  ? 74  VAL A O   1 
ATOM   548   C CB  . VAL A  1  75  ? -49.625 58.549  36.777  1.00 87.07  ? 74  VAL A CB  1 
ATOM   549   C CG1 . VAL A  1  75  ? -50.788 58.843  37.713  1.00 87.23  ? 74  VAL A CG1 1 
ATOM   550   C CG2 . VAL A  1  75  ? -49.483 59.671  35.761  1.00 89.51  ? 74  VAL A CG2 1 
ATOM   551   N N   . TYR A  1  76  ? -48.670 58.193  39.957  1.00 80.47  ? 75  TYR A N   1 
ATOM   552   C CA  . TYR A  1  76  ? -48.721 57.508  41.247  1.00 78.81  ? 75  TYR A CA  1 
ATOM   553   C C   . TYR A  1  76  ? -49.909 57.901  42.123  1.00 82.11  ? 75  TYR A C   1 
ATOM   554   O O   . TYR A  1  76  ? -50.690 58.792  41.783  1.00 84.57  ? 75  TYR A O   1 
ATOM   555   C CB  . TYR A  1  76  ? -47.420 57.757  42.017  1.00 75.98  ? 75  TYR A CB  1 
ATOM   556   C CG  . TYR A  1  76  ? -47.365 59.090  42.740  1.00 75.29  ? 75  TYR A CG  1 
ATOM   557   C CD1 . TYR A  1  76  ? -47.459 59.154  44.130  1.00 74.86  ? 75  TYR A CD1 1 
ATOM   558   C CD2 . TYR A  1  76  ? -47.227 60.287  42.034  1.00 75.52  ? 75  TYR A CD2 1 
ATOM   559   C CE1 . TYR A  1  76  ? -47.415 60.368  44.797  1.00 76.30  ? 75  TYR A CE1 1 
ATOM   560   C CE2 . TYR A  1  76  ? -47.180 61.506  42.693  1.00 76.32  ? 75  TYR A CE2 1 
ATOM   561   C CZ  . TYR A  1  76  ? -47.274 61.541  44.073  1.00 76.51  ? 75  TYR A CZ  1 
ATOM   562   O OH  . TYR A  1  76  ? -47.228 62.748  44.734  1.00 78.09  ? 75  TYR A OH  1 
ATOM   563   N N   . SER A  1  77  ? -50.023 57.211  43.256  1.00 83.35  ? 76  SER A N   1 
ATOM   564   C CA  . SER A  1  77  ? -50.934 57.574  44.335  1.00 87.51  ? 76  SER A CA  1 
ATOM   565   C C   . SER A  1  77  ? -50.262 57.274  45.673  1.00 88.73  ? 76  SER A C   1 
ATOM   566   O O   . SER A  1  77  ? -49.466 56.338  45.777  1.00 88.21  ? 76  SER A O   1 
ATOM   567   C CB  . SER A  1  77  ? -52.250 56.805  44.215  1.00 89.12  ? 76  SER A CB  1 
ATOM   568   O OG  . SER A  1  77  ? -52.963 57.200  43.057  1.00 91.24  ? 76  SER A OG  1 
ATOM   569   N N   . GLY A  1  78  ? -50.572 58.078  46.687  1.00 91.92  ? 77  GLY A N   1 
ATOM   570   C CA  . GLY A  1  78  ? -50.012 57.885  48.022  1.00 94.12  ? 77  GLY A CA  1 
ATOM   571   C C   . GLY A  1  78  ? -49.034 58.969  48.436  1.00 97.27  ? 77  GLY A C   1 
ATOM   572   O O   . GLY A  1  78  ? -49.378 60.153  48.449  1.00 99.06  ? 77  GLY A O   1 
ATOM   573   N N   . MET A  1  79  ? -47.813 58.557  48.774  1.00 95.79  ? 78  MET A N   1 
ATOM   574   C CA  . MET A  1  79  ? -46.784 59.473  49.271  1.00 94.94  ? 78  MET A CA  1 
ATOM   575   C C   . MET A  1  79  ? -45.905 60.034  48.157  1.00 95.18  ? 78  MET A C   1 
ATOM   576   O O   . MET A  1  79  ? -45.488 59.308  47.253  1.00 92.28  ? 78  MET A O   1 
ATOM   577   C CB  . MET A  1  79  ? -45.911 58.789  50.328  1.00 91.34  ? 78  MET A CB  1 
ATOM   578   C CG  . MET A  1  79  ? -46.631 58.466  51.629  1.00 90.52  ? 78  MET A CG  1 
ATOM   579   S SD  . MET A  1  79  ? -45.509 58.045  52.978  1.00 89.07  ? 78  MET A SD  1 
ATOM   580   C CE  . MET A  1  79  ? -44.849 56.476  52.420  1.00 84.84  ? 78  MET A CE  1 
ATOM   581   N N   . GLY A  1  80  ? -45.624 61.331  48.242  1.00 96.10  ? 79  GLY A N   1 
ATOM   582   C CA  . GLY A  1  80  ? -44.792 62.028  47.262  1.00 93.96  ? 79  GLY A CA  1 
ATOM   583   C C   . GLY A  1  80  ? -43.312 61.675  47.298  1.00 91.57  ? 79  GLY A C   1 
ATOM   584   O O   . GLY A  1  80  ? -42.749 61.305  46.266  1.00 89.89  ? 79  GLY A O   1 
ATOM   585   N N   . PRO A  1  81  ? -42.668 61.794  48.480  1.00 90.46  ? 80  PRO A N   1 
ATOM   586   C CA  . PRO A  1  81  ? -41.223 61.559  48.615  1.00 88.61  ? 80  PRO A CA  1 
ATOM   587   C C   . PRO A  1  81  ? -40.764 60.160  48.190  1.00 85.43  ? 80  PRO A C   1 
ATOM   588   O O   . PRO A  1  81  ? -39.698 60.025  47.585  1.00 84.71  ? 80  PRO A O   1 
ATOM   589   C CB  . PRO A  1  81  ? -40.972 61.766  50.113  1.00 88.08  ? 80  PRO A CB  1 
ATOM   590   C CG  . PRO A  1  81  ? -42.071 62.666  50.557  1.00 88.44  ? 80  PRO A CG  1 
ATOM   591   C CD  . PRO A  1  81  ? -43.262 62.235  49.757  1.00 91.47  ? 80  PRO A CD  1 
ATOM   592   N N   . ASP A  1  82  ? -41.562 59.140  48.502  1.00 83.48  ? 81  ASP A N   1 
ATOM   593   C CA  . ASP A  1  82  ? -41.237 57.755  48.150  1.00 79.83  ? 81  ASP A CA  1 
ATOM   594   C C   . ASP A  1  82  ? -41.334 57.502  46.646  1.00 78.61  ? 81  ASP A C   1 
ATOM   595   O O   . ASP A  1  82  ? -40.620 56.655  46.105  1.00 78.58  ? 81  ASP A O   1 
ATOM   596   C CB  . ASP A  1  82  ? -42.144 56.779  48.905  1.00 78.24  ? 81  ASP A CB  1 
ATOM   597   C CG  . ASP A  1  82  ? -41.875 56.761  50.400  1.00 78.91  ? 81  ASP A CG  1 
ATOM   598   O OD1 . ASP A  1  82  ? -41.721 57.845  51.003  1.00 80.63  ? 81  ASP A OD1 1 
ATOM   599   O OD2 . ASP A  1  82  ? -41.833 55.654  50.975  1.00 77.61  ? 81  ASP A OD2 1 
ATOM   600   N N   . TYR A  1  83  ? -42.223 58.241  45.986  1.00 77.34  ? 82  TYR A N   1 
ATOM   601   C CA  . TYR A  1  83  ? -42.420 58.148  44.540  1.00 74.94  ? 82  TYR A CA  1 
ATOM   602   C C   . TYR A  1  83  ? -41.214 58.678  43.765  1.00 74.29  ? 82  TYR A C   1 
ATOM   603   O O   . TYR A  1  83  ? -40.822 58.100  42.750  1.00 73.63  ? 82  TYR A O   1 
ATOM   604   C CB  . TYR A  1  83  ? -43.699 58.894  44.138  1.00 73.18  ? 82  TYR A CB  1 
ATOM   605   C CG  . TYR A  1  83  ? -43.846 59.197  42.659  1.00 71.31  ? 82  TYR A CG  1 
ATOM   606   C CD1 . TYR A  1  83  ? -44.088 58.180  41.736  1.00 70.58  ? 82  TYR A CD1 1 
ATOM   607   C CD2 . TYR A  1  83  ? -43.760 60.508  42.187  1.00 71.67  ? 82  TYR A CD2 1 
ATOM   608   C CE1 . TYR A  1  83  ? -44.235 58.457  40.385  1.00 70.65  ? 82  TYR A CE1 1 
ATOM   609   C CE2 . TYR A  1  83  ? -43.904 60.795  40.837  1.00 72.16  ? 82  TYR A CE2 1 
ATOM   610   C CZ  . TYR A  1  83  ? -44.143 59.767  39.942  1.00 72.16  ? 82  TYR A CZ  1 
ATOM   611   O OH  . TYR A  1  83  ? -44.284 60.046  38.601  1.00 73.71  ? 82  TYR A OH  1 
ATOM   612   N N   . ARG A  1  84  ? -40.630 59.767  44.261  1.00 74.63  ? 83  ARG A N   1 
ATOM   613   C CA  . ARG A  1  84  ? -39.512 60.440  43.601  1.00 73.72  ? 83  ARG A CA  1 
ATOM   614   C C   . ARG A  1  84  ? -38.279 59.543  43.489  1.00 72.27  ? 83  ARG A C   1 
ATOM   615   O O   . ARG A  1  84  ? -37.552 59.597  42.494  1.00 70.92  ? 83  ARG A O   1 
ATOM   616   C CB  . ARG A  1  84  ? -39.160 61.729  44.345  1.00 73.79  ? 83  ARG A CB  1 
ATOM   617   C CG  . ARG A  1  84  ? -38.635 62.842  43.452  1.00 74.31  ? 83  ARG A CG  1 
ATOM   618   C CD  . ARG A  1  84  ? -38.166 64.046  44.255  1.00 75.83  ? 83  ARG A CD  1 
ATOM   619   N NE  . ARG A  1  84  ? -39.200 64.564  45.150  1.00 76.73  ? 83  ARG A NE  1 
ATOM   620   C CZ  . ARG A  1  84  ? -39.172 64.469  46.477  1.00 76.49  ? 83  ARG A CZ  1 
ATOM   621   N NH1 . ARG A  1  84  ? -38.155 63.878  47.093  1.00 74.13  ? 83  ARG A NH1 1 
ATOM   622   N NH2 . ARG A  1  84  ? -40.166 64.973  47.193  1.00 77.90  ? 83  ARG A NH2 1 
ATOM   623   N N   . VAL A  1  85  ? -38.058 58.720  44.512  1.00 71.02  ? 84  VAL A N   1 
ATOM   624   C CA  . VAL A  1  85  ? -36.953 57.760  44.532  1.00 70.45  ? 84  VAL A CA  1 
ATOM   625   C C   . VAL A  1  85  ? -37.210 56.629  43.535  1.00 71.16  ? 84  VAL A C   1 
ATOM   626   O O   . VAL A  1  85  ? -36.276 56.114  42.913  1.00 72.33  ? 84  VAL A O   1 
ATOM   627   C CB  . VAL A  1  85  ? -36.725 57.187  45.950  1.00 70.38  ? 84  VAL A CB  1 
ATOM   628   C CG1 . VAL A  1  85  ? -35.489 56.298  45.988  1.00 70.15  ? 84  VAL A CG1 1 
ATOM   629   C CG2 . VAL A  1  85  ? -36.586 58.316  46.961  1.00 72.32  ? 84  VAL A CG2 1 
ATOM   630   N N   . LEU A  1  86  ? -38.481 56.261  43.382  1.00 71.74  ? 85  LEU A N   1 
ATOM   631   C CA  . LEU A  1  86  ? -38.889 55.236  42.422  1.00 71.68  ? 85  LEU A CA  1 
ATOM   632   C C   . LEU A  1  86  ? -38.774 55.716  40.975  1.00 70.97  ? 85  LEU A C   1 
ATOM   633   O O   . LEU A  1  86  ? -38.580 54.907  40.067  1.00 71.58  ? 85  LEU A O   1 
ATOM   634   C CB  . LEU A  1  86  ? -40.314 54.751  42.712  1.00 73.33  ? 85  LEU A CB  1 
ATOM   635   C CG  . LEU A  1  86  ? -40.541 53.899  43.967  1.00 75.16  ? 85  LEU A CG  1 
ATOM   636   C CD1 . LEU A  1  86  ? -42.023 53.829  44.303  1.00 76.45  ? 85  LEU A CD1 1 
ATOM   637   C CD2 . LEU A  1  86  ? -39.956 52.501  43.811  1.00 73.36  ? 85  LEU A CD2 1 
ATOM   638   N N   . VAL A  1  87  ? -38.895 57.028  40.771  1.00 70.50  ? 86  VAL A N   1 
ATOM   639   C CA  . VAL A  1  87  ? -38.732 57.639  39.448  1.00 70.89  ? 86  VAL A CA  1 
ATOM   640   C C   . VAL A  1  87  ? -37.271 57.567  39.001  1.00 72.91  ? 86  VAL A C   1 
ATOM   641   O O   . VAL A  1  87  ? -36.977 57.097  37.900  1.00 74.32  ? 86  VAL A O   1 
ATOM   642   C CB  . VAL A  1  87  ? -39.223 59.107  39.426  1.00 70.05  ? 86  VAL A CB  1 
ATOM   643   C CG1 . VAL A  1  87  ? -38.880 59.782  38.104  1.00 73.19  ? 86  VAL A CG1 1 
ATOM   644   C CG2 . VAL A  1  87  ? -40.722 59.174  39.670  1.00 69.77  ? 86  VAL A CG2 1 
ATOM   645   N N   . HIS A  1  88  ? -36.370 58.025  39.869  1.00 74.89  ? 87  HIS A N   1 
ATOM   646   C CA  . HIS A  1  88  ? -34.931 58.020  39.599  1.00 78.60  ? 87  HIS A CA  1 
ATOM   647   C C   . HIS A  1  88  ? -34.405 56.631  39.367  1.00 77.95  ? 87  HIS A C   1 
ATOM   648   O O   . HIS A  1  88  ? -33.521 56.428  38.533  1.00 79.94  ? 87  HIS A O   1 
ATOM   649   C CB  . HIS A  1  88  ? -34.174 58.696  40.740  1.00 84.60  ? 87  HIS A CB  1 
ATOM   650   C CG  . HIS A  1  88  ? -32.683 58.794  40.512  1.00 90.65  ? 87  HIS A CG  1 
ATOM   651   N ND1 . HIS A  1  88  ? -31.812 57.917  41.043  1.00 93.72  ? 87  HIS A ND1 1 
ATOM   652   C CD2 . HIS A  1  88  ? -31.927 59.705  39.777  1.00 95.58  ? 87  HIS A CD2 1 
ATOM   653   C CE1 . HIS A  1  88  ? -30.561 58.249  40.672  1.00 99.07  ? 87  HIS A CE1 1 
ATOM   654   N NE2 . HIS A  1  88  ? -30.632 59.344  39.897  1.00 99.78  ? 87  HIS A NE2 1 
ATOM   655   N N   . ARG A  1  89  ? -34.953 55.663  40.100  1.00 75.85  ? 88  ARG A N   1 
ATOM   656   C CA  . ARG A  1  89  ? -34.571 54.261  39.955  1.00 74.29  ? 88  ARG A CA  1 
ATOM   657   C C   . ARG A  1  89  ? -35.100 53.669  38.646  1.00 73.94  ? 88  ARG A C   1 
ATOM   658   O O   . ARG A  1  89  ? -34.413 52.875  38.000  1.00 73.86  ? 88  ARG A O   1 
ATOM   659   C CB  . ARG A  1  89  ? -35.056 53.445  41.160  1.00 74.27  ? 88  ARG A CB  1 
ATOM   660   C CG  . ARG A  1  89  ? -34.401 52.078  41.313  1.00 75.32  ? 88  ARG A CG  1 
ATOM   661   C CD  . ARG A  1  89  ? -32.938 52.183  41.720  1.00 75.46  ? 88  ARG A CD  1 
ATOM   662   N NE  . ARG A  1  89  ? -32.312 50.868  41.836  1.00 74.80  ? 88  ARG A NE  1 
ATOM   663   C CZ  . ARG A  1  89  ? -32.196 50.183  42.971  1.00 74.98  ? 88  ARG A CZ  1 
ATOM   664   N NH1 . ARG A  1  89  ? -32.660 50.682  44.111  1.00 74.51  ? 88  ARG A NH1 1 
ATOM   665   N NH2 . ARG A  1  89  ? -31.611 48.993  42.968  1.00 76.30  ? 88  ARG A NH2 1 
ATOM   666   N N   . ALA A  1  90  ? -36.315 54.065  38.263  1.00 73.37  ? 89  ALA A N   1 
ATOM   667   C CA  . ALA A  1  90  ? -36.922 53.632  37.002  1.00 72.83  ? 89  ALA A CA  1 
ATOM   668   C C   . ALA A  1  90  ? -36.208 54.241  35.796  1.00 73.92  ? 89  ALA A C   1 
ATOM   669   O O   . ALA A  1  90  ? -36.076 53.596  34.753  1.00 74.13  ? 89  ALA A O   1 
ATOM   670   C CB  . ALA A  1  90  ? -38.402 53.979  36.972  1.00 72.05  ? 89  ALA A CB  1 
ATOM   671   N N   . ARG A  1  91  ? -35.755 55.484  35.951  1.00 74.56  ? 90  ARG A N   1 
ATOM   672   C CA  . ARG A  1  91  ? -35.003 56.184  34.912  1.00 75.29  ? 90  ARG A CA  1 
ATOM   673   C C   . ARG A  1  91  ? -33.619 55.570  34.706  1.00 75.28  ? 90  ARG A C   1 
ATOM   674   O O   . ARG A  1  91  ? -33.134 55.491  33.576  1.00 76.26  ? 90  ARG A O   1 
ATOM   675   C CB  . ARG A  1  91  ? -34.873 57.672  35.252  1.00 75.84  ? 90  ARG A CB  1 
ATOM   676   C CG  . ARG A  1  91  ? -36.131 58.487  35.002  1.00 77.67  ? 90  ARG A CG  1 
ATOM   677   C CD  . ARG A  1  91  ? -35.974 59.914  35.499  1.00 79.75  ? 90  ARG A CD  1 
ATOM   678   N NE  . ARG A  1  91  ? -37.158 60.723  35.219  1.00 81.24  ? 90  ARG A NE  1 
ATOM   679   C CZ  . ARG A  1  91  ? -37.340 61.972  35.641  1.00 82.45  ? 90  ARG A CZ  1 
ATOM   680   N NH1 . ARG A  1  91  ? -36.417 62.578  36.376  1.00 81.98  ? 90  ARG A NH1 1 
ATOM   681   N NH2 . ARG A  1  91  ? -38.456 62.617  35.329  1.00 83.58  ? 90  ARG A NH2 1 
ATOM   682   N N   . LYS A  1  92  ? -32.997 55.135  35.802  1.00 76.46  ? 91  LYS A N   1 
ATOM   683   C CA  . LYS A  1  92  ? -31.660 54.542  35.762  1.00 78.47  ? 91  LYS A CA  1 
ATOM   684   C C   . LYS A  1  92  ? -31.682 53.122  35.195  1.00 78.46  ? 91  LYS A C   1 
ATOM   685   O O   . LYS A  1  92  ? -30.766 52.725  34.474  1.00 78.90  ? 91  LYS A O   1 
ATOM   686   C CB  . LYS A  1  92  ? -31.017 54.560  37.153  1.00 82.10  ? 91  LYS A CB  1 
ATOM   687   C CG  . LYS A  1  92  ? -29.502 54.394  37.141  1.00 86.94  ? 91  LYS A CG  1 
ATOM   688   C CD  . LYS A  1  92  ? -28.866 54.808  38.461  1.00 93.34  ? 91  LYS A CD  1 
ATOM   689   C CE  . LYS A  1  92  ? -28.850 53.674  39.476  1.00 97.15  ? 91  LYS A CE  1 
ATOM   690   N NZ  . LYS A  1  92  ? -28.182 54.087  40.741  1.00 99.17  ? 91  LYS A NZ  1 
ATOM   691   N N   . LEU A  1  93  ? -32.732 52.369  35.523  1.00 79.07  ? 92  LEU A N   1 
ATOM   692   C CA  . LEU A  1  93  ? -32.910 51.008  35.011  1.00 78.95  ? 92  LEU A CA  1 
ATOM   693   C C   . LEU A  1  93  ? -33.242 50.991  33.520  1.00 77.79  ? 92  LEU A C   1 
ATOM   694   O O   . LEU A  1  93  ? -32.886 50.047  32.810  1.00 76.53  ? 92  LEU A O   1 
ATOM   695   C CB  . LEU A  1  93  ? -33.993 50.265  35.802  1.00 78.74  ? 92  LEU A CB  1 
ATOM   696   C CG  . LEU A  1  93  ? -33.625 49.730  37.190  1.00 79.16  ? 92  LEU A CG  1 
ATOM   697   C CD1 . LEU A  1  93  ? -34.882 49.447  38.000  1.00 79.65  ? 92  LEU A CD1 1 
ATOM   698   C CD2 . LEU A  1  93  ? -32.747 48.488  37.101  1.00 79.28  ? 92  LEU A CD2 1 
ATOM   699   N N   . ALA A  1  94  ? -33.924 52.038  33.058  1.00 76.55  ? 93  ALA A N   1 
ATOM   700   C CA  . ALA A  1  94  ? -34.252 52.200  31.642  1.00 75.48  ? 93  ALA A CA  1 
ATOM   701   C C   . ALA A  1  94  ? -33.012 52.523  30.811  1.00 75.04  ? 93  ALA A C   1 
ATOM   702   O O   . ALA A  1  94  ? -32.907 52.110  29.654  1.00 74.64  ? 93  ALA A O   1 
ATOM   703   C CB  . ALA A  1  94  ? -35.306 53.282  31.464  1.00 75.84  ? 93  ALA A CB  1 
ATOM   704   N N   . GLN A  1  95  ? -32.080 53.262  31.411  1.00 75.31  ? 94  GLN A N   1 
ATOM   705   C CA  . GLN A  1  95  ? -30.833 53.641  30.747  1.00 75.21  ? 94  GLN A CA  1 
ATOM   706   C C   . GLN A  1  95  ? -29.812 52.504  30.735  1.00 74.56  ? 94  GLN A C   1 
ATOM   707   O O   . GLN A  1  95  ? -29.006 52.399  29.807  1.00 74.28  ? 94  GLN A O   1 
ATOM   708   C CB  . GLN A  1  95  ? -30.228 54.893  31.393  1.00 74.15  ? 94  GLN A CB  1 
ATOM   709   C CG  . GLN A  1  95  ? -30.993 56.184  31.124  1.00 74.53  ? 94  GLN A CG  1 
ATOM   710   C CD  . GLN A  1  95  ? -31.083 56.540  29.648  1.00 74.05  ? 94  GLN A CD  1 
ATOM   711   O OE1 . GLN A  1  95  ? -30.130 56.359  28.888  1.00 72.60  ? 94  GLN A OE1 1 
ATOM   712   N NE2 . GLN A  1  95  ? -32.234 57.058  29.238  1.00 76.74  ? 94  GLN A NE2 1 
ATOM   713   N N   . GLN A  1  96  ? -29.850 51.661  31.766  1.00 74.10  ? 95  GLN A N   1 
ATOM   714   C CA  . GLN A  1  96  ? -28.979 50.488  31.855  1.00 74.89  ? 95  GLN A CA  1 
ATOM   715   C C   . GLN A  1  96  ? -29.314 49.450  30.786  1.00 73.07  ? 95  GLN A C   1 
ATOM   716   O O   . GLN A  1  96  ? -28.436 48.718  30.326  1.00 73.16  ? 95  GLN A O   1 
ATOM   717   C CB  . GLN A  1  96  ? -29.058 49.856  33.247  1.00 79.89  ? 95  GLN A CB  1 
ATOM   718   C CG  . GLN A  1  96  ? -28.243 50.578  34.311  1.00 85.87  ? 95  GLN A CG  1 
ATOM   719   C CD  . GLN A  1  96  ? -28.455 50.017  35.707  1.00 90.52  ? 95  GLN A CD  1 
ATOM   720   O OE1 . GLN A  1  96  ? -28.776 48.840  35.880  1.00 90.74  ? 95  GLN A OE1 1 
ATOM   721   N NE2 . GLN A  1  96  ? -28.269 50.863  36.715  1.00 92.36  ? 95  GLN A NE2 1 
ATOM   722   N N   . TYR A  1  97  ? -30.587 49.395  30.400  1.00 72.01  ? 96  TYR A N   1 
ATOM   723   C CA  . TYR A  1  97  ? -31.050 48.508  29.336  1.00 71.89  ? 96  TYR A CA  1 
ATOM   724   C C   . TYR A  1  97  ? -30.621 49.030  27.965  1.00 72.97  ? 96  TYR A C   1 
ATOM   725   O O   . TYR A  1  97  ? -30.255 48.249  27.084  1.00 73.76  ? 96  TYR A O   1 
ATOM   726   C CB  . TYR A  1  97  ? -32.574 48.363  29.395  1.00 71.39  ? 96  TYR A CB  1 
ATOM   727   C CG  . TYR A  1  97  ? -33.147 47.291  28.489  1.00 72.42  ? 96  TYR A CG  1 
ATOM   728   C CD1 . TYR A  1  97  ? -33.363 45.995  28.959  1.00 72.43  ? 96  TYR A CD1 1 
ATOM   729   C CD2 . TYR A  1  97  ? -33.485 47.575  27.165  1.00 73.39  ? 96  TYR A CD2 1 
ATOM   730   C CE1 . TYR A  1  97  ? -33.891 45.012  28.134  1.00 73.09  ? 96  TYR A CE1 1 
ATOM   731   C CE2 . TYR A  1  97  ? -34.012 46.600  26.333  1.00 73.54  ? 96  TYR A CE2 1 
ATOM   732   C CZ  . TYR A  1  97  ? -34.213 45.322  26.821  1.00 73.60  ? 96  TYR A CZ  1 
ATOM   733   O OH  . TYR A  1  97  ? -34.738 44.356  25.993  1.00 74.81  ? 96  TYR A OH  1 
ATOM   734   N N   . TYR A  1  98  ? -30.668 50.351  27.798  1.00 74.12  ? 97  TYR A N   1 
ATOM   735   C CA  . TYR A  1  98  ? -30.335 50.995  26.527  1.00 78.25  ? 97  TYR A CA  1 
ATOM   736   C C   . TYR A  1  98  ? -28.836 50.954  26.223  1.00 79.20  ? 97  TYR A C   1 
ATOM   737   O O   . TYR A  1  98  ? -28.437 50.940  25.058  1.00 82.76  ? 97  TYR A O   1 
ATOM   738   C CB  . TYR A  1  98  ? -30.845 52.439  26.508  1.00 80.61  ? 97  TYR A CB  1 
ATOM   739   C CG  . TYR A  1  98  ? -30.880 53.065  25.129  1.00 84.25  ? 97  TYR A CG  1 
ATOM   740   C CD1 . TYR A  1  98  ? -31.933 52.806  24.252  1.00 87.22  ? 97  TYR A CD1 1 
ATOM   741   C CD2 . TYR A  1  98  ? -29.864 53.921  24.704  1.00 84.78  ? 97  TYR A CD2 1 
ATOM   742   C CE1 . TYR A  1  98  ? -31.970 53.377  22.989  1.00 90.90  ? 97  TYR A CE1 1 
ATOM   743   C CE2 . TYR A  1  98  ? -29.892 54.496  23.443  1.00 89.16  ? 97  TYR A CE2 1 
ATOM   744   C CZ  . TYR A  1  98  ? -30.947 54.221  22.591  1.00 92.10  ? 97  TYR A CZ  1 
ATOM   745   O OH  . TYR A  1  98  ? -30.981 54.790  21.339  1.00 95.46  ? 97  TYR A OH  1 
ATOM   746   N N   . LEU A  1  99  ? -28.016 50.941  27.272  1.00 77.62  ? 98  LEU A N   1 
ATOM   747   C CA  . LEU A  1  99  ? -26.563 50.882  27.122  1.00 76.81  ? 98  LEU A CA  1 
ATOM   748   C C   . LEU A  1  99  ? -26.077 49.491  26.716  1.00 77.69  ? 98  LEU A C   1 
ATOM   749   O O   . LEU A  1  99  ? -25.018 49.353  26.100  1.00 77.97  ? 98  LEU A O   1 
ATOM   750   C CB  . LEU A  1  99  ? -25.868 51.329  28.413  1.00 73.44  ? 98  LEU A CB  1 
ATOM   751   C CG  . LEU A  1  99  ? -25.832 52.829  28.726  1.00 70.97  ? 98  LEU A CG  1 
ATOM   752   C CD1 . LEU A  1  99  ? -25.551 53.062  30.203  1.00 69.62  ? 98  LEU A CD1 1 
ATOM   753   C CD2 . LEU A  1  99  ? -24.810 53.556  27.862  1.00 72.10  ? 98  LEU A CD2 1 
ATOM   754   N N   . VAL A  1  100 ? -26.859 48.470  27.061  1.00 76.26  ? 99  VAL A N   1 
ATOM   755   C CA  . VAL A  1  100 ? -26.502 47.077  26.787  1.00 74.98  ? 99  VAL A CA  1 
ATOM   756   C C   . VAL A  1  100 ? -27.103 46.586  25.467  1.00 76.70  ? 99  VAL A C   1 
ATOM   757   O O   . VAL A  1  100 ? -26.392 46.043  24.619  1.00 77.91  ? 99  VAL A O   1 
ATOM   758   C CB  . VAL A  1  100 ? -26.917 46.143  27.953  1.00 71.80  ? 99  VAL A CB  1 
ATOM   759   C CG1 . VAL A  1  100 ? -26.689 44.680  27.597  1.00 69.82  ? 99  VAL A CG1 1 
ATOM   760   C CG2 . VAL A  1  100 ? -26.158 46.498  29.223  1.00 71.08  ? 99  VAL A CG2 1 
ATOM   761   N N   . TYR A  1  101 ? -28.407 46.793  25.299  1.00 78.02  ? 100 TYR A N   1 
ATOM   762   C CA  . TYR A  1  101 ? -29.147 46.228  24.168  1.00 80.48  ? 100 TYR A CA  1 
ATOM   763   C C   . TYR A  1  101 ? -29.347 47.202  23.003  1.00 83.01  ? 100 TYR A C   1 
ATOM   764   O O   . TYR A  1  101 ? -29.784 46.794  21.923  1.00 84.61  ? 100 TYR A O   1 
ATOM   765   C CB  . TYR A  1  101 ? -30.498 45.674  24.640  1.00 79.18  ? 100 TYR A CB  1 
ATOM   766   C CG  . TYR A  1  101 ? -30.385 44.607  25.711  1.00 76.88  ? 100 TYR A CG  1 
ATOM   767   C CD1 . TYR A  1  101 ? -30.483 44.936  27.063  1.00 75.42  ? 100 TYR A CD1 1 
ATOM   768   C CD2 . TYR A  1  101 ? -30.176 43.270  25.372  1.00 77.53  ? 100 TYR A CD2 1 
ATOM   769   C CE1 . TYR A  1  101 ? -30.378 43.965  28.047  1.00 75.48  ? 100 TYR A CE1 1 
ATOM   770   C CE2 . TYR A  1  101 ? -30.070 42.292  26.349  1.00 77.03  ? 100 TYR A CE2 1 
ATOM   771   C CZ  . TYR A  1  101 ? -30.171 42.644  27.684  1.00 76.29  ? 100 TYR A CZ  1 
ATOM   772   O OH  . TYR A  1  101 ? -30.065 41.677  28.657  1.00 76.35  ? 100 TYR A OH  1 
ATOM   773   N N   . GLN A  1  102 ? -29.020 48.476  23.230  1.00 83.63  ? 101 GLN A N   1 
ATOM   774   C CA  . GLN A  1  102 ? -29.181 49.554  22.235  1.00 84.29  ? 101 GLN A CA  1 
ATOM   775   C C   . GLN A  1  102 ? -30.602 49.652  21.667  1.00 83.99  ? 101 GLN A C   1 
ATOM   776   O O   . GLN A  1  102 ? -30.804 50.021  20.506  1.00 84.75  ? 101 GLN A O   1 
ATOM   777   C CB  . GLN A  1  102 ? -28.136 49.441  21.112  1.00 86.14  ? 101 GLN A CB  1 
ATOM   778   C CG  . GLN A  1  102 ? -26.716 49.793  21.534  1.00 88.52  ? 101 GLN A CG  1 
ATOM   779   C CD  . GLN A  1  102 ? -26.527 51.277  21.794  1.00 90.72  ? 101 GLN A CD  1 
ATOM   780   O OE1 . GLN A  1  102 ? -26.642 52.100  20.886  1.00 92.07  ? 101 GLN A OE1 1 
ATOM   781   N NE2 . GLN A  1  102 ? -26.226 51.624  23.040  1.00 91.63  ? 101 GLN A NE2 1 
ATOM   782   N N   . GLU A  1  103 ? -31.578 49.326  22.510  1.00 83.33  ? 102 GLU A N   1 
ATOM   783   C CA  . GLU A  1  103 ? -32.984 49.306  22.129  1.00 83.70  ? 102 GLU A CA  1 
ATOM   784   C C   . GLU A  1  103 ? -33.828 49.856  23.277  1.00 82.05  ? 102 GLU A C   1 
ATOM   785   O O   . GLU A  1  103 ? -33.595 49.502  24.436  1.00 81.78  ? 102 GLU A O   1 
ATOM   786   C CB  . GLU A  1  103 ? -33.414 47.874  21.788  1.00 86.34  ? 102 GLU A CB  1 
ATOM   787   C CG  . GLU A  1  103 ? -34.818 47.740  21.210  1.00 89.30  ? 102 GLU A CG  1 
ATOM   788   C CD  . GLU A  1  103 ? -35.252 46.296  21.020  1.00 93.56  ? 102 GLU A CD  1 
ATOM   789   O OE1 . GLU A  1  103 ? -34.680 45.397  21.676  1.00 93.51  ? 102 GLU A OE1 1 
ATOM   790   O OE2 . GLU A  1  103 ? -36.177 46.058  20.215  1.00 95.05  ? 102 GLU A OE2 1 
ATOM   791   N N   . PRO A  1  104 ? -34.800 50.738  22.963  1.00 81.85  ? 103 PRO A N   1 
ATOM   792   C CA  . PRO A  1  104 ? -35.736 51.258  23.960  1.00 81.84  ? 103 PRO A CA  1 
ATOM   793   C C   . PRO A  1  104 ? -36.371 50.137  24.785  1.00 82.30  ? 103 PRO A C   1 
ATOM   794   O O   . PRO A  1  104 ? -36.910 49.181  24.221  1.00 82.60  ? 103 PRO A O   1 
ATOM   795   C CB  . PRO A  1  104 ? -36.791 51.959  23.105  1.00 82.34  ? 103 PRO A CB  1 
ATOM   796   C CG  . PRO A  1  104 ? -36.032 52.433  21.916  1.00 82.43  ? 103 PRO A CG  1 
ATOM   797   C CD  . PRO A  1  104 ? -34.992 51.380  21.647  1.00 82.79  ? 103 PRO A CD  1 
ATOM   798   N N   . ILE A  1  105 ? -36.285 50.262  26.108  1.00 82.02  ? 104 ILE A N   1 
ATOM   799   C CA  . ILE A  1  105 ? -36.753 49.227  27.037  1.00 80.29  ? 104 ILE A CA  1 
ATOM   800   C C   . ILE A  1  105 ? -38.261 48.965  26.918  1.00 79.44  ? 104 ILE A C   1 
ATOM   801   O O   . ILE A  1  105 ? -39.058 49.906  26.948  1.00 80.12  ? 104 ILE A O   1 
ATOM   802   C CB  . ILE A  1  105 ? -36.339 49.536  28.506  1.00 79.67  ? 104 ILE A CB  1 
ATOM   803   C CG1 . ILE A  1  105 ? -36.783 48.409  29.453  1.00 78.72  ? 104 ILE A CG1 1 
ATOM   804   C CG2 . ILE A  1  105 ? -36.865 50.898  28.958  1.00 79.94  ? 104 ILE A CG2 1 
ATOM   805   C CD1 . ILE A  1  105 ? -36.035 48.356  30.769  1.00 77.41  ? 104 ILE A CD1 1 
ATOM   806   N N   . PRO A  1  106 ? -38.648 47.682  26.754  1.00 77.76  ? 105 PRO A N   1 
ATOM   807   C CA  . PRO A  1  106 ? -40.059 47.293  26.757  1.00 78.32  ? 105 PRO A CA  1 
ATOM   808   C C   . PRO A  1  106 ? -40.727 47.640  28.084  1.00 77.64  ? 105 PRO A C   1 
ATOM   809   O O   . PRO A  1  106 ? -40.098 47.533  29.141  1.00 77.48  ? 105 PRO A O   1 
ATOM   810   C CB  . PRO A  1  106 ? -40.005 45.773  26.576  1.00 77.23  ? 105 PRO A CB  1 
ATOM   811   C CG  . PRO A  1  106 ? -38.709 45.520  25.888  1.00 76.46  ? 105 PRO A CG  1 
ATOM   812   C CD  . PRO A  1  106 ? -37.766 46.539  26.452  1.00 76.55  ? 105 PRO A CD  1 
ATOM   813   N N   . THR A  1  107 ? -41.989 48.056  28.017  1.00 77.57  ? 106 THR A N   1 
ATOM   814   C CA  . THR A  1  107 ? -42.742 48.475  29.198  1.00 76.02  ? 106 THR A CA  1 
ATOM   815   C C   . THR A  1  107 ? -42.895 47.326  30.193  1.00 76.49  ? 106 THR A C   1 
ATOM   816   O O   . THR A  1  107 ? -42.736 47.521  31.397  1.00 76.84  ? 106 THR A O   1 
ATOM   817   C CB  . THR A  1  107 ? -44.132 49.026  28.817  1.00 76.11  ? 106 THR A CB  1 
ATOM   818   O OG1 . THR A  1  107 ? -44.037 49.775  27.599  1.00 78.47  ? 106 THR A OG1 1 
ATOM   819   C CG2 . THR A  1  107 ? -44.679 49.925  29.922  1.00 74.99  ? 106 THR A CG2 1 
ATOM   820   N N   . ALA A  1  108 ? -43.184 46.132  29.675  1.00 77.75  ? 107 ALA A N   1 
ATOM   821   C CA  . ALA A  1  108 ? -43.330 44.926  30.492  1.00 79.88  ? 107 ALA A CA  1 
ATOM   822   C C   . ALA A  1  108 ? -42.043 44.562  31.236  1.00 80.91  ? 107 ALA A C   1 
ATOM   823   O O   . ALA A  1  108 ? -42.091 43.961  32.311  1.00 81.90  ? 107 ALA A O   1 
ATOM   824   C CB  . ALA A  1  108 ? -43.794 43.759  29.633  1.00 80.32  ? 107 ALA A CB  1 
ATOM   825   N N   . GLN A  1  109 ? -40.902 44.935  30.661  1.00 81.20  ? 108 GLN A N   1 
ATOM   826   C CA  . GLN A  1  109 ? -39.597 44.639  31.249  1.00 82.32  ? 108 GLN A CA  1 
ATOM   827   C C   . GLN A  1  109 ? -39.184 45.624  32.341  1.00 81.10  ? 108 GLN A C   1 
ATOM   828   O O   . GLN A  1  109 ? -38.550 45.232  33.324  1.00 80.03  ? 108 GLN A O   1 
ATOM   829   C CB  . GLN A  1  109 ? -38.519 44.565  30.163  1.00 85.89  ? 108 GLN A CB  1 
ATOM   830   C CG  . GLN A  1  109 ? -38.516 43.259  29.383  1.00 90.19  ? 108 GLN A CG  1 
ATOM   831   C CD  . GLN A  1  109 ? -38.251 42.048  30.262  1.00 93.12  ? 108 GLN A CD  1 
ATOM   832   O OE1 . GLN A  1  109 ? -37.234 41.975  30.955  1.00 90.24  ? 108 GLN A OE1 1 
ATOM   833   N NE2 . GLN A  1  109 ? -39.165 41.086  30.231  1.00 93.16  ? 108 GLN A NE2 1 
ATOM   834   N N   . LEU A  1  110 ? -39.540 46.895  32.162  1.00 81.09  ? 109 LEU A N   1 
ATOM   835   C CA  . LEU A  1  110 ? -39.212 47.939  33.133  1.00 81.02  ? 109 LEU A CA  1 
ATOM   836   C C   . LEU A  1  110 ? -39.989 47.761  34.438  1.00 82.79  ? 109 LEU A C   1 
ATOM   837   O O   . LEU A  1  110 ? -39.440 47.954  35.523  1.00 81.92  ? 109 LEU A O   1 
ATOM   838   C CB  . LEU A  1  110 ? -39.466 49.333  32.544  1.00 80.57  ? 109 LEU A CB  1 
ATOM   839   C CG  . LEU A  1  110 ? -39.021 50.549  33.367  1.00 80.18  ? 109 LEU A CG  1 
ATOM   840   C CD1 . LEU A  1  110 ? -37.516 50.764  33.284  1.00 79.54  ? 109 LEU A CD1 1 
ATOM   841   C CD2 . LEU A  1  110 ? -39.759 51.797  32.916  1.00 79.11  ? 109 LEU A CD2 1 
ATOM   842   N N   . VAL A  1  111 ? -41.262 47.385  34.317  1.00 84.32  ? 110 VAL A N   1 
ATOM   843   C CA  . VAL A  1  111 ? -42.131 47.149  35.474  1.00 85.30  ? 110 VAL A CA  1 
ATOM   844   C C   . VAL A  1  111 ? -41.612 45.986  36.324  1.00 83.74  ? 110 VAL A C   1 
ATOM   845   O O   . VAL A  1  111 ? -41.655 46.044  37.555  1.00 83.87  ? 110 VAL A O   1 
ATOM   846   C CB  . VAL A  1  111 ? -43.596 46.898  35.047  1.00 86.77  ? 110 VAL A CB  1 
ATOM   847   C CG1 . VAL A  1  111 ? -44.503 46.761  36.262  1.00 87.30  ? 110 VAL A CG1 1 
ATOM   848   C CG2 . VAL A  1  111 ? -44.092 48.030  34.162  1.00 86.04  ? 110 VAL A CG2 1 
ATOM   849   N N   . GLN A  1  112 ? -41.113 44.945  35.657  1.00 82.22  ? 111 GLN A N   1 
ATOM   850   C CA  . GLN A  1  112 ? -40.495 43.800  36.329  1.00 79.98  ? 111 GLN A CA  1 
ATOM   851   C C   . GLN A  1  112 ? -39.265 44.207  37.142  1.00 77.89  ? 111 GLN A C   1 
ATOM   852   O O   . GLN A  1  112 ? -39.031 43.677  38.230  1.00 77.76  ? 111 GLN A O   1 
ATOM   853   C CB  . GLN A  1  112 ? -40.115 42.720  35.311  1.00 81.11  ? 111 GLN A CB  1 
ATOM   854   C CG  . GLN A  1  112 ? -41.290 41.897  34.804  1.00 83.15  ? 111 GLN A CG  1 
ATOM   855   C CD  . GLN A  1  112 ? -40.914 40.945  33.680  1.00 85.72  ? 111 GLN A CD  1 
ATOM   856   O OE1 . GLN A  1  112 ? -41.692 40.737  32.749  1.00 85.92  ? 111 GLN A OE1 1 
ATOM   857   N NE2 . GLN A  1  112 ? -39.721 40.362  33.761  1.00 86.35  ? 111 GLN A NE2 1 
ATOM   858   N N   . ARG A  1  113 ? -38.492 45.150  36.606  1.00 75.42  ? 112 ARG A N   1 
ATOM   859   C CA  . ARG A  1  113 ? -37.289 45.653  37.270  1.00 72.01  ? 112 ARG A CA  1 
ATOM   860   C C   . ARG A  1  113 ? -37.610 46.617  38.412  1.00 70.19  ? 112 ARG A C   1 
ATOM   861   O O   . ARG A  1  113 ? -36.915 46.629  39.429  1.00 69.91  ? 112 ARG A O   1 
ATOM   862   C CB  . ARG A  1  113 ? -36.348 46.315  36.258  1.00 71.74  ? 112 ARG A CB  1 
ATOM   863   C CG  . ARG A  1  113 ? -35.591 45.330  35.380  1.00 73.78  ? 112 ARG A CG  1 
ATOM   864   C CD  . ARG A  1  113 ? -34.798 46.038  34.293  1.00 76.00  ? 112 ARG A CD  1 
ATOM   865   N NE  . ARG A  1  113 ? -33.939 45.113  33.552  1.00 79.15  ? 112 ARG A NE  1 
ATOM   866   C CZ  . ARG A  1  113 ? -34.308 44.437  32.466  1.00 81.51  ? 112 ARG A CZ  1 
ATOM   867   N NH1 . ARG A  1  113 ? -35.532 44.569  31.970  1.00 84.43  ? 112 ARG A NH1 1 
ATOM   868   N NH2 . ARG A  1  113 ? -33.446 43.622  31.872  1.00 79.46  ? 112 ARG A NH2 1 
ATOM   869   N N   . VAL A  1  114 ? -38.661 47.416  38.239  1.00 69.72  ? 113 VAL A N   1 
ATOM   870   C CA  . VAL A  1  114 ? -39.094 48.375  39.261  1.00 69.84  ? 113 VAL A CA  1 
ATOM   871   C C   . VAL A  1  114 ? -39.753 47.660  40.444  1.00 71.39  ? 113 VAL A C   1 
ATOM   872   O O   . VAL A  1  114 ? -39.500 48.005  41.601  1.00 72.21  ? 113 VAL A O   1 
ATOM   873   C CB  . VAL A  1  114 ? -40.033 49.459  38.675  1.00 69.85  ? 113 VAL A CB  1 
ATOM   874   C CG1 . VAL A  1  114 ? -40.639 50.319  39.776  1.00 70.55  ? 113 VAL A CG1 1 
ATOM   875   C CG2 . VAL A  1  114 ? -39.283 50.339  37.686  1.00 70.03  ? 113 VAL A CG2 1 
ATOM   876   N N   . ALA A  1  115 ? -40.581 46.660  40.146  1.00 72.11  ? 114 ALA A N   1 
ATOM   877   C CA  . ALA A  1  115 ? -41.259 45.867  41.174  1.00 73.30  ? 114 ALA A CA  1 
ATOM   878   C C   . ALA A  1  115 ? -40.280 45.019  41.986  1.00 71.43  ? 114 ALA A C   1 
ATOM   879   O O   . ALA A  1  115 ? -40.547 44.690  43.144  1.00 71.66  ? 114 ALA A O   1 
ATOM   880   C CB  . ALA A  1  115 ? -42.331 44.988  40.548  1.00 75.25  ? 114 ALA A CB  1 
ATOM   881   N N   . SER A  1  116 ? -39.152 44.674  41.368  1.00 72.04  ? 115 SER A N   1 
ATOM   882   C CA  . SER A  1  116 ? -38.087 43.923  42.027  1.00 72.47  ? 115 SER A CA  1 
ATOM   883   C C   . SER A  1  116 ? -37.399 44.764  43.105  1.00 71.88  ? 115 SER A C   1 
ATOM   884   O O   . SER A  1  116 ? -36.968 44.234  44.133  1.00 72.54  ? 115 SER A O   1 
ATOM   885   C CB  . SER A  1  116 ? -37.067 43.436  40.997  1.00 73.53  ? 115 SER A CB  1 
ATOM   886   O OG  . SER A  1  116 ? -36.232 42.431  41.541  1.00 75.92  ? 115 SER A OG  1 
ATOM   887   N N   . VAL A  1  117 ? -37.302 46.071  42.857  1.00 69.81  ? 116 VAL A N   1 
ATOM   888   C CA  . VAL A  1  117 ? -36.775 47.030  43.832  1.00 68.01  ? 116 VAL A CA  1 
ATOM   889   C C   . VAL A  1  117 ? -37.772 47.213  44.980  1.00 69.38  ? 116 VAL A C   1 
ATOM   890   O O   . VAL A  1  117 ? -37.380 47.307  46.146  1.00 70.99  ? 116 VAL A O   1 
ATOM   891   C CB  . VAL A  1  117 ? -36.460 48.398  43.176  1.00 65.36  ? 116 VAL A CB  1 
ATOM   892   C CG1 . VAL A  1  117 ? -35.918 49.388  44.200  1.00 65.49  ? 116 VAL A CG1 1 
ATOM   893   C CG2 . VAL A  1  117 ? -35.467 48.234  42.034  1.00 64.88  ? 116 VAL A CG2 1 
ATOM   894   N N   . MET A  1  118 ? -39.059 47.249  44.636  1.00 69.91  ? 117 MET A N   1 
ATOM   895   C CA  . MET A  1  118 ? -40.137 47.388  45.616  1.00 70.77  ? 117 MET A CA  1 
ATOM   896   C C   . MET A  1  118 ? -40.274 46.144  46.492  1.00 70.30  ? 117 MET A C   1 
ATOM   897   O O   . MET A  1  118 ? -40.718 46.231  47.640  1.00 72.31  ? 117 MET A O   1 
ATOM   898   C CB  . MET A  1  118 ? -41.465 47.691  44.916  1.00 73.49  ? 117 MET A CB  1 
ATOM   899   C CG  . MET A  1  118 ? -41.486 49.017  44.171  1.00 76.70  ? 117 MET A CG  1 
ATOM   900   S SD  . MET A  1  118 ? -43.079 49.413  43.426  1.00 80.75  ? 117 MET A SD  1 
ATOM   901   C CE  . MET A  1  118 ? -44.035 49.868  44.871  1.00 82.45  ? 117 MET A CE  1 
ATOM   902   N N   . GLN A  1  119 ? -39.890 44.994  45.941  1.00 69.11  ? 118 GLN A N   1 
ATOM   903   C CA  . GLN A  1  119 ? -39.896 43.728  46.669  1.00 69.11  ? 118 GLN A CA  1 
ATOM   904   C C   . GLN A  1  119 ? -38.785 43.700  47.717  1.00 69.62  ? 118 GLN A C   1 
ATOM   905   O O   . GLN A  1  119 ? -38.957 43.125  48.793  1.00 70.77  ? 118 GLN A O   1 
ATOM   906   C CB  . GLN A  1  119 ? -39.751 42.553  45.694  1.00 70.72  ? 118 GLN A CB  1 
ATOM   907   C CG  . GLN A  1  119 ? -40.081 41.182  46.277  1.00 72.43  ? 118 GLN A CG  1 
ATOM   908   C CD  . GLN A  1  119 ? -38.923 40.554  47.035  1.00 72.43  ? 118 GLN A CD  1 
ATOM   909   O OE1 . GLN A  1  119 ? -37.755 40.814  46.744  1.00 72.06  ? 118 GLN A OE1 1 
ATOM   910   N NE2 . GLN A  1  119 ? -39.245 39.718  48.015  1.00 74.05  ? 118 GLN A NE2 1 
ATOM   911   N N   . GLU A  1  120 ? -37.653 44.323  47.393  1.00 69.69  ? 119 GLU A N   1 
ATOM   912   C CA  . GLU A  1  120 ? -36.493 44.368  48.287  1.00 71.40  ? 119 GLU A CA  1 
ATOM   913   C C   . GLU A  1  120 ? -36.808 45.019  49.632  1.00 72.71  ? 119 GLU A C   1 
ATOM   914   O O   . GLU A  1  120 ? -36.429 44.497  50.679  1.00 73.64  ? 119 GLU A O   1 
ATOM   915   C CB  . GLU A  1  120 ? -35.321 45.094  47.623  1.00 72.62  ? 119 GLU A CB  1 
ATOM   916   C CG  . GLU A  1  120 ? -34.551 44.261  46.612  1.00 76.12  ? 119 GLU A CG  1 
ATOM   917   C CD  . GLU A  1  120 ? -33.307 44.963  46.098  1.00 80.24  ? 119 GLU A CD  1 
ATOM   918   O OE1 . GLU A  1  120 ? -33.057 44.903  44.876  1.00 83.63  ? 119 GLU A OE1 1 
ATOM   919   O OE2 . GLU A  1  120 ? -32.580 45.579  46.909  1.00 82.17  ? 119 GLU A OE2 1 
ATOM   920   N N   . TYR A  1  121 ? -37.515 46.145  49.593  1.00 73.57  ? 120 TYR A N   1 
ATOM   921   C CA  . TYR A  1  121 ? -37.815 46.928  50.793  1.00 75.87  ? 120 TYR A CA  1 
ATOM   922   C C   . TYR A  1  121 ? -38.854 46.279  51.715  1.00 77.44  ? 120 TYR A C   1 
ATOM   923   O O   . TYR A  1  121 ? -39.215 46.841  52.754  1.00 77.16  ? 120 TYR A O   1 
ATOM   924   C CB  . TYR A  1  121 ? -38.236 48.350  50.407  1.00 76.82  ? 120 TYR A CB  1 
ATOM   925   C CG  . TYR A  1  121 ? -37.080 49.239  49.993  1.00 77.14  ? 120 TYR A CG  1 
ATOM   926   C CD1 . TYR A  1  121 ? -36.567 49.194  48.696  1.00 76.23  ? 120 TYR A CD1 1 
ATOM   927   C CD2 . TYR A  1  121 ? -36.501 50.125  50.900  1.00 76.06  ? 120 TYR A CD2 1 
ATOM   928   C CE1 . TYR A  1  121 ? -35.511 50.007  48.315  1.00 75.50  ? 120 TYR A CE1 1 
ATOM   929   C CE2 . TYR A  1  121 ? -35.443 50.941  50.528  1.00 74.86  ? 120 TYR A CE2 1 
ATOM   930   C CZ  . TYR A  1  121 ? -34.953 50.878  49.236  1.00 75.11  ? 120 TYR A CZ  1 
ATOM   931   O OH  . TYR A  1  121 ? -33.905 51.687  48.863  1.00 76.76  ? 120 TYR A OH  1 
ATOM   932   N N   . THR A  1  122 ? -39.321 45.094  51.330  1.00 77.56  ? 121 THR A N   1 
ATOM   933   C CA  . THR A  1  122 ? -40.223 44.298  52.160  1.00 78.62  ? 121 THR A CA  1 
ATOM   934   C C   . THR A  1  122 ? -39.483 43.119  52.800  1.00 78.73  ? 121 THR A C   1 
ATOM   935   O O   . THR A  1  122 ? -40.067 42.353  53.570  1.00 78.24  ? 121 THR A O   1 
ATOM   936   C CB  . THR A  1  122 ? -41.431 43.771  51.353  1.00 77.68  ? 121 THR A CB  1 
ATOM   937   O OG1 . THR A  1  122 ? -40.983 42.844  50.357  1.00 74.46  ? 121 THR A OG1 1 
ATOM   938   C CG2 . THR A  1  122 ? -42.180 44.914  50.676  1.00 77.07  ? 121 THR A CG2 1 
ATOM   939   N N   . GLN A  1  123 ? -38.195 42.986  52.481  1.00 77.89  ? 122 GLN A N   1 
ATOM   940   C CA  . GLN A  1  123 ? -37.389 41.855  52.942  1.00 77.43  ? 122 GLN A CA  1 
ATOM   941   C C   . GLN A  1  123 ? -35.986 42.260  53.410  1.00 76.50  ? 122 GLN A C   1 
ATOM   942   O O   . GLN A  1  123 ? -35.362 41.544  54.195  1.00 77.23  ? 122 GLN A O   1 
ATOM   943   C CB  . GLN A  1  123 ? -37.297 40.791  51.841  1.00 75.96  ? 122 GLN A CB  1 
ATOM   944   C CG  . GLN A  1  123 ? -36.956 39.393  52.337  1.00 73.75  ? 122 GLN A CG  1 
ATOM   945   C CD  . GLN A  1  123 ? -36.971 38.348  51.236  1.00 72.37  ? 122 GLN A CD  1 
ATOM   946   O OE1 . GLN A  1  123 ? -36.766 38.657  50.060  1.00 72.27  ? 122 GLN A OE1 1 
ATOM   947   N NE2 . GLN A  1  123 ? -37.208 37.099  51.615  1.00 72.65  ? 122 GLN A NE2 1 
ATOM   948   N N   . SER A  1  124 ? -35.496 43.401  52.927  1.00 75.01  ? 123 SER A N   1 
ATOM   949   C CA  . SER A  1  124 ? -34.164 43.892  53.290  1.00 74.47  ? 123 SER A CA  1 
ATOM   950   C C   . SER A  1  124 ? -34.112 44.416  54.725  1.00 73.63  ? 123 SER A C   1 
ATOM   951   O O   . SER A  1  124 ? -35.145 44.742  55.316  1.00 74.11  ? 123 SER A O   1 
ATOM   952   C CB  . SER A  1  124 ? -33.691 44.969  52.309  1.00 75.33  ? 123 SER A CB  1 
ATOM   953   O OG  . SER A  1  124 ? -33.529 44.438  51.006  1.00 78.44  ? 123 SER A OG  1 
ATOM   954   N N   . GLY A  1  125 ? -32.901 44.496  55.271  1.00 73.53  ? 124 GLY A N   1 
ATOM   955   C CA  . GLY A  1  125 ? -32.693 44.861  56.669  1.00 73.46  ? 124 GLY A CA  1 
ATOM   956   C C   . GLY A  1  125 ? -32.887 46.329  56.998  1.00 72.11  ? 124 GLY A C   1 
ATOM   957   O O   . GLY A  1  125 ? -32.284 47.202  56.371  1.00 72.02  ? 124 GLY A O   1 
ATOM   958   N N   . GLY A  1  126 ? -33.738 46.589  57.989  1.00 70.92  ? 125 GLY A N   1 
ATOM   959   C CA  . GLY A  1  126 ? -33.934 47.930  58.538  1.00 70.65  ? 125 GLY A CA  1 
ATOM   960   C C   . GLY A  1  126 ? -34.641 48.930  57.642  1.00 70.40  ? 125 GLY A C   1 
ATOM   961   O O   . GLY A  1  126 ? -34.441 50.138  57.780  1.00 72.08  ? 125 GLY A O   1 
ATOM   962   N N   . VAL A  1  127 ? -35.473 48.436  56.728  1.00 70.89  ? 126 VAL A N   1 
ATOM   963   C CA  . VAL A  1  127 ? -36.224 49.307  55.820  1.00 71.64  ? 126 VAL A CA  1 
ATOM   964   C C   . VAL A  1  127 ? -37.712 48.965  55.759  1.00 74.24  ? 126 VAL A C   1 
ATOM   965   O O   . VAL A  1  127 ? -38.101 47.798  55.861  1.00 75.10  ? 126 VAL A O   1 
ATOM   966   C CB  . VAL A  1  127 ? -35.634 49.323  54.387  1.00 69.98  ? 126 VAL A CB  1 
ATOM   967   C CG1 . VAL A  1  127 ? -34.386 50.194  54.324  1.00 69.05  ? 126 VAL A CG1 1 
ATOM   968   C CG2 . VAL A  1  127 ? -35.346 47.913  53.888  1.00 70.64  ? 126 VAL A CG2 1 
ATOM   969   N N   . ARG A  1  128 ? -38.533 50.000  55.602  1.00 75.56  ? 127 ARG A N   1 
ATOM   970   C CA  . ARG A  1  128 ? -39.973 49.843  55.415  1.00 77.01  ? 127 ARG A CA  1 
ATOM   971   C C   . ARG A  1  128 ? -40.318 49.804  53.921  1.00 77.47  ? 127 ARG A C   1 
ATOM   972   O O   . ARG A  1  128 ? -39.563 50.331  53.100  1.00 77.26  ? 127 ARG A O   1 
ATOM   973   C CB  . ARG A  1  128 ? -40.737 50.978  56.114  1.00 76.40  ? 127 ARG A CB  1 
ATOM   974   C CG  . ARG A  1  128 ? -40.399 52.377  55.618  1.00 75.77  ? 127 ARG A CG  1 
ATOM   975   C CD  . ARG A  1  128 ? -41.502 53.370  55.941  1.00 76.85  ? 127 ARG A CD  1 
ATOM   976   N NE  . ARG A  1  128 ? -41.227 54.693  55.380  1.00 75.16  ? 127 ARG A NE  1 
ATOM   977   C CZ  . ARG A  1  128 ? -41.563 55.081  54.152  1.00 74.44  ? 127 ARG A CZ  1 
ATOM   978   N NH1 . ARG A  1  128 ? -42.192 54.250  53.329  1.00 75.27  ? 127 ARG A NH1 1 
ATOM   979   N NH2 . ARG A  1  128 ? -41.266 56.306  53.742  1.00 74.61  ? 127 ARG A NH2 1 
ATOM   980   N N   . PRO A  1  129 ? -41.455 49.171  53.562  1.00 77.22  ? 128 PRO A N   1 
ATOM   981   C CA  . PRO A  1  129 ? -41.922 49.170  52.170  1.00 76.82  ? 128 PRO A CA  1 
ATOM   982   C C   . PRO A  1  129 ? -42.349 50.559  51.691  1.00 78.23  ? 128 PRO A C   1 
ATOM   983   O O   . PRO A  1  129 ? -42.505 51.474  52.503  1.00 79.30  ? 128 PRO A O   1 
ATOM   984   C CB  . PRO A  1  129 ? -43.138 48.237  52.207  1.00 76.13  ? 128 PRO A CB  1 
ATOM   985   C CG  . PRO A  1  129 ? -42.952 47.402  53.426  1.00 76.71  ? 128 PRO A CG  1 
ATOM   986   C CD  . PRO A  1  129 ? -42.294 48.312  54.416  1.00 77.49  ? 128 PRO A CD  1 
ATOM   987   N N   . PHE A  1  130 ? -42.527 50.709  50.381  1.00 78.61  ? 129 PHE A N   1 
ATOM   988   C CA  . PHE A  1  130 ? -43.016 51.959  49.804  1.00 80.26  ? 129 PHE A CA  1 
ATOM   989   C C   . PHE A  1  130 ? -44.514 52.110  50.048  1.00 81.47  ? 129 PHE A C   1 
ATOM   990   O O   . PHE A  1  130 ? -45.251 51.124  50.049  1.00 84.61  ? 129 PHE A O   1 
ATOM   991   C CB  . PHE A  1  130 ? -42.737 52.013  48.300  1.00 80.68  ? 129 PHE A CB  1 
ATOM   992   C CG  . PHE A  1  130 ? -41.276 52.040  47.948  1.00 79.13  ? 129 PHE A CG  1 
ATOM   993   C CD1 . PHE A  1  130 ? -40.613 50.871  47.590  1.00 79.05  ? 129 PHE A CD1 1 
ATOM   994   C CD2 . PHE A  1  130 ? -40.563 53.235  47.961  1.00 77.99  ? 129 PHE A CD2 1 
ATOM   995   C CE1 . PHE A  1  130 ? -39.267 50.892  47.259  1.00 77.08  ? 129 PHE A CE1 1 
ATOM   996   C CE2 . PHE A  1  130 ? -39.216 53.262  47.632  1.00 75.70  ? 129 PHE A CE2 1 
ATOM   997   C CZ  . PHE A  1  130 ? -38.567 52.089  47.281  1.00 75.03  ? 129 PHE A CZ  1 
ATOM   998   N N   . GLY A  1  131 ? -44.956 53.347  50.257  1.00 79.99  ? 130 GLY A N   1 
ATOM   999   C CA  . GLY A  1  131 ? -46.380 53.646  50.390  1.00 78.50  ? 130 GLY A CA  1 
ATOM   1000  C C   . GLY A  1  131 ? -46.935 54.216  49.099  1.00 76.76  ? 130 GLY A C   1 
ATOM   1001  O O   . GLY A  1  131 ? -47.752 55.139  49.119  1.00 76.34  ? 130 GLY A O   1 
ATOM   1002  N N   . VAL A  1  132 ? -46.482 53.660  47.977  1.00 77.30  ? 131 VAL A N   1 
ATOM   1003  C CA  . VAL A  1  132 ? -46.823 54.165  46.647  1.00 77.96  ? 131 VAL A CA  1 
ATOM   1004  C C   . VAL A  1  132 ? -47.208 53.021  45.708  1.00 78.82  ? 131 VAL A C   1 
ATOM   1005  O O   . VAL A  1  132 ? -46.519 52.000  45.645  1.00 78.64  ? 131 VAL A O   1 
ATOM   1006  C CB  . VAL A  1  132 ? -45.643 54.953  46.022  1.00 77.28  ? 131 VAL A CB  1 
ATOM   1007  C CG1 . VAL A  1  132 ? -46.023 55.528  44.664  1.00 78.27  ? 131 VAL A CG1 1 
ATOM   1008  C CG2 . VAL A  1  132 ? -45.180 56.070  46.945  1.00 78.19  ? 131 VAL A CG2 1 
ATOM   1009  N N   . SER A  1  133 ? -48.317 53.197  44.993  1.00 80.76  ? 132 SER A N   1 
ATOM   1010  C CA  . SER A  1  133 ? -48.674 52.318  43.884  1.00 82.24  ? 132 SER A CA  1 
ATOM   1011  C C   . SER A  1  133 ? -48.450 53.063  42.569  1.00 82.60  ? 132 SER A C   1 
ATOM   1012  O O   . SER A  1  133 ? -48.805 54.238  42.445  1.00 84.09  ? 132 SER A O   1 
ATOM   1013  C CB  . SER A  1  133 ? -50.121 51.837  44.000  1.00 85.69  ? 132 SER A CB  1 
ATOM   1014  O OG  . SER A  1  133 ? -50.301 51.010  45.136  1.00 87.96  ? 132 SER A OG  1 
ATOM   1015  N N   . LEU A  1  134 ? -47.862 52.373  41.595  1.00 81.33  ? 133 LEU A N   1 
ATOM   1016  C CA  . LEU A  1  134 ? -47.392 53.013  40.367  1.00 81.07  ? 133 LEU A CA  1 
ATOM   1017  C C   . LEU A  1  134 ? -48.182 52.615  39.123  1.00 81.08  ? 133 LEU A C   1 
ATOM   1018  O O   . LEU A  1  134 ? -48.557 51.454  38.962  1.00 82.10  ? 133 LEU A O   1 
ATOM   1019  C CB  . LEU A  1  134 ? -45.905 52.703  40.150  1.00 80.06  ? 133 LEU A CB  1 
ATOM   1020  C CG  . LEU A  1  134 ? -44.890 53.114  41.224  1.00 78.80  ? 133 LEU A CG  1 
ATOM   1021  C CD1 . LEU A  1  134 ? -43.593 52.341  41.049  1.00 78.34  ? 133 LEU A CD1 1 
ATOM   1022  C CD2 . LEU A  1  134 ? -44.625 54.612  41.210  1.00 78.27  ? 133 LEU A CD2 1 
ATOM   1023  N N   . LEU A  1  135 ? -48.428 53.590  38.250  1.00 82.54  ? 134 LEU A N   1 
ATOM   1024  C CA  . LEU A  1  135 ? -49.012 53.338  36.932  1.00 85.81  ? 134 LEU A CA  1 
ATOM   1025  C C   . LEU A  1  135 ? -47.991 53.611  35.831  1.00 86.48  ? 134 LEU A C   1 
ATOM   1026  O O   . LEU A  1  135 ? -47.633 54.763  35.571  1.00 87.27  ? 134 LEU A O   1 
ATOM   1027  C CB  . LEU A  1  135 ? -50.273 54.181  36.710  1.00 88.64  ? 134 LEU A CB  1 
ATOM   1028  C CG  . LEU A  1  135 ? -51.631 53.623  37.144  1.00 91.79  ? 134 LEU A CG  1 
ATOM   1029  C CD1 . LEU A  1  135 ? -52.708 54.684  36.983  1.00 93.99  ? 134 LEU A CD1 1 
ATOM   1030  C CD2 . LEU A  1  135 ? -52.003 52.366  36.369  1.00 91.36  ? 134 LEU A CD2 1 
ATOM   1031  N N   . ILE A  1  136 ? -47.528 52.542  35.189  1.00 89.27  ? 135 ILE A N   1 
ATOM   1032  C CA  . ILE A  1  136 ? -46.507 52.642  34.148  1.00 91.50  ? 135 ILE A CA  1 
ATOM   1033  C C   . ILE A  1  136 ? -47.140 52.493  32.765  1.00 92.86  ? 135 ILE A C   1 
ATOM   1034  O O   . ILE A  1  136 ? -47.859 51.526  32.504  1.00 93.29  ? 135 ILE A O   1 
ATOM   1035  C CB  . ILE A  1  136 ? -45.382 51.588  34.328  1.00 93.08  ? 135 ILE A CB  1 
ATOM   1036  C CG1 . ILE A  1  136 ? -44.844 51.575  35.765  1.00 92.78  ? 135 ILE A CG1 1 
ATOM   1037  C CG2 . ILE A  1  136 ? -44.237 51.840  33.356  1.00 93.68  ? 135 ILE A CG2 1 
ATOM   1038  C CD1 . ILE A  1  136 ? -45.487 50.544  36.671  1.00 92.87  ? 135 ILE A CD1 1 
ATOM   1039  N N   . CYS A  1  137 ? -46.875 53.463  31.893  1.00 93.48  ? 136 CYS A N   1 
ATOM   1040  C CA  . CYS A  1  137 ? -47.343 53.420  30.509  1.00 94.23  ? 136 CYS A CA  1 
ATOM   1041  C C   . CYS A  1  137 ? -46.162 53.355  29.543  1.00 93.49  ? 136 CYS A C   1 
ATOM   1042  O O   . CYS A  1  137 ? -45.044 53.733  29.898  1.00 91.73  ? 136 CYS A O   1 
ATOM   1043  C CB  . CYS A  1  137 ? -48.220 54.637  30.197  1.00 95.64  ? 136 CYS A CB  1 
ATOM   1044  S SG  . CYS A  1  137 ? -47.324 56.184  29.930  1.00 97.22  ? 136 CYS A SG  1 
ATOM   1045  N N   . GLY A  1  138 ? -46.414 52.879  28.326  1.00 92.46  ? 137 GLY A N   1 
ATOM   1046  C CA  . GLY A  1  138 ? -45.364 52.770  27.316  1.00 91.49  ? 137 GLY A CA  1 
ATOM   1047  C C   . GLY A  1  138 ? -45.842 52.404  25.925  1.00 93.61  ? 137 GLY A C   1 
ATOM   1048  O O   . GLY A  1  138 ? -46.997 52.014  25.733  1.00 93.63  ? 137 GLY A O   1 
ATOM   1049  N N   . TRP A  1  139 ? -44.938 52.537  24.955  1.00 96.38  ? 138 TRP A N   1 
ATOM   1050  C CA  . TRP A  1  139 ? -45.216 52.195  23.561  1.00 99.91  ? 138 TRP A CA  1 
ATOM   1051  C C   . TRP A  1  139 ? -44.027 51.527  22.927  1.00 101.08 ? 138 TRP A C   1 
ATOM   1052  O O   . TRP A  1  139 ? -42.967 52.140  22.771  1.00 101.95 ? 138 TRP A O   1 
ATOM   1053  C CB  . TRP A  1  139 ? -45.616 53.441  22.771  1.00 103.02 ? 138 TRP A CB  1 
ATOM   1054  C CG  . TRP A  1  139 ? -46.075 53.150  21.360  1.00 106.10 ? 138 TRP A CG  1 
ATOM   1055  C CD1 . TRP A  1  139 ? -45.282 52.952  20.231  1.00 107.03 ? 138 TRP A CD1 1 
ATOM   1056  C CD2 . TRP A  1  139 ? -47.459 53.021  20.878  1.00 109.85 ? 138 TRP A CD2 1 
ATOM   1057  N NE1 . TRP A  1  139 ? -46.055 52.711  19.123  1.00 109.84 ? 138 TRP A NE1 1 
ATOM   1058  C CE2 . TRP A  1  139 ? -47.367 52.740  19.438  1.00 111.21 ? 138 TRP A CE2 1 
ATOM   1059  C CE3 . TRP A  1  139 ? -48.715 53.105  21.470  1.00 110.91 ? 138 TRP A CE3 1 
ATOM   1060  C CZ2 . TRP A  1  139 ? -48.495 52.556  18.651  1.00 113.07 ? 138 TRP A CZ2 1 
ATOM   1061  C CZ3 . TRP A  1  139 ? -49.845 52.917  20.664  1.00 112.83 ? 138 TRP A CZ3 1 
ATOM   1062  C CH2 . TRP A  1  139 ? -49.736 52.649  19.290  1.00 113.98 ? 138 TRP A CH2 1 
ATOM   1063  N N   . ASN A  1  140 ? -44.201 50.258  22.564  1.00 102.03 ? 139 ASN A N   1 
ATOM   1064  C CA  . ASN A  1  140 ? -43.165 49.471  21.886  1.00 102.88 ? 139 ASN A CA  1 
ATOM   1065  C C   . ASN A  1  140 ? -43.756 48.320  21.073  1.00 107.88 ? 139 ASN A C   1 
ATOM   1066  O O   . ASN A  1  140 ? -44.782 47.748  21.454  1.00 109.75 ? 139 ASN A O   1 
ATOM   1067  C CB  . ASN A  1  140 ? -42.116 48.956  22.882  1.00 99.45  ? 139 ASN A CB  1 
ATOM   1068  C CG  . ASN A  1  140 ? -42.735 48.309  24.106  1.00 96.42  ? 139 ASN A CG  1 
ATOM   1069  O OD1 . ASN A  1  140 ? -43.194 47.168  24.058  1.00 100.81 ? 139 ASN A OD1 1 
ATOM   1070  N ND2 . ASN A  1  140 ? -42.738 49.035  25.217  1.00 88.95  ? 139 ASN A ND2 1 
ATOM   1071  N N   . GLU A  1  141 ? -43.098 47.993  19.958  1.00 110.72 ? 140 GLU A N   1 
ATOM   1072  C CA  . GLU A  1  141 ? -43.573 46.987  18.991  1.00 114.34 ? 140 GLU A CA  1 
ATOM   1073  C C   . GLU A  1  141 ? -44.923 47.343  18.353  1.00 115.83 ? 140 GLU A C   1 
ATOM   1074  O O   . GLU A  1  141 ? -45.660 46.460  17.905  1.00 117.13 ? 140 GLU A O   1 
ATOM   1075  C CB  . GLU A  1  141 ? -43.611 45.580  19.612  1.00 115.79 ? 140 GLU A CB  1 
ATOM   1076  C CG  . GLU A  1  141 ? -42.351 44.754  19.396  1.00 119.42 ? 140 GLU A CG  1 
ATOM   1077  C CD  . GLU A  1  141 ? -41.171 45.224  20.227  1.00 120.86 ? 140 GLU A CD  1 
ATOM   1078  O OE1 . GLU A  1  141 ? -40.075 45.392  19.650  1.00 120.12 ? 140 GLU A OE1 1 
ATOM   1079  O OE2 . GLU A  1  141 ? -41.331 45.420  21.451  1.00 123.24 ? 140 GLU A OE2 1 
ATOM   1080  N N   . GLY A  1  142 ? -45.230 48.639  18.307  1.00 116.55 ? 141 GLY A N   1 
ATOM   1081  C CA  . GLY A  1  142 ? -46.496 49.129  17.762  1.00 118.24 ? 141 GLY A CA  1 
ATOM   1082  C C   . GLY A  1  142 ? -47.699 48.769  18.617  1.00 117.90 ? 141 GLY A C   1 
ATOM   1083  O O   . GLY A  1  142 ? -48.806 48.595  18.101  1.00 119.69 ? 141 GLY A O   1 
ATOM   1084  N N   . ARG A  1  143 ? -47.477 48.659  19.925  1.00 114.22 ? 142 ARG A N   1 
ATOM   1085  C CA  . ARG A  1  143 ? -48.522 48.280  20.871  1.00 111.63 ? 142 ARG A CA  1 
ATOM   1086  C C   . ARG A  1  143 ? -48.424 49.116  22.149  1.00 107.86 ? 142 ARG A C   1 
ATOM   1087  O O   . ARG A  1  143 ? -47.330 49.287  22.694  1.00 105.92 ? 142 ARG A O   1 
ATOM   1088  C CB  . ARG A  1  143 ? -48.421 46.788  21.206  1.00 113.65 ? 142 ARG A CB  1 
ATOM   1089  C CG  . ARG A  1  143 ? -49.670 46.202  21.845  1.00 118.38 ? 142 ARG A CG  1 
ATOM   1090  C CD  . ARG A  1  143 ? -49.388 44.865  22.511  1.00 121.98 ? 142 ARG A CD  1 
ATOM   1091  N NE  . ARG A  1  143 ? -50.602 44.260  23.058  1.00 128.29 ? 142 ARG A NE  1 
ATOM   1092  C CZ  . ARG A  1  143 ? -51.095 44.505  24.270  1.00 128.19 ? 142 ARG A CZ  1 
ATOM   1093  N NH1 . ARG A  1  143 ? -50.487 45.354  25.091  1.00 124.43 ? 142 ARG A NH1 1 
ATOM   1094  N NH2 . ARG A  1  143 ? -52.207 43.900  24.664  1.00 129.67 ? 142 ARG A NH2 1 
ATOM   1095  N N   . PRO A  1  144 ? -49.566 49.647  22.626  1.00 105.66 ? 143 PRO A N   1 
ATOM   1096  C CA  . PRO A  1  144 ? -49.592 50.379  23.893  1.00 104.30 ? 143 PRO A CA  1 
ATOM   1097  C C   . PRO A  1  144 ? -49.630 49.443  25.101  1.00 101.05 ? 143 PRO A C   1 
ATOM   1098  O O   . PRO A  1  144 ? -50.159 48.332  25.008  1.00 102.18 ? 143 PRO A O   1 
ATOM   1099  C CB  . PRO A  1  144 ? -50.887 51.185  23.803  1.00 107.47 ? 143 PRO A CB  1 
ATOM   1100  C CG  . PRO A  1  144 ? -51.771 50.373  22.927  1.00 109.24 ? 143 PRO A CG  1 
ATOM   1101  C CD  . PRO A  1  144 ? -50.875 49.673  21.945  1.00 108.35 ? 143 PRO A CD  1 
ATOM   1102  N N   . TYR A  1  145 ? -49.070 49.898  26.220  1.00 96.09  ? 144 TYR A N   1 
ATOM   1103  C CA  . TYR A  1  145 ? -49.008 49.099  27.444  1.00 92.98  ? 144 TYR A CA  1 
ATOM   1104  C C   . TYR A  1  145 ? -49.375 49.908  28.686  1.00 87.77  ? 144 TYR A C   1 
ATOM   1105  O O   . TYR A  1  145 ? -49.121 51.113  28.751  1.00 86.78  ? 144 TYR A O   1 
ATOM   1106  C CB  . TYR A  1  145 ? -47.612 48.495  27.620  1.00 93.57  ? 144 TYR A CB  1 
ATOM   1107  C CG  . TYR A  1  145 ? -47.294 47.355  26.678  1.00 99.27  ? 144 TYR A CG  1 
ATOM   1108  C CD1 . TYR A  1  145 ? -46.680 47.591  25.447  1.00 100.64 ? 144 TYR A CD1 1 
ATOM   1109  C CD2 . TYR A  1  145 ? -47.596 46.037  27.021  1.00 101.53 ? 144 TYR A CD2 1 
ATOM   1110  C CE1 . TYR A  1  145 ? -46.385 46.548  24.582  1.00 103.06 ? 144 TYR A CE1 1 
ATOM   1111  C CE2 . TYR A  1  145 ? -47.303 44.988  26.163  1.00 104.98 ? 144 TYR A CE2 1 
ATOM   1112  C CZ  . TYR A  1  145 ? -46.699 45.248  24.947  1.00 105.30 ? 144 TYR A CZ  1 
ATOM   1113  O OH  . TYR A  1  145 ? -46.407 44.210  24.093  1.00 107.36 ? 144 TYR A OH  1 
ATOM   1114  N N   . LEU A  1  146 ? -49.972 49.230  29.665  1.00 85.53  ? 145 LEU A N   1 
ATOM   1115  C CA  . LEU A  1  146 ? -50.310 49.837  30.952  1.00 83.04  ? 145 LEU A CA  1 
ATOM   1116  C C   . LEU A  1  146 ? -50.198 48.814  32.081  1.00 81.03  ? 145 LEU A C   1 
ATOM   1117  O O   . LEU A  1  146 ? -50.766 47.722  32.001  1.00 82.29  ? 145 LEU A O   1 
ATOM   1118  C CB  . LEU A  1  146 ? -51.710 50.463  30.910  1.00 83.67  ? 145 LEU A CB  1 
ATOM   1119  C CG  . LEU A  1  146 ? -52.097 51.381  32.074  1.00 85.21  ? 145 LEU A CG  1 
ATOM   1120  C CD1 . LEU A  1  146 ? -52.701 52.677  31.563  1.00 89.52  ? 145 LEU A CD1 1 
ATOM   1121  C CD2 . LEU A  1  146 ? -53.042 50.692  33.046  1.00 86.57  ? 145 LEU A CD2 1 
ATOM   1122  N N   . PHE A  1  147 ? -49.460 49.179  33.128  1.00 80.08  ? 146 PHE A N   1 
ATOM   1123  C CA  . PHE A  1  147 ? -49.200 48.282  34.254  1.00 80.63  ? 146 PHE A CA  1 
ATOM   1124  C C   . PHE A  1  147 ? -49.435 48.951  35.607  1.00 82.25  ? 146 PHE A C   1 
ATOM   1125  O O   . PHE A  1  147 ? -49.426 50.180  35.714  1.00 83.00  ? 146 PHE A O   1 
ATOM   1126  C CB  . PHE A  1  147 ? -47.767 47.742  34.189  1.00 78.39  ? 146 PHE A CB  1 
ATOM   1127  C CG  . PHE A  1  147 ? -47.526 46.780  33.060  1.00 77.72  ? 146 PHE A CG  1 
ATOM   1128  C CD1 . PHE A  1  147 ? -47.053 47.231  31.831  1.00 76.99  ? 146 PHE A CD1 1 
ATOM   1129  C CD2 . PHE A  1  147 ? -47.760 45.418  33.227  1.00 79.14  ? 146 PHE A CD2 1 
ATOM   1130  C CE1 . PHE A  1  147 ? -46.827 46.344  30.789  1.00 77.93  ? 146 PHE A CE1 1 
ATOM   1131  C CE2 . PHE A  1  147 ? -47.535 44.526  32.189  1.00 80.60  ? 146 PHE A CE2 1 
ATOM   1132  C CZ  . PHE A  1  147 ? -47.068 44.990  30.968  1.00 79.36  ? 146 PHE A CZ  1 
ATOM   1133  N N   . GLN A  1  148 ? -49.642 48.127  36.633  1.00 84.80  ? 147 GLN A N   1 
ATOM   1134  C CA  . GLN A  1  148 ? -49.798 48.601  38.006  1.00 86.36  ? 147 GLN A CA  1 
ATOM   1135  C C   . GLN A  1  148 ? -48.875 47.828  38.948  1.00 87.98  ? 147 GLN A C   1 
ATOM   1136  O O   . GLN A  1  148 ? -48.889 46.596  38.968  1.00 88.01  ? 147 GLN A O   1 
ATOM   1137  C CB  . GLN A  1  148 ? -51.255 48.471  38.462  1.00 87.60  ? 147 GLN A CB  1 
ATOM   1138  C CG  . GLN A  1  148 ? -51.535 49.056  39.840  1.00 86.70  ? 147 GLN A CG  1 
ATOM   1139  C CD  . GLN A  1  148 ? -52.888 48.652  40.396  1.00 88.14  ? 147 GLN A CD  1 
ATOM   1140  O OE1 . GLN A  1  148 ? -52.982 48.161  41.521  1.00 89.72  ? 147 GLN A OE1 1 
ATOM   1141  N NE2 . GLN A  1  148 ? -53.944 48.856  39.613  1.00 89.40  ? 147 GLN A NE2 1 
ATOM   1142  N N   . SER A  1  149 ? -48.077 48.561  39.723  1.00 89.10  ? 148 SER A N   1 
ATOM   1143  C CA  . SER A  1  149 ? -47.158 47.962  40.690  1.00 89.86  ? 148 SER A CA  1 
ATOM   1144  C C   . SER A  1  149 ? -47.433 48.476  42.103  1.00 89.83  ? 148 SER A C   1 
ATOM   1145  O O   . SER A  1  149 ? -47.349 49.678  42.362  1.00 88.32  ? 148 SER A O   1 
ATOM   1146  C CB  . SER A  1  149 ? -45.705 48.239  40.294  1.00 90.73  ? 148 SER A CB  1 
ATOM   1147  O OG  . SER A  1  149 ? -44.802 47.609  41.186  1.00 91.53  ? 148 SER A OG  1 
ATOM   1148  N N   . ASP A  1  150 ? -47.759 47.554  43.007  1.00 91.87  ? 149 ASP A N   1 
ATOM   1149  C CA  . ASP A  1  150 ? -48.112 47.896  44.388  1.00 94.51  ? 149 ASP A CA  1 
ATOM   1150  C C   . ASP A  1  150 ? -46.953 47.673  45.378  1.00 91.53  ? 149 ASP A C   1 
ATOM   1151  O O   . ASP A  1  150 ? -45.972 47.009  45.034  1.00 89.95  ? 149 ASP A O   1 
ATOM   1152  C CB  . ASP A  1  150 ? -49.382 47.141  44.826  1.00 99.15  ? 149 ASP A CB  1 
ATOM   1153  C CG  . ASP A  1  150 ? -49.297 45.634  44.598  1.00 104.62 ? 149 ASP A CG  1 
ATOM   1154  O OD1 . ASP A  1  150 ? -48.188 45.100  44.381  1.00 102.85 ? 149 ASP A OD1 1 
ATOM   1155  O OD2 . ASP A  1  150 ? -50.358 44.977  44.645  1.00 107.52 ? 149 ASP A OD2 1 
ATOM   1156  N N   . PRO A  1  151 ? -47.058 48.246  46.600  1.00 90.58  ? 150 PRO A N   1 
ATOM   1157  C CA  . PRO A  1  151 ? -46.076 48.106  47.682  1.00 89.36  ? 150 PRO A CA  1 
ATOM   1158  C C   . PRO A  1  151 ? -45.505 46.700  47.891  1.00 90.03  ? 150 PRO A C   1 
ATOM   1159  O O   . PRO A  1  151 ? -44.329 46.568  48.240  1.00 88.79  ? 150 PRO A O   1 
ATOM   1160  C CB  . PRO A  1  151 ? -46.874 48.525  48.914  1.00 89.08  ? 150 PRO A CB  1 
ATOM   1161  C CG  . PRO A  1  151 ? -47.808 49.563  48.398  1.00 89.99  ? 150 PRO A CG  1 
ATOM   1162  C CD  . PRO A  1  151 ? -48.094 49.237  46.955  1.00 91.16  ? 150 PRO A CD  1 
ATOM   1163  N N   . SER A  1  152 ? -46.329 45.673  47.685  1.00 90.22  ? 151 SER A N   1 
ATOM   1164  C CA  . SER A  1  152 ? -45.912 44.278  47.867  1.00 88.37  ? 151 SER A CA  1 
ATOM   1165  C C   . SER A  1  152 ? -44.810 43.861  46.893  1.00 86.23  ? 151 SER A C   1 
ATOM   1166  O O   . SER A  1  152 ? -43.912 43.100  47.254  1.00 85.91  ? 151 SER A O   1 
ATOM   1167  C CB  . SER A  1  152 ? -47.110 43.333  47.738  1.00 87.42  ? 151 SER A CB  1 
ATOM   1168  O OG  . SER A  1  152 ? -47.672 43.386  46.438  1.00 86.36  ? 151 SER A OG  1 
ATOM   1169  N N   . GLY A  1  153 ? -44.887 44.371  45.666  1.00 85.95  ? 152 GLY A N   1 
ATOM   1170  C CA  . GLY A  1  153 ? -43.935 44.028  44.613  1.00 85.31  ? 152 GLY A CA  1 
ATOM   1171  C C   . GLY A  1  153 ? -44.586 43.264  43.474  1.00 86.69  ? 152 GLY A C   1 
ATOM   1172  O O   . GLY A  1  153 ? -43.902 42.795  42.562  1.00 85.13  ? 152 GLY A O   1 
ATOM   1173  N N   . ALA A  1  154 ? -45.910 43.136  43.537  1.00 86.88  ? 153 ALA A N   1 
ATOM   1174  C CA  . ALA A  1  154 ? -46.685 42.466  42.498  1.00 86.29  ? 153 ALA A CA  1 
ATOM   1175  C C   . ALA A  1  154 ? -47.048 43.440  41.382  1.00 85.51  ? 153 ALA A C   1 
ATOM   1176  O O   . ALA A  1  154 ? -47.284 44.624  41.632  1.00 84.62  ? 153 ALA A O   1 
ATOM   1177  C CB  . ALA A  1  154 ? -47.939 41.845  43.092  1.00 85.47  ? 153 ALA A CB  1 
ATOM   1178  N N   . TYR A  1  155 ? -47.089 42.935  40.151  1.00 85.62  ? 154 TYR A N   1 
ATOM   1179  C CA  . TYR A  1  155 ? -47.431 43.760  38.994  1.00 84.68  ? 154 TYR A CA  1 
ATOM   1180  C C   . TYR A  1  155 ? -48.562 43.162  38.160  1.00 84.22  ? 154 TYR A C   1 
ATOM   1181  O O   . TYR A  1  155 ? -48.570 41.961  37.875  1.00 84.14  ? 154 TYR A O   1 
ATOM   1182  C CB  . TYR A  1  155 ? -46.193 44.056  38.134  1.00 83.53  ? 154 TYR A CB  1 
ATOM   1183  C CG  . TYR A  1  155 ? -45.473 42.838  37.592  1.00 82.14  ? 154 TYR A CG  1 
ATOM   1184  C CD1 . TYR A  1  155 ? -45.722 42.377  36.300  1.00 82.04  ? 154 TYR A CD1 1 
ATOM   1185  C CD2 . TYR A  1  155 ? -44.528 42.158  38.362  1.00 81.00  ? 154 TYR A CD2 1 
ATOM   1186  C CE1 . TYR A  1  155 ? -45.063 41.268  35.795  1.00 80.80  ? 154 TYR A CE1 1 
ATOM   1187  C CE2 . TYR A  1  155 ? -43.865 41.046  37.865  1.00 79.55  ? 154 TYR A CE2 1 
ATOM   1188  C CZ  . TYR A  1  155 ? -44.136 40.606  36.582  1.00 78.58  ? 154 TYR A CZ  1 
ATOM   1189  O OH  . TYR A  1  155 ? -43.482 39.506  36.080  1.00 78.05  ? 154 TYR A OH  1 
ATOM   1190  N N   . PHE A  1  156 ? -49.517 44.011  37.784  1.00 83.34  ? 155 PHE A N   1 
ATOM   1191  C CA  . PHE A  1  156 ? -50.691 43.585  37.022  1.00 84.16  ? 155 PHE A CA  1 
ATOM   1192  C C   . PHE A  1  156 ? -50.857 44.421  35.756  1.00 88.01  ? 155 PHE A C   1 
ATOM   1193  O O   . PHE A  1  156 ? -50.632 45.633  35.770  1.00 87.36  ? 155 PHE A O   1 
ATOM   1194  C CB  . PHE A  1  156 ? -51.965 43.691  37.871  1.00 81.40  ? 155 PHE A CB  1 
ATOM   1195  C CG  . PHE A  1  156 ? -51.786 43.279  39.308  1.00 77.81  ? 155 PHE A CG  1 
ATOM   1196  C CD1 . PHE A  1  156 ? -51.628 44.240  40.303  1.00 76.23  ? 155 PHE A CD1 1 
ATOM   1197  C CD2 . PHE A  1  156 ? -51.786 41.935  39.671  1.00 78.66  ? 155 PHE A CD2 1 
ATOM   1198  C CE1 . PHE A  1  156 ? -51.466 43.870  41.629  1.00 74.82  ? 155 PHE A CE1 1 
ATOM   1199  C CE2 . PHE A  1  156 ? -51.624 41.559  40.997  1.00 77.35  ? 155 PHE A CE2 1 
ATOM   1200  C CZ  . PHE A  1  156 ? -51.464 42.528  41.977  1.00 76.18  ? 155 PHE A CZ  1 
ATOM   1201  N N   . ALA A  1  157 ? -51.255 43.765  34.668  1.00 93.24  ? 156 ALA A N   1 
ATOM   1202  C CA  . ALA A  1  157 ? -51.517 44.441  33.400  1.00 96.45  ? 156 ALA A CA  1 
ATOM   1203  C C   . ALA A  1  157 ? -52.991 44.826  33.295  1.00 101.40 ? 156 ALA A C   1 
ATOM   1204  O O   . ALA A  1  157 ? -53.874 43.973  33.415  1.00 102.41 ? 156 ALA A O   1 
ATOM   1205  C CB  . ALA A  1  157 ? -51.105 43.560  32.231  1.00 96.48  ? 156 ALA A CB  1 
ATOM   1206  N N   . TRP A  1  158 ? -53.247 46.114  33.073  1.00 105.03 ? 157 TRP A N   1 
ATOM   1207  C CA  . TRP A  1  158 ? -54.610 46.641  33.020  1.00 108.35 ? 157 TRP A CA  1 
ATOM   1208  C C   . TRP A  1  158 ? -54.936 47.286  31.705  1.00 110.53 ? 157 TRP A C   1 
ATOM   1209  O O   . TRP A  1  158 ? -54.064 47.865  31.051  1.00 109.83 ? 157 TRP A O   1 
ATOM   1210  C CB  . TRP A  1  158 ? -54.833 47.655  34.137  1.00 107.05 ? 157 TRP A CB  1 
ATOM   1211  C CG  . TRP A  1  158 ? -54.817 47.072  35.529  1.00 109.74 ? 157 TRP A CG  1 
ATOM   1212  C CD1 . TRP A  1  158 ? -53.716 46.889  36.360  1.00 107.69 ? 157 TRP A CD1 1 
ATOM   1213  C CD2 . TRP A  1  158 ? -55.967 46.587  36.309  1.00 113.14 ? 157 TRP A CD2 1 
ATOM   1214  N NE1 . TRP A  1  158 ? -54.092 46.337  37.558  1.00 109.58 ? 157 TRP A NE1 1 
ATOM   1215  C CE2 . TRP A  1  158 ? -55.425 46.130  37.594  1.00 113.90 ? 157 TRP A CE2 1 
ATOM   1216  C CE3 . TRP A  1  158 ? -57.335 46.486  36.078  1.00 116.27 ? 157 TRP A CE3 1 
ATOM   1217  C CZ2 . TRP A  1  158 ? -56.237 45.600  38.588  1.00 117.10 ? 157 TRP A CZ2 1 
ATOM   1218  C CZ3 . TRP A  1  158 ? -58.143 45.949  37.089  1.00 118.66 ? 157 TRP A CZ3 1 
ATOM   1219  C CH2 . TRP A  1  158 ? -57.605 45.518  38.312  1.00 119.33 ? 157 TRP A CH2 1 
ATOM   1220  N N   . LYS A  1  159 ? -56.204 47.186  31.311  1.00 111.88 ? 158 LYS A N   1 
ATOM   1221  C CA  . LYS A  1  159 ? -56.734 47.942  30.179  1.00 111.65 ? 158 LYS A CA  1 
ATOM   1222  C C   . LYS A  1  159 ? -57.094 49.348  30.653  1.00 105.46 ? 158 LYS A C   1 
ATOM   1223  O O   . LYS A  1  159 ? -56.722 50.340  30.023  1.00 104.56 ? 158 LYS A O   1 
ATOM   1224  C CB  . LYS A  1  159 ? -57.968 47.252  29.588  1.00 116.89 ? 158 LYS A CB  1 
ATOM   1225  C CG  . LYS A  1  159 ? -57.687 45.927  28.896  1.00 118.91 ? 158 LYS A CG  1 
ATOM   1226  C CD  . LYS A  1  159 ? -58.976 45.276  28.418  1.00 121.49 ? 158 LYS A CD  1 
ATOM   1227  C CE  . LYS A  1  159 ? -58.736 43.873  27.880  1.00 120.86 ? 158 LYS A CE  1 
ATOM   1228  N NZ  . LYS A  1  159 ? -57.991 43.872  26.590  1.00 119.24 ? 158 LYS A NZ  1 
ATOM   1229  N N   . ALA A  1  160 ? -57.817 49.415  31.771  1.00 100.11 ? 159 ALA A N   1 
ATOM   1230  C CA  . ALA A  1  160 ? -58.184 50.674  32.415  1.00 96.21  ? 159 ALA A CA  1 
ATOM   1231  C C   . ALA A  1  160 ? -58.396 50.453  33.910  1.00 92.51  ? 159 ALA A C   1 
ATOM   1232  O O   . ALA A  1  160 ? -59.110 49.532  34.313  1.00 96.11  ? 159 ALA A O   1 
ATOM   1233  C CB  . ALA A  1  160 ? -59.434 51.262  31.775  1.00 101.25 ? 159 ALA A CB  1 
ATOM   1234  N N   . THR A  1  161 ? -57.766 51.296  34.727  1.00 90.69  ? 160 THR A N   1 
ATOM   1235  C CA  . THR A  1  161 ? -57.858 51.180  36.186  1.00 91.83  ? 160 THR A CA  1 
ATOM   1236  C C   . THR A  1  161 ? -57.747 52.533  36.895  1.00 92.43  ? 160 THR A C   1 
ATOM   1237  O O   . THR A  1  161 ? -57.289 53.518  36.308  1.00 91.46  ? 160 THR A O   1 
ATOM   1238  C CB  . THR A  1  161 ? -56.815 50.183  36.753  1.00 92.16  ? 160 THR A CB  1 
ATOM   1239  O OG1 . THR A  1  161 ? -57.002 50.036  38.166  1.00 92.59  ? 160 THR A OG1 1 
ATOM   1240  C CG2 . THR A  1  161 ? -55.386 50.652  36.476  1.00 92.50  ? 160 THR A CG2 1 
ATOM   1241  N N   . ALA A  1  162 ? -58.177 52.568  38.155  1.00 93.18  ? 161 ALA A N   1 
ATOM   1242  C CA  . ALA A  1  162 ? -58.126 53.781  38.970  1.00 94.76  ? 161 ALA A CA  1 
ATOM   1243  C C   . ALA A  1  162 ? -57.493 53.514  40.335  1.00 96.23  ? 161 ALA A C   1 
ATOM   1244  O O   . ALA A  1  162 ? -57.656 52.432  40.903  1.00 95.24  ? 161 ALA A O   1 
ATOM   1245  C CB  . ALA A  1  162 ? -59.519 54.367  39.136  1.00 97.40  ? 161 ALA A CB  1 
ATOM   1246  N N   . MET A  1  163 ? -56.771 54.509  40.850  1.00 99.30  ? 162 MET A N   1 
ATOM   1247  C CA  . MET A  1  163 ? -56.099 54.405  42.148  1.00 102.23 ? 162 MET A CA  1 
ATOM   1248  C C   . MET A  1  163 ? -56.559 55.513  43.100  1.00 107.41 ? 162 MET A C   1 
ATOM   1249  O O   . MET A  1  163 ? -57.535 56.215  42.825  1.00 109.37 ? 162 MET A O   1 
ATOM   1250  C CB  . MET A  1  163 ? -54.573 54.473  41.990  1.00 100.64 ? 162 MET A CB  1 
ATOM   1251  C CG  . MET A  1  163 ? -54.018 54.032  40.645  1.00 99.58  ? 162 MET A CG  1 
ATOM   1252  S SD  . MET A  1  163 ? -52.226 54.218  40.587  1.00 98.58  ? 162 MET A SD  1 
ATOM   1253  C CE  . MET A  1  163 ? -51.707 52.552  40.976  1.00 92.43  ? 162 MET A CE  1 
ATOM   1254  N N   . GLY A  1  164 ? -55.847 55.656  44.218  1.00 108.91 ? 163 GLY A N   1 
ATOM   1255  C CA  . GLY A  1  164 ? -56.107 56.714  45.193  1.00 114.75 ? 163 GLY A CA  1 
ATOM   1256  C C   . GLY A  1  164 ? -57.366 56.499  46.010  1.00 121.14 ? 163 GLY A C   1 
ATOM   1257  O O   . GLY A  1  164 ? -57.761 55.360  46.271  1.00 121.31 ? 163 GLY A O   1 
ATOM   1258  N N   . LYS A  1  165 ? -57.990 57.603  46.417  1.00 130.40 ? 164 LYS A N   1 
ATOM   1259  C CA  . LYS A  1  165 ? -59.242 57.563  47.170  1.00 137.31 ? 164 LYS A CA  1 
ATOM   1260  C C   . LYS A  1  165 ? -60.410 57.157  46.278  1.00 144.95 ? 164 LYS A C   1 
ATOM   1261  O O   . LYS A  1  165 ? -60.520 57.616  45.137  1.00 147.63 ? 164 LYS A O   1 
ATOM   1262  C CB  . LYS A  1  165 ? -59.529 58.916  47.826  1.00 139.71 ? 164 LYS A CB  1 
ATOM   1263  C CG  . LYS A  1  165 ? -58.795 59.143  49.138  1.00 136.33 ? 164 LYS A CG  1 
ATOM   1264  C CD  . LYS A  1  165 ? -59.191 60.471  49.762  1.00 143.33 ? 164 LYS A CD  1 
ATOM   1265  C CE  . LYS A  1  165 ? -58.519 60.673  51.110  1.00 144.63 ? 164 LYS A CE  1 
ATOM   1266  N NZ  . LYS A  1  165 ? -58.926 61.958  51.742  1.00 147.14 ? 164 LYS A NZ  1 
ATOM   1267  N N   . ASN A  1  166 ? -61.274 56.297  46.818  1.00 150.86 ? 165 ASN A N   1 
ATOM   1268  C CA  . ASN A  1  166 ? -62.436 55.756  46.104  1.00 156.31 ? 165 ASN A CA  1 
ATOM   1269  C C   . ASN A  1  166 ? -62.077 55.067  44.782  1.00 153.20 ? 165 ASN A C   1 
ATOM   1270  O O   . ASN A  1  166 ? -62.644 55.378  43.730  1.00 155.74 ? 165 ASN A O   1 
ATOM   1271  C CB  . ASN A  1  166 ? -63.515 56.833  45.902  1.00 160.46 ? 165 ASN A CB  1 
ATOM   1272  C CG  . ASN A  1  166 ? -64.100 57.333  47.211  1.00 165.62 ? 165 ASN A CG  1 
ATOM   1273  O OD1 . ASN A  1  166 ? -64.454 56.547  48.092  1.00 168.06 ? 165 ASN A OD1 1 
ATOM   1274  N ND2 . ASN A  1  166 ? -64.212 58.649  47.340  1.00 167.57 ? 165 ASN A ND2 1 
ATOM   1275  N N   . TYR A  1  167 ? -61.128 54.135  44.851  1.00 147.28 ? 166 TYR A N   1 
ATOM   1276  C CA  . TYR A  1  167 ? -60.710 53.356  43.684  1.00 140.21 ? 166 TYR A CA  1 
ATOM   1277  C C   . TYR A  1  167 ? -61.757 52.313  43.294  1.00 139.59 ? 166 TYR A C   1 
ATOM   1278  O O   . TYR A  1  167 ? -61.821 51.890  42.138  1.00 138.80 ? 166 TYR A O   1 
ATOM   1279  C CB  . TYR A  1  167 ? -59.339 52.702  43.914  1.00 131.90 ? 166 TYR A CB  1 
ATOM   1280  C CG  . TYR A  1  167 ? -59.260 51.773  45.110  1.00 126.40 ? 166 TYR A CG  1 
ATOM   1281  C CD1 . TYR A  1  167 ? -59.485 50.403  44.970  1.00 124.07 ? 166 TYR A CD1 1 
ATOM   1282  C CD2 . TYR A  1  167 ? -58.944 52.261  46.378  1.00 123.68 ? 166 TYR A CD2 1 
ATOM   1283  C CE1 . TYR A  1  167 ? -59.409 49.550  46.060  1.00 119.89 ? 166 TYR A CE1 1 
ATOM   1284  C CE2 . TYR A  1  167 ? -58.866 51.416  47.473  1.00 118.80 ? 166 TYR A CE2 1 
ATOM   1285  C CZ  . TYR A  1  167 ? -59.098 50.063  47.309  1.00 117.73 ? 166 TYR A CZ  1 
ATOM   1286  O OH  . TYR A  1  167 ? -59.021 49.220  48.393  1.00 116.55 ? 166 TYR A OH  1 
ATOM   1287  N N   . VAL A  1  168 ? -62.570 51.907  44.269  1.00 138.86 ? 167 VAL A N   1 
ATOM   1288  C CA  . VAL A  1  168 ? -63.683 50.982  44.036  1.00 136.79 ? 167 VAL A CA  1 
ATOM   1289  C C   . VAL A  1  168 ? -64.812 51.635  43.237  1.00 136.42 ? 167 VAL A C   1 
ATOM   1290  O O   . VAL A  1  168 ? -65.502 50.964  42.468  1.00 136.49 ? 167 VAL A O   1 
ATOM   1291  C CB  . VAL A  1  168 ? -64.238 50.386  45.353  1.00 136.24 ? 167 VAL A CB  1 
ATOM   1292  C CG1 . VAL A  1  168 ? -63.390 49.207  45.806  1.00 135.71 ? 167 VAL A CG1 1 
ATOM   1293  C CG2 . VAL A  1  168 ? -64.331 51.441  46.448  1.00 135.98 ? 167 VAL A CG2 1 
ATOM   1294  N N   . ASN A  1  169 ? -64.991 52.941  43.425  1.00 135.05 ? 168 ASN A N   1 
ATOM   1295  C CA  . ASN A  1  169 ? -65.975 53.714  42.669  1.00 134.98 ? 168 ASN A CA  1 
ATOM   1296  C C   . ASN A  1  169 ? -65.477 54.082  41.273  1.00 132.81 ? 168 ASN A C   1 
ATOM   1297  O O   . ASN A  1  169 ? -66.276 54.284  40.355  1.00 132.43 ? 168 ASN A O   1 
ATOM   1298  C CB  . ASN A  1  169 ? -66.378 54.976  43.437  1.00 135.29 ? 168 ASN A CB  1 
ATOM   1299  C CG  . ASN A  1  169 ? -67.193 54.672  44.682  1.00 136.48 ? 168 ASN A CG  1 
ATOM   1300  O OD1 . ASN A  1  169 ? -66.865 53.768  45.453  1.00 135.10 ? 168 ASN A OD1 1 
ATOM   1301  N ND2 . ASN A  1  169 ? -68.259 55.436  44.889  1.00 138.02 ? 168 ASN A ND2 1 
ATOM   1302  N N   . GLY A  1  170 ? -64.157 54.166  41.126  1.00 130.66 ? 169 GLY A N   1 
ATOM   1303  C CA  . GLY A  1  170 ? -63.527 54.491  39.849  1.00 128.12 ? 169 GLY A CA  1 
ATOM   1304  C C   . GLY A  1  170 ? -63.605 53.357  38.845  1.00 127.28 ? 169 GLY A C   1 
ATOM   1305  O O   . GLY A  1  170 ? -64.016 53.564  37.702  1.00 125.90 ? 169 GLY A O   1 
ATOM   1306  N N   . LYS A  1  171 ? -63.217 52.159  39.280  1.00 126.93 ? 170 LYS A N   1 
ATOM   1307  C CA  . LYS A  1  171 ? -63.212 50.969  38.422  1.00 126.93 ? 170 LYS A CA  1 
ATOM   1308  C C   . LYS A  1  171 ? -64.613 50.531  37.992  1.00 132.47 ? 170 LYS A C   1 
ATOM   1309  O O   . LYS A  1  171 ? -64.792 50.024  36.883  1.00 135.58 ? 170 LYS A O   1 
ATOM   1310  C CB  . LYS A  1  171 ? -62.475 49.809  39.099  1.00 121.91 ? 170 LYS A CB  1 
ATOM   1311  C CG  . LYS A  1  171 ? -60.962 49.970  39.141  1.00 114.55 ? 170 LYS A CG  1 
ATOM   1312  C CD  . LYS A  1  171 ? -60.252 48.637  39.338  1.00 110.34 ? 170 LYS A CD  1 
ATOM   1313  C CE  . LYS A  1  171 ? -60.272 48.176  40.789  1.00 105.30 ? 170 LYS A CE  1 
ATOM   1314  N NZ  . LYS A  1  171 ? -59.365 48.986  41.647  1.00 107.05 ? 170 LYS A NZ  1 
ATOM   1315  N N   . THR A  1  172 ? -65.596 50.724  38.872  1.00 134.44 ? 171 THR A N   1 
ATOM   1316  C CA  . THR A  1  172 ? -66.996 50.416  38.560  1.00 137.43 ? 171 THR A CA  1 
ATOM   1317  C C   . THR A  1  172 ? -67.569 51.390  37.532  1.00 137.05 ? 171 THR A C   1 
ATOM   1318  O O   . THR A  1  172 ? -68.440 51.024  36.739  1.00 138.43 ? 171 THR A O   1 
ATOM   1319  C CB  . THR A  1  172 ? -67.890 50.407  39.819  1.00 137.43 ? 171 THR A CB  1 
ATOM   1320  O OG1 . THR A  1  172 ? -67.623 51.570  40.613  1.00 136.14 ? 171 THR A OG1 1 
ATOM   1321  C CG2 . THR A  1  172 ? -67.639 49.154  40.650  1.00 137.18 ? 171 THR A CG2 1 
ATOM   1322  N N   . PHE A  1  173 ? -67.076 52.626  37.557  1.00 134.33 ? 172 PHE A N   1 
ATOM   1323  C CA  . PHE A  1  173 ? -67.428 53.628  36.554  1.00 134.90 ? 172 PHE A CA  1 
ATOM   1324  C C   . PHE A  1  173 ? -66.654 53.381  35.259  1.00 134.47 ? 172 PHE A C   1 
ATOM   1325  O O   . PHE A  1  173 ? -67.131 53.713  34.170  1.00 136.24 ? 172 PHE A O   1 
ATOM   1326  C CB  . PHE A  1  173 ? -67.157 55.040  37.089  1.00 134.59 ? 172 PHE A CB  1 
ATOM   1327  C CG  . PHE A  1  173 ? -67.582 56.141  36.154  1.00 137.66 ? 172 PHE A CG  1 
ATOM   1328  C CD1 . PHE A  1  173 ? -68.924 56.489  36.024  1.00 143.05 ? 172 PHE A CD1 1 
ATOM   1329  C CD2 . PHE A  1  173 ? -66.637 56.840  35.411  1.00 133.54 ? 172 PHE A CD2 1 
ATOM   1330  C CE1 . PHE A  1  173 ? -69.313 57.505  35.164  1.00 143.68 ? 172 PHE A CE1 1 
ATOM   1331  C CE2 . PHE A  1  173 ? -67.019 57.858  34.550  1.00 134.86 ? 172 PHE A CE2 1 
ATOM   1332  C CZ  . PHE A  1  173 ? -68.359 58.191  34.427  1.00 139.22 ? 172 PHE A CZ  1 
ATOM   1333  N N   . LEU A  1  174 ? -65.464 52.795  35.388  1.00 132.57 ? 173 LEU A N   1 
ATOM   1334  C CA  . LEU A  1  174 ? -64.621 52.467  34.239  1.00 131.02 ? 173 LEU A CA  1 
ATOM   1335  C C   . LEU A  1  174 ? -65.177 51.307  33.416  1.00 133.97 ? 173 LEU A C   1 
ATOM   1336  O O   . LEU A  1  174 ? -65.257 51.403  32.194  1.00 136.52 ? 173 LEU A O   1 
ATOM   1337  C CB  . LEU A  1  174 ? -63.179 52.187  34.678  1.00 126.42 ? 173 LEU A CB  1 
ATOM   1338  C CG  . LEU A  1  174 ? -62.269 53.407  34.856  1.00 120.77 ? 173 LEU A CG  1 
ATOM   1339  C CD1 . LEU A  1  174 ? -61.183 53.132  35.884  1.00 113.19 ? 173 LEU A CD1 1 
ATOM   1340  C CD2 . LEU A  1  174 ? -61.658 53.844  33.532  1.00 117.91 ? 173 LEU A CD2 1 
ATOM   1341  N N   . GLU A  1  175 ? -65.572 50.224  34.084  1.00 136.35 ? 174 GLU A N   1 
ATOM   1342  C CA  . GLU A  1  175 ? -66.169 49.065  33.405  1.00 140.12 ? 174 GLU A CA  1 
ATOM   1343  C C   . GLU A  1  175 ? -67.521 49.399  32.764  1.00 142.36 ? 174 GLU A C   1 
ATOM   1344  O O   . GLU A  1  175 ? -68.026 48.646  31.928  1.00 143.37 ? 174 GLU A O   1 
ATOM   1345  C CB  . GLU A  1  175 ? -66.297 47.868  34.359  1.00 143.54 ? 174 GLU A CB  1 
ATOM   1346  C CG  . GLU A  1  175 ? -67.225 48.077  35.550  1.00 148.35 ? 174 GLU A CG  1 
ATOM   1347  C CD  . GLU A  1  175 ? -67.244 46.895  36.505  1.00 153.47 ? 174 GLU A CD  1 
ATOM   1348  O OE1 . GLU A  1  175 ? -67.525 47.109  37.703  1.00 152.85 ? 174 GLU A OE1 1 
ATOM   1349  O OE2 . GLU A  1  175 ? -66.978 45.754  36.068  1.00 153.24 ? 174 GLU A OE2 1 
ATOM   1350  N N   . LYS A  1  176 ? -68.086 50.536  33.161  1.00 142.83 ? 175 LYS A N   1 
ATOM   1351  C CA  . LYS A  1  176 ? -69.359 51.017  32.640  1.00 144.34 ? 175 LYS A CA  1 
ATOM   1352  C C   . LYS A  1  176 ? -69.157 51.941  31.436  1.00 143.94 ? 175 LYS A C   1 
ATOM   1353  O O   . LYS A  1  176 ? -70.048 52.075  30.597  1.00 144.80 ? 175 LYS A O   1 
ATOM   1354  C CB  . LYS A  1  176 ? -70.127 51.748  33.744  1.00 144.22 ? 175 LYS A CB  1 
ATOM   1355  C CG  . LYS A  1  176 ? -71.638 51.761  33.571  1.00 144.49 ? 175 LYS A CG  1 
ATOM   1356  C CD  . LYS A  1  176 ? -72.326 52.517  34.701  1.00 144.55 ? 175 LYS A CD  1 
ATOM   1357  C CE  . LYS A  1  176 ? -72.404 51.703  35.987  1.00 145.48 ? 175 LYS A CE  1 
ATOM   1358  N NZ  . LYS A  1  176 ? -73.352 50.558  35.884  1.00 147.98 ? 175 LYS A NZ  1 
ATOM   1359  N N   . ARG A  1  177 ? -67.984 52.567  31.355  1.00 141.94 ? 176 ARG A N   1 
ATOM   1360  C CA  . ARG A  1  177 ? -67.696 53.549  30.306  1.00 142.08 ? 176 ARG A CA  1 
ATOM   1361  C C   . ARG A  1  177 ? -66.643 53.079  29.296  1.00 142.06 ? 176 ARG A C   1 
ATOM   1362  O O   . ARG A  1  177 ? -66.768 53.351  28.099  1.00 144.13 ? 176 ARG A O   1 
ATOM   1363  C CB  . ARG A  1  177 ? -67.284 54.891  30.929  1.00 139.83 ? 176 ARG A CB  1 
ATOM   1364  C CG  . ARG A  1  177 ? -67.321 56.082  29.976  1.00 137.91 ? 176 ARG A CG  1 
ATOM   1365  C CD  . ARG A  1  177 ? -68.742 56.457  29.574  1.00 137.62 ? 176 ARG A CD  1 
ATOM   1366  N NE  . ARG A  1  177 ? -69.468 57.124  30.653  1.00 138.20 ? 176 ARG A NE  1 
ATOM   1367  C CZ  . ARG A  1  177 ? -69.654 58.439  30.740  1.00 139.34 ? 176 ARG A CZ  1 
ATOM   1368  N NH1 . ARG A  1  177 ? -69.174 59.251  29.807  1.00 141.71 ? 176 ARG A NH1 1 
ATOM   1369  N NH2 . ARG A  1  177 ? -70.328 58.944  31.763  1.00 139.35 ? 176 ARG A NH2 1 
ATOM   1370  N N   . TYR A  1  178 ? -65.615 52.384  29.780  1.00 141.64 ? 177 TYR A N   1 
ATOM   1371  C CA  . TYR A  1  178 ? -64.508 51.926  28.934  1.00 142.89 ? 177 TYR A CA  1 
ATOM   1372  C C   . TYR A  1  178 ? -64.947 50.906  27.891  1.00 145.91 ? 177 TYR A C   1 
ATOM   1373  O O   . TYR A  1  178 ? -65.687 49.966  28.191  1.00 145.53 ? 177 TYR A O   1 
ATOM   1374  C CB  . TYR A  1  178 ? -63.361 51.362  29.785  1.00 143.34 ? 177 TYR A CB  1 
ATOM   1375  C CG  . TYR A  1  178 ? -62.256 50.692  28.991  1.00 143.84 ? 177 TYR A CG  1 
ATOM   1376  C CD1 . TYR A  1  178 ? -61.321 51.448  28.283  1.00 141.65 ? 177 TYR A CD1 1 
ATOM   1377  C CD2 . TYR A  1  178 ? -62.142 49.302  28.953  1.00 142.07 ? 177 TYR A CD2 1 
ATOM   1378  C CE1 . TYR A  1  178 ? -60.310 50.839  27.557  1.00 138.09 ? 177 TYR A CE1 1 
ATOM   1379  C CE2 . TYR A  1  178 ? -61.133 48.684  28.229  1.00 137.85 ? 177 TYR A CE2 1 
ATOM   1380  C CZ  . TYR A  1  178 ? -60.221 49.457  27.534  1.00 136.45 ? 177 TYR A CZ  1 
ATOM   1381  O OH  . TYR A  1  178 ? -59.217 48.849  26.814  1.00 130.39 ? 177 TYR A OH  1 
ATOM   1382  N N   . ASN A  1  179 ? -64.476 51.111  26.665  1.00 147.71 ? 178 ASN A N   1 
ATOM   1383  C CA  . ASN A  1  179 ? -64.741 50.208  25.554  1.00 153.79 ? 178 ASN A CA  1 
ATOM   1384  C C   . ASN A  1  179 ? -63.479 49.972  24.736  1.00 153.50 ? 178 ASN A C   1 
ATOM   1385  O O   . ASN A  1  179 ? -62.635 50.861  24.615  1.00 148.65 ? 178 ASN A O   1 
ATOM   1386  C CB  . ASN A  1  179 ? -65.849 50.771  24.664  1.00 159.55 ? 178 ASN A CB  1 
ATOM   1387  C CG  . ASN A  1  179 ? -67.220 50.665  25.303  1.00 165.91 ? 178 ASN A CG  1 
ATOM   1388  O OD1 . ASN A  1  179 ? -67.790 51.662  25.745  1.00 168.62 ? 178 ASN A OD1 1 
ATOM   1389  N ND2 . ASN A  1  179 ? -67.755 49.450  25.357  1.00 167.20 ? 178 ASN A ND2 1 
ATOM   1390  N N   . GLU A  1  180 ? -63.354 48.768  24.184  1.00 153.69 ? 179 GLU A N   1 
ATOM   1391  C CA  . GLU A  1  180 ? -62.201 48.416  23.362  1.00 150.44 ? 179 GLU A CA  1 
ATOM   1392  C C   . GLU A  1  180 ? -62.252 49.151  22.024  1.00 150.91 ? 179 GLU A C   1 
ATOM   1393  O O   . GLU A  1  180 ? -63.333 49.385  21.477  1.00 153.82 ? 179 GLU A O   1 
ATOM   1394  C CB  . GLU A  1  180 ? -62.131 46.901  23.149  1.00 147.33 ? 179 GLU A CB  1 
ATOM   1395  C CG  . GLU A  1  180 ? -60.752 46.391  22.754  1.00 142.55 ? 179 GLU A CG  1 
ATOM   1396  C CD  . GLU A  1  180 ? -60.631 44.882  22.840  1.00 141.76 ? 179 GLU A CD  1 
ATOM   1397  O OE1 . GLU A  1  180 ? -60.083 44.277  21.894  1.00 142.10 ? 179 GLU A OE1 1 
ATOM   1398  O OE2 . GLU A  1  180 ? -61.079 44.297  23.850  1.00 141.84 ? 179 GLU A OE2 1 
ATOM   1399  N N   . ASP A  1  181 ? -61.072 49.512  21.519  1.00 148.08 ? 180 ASP A N   1 
ATOM   1400  C CA  . ASP A  1  181 ? -60.913 50.264  20.269  1.00 148.45 ? 180 ASP A CA  1 
ATOM   1401  C C   . ASP A  1  181 ? -61.433 51.705  20.383  1.00 146.83 ? 180 ASP A C   1 
ATOM   1402  O O   . ASP A  1  181 ? -62.253 52.156  19.578  1.00 146.09 ? 180 ASP A O   1 
ATOM   1403  C CB  . ASP A  1  181 ? -61.543 49.518  19.079  1.00 151.21 ? 180 ASP A CB  1 
ATOM   1404  C CG  . ASP A  1  181 ? -60.982 49.963  17.736  1.00 152.83 ? 180 ASP A CG  1 
ATOM   1405  O OD1 . ASP A  1  181 ? -59.906 50.598  17.705  1.00 152.89 ? 180 ASP A OD1 1 
ATOM   1406  O OD2 . ASP A  1  181 ? -61.620 49.668  16.704  1.00 154.82 ? 180 ASP A OD2 1 
ATOM   1407  N N   . LEU A  1  182 ? -60.948 52.411  21.403  1.00 141.90 ? 181 LEU A N   1 
ATOM   1408  C CA  . LEU A  1  182 ? -61.210 53.838  21.570  1.00 139.39 ? 181 LEU A CA  1 
ATOM   1409  C C   . LEU A  1  182 ? -60.068 54.655  20.976  1.00 138.76 ? 181 LEU A C   1 
ATOM   1410  O O   . LEU A  1  182 ? -58.915 54.227  21.000  1.00 136.69 ? 181 LEU A O   1 
ATOM   1411  C CB  . LEU A  1  182 ? -61.381 54.191  23.051  1.00 135.41 ? 181 LEU A CB  1 
ATOM   1412  C CG  . LEU A  1  182 ? -62.777 54.103  23.674  1.00 135.74 ? 181 LEU A CG  1 
ATOM   1413  C CD1 . LEU A  1  182 ? -62.684 54.170  25.190  1.00 135.36 ? 181 LEU A CD1 1 
ATOM   1414  C CD2 . LEU A  1  182 ? -63.681 55.206  23.146  1.00 137.45 ? 181 LEU A CD2 1 
ATOM   1415  N N   . GLU A  1  183 ? -60.393 55.829  20.443  1.00 141.02 ? 182 GLU A N   1 
ATOM   1416  C CA  . GLU A  1  183 ? -59.379 56.723  19.889  1.00 141.81 ? 182 GLU A CA  1 
ATOM   1417  C C   . GLU A  1  183 ? -58.631 57.434  21.018  1.00 137.87 ? 182 GLU A C   1 
ATOM   1418  O O   . GLU A  1  183 ? -59.151 57.558  22.130  1.00 135.34 ? 182 GLU A O   1 
ATOM   1419  C CB  . GLU A  1  183 ? -60.021 57.734  18.932  1.00 146.85 ? 182 GLU A CB  1 
ATOM   1420  C CG  . GLU A  1  183 ? -59.083 58.289  17.866  1.00 149.52 ? 182 GLU A CG  1 
ATOM   1421  C CD  . GLU A  1  183 ? -58.617 57.241  16.866  1.00 151.92 ? 182 GLU A CD  1 
ATOM   1422  O OE1 . GLU A  1  183 ? -57.428 57.276  16.485  1.00 151.11 ? 182 GLU A OE1 1 
ATOM   1423  O OE2 . GLU A  1  183 ? -59.432 56.385  16.461  1.00 151.99 ? 182 GLU A OE2 1 
ATOM   1424  N N   . LEU A  1  184 ? -57.412 57.886  20.726  1.00 136.01 ? 183 LEU A N   1 
ATOM   1425  C CA  . LEU A  1  184 ? -56.568 58.580  21.704  1.00 133.05 ? 183 LEU A CA  1 
ATOM   1426  C C   . LEU A  1  184 ? -57.243 59.829  22.279  1.00 133.15 ? 183 LEU A C   1 
ATOM   1427  O O   . LEU A  1  184 ? -57.163 60.080  23.482  1.00 130.92 ? 183 LEU A O   1 
ATOM   1428  C CB  . LEU A  1  184 ? -55.205 58.930  21.087  1.00 131.55 ? 183 LEU A CB  1 
ATOM   1429  C CG  . LEU A  1  184 ? -54.144 59.654  21.928  1.00 128.15 ? 183 LEU A CG  1 
ATOM   1430  C CD1 . LEU A  1  184 ? -53.709 58.836  23.136  1.00 123.76 ? 183 LEU A CD1 1 
ATOM   1431  C CD2 . LEU A  1  184 ? -52.943 60.012  21.067  1.00 129.53 ? 183 LEU A CD2 1 
ATOM   1432  N N   . GLU A  1  185 ? -57.908 60.595  21.414  1.00 133.54 ? 184 GLU A N   1 
ATOM   1433  C CA  . GLU A  1  185 ? -58.648 61.791  21.826  1.00 132.93 ? 184 GLU A CA  1 
ATOM   1434  C C   . GLU A  1  185 ? -59.869 61.444  22.677  1.00 132.34 ? 184 GLU A C   1 
ATOM   1435  O O   . GLU A  1  185 ? -60.235 62.193  23.585  1.00 130.99 ? 184 GLU A O   1 
ATOM   1436  C CB  . GLU A  1  185 ? -59.073 62.612  20.606  1.00 135.39 ? 184 GLU A CB  1 
ATOM   1437  C CG  . GLU A  1  185 ? -57.931 63.333  19.906  1.00 137.46 ? 184 GLU A CG  1 
ATOM   1438  C CD  . GLU A  1  185 ? -58.395 64.165  18.724  1.00 140.75 ? 184 GLU A CD  1 
ATOM   1439  O OE1 . GLU A  1  185 ? -59.083 63.620  17.835  1.00 142.67 ? 184 GLU A OE1 1 
ATOM   1440  O OE2 . GLU A  1  185 ? -58.061 65.368  18.679  1.00 141.89 ? 184 GLU A OE2 1 
ATOM   1441  N N   . ASP A  1  186 ? -60.493 60.307  22.371  1.00 134.15 ? 185 ASP A N   1 
ATOM   1442  C CA  . ASP A  1  186 ? -61.625 59.798  23.143  1.00 134.95 ? 185 ASP A CA  1 
ATOM   1443  C C   . ASP A  1  186 ? -61.172 59.221  24.483  1.00 129.25 ? 185 ASP A C   1 
ATOM   1444  O O   . ASP A  1  186 ? -61.932 59.222  25.454  1.00 126.43 ? 185 ASP A O   1 
ATOM   1445  C CB  . ASP A  1  186 ? -62.389 58.737  22.345  1.00 140.42 ? 185 ASP A CB  1 
ATOM   1446  C CG  . ASP A  1  186 ? -63.082 59.308  21.116  1.00 148.69 ? 185 ASP A CG  1 
ATOM   1447  O OD1 . ASP A  1  186 ? -63.611 60.438  21.188  1.00 149.38 ? 185 ASP A OD1 1 
ATOM   1448  O OD2 . ASP A  1  186 ? -63.106 58.616  20.077  1.00 151.29 ? 185 ASP A OD2 1 
ATOM   1449  N N   . ALA A  1  187 ? -59.934 58.732  24.522  1.00 126.36 ? 186 ALA A N   1 
ATOM   1450  C CA  . ALA A  1  187 ? -59.349 58.160  25.733  1.00 124.30 ? 186 ALA A CA  1 
ATOM   1451  C C   . ALA A  1  187 ? -59.059 59.220  26.793  1.00 124.04 ? 186 ALA A C   1 
ATOM   1452  O O   . ALA A  1  187 ? -59.193 58.957  27.988  1.00 123.63 ? 186 ALA A O   1 
ATOM   1453  C CB  . ALA A  1  187 ? -58.085 57.384  25.397  1.00 124.82 ? 186 ALA A CB  1 
ATOM   1454  N N   . ILE A  1  188 ? -58.660 60.411  26.347  1.00 123.54 ? 187 ILE A N   1 
ATOM   1455  C CA  . ILE A  1  188 ? -58.400 61.543  27.242  1.00 121.91 ? 187 ILE A CA  1 
ATOM   1456  C C   . ILE A  1  188 ? -59.708 62.060  27.849  1.00 124.03 ? 187 ILE A C   1 
ATOM   1457  O O   . ILE A  1  188 ? -59.751 62.429  29.026  1.00 123.84 ? 187 ILE A O   1 
ATOM   1458  C CB  . ILE A  1  188 ? -57.652 62.689  26.517  1.00 120.72 ? 187 ILE A CB  1 
ATOM   1459  C CG1 . ILE A  1  188 ? -56.357 62.170  25.881  1.00 121.01 ? 187 ILE A CG1 1 
ATOM   1460  C CG2 . ILE A  1  188 ? -57.342 63.833  27.477  1.00 119.17 ? 187 ILE A CG2 1 
ATOM   1461  C CD1 . ILE A  1  188 ? -55.838 63.019  24.738  1.00 121.39 ? 187 ILE A CD1 1 
ATOM   1462  N N   . HIS A  1  189 ? -60.766 62.070  27.039  1.00 125.84 ? 188 HIS A N   1 
ATOM   1463  C CA  . HIS A  1  189 ? -62.090 62.523  27.471  1.00 127.26 ? 188 HIS A CA  1 
ATOM   1464  C C   . HIS A  1  189 ? -62.697 61.662  28.542  1.00 123.11 ? 188 HIS A C   1 
ATOM   1465  O O   . HIS A  1  189 ? -63.295 62.176  29.489  1.00 123.95 ? 188 HIS A O   1 
ATOM   1466  C CB  . HIS A  1  189 ? -63.039 62.625  26.283  1.00 133.82 ? 188 HIS A CB  1 
ATOM   1467  C CG  . HIS A  1  189 ? -63.057 63.985  25.637  1.00 141.89 ? 188 HIS A CG  1 
ATOM   1468  N ND1 . HIS A  1  189 ? -63.799 65.000  26.114  1.00 146.31 ? 188 HIS A ND1 1 
ATOM   1469  C CD2 . HIS A  1  189 ? -62.390 64.477  24.518  1.00 143.96 ? 188 HIS A CD2 1 
ATOM   1470  C CE1 . HIS A  1  189 ? -63.618 66.087  25.345  1.00 149.98 ? 188 HIS A CE1 1 
ATOM   1471  N NE2 . HIS A  1  189 ? -62.755 65.766  24.367  1.00 149.12 ? 188 HIS A NE2 1 
ATOM   1472  N N   . THR A  1  190 ? -62.550 60.346  28.403  1.00 118.77 ? 189 THR A N   1 
ATOM   1473  C CA  . THR A  1  190 ? -63.081 59.409  29.394  1.00 116.66 ? 189 THR A CA  1 
ATOM   1474  C C   . THR A  1  190 ? -62.182 59.296  30.632  1.00 115.79 ? 189 THR A C   1 
ATOM   1475  O O   . THR A  1  190 ? -62.639 58.877  31.696  1.00 114.27 ? 189 THR A O   1 
ATOM   1476  C CB  . THR A  1  190 ? -63.377 58.015  28.787  1.00 116.65 ? 189 THR A CB  1 
ATOM   1477  O OG1 . THR A  1  190 ? -63.991 57.180  29.778  1.00 116.85 ? 189 THR A OG1 1 
ATOM   1478  C CG2 . THR A  1  190 ? -62.107 57.341  28.275  1.00 117.84 ? 189 THR A CG2 1 
ATOM   1479  N N   . ALA A  1  191 ? -60.915 59.679  30.486  1.00 116.53 ? 190 ALA A N   1 
ATOM   1480  C CA  . ALA A  1  191 ? -59.973 59.699  31.605  1.00 117.58 ? 190 ALA A CA  1 
ATOM   1481  C C   . ALA A  1  191 ? -60.180 60.929  32.484  1.00 118.30 ? 190 ALA A C   1 
ATOM   1482  O O   . ALA A  1  191 ? -60.052 60.855  33.707  1.00 117.41 ? 190 ALA A O   1 
ATOM   1483  C CB  . ALA A  1  191 ? -58.538 59.640  31.101  1.00 117.63 ? 190 ALA A CB  1 
ATOM   1484  N N   . ILE A  1  192 ? -60.503 62.055  31.852  1.00 120.90 ? 191 ILE A N   1 
ATOM   1485  C CA  . ILE A  1  192 ? -60.735 63.309  32.566  1.00 125.63 ? 191 ILE A CA  1 
ATOM   1486  C C   . ILE A  1  192 ? -62.120 63.329  33.231  1.00 127.03 ? 191 ILE A C   1 
ATOM   1487  O O   . ILE A  1  192 ? -62.376 64.136  34.130  1.00 128.04 ? 191 ILE A O   1 
ATOM   1488  C CB  . ILE A  1  192 ? -60.505 64.534  31.642  1.00 128.45 ? 191 ILE A CB  1 
ATOM   1489  C CG1 . ILE A  1  192 ? -59.978 65.728  32.445  1.00 130.68 ? 191 ILE A CG1 1 
ATOM   1490  C CG2 . ILE A  1  192 ? -61.758 64.881  30.842  1.00 129.52 ? 191 ILE A CG2 1 
ATOM   1491  C CD1 . ILE A  1  192 ? -59.135 66.691  31.634  1.00 132.66 ? 191 ILE A CD1 1 
ATOM   1492  N N   . LEU A  1  193 ? -62.995 62.425  32.790  1.00 125.19 ? 192 LEU A N   1 
ATOM   1493  C CA  . LEU A  1  193 ? -64.330 62.264  33.366  1.00 122.86 ? 192 LEU A CA  1 
ATOM   1494  C C   . LEU A  1  193 ? -64.343 61.327  34.572  1.00 120.91 ? 192 LEU A C   1 
ATOM   1495  O O   . LEU A  1  193 ? -65.150 61.502  35.488  1.00 121.30 ? 192 LEU A O   1 
ATOM   1496  C CB  . LEU A  1  193 ? -65.320 61.768  32.308  1.00 123.83 ? 192 LEU A CB  1 
ATOM   1497  C CG  . LEU A  1  193 ? -66.074 62.827  31.501  1.00 127.14 ? 192 LEU A CG  1 
ATOM   1498  C CD1 . LEU A  1  193 ? -66.646 62.226  30.226  1.00 128.65 ? 192 LEU A CD1 1 
ATOM   1499  C CD2 . LEU A  1  193 ? -67.176 63.462  32.338  1.00 129.88 ? 192 LEU A CD2 1 
ATOM   1500  N N   . THR A  1  194 ? -63.453 60.335  34.561  1.00 118.86 ? 193 THR A N   1 
ATOM   1501  C CA  . THR A  1  194 ? -63.314 59.392  35.675  1.00 118.60 ? 193 THR A CA  1 
ATOM   1502  C C   . THR A  1  194 ? -62.732 60.061  36.918  1.00 119.97 ? 193 THR A C   1 
ATOM   1503  O O   . THR A  1  194 ? -62.990 59.629  38.043  1.00 121.59 ? 193 THR A O   1 
ATOM   1504  C CB  . THR A  1  194 ? -62.430 58.183  35.304  1.00 117.72 ? 193 THR A CB  1 
ATOM   1505  O OG1 . THR A  1  194 ? -61.252 58.636  34.625  1.00 117.61 ? 193 THR A OG1 1 
ATOM   1506  C CG2 . THR A  1  194 ? -63.186 57.215  34.409  1.00 119.27 ? 193 THR A CG2 1 
ATOM   1507  N N   . LEU A  1  195 ? -61.948 61.115  36.702  1.00 121.75 ? 194 LEU A N   1 
ATOM   1508  C CA  . LEU A  1  195 ? -61.344 61.877  37.789  1.00 126.35 ? 194 LEU A CA  1 
ATOM   1509  C C   . LEU A  1  195 ? -62.374 62.800  38.445  1.00 129.51 ? 194 LEU A C   1 
ATOM   1510  O O   . LEU A  1  195 ? -62.244 63.147  39.621  1.00 131.28 ? 194 LEU A O   1 
ATOM   1511  C CB  . LEU A  1  195 ? -60.148 62.680  37.270  1.00 128.00 ? 194 LEU A CB  1 
ATOM   1512  C CG  . LEU A  1  195 ? -58.868 62.713  38.113  1.00 126.56 ? 194 LEU A CG  1 
ATOM   1513  C CD1 . LEU A  1  195 ? -57.669 63.022  37.230  1.00 121.04 ? 194 LEU A CD1 1 
ATOM   1514  C CD2 . LEU A  1  195 ? -58.956 63.701  39.268  1.00 127.41 ? 194 LEU A CD2 1 
ATOM   1515  N N   . LYS A  1  196 ? -63.394 63.185  37.678  1.00 130.00 ? 195 LYS A N   1 
ATOM   1516  C CA  . LYS A  1  196 ? -64.498 64.009  38.182  1.00 133.41 ? 195 LYS A CA  1 
ATOM   1517  C C   . LYS A  1  196 ? -65.421 63.262  39.146  1.00 136.63 ? 195 LYS A C   1 
ATOM   1518  O O   . LYS A  1  196 ? -66.169 63.888  39.902  1.00 138.64 ? 195 LYS A O   1 
ATOM   1519  C CB  . LYS A  1  196 ? -65.319 64.585  37.024  1.00 133.16 ? 195 LYS A CB  1 
ATOM   1520  C CG  . LYS A  1  196 ? -65.009 66.038  36.698  1.00 133.66 ? 195 LYS A CG  1 
ATOM   1521  C CD  . LYS A  1  196 ? -66.042 66.641  35.757  1.00 133.19 ? 195 LYS A CD  1 
ATOM   1522  C CE  . LYS A  1  196 ? -65.697 66.402  34.294  1.00 132.52 ? 195 LYS A CE  1 
ATOM   1523  N NZ  . LYS A  1  196 ? -64.549 67.238  33.847  1.00 132.56 ? 195 LYS A NZ  1 
ATOM   1524  N N   . GLU A  1  197 ? -65.362 61.931  39.113  1.00 139.43 ? 196 GLU A N   1 
ATOM   1525  C CA  . GLU A  1  197 ? -66.196 61.080  39.964  1.00 144.58 ? 196 GLU A CA  1 
ATOM   1526  C C   . GLU A  1  197 ? -65.916 61.320  41.450  1.00 146.69 ? 196 GLU A C   1 
ATOM   1527  O O   . GLU A  1  197 ? -66.842 61.375  42.262  1.00 148.89 ? 196 GLU A O   1 
ATOM   1528  C CB  . GLU A  1  197 ? -65.986 59.604  39.612  1.00 145.93 ? 196 GLU A CB  1 
ATOM   1529  C CG  . GLU A  1  197 ? -67.210 58.724  39.829  1.00 151.26 ? 196 GLU A CG  1 
ATOM   1530  C CD  . GLU A  1  197 ? -68.308 58.965  38.805  1.00 155.34 ? 196 GLU A CD  1 
ATOM   1531  O OE1 . GLU A  1  197 ? -67.990 59.256  37.631  1.00 152.58 ? 196 GLU A OE1 1 
ATOM   1532  O OE2 . GLU A  1  197 ? -69.496 58.858  39.175  1.00 157.13 ? 196 GLU A OE2 1 
ATOM   1533  N N   . SER A  1  198 ? -64.637 61.466  41.790  1.00 148.54 ? 197 SER A N   1 
ATOM   1534  C CA  . SER A  1  198 ? -64.217 61.794  43.150  1.00 153.36 ? 197 SER A CA  1 
ATOM   1535  C C   . SER A  1  198 ? -63.233 62.962  43.124  1.00 154.62 ? 197 SER A C   1 
ATOM   1536  O O   . SER A  1  198 ? -62.017 62.763  43.048  1.00 151.76 ? 197 SER A O   1 
ATOM   1537  C CB  . SER A  1  198 ? -63.593 60.574  43.835  1.00 154.20 ? 197 SER A CB  1 
ATOM   1538  O OG  . SER A  1  198 ? -64.529 59.518  43.954  1.00 156.28 ? 197 SER A OG  1 
ATOM   1539  N N   . PHE A  1  199 ? -63.768 64.180  43.180  1.00 156.75 ? 198 PHE A N   1 
ATOM   1540  C CA  . PHE A  1  199 ? -62.948 65.387  43.079  1.00 159.16 ? 198 PHE A CA  1 
ATOM   1541  C C   . PHE A  1  199 ? -63.413 66.505  44.014  1.00 162.51 ? 198 PHE A C   1 
ATOM   1542  O O   . PHE A  1  199 ? -62.706 66.852  44.961  1.00 162.47 ? 198 PHE A O   1 
ATOM   1543  C CB  . PHE A  1  199 ? -62.901 65.881  41.626  1.00 159.42 ? 198 PHE A CB  1 
ATOM   1544  C CG  . PHE A  1  199 ? -61.883 66.960  41.383  1.00 157.66 ? 198 PHE A CG  1 
ATOM   1545  C CD1 . PHE A  1  199 ? -60.558 66.636  41.113  1.00 154.59 ? 198 PHE A CD1 1 
ATOM   1546  C CD2 . PHE A  1  199 ? -62.248 68.302  41.420  1.00 157.74 ? 198 PHE A CD2 1 
ATOM   1547  C CE1 . PHE A  1  199 ? -59.616 67.628  40.887  1.00 152.00 ? 198 PHE A CE1 1 
ATOM   1548  C CE2 . PHE A  1  199 ? -61.311 69.298  41.199  1.00 155.80 ? 198 PHE A CE2 1 
ATOM   1549  C CZ  . PHE A  1  199 ? -59.994 68.961  40.931  1.00 153.46 ? 198 PHE A CZ  1 
ATOM   1550  N N   . GLU A  1  200 ? -64.596 67.054  43.727  1.00 164.58 ? 199 GLU A N   1 
ATOM   1551  C CA  . GLU A  1  200 ? -65.205 68.197  44.441  1.00 166.42 ? 199 GLU A CA  1 
ATOM   1552  C C   . GLU A  1  200 ? -64.402 69.510  44.388  1.00 163.96 ? 199 GLU A C   1 
ATOM   1553  O O   . GLU A  1  200 ? -63.201 69.538  44.663  1.00 161.27 ? 199 GLU A O   1 
ATOM   1554  C CB  . GLU A  1  200 ? -65.629 67.829  45.882  1.00 167.65 ? 199 GLU A CB  1 
ATOM   1555  C CG  . GLU A  1  200 ? -64.570 68.009  46.965  1.00 166.12 ? 199 GLU A CG  1 
ATOM   1556  C CD  . GLU A  1  200 ? -64.955 67.378  48.291  1.00 166.09 ? 199 GLU A CD  1 
ATOM   1557  O OE1 . GLU A  1  200 ? -66.136 67.474  48.688  1.00 167.73 ? 199 GLU A OE1 1 
ATOM   1558  O OE2 . GLU A  1  200 ? -64.069 66.789  48.943  1.00 164.43 ? 199 GLU A OE2 1 
ATOM   1559  N N   . GLY A  1  201 ? -65.085 70.590  44.016  1.00 164.64 ? 200 GLY A N   1 
ATOM   1560  C CA  . GLY A  1  201 ? -64.492 71.927  44.008  1.00 164.89 ? 200 GLY A CA  1 
ATOM   1561  C C   . GLY A  1  201 ? -63.903 72.364  42.679  1.00 166.13 ? 200 GLY A C   1 
ATOM   1562  O O   . GLY A  1  201 ? -62.752 72.798  42.628  1.00 166.07 ? 200 GLY A O   1 
ATOM   1563  N N   . GLN A  1  202 ? -64.711 72.262  41.620  1.00 167.14 ? 201 GLN A N   1 
ATOM   1564  C CA  . GLN A  1  202 ? -64.362 72.646  40.228  1.00 168.41 ? 201 GLN A CA  1 
ATOM   1565  C C   . GLN A  1  202 ? -62.966 72.266  39.697  1.00 163.93 ? 201 GLN A C   1 
ATOM   1566  O O   . GLN A  1  202 ? -61.960 72.393  40.394  1.00 162.34 ? 201 GLN A O   1 
ATOM   1567  C CB  . GLN A  1  202 ? -64.690 74.122  39.918  1.00 172.06 ? 201 GLN A CB  1 
ATOM   1568  C CG  . GLN A  1  202 ? -64.333 75.144  40.990  1.00 176.03 ? 201 GLN A CG  1 
ATOM   1569  C CD  . GLN A  1  202 ? -65.481 75.435  41.943  1.00 179.93 ? 201 GLN A CD  1 
ATOM   1570  O OE1 . GLN A  1  202 ? -66.285 74.558  42.263  1.00 179.12 ? 201 GLN A OE1 1 
ATOM   1571  N NE2 . GLN A  1  202 ? -65.557 76.677  42.405  1.00 182.50 ? 201 GLN A NE2 1 
ATOM   1572  N N   . MET A  1  203 ? -62.924 71.832  38.440  1.00 161.44 ? 202 MET A N   1 
ATOM   1573  C CA  . MET A  1  203 ? -61.664 71.502  37.777  1.00 156.19 ? 202 MET A CA  1 
ATOM   1574  C C   . MET A  1  203 ? -61.099 72.682  36.990  1.00 152.79 ? 202 MET A C   1 
ATOM   1575  O O   . MET A  1  203 ? -61.779 73.256  36.134  1.00 152.25 ? 202 MET A O   1 
ATOM   1576  C CB  . MET A  1  203 ? -61.833 70.290  36.858  1.00 153.17 ? 202 MET A CB  1 
ATOM   1577  C CG  . MET A  1  203 ? -61.759 68.949  37.568  1.00 151.07 ? 202 MET A CG  1 
ATOM   1578  S SD  . MET A  1  203 ? -61.627 67.571  36.414  1.00 144.76 ? 202 MET A SD  1 
ATOM   1579  C CE  . MET A  1  203 ? -61.378 66.208  37.547  1.00 139.45 ? 202 MET A CE  1 
ATOM   1580  N N   . THR A  1  204 ? -59.855 73.040  37.298  1.00 148.45 ? 203 THR A N   1 
ATOM   1581  C CA  . THR A  1  204 ? -59.112 74.055  36.548  1.00 147.20 ? 203 THR A CA  1 
ATOM   1582  C C   . THR A  1  204 ? -57.843 73.434  35.962  1.00 143.24 ? 203 THR A C   1 
ATOM   1583  O O   . THR A  1  204 ? -57.454 72.331  36.352  1.00 139.16 ? 203 THR A O   1 
ATOM   1584  C CB  . THR A  1  204 ? -58.744 75.276  37.420  1.00 147.37 ? 203 THR A CB  1 
ATOM   1585  O OG1 . THR A  1  204 ? -58.032 74.844  38.586  1.00 145.12 ? 203 THR A OG1 1 
ATOM   1586  C CG2 . THR A  1  204 ? -59.994 76.042  37.842  1.00 149.08 ? 203 THR A CG2 1 
ATOM   1587  N N   . GLU A  1  205 ? -57.207 74.140  35.027  1.00 144.82 ? 204 GLU A N   1 
ATOM   1588  C CA  . GLU A  1  205 ? -55.996 73.650  34.351  1.00 143.01 ? 204 GLU A CA  1 
ATOM   1589  C C   . GLU A  1  205 ? -54.828 73.363  35.305  1.00 138.82 ? 204 GLU A C   1 
ATOM   1590  O O   . GLU A  1  205 ? -53.851 72.715  34.923  1.00 136.99 ? 204 GLU A O   1 
ATOM   1591  C CB  . GLU A  1  205 ? -55.559 74.609  33.230  1.00 145.82 ? 204 GLU A CB  1 
ATOM   1592  C CG  . GLU A  1  205 ? -55.231 76.032  33.672  1.00 147.99 ? 204 GLU A CG  1 
ATOM   1593  C CD  . GLU A  1  205 ? -56.409 76.986  33.558  1.00 151.31 ? 204 GLU A CD  1 
ATOM   1594  O OE1 . GLU A  1  205 ? -56.196 78.134  33.116  1.00 151.51 ? 204 GLU A OE1 1 
ATOM   1595  O OE2 . GLU A  1  205 ? -57.546 76.598  33.903  1.00 151.44 ? 204 GLU A OE2 1 
ATOM   1596  N N   . ASP A  1  206 ? -54.946 73.847  36.539  1.00 136.87 ? 205 ASP A N   1 
ATOM   1597  C CA  . ASP A  1  206 ? -53.944 73.616  37.577  1.00 134.74 ? 205 ASP A CA  1 
ATOM   1598  C C   . ASP A  1  206 ? -54.379 72.519  38.552  1.00 130.29 ? 205 ASP A C   1 
ATOM   1599  O O   . ASP A  1  206 ? -53.555 71.977  39.291  1.00 127.78 ? 205 ASP A O   1 
ATOM   1600  C CB  . ASP A  1  206 ? -53.660 74.914  38.341  1.00 139.03 ? 205 ASP A CB  1 
ATOM   1601  C CG  . ASP A  1  206 ? -53.173 76.038  37.436  1.00 143.29 ? 205 ASP A CG  1 
ATOM   1602  O OD1 . ASP A  1  206 ? -52.424 75.764  36.474  1.00 144.28 ? 205 ASP A OD1 1 
ATOM   1603  O OD2 . ASP A  1  206 ? -53.536 77.204  37.696  1.00 144.03 ? 205 ASP A OD2 1 
ATOM   1604  N N   . ASN A  1  207 ? -55.672 72.200  38.543  1.00 130.14 ? 206 ASN A N   1 
ATOM   1605  C CA  . ASN A  1  207 ? -56.246 71.213  39.462  1.00 130.00 ? 206 ASN A CA  1 
ATOM   1606  C C   . ASN A  1  207 ? -55.929 69.757  39.124  1.00 124.60 ? 206 ASN A C   1 
ATOM   1607  O O   . ASN A  1  207 ? -55.907 68.907  40.016  1.00 125.79 ? 206 ASN A O   1 
ATOM   1608  C CB  . ASN A  1  207 ? -57.761 71.408  39.588  1.00 134.89 ? 206 ASN A CB  1 
ATOM   1609  C CG  . ASN A  1  207 ? -58.136 72.447  40.632  1.00 137.19 ? 206 ASN A CG  1 
ATOM   1610  O OD1 . ASN A  1  207 ? -57.438 72.628  41.631  1.00 136.90 ? 206 ASN A OD1 1 
ATOM   1611  N ND2 . ASN A  1  207 ? -59.252 73.130  40.407  1.00 140.88 ? 206 ASN A ND2 1 
ATOM   1612  N N   . ILE A  1  208 ? -55.706 69.467  37.843  1.00 119.44 ? 207 ILE A N   1 
ATOM   1613  C CA  . ILE A  1  208 ? -55.334 68.115  37.403  1.00 114.42 ? 207 ILE A CA  1 
ATOM   1614  C C   . ILE A  1  208 ? -54.119 68.126  36.471  1.00 111.11 ? 207 ILE A C   1 
ATOM   1615  O O   . ILE A  1  208 ? -53.786 69.157  35.880  1.00 111.56 ? 207 ILE A O   1 
ATOM   1616  C CB  . ILE A  1  208 ? -56.512 67.336  36.739  1.00 113.65 ? 207 ILE A CB  1 
ATOM   1617  C CG1 . ILE A  1  208 ? -56.824 67.847  35.315  1.00 113.84 ? 207 ILE A CG1 1 
ATOM   1618  C CG2 . ILE A  1  208 ? -57.738 67.291  37.649  1.00 117.24 ? 207 ILE A CG2 1 
ATOM   1619  C CD1 . ILE A  1  208 ? -57.560 69.170  35.227  1.00 120.14 ? 207 ILE A CD1 1 
ATOM   1620  N N   . GLU A  1  209 ? -53.465 66.973  36.352  1.00 108.56 ? 208 GLU A N   1 
ATOM   1621  C CA  . GLU A  1  209 ? -52.320 66.812  35.462  1.00 106.81 ? 208 GLU A CA  1 
ATOM   1622  C C   . GLU A  1  209 ? -52.485 65.553  34.615  1.00 102.54 ? 208 GLU A C   1 
ATOM   1623  O O   . GLU A  1  209 ? -52.773 64.474  35.140  1.00 101.39 ? 208 GLU A O   1 
ATOM   1624  C CB  . GLU A  1  209 ? -51.019 66.758  36.266  1.00 107.73 ? 208 GLU A CB  1 
ATOM   1625  C CG  . GLU A  1  209 ? -49.765 67.027  35.447  1.00 109.05 ? 208 GLU A CG  1 
ATOM   1626  C CD  . GLU A  1  209 ? -48.500 67.043  36.284  1.00 111.58 ? 208 GLU A CD  1 
ATOM   1627  O OE1 . GLU A  1  209 ? -47.650 67.926  36.051  1.00 109.94 ? 208 GLU A OE1 1 
ATOM   1628  O OE2 . GLU A  1  209 ? -48.349 66.178  37.174  1.00 109.55 ? 208 GLU A OE2 1 
ATOM   1629  N N   . VAL A  1  210 ? -52.303 65.701  33.305  1.00 101.05 ? 209 VAL A N   1 
ATOM   1630  C CA  . VAL A  1  210 ? -52.517 64.603  32.361  1.00 101.17 ? 209 VAL A CA  1 
ATOM   1631  C C   . VAL A  1  210 ? -51.352 64.448  31.372  1.00 99.63  ? 209 VAL A C   1 
ATOM   1632  O O   . VAL A  1  210 ? -50.812 65.437  30.870  1.00 101.03 ? 209 VAL A O   1 
ATOM   1633  C CB  . VAL A  1  210 ? -53.889 64.733  31.638  1.00 104.06 ? 209 VAL A CB  1 
ATOM   1634  C CG1 . VAL A  1  210 ? -54.004 66.054  30.886  1.00 105.86 ? 209 VAL A CG1 1 
ATOM   1635  C CG2 . VAL A  1  210 ? -54.150 63.547  30.716  1.00 104.28 ? 209 VAL A CG2 1 
ATOM   1636  N N   . GLY A  1  211 ? -50.966 63.198  31.118  1.00 98.23  ? 210 GLY A N   1 
ATOM   1637  C CA  . GLY A  1  211 ? -49.899 62.880  30.169  1.00 97.34  ? 210 GLY A CA  1 
ATOM   1638  C C   . GLY A  1  211 ? -50.308 61.810  29.173  1.00 97.08  ? 210 GLY A C   1 
ATOM   1639  O O   . GLY A  1  211 ? -51.011 60.859  29.524  1.00 96.68  ? 210 GLY A O   1 
ATOM   1640  N N   . ILE A  1  212 ? -49.861 61.966  27.928  1.00 98.52  ? 211 ILE A N   1 
ATOM   1641  C CA  . ILE A  1  212 ? -50.206 61.033  26.849  1.00 99.85  ? 211 ILE A CA  1 
ATOM   1642  C C   . ILE A  1  212 ? -48.996 60.261  26.316  1.00 100.12 ? 211 ILE A C   1 
ATOM   1643  O O   . ILE A  1  212 ? -47.866 60.756  26.349  1.00 98.42  ? 211 ILE A O   1 
ATOM   1644  C CB  . ILE A  1  212 ? -50.939 61.736  25.678  1.00 99.59  ? 211 ILE A CB  1 
ATOM   1645  C CG1 . ILE A  1  212 ? -50.139 62.945  25.171  1.00 98.00  ? 211 ILE A CG1 1 
ATOM   1646  C CG2 . ILE A  1  212 ? -52.348 62.138  26.099  1.00 101.41 ? 211 ILE A CG2 1 
ATOM   1647  C CD1 . ILE A  1  212 ? -50.449 63.344  23.742  1.00 99.72  ? 211 ILE A CD1 1 
ATOM   1648  N N   . CYS A  1  213 ? -49.248 59.049  25.826  1.00 101.76 ? 212 CYS A N   1 
ATOM   1649  C CA  . CYS A  1  213 ? -48.208 58.198  25.255  1.00 102.02 ? 212 CYS A CA  1 
ATOM   1650  C C   . CYS A  1  213 ? -48.708 57.500  23.992  1.00 101.41 ? 212 CYS A C   1 
ATOM   1651  O O   . CYS A  1  213 ? -49.754 56.851  24.008  1.00 102.14 ? 212 CYS A O   1 
ATOM   1652  C CB  . CYS A  1  213 ? -47.737 57.166  26.283  1.00 101.98 ? 212 CYS A CB  1 
ATOM   1653  S SG  . CYS A  1  213 ? -46.483 56.015  25.674  1.00 104.50 ? 212 CYS A SG  1 
ATOM   1654  N N   . ASN A  1  214 ? -47.956 57.643  22.903  1.00 102.23 ? 213 ASN A N   1 
ATOM   1655  C CA  . ASN A  1  214 ? -48.305 57.027  21.621  1.00 103.55 ? 213 ASN A CA  1 
ATOM   1656  C C   . ASN A  1  214 ? -47.068 56.656  20.796  1.00 105.55 ? 213 ASN A C   1 
ATOM   1657  O O   . ASN A  1  214 ? -45.970 56.528  21.343  1.00 105.54 ? 213 ASN A O   1 
ATOM   1658  C CB  . ASN A  1  214 ? -49.253 57.935  20.821  1.00 105.11 ? 213 ASN A CB  1 
ATOM   1659  C CG  . ASN A  1  214 ? -48.645 59.290  20.500  1.00 106.58 ? 213 ASN A CG  1 
ATOM   1660  O OD1 . ASN A  1  214 ? -48.011 59.923  21.346  1.00 105.05 ? 213 ASN A OD1 1 
ATOM   1661  N ND2 . ASN A  1  214 ? -48.847 59.747  19.270  1.00 108.13 ? 213 ASN A ND2 1 
ATOM   1662  N N   . GLU A  1  215 ? -47.254 56.484  19.487  1.00 109.18 ? 214 GLU A N   1 
ATOM   1663  C CA  . GLU A  1  215 ? -46.158 56.146  18.570  1.00 112.30 ? 214 GLU A CA  1 
ATOM   1664  C C   . GLU A  1  215 ? -45.110 57.256  18.453  1.00 111.48 ? 214 GLU A C   1 
ATOM   1665  O O   . GLU A  1  215 ? -43.945 56.987  18.149  1.00 111.76 ? 214 GLU A O   1 
ATOM   1666  C CB  . GLU A  1  215 ? -46.687 55.752  17.182  1.00 119.72 ? 214 GLU A CB  1 
ATOM   1667  C CG  . GLU A  1  215 ? -47.613 56.765  16.517  1.00 127.09 ? 214 GLU A CG  1 
ATOM   1668  C CD  . GLU A  1  215 ? -49.081 56.522  16.825  1.00 133.67 ? 214 GLU A CD  1 
ATOM   1669  O OE1 . GLU A  1  215 ? -49.573 55.403  16.562  1.00 135.73 ? 214 GLU A OE1 1 
ATOM   1670  O OE2 . GLU A  1  215 ? -49.748 57.456  17.317  1.00 137.82 ? 214 GLU A OE2 1 
ATOM   1671  N N   . ALA A  1  216 ? -45.532 58.496  18.698  1.00 112.14 ? 215 ALA A N   1 
ATOM   1672  C CA  . ALA A  1  216 ? -44.627 59.644  18.708  1.00 111.58 ? 215 ALA A CA  1 
ATOM   1673  C C   . ALA A  1  216 ? -43.778 59.679  19.979  1.00 110.48 ? 215 ALA A C   1 
ATOM   1674  O O   . ALA A  1  216 ? -42.673 60.227  19.980  1.00 111.10 ? 215 ALA A O   1 
ATOM   1675  C CB  . ALA A  1  216 ? -45.411 60.939  18.556  1.00 112.23 ? 215 ALA A CB  1 
ATOM   1676  N N   . GLY A  1  217 ? -44.302 59.090  21.053  1.00 108.16 ? 216 GLY A N   1 
ATOM   1677  C CA  . GLY A  1  217 ? -43.604 59.027  22.336  1.00 104.22 ? 216 GLY A CA  1 
ATOM   1678  C C   . GLY A  1  217 ? -44.408 59.617  23.479  1.00 102.41 ? 216 GLY A C   1 
ATOM   1679  O O   . GLY A  1  217 ? -45.451 60.240  23.260  1.00 100.90 ? 216 GLY A O   1 
ATOM   1680  N N   . PHE A  1  218 ? -43.921 59.418  24.702  1.00 100.97 ? 217 PHE A N   1 
ATOM   1681  C CA  . PHE A  1  218 ? -44.574 59.957  25.894  1.00 99.11  ? 217 PHE A CA  1 
ATOM   1682  C C   . PHE A  1  218 ? -44.230 61.428  26.109  1.00 99.07  ? 217 PHE A C   1 
ATOM   1683  O O   . PHE A  1  218 ? -43.064 61.824  26.030  1.00 98.74  ? 217 PHE A O   1 
ATOM   1684  C CB  . PHE A  1  218 ? -44.209 59.139  27.142  1.00 96.26  ? 217 PHE A CB  1 
ATOM   1685  C CG  . PHE A  1  218 ? -44.805 59.677  28.418  1.00 94.85  ? 217 PHE A CG  1 
ATOM   1686  C CD1 . PHE A  1  218 ? -46.114 59.369  28.774  1.00 95.03  ? 217 PHE A CD1 1 
ATOM   1687  C CD2 . PHE A  1  218 ? -44.058 60.495  29.262  1.00 93.96  ? 217 PHE A CD2 1 
ATOM   1688  C CE1 . PHE A  1  218 ? -46.667 59.865  29.946  1.00 93.20  ? 217 PHE A CE1 1 
ATOM   1689  C CE2 . PHE A  1  218 ? -44.607 60.996  30.434  1.00 92.33  ? 217 PHE A CE2 1 
ATOM   1690  C CZ  . PHE A  1  218 ? -45.913 60.679  30.777  1.00 91.87  ? 217 PHE A CZ  1 
ATOM   1691  N N   . ARG A  1  219 ? -45.260 62.226  26.381  1.00 100.37 ? 218 ARG A N   1 
ATOM   1692  C CA  . ARG A  1  219 ? -45.096 63.638  26.723  1.00 100.60 ? 218 ARG A CA  1 
ATOM   1693  C C   . ARG A  1  219 ? -46.214 64.113  27.651  1.00 101.40 ? 218 ARG A C   1 
ATOM   1694  O O   . ARG A  1  219 ? -47.338 63.607  27.598  1.00 101.15 ? 218 ARG A O   1 
ATOM   1695  C CB  . ARG A  1  219 ? -45.022 64.514  25.462  1.00 102.04 ? 218 ARG A CB  1 
ATOM   1696  C CG  . ARG A  1  219 ? -46.284 64.538  24.610  1.00 103.44 ? 218 ARG A CG  1 
ATOM   1697  C CD  . ARG A  1  219 ? -46.189 65.586  23.513  1.00 105.39 ? 218 ARG A CD  1 
ATOM   1698  N NE  . ARG A  1  219 ? -47.471 65.800  22.844  1.00 108.49 ? 218 ARG A NE  1 
ATOM   1699  C CZ  . ARG A  1  219 ? -48.387 66.688  23.225  1.00 111.26 ? 218 ARG A CZ  1 
ATOM   1700  N NH1 . ARG A  1  219 ? -48.178 67.462  24.283  1.00 112.17 ? 218 ARG A NH1 1 
ATOM   1701  N NH2 . ARG A  1  219 ? -49.519 66.801  22.545  1.00 111.82 ? 218 ARG A NH2 1 
ATOM   1702  N N   . ARG A  1  220 ? -45.891 65.079  28.506  1.00 102.70 ? 219 ARG A N   1 
ATOM   1703  C CA  . ARG A  1  220 ? -46.874 65.685  29.396  1.00 105.99 ? 219 ARG A CA  1 
ATOM   1704  C C   . ARG A  1  220 ? -47.617 66.791  28.654  1.00 109.22 ? 219 ARG A C   1 
ATOM   1705  O O   . ARG A  1  220 ? -46.995 67.633  27.999  1.00 110.92 ? 219 ARG A O   1 
ATOM   1706  C CB  . ARG A  1  220 ? -46.190 66.248  30.643  1.00 105.80 ? 219 ARG A CB  1 
ATOM   1707  C CG  . ARG A  1  220 ? -47.131 66.519  31.808  1.00 107.29 ? 219 ARG A CG  1 
ATOM   1708  C CD  . ARG A  1  220 ? -46.480 67.382  32.881  1.00 108.55 ? 219 ARG A CD  1 
ATOM   1709  N NE  . ARG A  1  220 ? -45.404 66.691  33.591  1.00 108.74 ? 219 ARG A NE  1 
ATOM   1710  C CZ  . ARG A  1  220 ? -44.104 66.906  33.394  1.00 109.56 ? 219 ARG A CZ  1 
ATOM   1711  N NH1 . ARG A  1  220 ? -43.695 67.801  32.503  1.00 110.15 ? 219 ARG A NH1 1 
ATOM   1712  N NH2 . ARG A  1  220 ? -43.208 66.223  34.093  1.00 107.89 ? 219 ARG A NH2 1 
ATOM   1713  N N   . LEU A  1  221 ? -48.944 66.781  28.754  1.00 111.14 ? 220 LEU A N   1 
ATOM   1714  C CA  . LEU A  1  221 ? -49.777 67.788  28.099  1.00 113.23 ? 220 LEU A CA  1 
ATOM   1715  C C   . LEU A  1  221 ? -49.677 69.137  28.806  1.00 116.24 ? 220 LEU A C   1 
ATOM   1716  O O   . LEU A  1  221 ? -49.821 69.221  30.029  1.00 116.91 ? 220 LEU A O   1 
ATOM   1717  C CB  . LEU A  1  221 ? -51.239 67.330  28.018  1.00 111.45 ? 220 LEU A CB  1 
ATOM   1718  C CG  . LEU A  1  221 ? -51.596 66.183  27.062  1.00 110.12 ? 220 LEU A CG  1 
ATOM   1719  C CD1 . LEU A  1  221 ? -53.003 65.678  27.339  1.00 109.00 ? 220 LEU A CD1 1 
ATOM   1720  C CD2 . LEU A  1  221 ? -51.458 66.592  25.601  1.00 110.68 ? 220 LEU A CD2 1 
ATOM   1721  N N   . THR A  1  222 ? -49.421 70.182  28.021  1.00 118.46 ? 221 THR A N   1 
ATOM   1722  C CA  . THR A  1  222 ? -49.289 71.552  28.525  1.00 120.23 ? 221 THR A CA  1 
ATOM   1723  C C   . THR A  1  222 ? -50.612 72.069  29.100  1.00 122.12 ? 221 THR A C   1 
ATOM   1724  O O   . THR A  1  222 ? -51.680 71.646  28.652  1.00 125.17 ? 221 THR A O   1 
ATOM   1725  C CB  . THR A  1  222 ? -48.802 72.516  27.420  1.00 120.35 ? 221 THR A CB  1 
ATOM   1726  O OG1 . THR A  1  222 ? -49.638 72.390  26.262  1.00 119.44 ? 221 THR A OG1 1 
ATOM   1727  C CG2 . THR A  1  222 ? -47.356 72.217  27.036  1.00 119.69 ? 221 THR A CG2 1 
ATOM   1728  N N   . PRO A  1  223 ? -50.547 72.983  30.095  1.00 122.66 ? 222 PRO A N   1 
ATOM   1729  C CA  . PRO A  1  223 ? -51.753 73.564  30.705  1.00 125.24 ? 222 PRO A CA  1 
ATOM   1730  C C   . PRO A  1  223 ? -52.714 74.212  29.703  1.00 127.80 ? 222 PRO A C   1 
ATOM   1731  O O   . PRO A  1  223 ? -53.898 74.371  30.006  1.00 129.71 ? 222 PRO A O   1 
ATOM   1732  C CB  . PRO A  1  223 ? -51.193 74.626  31.667  1.00 124.09 ? 222 PRO A CB  1 
ATOM   1733  C CG  . PRO A  1  223 ? -49.759 74.802  31.291  1.00 122.88 ? 222 PRO A CG  1 
ATOM   1734  C CD  . PRO A  1  223 ? -49.326 73.474  30.755  1.00 121.65 ? 222 PRO A CD  1 
ATOM   1735  N N   . THR A  1  224 ? -52.201 74.576  28.528  1.00 129.08 ? 223 THR A N   1 
ATOM   1736  C CA  . THR A  1  224 ? -53.022 75.114  27.442  1.00 132.11 ? 223 THR A CA  1 
ATOM   1737  C C   . THR A  1  224 ? -53.866 74.005  26.806  1.00 135.04 ? 223 THR A C   1 
ATOM   1738  O O   . THR A  1  224 ? -55.029 74.223  26.459  1.00 139.11 ? 223 THR A O   1 
ATOM   1739  C CB  . THR A  1  224 ? -52.156 75.799  26.361  1.00 131.53 ? 223 THR A CB  1 
ATOM   1740  O OG1 . THR A  1  224 ? -51.151 76.607  26.987  1.00 130.74 ? 223 THR A OG1 1 
ATOM   1741  C CG2 . THR A  1  224 ? -53.010 76.677  25.451  1.00 132.77 ? 223 THR A CG2 1 
ATOM   1742  N N   . GLU A  1  225 ? -53.272 72.820  26.665  1.00 132.94 ? 224 GLU A N   1 
ATOM   1743  C CA  . GLU A  1  225 ? -53.960 71.653  26.107  1.00 132.22 ? 224 GLU A CA  1 
ATOM   1744  C C   . GLU A  1  225 ? -54.971 71.060  27.089  1.00 134.08 ? 224 GLU A C   1 
ATOM   1745  O O   . GLU A  1  225 ? -56.007 70.536  26.676  1.00 134.38 ? 224 GLU A O   1 
ATOM   1746  C CB  . GLU A  1  225 ? -52.951 70.585  25.675  1.00 126.87 ? 224 GLU A CB  1 
ATOM   1747  C CG  . GLU A  1  225 ? -52.167 70.940  24.419  1.00 122.78 ? 224 GLU A CG  1 
ATOM   1748  C CD  . GLU A  1  225 ? -51.092 69.922  24.087  1.00 119.64 ? 224 GLU A CD  1 
ATOM   1749  O OE1 . GLU A  1  225 ? -50.202 69.688  24.932  1.00 119.50 ? 224 GLU A OE1 1 
ATOM   1750  O OE2 . GLU A  1  225 ? -51.131 69.362  22.971  1.00 118.93 ? 224 GLU A OE2 1 
ATOM   1751  N N   . VAL A  1  226 ? -54.660 71.146  28.382  1.00 134.30 ? 225 VAL A N   1 
ATOM   1752  C CA  . VAL A  1  226 ? -55.561 70.691  29.445  1.00 133.89 ? 225 VAL A CA  1 
ATOM   1753  C C   . VAL A  1  226 ? -56.786 71.606  29.526  1.00 136.33 ? 225 VAL A C   1 
ATOM   1754  O O   . VAL A  1  226 ? -57.898 71.145  29.785  1.00 137.03 ? 225 VAL A O   1 
ATOM   1755  C CB  . VAL A  1  226 ? -54.849 70.635  30.820  1.00 131.62 ? 225 VAL A CB  1 
ATOM   1756  C CG1 . VAL A  1  226 ? -55.763 70.042  31.886  1.00 130.66 ? 225 VAL A CG1 1 
ATOM   1757  C CG2 . VAL A  1  226 ? -53.562 69.827  30.732  1.00 125.70 ? 225 VAL A CG2 1 
ATOM   1758  N N   . ARG A  1  227 ? -56.563 72.897  29.285  1.00 136.95 ? 226 ARG A N   1 
ATOM   1759  C CA  . ARG A  1  227 ? -57.609 73.921  29.302  1.00 139.08 ? 226 ARG A CA  1 
ATOM   1760  C C   . ARG A  1  227 ? -58.735 73.641  28.297  1.00 142.42 ? 226 ARG A C   1 
ATOM   1761  O O   . ARG A  1  227 ? -59.913 73.832  28.610  1.00 143.18 ? 226 ARG A O   1 
ATOM   1762  C CB  . ARG A  1  227 ? -56.976 75.293  29.045  1.00 138.21 ? 226 ARG A CB  1 
ATOM   1763  C CG  . ARG A  1  227 ? -57.937 76.465  28.945  1.00 141.74 ? 226 ARG A CG  1 
ATOM   1764  C CD  . ARG A  1  227 ? -57.167 77.731  28.608  1.00 145.30 ? 226 ARG A CD  1 
ATOM   1765  N NE  . ARG A  1  227 ? -57.996 78.723  27.930  1.00 150.76 ? 226 ARG A NE  1 
ATOM   1766  C CZ  . ARG A  1  227 ? -58.615 79.731  28.536  1.00 154.50 ? 226 ARG A CZ  1 
ATOM   1767  N NH1 . ARG A  1  227 ? -58.511 79.899  29.848  1.00 154.34 ? 226 ARG A NH1 1 
ATOM   1768  N NH2 . ARG A  1  227 ? -59.342 80.579  27.822  1.00 155.26 ? 226 ARG A NH2 1 
ATOM   1769  N N   . ASP A  1  228 ? -58.364 73.182  27.102  1.00 145.94 ? 227 ASP A N   1 
ATOM   1770  C CA  . ASP A  1  228 ? -59.325 72.891  26.035  1.00 151.69 ? 227 ASP A CA  1 
ATOM   1771  C C   . ASP A  1  228 ? -60.148 71.627  26.294  1.00 150.55 ? 227 ASP A C   1 
ATOM   1772  O O   . ASP A  1  228 ? -61.329 71.568  25.944  1.00 155.88 ? 227 ASP A O   1 
ATOM   1773  C CB  . ASP A  1  228 ? -58.612 72.787  24.681  1.00 156.47 ? 227 ASP A CB  1 
ATOM   1774  C CG  . ASP A  1  228 ? -58.080 74.126  24.190  1.00 159.50 ? 227 ASP A CG  1 
ATOM   1775  O OD1 . ASP A  1  228 ? -57.594 74.927  25.018  1.00 157.63 ? 227 ASP A OD1 1 
ATOM   1776  O OD2 . ASP A  1  228 ? -58.141 74.373  22.967  1.00 160.03 ? 227 ASP A OD2 1 
ATOM   1777  N N   . TYR A  1  229 ? -59.520 70.627  26.908  1.00 146.15 ? 228 TYR A N   1 
ATOM   1778  C CA  . TYR A  1  229 ? -60.175 69.354  27.219  1.00 142.50 ? 228 TYR A CA  1 
ATOM   1779  C C   . TYR A  1  229 ? -60.990 69.395  28.517  1.00 144.92 ? 228 TYR A C   1 
ATOM   1780  O O   . TYR A  1  229 ? -61.516 68.368  28.955  1.00 145.55 ? 228 TYR A O   1 
ATOM   1781  C CB  . TYR A  1  229 ? -59.134 68.231  27.307  1.00 135.34 ? 228 TYR A CB  1 
ATOM   1782  C CG  . TYR A  1  229 ? -58.730 67.630  25.977  1.00 129.81 ? 228 TYR A CG  1 
ATOM   1783  C CD1 . TYR A  1  229 ? -57.661 68.152  25.248  1.00 128.26 ? 228 TYR A CD1 1 
ATOM   1784  C CD2 . TYR A  1  229 ? -59.407 66.528  25.455  1.00 128.66 ? 228 TYR A CD2 1 
ATOM   1785  C CE1 . TYR A  1  229 ? -57.285 67.600  24.033  1.00 126.26 ? 228 TYR A CE1 1 
ATOM   1786  C CE2 . TYR A  1  229 ? -59.038 65.969  24.241  1.00 126.51 ? 228 TYR A CE2 1 
ATOM   1787  C CZ  . TYR A  1  229 ? -57.977 66.508  23.535  1.00 125.96 ? 228 TYR A CZ  1 
ATOM   1788  O OH  . TYR A  1  229 ? -57.609 65.955  22.330  1.00 126.31 ? 228 TYR A OH  1 
ATOM   1789  N N   . LEU A  1  230 ? -61.107 70.578  29.118  1.00 147.25 ? 229 LEU A N   1 
ATOM   1790  C CA  . LEU A  1  230 ? -61.681 70.703  30.458  1.00 147.70 ? 229 LEU A CA  1 
ATOM   1791  C C   . LEU A  1  230 ? -62.927 71.582  30.553  1.00 154.55 ? 229 LEU A C   1 
ATOM   1792  O O   . LEU A  1  230 ? -63.770 71.364  31.426  1.00 153.75 ? 229 LEU A O   1 
ATOM   1793  C CB  . LEU A  1  230 ? -60.616 71.205  31.435  1.00 142.14 ? 229 LEU A CB  1 
ATOM   1794  C CG  . LEU A  1  230 ? -60.862 71.040  32.935  1.00 140.28 ? 229 LEU A CG  1 
ATOM   1795  C CD1 . LEU A  1  230 ? -60.828 69.576  33.347  1.00 138.54 ? 229 LEU A CD1 1 
ATOM   1796  C CD2 . LEU A  1  230 ? -59.819 71.833  33.696  1.00 140.00 ? 229 LEU A CD2 1 
ATOM   1797  N N   . ALA A  1  231 ? -63.040 72.569  29.665  1.00 160.55 ? 230 ALA A N   1 
ATOM   1798  C CA  . ALA A  1  231 ? -64.152 73.523  29.692  1.00 166.18 ? 230 ALA A CA  1 
ATOM   1799  C C   . ALA A  1  231 ? -65.488 72.871  29.316  1.00 169.20 ? 230 ALA A C   1 
ATOM   1800  O O   . ALA A  1  231 ? -66.107 73.232  28.311  1.00 171.08 ? 230 ALA A O   1 
ATOM   1801  C CB  . ALA A  1  231 ? -63.852 74.712  28.789  1.00 168.09 ? 230 ALA A CB  1 
ATOM   1802  N N   . ALA A  1  232 ? -65.920 71.921  30.149  1.00 168.09 ? 231 ALA A N   1 
ATOM   1803  C CA  . ALA A  1  232 ? -67.118 71.096  29.927  1.00 169.70 ? 231 ALA A CA  1 
ATOM   1804  C C   . ALA A  1  232 ? -67.076 70.314  28.610  1.00 169.07 ? 231 ALA A C   1 
ATOM   1805  O O   . ALA A  1  232 ? -67.075 69.081  28.615  1.00 166.11 ? 231 ALA A O   1 
ATOM   1806  C CB  . ALA A  1  232 ? -68.393 71.928  30.037  1.00 169.97 ? 231 ALA A CB  1 
ATOM   1807  N N   . ILE A  1  233 ? -67.036 71.042  27.496  1.00 172.17 ? 232 ILE A N   1 
ATOM   1808  C CA  . ILE A  1  233 ? -66.987 70.452  26.162  1.00 173.33 ? 232 ILE A CA  1 
ATOM   1809  C C   . ILE A  1  233 ? -65.558 70.336  25.630  1.00 173.84 ? 232 ILE A C   1 
ATOM   1810  O O   . ILE A  1  233 ? -64.613 70.833  26.250  1.00 170.70 ? 232 ILE A O   1 
ATOM   1811  C CB  . ILE A  1  233 ? -67.838 71.261  25.163  1.00 175.03 ? 232 ILE A CB  1 
ATOM   1812  N N   . ALA A  1  234 ? -65.412 69.674  24.483  1.00 176.47 ? 233 ALA A N   1 
ATOM   1813  C CA  . ALA A  1  234 ? -64.119 69.519  23.818  1.00 176.22 ? 233 ALA A CA  1 
ATOM   1814  C C   . ALA A  1  234 ? -63.668 70.823  23.169  1.00 180.01 ? 233 ALA A C   1 
ATOM   1815  O O   . ALA A  1  234 ? -64.473 71.559  22.598  1.00 182.51 ? 233 ALA A O   1 
ATOM   1816  C CB  . ALA A  1  234 ? -64.187 68.411  22.779  1.00 170.72 ? 233 ALA A CB  1 
ATOM   1817  O OXT . ALA A  1  234 ? -62.487 71.168  23.195  1.00 180.24 ? 233 ALA A OXT 1 
ATOM   1818  N N   . SER B  2  2   ? -31.491 48.630  69.307  1.00 84.18  ? 2   SER B N   1 
ATOM   1819  C CA  . SER B  2  2   ? -31.364 47.797  68.075  1.00 85.00  ? 2   SER B CA  1 
ATOM   1820  C C   . SER B  2  2   ? -31.988 46.415  68.260  1.00 87.35  ? 2   SER B C   1 
ATOM   1821  O O   . SER B  2  2   ? -32.715 45.937  67.387  1.00 88.42  ? 2   SER B O   1 
ATOM   1822  C CB  . SER B  2  2   ? -29.895 47.668  67.657  1.00 86.03  ? 2   SER B CB  1 
ATOM   1823  O OG  . SER B  2  2   ? -29.764 46.931  66.453  1.00 84.63  ? 2   SER B OG  1 
ATOM   1824  N N   . ARG B  2  3   ? -31.701 45.781  69.396  1.00 89.00  ? 3   ARG B N   1 
ATOM   1825  C CA  . ARG B  2  3   ? -32.237 44.453  69.704  1.00 92.10  ? 3   ARG B CA  1 
ATOM   1826  C C   . ARG B  2  3   ? -33.689 44.512  70.187  1.00 94.06  ? 3   ARG B C   1 
ATOM   1827  O O   . ARG B  2  3   ? -34.389 43.497  70.200  1.00 95.00  ? 3   ARG B O   1 
ATOM   1828  C CB  . ARG B  2  3   ? -31.348 43.727  70.723  1.00 93.35  ? 3   ARG B CB  1 
ATOM   1829  C CG  . ARG B  2  3   ? -31.366 44.309  72.130  1.00 96.68  ? 3   ARG B CG  1 
ATOM   1830  C CD  . ARG B  2  3   ? -30.379 43.595  73.039  1.00 100.83 ? 3   ARG B CD  1 
ATOM   1831  N NE  . ARG B  2  3   ? -29.003 44.028  72.802  1.00 106.28 ? 3   ARG B NE  1 
ATOM   1832  C CZ  . ARG B  2  3   ? -28.399 45.017  73.456  1.00 110.99 ? 3   ARG B CZ  1 
ATOM   1833  N NH1 . ARG B  2  3   ? -29.043 45.690  74.401  1.00 112.96 ? 3   ARG B NH1 1 
ATOM   1834  N NH2 . ARG B  2  3   ? -27.144 45.334  73.166  1.00 112.25 ? 3   ARG B NH2 1 
ATOM   1835  N N   . ARG B  2  4   ? -34.126 45.707  70.583  1.00 96.20  ? 4   ARG B N   1 
ATOM   1836  C CA  . ARG B  2  4   ? -35.496 45.938  71.032  1.00 99.95  ? 4   ARG B CA  1 
ATOM   1837  C C   . ARG B  2  4   ? -36.471 45.905  69.855  1.00 96.96  ? 4   ARG B C   1 
ATOM   1838  O O   . ARG B  2  4   ? -37.604 45.437  69.991  1.00 96.78  ? 4   ARG B O   1 
ATOM   1839  C CB  . ARG B  2  4   ? -35.593 47.283  71.757  1.00 106.86 ? 4   ARG B CB  1 
ATOM   1840  C CG  . ARG B  2  4   ? -36.812 47.433  72.655  1.00 111.94 ? 4   ARG B CG  1 
ATOM   1841  C CD  . ARG B  2  4   ? -37.017 48.873  73.109  1.00 119.15 ? 4   ARG B CD  1 
ATOM   1842  N NE  . ARG B  2  4   ? -35.945 49.353  73.983  1.00 122.02 ? 4   ARG B NE  1 
ATOM   1843  C CZ  . ARG B  2  4   ? -34.986 50.199  73.612  1.00 121.65 ? 4   ARG B CZ  1 
ATOM   1844  N NH1 . ARG B  2  4   ? -34.947 50.678  72.374  1.00 121.07 ? 4   ARG B NH1 1 
ATOM   1845  N NH2 . ARG B  2  4   ? -34.060 50.572  74.486  1.00 123.01 ? 4   ARG B NH2 1 
ATOM   1846  N N   . TYR B  2  5   ? -36.016 46.400  68.705  1.00 93.79  ? 5   TYR B N   1 
ATOM   1847  C CA  . TYR B  2  5   ? -36.841 46.478  67.499  1.00 91.25  ? 5   TYR B CA  1 
ATOM   1848  C C   . TYR B  2  5   ? -36.740 45.219  66.634  1.00 88.64  ? 5   TYR B C   1 
ATOM   1849  O O   . TYR B  2  5   ? -37.479 45.072  65.657  1.00 89.24  ? 5   TYR B O   1 
ATOM   1850  C CB  . TYR B  2  5   ? -36.467 47.714  66.670  1.00 91.93  ? 5   TYR B CB  1 
ATOM   1851  C CG  . TYR B  2  5   ? -36.456 49.017  67.444  1.00 95.12  ? 5   TYR B CG  1 
ATOM   1852  C CD1 . TYR B  2  5   ? -35.255 49.595  67.853  1.00 97.16  ? 5   TYR B CD1 1 
ATOM   1853  C CD2 . TYR B  2  5   ? -37.645 49.675  67.761  1.00 96.78  ? 5   TYR B CD2 1 
ATOM   1854  C CE1 . TYR B  2  5   ? -35.237 50.788  68.559  1.00 99.66  ? 5   TYR B CE1 1 
ATOM   1855  C CE2 . TYR B  2  5   ? -37.637 50.869  68.468  1.00 99.32  ? 5   TYR B CE2 1 
ATOM   1856  C CZ  . TYR B  2  5   ? -36.432 51.421  68.863  1.00 100.61 ? 5   TYR B CZ  1 
ATOM   1857  O OH  . TYR B  2  5   ? -36.418 52.605  69.563  1.00 100.04 ? 5   TYR B OH  1 
ATOM   1858  N N   . ASP B  2  6   ? -35.829 44.317  66.999  1.00 88.58  ? 6   ASP B N   1 
ATOM   1859  C CA  . ASP B  2  6   ? -35.613 43.077  66.252  1.00 89.00  ? 6   ASP B CA  1 
ATOM   1860  C C   . ASP B  2  6   ? -36.768 42.099  66.448  1.00 88.48  ? 6   ASP B C   1 
ATOM   1861  O O   . ASP B  2  6   ? -37.187 41.831  67.577  1.00 88.49  ? 6   ASP B O   1 
ATOM   1862  C CB  . ASP B  2  6   ? -34.287 42.422  66.661  1.00 91.37  ? 6   ASP B CB  1 
ATOM   1863  C CG  . ASP B  2  6   ? -33.763 41.437  65.619  1.00 93.19  ? 6   ASP B CG  1 
ATOM   1864  O OD1 . ASP B  2  6   ? -34.569 40.829  64.879  1.00 93.47  ? 6   ASP B OD1 1 
ATOM   1865  O OD2 . ASP B  2  6   ? -32.529 41.263  65.544  1.00 94.67  ? 6   ASP B OD2 1 
ATOM   1866  N N   . SER B  2  7   ? -37.270 41.571  65.335  1.00 89.20  ? 7   SER B N   1 
ATOM   1867  C CA  . SER B  2  7   ? -38.388 40.631  65.344  1.00 92.68  ? 7   SER B CA  1 
ATOM   1868  C C   . SER B  2  7   ? -37.954 39.206  65.688  1.00 93.55  ? 7   SER B C   1 
ATOM   1869  O O   . SER B  2  7   ? -38.778 38.389  66.107  1.00 94.73  ? 7   SER B O   1 
ATOM   1870  C CB  . SER B  2  7   ? -39.108 40.652  63.994  1.00 95.28  ? 7   SER B CB  1 
ATOM   1871  O OG  . SER B  2  7   ? -38.195 40.448  62.930  1.00 98.19  ? 7   SER B OG  1 
ATOM   1872  N N   . ARG B  2  8   ? -36.660 38.924  65.508  1.00 93.29  ? 8   ARG B N   1 
ATOM   1873  C CA  . ARG B  2  8   ? -36.054 37.614  65.800  1.00 93.96  ? 8   ARG B CA  1 
ATOM   1874  C C   . ARG B  2  8   ? -36.693 36.493  64.971  1.00 91.53  ? 8   ARG B C   1 
ATOM   1875  O O   . ARG B  2  8   ? -37.515 35.722  65.474  1.00 92.07  ? 8   ARG B O   1 
ATOM   1876  C CB  . ARG B  2  8   ? -36.113 37.288  67.304  1.00 97.10  ? 8   ARG B CB  1 
ATOM   1877  C CG  . ARG B  2  8   ? -35.654 38.406  68.232  1.00 100.70 ? 8   ARG B CG  1 
ATOM   1878  C CD  . ARG B  2  8   ? -34.169 38.329  68.543  1.00 104.56 ? 8   ARG B CD  1 
ATOM   1879  N NE  . ARG B  2  8   ? -33.758 39.385  69.466  1.00 107.98 ? 8   ARG B NE  1 
ATOM   1880  C CZ  . ARG B  2  8   ? -32.654 39.356  70.209  1.00 110.82 ? 8   ARG B CZ  1 
ATOM   1881  N NH1 . ARG B  2  8   ? -31.832 38.315  70.158  1.00 113.57 ? 8   ARG B NH1 1 
ATOM   1882  N NH2 . ARG B  2  8   ? -32.375 40.371  71.016  1.00 109.76 ? 8   ARG B NH2 1 
ATOM   1883  N N   . THR B  2  9   ? -36.302 36.414  63.701  1.00 88.43  ? 9   THR B N   1 
ATOM   1884  C CA  . THR B  2  9   ? -36.910 35.477  62.749  1.00 86.12  ? 9   THR B CA  1 
ATOM   1885  C C   . THR B  2  9   ? -36.249 34.098  62.742  1.00 85.10  ? 9   THR B C   1 
ATOM   1886  O O   . THR B  2  9   ? -36.929 33.081  62.588  1.00 85.08  ? 9   THR B O   1 
ATOM   1887  C CB  . THR B  2  9   ? -36.905 36.036  61.309  1.00 85.54  ? 9   THR B CB  1 
ATOM   1888  O OG1 . THR B  2  9   ? -35.562 36.339  60.915  1.00 86.14  ? 9   THR B OG1 1 
ATOM   1889  C CG2 . THR B  2  9   ? -37.758 37.295  61.210  1.00 85.78  ? 9   THR B CG2 1 
ATOM   1890  N N   . THR B  2  10  ? -34.928 34.073  62.903  1.00 85.62  ? 10  THR B N   1 
ATOM   1891  C CA  . THR B  2  10  ? -34.153 32.832  62.846  1.00 85.62  ? 10  THR B CA  1 
ATOM   1892  C C   . THR B  2  10  ? -33.879 32.272  64.247  1.00 89.50  ? 10  THR B C   1 
ATOM   1893  O O   . THR B  2  10  ? -32.727 32.053  64.632  1.00 91.81  ? 10  THR B O   1 
ATOM   1894  C CB  . THR B  2  10  ? -32.825 33.029  62.077  1.00 83.89  ? 10  THR B CB  1 
ATOM   1895  O OG1 . THR B  2  10  ? -32.053 34.062  62.703  1.00 85.26  ? 10  THR B OG1 1 
ATOM   1896  C CG2 . THR B  2  10  ? -33.090 33.411  60.625  1.00 80.68  ? 10  THR B CG2 1 
ATOM   1897  N N   . ILE B  2  11  ? -34.954 32.040  65.000  1.00 91.11  ? 11  ILE B N   1 
ATOM   1898  C CA  . ILE B  2  11  ? -34.865 31.563  66.382  1.00 94.43  ? 11  ILE B CA  1 
ATOM   1899  C C   . ILE B  2  11  ? -35.865 30.433  66.647  1.00 96.32  ? 11  ILE B C   1 
ATOM   1900  O O   . ILE B  2  11  ? -37.016 30.493  66.207  1.00 97.11  ? 11  ILE B O   1 
ATOM   1901  C CB  . ILE B  2  11  ? -35.032 32.735  67.387  1.00 96.90  ? 11  ILE B CB  1 
ATOM   1902  C CG1 . ILE B  2  11  ? -33.675 33.400  67.646  1.00 98.38  ? 11  ILE B CG1 1 
ATOM   1903  C CG2 . ILE B  2  11  ? -35.656 32.275  68.701  1.00 96.81  ? 11  ILE B CG2 1 
ATOM   1904  C CD1 . ILE B  2  11  ? -33.725 34.634  68.522  1.00 101.89 ? 11  ILE B CD1 1 
ATOM   1905  N N   . PHE B  2  12  ? -35.404 29.402  67.356  1.00 96.65  ? 12  PHE B N   1 
ATOM   1906  C CA  . PHE B  2  12  ? -36.235 28.253  67.719  1.00 97.37  ? 12  PHE B CA  1 
ATOM   1907  C C   . PHE B  2  12  ? -37.245 28.572  68.821  1.00 99.20  ? 12  PHE B C   1 
ATOM   1908  O O   . PHE B  2  12  ? -37.015 29.450  69.656  1.00 99.45  ? 12  PHE B O   1 
ATOM   1909  C CB  . PHE B  2  12  ? -35.360 27.075  68.159  1.00 95.93  ? 12  PHE B CB  1 
ATOM   1910  C CG  . PHE B  2  12  ? -34.834 26.244  67.023  1.00 93.98  ? 12  PHE B CG  1 
ATOM   1911  C CD1 . PHE B  2  12  ? -33.523 26.393  66.585  1.00 92.69  ? 12  PHE B CD1 1 
ATOM   1912  C CD2 . PHE B  2  12  ? -35.645 25.302  66.397  1.00 95.21  ? 12  PHE B CD2 1 
ATOM   1913  C CE1 . PHE B  2  12  ? -33.033 25.624  65.541  1.00 92.59  ? 12  PHE B CE1 1 
ATOM   1914  C CE2 . PHE B  2  12  ? -35.161 24.531  65.351  1.00 95.12  ? 12  PHE B CE2 1 
ATOM   1915  C CZ  . PHE B  2  12  ? -33.853 24.692  64.923  1.00 94.01  ? 12  PHE B CZ  1 
ATOM   1916  N N   . SER B  2  13  ? -38.357 27.842  68.817  1.00 102.09 ? 13  SER B N   1 
ATOM   1917  C CA  . SER B  2  13  ? -39.391 27.974  69.841  1.00 105.89 ? 13  SER B CA  1 
ATOM   1918  C C   . SER B  2  13  ? -39.304 26.823  70.852  1.00 106.06 ? 13  SER B C   1 
ATOM   1919  O O   . SER B  2  13  ? -38.684 25.798  70.560  1.00 106.82 ? 13  SER B O   1 
ATOM   1920  C CB  . SER B  2  13  ? -40.776 28.013  69.190  1.00 109.24 ? 13  SER B CB  1 
ATOM   1921  O OG  . SER B  2  13  ? -41.104 26.769  68.599  1.00 112.67 ? 13  SER B OG  1 
ATOM   1922  N N   . PRO B  2  14  ? -39.920 26.990  72.045  1.00 104.64 ? 14  PRO B N   1 
ATOM   1923  C CA  . PRO B  2  14  ? -39.932 25.958  73.091  1.00 105.05 ? 14  PRO B CA  1 
ATOM   1924  C C   . PRO B  2  14  ? -40.323 24.556  72.619  1.00 106.98 ? 14  PRO B C   1 
ATOM   1925  O O   . PRO B  2  14  ? -39.854 23.567  73.187  1.00 108.57 ? 14  PRO B O   1 
ATOM   1926  C CB  . PRO B  2  14  ? -40.969 26.488  74.081  1.00 103.79 ? 14  PRO B CB  1 
ATOM   1927  C CG  . PRO B  2  14  ? -40.849 27.965  73.966  1.00 102.97 ? 14  PRO B CG  1 
ATOM   1928  C CD  . PRO B  2  14  ? -40.537 28.245  72.520  1.00 103.66 ? 14  PRO B CD  1 
ATOM   1929  N N   . GLU B  2  15  ? -41.166 24.475  71.592  1.00 109.23 ? 15  GLU B N   1 
ATOM   1930  C CA  . GLU B  2  15  ? -41.631 23.190  71.070  1.00 114.17 ? 15  GLU B CA  1 
ATOM   1931  C C   . GLU B  2  15  ? -40.686 22.584  70.028  1.00 111.37 ? 15  GLU B C   1 
ATOM   1932  O O   . GLU B  2  15  ? -40.861 21.435  69.618  1.00 112.58 ? 15  GLU B O   1 
ATOM   1933  C CB  . GLU B  2  15  ? -43.051 23.319  70.509  1.00 121.86 ? 15  GLU B CB  1 
ATOM   1934  C CG  . GLU B  2  15  ? -44.109 23.550  71.578  1.00 129.34 ? 15  GLU B CG  1 
ATOM   1935  C CD  . GLU B  2  15  ? -45.529 23.470  71.049  1.00 135.51 ? 15  GLU B CD  1 
ATOM   1936  O OE1 . GLU B  2  15  ? -45.788 22.680  70.116  1.00 136.21 ? 15  GLU B OE1 1 
ATOM   1937  O OE2 . GLU B  2  15  ? -46.394 24.196  71.582  1.00 138.19 ? 15  GLU B OE2 1 
ATOM   1938  N N   . GLY B  2  16  ? -39.685 23.357  69.615  1.00 107.29 ? 16  GLY B N   1 
ATOM   1939  C CA  . GLY B  2  16  ? -38.699 22.897  68.640  1.00 105.13 ? 16  GLY B CA  1 
ATOM   1940  C C   . GLY B  2  16  ? -39.156 23.084  67.207  1.00 103.45 ? 16  GLY B C   1 
ATOM   1941  O O   . GLY B  2  16  ? -39.032 22.176  66.383  1.00 102.79 ? 16  GLY B O   1 
ATOM   1942  N N   . ARG B  2  17  ? -39.684 24.270  66.917  1.00 101.91 ? 17  ARG B N   1 
ATOM   1943  C CA  . ARG B  2  17  ? -40.170 24.608  65.581  1.00 100.83 ? 17  ARG B CA  1 
ATOM   1944  C C   . ARG B  2  17  ? -39.951 26.089  65.274  1.00 94.82  ? 17  ARG B C   1 
ATOM   1945  O O   . ARG B  2  17  ? -39.852 26.913  66.184  1.00 95.80  ? 17  ARG B O   1 
ATOM   1946  C CB  . ARG B  2  17  ? -41.650 24.225  65.420  1.00 104.67 ? 17  ARG B CB  1 
ATOM   1947  C CG  . ARG B  2  17  ? -42.583 24.816  66.468  1.00 109.42 ? 17  ARG B CG  1 
ATOM   1948  C CD  . ARG B  2  17  ? -44.009 24.323  66.293  1.00 114.61 ? 17  ARG B CD  1 
ATOM   1949  N NE  . ARG B  2  17  ? -44.922 24.961  67.240  1.00 119.66 ? 17  ARG B NE  1 
ATOM   1950  C CZ  . ARG B  2  17  ? -46.247 24.837  67.217  1.00 123.22 ? 17  ARG B CZ  1 
ATOM   1951  N NH1 . ARG B  2  17  ? -46.840 24.096  66.289  1.00 123.23 ? 17  ARG B NH1 1 
ATOM   1952  N NH2 . ARG B  2  17  ? -46.984 25.462  68.125  1.00 125.98 ? 17  ARG B NH2 1 
ATOM   1953  N N   . LEU B  2  18  ? -39.870 26.412  63.987  1.00 88.33  ? 18  LEU B N   1 
ATOM   1954  C CA  . LEU B  2  18  ? -39.668 27.787  63.541  1.00 85.12  ? 18  LEU B CA  1 
ATOM   1955  C C   . LEU B  2  18  ? -41.014 28.466  63.304  1.00 86.19  ? 18  LEU B C   1 
ATOM   1956  O O   . LEU B  2  18  ? -41.828 27.983  62.513  1.00 88.42  ? 18  LEU B O   1 
ATOM   1957  C CB  . LEU B  2  18  ? -38.822 27.815  62.265  1.00 83.73  ? 18  LEU B CB  1 
ATOM   1958  C CG  . LEU B  2  18  ? -37.441 27.149  62.306  1.00 82.55  ? 18  LEU B CG  1 
ATOM   1959  C CD1 . LEU B  2  18  ? -37.069 26.602  60.936  1.00 82.72  ? 18  LEU B CD1 1 
ATOM   1960  C CD2 . LEU B  2  18  ? -36.371 28.101  62.823  1.00 83.70  ? 18  LEU B CD2 1 
ATOM   1961  N N   . TYR B  2  19  ? -41.243 29.580  63.997  1.00 86.78  ? 19  TYR B N   1 
ATOM   1962  C CA  . TYR B  2  19  ? -42.508 30.309  63.900  1.00 89.30  ? 19  TYR B CA  1 
ATOM   1963  C C   . TYR B  2  19  ? -42.702 30.994  62.548  1.00 88.37  ? 19  TYR B C   1 
ATOM   1964  O O   . TYR B  2  19  ? -43.753 30.843  61.921  1.00 89.24  ? 19  TYR B O   1 
ATOM   1965  C CB  . TYR B  2  19  ? -42.647 31.333  65.034  1.00 94.84  ? 19  TYR B CB  1 
ATOM   1966  C CG  . TYR B  2  19  ? -43.243 30.781  66.314  1.00 102.88 ? 19  TYR B CG  1 
ATOM   1967  C CD1 . TYR B  2  19  ? -42.617 30.993  67.541  1.00 106.75 ? 19  TYR B CD1 1 
ATOM   1968  C CD2 . TYR B  2  19  ? -44.435 30.053  66.299  1.00 107.60 ? 19  TYR B CD2 1 
ATOM   1969  C CE1 . TYR B  2  19  ? -43.160 30.497  68.716  1.00 114.24 ? 19  TYR B CE1 1 
ATOM   1970  C CE2 . TYR B  2  19  ? -44.982 29.549  67.469  1.00 114.94 ? 19  TYR B CE2 1 
ATOM   1971  C CZ  . TYR B  2  19  ? -44.341 29.773  68.674  1.00 118.36 ? 19  TYR B CZ  1 
ATOM   1972  O OH  . TYR B  2  19  ? -44.880 29.277  69.838  1.00 120.43 ? 19  TYR B OH  1 
ATOM   1973  N N   . GLN B  2  20  ? -41.685 31.733  62.108  1.00 88.61  ? 20  GLN B N   1 
ATOM   1974  C CA  . GLN B  2  20  ? -41.746 32.507  60.863  1.00 88.30  ? 20  GLN B CA  1 
ATOM   1975  C C   . GLN B  2  20  ? -41.955 31.643  59.619  1.00 89.18  ? 20  GLN B C   1 
ATOM   1976  O O   . GLN B  2  20  ? -42.534 32.101  58.632  1.00 89.57  ? 20  GLN B O   1 
ATOM   1977  C CB  . GLN B  2  20  ? -40.495 33.378  60.705  1.00 86.14  ? 20  GLN B CB  1 
ATOM   1978  C CG  . GLN B  2  20  ? -40.462 34.599  61.615  1.00 85.21  ? 20  GLN B CG  1 
ATOM   1979  C CD  . GLN B  2  20  ? -41.499 35.648  61.249  1.00 84.18  ? 20  GLN B CD  1 
ATOM   1980  O OE1 . GLN B  2  20  ? -41.768 35.895  60.072  1.00 82.57  ? 20  GLN B OE1 1 
ATOM   1981  N NE2 . GLN B  2  20  ? -42.084 36.277  62.262  1.00 85.77  ? 20  GLN B NE2 1 
ATOM   1982  N N   . VAL B  2  21  ? -41.483 30.400  59.677  1.00 89.62  ? 21  VAL B N   1 
ATOM   1983  C CA  . VAL B  2  21  ? -41.685 29.431  58.600  1.00 90.54  ? 21  VAL B CA  1 
ATOM   1984  C C   . VAL B  2  21  ? -43.129 28.925  58.602  1.00 92.42  ? 21  VAL B C   1 
ATOM   1985  O O   . VAL B  2  21  ? -43.763 28.834  57.548  1.00 93.46  ? 21  VAL B O   1 
ATOM   1986  C CB  . VAL B  2  21  ? -40.701 28.242  58.706  1.00 89.17  ? 21  VAL B CB  1 
ATOM   1987  C CG1 . VAL B  2  21  ? -40.948 27.227  57.598  1.00 88.51  ? 21  VAL B CG1 1 
ATOM   1988  C CG2 . VAL B  2  21  ? -39.262 28.733  58.655  1.00 86.79  ? 21  VAL B CG2 1 
ATOM   1989  N N   . GLU B  2  22  ? -43.639 28.610  59.792  1.00 94.05  ? 22  GLU B N   1 
ATOM   1990  C CA  . GLU B  2  22  ? -45.012 28.129  59.956  1.00 96.13  ? 22  GLU B CA  1 
ATOM   1991  C C   . GLU B  2  22  ? -46.048 29.213  59.664  1.00 93.64  ? 22  GLU B C   1 
ATOM   1992  O O   . GLU B  2  22  ? -47.156 28.910  59.216  1.00 94.53  ? 22  GLU B O   1 
ATOM   1993  C CB  . GLU B  2  22  ? -45.224 27.555  61.359  1.00 99.81  ? 22  GLU B CB  1 
ATOM   1994  C CG  . GLU B  2  22  ? -44.580 26.193  61.577  1.00 104.17 ? 22  GLU B CG  1 
ATOM   1995  C CD  . GLU B  2  22  ? -44.945 25.567  62.912  1.00 111.02 ? 22  GLU B CD  1 
ATOM   1996  O OE1 . GLU B  2  22  ? -45.252 26.312  63.868  1.00 111.27 ? 22  GLU B OE1 1 
ATOM   1997  O OE2 . GLU B  2  22  ? -44.919 24.322  63.007  1.00 113.55 ? 22  GLU B OE2 1 
ATOM   1998  N N   . TYR B  2  23  ? -45.684 30.469  59.920  1.00 91.45  ? 23  TYR B N   1 
ATOM   1999  C CA  . TYR B  2  23  ? -46.545 31.603  59.585  1.00 90.91  ? 23  TYR B CA  1 
ATOM   2000  C C   . TYR B  2  23  ? -46.526 31.890  58.084  1.00 90.46  ? 23  TYR B C   1 
ATOM   2001  O O   . TYR B  2  23  ? -47.506 32.395  57.531  1.00 90.78  ? 23  TYR B O   1 
ATOM   2002  C CB  . TYR B  2  23  ? -46.151 32.858  60.374  1.00 91.20  ? 23  TYR B CB  1 
ATOM   2003  C CG  . TYR B  2  23  ? -46.303 32.750  61.881  1.00 92.72  ? 23  TYR B CG  1 
ATOM   2004  C CD1 . TYR B  2  23  ? -45.476 33.480  62.733  1.00 94.39  ? 23  TYR B CD1 1 
ATOM   2005  C CD2 . TYR B  2  23  ? -47.268 31.919  62.456  1.00 93.95  ? 23  TYR B CD2 1 
ATOM   2006  C CE1 . TYR B  2  23  ? -45.606 33.392  64.111  1.00 95.15  ? 23  TYR B CE1 1 
ATOM   2007  C CE2 . TYR B  2  23  ? -47.402 31.822  63.833  1.00 95.39  ? 23  TYR B CE2 1 
ATOM   2008  C CZ  . TYR B  2  23  ? -46.571 32.560  64.654  1.00 95.01  ? 23  TYR B CZ  1 
ATOM   2009  O OH  . TYR B  2  23  ? -46.703 32.467  66.020  1.00 96.55  ? 23  TYR B OH  1 
ATOM   2010  N N   . ALA B  2  24  ? -45.407 31.568  57.436  1.00 90.33  ? 24  ALA B N   1 
ATOM   2011  C CA  . ALA B  2  24  ? -45.290 31.659  55.981  1.00 90.82  ? 24  ALA B CA  1 
ATOM   2012  C C   . ALA B  2  24  ? -46.073 30.535  55.301  1.00 93.00  ? 24  ALA B C   1 
ATOM   2013  O O   . ALA B  2  24  ? -46.549 30.696  54.175  1.00 94.12  ? 24  ALA B O   1 
ATOM   2014  C CB  . ALA B  2  24  ? -43.830 31.625  55.558  1.00 90.63  ? 24  ALA B CB  1 
ATOM   2015  N N   . MET B  2  25  ? -46.197 29.404  55.995  1.00 94.42  ? 25  MET B N   1 
ATOM   2016  C CA  . MET B  2  25  ? -47.016 28.278  55.544  1.00 96.38  ? 25  MET B CA  1 
ATOM   2017  C C   . MET B  2  25  ? -48.502 28.632  55.557  1.00 96.04  ? 25  MET B C   1 
ATOM   2018  O O   . MET B  2  25  ? -49.277 28.119  54.747  1.00 96.94  ? 25  MET B O   1 
ATOM   2019  C CB  . MET B  2  25  ? -46.760 27.045  56.417  1.00 98.51  ? 25  MET B CB  1 
ATOM   2020  C CG  . MET B  2  25  ? -45.473 26.296  56.098  1.00 101.68 ? 25  MET B CG  1 
ATOM   2021  S SD  . MET B  2  25  ? -45.709 24.797  55.119  1.00 106.35 ? 25  MET B SD  1 
ATOM   2022  C CE  . MET B  2  25  ? -46.053 25.456  53.488  1.00 102.72 ? 25  MET B CE  1 
ATOM   2023  N N   . GLU B  2  26  ? -48.884 29.511  56.482  1.00 96.85  ? 26  GLU B N   1 
ATOM   2024  C CA  . GLU B  2  26  ? -50.252 30.018  56.576  1.00 98.76  ? 26  GLU B CA  1 
ATOM   2025  C C   . GLU B  2  26  ? -50.581 30.982  55.436  1.00 97.30  ? 26  GLU B C   1 
ATOM   2026  O O   . GLU B  2  26  ? -51.738 31.094  55.026  1.00 99.12  ? 26  GLU B O   1 
ATOM   2027  C CB  . GLU B  2  26  ? -50.478 30.709  57.926  1.00 102.14 ? 26  GLU B CB  1 
ATOM   2028  C CG  . GLU B  2  26  ? -50.601 29.762  59.112  1.00 106.96 ? 26  GLU B CG  1 
ATOM   2029  C CD  . GLU B  2  26  ? -51.917 29.002  59.134  1.00 110.67 ? 26  GLU B CD  1 
ATOM   2030  O OE1 . GLU B  2  26  ? -52.977 29.618  58.891  1.00 111.74 ? 26  GLU B OE1 1 
ATOM   2031  O OE2 . GLU B  2  26  ? -51.890 27.783  59.403  1.00 113.81 ? 26  GLU B OE2 1 
ATOM   2032  N N   . ALA B  2  27  ? -49.557 31.672  54.935  1.00 96.13  ? 27  ALA B N   1 
ATOM   2033  C CA  . ALA B  2  27  ? -49.705 32.620  53.830  1.00 96.61  ? 27  ALA B CA  1 
ATOM   2034  C C   . ALA B  2  27  ? -50.020 31.920  52.509  1.00 96.88  ? 27  ALA B C   1 
ATOM   2035  O O   . ALA B  2  27  ? -50.748 32.457  51.672  1.00 99.05  ? 27  ALA B O   1 
ATOM   2036  C CB  . ALA B  2  27  ? -48.451 33.470  53.691  1.00 96.67  ? 27  ALA B CB  1 
ATOM   2037  N N   . ILE B  2  28  ? -49.464 30.723  52.336  1.00 95.58  ? 28  ILE B N   1 
ATOM   2038  C CA  . ILE B  2  28  ? -49.664 29.921  51.128  1.00 94.80  ? 28  ILE B CA  1 
ATOM   2039  C C   . ILE B  2  28  ? -51.061 29.295  51.111  1.00 95.57  ? 28  ILE B C   1 
ATOM   2040  O O   . ILE B  2  28  ? -51.664 29.131  50.047  1.00 94.90  ? 28  ILE B O   1 
ATOM   2041  C CB  . ILE B  2  28  ? -48.562 28.844  50.989  1.00 92.92  ? 28  ILE B CB  1 
ATOM   2042  C CG1 . ILE B  2  28  ? -47.185 29.514  50.924  1.00 91.53  ? 28  ILE B CG1 1 
ATOM   2043  C CG2 . ILE B  2  28  ? -48.782 27.982  49.751  1.00 93.56  ? 28  ILE B CG2 1 
ATOM   2044  C CD1 . ILE B  2  28  ? -46.053 28.672  51.467  1.00 91.25  ? 28  ILE B CD1 1 
ATOM   2045  N N   . GLY B  2  29  ? -51.574 28.968  52.298  1.00 96.76  ? 29  GLY B N   1 
ATOM   2046  C CA  . GLY B  2  29  ? -52.915 28.401  52.452  1.00 98.48  ? 29  GLY B CA  1 
ATOM   2047  C C   . GLY B  2  29  ? -54.044 29.342  52.061  1.00 100.10 ? 29  GLY B C   1 
ATOM   2048  O O   . GLY B  2  29  ? -55.182 28.907  51.872  1.00 101.30 ? 29  GLY B O   1 
ATOM   2049  N N   . HIS B  2  30  ? -53.726 30.630  51.947  1.00 98.15  ? 30  HIS B N   1 
ATOM   2050  C CA  . HIS B  2  30  ? -54.689 31.643  51.515  1.00 97.00  ? 30  HIS B CA  1 
ATOM   2051  C C   . HIS B  2  30  ? -54.640 31.879  50.032  1.00 92.21  ? 30  HIS B C   1 
ATOM   2052  O O   . HIS B  2  30  ? -55.604 32.377  49.448  1.00 93.30  ? 30  HIS B O   1 
ATOM   2053  C CB  . HIS B  2  30  ? -54.461 32.951  52.264  1.00 100.83 ? 30  HIS B CB  1 
ATOM   2054  C CG  . HIS B  2  30  ? -54.917 32.915  53.701  1.00 106.04 ? 30  HIS B CG  1 
ATOM   2055  N ND1 . HIS B  2  30  ? -54.119 32.508  54.703  1.00 108.04 ? 30  HIS B ND1 1 
ATOM   2056  C CD2 . HIS B  2  30  ? -56.138 33.250  54.283  1.00 109.04 ? 30  HIS B CD2 1 
ATOM   2057  C CE1 . HIS B  2  30  ? -54.790 32.579  55.868  1.00 110.45 ? 30  HIS B CE1 1 
ATOM   2058  N NE2 . HIS B  2  30  ? -56.026 33.033  55.609  1.00 110.60 ? 30  HIS B NE2 1 
ATOM   2059  N N   . ALA B  2  31  ? -53.518 31.519  49.412  1.00 89.71  ? 31  ALA B N   1 
ATOM   2060  C CA  . ALA B  2  31  ? -53.315 31.698  47.973  1.00 90.87  ? 31  ALA B CA  1 
ATOM   2061  C C   . ALA B  2  31  ? -54.125 30.702  47.141  1.00 92.48  ? 31  ALA B C   1 
ATOM   2062  O O   . ALA B  2  31  ? -54.728 29.774  47.684  1.00 93.92  ? 31  ALA B O   1 
ATOM   2063  C CB  . ALA B  2  31  ? -51.835 31.601  47.634  1.00 89.34  ? 31  ALA B CB  1 
ATOM   2064  N N   . GLY B  2  32  ? -54.128 30.903  45.823  1.00 93.59  ? 32  GLY B N   1 
ATOM   2065  C CA  . GLY B  2  32  ? -54.882 30.060  44.893  1.00 95.70  ? 32  GLY B CA  1 
ATOM   2066  C C   . GLY B  2  32  ? -54.479 28.596  44.903  1.00 96.90  ? 32  GLY B C   1 
ATOM   2067  O O   . GLY B  2  32  ? -53.321 28.262  45.167  1.00 95.27  ? 32  GLY B O   1 
ATOM   2068  N N   . THR B  2  33  ? -55.446 27.728  44.611  1.00 99.44  ? 33  THR B N   1 
ATOM   2069  C CA  . THR B  2  33  ? -55.236 26.280  44.603  1.00 99.36  ? 33  THR B CA  1 
ATOM   2070  C C   . THR B  2  33  ? -54.348 25.866  43.430  1.00 97.64  ? 33  THR B C   1 
ATOM   2071  O O   . THR B  2  33  ? -54.630 26.196  42.275  1.00 97.30  ? 33  THR B O   1 
ATOM   2072  C CB  . THR B  2  33  ? -56.578 25.515  44.547  1.00 100.03 ? 33  THR B CB  1 
ATOM   2073  O OG1 . THR B  2  33  ? -57.485 26.064  45.511  1.00 99.93  ? 33  THR B OG1 1 
ATOM   2074  C CG2 . THR B  2  33  ? -56.374 24.033  44.840  1.00 99.52  ? 33  THR B CG2 1 
ATOM   2075  N N   . CYS B  2  34  ? -53.274 25.145  43.741  1.00 96.50  ? 34  CYS B N   1 
ATOM   2076  C CA  . CYS B  2  34  ? -52.302 24.727  42.736  1.00 95.29  ? 34  CYS B CA  1 
ATOM   2077  C C   . CYS B  2  34  ? -51.956 23.248  42.883  1.00 92.78  ? 34  CYS B C   1 
ATOM   2078  O O   . CYS B  2  34  ? -51.507 22.809  43.944  1.00 93.31  ? 34  CYS B O   1 
ATOM   2079  C CB  . CYS B  2  34  ? -51.039 25.585  42.838  1.00 94.63  ? 34  CYS B CB  1 
ATOM   2080  S SG  . CYS B  2  34  ? -49.806 25.263  41.559  1.00 93.14  ? 34  CYS B SG  1 
ATOM   2081  N N   . LEU B  2  35  ? -52.170 22.487  41.812  1.00 89.99  ? 35  LEU B N   1 
ATOM   2082  C CA  . LEU B  2  35  ? -51.899 21.049  41.815  1.00 88.45  ? 35  LEU B CA  1 
ATOM   2083  C C   . LEU B  2  35  ? -51.172 20.583  40.557  1.00 86.09  ? 35  LEU B C   1 
ATOM   2084  O O   . LEU B  2  35  ? -51.409 21.094  39.462  1.00 86.10  ? 35  LEU B O   1 
ATOM   2085  C CB  . LEU B  2  35  ? -53.193 20.247  42.028  1.00 89.76  ? 35  LEU B CB  1 
ATOM   2086  C CG  . LEU B  2  35  ? -54.393 20.428  41.089  1.00 90.30  ? 35  LEU B CG  1 
ATOM   2087  C CD1 . LEU B  2  35  ? -54.353 19.434  39.938  1.00 89.51  ? 35  LEU B CD1 1 
ATOM   2088  C CD2 . LEU B  2  35  ? -55.688 20.268  41.868  1.00 92.79  ? 35  LEU B CD2 1 
ATOM   2089  N N   . GLY B  2  36  ? -50.282 19.612  40.734  1.00 86.17  ? 36  GLY B N   1 
ATOM   2090  C CA  . GLY B  2  36  ? -49.561 18.992  39.627  1.00 86.14  ? 36  GLY B CA  1 
ATOM   2091  C C   . GLY B  2  36  ? -49.535 17.486  39.795  1.00 86.95  ? 36  GLY B C   1 
ATOM   2092  O O   . GLY B  2  36  ? -49.322 16.985  40.901  1.00 87.34  ? 36  GLY B O   1 
ATOM   2093  N N   . ILE B  2  37  ? -49.764 16.764  38.701  1.00 87.40  ? 37  ILE B N   1 
ATOM   2094  C CA  . ILE B  2  37  ? -49.786 15.297  38.733  1.00 88.59  ? 37  ILE B CA  1 
ATOM   2095  C C   . ILE B  2  37  ? -48.953 14.667  37.614  1.00 87.34  ? 37  ILE B C   1 
ATOM   2096  O O   . ILE B  2  37  ? -48.808 15.242  36.532  1.00 86.50  ? 37  ILE B O   1 
ATOM   2097  C CB  . ILE B  2  37  ? -51.227 14.726  38.719  1.00 89.45  ? 37  ILE B CB  1 
ATOM   2098  C CG1 . ILE B  2  37  ? -52.019 15.239  37.512  1.00 89.77  ? 37  ILE B CG1 1 
ATOM   2099  C CG2 . ILE B  2  37  ? -51.952 15.060  40.016  1.00 90.54  ? 37  ILE B CG2 1 
ATOM   2100  C CD1 . ILE B  2  37  ? -53.338 14.528  37.305  1.00 93.32  ? 37  ILE B CD1 1 
ATOM   2101  N N   . LEU B  2  38  ? -48.414 13.481  37.892  1.00 86.41  ? 38  LEU B N   1 
ATOM   2102  C CA  . LEU B  2  38  ? -47.546 12.763  36.961  1.00 85.35  ? 38  LEU B CA  1 
ATOM   2103  C C   . LEU B  2  38  ? -48.317 11.720  36.153  1.00 85.82  ? 38  LEU B C   1 
ATOM   2104  O O   . LEU B  2  38  ? -49.214 11.054  36.674  1.00 86.84  ? 38  LEU B O   1 
ATOM   2105  C CB  . LEU B  2  38  ? -46.397 12.092  37.725  1.00 84.21  ? 38  LEU B CB  1 
ATOM   2106  C CG  . LEU B  2  38  ? -45.244 11.436  36.955  1.00 83.92  ? 38  LEU B CG  1 
ATOM   2107  C CD1 . LEU B  2  38  ? -44.299 12.481  36.380  1.00 83.51  ? 38  LEU B CD1 1 
ATOM   2108  C CD2 . LEU B  2  38  ? -44.485 10.475  37.857  1.00 83.35  ? 38  LEU B CD2 1 
ATOM   2109  N N   . ALA B  2  39  ? -47.955 11.592  34.879  1.00 86.93  ? 39  ALA B N   1 
ATOM   2110  C CA  . ALA B  2  39  ? -48.524 10.580  33.992  1.00 89.58  ? 39  ALA B CA  1 
ATOM   2111  C C   . ALA B  2  39  ? -47.415 9.772   33.314  1.00 90.19  ? 39  ALA B C   1 
ATOM   2112  O O   . ALA B  2  39  ? -46.229 10.064  33.491  1.00 90.49  ? 39  ALA B O   1 
ATOM   2113  C CB  . ALA B  2  39  ? -49.431 11.231  32.958  1.00 90.39  ? 39  ALA B CB  1 
ATOM   2114  N N   . ASN B  2  40  ? -47.805 8.756   32.546  1.00 91.89  ? 40  ASN B N   1 
ATOM   2115  C CA  . ASN B  2  40  ? -46.849 7.879   31.865  1.00 91.84  ? 40  ASN B CA  1 
ATOM   2116  C C   . ASN B  2  40  ? -46.189 8.510   30.637  1.00 89.85  ? 40  ASN B C   1 
ATOM   2117  O O   . ASN B  2  40  ? -44.987 8.342   30.419  1.00 87.78  ? 40  ASN B O   1 
ATOM   2118  C CB  . ASN B  2  40  ? -47.509 6.548   31.486  1.00 95.35  ? 40  ASN B CB  1 
ATOM   2119  C CG  . ASN B  2  40  ? -47.612 5.589   32.658  1.00 99.60  ? 40  ASN B CG  1 
ATOM   2120  O OD1 . ASN B  2  40  ? -46.978 4.534   32.665  1.00 102.87 ? 40  ASN B OD1 1 
ATOM   2121  N ND2 . ASN B  2  40  ? -48.410 5.950   33.658  1.00 101.01 ? 40  ASN B ND2 1 
ATOM   2122  N N   . ASP B  2  41  ? -46.978 9.230   29.842  1.00 91.94  ? 41  ASP B N   1 
ATOM   2123  C CA  . ASP B  2  41  ? -46.485 9.847   28.609  1.00 94.48  ? 41  ASP B CA  1 
ATOM   2124  C C   . ASP B  2  41  ? -46.075 11.313  28.781  1.00 95.89  ? 41  ASP B C   1 
ATOM   2125  O O   . ASP B  2  41  ? -45.363 11.864  27.938  1.00 96.12  ? 41  ASP B O   1 
ATOM   2126  C CB  . ASP B  2  41  ? -47.512 9.699   27.474  1.00 96.26  ? 41  ASP B CB  1 
ATOM   2127  C CG  . ASP B  2  41  ? -48.854 10.337  27.801  1.00 99.08  ? 41  ASP B CG  1 
ATOM   2128  O OD1 . ASP B  2  41  ? -49.398 10.079  28.897  1.00 100.70 ? 41  ASP B OD1 1 
ATOM   2129  O OD2 . ASP B  2  41  ? -49.375 11.087  26.949  1.00 102.44 ? 41  ASP B OD2 1 
ATOM   2130  N N   . GLY B  2  42  ? -46.521 11.934  29.872  1.00 95.93  ? 42  GLY B N   1 
ATOM   2131  C CA  . GLY B  2  42  ? -46.190 13.329  30.160  1.00 94.85  ? 42  GLY B CA  1 
ATOM   2132  C C   . GLY B  2  42  ? -46.406 13.735  31.606  1.00 94.17  ? 42  GLY B C   1 
ATOM   2133  O O   . GLY B  2  42  ? -46.536 12.884  32.488  1.00 93.57  ? 42  GLY B O   1 
ATOM   2134  N N   . VAL B  2  43  ? -46.434 15.046  31.842  1.00 91.71  ? 43  VAL B N   1 
ATOM   2135  C CA  . VAL B  2  43  ? -46.669 15.618  33.172  1.00 88.95  ? 43  VAL B CA  1 
ATOM   2136  C C   . VAL B  2  43  ? -47.271 17.024  33.032  1.00 86.82  ? 43  VAL B C   1 
ATOM   2137  O O   . VAL B  2  43  ? -46.917 17.766  32.113  1.00 87.27  ? 43  VAL B O   1 
ATOM   2138  C CB  . VAL B  2  43  ? -45.379 15.612  34.040  1.00 87.54  ? 43  VAL B CB  1 
ATOM   2139  C CG1 . VAL B  2  43  ? -44.314 16.549  33.479  1.00 85.68  ? 43  VAL B CG1 1 
ATOM   2140  C CG2 . VAL B  2  43  ? -45.689 15.938  35.495  1.00 86.19  ? 43  VAL B CG2 1 
ATOM   2141  N N   . LEU B  2  44  ? -48.188 17.378  33.932  1.00 86.06  ? 44  LEU B N   1 
ATOM   2142  C CA  . LEU B  2  44  ? -48.916 18.647  33.825  1.00 86.05  ? 44  LEU B CA  1 
ATOM   2143  C C   . LEU B  2  44  ? -49.074 19.409  35.143  1.00 86.72  ? 44  LEU B C   1 
ATOM   2144  O O   . LEU B  2  44  ? -48.973 18.830  36.228  1.00 88.42  ? 44  LEU B O   1 
ATOM   2145  C CB  . LEU B  2  44  ? -50.287 18.443  33.145  1.00 87.46  ? 44  LEU B CB  1 
ATOM   2146  C CG  . LEU B  2  44  ? -51.443 17.578  33.692  1.00 88.05  ? 44  LEU B CG  1 
ATOM   2147  C CD1 . LEU B  2  44  ? -51.048 16.119  33.887  1.00 90.96  ? 44  LEU B CD1 1 
ATOM   2148  C CD2 . LEU B  2  44  ? -52.072 18.136  34.965  1.00 85.64  ? 44  LEU B CD2 1 
ATOM   2149  N N   . LEU B  2  45  ? -49.320 20.713  35.022  1.00 87.14  ? 45  LEU B N   1 
ATOM   2150  C CA  . LEU B  2  45  ? -49.630 21.580  36.158  1.00 86.71  ? 45  LEU B CA  1 
ATOM   2151  C C   . LEU B  2  45  ? -51.005 22.216  35.978  1.00 88.89  ? 45  LEU B C   1 
ATOM   2152  O O   . LEU B  2  45  ? -51.409 22.529  34.856  1.00 89.48  ? 45  LEU B O   1 
ATOM   2153  C CB  . LEU B  2  45  ? -48.576 22.681  36.309  1.00 84.70  ? 45  LEU B CB  1 
ATOM   2154  C CG  . LEU B  2  45  ? -47.177 22.327  36.819  1.00 82.64  ? 45  LEU B CG  1 
ATOM   2155  C CD1 . LEU B  2  45  ? -46.214 23.468  36.530  1.00 81.20  ? 45  LEU B CD1 1 
ATOM   2156  C CD2 . LEU B  2  45  ? -47.183 21.994  38.305  1.00 83.00  ? 45  LEU B CD2 1 
ATOM   2157  N N   . ALA B  2  46  ? -51.713 22.405  37.089  1.00 90.64  ? 46  ALA B N   1 
ATOM   2158  C CA  . ALA B  2  46  ? -53.026 23.048  37.082  1.00 92.92  ? 46  ALA B CA  1 
ATOM   2159  C C   . ALA B  2  46  ? -53.158 24.014  38.257  1.00 94.63  ? 46  ALA B C   1 
ATOM   2160  O O   . ALA B  2  46  ? -53.019 23.618  39.417  1.00 94.39  ? 46  ALA B O   1 
ATOM   2161  C CB  . ALA B  2  46  ? -54.133 22.005  37.111  1.00 93.23  ? 46  ALA B CB  1 
ATOM   2162  N N   . ALA B  2  47  ? -53.427 25.280  37.946  1.00 95.86  ? 47  ALA B N   1 
ATOM   2163  C CA  . ALA B  2  47  ? -53.479 26.332  38.959  1.00 97.13  ? 47  ALA B CA  1 
ATOM   2164  C C   . ALA B  2  47  ? -54.742 27.186  38.864  1.00 98.61  ? 47  ALA B C   1 
ATOM   2165  O O   . ALA B  2  47  ? -55.289 27.392  37.778  1.00 99.35  ? 47  ALA B O   1 
ATOM   2166  C CB  . ALA B  2  47  ? -52.237 27.208  38.872  1.00 96.13  ? 47  ALA B CB  1 
ATOM   2167  N N   . GLU B  2  48  ? -55.194 27.674  40.017  1.00 98.98  ? 48  GLU B N   1 
ATOM   2168  C CA  . GLU B  2  48  ? -56.339 28.573  40.104  1.00 98.70  ? 48  GLU B CA  1 
ATOM   2169  C C   . GLU B  2  48  ? -55.876 30.020  39.952  1.00 98.70  ? 48  GLU B C   1 
ATOM   2170  O O   . GLU B  2  48  ? -55.126 30.529  40.789  1.00 98.67  ? 48  GLU B O   1 
ATOM   2171  C CB  . GLU B  2  48  ? -57.061 28.381  41.443  1.00 99.10  ? 48  GLU B CB  1 
ATOM   2172  C CG  . GLU B  2  48  ? -58.208 29.351  41.698  1.00 100.35 ? 48  GLU B CG  1 
ATOM   2173  C CD  . GLU B  2  48  ? -58.668 29.365  43.146  1.00 99.65  ? 48  GLU B CD  1 
ATOM   2174  O OE1 . GLU B  2  48  ? -58.460 28.361  43.862  1.00 100.55 ? 48  GLU B OE1 1 
ATOM   2175  O OE2 . GLU B  2  48  ? -59.246 30.387  43.572  1.00 100.23 ? 48  GLU B OE2 1 
ATOM   2176  N N   . ARG B  2  49  ? -56.322 30.674  38.881  1.00 98.16  ? 49  ARG B N   1 
ATOM   2177  C CA  . ARG B  2  49  ? -55.981 32.075  38.636  1.00 98.13  ? 49  ARG B CA  1 
ATOM   2178  C C   . ARG B  2  49  ? -56.759 32.994  39.572  1.00 98.01  ? 49  ARG B C   1 
ATOM   2179  O O   . ARG B  2  49  ? -57.992 33.013  39.559  1.00 98.95  ? 49  ARG B O   1 
ATOM   2180  C CB  . ARG B  2  49  ? -56.228 32.462  37.173  1.00 99.97  ? 49  ARG B CB  1 
ATOM   2181  C CG  . ARG B  2  49  ? -55.296 31.786  36.179  1.00 102.89 ? 49  ARG B CG  1 
ATOM   2182  C CD  . ARG B  2  49  ? -54.970 32.692  35.001  1.00 105.64 ? 49  ARG B CD  1 
ATOM   2183  N NE  . ARG B  2  49  ? -56.131 32.968  34.156  1.00 110.15 ? 49  ARG B NE  1 
ATOM   2184  C CZ  . ARG B  2  49  ? -56.328 32.445  32.948  1.00 115.04 ? 49  ARG B CZ  1 
ATOM   2185  N NH1 . ARG B  2  49  ? -55.440 31.613  32.420  1.00 114.90 ? 49  ARG B NH1 1 
ATOM   2186  N NH2 . ARG B  2  49  ? -57.416 32.763  32.262  1.00 117.83 ? 49  ARG B NH2 1 
ATOM   2187  N N   . ARG B  2  50  ? -56.024 33.745  40.389  1.00 96.96  ? 50  ARG B N   1 
ATOM   2188  C CA  . ARG B  2  50  ? -56.626 34.640  41.373  1.00 96.39  ? 50  ARG B CA  1 
ATOM   2189  C C   . ARG B  2  50  ? -56.866 36.031  40.794  1.00 100.28 ? 50  ARG B C   1 
ATOM   2190  O O   . ARG B  2  50  ? -57.775 36.743  41.229  1.00 101.85 ? 50  ARG B O   1 
ATOM   2191  C CB  . ARG B  2  50  ? -55.750 34.730  42.625  1.00 92.94  ? 50  ARG B CB  1 
ATOM   2192  C CG  . ARG B  2  50  ? -56.533 34.820  43.925  1.00 89.88  ? 50  ARG B CG  1 
ATOM   2193  C CD  . ARG B  2  50  ? -57.097 33.461  44.315  1.00 89.63  ? 50  ARG B CD  1 
ATOM   2194  N NE  . ARG B  2  50  ? -57.959 33.526  45.493  1.00 94.22  ? 50  ARG B NE  1 
ATOM   2195  C CZ  . ARG B  2  50  ? -57.532 33.426  46.749  1.00 96.93  ? 50  ARG B CZ  1 
ATOM   2196  N NH1 . ARG B  2  50  ? -56.242 33.263  47.009  1.00 95.37  ? 50  ARG B NH1 1 
ATOM   2197  N NH2 . ARG B  2  50  ? -58.398 33.493  47.750  1.00 100.05 ? 50  ARG B NH2 1 
ATOM   2198  N N   . ASN B  2  51  ? -56.044 36.412  39.818  1.00 103.80 ? 51  ASN B N   1 
ATOM   2199  C CA  . ASN B  2  51  ? -56.209 37.677  39.110  1.00 107.15 ? 51  ASN B CA  1 
ATOM   2200  C C   . ASN B  2  51  ? -57.362 37.592  38.111  1.00 106.55 ? 51  ASN B C   1 
ATOM   2201  O O   . ASN B  2  51  ? -57.164 37.268  36.936  1.00 107.13 ? 51  ASN B O   1 
ATOM   2202  C CB  . ASN B  2  51  ? -54.908 38.083  38.404  1.00 107.42 ? 51  ASN B CB  1 
ATOM   2203  C CG  . ASN B  2  51  ? -53.744 38.268  39.366  1.00 108.04 ? 51  ASN B CG  1 
ATOM   2204  O OD1 . ASN B  2  51  ? -53.848 37.982  40.561  1.00 109.37 ? 51  ASN B OD1 1 
ATOM   2205  N ND2 . ASN B  2  51  ? -52.622 38.748  38.842  1.00 100.42 ? 51  ASN B ND2 1 
ATOM   2206  N N   . ILE B  2  52  ? -58.569 37.871  38.597  1.00 107.14 ? 52  ILE B N   1 
ATOM   2207  C CA  . ILE B  2  52  ? -59.775 37.829  37.769  1.00 107.78 ? 52  ILE B CA  1 
ATOM   2208  C C   . ILE B  2  52  ? -60.553 39.145  37.834  1.00 109.03 ? 52  ILE B C   1 
ATOM   2209  O O   . ILE B  2  52  ? -61.153 39.482  38.859  1.00 110.54 ? 52  ILE B O   1 
ATOM   2210  C CB  . ILE B  2  52  ? -60.692 36.629  38.117  1.00 106.13 ? 52  ILE B CB  1 
ATOM   2211  C CG1 . ILE B  2  52  ? -60.809 36.442  39.637  1.00 105.77 ? 52  ILE B CG1 1 
ATOM   2212  C CG2 . ILE B  2  52  ? -60.169 35.359  37.457  1.00 104.44 ? 52  ILE B CG2 1 
ATOM   2213  C CD1 . ILE B  2  52  ? -62.084 35.758  40.088  1.00 104.78 ? 52  ILE B CD1 1 
ATOM   2214  N N   . HIS B  2  53  ? -60.520 39.888  36.730  1.00 109.25 ? 53  HIS B N   1 
ATOM   2215  C CA  . HIS B  2  53  ? -61.218 41.167  36.618  1.00 111.41 ? 53  HIS B CA  1 
ATOM   2216  C C   . HIS B  2  53  ? -61.574 41.445  35.185  1.00 113.85 ? 53  HIS B C   1 
ATOM   2217  O O   . HIS B  2  53  ? -60.957 40.898  34.266  1.00 112.98 ? 53  HIS B O   1 
ATOM   2218  C CB  . HIS B  2  53  ? -60.365 42.298  37.186  1.00 110.60 ? 53  HIS B CB  1 
ATOM   2219  C CG  . HIS B  2  53  ? -61.165 43.496  37.644  1.00 111.42 ? 53  HIS B CG  1 
ATOM   2220  N ND1 . HIS B  2  53  ? -61.329 44.591  36.881  1.00 110.46 ? 53  HIS B ND1 1 
ATOM   2221  C CD2 . HIS B  2  53  ? -61.852 43.737  38.832  1.00 111.52 ? 53  HIS B CD2 1 
ATOM   2222  C CE1 . HIS B  2  53  ? -62.080 45.490  37.545  1.00 110.78 ? 53  HIS B CE1 1 
ATOM   2223  N NE2 . HIS B  2  53  ? -62.400 44.966  38.738  1.00 110.84 ? 53  HIS B NE2 1 
ATOM   2224  N N   . LYS B  2  54  ? -62.574 42.300  34.987  1.00 116.66 ? 54  LYS B N   1 
ATOM   2225  C CA  . LYS B  2  54  ? -63.076 42.628  33.654  1.00 120.12 ? 54  LYS B CA  1 
ATOM   2226  C C   . LYS B  2  54  ? -62.072 43.436  32.828  1.00 117.58 ? 54  LYS B C   1 
ATOM   2227  O O   . LYS B  2  54  ? -61.979 43.259  31.612  1.00 118.97 ? 54  LYS B O   1 
ATOM   2228  C CB  . LYS B  2  54  ? -64.407 43.381  33.762  1.00 124.64 ? 54  LYS B CB  1 
ATOM   2229  C CG  . LYS B  2  54  ? -65.233 43.389  32.485  1.00 129.03 ? 54  LYS B CG  1 
ATOM   2230  C CD  . LYS B  2  54  ? -66.524 44.168  32.668  1.00 134.35 ? 54  LYS B CD  1 
ATOM   2231  C CE  . LYS B  2  54  ? -67.342 44.184  31.388  1.00 139.20 ? 54  LYS B CE  1 
ATOM   2232  N NZ  . LYS B  2  54  ? -68.583 44.993  31.533  1.00 140.50 ? 54  LYS B NZ  1 
ATOM   2233  N N   . LEU B  2  55  ? -61.319 44.309  33.495  1.00 114.11 ? 55  LEU B N   1 
ATOM   2234  C CA  . LEU B  2  55  ? -60.417 45.236  32.804  1.00 111.64 ? 55  LEU B CA  1 
ATOM   2235  C C   . LEU B  2  55  ? -58.933 44.854  32.886  1.00 107.49 ? 55  LEU B C   1 
ATOM   2236  O O   . LEU B  2  55  ? -58.058 45.717  32.766  1.00 108.24 ? 55  LEU B O   1 
ATOM   2237  C CB  . LEU B  2  55  ? -60.633 46.677  33.294  1.00 111.58 ? 55  LEU B CB  1 
ATOM   2238  C CG  . LEU B  2  55  ? -62.043 47.266  33.205  1.00 114.60 ? 55  LEU B CG  1 
ATOM   2239  C CD1 . LEU B  2  55  ? -62.711 47.235  34.569  1.00 116.69 ? 55  LEU B CD1 1 
ATOM   2240  C CD2 . LEU B  2  55  ? -62.000 48.691  32.681  1.00 110.23 ? 55  LEU B CD2 1 
ATOM   2241  N N   . LEU B  2  56  ? -58.652 43.567  33.084  1.00 104.25 ? 56  LEU B N   1 
ATOM   2242  C CA  . LEU B  2  56  ? -57.277 43.069  33.029  1.00 100.66 ? 56  LEU B CA  1 
ATOM   2243  C C   . LEU B  2  56  ? -56.847 42.868  31.579  1.00 105.12 ? 56  LEU B C   1 
ATOM   2244  O O   . LEU B  2  56  ? -57.606 42.335  30.767  1.00 106.83 ? 56  LEU B O   1 
ATOM   2245  C CB  . LEU B  2  56  ? -57.122 41.769  33.822  1.00 96.67  ? 56  LEU B CB  1 
ATOM   2246  C CG  . LEU B  2  56  ? -57.060 41.861  35.350  1.00 94.39  ? 56  LEU B CG  1 
ATOM   2247  C CD1 . LEU B  2  56  ? -57.155 40.470  35.952  1.00 96.95  ? 56  LEU B CD1 1 
ATOM   2248  C CD2 . LEU B  2  56  ? -55.796 42.559  35.832  1.00 93.04  ? 56  LEU B CD2 1 
ATOM   2249  N N   . ASP B  2  57  ? -55.625 43.295  31.269  1.00 109.64 ? 57  ASP B N   1 
ATOM   2250  C CA  . ASP B  2  57  ? -55.140 43.342  29.888  1.00 115.21 ? 57  ASP B CA  1 
ATOM   2251  C C   . ASP B  2  57  ? -54.796 41.974  29.296  1.00 119.68 ? 57  ASP B C   1 
ATOM   2252  O O   . ASP B  2  57  ? -55.111 41.711  28.133  1.00 125.85 ? 57  ASP B O   1 
ATOM   2253  C CB  . ASP B  2  57  ? -53.940 44.291  29.772  1.00 116.12 ? 57  ASP B CB  1 
ATOM   2254  C CG  . ASP B  2  57  ? -53.665 44.723  28.337  1.00 118.32 ? 57  ASP B CG  1 
ATOM   2255  O OD1 . ASP B  2  57  ? -54.577 44.633  27.486  1.00 117.96 ? 57  ASP B OD1 1 
ATOM   2256  O OD2 . ASP B  2  57  ? -52.530 45.163  28.061  1.00 120.80 ? 57  ASP B OD2 1 
ATOM   2257  N N   . GLU B  2  58  ? -54.161 41.118  30.100  1.00 122.12 ? 58  GLU B N   1 
ATOM   2258  C CA  . GLU B  2  58  ? -53.686 39.794  29.666  1.00 127.75 ? 58  GLU B CA  1 
ATOM   2259  C C   . GLU B  2  58  ? -52.634 39.901  28.553  1.00 126.39 ? 58  GLU B C   1 
ATOM   2260  O O   . GLU B  2  58  ? -52.960 39.897  27.361  1.00 125.66 ? 58  GLU B O   1 
ATOM   2261  C CB  . GLU B  2  58  ? -54.858 38.877  29.263  1.00 133.98 ? 58  GLU B CB  1 
ATOM   2262  C CG  . GLU B  2  58  ? -54.472 37.449  28.886  1.00 140.45 ? 58  GLU B CG  1 
ATOM   2263  C CD  . GLU B  2  58  ? -53.968 36.629  30.061  1.00 146.55 ? 58  GLU B CD  1 
ATOM   2264  O OE1 . GLU B  2  58  ? -54.544 36.736  31.166  1.00 146.90 ? 58  GLU B OE1 1 
ATOM   2265  O OE2 . GLU B  2  58  ? -52.997 35.865  29.877  1.00 148.16 ? 58  GLU B OE2 1 
ATOM   2266  N N   . VAL B  2  59  ? -51.372 40.007  28.963  1.00 124.44 ? 59  VAL B N   1 
ATOM   2267  C CA  . VAL B  2  59  ? -50.250 40.156  28.033  1.00 120.09 ? 59  VAL B CA  1 
ATOM   2268  C C   . VAL B  2  59  ? -49.355 38.915  28.059  1.00 116.33 ? 59  VAL B C   1 
ATOM   2269  O O   . VAL B  2  59  ? -48.949 38.410  27.010  1.00 116.24 ? 59  VAL B O   1 
ATOM   2270  C CB  . VAL B  2  59  ? -49.406 41.414  28.351  1.00 118.57 ? 59  VAL B CB  1 
ATOM   2271  C CG1 . VAL B  2  59  ? -48.354 41.647  27.275  1.00 115.61 ? 59  VAL B CG1 1 
ATOM   2272  C CG2 . VAL B  2  59  ? -50.293 42.644  28.489  1.00 120.17 ? 59  VAL B CG2 1 
ATOM   2273  N N   . PHE B  2  60  ? -49.065 38.431  29.266  1.00 113.15 ? 60  PHE B N   1 
ATOM   2274  C CA  . PHE B  2  60  ? -48.165 37.296  29.471  1.00 108.44 ? 60  PHE B CA  1 
ATOM   2275  C C   . PHE B  2  60  ? -48.801 35.975  29.045  1.00 104.50 ? 60  PHE B C   1 
ATOM   2276  O O   . PHE B  2  60  ? -50.027 35.857  28.985  1.00 104.26 ? 60  PHE B O   1 
ATOM   2277  C CB  . PHE B  2  60  ? -47.726 37.219  30.940  1.00 109.76 ? 60  PHE B CB  1 
ATOM   2278  C CG  . PHE B  2  60  ? -47.334 38.546  31.529  1.00 113.62 ? 60  PHE B CG  1 
ATOM   2279  C CD1 . PHE B  2  60  ? -48.220 39.249  32.340  1.00 113.72 ? 60  PHE B CD1 1 
ATOM   2280  C CD2 . PHE B  2  60  ? -46.082 39.098  31.271  1.00 113.97 ? 60  PHE B CD2 1 
ATOM   2281  C CE1 . PHE B  2  60  ? -47.865 40.474  32.884  1.00 115.23 ? 60  PHE B CE1 1 
ATOM   2282  C CE2 . PHE B  2  60  ? -45.721 40.323  31.811  1.00 114.73 ? 60  PHE B CE2 1 
ATOM   2283  C CZ  . PHE B  2  60  ? -46.615 41.012  32.618  1.00 112.44 ? 60  PHE B CZ  1 
ATOM   2284  N N   . PHE B  2  61  ? -47.954 34.989  28.753  1.00 102.55 ? 61  PHE B N   1 
ATOM   2285  C CA  . PHE B  2  61  ? -48.401 33.654  28.355  1.00 101.12 ? 61  PHE B CA  1 
ATOM   2286  C C   . PHE B  2  61  ? -49.093 32.920  29.501  1.00 96.25  ? 61  PHE B C   1 
ATOM   2287  O O   . PHE B  2  61  ? -49.999 32.116  29.274  1.00 96.27  ? 61  PHE B O   1 
ATOM   2288  C CB  . PHE B  2  61  ? -47.223 32.820  27.841  1.00 106.90 ? 61  PHE B CB  1 
ATOM   2289  C CG  . PHE B  2  61  ? -46.633 33.324  26.554  1.00 114.45 ? 61  PHE B CG  1 
ATOM   2290  C CD1 . PHE B  2  61  ? -47.149 32.914  25.328  1.00 119.46 ? 61  PHE B CD1 1 
ATOM   2291  C CD2 . PHE B  2  61  ? -45.554 34.203  26.565  1.00 115.01 ? 61  PHE B CD2 1 
ATOM   2292  C CE1 . PHE B  2  61  ? -46.605 33.376  24.138  1.00 123.69 ? 61  PHE B CE1 1 
ATOM   2293  C CE2 . PHE B  2  61  ? -45.007 34.669  25.379  1.00 117.17 ? 61  PHE B CE2 1 
ATOM   2294  C CZ  . PHE B  2  61  ? -45.532 34.255  24.164  1.00 123.60 ? 61  PHE B CZ  1 
ATOM   2295  N N   . SER B  2  62  ? -48.655 33.202  30.726  1.00 94.84  ? 62  SER B N   1 
ATOM   2296  C CA  . SER B  2  62  ? -49.216 32.578  31.920  1.00 93.28  ? 62  SER B CA  1 
ATOM   2297  C C   . SER B  2  62  ? -49.193 33.524  33.120  1.00 94.14  ? 62  SER B C   1 
ATOM   2298  O O   . SER B  2  62  ? -48.490 34.539  33.111  1.00 96.58  ? 62  SER B O   1 
ATOM   2299  C CB  . SER B  2  62  ? -48.463 31.287  32.250  1.00 91.63  ? 62  SER B CB  1 
ATOM   2300  O OG  . SER B  2  62  ? -48.981 30.685  33.422  1.00 92.50  ? 62  SER B OG  1 
ATOM   2301  N N   . GLU B  2  63  ? -49.968 33.182  34.147  1.00 94.10  ? 63  GLU B N   1 
ATOM   2302  C CA  . GLU B  2  63  ? -50.036 33.970  35.375  1.00 95.62  ? 63  GLU B CA  1 
ATOM   2303  C C   . GLU B  2  63  ? -49.128 33.398  36.465  1.00 95.22  ? 63  GLU B C   1 
ATOM   2304  O O   . GLU B  2  63  ? -48.346 34.132  37.075  1.00 95.30  ? 63  GLU B O   1 
ATOM   2305  C CB  . GLU B  2  63  ? -51.482 34.062  35.875  1.00 97.29  ? 63  GLU B CB  1 
ATOM   2306  C CG  . GLU B  2  63  ? -51.677 34.972  37.080  1.00 99.71  ? 63  GLU B CG  1 
ATOM   2307  C CD  . GLU B  2  63  ? -53.090 34.930  37.629  1.00 101.59 ? 63  GLU B CD  1 
ATOM   2308  O OE1 . GLU B  2  63  ? -54.040 35.218  36.869  1.00 103.12 ? 63  GLU B OE1 1 
ATOM   2309  O OE2 . GLU B  2  63  ? -53.253 34.618  38.828  1.00 101.25 ? 63  GLU B OE2 1 
ATOM   2310  N N   . LYS B  2  64  ? -49.236 32.091  36.703  1.00 93.78  ? 64  LYS B N   1 
ATOM   2311  C CA  . LYS B  2  64  ? -48.486 31.433  37.776  1.00 92.14  ? 64  LYS B CA  1 
ATOM   2312  C C   . LYS B  2  64  ? -47.533 30.336  37.290  1.00 90.61  ? 64  LYS B C   1 
ATOM   2313  O O   . LYS B  2  64  ? -46.694 29.859  38.058  1.00 90.09  ? 64  LYS B O   1 
ATOM   2314  C CB  . LYS B  2  64  ? -49.436 30.883  38.846  1.00 92.77  ? 64  LYS B CB  1 
ATOM   2315  C CG  . LYS B  2  64  ? -50.187 31.955  39.625  1.00 94.02  ? 64  LYS B CG  1 
ATOM   2316  C CD  . LYS B  2  64  ? -50.673 31.449  40.975  1.00 95.66  ? 64  LYS B CD  1 
ATOM   2317  C CE  . LYS B  2  64  ? -51.828 30.470  40.839  1.00 99.21  ? 64  LYS B CE  1 
ATOM   2318  N NZ  . LYS B  2  64  ? -52.277 29.953  42.161  1.00 102.43 ? 64  LYS B NZ  1 
ATOM   2319  N N   . ILE B  2  65  ? -47.664 29.939  36.026  1.00 88.33  ? 65  ILE B N   1 
ATOM   2320  C CA  . ILE B  2  65  ? -46.757 28.954  35.432  1.00 86.29  ? 65  ILE B CA  1 
ATOM   2321  C C   . ILE B  2  65  ? -45.531 29.663  34.855  1.00 81.81  ? 65  ILE B C   1 
ATOM   2322  O O   . ILE B  2  65  ? -45.654 30.524  33.981  1.00 82.06  ? 65  ILE B O   1 
ATOM   2323  C CB  . ILE B  2  65  ? -47.443 28.097  34.335  1.00 88.79  ? 65  ILE B CB  1 
ATOM   2324  C CG1 . ILE B  2  65  ? -48.811 27.561  34.804  1.00 91.26  ? 65  ILE B CG1 1 
ATOM   2325  C CG2 . ILE B  2  65  ? -46.517 26.983  33.853  1.00 88.38  ? 65  ILE B CG2 1 
ATOM   2326  C CD1 . ILE B  2  65  ? -48.773 26.568  35.951  1.00 90.53  ? 65  ILE B CD1 1 
ATOM   2327  N N   . TYR B  2  66  ? -44.354 29.295  35.358  1.00 77.71  ? 66  TYR B N   1 
ATOM   2328  C CA  . TYR B  2  66  ? -43.096 29.899  34.926  1.00 74.37  ? 66  TYR B CA  1 
ATOM   2329  C C   . TYR B  2  66  ? -42.196 28.890  34.217  1.00 72.20  ? 66  TYR B C   1 
ATOM   2330  O O   . TYR B  2  66  ? -42.027 27.759  34.681  1.00 72.69  ? 66  TYR B O   1 
ATOM   2331  C CB  . TYR B  2  66  ? -42.351 30.503  36.121  1.00 75.05  ? 66  TYR B CB  1 
ATOM   2332  C CG  . TYR B  2  66  ? -43.006 31.729  36.721  1.00 76.37  ? 66  TYR B CG  1 
ATOM   2333  C CD1 . TYR B  2  66  ? -43.937 31.612  37.752  1.00 77.58  ? 66  TYR B CD1 1 
ATOM   2334  C CD2 . TYR B  2  66  ? -42.682 33.008  36.268  1.00 77.47  ? 66  TYR B CD2 1 
ATOM   2335  C CE1 . TYR B  2  66  ? -44.535 32.733  38.308  1.00 79.14  ? 66  TYR B CE1 1 
ATOM   2336  C CE2 . TYR B  2  66  ? -43.274 34.135  36.818  1.00 78.82  ? 66  TYR B CE2 1 
ATOM   2337  C CZ  . TYR B  2  66  ? -44.199 33.992  37.837  1.00 79.72  ? 66  TYR B CZ  1 
ATOM   2338  O OH  . TYR B  2  66  ? -44.791 35.106  38.388  1.00 81.18  ? 66  TYR B OH  1 
ATOM   2339  N N   . LYS B  2  67  ? -41.626 29.312  33.091  1.00 70.84  ? 67  LYS B N   1 
ATOM   2340  C CA  . LYS B  2  67  ? -40.653 28.507  32.358  1.00 69.85  ? 67  LYS B CA  1 
ATOM   2341  C C   . LYS B  2  67  ? -39.252 28.801  32.893  1.00 71.18  ? 67  LYS B C   1 
ATOM   2342  O O   . LYS B  2  67  ? -38.822 29.958  32.930  1.00 71.81  ? 67  LYS B O   1 
ATOM   2343  C CB  . LYS B  2  67  ? -40.737 28.801  30.856  1.00 67.77  ? 67  LYS B CB  1 
ATOM   2344  C CG  . LYS B  2  67  ? -39.970 27.830  29.969  1.00 66.09  ? 67  LYS B CG  1 
ATOM   2345  C CD  . LYS B  2  67  ? -40.005 28.279  28.516  1.00 65.75  ? 67  LYS B CD  1 
ATOM   2346  C CE  . LYS B  2  67  ? -39.053 27.472  27.647  1.00 66.53  ? 67  LYS B CE  1 
ATOM   2347  N NZ  . LYS B  2  67  ? -39.569 26.113  27.327  1.00 68.35  ? 67  LYS B NZ  1 
ATOM   2348  N N   . LEU B  2  68  ? -38.553 27.750  33.313  1.00 72.94  ? 68  LEU B N   1 
ATOM   2349  C CA  . LEU B  2  68  ? -37.225 27.887  33.909  1.00 75.00  ? 68  LEU B CA  1 
ATOM   2350  C C   . LEU B  2  68  ? -36.129 27.383  32.976  1.00 78.61  ? 68  LEU B C   1 
ATOM   2351  O O   . LEU B  2  68  ? -35.078 28.015  32.839  1.00 79.77  ? 68  LEU B O   1 
ATOM   2352  C CB  . LEU B  2  68  ? -37.150 27.138  35.245  1.00 74.42  ? 68  LEU B CB  1 
ATOM   2353  C CG  . LEU B  2  68  ? -38.218 27.387  36.315  1.00 74.28  ? 68  LEU B CG  1 
ATOM   2354  C CD1 . LEU B  2  68  ? -38.053 26.385  37.447  1.00 74.39  ? 68  LEU B CD1 1 
ATOM   2355  C CD2 . LEU B  2  68  ? -38.174 28.815  36.844  1.00 74.93  ? 68  LEU B CD2 1 
ATOM   2356  N N   . ASN B  2  69  ? -36.385 26.242  32.343  1.00 81.43  ? 69  ASN B N   1 
ATOM   2357  C CA  . ASN B  2  69  ? -35.418 25.593  31.467  1.00 85.54  ? 69  ASN B CA  1 
ATOM   2358  C C   . ASN B  2  69  ? -36.083 25.099  30.182  1.00 88.18  ? 69  ASN B C   1 
ATOM   2359  O O   . ASN B  2  69  ? -37.307 25.169  30.043  1.00 87.63  ? 69  ASN B O   1 
ATOM   2360  C CB  . ASN B  2  69  ? -34.743 24.432  32.212  1.00 87.57  ? 69  ASN B CB  1 
ATOM   2361  C CG  . ASN B  2  69  ? -33.434 23.999  31.573  1.00 92.82  ? 69  ASN B CG  1 
ATOM   2362  O OD1 . ASN B  2  69  ? -32.668 24.820  31.065  1.00 96.42  ? 69  ASN B OD1 1 
ATOM   2363  N ND2 . ASN B  2  69  ? -33.167 22.699  31.605  1.00 97.08  ? 69  ASN B ND2 1 
ATOM   2364  N N   . GLU B  2  70  ? -35.271 24.613  29.245  1.00 91.42  ? 70  GLU B N   1 
ATOM   2365  C CA  . GLU B  2  70  ? -35.759 24.035  27.994  1.00 95.96  ? 70  GLU B CA  1 
ATOM   2366  C C   . GLU B  2  70  ? -36.594 22.777  28.250  1.00 92.61  ? 70  GLU B C   1 
ATOM   2367  O O   . GLU B  2  70  ? -37.528 22.480  27.501  1.00 92.90  ? 70  GLU B O   1 
ATOM   2368  C CB  . GLU B  2  70  ? -34.580 23.711  27.067  1.00 101.70 ? 70  GLU B CB  1 
ATOM   2369  C CG  . GLU B  2  70  ? -34.957 23.321  25.642  1.00 108.57 ? 70  GLU B CG  1 
ATOM   2370  C CD  . GLU B  2  70  ? -35.205 24.516  24.738  1.00 118.15 ? 70  GLU B CD  1 
ATOM   2371  O OE1 . GLU B  2  70  ? -36.173 25.270  24.977  1.00 115.97 ? 70  GLU B OE1 1 
ATOM   2372  O OE2 . GLU B  2  70  ? -34.435 24.694  23.772  1.00 124.01 ? 70  GLU B OE2 1 
ATOM   2373  N N   . ASP B  2  71  ? -36.254 22.057  29.317  1.00 88.55  ? 71  ASP B N   1 
ATOM   2374  C CA  . ASP B  2  71  ? -36.916 20.800  29.658  1.00 84.73  ? 71  ASP B CA  1 
ATOM   2375  C C   . ASP B  2  71  ? -37.698 20.869  30.974  1.00 80.82  ? 71  ASP B C   1 
ATOM   2376  O O   . ASP B  2  71  ? -38.190 19.846  31.455  1.00 82.45  ? 71  ASP B O   1 
ATOM   2377  C CB  . ASP B  2  71  ? -35.889 19.660  29.728  1.00 85.17  ? 71  ASP B CB  1 
ATOM   2378  C CG  . ASP B  2  71  ? -35.025 19.560  28.478  1.00 86.60  ? 71  ASP B CG  1 
ATOM   2379  O OD1 . ASP B  2  71  ? -35.550 19.735  27.357  1.00 88.42  ? 71  ASP B OD1 1 
ATOM   2380  O OD2 . ASP B  2  71  ? -33.813 19.294  28.620  1.00 85.26  ? 71  ASP B OD2 1 
ATOM   2381  N N   . MET B  2  72  ? -37.821 22.065  31.549  1.00 77.22  ? 72  MET B N   1 
ATOM   2382  C CA  . MET B  2  72  ? -38.435 22.215  32.872  1.00 76.11  ? 72  MET B CA  1 
ATOM   2383  C C   . MET B  2  72  ? -39.351 23.434  33.003  1.00 74.04  ? 72  MET B C   1 
ATOM   2384  O O   . MET B  2  72  ? -39.146 24.455  32.343  1.00 74.13  ? 72  MET B O   1 
ATOM   2385  C CB  . MET B  2  72  ? -37.348 22.262  33.949  1.00 77.95  ? 72  MET B CB  1 
ATOM   2386  C CG  . MET B  2  72  ? -37.719 21.546  35.239  1.00 79.95  ? 72  MET B CG  1 
ATOM   2387  S SD  . MET B  2  72  ? -36.436 21.616  36.506  1.00 83.08  ? 72  MET B SD  1 
ATOM   2388  C CE  . MET B  2  72  ? -35.022 20.949  35.628  1.00 81.33  ? 72  MET B CE  1 
ATOM   2389  N N   . ALA B  2  73  ? -40.359 23.307  33.867  1.00 72.89  ? 73  ALA B N   1 
ATOM   2390  C CA  . ALA B  2  73  ? -41.299 24.388  34.177  1.00 71.57  ? 73  ALA B CA  1 
ATOM   2391  C C   . ALA B  2  73  ? -41.792 24.269  35.620  1.00 72.60  ? 73  ALA B C   1 
ATOM   2392  O O   . ALA B  2  73  ? -41.774 23.181  36.199  1.00 73.75  ? 73  ALA B O   1 
ATOM   2393  C CB  . ALA B  2  73  ? -42.474 24.367  33.210  1.00 70.98  ? 73  ALA B CB  1 
ATOM   2394  N N   . CYS B  2  74  ? -42.229 25.386  36.198  1.00 74.29  ? 74  CYS B N   1 
ATOM   2395  C CA  . CYS B  2  74  ? -42.709 25.395  37.581  1.00 76.73  ? 74  CYS B CA  1 
ATOM   2396  C C   . CYS B  2  74  ? -43.998 26.196  37.765  1.00 79.54  ? 74  CYS B C   1 
ATOM   2397  O O   . CYS B  2  74  ? -44.376 26.989  36.902  1.00 80.63  ? 74  CYS B O   1 
ATOM   2398  C CB  . CYS B  2  74  ? -41.623 25.918  38.528  1.00 77.06  ? 74  CYS B CB  1 
ATOM   2399  S SG  . CYS B  2  74  ? -41.368 27.707  38.476  1.00 77.60  ? 74  CYS B SG  1 
ATOM   2400  N N   . SER B  2  75  ? -44.663 25.973  38.898  1.00 81.79  ? 75  SER B N   1 
ATOM   2401  C CA  . SER B  2  75  ? -45.867 26.718  39.267  1.00 83.55  ? 75  SER B CA  1 
ATOM   2402  C C   . SER B  2  75  ? -45.714 27.352  40.648  1.00 82.98  ? 75  SER B C   1 
ATOM   2403  O O   . SER B  2  75  ? -44.858 26.944  41.437  1.00 83.10  ? 75  SER B O   1 
ATOM   2404  C CB  . SER B  2  75  ? -47.096 25.812  39.231  1.00 86.08  ? 75  SER B CB  1 
ATOM   2405  O OG  . SER B  2  75  ? -48.283 26.576  39.346  1.00 89.20  ? 75  SER B OG  1 
ATOM   2406  N N   . VAL B  2  76  ? -46.557 28.342  40.936  1.00 82.28  ? 76  VAL B N   1 
ATOM   2407  C CA  . VAL B  2  76  ? -46.414 29.164  42.139  1.00 81.49  ? 76  VAL B CA  1 
ATOM   2408  C C   . VAL B  2  76  ? -47.643 29.121  43.048  1.00 80.03  ? 76  VAL B C   1 
ATOM   2409  O O   . VAL B  2  76  ? -48.781 29.187  42.579  1.00 81.66  ? 76  VAL B O   1 
ATOM   2410  C CB  . VAL B  2  76  ? -46.064 30.627  41.768  1.00 81.08  ? 76  VAL B CB  1 
ATOM   2411  C CG1 . VAL B  2  76  ? -46.360 31.588  42.913  1.00 80.78  ? 76  VAL B CG1 1 
ATOM   2412  C CG2 . VAL B  2  76  ? -44.606 30.730  41.345  1.00 79.60  ? 76  VAL B CG2 1 
ATOM   2413  N N   . ALA B  2  77  ? -47.390 28.999  44.350  1.00 79.23  ? 77  ALA B N   1 
ATOM   2414  C CA  . ALA B  2  77  ? -48.426 29.101  45.372  1.00 81.06  ? 77  ALA B CA  1 
ATOM   2415  C C   . ALA B  2  77  ? -47.916 29.931  46.549  1.00 82.08  ? 77  ALA B C   1 
ATOM   2416  O O   . ALA B  2  77  ? -46.999 29.516  47.263  1.00 82.66  ? 77  ALA B O   1 
ATOM   2417  C CB  . ALA B  2  77  ? -48.863 27.718  45.832  1.00 81.51  ? 77  ALA B CB  1 
ATOM   2418  N N   . GLY B  2  78  ? -48.505 31.110  46.733  1.00 82.99  ? 78  GLY B N   1 
ATOM   2419  C CA  . GLY B  2  78  ? -48.106 32.025  47.803  1.00 81.39  ? 78  GLY B CA  1 
ATOM   2420  C C   . GLY B  2  78  ? -48.045 33.473  47.354  1.00 79.49  ? 78  GLY B C   1 
ATOM   2421  O O   . GLY B  2  78  ? -48.902 33.936  46.597  1.00 82.05  ? 78  GLY B O   1 
ATOM   2422  N N   . ILE B  2  79  ? -47.026 34.189  47.827  1.00 76.04  ? 79  ILE B N   1 
ATOM   2423  C CA  . ILE B  2  79  ? -46.824 35.597  47.479  1.00 75.69  ? 79  ILE B CA  1 
ATOM   2424  C C   . ILE B  2  79  ? -46.182 35.713  46.097  1.00 77.85  ? 79  ILE B C   1 
ATOM   2425  O O   . ILE B  2  79  ? -45.127 35.127  45.842  1.00 78.44  ? 79  ILE B O   1 
ATOM   2426  C CB  . ILE B  2  79  ? -45.947 36.325  48.524  1.00 73.52  ? 79  ILE B CB  1 
ATOM   2427  C CG1 . ILE B  2  79  ? -46.453 36.046  49.944  1.00 73.31  ? 79  ILE B CG1 1 
ATOM   2428  C CG2 . ILE B  2  79  ? -45.914 37.824  48.251  1.00 75.71  ? 79  ILE B CG2 1 
ATOM   2429  C CD1 . ILE B  2  79  ? -45.402 36.214  51.021  1.00 73.60  ? 79  ILE B CD1 1 
ATOM   2430  N N   . THR B  2  80  ? -46.824 36.478  45.216  1.00 79.54  ? 80  THR B N   1 
ATOM   2431  C CA  . THR B  2  80  ? -46.380 36.619  43.825  1.00 80.17  ? 80  THR B CA  1 
ATOM   2432  C C   . THR B  2  80  ? -45.048 37.360  43.677  1.00 81.19  ? 80  THR B C   1 
ATOM   2433  O O   . THR B  2  80  ? -44.274 37.071  42.762  1.00 81.66  ? 80  THR B O   1 
ATOM   2434  C CB  . THR B  2  80  ? -47.452 37.294  42.944  1.00 80.26  ? 80  THR B CB  1 
ATOM   2435  O OG1 . THR B  2  80  ? -47.941 38.473  43.596  1.00 82.81  ? 80  THR B OG1 1 
ATOM   2436  C CG2 . THR B  2  80  ? -48.615 36.343  42.689  1.00 78.50  ? 80  THR B CG2 1 
ATOM   2437  N N   . SER B  2  81  ? -44.789 38.307  44.578  1.00 82.13  ? 81  SER B N   1 
ATOM   2438  C CA  . SER B  2  81  ? -43.574 39.126  44.524  1.00 82.37  ? 81  SER B CA  1 
ATOM   2439  C C   . SER B  2  81  ? -42.313 38.346  44.901  1.00 82.41  ? 81  SER B C   1 
ATOM   2440  O O   . SER B  2  81  ? -41.278 38.480  44.245  1.00 83.33  ? 81  SER B O   1 
ATOM   2441  C CB  . SER B  2  81  ? -43.716 40.366  45.411  1.00 83.58  ? 81  SER B CB  1 
ATOM   2442  O OG  . SER B  2  81  ? -43.777 40.019  46.783  1.00 83.41  ? 81  SER B OG  1 
ATOM   2443  N N   . ASP B  2  82  ? -42.410 37.539  45.957  1.00 82.19  ? 82  ASP B N   1 
ATOM   2444  C CA  . ASP B  2  82  ? -41.296 36.706  46.415  1.00 80.48  ? 82  ASP B CA  1 
ATOM   2445  C C   . ASP B  2  82  ? -41.023 35.560  45.445  1.00 79.48  ? 82  ASP B C   1 
ATOM   2446  O O   . ASP B  2  82  ? -39.896 35.069  45.351  1.00 78.41  ? 82  ASP B O   1 
ATOM   2447  C CB  . ASP B  2  82  ? -41.577 36.148  47.815  1.00 80.51  ? 82  ASP B CB  1 
ATOM   2448  C CG  . ASP B  2  82  ? -41.808 37.237  48.853  1.00 80.02  ? 82  ASP B CG  1 
ATOM   2449  O OD1 . ASP B  2  82  ? -41.685 38.438  48.524  1.00 81.07  ? 82  ASP B OD1 1 
ATOM   2450  O OD2 . ASP B  2  82  ? -42.117 36.886  50.011  1.00 79.56  ? 82  ASP B OD2 1 
ATOM   2451  N N   . ALA B  2  83  ? -42.066 35.142  44.731  1.00 79.67  ? 83  ALA B N   1 
ATOM   2452  C CA  . ALA B  2  83  ? -41.971 34.080  43.734  1.00 78.15  ? 83  ALA B CA  1 
ATOM   2453  C C   . ALA B  2  83  ? -41.189 34.522  42.499  1.00 77.16  ? 83  ALA B C   1 
ATOM   2454  O O   . ALA B  2  83  ? -40.460 33.726  41.906  1.00 76.17  ? 83  ALA B O   1 
ATOM   2455  C CB  . ALA B  2  83  ? -43.360 33.610  43.340  1.00 78.56  ? 83  ALA B CB  1 
ATOM   2456  N N   . ASN B  2  84  ? -41.348 35.791  42.123  1.00 76.13  ? 84  ASN B N   1 
ATOM   2457  C CA  . ASN B  2  84  ? -40.641 36.370  40.979  1.00 74.61  ? 84  ASN B CA  1 
ATOM   2458  C C   . ASN B  2  84  ? -39.128 36.436  41.182  1.00 74.43  ? 84  ASN B C   1 
ATOM   2459  O O   . ASN B  2  84  ? -38.364 36.427  40.215  1.00 74.64  ? 84  ASN B O   1 
ATOM   2460  C CB  . ASN B  2  84  ? -41.192 37.762  40.653  1.00 73.30  ? 84  ASN B CB  1 
ATOM   2461  C CG  . ASN B  2  84  ? -42.590 37.716  40.061  1.00 72.46  ? 84  ASN B CG  1 
ATOM   2462  O OD1 . ASN B  2  84  ? -42.898 36.870  39.221  1.00 72.02  ? 84  ASN B OD1 1 
ATOM   2463  N ND2 . ASN B  2  84  ? -43.441 38.640  40.489  1.00 71.83  ? 84  ASN B ND2 1 
ATOM   2464  N N   . VAL B  2  85  ? -38.712 36.506  42.444  1.00 73.31  ? 85  VAL B N   1 
ATOM   2465  C CA  . VAL B  2  85  ? -37.297 36.499  42.813  1.00 71.59  ? 85  VAL B CA  1 
ATOM   2466  C C   . VAL B  2  85  ? -36.745 35.072  42.767  1.00 72.79  ? 85  VAL B C   1 
ATOM   2467  O O   . VAL B  2  85  ? -35.632 34.845  42.287  1.00 73.36  ? 85  VAL B O   1 
ATOM   2468  C CB  . VAL B  2  85  ? -37.073 37.114  44.215  1.00 68.51  ? 85  VAL B CB  1 
ATOM   2469  C CG1 . VAL B  2  85  ? -35.590 37.190  44.551  1.00 69.72  ? 85  VAL B CG1 1 
ATOM   2470  C CG2 . VAL B  2  85  ? -37.701 38.499  44.298  1.00 70.04  ? 85  VAL B CG2 1 
ATOM   2471  N N   . LEU B  2  86  ? -37.537 34.120  43.260  1.00 73.44  ? 86  LEU B N   1 
ATOM   2472  C CA  . LEU B  2  86  ? -37.141 32.712  43.310  1.00 74.68  ? 86  LEU B CA  1 
ATOM   2473  C C   . LEU B  2  86  ? -37.092 32.062  41.927  1.00 74.56  ? 86  LEU B C   1 
ATOM   2474  O O   . LEU B  2  86  ? -36.173 31.294  41.634  1.00 74.82  ? 86  LEU B O   1 
ATOM   2475  C CB  . LEU B  2  86  ? -38.070 31.918  44.237  1.00 77.07  ? 86  LEU B CB  1 
ATOM   2476  C CG  . LEU B  2  86  ? -38.026 32.217  45.740  1.00 79.57  ? 86  LEU B CG  1 
ATOM   2477  C CD1 . LEU B  2  86  ? -39.257 31.649  46.431  1.00 81.43  ? 86  LEU B CD1 1 
ATOM   2478  C CD2 . LEU B  2  86  ? -36.753 31.686  46.386  1.00 81.39  ? 86  LEU B CD2 1 
ATOM   2479  N N   . THR B  2  87  ? -38.078 32.373  41.087  1.00 74.49  ? 87  THR B N   1 
ATOM   2480  C CA  . THR B  2  87  ? -38.141 31.842  39.721  1.00 74.06  ? 87  THR B CA  1 
ATOM   2481  C C   . THR B  2  87  ? -37.012 32.383  38.846  1.00 74.48  ? 87  THR B C   1 
ATOM   2482  O O   . THR B  2  87  ? -36.513 31.680  37.964  1.00 74.26  ? 87  THR B O   1 
ATOM   2483  C CB  . THR B  2  87  ? -39.496 32.133  39.043  1.00 73.71  ? 87  THR B CB  1 
ATOM   2484  O OG1 . THR B  2  87  ? -39.845 33.510  39.232  1.00 74.73  ? 87  THR B OG1 1 
ATOM   2485  C CG2 . THR B  2  87  ? -40.592 31.249  39.624  1.00 73.67  ? 87  THR B CG2 1 
ATOM   2486  N N   . ASN B  2  88  ? -36.619 33.631  39.099  1.00 75.25  ? 88  ASN B N   1 
ATOM   2487  C CA  . ASN B  2  88  ? -35.495 34.257  38.407  1.00 76.43  ? 88  ASN B CA  1 
ATOM   2488  C C   . ASN B  2  88  ? -34.166 33.616  38.804  1.00 76.11  ? 88  ASN B C   1 
ATOM   2489  O O   . ASN B  2  88  ? -33.256 33.493  37.981  1.00 75.30  ? 88  ASN B O   1 
ATOM   2490  C CB  . ASN B  2  88  ? -35.468 35.763  38.684  1.00 77.44  ? 88  ASN B CB  1 
ATOM   2491  C CG  . ASN B  2  88  ? -34.595 36.525  37.704  1.00 79.28  ? 88  ASN B CG  1 
ATOM   2492  O OD1 . ASN B  2  88  ? -33.367 36.482  37.781  1.00 78.46  ? 88  ASN B OD1 1 
ATOM   2493  N ND2 . ASN B  2  88  ? -35.230 37.240  36.783  1.00 80.72  ? 88  ASN B ND2 1 
ATOM   2494  N N   . GLU B  2  89  ? -34.070 33.209  40.070  1.00 75.53  ? 89  GLU B N   1 
ATOM   2495  C CA  . GLU B  2  89  ? -32.891 32.519  40.588  1.00 74.90  ? 89  GLU B CA  1 
ATOM   2496  C C   . GLU B  2  89  ? -32.791 31.108  40.009  1.00 74.41  ? 89  GLU B C   1 
ATOM   2497  O O   . GLU B  2  89  ? -31.695 30.635  39.703  1.00 73.90  ? 89  GLU B O   1 
ATOM   2498  C CB  . GLU B  2  89  ? -32.925 32.474  42.120  1.00 74.30  ? 89  GLU B CB  1 
ATOM   2499  C CG  . GLU B  2  89  ? -31.629 32.010  42.776  1.00 76.45  ? 89  GLU B CG  1 
ATOM   2500  C CD  . GLU B  2  89  ? -30.463 32.959  42.547  1.00 80.38  ? 89  GLU B CD  1 
ATOM   2501  O OE1 . GLU B  2  89  ? -29.344 32.471  42.286  1.00 81.07  ? 89  GLU B OE1 1 
ATOM   2502  O OE2 . GLU B  2  89  ? -30.662 34.191  42.624  1.00 82.49  ? 89  GLU B OE2 1 
ATOM   2503  N N   . LEU B  2  90  ? -33.941 30.452  39.856  1.00 73.67  ? 90  LEU B N   1 
ATOM   2504  C CA  . LEU B  2  90  ? -34.016 29.116  39.259  1.00 73.00  ? 90  LEU B CA  1 
ATOM   2505  C C   . LEU B  2  90  ? -33.546 29.108  37.804  1.00 72.43  ? 90  LEU B C   1 
ATOM   2506  O O   . LEU B  2  90  ? -32.952 28.131  37.344  1.00 72.52  ? 90  LEU B O   1 
ATOM   2507  C CB  . LEU B  2  90  ? -35.442 28.563  39.353  1.00 73.38  ? 90  LEU B CB  1 
ATOM   2508  C CG  . LEU B  2  90  ? -35.939 28.050  40.708  1.00 73.91  ? 90  LEU B CG  1 
ATOM   2509  C CD1 . LEU B  2  90  ? -37.455 28.130  40.788  1.00 74.40  ? 90  LEU B CD1 1 
ATOM   2510  C CD2 . LEU B  2  90  ? -35.458 26.632  40.981  1.00 73.00  ? 90  LEU B CD2 1 
ATOM   2511  N N   . ARG B  2  91  ? -33.816 30.202  37.093  1.00 72.27  ? 91  ARG B N   1 
ATOM   2512  C CA  . ARG B  2  91  ? -33.377 30.368  35.707  1.00 72.56  ? 91  ARG B CA  1 
ATOM   2513  C C   . ARG B  2  91  ? -31.866 30.575  35.616  1.00 72.29  ? 91  ARG B C   1 
ATOM   2514  O O   . ARG B  2  91  ? -31.238 30.170  34.636  1.00 73.98  ? 91  ARG B O   1 
ATOM   2515  C CB  . ARG B  2  91  ? -34.108 31.537  35.044  1.00 73.81  ? 91  ARG B CB  1 
ATOM   2516  C CG  . ARG B  2  91  ? -35.575 31.270  34.745  1.00 75.40  ? 91  ARG B CG  1 
ATOM   2517  C CD  . ARG B  2  91  ? -36.272 32.528  34.254  1.00 77.71  ? 91  ARG B CD  1 
ATOM   2518  N NE  . ARG B  2  91  ? -37.689 32.298  33.978  1.00 77.98  ? 91  ARG B NE  1 
ATOM   2519  C CZ  . ARG B  2  91  ? -38.551 33.242  33.608  1.00 77.80  ? 91  ARG B CZ  1 
ATOM   2520  N NH1 . ARG B  2  91  ? -38.154 34.501  33.467  1.00 77.49  ? 91  ARG B NH1 1 
ATOM   2521  N NH2 . ARG B  2  91  ? -39.818 32.927  33.382  1.00 76.06  ? 91  ARG B NH2 1 
ATOM   2522  N N   . LEU B  2  92  ? -31.295 31.204  36.642  1.00 70.81  ? 92  LEU B N   1 
ATOM   2523  C CA  . LEU B  2  92  ? -29.856 31.458  36.703  1.00 68.87  ? 92  LEU B CA  1 
ATOM   2524  C C   . LEU B  2  92  ? -29.059 30.192  37.012  1.00 68.62  ? 92  LEU B C   1 
ATOM   2525  O O   . LEU B  2  92  ? -28.032 29.936  36.381  1.00 68.59  ? 92  LEU B O   1 
ATOM   2526  C CB  . LEU B  2  92  ? -29.538 32.553  37.729  1.00 67.37  ? 92  LEU B CB  1 
ATOM   2527  C CG  . LEU B  2  92  ? -29.906 33.999  37.374  1.00 65.30  ? 92  LEU B CG  1 
ATOM   2528  C CD1 . LEU B  2  92  ? -30.022 34.845  38.633  1.00 66.24  ? 92  LEU B CD1 1 
ATOM   2529  C CD2 . LEU B  2  92  ? -28.905 34.608  36.402  1.00 64.77  ? 92  LEU B CD2 1 
ATOM   2530  N N   . ILE B  2  93  ? -29.539 29.407  37.978  1.00 67.09  ? 93  ILE B N   1 
ATOM   2531  C CA  . ILE B  2  93  ? -28.887 28.154  38.377  1.00 67.05  ? 93  ILE B CA  1 
ATOM   2532  C C   . ILE B  2  93  ? -28.903 27.134  37.234  1.00 68.61  ? 93  ILE B C   1 
ATOM   2533  O O   . ILE B  2  93  ? -27.924 26.414  37.021  1.00 69.74  ? 93  ILE B O   1 
ATOM   2534  C CB  . ILE B  2  93  ? -29.529 27.547  39.649  1.00 65.72  ? 93  ILE B CB  1 
ATOM   2535  C CG1 . ILE B  2  93  ? -29.507 28.556  40.803  1.00 65.10  ? 93  ILE B CG1 1 
ATOM   2536  C CG2 . ILE B  2  93  ? -28.808 26.270  40.064  1.00 66.84  ? 93  ILE B CG2 1 
ATOM   2537  C CD1 . ILE B  2  93  ? -30.506 28.268  41.906  1.00 64.92  ? 93  ILE B CD1 1 
ATOM   2538  N N   . ALA B  2  94  ? -30.015 27.095  36.499  1.00 69.71  ? 94  ALA B N   1 
ATOM   2539  C CA  . ALA B  2  94  ? -30.168 26.211  35.342  1.00 71.71  ? 94  ALA B CA  1 
ATOM   2540  C C   . ALA B  2  94  ? -29.202 26.566  34.213  1.00 73.90  ? 94  ALA B C   1 
ATOM   2541  O O   . ALA B  2  94  ? -28.748 25.686  33.477  1.00 76.01  ? 94  ALA B O   1 
ATOM   2542  C CB  . ALA B  2  94  ? -31.604 26.242  34.840  1.00 71.56  ? 94  ALA B CB  1 
ATOM   2543  N N   . GLN B  2  95  ? -28.893 27.855  34.086  1.00 74.87  ? 95  GLN B N   1 
ATOM   2544  C CA  . GLN B  2  95  ? -27.970 28.340  33.061  1.00 76.30  ? 95  GLN B CA  1 
ATOM   2545  C C   . GLN B  2  95  ? -26.504 28.207  33.474  1.00 75.50  ? 95  GLN B C   1 
ATOM   2546  O O   . GLN B  2  95  ? -25.626 28.083  32.617  1.00 75.91  ? 95  GLN B O   1 
ATOM   2547  C CB  . GLN B  2  95  ? -28.296 29.786  32.678  1.00 75.56  ? 95  GLN B CB  1 
ATOM   2548  C CG  . GLN B  2  95  ? -29.515 29.934  31.777  1.00 74.78  ? 95  GLN B CG  1 
ATOM   2549  C CD  . GLN B  2  95  ? -29.372 29.198  30.456  1.00 73.45  ? 95  GLN B CD  1 
ATOM   2550  O OE1 . GLN B  2  95  ? -30.225 28.392  30.089  1.00 72.07  ? 95  GLN B OE1 1 
ATOM   2551  N NE2 . GLN B  2  95  ? -28.287 29.469  29.738  1.00 75.15  ? 95  GLN B NE2 1 
ATOM   2552  N N   . ARG B  2  96  ? -26.248 28.238  34.782  1.00 74.00  ? 96  ARG B N   1 
ATOM   2553  C CA  . ARG B  2  96  ? -24.903 28.028  35.324  1.00 72.91  ? 96  ARG B CA  1 
ATOM   2554  C C   . ARG B  2  96  ? -24.447 26.585  35.120  1.00 72.50  ? 96  ARG B C   1 
ATOM   2555  O O   . ARG B  2  96  ? -23.267 26.327  34.877  1.00 73.32  ? 96  ARG B O   1 
ATOM   2556  C CB  . ARG B  2  96  ? -24.848 28.386  36.812  1.00 70.61  ? 96  ARG B CB  1 
ATOM   2557  C CG  . ARG B  2  96  ? -24.869 29.877  37.109  1.00 68.64  ? 96  ARG B CG  1 
ATOM   2558  C CD  . ARG B  2  96  ? -24.591 30.143  38.580  1.00 67.23  ? 96  ARG B CD  1 
ATOM   2559  N NE  . ARG B  2  96  ? -24.948 31.505  38.971  1.00 66.20  ? 96  ARG B NE  1 
ATOM   2560  C CZ  . ARG B  2  96  ? -26.091 31.847  39.563  1.00 64.53  ? 96  ARG B CZ  1 
ATOM   2561  N NH1 . ARG B  2  96  ? -27.004 30.927  39.847  1.00 64.69  ? 96  ARG B NH1 1 
ATOM   2562  N NH2 . ARG B  2  96  ? -26.320 33.114  39.878  1.00 64.08  ? 96  ARG B NH2 1 
ATOM   2563  N N   . TYR B  2  97  ? -25.394 25.654  35.226  1.00 70.75  ? 97  TYR B N   1 
ATOM   2564  C CA  . TYR B  2  97  ? -25.140 24.236  34.988  1.00 69.13  ? 97  TYR B CA  1 
ATOM   2565  C C   . TYR B  2  97  ? -24.925 23.966  33.498  1.00 68.70  ? 97  TYR B C   1 
ATOM   2566  O O   . TYR B  2  97  ? -24.093 23.135  33.125  1.00 69.67  ? 97  TYR B O   1 
ATOM   2567  C CB  . TYR B  2  97  ? -26.307 23.397  35.518  1.00 68.23  ? 97  TYR B CB  1 
ATOM   2568  C CG  . TYR B  2  97  ? -26.033 21.910  35.598  1.00 68.84  ? 97  TYR B CG  1 
ATOM   2569  C CD1 . TYR B  2  97  ? -25.561 21.331  36.776  1.00 69.35  ? 97  TYR B CD1 1 
ATOM   2570  C CD2 . TYR B  2  97  ? -26.257 21.079  34.501  1.00 69.43  ? 97  TYR B CD2 1 
ATOM   2571  C CE1 . TYR B  2  97  ? -25.315 19.969  36.855  1.00 69.66  ? 97  TYR B CE1 1 
ATOM   2572  C CE2 . TYR B  2  97  ? -26.013 19.717  34.570  1.00 70.53  ? 97  TYR B CE2 1 
ATOM   2573  C CZ  . TYR B  2  97  ? -25.542 19.167  35.748  1.00 70.69  ? 97  TYR B CZ  1 
ATOM   2574  O OH  . TYR B  2  97  ? -25.300 17.816  35.815  1.00 72.42  ? 97  TYR B OH  1 
ATOM   2575  N N   . LEU B  2  98  ? -25.679 24.675  32.659  1.00 67.29  ? 98  LEU B N   1 
ATOM   2576  C CA  . LEU B  2  98  ? -25.593 24.536  31.205  1.00 66.66  ? 98  LEU B CA  1 
ATOM   2577  C C   . LEU B  2  98  ? -24.274 25.100  30.674  1.00 68.48  ? 98  LEU B C   1 
ATOM   2578  O O   . LEU B  2  98  ? -23.731 24.603  29.687  1.00 69.90  ? 98  LEU B O   1 
ATOM   2579  C CB  . LEU B  2  98  ? -26.775 25.245  30.537  1.00 64.84  ? 98  LEU B CB  1 
ATOM   2580  C CG  . LEU B  2  98  ? -27.480 24.585  29.344  1.00 64.04  ? 98  LEU B CG  1 
ATOM   2581  C CD1 . LEU B  2  98  ? -28.791 25.304  29.062  1.00 67.84  ? 98  LEU B CD1 1 
ATOM   2582  C CD2 . LEU B  2  98  ? -26.616 24.550  28.089  1.00 63.00  ? 98  LEU B CD2 1 
ATOM   2583  N N   . LEU B  2  99  ? -23.770 26.139  31.335  1.00 70.41  ? 99  LEU B N   1 
ATOM   2584  C CA  . LEU B  2  99  ? -22.495 26.753  30.974  1.00 73.18  ? 99  LEU B CA  1 
ATOM   2585  C C   . LEU B  2  99  ? -21.319 25.855  31.361  1.00 74.27  ? 99  LEU B C   1 
ATOM   2586  O O   . LEU B  2  99  ? -20.318 25.784  30.643  1.00 75.32  ? 99  LEU B O   1 
ATOM   2587  C CB  . LEU B  2  99  ? -22.366 28.126  31.648  1.00 73.82  ? 99  LEU B CB  1 
ATOM   2588  C CG  . LEU B  2  99  ? -21.119 28.991  31.431  1.00 74.03  ? 99  LEU B CG  1 
ATOM   2589  C CD1 . LEU B  2  99  ? -21.068 29.562  30.021  1.00 74.14  ? 99  LEU B CD1 1 
ATOM   2590  C CD2 . LEU B  2  99  ? -21.081 30.112  32.457  1.00 73.69  ? 99  LEU B CD2 1 
ATOM   2591  N N   . GLN B  2  100 ? -21.461 25.161  32.488  1.00 72.99  ? 100 GLN B N   1 
ATOM   2592  C CA  . GLN B  2  100 ? -20.375 24.381  33.077  1.00 72.78  ? 100 GLN B CA  1 
ATOM   2593  C C   . GLN B  2  100 ? -20.252 22.968  32.500  1.00 72.12  ? 100 GLN B C   1 
ATOM   2594  O O   . GLN B  2  100 ? -19.142 22.496  32.243  1.00 72.37  ? 100 GLN B O   1 
ATOM   2595  C CB  . GLN B  2  100 ? -20.546 24.322  34.599  1.00 72.04  ? 100 GLN B CB  1 
ATOM   2596  C CG  . GLN B  2  100 ? -19.304 23.896  35.364  1.00 74.39  ? 100 GLN B CG  1 
ATOM   2597  C CD  . GLN B  2  100 ? -19.411 24.179  36.850  1.00 77.30  ? 100 GLN B CD  1 
ATOM   2598  O OE1 . GLN B  2  100 ? -19.580 23.264  37.655  1.00 77.17  ? 100 GLN B OE1 1 
ATOM   2599  N NE2 . GLN B  2  100 ? -19.324 25.453  37.220  1.00 78.39  ? 100 GLN B NE2 1 
ATOM   2600  N N   . TYR B  2  101 ? -21.388 22.304  32.296  1.00 70.13  ? 101 TYR B N   1 
ATOM   2601  C CA  . TYR B  2  101 ? -21.405 20.903  31.864  1.00 68.53  ? 101 TYR B CA  1 
ATOM   2602  C C   . TYR B  2  101 ? -21.874 20.711  30.418  1.00 68.96  ? 101 TYR B C   1 
ATOM   2603  O O   . TYR B  2  101 ? -21.702 19.630  29.847  1.00 69.37  ? 101 TYR B O   1 
ATOM   2604  C CB  . TYR B  2  101 ? -22.267 20.063  32.814  1.00 65.48  ? 101 TYR B CB  1 
ATOM   2605  C CG  . TYR B  2  101 ? -21.776 20.050  34.247  1.00 63.58  ? 101 TYR B CG  1 
ATOM   2606  C CD1 . TYR B  2  101 ? -22.299 20.933  35.191  1.00 63.11  ? 101 TYR B CD1 1 
ATOM   2607  C CD2 . TYR B  2  101 ? -20.790 19.154  34.659  1.00 63.85  ? 101 TYR B CD2 1 
ATOM   2608  C CE1 . TYR B  2  101 ? -21.854 20.925  36.504  1.00 61.93  ? 101 TYR B CE1 1 
ATOM   2609  C CE2 . TYR B  2  101 ? -20.338 19.138  35.971  1.00 62.89  ? 101 TYR B CE2 1 
ATOM   2610  C CZ  . TYR B  2  101 ? -20.873 20.026  36.888  1.00 61.63  ? 101 TYR B CZ  1 
ATOM   2611  O OH  . TYR B  2  101 ? -20.430 20.017  38.191  1.00 61.35  ? 101 TYR B OH  1 
ATOM   2612  N N   . GLN B  2  102 ? -22.458 21.762  29.842  1.00 69.40  ? 102 GLN B N   1 
ATOM   2613  C CA  . GLN B  2  102 ? -23.001 21.751  28.471  1.00 70.01  ? 102 GLN B CA  1 
ATOM   2614  C C   . GLN B  2  102 ? -24.154 20.760  28.261  1.00 71.54  ? 102 GLN B C   1 
ATOM   2615  O O   . GLN B  2  102 ? -24.359 20.244  27.158  1.00 72.22  ? 102 GLN B O   1 
ATOM   2616  C CB  . GLN B  2  102 ? -21.891 21.569  27.421  1.00 68.17  ? 102 GLN B CB  1 
ATOM   2617  C CG  . GLN B  2  102 ? -20.974 22.775  27.265  1.00 66.98  ? 102 GLN B CG  1 
ATOM   2618  C CD  . GLN B  2  102 ? -21.702 24.014  26.773  1.00 66.81  ? 102 GLN B CD  1 
ATOM   2619  O OE1 . GLN B  2  102 ? -22.235 24.039  25.663  1.00 68.15  ? 102 GLN B OE1 1 
ATOM   2620  N NE2 . GLN B  2  102 ? -21.723 25.053  27.600  1.00 66.80  ? 102 GLN B NE2 1 
ATOM   2621  N N   . GLU B  2  103 ? -24.902 20.508  29.333  1.00 71.80  ? 103 GLU B N   1 
ATOM   2622  C CA  . GLU B  2  103 ? -26.087 19.654  29.287  1.00 72.76  ? 103 GLU B CA  1 
ATOM   2623  C C   . GLU B  2  103 ? -27.162 20.179  30.246  1.00 71.77  ? 103 GLU B C   1 
ATOM   2624  O O   . GLU B  2  103 ? -26.829 20.801  31.258  1.00 71.01  ? 103 GLU B O   1 
ATOM   2625  C CB  . GLU B  2  103 ? -25.730 18.191  29.594  1.00 75.42  ? 103 GLU B CB  1 
ATOM   2626  C CG  . GLU B  2  103 ? -25.079 17.944  30.949  1.00 79.11  ? 103 GLU B CG  1 
ATOM   2627  C CD  . GLU B  2  103 ? -24.920 16.466  31.266  1.00 82.65  ? 103 GLU B CD  1 
ATOM   2628  O OE1 . GLU B  2  103 ? -25.201 16.075  32.418  1.00 84.90  ? 103 GLU B OE1 1 
ATOM   2629  O OE2 . GLU B  2  103 ? -24.518 15.694  30.367  1.00 83.16  ? 103 GLU B OE2 1 
ATOM   2630  N N   . PRO B  2  104 ? -28.452 19.944  29.921  1.00 72.35  ? 104 PRO B N   1 
ATOM   2631  C CA  . PRO B  2  104 ? -29.563 20.405  30.762  1.00 72.53  ? 104 PRO B CA  1 
ATOM   2632  C C   . PRO B  2  104 ? -29.477 19.887  32.196  1.00 70.75  ? 104 PRO B C   1 
ATOM   2633  O O   . PRO B  2  104 ? -29.093 18.735  32.417  1.00 71.95  ? 104 PRO B O   1 
ATOM   2634  C CB  . PRO B  2  104 ? -30.795 19.820  30.067  1.00 74.28  ? 104 PRO B CB  1 
ATOM   2635  C CG  . PRO B  2  104 ? -30.387 19.677  28.643  1.00 74.93  ? 104 PRO B CG  1 
ATOM   2636  C CD  . PRO B  2  104 ? -28.937 19.292  28.689  1.00 73.56  ? 104 PRO B CD  1 
ATOM   2637  N N   . ILE B  2  105 ? -29.830 20.743  33.153  1.00 69.14  ? 105 ILE B N   1 
ATOM   2638  C CA  . ILE B  2  105 ? -29.786 20.396  34.575  1.00 68.74  ? 105 ILE B CA  1 
ATOM   2639  C C   . ILE B  2  105 ? -30.887 19.394  34.947  1.00 69.74  ? 105 ILE B C   1 
ATOM   2640  O O   . ILE B  2  105 ? -32.050 19.590  34.585  1.00 70.85  ? 105 ILE B O   1 
ATOM   2641  C CB  . ILE B  2  105 ? -29.828 21.662  35.478  1.00 68.20  ? 105 ILE B CB  1 
ATOM   2642  C CG1 . ILE B  2  105 ? -29.642 21.293  36.958  1.00 68.60  ? 105 ILE B CG1 1 
ATOM   2643  C CG2 . ILE B  2  105 ? -31.104 22.470  35.251  1.00 68.40  ? 105 ILE B CG2 1 
ATOM   2644  C CD1 . ILE B  2  105 ? -29.219 22.446  37.845  1.00 68.39  ? 105 ILE B CD1 1 
ATOM   2645  N N   . PRO B  2  106 ? -30.512 18.299  35.641  1.00 69.64  ? 106 PRO B N   1 
ATOM   2646  C CA  . PRO B  2  106 ? -31.476 17.332  36.173  1.00 71.29  ? 106 PRO B CA  1 
ATOM   2647  C C   . PRO B  2  106 ? -32.474 17.981  37.131  1.00 72.44  ? 106 PRO B C   1 
ATOM   2648  O O   . PRO B  2  106 ? -32.128 18.935  37.835  1.00 72.57  ? 106 PRO B O   1 
ATOM   2649  C CB  . PRO B  2  106 ? -30.591 16.336  36.924  1.00 71.33  ? 106 PRO B CB  1 
ATOM   2650  C CG  . PRO B  2  106 ? -29.290 16.391  36.204  1.00 69.92  ? 106 PRO B CG  1 
ATOM   2651  C CD  . PRO B  2  106 ? -29.123 17.833  35.818  1.00 68.75  ? 106 PRO B CD  1 
ATOM   2652  N N   . CYS B  2  107 ? -33.695 17.454  37.151  1.00 74.21  ? 107 CYS B N   1 
ATOM   2653  C CA  . CYS B  2  107 ? -34.799 18.049  37.906  1.00 74.64  ? 107 CYS B CA  1 
ATOM   2654  C C   . CYS B  2  107 ? -34.543 18.153  39.408  1.00 74.06  ? 107 CYS B C   1 
ATOM   2655  O O   . CYS B  2  107 ? -34.849 19.177  40.017  1.00 72.95  ? 107 CYS B O   1 
ATOM   2656  C CB  . CYS B  2  107 ? -36.100 17.296  37.632  1.00 77.68  ? 107 CYS B CB  1 
ATOM   2657  S SG  . CYS B  2  107 ? -36.623 17.387  35.905  1.00 81.94  ? 107 CYS B SG  1 
ATOM   2658  N N   . GLU B  2  108 ? -33.969 17.102  39.990  1.00 75.93  ? 108 GLU B N   1 
ATOM   2659  C CA  . GLU B  2  108 ? -33.695 17.061  41.426  1.00 77.93  ? 108 GLU B CA  1 
ATOM   2660  C C   . GLU B  2  108 ? -32.609 18.057  41.844  1.00 77.16  ? 108 GLU B C   1 
ATOM   2661  O O   . GLU B  2  108 ? -32.659 18.607  42.947  1.00 76.63  ? 108 GLU B O   1 
ATOM   2662  C CB  . GLU B  2  108 ? -33.315 15.642  41.858  1.00 80.98  ? 108 GLU B CB  1 
ATOM   2663  C CG  . GLU B  2  108 ? -33.505 15.369  43.344  1.00 83.89  ? 108 GLU B CG  1 
ATOM   2664  C CD  . GLU B  2  108 ? -33.249 13.921  43.726  1.00 87.98  ? 108 GLU B CD  1 
ATOM   2665  O OE1 . GLU B  2  108 ? -32.524 13.215  42.990  1.00 89.70  ? 108 GLU B OE1 1 
ATOM   2666  O OE2 . GLU B  2  108 ? -33.774 13.487  44.773  1.00 89.23  ? 108 GLU B OE2 1 
ATOM   2667  N N   . GLN B  2  109 ? -31.643 18.291  40.958  1.00 76.23  ? 109 GLN B N   1 
ATOM   2668  C CA  . GLN B  2  109 ? -30.522 19.190  41.243  1.00 75.29  ? 109 GLN B CA  1 
ATOM   2669  C C   . GLN B  2  109 ? -30.916 20.669  41.292  1.00 75.56  ? 109 GLN B C   1 
ATOM   2670  O O   . GLN B  2  109 ? -30.329 21.442  42.052  1.00 75.75  ? 109 GLN B O   1 
ATOM   2671  C CB  . GLN B  2  109 ? -29.376 18.971  40.248  1.00 73.36  ? 109 GLN B CB  1 
ATOM   2672  C CG  . GLN B  2  109 ? -28.534 17.738  40.544  1.00 71.35  ? 109 GLN B CG  1 
ATOM   2673  C CD  . GLN B  2  109 ? -27.223 17.713  39.779  1.00 71.90  ? 109 GLN B CD  1 
ATOM   2674  O OE1 . GLN B  2  109 ? -27.203 17.546  38.560  1.00 71.88  ? 109 GLN B OE1 1 
ATOM   2675  N NE2 . GLN B  2  109 ? -26.117 17.862  40.499  1.00 72.02  ? 109 GLN B NE2 1 
ATOM   2676  N N   . LEU B  2  110 ? -31.905 21.056  40.489  1.00 74.45  ? 110 LEU B N   1 
ATOM   2677  C CA  . LEU B  2  110 ? -32.377 22.443  40.460  1.00 72.70  ? 110 LEU B CA  1 
ATOM   2678  C C   . LEU B  2  110 ? -33.279 22.763  41.654  1.00 71.90  ? 110 LEU B C   1 
ATOM   2679  O O   . LEU B  2  110 ? -33.262 23.885  42.167  1.00 71.46  ? 110 LEU B O   1 
ATOM   2680  C CB  . LEU B  2  110 ? -33.097 22.754  39.141  1.00 71.41  ? 110 LEU B CB  1 
ATOM   2681  C CG  . LEU B  2  110 ? -33.356 24.231  38.805  1.00 70.12  ? 110 LEU B CG  1 
ATOM   2682  C CD1 . LEU B  2  110 ? -32.065 24.966  38.473  1.00 70.02  ? 110 LEU B CD1 1 
ATOM   2683  C CD2 . LEU B  2  110 ? -34.346 24.364  37.659  1.00 69.85  ? 110 LEU B CD2 1 
ATOM   2684  N N   . VAL B  2  111 ? -34.061 21.775  42.085  1.00 71.66  ? 111 VAL B N   1 
ATOM   2685  C CA  . VAL B  2  111 ? -34.954 21.926  43.236  1.00 72.37  ? 111 VAL B CA  1 
ATOM   2686  C C   . VAL B  2  111 ? -34.149 22.064  44.531  1.00 73.29  ? 111 VAL B C   1 
ATOM   2687  O O   . VAL B  2  111 ? -34.445 22.924  45.362  1.00 75.62  ? 111 VAL B O   1 
ATOM   2688  C CB  . VAL B  2  111 ? -35.957 20.752  43.345  1.00 73.01  ? 111 VAL B CB  1 
ATOM   2689  C CG1 . VAL B  2  111 ? -36.874 20.926  44.548  1.00 75.49  ? 111 VAL B CG1 1 
ATOM   2690  C CG2 . VAL B  2  111 ? -36.787 20.636  42.075  1.00 72.71  ? 111 VAL B CG2 1 
ATOM   2691  N N   . THR B  2  112 ? -33.127 21.223  44.683  1.00 73.22  ? 112 THR B N   1 
ATOM   2692  C CA  . THR B  2  112 ? -32.256 21.247  45.861  1.00 74.34  ? 112 THR B CA  1 
ATOM   2693  C C   . THR B  2  112 ? -31.410 22.519  45.947  1.00 75.91  ? 112 THR B C   1 
ATOM   2694  O O   . THR B  2  112 ? -31.085 22.977  47.044  1.00 77.48  ? 112 THR B O   1 
ATOM   2695  C CB  . THR B  2  112 ? -31.325 20.017  45.914  1.00 74.50  ? 112 THR B CB  1 
ATOM   2696  O OG1 . THR B  2  112 ? -30.701 19.828  44.639  1.00 74.56  ? 112 THR B OG1 1 
ATOM   2697  C CG2 . THR B  2  112 ? -32.106 18.765  46.281  1.00 76.56  ? 112 THR B CG2 1 
ATOM   2698  N N   . ALA B  2  113 ? -31.065 23.082  44.789  1.00 75.22  ? 113 ALA B N   1 
ATOM   2699  C CA  . ALA B  2  113 ? -30.241 24.290  44.713  1.00 75.21  ? 113 ALA B CA  1 
ATOM   2700  C C   . ALA B  2  113 ? -30.944 25.527  45.275  1.00 75.29  ? 113 ALA B C   1 
ATOM   2701  O O   . ALA B  2  113 ? -30.328 26.326  45.985  1.00 74.99  ? 113 ALA B O   1 
ATOM   2702  C CB  . ALA B  2  113 ? -29.792 24.537  43.280  1.00 74.08  ? 113 ALA B CB  1 
ATOM   2703  N N   . LEU B  2  114 ? -32.228 25.679  44.952  1.00 74.76  ? 114 LEU B N   1 
ATOM   2704  C CA  . LEU B  2  114 ? -33.029 26.794  45.454  1.00 73.61  ? 114 LEU B CA  1 
ATOM   2705  C C   . LEU B  2  114 ? -33.416 26.579  46.915  1.00 75.05  ? 114 LEU B C   1 
ATOM   2706  O O   . LEU B  2  114 ? -33.483 27.534  47.693  1.00 74.85  ? 114 LEU B O   1 
ATOM   2707  C CB  . LEU B  2  114 ? -34.287 26.991  44.601  1.00 71.95  ? 114 LEU B CB  1 
ATOM   2708  C CG  . LEU B  2  114 ? -35.083 28.281  44.829  1.00 71.56  ? 114 LEU B CG  1 
ATOM   2709  C CD1 . LEU B  2  114 ? -34.498 29.438  44.030  1.00 71.92  ? 114 LEU B CD1 1 
ATOM   2710  C CD2 . LEU B  2  114 ? -36.546 28.075  44.478  1.00 72.73  ? 114 LEU B CD2 1 
ATOM   2711  N N   . CYS B  2  115 ? -33.666 25.322  47.277  1.00 76.97  ? 115 CYS B N   1 
ATOM   2712  C CA  . CYS B  2  115 ? -34.035 24.958  48.644  1.00 80.89  ? 115 CYS B CA  1 
ATOM   2713  C C   . CYS B  2  115 ? -32.885 25.153  49.636  1.00 80.47  ? 115 CYS B C   1 
ATOM   2714  O O   . CYS B  2  115 ? -33.119 25.309  50.836  1.00 81.74  ? 115 CYS B O   1 
ATOM   2715  C CB  . CYS B  2  115 ? -34.559 23.520  48.698  1.00 83.86  ? 115 CYS B CB  1 
ATOM   2716  S SG  . CYS B  2  115 ? -36.245 23.310  48.079  1.00 83.89  ? 115 CYS B SG  1 
ATOM   2717  N N   . ASP B  2  116 ? -31.653 25.145  49.128  1.00 79.79  ? 116 ASP B N   1 
ATOM   2718  C CA  . ASP B  2  116 ? -30.473 25.482  49.928  1.00 80.11  ? 116 ASP B CA  1 
ATOM   2719  C C   . ASP B  2  116 ? -30.448 26.971  50.268  1.00 78.84  ? 116 ASP B C   1 
ATOM   2720  O O   . ASP B  2  116 ? -30.011 27.359  51.354  1.00 77.86  ? 116 ASP B O   1 
ATOM   2721  C CB  . ASP B  2  116 ? -29.185 25.094  49.194  1.00 80.33  ? 116 ASP B CB  1 
ATOM   2722  C CG  . ASP B  2  116 ? -28.913 23.598  49.224  1.00 81.30  ? 116 ASP B CG  1 
ATOM   2723  O OD1 . ASP B  2  116 ? -29.373 22.915  50.164  1.00 82.69  ? 116 ASP B OD1 1 
ATOM   2724  O OD2 . ASP B  2  116 ? -28.226 23.106  48.305  1.00 81.85  ? 116 ASP B OD2 1 
ATOM   2725  N N   . ILE B  2  117 ? -30.917 27.793  49.330  1.00 75.79  ? 117 ILE B N   1 
ATOM   2726  C CA  . ILE B  2  117 ? -30.999 29.244  49.514  1.00 72.28  ? 117 ILE B CA  1 
ATOM   2727  C C   . ILE B  2  117 ? -32.130 29.595  50.483  1.00 73.39  ? 117 ILE B C   1 
ATOM   2728  O O   . ILE B  2  117 ? -31.973 30.469  51.339  1.00 74.24  ? 117 ILE B O   1 
ATOM   2729  C CB  . ILE B  2  117 ? -31.189 29.987  48.169  1.00 67.58  ? 117 ILE B CB  1 
ATOM   2730  C CG1 . ILE B  2  117 ? -30.113 29.563  47.160  1.00 66.74  ? 117 ILE B CG1 1 
ATOM   2731  C CG2 . ILE B  2  117 ? -31.160 31.499  48.373  1.00 67.42  ? 117 ILE B CG2 1 
ATOM   2732  C CD1 . ILE B  2  117 ? -30.450 29.871  45.715  1.00 66.95  ? 117 ILE B CD1 1 
ATOM   2733  N N   . LYS B  2  118 ? -33.261 28.903  50.351  1.00 74.26  ? 118 LYS B N   1 
ATOM   2734  C CA  . LYS B  2  118 ? -34.411 29.116  51.232  1.00 76.59  ? 118 LYS B CA  1 
ATOM   2735  C C   . LYS B  2  118 ? -34.149 28.631  52.657  1.00 74.77  ? 118 LYS B C   1 
ATOM   2736  O O   . LYS B  2  118 ? -34.711 29.170  53.613  1.00 75.43  ? 118 LYS B O   1 
ATOM   2737  C CB  . LYS B  2  118 ? -35.671 28.457  50.661  1.00 80.45  ? 118 LYS B CB  1 
ATOM   2738  C CG  . LYS B  2  118 ? -36.264 29.192  49.467  1.00 84.90  ? 118 LYS B CG  1 
ATOM   2739  C CD  . LYS B  2  118 ? -37.701 28.773  49.190  1.00 88.84  ? 118 LYS B CD  1 
ATOM   2740  C CE  . LYS B  2  118 ? -37.779 27.485  48.386  1.00 90.42  ? 118 LYS B CE  1 
ATOM   2741  N NZ  . LYS B  2  118 ? -39.190 27.120  48.083  1.00 89.67  ? 118 LYS B NZ  1 
ATOM   2742  N N   . GLN B  2  119 ? -33.294 27.618  52.789  1.00 72.95  ? 119 GLN B N   1 
ATOM   2743  C CA  . GLN B  2  119 ? -32.877 27.108  54.095  1.00 72.38  ? 119 GLN B CA  1 
ATOM   2744  C C   . GLN B  2  119 ? -31.936 28.099  54.782  1.00 72.01  ? 119 GLN B C   1 
ATOM   2745  O O   . GLN B  2  119 ? -31.944 28.224  56.008  1.00 72.86  ? 119 GLN B O   1 
ATOM   2746  C CB  . GLN B  2  119 ? -32.199 25.742  53.946  1.00 71.98  ? 119 GLN B CB  1 
ATOM   2747  C CG  . GLN B  2  119 ? -32.196 24.882  55.205  1.00 72.31  ? 119 GLN B CG  1 
ATOM   2748  C CD  . GLN B  2  119 ? -31.062 25.209  56.164  1.00 72.91  ? 119 GLN B CD  1 
ATOM   2749  O OE1 . GLN B  2  119 ? -30.034 25.766  55.773  1.00 72.51  ? 119 GLN B OE1 1 
ATOM   2750  N NE2 . GLN B  2  119 ? -31.246 24.857  57.432  1.00 74.34  ? 119 GLN B NE2 1 
ATOM   2751  N N   . ALA B  2  120 ? -31.131 28.795  53.981  1.00 71.68  ? 120 ALA B N   1 
ATOM   2752  C CA  . ALA B  2  120 ? -30.181 29.784  54.487  1.00 71.38  ? 120 ALA B CA  1 
ATOM   2753  C C   . ALA B  2  120 ? -30.879 30.972  55.147  1.00 72.02  ? 120 ALA B C   1 
ATOM   2754  O O   . ALA B  2  120 ? -30.405 31.484  56.161  1.00 74.40  ? 120 ALA B O   1 
ATOM   2755  C CB  . ALA B  2  120 ? -29.258 30.256  53.372  1.00 71.39  ? 120 ALA B CB  1 
ATOM   2756  N N   . TYR B  2  121 ? -32.007 31.394  54.574  1.00 71.24  ? 121 TYR B N   1 
ATOM   2757  C CA  . TYR B  2  121 ? -32.798 32.508  55.107  1.00 71.83  ? 121 TYR B CA  1 
ATOM   2758  C C   . TYR B  2  121 ? -33.478 32.176  56.436  1.00 72.86  ? 121 TYR B C   1 
ATOM   2759  O O   . TYR B  2  121 ? -33.798 33.074  57.217  1.00 74.56  ? 121 TYR B O   1 
ATOM   2760  C CB  . TYR B  2  121 ? -33.846 32.963  54.086  1.00 71.82  ? 121 TYR B CB  1 
ATOM   2761  C CG  . TYR B  2  121 ? -33.338 33.976  53.085  1.00 72.34  ? 121 TYR B CG  1 
ATOM   2762  C CD1 . TYR B  2  121 ? -32.694 33.570  51.917  1.00 73.38  ? 121 TYR B CD1 1 
ATOM   2763  C CD2 . TYR B  2  121 ? -33.508 35.344  53.302  1.00 73.53  ? 121 TYR B CD2 1 
ATOM   2764  C CE1 . TYR B  2  121 ? -32.227 34.496  50.996  1.00 75.18  ? 121 TYR B CE1 1 
ATOM   2765  C CE2 . TYR B  2  121 ? -33.046 36.278  52.386  1.00 74.94  ? 121 TYR B CE2 1 
ATOM   2766  C CZ  . TYR B  2  121 ? -32.406 35.849  51.236  1.00 75.87  ? 121 TYR B CZ  1 
ATOM   2767  O OH  . TYR B  2  121 ? -31.946 36.771  50.325  1.00 76.50  ? 121 TYR B OH  1 
ATOM   2768  N N   . THR B  2  122 ? -33.694 30.886  56.680  1.00 73.57  ? 122 THR B N   1 
ATOM   2769  C CA  . THR B  2  122 ? -34.348 30.422  57.902  1.00 75.22  ? 122 THR B CA  1 
ATOM   2770  C C   . THR B  2  122 ? -33.352 30.184  59.038  1.00 76.67  ? 122 THR B C   1 
ATOM   2771  O O   . THR B  2  122 ? -33.743 30.104  60.205  1.00 78.26  ? 122 THR B O   1 
ATOM   2772  C CB  . THR B  2  122 ? -35.163 29.133  57.659  1.00 76.21  ? 122 THR B CB  1 
ATOM   2773  O OG1 . THR B  2  122 ? -34.293 28.088  57.205  1.00 75.08  ? 122 THR B OG1 1 
ATOM   2774  C CG2 . THR B  2  122 ? -36.255 29.368  56.621  1.00 77.31  ? 122 THR B CG2 1 
ATOM   2775  N N   . GLN B  2  123 ? -32.070 30.076  58.691  1.00 77.24  ? 123 GLN B N   1 
ATOM   2776  C CA  . GLN B  2  123 ? -31.023 29.773  59.668  1.00 79.30  ? 123 GLN B CA  1 
ATOM   2777  C C   . GLN B  2  123 ? -30.223 31.004  60.096  1.00 81.97  ? 123 GLN B C   1 
ATOM   2778  O O   . GLN B  2  123 ? -29.976 31.203  61.288  1.00 83.23  ? 123 GLN B O   1 
ATOM   2779  C CB  . GLN B  2  123 ? -30.090 28.681  59.131  1.00 78.13  ? 123 GLN B CB  1 
ATOM   2780  C CG  . GLN B  2  123 ? -29.082 28.162  60.147  1.00 77.61  ? 123 GLN B CG  1 
ATOM   2781  C CD  . GLN B  2  123 ? -28.431 26.859  59.726  1.00 76.86  ? 123 GLN B CD  1 
ATOM   2782  O OE1 . GLN B  2  123 ? -28.437 25.884  60.477  1.00 77.26  ? 123 GLN B OE1 1 
ATOM   2783  N NE2 . GLN B  2  123 ? -27.868 26.832  58.522  1.00 76.25  ? 123 GLN B NE2 1 
ATOM   2784  N N   . PHE B  2  124 ? -29.818 31.820  59.125  1.00 83.42  ? 124 PHE B N   1 
ATOM   2785  C CA  . PHE B  2  124 ? -29.035 33.027  59.402  1.00 86.22  ? 124 PHE B CA  1 
ATOM   2786  C C   . PHE B  2  124 ? -29.413 34.197  58.494  1.00 84.32  ? 124 PHE B C   1 
ATOM   2787  O O   . PHE B  2  124 ? -29.839 34.000  57.355  1.00 80.85  ? 124 PHE B O   1 
ATOM   2788  C CB  . PHE B  2  124 ? -27.526 32.738  59.326  1.00 89.31  ? 124 PHE B CB  1 
ATOM   2789  C CG  . PHE B  2  124 ? -27.071 32.170  58.007  1.00 92.86  ? 124 PHE B CG  1 
ATOM   2790  C CD1 . PHE B  2  124 ? -26.628 33.009  56.988  1.00 93.86  ? 124 PHE B CD1 1 
ATOM   2791  C CD2 . PHE B  2  124 ? -27.066 30.795  57.789  1.00 94.55  ? 124 PHE B CD2 1 
ATOM   2792  C CE1 . PHE B  2  124 ? -26.205 32.489  55.774  1.00 98.17  ? 124 PHE B CE1 1 
ATOM   2793  C CE2 . PHE B  2  124 ? -26.644 30.269  56.577  1.00 98.33  ? 124 PHE B CE2 1 
ATOM   2794  C CZ  . PHE B  2  124 ? -26.212 31.117  55.568  1.00 99.79  ? 124 PHE B CZ  1 
ATOM   2795  N N   . GLY B  2  125 ? -29.254 35.412  59.011  1.00 81.95  ? 125 GLY B N   1 
ATOM   2796  C CA  . GLY B  2  125 ? -29.554 36.624  58.253  1.00 78.35  ? 125 GLY B CA  1 
ATOM   2797  C C   . GLY B  2  125 ? -30.532 37.552  58.946  1.00 76.49  ? 125 GLY B C   1 
ATOM   2798  O O   . GLY B  2  125 ? -30.530 38.759  58.699  1.00 76.08  ? 125 GLY B O   1 
ATOM   2799  N N   . GLY B  2  126 ? -31.373 36.984  59.809  1.00 76.62  ? 126 GLY B N   1 
ATOM   2800  C CA  . GLY B  2  126 ? -32.369 37.750  60.560  1.00 77.37  ? 126 GLY B CA  1 
ATOM   2801  C C   . GLY B  2  126 ? -33.474 38.335  59.700  1.00 77.36  ? 126 GLY B C   1 
ATOM   2802  O O   . GLY B  2  126 ? -34.142 39.289  60.102  1.00 78.64  ? 126 GLY B O   1 
ATOM   2803  N N   . LYS B  2  127 ? -33.669 37.753  58.519  1.00 77.43  ? 127 LYS B N   1 
ATOM   2804  C CA  . LYS B  2  127 ? -34.671 38.224  57.566  1.00 77.63  ? 127 LYS B CA  1 
ATOM   2805  C C   . LYS B  2  127 ? -35.839 37.247  57.460  1.00 76.86  ? 127 LYS B C   1 
ATOM   2806  O O   . LYS B  2  127 ? -35.727 36.088  57.868  1.00 78.07  ? 127 LYS B O   1 
ATOM   2807  C CB  . LYS B  2  127 ? -34.036 38.450  56.190  1.00 78.76  ? 127 LYS B CB  1 
ATOM   2808  C CG  . LYS B  2  127 ? -33.037 39.596  56.146  1.00 81.30  ? 127 LYS B CG  1 
ATOM   2809  C CD  . LYS B  2  127 ? -32.394 39.723  54.774  1.00 84.30  ? 127 LYS B CD  1 
ATOM   2810  C CE  . LYS B  2  127 ? -31.356 40.835  54.745  1.00 87.52  ? 127 LYS B CE  1 
ATOM   2811  N NZ  . LYS B  2  127 ? -30.156 40.519  55.571  1.00 90.34  ? 127 LYS B NZ  1 
ATOM   2812  N N   . ARG B  2  128 ? -36.957 37.724  56.918  1.00 75.76  ? 128 ARG B N   1 
ATOM   2813  C CA  . ARG B  2  128 ? -38.144 36.892  56.723  1.00 75.69  ? 128 ARG B CA  1 
ATOM   2814  C C   . ARG B  2  128 ? -37.933 35.864  55.605  1.00 76.96  ? 128 ARG B C   1 
ATOM   2815  O O   . ARG B  2  128 ? -37.335 36.185  54.574  1.00 77.89  ? 128 ARG B O   1 
ATOM   2816  C CB  . ARG B  2  128 ? -39.386 37.753  56.446  1.00 74.11  ? 128 ARG B CB  1 
ATOM   2817  C CG  . ARG B  2  128 ? -39.333 38.582  55.169  1.00 72.51  ? 128 ARG B CG  1 
ATOM   2818  C CD  . ARG B  2  128 ? -40.713 39.091  54.784  1.00 70.91  ? 128 ARG B CD  1 
ATOM   2819  N NE  . ARG B  2  128 ? -40.743 39.636  53.427  1.00 69.87  ? 128 ARG B NE  1 
ATOM   2820  C CZ  . ARG B  2  128 ? -41.029 38.930  52.335  1.00 68.20  ? 128 ARG B CZ  1 
ATOM   2821  N NH1 . ARG B  2  128 ? -41.315 37.637  52.425  1.00 69.29  ? 128 ARG B NH1 1 
ATOM   2822  N NH2 . ARG B  2  128 ? -41.031 39.520  51.147  1.00 67.89  ? 128 ARG B NH2 1 
ATOM   2823  N N   . PRO B  2  129 ? -38.410 34.621  55.813  1.00 78.24  ? 129 PRO B N   1 
ATOM   2824  C CA  . PRO B  2  129 ? -38.303 33.589  54.780  1.00 78.45  ? 129 PRO B CA  1 
ATOM   2825  C C   . PRO B  2  129 ? -39.285 33.820  53.633  1.00 78.42  ? 129 PRO B C   1 
ATOM   2826  O O   . PRO B  2  129 ? -40.259 34.560  53.791  1.00 78.56  ? 129 PRO B O   1 
ATOM   2827  C CB  . PRO B  2  129 ? -38.655 32.304  55.534  1.00 79.62  ? 129 PRO B CB  1 
ATOM   2828  C CG  . PRO B  2  129 ? -39.538 32.752  56.647  1.00 79.75  ? 129 PRO B CG  1 
ATOM   2829  C CD  . PRO B  2  129 ? -39.018 34.101  57.053  1.00 78.66  ? 129 PRO B CD  1 
ATOM   2830  N N   . PHE B  2  130 ? -39.020 33.192  52.490  1.00 79.06  ? 130 PHE B N   1 
ATOM   2831  C CA  . PHE B  2  130 ? -39.898 33.289  51.328  1.00 80.67  ? 130 PHE B CA  1 
ATOM   2832  C C   . PHE B  2  130 ? -41.164 32.466  51.547  1.00 83.11  ? 130 PHE B C   1 
ATOM   2833  O O   . PHE B  2  130 ? -41.096 31.254  51.758  1.00 84.78  ? 130 PHE B O   1 
ATOM   2834  C CB  . PHE B  2  130 ? -39.176 32.820  50.059  1.00 79.39  ? 130 PHE B CB  1 
ATOM   2835  C CG  . PHE B  2  130 ? -37.976 33.651  49.694  1.00 77.27  ? 130 PHE B CG  1 
ATOM   2836  C CD1 . PHE B  2  130 ? -36.700 33.270  50.099  1.00 76.40  ? 130 PHE B CD1 1 
ATOM   2837  C CD2 . PHE B  2  130 ? -38.117 34.810  48.936  1.00 76.34  ? 130 PHE B CD2 1 
ATOM   2838  C CE1 . PHE B  2  130 ? -35.591 34.031  49.762  1.00 75.43  ? 130 PHE B CE1 1 
ATOM   2839  C CE2 . PHE B  2  130 ? -37.012 35.575  48.595  1.00 75.49  ? 130 PHE B CE2 1 
ATOM   2840  C CZ  . PHE B  2  130 ? -35.747 35.185  49.009  1.00 75.20  ? 130 PHE B CZ  1 
ATOM   2841  N N   . GLY B  2  131 ? -42.314 33.134  51.501  1.00 83.94  ? 131 GLY B N   1 
ATOM   2842  C CA  . GLY B  2  131 ? -43.605 32.475  51.684  1.00 85.99  ? 131 GLY B CA  1 
ATOM   2843  C C   . GLY B  2  131 ? -44.176 31.958  50.378  1.00 87.10  ? 131 GLY B C   1 
ATOM   2844  O O   . GLY B  2  131 ? -45.296 32.308  50.001  1.00 87.14  ? 131 GLY B O   1 
ATOM   2845  N N   . VAL B  2  132 ? -43.397 31.126  49.688  1.00 87.24  ? 132 VAL B N   1 
ATOM   2846  C CA  . VAL B  2  132 ? -43.782 30.582  48.386  1.00 87.14  ? 132 VAL B CA  1 
ATOM   2847  C C   . VAL B  2  132 ? -43.557 29.069  48.340  1.00 87.90  ? 132 VAL B C   1 
ATOM   2848  O O   . VAL B  2  132 ? -42.462 28.584  48.636  1.00 88.93  ? 132 VAL B O   1 
ATOM   2849  C CB  . VAL B  2  132 ? -43.001 31.254  47.226  1.00 85.99  ? 132 VAL B CB  1 
ATOM   2850  C CG1 . VAL B  2  132 ? -43.452 30.711  45.876  1.00 85.65  ? 132 VAL B CG1 1 
ATOM   2851  C CG2 . VAL B  2  132 ? -43.162 32.768  47.260  1.00 84.22  ? 132 VAL B CG2 1 
ATOM   2852  N N   . SER B  2  133 ? -44.608 28.335  47.980  1.00 84.34  ? 133 SER B N   1 
ATOM   2853  C CA  . SER B  2  133 ? -44.503 26.908  47.694  1.00 81.24  ? 133 SER B CA  1 
ATOM   2854  C C   . SER B  2  133 ? -44.496 26.693  46.185  1.00 78.35  ? 133 SER B C   1 
ATOM   2855  O O   . SER B  2  133 ? -45.347 27.225  45.468  1.00 79.45  ? 133 SER B O   1 
ATOM   2856  C CB  . SER B  2  133 ? -45.652 26.133  48.341  1.00 81.96  ? 133 SER B CB  1 
ATOM   2857  O OG  . SER B  2  133 ? -45.430 25.953  49.728  1.00 83.46  ? 133 SER B OG  1 
ATOM   2858  N N   . LEU B  2  134 ? -43.529 25.912  45.711  1.00 76.54  ? 134 LEU B N   1 
ATOM   2859  C CA  . LEU B  2  134 ? -43.314 25.729  44.278  1.00 75.94  ? 134 LEU B CA  1 
ATOM   2860  C C   . LEU B  2  134 ? -43.506 24.283  43.837  1.00 75.75  ? 134 LEU B C   1 
ATOM   2861  O O   . LEU B  2  134 ? -43.037 23.354  44.498  1.00 75.90  ? 134 LEU B O   1 
ATOM   2862  C CB  . LEU B  2  134 ? -41.916 26.221  43.890  1.00 75.96  ? 134 LEU B CB  1 
ATOM   2863  C CG  . LEU B  2  134 ? -41.702 27.738  43.878  1.00 76.52  ? 134 LEU B CG  1 
ATOM   2864  C CD1 . LEU B  2  134 ? -40.351 28.103  44.472  1.00 76.35  ? 134 LEU B CD1 1 
ATOM   2865  C CD2 . LEU B  2  134 ? -41.854 28.305  42.473  1.00 78.06  ? 134 LEU B CD2 1 
ATOM   2866  N N   . LEU B  2  135 ? -44.206 24.107  42.718  1.00 75.42  ? 135 LEU B N   1 
ATOM   2867  C CA  . LEU B  2  135 ? -44.402 22.789  42.120  1.00 75.93  ? 135 LEU B CA  1 
ATOM   2868  C C   . LEU B  2  135 ? -43.674 22.706  40.782  1.00 76.25  ? 135 LEU B C   1 
ATOM   2869  O O   . LEU B  2  135 ? -44.002 23.431  39.842  1.00 77.41  ? 135 LEU B O   1 
ATOM   2870  C CB  . LEU B  2  135 ? -45.894 22.475  41.952  1.00 75.74  ? 135 LEU B CB  1 
ATOM   2871  C CG  . LEU B  2  135 ? -46.759 22.318  43.210  1.00 75.70  ? 135 LEU B CG  1 
ATOM   2872  C CD1 . LEU B  2  135 ? -48.223 22.158  42.831  1.00 75.97  ? 135 LEU B CD1 1 
ATOM   2873  C CD2 . LEU B  2  135 ? -46.301 21.147  44.068  1.00 77.32  ? 135 LEU B CD2 1 
ATOM   2874  N N   . TYR B  2  136 ? -42.683 21.820  40.710  1.00 76.49  ? 136 TYR B N   1 
ATOM   2875  C CA  . TYR B  2  136 ? -41.822 21.701  39.533  1.00 76.84  ? 136 TYR B CA  1 
ATOM   2876  C C   . TYR B  2  136 ? -42.204 20.506  38.666  1.00 77.19  ? 136 TYR B C   1 
ATOM   2877  O O   . TYR B  2  136 ? -42.503 19.427  39.180  1.00 79.27  ? 136 TYR B O   1 
ATOM   2878  C CB  . TYR B  2  136 ? -40.353 21.563  39.949  1.00 76.77  ? 136 TYR B CB  1 
ATOM   2879  C CG  . TYR B  2  136 ? -39.871 22.583  40.958  1.00 77.31  ? 136 TYR B CG  1 
ATOM   2880  C CD1 . TYR B  2  136 ? -39.956 22.330  42.328  1.00 77.43  ? 136 TYR B CD1 1 
ATOM   2881  C CD2 . TYR B  2  136 ? -39.313 23.792  40.546  1.00 77.68  ? 136 TYR B CD2 1 
ATOM   2882  C CE1 . TYR B  2  136 ? -39.510 23.256  43.257  1.00 78.48  ? 136 TYR B CE1 1 
ATOM   2883  C CE2 . TYR B  2  136 ? -38.864 24.725  41.469  1.00 78.55  ? 136 TYR B CE2 1 
ATOM   2884  C CZ  . TYR B  2  136 ? -38.965 24.451  42.821  1.00 78.66  ? 136 TYR B CZ  1 
ATOM   2885  O OH  . TYR B  2  136 ? -38.522 25.369  43.745  1.00 78.93  ? 136 TYR B OH  1 
ATOM   2886  N N   . ILE B  2  137 ? -42.192 20.712  37.350  1.00 76.41  ? 137 ILE B N   1 
ATOM   2887  C CA  . ILE B  2  137 ? -42.375 19.628  36.379  1.00 76.95  ? 137 ILE B CA  1 
ATOM   2888  C C   . ILE B  2  137 ? -41.271 19.676  35.323  1.00 78.00  ? 137 ILE B C   1 
ATOM   2889  O O   . ILE B  2  137 ? -40.918 20.752  34.834  1.00 77.96  ? 137 ILE B O   1 
ATOM   2890  C CB  . ILE B  2  137 ? -43.769 19.653  35.700  1.00 76.67  ? 137 ILE B CB  1 
ATOM   2891  C CG1 . ILE B  2  137 ? -44.021 20.990  34.987  1.00 75.50  ? 137 ILE B CG1 1 
ATOM   2892  C CG2 . ILE B  2  137 ? -44.867 19.351  36.713  1.00 78.37  ? 137 ILE B CG2 1 
ATOM   2893  C CD1 . ILE B  2  137 ? -45.068 20.930  33.893  1.00 76.39  ? 137 ILE B CD1 1 
ATOM   2894  N N   . GLY B  2  138 ? -40.723 18.514  34.978  1.00 80.66  ? 138 GLY B N   1 
ATOM   2895  C CA  . GLY B  2  138 ? -39.637 18.455  34.003  1.00 81.71  ? 138 GLY B CA  1 
ATOM   2896  C C   . GLY B  2  138 ? -39.230 17.069  33.546  1.00 82.23  ? 138 GLY B C   1 
ATOM   2897  O O   . GLY B  2  138 ? -39.832 16.067  33.939  1.00 82.06  ? 138 GLY B O   1 
ATOM   2898  N N   . TRP B  2  139 ? -38.196 17.027  32.708  1.00 82.54  ? 139 TRP B N   1 
ATOM   2899  C CA  . TRP B  2  139 ? -37.666 15.781  32.165  1.00 84.00  ? 139 TRP B CA  1 
ATOM   2900  C C   . TRP B  2  139 ? -36.167 15.822  32.084  1.00 83.23  ? 139 TRP B C   1 
ATOM   2901  O O   . TRP B  2  139 ? -35.587 16.803  31.612  1.00 82.48  ? 139 TRP B O   1 
ATOM   2902  C CB  . TRP B  2  139 ? -38.256 15.507  30.783  1.00 85.26  ? 139 TRP B CB  1 
ATOM   2903  C CG  . TRP B  2  139 ? -37.928 14.135  30.237  1.00 86.16  ? 139 TRP B CG  1 
ATOM   2904  C CD1 . TRP B  2  139 ? -38.704 12.982  30.319  1.00 86.14  ? 139 TRP B CD1 1 
ATOM   2905  C CD2 . TRP B  2  139 ? -36.717 13.725  29.505  1.00 86.58  ? 139 TRP B CD2 1 
ATOM   2906  N NE1 . TRP B  2  139 ? -38.078 11.924  29.710  1.00 86.79  ? 139 TRP B NE1 1 
ATOM   2907  C CE2 . TRP B  2  139 ? -36.885 12.298  29.202  1.00 87.10  ? 139 TRP B CE2 1 
ATOM   2908  C CE3 . TRP B  2  139 ? -35.557 14.370  29.086  1.00 86.04  ? 139 TRP B CE3 1 
ATOM   2909  C CZ2 . TRP B  2  139 ? -35.923 11.574  28.512  1.00 87.99  ? 139 TRP B CZ2 1 
ATOM   2910  C CZ3 . TRP B  2  139 ? -34.593 13.628  28.394  1.00 86.92  ? 139 TRP B CZ3 1 
ATOM   2911  C CH2 . TRP B  2  139 ? -34.773 12.264  28.115  1.00 88.20  ? 139 TRP B CH2 1 
ATOM   2912  N N   . ASP B  2  140 ? -35.529 14.750  32.548  1.00 82.76  ? 140 ASP B N   1 
ATOM   2913  C CA  . ASP B  2  140 ? -34.085 14.569  32.393  1.00 83.84  ? 140 ASP B CA  1 
ATOM   2914  C C   . ASP B  2  140 ? -33.752 13.153  31.918  1.00 84.45  ? 140 ASP B C   1 
ATOM   2915  O O   . ASP B  2  140 ? -34.593 12.254  31.983  1.00 84.59  ? 140 ASP B O   1 
ATOM   2916  C CB  . ASP B  2  140 ? -33.328 14.924  33.683  1.00 83.72  ? 140 ASP B CB  1 
ATOM   2917  C CG  . ASP B  2  140 ? -33.845 14.175  34.902  1.00 84.89  ? 140 ASP B CG  1 
ATOM   2918  O OD1 . ASP B  2  140 ? -33.894 12.925  34.877  1.00 85.98  ? 140 ASP B OD1 1 
ATOM   2919  O OD2 . ASP B  2  140 ? -34.187 14.843  35.901  1.00 84.93  ? 140 ASP B OD2 1 
ATOM   2920  N N   . LYS B  2  141 ? -32.522 12.965  31.446  1.00 84.48  ? 141 LYS B N   1 
ATOM   2921  C CA  . LYS B  2  141 ? -32.086 11.687  30.879  1.00 85.26  ? 141 LYS B CA  1 
ATOM   2922  C C   . LYS B  2  141 ? -31.764 10.616  31.930  1.00 85.79  ? 141 LYS B C   1 
ATOM   2923  O O   . LYS B  2  141 ? -31.370 9.499   31.583  1.00 87.22  ? 141 LYS B O   1 
ATOM   2924  C CB  . LYS B  2  141 ? -30.887 11.899  29.943  1.00 86.76  ? 141 LYS B CB  1 
ATOM   2925  C CG  . LYS B  2  141 ? -29.641 12.456  30.617  1.00 86.95  ? 141 LYS B CG  1 
ATOM   2926  C CD  . LYS B  2  141 ? -28.486 12.540  29.635  1.00 87.70  ? 141 LYS B CD  1 
ATOM   2927  C CE  . LYS B  2  141 ? -27.182 12.861  30.342  1.00 87.72  ? 141 LYS B CE  1 
ATOM   2928  N NZ  . LYS B  2  141 ? -26.034 12.851  29.394  1.00 89.71  ? 141 LYS B NZ  1 
ATOM   2929  N N   . HIS B  2  142 ? -31.939 10.957  33.205  1.00 86.33  ? 142 HIS B N   1 
ATOM   2930  C CA  . HIS B  2  142 ? -31.600 10.051  34.302  1.00 88.22  ? 142 HIS B CA  1 
ATOM   2931  C C   . HIS B  2  142 ? -32.784 9.304   34.852  1.00 86.86  ? 142 HIS B C   1 
ATOM   2932  O O   . HIS B  2  142 ? -32.691 8.104   35.116  1.00 87.73  ? 142 HIS B O   1 
ATOM   2933  C CB  . HIS B  2  142 ? -30.872 10.799  35.415  1.00 91.07  ? 142 HIS B CB  1 
ATOM   2934  C CG  . HIS B  2  142 ? -29.541 11.375  34.992  1.00 95.13  ? 142 HIS B CG  1 
ATOM   2935  N ND1 . HIS B  2  142 ? -28.427 10.626  34.893  1.00 96.77  ? 142 HIS B ND1 1 
ATOM   2936  C CD2 . HIS B  2  142 ? -29.174 12.672  34.640  1.00 96.83  ? 142 HIS B CD2 1 
ATOM   2937  C CE1 . HIS B  2  142 ? -27.400 11.400  34.495  1.00 97.00  ? 142 HIS B CE1 1 
ATOM   2938  N NE2 . HIS B  2  142 ? -27.858 12.653  34.342  1.00 98.30  ? 142 HIS B NE2 1 
ATOM   2939  N N   . TYR B  2  143 ? -33.907 10.000  35.029  1.00 85.01  ? 143 TYR B N   1 
ATOM   2940  C CA  . TYR B  2  143 ? -35.111 9.389   35.598  1.00 85.84  ? 143 TYR B CA  1 
ATOM   2941  C C   . TYR B  2  143 ? -36.357 9.574   34.729  1.00 85.51  ? 143 TYR B C   1 
ATOM   2942  O O   . TYR B  2  143 ? -37.273 8.749   34.769  1.00 86.48  ? 143 TYR B O   1 
ATOM   2943  C CB  . TYR B  2  143 ? -35.369 9.915   37.015  1.00 85.66  ? 143 TYR B CB  1 
ATOM   2944  C CG  . TYR B  2  143 ? -34.246 9.639   37.993  1.00 88.92  ? 143 TYR B CG  1 
ATOM   2945  C CD1 . TYR B  2  143 ? -33.328 10.634  38.327  1.00 89.40  ? 143 TYR B CD1 1 
ATOM   2946  C CD2 . TYR B  2  143 ? -34.101 8.384   38.586  1.00 90.02  ? 143 TYR B CD2 1 
ATOM   2947  C CE1 . TYR B  2  143 ? -32.298 10.388  39.223  1.00 90.38  ? 143 TYR B CE1 1 
ATOM   2948  C CE2 . TYR B  2  143 ? -33.073 8.128   39.481  1.00 89.83  ? 143 TYR B CE2 1 
ATOM   2949  C CZ  . TYR B  2  143 ? -32.176 9.132   39.797  1.00 89.67  ? 143 TYR B CZ  1 
ATOM   2950  O OH  . TYR B  2  143 ? -31.157 8.880   40.686  1.00 90.01  ? 143 TYR B OH  1 
ATOM   2951  N N   . GLY B  2  144 ? -36.387 10.654  33.953  1.00 83.97  ? 144 GLY B N   1 
ATOM   2952  C CA  . GLY B  2  144 ? -37.508 10.936  33.058  1.00 84.06  ? 144 GLY B CA  1 
ATOM   2953  C C   . GLY B  2  144 ? -38.434 12.013  33.589  1.00 83.77  ? 144 GLY B C   1 
ATOM   2954  O O   . GLY B  2  144 ? -37.978 13.005  34.164  1.00 84.02  ? 144 GLY B O   1 
ATOM   2955  N N   . PHE B  2  145 ? -39.736 11.814  33.389  1.00 81.78  ? 145 PHE B N   1 
ATOM   2956  C CA  . PHE B  2  145 ? -40.756 12.756  33.851  1.00 81.39  ? 145 PHE B CA  1 
ATOM   2957  C C   . PHE B  2  145 ? -40.821 12.781  35.376  1.00 80.34  ? 145 PHE B C   1 
ATOM   2958  O O   . PHE B  2  145 ? -40.905 11.731  36.019  1.00 80.14  ? 145 PHE B O   1 
ATOM   2959  C CB  . PHE B  2  145 ? -42.127 12.405  33.262  1.00 81.82  ? 145 PHE B CB  1 
ATOM   2960  C CG  . PHE B  2  145 ? -42.203 12.541  31.765  1.00 80.91  ? 145 PHE B CG  1 
ATOM   2961  C CD1 . PHE B  2  145 ? -42.027 11.432  30.942  1.00 79.41  ? 145 PHE B CD1 1 
ATOM   2962  C CD2 . PHE B  2  145 ? -42.456 13.776  31.175  1.00 80.03  ? 145 PHE B CD2 1 
ATOM   2963  C CE1 . PHE B  2  145 ? -42.099 11.552  29.562  1.00 76.85  ? 145 PHE B CE1 1 
ATOM   2964  C CE2 . PHE B  2  145 ? -42.527 13.902  29.795  1.00 78.93  ? 145 PHE B CE2 1 
ATOM   2965  C CZ  . PHE B  2  145 ? -42.349 12.789  28.989  1.00 78.56  ? 145 PHE B CZ  1 
ATOM   2966  N N   . GLN B  2  146 ? -40.774 13.984  35.944  1.00 79.49  ? 146 GLN B N   1 
ATOM   2967  C CA  . GLN B  2  146 ? -40.710 14.159  37.396  1.00 79.36  ? 146 GLN B CA  1 
ATOM   2968  C C   . GLN B  2  146 ? -41.613 15.280  37.910  1.00 79.48  ? 146 GLN B C   1 
ATOM   2969  O O   . GLN B  2  146 ? -41.983 16.191  37.163  1.00 79.07  ? 146 GLN B O   1 
ATOM   2970  C CB  . GLN B  2  146 ? -39.265 14.413  37.838  1.00 77.61  ? 146 GLN B CB  1 
ATOM   2971  C CG  . GLN B  2  146 ? -38.378 13.178  37.824  1.00 77.73  ? 146 GLN B CG  1 
ATOM   2972  C CD  . GLN B  2  146 ? -36.903 13.522  37.774  1.00 76.78  ? 146 GLN B CD  1 
ATOM   2973  O OE1 . GLN B  2  146 ? -36.348 14.083  38.718  1.00 77.10  ? 146 GLN B OE1 1 
ATOM   2974  N NE2 . GLN B  2  146 ? -36.259 13.178  36.668  1.00 78.66  ? 146 GLN B NE2 1 
ATOM   2975  N N   . LEU B  2  147 ? -41.955 15.197  39.194  1.00 80.17  ? 147 LEU B N   1 
ATOM   2976  C CA  . LEU B  2  147 ? -42.764 16.205  39.873  1.00 80.28  ? 147 LEU B CA  1 
ATOM   2977  C C   . LEU B  2  147 ? -42.212 16.453  41.276  1.00 79.91  ? 147 LEU B C   1 
ATOM   2978  O O   . LEU B  2  147 ? -41.936 15.506  42.017  1.00 81.15  ? 147 LEU B O   1 
ATOM   2979  C CB  . LEU B  2  147 ? -44.227 15.755  39.938  1.00 81.10  ? 147 LEU B CB  1 
ATOM   2980  C CG  . LEU B  2  147 ? -45.229 16.534  40.797  1.00 81.38  ? 147 LEU B CG  1 
ATOM   2981  C CD1 . LEU B  2  147 ? -45.731 17.781  40.085  1.00 80.28  ? 147 LEU B CD1 1 
ATOM   2982  C CD2 . LEU B  2  147 ? -46.390 15.629  41.173  1.00 83.88  ? 147 LEU B CD2 1 
ATOM   2983  N N   . TYR B  2  148 ? -42.054 17.726  41.632  1.00 79.72  ? 148 TYR B N   1 
ATOM   2984  C CA  . TYR B  2  148 ? -41.478 18.107  42.923  1.00 80.78  ? 148 TYR B CA  1 
ATOM   2985  C C   . TYR B  2  148 ? -42.296 19.169  43.657  1.00 81.69  ? 148 TYR B C   1 
ATOM   2986  O O   . TYR B  2  148 ? -42.948 20.006  43.031  1.00 80.80  ? 148 TYR B O   1 
ATOM   2987  C CB  . TYR B  2  148 ? -40.032 18.583  42.745  1.00 79.28  ? 148 TYR B CB  1 
ATOM   2988  C CG  . TYR B  2  148 ? -39.063 17.478  42.382  1.00 77.84  ? 148 TYR B CG  1 
ATOM   2989  C CD1 . TYR B  2  148 ? -38.762 17.196  41.050  1.00 76.38  ? 148 TYR B CD1 1 
ATOM   2990  C CD2 . TYR B  2  148 ? -38.446 16.714  43.373  1.00 79.03  ? 148 TYR B CD2 1 
ATOM   2991  C CE1 . TYR B  2  148 ? -37.876 16.185  40.715  1.00 76.41  ? 148 TYR B CE1 1 
ATOM   2992  C CE2 . TYR B  2  148 ? -37.559 15.700  43.047  1.00 78.60  ? 148 TYR B CE2 1 
ATOM   2993  C CZ  . TYR B  2  148 ? -37.278 15.440  41.719  1.00 77.73  ? 148 TYR B CZ  1 
ATOM   2994  O OH  . TYR B  2  148 ? -36.399 14.434  41.393  1.00 79.83  ? 148 TYR B OH  1 
ATOM   2995  N N   . GLN B  2  149 ? -42.253 19.118  44.987  1.00 83.70  ? 149 GLN B N   1 
ATOM   2996  C CA  . GLN B  2  149 ? -42.917 20.100  45.842  1.00 86.19  ? 149 GLN B CA  1 
ATOM   2997  C C   . GLN B  2  149 ? -41.888 20.793  46.732  1.00 89.08  ? 149 GLN B C   1 
ATOM   2998  O O   . GLN B  2  149 ? -40.994 20.141  47.276  1.00 89.74  ? 149 GLN B O   1 
ATOM   2999  C CB  . GLN B  2  149 ? -43.993 19.425  46.699  1.00 87.02  ? 149 GLN B CB  1 
ATOM   3000  C CG  . GLN B  2  149 ? -44.877 20.389  47.480  1.00 87.88  ? 149 GLN B CG  1 
ATOM   3001  C CD  . GLN B  2  149 ? -45.820 19.687  48.441  1.00 90.81  ? 149 GLN B CD  1 
ATOM   3002  O OE1 . GLN B  2  149 ? -47.039 19.826  48.341  1.00 94.00  ? 149 GLN B OE1 1 
ATOM   3003  N NE2 . GLN B  2  149 ? -45.260 18.931  49.380  1.00 91.47  ? 149 GLN B NE2 1 
ATOM   3004  N N   . SER B  2  150 ? -42.020 22.110  46.879  1.00 91.21  ? 150 SER B N   1 
ATOM   3005  C CA  . SER B  2  150 ? -41.075 22.903  47.665  1.00 91.92  ? 150 SER B CA  1 
ATOM   3006  C C   . SER B  2  150 ? -41.742 23.630  48.835  1.00 92.82  ? 150 SER B C   1 
ATOM   3007  O O   . SER B  2  150 ? -42.892 24.062  48.737  1.00 91.73  ? 150 SER B O   1 
ATOM   3008  C CB  . SER B  2  150 ? -40.347 23.906  46.768  1.00 91.19  ? 150 SER B CB  1 
ATOM   3009  O OG  . SER B  2  150 ? -39.232 24.469  47.435  1.00 91.45  ? 150 SER B OG  1 
ATOM   3010  N N   . ASP B  2  151 ? -41.000 23.759  49.933  1.00 94.10  ? 151 ASP B N   1 
ATOM   3011  C CA  . ASP B  2  151 ? -41.482 24.422  51.145  1.00 96.88  ? 151 ASP B CA  1 
ATOM   3012  C C   . ASP B  2  151 ? -40.604 25.626  51.511  1.00 95.79  ? 151 ASP B C   1 
ATOM   3013  O O   . ASP B  2  151 ? -39.439 25.683  51.108  1.00 95.60  ? 151 ASP B O   1 
ATOM   3014  C CB  . ASP B  2  151 ? -41.531 23.426  52.312  1.00 99.38  ? 151 ASP B CB  1 
ATOM   3015  C CG  . ASP B  2  151 ? -42.609 22.365  52.139  1.00 100.93 ? 151 ASP B CG  1 
ATOM   3016  O OD1 . ASP B  2  151 ? -43.575 22.593  51.378  1.00 102.73 ? 151 ASP B OD1 1 
ATOM   3017  O OD2 . ASP B  2  151 ? -42.492 21.298  52.778  1.00 101.59 ? 151 ASP B OD2 1 
ATOM   3018  N N   . PRO B  2  152 ? -41.162 26.595  52.270  1.00 95.37  ? 152 PRO B N   1 
ATOM   3019  C CA  . PRO B  2  152 ? -40.418 27.774  52.739  1.00 93.15  ? 152 PRO B CA  1 
ATOM   3020  C C   . PRO B  2  152 ? -39.195 27.446  53.600  1.00 91.93  ? 152 PRO B C   1 
ATOM   3021  O O   . PRO B  2  152 ? -38.245 28.231  53.639  1.00 91.80  ? 152 PRO B O   1 
ATOM   3022  C CB  . PRO B  2  152 ? -41.452 28.525  53.581  1.00 92.51  ? 152 PRO B CB  1 
ATOM   3023  C CG  . PRO B  2  152 ? -42.759 28.136  52.993  1.00 93.77  ? 152 PRO B CG  1 
ATOM   3024  C CD  . PRO B  2  152 ? -42.597 26.697  52.602  1.00 95.96  ? 152 PRO B CD  1 
ATOM   3025  N N   . SER B  2  153 ? -39.231 26.302  54.281  1.00 90.44  ? 153 SER B N   1 
ATOM   3026  C CA  . SER B  2  153 ? -38.135 25.862  55.146  1.00 89.31  ? 153 SER B CA  1 
ATOM   3027  C C   . SER B  2  153 ? -36.926 25.352  54.360  1.00 88.81  ? 153 SER B C   1 
ATOM   3028  O O   . SER B  2  153 ? -35.830 25.224  54.910  1.00 89.39  ? 153 SER B O   1 
ATOM   3029  C CB  . SER B  2  153 ? -38.625 24.772  56.103  1.00 89.73  ? 153 SER B CB  1 
ATOM   3030  O OG  . SER B  2  153 ? -39.188 23.683  55.390  1.00 90.24  ? 153 SER B OG  1 
ATOM   3031  N N   . GLY B  2  154 ? -37.134 25.072  53.076  1.00 90.76  ? 154 GLY B N   1 
ATOM   3032  C CA  . GLY B  2  154 ? -36.109 24.465  52.232  1.00 92.31  ? 154 GLY B CA  1 
ATOM   3033  C C   . GLY B  2  154 ? -36.328 22.970  52.111  1.00 96.18  ? 154 GLY B C   1 
ATOM   3034  O O   . GLY B  2  154 ? -35.413 22.224  51.756  1.00 94.16  ? 154 GLY B O   1 
ATOM   3035  N N   . ASN B  2  155 ? -37.552 22.542  52.413  1.00 100.06 ? 155 ASN B N   1 
ATOM   3036  C CA  . ASN B  2  155 ? -37.936 21.138  52.371  1.00 102.79 ? 155 ASN B CA  1 
ATOM   3037  C C   . ASN B  2  155 ? -38.509 20.776  51.004  1.00 102.82 ? 155 ASN B C   1 
ATOM   3038  O O   . ASN B  2  155 ? -39.449 21.416  50.527  1.00 103.91 ? 155 ASN B O   1 
ATOM   3039  C CB  . ASN B  2  155 ? -38.961 20.848  53.474  1.00 105.26 ? 155 ASN B CB  1 
ATOM   3040  C CG  . ASN B  2  155 ? -38.996 19.384  53.888  1.00 108.74 ? 155 ASN B CG  1 
ATOM   3041  O OD1 . ASN B  2  155 ? -39.612 19.039  54.896  1.00 111.79 ? 155 ASN B OD1 1 
ATOM   3042  N ND2 . ASN B  2  155 ? -38.341 18.519  53.118  1.00 107.01 ? 155 ASN B ND2 1 
ATOM   3043  N N   . TYR B  2  156 ? -37.933 19.753  50.378  1.00 101.17 ? 156 TYR B N   1 
ATOM   3044  C CA  . TYR B  2  156 ? -38.387 19.298  49.068  1.00 99.34  ? 156 TYR B CA  1 
ATOM   3045  C C   . TYR B  2  156 ? -38.823 17.833  49.094  1.00 99.65  ? 156 TYR B C   1 
ATOM   3046  O O   . TYR B  2  156 ? -38.411 17.066  49.969  1.00 101.74 ? 156 TYR B O   1 
ATOM   3047  C CB  . TYR B  2  156 ? -37.303 19.534  48.005  1.00 96.84  ? 156 TYR B CB  1 
ATOM   3048  C CG  . TYR B  2  156 ? -36.314 18.398  47.829  1.00 97.85  ? 156 TYR B CG  1 
ATOM   3049  C CD1 . TYR B  2  156 ? -36.372 17.570  46.708  1.00 97.15  ? 156 TYR B CD1 1 
ATOM   3050  C CD2 . TYR B  2  156 ? -35.319 18.154  48.777  1.00 97.94  ? 156 TYR B CD2 1 
ATOM   3051  C CE1 . TYR B  2  156 ? -35.473 16.529  46.537  1.00 95.66  ? 156 TYR B CE1 1 
ATOM   3052  C CE2 . TYR B  2  156 ? -34.416 17.115  48.615  1.00 94.88  ? 156 TYR B CE2 1 
ATOM   3053  C CZ  . TYR B  2  156 ? -34.497 16.307  47.494  1.00 94.27  ? 156 TYR B CZ  1 
ATOM   3054  O OH  . TYR B  2  156 ? -33.602 15.275  47.327  1.00 96.15  ? 156 TYR B OH  1 
ATOM   3055  N N   . GLY B  2  157 ? -39.658 17.457  48.129  1.00 96.88  ? 157 GLY B N   1 
ATOM   3056  C CA  . GLY B  2  157 ? -40.144 16.087  48.009  1.00 94.31  ? 157 GLY B CA  1 
ATOM   3057  C C   . GLY B  2  157 ? -40.616 15.766  46.605  1.00 92.65  ? 157 GLY B C   1 
ATOM   3058  O O   . GLY B  2  157 ? -41.327 16.559  45.984  1.00 92.02  ? 157 GLY B O   1 
ATOM   3059  N N   . GLY B  2  158 ? -40.210 14.602  46.105  1.00 91.93  ? 158 GLY B N   1 
ATOM   3060  C CA  . GLY B  2  158 ? -40.632 14.130  44.790  1.00 91.23  ? 158 GLY B CA  1 
ATOM   3061  C C   . GLY B  2  158 ? -41.962 13.409  44.871  1.00 95.07  ? 158 GLY B C   1 
ATOM   3062  O O   . GLY B  2  158 ? -42.068 12.368  45.519  1.00 101.00 ? 158 GLY B O   1 
ATOM   3063  N N   . TRP B  2  159 ? -42.974 13.965  44.212  1.00 91.81  ? 159 TRP B N   1 
ATOM   3064  C CA  . TRP B  2  159 ? -44.330 13.418  44.254  1.00 90.74  ? 159 TRP B CA  1 
ATOM   3065  C C   . TRP B  2  159 ? -44.763 12.839  42.936  1.00 88.85  ? 159 TRP B C   1 
ATOM   3066  O O   . TRP B  2  159 ? -44.139 13.084  41.901  1.00 87.40  ? 159 TRP B O   1 
ATOM   3067  C CB  . TRP B  2  159 ? -45.318 14.495  44.691  1.00 91.85  ? 159 TRP B CB  1 
ATOM   3068  C CG  . TRP B  2  159 ? -45.226 14.862  46.153  1.00 96.56  ? 159 TRP B CG  1 
ATOM   3069  C CD1 . TRP B  2  159 ? -44.288 15.690  46.764  1.00 96.44  ? 159 TRP B CD1 1 
ATOM   3070  C CD2 . TRP B  2  159 ? -46.117 14.430  47.242  1.00 100.71 ? 159 TRP B CD2 1 
ATOM   3071  N NE1 . TRP B  2  159 ? -44.527 15.792  48.112  1.00 98.96  ? 159 TRP B NE1 1 
ATOM   3072  C CE2 . TRP B  2  159 ? -45.607 15.063  48.465  1.00 101.12 ? 159 TRP B CE2 1 
ATOM   3073  C CE3 . TRP B  2  159 ? -47.240 13.612  47.324  1.00 104.05 ? 159 TRP B CE3 1 
ATOM   3074  C CZ2 . TRP B  2  159 ? -46.211 14.870  49.700  1.00 102.69 ? 159 TRP B CZ2 1 
ATOM   3075  C CZ3 . TRP B  2  159 ? -47.840 13.426  48.576  1.00 103.67 ? 159 TRP B CZ3 1 
ATOM   3076  C CH2 . TRP B  2  159 ? -47.336 14.041  49.734  1.00 103.46 ? 159 TRP B CH2 1 
ATOM   3077  N N   . LYS B  2  160 ? -45.836 12.052  42.973  1.00 89.31  ? 160 LYS B N   1 
ATOM   3078  C CA  . LYS B  2  160 ? -46.494 11.554  41.766  1.00 88.50  ? 160 LYS B CA  1 
ATOM   3079  C C   . LYS B  2  160 ? -47.816 12.287  41.555  1.00 86.86  ? 160 LYS B C   1 
ATOM   3080  O O   . LYS B  2  160 ? -48.266 12.461  40.421  1.00 86.54  ? 160 LYS B O   1 
ATOM   3081  C CB  . LYS B  2  160 ? -46.728 10.045  41.853  1.00 89.42  ? 160 LYS B CB  1 
ATOM   3082  C CG  . LYS B  2  160 ? -45.466 9.213   41.690  1.00 91.93  ? 160 LYS B CG  1 
ATOM   3083  C CD  . LYS B  2  160 ? -45.745 7.731   41.872  1.00 95.44  ? 160 LYS B CD  1 
ATOM   3084  C CE  . LYS B  2  160 ? -44.466 6.921   41.740  1.00 100.21 ? 160 LYS B CE  1 
ATOM   3085  N NZ  . LYS B  2  160 ? -44.693 5.470   41.978  1.00 107.51 ? 160 LYS B NZ  1 
ATOM   3086  N N   . ALA B  2  161 ? -48.428 12.707  42.660  1.00 87.17  ? 161 ALA B N   1 
ATOM   3087  C CA  . ALA B  2  161 ? -49.643 13.516  42.645  1.00 88.00  ? 161 ALA B CA  1 
ATOM   3088  C C   . ALA B  2  161 ? -49.720 14.331  43.932  1.00 88.96  ? 161 ALA B C   1 
ATOM   3089  O O   . ALA B  2  161 ? -49.761 13.769  45.031  1.00 92.23  ? 161 ALA B O   1 
ATOM   3090  C CB  . ALA B  2  161 ? -50.875 12.635  42.489  1.00 91.44  ? 161 ALA B CB  1 
ATOM   3091  N N   . THR B  2  162 ? -49.727 15.655  43.791  1.00 87.56  ? 162 THR B N   1 
ATOM   3092  C CA  . THR B  2  162 ? -49.724 16.559  44.945  1.00 87.66  ? 162 THR B CA  1 
ATOM   3093  C C   . THR B  2  162 ? -50.473 17.869  44.681  1.00 86.91  ? 162 THR B C   1 
ATOM   3094  O O   . THR B  2  162 ? -50.693 18.253  43.529  1.00 85.02  ? 162 THR B O   1 
ATOM   3095  C CB  . THR B  2  162 ? -48.284 16.855  45.437  1.00 86.75  ? 162 THR B CB  1 
ATOM   3096  O OG1 . THR B  2  162 ? -48.332 17.657  46.624  1.00 86.33  ? 162 THR B OG1 1 
ATOM   3097  C CG2 . THR B  2  162 ? -47.466 17.578  44.366  1.00 86.02  ? 162 THR B CG2 1 
ATOM   3098  N N   . CYS B  2  163 ? -50.862 18.539  45.764  1.00 88.74  ? 163 CYS B N   1 
ATOM   3099  C CA  . CYS B  2  163 ? -51.533 19.835  45.694  1.00 90.82  ? 163 CYS B CA  1 
ATOM   3100  C C   . CYS B  2  163 ? -51.079 20.751  46.826  1.00 92.46  ? 163 CYS B C   1 
ATOM   3101  O O   . CYS B  2  163 ? -50.790 20.290  47.933  1.00 93.60  ? 163 CYS B O   1 
ATOM   3102  C CB  . CYS B  2  163 ? -53.052 19.661  45.742  1.00 92.64  ? 163 CYS B CB  1 
ATOM   3103  S SG  . CYS B  2  163 ? -53.980 21.204  45.577  1.00 92.91  ? 163 CYS B SG  1 
ATOM   3104  N N   . ILE B  2  164 ? -51.020 22.049  46.539  1.00 93.37  ? 164 ILE B N   1 
ATOM   3105  C CA  . ILE B  2  164 ? -50.639 23.057  47.531  1.00 93.84  ? 164 ILE B CA  1 
ATOM   3106  C C   . ILE B  2  164 ? -51.409 24.368  47.324  1.00 92.65  ? 164 ILE B C   1 
ATOM   3107  O O   . ILE B  2  164 ? -51.683 24.770  46.189  1.00 90.44  ? 164 ILE B O   1 
ATOM   3108  C CB  . ILE B  2  164 ? -49.099 23.278  47.572  1.00 93.37  ? 164 ILE B CB  1 
ATOM   3109  C CG1 . ILE B  2  164 ? -48.676 24.053  48.828  1.00 94.48  ? 164 ILE B CG1 1 
ATOM   3110  C CG2 . ILE B  2  164 ? -48.587 23.947  46.299  1.00 89.77  ? 164 ILE B CG2 1 
ATOM   3111  C CD1 . ILE B  2  164 ? -48.666 23.231  50.101  1.00 97.78  ? 164 ILE B CD1 1 
ATOM   3112  N N   . GLY B  2  165 ? -51.765 25.015  48.431  1.00 94.80  ? 165 GLY B N   1 
ATOM   3113  C CA  . GLY B  2  165 ? -52.524 26.264  48.401  1.00 98.97  ? 165 GLY B CA  1 
ATOM   3114  C C   . GLY B  2  165 ? -53.787 26.181  49.235  1.00 105.00 ? 165 GLY B C   1 
ATOM   3115  O O   . GLY B  2  165 ? -53.782 25.606  50.328  1.00 105.29 ? 165 GLY B O   1 
ATOM   3116  N N   . ASN B  2  166 ? -54.871 26.758  48.719  1.00 108.29 ? 166 ASN B N   1 
ATOM   3117  C CA  . ASN B  2  166 ? -56.168 26.717  49.392  1.00 111.00 ? 166 ASN B CA  1 
ATOM   3118  C C   . ASN B  2  166 ? -56.817 25.344  49.261  1.00 113.94 ? 166 ASN B C   1 
ATOM   3119  O O   . ASN B  2  166 ? -56.817 24.752  48.177  1.00 113.00 ? 166 ASN B O   1 
ATOM   3120  C CB  . ASN B  2  166 ? -57.101 27.801  48.843  1.00 111.45 ? 166 ASN B CB  1 
ATOM   3121  C CG  . ASN B  2  166 ? -58.332 28.011  49.708  1.00 113.42 ? 166 ASN B CG  1 
ATOM   3122  O OD1 . ASN B  2  166 ? -58.247 28.063  50.936  1.00 114.04 ? 166 ASN B OD1 1 
ATOM   3123  N ND2 . ASN B  2  166 ? -59.486 28.144  49.066  1.00 114.33 ? 166 ASN B ND2 1 
ATOM   3124  N N   . ASN B  2  167 ? -57.363 24.851  50.374  1.00 117.28 ? 167 ASN B N   1 
ATOM   3125  C CA  . ASN B  2  167 ? -57.971 23.516  50.458  1.00 120.09 ? 167 ASN B CA  1 
ATOM   3126  C C   . ASN B  2  167 ? -57.026 22.400  49.998  1.00 118.34 ? 167 ASN B C   1 
ATOM   3127  O O   . ASN B  2  167 ? -57.429 21.478  49.284  1.00 117.47 ? 167 ASN B O   1 
ATOM   3128  C CB  . ASN B  2  167 ? -59.307 23.466  49.699  1.00 122.86 ? 167 ASN B CB  1 
ATOM   3129  C CG  . ASN B  2  167 ? -60.314 24.484  50.209  1.00 127.16 ? 167 ASN B CG  1 
ATOM   3130  O OD1 . ASN B  2  167 ? -60.400 24.749  51.410  1.00 126.99 ? 167 ASN B OD1 1 
ATOM   3131  N ND2 . ASN B  2  167 ? -61.088 25.055  49.294  1.00 127.27 ? 167 ASN B ND2 1 
ATOM   3132  N N   . SER B  2  168 ? -55.768 22.499  50.424  1.00 117.34 ? 168 SER B N   1 
ATOM   3133  C CA  . SER B  2  168 ? -54.714 21.566  50.026  1.00 116.11 ? 168 SER B CA  1 
ATOM   3134  C C   . SER B  2  168 ? -54.881 20.183  50.657  1.00 116.84 ? 168 SER B C   1 
ATOM   3135  O O   . SER B  2  168 ? -54.604 19.167  50.016  1.00 115.71 ? 168 SER B O   1 
ATOM   3136  C CB  . SER B  2  168 ? -53.339 22.144  50.374  1.00 113.29 ? 168 SER B CB  1 
ATOM   3137  O OG  . SER B  2  168 ? -52.295 21.284  49.951  1.00 109.87 ? 168 SER B OG  1 
ATOM   3138  N N   . ALA B  2  169 ? -55.332 20.156  51.911  1.00 117.86 ? 169 ALA B N   1 
ATOM   3139  C CA  . ALA B  2  169 ? -55.530 18.909  52.652  1.00 118.26 ? 169 ALA B CA  1 
ATOM   3140  C C   . ALA B  2  169 ? -56.692 18.084  52.099  1.00 117.88 ? 169 ALA B C   1 
ATOM   3141  O O   . ALA B  2  169 ? -56.644 16.852  52.103  1.00 118.33 ? 169 ALA B O   1 
ATOM   3142  C CB  . ALA B  2  169 ? -55.738 19.198  54.131  1.00 118.01 ? 169 ALA B CB  1 
ATOM   3143  N N   . ALA B  2  170 ? -57.730 18.772  51.627  1.00 116.00 ? 170 ALA B N   1 
ATOM   3144  C CA  . ALA B  2  170 ? -58.902 18.122  51.046  1.00 113.49 ? 170 ALA B CA  1 
ATOM   3145  C C   . ALA B  2  170 ? -58.642 17.651  49.615  1.00 111.09 ? 170 ALA B C   1 
ATOM   3146  O O   . ALA B  2  170 ? -59.207 16.648  49.174  1.00 110.84 ? 170 ALA B O   1 
ATOM   3147  C CB  . ALA B  2  170 ? -60.102 19.055  51.092  1.00 113.12 ? 170 ALA B CB  1 
ATOM   3148  N N   . ALA B  2  171 ? -57.787 18.381  48.901  1.00 108.52 ? 171 ALA B N   1 
ATOM   3149  C CA  . ALA B  2  171 ? -57.464 18.069  47.509  1.00 106.06 ? 171 ALA B CA  1 
ATOM   3150  C C   . ALA B  2  171 ? -56.498 16.891  47.376  1.00 107.27 ? 171 ALA B C   1 
ATOM   3151  O O   . ALA B  2  171 ? -56.627 16.083  46.455  1.00 106.16 ? 171 ALA B O   1 
ATOM   3152  C CB  . ALA B  2  171 ? -56.908 19.297  46.803  1.00 104.34 ? 171 ALA B CB  1 
ATOM   3153  N N   . VAL B  2  172 ? -55.538 16.801  48.297  1.00 110.28 ? 172 VAL B N   1 
ATOM   3154  C CA  . VAL B  2  172 ? -54.540 15.725  48.288  1.00 111.79 ? 172 VAL B CA  1 
ATOM   3155  C C   . VAL B  2  172 ? -55.164 14.365  48.637  1.00 114.21 ? 172 VAL B C   1 
ATOM   3156  O O   . VAL B  2  172 ? -54.691 13.322  48.179  1.00 114.36 ? 172 VAL B O   1 
ATOM   3157  C CB  . VAL B  2  172 ? -53.321 16.057  49.193  1.00 112.94 ? 172 VAL B CB  1 
ATOM   3158  C CG1 . VAL B  2  172 ? -53.669 15.946  50.674  1.00 114.68 ? 172 VAL B CG1 1 
ATOM   3159  C CG2 . VAL B  2  172 ? -52.125 15.178  48.847  1.00 111.07 ? 172 VAL B CG2 1 
ATOM   3160  N N   . SER B  2  173 ? -56.232 14.391  49.434  1.00 117.39 ? 173 SER B N   1 
ATOM   3161  C CA  . SER B  2  173 ? -56.993 13.187  49.764  1.00 121.09 ? 173 SER B CA  1 
ATOM   3162  C C   . SER B  2  173 ? -57.886 12.769  48.596  1.00 121.32 ? 173 SER B C   1 
ATOM   3163  O O   . SER B  2  173 ? -58.170 11.583  48.414  1.00 121.67 ? 173 SER B O   1 
ATOM   3164  C CB  . SER B  2  173 ? -57.834 13.408  51.023  1.00 124.17 ? 173 SER B CB  1 
ATOM   3165  O OG  . SER B  2  173 ? -58.743 14.481  50.851  1.00 125.94 ? 173 SER B OG  1 
ATOM   3166  N N   . MET B  2  174 ? -58.323 13.756  47.815  1.00 120.04 ? 174 MET B N   1 
ATOM   3167  C CA  . MET B  2  174 ? -59.125 13.520  46.617  1.00 118.59 ? 174 MET B CA  1 
ATOM   3168  C C   . MET B  2  174 ? -58.259 12.958  45.489  1.00 118.48 ? 174 MET B C   1 
ATOM   3169  O O   . MET B  2  174 ? -58.723 12.140  44.691  1.00 117.98 ? 174 MET B O   1 
ATOM   3170  C CB  . MET B  2  174 ? -59.806 14.817  46.173  1.00 117.98 ? 174 MET B CB  1 
ATOM   3171  C CG  . MET B  2  174 ? -60.983 14.625  45.228  1.00 120.57 ? 174 MET B CG  1 
ATOM   3172  S SD  . MET B  2  174 ? -61.872 16.159  44.892  1.00 124.50 ? 174 MET B SD  1 
ATOM   3173  C CE  . MET B  2  174 ? -62.644 16.472  46.479  1.00 129.21 ? 174 MET B CE  1 
ATOM   3174  N N   . LEU B  2  175 ? -57.004 13.403  45.436  1.00 117.30 ? 175 LEU B N   1 
ATOM   3175  C CA  . LEU B  2  175 ? -56.022 12.888  44.479  1.00 113.91 ? 175 LEU B CA  1 
ATOM   3176  C C   . LEU B  2  175 ? -55.577 11.475  44.850  1.00 116.50 ? 175 LEU B C   1 
ATOM   3177  O O   . LEU B  2  175 ? -55.181 10.695  43.984  1.00 115.34 ? 175 LEU B O   1 
ATOM   3178  C CB  . LEU B  2  175 ? -54.802 13.814  44.398  1.00 109.18 ? 175 LEU B CB  1 
ATOM   3179  C CG  . LEU B  2  175 ? -54.956 15.177  43.712  1.00 105.17 ? 175 LEU B CG  1 
ATOM   3180  C CD1 . LEU B  2  175 ? -53.861 16.129  44.167  1.00 103.89 ? 175 LEU B CD1 1 
ATOM   3181  C CD2 . LEU B  2  175 ? -54.960 15.048  42.196  1.00 102.12 ? 175 LEU B CD2 1 
ATOM   3182  N N   . LYS B  2  176 ? -55.650 11.160  46.142  1.00 119.66 ? 176 LYS B N   1 
ATOM   3183  C CA  . LYS B  2  176 ? -55.301 9.838   46.661  1.00 121.41 ? 176 LYS B CA  1 
ATOM   3184  C C   . LYS B  2  176 ? -56.369 8.799   46.307  1.00 123.28 ? 176 LYS B C   1 
ATOM   3185  O O   . LYS B  2  176 ? -56.095 7.596   46.284  1.00 124.40 ? 176 LYS B O   1 
ATOM   3186  C CB  . LYS B  2  176 ? -55.113 9.912   48.180  1.00 122.39 ? 176 LYS B CB  1 
ATOM   3187  C CG  . LYS B  2  176 ? -54.284 8.788   48.782  1.00 124.92 ? 176 LYS B CG  1 
ATOM   3188  C CD  . LYS B  2  176 ? -54.068 9.010   50.271  1.00 128.79 ? 176 LYS B CD  1 
ATOM   3189  C CE  . LYS B  2  176 ? -53.228 7.900   50.882  1.00 131.84 ? 176 LYS B CE  1 
ATOM   3190  N NZ  . LYS B  2  176 ? -52.929 8.159   52.318  1.00 132.91 ? 176 LYS B NZ  1 
ATOM   3191  N N   . GLN B  2  177 ? -57.578 9.277   46.021  1.00 125.65 ? 177 GLN B N   1 
ATOM   3192  C CA  . GLN B  2  177 ? -58.727 8.418   45.744  1.00 129.10 ? 177 GLN B CA  1 
ATOM   3193  C C   . GLN B  2  177 ? -58.771 7.917   44.297  1.00 128.93 ? 177 GLN B C   1 
ATOM   3194  O O   . GLN B  2  177 ? -59.091 6.752   44.051  1.00 128.82 ? 177 GLN B O   1 
ATOM   3195  C CB  . GLN B  2  177 ? -60.027 9.157   46.085  1.00 133.36 ? 177 GLN B CB  1 
ATOM   3196  C CG  . GLN B  2  177 ? -61.258 8.267   46.214  1.00 136.70 ? 177 GLN B CG  1 
ATOM   3197  C CD  . GLN B  2  177 ? -61.313 7.510   47.530  1.00 138.51 ? 177 GLN B CD  1 
ATOM   3198  O OE1 . GLN B  2  177 ? -61.002 8.053   48.591  1.00 138.43 ? 177 GLN B OE1 1 
ATOM   3199  N NE2 . GLN B  2  177 ? -61.723 6.249   47.466  1.00 140.36 ? 177 GLN B NE2 1 
ATOM   3200  N N   . ASP B  2  178 ? -58.445 8.797   43.350  1.00 125.20 ? 178 ASP B N   1 
ATOM   3201  C CA  . ASP B  2  178 ? -58.619 8.507   41.923  1.00 122.91 ? 178 ASP B CA  1 
ATOM   3202  C C   . ASP B  2  178 ? -57.357 8.022   41.199  1.00 118.76 ? 178 ASP B C   1 
ATOM   3203  O O   . ASP B  2  178 ? -57.451 7.281   40.219  1.00 119.40 ? 178 ASP B O   1 
ATOM   3204  C CB  . ASP B  2  178 ? -59.205 9.725   41.197  1.00 123.24 ? 178 ASP B CB  1 
ATOM   3205  C CG  . ASP B  2  178 ? -60.636 10.027  41.616  1.00 121.55 ? 178 ASP B CG  1 
ATOM   3206  O OD1 . ASP B  2  178 ? -61.483 10.237  40.721  1.00 120.78 ? 178 ASP B OD1 1 
ATOM   3207  O OD2 . ASP B  2  178 ? -60.918 10.056  42.834  1.00 118.89 ? 178 ASP B OD2 1 
ATOM   3208  N N   . TYR B  2  179 ? -56.189 8.444   41.684  1.00 113.91 ? 179 TYR B N   1 
ATOM   3209  C CA  . TYR B  2  179 ? -54.910 8.172   41.018  1.00 111.03 ? 179 TYR B CA  1 
ATOM   3210  C C   . TYR B  2  179 ? -54.545 6.689   40.995  1.00 112.18 ? 179 TYR B C   1 
ATOM   3211  O O   . TYR B  2  179 ? -54.682 5.987   41.999  1.00 112.86 ? 179 TYR B O   1 
ATOM   3212  C CB  . TYR B  2  179 ? -53.786 8.980   41.677  1.00 105.54 ? 179 TYR B CB  1 
ATOM   3213  C CG  . TYR B  2  179 ? -52.501 9.054   40.876  1.00 99.99  ? 179 TYR B CG  1 
ATOM   3214  C CD1 . TYR B  2  179 ? -52.318 10.039  39.905  1.00 96.66  ? 179 TYR B CD1 1 
ATOM   3215  C CD2 . TYR B  2  179 ? -51.463 8.148   41.099  1.00 98.50  ? 179 TYR B CD2 1 
ATOM   3216  C CE1 . TYR B  2  179 ? -51.143 10.114  39.174  1.00 93.37  ? 179 TYR B CE1 1 
ATOM   3217  C CE2 . TYR B  2  179 ? -50.284 8.215   40.372  1.00 93.97  ? 179 TYR B CE2 1 
ATOM   3218  C CZ  . TYR B  2  179 ? -50.129 9.198   39.412  1.00 92.70  ? 179 TYR B CZ  1 
ATOM   3219  O OH  . TYR B  2  179 ? -48.960 9.267   38.690  1.00 92.69  ? 179 TYR B OH  1 
ATOM   3220  N N   . LYS B  2  180 ? -54.080 6.229   39.835  1.00 117.78 ? 180 LYS B N   1 
ATOM   3221  C CA  . LYS B  2  180 ? -53.611 4.855   39.659  1.00 124.47 ? 180 LYS B CA  1 
ATOM   3222  C C   . LYS B  2  180 ? -52.125 4.850   39.310  1.00 121.34 ? 180 LYS B C   1 
ATOM   3223  O O   . LYS B  2  180 ? -51.704 5.485   38.340  1.00 119.82 ? 180 LYS B O   1 
ATOM   3224  C CB  . LYS B  2  180 ? -54.423 4.136   38.577  1.00 132.32 ? 180 LYS B CB  1 
ATOM   3225  C CG  . LYS B  2  180 ? -55.872 3.872   38.959  1.00 139.62 ? 180 LYS B CG  1 
ATOM   3226  C CD  . LYS B  2  180 ? -56.643 3.235   37.816  1.00 145.45 ? 180 LYS B CD  1 
ATOM   3227  C CE  . LYS B  2  180 ? -58.096 3.006   38.198  1.00 148.17 ? 180 LYS B CE  1 
ATOM   3228  N NZ  . LYS B  2  180 ? -58.891 2.447   37.071  1.00 147.37 ? 180 LYS B NZ  1 
ATOM   3229  N N   . GLU B  2  181 ? -51.340 4.129   40.107  1.00 121.80 ? 181 GLU B N   1 
ATOM   3230  C CA  . GLU B  2  181 ? -49.882 4.138   39.987  1.00 123.27 ? 181 GLU B CA  1 
ATOM   3231  C C   . GLU B  2  181 ? -49.380 3.368   38.764  1.00 125.07 ? 181 GLU B C   1 
ATOM   3232  O O   . GLU B  2  181 ? -49.694 2.189   38.584  1.00 126.68 ? 181 GLU B O   1 
ATOM   3233  C CB  . GLU B  2  181 ? -49.239 3.591   41.266  1.00 126.43 ? 181 GLU B CB  1 
ATOM   3234  C CG  . GLU B  2  181 ? -47.756 3.905   41.407  1.00 127.76 ? 181 GLU B CG  1 
ATOM   3235  C CD  . GLU B  2  181 ? -47.148 3.364   42.690  1.00 131.11 ? 181 GLU B CD  1 
ATOM   3236  O OE1 . GLU B  2  181 ? -47.870 3.252   43.705  1.00 133.28 ? 181 GLU B OE1 1 
ATOM   3237  O OE2 . GLU B  2  181 ? -45.937 3.060   42.687  1.00 132.01 ? 181 GLU B OE2 1 
ATOM   3238  N N   . GLY B  2  182 ? -48.605 4.058   37.928  1.00 125.42 ? 182 GLY B N   1 
ATOM   3239  C CA  . GLY B  2  182 ? -47.959 3.458   36.759  1.00 123.87 ? 182 GLY B CA  1 
ATOM   3240  C C   . GLY B  2  182 ? -48.885 3.071   35.620  1.00 122.94 ? 182 GLY B C   1 
ATOM   3241  O O   . GLY B  2  182 ? -48.507 2.280   34.753  1.00 124.20 ? 182 GLY B O   1 
ATOM   3242  N N   . GLU B  2  183 ? -50.095 3.628   35.618  1.00 121.27 ? 183 GLU B N   1 
ATOM   3243  C CA  . GLU B  2  183 ? -51.098 3.314   34.598  1.00 121.54 ? 183 GLU B CA  1 
ATOM   3244  C C   . GLU B  2  183 ? -51.805 4.558   34.055  1.00 118.01 ? 183 GLU B C   1 
ATOM   3245  O O   . GLU B  2  183 ? -52.509 4.487   33.044  1.00 118.76 ? 183 GLU B O   1 
ATOM   3246  C CB  . GLU B  2  183 ? -52.129 2.318   35.143  1.00 125.39 ? 183 GLU B CB  1 
ATOM   3247  C CG  . GLU B  2  183 ? -51.617 0.890   35.283  1.00 128.34 ? 183 GLU B CG  1 
ATOM   3248  C CD  . GLU B  2  183 ? -52.669 -0.069  35.811  1.00 132.61 ? 183 GLU B CD  1 
ATOM   3249  O OE1 . GLU B  2  183 ? -53.786 -0.110  35.251  1.00 133.55 ? 183 GLU B OE1 1 
ATOM   3250  O OE2 . GLU B  2  183 ? -52.374 -0.797  36.781  1.00 132.62 ? 183 GLU B OE2 1 
ATOM   3251  N N   . MET B  2  184 ? -51.612 5.691   34.728  1.00 114.55 ? 184 MET B N   1 
ATOM   3252  C CA  . MET B  2  184 ? -52.256 6.948   34.346  1.00 112.14 ? 184 MET B CA  1 
ATOM   3253  C C   . MET B  2  184 ? -51.616 7.594   33.119  1.00 111.62 ? 184 MET B C   1 
ATOM   3254  O O   . MET B  2  184 ? -50.408 7.839   33.090  1.00 106.60 ? 184 MET B O   1 
ATOM   3255  C CB  . MET B  2  184 ? -52.262 7.934   35.520  1.00 109.23 ? 184 MET B CB  1 
ATOM   3256  C CG  . MET B  2  184 ? -53.388 7.713   36.518  1.00 112.68 ? 184 MET B CG  1 
ATOM   3257  S SD  . MET B  2  184 ? -55.002 8.177   35.863  1.00 119.52 ? 184 MET B SD  1 
ATOM   3258  C CE  . MET B  2  184 ? -56.085 7.487   37.112  1.00 120.72 ? 184 MET B CE  1 
ATOM   3259  N N   . THR B  2  185 ? -52.442 7.858   32.110  1.00 113.70 ? 185 THR B N   1 
ATOM   3260  C CA  . THR B  2  185 ? -52.017 8.578   30.909  1.00 116.19 ? 185 THR B CA  1 
ATOM   3261  C C   . THR B  2  185 ? -52.368 10.064  31.029  1.00 116.98 ? 185 THR B C   1 
ATOM   3262  O O   . THR B  2  185 ? -53.158 10.450  31.894  1.00 115.82 ? 185 THR B O   1 
ATOM   3263  C CB  . THR B  2  185 ? -52.630 7.970   29.623  1.00 117.71 ? 185 THR B CB  1 
ATOM   3264  O OG1 . THR B  2  185 ? -52.144 8.675   28.474  1.00 119.56 ? 185 THR B OG1 1 
ATOM   3265  C CG2 . THR B  2  185 ? -54.159 8.031   29.648  1.00 116.89 ? 185 THR B CG2 1 
ATOM   3266  N N   . LEU B  2  186 ? -51.781 10.885  30.158  1.00 115.85 ? 186 LEU B N   1 
ATOM   3267  C CA  . LEU B  2  186 ? -51.997 12.336  30.167  1.00 115.17 ? 186 LEU B CA  1 
ATOM   3268  C C   . LEU B  2  186 ? -53.451 12.719  29.878  1.00 117.78 ? 186 LEU B C   1 
ATOM   3269  O O   . LEU B  2  186 ? -53.930 13.752  30.349  1.00 116.29 ? 186 LEU B O   1 
ATOM   3270  C CB  . LEU B  2  186 ? -51.059 13.022  29.165  1.00 110.92 ? 186 LEU B CB  1 
ATOM   3271  C CG  . LEU B  2  186 ? -50.795 14.527  29.304  1.00 109.05 ? 186 LEU B CG  1 
ATOM   3272  C CD1 . LEU B  2  186 ? -49.838 14.821  30.450  1.00 105.38 ? 186 LEU B CD1 1 
ATOM   3273  C CD2 . LEU B  2  186 ? -50.248 15.091  28.001  1.00 107.88 ? 186 LEU B CD2 1 
ATOM   3274  N N   . LYS B  2  187 ? -54.140 11.880  29.107  1.00 121.55 ? 187 LYS B N   1 
ATOM   3275  C CA  . LYS B  2  187 ? -55.547 12.091  28.767  1.00 125.36 ? 187 LYS B CA  1 
ATOM   3276  C C   . LYS B  2  187 ? -56.454 11.917  29.989  1.00 123.35 ? 187 LYS B C   1 
ATOM   3277  O O   . LYS B  2  187 ? -57.396 12.689  30.184  1.00 124.55 ? 187 LYS B O   1 
ATOM   3278  C CB  . LYS B  2  187 ? -55.969 11.138  27.644  1.00 130.53 ? 187 LYS B CB  1 
ATOM   3279  C CG  . LYS B  2  187 ? -57.246 11.537  26.921  1.00 135.53 ? 187 LYS B CG  1 
ATOM   3280  C CD  . LYS B  2  187 ? -57.569 10.559  25.802  1.00 140.38 ? 187 LYS B CD  1 
ATOM   3281  C CE  . LYS B  2  187 ? -58.832 10.958  25.055  1.00 144.92 ? 187 LYS B CE  1 
ATOM   3282  N NZ  . LYS B  2  187 ? -58.650 12.189  24.236  1.00 148.84 ? 187 LYS B NZ  1 
ATOM   3283  N N   . SER B  2  188 ? -56.160 10.904  30.802  1.00 119.50 ? 188 SER B N   1 
ATOM   3284  C CA  . SER B  2  188 ? -56.911 10.636  32.029  1.00 114.13 ? 188 SER B CA  1 
ATOM   3285  C C   . SER B  2  188 ? -56.467 11.543  33.176  1.00 110.07 ? 188 SER B C   1 
ATOM   3286  O O   . SER B  2  188 ? -57.222 11.774  34.124  1.00 108.15 ? 188 SER B O   1 
ATOM   3287  C CB  . SER B  2  188 ? -56.770 9.166   32.435  1.00 112.89 ? 188 SER B CB  1 
ATOM   3288  O OG  . SER B  2  188 ? -55.420 8.837   32.712  1.00 111.54 ? 188 SER B OG  1 
ATOM   3289  N N   . ALA B  2  189 ? -55.239 12.049  33.079  1.00 108.11 ? 189 ALA B N   1 
ATOM   3290  C CA  . ALA B  2  189 ? -54.674 12.948  34.083  1.00 104.24 ? 189 ALA B CA  1 
ATOM   3291  C C   . ALA B  2  189 ? -55.317 14.334  34.033  1.00 102.32 ? 189 ALA B C   1 
ATOM   3292  O O   . ALA B  2  189 ? -55.583 14.937  35.074  1.00 99.75  ? 189 ALA B O   1 
ATOM   3293  C CB  . ALA B  2  189 ? -53.166 13.051  33.912  1.00 101.80 ? 189 ALA B CB  1 
ATOM   3294  N N   . LEU B  2  190 ? -55.566 14.827  32.820  1.00 102.44 ? 190 LEU B N   1 
ATOM   3295  C CA  . LEU B  2  190 ? -56.221 16.121  32.620  1.00 103.34 ? 190 LEU B CA  1 
ATOM   3296  C C   . LEU B  2  190 ? -57.673 16.106  33.098  1.00 106.42 ? 190 LEU B C   1 
ATOM   3297  O O   . LEU B  2  190 ? -58.180 17.117  33.586  1.00 108.75 ? 190 LEU B O   1 
ATOM   3298  C CB  . LEU B  2  190 ? -56.149 16.550  31.149  1.00 102.57 ? 190 LEU B CB  1 
ATOM   3299  C CG  . LEU B  2  190 ? -54.802 17.031  30.597  1.00 100.30 ? 190 LEU B CG  1 
ATOM   3300  C CD1 . LEU B  2  190 ? -54.800 16.988  29.076  1.00 99.27  ? 190 LEU B CD1 1 
ATOM   3301  C CD2 . LEU B  2  190 ? -54.457 18.429  31.094  1.00 100.61 ? 190 LEU B CD2 1 
ATOM   3302  N N   . ALA B  2  191 ? -58.329 14.955  32.955  1.00 108.27 ? 191 ALA B N   1 
ATOM   3303  C CA  . ALA B  2  191 ? -59.698 14.766  33.435  1.00 109.64 ? 191 ALA B CA  1 
ATOM   3304  C C   . ALA B  2  191 ? -59.753 14.693  34.960  1.00 110.15 ? 191 ALA B C   1 
ATOM   3305  O O   . ALA B  2  191 ? -60.744 15.098  35.572  1.00 110.80 ? 191 ALA B O   1 
ATOM   3306  C CB  . ALA B  2  191 ? -60.309 13.517  32.818  1.00 110.40 ? 191 ALA B CB  1 
ATOM   3307  N N   . LEU B  2  192 ? -58.683 14.175  35.561  1.00 109.82 ? 192 LEU B N   1 
ATOM   3308  C CA  . LEU B  2  192 ? -58.571 14.061  37.013  1.00 110.37 ? 192 LEU B CA  1 
ATOM   3309  C C   . LEU B  2  192 ? -58.308 15.426  37.651  1.00 110.91 ? 192 LEU B C   1 
ATOM   3310  O O   . LEU B  2  192 ? -58.836 15.726  38.723  1.00 111.05 ? 192 LEU B O   1 
ATOM   3311  C CB  . LEU B  2  192 ? -57.456 13.076  37.384  1.00 109.75 ? 192 LEU B CB  1 
ATOM   3312  C CG  . LEU B  2  192 ? -57.598 12.234  38.658  1.00 110.54 ? 192 LEU B CG  1 
ATOM   3313  C CD1 . LEU B  2  192 ? -56.770 10.964  38.535  1.00 114.72 ? 192 LEU B CD1 1 
ATOM   3314  C CD2 . LEU B  2  192 ? -57.213 12.999  39.916  1.00 108.13 ? 192 LEU B CD2 1 
ATOM   3315  N N   . ALA B  2  193 ? -57.495 16.242  36.979  1.00 109.96 ? 193 ALA B N   1 
ATOM   3316  C CA  . ALA B  2  193 ? -57.133 17.577  37.462  1.00 108.40 ? 193 ALA B CA  1 
ATOM   3317  C C   . ALA B  2  193 ? -58.333 18.523  37.523  1.00 106.61 ? 193 ALA B C   1 
ATOM   3318  O O   . ALA B  2  193 ? -58.452 19.320  38.455  1.00 104.23 ? 193 ALA B O   1 
ATOM   3319  C CB  . ALA B  2  193 ? -56.027 18.170  36.601  1.00 108.34 ? 193 ALA B CB  1 
ATOM   3320  N N   . VAL B  2  194 ? -59.212 18.426  36.526  1.00 106.07 ? 194 VAL B N   1 
ATOM   3321  C CA  . VAL B  2  194 ? -60.437 19.227  36.474  1.00 103.48 ? 194 VAL B CA  1 
ATOM   3322  C C   . VAL B  2  194 ? -61.425 18.771  37.554  1.00 102.70 ? 194 VAL B C   1 
ATOM   3323  O O   . VAL B  2  194 ? -62.107 19.596  38.168  1.00 103.44 ? 194 VAL B O   1 
ATOM   3324  C CB  . VAL B  2  194 ? -61.088 19.184  35.067  1.00 102.50 ? 194 VAL B CB  1 
ATOM   3325  C CG1 . VAL B  2  194 ? -62.422 19.919  35.049  1.00 104.70 ? 194 VAL B CG1 1 
ATOM   3326  C CG2 . VAL B  2  194 ? -60.154 19.786  34.027  1.00 101.00 ? 194 VAL B CG2 1 
ATOM   3327  N N   . LYS B  2  195 ? -61.475 17.460  37.790  1.00 103.20 ? 195 LYS B N   1 
ATOM   3328  C CA  . LYS B  2  195 ? -62.354 16.864  38.799  1.00 105.46 ? 195 LYS B CA  1 
ATOM   3329  C C   . LYS B  2  195 ? -62.053 17.377  40.210  1.00 106.99 ? 195 LYS B C   1 
ATOM   3330  O O   . LYS B  2  195 ? -62.972 17.659  40.982  1.00 108.05 ? 195 LYS B O   1 
ATOM   3331  C CB  . LYS B  2  195 ? -62.253 15.334  38.753  1.00 107.45 ? 195 LYS B CB  1 
ATOM   3332  C CG  . LYS B  2  195 ? -63.296 14.604  39.586  1.00 112.21 ? 195 LYS B CG  1 
ATOM   3333  C CD  . LYS B  2  195 ? -63.194 13.098  39.409  1.00 115.80 ? 195 LYS B CD  1 
ATOM   3334  C CE  . LYS B  2  195 ? -64.272 12.378  40.205  1.00 118.51 ? 195 LYS B CE  1 
ATOM   3335  N NZ  . LYS B  2  195 ? -64.249 10.908  39.975  1.00 117.59 ? 195 LYS B NZ  1 
ATOM   3336  N N   . VAL B  2  196 ? -60.766 17.500  40.530  1.00 107.50 ? 196 VAL B N   1 
ATOM   3337  C CA  . VAL B  2  196 ? -60.321 17.964  41.846  1.00 108.65 ? 196 VAL B CA  1 
ATOM   3338  C C   . VAL B  2  196 ? -60.535 19.472  42.009  1.00 111.68 ? 196 VAL B C   1 
ATOM   3339  O O   . VAL B  2  196 ? -61.043 19.922  43.040  1.00 115.51 ? 196 VAL B O   1 
ATOM   3340  C CB  . VAL B  2  196 ? -58.842 17.589  42.116  1.00 105.47 ? 196 VAL B CB  1 
ATOM   3341  C CG1 . VAL B  2  196 ? -58.389 18.090  43.481  1.00 104.95 ? 196 VAL B CG1 1 
ATOM   3342  C CG2 . VAL B  2  196 ? -58.646 16.083  42.025  1.00 104.77 ? 196 VAL B CG2 1 
ATOM   3343  N N   . LEU B  2  197 ? -60.160 20.239  40.985  1.00 112.08 ? 197 LEU B N   1 
ATOM   3344  C CA  . LEU B  2  197 ? -60.282 21.701  41.005  1.00 112.82 ? 197 LEU B CA  1 
ATOM   3345  C C   . LEU B  2  197 ? -61.725 22.194  41.116  1.00 118.61 ? 197 LEU B C   1 
ATOM   3346  O O   . LEU B  2  197 ? -61.980 23.236  41.721  1.00 123.27 ? 197 LEU B O   1 
ATOM   3347  C CB  . LEU B  2  197 ? -59.618 22.320  39.769  1.00 107.29 ? 197 LEU B CB  1 
ATOM   3348  C CG  . LEU B  2  197 ? -58.093 22.458  39.731  1.00 101.52 ? 197 LEU B CG  1 
ATOM   3349  C CD1 . LEU B  2  197 ? -57.639 22.788  38.318  1.00 99.37  ? 197 LEU B CD1 1 
ATOM   3350  C CD2 . LEU B  2  197 ? -57.595 23.512  40.711  1.00 99.32  ? 197 LEU B CD2 1 
ATOM   3351  N N   . ASN B  2  198 ? -62.656 21.446  40.528  1.00 123.18 ? 198 ASN B N   1 
ATOM   3352  C CA  . ASN B  2  198 ? -64.075 21.801  40.548  1.00 129.53 ? 198 ASN B CA  1 
ATOM   3353  C C   . ASN B  2  198 ? -64.712 21.639  41.929  1.00 130.72 ? 198 ASN B C   1 
ATOM   3354  O O   . ASN B  2  198 ? -65.568 22.436  42.322  1.00 130.97 ? 198 ASN B O   1 
ATOM   3355  C CB  . ASN B  2  198 ? -64.845 20.978  39.509  1.00 132.48 ? 198 ASN B CB  1 
ATOM   3356  C CG  . ASN B  2  198 ? -66.270 21.464  39.311  1.00 136.85 ? 198 ASN B CG  1 
ATOM   3357  O OD1 . ASN B  2  198 ? -66.512 22.651  39.084  1.00 139.44 ? 198 ASN B OD1 1 
ATOM   3358  N ND2 . ASN B  2  198 ? -67.222 20.541  39.384  1.00 138.20 ? 198 ASN B ND2 1 
ATOM   3359  N N   . LYS B  2  199 ? -64.284 20.610  42.658  1.00 131.84 ? 199 LYS B N   1 
ATOM   3360  C CA  . LYS B  2  199 ? -64.845 20.293  43.970  1.00 134.25 ? 199 LYS B CA  1 
ATOM   3361  C C   . LYS B  2  199 ? -64.189 21.105  45.089  1.00 135.91 ? 199 LYS B C   1 
ATOM   3362  O O   . LYS B  2  199 ? -64.875 21.591  45.991  1.00 135.89 ? 199 LYS B O   1 
ATOM   3363  C CB  . LYS B  2  199 ? -64.715 18.793  44.256  1.00 135.48 ? 199 LYS B CB  1 
ATOM   3364  C CG  . LYS B  2  199 ? -65.746 18.228  45.226  1.00 135.54 ? 199 LYS B CG  1 
ATOM   3365  C CD  . LYS B  2  199 ? -66.943 17.619  44.504  1.00 134.84 ? 199 LYS B CD  1 
ATOM   3366  C CE  . LYS B  2  199 ? -68.097 18.599  44.358  1.00 134.94 ? 199 LYS B CE  1 
ATOM   3367  N NZ  . LYS B  2  199 ? -68.817 18.802  45.646  1.00 133.83 ? 199 LYS B NZ  1 
ATOM   3368  N N   . THR B  2  200 ? -62.866 21.246  45.023  1.00 137.76 ? 200 THR B N   1 
ATOM   3369  C CA  . THR B  2  200 ? -62.108 21.982  46.038  1.00 141.39 ? 200 THR B CA  1 
ATOM   3370  C C   . THR B  2  200 ? -61.900 23.441  45.629  1.00 142.18 ? 200 THR B C   1 
ATOM   3371  O O   . THR B  2  200 ? -60.771 23.887  45.410  1.00 142.05 ? 200 THR B O   1 
ATOM   3372  C CB  . THR B  2  200 ? -60.742 21.320  46.332  1.00 143.12 ? 200 THR B CB  1 
ATOM   3373  O OG1 . THR B  2  200 ? -59.975 21.237  45.124  1.00 138.52 ? 200 THR B OG1 1 
ATOM   3374  C CG2 . THR B  2  200 ? -60.927 19.923  46.914  1.00 141.72 ? 200 THR B CG2 1 
ATOM   3375  N N   . MET B  2  201 ? -63.003 24.179  45.529  1.00 143.78 ? 201 MET B N   1 
ATOM   3376  C CA  . MET B  2  201 ? -62.969 25.582  45.126  1.00 145.60 ? 201 MET B CA  1 
ATOM   3377  C C   . MET B  2  201 ? -64.090 26.368  45.801  1.00 151.86 ? 201 MET B C   1 
ATOM   3378  O O   . MET B  2  201 ? -65.164 25.824  46.070  1.00 153.77 ? 201 MET B O   1 
ATOM   3379  C CB  . MET B  2  201 ? -63.079 25.695  43.602  1.00 143.06 ? 201 MET B CB  1 
ATOM   3380  C CG  . MET B  2  201 ? -62.464 26.952  43.007  1.00 140.82 ? 201 MET B CG  1 
ATOM   3381  S SD  . MET B  2  201 ? -62.240 26.811  41.222  1.00 140.15 ? 201 MET B SD  1 
ATOM   3382  C CE  . MET B  2  201 ? -61.721 28.473  40.805  1.00 125.06 ? 201 MET B CE  1 
ATOM   3383  N N   . ASP B  2  202 ? -63.829 27.646  46.070  1.00 156.05 ? 202 ASP B N   1 
ATOM   3384  C CA  . ASP B  2  202 ? -64.806 28.535  46.700  1.00 162.29 ? 202 ASP B CA  1 
ATOM   3385  C C   . ASP B  2  202 ? -65.975 28.832  45.759  1.00 164.28 ? 202 ASP B C   1 
ATOM   3386  O O   . ASP B  2  202 ? -67.134 28.594  46.106  1.00 165.34 ? 202 ASP B O   1 
ATOM   3387  C CB  . ASP B  2  202 ? -64.135 29.836  47.159  1.00 163.66 ? 202 ASP B CB  1 
ATOM   3388  C CG  . ASP B  2  202 ? -65.067 30.730  47.963  1.00 166.06 ? 202 ASP B CG  1 
ATOM   3389  O OD1 . ASP B  2  202 ? -65.750 30.224  48.879  1.00 166.18 ? 202 ASP B OD1 1 
ATOM   3390  O OD2 . ASP B  2  202 ? -65.109 31.946  47.681  1.00 165.71 ? 202 ASP B OD2 1 
ATOM   3391  N N   . VAL B  2  203 ? -65.660 29.351  44.573  1.00 163.85 ? 203 VAL B N   1 
ATOM   3392  C CA  . VAL B  2  203 ? -66.662 29.591  43.537  1.00 162.38 ? 203 VAL B CA  1 
ATOM   3393  C C   . VAL B  2  203 ? -66.659 28.411  42.566  1.00 162.28 ? 203 VAL B C   1 
ATOM   3394  O O   . VAL B  2  203 ? -65.712 28.226  41.796  1.00 162.01 ? 203 VAL B O   1 
ATOM   3395  C CB  . VAL B  2  203 ? -66.417 30.921  42.784  1.00 161.28 ? 203 VAL B CB  1 
ATOM   3396  C CG1 . VAL B  2  203 ? -67.512 31.168  41.754  1.00 160.36 ? 203 VAL B CG1 1 
ATOM   3397  C CG2 . VAL B  2  203 ? -66.342 32.088  43.760  1.00 159.59 ? 203 VAL B CG2 1 
ATOM   3398  N N   . SER B  2  204 ? -67.725 27.615  42.616  1.00 165.85 ? 204 SER B N   1 
ATOM   3399  C CA  . SER B  2  204 ? -67.831 26.396  41.812  1.00 167.11 ? 204 SER B CA  1 
ATOM   3400  C C   . SER B  2  204 ? -68.287 26.675  40.375  1.00 166.39 ? 204 SER B C   1 
ATOM   3401  O O   . SER B  2  204 ? -68.058 27.766  39.846  1.00 164.54 ? 204 SER B O   1 
ATOM   3402  C CB  . SER B  2  204 ? -68.754 25.380  42.498  1.00 167.72 ? 204 SER B CB  1 
ATOM   3403  O OG  . SER B  2  204 ? -70.078 25.871  42.601  1.00 169.72 ? 204 SER B OG  1 
ATOM   3404  N N   . LYS B  2  205 ? -68.922 25.677  39.756  1.00 165.66 ? 205 LYS B N   1 
ATOM   3405  C CA  . LYS B  2  205 ? -69.358 25.716  38.349  1.00 163.77 ? 205 LYS B CA  1 
ATOM   3406  C C   . LYS B  2  205 ? -68.182 25.646  37.364  1.00 159.51 ? 205 LYS B C   1 
ATOM   3407  O O   . LYS B  2  205 ? -68.258 24.941  36.354  1.00 156.26 ? 205 LYS B O   1 
ATOM   3408  C CB  . LYS B  2  205 ? -70.266 26.923  38.065  1.00 164.12 ? 205 LYS B CB  1 
ATOM   3409  C CG  . LYS B  2  205 ? -71.125 26.785  36.816  1.00 164.78 ? 205 LYS B CG  1 
ATOM   3410  C CD  . LYS B  2  205 ? -72.275 27.784  36.802  1.00 166.42 ? 205 LYS B CD  1 
ATOM   3411  C CE  . LYS B  2  205 ? -71.823 29.188  36.425  1.00 166.84 ? 205 LYS B CE  1 
ATOM   3412  N NZ  . LYS B  2  205 ? -71.447 29.297  34.988  1.00 165.93 ? 205 LYS B NZ  1 
ATOM   3413  N N   . LEU B  2  206 ? -67.115 26.386  37.674  1.00 154.21 ? 206 LEU B N   1 
ATOM   3414  C CA  . LEU B  2  206 ? -65.845 26.383  36.930  1.00 144.36 ? 206 LEU B CA  1 
ATOM   3415  C C   . LEU B  2  206 ? -65.927 27.026  35.540  1.00 142.18 ? 206 LEU B C   1 
ATOM   3416  O O   . LEU B  2  206 ? -66.669 26.565  34.669  1.00 146.21 ? 206 LEU B O   1 
ATOM   3417  C CB  . LEU B  2  206 ? -65.244 24.969  36.852  1.00 140.11 ? 206 LEU B CB  1 
ATOM   3418  C CG  . LEU B  2  206 ? -63.733 24.833  36.638  1.00 132.08 ? 206 LEU B CG  1 
ATOM   3419  C CD1 . LEU B  2  206 ? -62.971 25.154  37.915  1.00 128.04 ? 206 LEU B CD1 1 
ATOM   3420  C CD2 . LEU B  2  206 ? -63.394 23.430  36.161  1.00 125.35 ? 206 LEU B CD2 1 
ATOM   3421  N N   . SER B  2  207 ? -65.154 28.092  35.348  1.00 135.20 ? 207 SER B N   1 
ATOM   3422  C CA  . SER B  2  207 ? -65.039 28.755  34.050  1.00 130.36 ? 207 SER B CA  1 
ATOM   3423  C C   . SER B  2  207 ? -63.597 28.705  33.541  1.00 125.61 ? 207 SER B C   1 
ATOM   3424  O O   . SER B  2  207 ? -62.672 28.412  34.303  1.00 122.31 ? 207 SER B O   1 
ATOM   3425  C CB  . SER B  2  207 ? -65.538 30.201  34.129  1.00 128.64 ? 207 SER B CB  1 
ATOM   3426  O OG  . SER B  2  207 ? -64.733 30.977  34.997  1.00 125.67 ? 207 SER B OG  1 
ATOM   3427  N N   . ALA B  2  208 ? -63.417 28.995  32.253  1.00 124.97 ? 208 ALA B N   1 
ATOM   3428  C CA  . ALA B  2  208 ? -62.107 28.914  31.601  1.00 123.88 ? 208 ALA B CA  1 
ATOM   3429  C C   . ALA B  2  208 ? -61.113 29.976  32.080  1.00 121.58 ? 208 ALA B C   1 
ATOM   3430  O O   . ALA B  2  208 ? -59.902 29.744  32.070  1.00 121.33 ? 208 ALA B O   1 
ATOM   3431  C CB  . ALA B  2  208 ? -62.266 28.980  30.089  1.00 125.93 ? 208 ALA B CB  1 
ATOM   3432  N N   . GLU B  2  209 ? -61.629 31.130  32.498  1.00 118.97 ? 209 GLU B N   1 
ATOM   3433  C CA  . GLU B  2  209 ? -60.788 32.244  32.937  1.00 116.94 ? 209 GLU B CA  1 
ATOM   3434  C C   . GLU B  2  209 ? -60.202 32.026  34.335  1.00 112.18 ? 209 GLU B C   1 
ATOM   3435  O O   . GLU B  2  209 ? -59.117 32.527  34.643  1.00 113.44 ? 209 GLU B O   1 
ATOM   3436  C CB  . GLU B  2  209 ? -61.572 33.559  32.886  1.00 121.66 ? 209 GLU B CB  1 
ATOM   3437  C CG  . GLU B  2  209 ? -60.700 34.806  32.821  1.00 125.01 ? 209 GLU B CG  1 
ATOM   3438  C CD  . GLU B  2  209 ? -61.497 36.098  32.863  1.00 131.15 ? 209 GLU B CD  1 
ATOM   3439  O OE1 . GLU B  2  209 ? -62.609 36.143  32.293  1.00 133.84 ? 209 GLU B OE1 1 
ATOM   3440  O OE2 . GLU B  2  209 ? -61.005 37.076  33.463  1.00 132.24 ? 209 GLU B OE2 1 
ATOM   3441  N N   . LYS B  2  210 ? -60.916 31.273  35.168  1.00 105.60 ? 210 LYS B N   1 
ATOM   3442  C CA  . LYS B  2  210 ? -60.519 31.054  36.563  1.00 99.98  ? 210 LYS B CA  1 
ATOM   3443  C C   . LYS B  2  210 ? -59.401 30.021  36.740  1.00 96.02  ? 210 LYS B C   1 
ATOM   3444  O O   . LYS B  2  210 ? -58.746 29.990  37.784  1.00 95.59  ? 210 LYS B O   1 
ATOM   3445  C CB  . LYS B  2  210 ? -61.735 30.677  37.417  1.00 100.92 ? 210 LYS B CB  1 
ATOM   3446  C CG  . LYS B  2  210 ? -62.743 31.803  37.604  1.00 104.07 ? 210 LYS B CG  1 
ATOM   3447  C CD  . LYS B  2  210 ? -64.023 31.312  38.267  1.00 106.64 ? 210 LYS B CD  1 
ATOM   3448  C CE  . LYS B  2  210 ? -63.976 31.436  39.782  1.00 109.47 ? 210 LYS B CE  1 
ATOM   3449  N NZ  . LYS B  2  210 ? -64.239 32.830  40.234  1.00 111.48 ? 210 LYS B NZ  1 
ATOM   3450  N N   . VAL B  2  211 ? -59.184 29.185  35.726  1.00 95.51  ? 211 VAL B N   1 
ATOM   3451  C CA  . VAL B  2  211 ? -58.175 28.119  35.794  1.00 94.74  ? 211 VAL B CA  1 
ATOM   3452  C C   . VAL B  2  211 ? -57.071 28.257  34.743  1.00 94.82  ? 211 VAL B C   1 
ATOM   3453  O O   . VAL B  2  211 ? -57.268 28.882  33.698  1.00 94.74  ? 211 VAL B O   1 
ATOM   3454  C CB  . VAL B  2  211 ? -58.805 26.706  35.704  1.00 96.06  ? 211 VAL B CB  1 
ATOM   3455  C CG1 . VAL B  2  211 ? -59.494 26.342  37.011  1.00 98.55  ? 211 VAL B CG1 1 
ATOM   3456  C CG2 . VAL B  2  211 ? -59.770 26.604  34.528  1.00 98.68  ? 211 VAL B CG2 1 
ATOM   3457  N N   . GLU B  2  212 ? -55.915 27.663  35.036  1.00 95.43  ? 212 GLU B N   1 
ATOM   3458  C CA  . GLU B  2  212 ? -54.755 27.705  34.147  1.00 96.07  ? 212 GLU B CA  1 
ATOM   3459  C C   . GLU B  2  212 ? -54.035 26.357  34.144  1.00 93.85  ? 212 GLU B C   1 
ATOM   3460  O O   . GLU B  2  212 ? -53.552 25.900  35.184  1.00 92.30  ? 212 GLU B O   1 
ATOM   3461  C CB  . GLU B  2  212 ? -53.800 28.819  34.578  1.00 98.81  ? 212 GLU B CB  1 
ATOM   3462  C CG  . GLU B  2  212 ? -52.867 29.313  33.485  1.00 102.74 ? 212 GLU B CG  1 
ATOM   3463  C CD  . GLU B  2  212 ? -52.096 30.554  33.894  1.00 105.63 ? 212 GLU B CD  1 
ATOM   3464  O OE1 . GLU B  2  212 ? -51.382 30.508  34.920  1.00 104.64 ? 212 GLU B OE1 1 
ATOM   3465  O OE2 . GLU B  2  212 ? -52.199 31.576  33.184  1.00 106.40 ? 212 GLU B OE2 1 
ATOM   3466  N N   . ILE B  2  213 ? -53.972 25.727  32.973  1.00 94.60  ? 213 ILE B N   1 
ATOM   3467  C CA  . ILE B  2  213 ? -53.370 24.399  32.831  1.00 97.54  ? 213 ILE B CA  1 
ATOM   3468  C C   . ILE B  2  213 ? -52.220 24.417  31.820  1.00 98.01  ? 213 ILE B C   1 
ATOM   3469  O O   . ILE B  2  213 ? -52.365 24.933  30.709  1.00 98.76  ? 213 ILE B O   1 
ATOM   3470  C CB  . ILE B  2  213 ? -54.415 23.330  32.421  1.00 100.19 ? 213 ILE B CB  1 
ATOM   3471  C CG1 . ILE B  2  213 ? -55.676 23.434  33.290  1.00 101.23 ? 213 ILE B CG1 1 
ATOM   3472  C CG2 . ILE B  2  213 ? -53.820 21.929  32.518  1.00 100.10 ? 213 ILE B CG2 1 
ATOM   3473  C CD1 . ILE B  2  213 ? -56.908 22.785  32.692  1.00 103.09 ? 213 ILE B CD1 1 
ATOM   3474  N N   . ALA B  2  214 ? -51.082 23.854  32.222  1.00 97.91  ? 214 ALA B N   1 
ATOM   3475  C CA  . ALA B  2  214 ? -49.911 23.735  31.355  1.00 98.00  ? 214 ALA B CA  1 
ATOM   3476  C C   . ALA B  2  214 ? -49.409 22.293  31.317  1.00 95.88  ? 214 ALA B C   1 
ATOM   3477  O O   . ALA B  2  214 ? -49.384 21.613  32.344  1.00 94.63  ? 214 ALA B O   1 
ATOM   3478  C CB  . ALA B  2  214 ? -48.807 24.673  31.820  1.00 97.46  ? 214 ALA B CB  1 
ATOM   3479  N N   . THR B  2  215 ? -49.012 21.837  30.130  1.00 95.66  ? 215 THR B N   1 
ATOM   3480  C CA  . THR B  2  215 ? -48.575 20.450  29.931  1.00 94.67  ? 215 THR B CA  1 
ATOM   3481  C C   . THR B  2  215 ? -47.123 20.342  29.462  1.00 94.06  ? 215 THR B C   1 
ATOM   3482  O O   . THR B  2  215 ? -46.619 21.219  28.756  1.00 94.92  ? 215 THR B O   1 
ATOM   3483  C CB  . THR B  2  215 ? -49.480 19.701  28.928  1.00 94.26  ? 215 THR B CB  1 
ATOM   3484  O OG1 . THR B  2  215 ? -49.571 20.447  27.708  1.00 96.01  ? 215 THR B OG1 1 
ATOM   3485  C CG2 . THR B  2  215 ? -50.877 19.496  29.503  1.00 92.90  ? 215 THR B CG2 1 
ATOM   3486  N N   . LEU B  2  216 ? -46.466 19.255  29.863  1.00 90.94  ? 216 LEU B N   1 
ATOM   3487  C CA  . LEU B  2  216 ? -45.088 18.967  29.471  1.00 88.74  ? 216 LEU B CA  1 
ATOM   3488  C C   . LEU B  2  216 ? -44.995 17.543  28.923  1.00 89.91  ? 216 LEU B C   1 
ATOM   3489  O O   . LEU B  2  216 ? -45.199 16.571  29.654  1.00 89.46  ? 216 LEU B O   1 
ATOM   3490  C CB  . LEU B  2  216 ? -44.141 19.162  30.664  1.00 86.52  ? 216 LEU B CB  1 
ATOM   3491  C CG  . LEU B  2  216 ? -42.621 19.111  30.463  1.00 86.23  ? 216 LEU B CG  1 
ATOM   3492  C CD1 . LEU B  2  216 ? -41.927 20.057  31.431  1.00 84.46  ? 216 LEU B CD1 1 
ATOM   3493  C CD2 . LEU B  2  216 ? -42.073 17.698  30.611  1.00 86.45  ? 216 LEU B CD2 1 
ATOM   3494  N N   . THR B  2  217 ? -44.688 17.434  27.633  1.00 92.03  ? 217 THR B N   1 
ATOM   3495  C CA  . THR B  2  217 ? -44.623 16.142  26.951  1.00 93.55  ? 217 THR B CA  1 
ATOM   3496  C C   . THR B  2  217 ? -43.395 16.071  26.045  1.00 94.04  ? 217 THR B C   1 
ATOM   3497  O O   . THR B  2  217 ? -43.067 17.039  25.354  1.00 95.17  ? 217 THR B O   1 
ATOM   3498  C CB  . THR B  2  217 ? -45.896 15.884  26.112  1.00 95.67  ? 217 THR B CB  1 
ATOM   3499  O OG1 . THR B  2  217 ? -47.056 16.283  26.854  1.00 96.47  ? 217 THR B OG1 1 
ATOM   3500  C CG2 . THR B  2  217 ? -46.020 14.408  25.743  1.00 96.24  ? 217 THR B CG2 1 
ATOM   3501  N N   . ARG B  2  218 ? -42.720 14.924  26.060  1.00 94.32  ? 218 ARG B N   1 
ATOM   3502  C CA  . ARG B  2  218 ? -41.573 14.690  25.189  1.00 94.41  ? 218 ARG B CA  1 
ATOM   3503  C C   . ARG B  2  218 ? -42.048 14.224  23.815  1.00 94.45  ? 218 ARG B C   1 
ATOM   3504  O O   . ARG B  2  218 ? -42.705 13.187  23.694  1.00 95.08  ? 218 ARG B O   1 
ATOM   3505  C CB  . ARG B  2  218 ? -40.626 13.654  25.803  1.00 94.59  ? 218 ARG B CB  1 
ATOM   3506  C CG  . ARG B  2  218 ? -39.188 13.770  25.323  1.00 97.18  ? 218 ARG B CG  1 
ATOM   3507  C CD  . ARG B  2  218 ? -38.339 14.568  26.303  1.00 97.27  ? 218 ARG B CD  1 
ATOM   3508  N NE  . ARG B  2  218 ? -37.291 15.348  25.642  1.00 98.55  ? 218 ARG B NE  1 
ATOM   3509  C CZ  . ARG B  2  218 ? -36.137 14.856  25.196  1.00 100.24 ? 218 ARG B CZ  1 
ATOM   3510  N NH1 . ARG B  2  218 ? -35.856 13.564  25.314  1.00 97.37  ? 218 ARG B NH1 1 
ATOM   3511  N NH2 . ARG B  2  218 ? -35.258 15.662  24.617  1.00 100.28 ? 218 ARG B NH2 1 
ATOM   3512  N N   . GLU B  2  219 ? -41.717 15.001  22.786  1.00 93.83  ? 219 GLU B N   1 
ATOM   3513  C CA  . GLU B  2  219 ? -42.138 14.706  21.417  1.00 95.44  ? 219 GLU B CA  1 
ATOM   3514  C C   . GLU B  2  219 ? -40.969 14.763  20.437  1.00 93.61  ? 219 GLU B C   1 
ATOM   3515  O O   . GLU B  2  219 ? -40.284 15.785  20.333  1.00 91.57  ? 219 GLU B O   1 
ATOM   3516  C CB  . GLU B  2  219 ? -43.253 15.659  20.976  1.00 99.15  ? 219 GLU B CB  1 
ATOM   3517  C CG  . GLU B  2  219 ? -44.603 15.380  21.623  1.00 103.52 ? 219 GLU B CG  1 
ATOM   3518  C CD  . GLU B  2  219 ? -45.624 16.476  21.374  1.00 107.61 ? 219 GLU B CD  1 
ATOM   3519  O OE1 . GLU B  2  219 ? -45.649 17.039  20.258  1.00 111.48 ? 219 GLU B OE1 1 
ATOM   3520  O OE2 . GLU B  2  219 ? -46.411 16.769  22.299  1.00 107.21 ? 219 GLU B OE2 1 
ATOM   3521  N N   . SER B  2  220 ? -40.756 13.654  19.729  1.00 94.20  ? 220 SER B N   1 
ATOM   3522  C CA  . SER B  2  220 ? -39.688 13.509  18.727  1.00 94.77  ? 220 SER B CA  1 
ATOM   3523  C C   . SER B  2  220 ? -38.289 13.842  19.266  1.00 93.80  ? 220 SER B C   1 
ATOM   3524  O O   . SER B  2  220 ? -37.481 14.481  18.584  1.00 93.42  ? 220 SER B O   1 
ATOM   3525  C CB  . SER B  2  220 ? -40.009 14.322  17.463  1.00 96.07  ? 220 SER B CB  1 
ATOM   3526  O OG  . SER B  2  220 ? -39.082 14.044  16.427  1.00 97.96  ? 220 SER B OG  1 
ATOM   3527  N N   . GLY B  2  221 ? -38.015 13.402  20.492  1.00 93.09  ? 221 GLY B N   1 
ATOM   3528  C CA  . GLY B  2  221 ? -36.722 13.628  21.135  1.00 91.51  ? 221 GLY B CA  1 
ATOM   3529  C C   . GLY B  2  221 ? -36.508 15.046  21.635  1.00 90.83  ? 221 GLY B C   1 
ATOM   3530  O O   . GLY B  2  221 ? -35.370 15.463  21.859  1.00 90.35  ? 221 GLY B O   1 
ATOM   3531  N N   . LYS B  2  222 ? -37.603 15.786  21.806  1.00 90.69  ? 222 LYS B N   1 
ATOM   3532  C CA  . LYS B  2  222 ? -37.560 17.160  22.314  1.00 88.45  ? 222 LYS B CA  1 
ATOM   3533  C C   . LYS B  2  222 ? -38.697 17.427  23.298  1.00 87.74  ? 222 LYS B C   1 
ATOM   3534  O O   . LYS B  2  222 ? -39.833 17.001  23.077  1.00 88.68  ? 222 LYS B O   1 
ATOM   3535  C CB  . LYS B  2  222 ? -37.618 18.173  21.165  1.00 88.38  ? 222 LYS B CB  1 
ATOM   3536  C CG  . LYS B  2  222 ? -36.328 18.305  20.369  1.00 88.83  ? 222 LYS B CG  1 
ATOM   3537  C CD  . LYS B  2  222 ? -36.358 19.506  19.435  1.00 90.45  ? 222 LYS B CD  1 
ATOM   3538  C CE  . LYS B  2  222 ? -36.018 20.795  20.168  1.00 90.76  ? 222 LYS B CE  1 
ATOM   3539  N NZ  . LYS B  2  222 ? -36.085 21.978  19.267  1.00 93.03  ? 222 LYS B NZ  1 
ATOM   3540  N N   . THR B  2  223 ? -38.383 18.139  24.378  1.00 86.14  ? 223 THR B N   1 
ATOM   3541  C CA  . THR B  2  223 ? -39.370 18.481  25.401  1.00 86.19  ? 223 THR B CA  1 
ATOM   3542  C C   . THR B  2  223 ? -40.241 19.651  24.942  1.00 88.02  ? 223 THR B C   1 
ATOM   3543  O O   . THR B  2  223 ? -39.729 20.708  24.563  1.00 88.49  ? 223 THR B O   1 
ATOM   3544  C CB  . THR B  2  223 ? -38.699 18.828  26.748  1.00 84.25  ? 223 THR B CB  1 
ATOM   3545  O OG1 . THR B  2  223 ? -37.694 17.853  27.054  1.00 83.54  ? 223 THR B OG1 1 
ATOM   3546  C CG2 . THR B  2  223 ? -39.725 18.862  27.875  1.00 84.02  ? 223 THR B CG2 1 
ATOM   3547  N N   . VAL B  2  224 ? -41.556 19.448  24.977  1.00 88.33  ? 224 VAL B N   1 
ATOM   3548  C CA  . VAL B  2  224 ? -42.515 20.474  24.572  1.00 86.79  ? 224 VAL B CA  1 
ATOM   3549  C C   . VAL B  2  224 ? -43.320 20.958  25.779  1.00 85.31  ? 224 VAL B C   1 
ATOM   3550  O O   . VAL B  2  224 ? -44.054 20.185  26.401  1.00 85.20  ? 224 VAL B O   1 
ATOM   3551  C CB  . VAL B  2  224 ? -43.465 19.969  23.457  1.00 86.53  ? 224 VAL B CB  1 
ATOM   3552  C CG1 . VAL B  2  224 ? -44.470 21.046  23.069  1.00 86.59  ? 224 VAL B CG1 1 
ATOM   3553  C CG2 . VAL B  2  224 ? -42.674 19.524  22.233  1.00 86.27  ? 224 VAL B CG2 1 
ATOM   3554  N N   . ILE B  2  225 ? -43.163 22.239  26.106  1.00 83.90  ? 225 ILE B N   1 
ATOM   3555  C CA  . ILE B  2  225 ? -43.907 22.868  27.196  1.00 82.82  ? 225 ILE B CA  1 
ATOM   3556  C C   . ILE B  2  225 ? -44.885 23.886  26.616  1.00 84.90  ? 225 ILE B C   1 
ATOM   3557  O O   . ILE B  2  225 ? -44.477 24.844  25.953  1.00 86.24  ? 225 ILE B O   1 
ATOM   3558  C CB  . ILE B  2  225 ? -42.971 23.561  28.215  1.00 80.02  ? 225 ILE B CB  1 
ATOM   3559  C CG1 . ILE B  2  225 ? -41.851 22.611  28.661  1.00 79.22  ? 225 ILE B CG1 1 
ATOM   3560  C CG2 . ILE B  2  225 ? -43.767 24.069  29.413  1.00 78.99  ? 225 ILE B CG2 1 
ATOM   3561  C CD1 . ILE B  2  225 ? -40.661 23.300  29.297  1.00 76.80  ? 225 ILE B CD1 1 
ATOM   3562  N N   . ARG B  2  226 ? -46.175 23.669  26.862  1.00 86.73  ? 226 ARG B N   1 
ATOM   3563  C CA  . ARG B  2  226 ? -47.217 24.564  26.359  1.00 90.62  ? 226 ARG B CA  1 
ATOM   3564  C C   . ARG B  2  226 ? -48.304 24.847  27.396  1.00 91.94  ? 226 ARG B C   1 
ATOM   3565  O O   . ARG B  2  226 ? -48.653 23.980  28.201  1.00 91.66  ? 226 ARG B O   1 
ATOM   3566  C CB  . ARG B  2  226 ? -47.838 24.015  25.065  1.00 93.52  ? 226 ARG B CB  1 
ATOM   3567  C CG  . ARG B  2  226 ? -48.627 22.721  25.222  1.00 98.98  ? 226 ARG B CG  1 
ATOM   3568  C CD  . ARG B  2  226 ? -49.439 22.405  23.975  1.00 106.29 ? 226 ARG B CD  1 
ATOM   3569  N NE  . ARG B  2  226 ? -48.609 21.874  22.895  1.00 111.64 ? 226 ARG B NE  1 
ATOM   3570  C CZ  . ARG B  2  226 ? -48.448 20.580  22.632  1.00 116.00 ? 226 ARG B CZ  1 
ATOM   3571  N NH1 . ARG B  2  226 ? -49.062 19.660  23.366  1.00 119.87 ? 226 ARG B NH1 1 
ATOM   3572  N NH2 . ARG B  2  226 ? -47.670 20.202  21.626  1.00 114.63 ? 226 ARG B NH2 1 
ATOM   3573  N N   . VAL B  2  227 ? -48.823 26.072  27.368  1.00 94.12  ? 227 VAL B N   1 
ATOM   3574  C CA  . VAL B  2  227 ? -49.958 26.461  28.199  1.00 95.96  ? 227 VAL B CA  1 
ATOM   3575  C C   . VAL B  2  227 ? -51.227 26.314  27.364  1.00 98.79  ? 227 VAL B C   1 
ATOM   3576  O O   . VAL B  2  227 ? -51.353 26.931  26.303  1.00 99.57  ? 227 VAL B O   1 
ATOM   3577  C CB  . VAL B  2  227 ? -49.822 27.909  28.724  1.00 95.08  ? 227 VAL B CB  1 
ATOM   3578  C CG1 . VAL B  2  227 ? -50.997 28.274  29.621  1.00 95.39  ? 227 VAL B CG1 1 
ATOM   3579  C CG2 . VAL B  2  227 ? -48.511 28.090  29.476  1.00 94.20  ? 227 VAL B CG2 1 
ATOM   3580  N N   . LEU B  2  228 ? -52.154 25.487  27.843  1.00 100.87 ? 228 LEU B N   1 
ATOM   3581  C CA  . LEU B  2  228 ? -53.397 25.210  27.125  1.00 104.53 ? 228 LEU B CA  1 
ATOM   3582  C C   . LEU B  2  228 ? -54.286 26.447  27.039  1.00 108.94 ? 228 LEU B C   1 
ATOM   3583  O O   . LEU B  2  228 ? -54.555 27.101  28.050  1.00 109.75 ? 228 LEU B O   1 
ATOM   3584  C CB  . LEU B  2  228 ? -54.161 24.052  27.780  1.00 104.34 ? 228 LEU B CB  1 
ATOM   3585  C CG  . LEU B  2  228 ? -53.534 22.652  27.770  1.00 104.26 ? 228 LEU B CG  1 
ATOM   3586  C CD1 . LEU B  2  228 ? -54.285 21.732  28.720  1.00 103.78 ? 228 LEU B CD1 1 
ATOM   3587  C CD2 . LEU B  2  228 ? -53.494 22.056  26.368  1.00 106.71 ? 228 LEU B CD2 1 
ATOM   3588  N N   . LYS B  2  229 ? -54.727 26.761  25.823  1.00 112.58 ? 229 LYS B N   1 
ATOM   3589  C CA  . LYS B  2  229 ? -55.592 27.917  25.575  1.00 113.86 ? 229 LYS B CA  1 
ATOM   3590  C C   . LYS B  2  229 ? -57.016 27.680  26.080  1.00 116.40 ? 229 LYS B C   1 
ATOM   3591  O O   . LYS B  2  229 ? -57.406 26.541  26.345  1.00 116.40 ? 229 LYS B O   1 
ATOM   3592  C CB  . LYS B  2  229 ? -55.585 28.305  24.089  1.00 111.51 ? 229 LYS B CB  1 
ATOM   3593  C CG  . LYS B  2  229 ? -55.936 27.184  23.120  1.00 110.78 ? 229 LYS B CG  1 
ATOM   3594  C CD  . LYS B  2  229 ? -55.863 27.645  21.670  1.00 110.13 ? 229 LYS B CD  1 
ATOM   3595  C CE  . LYS B  2  229 ? -54.475 27.457  21.069  1.00 109.73 ? 229 LYS B CE  1 
ATOM   3596  N NZ  . LYS B  2  229 ? -53.481 28.464  21.537  1.00 109.93 ? 229 LYS B NZ  1 
ATOM   3597  N N   . GLN B  2  230 ? -57.780 28.765  26.206  1.00 120.46 ? 230 GLN B N   1 
ATOM   3598  C CA  . GLN B  2  230 ? -59.127 28.729  26.785  1.00 123.23 ? 230 GLN B CA  1 
ATOM   3599  C C   . GLN B  2  230 ? -60.072 27.731  26.118  1.00 122.24 ? 230 GLN B C   1 
ATOM   3600  O O   . GLN B  2  230 ? -60.854 27.071  26.802  1.00 123.30 ? 230 GLN B O   1 
ATOM   3601  C CB  . GLN B  2  230 ? -59.754 30.127  26.792  1.00 125.64 ? 230 GLN B CB  1 
ATOM   3602  C CG  . GLN B  2  230 ? -59.167 31.062  27.839  1.00 128.30 ? 230 GLN B CG  1 
ATOM   3603  C CD  . GLN B  2  230 ? -59.952 32.351  27.988  1.00 130.59 ? 230 GLN B CD  1 
ATOM   3604  O OE1 . GLN B  2  230 ? -60.328 32.985  27.002  1.00 131.21 ? 230 GLN B OE1 1 
ATOM   3605  N NE2 . GLN B  2  230 ? -60.194 32.751  29.231  1.00 130.63 ? 230 GLN B NE2 1 
ATOM   3606  N N   . LYS B  2  231 ? -59.991 27.619  24.793  1.00 122.31 ? 231 LYS B N   1 
ATOM   3607  C CA  . LYS B  2  231 ? -60.819 26.674  24.036  1.00 124.12 ? 231 LYS B CA  1 
ATOM   3608  C C   . LYS B  2  231 ? -60.480 25.213  24.337  1.00 121.71 ? 231 LYS B C   1 
ATOM   3609  O O   . LYS B  2  231 ? -61.361 24.350  24.313  1.00 122.33 ? 231 LYS B O   1 
ATOM   3610  C CB  . LYS B  2  231 ? -60.722 26.944  22.532  1.00 127.86 ? 231 LYS B CB  1 
ATOM   3611  C CG  . LYS B  2  231 ? -61.561 28.120  22.061  1.00 131.81 ? 231 LYS B CG  1 
ATOM   3612  C CD  . LYS B  2  231 ? -61.696 28.136  20.548  1.00 134.39 ? 231 LYS B CD  1 
ATOM   3613  C CE  . LYS B  2  231 ? -62.656 29.222  20.095  1.00 136.99 ? 231 LYS B CE  1 
ATOM   3614  N NZ  . LYS B  2  231 ? -62.946 29.137  18.638  1.00 138.05 ? 231 LYS B NZ  1 
ATOM   3615  N N   . GLU B  2  232 ? -59.206 24.946  24.616  1.00 119.35 ? 232 GLU B N   1 
ATOM   3616  C CA  . GLU B  2  232 ? -58.754 23.611  25.006  1.00 117.13 ? 232 GLU B CA  1 
ATOM   3617  C C   . GLU B  2  232 ? -59.189 23.268  26.430  1.00 116.07 ? 232 GLU B C   1 
ATOM   3618  O O   . GLU B  2  232 ? -59.486 22.111  26.733  1.00 115.27 ? 232 GLU B O   1 
ATOM   3619  C CB  . GLU B  2  232 ? -57.233 23.489  24.872  1.00 117.27 ? 232 GLU B CB  1 
ATOM   3620  C CG  . GLU B  2  232 ? -56.734 23.409  23.437  1.00 118.62 ? 232 GLU B CG  1 
ATOM   3621  C CD  . GLU B  2  232 ? -55.224 23.289  23.343  1.00 117.53 ? 232 GLU B CD  1 
ATOM   3622  O OE1 . GLU B  2  232 ? -54.515 24.188  23.844  1.00 114.95 ? 232 GLU B OE1 1 
ATOM   3623  O OE2 . GLU B  2  232 ? -54.742 22.297  22.759  1.00 120.69 ? 232 GLU B OE2 1 
ATOM   3624  N N   . VAL B  2  233 ? -59.226 24.281  27.295  1.00 116.47 ? 233 VAL B N   1 
ATOM   3625  C CA  . VAL B  2  233 ? -59.658 24.115  28.685  1.00 115.13 ? 233 VAL B CA  1 
ATOM   3626  C C   . VAL B  2  233 ? -61.180 23.952  28.760  1.00 115.52 ? 233 VAL B C   1 
ATOM   3627  O O   . VAL B  2  233 ? -61.680 23.136  29.538  1.00 114.37 ? 233 VAL B O   1 
ATOM   3628  C CB  . VAL B  2  233 ? -59.188 25.289  29.580  1.00 114.80 ? 233 VAL B CB  1 
ATOM   3629  C CG1 . VAL B  2  233 ? -59.598 25.070  31.030  1.00 112.22 ? 233 VAL B CG1 1 
ATOM   3630  C CG2 . VAL B  2  233 ? -57.678 25.462  29.492  1.00 113.83 ? 233 VAL B CG2 1 
ATOM   3631  N N   . GLU B  2  234 ? -61.899 24.719  27.940  1.00 117.30 ? 234 GLU B N   1 
ATOM   3632  C CA  . GLU B  2  234 ? -63.364 24.655  27.858  1.00 120.37 ? 234 GLU B CA  1 
ATOM   3633  C C   . GLU B  2  234 ? -63.879 23.245  27.564  1.00 118.22 ? 234 GLU B C   1 
ATOM   3634  O O   . GLU B  2  234 ? -64.902 22.829  28.109  1.00 117.18 ? 234 GLU B O   1 
ATOM   3635  C CB  . GLU B  2  234 ? -63.890 25.627  26.796  1.00 124.74 ? 234 GLU B CB  1 
ATOM   3636  C CG  . GLU B  2  234 ? -64.007 27.075  27.254  1.00 129.87 ? 234 GLU B CG  1 
ATOM   3637  C CD  . GLU B  2  234 ? -65.317 27.384  27.956  1.00 135.61 ? 234 GLU B CD  1 
ATOM   3638  O OE1 . GLU B  2  234 ? -66.297 26.629  27.777  1.00 137.10 ? 234 GLU B OE1 1 
ATOM   3639  O OE2 . GLU B  2  234 ? -65.371 28.401  28.681  1.00 134.89 ? 234 GLU B OE2 1 
ATOM   3640  N N   . GLN B  2  235 ? -63.162 22.523  26.704  1.00 118.24 ? 235 GLN B N   1 
ATOM   3641  C CA  . GLN B  2  235 ? -63.517 21.153  26.335  1.00 119.32 ? 235 GLN B CA  1 
ATOM   3642  C C   . GLN B  2  235 ? -63.352 20.184  27.508  1.00 119.30 ? 235 GLN B C   1 
ATOM   3643  O O   . GLN B  2  235 ? -64.156 19.265  27.675  1.00 120.80 ? 235 GLN B O   1 
ATOM   3644  C CB  . GLN B  2  235 ? -62.681 20.688  25.139  1.00 122.83 ? 235 GLN B CB  1 
ATOM   3645  C CG  . GLN B  2  235 ? -63.208 19.434  24.455  1.00 127.59 ? 235 GLN B CG  1 
ATOM   3646  C CD  . GLN B  2  235 ? -62.224 18.841  23.463  1.00 132.06 ? 235 GLN B CD  1 
ATOM   3647  O OE1 . GLN B  2  235 ? -61.533 19.562  22.742  1.00 133.76 ? 235 GLN B OE1 1 
ATOM   3648  N NE2 . GLN B  2  235 ? -62.162 17.515  23.419  1.00 132.43 ? 235 GLN B NE2 1 
ATOM   3649  N N   . LEU B  2  236 ? -62.309 20.396  28.309  1.00 118.44 ? 236 LEU B N   1 
ATOM   3650  C CA  . LEU B  2  236 ? -62.037 19.563  29.483  1.00 117.15 ? 236 LEU B CA  1 
ATOM   3651  C C   . LEU B  2  236 ? -63.057 19.766  30.604  1.00 117.39 ? 236 LEU B C   1 
ATOM   3652  O O   . LEU B  2  236 ? -63.372 18.828  31.338  1.00 117.29 ? 236 LEU B O   1 
ATOM   3653  C CB  . LEU B  2  236 ? -60.613 19.800  30.010  1.00 114.96 ? 236 LEU B CB  1 
ATOM   3654  C CG  . LEU B  2  236 ? -59.444 18.916  29.540  1.00 113.61 ? 236 LEU B CG  1 
ATOM   3655  C CD1 . LEU B  2  236 ? -59.651 17.456  29.929  1.00 112.63 ? 236 LEU B CD1 1 
ATOM   3656  C CD2 . LEU B  2  236 ? -59.169 19.044  28.046  1.00 114.68 ? 236 LEU B CD2 1 
ATOM   3657  N N   . ILE B  2  237 ? -63.563 20.992  30.727  1.00 117.28 ? 237 ILE B N   1 
ATOM   3658  C CA  . ILE B  2  237 ? -64.598 21.319  31.711  1.00 117.52 ? 237 ILE B CA  1 
ATOM   3659  C C   . ILE B  2  237 ? -65.942 20.716  31.292  1.00 121.21 ? 237 ILE B C   1 
ATOM   3660  O O   . ILE B  2  237 ? -66.652 20.140  32.118  1.00 123.40 ? 237 ILE B O   1 
ATOM   3661  C CB  . ILE B  2  237 ? -64.734 22.847  31.926  1.00 115.32 ? 237 ILE B CB  1 
ATOM   3662  C CG1 . ILE B  2  237 ? -63.386 23.459  32.325  1.00 113.96 ? 237 ILE B CG1 1 
ATOM   3663  C CG2 . ILE B  2  237 ? -65.785 23.155  32.987  1.00 115.52 ? 237 ILE B CG2 1 
ATOM   3664  C CD1 . ILE B  2  237 ? -63.284 24.953  32.092  1.00 114.29 ? 237 ILE B CD1 1 
ATOM   3665  N N   . LYS B  2  238 ? -66.269 20.842  30.005  1.00 122.55 ? 238 LYS B N   1 
ATOM   3666  C CA  . LYS B  2  238 ? -67.517 20.311  29.445  1.00 124.10 ? 238 LYS B CA  1 
ATOM   3667  C C   . LYS B  2  238 ? -67.572 18.781  29.458  1.00 127.36 ? 238 LYS B C   1 
ATOM   3668  O O   . LYS B  2  238 ? -68.654 18.197  29.550  1.00 131.61 ? 238 LYS B O   1 
ATOM   3669  C CB  . LYS B  2  238 ? -67.735 20.830  28.018  1.00 119.14 ? 238 LYS B CB  1 
ATOM   3670  C CG  . LYS B  2  238 ? -68.122 22.300  27.916  1.00 116.14 ? 238 LYS B CG  1 
ATOM   3671  C CD  . LYS B  2  238 ? -69.622 22.511  28.052  1.00 115.37 ? 238 LYS B CD  1 
ATOM   3672  C CE  . LYS B  2  238 ? -69.990 23.971  27.839  1.00 113.62 ? 238 LYS B CE  1 
ATOM   3673  N NZ  . LYS B  2  238 ? -71.466 24.180  27.844  1.00 114.92 ? 238 LYS B NZ  1 
ATOM   3674  N N   . LYS B  2  239 ? -66.404 18.144  29.361  1.00 128.53 ? 239 LYS B N   1 
ATOM   3675  C CA  . LYS B  2  239 ? -66.294 16.685  29.423  1.00 130.55 ? 239 LYS B CA  1 
ATOM   3676  C C   . LYS B  2  239 ? -66.597 16.175  30.834  1.00 128.21 ? 239 LYS B C   1 
ATOM   3677  O O   . LYS B  2  239 ? -67.123 15.073  31.005  1.00 127.45 ? 239 LYS B O   1 
ATOM   3678  C CB  . LYS B  2  239 ? -64.899 16.235  28.978  1.00 133.65 ? 239 LYS B CB  1 
ATOM   3679  C CG  . LYS B  2  239 ? -64.812 14.781  28.535  1.00 137.83 ? 239 LYS B CG  1 
ATOM   3680  C CD  . LYS B  2  239 ? -63.422 14.447  28.013  1.00 142.57 ? 239 LYS B CD  1 
ATOM   3681  C CE  . LYS B  2  239 ? -63.351 13.032  27.458  1.00 144.39 ? 239 LYS B CE  1 
ATOM   3682  N NZ  . LYS B  2  239 ? -63.417 11.993  28.523  1.00 145.46 ? 239 LYS B NZ  1 
ATOM   3683  N N   . HIS B  2  240 ? -66.258 16.988  31.833  1.00 126.22 ? 240 HIS B N   1 
ATOM   3684  C CA  . HIS B  2  240 ? -66.561 16.689  33.231  1.00 123.82 ? 240 HIS B CA  1 
ATOM   3685  C C   . HIS B  2  240 ? -67.945 17.152  33.600  1.00 128.77 ? 240 HIS B C   1 
ATOM   3686  O O   . HIS B  2  240 ? -68.574 16.590  34.500  1.00 129.17 ? 240 HIS B O   1 
ATOM   3687  C CB  . HIS B  2  240 ? -65.521 17.327  34.148  1.00 116.70 ? 240 HIS B CB  1 
ATOM   3688  C CG  . HIS B  2  240 ? -65.695 16.978  35.607  1.00 111.99 ? 240 HIS B CG  1 
ATOM   3689  N ND1 . HIS B  2  240 ? -66.279 17.812  36.486  1.00 108.61 ? 240 HIS B ND1 1 
ATOM   3690  C CD2 . HIS B  2  240 ? -65.344 15.835  36.323  1.00 110.16 ? 240 HIS B CD2 1 
ATOM   3691  C CE1 . HIS B  2  240 ? -66.299 17.239  37.703  1.00 108.19 ? 240 HIS B CE1 1 
ATOM   3692  N NE2 . HIS B  2  240 ? -65.727 16.028  37.602  1.00 109.28 ? 240 HIS B NE2 1 
ATOM   3693  N N   . GLU B  2  241 ? -68.428 18.181  32.904  1.00 133.29 ? 241 GLU B N   1 
ATOM   3694  C CA  . GLU B  2  241 ? -69.767 18.727  33.132  1.00 140.53 ? 241 GLU B CA  1 
ATOM   3695  C C   . GLU B  2  241 ? -70.851 17.761  32.653  1.00 145.50 ? 241 GLU B C   1 
ATOM   3696  O O   . GLU B  2  241 ? -71.921 17.669  33.259  1.00 148.05 ? 241 GLU B O   1 
ATOM   3697  C CB  . GLU B  2  241 ? -69.922 20.083  32.435  1.00 142.36 ? 241 GLU B CB  1 
ATOM   3698  C CG  . GLU B  2  241 ? -70.956 21.005  33.068  1.00 147.00 ? 241 GLU B CG  1 
ATOM   3699  C CD  . GLU B  2  241 ? -70.482 21.619  34.375  1.00 148.77 ? 241 GLU B CD  1 
ATOM   3700  O OE1 . GLU B  2  241 ? -69.366 22.181  34.408  1.00 146.89 ? 241 GLU B OE1 1 
ATOM   3701  O OE2 . GLU B  2  241 ? -71.234 21.545  35.370  1.00 150.89 ? 241 GLU B OE2 1 
ATOM   3702  N N   . GLU B  2  242 ? -70.564 17.050  31.564  1.00 147.96 ? 242 GLU B N   1 
ATOM   3703  C CA  . GLU B  2  242 ? -71.459 16.019  31.039  1.00 152.80 ? 242 GLU B CA  1 
ATOM   3704  C C   . GLU B  2  242 ? -71.390 14.741  31.875  1.00 154.98 ? 242 GLU B C   1 
ATOM   3705  O O   . GLU B  2  242 ? -72.339 13.955  31.896  1.00 157.84 ? 242 GLU B O   1 
ATOM   3706  C CB  . GLU B  2  242 ? -71.136 15.715  29.575  1.00 151.93 ? 242 GLU B CB  1 
ATOM   3707  C CG  . GLU B  2  242 ? -71.612 16.784  28.601  1.00 151.71 ? 242 GLU B CG  1 
ATOM   3708  C CD  . GLU B  2  242 ? -71.153 16.538  27.176  1.00 152.43 ? 242 GLU B CD  1 
ATOM   3709  O OE1 . GLU B  2  242 ? -71.955 16.764  26.248  1.00 153.14 ? 242 GLU B OE1 1 
ATOM   3710  O OE2 . GLU B  2  242 ? -69.992 16.123  26.979  1.00 150.18 ? 242 GLU B OE2 1 
ATOM   3711  N N   . GLU B  2  243 ? -70.261 14.545  32.556  1.00 153.53 ? 243 GLU B N   1 
ATOM   3712  C CA  . GLU B  2  243 ? -70.075 13.423  33.476  1.00 153.04 ? 243 GLU B CA  1 
ATOM   3713  C C   . GLU B  2  243 ? -70.902 13.622  34.748  1.00 155.68 ? 243 GLU B C   1 
ATOM   3714  O O   . GLU B  2  243 ? -71.304 12.651  35.394  1.00 155.81 ? 243 GLU B O   1 
ATOM   3715  C CB  . GLU B  2  243 ? -68.591 13.262  33.825  1.00 150.35 ? 243 GLU B CB  1 
ATOM   3716  C CG  . GLU B  2  243 ? -68.215 11.909  34.417  1.00 151.72 ? 243 GLU B CG  1 
ATOM   3717  C CD  . GLU B  2  243 ? -68.233 10.786  33.394  1.00 152.10 ? 243 GLU B CD  1 
ATOM   3718  O OE1 . GLU B  2  243 ? -67.631 10.947  32.310  1.00 152.55 ? 243 GLU B OE1 1 
ATOM   3719  O OE2 . GLU B  2  243 ? -68.842 9.734   33.678  1.00 154.32 ? 243 GLU B OE2 1 
ATOM   3720  N N   . GLU B  2  244 ? -71.143 14.885  35.097  1.00 158.45 ? 244 GLU B N   1 
ATOM   3721  C CA  . GLU B  2  244 ? -71.994 15.246  36.230  1.00 161.03 ? 244 GLU B CA  1 
ATOM   3722  C C   . GLU B  2  244 ? -73.459 14.917  35.935  1.00 162.52 ? 244 GLU B C   1 
ATOM   3723  O O   . GLU B  2  244 ? -74.199 14.497  36.827  1.00 163.18 ? 244 GLU B O   1 
ATOM   3724  C CB  . GLU B  2  244 ? -71.835 16.735  36.559  1.00 160.72 ? 244 GLU B CB  1 
ATOM   3725  C CG  . GLU B  2  244 ? -72.399 17.160  37.909  1.00 159.68 ? 244 GLU B CG  1 
ATOM   3726  C CD  . GLU B  2  244 ? -71.515 16.766  39.080  1.00 158.83 ? 244 GLU B CD  1 
ATOM   3727  O OE1 . GLU B  2  244 ? -70.273 16.853  38.958  1.00 155.06 ? 244 GLU B OE1 1 
ATOM   3728  O OE2 . GLU B  2  244 ? -72.064 16.379  40.133  1.00 160.10 ? 244 GLU B OE2 1 
ATOM   3729  N N   . ALA B  2  245 ? -73.863 15.112  34.681  1.00 163.03 ? 245 ALA B N   1 
ATOM   3730  C CA  . ALA B  2  245 ? -75.225 14.819  34.237  1.00 165.80 ? 245 ALA B CA  1 
ATOM   3731  C C   . ALA B  2  245 ? -75.444 13.323  34.014  1.00 167.15 ? 245 ALA B C   1 
ATOM   3732  O O   . ALA B  2  245 ? -76.551 12.817  34.214  1.00 168.28 ? 245 ALA B O   1 
ATOM   3733  C CB  . ALA B  2  245 ? -75.548 15.600  32.972  1.00 161.63 ? 245 ALA B CB  1 
ATOM   3734  N N   . LYS B  2  246 ? -74.386 12.625  33.603  1.00 166.55 ? 246 LYS B N   1 
ATOM   3735  C CA  . LYS B  2  246 ? -74.444 11.185  33.344  1.00 166.90 ? 246 LYS B CA  1 
ATOM   3736  C C   . LYS B  2  246 ? -74.461 10.371  34.641  1.00 165.21 ? 246 LYS B C   1 
ATOM   3737  O O   . LYS B  2  246 ? -74.869 9.206   34.644  1.00 165.53 ? 246 LYS B O   1 
ATOM   3738  C CB  . LYS B  2  246 ? -73.272 10.750  32.457  1.00 166.35 ? 246 LYS B CB  1 
ATOM   3739  C CG  . LYS B  2  246 ? -73.543 9.497   31.633  1.00 166.99 ? 246 LYS B CG  1 
ATOM   3740  C CD  . LYS B  2  246 ? -72.316 9.040   30.858  1.00 166.85 ? 246 LYS B CD  1 
ATOM   3741  C CE  . LYS B  2  246 ? -71.420 8.137   31.693  1.00 165.93 ? 246 LYS B CE  1 
ATOM   3742  N NZ  . LYS B  2  246 ? -70.306 7.570   30.884  1.00 165.62 ? 246 LYS B NZ  1 
ATOM   3743  N N   . ALA B  2  247 ? -74.019 10.992  35.734  1.00 163.26 ? 247 ALA B N   1 
ATOM   3744  C CA  . ALA B  2  247 ? -73.990 10.354  37.052  1.00 160.52 ? 247 ALA B CA  1 
ATOM   3745  C C   . ALA B  2  247 ? -75.391 10.047  37.582  1.00 160.93 ? 247 ALA B C   1 
ATOM   3746  O O   . ALA B  2  247 ? -75.597 9.031   38.249  1.00 159.15 ? 247 ALA B O   1 
ATOM   3747  C CB  . ALA B  2  247 ? -73.219 11.215  38.042  1.00 158.89 ? 247 ALA B CB  1 
ATOM   3748  N N   . GLU B  2  248 ? -76.344 10.929  37.286  1.00 163.51 ? 248 GLU B N   1 
ATOM   3749  C CA  . GLU B  2  248 ? -77.745 10.718  37.649  1.00 168.27 ? 248 GLU B CA  1 
ATOM   3750  C C   . GLU B  2  248 ? -78.477 9.909   36.579  1.00 167.44 ? 248 GLU B C   1 
ATOM   3751  O O   . GLU B  2  248 ? -79.083 10.470  35.662  1.00 167.63 ? 248 GLU B O   1 
ATOM   3752  C CB  . GLU B  2  248 ? -78.455 12.054  37.896  1.00 172.36 ? 248 GLU B CB  1 
ATOM   3753  C CG  . GLU B  2  248 ? -78.361 12.571  39.325  1.00 172.99 ? 248 GLU B CG  1 
ATOM   3754  C CD  . GLU B  2  248 ? -77.062 13.301  39.629  1.00 172.16 ? 248 GLU B CD  1 
ATOM   3755  O OE1 . GLU B  2  248 ? -76.931 13.813  40.760  1.00 170.17 ? 248 GLU B OE1 1 
ATOM   3756  O OE2 . GLU B  2  248 ? -76.175 13.373  38.752  1.00 170.39 ? 248 GLU B OE2 1 
ATOM   3757  N N   . ARG B  2  249 ? -78.407 8.586   36.705  1.00 164.78 ? 249 ARG B N   1 
ATOM   3758  C CA  . ARG B  2  249 ? -79.073 7.672   35.779  1.00 163.62 ? 249 ARG B CA  1 
ATOM   3759  C C   . ARG B  2  249 ? -79.495 6.388   36.489  1.00 161.34 ? 249 ARG B C   1 
ATOM   3760  O O   . ARG B  2  249 ? -78.754 5.847   37.311  1.00 160.27 ? 249 ARG B O   1 
ATOM   3761  C CB  . ARG B  2  249 ? -78.163 7.351   34.588  1.00 164.16 ? 249 ARG B CB  1 
ATOM   3762  C CG  . ARG B  2  249 ? -78.863 6.649   33.433  1.00 166.78 ? 249 ARG B CG  1 
ATOM   3763  C CD  . ARG B  2  249 ? -77.940 6.478   32.236  1.00 170.84 ? 249 ARG B CD  1 
ATOM   3764  N NE  . ARG B  2  249 ? -77.663 7.747   31.563  1.00 174.46 ? 249 ARG B NE  1 
ATOM   3765  C CZ  . ARG B  2  249 ? -76.876 7.885   30.499  1.00 175.70 ? 249 ARG B CZ  1 
ATOM   3766  N NH1 . ARG B  2  249 ? -76.269 6.831   29.965  1.00 177.22 ? 249 ARG B NH1 1 
ATOM   3767  N NH2 . ARG B  2  249 ? -76.693 9.085   29.965  1.00 175.07 ? 249 ARG B NH2 1 
ATOM   3768  N N   . SER C  3  2   ? -24.306 42.950  57.846  1.00 99.61  ? 2   SER C N   1 
ATOM   3769  C CA  . SER C  3  2   ? -24.473 41.517  58.224  1.00 101.10 ? 2   SER C CA  1 
ATOM   3770  C C   . SER C  3  2   ? -25.142 41.366  59.589  1.00 100.56 ? 2   SER C C   1 
ATOM   3771  O O   . SER C  3  2   ? -24.950 42.196  60.481  1.00 100.98 ? 2   SER C O   1 
ATOM   3772  C CB  . SER C  3  2   ? -23.123 40.796  58.214  1.00 101.24 ? 2   SER C CB  1 
ATOM   3773  O OG  . SER C  3  2   ? -22.214 41.398  59.120  1.00 103.71 ? 2   SER C OG  1 
ATOM   3774  N N   . TYR C  3  3   ? -25.922 40.297  59.738  1.00 99.62  ? 3   TYR C N   1 
ATOM   3775  C CA  . TYR C  3  3   ? -26.644 40.009  60.976  1.00 97.60  ? 3   TYR C CA  1 
ATOM   3776  C C   . TYR C  3  3   ? -25.692 39.473  62.042  1.00 98.86  ? 3   TYR C C   1 
ATOM   3777  O O   . TYR C  3  3   ? -25.080 38.416  61.868  1.00 97.55  ? 3   TYR C O   1 
ATOM   3778  C CB  . TYR C  3  3   ? -27.776 39.013  60.704  1.00 93.69  ? 3   TYR C CB  1 
ATOM   3779  C CG  . TYR C  3  3   ? -28.844 38.949  61.777  1.00 94.81  ? 3   TYR C CG  1 
ATOM   3780  C CD1 . TYR C  3  3   ? -29.686 40.035  62.020  1.00 94.02  ? 3   TYR C CD1 1 
ATOM   3781  C CD2 . TYR C  3  3   ? -29.031 37.791  62.531  1.00 95.50  ? 3   TYR C CD2 1 
ATOM   3782  C CE1 . TYR C  3  3   ? -30.670 39.975  62.995  1.00 92.36  ? 3   TYR C CE1 1 
ATOM   3783  C CE2 . TYR C  3  3   ? -30.014 37.721  63.507  1.00 95.93  ? 3   TYR C CE2 1 
ATOM   3784  C CZ  . TYR C  3  3   ? -30.830 38.815  63.734  1.00 95.10  ? 3   TYR C CZ  1 
ATOM   3785  O OH  . TYR C  3  3   ? -31.806 38.752  64.703  1.00 95.23  ? 3   TYR C OH  1 
ATOM   3786  N N   . ASP C  3  4   ? -25.570 40.216  63.140  1.00 101.51 ? 4   ASP C N   1 
ATOM   3787  C CA  . ASP C  3  4   ? -24.615 39.891  64.199  1.00 104.26 ? 4   ASP C CA  1 
ATOM   3788  C C   . ASP C  3  4   ? -25.273 39.768  65.578  1.00 100.54 ? 4   ASP C C   1 
ATOM   3789  O O   . ASP C  3  4   ? -24.628 39.992  66.606  1.00 101.30 ? 4   ASP C O   1 
ATOM   3790  C CB  . ASP C  3  4   ? -23.487 40.930  64.230  1.00 110.68 ? 4   ASP C CB  1 
ATOM   3791  C CG  . ASP C  3  4   ? -22.640 40.914  62.969  1.00 117.39 ? 4   ASP C CG  1 
ATOM   3792  O OD1 . ASP C  3  4   ? -22.077 39.849  62.634  1.00 119.13 ? 4   ASP C OD1 1 
ATOM   3793  O OD2 . ASP C  3  4   ? -22.529 41.973  62.316  1.00 121.38 ? 4   ASP C OD2 1 
ATOM   3794  N N   . ARG C  3  5   ? -26.553 39.404  65.591  1.00 96.71  ? 5   ARG C N   1 
ATOM   3795  C CA  . ARG C  3  5   ? -27.296 39.217  66.834  1.00 96.23  ? 5   ARG C CA  1 
ATOM   3796  C C   . ARG C  3  5   ? -26.943 37.873  67.465  1.00 92.78  ? 5   ARG C C   1 
ATOM   3797  O O   . ARG C  3  5   ? -26.756 36.880  66.761  1.00 89.87  ? 5   ARG C O   1 
ATOM   3798  C CB  . ARG C  3  5   ? -28.802 39.288  66.570  1.00 98.53  ? 5   ARG C CB  1 
ATOM   3799  C CG  . ARG C  3  5   ? -29.656 39.636  67.782  1.00 101.01 ? 5   ARG C CG  1 
ATOM   3800  C CD  . ARG C  3  5   ? -30.022 41.113  67.809  1.00 103.28 ? 5   ARG C CD  1 
ATOM   3801  N NE  . ARG C  3  5   ? -28.902 41.964  68.205  1.00 107.22 ? 5   ARG C NE  1 
ATOM   3802  C CZ  . ARG C  3  5   ? -28.813 43.266  67.944  1.00 112.80 ? 5   ARG C CZ  1 
ATOM   3803  N NH1 . ARG C  3  5   ? -29.775 43.887  67.271  1.00 110.77 ? 5   ARG C NH1 1 
ATOM   3804  N NH2 . ARG C  3  5   ? -27.753 43.949  68.352  1.00 115.57 ? 5   ARG C NH2 1 
ATOM   3805  N N   . ALA C  3  6   ? -26.853 37.851  68.792  1.00 92.84  ? 6   ALA C N   1 
ATOM   3806  C CA  . ALA C  3  6   ? -26.583 36.620  69.529  1.00 94.34  ? 6   ALA C CA  1 
ATOM   3807  C C   . ALA C  3  6   ? -27.845 35.765  69.626  1.00 95.81  ? 6   ALA C C   1 
ATOM   3808  O O   . ALA C  3  6   ? -28.821 36.151  70.274  1.00 98.99  ? 6   ALA C O   1 
ATOM   3809  C CB  . ALA C  3  6   ? -26.033 36.935  70.912  1.00 93.45  ? 6   ALA C CB  1 
ATOM   3810  N N   . ILE C  3  7   ? -27.816 34.607  68.969  1.00 94.09  ? 7   ILE C N   1 
ATOM   3811  C CA  . ILE C  3  7   ? -28.961 33.697  68.942  1.00 91.59  ? 7   ILE C CA  1 
ATOM   3812  C C   . ILE C  3  7   ? -28.949 32.770  70.159  1.00 88.86  ? 7   ILE C C   1 
ATOM   3813  O O   . ILE C  3  7   ? -29.879 32.788  70.967  1.00 87.20  ? 7   ILE C O   1 
ATOM   3814  C CB  . ILE C  3  7   ? -29.016 32.877  67.626  1.00 90.08  ? 7   ILE C CB  1 
ATOM   3815  C CG1 . ILE C  3  7   ? -29.000 33.798  66.391  1.00 88.67  ? 7   ILE C CG1 1 
ATOM   3816  C CG2 . ILE C  3  7   ? -30.216 31.935  67.612  1.00 90.48  ? 7   ILE C CG2 1 
ATOM   3817  C CD1 . ILE C  3  7   ? -30.159 34.773  66.283  1.00 87.91  ? 7   ILE C CD1 1 
ATOM   3818  N N   . THR C  3  8   ? -27.892 31.968  70.281  1.00 86.66  ? 8   THR C N   1 
ATOM   3819  C CA  . THR C  3  8   ? -27.741 31.045  71.403  1.00 86.21  ? 8   THR C CA  1 
ATOM   3820  C C   . THR C  3  8   ? -27.060 31.752  72.573  1.00 88.02  ? 8   THR C C   1 
ATOM   3821  O O   . THR C  3  8   ? -25.908 32.184  72.466  1.00 88.02  ? 8   THR C O   1 
ATOM   3822  C CB  . THR C  3  8   ? -26.940 29.788  71.002  1.00 83.85  ? 8   THR C CB  1 
ATOM   3823  O OG1 . THR C  3  8   ? -27.461 29.253  69.779  1.00 83.43  ? 8   THR C OG1 1 
ATOM   3824  C CG2 . THR C  3  8   ? -27.021 28.723  72.089  1.00 83.58  ? 8   THR C CG2 1 
ATOM   3825  N N   . VAL C  3  9   ? -27.787 31.873  73.681  1.00 88.69  ? 9   VAL C N   1 
ATOM   3826  C CA  . VAL C  3  9   ? -27.285 32.541  74.886  1.00 87.83  ? 9   VAL C CA  1 
ATOM   3827  C C   . VAL C  3  9   ? -27.567 31.728  76.150  1.00 88.26  ? 9   VAL C C   1 
ATOM   3828  O O   . VAL C  3  9   ? -28.496 30.915  76.182  1.00 88.53  ? 9   VAL C O   1 
ATOM   3829  C CB  . VAL C  3  9   ? -27.861 33.971  75.049  1.00 86.49  ? 9   VAL C CB  1 
ATOM   3830  C CG1 . VAL C  3  9   ? -27.217 34.932  74.059  1.00 86.76  ? 9   VAL C CG1 1 
ATOM   3831  C CG2 . VAL C  3  9   ? -29.379 33.978  74.906  1.00 86.89  ? 9   VAL C CG2 1 
ATOM   3832  N N   . PHE C  3  10  ? -26.758 31.954  77.183  1.00 89.12  ? 10  PHE C N   1 
ATOM   3833  C CA  . PHE C  3  10  ? -26.925 31.285  78.473  1.00 89.94  ? 10  PHE C CA  1 
ATOM   3834  C C   . PHE C  3  10  ? -28.126 31.819  79.253  1.00 92.81  ? 10  PHE C C   1 
ATOM   3835  O O   . PHE C  3  10  ? -28.560 32.955  79.045  1.00 94.16  ? 10  PHE C O   1 
ATOM   3836  C CB  . PHE C  3  10  ? -25.650 31.405  79.312  1.00 88.63  ? 10  PHE C CB  1 
ATOM   3837  C CG  . PHE C  3  10  ? -24.593 30.396  78.960  1.00 86.93  ? 10  PHE C CG  1 
ATOM   3838  C CD1 . PHE C  3  10  ? -23.568 30.721  78.078  1.00 85.94  ? 10  PHE C CD1 1 
ATOM   3839  C CD2 . PHE C  3  10  ? -24.618 29.121  79.516  1.00 86.13  ? 10  PHE C CD2 1 
ATOM   3840  C CE1 . PHE C  3  10  ? -22.591 29.792  77.754  1.00 83.45  ? 10  PHE C CE1 1 
ATOM   3841  C CE2 . PHE C  3  10  ? -23.644 28.187  79.194  1.00 85.47  ? 10  PHE C CE2 1 
ATOM   3842  C CZ  . PHE C  3  10  ? -22.629 28.523  78.312  1.00 84.60  ? 10  PHE C CZ  1 
ATOM   3843  N N   . SER C  3  11  ? -28.649 30.991  80.154  1.00 95.16  ? 11  SER C N   1 
ATOM   3844  C CA  . SER C  3  11  ? -29.852 31.316  80.919  1.00 99.05  ? 11  SER C CA  1 
ATOM   3845  C C   . SER C  3  11  ? -29.602 31.242  82.429  1.00 100.52 ? 11  SER C C   1 
ATOM   3846  O O   . SER C  3  11  ? -28.648 30.591  82.860  1.00 99.54  ? 11  SER C O   1 
ATOM   3847  C CB  . SER C  3  11  ? -30.991 30.377  80.518  1.00 102.78 ? 11  SER C CB  1 
ATOM   3848  O OG  . SER C  3  11  ? -31.192 30.408  79.117  1.00 105.73 ? 11  SER C OG  1 
ATOM   3849  N N   . PRO C  3  12  ? -30.454 31.916  83.236  1.00 103.73 ? 12  PRO C N   1 
ATOM   3850  C CA  . PRO C  3  12  ? -30.357 31.939  84.701  1.00 105.18 ? 12  PRO C CA  1 
ATOM   3851  C C   . PRO C  3  12  ? -30.050 30.593  85.360  1.00 106.81 ? 12  PRO C C   1 
ATOM   3852  O O   . PRO C  3  12  ? -29.230 30.535  86.279  1.00 109.40 ? 12  PRO C O   1 
ATOM   3853  C CB  . PRO C  3  12  ? -31.738 32.436  85.125  1.00 106.53 ? 12  PRO C CB  1 
ATOM   3854  C CG  . PRO C  3  12  ? -32.138 33.355  84.025  1.00 106.43 ? 12  PRO C CG  1 
ATOM   3855  C CD  . PRO C  3  12  ? -31.517 32.825  82.758  1.00 104.96 ? 12  PRO C CD  1 
ATOM   3856  N N   . ASP C  3  13  ? -30.699 29.528  84.892  1.00 109.51 ? 13  ASP C N   1 
ATOM   3857  C CA  . ASP C  3  13  ? -30.489 28.183  85.434  1.00 113.45 ? 13  ASP C CA  1 
ATOM   3858  C C   . ASP C  3  13  ? -29.165 27.557  84.987  1.00 111.00 ? 13  ASP C C   1 
ATOM   3859  O O   . ASP C  3  13  ? -28.599 26.721  85.693  1.00 110.24 ? 13  ASP C O   1 
ATOM   3860  C CB  . ASP C  3  13  ? -31.667 27.262  85.083  1.00 119.09 ? 13  ASP C CB  1 
ATOM   3861  C CG  . ASP C  3  13  ? -32.117 27.395  83.633  1.00 123.25 ? 13  ASP C CG  1 
ATOM   3862  O OD1 . ASP C  3  13  ? -33.342 27.367  83.394  1.00 124.64 ? 13  ASP C OD1 1 
ATOM   3863  O OD2 . ASP C  3  13  ? -31.260 27.530  82.733  1.00 122.18 ? 13  ASP C OD2 1 
ATOM   3864  N N   . GLY C  3  14  ? -28.684 27.967  83.815  1.00 107.16 ? 14  GLY C N   1 
ATOM   3865  C CA  . GLY C  3  14  ? -27.432 27.457  83.260  1.00 103.06 ? 14  GLY C CA  1 
ATOM   3866  C C   . GLY C  3  14  ? -27.639 26.552  82.060  1.00 101.29 ? 14  GLY C C   1 
ATOM   3867  O O   . GLY C  3  14  ? -26.928 25.560  81.893  1.00 101.90 ? 14  GLY C O   1 
ATOM   3868  N N   . HIS C  3  15  ? -28.614 26.902  81.224  1.00 100.03 ? 15  HIS C N   1 
ATOM   3869  C CA  . HIS C  3  15  ? -28.947 26.121  80.034  1.00 99.91  ? 15  HIS C CA  1 
ATOM   3870  C C   . HIS C  3  15  ? -28.939 26.963  78.792  1.00 94.55  ? 15  HIS C C   1 
ATOM   3871  O O   . HIS C  3  15  ? -29.276 28.147  78.830  1.00 95.58  ? 15  HIS C O   1 
ATOM   3872  C CB  . HIS C  3  15  ? -30.312 25.458  80.194  1.00 105.44 ? 15  HIS C CB  1 
ATOM   3873  C CG  . HIS C  3  15  ? -30.336 24.345  81.214  1.00 110.42 ? 15  HIS C CG  1 
ATOM   3874  N ND1 . HIS C  3  15  ? -29.974 23.084  80.917  1.00 112.27 ? 15  HIS C ND1 1 
ATOM   3875  C CD2 . HIS C  3  15  ? -30.705 24.342  82.558  1.00 113.57 ? 15  HIS C CD2 1 
ATOM   3876  C CE1 . HIS C  3  15  ? -30.100 22.312  82.013  1.00 114.02 ? 15  HIS C CE1 1 
ATOM   3877  N NE2 . HIS C  3  15  ? -30.547 23.083  83.016  1.00 114.55 ? 15  HIS C NE2 1 
ATOM   3878  N N   . LEU C  3  16  ? -28.544 26.352  77.678  1.00 89.04  ? 16  LEU C N   1 
ATOM   3879  C CA  . LEU C  3  16  ? -28.629 26.992  76.369  1.00 84.55  ? 16  LEU C CA  1 
ATOM   3880  C C   . LEU C  3  16  ? -29.927 26.554  75.701  1.00 86.67  ? 16  LEU C C   1 
ATOM   3881  O O   . LEU C  3  16  ? -30.013 25.451  75.152  1.00 87.23  ? 16  LEU C O   1 
ATOM   3882  C CB  . LEU C  3  16  ? -27.420 26.625  75.501  1.00 77.36  ? 16  LEU C CB  1 
ATOM   3883  C CG  . LEU C  3  16  ? -26.019 27.002  75.997  1.00 73.04  ? 16  LEU C CG  1 
ATOM   3884  C CD1 . LEU C  3  16  ? -24.956 26.256  75.206  1.00 70.15  ? 16  LEU C CD1 1 
ATOM   3885  C CD2 . LEU C  3  16  ? -25.786 28.505  75.930  1.00 74.47  ? 16  LEU C CD2 1 
ATOM   3886  N N   . PHE C  3  17  ? -30.937 27.422  75.765  1.00 89.72  ? 17  PHE C N   1 
ATOM   3887  C CA  . PHE C  3  17  ? -32.281 27.102  75.279  1.00 92.28  ? 17  PHE C CA  1 
ATOM   3888  C C   . PHE C  3  17  ? -32.330 26.749  73.793  1.00 90.21  ? 17  PHE C C   1 
ATOM   3889  O O   . PHE C  3  17  ? -33.012 25.800  73.406  1.00 91.45  ? 17  PHE C O   1 
ATOM   3890  C CB  . PHE C  3  17  ? -33.269 28.235  75.590  1.00 96.60  ? 17  PHE C CB  1 
ATOM   3891  C CG  . PHE C  3  17  ? -33.783 28.230  77.006  1.00 102.50 ? 17  PHE C CG  1 
ATOM   3892  C CD1 . PHE C  3  17  ? -33.803 29.402  77.753  1.00 105.24 ? 17  PHE C CD1 1 
ATOM   3893  C CD2 . PHE C  3  17  ? -34.256 27.057  77.593  1.00 104.73 ? 17  PHE C CD2 1 
ATOM   3894  C CE1 . PHE C  3  17  ? -34.279 29.407  79.057  1.00 107.80 ? 17  PHE C CE1 1 
ATOM   3895  C CE2 . PHE C  3  17  ? -34.730 27.056  78.897  1.00 108.07 ? 17  PHE C CE2 1 
ATOM   3896  C CZ  . PHE C  3  17  ? -34.742 28.233  79.630  1.00 108.32 ? 17  PHE C CZ  1 
ATOM   3897  N N   . GLN C  3  18  ? -31.600 27.506  72.976  1.00 89.29  ? 18  GLN C N   1 
ATOM   3898  C CA  . GLN C  3  18  ? -31.558 27.288  71.526  1.00 88.25  ? 18  GLN C CA  1 
ATOM   3899  C C   . GLN C  3  18  ? -31.000 25.915  71.152  1.00 88.87  ? 18  GLN C C   1 
ATOM   3900  O O   . GLN C  3  18  ? -31.391 25.334  70.138  1.00 89.58  ? 18  GLN C O   1 
ATOM   3901  C CB  . GLN C  3  18  ? -30.758 28.396  70.831  1.00 86.79  ? 18  GLN C CB  1 
ATOM   3902  C CG  . GLN C  3  18  ? -31.415 29.769  70.876  1.00 85.95  ? 18  GLN C CG  1 
ATOM   3903  C CD  . GLN C  3  18  ? -32.747 29.814  70.149  1.00 85.54  ? 18  GLN C CD  1 
ATOM   3904  O OE1 . GLN C  3  18  ? -32.836 29.492  68.964  1.00 83.96  ? 18  GLN C OE1 1 
ATOM   3905  N NE2 . GLN C  3  18  ? -33.792 30.223  70.859  1.00 86.68  ? 18  GLN C NE2 1 
ATOM   3906  N N   . VAL C  3  19  ? -30.086 25.410  71.978  1.00 89.29  ? 19  VAL C N   1 
ATOM   3907  C CA  . VAL C  3  19  ? -29.550 24.059  71.824  1.00 90.25  ? 19  VAL C CA  1 
ATOM   3908  C C   . VAL C  3  19  ? -30.595 23.035  72.274  1.00 92.30  ? 19  VAL C C   1 
ATOM   3909  O O   . VAL C  3  19  ? -30.790 22.007  71.619  1.00 93.72  ? 19  VAL C O   1 
ATOM   3910  C CB  . VAL C  3  19  ? -28.233 23.876  72.616  1.00 89.42  ? 19  VAL C CB  1 
ATOM   3911  C CG1 . VAL C  3  19  ? -27.712 22.451  72.495  1.00 89.15  ? 19  VAL C CG1 1 
ATOM   3912  C CG2 . VAL C  3  19  ? -27.177 24.861  72.136  1.00 86.36  ? 19  VAL C CG2 1 
ATOM   3913  N N   . GLU C  3  20  ? -31.271 23.335  73.383  1.00 94.39  ? 20  GLU C N   1 
ATOM   3914  C CA  . GLU C  3  20  ? -32.298 22.457  73.946  1.00 96.65  ? 20  GLU C CA  1 
ATOM   3915  C C   . GLU C  3  20  ? -33.533 22.343  73.053  1.00 95.80  ? 20  GLU C C   1 
ATOM   3916  O O   . GLU C  3  20  ? -34.136 21.273  72.962  1.00 96.58  ? 20  GLU C O   1 
ATOM   3917  C CB  . GLU C  3  20  ? -32.703 22.922  75.349  1.00 100.24 ? 20  GLU C CB  1 
ATOM   3918  C CG  . GLU C  3  20  ? -31.634 22.703  76.410  1.00 103.11 ? 20  GLU C CG  1 
ATOM   3919  C CD  . GLU C  3  20  ? -32.100 23.060  77.811  1.00 108.78 ? 20  GLU C CD  1 
ATOM   3920  O OE1 . GLU C  3  20  ? -32.962 23.954  77.958  1.00 110.13 ? 20  GLU C OE1 1 
ATOM   3921  O OE2 . GLU C  3  20  ? -31.593 22.447  78.773  1.00 112.85 ? 20  GLU C OE2 1 
ATOM   3922  N N   . TYR C  3  21  ? -33.899 23.444  72.397  1.00 94.85  ? 21  TYR C N   1 
ATOM   3923  C CA  . TYR C  3  21  ? -35.040 23.455  71.480  1.00 95.47  ? 21  TYR C CA  1 
ATOM   3924  C C   . TYR C  3  21  ? -34.719 22.714  70.184  1.00 96.28  ? 21  TYR C C   1 
ATOM   3925  O O   . TYR C  3  21  ? -35.609 22.139  69.556  1.00 97.45  ? 21  TYR C O   1 
ATOM   3926  C CB  . TYR C  3  21  ? -35.500 24.884  71.168  1.00 95.91  ? 21  TYR C CB  1 
ATOM   3927  C CG  . TYR C  3  21  ? -35.903 25.723  72.369  1.00 96.41  ? 21  TYR C CG  1 
ATOM   3928  C CD1 . TYR C  3  21  ? -35.786 27.113  72.335  1.00 96.22  ? 21  TYR C CD1 1 
ATOM   3929  C CD2 . TYR C  3  21  ? -36.393 25.134  73.539  1.00 96.73  ? 21  TYR C CD2 1 
ATOM   3930  C CE1 . TYR C  3  21  ? -36.151 27.891  73.422  1.00 95.27  ? 21  TYR C CE1 1 
ATOM   3931  C CE2 . TYR C  3  21  ? -36.754 25.906  74.633  1.00 96.10  ? 21  TYR C CE2 1 
ATOM   3932  C CZ  . TYR C  3  21  ? -36.634 27.282  74.568  1.00 95.22  ? 21  TYR C CZ  1 
ATOM   3933  O OH  . TYR C  3  21  ? -36.994 28.053  75.650  1.00 94.27  ? 21  TYR C OH  1 
ATOM   3934  N N   . ALA C  3  22  ? -33.447 22.737  69.792  1.00 96.74  ? 22  ALA C N   1 
ATOM   3935  C CA  . ALA C  3  22  ? -32.970 21.977  68.639  1.00 97.73  ? 22  ALA C CA  1 
ATOM   3936  C C   . ALA C  3  22  ? -32.985 20.478  68.937  1.00 97.03  ? 22  ALA C C   1 
ATOM   3937  O O   . ALA C  3  22  ? -33.120 19.657  68.027  1.00 95.95  ? 22  ALA C O   1 
ATOM   3938  C CB  . ALA C  3  22  ? -31.575 22.432  68.240  1.00 97.52  ? 22  ALA C CB  1 
ATOM   3939  N N   . GLN C  3  23  ? -32.850 20.137  70.218  1.00 97.97  ? 23  GLN C N   1 
ATOM   3940  C CA  . GLN C  3  23  ? -32.962 18.756  70.683  1.00 100.07 ? 23  GLN C CA  1 
ATOM   3941  C C   . GLN C  3  23  ? -34.423 18.307  70.765  1.00 101.05 ? 23  GLN C C   1 
ATOM   3942  O O   . GLN C  3  23  ? -34.707 17.110  70.825  1.00 103.02 ? 23  GLN C O   1 
ATOM   3943  C CB  . GLN C  3  23  ? -32.274 18.584  72.041  1.00 100.50 ? 23  GLN C CB  1 
ATOM   3944  C CG  . GLN C  3  23  ? -30.754 18.630  71.980  1.00 98.50  ? 23  GLN C CG  1 
ATOM   3945  C CD  . GLN C  3  23  ? -30.098 18.505  73.344  1.00 98.61  ? 23  GLN C CD  1 
ATOM   3946  O OE1 . GLN C  3  23  ? -29.208 17.679  73.540  1.00 101.47 ? 23  GLN C OE1 1 
ATOM   3947  N NE2 . GLN C  3  23  ? -30.534 19.328  74.294  1.00 99.02  ? 23  GLN C NE2 1 
ATOM   3948  N N   . GLU C  3  24  ? -35.339 19.274  70.776  1.00 100.33 ? 24  GLU C N   1 
ATOM   3949  C CA  . GLU C  3  24  ? -36.773 18.992  70.740  1.00 101.53 ? 24  GLU C CA  1 
ATOM   3950  C C   . GLU C  3  24  ? -37.246 18.770  69.304  1.00 102.39 ? 24  GLU C C   1 
ATOM   3951  O O   . GLU C  3  24  ? -38.233 18.070  69.068  1.00 103.67 ? 24  GLU C O   1 
ATOM   3952  C CB  . GLU C  3  24  ? -37.571 20.130  71.388  1.00 102.26 ? 24  GLU C CB  1 
ATOM   3953  C CG  . GLU C  3  24  ? -37.339 20.304  72.885  1.00 104.16 ? 24  GLU C CG  1 
ATOM   3954  C CD  . GLU C  3  24  ? -37.843 19.135  73.714  1.00 109.65 ? 24  GLU C CD  1 
ATOM   3955  O OE1 . GLU C  3  24  ? -38.941 18.613  73.421  1.00 112.28 ? 24  GLU C OE1 1 
ATOM   3956  O OE2 . GLU C  3  24  ? -37.141 18.742  74.669  1.00 111.06 ? 24  GLU C OE2 1 
ATOM   3957  N N   . ALA C  3  25  ? -36.533 19.374  68.355  1.00 102.59 ? 25  ALA C N   1 
ATOM   3958  C CA  . ALA C  3  25  ? -36.836 19.240  66.932  1.00 102.99 ? 25  ALA C CA  1 
ATOM   3959  C C   . ALA C  3  25  ? -36.434 17.870  66.389  1.00 101.39 ? 25  ALA C C   1 
ATOM   3960  O O   . ALA C  3  25  ? -37.101 17.328  65.504  1.00 101.45 ? 25  ALA C O   1 
ATOM   3961  C CB  . ALA C  3  25  ? -36.157 20.347  66.139  1.00 103.28 ? 25  ALA C CB  1 
ATOM   3962  N N   . VAL C  3  26  ? -35.343 17.321  66.921  1.00 99.95  ? 26  VAL C N   1 
ATOM   3963  C CA  . VAL C  3  26  ? -34.856 16.000  66.516  1.00 99.40  ? 26  VAL C CA  1 
ATOM   3964  C C   . VAL C  3  26  ? -35.723 14.876  67.101  1.00 100.49 ? 26  VAL C C   1 
ATOM   3965  O O   . VAL C  3  26  ? -35.845 13.802  66.506  1.00 100.30 ? 26  VAL C O   1 
ATOM   3966  C CB  . VAL C  3  26  ? -33.350 15.808  66.844  1.00 97.12  ? 26  VAL C CB  1 
ATOM   3967  C CG1 . VAL C  3  26  ? -33.100 15.753  68.346  1.00 98.13  ? 26  VAL C CG1 1 
ATOM   3968  C CG2 . VAL C  3  26  ? -32.798 14.565  66.162  1.00 95.61  ? 26  VAL C CG2 1 
ATOM   3969  N N   . LYS C  3  27  ? -36.328 15.140  68.258  1.00 102.46 ? 27  LYS C N   1 
ATOM   3970  C CA  . LYS C  3  27  ? -37.237 14.191  68.902  1.00 104.86 ? 27  LYS C CA  1 
ATOM   3971  C C   . LYS C  3  27  ? -38.559 14.075  68.147  1.00 106.07 ? 27  LYS C C   1 
ATOM   3972  O O   . LYS C  3  27  ? -39.161 13.003  68.105  1.00 110.01 ? 27  LYS C O   1 
ATOM   3973  C CB  . LYS C  3  27  ? -37.493 14.587  70.359  1.00 107.00 ? 27  LYS C CB  1 
ATOM   3974  C CG  . LYS C  3  27  ? -36.342 14.277  71.302  1.00 109.13 ? 27  LYS C CG  1 
ATOM   3975  C CD  . LYS C  3  27  ? -36.602 14.833  72.693  1.00 111.03 ? 27  LYS C CD  1 
ATOM   3976  C CE  . LYS C  3  27  ? -35.424 14.579  73.619  1.00 112.00 ? 27  LYS C CE  1 
ATOM   3977  N NZ  . LYS C  3  27  ? -35.640 15.170  74.968  1.00 110.56 ? 27  LYS C NZ  1 
ATOM   3978  N N   . LYS C  3  28  ? -39.000 15.181  67.550  1.00 104.39 ? 28  LYS C N   1 
ATOM   3979  C CA  . LYS C  3  28  ? -40.242 15.213  66.776  1.00 104.36 ? 28  LYS C CA  1 
ATOM   3980  C C   . LYS C  3  28  ? -40.110 14.546  65.403  1.00 105.76 ? 28  LYS C C   1 
ATOM   3981  O O   . LYS C  3  28  ? -41.114 14.186  64.784  1.00 106.91 ? 28  LYS C O   1 
ATOM   3982  C CB  . LYS C  3  28  ? -40.747 16.650  66.623  1.00 103.35 ? 28  LYS C CB  1 
ATOM   3983  C CG  . LYS C  3  28  ? -41.431 17.201  67.863  1.00 104.95 ? 28  LYS C CG  1 
ATOM   3984  C CD  . LYS C  3  28  ? -42.058 18.556  67.586  1.00 106.98 ? 28  LYS C CD  1 
ATOM   3985  C CE  . LYS C  3  28  ? -42.933 19.002  68.744  1.00 110.03 ? 28  LYS C CE  1 
ATOM   3986  N NZ  . LYS C  3  28  ? -43.505 20.356  68.505  1.00 110.69 ? 28  LYS C NZ  1 
ATOM   3987  N N   . GLY C  3  29  ? -38.871 14.385  64.939  1.00 105.09 ? 29  GLY C N   1 
ATOM   3988  C CA  . GLY C  3  29  ? -38.591 13.753  63.650  1.00 105.24 ? 29  GLY C CA  1 
ATOM   3989  C C   . GLY C  3  29  ? -38.767 12.245  63.660  1.00 107.97 ? 29  GLY C C   1 
ATOM   3990  O O   . GLY C  3  29  ? -39.062 11.650  64.700  1.00 108.64 ? 29  GLY C O   1 
ATOM   3991  N N   . SER C  3  30  ? -38.578 11.631  62.494  1.00 109.29 ? 30  SER C N   1 
ATOM   3992  C CA  . SER C  3  30  ? -38.739 10.186  62.328  1.00 112.33 ? 30  SER C CA  1 
ATOM   3993  C C   . SER C  3  30  ? -37.651 9.397   63.054  1.00 113.84 ? 30  SER C C   1 
ATOM   3994  O O   . SER C  3  30  ? -36.526 9.876   63.212  1.00 113.56 ? 30  SER C O   1 
ATOM   3995  C CB  . SER C  3  30  ? -38.754 9.817   60.843  1.00 112.74 ? 30  SER C CB  1 
ATOM   3996  O OG  . SER C  3  30  ? -39.824 10.456  60.169  1.00 113.64 ? 30  SER C OG  1 
ATOM   3997  N N   . THR C  3  31  ? -38.001 8.188   63.489  1.00 114.89 ? 31  THR C N   1 
ATOM   3998  C CA  . THR C  3  31  ? -37.089 7.321   64.236  1.00 114.01 ? 31  THR C CA  1 
ATOM   3999  C C   . THR C  3  31  ? -36.004 6.746   63.327  1.00 111.81 ? 31  THR C C   1 
ATOM   4000  O O   . THR C  3  31  ? -36.269 6.395   62.176  1.00 112.29 ? 31  THR C O   1 
ATOM   4001  C CB  . THR C  3  31  ? -37.846 6.162   64.921  1.00 116.79 ? 31  THR C CB  1 
ATOM   4002  O OG1 . THR C  3  31  ? -39.126 6.617   65.377  1.00 119.58 ? 31  THR C OG1 1 
ATOM   4003  C CG2 . THR C  3  31  ? -37.053 5.613   66.105  1.00 114.91 ? 31  THR C CG2 1 
ATOM   4004  N N   . ALA C  3  32  ? -34.784 6.664   63.853  1.00 108.03 ? 32  ALA C N   1 
ATOM   4005  C CA  . ALA C  3  32  ? -33.653 6.084   63.134  1.00 106.37 ? 32  ALA C CA  1 
ATOM   4006  C C   . ALA C  3  32  ? -32.790 5.262   64.085  1.00 103.75 ? 32  ALA C C   1 
ATOM   4007  O O   . ALA C  3  32  ? -32.300 5.779   65.091  1.00 102.62 ? 32  ALA C O   1 
ATOM   4008  C CB  . ALA C  3  32  ? -32.828 7.175   62.468  1.00 105.82 ? 32  ALA C CB  1 
ATOM   4009  N N   . VAL C  3  33  ? -32.617 3.983   63.764  1.00 102.15 ? 33  VAL C N   1 
ATOM   4010  C CA  . VAL C  3  33  ? -31.833 3.069   64.597  1.00 102.39 ? 33  VAL C CA  1 
ATOM   4011  C C   . VAL C  3  33  ? -30.723 2.389   63.788  1.00 101.89 ? 33  VAL C C   1 
ATOM   4012  O O   . VAL C  3  33  ? -30.921 2.024   62.628  1.00 101.72 ? 33  VAL C O   1 
ATOM   4013  C CB  . VAL C  3  33  ? -32.736 2.030   65.319  1.00 104.01 ? 33  VAL C CB  1 
ATOM   4014  C CG1 . VAL C  3  33  ? -33.432 1.106   64.327  1.00 106.30 ? 33  VAL C CG1 1 
ATOM   4015  C CG2 . VAL C  3  33  ? -31.945 1.222   66.340  1.00 105.62 ? 33  VAL C CG2 1 
ATOM   4016  N N   . GLY C  3  34  ? -29.556 2.241   64.409  1.00 102.22 ? 34  GLY C N   1 
ATOM   4017  C CA  . GLY C  3  34  ? -28.418 1.566   63.792  1.00 102.52 ? 34  GLY C CA  1 
ATOM   4018  C C   . GLY C  3  34  ? -27.685 0.683   64.782  1.00 103.84 ? 34  GLY C C   1 
ATOM   4019  O O   . GLY C  3  34  ? -27.421 1.097   65.913  1.00 102.95 ? 34  GLY C O   1 
ATOM   4020  N N   . VAL C  3  35  ? -27.367 -0.538  64.359  1.00 107.13 ? 35  VAL C N   1 
ATOM   4021  C CA  . VAL C  3  35  ? -26.633 -1.490  65.202  1.00 110.61 ? 35  VAL C CA  1 
ATOM   4022  C C   . VAL C  3  35  ? -25.299 -1.896  64.571  1.00 113.21 ? 35  VAL C C   1 
ATOM   4023  O O   . VAL C  3  35  ? -25.145 -1.867  63.347  1.00 112.33 ? 35  VAL C O   1 
ATOM   4024  C CB  . VAL C  3  35  ? -27.468 -2.754  65.544  1.00 112.19 ? 35  VAL C CB  1 
ATOM   4025  C CG1 . VAL C  3  35  ? -28.766 -2.379  66.247  1.00 111.49 ? 35  VAL C CG1 1 
ATOM   4026  C CG2 . VAL C  3  35  ? -27.749 -3.589  64.302  1.00 113.22 ? 35  VAL C CG2 1 
ATOM   4027  N N   . ARG C  3  36  ? -24.342 -2.270  65.417  1.00 115.71 ? 36  ARG C N   1 
ATOM   4028  C CA  . ARG C  3  36  ? -23.024 -2.707  64.966  1.00 117.77 ? 36  ARG C CA  1 
ATOM   4029  C C   . ARG C  3  36  ? -22.890 -4.223  65.100  1.00 122.12 ? 36  ARG C C   1 
ATOM   4030  O O   . ARG C  3  36  ? -23.103 -4.780  66.180  1.00 121.63 ? 36  ARG C O   1 
ATOM   4031  C CB  . ARG C  3  36  ? -21.926 -1.993  65.761  1.00 117.22 ? 36  ARG C CB  1 
ATOM   4032  C CG  . ARG C  3  36  ? -20.520 -2.173  65.206  1.00 120.00 ? 36  ARG C CG  1 
ATOM   4033  C CD  . ARG C  3  36  ? -19.482 -1.478  66.075  1.00 123.02 ? 36  ARG C CD  1 
ATOM   4034  N NE  . ARG C  3  36  ? -19.300 -2.143  67.366  1.00 125.24 ? 36  ARG C NE  1 
ATOM   4035  C CZ  . ARG C  3  36  ? -18.468 -1.732  68.320  1.00 125.72 ? 36  ARG C CZ  1 
ATOM   4036  N NH1 . ARG C  3  36  ? -17.725 -0.645  68.147  1.00 125.35 ? 36  ARG C NH1 1 
ATOM   4037  N NH2 . ARG C  3  36  ? -18.380 -2.411  69.455  1.00 123.28 ? 36  ARG C NH2 1 
ATOM   4038  N N   . GLY C  3  37  ? -22.541 -4.879  63.997  1.00 127.53 ? 37  GLY C N   1 
ATOM   4039  C CA  . GLY C  3  37  ? -22.381 -6.332  63.971  1.00 133.61 ? 37  GLY C CA  1 
ATOM   4040  C C   . GLY C  3  37  ? -20.929 -6.772  63.944  1.00 139.81 ? 37  GLY C C   1 
ATOM   4041  O O   . GLY C  3  37  ? -20.032 -6.006  64.305  1.00 139.99 ? 37  GLY C O   1 
ATOM   4042  N N   . LYS C  3  38  ? -20.702 -8.011  63.514  1.00 145.52 ? 38  LYS C N   1 
ATOM   4043  C CA  . LYS C  3  38  ? -19.354 -8.573  63.425  1.00 149.74 ? 38  LYS C CA  1 
ATOM   4044  C C   . LYS C  3  38  ? -18.659 -8.194  62.118  1.00 147.97 ? 38  LYS C C   1 
ATOM   4045  O O   . LYS C  3  38  ? -17.496 -7.785  62.124  1.00 146.31 ? 38  LYS C O   1 
ATOM   4046  C CB  . LYS C  3  38  ? -19.384 -10.096 63.586  1.00 154.35 ? 38  LYS C CB  1 
ATOM   4047  C CG  . LYS C  3  38  ? -19.583 -10.571 65.017  1.00 157.62 ? 38  LYS C CG  1 
ATOM   4048  C CD  . LYS C  3  38  ? -19.509 -12.086 65.112  1.00 162.46 ? 38  LYS C CD  1 
ATOM   4049  C CE  . LYS C  3  38  ? -19.678 -12.557 66.548  1.00 165.27 ? 38  LYS C CE  1 
ATOM   4050  N NZ  . LYS C  3  38  ? -19.584 -14.038 66.669  1.00 168.39 ? 38  LYS C NZ  1 
ATOM   4051  N N   . ASP C  3  39  ? -19.376 -8.333  61.005  1.00 149.10 ? 39  ASP C N   1 
ATOM   4052  C CA  . ASP C  3  39  ? -18.825 -8.044  59.682  1.00 151.70 ? 39  ASP C CA  1 
ATOM   4053  C C   . ASP C  3  39  ? -19.562 -6.919  58.955  1.00 147.98 ? 39  ASP C C   1 
ATOM   4054  O O   . ASP C  3  39  ? -18.998 -6.280  58.065  1.00 145.62 ? 39  ASP C O   1 
ATOM   4055  C CB  . ASP C  3  39  ? -18.809 -9.309  58.815  1.00 156.18 ? 39  ASP C CB  1 
ATOM   4056  C CG  . ASP C  3  39  ? -17.801 -10.341 59.297  1.00 160.27 ? 39  ASP C CG  1 
ATOM   4057  O OD1 . ASP C  3  39  ? -16.703 -9.953  59.753  1.00 162.23 ? 39  ASP C OD1 1 
ATOM   4058  O OD2 . ASP C  3  39  ? -18.105 -11.549 59.208  1.00 162.45 ? 39  ASP C OD2 1 
ATOM   4059  N N   . ILE C  3  40  ? -20.820 -6.689  59.330  1.00 142.97 ? 40  ILE C N   1 
ATOM   4060  C CA  . ILE C  3  40  ? -21.640 -5.648  58.699  1.00 138.90 ? 40  ILE C CA  1 
ATOM   4061  C C   . ILE C  3  40  ? -22.290 -4.702  59.712  1.00 133.30 ? 40  ILE C C   1 
ATOM   4062  O O   . ILE C  3  40  ? -22.684 -5.117  60.804  1.00 133.30 ? 40  ILE C O   1 
ATOM   4063  C CB  . ILE C  3  40  ? -22.724 -6.235  57.757  1.00 138.84 ? 40  ILE C CB  1 
ATOM   4064  C CG1 . ILE C  3  40  ? -23.660 -7.196  58.504  1.00 138.65 ? 40  ILE C CG1 1 
ATOM   4065  C CG2 . ILE C  3  40  ? -22.079 -6.920  56.559  1.00 142.28 ? 40  ILE C CG2 1 
ATOM   4066  C CD1 . ILE C  3  40  ? -24.986 -7.428  57.810  1.00 138.43 ? 40  ILE C CD1 1 
ATOM   4067  N N   . VAL C  3  41  ? -22.384 -3.428  59.335  1.00 125.63 ? 41  VAL C N   1 
ATOM   4068  C CA  . VAL C  3  41  ? -23.069 -2.418  60.142  1.00 117.57 ? 41  VAL C CA  1 
ATOM   4069  C C   . VAL C  3  41  ? -24.318 -1.959  59.391  1.00 112.83 ? 41  VAL C C   1 
ATOM   4070  O O   . VAL C  3  41  ? -24.242 -1.574  58.221  1.00 112.27 ? 41  VAL C O   1 
ATOM   4071  C CB  . VAL C  3  41  ? -22.165 -1.204  60.456  1.00 113.95 ? 41  VAL C CB  1 
ATOM   4072  C CG1 . VAL C  3  41  ? -22.762 -0.373  61.582  1.00 110.37 ? 41  VAL C CG1 1 
ATOM   4073  C CG2 . VAL C  3  41  ? -20.761 -1.651  60.833  1.00 116.40 ? 41  VAL C CG2 1 
ATOM   4074  N N   . VAL C  3  42  ? -25.461 -2.008  60.070  1.00 109.11 ? 42  VAL C N   1 
ATOM   4075  C CA  . VAL C  3  42  ? -26.752 -1.725  59.439  1.00 106.56 ? 42  VAL C CA  1 
ATOM   4076  C C   . VAL C  3  42  ? -27.561 -0.662  60.189  1.00 106.19 ? 42  VAL C C   1 
ATOM   4077  O O   . VAL C  3  42  ? -27.749 -0.748  61.405  1.00 106.83 ? 42  VAL C O   1 
ATOM   4078  C CB  . VAL C  3  42  ? -27.581 -3.024  59.226  1.00 106.50 ? 42  VAL C CB  1 
ATOM   4079  C CG1 . VAL C  3  42  ? -27.580 -3.898  60.475  1.00 108.34 ? 42  VAL C CG1 1 
ATOM   4080  C CG2 . VAL C  3  42  ? -29.004 -2.713  58.774  1.00 106.22 ? 42  VAL C CG2 1 
ATOM   4081  N N   . LEU C  3  43  ? -28.021 0.343   59.446  1.00 104.46 ? 43  LEU C N   1 
ATOM   4082  C CA  . LEU C  3  43  ? -28.930 1.361   59.974  1.00 102.54 ? 43  LEU C CA  1 
ATOM   4083  C C   . LEU C  3  43  ? -30.277 1.349   59.249  1.00 101.91 ? 43  LEU C C   1 
ATOM   4084  O O   . LEU C  3  43  ? -30.355 1.001   58.069  1.00 102.01 ? 43  LEU C O   1 
ATOM   4085  C CB  . LEU C  3  43  ? -28.296 2.762   59.935  1.00 99.24  ? 43  LEU C CB  1 
ATOM   4086  C CG  . LEU C  3  43  ? -27.320 3.212   58.838  1.00 96.76  ? 43  LEU C CG  1 
ATOM   4087  C CD1 . LEU C  3  43  ? -27.955 3.256   57.456  1.00 98.30  ? 43  LEU C CD1 1 
ATOM   4088  C CD2 . LEU C  3  43  ? -26.761 4.578   59.198  1.00 95.11  ? 43  LEU C CD2 1 
ATOM   4089  N N   . GLY C  3  44  ? -31.332 1.727   59.969  1.00 102.51 ? 44  GLY C N   1 
ATOM   4090  C CA  . GLY C  3  44  ? -32.687 1.750   59.421  1.00 103.58 ? 44  GLY C CA  1 
ATOM   4091  C C   . GLY C  3  44  ? -33.552 2.849   60.008  1.00 104.14 ? 44  GLY C C   1 
ATOM   4092  O O   . GLY C  3  44  ? -33.364 3.251   61.159  1.00 104.12 ? 44  GLY C O   1 
ATOM   4093  N N   . VAL C  3  45  ? -34.505 3.329   59.213  1.00 107.21 ? 45  VAL C N   1 
ATOM   4094  C CA  . VAL C  3  45  ? -35.403 4.409   59.633  1.00 110.58 ? 45  VAL C CA  1 
ATOM   4095  C C   . VAL C  3  45  ? -36.857 3.954   59.774  1.00 114.13 ? 45  VAL C C   1 
ATOM   4096  O O   . VAL C  3  45  ? -37.365 3.192   58.947  1.00 115.11 ? 45  VAL C O   1 
ATOM   4097  C CB  . VAL C  3  45  ? -35.318 5.644   58.700  1.00 111.59 ? 45  VAL C CB  1 
ATOM   4098  C CG1 . VAL C  3  45  ? -34.019 6.403   58.930  1.00 110.05 ? 45  VAL C CG1 1 
ATOM   4099  C CG2 . VAL C  3  45  ? -35.461 5.251   57.233  1.00 113.40 ? 45  VAL C CG2 1 
ATOM   4100  N N   . GLU C  3  46  ? -37.511 4.425   60.834  1.00 118.32 ? 46  GLU C N   1 
ATOM   4101  C CA  . GLU C  3  46  ? -38.915 4.113   61.099  1.00 126.39 ? 46  GLU C CA  1 
ATOM   4102  C C   . GLU C  3  46  ? -39.801 5.341   60.914  1.00 133.45 ? 46  GLU C C   1 
ATOM   4103  O O   . GLU C  3  46  ? -39.299 6.453   60.726  1.00 132.28 ? 46  GLU C O   1 
ATOM   4104  C CB  . GLU C  3  46  ? -39.080 3.544   62.501  1.00 129.14 ? 46  GLU C CB  1 
ATOM   4105  N N   . LYS C  3  47  ? -41.116 5.126   60.981  1.00 139.83 ? 47  LYS C N   1 
ATOM   4106  C CA  . LYS C  3  47  ? -42.123 6.166   60.741  1.00 144.33 ? 47  LYS C CA  1 
ATOM   4107  C C   . LYS C  3  47  ? -41.858 6.974   59.471  1.00 146.51 ? 47  LYS C C   1 
ATOM   4108  O O   . LYS C  3  47  ? -41.638 8.189   59.524  1.00 147.78 ? 47  LYS C O   1 
ATOM   4109  C CB  . LYS C  3  47  ? -42.292 7.090   61.956  1.00 143.34 ? 47  LYS C CB  1 
ATOM   4110  C CG  . LYS C  3  47  ? -43.425 6.691   62.889  1.00 144.09 ? 47  LYS C CG  1 
ATOM   4111  C CD  . LYS C  3  47  ? -42.919 6.030   64.162  1.00 143.65 ? 47  LYS C CD  1 
ATOM   4112  C CE  . LYS C  3  47  ? -42.529 7.063   65.211  1.00 142.27 ? 47  LYS C CE  1 
ATOM   4113  N NZ  . LYS C  3  47  ? -43.681 7.917   65.621  1.00 142.04 ? 47  LYS C NZ  1 
ATOM   4114  N N   . LYS C  3  48  ? -41.871 6.282   58.335  1.00 146.94 ? 48  LYS C N   1 
ATOM   4115  C CA  . LYS C  3  48  ? -41.757 6.929   57.033  1.00 144.47 ? 48  LYS C CA  1 
ATOM   4116  C C   . LYS C  3  48  ? -43.008 7.756   56.753  1.00 150.12 ? 48  LYS C C   1 
ATOM   4117  O O   . LYS C  3  48  ? -42.915 8.878   56.248  1.00 151.52 ? 48  LYS C O   1 
ATOM   4118  C CB  . LYS C  3  48  ? -41.542 5.889   55.931  1.00 137.26 ? 48  LYS C CB  1 
ATOM   4119  C CG  . LYS C  3  48  ? -40.157 5.252   55.925  1.00 132.37 ? 48  LYS C CG  1 
ATOM   4120  C CD  . LYS C  3  48  ? -39.131 6.095   55.174  1.00 129.89 ? 48  LYS C CD  1 
ATOM   4121  C CE  . LYS C  3  48  ? -39.272 5.960   53.664  1.00 130.74 ? 48  LYS C CE  1 
ATOM   4122  N NZ  . LYS C  3  48  ? -39.014 4.570   53.193  1.00 133.37 ? 48  LYS C NZ  1 
ATOM   4123  N N   . SER C  3  49  ? -44.168 7.191   57.098  1.00 151.51 ? 49  SER C N   1 
ATOM   4124  C CA  . SER C  3  49  ? -45.472 7.854   56.972  1.00 153.91 ? 49  SER C CA  1 
ATOM   4125  C C   . SER C  3  49  ? -45.699 8.483   55.591  1.00 153.09 ? 49  SER C C   1 
ATOM   4126  O O   . SER C  3  49  ? -46.357 9.520   55.466  1.00 153.45 ? 49  SER C O   1 
ATOM   4127  C CB  . SER C  3  49  ? -45.662 8.889   58.091  1.00 153.90 ? 49  SER C CB  1 
ATOM   4128  O OG  . SER C  3  49  ? -46.979 9.409   58.097  1.00 155.34 ? 49  SER C OG  1 
ATOM   4129  N N   . VAL C  3  50  ? -45.147 7.841   54.563  1.00 151.43 ? 50  VAL C N   1 
ATOM   4130  C CA  . VAL C  3  50  ? -45.280 8.300   53.183  1.00 148.69 ? 50  VAL C CA  1 
ATOM   4131  C C   . VAL C  3  50  ? -46.705 8.034   52.704  1.00 148.18 ? 50  VAL C C   1 
ATOM   4132  O O   . VAL C  3  50  ? -47.251 6.949   52.925  1.00 150.26 ? 50  VAL C O   1 
ATOM   4133  C CB  . VAL C  3  50  ? -44.259 7.608   52.247  1.00 147.68 ? 50  VAL C CB  1 
ATOM   4134  C CG1 . VAL C  3  50  ? -44.300 8.214   50.850  1.00 145.97 ? 50  VAL C CG1 1 
ATOM   4135  C CG2 . VAL C  3  50  ? -42.850 7.711   52.817  1.00 146.08 ? 50  VAL C CG2 1 
ATOM   4136  N N   . ALA C  3  51  ? -47.298 9.033   52.053  1.00 144.32 ? 51  ALA C N   1 
ATOM   4137  C CA  . ALA C  3  51  ? -48.682 8.961   51.582  1.00 143.81 ? 51  ALA C CA  1 
ATOM   4138  C C   . ALA C  3  51  ? -48.888 7.960   50.438  1.00 144.42 ? 51  ALA C C   1 
ATOM   4139  O O   . ALA C  3  51  ? -49.986 7.873   49.878  1.00 144.35 ? 51  ALA C O   1 
ATOM   4140  C CB  . ALA C  3  51  ? -49.169 10.347  51.176  1.00 141.99 ? 51  ALA C CB  1 
ATOM   4141  N N   . LYS C  3  52  ? -47.832 7.214   50.103  1.00 144.47 ? 52  LYS C N   1 
ATOM   4142  C CA  . LYS C  3  52  ? -47.840 6.214   49.022  1.00 145.05 ? 52  LYS C CA  1 
ATOM   4143  C C   . LYS C  3  52  ? -48.003 6.855   47.638  1.00 142.66 ? 52  LYS C C   1 
ATOM   4144  O O   . LYS C  3  52  ? -47.733 6.227   46.611  1.00 141.81 ? 52  LYS C O   1 
ATOM   4145  C CB  . LYS C  3  52  ? -48.913 5.141   49.270  1.00 145.84 ? 52  LYS C CB  1 
ATOM   4146  C CG  . LYS C  3  52  ? -48.683 3.818   48.553  1.00 145.95 ? 52  LYS C CG  1 
ATOM   4147  C CD  . LYS C  3  52  ? -47.582 3.002   49.211  1.00 143.20 ? 52  LYS C CD  1 
ATOM   4148  C CE  . LYS C  3  52  ? -47.336 1.712   48.450  1.00 141.01 ? 52  LYS C CE  1 
ATOM   4149  N NZ  . LYS C  3  52  ? -46.232 0.917   49.052  1.00 139.41 ? 52  LYS C NZ  1 
ATOM   4150  N N   . LEU C  3  53  ? -48.435 8.114   47.633  1.00 138.04 ? 53  LEU C N   1 
ATOM   4151  C CA  . LEU C  3  53  ? -48.625 8.895   46.419  1.00 131.60 ? 53  LEU C CA  1 
ATOM   4152  C C   . LEU C  3  53  ? -47.402 9.786   46.180  1.00 131.34 ? 53  LEU C C   1 
ATOM   4153  O O   . LEU C  3  53  ? -47.438 10.721  45.375  1.00 128.57 ? 53  LEU C O   1 
ATOM   4154  C CB  . LEU C  3  53  ? -49.895 9.740   46.557  1.00 123.35 ? 53  LEU C CB  1 
ATOM   4155  C CG  . LEU C  3  53  ? -50.721 10.098  45.320  1.00 116.27 ? 53  LEU C CG  1 
ATOM   4156  C CD1 . LEU C  3  53  ? -51.335 8.861   44.681  1.00 117.42 ? 53  LEU C CD1 1 
ATOM   4157  C CD2 . LEU C  3  53  ? -51.807 11.089  45.706  1.00 110.92 ? 53  LEU C CD2 1 
ATOM   4158  N N   . GLN C  3  54  ? -46.318 9.469   46.886  1.00 131.90 ? 54  GLN C N   1 
ATOM   4159  C CA  . GLN C  3  54  ? -45.070 10.220  46.828  1.00 130.07 ? 54  GLN C CA  1 
ATOM   4160  C C   . GLN C  3  54  ? -43.915 9.277   46.497  1.00 127.87 ? 54  GLN C C   1 
ATOM   4161  O O   . GLN C  3  54  ? -43.854 8.158   47.015  1.00 127.74 ? 54  GLN C O   1 
ATOM   4162  C CB  . GLN C  3  54  ? -44.824 10.909  48.174  1.00 129.55 ? 54  GLN C CB  1 
ATOM   4163  C CG  . GLN C  3  54  ? -43.675 11.908  48.190  1.00 127.83 ? 54  GLN C CG  1 
ATOM   4164  C CD  . GLN C  3  54  ? -43.422 12.508  49.562  1.00 129.97 ? 54  GLN C CD  1 
ATOM   4165  O OE1 . GLN C  3  54  ? -43.895 11.997  50.579  1.00 130.03 ? 54  GLN C OE1 1 
ATOM   4166  N NE2 . GLN C  3  54  ? -42.666 13.599  49.596  1.00 127.56 ? 54  GLN C NE2 1 
ATOM   4167  N N   . ASP C  3  55  ? -43.009 9.731   45.631  1.00 123.31 ? 55  ASP C N   1 
ATOM   4168  C CA  . ASP C  3  55  ? -41.827 8.955   45.255  1.00 122.55 ? 55  ASP C CA  1 
ATOM   4169  C C   . ASP C  3  55  ? -40.897 8.810   46.458  1.00 124.59 ? 55  ASP C C   1 
ATOM   4170  O O   . ASP C  3  55  ? -40.449 9.805   47.034  1.00 124.83 ? 55  ASP C O   1 
ATOM   4171  C CB  . ASP C  3  55  ? -41.097 9.614   44.078  1.00 120.06 ? 55  ASP C CB  1 
ATOM   4172  C CG  . ASP C  3  55  ? -40.195 8.647   43.317  1.00 120.65 ? 55  ASP C CG  1 
ATOM   4173  O OD1 . ASP C  3  55  ? -39.682 7.678   43.918  1.00 122.13 ? 55  ASP C OD1 1 
ATOM   4174  O OD2 . ASP C  3  55  ? -39.992 8.868   42.104  1.00 121.89 ? 55  ASP C OD2 1 
ATOM   4175  N N   . GLU C  3  56  ? -40.619 7.563   46.829  1.00 126.55 ? 56  GLU C N   1 
ATOM   4176  C CA  . GLU C  3  56  ? -39.835 7.252   48.027  1.00 127.53 ? 56  GLU C CA  1 
ATOM   4177  C C   . GLU C  3  56  ? -38.325 7.240   47.770  1.00 122.56 ? 56  GLU C C   1 
ATOM   4178  O O   . GLU C  3  56  ? -37.545 6.823   48.630  1.00 123.18 ? 56  GLU C O   1 
ATOM   4179  C CB  . GLU C  3  56  ? -40.288 5.916   48.627  1.00 134.87 ? 56  GLU C CB  1 
ATOM   4180  C CG  . GLU C  3  56  ? -41.712 5.925   49.167  1.00 142.55 ? 56  GLU C CG  1 
ATOM   4181  C CD  . GLU C  3  56  ? -42.185 4.558   49.634  1.00 149.46 ? 56  GLU C CD  1 
ATOM   4182  O OE1 . GLU C  3  56  ? -41.703 3.534   49.102  1.00 152.29 ? 56  GLU C OE1 1 
ATOM   4183  O OE2 . GLU C  3  56  ? -43.050 4.506   50.533  1.00 151.80 ? 56  GLU C OE2 1 
ATOM   4184  N N   . ARG C  3  57  ? -37.924 7.705   46.589  1.00 114.60 ? 57  ARG C N   1 
ATOM   4185  C CA  . ARG C  3  57  ? -36.514 7.792   46.217  1.00 108.63 ? 57  ARG C CA  1 
ATOM   4186  C C   . ARG C  3  57  ? -35.910 9.117   46.682  1.00 104.03 ? 57  ARG C C   1 
ATOM   4187  O O   . ARG C  3  57  ? -34.704 9.208   46.919  1.00 102.44 ? 57  ARG C O   1 
ATOM   4188  C CB  . ARG C  3  57  ? -36.359 7.627   44.702  1.00 105.43 ? 57  ARG C CB  1 
ATOM   4189  C CG  . ARG C  3  57  ? -35.010 7.081   44.252  1.00 104.51 ? 57  ARG C CG  1 
ATOM   4190  C CD  . ARG C  3  57  ? -34.075 8.168   43.739  1.00 101.22 ? 57  ARG C CD  1 
ATOM   4191  N NE  . ARG C  3  57  ? -34.512 8.708   42.451  1.00 99.19  ? 57  ARG C NE  1 
ATOM   4192  C CZ  . ARG C  3  57  ? -34.933 9.955   42.255  1.00 98.12  ? 57  ARG C CZ  1 
ATOM   4193  N NH1 . ARG C  3  57  ? -34.965 10.821  43.259  1.00 97.35  ? 57  ARG C NH1 1 
ATOM   4194  N NH2 . ARG C  3  57  ? -35.312 10.343  41.045  1.00 97.02  ? 57  ARG C NH2 1 
ATOM   4195  N N   . THR C  3  58  ? -36.761 10.132  46.817  1.00 101.02 ? 58  THR C N   1 
ATOM   4196  C CA  . THR C  3  58  ? -36.338 11.475  47.218  1.00 97.93  ? 58  THR C CA  1 
ATOM   4197  C C   . THR C  3  58  ? -36.286 11.654  48.735  1.00 98.21  ? 58  THR C C   1 
ATOM   4198  O O   . THR C  3  58  ? -35.479 12.435  49.244  1.00 98.34  ? 58  THR C O   1 
ATOM   4199  C CB  . THR C  3  58  ? -37.261 12.561  46.627  1.00 95.06  ? 58  THR C CB  1 
ATOM   4200  O OG1 . THR C  3  58  ? -38.624 12.268  46.961  1.00 94.81  ? 58  THR C OG1 1 
ATOM   4201  C CG2 . THR C  3  58  ? -37.119 12.631  45.113  1.00 92.87  ? 58  THR C CG2 1 
ATOM   4202  N N   . VAL C  3  59  ? -37.144 10.928  49.448  1.00 98.30  ? 59  VAL C N   1 
ATOM   4203  C CA  . VAL C  3  59  ? -37.285 11.090  50.898  1.00 98.38  ? 59  VAL C CA  1 
ATOM   4204  C C   . VAL C  3  59  ? -36.432 10.079  51.679  1.00 98.70  ? 59  VAL C C   1 
ATOM   4205  O O   . VAL C  3  59  ? -36.700 9.797   52.851  1.00 99.84  ? 59  VAL C O   1 
ATOM   4206  C CB  . VAL C  3  59  ? -38.768 11.015  51.343  1.00 99.58  ? 59  VAL C CB  1 
ATOM   4207  C CG1 . VAL C  3  59  ? -38.993 11.846  52.598  1.00 100.29 ? 59  VAL C CG1 1 
ATOM   4208  C CG2 . VAL C  3  59  ? -39.694 11.500  50.236  1.00 100.65 ? 59  VAL C CG2 1 
ATOM   4209  N N   . ARG C  3  60  ? -35.401 9.543   51.026  1.00 99.71  ? 60  ARG C N   1 
ATOM   4210  C CA  . ARG C  3  60  ? -34.486 8.596   51.666  1.00 101.32 ? 60  ARG C CA  1 
ATOM   4211  C C   . ARG C  3  60  ? -33.573 9.299   52.668  1.00 100.03 ? 60  ARG C C   1 
ATOM   4212  O O   . ARG C  3  60  ? -32.825 10.213  52.308  1.00 101.18 ? 60  ARG C O   1 
ATOM   4213  C CB  . ARG C  3  60  ? -33.657 7.835   50.625  1.00 104.21 ? 60  ARG C CB  1 
ATOM   4214  C CG  . ARG C  3  60  ? -34.425 6.755   49.879  1.00 109.46 ? 60  ARG C CG  1 
ATOM   4215  C CD  . ARG C  3  60  ? -33.504 5.642   49.403  1.00 112.26 ? 60  ARG C CD  1 
ATOM   4216  N NE  . ARG C  3  60  ? -32.715 6.021   48.232  1.00 113.99 ? 60  ARG C NE  1 
ATOM   4217  C CZ  . ARG C  3  60  ? -32.976 5.632   46.986  1.00 115.68 ? 60  ARG C CZ  1 
ATOM   4218  N NH1 . ARG C  3  60  ? -34.009 4.839   46.728  1.00 115.11 ? 60  ARG C NH1 1 
ATOM   4219  N NH2 . ARG C  3  60  ? -32.195 6.033   45.992  1.00 116.00 ? 60  ARG C NH2 1 
ATOM   4220  N N   . LYS C  3  61  ? -33.649 8.867   53.925  1.00 97.84  ? 61  LYS C N   1 
ATOM   4221  C CA  . LYS C  3  61  ? -32.861 9.458   55.008  1.00 95.10  ? 61  LYS C CA  1 
ATOM   4222  C C   . LYS C  3  61  ? -31.449 8.881   55.095  1.00 95.08  ? 61  LYS C C   1 
ATOM   4223  O O   . LYS C  3  61  ? -30.564 9.479   55.711  1.00 96.44  ? 61  LYS C O   1 
ATOM   4224  C CB  . LYS C  3  61  ? -33.585 9.304   56.349  1.00 94.17  ? 61  LYS C CB  1 
ATOM   4225  C CG  . LYS C  3  61  ? -34.784 10.224  56.512  1.00 95.19  ? 61  LYS C CG  1 
ATOM   4226  C CD  . LYS C  3  61  ? -35.430 10.062  57.879  1.00 98.09  ? 61  LYS C CD  1 
ATOM   4227  C CE  . LYS C  3  61  ? -36.542 11.077  58.094  1.00 101.28 ? 61  LYS C CE  1 
ATOM   4228  N NZ  . LYS C  3  61  ? -37.722 10.836  57.217  1.00 102.50 ? 61  LYS C NZ  1 
ATOM   4229  N N   . ILE C  3  62  ? -31.248 7.716   54.481  1.00 95.51  ? 62  ILE C N   1 
ATOM   4230  C CA  . ILE C  3  62  ? -29.930 7.092   54.418  1.00 96.06  ? 62  ILE C CA  1 
ATOM   4231  C C   . ILE C  3  62  ? -29.133 7.714   53.271  1.00 95.61  ? 62  ILE C C   1 
ATOM   4232  O O   . ILE C  3  62  ? -29.495 7.575   52.100  1.00 94.67  ? 62  ILE C O   1 
ATOM   4233  C CB  . ILE C  3  62  ? -30.015 5.554   54.251  1.00 98.14  ? 62  ILE C CB  1 
ATOM   4234  C CG1 . ILE C  3  62  ? -30.756 4.908   55.429  1.00 100.15 ? 62  ILE C CG1 1 
ATOM   4235  C CG2 . ILE C  3  62  ? -28.625 4.943   54.127  1.00 98.33  ? 62  ILE C CG2 1 
ATOM   4236  C CD1 . ILE C  3  62  ? -32.229 4.653   55.179  1.00 102.48 ? 62  ILE C CD1 1 
ATOM   4237  N N   . CYS C  3  63  ? -28.057 8.411   53.626  1.00 95.61  ? 63  CYS C N   1 
ATOM   4238  C CA  . CYS C  3  63  ? -27.203 9.081   52.650  1.00 95.77  ? 63  CYS C CA  1 
ATOM   4239  C C   . CYS C  3  63  ? -25.739 8.706   52.851  1.00 93.48  ? 63  CYS C C   1 
ATOM   4240  O O   . CYS C  3  63  ? -25.221 8.769   53.968  1.00 93.22  ? 63  CYS C O   1 
ATOM   4241  C CB  . CYS C  3  63  ? -27.375 10.600  52.737  1.00 97.78  ? 63  CYS C CB  1 
ATOM   4242  S SG  . CYS C  3  63  ? -29.037 11.195  52.348  1.00 100.74 ? 63  CYS C SG  1 
ATOM   4243  N N   . ALA C  3  64  ? -25.082 8.314   51.763  1.00 93.14  ? 64  ALA C N   1 
ATOM   4244  C CA  . ALA C  3  64  ? -23.671 7.948   51.801  1.00 94.91  ? 64  ALA C CA  1 
ATOM   4245  C C   . ALA C  3  64  ? -22.787 9.178   51.626  1.00 95.18  ? 64  ALA C C   1 
ATOM   4246  O O   . ALA C  3  64  ? -22.899 9.899   50.631  1.00 95.91  ? 64  ALA C O   1 
ATOM   4247  C CB  . ALA C  3  64  ? -23.362 6.904   50.738  1.00 95.57  ? 64  ALA C CB  1 
ATOM   4248  N N   . LEU C  3  65  ? -21.919 9.415   52.607  1.00 93.79  ? 65  LEU C N   1 
ATOM   4249  C CA  . LEU C  3  65  ? -20.996 10.548  52.576  1.00 92.99  ? 65  LEU C CA  1 
ATOM   4250  C C   . LEU C  3  65  ? -19.779 10.242  51.706  1.00 95.88  ? 65  LEU C C   1 
ATOM   4251  O O   . LEU C  3  65  ? -19.309 11.102  50.960  1.00 94.23  ? 65  LEU C O   1 
ATOM   4252  C CB  . LEU C  3  65  ? -20.558 10.932  53.994  1.00 89.88  ? 65  LEU C CB  1 
ATOM   4253  C CG  . LEU C  3  65  ? -21.632 11.296  55.028  1.00 87.92  ? 65  LEU C CG  1 
ATOM   4254  C CD1 . LEU C  3  65  ? -21.010 11.443  56.408  1.00 86.62  ? 65  LEU C CD1 1 
ATOM   4255  C CD2 . LEU C  3  65  ? -22.390 12.560  54.644  1.00 87.59  ? 65  LEU C CD2 1 
ATOM   4256  N N   . ASP C  3  66  ? -19.279 9.014   51.815  1.00 100.18 ? 66  ASP C N   1 
ATOM   4257  C CA  . ASP C  3  66  ? -18.160 8.541   51.005  1.00 106.16 ? 66  ASP C CA  1 
ATOM   4258  C C   . ASP C  3  66  ? -18.393 7.081   50.601  1.00 110.08 ? 66  ASP C C   1 
ATOM   4259  O O   . ASP C  3  66  ? -19.475 6.535   50.835  1.00 109.21 ? 66  ASP C O   1 
ATOM   4260  C CB  . ASP C  3  66  ? -16.840 8.700   51.771  1.00 109.09 ? 66  ASP C CB  1 
ATOM   4261  C CG  . ASP C  3  66  ? -15.639 8.887   50.852  1.00 112.76 ? 66  ASP C CG  1 
ATOM   4262  O OD1 . ASP C  3  66  ? -14.543 9.192   51.368  1.00 112.60 ? 66  ASP C OD1 1 
ATOM   4263  O OD2 . ASP C  3  66  ? -15.781 8.732   49.619  1.00 114.33 ? 66  ASP C OD2 1 
ATOM   4264  N N   . ASP C  3  67  ? -17.382 6.460   49.994  1.00 113.29 ? 67  ASP C N   1 
ATOM   4265  C CA  . ASP C  3  67  ? -17.460 5.063   49.559  1.00 117.49 ? 67  ASP C CA  1 
ATOM   4266  C C   . ASP C  3  67  ? -17.594 4.089   50.730  1.00 118.92 ? 67  ASP C C   1 
ATOM   4267  O O   . ASP C  3  67  ? -18.189 3.018   50.588  1.00 121.61 ? 67  ASP C O   1 
ATOM   4268  C CB  . ASP C  3  67  ? -16.237 4.694   48.711  1.00 117.96 ? 67  ASP C CB  1 
ATOM   4269  C CG  . ASP C  3  67  ? -16.178 5.459   47.399  1.00 117.38 ? 67  ASP C CG  1 
ATOM   4270  O OD1 . ASP C  3  67  ? -17.214 5.556   46.706  1.00 118.41 ? 67  ASP C OD1 1 
ATOM   4271  O OD2 . ASP C  3  67  ? -15.085 5.955   47.052  1.00 118.63 ? 67  ASP C OD2 1 
ATOM   4272  N N   . ASN C  3  68  ? -17.042 4.468   51.880  1.00 115.77 ? 68  ASN C N   1 
ATOM   4273  C CA  . ASN C  3  68  ? -17.077 3.630   53.077  1.00 114.48 ? 68  ASN C CA  1 
ATOM   4274  C C   . ASN C  3  68  ? -17.838 4.252   54.253  1.00 107.44 ? 68  ASN C C   1 
ATOM   4275  O O   . ASN C  3  68  ? -17.894 3.668   55.336  1.00 107.50 ? 68  ASN C O   1 
ATOM   4276  C CB  . ASN C  3  68  ? -15.653 3.244   53.503  1.00 116.75 ? 68  ASN C CB  1 
ATOM   4277  C CG  . ASN C  3  68  ? -14.812 4.444   53.907  1.00 117.38 ? 68  ASN C CG  1 
ATOM   4278  O OD1 . ASN C  3  68  ? -14.824 5.484   53.245  1.00 115.96 ? 68  ASN C OD1 1 
ATOM   4279  N ND2 . ASN C  3  68  ? -14.067 4.300   54.997  1.00 119.56 ? 68  ASN C ND2 1 
ATOM   4280  N N   . VAL C  3  69  ? -18.419 5.431   54.034  1.00 99.96  ? 69  VAL C N   1 
ATOM   4281  C CA  . VAL C  3  69  ? -19.149 6.150   55.084  1.00 94.13  ? 69  VAL C CA  1 
ATOM   4282  C C   . VAL C  3  69  ? -20.573 6.491   54.640  1.00 91.63  ? 69  VAL C C   1 
ATOM   4283  O O   . VAL C  3  69  ? -20.781 7.040   53.556  1.00 92.39  ? 69  VAL C O   1 
ATOM   4284  C CB  . VAL C  3  69  ? -18.413 7.442   55.523  1.00 92.01  ? 69  VAL C CB  1 
ATOM   4285  C CG1 . VAL C  3  69  ? -19.121 8.098   56.701  1.00 90.47  ? 69  VAL C CG1 1 
ATOM   4286  C CG2 . VAL C  3  69  ? -16.963 7.150   55.888  1.00 94.28  ? 69  VAL C CG2 1 
ATOM   4287  N N   . CYS C  3  70  ? -21.544 6.154   55.487  1.00 91.68  ? 70  CYS C N   1 
ATOM   4288  C CA  . CYS C  3  70  ? -22.949 6.492   55.258  1.00 93.08  ? 70  CYS C CA  1 
ATOM   4289  C C   . CYS C  3  70  ? -23.613 6.940   56.560  1.00 93.29  ? 70  CYS C C   1 
ATOM   4290  O O   . CYS C  3  70  ? -23.141 6.606   57.649  1.00 94.37  ? 70  CYS C O   1 
ATOM   4291  C CB  . CYS C  3  70  ? -23.700 5.302   54.658  1.00 96.19  ? 70  CYS C CB  1 
ATOM   4292  S SG  . CYS C  3  70  ? -23.787 3.854   55.736  1.00 101.81 ? 70  CYS C SG  1 
ATOM   4293  N N   . MET C  3  71  ? -24.704 7.695   56.446  1.00 93.20  ? 71  MET C N   1 
ATOM   4294  C CA  . MET C  3  71  ? -25.389 8.235   57.624  1.00 93.84  ? 71  MET C CA  1 
ATOM   4295  C C   . MET C  3  71  ? -26.912 8.296   57.496  1.00 94.33  ? 71  MET C C   1 
ATOM   4296  O O   . MET C  3  71  ? -27.451 8.466   56.400  1.00 95.30  ? 71  MET C O   1 
ATOM   4297  C CB  . MET C  3  71  ? -24.835 9.619   57.994  1.00 93.79  ? 71  MET C CB  1 
ATOM   4298  C CG  . MET C  3  71  ? -24.960 10.676  56.904  1.00 94.52  ? 71  MET C CG  1 
ATOM   4299  S SD  . MET C  3  71  ? -24.834 12.364  57.529  1.00 93.10  ? 71  MET C SD  1 
ATOM   4300  C CE  . MET C  3  71  ? -26.467 12.598  58.228  1.00 90.68  ? 71  MET C CE  1 
ATOM   4301  N N   . ALA C  3  72  ? -27.587 8.149   58.634  1.00 93.31  ? 72  ALA C N   1 
ATOM   4302  C CA  . ALA C  3  72  ? -29.034 8.324   58.734  1.00 92.81  ? 72  ALA C CA  1 
ATOM   4303  C C   . ALA C  3  72  ? -29.342 9.386   59.786  1.00 90.04  ? 72  ALA C C   1 
ATOM   4304  O O   . ALA C  3  72  ? -28.698 9.430   60.838  1.00 89.81  ? 72  ALA C O   1 
ATOM   4305  C CB  . ALA C  3  72  ? -29.709 7.009   59.086  1.00 93.33  ? 72  ALA C CB  1 
ATOM   4306  N N   . PHE C  3  73  ? -30.325 10.237  59.501  1.00 88.62  ? 73  PHE C N   1 
ATOM   4307  C CA  . PHE C  3  73  ? -30.625 11.382  60.363  1.00 87.52  ? 73  PHE C CA  1 
ATOM   4308  C C   . PHE C  3  73  ? -32.048 11.393  60.929  1.00 88.28  ? 73  PHE C C   1 
ATOM   4309  O O   . PHE C  3  73  ? -32.877 10.547  60.583  1.00 88.06  ? 73  PHE C O   1 
ATOM   4310  C CB  . PHE C  3  73  ? -30.329 12.700  59.629  1.00 86.55  ? 73  PHE C CB  1 
ATOM   4311  C CG  . PHE C  3  73  ? -31.221 12.955  58.443  1.00 87.27  ? 73  PHE C CG  1 
ATOM   4312  C CD1 . PHE C  3  73  ? -32.451 13.590  58.601  1.00 88.06  ? 73  PHE C CD1 1 
ATOM   4313  C CD2 . PHE C  3  73  ? -30.827 12.574  57.164  1.00 87.72  ? 73  PHE C CD2 1 
ATOM   4314  C CE1 . PHE C  3  73  ? -33.273 13.828  57.510  1.00 89.15  ? 73  PHE C CE1 1 
ATOM   4315  C CE2 . PHE C  3  73  ? -31.645 12.811  56.069  1.00 88.31  ? 73  PHE C CE2 1 
ATOM   4316  C CZ  . PHE C  3  73  ? -32.869 13.439  56.242  1.00 89.05  ? 73  PHE C CZ  1 
ATOM   4317  N N   . ALA C  3  74  ? -32.310 12.365  61.802  1.00 88.79  ? 74  ALA C N   1 
ATOM   4318  C CA  . ALA C  3  74  ? -33.630 12.579  62.391  1.00 91.01  ? 74  ALA C CA  1 
ATOM   4319  C C   . ALA C  3  74  ? -33.873 14.068  62.634  1.00 90.89  ? 74  ALA C C   1 
ATOM   4320  O O   . ALA C  3  74  ? -32.932 14.825  62.885  1.00 89.52  ? 74  ALA C O   1 
ATOM   4321  C CB  . ALA C  3  74  ? -33.762 11.800  63.691  1.00 92.23  ? 74  ALA C CB  1 
ATOM   4322  N N   . GLY C  3  75  ? -35.135 14.482  62.551  1.00 93.62  ? 75  GLY C N   1 
ATOM   4323  C CA  . GLY C  3  75  ? -35.514 15.872  62.799  1.00 93.86  ? 75  GLY C CA  1 
ATOM   4324  C C   . GLY C  3  75  ? -35.784 16.659  61.532  1.00 92.59  ? 75  GLY C C   1 
ATOM   4325  O O   . GLY C  3  75  ? -36.448 16.169  60.617  1.00 93.34  ? 75  GLY C O   1 
ATOM   4326  N N   . LEU C  3  76  ? -35.267 17.886  61.488  1.00 89.99  ? 76  LEU C N   1 
ATOM   4327  C CA  . LEU C  3  76  ? -35.457 18.778  60.343  1.00 89.42  ? 76  LEU C CA  1 
ATOM   4328  C C   . LEU C  3  76  ? -34.647 18.313  59.135  1.00 89.39  ? 76  LEU C C   1 
ATOM   4329  O O   . LEU C  3  76  ? -33.422 18.448  59.104  1.00 88.75  ? 76  LEU C O   1 
ATOM   4330  C CB  . LEU C  3  76  ? -35.093 20.222  60.712  1.00 87.36  ? 76  LEU C CB  1 
ATOM   4331  C CG  . LEU C  3  76  ? -35.972 20.961  61.728  1.00 87.29  ? 76  LEU C CG  1 
ATOM   4332  C CD1 . LEU C  3  76  ? -35.217 22.139  62.323  1.00 86.18  ? 76  LEU C CD1 1 
ATOM   4333  C CD2 . LEU C  3  76  ? -37.286 21.419  61.109  1.00 85.74  ? 76  LEU C CD2 1 
ATOM   4334  N N   . THR C  3  77  ? -35.348 17.768  58.143  1.00 88.65  ? 77  THR C N   1 
ATOM   4335  C CA  . THR C  3  77  ? -34.716 17.211  56.942  1.00 87.63  ? 77  THR C CA  1 
ATOM   4336  C C   . THR C  3  77  ? -34.069 18.272  56.041  1.00 85.68  ? 77  THR C C   1 
ATOM   4337  O O   . THR C  3  77  ? -33.192 17.955  55.235  1.00 84.41  ? 77  THR C O   1 
ATOM   4338  C CB  . THR C  3  77  ? -35.699 16.326  56.137  1.00 88.95  ? 77  THR C CB  1 
ATOM   4339  O OG1 . THR C  3  77  ? -35.089 15.915  54.906  1.00 91.41  ? 77  THR C OG1 1 
ATOM   4340  C CG2 . THR C  3  77  ? -36.997 17.068  55.838  1.00 90.13  ? 77  THR C CG2 1 
ATOM   4341  N N   . ALA C  3  78  ? -34.503 19.522  56.189  1.00 85.29  ? 78  ALA C N   1 
ATOM   4342  C CA  . ALA C  3  78  ? -33.918 20.643  55.454  1.00 84.37  ? 78  ALA C CA  1 
ATOM   4343  C C   . ALA C  3  78  ? -32.533 21.009  55.991  1.00 84.32  ? 78  ALA C C   1 
ATOM   4344  O O   . ALA C  3  78  ? -31.651 21.406  55.227  1.00 84.86  ? 78  ALA C O   1 
ATOM   4345  C CB  . ALA C  3  78  ? -34.845 21.850  55.496  1.00 83.77  ? 78  ALA C CB  1 
ATOM   4346  N N   . ASP C  3  79  ? -32.354 20.868  57.304  1.00 84.49  ? 79  ASP C N   1 
ATOM   4347  C CA  . ASP C  3  79  ? -31.082 21.167  57.964  1.00 83.15  ? 79  ASP C CA  1 
ATOM   4348  C C   . ASP C  3  79  ? -30.032 20.088  57.711  1.00 82.93  ? 79  ASP C C   1 
ATOM   4349  O O   . ASP C  3  79  ? -28.847 20.393  57.560  1.00 81.64  ? 79  ASP C O   1 
ATOM   4350  C CB  . ASP C  3  79  ? -31.287 21.349  59.472  1.00 83.93  ? 79  ASP C CB  1 
ATOM   4351  C CG  . ASP C  3  79  ? -32.069 22.607  59.814  1.00 85.53  ? 79  ASP C CG  1 
ATOM   4352  O OD1 . ASP C  3  79  ? -31.745 23.243  60.839  1.00 85.90  ? 79  ASP C OD1 1 
ATOM   4353  O OD2 . ASP C  3  79  ? -33.006 22.963  59.067  1.00 88.20  ? 79  ASP C OD2 1 
ATOM   4354  N N   . ALA C  3  80  ? -30.476 18.833  57.669  1.00 82.94  ? 80  ALA C N   1 
ATOM   4355  C CA  . ALA C  3  80  ? -29.587 17.689  57.471  1.00 82.16  ? 80  ALA C CA  1 
ATOM   4356  C C   . ALA C  3  80  ? -28.955 17.668  56.081  1.00 81.33  ? 80  ALA C C   1 
ATOM   4357  O O   . ALA C  3  80  ? -27.782 17.325  55.935  1.00 80.16  ? 80  ALA C O   1 
ATOM   4358  C CB  . ALA C  3  80  ? -30.330 16.389  57.738  1.00 83.43  ? 80  ALA C CB  1 
ATOM   4359  N N   . ARG C  3  81  ? -29.741 18.046  55.074  1.00 82.18  ? 81  ARG C N   1 
ATOM   4360  C CA  . ARG C  3  81  ? -29.295 18.088  53.679  1.00 82.22  ? 81  ARG C CA  1 
ATOM   4361  C C   . ARG C  3  81  ? -28.117 19.047  53.476  1.00 79.96  ? 81  ARG C C   1 
ATOM   4362  O O   . ARG C  3  81  ? -27.266 18.822  52.612  1.00 79.73  ? 81  ARG C O   1 
ATOM   4363  C CB  . ARG C  3  81  ? -30.469 18.471  52.773  1.00 84.11  ? 81  ARG C CB  1 
ATOM   4364  C CG  . ARG C  3  81  ? -30.245 18.251  51.283  1.00 85.45  ? 81  ARG C CG  1 
ATOM   4365  C CD  . ARG C  3  81  ? -31.528 18.492  50.499  1.00 88.65  ? 81  ARG C CD  1 
ATOM   4366  N NE  . ARG C  3  81  ? -32.201 19.720  50.922  1.00 91.81  ? 81  ARG C NE  1 
ATOM   4367  C CZ  . ARG C  3  81  ? -32.004 20.919  50.381  1.00 93.85  ? 81  ARG C CZ  1 
ATOM   4368  N NH1 . ARG C  3  81  ? -31.155 21.074  49.373  1.00 94.76  ? 81  ARG C NH1 1 
ATOM   4369  N NH2 . ARG C  3  81  ? -32.664 21.968  50.852  1.00 93.08  ? 81  ARG C NH2 1 
ATOM   4370  N N   . ILE C  3  82  ? -28.079 20.110  54.279  1.00 77.93  ? 82  ILE C N   1 
ATOM   4371  C CA  . ILE C  3  82  ? -26.955 21.047  54.297  1.00 76.32  ? 82  ILE C CA  1 
ATOM   4372  C C   . ILE C  3  82  ? -25.709 20.369  54.873  1.00 76.53  ? 82  ILE C C   1 
ATOM   4373  O O   . ILE C  3  82  ? -24.628 20.440  54.285  1.00 77.30  ? 82  ILE C O   1 
ATOM   4374  C CB  . ILE C  3  82  ? -27.288 22.326  55.109  1.00 75.05  ? 82  ILE C CB  1 
ATOM   4375  C CG1 . ILE C  3  82  ? -28.510 23.054  54.524  1.00 75.15  ? 82  ILE C CG1 1 
ATOM   4376  C CG2 . ILE C  3  82  ? -26.078 23.252  55.209  1.00 74.81  ? 82  ILE C CG2 1 
ATOM   4377  C CD1 . ILE C  3  82  ? -28.295 23.702  53.169  1.00 75.54  ? 82  ILE C CD1 1 
ATOM   4378  N N   . VAL C  3  83  ? -25.881 19.703  56.015  1.00 75.90  ? 83  VAL C N   1 
ATOM   4379  C CA  . VAL C  3  83  ? -24.786 19.030  56.723  1.00 74.94  ? 83  VAL C CA  1 
ATOM   4380  C C   . VAL C  3  83  ? -24.204 17.870  55.908  1.00 76.39  ? 83  VAL C C   1 
ATOM   4381  O O   . VAL C  3  83  ? -22.984 17.698  55.855  1.00 76.81  ? 83  VAL C O   1 
ATOM   4382  C CB  . VAL C  3  83  ? -25.231 18.541  58.123  1.00 73.71  ? 83  VAL C CB  1 
ATOM   4383  C CG1 . VAL C  3  83  ? -24.074 17.898  58.874  1.00 73.84  ? 83  VAL C CG1 1 
ATOM   4384  C CG2 . VAL C  3  83  ? -25.794 19.698  58.934  1.00 74.91  ? 83  VAL C CG2 1 
ATOM   4385  N N   . ILE C  3  84  ? -25.079 17.090  55.272  1.00 77.56  ? 84  ILE C N   1 
ATOM   4386  C CA  . ILE C  3  84  ? -24.665 15.976  54.414  1.00 79.69  ? 84  ILE C CA  1 
ATOM   4387  C C   . ILE C  3  84  ? -23.777 16.471  53.266  1.00 81.94  ? 84  ILE C C   1 
ATOM   4388  O O   . ILE C  3  84  ? -22.700 15.919  53.028  1.00 83.06  ? 84  ILE C O   1 
ATOM   4389  C CB  . ILE C  3  84  ? -25.880 15.183  53.868  1.00 80.53  ? 84  ILE C CB  1 
ATOM   4390  C CG1 . ILE C  3  84  ? -26.645 14.516  55.016  1.00 80.66  ? 84  ILE C CG1 1 
ATOM   4391  C CG2 . ILE C  3  84  ? -25.438 14.124  52.866  1.00 82.53  ? 84  ILE C CG2 1 
ATOM   4392  C CD1 . ILE C  3  84  ? -28.071 14.130  54.680  1.00 81.34  ? 84  ILE C CD1 1 
ATOM   4393  N N   . ASN C  3  85  ? -24.227 17.520  52.579  1.00 84.02  ? 85  ASN C N   1 
ATOM   4394  C CA  . ASN C  3  85  ? -23.473 18.118  51.475  1.00 88.82  ? 85  ASN C CA  1 
ATOM   4395  C C   . ASN C  3  85  ? -22.146 18.739  51.908  1.00 87.47  ? 85  ASN C C   1 
ATOM   4396  O O   . ASN C  3  85  ? -21.155 18.658  51.181  1.00 87.70  ? 85  ASN C O   1 
ATOM   4397  C CB  . ASN C  3  85  ? -24.327 19.149  50.728  1.00 93.61  ? 85  ASN C CB  1 
ATOM   4398  C CG  . ASN C  3  85  ? -25.415 18.509  49.880  1.00 98.87  ? 85  ASN C CG  1 
ATOM   4399  O OD1 . ASN C  3  85  ? -25.391 17.306  49.610  1.00 98.63  ? 85  ASN C OD1 1 
ATOM   4400  N ND2 . ASN C  3  85  ? -26.374 19.319  49.448  1.00 102.13 ? 85  ASN C ND2 1 
ATOM   4401  N N   . ARG C  3  86  ? -22.135 19.353  53.090  1.00 86.45  ? 86  ARG C N   1 
ATOM   4402  C CA  . ARG C  3  86  ? -20.917 19.933  53.660  1.00 85.92  ? 86  ARG C CA  1 
ATOM   4403  C C   . ARG C  3  86  ? -19.926 18.851  54.087  1.00 83.86  ? 86  ARG C C   1 
ATOM   4404  O O   . ARG C  3  86  ? -18.711 19.042  53.992  1.00 83.11  ? 86  ARG C O   1 
ATOM   4405  C CB  . ARG C  3  86  ? -21.248 20.849  54.846  1.00 87.12  ? 86  ARG C CB  1 
ATOM   4406  C CG  . ARG C  3  86  ? -21.876 22.185  54.467  1.00 87.90  ? 86  ARG C CG  1 
ATOM   4407  C CD  . ARG C  3  86  ? -20.852 23.181  53.942  1.00 90.57  ? 86  ARG C CD  1 
ATOM   4408  N NE  . ARG C  3  86  ? -20.006 23.721  55.006  1.00 92.75  ? 86  ARG C NE  1 
ATOM   4409  C CZ  . ARG C  3  86  ? -20.281 24.817  55.710  1.00 93.23  ? 86  ARG C CZ  1 
ATOM   4410  N NH1 . ARG C  3  86  ? -21.389 25.510  55.477  1.00 91.22  ? 86  ARG C NH1 1 
ATOM   4411  N NH2 . ARG C  3  86  ? -19.442 25.221  56.654  1.00 93.06  ? 86  ARG C NH2 1 
ATOM   4412  N N   . ALA C  3  87  ? -20.454 17.721  54.553  1.00 82.16  ? 87  ALA C N   1 
ATOM   4413  C CA  . ALA C  3  87  ? -19.635 16.574  54.938  1.00 80.83  ? 87  ALA C CA  1 
ATOM   4414  C C   . ALA C  3  87  ? -19.087 15.837  53.717  1.00 81.43  ? 87  ALA C C   1 
ATOM   4415  O O   . ALA C  3  87  ? -17.974 15.309  53.756  1.00 81.63  ? 87  ALA C O   1 
ATOM   4416  C CB  . ALA C  3  87  ? -20.431 15.626  55.823  1.00 79.92  ? 87  ALA C CB  1 
ATOM   4417  N N   . ARG C  3  88  ? -19.874 15.809  52.641  1.00 82.00  ? 88  ARG C N   1 
ATOM   4418  C CA  . ARG C  3  88  ? -19.475 15.172  51.382  1.00 83.69  ? 88  ARG C CA  1 
ATOM   4419  C C   . ARG C  3  88  ? -18.316 15.896  50.696  1.00 81.61  ? 88  ARG C C   1 
ATOM   4420  O O   . ARG C  3  88  ? -17.489 15.264  50.035  1.00 81.25  ? 88  ARG C O   1 
ATOM   4421  C CB  . ARG C  3  88  ? -20.668 15.061  50.430  1.00 87.12  ? 88  ARG C CB  1 
ATOM   4422  C CG  . ARG C  3  88  ? -21.574 13.872  50.706  1.00 90.65  ? 88  ARG C CG  1 
ATOM   4423  C CD  . ARG C  3  88  ? -22.868 13.963  49.914  1.00 94.33  ? 88  ARG C CD  1 
ATOM   4424  N NE  . ARG C  3  88  ? -23.700 12.773  50.089  1.00 96.71  ? 88  ARG C NE  1 
ATOM   4425  C CZ  . ARG C  3  88  ? -24.954 12.655  49.657  1.00 97.83  ? 88  ARG C CZ  1 
ATOM   4426  N NH1 . ARG C  3  88  ? -25.548 13.658  49.021  1.00 96.86  ? 88  ARG C NH1 1 
ATOM   4427  N NH2 . ARG C  3  88  ? -25.620 11.529  49.869  1.00 99.91  ? 88  ARG C NH2 1 
ATOM   4428  N N   . VAL C  3  89  ? -18.270 17.218  50.852  1.00 79.53  ? 89  VAL C N   1 
ATOM   4429  C CA  . VAL C  3  89  ? -17.162 18.032  50.346  1.00 75.89  ? 89  VAL C CA  1 
ATOM   4430  C C   . VAL C  3  89  ? -15.895 17.746  51.157  1.00 76.78  ? 89  VAL C C   1 
ATOM   4431  O O   . VAL C  3  89  ? -14.804 17.637  50.594  1.00 77.93  ? 89  VAL C O   1 
ATOM   4432  C CB  . VAL C  3  89  ? -17.505 19.544  50.359  1.00 72.60  ? 89  VAL C CB  1 
ATOM   4433  C CG1 . VAL C  3  89  ? -16.296 20.390  49.981  1.00 72.03  ? 89  VAL C CG1 1 
ATOM   4434  C CG2 . VAL C  3  89  ? -18.659 19.838  49.412  1.00 71.88  ? 89  VAL C CG2 1 
ATOM   4435  N N   . GLU C  3  90  ? -16.059 17.603  52.472  1.00 77.04  ? 90  GLU C N   1 
ATOM   4436  C CA  . GLU C  3  90  ? -14.948 17.324  53.385  1.00 78.28  ? 90  GLU C CA  1 
ATOM   4437  C C   . GLU C  3  90  ? -14.294 15.967  53.117  1.00 80.56  ? 90  GLU C C   1 
ATOM   4438  O O   . GLU C  3  90  ? -13.085 15.814  53.302  1.00 83.12  ? 90  GLU C O   1 
ATOM   4439  C CB  . GLU C  3  90  ? -15.415 17.422  54.843  1.00 78.36  ? 90  GLU C CB  1 
ATOM   4440  C CG  . GLU C  3  90  ? -14.300 17.398  55.886  1.00 78.86  ? 90  GLU C CG  1 
ATOM   4441  C CD  . GLU C  3  90  ? -13.306 18.541  55.740  1.00 79.01  ? 90  GLU C CD  1 
ATOM   4442  O OE1 . GLU C  3  90  ? -13.725 19.679  55.436  1.00 79.04  ? 90  GLU C OE1 1 
ATOM   4443  O OE2 . GLU C  3  90  ? -12.098 18.299  55.939  1.00 80.11  ? 90  GLU C OE2 1 
ATOM   4444  N N   . CYS C  3  91  ? -15.094 14.995  52.682  1.00 81.52  ? 91  CYS C N   1 
ATOM   4445  C CA  . CYS C  3  91  ? -14.590 13.672  52.306  1.00 84.18  ? 91  CYS C CA  1 
ATOM   4446  C C   . CYS C  3  91  ? -13.651 13.743  51.101  1.00 85.73  ? 91  CYS C C   1 
ATOM   4447  O O   . CYS C  3  91  ? -12.682 12.985  51.015  1.00 85.80  ? 91  CYS C O   1 
ATOM   4448  C CB  . CYS C  3  91  ? -15.748 12.716  52.013  1.00 85.25  ? 91  CYS C CB  1 
ATOM   4449  S SG  . CYS C  3  91  ? -16.737 12.268  53.459  1.00 84.86  ? 91  CYS C SG  1 
ATOM   4450  N N   . GLN C  3  92  ? -13.949 14.656  50.178  1.00 86.70  ? 92  GLN C N   1 
ATOM   4451  C CA  . GLN C  3  92  ? -13.123 14.873  48.991  1.00 87.92  ? 92  GLN C CA  1 
ATOM   4452  C C   . GLN C  3  92  ? -11.987 15.859  49.270  1.00 89.94  ? 92  GLN C C   1 
ATOM   4453  O O   . GLN C  3  92  ? -10.919 15.769  48.661  1.00 91.16  ? 92  GLN C O   1 
ATOM   4454  C CB  . GLN C  3  92  ? -13.977 15.359  47.813  1.00 86.85  ? 92  GLN C CB  1 
ATOM   4455  C CG  . GLN C  3  92  ? -15.115 14.424  47.414  1.00 85.14  ? 92  GLN C CG  1 
ATOM   4456  C CD  . GLN C  3  92  ? -14.643 13.050  46.967  1.00 85.46  ? 92  GLN C CD  1 
ATOM   4457  O OE1 . GLN C  3  92  ? -15.132 12.029  47.449  1.00 86.49  ? 92  GLN C OE1 1 
ATOM   4458  N NE2 . GLN C  3  92  ? -13.688 13.018  46.043  1.00 85.24  ? 92  GLN C NE2 1 
ATOM   4459  N N   . SER C  3  93  ? -12.228 16.792  50.191  1.00 90.25  ? 93  SER C N   1 
ATOM   4460  C CA  . SER C  3  93  ? -11.215 17.761  50.617  1.00 93.12  ? 93  SER C CA  1 
ATOM   4461  C C   . SER C  3  93  ? -10.127 17.098  51.457  1.00 96.79  ? 93  SER C C   1 
ATOM   4462  O O   . SER C  3  93  ? -8.978  17.544  51.458  1.00 98.64  ? 93  SER C O   1 
ATOM   4463  C CB  . SER C  3  93  ? -11.854 18.908  51.401  1.00 92.89  ? 93  SER C CB  1 
ATOM   4464  O OG  . SER C  3  93  ? -12.750 19.644  50.588  1.00 95.19  ? 93  SER C OG  1 
ATOM   4465  N N   . HIS C  3  94  ? -10.503 16.039  52.173  1.00 99.17  ? 94  HIS C N   1 
ATOM   4466  C CA  . HIS C  3  94  ? -9.555  15.236  52.941  1.00 104.93 ? 94  HIS C CA  1 
ATOM   4467  C C   . HIS C  3  94  ? -8.627  14.489  52.027  1.00 109.67 ? 94  HIS C C   1 
ATOM   4468  O O   . HIS C  3  94  ? -7.447  14.337  52.334  1.00 114.56 ? 94  HIS C O   1 
ATOM   4469  C CB  . HIS C  3  94  ? -10.289 14.265  53.863  1.00 107.13 ? 94  HIS C CB  1 
ATOM   4470  C CG  . HIS C  3  94  ? -9.374  13.459  54.757  1.00 112.33 ? 94  HIS C CG  1 
ATOM   4471  N ND1 . HIS C  3  94  ? -8.965  12.217  54.442  1.00 113.84 ? 94  HIS C ND1 1 
ATOM   4472  C CD2 . HIS C  3  94  ? -8.793  13.764  55.987  1.00 112.64 ? 94  HIS C CD2 1 
ATOM   4473  C CE1 . HIS C  3  94  ? -8.164  11.748  55.417  1.00 114.37 ? 94  HIS C CE1 1 
ATOM   4474  N NE2 . HIS C  3  94  ? -8.059  12.695  56.362  1.00 113.54 ? 94  HIS C NE2 1 
ATOM   4475  N N   . ARG C  3  95  ? -9.156  14.027  50.894  1.00 108.58 ? 95  ARG C N   1 
ATOM   4476  C CA  . ARG C  3  95  ? -8.378  13.272  49.908  1.00 109.84 ? 95  ARG C CA  1 
ATOM   4477  C C   . ARG C  3  95  ? -7.348  14.123  49.161  1.00 113.62 ? 95  ARG C C   1 
ATOM   4478  O O   . ARG C  3  95  ? -6.300  13.617  48.756  1.00 115.86 ? 95  ARG C O   1 
ATOM   4479  C CB  . ARG C  3  95  ? -9.301  12.567  48.913  1.00 105.58 ? 95  ARG C CB  1 
ATOM   4480  C CG  . ARG C  3  95  ? -9.924  11.283  49.436  1.00 105.53 ? 95  ARG C CG  1 
ATOM   4481  C CD  . ARG C  3  95  ? -10.464 10.439  48.294  1.00 106.80 ? 95  ARG C CD  1 
ATOM   4482  N NE  . ARG C  3  95  ? -11.007 9.165   48.761  1.00 107.09 ? 95  ARG C NE  1 
ATOM   4483  C CZ  . ARG C  3  95  ? -12.294 8.938   49.010  1.00 107.44 ? 95  ARG C CZ  1 
ATOM   4484  N NH1 . ARG C  3  95  ? -13.195 9.898   48.839  1.00 107.53 ? 95  ARG C NH1 1 
ATOM   4485  N NH2 . ARG C  3  95  ? -12.684 7.743   49.431  1.00 107.47 ? 95  ARG C NH2 1 
ATOM   4486  N N   . LEU C  3  96  ? -7.655  15.406  48.980  1.00 114.47 ? 96  LEU C N   1 
ATOM   4487  C CA  . LEU C  3  96  ? -6.750  16.339  48.304  1.00 115.59 ? 96  LEU C CA  1 
ATOM   4488  C C   . LEU C  3  96  ? -5.548  16.719  49.167  1.00 118.00 ? 96  LEU C C   1 
ATOM   4489  O O   . LEU C  3  96  ? -4.463  16.987  48.645  1.00 115.73 ? 96  LEU C O   1 
ATOM   4490  C CB  . LEU C  3  96  ? -7.501  17.601  47.865  1.00 111.18 ? 96  LEU C CB  1 
ATOM   4491  C CG  . LEU C  3  96  ? -8.359  17.525  46.599  1.00 108.44 ? 96  LEU C CG  1 
ATOM   4492  C CD1 . LEU C  3  96  ? -9.368  18.663  46.570  1.00 107.28 ? 96  LEU C CD1 1 
ATOM   4493  C CD2 . LEU C  3  96  ? -7.495  17.541  45.344  1.00 107.08 ? 96  LEU C CD2 1 
ATOM   4494  N N   . THR C  3  97  ? -5.752  16.744  50.482  1.00 118.74 ? 97  THR C N   1 
ATOM   4495  C CA  . THR C  3  97  ? -4.697  17.088  51.436  1.00 120.66 ? 97  THR C CA  1 
ATOM   4496  C C   . THR C  3  97  ? -3.986  15.828  51.938  1.00 120.19 ? 97  THR C C   1 
ATOM   4497  O O   . THR C  3  97  ? -2.758  15.800  52.050  1.00 113.65 ? 97  THR C O   1 
ATOM   4498  C CB  . THR C  3  97  ? -5.255  17.891  52.632  1.00 118.65 ? 97  THR C CB  1 
ATOM   4499  O OG1 . THR C  3  97  ? -6.209  18.853  52.166  1.00 117.73 ? 97  THR C OG1 1 
ATOM   4500  C CG2 . THR C  3  97  ? -4.134  18.614  53.372  1.00 116.00 ? 97  THR C CG2 1 
ATOM   4501  N N   . VAL C  3  98  ? -4.771  14.796  52.240  1.00 120.91 ? 98  VAL C N   1 
ATOM   4502  C CA  . VAL C  3  98  ? -4.256  13.504  52.690  1.00 120.71 ? 98  VAL C CA  1 
ATOM   4503  C C   . VAL C  3  98  ? -4.716  12.425  51.709  1.00 119.67 ? 98  VAL C C   1 
ATOM   4504  O O   . VAL C  3  98  ? -5.915  12.188  51.555  1.00 120.26 ? 98  VAL C O   1 
ATOM   4505  C CB  . VAL C  3  98  ? -4.735  13.172  54.125  1.00 120.11 ? 98  VAL C CB  1 
ATOM   4506  C CG1 . VAL C  3  98  ? -4.367  11.745  54.514  1.00 117.59 ? 98  VAL C CG1 1 
ATOM   4507  C CG2 . VAL C  3  98  ? -4.159  14.161  55.129  1.00 118.64 ? 98  VAL C CG2 1 
ATOM   4508  N N   . GLU C  3  99  ? -3.759  11.771  51.054  1.00 116.21 ? 99  GLU C N   1 
ATOM   4509  C CA  . GLU C  3  99  ? -4.057  10.785  50.010  1.00 114.72 ? 99  GLU C CA  1 
ATOM   4510  C C   . GLU C  3  99  ? -4.857  9.577   50.517  1.00 117.42 ? 99  GLU C C   1 
ATOM   4511  O O   . GLU C  3  99  ? -5.464  8.849   49.727  1.00 119.21 ? 99  GLU C O   1 
ATOM   4512  C CB  . GLU C  3  99  ? -2.766  10.337  49.318  1.00 111.96 ? 99  GLU C CB  1 
ATOM   4513  C CG  . GLU C  3  99  ? -2.959  9.841   47.893  1.00 111.62 ? 99  GLU C CG  1 
ATOM   4514  C CD  . GLU C  3  99  ? -1.745  10.084  47.017  1.00 111.63 ? 99  GLU C CD  1 
ATOM   4515  O OE1 . GLU C  3  99  ? -1.300  11.247  46.923  1.00 106.36 ? 99  GLU C OE1 1 
ATOM   4516  O OE2 . GLU C  3  99  ? -1.243  9.115   46.413  1.00 114.73 ? 99  GLU C OE2 1 
ATOM   4517  N N   . ASP C  3  100 ? -4.860  9.380   51.834  1.00 120.85 ? 100 ASP C N   1 
ATOM   4518  C CA  . ASP C  3  100 ? -5.627  8.310   52.470  1.00 124.74 ? 100 ASP C CA  1 
ATOM   4519  C C   . ASP C  3  100 ? -7.120  8.655   52.526  1.00 124.02 ? 100 ASP C C   1 
ATOM   4520  O O   . ASP C  3  100 ? -7.476  9.827   52.672  1.00 123.68 ? 100 ASP C O   1 
ATOM   4521  C CB  . ASP C  3  100 ? -5.099  8.042   53.884  1.00 127.02 ? 100 ASP C CB  1 
ATOM   4522  C CG  . ASP C  3  100 ? -3.636  7.628   53.898  1.00 127.55 ? 100 ASP C CG  1 
ATOM   4523  O OD1 . ASP C  3  100 ? -3.339  6.521   54.394  1.00 130.33 ? 100 ASP C OD1 1 
ATOM   4524  O OD2 . ASP C  3  100 ? -2.784  8.403   53.413  1.00 127.03 ? 100 ASP C OD2 1 
ATOM   4525  N N   . PRO C  3  101 ? -7.996  7.635   52.403  1.00 125.27 ? 101 PRO C N   1 
ATOM   4526  C CA  . PRO C  3  101 ? -9.443  7.844   52.529  1.00 124.53 ? 101 PRO C CA  1 
ATOM   4527  C C   . PRO C  3  101 ? -9.855  8.241   53.948  1.00 118.36 ? 101 PRO C C   1 
ATOM   4528  O O   . PRO C  3  101 ? -9.146  7.932   54.909  1.00 118.72 ? 101 PRO C O   1 
ATOM   4529  C CB  . PRO C  3  101 ? -10.032 6.475   52.167  1.00 124.58 ? 101 PRO C CB  1 
ATOM   4530  C CG  . PRO C  3  101 ? -8.931  5.502   52.418  1.00 126.19 ? 101 PRO C CG  1 
ATOM   4531  C CD  . PRO C  3  101 ? -7.675  6.237   52.058  1.00 127.30 ? 101 PRO C CD  1 
ATOM   4532  N N   . VAL C  3  102 ? -10.995 8.918   54.065  1.00 110.48 ? 102 VAL C N   1 
ATOM   4533  C CA  . VAL C  3  102 ? -11.469 9.435   55.350  1.00 103.60 ? 102 VAL C CA  1 
ATOM   4534  C C   . VAL C  3  102 ? -12.032 8.330   56.249  1.00 100.60 ? 102 VAL C C   1 
ATOM   4535  O O   . VAL C  3  102 ? -12.817 7.488   55.805  1.00 100.79 ? 102 VAL C O   1 
ATOM   4536  C CB  . VAL C  3  102 ? -12.477 10.604  55.163  1.00 99.87  ? 102 VAL C CB  1 
ATOM   4537  C CG1 . VAL C  3  102 ? -13.777 10.133  54.524  1.00 99.76  ? 102 VAL C CG1 1 
ATOM   4538  C CG2 . VAL C  3  102 ? -12.753 11.308  56.482  1.00 96.76  ? 102 VAL C CG2 1 
ATOM   4539  N N   . THR C  3  103 ? -11.603 8.332   57.509  1.00 94.50  ? 103 THR C N   1 
ATOM   4540  C CA  . THR C  3  103 ? -12.072 7.360   58.497  1.00 91.93  ? 103 THR C CA  1 
ATOM   4541  C C   . THR C  3  103 ? -13.385 7.812   59.148  1.00 89.56  ? 103 THR C C   1 
ATOM   4542  O O   . THR C  3  103 ? -13.777 8.975   59.028  1.00 89.29  ? 103 THR C O   1 
ATOM   4543  C CB  . THR C  3  103 ? -10.988 7.048   59.559  1.00 90.40  ? 103 THR C CB  1 
ATOM   4544  O OG1 . THR C  3  103 ? -11.502 6.120   60.522  1.00 93.39  ? 103 THR C OG1 1 
ATOM   4545  C CG2 . THR C  3  103 ? -10.524 8.312   60.275  1.00 87.81  ? 103 THR C CG2 1 
ATOM   4546  N N   . VAL C  3  104 ? -14.054 6.884   59.829  1.00 88.96  ? 104 VAL C N   1 
ATOM   4547  C CA  . VAL C  3  104 ? -15.353 7.142   60.460  1.00 88.23  ? 104 VAL C CA  1 
ATOM   4548  C C   . VAL C  3  104 ? -15.242 8.154   61.603  1.00 89.41  ? 104 VAL C C   1 
ATOM   4549  O O   . VAL C  3  104 ? -16.139 8.976   61.799  1.00 89.69  ? 104 VAL C O   1 
ATOM   4550  C CB  . VAL C  3  104 ? -16.001 5.837   60.982  1.00 88.77  ? 104 VAL C CB  1 
ATOM   4551  C CG1 . VAL C  3  104 ? -17.476 6.051   61.293  1.00 88.35  ? 104 VAL C CG1 1 
ATOM   4552  C CG2 . VAL C  3  104 ? -15.843 4.712   59.969  1.00 93.83  ? 104 VAL C CG2 1 
ATOM   4553  N N   . GLU C  3  105 ? -14.135 8.093   62.341  1.00 92.34  ? 105 GLU C N   1 
ATOM   4554  C CA  . GLU C  3  105 ? -13.914 8.956   63.502  1.00 95.97  ? 105 GLU C CA  1 
ATOM   4555  C C   . GLU C  3  105 ? -13.633 10.410  63.110  1.00 91.98  ? 105 GLU C C   1 
ATOM   4556  O O   . GLU C  3  105 ? -14.051 11.335  63.811  1.00 90.18  ? 105 GLU C O   1 
ATOM   4557  C CB  . GLU C  3  105 ? -12.777 8.395   64.365  1.00 103.34 ? 105 GLU C CB  1 
ATOM   4558  C CG  . GLU C  3  105 ? -12.857 8.760   65.843  1.00 108.29 ? 105 GLU C CG  1 
ATOM   4559  C CD  . GLU C  3  105 ? -12.167 10.071  66.178  1.00 112.76 ? 105 GLU C CD  1 
ATOM   4560  O OE1 . GLU C  3  105 ? -11.081 10.340  65.623  1.00 113.71 ? 105 GLU C OE1 1 
ATOM   4561  O OE2 . GLU C  3  105 ? -12.705 10.827  67.014  1.00 114.51 ? 105 GLU C OE2 1 
ATOM   4562  N N   . TYR C  3  106 ? -12.932 10.603  61.992  1.00 88.91  ? 106 TYR C N   1 
ATOM   4563  C CA  . TYR C  3  106 ? -12.580 11.940  61.505  1.00 85.60  ? 106 TYR C CA  1 
ATOM   4564  C C   . TYR C  3  106 ? -13.795 12.706  60.985  1.00 83.53  ? 106 TYR C C   1 
ATOM   4565  O O   . TYR C  3  106 ? -13.947 13.898  61.265  1.00 81.86  ? 106 TYR C O   1 
ATOM   4566  C CB  . TYR C  3  106 ? -11.501 11.858  60.416  1.00 86.74  ? 106 TYR C CB  1 
ATOM   4567  C CG  . TYR C  3  106 ? -11.028 13.204  59.897  1.00 88.20  ? 106 TYR C CG  1 
ATOM   4568  C CD1 . TYR C  3  106 ? -9.992  13.891  60.527  1.00 89.80  ? 106 TYR C CD1 1 
ATOM   4569  C CD2 . TYR C  3  106 ? -11.614 13.786  58.772  1.00 88.45  ? 106 TYR C CD2 1 
ATOM   4570  C CE1 . TYR C  3  106 ? -9.558  15.122  60.057  1.00 91.33  ? 106 TYR C CE1 1 
ATOM   4571  C CE2 . TYR C  3  106 ? -11.187 15.015  58.295  1.00 89.94  ? 106 TYR C CE2 1 
ATOM   4572  C CZ  . TYR C  3  106 ? -10.160 15.678  58.939  1.00 90.47  ? 106 TYR C CZ  1 
ATOM   4573  O OH  . TYR C  3  106 ? -9.734  16.897  58.466  1.00 91.77  ? 106 TYR C OH  1 
ATOM   4574  N N   . ILE C  3  107 ? -14.649 12.018  60.230  1.00 82.71  ? 107 ILE C N   1 
ATOM   4575  C CA  . ILE C  3  107 ? -15.814 12.645  59.605  1.00 82.25  ? 107 ILE C CA  1 
ATOM   4576  C C   . ILE C  3  107 ? -16.890 12.992  60.642  1.00 82.15  ? 107 ILE C C   1 
ATOM   4577  O O   . ILE C  3  107 ? -17.642 13.953  60.467  1.00 82.00  ? 107 ILE C O   1 
ATOM   4578  C CB  . ILE C  3  107 ? -16.373 11.776  58.441  1.00 83.03  ? 107 ILE C CB  1 
ATOM   4579  C CG1 . ILE C  3  107 ? -16.496 12.597  57.142  1.00 82.91  ? 107 ILE C CG1 1 
ATOM   4580  C CG2 . ILE C  3  107 ? -17.659 11.045  58.825  1.00 83.96  ? 107 ILE C CG2 1 
ATOM   4581  C CD1 . ILE C  3  107 ? -17.461 13.767  57.182  1.00 81.63  ? 107 ILE C CD1 1 
ATOM   4582  N N   . THR C  3  108 ? -16.942 12.213  61.722  1.00 83.54  ? 108 THR C N   1 
ATOM   4583  C CA  . THR C  3  108 ? -17.876 12.455  62.820  1.00 84.36  ? 108 THR C CA  1 
ATOM   4584  C C   . THR C  3  108 ? -17.442 13.678  63.632  1.00 82.78  ? 108 THR C C   1 
ATOM   4585  O O   . THR C  3  108 ? -18.283 14.452  64.098  1.00 81.23  ? 108 THR C O   1 
ATOM   4586  C CB  . THR C  3  108 ? -17.998 11.221  63.740  1.00 86.05  ? 108 THR C CB  1 
ATOM   4587  O OG1 . THR C  3  108 ? -18.253 10.055  62.948  1.00 87.78  ? 108 THR C OG1 1 
ATOM   4588  C CG2 . THR C  3  108 ? -19.134 11.396  64.737  1.00 84.30  ? 108 THR C CG2 1 
ATOM   4589  N N   . ARG C  3  109 ? -16.129 13.845  63.785  1.00 82.20  ? 109 ARG C N   1 
ATOM   4590  C CA  . ARG C  3  109 ? -15.560 14.984  64.506  1.00 80.31  ? 109 ARG C CA  1 
ATOM   4591  C C   . ARG C  3  109 ? -15.803 16.292  63.755  1.00 78.10  ? 109 ARG C C   1 
ATOM   4592  O O   . ARG C  3  109 ? -15.966 17.346  64.373  1.00 77.13  ? 109 ARG C O   1 
ATOM   4593  C CB  . ARG C  3  109 ? -14.060 14.784  64.739  1.00 82.06  ? 109 ARG C CB  1 
ATOM   4594  C CG  . ARG C  3  109 ? -13.504 15.583  65.910  1.00 83.22  ? 109 ARG C CG  1 
ATOM   4595  C CD  . ARG C  3  109 ? -11.995 15.776  65.827  1.00 86.73  ? 109 ARG C CD  1 
ATOM   4596  N NE  . ARG C  3  109 ? -11.254 14.515  65.883  1.00 90.90  ? 109 ARG C NE  1 
ATOM   4597  C CZ  . ARG C  3  109 ? -10.553 14.004  64.874  1.00 92.34  ? 109 ARG C CZ  1 
ATOM   4598  N NH1 . ARG C  3  109 ? -10.478 14.642  63.713  1.00 92.96  ? 109 ARG C NH1 1 
ATOM   4599  N NH2 . ARG C  3  109 ? -9.917  12.851  65.029  1.00 93.20  ? 109 ARG C NH2 1 
ATOM   4600  N N   . TYR C  3  110 ? -15.826 16.212  62.425  1.00 77.08  ? 110 TYR C N   1 
ATOM   4601  C CA  . TYR C  3  110 ? -16.079 17.374  61.573  1.00 75.70  ? 110 TYR C CA  1 
ATOM   4602  C C   . TYR C  3  110 ? -17.538 17.830  61.640  1.00 76.03  ? 110 TYR C C   1 
ATOM   4603  O O   . TYR C  3  110 ? -17.812 19.031  61.696  1.00 76.40  ? 110 TYR C O   1 
ATOM   4604  C CB  . TYR C  3  110 ? -15.670 17.085  60.123  1.00 75.07  ? 110 TYR C CB  1 
ATOM   4605  C CG  . TYR C  3  110 ? -15.919 18.237  59.172  1.00 75.07  ? 110 TYR C CG  1 
ATOM   4606  C CD1 . TYR C  3  110 ? -15.055 19.332  59.130  1.00 74.85  ? 110 TYR C CD1 1 
ATOM   4607  C CD2 . TYR C  3  110 ? -17.018 18.232  58.313  1.00 75.57  ? 110 TYR C CD2 1 
ATOM   4608  C CE1 . TYR C  3  110 ? -15.282 20.390  58.263  1.00 75.71  ? 110 TYR C CE1 1 
ATOM   4609  C CE2 . TYR C  3  110 ? -17.252 19.285  57.443  1.00 76.60  ? 110 TYR C CE2 1 
ATOM   4610  C CZ  . TYR C  3  110 ? -16.382 20.359  57.421  1.00 77.12  ? 110 TYR C CZ  1 
ATOM   4611  O OH  . TYR C  3  110 ? -16.611 21.405  56.556  1.00 80.04  ? 110 TYR C OH  1 
ATOM   4612  N N   . ILE C  3  111 ? -18.461 16.870  61.625  1.00 76.53  ? 111 ILE C N   1 
ATOM   4613  C CA  . ILE C  3  111 ? -19.896 17.154  61.722  1.00 77.65  ? 111 ILE C CA  1 
ATOM   4614  C C   . ILE C  3  111 ? -20.240 17.747  63.092  1.00 77.87  ? 111 ILE C C   1 
ATOM   4615  O O   . ILE C  3  111 ? -21.009 18.708  63.183  1.00 79.38  ? 111 ILE C O   1 
ATOM   4616  C CB  . ILE C  3  111 ? -20.750 15.895  61.433  1.00 79.27  ? 111 ILE C CB  1 
ATOM   4617  C CG1 . ILE C  3  111 ? -20.573 15.455  59.975  1.00 80.79  ? 111 ILE C CG1 1 
ATOM   4618  C CG2 . ILE C  3  111 ? -22.225 16.151  61.726  1.00 78.95  ? 111 ILE C CG2 1 
ATOM   4619  C CD1 . ILE C  3  111 ? -21.002 14.029  59.693  1.00 82.16  ? 111 ILE C CD1 1 
ATOM   4620  N N   . ALA C  3  112 ? -19.654 17.178  64.144  1.00 77.85  ? 112 ALA C N   1 
ATOM   4621  C CA  . ALA C  3  112 ? -19.862 17.652  65.513  1.00 77.73  ? 112 ALA C CA  1 
ATOM   4622  C C   . ALA C  3  112 ? -19.333 19.072  65.722  1.00 78.20  ? 112 ALA C C   1 
ATOM   4623  O O   . ALA C  3  112 ? -19.976 19.882  66.391  1.00 77.88  ? 112 ALA C O   1 
ATOM   4624  C CB  . ALA C  3  112 ? -19.230 16.692  66.510  1.00 78.94  ? 112 ALA C CB  1 
ATOM   4625  N N   . SER C  3  113 ? -18.170 19.365  65.141  1.00 78.96  ? 113 SER C N   1 
ATOM   4626  C CA  . SER C  3  113 ? -17.569 20.699  65.224  1.00 80.04  ? 113 SER C CA  1 
ATOM   4627  C C   . SER C  3  113 ? -18.336 21.726  64.391  1.00 80.90  ? 113 SER C C   1 
ATOM   4628  O O   . SER C  3  113 ? -18.329 22.918  64.708  1.00 81.41  ? 113 SER C O   1 
ATOM   4629  C CB  . SER C  3  113 ? -16.099 20.662  64.797  1.00 82.26  ? 113 SER C CB  1 
ATOM   4630  O OG  . SER C  3  113 ? -15.965 20.248  63.449  1.00 84.52  ? 113 SER C OG  1 
ATOM   4631  N N   . LEU C  3  114 ? -18.985 21.256  63.326  1.00 81.44  ? 114 LEU C N   1 
ATOM   4632  C CA  . LEU C  3  114 ? -19.838 22.098  62.489  1.00 81.79  ? 114 LEU C CA  1 
ATOM   4633  C C   . LEU C  3  114 ? -21.104 22.502  63.243  1.00 81.76  ? 114 LEU C C   1 
ATOM   4634  O O   . LEU C  3  114 ? -21.568 23.637  63.128  1.00 80.95  ? 114 LEU C O   1 
ATOM   4635  C CB  . LEU C  3  114 ? -20.198 21.374  61.184  1.00 81.85  ? 114 LEU C CB  1 
ATOM   4636  C CG  . LEU C  3  114 ? -20.979 22.130  60.101  1.00 83.17  ? 114 LEU C CG  1 
ATOM   4637  C CD1 . LEU C  3  114 ? -20.118 23.184  59.418  1.00 84.58  ? 114 LEU C CD1 1 
ATOM   4638  C CD2 . LEU C  3  114 ? -21.538 21.156  59.076  1.00 83.29  ? 114 LEU C CD2 1 
ATOM   4639  N N   . LYS C  3  115 ? -21.650 21.563  64.015  1.00 81.79  ? 115 LYS C N   1 
ATOM   4640  C CA  . LYS C  3  115 ? -22.826 21.815  64.847  1.00 80.92  ? 115 LYS C CA  1 
ATOM   4641  C C   . LYS C  3  115 ? -22.475 22.674  66.062  1.00 79.00  ? 115 LYS C C   1 
ATOM   4642  O O   . LYS C  3  115 ? -23.304 23.451  66.538  1.00 78.97  ? 115 LYS C O   1 
ATOM   4643  C CB  . LYS C  3  115 ? -23.460 20.497  65.300  1.00 81.24  ? 115 LYS C CB  1 
ATOM   4644  C CG  . LYS C  3  115 ? -24.119 19.701  64.185  1.00 81.08  ? 115 LYS C CG  1 
ATOM   4645  C CD  . LYS C  3  115 ? -24.663 18.377  64.699  1.00 81.85  ? 115 LYS C CD  1 
ATOM   4646  C CE  . LYS C  3  115 ? -25.292 17.565  63.579  1.00 82.12  ? 115 LYS C CE  1 
ATOM   4647  N NZ  . LYS C  3  115 ? -25.827 16.262  64.066  1.00 81.90  ? 115 LYS C NZ  1 
ATOM   4648  N N   . GLN C  3  116 ? -21.244 22.527  66.549  1.00 76.58  ? 116 GLN C N   1 
ATOM   4649  C CA  . GLN C  3  116 ? -20.759 23.269  67.713  1.00 74.22  ? 116 GLN C CA  1 
ATOM   4650  C C   . GLN C  3  116 ? -20.527 24.748  67.398  1.00 75.52  ? 116 GLN C C   1 
ATOM   4651  O O   . GLN C  3  116 ? -20.812 25.614  68.229  1.00 74.86  ? 116 GLN C O   1 
ATOM   4652  C CB  . GLN C  3  116 ? -19.478 22.622  68.257  1.00 72.68  ? 116 GLN C CB  1 
ATOM   4653  C CG  . GLN C  3  116 ? -19.034 23.119  69.627  1.00 71.93  ? 116 GLN C CG  1 
ATOM   4654  C CD  . GLN C  3  116 ? -18.177 24.372  69.560  1.00 71.17  ? 116 GLN C CD  1 
ATOM   4655  O OE1 . GLN C  3  116 ? -17.369 24.541  68.645  1.00 72.67  ? 116 GLN C OE1 1 
ATOM   4656  N NE2 . GLN C  3  116 ? -18.350 25.258  70.534  1.00 69.70  ? 116 GLN C NE2 1 
ATOM   4657  N N   . ARG C  3  117 ? -20.010 25.030  66.204  1.00 77.73  ? 117 ARG C N   1 
ATOM   4658  C CA  . ARG C  3  117 ? -19.729 26.406  65.782  1.00 79.48  ? 117 ARG C CA  1 
ATOM   4659  C C   . ARG C  3  117 ? -20.999 27.225  65.539  1.00 78.57  ? 117 ARG C C   1 
ATOM   4660  O O   . ARG C  3  117 ? -20.991 28.446  65.699  1.00 79.27  ? 117 ARG C O   1 
ATOM   4661  C CB  . ARG C  3  117 ? -18.824 26.429  64.545  1.00 85.36  ? 117 ARG C CB  1 
ATOM   4662  C CG  . ARG C  3  117 ? -17.352 26.193  64.855  1.00 90.13  ? 117 ARG C CG  1 
ATOM   4663  C CD  . ARG C  3  117 ? -16.462 26.416  63.640  1.00 96.57  ? 117 ARG C CD  1 
ATOM   4664  N NE  . ARG C  3  117 ? -16.468 25.278  62.720  1.00 100.70 ? 117 ARG C NE  1 
ATOM   4665  C CZ  . ARG C  3  117 ? -17.109 25.245  61.554  1.00 101.83 ? 117 ARG C CZ  1 
ATOM   4666  N NH1 . ARG C  3  117 ? -17.808 26.294  61.137  1.00 103.57 ? 117 ARG C NH1 1 
ATOM   4667  N NH2 . ARG C  3  117 ? -17.045 24.158  60.796  1.00 99.21  ? 117 ARG C NH2 1 
ATOM   4668  N N   . TYR C  3  118 ? -22.082 26.546  65.163  1.00 78.59  ? 118 TYR C N   1 
ATOM   4669  C CA  . TYR C  3  118 ? -23.376 27.196  64.934  1.00 79.14  ? 118 TYR C CA  1 
ATOM   4670  C C   . TYR C  3  118 ? -24.137 27.493  66.230  1.00 79.71  ? 118 TYR C C   1 
ATOM   4671  O O   . TYR C  3  118 ? -25.140 28.211  66.217  1.00 81.13  ? 118 TYR C O   1 
ATOM   4672  C CB  . TYR C  3  118 ? -24.238 26.361  63.980  1.00 78.61  ? 118 TYR C CB  1 
ATOM   4673  C CG  . TYR C  3  118 ? -24.031 26.690  62.517  1.00 79.80  ? 118 TYR C CG  1 
ATOM   4674  C CD1 . TYR C  3  118 ? -22.860 26.320  61.854  1.00 80.31  ? 118 TYR C CD1 1 
ATOM   4675  C CD2 . TYR C  3  118 ? -25.010 27.369  61.792  1.00 81.32  ? 118 TYR C CD2 1 
ATOM   4676  C CE1 . TYR C  3  118 ? -22.668 26.621  60.514  1.00 81.86  ? 118 TYR C CE1 1 
ATOM   4677  C CE2 . TYR C  3  118 ? -24.828 27.674  60.451  1.00 83.40  ? 118 TYR C CE2 1 
ATOM   4678  C CZ  . TYR C  3  118 ? -23.656 27.298  59.817  1.00 83.04  ? 118 TYR C CZ  1 
ATOM   4679  O OH  . TYR C  3  118 ? -23.470 27.598  58.488  1.00 85.46  ? 118 TYR C OH  1 
ATOM   4680  N N   . THR C  3  119 ? -23.654 26.940  67.341  1.00 78.96  ? 119 THR C N   1 
ATOM   4681  C CA  . THR C  3  119 ? -24.240 27.195  68.658  1.00 77.71  ? 119 THR C CA  1 
ATOM   4682  C C   . THR C  3  119 ? -23.493 28.302  69.409  1.00 76.69  ? 119 THR C C   1 
ATOM   4683  O O   . THR C  3  119 ? -23.771 28.558  70.583  1.00 77.11  ? 119 THR C O   1 
ATOM   4684  C CB  . THR C  3  119 ? -24.270 25.919  69.530  1.00 77.07  ? 119 THR C CB  1 
ATOM   4685  O OG1 . THR C  3  119 ? -22.944 25.397  69.672  1.00 76.76  ? 119 THR C OG1 1 
ATOM   4686  C CG2 . THR C  3  119 ? -25.164 24.857  68.910  1.00 78.97  ? 119 THR C CG2 1 
ATOM   4687  N N   . GLN C  3  120 ? -22.557 28.958  68.726  1.00 75.75  ? 120 GLN C N   1 
ATOM   4688  C CA  . GLN C  3  120 ? -21.712 29.977  69.352  1.00 75.54  ? 120 GLN C CA  1 
ATOM   4689  C C   . GLN C  3  120 ? -21.455 31.189  68.448  1.00 77.07  ? 120 GLN C C   1 
ATOM   4690  O O   . GLN C  3  120 ? -21.009 32.236  68.923  1.00 78.86  ? 120 GLN C O   1 
ATOM   4691  C CB  . GLN C  3  120 ? -20.388 29.352  69.806  1.00 74.10  ? 120 GLN C CB  1 
ATOM   4692  C CG  . GLN C  3  120 ? -19.708 30.073  70.962  1.00 72.70  ? 120 GLN C CG  1 
ATOM   4693  C CD  . GLN C  3  120 ? -18.632 29.238  71.634  1.00 70.38  ? 120 GLN C CD  1 
ATOM   4694  O OE1 . GLN C  3  120 ? -18.063 28.325  71.032  1.00 69.67  ? 120 GLN C OE1 1 
ATOM   4695  N NE2 . GLN C  3  120 ? -18.348 29.550  72.894  1.00 69.80  ? 120 GLN C NE2 1 
ATOM   4696  N N   . SER C  3  121 ? -21.740 31.045  67.155  1.00 77.25  ? 121 SER C N   1 
ATOM   4697  C CA  . SER C  3  121 ? -21.542 32.131  66.191  1.00 77.77  ? 121 SER C CA  1 
ATOM   4698  C C   . SER C  3  121 ? -22.708 33.118  66.182  1.00 75.65  ? 121 SER C C   1 
ATOM   4699  O O   . SER C  3  121 ? -23.845 32.754  66.494  1.00 76.79  ? 121 SER C O   1 
ATOM   4700  C CB  . SER C  3  121 ? -21.317 31.572  64.785  1.00 81.23  ? 121 SER C CB  1 
ATOM   4701  O OG  . SER C  3  121 ? -20.112 30.829  64.719  1.00 84.34  ? 121 SER C OG  1 
ATOM   4702  N N   . ASN C  3  122 ? -22.412 34.365  65.822  1.00 74.80  ? 122 ASN C N   1 
ATOM   4703  C CA  . ASN C  3  122 ? -23.418 35.421  65.744  1.00 74.72  ? 122 ASN C CA  1 
ATOM   4704  C C   . ASN C  3  122 ? -24.343 35.264  64.542  1.00 74.04  ? 122 ASN C C   1 
ATOM   4705  O O   . ASN C  3  122 ? -23.885 35.046  63.418  1.00 73.74  ? 122 ASN C O   1 
ATOM   4706  C CB  . ASN C  3  122 ? -22.748 36.798  65.713  1.00 76.59  ? 122 ASN C CB  1 
ATOM   4707  C CG  . ASN C  3  122 ? -22.204 37.216  67.066  1.00 79.65  ? 122 ASN C CG  1 
ATOM   4708  O OD1 . ASN C  3  122 ? -22.961 37.459  68.006  1.00 79.76  ? 122 ASN C OD1 1 
ATOM   4709  N ND2 . ASN C  3  122 ? -20.884 37.317  67.166  1.00 80.31  ? 122 ASN C ND2 1 
ATOM   4710  N N   . GLY C  3  123 ? -25.646 35.364  64.793  1.00 75.74  ? 123 GLY C N   1 
ATOM   4711  C CA  . GLY C  3  123 ? -26.656 35.328  63.737  1.00 77.73  ? 123 GLY C CA  1 
ATOM   4712  C C   . GLY C  3  123 ? -27.083 33.944  63.280  1.00 78.98  ? 123 GLY C C   1 
ATOM   4713  O O   . GLY C  3  123 ? -28.049 33.810  62.528  1.00 80.71  ? 123 GLY C O   1 
ATOM   4714  N N   . ARG C  3  124 ? -26.369 32.919  63.738  1.00 79.32  ? 124 ARG C N   1 
ATOM   4715  C CA  . ARG C  3  124 ? -26.619 31.542  63.313  1.00 80.69  ? 124 ARG C CA  1 
ATOM   4716  C C   . ARG C  3  124 ? -27.369 30.741  64.373  1.00 80.47  ? 124 ARG C C   1 
ATOM   4717  O O   . ARG C  3  124 ? -27.106 30.877  65.571  1.00 80.83  ? 124 ARG C O   1 
ATOM   4718  C CB  . ARG C  3  124 ? -25.303 30.844  62.959  1.00 83.70  ? 124 ARG C CB  1 
ATOM   4719  C CG  . ARG C  3  124 ? -24.553 31.473  61.794  1.00 89.64  ? 124 ARG C CG  1 
ATOM   4720  C CD  . ARG C  3  124 ? -23.196 30.820  61.593  1.00 94.88  ? 124 ARG C CD  1 
ATOM   4721  N NE  . ARG C  3  124 ? -22.395 31.521  60.591  1.00 105.44 ? 124 ARG C NE  1 
ATOM   4722  C CZ  . ARG C  3  124 ? -21.138 31.215  60.277  1.00 111.81 ? 124 ARG C CZ  1 
ATOM   4723  N NH1 . ARG C  3  124 ? -20.515 30.212  60.884  1.00 112.57 ? 124 ARG C NH1 1 
ATOM   4724  N NH2 . ARG C  3  124 ? -20.499 31.917  59.351  1.00 114.10 ? 124 ARG C NH2 1 
ATOM   4725  N N   . ARG C  3  125 ? -28.303 29.908  63.920  1.00 81.92  ? 125 ARG C N   1 
ATOM   4726  C CA  . ARG C  3  125 ? -29.068 29.030  64.804  1.00 82.25  ? 125 ARG C CA  1 
ATOM   4727  C C   . ARG C  3  125 ? -28.425 27.634  64.852  1.00 83.56  ? 125 ARG C C   1 
ATOM   4728  O O   . ARG C  3  125 ? -27.713 27.250  63.919  1.00 83.46  ? 125 ARG C O   1 
ATOM   4729  C CB  . ARG C  3  125 ? -30.532 28.947  64.343  1.00 82.17  ? 125 ARG C CB  1 
ATOM   4730  C CG  . ARG C  3  125 ? -30.838 27.778  63.419  1.00 83.13  ? 125 ARG C CG  1 
ATOM   4731  C CD  . ARG C  3  125 ? -32.201 27.884  62.764  1.00 83.18  ? 125 ARG C CD  1 
ATOM   4732  N NE  . ARG C  3  125 ? -32.645 26.578  62.281  1.00 83.92  ? 125 ARG C NE  1 
ATOM   4733  C CZ  . ARG C  3  125 ? -33.404 26.383  61.207  1.00 84.98  ? 125 ARG C CZ  1 
ATOM   4734  N NH1 . ARG C  3  125 ? -33.808 27.409  60.471  1.00 83.03  ? 125 ARG C NH1 1 
ATOM   4735  N NH2 . ARG C  3  125 ? -33.751 25.152  60.860  1.00 86.67  ? 125 ARG C NH2 1 
ATOM   4736  N N   . PRO C  3  126 ? -28.660 26.879  65.945  1.00 85.09  ? 126 PRO C N   1 
ATOM   4737  C CA  . PRO C  3  126 ? -28.171 25.499  66.036  1.00 87.18  ? 126 PRO C CA  1 
ATOM   4738  C C   . PRO C  3  126 ? -28.867 24.563  65.049  1.00 89.96  ? 126 PRO C C   1 
ATOM   4739  O O   . PRO C  3  126 ? -30.039 24.769  64.725  1.00 90.10  ? 126 PRO C O   1 
ATOM   4740  C CB  . PRO C  3  126 ? -28.531 25.091  67.470  1.00 85.87  ? 126 PRO C CB  1 
ATOM   4741  C CG  . PRO C  3  126 ? -28.682 26.374  68.213  1.00 85.01  ? 126 PRO C CG  1 
ATOM   4742  C CD  . PRO C  3  126 ? -29.267 27.323  67.214  1.00 84.43  ? 126 PRO C CD  1 
ATOM   4743  N N   . PHE C  3  127 ? -28.144 23.549  64.576  1.00 90.58  ? 127 PHE C N   1 
ATOM   4744  C CA  . PHE C  3  127 ? -28.727 22.519  63.718  1.00 88.26  ? 127 PHE C CA  1 
ATOM   4745  C C   . PHE C  3  127 ? -29.611 21.587  64.541  1.00 89.29  ? 127 PHE C C   1 
ATOM   4746  O O   . PHE C  3  127 ? -29.165 21.016  65.539  1.00 89.97  ? 127 PHE C O   1 
ATOM   4747  C CB  . PHE C  3  127 ? -27.636 21.714  63.005  1.00 84.68  ? 127 PHE C CB  1 
ATOM   4748  C CG  . PHE C  3  127 ? -26.991 22.439  61.857  1.00 80.59  ? 127 PHE C CG  1 
ATOM   4749  C CD1 . PHE C  3  127 ? -25.773 23.088  62.023  1.00 79.90  ? 127 PHE C CD1 1 
ATOM   4750  C CD2 . PHE C  3  127 ? -27.596 22.464  60.603  1.00 79.19  ? 127 PHE C CD2 1 
ATOM   4751  C CE1 . PHE C  3  127 ? -25.173 23.753  60.963  1.00 78.57  ? 127 PHE C CE1 1 
ATOM   4752  C CE2 . PHE C  3  127 ? -27.001 23.128  59.540  1.00 77.20  ? 127 PHE C CE2 1 
ATOM   4753  C CZ  . PHE C  3  127 ? -25.787 23.774  59.721  1.00 76.68  ? 127 PHE C CZ  1 
ATOM   4754  N N   . GLY C  3  128 ? -30.864 21.443  64.120  1.00 87.37  ? 128 GLY C N   1 
ATOM   4755  C CA  . GLY C  3  128 ? -31.828 20.605  64.829  1.00 87.43  ? 128 GLY C CA  1 
ATOM   4756  C C   . GLY C  3  128 ? -31.867 19.177  64.320  1.00 85.87  ? 128 GLY C C   1 
ATOM   4757  O O   . GLY C  3  128 ? -32.941 18.649  64.023  1.00 86.05  ? 128 GLY C O   1 
ATOM   4758  N N   . ILE C  3  129 ? -30.694 18.555  64.220  1.00 84.61  ? 129 ILE C N   1 
ATOM   4759  C CA  . ILE C  3  129 ? -30.573 17.179  63.733  1.00 83.58  ? 129 ILE C CA  1 
ATOM   4760  C C   . ILE C  3  129 ? -29.583 16.341  64.541  1.00 84.74  ? 129 ILE C C   1 
ATOM   4761  O O   . ILE C  3  129 ? -28.685 16.874  65.198  1.00 86.03  ? 129 ILE C O   1 
ATOM   4762  C CB  . ILE C  3  129 ? -30.156 17.112  62.241  1.00 82.49  ? 129 ILE C CB  1 
ATOM   4763  C CG1 . ILE C  3  129 ? -28.910 17.967  61.976  1.00 82.55  ? 129 ILE C CG1 1 
ATOM   4764  C CG2 . ILE C  3  129 ? -31.311 17.510  61.333  1.00 83.15  ? 129 ILE C CG2 1 
ATOM   4765  C CD1 . ILE C  3  129 ? -28.016 17.422  60.884  1.00 82.02  ? 129 ILE C CD1 1 
ATOM   4766  N N   . SER C  3  130 ? -29.769 15.025  64.481  1.00 85.43  ? 130 SER C N   1 
ATOM   4767  C CA  . SER C  3  130 ? -28.806 14.059  64.997  1.00 85.61  ? 130 SER C CA  1 
ATOM   4768  C C   . SER C  3  130 ? -28.452 13.083  63.880  1.00 84.72  ? 130 SER C C   1 
ATOM   4769  O O   . SER C  3  130 ? -29.329 12.645  63.133  1.00 85.64  ? 130 SER C O   1 
ATOM   4770  C CB  . SER C  3  130 ? -29.379 13.311  66.202  1.00 86.91  ? 130 SER C CB  1 
ATOM   4771  O OG  . SER C  3  130 ? -29.575 14.187  67.299  1.00 88.04  ? 130 SER C OG  1 
ATOM   4772  N N   . ALA C  3  131 ? -27.169 12.752  63.766  1.00 84.21  ? 131 ALA C N   1 
ATOM   4773  C CA  . ALA C  3  131 ? -26.687 11.907  62.676  1.00 84.14  ? 131 ALA C CA  1 
ATOM   4774  C C   . ALA C  3  131 ? -26.104 10.593  63.180  1.00 86.55  ? 131 ALA C C   1 
ATOM   4775  O O   . ALA C  3  131 ? -25.330 10.577  64.137  1.00 86.73  ? 131 ALA C O   1 
ATOM   4776  C CB  . ALA C  3  131 ? -25.659 12.659  61.845  1.00 83.64  ? 131 ALA C CB  1 
ATOM   4777  N N   . LEU C  3  132 ? -26.486 9.496   62.530  1.00 89.02  ? 132 LEU C N   1 
ATOM   4778  C CA  . LEU C  3  132 ? -25.925 8.178   62.824  1.00 89.89  ? 132 LEU C CA  1 
ATOM   4779  C C   . LEU C  3  132 ? -24.868 7.807   61.785  1.00 90.70  ? 132 LEU C C   1 
ATOM   4780  O O   . LEU C  3  132 ? -25.180 7.211   60.751  1.00 91.62  ? 132 LEU C O   1 
ATOM   4781  C CB  . LEU C  3  132 ? -27.025 7.111   62.881  1.00 89.51  ? 132 LEU C CB  1 
ATOM   4782  C CG  . LEU C  3  132 ? -27.960 7.069   64.094  1.00 89.61  ? 132 LEU C CG  1 
ATOM   4783  C CD1 . LEU C  3  132 ? -29.177 6.212   63.787  1.00 91.65  ? 132 LEU C CD1 1 
ATOM   4784  C CD2 . LEU C  3  132 ? -27.246 6.558   65.338  1.00 88.99  ? 132 LEU C CD2 1 
ATOM   4785  N N   . ILE C  3  133 ? -23.620 8.170   62.070  1.00 91.48  ? 133 ILE C N   1 
ATOM   4786  C CA  . ILE C  3  133 ? -22.504 7.931   61.153  1.00 92.34  ? 133 ILE C CA  1 
ATOM   4787  C C   . ILE C  3  133 ? -22.054 6.470   61.222  1.00 92.54  ? 133 ILE C C   1 
ATOM   4788  O O   . ILE C  3  133 ? -21.662 5.976   62.283  1.00 93.26  ? 133 ILE C O   1 
ATOM   4789  C CB  . ILE C  3  133 ? -21.314 8.890   61.418  1.00 92.00  ? 133 ILE C CB  1 
ATOM   4790  C CG1 . ILE C  3  133 ? -21.738 10.356  61.260  1.00 92.13  ? 133 ILE C CG1 1 
ATOM   4791  C CG2 . ILE C  3  133 ? -20.158 8.601   60.470  1.00 91.49  ? 133 ILE C CG2 1 
ATOM   4792  C CD1 . ILE C  3  133 ? -22.214 11.020  62.537  1.00 89.63  ? 133 ILE C CD1 1 
ATOM   4793  N N   . VAL C  3  134 ? -22.120 5.793   60.078  1.00 92.36  ? 134 VAL C N   1 
ATOM   4794  C CA  . VAL C  3  134 ? -21.814 4.368   59.978  1.00 92.60  ? 134 VAL C CA  1 
ATOM   4795  C C   . VAL C  3  134 ? -20.767 4.108   58.894  1.00 94.32  ? 134 VAL C C   1 
ATOM   4796  O O   . VAL C  3  134 ? -20.829 4.687   57.807  1.00 94.21  ? 134 VAL C O   1 
ATOM   4797  C CB  . VAL C  3  134 ? -23.100 3.546   59.716  1.00 93.20  ? 134 VAL C CB  1 
ATOM   4798  C CG1 . VAL C  3  134 ? -22.804 2.235   58.998  1.00 96.50  ? 134 VAL C CG1 1 
ATOM   4799  C CG2 . VAL C  3  134 ? -23.835 3.288   61.022  1.00 93.88  ? 134 VAL C CG2 1 
ATOM   4800  N N   . GLY C  3  135 ? -19.804 3.242   59.206  1.00 97.79  ? 135 GLY C N   1 
ATOM   4801  C CA  . GLY C  3  135 ? -18.773 2.858   58.248  1.00 101.63 ? 135 GLY C CA  1 
ATOM   4802  C C   . GLY C  3  135 ? -17.720 1.906   58.784  1.00 105.34 ? 135 GLY C C   1 
ATOM   4803  O O   . GLY C  3  135 ? -17.864 1.349   59.875  1.00 105.83 ? 135 GLY C O   1 
ATOM   4804  N N   . PHE C  3  136 ? -16.659 1.727   58.001  1.00 111.65 ? 136 PHE C N   1 
ATOM   4805  C CA  . PHE C  3  136 ? -15.541 0.863   58.370  1.00 117.32 ? 136 PHE C CA  1 
ATOM   4806  C C   . PHE C  3  136 ? -14.213 1.604   58.264  1.00 123.25 ? 136 PHE C C   1 
ATOM   4807  O O   . PHE C  3  136 ? -14.031 2.448   57.383  1.00 122.68 ? 136 PHE C O   1 
ATOM   4808  C CB  . PHE C  3  136 ? -15.500 -0.380  57.476  1.00 119.93 ? 136 PHE C CB  1 
ATOM   4809  C CG  . PHE C  3  136 ? -16.649 -1.325  57.689  1.00 122.67 ? 136 PHE C CG  1 
ATOM   4810  C CD1 . PHE C  3  136 ? -16.579 -2.320  58.658  1.00 124.22 ? 136 PHE C CD1 1 
ATOM   4811  C CD2 . PHE C  3  136 ? -17.799 -1.229  56.912  1.00 123.89 ? 136 PHE C CD2 1 
ATOM   4812  C CE1 . PHE C  3  136 ? -17.637 -3.195  58.855  1.00 124.85 ? 136 PHE C CE1 1 
ATOM   4813  C CE2 . PHE C  3  136 ? -18.860 -2.101  57.103  1.00 126.66 ? 136 PHE C CE2 1 
ATOM   4814  C CZ  . PHE C  3  136 ? -18.778 -3.085  58.076  1.00 126.35 ? 136 PHE C CZ  1 
ATOM   4815  N N   . ASP C  3  137 ? -13.290 1.276   59.164  1.00 129.25 ? 137 ASP C N   1 
ATOM   4816  C CA  . ASP C  3  137 ? -11.934 1.819   59.125  1.00 137.25 ? 137 ASP C CA  1 
ATOM   4817  C C   . ASP C  3  137 ? -11.076 1.051   58.119  1.00 142.16 ? 137 ASP C C   1 
ATOM   4818  O O   . ASP C  3  137 ? -11.533 0.072   57.522  1.00 141.65 ? 137 ASP C O   1 
ATOM   4819  C CB  . ASP C  3  137 ? -11.299 1.772   60.520  1.00 139.51 ? 137 ASP C CB  1 
ATOM   4820  C CG  . ASP C  3  137 ? -11.946 2.743   61.496  1.00 140.33 ? 137 ASP C CG  1 
ATOM   4821  O OD1 . ASP C  3  137 ? -13.144 3.064   61.334  1.00 129.66 ? 137 ASP C OD1 1 
ATOM   4822  O OD2 . ASP C  3  137 ? -11.252 3.182   62.437  1.00 139.01 ? 137 ASP C OD2 1 
ATOM   4823  N N   . PHE C  3  138 ? -9.835  1.500   57.936  1.00 145.85 ? 138 PHE C N   1 
ATOM   4824  C CA  . PHE C  3  138 ? -8.896  0.844   57.025  1.00 149.52 ? 138 PHE C CA  1 
ATOM   4825  C C   . PHE C  3  138 ? -8.435  -0.511  57.566  1.00 150.72 ? 138 PHE C C   1 
ATOM   4826  O O   . PHE C  3  138 ? -8.019  -1.383  56.800  1.00 153.23 ? 138 PHE C O   1 
ATOM   4827  C CB  . PHE C  3  138 ? -7.693  1.750   56.744  1.00 150.51 ? 138 PHE C CB  1 
ATOM   4828  C CG  . PHE C  3  138 ? -6.972  1.424   55.465  1.00 152.93 ? 138 PHE C CG  1 
ATOM   4829  C CD1 . PHE C  3  138 ? -7.438  1.907   54.245  1.00 152.22 ? 138 PHE C CD1 1 
ATOM   4830  C CD2 . PHE C  3  138 ? -5.822  0.640   55.477  1.00 154.03 ? 138 PHE C CD2 1 
ATOM   4831  C CE1 . PHE C  3  138 ? -6.776  1.609   53.063  1.00 152.09 ? 138 PHE C CE1 1 
ATOM   4832  C CE2 . PHE C  3  138 ? -5.156  0.339   54.297  1.00 154.03 ? 138 PHE C CE2 1 
ATOM   4833  C CZ  . PHE C  3  138 ? -5.633  0.825   53.089  1.00 153.07 ? 138 PHE C CZ  1 
ATOM   4834  N N   . ASP C  3  139 ? -8.517  -0.676  58.886  1.00 150.01 ? 139 ASP C N   1 
ATOM   4835  C CA  . ASP C  3  139 ? -8.203  -1.943  59.546  1.00 149.46 ? 139 ASP C CA  1 
ATOM   4836  C C   . ASP C  3  139 ? -9.273  -3.000  59.279  1.00 143.76 ? 139 ASP C C   1 
ATOM   4837  O O   . ASP C  3  139 ? -8.978  -4.196  59.242  1.00 141.43 ? 139 ASP C O   1 
ATOM   4838  C CB  . ASP C  3  139 ? -8.046  -1.737  61.057  1.00 152.79 ? 139 ASP C CB  1 
ATOM   4839  C CG  . ASP C  3  139 ? -6.833  -0.894  61.415  1.00 157.92 ? 139 ASP C CG  1 
ATOM   4840  O OD1 . ASP C  3  139 ? -6.098  -1.283  62.347  1.00 155.81 ? 139 ASP C OD1 1 
ATOM   4841  O OD2 . ASP C  3  139 ? -6.610  0.155   60.771  1.00 159.66 ? 139 ASP C OD2 1 
ATOM   4842  N N   . GLY C  3  140 ? -10.512 -2.547  59.095  1.00 137.44 ? 140 GLY C N   1 
ATOM   4843  C CA  . GLY C  3  140 ? -11.647 -3.436  58.855  1.00 132.66 ? 140 GLY C CA  1 
ATOM   4844  C C   . GLY C  3  140 ? -12.560 -3.568  60.060  1.00 128.27 ? 140 GLY C C   1 
ATOM   4845  O O   . GLY C  3  140 ? -13.449 -4.421  60.082  1.00 128.61 ? 140 GLY C O   1 
ATOM   4846  N N   . THR C  3  141 ? -12.337 -2.718  61.061  1.00 125.17 ? 141 THR C N   1 
ATOM   4847  C CA  . THR C  3  141 ? -13.121 -2.731  62.293  1.00 122.50 ? 141 THR C CA  1 
ATOM   4848  C C   . THR C  3  141 ? -14.410 -1.924  62.110  1.00 121.77 ? 141 THR C C   1 
ATOM   4849  O O   . THR C  3  141 ? -14.359 -0.767  61.683  1.00 121.30 ? 141 THR C O   1 
ATOM   4850  C CB  . THR C  3  141 ? -12.311 -2.171  63.484  1.00 119.19 ? 141 THR C CB  1 
ATOM   4851  O OG1 . THR C  3  141 ? -10.975 -2.691  63.448  1.00 118.52 ? 141 THR C OG1 1 
ATOM   4852  C CG2 . THR C  3  141 ? -12.959 -2.551  64.814  1.00 117.48 ? 141 THR C CG2 1 
ATOM   4853  N N   . PRO C  3  142 ? -15.570 -2.539  62.420  1.00 122.03 ? 142 PRO C N   1 
ATOM   4854  C CA  . PRO C  3  142 ? -16.873 -1.869  62.325  1.00 121.01 ? 142 PRO C CA  1 
ATOM   4855  C C   . PRO C  3  142 ? -17.022 -0.707  63.311  1.00 119.03 ? 142 PRO C C   1 
ATOM   4856  O O   . PRO C  3  142 ? -16.555 -0.797  64.450  1.00 120.13 ? 142 PRO C O   1 
ATOM   4857  C CB  . PRO C  3  142 ? -17.870 -2.987  62.661  1.00 121.86 ? 142 PRO C CB  1 
ATOM   4858  C CG  . PRO C  3  142 ? -17.079 -4.004  63.410  1.00 123.61 ? 142 PRO C CG  1 
ATOM   4859  C CD  . PRO C  3  142 ? -15.715 -3.957  62.795  1.00 123.50 ? 142 PRO C CD  1 
ATOM   4860  N N   . ARG C  3  143 ? -17.663 0.372   62.862  1.00 115.42 ? 143 ARG C N   1 
ATOM   4861  C CA  . ARG C  3  143 ? -17.861 1.569   63.686  1.00 111.56 ? 143 ARG C CA  1 
ATOM   4862  C C   . ARG C  3  143 ? -19.282 2.128   63.607  1.00 106.02 ? 143 ARG C C   1 
ATOM   4863  O O   . ARG C  3  143 ? -19.937 2.050   62.565  1.00 104.05 ? 143 ARG C O   1 
ATOM   4864  C CB  . ARG C  3  143 ? -16.863 2.670   63.303  1.00 108.65 ? 143 ARG C CB  1 
ATOM   4865  C CG  . ARG C  3  143 ? -15.440 2.476   63.808  1.00 109.36 ? 143 ARG C CG  1 
ATOM   4866  C CD  . ARG C  3  143 ? -15.355 2.433   65.330  1.00 110.01 ? 143 ARG C CD  1 
ATOM   4867  N NE  . ARG C  3  143 ? -14.016 2.761   65.826  1.00 113.33 ? 143 ARG C NE  1 
ATOM   4868  C CZ  . ARG C  3  143 ? -12.934 2.000   65.666  1.00 114.89 ? 143 ARG C CZ  1 
ATOM   4869  N NH1 . ARG C  3  143 ? -13.003 0.848   65.010  1.00 115.92 ? 143 ARG C NH1 1 
ATOM   4870  N NH2 . ARG C  3  143 ? -11.769 2.398   66.161  1.00 114.44 ? 143 ARG C NH2 1 
ATOM   4871  N N   . LEU C  3  144 ? -19.737 2.697   64.721  1.00 102.76 ? 144 LEU C N   1 
ATOM   4872  C CA  . LEU C  3  144 ? -21.034 3.364   64.802  1.00 100.99 ? 144 LEU C CA  1 
ATOM   4873  C C   . LEU C  3  144 ? -20.932 4.593   65.703  1.00 98.18  ? 144 LEU C C   1 
ATOM   4874  O O   . LEU C  3  144 ? -20.535 4.489   66.865  1.00 98.40  ? 144 LEU C O   1 
ATOM   4875  C CB  . LEU C  3  144 ? -22.108 2.397   65.318  1.00 101.17 ? 144 LEU C CB  1 
ATOM   4876  C CG  . LEU C  3  144 ? -23.456 2.943   65.810  1.00 101.07 ? 144 LEU C CG  1 
ATOM   4877  C CD1 . LEU C  3  144 ? -24.297 3.509   64.675  1.00 98.89  ? 144 LEU C CD1 1 
ATOM   4878  C CD2 . LEU C  3  144 ? -24.223 1.857   66.545  1.00 103.35 ? 144 LEU C CD2 1 
ATOM   4879  N N   . TYR C  3  145 ? -21.291 5.750   65.153  1.00 94.00  ? 145 TYR C N   1 
ATOM   4880  C CA  . TYR C  3  145 ? -21.218 7.020   65.875  1.00 91.16  ? 145 TYR C CA  1 
ATOM   4881  C C   . TYR C  3  145 ? -22.527 7.799   65.772  1.00 90.21  ? 145 TYR C C   1 
ATOM   4882  O O   . TYR C  3  145 ? -23.284 7.629   64.814  1.00 90.44  ? 145 TYR C O   1 
ATOM   4883  C CB  . TYR C  3  145 ? -20.072 7.876   65.330  1.00 88.65  ? 145 TYR C CB  1 
ATOM   4884  C CG  . TYR C  3  145 ? -18.688 7.415   65.730  1.00 87.64  ? 145 TYR C CG  1 
ATOM   4885  C CD1 . TYR C  3  145 ? -17.999 6.469   64.972  1.00 89.36  ? 145 TYR C CD1 1 
ATOM   4886  C CD2 . TYR C  3  145 ? -18.059 7.937   66.860  1.00 87.45  ? 145 TYR C CD2 1 
ATOM   4887  C CE1 . TYR C  3  145 ? -16.728 6.048   65.333  1.00 89.58  ? 145 TYR C CE1 1 
ATOM   4888  C CE2 . TYR C  3  145 ? -16.787 7.524   67.229  1.00 88.35  ? 145 TYR C CE2 1 
ATOM   4889  C CZ  . TYR C  3  145 ? -16.127 6.580   66.463  1.00 89.61  ? 145 TYR C CZ  1 
ATOM   4890  O OH  . TYR C  3  145 ? -14.866 6.165   66.825  1.00 91.81  ? 145 TYR C OH  1 
ATOM   4891  N N   . GLN C  3  146 ? -22.787 8.650   66.764  1.00 88.39  ? 146 GLN C N   1 
ATOM   4892  C CA  . GLN C  3  146 ? -23.949 9.541   66.736  1.00 88.11  ? 146 GLN C CA  1 
ATOM   4893  C C   . GLN C  3  146 ? -23.617 10.943  67.252  1.00 86.07  ? 146 GLN C C   1 
ATOM   4894  O O   . GLN C  3  146 ? -22.798 11.103  68.160  1.00 87.49  ? 146 GLN C O   1 
ATOM   4895  C CB  . GLN C  3  146 ? -25.146 8.926   67.481  1.00 90.10  ? 146 GLN C CB  1 
ATOM   4896  C CG  . GLN C  3  146 ? -25.067 8.945   69.003  1.00 93.53  ? 146 GLN C CG  1 
ATOM   4897  C CD  . GLN C  3  146 ? -25.765 10.144  69.623  1.00 93.68  ? 146 GLN C CD  1 
ATOM   4898  O OE1 . GLN C  3  146 ? -26.780 10.624  69.114  1.00 92.10  ? 146 GLN C OE1 1 
ATOM   4899  N NE2 . GLN C  3  146 ? -25.227 10.628  70.737  1.00 95.61  ? 146 GLN C NE2 1 
ATOM   4900  N N   . THR C  3  147 ? -24.254 11.949  66.658  1.00 84.00  ? 147 THR C N   1 
ATOM   4901  C CA  . THR C  3  147 ? -24.045 13.347  67.038  1.00 83.15  ? 147 THR C CA  1 
ATOM   4902  C C   . THR C  3  147 ? -25.342 13.988  67.531  1.00 85.11  ? 147 THR C C   1 
ATOM   4903  O O   . THR C  3  147 ? -26.418 13.405  67.397  1.00 86.09  ? 147 THR C O   1 
ATOM   4904  C CB  . THR C  3  147 ? -23.480 14.181  65.867  1.00 80.87  ? 147 THR C CB  1 
ATOM   4905  O OG1 . THR C  3  147 ? -24.296 13.995  64.704  1.00 80.66  ? 147 THR C OG1 1 
ATOM   4906  C CG2 . THR C  3  147 ? -22.046 13.774  65.551  1.00 81.43  ? 147 THR C CG2 1 
ATOM   4907  N N   . ASP C  3  148 ? -25.229 15.184  68.105  1.00 87.25  ? 148 ASP C N   1 
ATOM   4908  C CA  . ASP C  3  148 ? -26.390 15.936  68.581  1.00 90.79  ? 148 ASP C CA  1 
ATOM   4909  C C   . ASP C  3  148 ? -26.205 17.444  68.348  1.00 89.70  ? 148 ASP C C   1 
ATOM   4910  O O   . ASP C  3  148 ? -25.077 17.897  68.134  1.00 88.16  ? 148 ASP C O   1 
ATOM   4911  C CB  . ASP C  3  148 ? -26.667 15.625  70.062  1.00 93.75  ? 148 ASP C CB  1 
ATOM   4912  C CG  . ASP C  3  148 ? -25.618 16.204  70.999  1.00 97.26  ? 148 ASP C CG  1 
ATOM   4913  O OD1 . ASP C  3  148 ? -24.419 16.212  70.645  1.00 97.01  ? 148 ASP C OD1 1 
ATOM   4914  O OD2 . ASP C  3  148 ? -25.999 16.646  72.103  1.00 100.84 ? 148 ASP C OD2 1 
ATOM   4915  N N   . PRO C  3  149 ? -27.312 18.220  68.376  1.00 90.02  ? 149 PRO C N   1 
ATOM   4916  C CA  . PRO C  3  149 ? -27.299 19.675  68.176  1.00 89.85  ? 149 PRO C CA  1 
ATOM   4917  C C   . PRO C  3  149 ? -26.187 20.438  68.907  1.00 89.07  ? 149 PRO C C   1 
ATOM   4918  O O   . PRO C  3  149 ? -25.675 21.424  68.370  1.00 87.84  ? 149 PRO C O   1 
ATOM   4919  C CB  . PRO C  3  149 ? -28.664 20.099  68.712  1.00 91.29  ? 149 PRO C CB  1 
ATOM   4920  C CG  . PRO C  3  149 ? -29.545 18.948  68.377  1.00 92.14  ? 149 PRO C CG  1 
ATOM   4921  C CD  . PRO C  3  149 ? -28.695 17.710  68.481  1.00 91.46  ? 149 PRO C CD  1 
ATOM   4922  N N   . SER C  3  150 ? -25.824 19.990  70.109  1.00 88.27  ? 150 SER C N   1 
ATOM   4923  C CA  . SER C  3  150 ? -24.775 20.639  70.901  1.00 87.48  ? 150 SER C CA  1 
ATOM   4924  C C   . SER C  3  150 ? -23.390 20.491  70.269  1.00 87.85  ? 150 SER C C   1 
ATOM   4925  O O   . SER C  3  150 ? -22.573 21.412  70.327  1.00 88.26  ? 150 SER C O   1 
ATOM   4926  C CB  . SER C  3  150 ? -24.766 20.105  72.338  1.00 85.57  ? 150 SER C CB  1 
ATOM   4927  O OG  . SER C  3  150 ? -24.362 18.748  72.383  1.00 85.49  ? 150 SER C OG  1 
ATOM   4928  N N   . GLY C  3  151 ? -23.140 19.331  69.666  1.00 87.63  ? 151 GLY C N   1 
ATOM   4929  C CA  . GLY C  3  151 ? -21.867 19.051  69.006  1.00 86.67  ? 151 GLY C CA  1 
ATOM   4930  C C   . GLY C  3  151 ? -21.022 18.025  69.737  1.00 87.34  ? 151 GLY C C   1 
ATOM   4931  O O   . GLY C  3  151 ? -19.792 18.109  69.737  1.00 86.56  ? 151 GLY C O   1 
ATOM   4932  N N   . THR C  3  152 ? -21.688 17.053  70.358  1.00 87.97  ? 152 THR C N   1 
ATOM   4933  C CA  . THR C  3  152 ? -21.015 15.994  71.103  1.00 88.54  ? 152 THR C CA  1 
ATOM   4934  C C   . THR C  3  152 ? -21.208 14.660  70.386  1.00 87.40  ? 152 THR C C   1 
ATOM   4935  O O   . THR C  3  152 ? -22.329 14.302  70.017  1.00 89.85  ? 152 THR C O   1 
ATOM   4936  C CB  . THR C  3  152 ? -21.553 15.884  72.546  1.00 90.39  ? 152 THR C CB  1 
ATOM   4937  O OG1 . THR C  3  152 ? -21.900 17.185  73.038  1.00 91.40  ? 152 THR C OG1 1 
ATOM   4938  C CG2 . THR C  3  152 ? -20.509 15.259  73.464  1.00 90.66  ? 152 THR C CG2 1 
ATOM   4939  N N   . TYR C  3  153 ? -20.112 13.932  70.188  1.00 84.22  ? 153 TYR C N   1 
ATOM   4940  C CA  . TYR C  3  153 ? -20.165 12.645  69.498  1.00 83.58  ? 153 TYR C CA  1 
ATOM   4941  C C   . TYR C  3  153 ? -19.691 11.488  70.375  1.00 84.35  ? 153 TYR C C   1 
ATOM   4942  O O   . TYR C  3  153 ? -18.742 11.630  71.151  1.00 84.93  ? 153 TYR C O   1 
ATOM   4943  C CB  . TYR C  3  153 ? -19.387 12.695  68.175  1.00 82.51  ? 153 TYR C CB  1 
ATOM   4944  C CG  . TYR C  3  153 ? -17.890 12.893  68.313  1.00 83.34  ? 153 TYR C CG  1 
ATOM   4945  C CD1 . TYR C  3  153 ? -17.020 11.803  68.310  1.00 83.82  ? 153 TYR C CD1 1 
ATOM   4946  C CD2 . TYR C  3  153 ? -17.342 14.171  68.431  1.00 82.74  ? 153 TYR C CD2 1 
ATOM   4947  C CE1 . TYR C  3  153 ? -15.650 11.979  68.432  1.00 83.85  ? 153 TYR C CE1 1 
ATOM   4948  C CE2 . TYR C  3  153 ? -15.974 14.357  68.552  1.00 83.70  ? 153 TYR C CE2 1 
ATOM   4949  C CZ  . TYR C  3  153 ? -15.133 13.259  68.553  1.00 83.35  ? 153 TYR C CZ  1 
ATOM   4950  O OH  . TYR C  3  153 ? -13.774 13.438  68.674  1.00 84.68  ? 153 TYR C OH  1 
ATOM   4951  N N   . HIS C  3  154 ? -20.368 10.349  70.246  1.00 85.03  ? 154 HIS C N   1 
ATOM   4952  C CA  . HIS C  3  154 ? -20.044 9.143   71.007  1.00 86.11  ? 154 HIS C CA  1 
ATOM   4953  C C   . HIS C  3  154 ? -20.130 7.921   70.141  1.00 86.79  ? 154 HIS C C   1 
ATOM   4954  O O   . HIS C  3  154 ? -20.960 7.854   69.231  1.00 88.90  ? 154 HIS C O   1 
ATOM   4955  C CB  . HIS C  3  154 ? -20.985 8.991   72.199  1.00 88.62  ? 154 HIS C CB  1 
ATOM   4956  C CG  . HIS C  3  154 ? -20.898 10.119  73.198  1.00 91.70  ? 154 HIS C CG  1 
ATOM   4957  N ND1 . HIS C  3  154 ? -19.966 10.158  74.167  1.00 93.91  ? 154 HIS C ND1 1 
ATOM   4958  C CD2 . HIS C  3  154 ? -21.672 11.268  73.351  1.00 93.54  ? 154 HIS C CD2 1 
ATOM   4959  C CE1 . HIS C  3  154 ? -20.130 11.273  74.903  1.00 95.18  ? 154 HIS C CE1 1 
ATOM   4960  N NE2 . HIS C  3  154 ? -21.175 11.951  74.403  1.00 94.70  ? 154 HIS C NE2 1 
ATOM   4961  N N   . ALA C  3  155 ? -19.269 6.944   70.416  1.00 88.34  ? 155 ALA C N   1 
ATOM   4962  C CA  . ALA C  3  155 ? -19.318 5.655   69.730  1.00 90.75  ? 155 ALA C CA  1 
ATOM   4963  C C   . ALA C  3  155 ? -20.313 4.726   70.417  1.00 94.58  ? 155 ALA C C   1 
ATOM   4964  O O   . ALA C  3  155 ? -20.398 4.691   71.647  1.00 96.70  ? 155 ALA C O   1 
ATOM   4965  C CB  . ALA C  3  155 ? -17.938 5.019   69.675  1.00 92.50  ? 155 ALA C CB  1 
ATOM   4966  N N   . TRP C  3  156 ? -21.065 3.979   69.613  1.00 98.95  ? 156 TRP C N   1 
ATOM   4967  C CA  . TRP C  3  156 ? -22.105 3.088   70.123  1.00 103.38 ? 156 TRP C CA  1 
ATOM   4968  C C   . TRP C  3  156 ? -22.017 1.709   69.537  1.00 106.20 ? 156 TRP C C   1 
ATOM   4969  O O   . TRP C  3  156 ? -21.427 1.510   68.472  1.00 105.54 ? 156 TRP C O   1 
ATOM   4970  C CB  . TRP C  3  156 ? -23.485 3.674   69.843  1.00 106.09 ? 156 TRP C CB  1 
ATOM   4971  C CG  . TRP C  3  156 ? -23.846 4.857   70.708  1.00 108.27 ? 156 TRP C CG  1 
ATOM   4972  C CD1 . TRP C  3  156 ? -23.403 6.171   70.580  1.00 104.96 ? 156 TRP C CD1 1 
ATOM   4973  C CD2 . TRP C  3  156 ? -24.757 4.876   71.863  1.00 112.32 ? 156 TRP C CD2 1 
ATOM   4974  N NE1 . TRP C  3  156 ? -23.953 6.972   71.548  1.00 108.42 ? 156 TRP C NE1 1 
ATOM   4975  C CE2 . TRP C  3  156 ? -24.775 6.261   72.349  1.00 112.70 ? 156 TRP C CE2 1 
ATOM   4976  C CE3 . TRP C  3  156 ? -25.527 3.921   72.520  1.00 115.97 ? 156 TRP C CE3 1 
ATOM   4977  C CZ2 . TRP C  3  156 ? -25.537 6.647   73.443  1.00 115.31 ? 156 TRP C CZ2 1 
ATOM   4978  C CZ3 . TRP C  3  156 ? -26.291 4.323   73.623  1.00 118.90 ? 156 TRP C CZ3 1 
ATOM   4979  C CH2 . TRP C  3  156 ? -26.294 5.654   74.072  1.00 118.10 ? 156 TRP C CH2 1 
ATOM   4980  N N   . LYS C  3  157 ? -22.599 0.743   70.243  1.00 107.19 ? 157 LYS C N   1 
ATOM   4981  C CA  . LYS C  3  157 ? -22.773 -0.610  69.723  1.00 108.81 ? 157 LYS C CA  1 
ATOM   4982  C C   . LYS C  3  157 ? -24.144 -0.723  69.061  1.00 108.82 ? 157 LYS C C   1 
ATOM   4983  O O   . LYS C  3  157 ? -24.298 -1.400  68.043  1.00 109.52 ? 157 LYS C O   1 
ATOM   4984  C CB  . LYS C  3  157 ? -22.636 -1.647  70.842  1.00 109.25 ? 157 LYS C CB  1 
ATOM   4985  C CG  . LYS C  3  157 ? -21.230 -1.785  71.408  1.00 107.07 ? 157 LYS C CG  1 
ATOM   4986  C CD  . LYS C  3  157 ? -21.143 -2.884  72.459  1.00 101.17 ? 157 LYS C CD  1 
ATOM   4987  C CE  . LYS C  3  157 ? -21.651 -2.429  73.820  1.00 87.43  ? 157 LYS C CE  1 
ATOM   4988  N NZ  . LYS C  3  157 ? -20.735 -1.450  74.469  1.00 105.97 ? 157 LYS C NZ  1 
ATOM   4989  N N   . ALA C  3  158 ? -25.128 -0.048  69.653  1.00 110.01 ? 158 ALA C N   1 
ATOM   4990  C CA  . ALA C  3  158 ? -26.494 0.015   69.135  1.00 109.96 ? 158 ALA C CA  1 
ATOM   4991  C C   . ALA C  3  158 ? -27.197 1.241   69.711  1.00 108.46 ? 158 ALA C C   1 
ATOM   4992  O O   . ALA C  3  158 ? -27.242 1.418   70.931  1.00 111.20 ? 158 ALA C O   1 
ATOM   4993  C CB  . ALA C  3  158 ? -27.258 -1.254  69.488  1.00 112.61 ? 158 ALA C CB  1 
ATOM   4994  N N   . ASN C  3  159 ? -27.736 2.089   68.838  1.00 105.00 ? 159 ASN C N   1 
ATOM   4995  C CA  . ASN C  3  159 ? -28.395 3.322   69.274  1.00 103.54 ? 159 ASN C CA  1 
ATOM   4996  C C   . ASN C  3  159 ? -29.544 3.761   68.369  1.00 101.10 ? 159 ASN C C   1 
ATOM   4997  O O   . ASN C  3  159 ? -29.561 3.452   67.175  1.00 100.77 ? 159 ASN C O   1 
ATOM   4998  C CB  . ASN C  3  159 ? -27.371 4.457   69.413  1.00 105.38 ? 159 ASN C CB  1 
ATOM   4999  C CG  . ASN C  3  159 ? -27.846 5.569   70.334  1.00 106.02 ? 159 ASN C CG  1 
ATOM   5000  O OD1 . ASN C  3  159 ? -28.492 5.319   71.353  1.00 106.95 ? 159 ASN C OD1 1 
ATOM   5001  N ND2 . ASN C  3  159 ? -27.520 6.805   69.980  1.00 105.10 ? 159 ASN C ND2 1 
ATOM   5002  N N   . ALA C  3  160 ? -30.498 4.484   68.953  1.00 101.10 ? 160 ALA C N   1 
ATOM   5003  C CA  . ALA C  3  160 ? -31.650 5.006   68.223  1.00 101.59 ? 160 ALA C CA  1 
ATOM   5004  C C   . ALA C  3  160 ? -31.885 6.487   68.513  1.00 100.84 ? 160 ALA C C   1 
ATOM   5005  O O   . ALA C  3  160 ? -31.663 6.953   69.633  1.00 100.98 ? 160 ALA C O   1 
ATOM   5006  C CB  . ALA C  3  160 ? -32.894 4.200   68.553  1.00 103.67 ? 160 ALA C CB  1 
ATOM   5007  N N   . ILE C  3  161 ? -32.336 7.214   67.492  1.00 100.30 ? 161 ILE C N   1 
ATOM   5008  C CA  . ILE C  3  161 ? -32.631 8.646   67.605  1.00 99.35  ? 161 ILE C CA  1 
ATOM   5009  C C   . ILE C  3  161 ? -33.966 9.000   66.948  1.00 99.47  ? 161 ILE C C   1 
ATOM   5010  O O   . ILE C  3  161 ? -34.349 8.399   65.942  1.00 100.40 ? 161 ILE C O   1 
ATOM   5011  C CB  . ILE C  3  161 ? -31.510 9.523   66.997  1.00 97.16  ? 161 ILE C CB  1 
ATOM   5012  C CG1 . ILE C  3  161 ? -31.051 8.961   65.644  1.00 96.54  ? 161 ILE C CG1 1 
ATOM   5013  C CG2 . ILE C  3  161 ? -30.341 9.646   67.967  1.00 96.54  ? 161 ILE C CG2 1 
ATOM   5014  C CD1 . ILE C  3  161 ? -30.408 9.978   64.727  1.00 94.28  ? 161 ILE C CD1 1 
ATOM   5015  N N   . GLY C  3  162 ? -34.665 9.976   67.523  1.00 99.28  ? 162 GLY C N   1 
ATOM   5016  C CA  . GLY C  3  162 ? -35.949 10.435  66.993  1.00 100.97 ? 162 GLY C CA  1 
ATOM   5017  C C   . GLY C  3  162 ? -37.103 10.221  67.954  1.00 104.64 ? 162 GLY C C   1 
ATOM   5018  O O   . GLY C  3  162 ? -36.920 10.252  69.173  1.00 106.44 ? 162 GLY C O   1 
ATOM   5019  N N   . ARG C  3  163 ? -38.295 10.010  67.400  1.00 108.51 ? 163 ARG C N   1 
ATOM   5020  C CA  . ARG C  3  163 ? -39.491 9.749   68.199  1.00 113.17 ? 163 ARG C CA  1 
ATOM   5021  C C   . ARG C  3  163 ? -39.513 8.299   68.677  1.00 115.05 ? 163 ARG C C   1 
ATOM   5022  O O   . ARG C  3  163 ? -39.417 7.368   67.875  1.00 115.68 ? 163 ARG C O   1 
ATOM   5023  C CB  . ARG C  3  163 ? -40.761 10.102  67.408  1.00 117.09 ? 163 ARG C CB  1 
ATOM   5024  C CG  . ARG C  3  163 ? -42.084 9.706   68.060  1.00 123.83 ? 163 ARG C CG  1 
ATOM   5025  C CD  . ARG C  3  163 ? -42.342 10.392  69.397  1.00 130.63 ? 163 ARG C CD  1 
ATOM   5026  N NE  . ARG C  3  163 ? -42.673 11.811  69.263  1.00 136.24 ? 163 ARG C NE  1 
ATOM   5027  C CZ  . ARG C  3  163 ? -41.917 12.810  69.711  1.00 136.44 ? 163 ARG C CZ  1 
ATOM   5028  N NH1 . ARG C  3  163 ? -40.771 12.565  70.336  1.00 135.46 ? 163 ARG C NH1 1 
ATOM   5029  N NH2 . ARG C  3  163 ? -42.313 14.064  69.540  1.00 139.16 ? 163 ARG C NH2 1 
ATOM   5030  N N   . GLY C  3  164 ? -39.636 8.124   69.990  1.00 116.25 ? 164 GLY C N   1 
ATOM   5031  C CA  . GLY C  3  164 ? -39.597 6.802   70.608  1.00 118.57 ? 164 GLY C CA  1 
ATOM   5032  C C   . GLY C  3  164 ? -38.192 6.229   70.650  1.00 118.97 ? 164 GLY C C   1 
ATOM   5033  O O   . GLY C  3  164 ? -38.008 5.013   70.569  1.00 120.60 ? 164 GLY C O   1 
ATOM   5034  N N   . ALA C  3  165 ? -37.204 7.113   70.775  1.00 117.66 ? 165 ALA C N   1 
ATOM   5035  C CA  . ALA C  3  165 ? -35.796 6.722   70.841  1.00 116.90 ? 165 ALA C CA  1 
ATOM   5036  C C   . ALA C  3  165 ? -35.466 6.024   72.158  1.00 119.78 ? 165 ALA C C   1 
ATOM   5037  O O   . ALA C  3  165 ? -34.587 5.162   72.206  1.00 121.57 ? 165 ALA C O   1 
ATOM   5038  C CB  . ALA C  3  165 ? -34.899 7.933   70.642  1.00 113.45 ? 165 ALA C CB  1 
ATOM   5039  N N   . LYS C  3  166 ? -36.178 6.407   73.216  1.00 121.60 ? 166 LYS C N   1 
ATOM   5040  C CA  . LYS C  3  166 ? -36.010 5.814   74.540  1.00 125.29 ? 166 LYS C CA  1 
ATOM   5041  C C   . LYS C  3  166 ? -36.583 4.396   74.589  1.00 126.82 ? 166 LYS C C   1 
ATOM   5042  O O   . LYS C  3  166 ? -36.092 3.547   75.336  1.00 129.37 ? 166 LYS C O   1 
ATOM   5043  C CB  . LYS C  3  166 ? -36.680 6.693   75.599  1.00 129.07 ? 166 LYS C CB  1 
ATOM   5044  C CG  . LYS C  3  166 ? -36.175 6.473   77.018  1.00 132.48 ? 166 LYS C CG  1 
ATOM   5045  C CD  . LYS C  3  166 ? -36.912 7.347   78.024  1.00 134.92 ? 166 LYS C CD  1 
ATOM   5046  C CE  . LYS C  3  166 ? -36.443 8.794   77.975  1.00 134.36 ? 166 LYS C CE  1 
ATOM   5047  N NZ  . LYS C  3  166 ? -37.185 9.653   78.939  1.00 135.47 ? 166 LYS C NZ  1 
ATOM   5048  N N   . SER C  3  167 ? -37.620 4.156   73.788  1.00 125.96 ? 167 SER C N   1 
ATOM   5049  C CA  . SER C  3  167 ? -38.279 2.851   73.714  1.00 125.66 ? 167 SER C CA  1 
ATOM   5050  C C   . SER C  3  167 ? -37.417 1.804   73.007  1.00 124.41 ? 167 SER C C   1 
ATOM   5051  O O   . SER C  3  167 ? -37.407 0.636   73.399  1.00 123.31 ? 167 SER C O   1 
ATOM   5052  C CB  . SER C  3  167 ? -39.636 2.976   73.017  1.00 126.63 ? 167 SER C CB  1 
ATOM   5053  O OG  . SER C  3  167 ? -40.489 3.867   73.715  1.00 125.56 ? 167 SER C OG  1 
ATOM   5054  N N   . VAL C  3  168 ? -36.702 2.231   71.968  1.00 123.05 ? 168 VAL C N   1 
ATOM   5055  C CA  . VAL C  3  168 ? -35.816 1.345   71.208  1.00 122.08 ? 168 VAL C CA  1 
ATOM   5056  C C   . VAL C  3  168 ? -34.504 1.104   71.963  1.00 125.99 ? 168 VAL C C   1 
ATOM   5057  O O   . VAL C  3  168 ? -33.937 0.010   71.896  1.00 127.73 ? 168 VAL C O   1 
ATOM   5058  C CB  . VAL C  3  168 ? -35.530 1.893   69.788  1.00 118.08 ? 168 VAL C CB  1 
ATOM   5059  C CG1 . VAL C  3  168 ? -34.721 0.896   68.971  1.00 116.37 ? 168 VAL C CG1 1 
ATOM   5060  C CG2 . VAL C  3  168 ? -36.828 2.217   69.064  1.00 118.89 ? 168 VAL C CG2 1 
ATOM   5061  N N   . ARG C  3  169 ? -34.036 2.127   72.678  1.00 130.30 ? 169 ARG C N   1 
ATOM   5062  C CA  . ARG C  3  169 ? -32.816 2.033   73.485  1.00 136.78 ? 169 ARG C CA  1 
ATOM   5063  C C   . ARG C  3  169 ? -32.952 0.984   74.591  1.00 139.36 ? 169 ARG C C   1 
ATOM   5064  O O   . ARG C  3  169 ? -32.050 0.169   74.793  1.00 140.64 ? 169 ARG C O   1 
ATOM   5065  C CB  . ARG C  3  169 ? -32.447 3.401   74.078  1.00 139.50 ? 169 ARG C CB  1 
ATOM   5066  C CG  . ARG C  3  169 ? -31.176 3.405   74.917  1.00 142.07 ? 169 ARG C CG  1 
ATOM   5067  C CD  . ARG C  3  169 ? -30.861 4.783   75.476  1.00 141.44 ? 169 ARG C CD  1 
ATOM   5068  N NE  . ARG C  3  169 ? -30.130 5.615   74.521  1.00 139.88 ? 169 ARG C NE  1 
ATOM   5069  C CZ  . ARG C  3  169 ? -30.673 6.575   73.777  1.00 138.74 ? 169 ARG C CZ  1 
ATOM   5070  N NH1 . ARG C  3  169 ? -31.969 6.848   73.867  1.00 139.96 ? 169 ARG C NH1 1 
ATOM   5071  N NH2 . ARG C  3  169 ? -29.915 7.270   72.940  1.00 137.56 ? 169 ARG C NH2 1 
ATOM   5072  N N   . GLU C  3  170 ? -34.086 1.008   75.291  1.00 140.99 ? 170 GLU C N   1 
ATOM   5073  C CA  . GLU C  3  170 ? -34.376 0.045   76.356  1.00 144.09 ? 170 GLU C CA  1 
ATOM   5074  C C   . GLU C  3  170 ? -34.585 -1.370  75.815  1.00 143.41 ? 170 GLU C C   1 
ATOM   5075  O O   . GLU C  3  170 ? -34.331 -2.352  76.516  1.00 145.12 ? 170 GLU C O   1 
ATOM   5076  C CB  . GLU C  3  170 ? -35.592 0.490   77.174  1.00 146.90 ? 170 GLU C CB  1 
ATOM   5077  C CG  . GLU C  3  170 ? -35.322 1.671   78.096  1.00 148.80 ? 170 GLU C CG  1 
ATOM   5078  C CD  . GLU C  3  170 ? -36.539 2.080   78.906  1.00 152.29 ? 170 GLU C CD  1 
ATOM   5079  O OE1 . GLU C  3  170 ? -36.455 2.061   80.152  1.00 153.26 ? 170 GLU C OE1 1 
ATOM   5080  O OE2 . GLU C  3  170 ? -37.580 2.419   78.302  1.00 151.60 ? 170 GLU C OE2 1 
ATOM   5081  N N   . PHE C  3  171 ? -35.052 -1.461  74.571  1.00 140.86 ? 171 PHE C N   1 
ATOM   5082  C CA  . PHE C  3  171 ? -35.194 -2.737  73.874  1.00 139.39 ? 171 PHE C CA  1 
ATOM   5083  C C   . PHE C  3  171 ? -33.824 -3.294  73.485  1.00 138.99 ? 171 PHE C C   1 
ATOM   5084  O O   . PHE C  3  171 ? -33.594 -4.501  73.560  1.00 140.67 ? 171 PHE C O   1 
ATOM   5085  C CB  . PHE C  3  171 ? -36.081 -2.571  72.633  1.00 138.61 ? 171 PHE C CB  1 
ATOM   5086  C CG  . PHE C  3  171 ? -36.331 -3.851  71.881  1.00 140.09 ? 171 PHE C CG  1 
ATOM   5087  C CD1 . PHE C  3  171 ? -37.320 -4.737  72.297  1.00 142.14 ? 171 PHE C CD1 1 
ATOM   5088  C CD2 . PHE C  3  171 ? -35.586 -4.165  70.748  1.00 139.88 ? 171 PHE C CD2 1 
ATOM   5089  C CE1 . PHE C  3  171 ? -37.554 -5.915  71.603  1.00 144.98 ? 171 PHE C CE1 1 
ATOM   5090  C CE2 . PHE C  3  171 ? -35.815 -5.341  70.051  1.00 141.82 ? 171 PHE C CE2 1 
ATOM   5091  C CZ  . PHE C  3  171 ? -36.801 -6.217  70.479  1.00 144.40 ? 171 PHE C CZ  1 
ATOM   5092  N N   . LEU C  3  172 ? -32.925 -2.401  73.076  1.00 136.56 ? 172 LEU C N   1 
ATOM   5093  C CA  . LEU C  3  172 ? -31.573 -2.775  72.658  1.00 134.87 ? 172 LEU C CA  1 
ATOM   5094  C C   . LEU C  3  172 ? -30.653 -3.104  73.834  1.00 136.48 ? 172 LEU C C   1 
ATOM   5095  O O   . LEU C  3  172 ? -29.676 -3.837  73.674  1.00 136.00 ? 172 LEU C O   1 
ATOM   5096  C CB  . LEU C  3  172 ? -30.961 -1.671  71.786  1.00 130.23 ? 172 LEU C CB  1 
ATOM   5097  C CG  . LEU C  3  172 ? -31.044 -1.763  70.254  1.00 125.79 ? 172 LEU C CG  1 
ATOM   5098  C CD1 . LEU C  3  172 ? -32.298 -2.470  69.755  1.00 128.87 ? 172 LEU C CD1 1 
ATOM   5099  C CD2 . LEU C  3  172 ? -30.935 -0.377  69.639  1.00 119.31 ? 172 LEU C CD2 1 
ATOM   5100  N N   . GLU C  3  173 ? -30.972 -2.561  75.009  1.00 137.66 ? 173 GLU C N   1 
ATOM   5101  C CA  . GLU C  3  173 ? -30.224 -2.848  76.236  1.00 139.33 ? 173 GLU C CA  1 
ATOM   5102  C C   . GLU C  3  173 ? -30.452 -4.280  76.726  1.00 141.10 ? 173 GLU C C   1 
ATOM   5103  O O   . GLU C  3  173 ? -29.641 -4.822  77.482  1.00 140.29 ? 173 GLU C O   1 
ATOM   5104  C CB  . GLU C  3  173 ? -30.597 -1.853  77.339  1.00 141.16 ? 173 GLU C CB  1 
ATOM   5105  C CG  . GLU C  3  173 ? -29.928 -0.492  77.212  1.00 140.03 ? 173 GLU C CG  1 
ATOM   5106  C CD  . GLU C  3  173 ? -30.475 0.535   78.189  1.00 142.09 ? 173 GLU C CD  1 
ATOM   5107  O OE1 . GLU C  3  173 ? -29.670 1.304   78.753  1.00 138.93 ? 173 GLU C OE1 1 
ATOM   5108  O OE2 . GLU C  3  173 ? -31.707 0.580   78.395  1.00 144.16 ? 173 GLU C OE2 1 
ATOM   5109  N N   . LYS C  3  174 ? -31.555 -4.881  76.284  1.00 141.87 ? 174 LYS C N   1 
ATOM   5110  C CA  . LYS C  3  174 ? -31.941 -6.231  76.694  1.00 143.07 ? 174 LYS C CA  1 
ATOM   5111  C C   . LYS C  3  174 ? -31.699 -7.269  75.596  1.00 143.89 ? 174 LYS C C   1 
ATOM   5112  O O   . LYS C  3  174 ? -31.697 -8.472  75.866  1.00 144.54 ? 174 LYS C O   1 
ATOM   5113  C CB  . LYS C  3  174 ? -33.418 -6.257  77.106  1.00 143.74 ? 174 LYS C CB  1 
ATOM   5114  C CG  . LYS C  3  174 ? -33.793 -5.325  78.254  1.00 144.01 ? 174 LYS C CG  1 
ATOM   5115  C CD  . LYS C  3  174 ? -33.895 -6.051  79.588  1.00 144.63 ? 174 LYS C CD  1 
ATOM   5116  C CE  . LYS C  3  174 ? -32.578 -6.066  80.346  1.00 142.18 ? 174 LYS C CE  1 
ATOM   5117  N NZ  . LYS C  3  174 ? -32.766 -6.634  81.709  1.00 140.91 ? 174 LYS C NZ  1 
ATOM   5118  N N   . ASN C  3  175 ? -31.494 -6.800  74.365  1.00 143.45 ? 175 ASN C N   1 
ATOM   5119  C CA  . ASN C  3  175 ? -31.380 -7.686  73.202  1.00 144.21 ? 175 ASN C CA  1 
ATOM   5120  C C   . ASN C  3  175 ? -29.971 -7.858  72.632  1.00 144.14 ? 175 ASN C C   1 
ATOM   5121  O O   . ASN C  3  175 ? -29.636 -8.929  72.122  1.00 144.77 ? 175 ASN C O   1 
ATOM   5122  C CB  . ASN C  3  175 ? -32.338 -7.243  72.089  1.00 144.86 ? 175 ASN C CB  1 
ATOM   5123  C CG  . ASN C  3  175 ? -33.763 -7.712  72.320  1.00 147.35 ? 175 ASN C CG  1 
ATOM   5124  O OD1 . ASN C  3  175 ? -34.267 -8.569  71.595  1.00 149.56 ? 175 ASN C OD1 1 
ATOM   5125  N ND2 . ASN C  3  175 ? -34.418 -7.156  73.334  1.00 146.15 ? 175 ASN C ND2 1 
ATOM   5126  N N   . TYR C  3  176 ? -29.159 -6.805  72.713  1.00 141.52 ? 176 TYR C N   1 
ATOM   5127  C CA  . TYR C  3  176 ? -27.821 -6.808  72.117  1.00 139.20 ? 176 TYR C CA  1 
ATOM   5128  C C   . TYR C  3  176 ? -26.854 -7.745  72.847  1.00 140.81 ? 176 TYR C C   1 
ATOM   5129  O O   . TYR C  3  176 ? -26.323 -7.413  73.911  1.00 139.16 ? 176 TYR C O   1 
ATOM   5130  C CB  . TYR C  3  176 ? -27.252 -5.385  72.039  1.00 133.81 ? 176 TYR C CB  1 
ATOM   5131  C CG  . TYR C  3  176 ? -26.009 -5.259  71.181  1.00 129.63 ? 176 TYR C CG  1 
ATOM   5132  C CD1 . TYR C  3  176 ? -26.106 -5.070  69.802  1.00 126.10 ? 176 TYR C CD1 1 
ATOM   5133  C CD2 . TYR C  3  176 ? -24.736 -5.325  71.748  1.00 127.47 ? 176 TYR C CD2 1 
ATOM   5134  C CE1 . TYR C  3  176 ? -24.971 -4.954  69.013  1.00 122.72 ? 176 TYR C CE1 1 
ATOM   5135  C CE2 . TYR C  3  176 ? -23.596 -5.211  70.968  1.00 121.03 ? 176 TYR C CE2 1 
ATOM   5136  C CZ  . TYR C  3  176 ? -23.718 -5.025  69.602  1.00 120.00 ? 176 TYR C CZ  1 
ATOM   5137  O OH  . TYR C  3  176 ? -22.587 -4.910  68.827  1.00 116.65 ? 176 TYR C OH  1 
ATOM   5138  N N   . THR C  3  177 ? -26.646 -8.920  72.258  1.00 142.26 ? 177 THR C N   1 
ATOM   5139  C CA  . THR C  3  177 ? -25.704 -9.918  72.767  1.00 142.90 ? 177 THR C CA  1 
ATOM   5140  C C   . THR C  3  177 ? -24.850 -10.463 71.621  1.00 145.66 ? 177 THR C C   1 
ATOM   5141  O O   . THR C  3  177 ? -25.077 -10.121 70.458  1.00 145.58 ? 177 THR C O   1 
ATOM   5142  C CB  . THR C  3  177 ? -26.428 -11.090 73.466  1.00 141.46 ? 177 THR C CB  1 
ATOM   5143  O OG1 . THR C  3  177 ? -27.507 -11.552 72.643  1.00 140.77 ? 177 THR C OG1 1 
ATOM   5144  C CG2 . THR C  3  177 ? -26.975 -10.665 74.825  1.00 140.59 ? 177 THR C CG2 1 
ATOM   5145  N N   . ASP C  3  178 ? -23.874 -11.307 71.954  1.00 148.53 ? 178 ASP C N   1 
ATOM   5146  C CA  . ASP C  3  178 ? -23.012 -11.948 70.956  1.00 151.66 ? 178 ASP C CA  1 
ATOM   5147  C C   . ASP C  3  178 ? -23.787 -12.896 70.042  1.00 154.57 ? 178 ASP C C   1 
ATOM   5148  O O   . ASP C  3  178 ? -23.430 -13.073 68.875  1.00 154.13 ? 178 ASP C O   1 
ATOM   5149  C CB  . ASP C  3  178 ? -21.866 -12.703 71.635  1.00 153.15 ? 178 ASP C CB  1 
ATOM   5150  C CG  . ASP C  3  178 ? -20.841 -11.776 72.261  1.00 153.37 ? 178 ASP C CG  1 
ATOM   5151  O OD1 . ASP C  3  178 ? -19.633 -11.987 72.025  1.00 150.04 ? 178 ASP C OD1 1 
ATOM   5152  O OD2 . ASP C  3  178 ? -21.237 -10.839 72.986  1.00 154.60 ? 178 ASP C OD2 1 
ATOM   5153  N N   . ASP C  3  179 ? -24.842 -13.500 70.584  1.00 157.98 ? 179 ASP C N   1 
ATOM   5154  C CA  . ASP C  3  179 ? -25.706 -14.406 69.829  1.00 162.75 ? 179 ASP C CA  1 
ATOM   5155  C C   . ASP C  3  179 ? -26.613 -13.653 68.857  1.00 160.82 ? 179 ASP C C   1 
ATOM   5156  O O   . ASP C  3  179 ? -26.987 -14.188 67.811  1.00 163.47 ? 179 ASP C O   1 
ATOM   5157  C CB  . ASP C  3  179 ? -26.548 -15.261 70.781  1.00 169.11 ? 179 ASP C CB  1 
ATOM   5158  C CG  . ASP C  3  179 ? -25.703 -16.185 71.644  1.00 173.79 ? 179 ASP C CG  1 
ATOM   5159  O OD1 . ASP C  3  179 ? -25.799 -16.090 72.886  1.00 174.27 ? 179 ASP C OD1 1 
ATOM   5160  O OD2 . ASP C  3  179 ? -24.940 -17.002 71.084  1.00 176.12 ? 179 ASP C OD2 1 
ATOM   5161  N N   . ALA C  3  180 ? -26.958 -12.415 69.209  1.00 156.07 ? 180 ALA C N   1 
ATOM   5162  C CA  . ALA C  3  180 ? -27.811 -11.568 68.375  1.00 152.64 ? 180 ALA C CA  1 
ATOM   5163  C C   . ALA C  3  180 ? -27.084 -11.071 67.125  1.00 150.04 ? 180 ALA C C   1 
ATOM   5164  O O   . ALA C  3  180 ? -27.700 -10.896 66.071  1.00 148.55 ? 180 ALA C O   1 
ATOM   5165  C CB  . ALA C  3  180 ? -28.347 -10.395 69.182  1.00 149.01 ? 180 ALA C CB  1 
ATOM   5166  N N   . ILE C  3  181 ? -25.778 -10.847 67.253  1.00 149.37 ? 181 ILE C N   1 
ATOM   5167  C CA  . ILE C  3  181 ? -24.948 -10.380 66.137  1.00 146.84 ? 181 ILE C CA  1 
ATOM   5168  C C   . ILE C  3  181 ? -24.009 -11.476 65.614  1.00 150.05 ? 181 ILE C C   1 
ATOM   5169  O O   . ILE C  3  181 ? -22.936 -11.186 65.075  1.00 151.55 ? 181 ILE C O   1 
ATOM   5170  C CB  . ILE C  3  181 ? -24.154 -9.096  66.497  1.00 142.92 ? 181 ILE C CB  1 
ATOM   5171  C CG1 . ILE C  3  181 ? -23.300 -9.307  67.758  1.00 143.66 ? 181 ILE C CG1 1 
ATOM   5172  C CG2 . ILE C  3  181 ? -25.102 -7.913  66.662  1.00 140.41 ? 181 ILE C CG2 1 
ATOM   5173  C CD1 . ILE C  3  181 ? -22.162 -8.319  67.917  1.00 143.28 ? 181 ILE C CD1 1 
ATOM   5174  N N   . GLU C  3  182 ? -24.433 -12.730 65.766  1.00 152.73 ? 182 GLU C N   1 
ATOM   5175  C CA  . GLU C  3  182 ? -23.637 -13.892 65.365  1.00 154.91 ? 182 GLU C CA  1 
ATOM   5176  C C   . GLU C  3  182 ? -23.425 -13.953 63.850  1.00 155.57 ? 182 GLU C C   1 
ATOM   5177  O O   . GLU C  3  182 ? -22.289 -14.058 63.382  1.00 153.22 ? 182 GLU C O   1 
ATOM   5178  C CB  . GLU C  3  182 ? -24.290 -15.186 65.869  1.00 155.75 ? 182 GLU C CB  1 
ATOM   5179  C CG  . GLU C  3  182 ? -23.413 -16.429 65.771  1.00 156.07 ? 182 GLU C CG  1 
ATOM   5180  C CD  . GLU C  3  182 ? -22.441 -16.573 66.930  1.00 154.00 ? 182 GLU C CD  1 
ATOM   5181  O OE1 . GLU C  3  182 ? -22.853 -16.373 68.093  1.00 153.48 ? 182 GLU C OE1 1 
ATOM   5182  O OE2 . GLU C  3  182 ? -21.264 -16.907 66.677  1.00 153.05 ? 182 GLU C OE2 1 
ATOM   5183  N N   . THR C  3  183 ? -24.520 -13.882 63.095  1.00 157.05 ? 183 THR C N   1 
ATOM   5184  C CA  . THR C  3  183 ? -24.466 -13.937 61.632  1.00 157.67 ? 183 THR C CA  1 
ATOM   5185  C C   . THR C  3  183 ? -24.932 -12.626 60.998  1.00 152.31 ? 183 THR C C   1 
ATOM   5186  O O   . THR C  3  183 ? -25.467 -11.751 61.683  1.00 149.70 ? 183 THR C O   1 
ATOM   5187  C CB  . THR C  3  183 ? -25.297 -15.113 61.072  1.00 160.60 ? 183 THR C CB  1 
ATOM   5188  O OG1 . THR C  3  183 ? -26.622 -15.070 61.616  1.00 159.78 ? 183 THR C OG1 1 
ATOM   5189  C CG2 . THR C  3  183 ? -24.650 -16.449 61.421  1.00 161.11 ? 183 THR C CG2 1 
ATOM   5190  N N   . ASP C  3  184 ? -24.722 -12.501 59.688  1.00 149.70 ? 184 ASP C N   1 
ATOM   5191  C CA  . ASP C  3  184 ? -25.087 -11.298 58.936  1.00 145.18 ? 184 ASP C CA  1 
ATOM   5192  C C   . ASP C  3  184 ? -26.599 -11.080 58.847  1.00 145.33 ? 184 ASP C C   1 
ATOM   5193  O O   . ASP C  3  184 ? -27.062 -9.940  58.809  1.00 139.71 ? 184 ASP C O   1 
ATOM   5194  C CB  . ASP C  3  184 ? -24.480 -11.337 57.529  1.00 143.14 ? 184 ASP C CB  1 
ATOM   5195  C CG  . ASP C  3  184 ? -22.963 -11.225 57.538  1.00 141.47 ? 184 ASP C CG  1 
ATOM   5196  O OD1 . ASP C  3  184 ? -22.308 -11.917 58.349  1.00 143.56 ? 184 ASP C OD1 1 
ATOM   5197  O OD2 . ASP C  3  184 ? -22.423 -10.448 56.723  1.00 139.69 ? 184 ASP C OD2 1 
ATOM   5198  N N   . ASP C  3  185 ? -27.357 -12.173 58.809  1.00 148.45 ? 185 ASP C N   1 
ATOM   5199  C CA  . ASP C  3  185 ? -28.817 -12.106 58.743  1.00 149.78 ? 185 ASP C CA  1 
ATOM   5200  C C   . ASP C  3  185 ? -29.443 -11.731 60.086  1.00 148.58 ? 185 ASP C C   1 
ATOM   5201  O O   . ASP C  3  185 ? -30.457 -11.033 60.128  1.00 148.67 ? 185 ASP C O   1 
ATOM   5202  C CB  . ASP C  3  185 ? -29.399 -13.431 58.238  1.00 153.28 ? 185 ASP C CB  1 
ATOM   5203  C CG  . ASP C  3  185 ? -29.095 -13.685 56.771  1.00 156.03 ? 185 ASP C CG  1 
ATOM   5204  O OD1 . ASP C  3  185 ? -30.040 -13.999 56.017  1.00 157.86 ? 185 ASP C OD1 1 
ATOM   5205  O OD2 . ASP C  3  185 ? -27.918 -13.572 56.367  1.00 155.01 ? 185 ASP C OD2 1 
ATOM   5206  N N   . LEU C  3  186 ? -28.830 -12.195 61.174  1.00 149.98 ? 186 LEU C N   1 
ATOM   5207  C CA  . LEU C  3  186 ? -29.328 -11.937 62.529  1.00 149.07 ? 186 LEU C CA  1 
ATOM   5208  C C   . LEU C  3  186 ? -29.099 -10.501 63.002  1.00 141.98 ? 186 LEU C C   1 
ATOM   5209  O O   . LEU C  3  186 ? -29.782 -10.030 63.915  1.00 138.30 ? 186 LEU C O   1 
ATOM   5210  C CB  . LEU C  3  186 ? -28.728 -12.935 63.528  1.00 153.75 ? 186 LEU C CB  1 
ATOM   5211  C CG  . LEU C  3  186 ? -29.552 -14.174 63.906  1.00 159.16 ? 186 LEU C CG  1 
ATOM   5212  C CD1 . LEU C  3  186 ? -29.794 -15.106 62.725  1.00 158.90 ? 186 LEU C CD1 1 
ATOM   5213  C CD2 . LEU C  3  186 ? -28.878 -14.925 65.044  1.00 159.98 ? 186 LEU C CD2 1 
ATOM   5214  N N   . THR C  3  187 ? -28.141 -9.813  62.381  1.00 137.91 ? 187 THR C N   1 
ATOM   5215  C CA  . THR C  3  187 ? -27.890 -8.398  62.664  1.00 132.84 ? 187 THR C CA  1 
ATOM   5216  C C   . THR C  3  187 ? -28.995 -7.521  62.077  1.00 125.74 ? 187 THR C C   1 
ATOM   5217  O O   . THR C  3  187 ? -29.415 -6.544  62.700  1.00 123.06 ? 187 THR C O   1 
ATOM   5218  C CB  . THR C  3  187 ? -26.527 -7.926  62.116  1.00 135.78 ? 187 THR C CB  1 
ATOM   5219  O OG1 . THR C  3  187 ? -26.420 -8.270  60.730  1.00 139.65 ? 187 THR C OG1 1 
ATOM   5220  C CG2 . THR C  3  187 ? -25.380 -8.567  62.883  1.00 138.23 ? 187 THR C CG2 1 
ATOM   5221  N N   . ILE C  3  188 ? -29.456 -7.882  60.880  1.00 120.98 ? 188 ILE C N   1 
ATOM   5222  C CA  . ILE C  3  188 ? -30.541 -7.172  60.198  1.00 116.79 ? 188 ILE C CA  1 
ATOM   5223  C C   . ILE C  3  188 ? -31.879 -7.444  60.890  1.00 121.71 ? 188 ILE C C   1 
ATOM   5224  O O   . ILE C  3  188 ? -32.714 -6.545  61.018  1.00 121.91 ? 188 ILE C O   1 
ATOM   5225  C CB  . ILE C  3  188 ? -30.627 -7.555  58.700  1.00 111.99 ? 188 ILE C CB  1 
ATOM   5226  C CG1 . ILE C  3  188 ? -29.249 -7.445  58.032  1.00 110.40 ? 188 ILE C CG1 1 
ATOM   5227  C CG2 . ILE C  3  188 ? -31.643 -6.681  57.973  1.00 112.10 ? 188 ILE C CG2 1 
ATOM   5228  C CD1 . ILE C  3  188 ? -29.134 -8.173  56.708  1.00 112.57 ? 188 ILE C CD1 1 
ATOM   5229  N N   . LYS C  3  189 ? -32.065 -8.685  61.341  1.00 127.54 ? 189 LYS C N   1 
ATOM   5230  C CA  . LYS C  3  189 ? -33.274 -9.096  62.061  1.00 134.79 ? 189 LYS C CA  1 
ATOM   5231  C C   . LYS C  3  189 ? -33.424 -8.383  63.405  1.00 131.17 ? 189 LYS C C   1 
ATOM   5232  O O   . LYS C  3  189 ? -34.539 -8.204  63.896  1.00 132.90 ? 189 LYS C O   1 
ATOM   5233  C CB  . LYS C  3  189 ? -33.289 -10.613 62.271  1.00 143.99 ? 189 LYS C CB  1 
ATOM   5234  C CG  . LYS C  3  189 ? -33.634 -11.418 61.028  1.00 152.64 ? 189 LYS C CG  1 
ATOM   5235  C CD  . LYS C  3  189 ? -33.475 -12.909 61.280  1.00 158.37 ? 189 LYS C CD  1 
ATOM   5236  C CE  . LYS C  3  189 ? -33.738 -13.713 60.018  1.00 161.82 ? 189 LYS C CE  1 
ATOM   5237  N NZ  . LYS C  3  189 ? -33.473 -15.164 60.219  1.00 164.71 ? 189 LYS C NZ  1 
ATOM   5238  N N   . LEU C  3  190 ? -32.295 -7.983  63.989  1.00 127.87 ? 190 LEU C N   1 
ATOM   5239  C CA  . LEU C  3  190 ? -32.281 -7.238  65.247  1.00 124.83 ? 190 LEU C CA  1 
ATOM   5240  C C   . LEU C  3  190 ? -32.799 -5.811  65.061  1.00 125.05 ? 190 LEU C C   1 
ATOM   5241  O O   . LEU C  3  190 ? -33.416 -5.247  65.968  1.00 125.48 ? 190 LEU C O   1 
ATOM   5242  C CB  . LEU C  3  190 ? -30.866 -7.221  65.842  1.00 121.61 ? 190 LEU C CB  1 
ATOM   5243  C CG  . LEU C  3  190 ? -30.671 -6.739  67.285  1.00 118.86 ? 190 LEU C CG  1 
ATOM   5244  C CD1 . LEU C  3  190 ? -31.182 -7.761  68.292  1.00 120.49 ? 190 LEU C CD1 1 
ATOM   5245  C CD2 . LEU C  3  190 ? -29.206 -6.425  67.544  1.00 117.90 ? 190 LEU C CD2 1 
ATOM   5246  N N   . VAL C  3  191 ? -32.546 -5.240  63.884  1.00 125.51 ? 191 VAL C N   1 
ATOM   5247  C CA  . VAL C  3  191 ? -32.995 -3.886  63.549  1.00 125.80 ? 191 VAL C CA  1 
ATOM   5248  C C   . VAL C  3  191 ? -34.513 -3.847  63.366  1.00 127.24 ? 191 VAL C C   1 
ATOM   5249  O O   . VAL C  3  191 ? -35.191 -3.005  63.957  1.00 127.57 ? 191 VAL C O   1 
ATOM   5250  C CB  . VAL C  3  191 ? -32.304 -3.343  62.273  1.00 124.36 ? 191 VAL C CB  1 
ATOM   5251  C CG1 . VAL C  3  191 ? -32.640 -1.875  62.057  1.00 122.52 ? 191 VAL C CG1 1 
ATOM   5252  C CG2 . VAL C  3  191 ? -30.797 -3.516  62.359  1.00 120.97 ? 191 VAL C CG2 1 
ATOM   5253  N N   . ILE C  3  192 ? -35.031 -4.769  62.555  1.00 128.29 ? 192 ILE C N   1 
ATOM   5254  C CA  . ILE C  3  192 ? -36.462 -4.842  62.240  1.00 129.80 ? 192 ILE C CA  1 
ATOM   5255  C C   . ILE C  3  192 ? -37.300 -5.138  63.487  1.00 133.81 ? 192 ILE C C   1 
ATOM   5256  O O   . ILE C  3  192 ? -38.391 -4.587  63.653  1.00 137.03 ? 192 ILE C O   1 
ATOM   5257  C CB  . ILE C  3  192 ? -36.746 -5.886  61.134  1.00 130.03 ? 192 ILE C CB  1 
ATOM   5258  C CG1 . ILE C  3  192 ? -35.821 -5.653  59.934  1.00 127.16 ? 192 ILE C CG1 1 
ATOM   5259  C CG2 . ILE C  3  192 ? -38.205 -5.827  60.693  1.00 130.88 ? 192 ILE C CG2 1 
ATOM   5260  C CD1 . ILE C  3  192 ? -35.584 -6.875  59.073  1.00 130.57 ? 192 ILE C CD1 1 
ATOM   5261  N N   . LYS C  3  193 ? -36.775 -5.995  64.362  1.00 136.02 ? 193 LYS C N   1 
ATOM   5262  C CA  . LYS C  3  193 ? -37.423 -6.323  65.632  1.00 139.93 ? 193 LYS C CA  1 
ATOM   5263  C C   . LYS C  3  193 ? -37.484 -5.100  66.552  1.00 140.24 ? 193 LYS C C   1 
ATOM   5264  O O   . LYS C  3  193 ? -38.413 -4.957  67.350  1.00 141.18 ? 193 LYS C O   1 
ATOM   5265  C CB  . LYS C  3  193 ? -36.684 -7.471  66.323  1.00 140.51 ? 193 LYS C CB  1 
ATOM   5266  C CG  . LYS C  3  193 ? -37.527 -8.267  67.309  1.00 139.96 ? 193 LYS C CG  1 
ATOM   5267  C CD  . LYS C  3  193 ? -36.751 -9.434  67.905  1.00 137.17 ? 193 LYS C CD  1 
ATOM   5268  C CE  . LYS C  3  193 ? -36.658 -10.610 66.942  1.00 135.90 ? 193 LYS C CE  1 
ATOM   5269  N NZ  . LYS C  3  193 ? -35.944 -11.768 67.546  1.00 136.36 ? 193 LYS C NZ  1 
ATOM   5270  N N   . ALA C  3  194 ? -36.487 -4.226  66.426  1.00 137.70 ? 194 ALA C N   1 
ATOM   5271  C CA  . ALA C  3  194 ? -36.424 -2.985  67.194  1.00 137.23 ? 194 ALA C CA  1 
ATOM   5272  C C   . ALA C  3  194 ? -37.316 -1.898  66.598  1.00 138.46 ? 194 ALA C C   1 
ATOM   5273  O O   . ALA C  3  194 ? -37.885 -1.086  67.332  1.00 140.34 ? 194 ALA C O   1 
ATOM   5274  C CB  . ALA C  3  194 ? -34.988 -2.498  67.290  1.00 132.21 ? 194 ALA C CB  1 
ATOM   5275  N N   . LEU C  3  195 ? -37.429 -1.888  65.271  1.00 137.76 ? 195 LEU C N   1 
ATOM   5276  C CA  . LEU C  3  195 ? -38.245 -0.904  64.557  1.00 137.54 ? 195 LEU C CA  1 
ATOM   5277  C C   . LEU C  3  195 ? -39.740 -1.108  64.799  1.00 140.76 ? 195 LEU C C   1 
ATOM   5278  O O   . LEU C  3  195 ? -40.490 -0.137  64.921  1.00 141.01 ? 195 LEU C O   1 
ATOM   5279  C CB  . LEU C  3  195 ? -37.945 -0.940  63.053  1.00 134.93 ? 195 LEU C CB  1 
ATOM   5280  C CG  . LEU C  3  195 ? -36.582 -0.429  62.573  1.00 129.17 ? 195 LEU C CG  1 
ATOM   5281  C CD1 . LEU C  3  195 ? -36.209 -1.062  61.242  1.00 130.51 ? 195 LEU C CD1 1 
ATOM   5282  C CD2 . LEU C  3  195 ? -36.553 1.088   62.472  1.00 124.13 ? 195 LEU C CD2 1 
ATOM   5283  N N   . LEU C  3  196 ? -40.156 -2.371  64.880  1.00 142.66 ? 196 LEU C N   1 
ATOM   5284  C CA  . LEU C  3  196 ? -41.564 -2.739  65.064  1.00 144.35 ? 196 LEU C CA  1 
ATOM   5285  C C   . LEU C  3  196 ? -42.120 -2.385  66.448  1.00 143.36 ? 196 LEU C C   1 
ATOM   5286  O O   . LEU C  3  196 ? -43.332 -2.453  66.670  1.00 143.64 ? 196 LEU C O   1 
ATOM   5287  C CB  . LEU C  3  196 ? -41.766 -4.233  64.781  1.00 147.73 ? 196 LEU C CB  1 
ATOM   5288  C CG  . LEU C  3  196 ? -41.756 -4.696  63.319  1.00 150.20 ? 196 LEU C CG  1 
ATOM   5289  C CD1 . LEU C  3  196 ? -41.394 -6.170  63.219  1.00 151.00 ? 196 LEU C CD1 1 
ATOM   5290  C CD2 . LEU C  3  196 ? -43.095 -4.427  62.647  1.00 153.30 ? 196 LEU C CD2 1 
ATOM   5291  N N   . GLU C  3  197 ? -41.232 -2.010  67.366  1.00 142.82 ? 197 GLU C N   1 
ATOM   5292  C CA  . GLU C  3  197 ? -41.616 -1.641  68.730  1.00 144.33 ? 197 GLU C CA  1 
ATOM   5293  C C   . GLU C  3  197 ? -42.347 -0.300  68.804  1.00 144.15 ? 197 GLU C C   1 
ATOM   5294  O O   . GLU C  3  197 ? -43.223 -0.113  69.651  1.00 147.19 ? 197 GLU C O   1 
ATOM   5295  C CB  . GLU C  3  197 ? -40.389 -1.619  69.648  1.00 147.06 ? 197 GLU C CB  1 
ATOM   5296  C CG  . GLU C  3  197 ? -39.859 -2.995  70.030  1.00 152.00 ? 197 GLU C CG  1 
ATOM   5297  C CD  . GLU C  3  197 ? -40.758 -3.729  71.011  1.00 156.87 ? 197 GLU C CD  1 
ATOM   5298  O OE1 . GLU C  3  197 ? -41.189 -3.116  72.011  1.00 155.93 ? 197 GLU C OE1 1 
ATOM   5299  O OE2 . GLU C  3  197 ? -41.026 -4.928  70.786  1.00 158.23 ? 197 GLU C OE2 1 
ATOM   5300  N N   . VAL C  3  198 ? -41.983 0.625   67.917  1.00 143.58 ? 198 VAL C N   1 
ATOM   5301  C CA  . VAL C  3  198 ? -42.557 1.974   67.914  1.00 144.06 ? 198 VAL C CA  1 
ATOM   5302  C C   . VAL C  3  198 ? -43.486 2.201   66.717  1.00 145.18 ? 198 VAL C C   1 
ATOM   5303  O O   . VAL C  3  198 ? -44.564 2.783   66.868  1.00 147.08 ? 198 VAL C O   1 
ATOM   5304  C CB  . VAL C  3  198 ? -41.458 3.066   67.963  1.00 141.27 ? 198 VAL C CB  1 
ATOM   5305  C CG1 . VAL C  3  198 ? -42.071 4.458   68.043  1.00 140.74 ? 198 VAL C CG1 1 
ATOM   5306  C CG2 . VAL C  3  198 ? -40.531 2.840   69.149  1.00 138.72 ? 198 VAL C CG2 1 
ATOM   5307  N N   . VAL C  3  199 ? -43.070 1.736   65.539  1.00 146.18 ? 199 VAL C N   1 
ATOM   5308  C CA  . VAL C  3  199 ? -43.842 1.925   64.306  1.00 149.98 ? 199 VAL C CA  1 
ATOM   5309  C C   . VAL C  3  199 ? -45.176 1.169   64.348  1.00 154.81 ? 199 VAL C C   1 
ATOM   5310  O O   . VAL C  3  199 ? -45.269 0.086   64.933  1.00 157.01 ? 199 VAL C O   1 
ATOM   5311  C CB  . VAL C  3  199 ? -43.010 1.569   63.043  1.00 148.79 ? 199 VAL C CB  1 
ATOM   5312  C CG1 . VAL C  3  199 ? -42.990 0.067   62.783  1.00 147.41 ? 199 VAL C CG1 1 
ATOM   5313  C CG2 . VAL C  3  199 ? -43.527 2.323   61.824  1.00 149.80 ? 199 VAL C CG2 1 
ATOM   5314  N N   . GLN C  3  200 ? -46.203 1.758   63.742  1.00 159.42 ? 200 GLN C N   1 
ATOM   5315  C CA  . GLN C  3  200 ? -47.533 1.161   63.712  1.00 166.77 ? 200 GLN C CA  1 
ATOM   5316  C C   . GLN C  3  200 ? -47.640 0.165   62.557  1.00 168.03 ? 200 GLN C C   1 
ATOM   5317  O O   . GLN C  3  200 ? -47.817 0.560   61.401  1.00 168.32 ? 200 GLN C O   1 
ATOM   5318  C CB  . GLN C  3  200 ? -48.606 2.252   63.605  1.00 170.09 ? 200 GLN C CB  1 
ATOM   5319  C CG  . GLN C  3  200 ? -49.990 1.841   64.094  1.00 174.40 ? 200 GLN C CG  1 
ATOM   5320  C CD  . GLN C  3  200 ? -50.764 1.013   63.084  1.00 177.35 ? 200 GLN C CD  1 
ATOM   5321  O OE1 . GLN C  3  200 ? -50.725 1.278   61.881  1.00 177.94 ? 200 GLN C OE1 1 
ATOM   5322  N NE2 . GLN C  3  200 ? -51.480 0.007   63.570  1.00 178.96 ? 200 GLN C NE2 1 
ATOM   5323  N N   . SER C  3  201 ? -47.521 -1.122  62.892  1.00 167.98 ? 201 SER C N   1 
ATOM   5324  C CA  . SER C  3  201 ? -47.600 -2.232  61.931  1.00 166.53 ? 201 SER C CA  1 
ATOM   5325  C C   . SER C  3  201 ? -46.676 -2.047  60.721  1.00 163.82 ? 201 SER C C   1 
ATOM   5326  O O   . SER C  3  201 ? -47.102 -1.580  59.660  1.00 162.93 ? 201 SER C O   1 
ATOM   5327  C CB  . SER C  3  201 ? -49.051 -2.476  61.494  1.00 165.73 ? 201 SER C CB  1 
ATOM   5328  O OG  . SER C  3  201 ? -49.173 -3.688  60.774  1.00 167.78 ? 201 SER C OG  1 
ATOM   5329  N N   . GLY C  3  202 ? -45.412 -2.425  60.894  1.00 162.14 ? 202 GLY C N   1 
ATOM   5330  C CA  . GLY C  3  202 ? -44.382 -2.198  59.884  1.00 160.00 ? 202 GLY C CA  1 
ATOM   5331  C C   . GLY C  3  202 ? -44.421 -3.120  58.680  1.00 162.93 ? 202 GLY C C   1 
ATOM   5332  O O   . GLY C  3  202 ? -45.415 -3.811  58.438  1.00 163.29 ? 202 GLY C O   1 
ATOM   5333  N N   . GLY C  3  203 ? -43.324 -3.126  57.927  1.00 166.04 ? 203 GLY C N   1 
ATOM   5334  C CA  . GLY C  3  203 ? -43.223 -3.893  56.689  1.00 168.81 ? 203 GLY C CA  1 
ATOM   5335  C C   . GLY C  3  203 ? -42.931 -2.985  55.511  1.00 170.59 ? 203 GLY C C   1 
ATOM   5336  O O   . GLY C  3  203 ? -41.896 -3.117  54.855  1.00 171.89 ? 203 GLY C O   1 
ATOM   5337  N N   . LYS C  3  204 ? -43.854 -2.062  55.248  1.00 167.83 ? 204 LYS C N   1 
ATOM   5338  C CA  . LYS C  3  204 ? -43.695 -1.067  54.187  1.00 163.74 ? 204 LYS C CA  1 
ATOM   5339  C C   . LYS C  3  204 ? -43.192 0.272   54.725  1.00 154.85 ? 204 LYS C C   1 
ATOM   5340  O O   . LYS C  3  204 ? -42.728 1.121   53.960  1.00 155.20 ? 204 LYS C O   1 
ATOM   5341  C CB  . LYS C  3  204 ? -45.013 -0.871  53.428  1.00 167.22 ? 204 LYS C CB  1 
ATOM   5342  C CG  . LYS C  3  204 ? -45.305 -1.933  52.377  1.00 169.78 ? 204 LYS C CG  1 
ATOM   5343  C CD  . LYS C  3  204 ? -44.476 -1.721  51.117  1.00 168.69 ? 204 LYS C CD  1 
ATOM   5344  C CE  . LYS C  3  204 ? -44.797 -2.754  50.048  1.00 168.00 ? 204 LYS C CE  1 
ATOM   5345  N NZ  . LYS C  3  204 ? -46.125 -2.522  49.414  1.00 163.69 ? 204 LYS C NZ  1 
ATOM   5346  N N   . ASN C  3  205 ? -43.286 0.451   56.042  1.00 147.73 ? 205 ASN C N   1 
ATOM   5347  C CA  . ASN C  3  205 ? -42.836 1.675   56.705  1.00 141.50 ? 205 ASN C CA  1 
ATOM   5348  C C   . ASN C  3  205 ? -41.373 1.613   57.156  1.00 135.67 ? 205 ASN C C   1 
ATOM   5349  O O   . ASN C  3  205 ? -40.886 2.516   57.843  1.00 134.88 ? 205 ASN C O   1 
ATOM   5350  C CB  . ASN C  3  205 ? -43.748 2.003   57.894  1.00 142.13 ? 205 ASN C CB  1 
ATOM   5351  C CG  . ASN C  3  205 ? -45.176 2.313   57.476  1.00 143.35 ? 205 ASN C CG  1 
ATOM   5352  O OD1 . ASN C  3  205 ? -45.563 2.114   56.324  1.00 142.84 ? 205 ASN C OD1 1 
ATOM   5353  N ND2 . ASN C  3  205 ? -45.970 2.803   58.420  1.00 143.75 ? 205 ASN C ND2 1 
ATOM   5354  N N   . ILE C  3  206 ? -40.679 0.549   56.757  1.00 132.31 ? 206 ILE C N   1 
ATOM   5355  C CA  . ILE C  3  206 ? -39.283 0.335   57.132  1.00 128.89 ? 206 ILE C CA  1 
ATOM   5356  C C   . ILE C  3  206 ? -38.362 0.374   55.911  1.00 127.84 ? 206 ILE C C   1 
ATOM   5357  O O   . ILE C  3  206 ? -38.615 -0.293  54.904  1.00 128.90 ? 206 ILE C O   1 
ATOM   5358  C CB  . ILE C  3  206 ? -39.103 -0.988  57.923  1.00 128.70 ? 206 ILE C CB  1 
ATOM   5359  C CG1 . ILE C  3  206 ? -39.482 -0.796  59.395  1.00 130.91 ? 206 ILE C CG1 1 
ATOM   5360  C CG2 . ILE C  3  206 ? -37.671 -1.502  57.847  1.00 128.33 ? 206 ILE C CG2 1 
ATOM   5361  C CD1 . ILE C  3  206 ? -40.945 -1.025  59.705  1.00 135.55 ? 206 ILE C CD1 1 
ATOM   5362  N N   . GLU C  3  207 ? -37.306 1.176   56.013  1.00 127.61 ? 207 GLU C N   1 
ATOM   5363  C CA  . GLU C  3  207 ? -36.260 1.232   55.000  1.00 128.73 ? 207 GLU C CA  1 
ATOM   5364  C C   . GLU C  3  207 ? -34.894 1.181   55.678  1.00 124.61 ? 207 GLU C C   1 
ATOM   5365  O O   . GLU C  3  207 ? -34.570 2.033   56.510  1.00 124.78 ? 207 GLU C O   1 
ATOM   5366  C CB  . GLU C  3  207 ? -36.394 2.497   54.150  1.00 133.40 ? 207 GLU C CB  1 
ATOM   5367  C CG  . GLU C  3  207 ? -35.394 2.587   53.008  1.00 138.31 ? 207 GLU C CG  1 
ATOM   5368  C CD  . GLU C  3  207 ? -35.429 3.927   52.304  1.00 141.81 ? 207 GLU C CD  1 
ATOM   5369  O OE1 . GLU C  3  207 ? -36.409 4.194   51.576  1.00 145.71 ? 207 GLU C OE1 1 
ATOM   5370  O OE2 . GLU C  3  207 ? -34.470 4.708   52.472  1.00 133.91 ? 207 GLU C OE2 1 
ATOM   5371  N N   . LEU C  3  208 ? -34.103 0.172   55.322  1.00 119.17 ? 208 LEU C N   1 
ATOM   5372  C CA  . LEU C  3  208 ? -32.783 -0.027  55.918  1.00 115.21 ? 208 LEU C CA  1 
ATOM   5373  C C   . LEU C  3  208 ? -31.722 -0.403  54.887  1.00 113.25 ? 208 LEU C C   1 
ATOM   5374  O O   . LEU C  3  208 ? -32.024 -1.031  53.870  1.00 113.53 ? 208 LEU C O   1 
ATOM   5375  C CB  . LEU C  3  208 ? -32.843 -1.069  57.046  1.00 114.95 ? 208 LEU C CB  1 
ATOM   5376  C CG  . LEU C  3  208 ? -33.588 -2.393  56.849  1.00 116.92 ? 208 LEU C CG  1 
ATOM   5377  C CD1 . LEU C  3  208 ? -32.703 -3.444  56.196  1.00 118.16 ? 208 LEU C CD1 1 
ATOM   5378  C CD2 . LEU C  3  208 ? -34.092 -2.896  58.190  1.00 118.57 ? 208 LEU C CD2 1 
ATOM   5379  N N   . ALA C  3  209 ? -30.482 -0.009  55.166  1.00 111.52 ? 209 ALA C N   1 
ATOM   5380  C CA  . ALA C  3  209 ? -29.359 -0.270  54.270  1.00 110.16 ? 209 ALA C CA  1 
ATOM   5381  C C   . ALA C  3  209 ? -28.236 -1.025  54.976  1.00 108.85 ? 209 ALA C C   1 
ATOM   5382  O O   . ALA C  3  209 ? -27.937 -0.767  56.144  1.00 107.50 ? 209 ALA C O   1 
ATOM   5383  C CB  . ALA C  3  209 ? -28.840 1.032   53.679  1.00 107.62 ? 209 ALA C CB  1 
ATOM   5384  N N   . VAL C  3  210 ? -27.625 -1.959  54.252  1.00 111.63 ? 210 VAL C N   1 
ATOM   5385  C CA  . VAL C  3  210 ? -26.506 -2.750  54.768  1.00 113.89 ? 210 VAL C CA  1 
ATOM   5386  C C   . VAL C  3  210 ? -25.217 -2.454  54.001  1.00 117.69 ? 210 VAL C C   1 
ATOM   5387  O O   . VAL C  3  210 ? -25.253 -2.132  52.811  1.00 119.37 ? 210 VAL C O   1 
ATOM   5388  C CB  . VAL C  3  210 ? -26.797 -4.272  54.732  1.00 114.02 ? 210 VAL C CB  1 
ATOM   5389  C CG1 . VAL C  3  210 ? -27.817 -4.653  55.795  1.00 112.16 ? 210 VAL C CG1 1 
ATOM   5390  C CG2 . VAL C  3  210 ? -27.264 -4.718  53.350  1.00 116.45 ? 210 VAL C CG2 1 
ATOM   5391  N N   . MET C  3  211 ? -24.085 -2.556  54.693  1.00 121.32 ? 211 MET C N   1 
ATOM   5392  C CA  . MET C  3  211 ? -22.776 -2.407  54.057  1.00 126.65 ? 211 MET C CA  1 
ATOM   5393  C C   . MET C  3  211 ? -21.733 -3.346  54.663  1.00 131.71 ? 211 MET C C   1 
ATOM   5394  O O   . MET C  3  211 ? -21.706 -3.565  55.876  1.00 131.25 ? 211 MET C O   1 
ATOM   5395  C CB  . MET C  3  211 ? -22.301 -0.947  54.085  1.00 124.96 ? 211 MET C CB  1 
ATOM   5396  C CG  . MET C  3  211 ? -22.009 -0.374  55.466  1.00 127.68 ? 211 MET C CG  1 
ATOM   5397  S SD  . MET C  3  211 ? -21.262 1.266   55.392  1.00 128.36 ? 211 MET C SD  1 
ATOM   5398  C CE  . MET C  3  211 ? -19.706 0.918   54.573  1.00 124.41 ? 211 MET C CE  1 
ATOM   5399  N N   . ARG C  3  212 ? -20.883 -3.897  53.800  1.00 140.10 ? 212 ARG C N   1 
ATOM   5400  C CA  . ARG C  3  212 ? -19.850 -4.844  54.216  1.00 145.91 ? 212 ARG C CA  1 
ATOM   5401  C C   . ARG C  3  212 ? -18.476 -4.175  54.214  1.00 150.04 ? 212 ARG C C   1 
ATOM   5402  O O   . ARG C  3  212 ? -18.302 -3.104  53.627  1.00 150.25 ? 212 ARG C O   1 
ATOM   5403  C CB  . ARG C  3  212 ? -19.862 -6.088  53.319  1.00 150.63 ? 212 ARG C CB  1 
ATOM   5404  C CG  . ARG C  3  212 ? -21.260 -6.611  53.016  1.00 151.92 ? 212 ARG C CG  1 
ATOM   5405  C CD  . ARG C  3  212 ? -21.269 -8.084  52.645  1.00 153.37 ? 212 ARG C CD  1 
ATOM   5406  N NE  . ARG C  3  212 ? -22.581 -8.498  52.150  1.00 151.89 ? 212 ARG C NE  1 
ATOM   5407  C CZ  . ARG C  3  212 ? -23.567 -8.973  52.910  1.00 149.56 ? 212 ARG C CZ  1 
ATOM   5408  N NH1 . ARG C  3  212 ? -23.407 -9.111  54.220  1.00 147.92 ? 212 ARG C NH1 1 
ATOM   5409  N NH2 . ARG C  3  212 ? -24.720 -9.316  52.353  1.00 150.58 ? 212 ARG C NH2 1 
ATOM   5410  N N   . ARG C  3  213 ? -17.506 -4.809  54.870  1.00 153.29 ? 213 ARG C N   1 
ATOM   5411  C CA  . ARG C  3  213 ? -16.169 -4.226  55.048  1.00 156.83 ? 213 ARG C CA  1 
ATOM   5412  C C   . ARG C  3  213 ? -15.303 -4.189  53.777  1.00 160.22 ? 213 ARG C C   1 
ATOM   5413  O O   . ARG C  3  213 ? -14.139 -3.783  53.825  1.00 162.38 ? 213 ARG C O   1 
ATOM   5414  C CB  . ARG C  3  213 ? -15.424 -4.894  56.218  1.00 156.44 ? 213 ARG C CB  1 
ATOM   5415  C CG  . ARG C  3  213 ? -15.468 -6.416  56.250  1.00 162.14 ? 213 ARG C CG  1 
ATOM   5416  C CD  . ARG C  3  213 ? -14.274 -7.043  55.550  1.00 165.92 ? 213 ARG C CD  1 
ATOM   5417  N NE  . ARG C  3  213 ? -14.147 -8.463  55.872  1.00 170.72 ? 213 ARG C NE  1 
ATOM   5418  C CZ  . ARG C  3  213 ? -14.723 -9.450  55.189  1.00 175.32 ? 213 ARG C CZ  1 
ATOM   5419  N NH1 . ARG C  3  213 ? -15.477 -9.191  54.128  1.00 175.43 ? 213 ARG C NH1 1 
ATOM   5420  N NH2 . ARG C  3  213 ? -14.546 -10.707 55.570  1.00 175.78 ? 213 ARG C NH2 1 
ATOM   5421  N N   . ASP C  3  214 ? -15.880 -4.604  52.651  1.00 161.15 ? 214 ASP C N   1 
ATOM   5422  C CA  . ASP C  3  214 ? -15.216 -4.522  51.349  1.00 164.42 ? 214 ASP C CA  1 
ATOM   5423  C C   . ASP C  3  214 ? -16.166 -4.061  50.243  1.00 161.14 ? 214 ASP C C   1 
ATOM   5424  O O   . ASP C  3  214 ? -15.729 -3.514  49.228  1.00 160.12 ? 214 ASP C O   1 
ATOM   5425  C CB  . ASP C  3  214 ? -14.584 -5.866  50.972  1.00 168.19 ? 214 ASP C CB  1 
ATOM   5426  C CG  . ASP C  3  214 ? -13.240 -6.095  51.643  1.00 170.82 ? 214 ASP C CG  1 
ATOM   5427  O OD1 . ASP C  3  214 ? -12.411 -5.160  51.673  1.00 169.52 ? 214 ASP C OD1 1 
ATOM   5428  O OD2 . ASP C  3  214 ? -13.007 -7.221  52.128  1.00 173.38 ? 214 ASP C OD2 1 
ATOM   5429  N N   . GLN C  3  215 ? -17.461 -4.286  50.452  1.00 156.79 ? 215 GLN C N   1 
ATOM   5430  C CA  . GLN C  3  215 ? -18.486 -3.953  49.463  1.00 152.90 ? 215 GLN C CA  1 
ATOM   5431  C C   . GLN C  3  215 ? -19.205 -2.638  49.787  1.00 147.52 ? 215 GLN C C   1 
ATOM   5432  O O   . GLN C  3  215 ? -19.360 -2.292  50.960  1.00 147.33 ? 215 GLN C O   1 
ATOM   5433  C CB  . GLN C  3  215 ? -19.491 -5.103  49.337  1.00 153.45 ? 215 GLN C CB  1 
ATOM   5434  C CG  . GLN C  3  215 ? -18.966 -6.289  48.541  1.00 155.66 ? 215 GLN C CG  1 
ATOM   5435  C CD  . GLN C  3  215 ? -19.928 -7.460  48.524  1.00 158.61 ? 215 GLN C CD  1 
ATOM   5436  O OE1 . GLN C  3  215 ? -20.209 -8.066  49.557  1.00 157.16 ? 215 GLN C OE1 1 
ATOM   5437  N NE2 . GLN C  3  215 ? -20.428 -7.795  47.341  1.00 160.85 ? 215 GLN C NE2 1 
ATOM   5438  N N   . PRO C  3  216 ? -19.644 -1.901  48.743  1.00 142.33 ? 216 PRO C N   1 
ATOM   5439  C CA  . PRO C  3  216 ? -20.338 -0.619  48.920  1.00 136.66 ? 216 PRO C CA  1 
ATOM   5440  C C   . PRO C  3  216 ? -21.732 -0.748  49.546  1.00 133.71 ? 216 PRO C C   1 
ATOM   5441  O O   . PRO C  3  216 ? -22.171 -1.856  49.869  1.00 134.30 ? 216 PRO C O   1 
ATOM   5442  C CB  . PRO C  3  216 ? -20.441 -0.075  47.489  1.00 134.21 ? 216 PRO C CB  1 
ATOM   5443  C CG  . PRO C  3  216 ? -20.382 -1.282  46.619  1.00 136.72 ? 216 PRO C CG  1 
ATOM   5444  C CD  . PRO C  3  216 ? -19.431 -2.209  47.315  1.00 141.33 ? 216 PRO C CD  1 
ATOM   5445  N N   . LEU C  3  217 ? -22.409 0.388   49.706  1.00 126.07 ? 217 LEU C N   1 
ATOM   5446  C CA  . LEU C  3  217 ? -23.728 0.451   50.338  1.00 120.87 ? 217 LEU C CA  1 
ATOM   5447  C C   . LEU C  3  217 ? -24.795 -0.288  49.532  1.00 126.28 ? 217 LEU C C   1 
ATOM   5448  O O   . LEU C  3  217 ? -24.873 -0.147  48.309  1.00 127.66 ? 217 LEU C O   1 
ATOM   5449  C CB  . LEU C  3  217 ? -24.140 1.914   50.554  1.00 112.38 ? 217 LEU C CB  1 
ATOM   5450  C CG  . LEU C  3  217 ? -25.394 2.227   51.379  1.00 107.33 ? 217 LEU C CG  1 
ATOM   5451  C CD1 . LEU C  3  217 ? -25.192 1.890   52.850  1.00 107.14 ? 217 LEU C CD1 1 
ATOM   5452  C CD2 . LEU C  3  217 ? -25.778 3.689   51.218  1.00 104.97 ? 217 LEU C CD2 1 
ATOM   5453  N N   . LYS C  3  218 ? -25.609 -1.075  50.233  1.00 129.07 ? 218 LYS C N   1 
ATOM   5454  C CA  . LYS C  3  218 ? -26.691 -1.837  49.613  1.00 135.09 ? 218 LYS C CA  1 
ATOM   5455  C C   . LYS C  3  218 ? -28.045 -1.439  50.196  1.00 138.74 ? 218 LYS C C   1 
ATOM   5456  O O   . LYS C  3  218 ? -28.330 -1.704  51.367  1.00 136.42 ? 218 LYS C O   1 
ATOM   5457  C CB  . LYS C  3  218 ? -26.467 -3.344  49.789  1.00 137.30 ? 218 LYS C CB  1 
ATOM   5458  C CG  . LYS C  3  218 ? -25.234 -3.894  49.090  1.00 140.65 ? 218 LYS C CG  1 
ATOM   5459  C CD  . LYS C  3  218 ? -25.059 -5.376  49.387  1.00 143.90 ? 218 LYS C CD  1 
ATOM   5460  C CE  . LYS C  3  218 ? -23.739 -5.909  48.851  1.00 144.09 ? 218 LYS C CE  1 
ATOM   5461  N NZ  . LYS C  3  218 ? -23.713 -5.980  47.363  1.00 143.97 ? 218 LYS C NZ  1 
ATOM   5462  N N   . ILE C  3  219 ? -28.869 -0.794  49.375  1.00 141.03 ? 219 ILE C N   1 
ATOM   5463  C CA  . ILE C  3  219 ? -30.223 -0.415  49.774  1.00 142.40 ? 219 ILE C CA  1 
ATOM   5464  C C   . ILE C  3  219 ? -31.185 -1.547  49.417  1.00 143.91 ? 219 ILE C C   1 
ATOM   5465  O O   . ILE C  3  219 ? -31.352 -1.886  48.243  1.00 146.22 ? 219 ILE C O   1 
ATOM   5466  C CB  . ILE C  3  219 ? -30.678 0.908   49.116  1.00 142.72 ? 219 ILE C CB  1 
ATOM   5467  C CG1 . ILE C  3  219 ? -29.641 2.014   49.351  1.00 142.73 ? 219 ILE C CG1 1 
ATOM   5468  C CG2 . ILE C  3  219 ? -32.044 1.328   49.650  1.00 141.72 ? 219 ILE C CG2 1 
ATOM   5469  C CD1 . ILE C  3  219 ? -29.739 3.179   48.387  1.00 141.76 ? 219 ILE C CD1 1 
ATOM   5470  N N   . LEU C  3  220 ? -31.806 -2.130  50.440  1.00 139.88 ? 220 LEU C N   1 
ATOM   5471  C CA  . LEU C  3  220 ? -32.704 -3.268  50.255  1.00 138.78 ? 220 LEU C CA  1 
ATOM   5472  C C   . LEU C  3  220 ? -34.126 -2.827  49.918  1.00 137.47 ? 220 LEU C C   1 
ATOM   5473  O O   . LEU C  3  220 ? -34.669 -1.910  50.539  1.00 136.92 ? 220 LEU C O   1 
ATOM   5474  C CB  . LEU C  3  220 ? -32.702 -4.173  51.495  1.00 137.17 ? 220 LEU C CB  1 
ATOM   5475  C CG  . LEU C  3  220 ? -31.397 -4.865  51.910  1.00 135.81 ? 220 LEU C CG  1 
ATOM   5476  C CD1 . LEU C  3  220 ? -31.554 -5.517  53.275  1.00 132.88 ? 220 LEU C CD1 1 
ATOM   5477  C CD2 . LEU C  3  220 ? -30.940 -5.891  50.881  1.00 136.34 ? 220 LEU C CD2 1 
ATOM   5478  N N   . ASN C  3  221 ? -34.714 -3.489  48.925  1.00 137.70 ? 221 ASN C N   1 
ATOM   5479  C CA  . ASN C  3  221 ? -36.079 -3.210  48.478  1.00 138.90 ? 221 ASN C CA  1 
ATOM   5480  C C   . ASN C  3  221 ? -37.135 -3.884  49.363  1.00 141.30 ? 221 ASN C C   1 
ATOM   5481  O O   . ASN C  3  221 ? -36.844 -4.904  49.990  1.00 143.01 ? 221 ASN C O   1 
ATOM   5482  C CB  . ASN C  3  221 ? -36.254 -3.619  47.007  1.00 139.89 ? 221 ASN C CB  1 
ATOM   5483  C CG  . ASN C  3  221 ? -35.638 -4.972  46.691  1.00 143.02 ? 221 ASN C CG  1 
ATOM   5484  O OD1 . ASN C  3  221 ? -34.632 -5.056  45.987  1.00 142.61 ? 221 ASN C OD1 1 
ATOM   5485  N ND2 . ASN C  3  221 ? -36.238 -6.036  47.212  1.00 146.29 ? 221 ASN C ND2 1 
ATOM   5486  N N   . PRO C  3  222 ? -38.362 -3.315  49.417  1.00 142.97 ? 222 PRO C N   1 
ATOM   5487  C CA  . PRO C  3  222 ? -39.466 -3.848  50.234  1.00 145.98 ? 222 PRO C CA  1 
ATOM   5488  C C   . PRO C  3  222 ? -39.750 -5.340  50.038  1.00 152.46 ? 222 PRO C C   1 
ATOM   5489  O O   . PRO C  3  222 ? -40.341 -5.970  50.918  1.00 155.93 ? 222 PRO C O   1 
ATOM   5490  C CB  . PRO C  3  222 ? -40.668 -3.026  49.768  1.00 143.53 ? 222 PRO C CB  1 
ATOM   5491  C CG  . PRO C  3  222 ? -40.079 -1.723  49.359  1.00 140.31 ? 222 PRO C CG  1 
ATOM   5492  C CD  . PRO C  3  222 ? -38.743 -2.051  48.756  1.00 140.89 ? 222 PRO C CD  1 
ATOM   5493  N N   . GLU C  3  223 ? -39.336 -5.887  48.897  1.00 157.79 ? 223 GLU C N   1 
ATOM   5494  C CA  . GLU C  3  223 ? -39.485 -7.314  48.607  1.00 164.36 ? 223 GLU C CA  1 
ATOM   5495  C C   . GLU C  3  223 ? -38.531 -8.166  49.448  1.00 162.52 ? 223 GLU C C   1 
ATOM   5496  O O   . GLU C  3  223 ? -38.826 -9.325  49.749  1.00 163.49 ? 223 GLU C O   1 
ATOM   5497  C CB  . GLU C  3  223 ? -39.262 -7.585  47.116  1.00 169.84 ? 223 GLU C CB  1 
ATOM   5498  C CG  . GLU C  3  223 ? -40.294 -6.938  46.200  1.00 176.44 ? 223 GLU C CG  1 
ATOM   5499  C CD  . GLU C  3  223 ? -39.897 -6.966  44.733  1.00 181.60 ? 223 GLU C CD  1 
ATOM   5500  O OE1 . GLU C  3  223 ? -39.100 -7.843  44.332  1.00 184.73 ? 223 GLU C OE1 1 
ATOM   5501  O OE2 . GLU C  3  223 ? -40.393 -6.108  43.973  1.00 182.41 ? 223 GLU C OE2 1 
ATOM   5502  N N   . GLU C  3  224 ? -37.394 -7.581  49.821  1.00 156.70 ? 224 GLU C N   1 
ATOM   5503  C CA  . GLU C  3  224 ? -36.389 -8.255  50.645  1.00 152.73 ? 224 GLU C CA  1 
ATOM   5504  C C   . GLU C  3  224 ? -36.648 -8.094  52.144  1.00 155.07 ? 224 GLU C C   1 
ATOM   5505  O O   . GLU C  3  224 ? -36.349 -8.998  52.925  1.00 157.06 ? 224 GLU C O   1 
ATOM   5506  C CB  . GLU C  3  224 ? -34.983 -7.758  50.295  1.00 146.14 ? 224 GLU C CB  1 
ATOM   5507  C CG  . GLU C  3  224 ? -34.418 -8.345  49.010  1.00 142.80 ? 224 GLU C CG  1 
ATOM   5508  C CD  . GLU C  3  224 ? -33.127 -7.677  48.574  1.00 137.79 ? 224 GLU C CD  1 
ATOM   5509  O OE1 . GLU C  3  224 ? -33.146 -6.460  48.291  1.00 135.67 ? 224 GLU C OE1 1 
ATOM   5510  O OE2 . GLU C  3  224 ? -32.092 -8.373  48.505  1.00 137.73 ? 224 GLU C OE2 1 
ATOM   5511  N N   . ILE C  3  225 ? -37.197 -6.944  52.535  1.00 155.38 ? 225 ILE C N   1 
ATOM   5512  C CA  . ILE C  3  225 ? -37.537 -6.668  53.936  1.00 157.56 ? 225 ILE C CA  1 
ATOM   5513  C C   . ILE C  3  225 ? -38.664 -7.581  54.427  1.00 162.45 ? 225 ILE C C   1 
ATOM   5514  O O   . ILE C  3  225 ? -38.583 -8.138  55.525  1.00 163.71 ? 225 ILE C O   1 
ATOM   5515  C CB  . ILE C  3  225 ? -37.889 -5.172  54.163  1.00 154.55 ? 225 ILE C CB  1 
ATOM   5516  C CG1 . ILE C  3  225 ? -36.618 -4.330  54.304  1.00 150.04 ? 225 ILE C CG1 1 
ATOM   5517  C CG2 . ILE C  3  225 ? -38.742 -4.972  55.409  1.00 156.62 ? 225 ILE C CG2 1 
ATOM   5518  C CD1 . ILE C  3  225 ? -36.124 -3.718  53.012  1.00 146.43 ? 225 ILE C CD1 1 
ATOM   5519  N N   . GLU C  3  226 ? -39.694 -7.748  53.597  1.00 166.58 ? 226 GLU C N   1 
ATOM   5520  C CA  . GLU C  3  226 ? -40.855 -8.579  53.933  1.00 171.83 ? 226 GLU C CA  1 
ATOM   5521  C C   . GLU C  3  226 ? -40.521 -10.066 54.079  1.00 172.77 ? 226 GLU C C   1 
ATOM   5522  O O   . GLU C  3  226 ? -41.299 -10.824 54.664  1.00 172.00 ? 226 GLU C O   1 
ATOM   5523  C CB  . GLU C  3  226 ? -41.978 -8.378  52.911  1.00 174.84 ? 226 GLU C CB  1 
ATOM   5524  C CG  . GLU C  3  226 ? -42.727 -7.063  53.069  1.00 175.42 ? 226 GLU C CG  1 
ATOM   5525  C CD  . GLU C  3  226 ? -43.869 -6.903  52.082  1.00 178.11 ? 226 GLU C CD  1 
ATOM   5526  O OE1 . GLU C  3  226 ? -44.564 -7.900  51.792  1.00 178.06 ? 226 GLU C OE1 1 
ATOM   5527  O OE2 . GLU C  3  226 ? -44.081 -5.769  51.603  1.00 176.02 ? 226 GLU C OE2 1 
ATOM   5528  N N   . LYS C  3  227 ? -39.368 -10.472 53.547  1.00 173.12 ? 227 LYS C N   1 
ATOM   5529  C CA  . LYS C  3  227 ? -38.857 -11.831 53.728  1.00 174.52 ? 227 LYS C CA  1 
ATOM   5530  C C   . LYS C  3  227 ? -38.431 -12.067 55.177  1.00 174.15 ? 227 LYS C C   1 
ATOM   5531  O O   . LYS C  3  227 ? -38.655 -13.147 55.727  1.00 173.27 ? 227 LYS C O   1 
ATOM   5532  C CB  . LYS C  3  227 ? -37.682 -12.106 52.784  1.00 172.41 ? 227 LYS C CB  1 
ATOM   5533  C CG  . LYS C  3  227 ? -38.075 -12.306 51.329  1.00 171.65 ? 227 LYS C CG  1 
ATOM   5534  C CD  . LYS C  3  227 ? -36.863 -12.642 50.475  1.00 170.62 ? 227 LYS C CD  1 
ATOM   5535  C CE  . LYS C  3  227 ? -37.251 -12.845 49.020  1.00 170.65 ? 227 LYS C CE  1 
ATOM   5536  N NZ  . LYS C  3  227 ? -36.071 -13.167 48.170  1.00 170.85 ? 227 LYS C NZ  1 
ATOM   5537  N N   . TYR C  3  228 ? -37.818 -11.051 55.782  1.00 170.49 ? 228 TYR C N   1 
ATOM   5538  C CA  . TYR C  3  228 ? -37.409 -11.106 57.185  1.00 164.72 ? 228 TYR C CA  1 
ATOM   5539  C C   . TYR C  3  228 ? -38.595 -10.899 58.126  1.00 166.37 ? 228 TYR C C   1 
ATOM   5540  O O   . TYR C  3  228 ? -38.664 -11.526 59.185  1.00 168.02 ? 228 TYR C O   1 
ATOM   5541  C CB  . TYR C  3  228 ? -36.322 -10.068 57.477  1.00 156.43 ? 228 TYR C CB  1 
ATOM   5542  C CG  . TYR C  3  228 ? -35.006 -10.320 56.773  1.00 152.32 ? 228 TYR C CG  1 
ATOM   5543  C CD1 . TYR C  3  228 ? -34.065 -11.202 57.304  1.00 152.53 ? 228 TYR C CD1 1 
ATOM   5544  C CD2 . TYR C  3  228 ? -34.697 -9.666  55.582  1.00 148.25 ? 228 TYR C CD2 1 
ATOM   5545  C CE1 . TYR C  3  228 ? -32.857 -11.431 56.663  1.00 149.67 ? 228 TYR C CE1 1 
ATOM   5546  C CE2 . TYR C  3  228 ? -33.491 -9.888  54.933  1.00 145.19 ? 228 TYR C CE2 1 
ATOM   5547  C CZ  . TYR C  3  228 ? -32.576 -10.771 55.478  1.00 146.03 ? 228 TYR C CZ  1 
ATOM   5548  O OH  . TYR C  3  228 ? -31.378 -10.995 54.838  1.00 145.48 ? 228 TYR C OH  1 
ATOM   5549  N N   . VAL C  3  229 ? -39.516 -10.019 57.732  1.00 166.54 ? 229 VAL C N   1 
ATOM   5550  C CA  . VAL C  3  229 ? -40.741 -9.747  58.495  1.00 167.72 ? 229 VAL C CA  1 
ATOM   5551  C C   . VAL C  3  229 ? -41.571 -11.024 58.656  1.00 168.56 ? 229 VAL C C   1 
ATOM   5552  O O   . VAL C  3  229 ? -42.118 -11.289 59.730  1.00 169.39 ? 229 VAL C O   1 
ATOM   5553  C CB  . VAL C  3  229 ? -41.585 -8.622  57.842  1.00 167.59 ? 229 VAL C CB  1 
ATOM   5554  C CG1 . VAL C  3  229 ? -42.910 -8.429  58.568  1.00 170.05 ? 229 VAL C CG1 1 
ATOM   5555  C CG2 . VAL C  3  229 ? -40.810 -7.313  57.821  1.00 165.30 ? 229 VAL C CG2 1 
ATOM   5556  N N   . ALA C  3  230 ? -41.642 -11.815 57.586  1.00 167.45 ? 230 ALA C N   1 
ATOM   5557  C CA  . ALA C  3  230 ? -42.326 -13.106 57.607  1.00 167.14 ? 230 ALA C CA  1 
ATOM   5558  C C   . ALA C  3  230 ? -41.608 -14.126 58.494  1.00 167.11 ? 230 ALA C C   1 
ATOM   5559  O O   . ALA C  3  230 ? -42.248 -15.007 59.068  1.00 169.85 ? 230 ALA C O   1 
ATOM   5560  C CB  . ALA C  3  230 ? -42.482 -13.646 56.193  1.00 166.61 ? 230 ALA C CB  1 
ATOM   5561  N N   . GLU C  3  231 ? -40.286 -13.997 58.602  1.00 162.86 ? 231 GLU C N   1 
ATOM   5562  C CA  . GLU C  3  231 ? -39.470 -14.904 59.414  1.00 160.46 ? 231 GLU C CA  1 
ATOM   5563  C C   . GLU C  3  231 ? -39.513 -14.577 60.908  1.00 162.54 ? 231 GLU C C   1 
ATOM   5564  O O   . GLU C  3  231 ? -39.524 -15.483 61.744  1.00 161.84 ? 231 GLU C O   1 
ATOM   5565  C CB  . GLU C  3  231 ? -38.020 -14.921 58.920  1.00 157.20 ? 231 GLU C CB  1 
ATOM   5566  C CG  . GLU C  3  231 ? -37.797 -15.745 57.661  1.00 157.22 ? 231 GLU C CG  1 
ATOM   5567  C CD  . GLU C  3  231 ? -36.344 -15.781 57.223  1.00 154.29 ? 231 GLU C CD  1 
ATOM   5568  O OE1 . GLU C  3  231 ? -35.455 -15.941 58.087  1.00 154.68 ? 231 GLU C OE1 1 
ATOM   5569  O OE2 . GLU C  3  231 ? -36.089 -15.657 56.006  1.00 152.08 ? 231 GLU C OE2 1 
ATOM   5570  N N   . ILE C  3  232 ? -39.529 -13.284 61.232  1.00 165.87 ? 232 ILE C N   1 
ATOM   5571  C CA  . ILE C  3  232 ? -39.582 -12.819 62.623  1.00 170.33 ? 232 ILE C CA  1 
ATOM   5572  C C   . ILE C  3  232 ? -40.940 -13.132 63.257  1.00 175.49 ? 232 ILE C C   1 
ATOM   5573  O O   . ILE C  3  232 ? -41.005 -13.614 64.391  1.00 179.52 ? 232 ILE C O   1 
ATOM   5574  C CB  . ILE C  3  232 ? -39.251 -11.309 62.739  1.00 169.14 ? 232 ILE C CB  1 
ATOM   5575  C CG1 . ILE C  3  232 ? -37.803 -11.045 62.308  1.00 165.81 ? 232 ILE C CG1 1 
ATOM   5576  C CG2 . ILE C  3  232 ? -39.468 -10.807 64.163  1.00 168.79 ? 232 ILE C CG2 1 
ATOM   5577  C CD1 . ILE C  3  232 ? -37.520 -9.613  61.902  1.00 159.08 ? 232 ILE C CD1 1 
ATOM   5578  N N   . GLU C  3  233 ? -42.015 -12.870 62.515  1.00 178.87 ? 233 GLU C N   1 
ATOM   5579  C CA  . GLU C  3  233 ? -43.375 -13.182 62.964  1.00 184.82 ? 233 GLU C CA  1 
ATOM   5580  C C   . GLU C  3  233 ? -43.667 -14.685 63.001  1.00 186.80 ? 233 GLU C C   1 
ATOM   5581  O O   . GLU C  3  233 ? -44.568 -15.127 63.718  1.00 188.85 ? 233 GLU C O   1 
ATOM   5582  C CB  . GLU C  3  233 ? -44.415 -12.459 62.100  1.00 185.41 ? 233 GLU C CB  1 
ATOM   5583  C CG  . GLU C  3  233 ? -44.999 -11.203 62.733  1.00 186.32 ? 233 GLU C CG  1 
ATOM   5584  C CD  . GLU C  3  233 ? -44.029 -10.037 62.770  1.00 185.88 ? 233 GLU C CD  1 
ATOM   5585  O OE1 . GLU C  3  233 ? -43.539 -9.629  61.696  1.00 183.83 ? 233 GLU C OE1 1 
ATOM   5586  O OE2 . GLU C  3  233 ? -43.772 -9.516  63.875  1.00 186.77 ? 233 GLU C OE2 1 
ATOM   5587  N N   . LYS C  3  234 ? -42.904 -15.459 62.229  1.00 186.16 ? 234 LYS C N   1 
ATOM   5588  C CA  . LYS C  3  234 ? -43.031 -16.917 62.207  1.00 186.60 ? 234 LYS C CA  1 
ATOM   5589  C C   . LYS C  3  234 ? -42.486 -17.530 63.496  1.00 189.38 ? 234 LYS C C   1 
ATOM   5590  O O   . LYS C  3  234 ? -43.047 -18.494 64.020  1.00 192.67 ? 234 LYS C O   1 
ATOM   5591  C CB  . LYS C  3  234 ? -42.291 -17.502 61.000  1.00 181.82 ? 234 LYS C CB  1 
ATOM   5592  C CG  . LYS C  3  234 ? -42.868 -18.804 60.468  1.00 180.23 ? 234 LYS C CG  1 
ATOM   5593  C CD  . LYS C  3  234 ? -43.986 -18.551 59.467  1.00 177.20 ? 234 LYS C CD  1 
ATOM   5594  C CE  . LYS C  3  234 ? -44.444 -19.842 58.811  1.00 176.69 ? 234 LYS C CE  1 
ATOM   5595  N NZ  . LYS C  3  234 ? -45.433 -19.586 57.729  1.00 172.19 ? 234 LYS C NZ  1 
ATOM   5596  N N   . GLU C  3  235 ? -41.388 -16.962 63.993  1.00 189.12 ? 235 GLU C N   1 
ATOM   5597  C CA  . GLU C  3  235 ? -40.776 -17.396 65.248  1.00 190.11 ? 235 GLU C CA  1 
ATOM   5598  C C   . GLU C  3  235 ? -41.484 -16.789 66.458  1.00 189.00 ? 235 GLU C C   1 
ATOM   5599  O O   . GLU C  3  235 ? -41.365 -17.298 67.576  1.00 189.42 ? 235 GLU C O   1 
ATOM   5600  C CB  . GLU C  3  235 ? -39.286 -17.043 65.271  1.00 189.23 ? 235 GLU C CB  1 
ATOM   5601  C CG  . GLU C  3  235 ? -38.432 -17.891 64.339  1.00 190.41 ? 235 GLU C CG  1 
ATOM   5602  C CD  . GLU C  3  235 ? -36.977 -17.458 64.300  1.00 189.30 ? 235 GLU C CD  1 
ATOM   5603  O OE1 . GLU C  3  235 ? -36.458 -16.978 65.330  1.00 188.78 ? 235 GLU C OE1 1 
ATOM   5604  O OE2 . GLU C  3  235 ? -36.347 -17.605 63.232  1.00 189.33 ? 235 GLU C OE2 1 
ATOM   5605  N N   . LYS C  3  236 ? -42.215 -15.702 66.224  1.00 187.67 ? 236 LYS C N   1 
ATOM   5606  C CA  . LYS C  3  236 ? -43.006 -15.045 67.261  1.00 186.89 ? 236 LYS C CA  1 
ATOM   5607  C C   . LYS C  3  236 ? -44.319 -15.796 67.488  1.00 191.74 ? 236 LYS C C   1 
ATOM   5608  O O   . LYS C  3  236 ? -44.872 -15.779 68.590  1.00 193.97 ? 236 LYS C O   1 
ATOM   5609  C CB  . LYS C  3  236 ? -43.282 -13.592 66.869  1.00 181.74 ? 236 LYS C CB  1 
ATOM   5610  C CG  . LYS C  3  236 ? -43.427 -12.642 68.045  1.00 177.39 ? 236 LYS C CG  1 
ATOM   5611  C CD  . LYS C  3  236 ? -43.449 -11.196 67.575  1.00 173.30 ? 236 LYS C CD  1 
ATOM   5612  C CE  . LYS C  3  236 ? -43.520 -10.228 68.744  1.00 172.06 ? 236 LYS C CE  1 
ATOM   5613  N NZ  . LYS C  3  236 ? -42.247 -10.168 69.515  1.00 170.96 ? 236 LYS C NZ  1 
ATOM   5614  N N   . GLU C  3  237 ? -44.804 -16.449 66.434  1.00 195.12 ? 237 GLU C N   1 
ATOM   5615  C CA  . GLU C  3  237 ? -46.012 -17.272 66.483  1.00 198.37 ? 237 GLU C CA  1 
ATOM   5616  C C   . GLU C  3  237 ? -45.755 -18.600 67.200  1.00 200.11 ? 237 GLU C C   1 
ATOM   5617  O O   . GLU C  3  237 ? -46.635 -19.123 67.889  1.00 200.58 ? 237 GLU C O   1 
ATOM   5618  C CB  . GLU C  3  237 ? -46.532 -17.515 65.057  1.00 199.40 ? 237 GLU C CB  1 
ATOM   5619  C CG  . GLU C  3  237 ? -47.665 -18.528 64.916  1.00 201.68 ? 237 GLU C CG  1 
ATOM   5620  C CD  . GLU C  3  237 ? -48.977 -18.066 65.529  1.00 203.88 ? 237 GLU C CD  1 
ATOM   5621  O OE1 . GLU C  3  237 ? -49.735 -18.930 66.014  1.00 206.62 ? 237 GLU C OE1 1 
ATOM   5622  O OE2 . GLU C  3  237 ? -49.257 -16.848 65.525  1.00 202.61 ? 237 GLU C OE2 1 
ATOM   5623  N N   . GLU C  3  238 ? -44.541 -19.124 67.040  1.00 199.90 ? 238 GLU C N   1 
ATOM   5624  C CA  . GLU C  3  238 ? -44.157 -20.434 67.572  1.00 201.25 ? 238 GLU C CA  1 
ATOM   5625  C C   . GLU C  3  238 ? -44.156 -20.499 69.103  1.00 202.96 ? 238 GLU C C   1 
ATOM   5626  O O   . GLU C  3  238 ? -44.395 -21.562 69.683  1.00 205.65 ? 238 GLU C O   1 
ATOM   5627  C CB  . GLU C  3  238 ? -42.787 -20.845 67.024  1.00 199.52 ? 238 GLU C CB  1 
ATOM   5628  C CG  . GLU C  3  238 ? -42.503 -22.339 67.094  1.00 200.01 ? 238 GLU C CG  1 
ATOM   5629  C CD  . GLU C  3  238 ? -41.171 -22.724 66.476  1.00 198.66 ? 238 GLU C CD  1 
ATOM   5630  O OE1 . GLU C  3  238 ? -40.538 -23.672 66.985  1.00 199.90 ? 238 GLU C OE1 1 
ATOM   5631  O OE2 . GLU C  3  238 ? -40.755 -22.089 65.484  1.00 196.80 ? 238 GLU C OE2 1 
ATOM   5632  N N   . ASN C  3  239 ? -43.887 -19.364 69.747  1.00 201.13 ? 239 ASN C N   1 
ATOM   5633  C CA  . ASN C  3  239 ? -43.842 -19.282 71.209  1.00 200.15 ? 239 ASN C CA  1 
ATOM   5634  C C   . ASN C  3  239 ? -45.202 -19.488 71.880  1.00 202.05 ? 239 ASN C C   1 
ATOM   5635  O O   . ASN C  3  239 ? -45.295 -20.166 72.906  1.00 201.64 ? 239 ASN C O   1 
ATOM   5636  C CB  . ASN C  3  239 ? -43.221 -17.953 71.656  1.00 196.95 ? 239 ASN C CB  1 
ATOM   5637  C CG  . ASN C  3  239 ? -41.741 -17.855 71.323  1.00 194.29 ? 239 ASN C CG  1 
ATOM   5638  O OD1 . ASN C  3  239 ? -41.264 -18.445 70.352  1.00 193.76 ? 239 ASN C OD1 1 
ATOM   5639  N ND2 . ASN C  3  239 ? -41.006 -17.099 72.131  1.00 192.96 ? 239 ASN C ND2 1 
ATOM   5640  N N   . GLU C  3  240 ? -46.246 -18.902 71.296  1.00 203.09 ? 240 GLU C N   1 
ATOM   5641  C CA  . GLU C  3  240 ? -47.610 -19.056 71.799  1.00 204.01 ? 240 GLU C CA  1 
ATOM   5642  C C   . GLU C  3  240 ? -48.360 -20.147 71.042  1.00 205.30 ? 240 GLU C C   1 
ATOM   5643  O O   . GLU C  3  240 ? -47.997 -21.321 71.103  1.00 205.18 ? 240 GLU C O   1 
ATOM   5644  C CB  . GLU C  3  240 ? -48.379 -17.734 71.711  1.00 202.51 ? 240 GLU C CB  1 
ATOM   5645  C CG  . GLU C  3  240 ? -48.130 -16.773 72.866  1.00 200.77 ? 240 GLU C CG  1 
ATOM   5646  C CD  . GLU C  3  240 ? -46.808 -16.032 72.760  1.00 199.39 ? 240 GLU C CD  1 
ATOM   5647  O OE1 . GLU C  3  240 ? -46.447 -15.593 71.646  1.00 197.60 ? 240 GLU C OE1 1 
ATOM   5648  O OE2 . GLU C  3  240 ? -46.131 -15.878 73.799  1.00 197.68 ? 240 GLU C OE2 1 
ATOM   5649  N N   . ASP D  4  9   ? -35.347 41.088  78.089  1.00 126.59 ? 9   ASP D N   1 
ATOM   5650  C CA  . ASP D  4  9   ? -34.185 40.667  77.254  1.00 125.82 ? 9   ASP D CA  1 
ATOM   5651  C C   . ASP D  4  9   ? -33.115 41.755  77.217  1.00 122.10 ? 9   ASP D C   1 
ATOM   5652  O O   . ASP D  4  9   ? -33.428 42.944  77.115  1.00 121.85 ? 9   ASP D O   1 
ATOM   5653  C CB  . ASP D  4  9   ? -34.643 40.322  75.833  1.00 127.11 ? 9   ASP D CB  1 
ATOM   5654  C CG  . ASP D  4  9   ? -33.566 39.620  75.021  1.00 126.62 ? 9   ASP D CG  1 
ATOM   5655  O OD1 . ASP D  4  9   ? -32.992 38.624  75.513  1.00 123.46 ? 9   ASP D OD1 1 
ATOM   5656  O OD2 . ASP D  4  9   ? -33.301 40.060  73.882  1.00 126.80 ? 9   ASP D OD2 1 
ATOM   5657  N N   . ARG D  4  10  ? -31.854 41.336  77.299  1.00 115.80 ? 10  ARG D N   1 
ATOM   5658  C CA  . ARG D  4  10  ? -30.717 42.258  77.317  1.00 109.31 ? 10  ARG D CA  1 
ATOM   5659  C C   . ARG D  4  10  ? -29.553 41.759  76.456  1.00 105.23 ? 10  ARG D C   1 
ATOM   5660  O O   . ARG D  4  10  ? -29.585 40.637  75.945  1.00 104.44 ? 10  ARG D O   1 
ATOM   5661  C CB  . ARG D  4  10  ? -30.252 42.508  78.758  1.00 105.72 ? 10  ARG D CB  1 
ATOM   5662  C CG  . ARG D  4  10  ? -29.762 41.268  79.493  1.00 102.81 ? 10  ARG D CG  1 
ATOM   5663  C CD  . ARG D  4  10  ? -29.270 41.603  80.892  1.00 103.53 ? 10  ARG D CD  1 
ATOM   5664  N NE  . ARG D  4  10  ? -30.366 41.904  81.813  1.00 108.29 ? 10  ARG D NE  1 
ATOM   5665  C CZ  . ARG D  4  10  ? -30.945 41.015  82.617  1.00 109.55 ? 10  ARG D CZ  1 
ATOM   5666  N NH1 . ARG D  4  10  ? -30.541 39.750  82.629  1.00 107.34 ? 10  ARG D NH1 1 
ATOM   5667  N NH2 . ARG D  4  10  ? -31.933 41.393  83.416  1.00 110.81 ? 10  ARG D NH2 1 
ATOM   5668  N N   . GLY D  4  11  ? -28.532 42.600  76.304  1.00 102.12 ? 11  GLY D N   1 
ATOM   5669  C CA  . GLY D  4  11  ? -27.334 42.253  75.540  1.00 98.27  ? 11  GLY D CA  1 
ATOM   5670  C C   . GLY D  4  11  ? -26.415 41.289  76.268  1.00 93.72  ? 11  GLY D C   1 
ATOM   5671  O O   . GLY D  4  11  ? -26.564 41.060  77.471  1.00 93.61  ? 11  GLY D O   1 
ATOM   5672  N N   . VAL D  4  12  ? -25.459 40.727  75.532  1.00 90.84  ? 12  VAL D N   1 
ATOM   5673  C CA  . VAL D  4  12  ? -24.520 39.743  76.084  1.00 88.71  ? 12  VAL D CA  1 
ATOM   5674  C C   . VAL D  4  12  ? -23.460 40.367  76.994  1.00 88.76  ? 12  VAL D C   1 
ATOM   5675  O O   . VAL D  4  12  ? -23.010 39.735  77.952  1.00 87.43  ? 12  VAL D O   1 
ATOM   5676  C CB  . VAL D  4  12  ? -23.842 38.892  74.981  1.00 87.78  ? 12  VAL D CB  1 
ATOM   5677  C CG1 . VAL D  4  12  ? -24.813 37.853  74.441  1.00 86.93  ? 12  VAL D CG1 1 
ATOM   5678  C CG2 . VAL D  4  12  ? -23.299 39.765  73.854  1.00 89.50  ? 12  VAL D CG2 1 
ATOM   5679  N N   . ASN D  4  13  ? -23.071 41.603  76.689  1.00 88.83  ? 13  ASN D N   1 
ATOM   5680  C CA  . ASN D  4  13  ? -22.097 42.336  77.494  1.00 89.39  ? 13  ASN D CA  1 
ATOM   5681  C C   . ASN D  4  13  ? -22.773 43.350  78.418  1.00 90.57  ? 13  ASN D C   1 
ATOM   5682  O O   . ASN D  4  13  ? -22.490 44.550  78.366  1.00 92.21  ? 13  ASN D O   1 
ATOM   5683  C CB  . ASN D  4  13  ? -21.056 43.013  76.595  1.00 89.28  ? 13  ASN D CB  1 
ATOM   5684  C CG  . ASN D  4  13  ? -20.142 42.018  75.903  1.00 88.54  ? 13  ASN D CG  1 
ATOM   5685  O OD1 . ASN D  4  13  ? -19.522 41.171  76.548  1.00 87.14  ? 13  ASN D OD1 1 
ATOM   5686  N ND2 . ASN D  4  13  ? -20.049 42.122  74.583  1.00 89.36  ? 13  ASN D ND2 1 
ATOM   5687  N N   . THR D  4  14  ? -23.669 42.848  79.265  1.00 89.29  ? 14  THR D N   1 
ATOM   5688  C CA  . THR D  4  14  ? -24.423 43.684  80.194  1.00 89.13  ? 14  THR D CA  1 
ATOM   5689  C C   . THR D  4  14  ? -23.976 43.417  81.631  1.00 90.40  ? 14  THR D C   1 
ATOM   5690  O O   . THR D  4  14  ? -23.922 42.265  82.071  1.00 89.54  ? 14  THR D O   1 
ATOM   5691  C CB  . THR D  4  14  ? -25.943 43.444  80.058  1.00 87.77  ? 14  THR D CB  1 
ATOM   5692  O OG1 . THR D  4  14  ? -26.317 43.496  78.676  1.00 86.78  ? 14  THR D OG1 1 
ATOM   5693  C CG2 . THR D  4  14  ? -26.734 44.495  80.826  1.00 89.49  ? 14  THR D CG2 1 
ATOM   5694  N N   . PHE D  4  15  ? -23.650 44.491  82.348  1.00 91.10  ? 15  PHE D N   1 
ATOM   5695  C CA  . PHE D  4  15  ? -23.238 44.402  83.748  1.00 90.94  ? 15  PHE D CA  1 
ATOM   5696  C C   . PHE D  4  15  ? -24.434 44.348  84.695  1.00 92.20  ? 15  PHE D C   1 
ATOM   5697  O O   . PHE D  4  15  ? -25.453 45.003  84.464  1.00 92.31  ? 15  PHE D O   1 
ATOM   5698  C CB  . PHE D  4  15  ? -22.333 45.580  84.121  1.00 89.88  ? 15  PHE D CB  1 
ATOM   5699  C CG  . PHE D  4  15  ? -20.878 45.349  83.826  1.00 88.40  ? 15  PHE D CG  1 
ATOM   5700  C CD1 . PHE D  4  15  ? -20.316 45.794  82.635  1.00 88.66  ? 15  PHE D CD1 1 
ATOM   5701  C CD2 . PHE D  4  15  ? -20.064 44.692  84.745  1.00 88.01  ? 15  PHE D CD2 1 
ATOM   5702  C CE1 . PHE D  4  15  ? -18.972 45.586  82.364  1.00 88.03  ? 15  PHE D CE1 1 
ATOM   5703  C CE2 . PHE D  4  15  ? -18.720 44.480  84.479  1.00 87.00  ? 15  PHE D CE2 1 
ATOM   5704  C CZ  . PHE D  4  15  ? -18.173 44.927  83.286  1.00 87.29  ? 15  PHE D CZ  1 
ATOM   5705  N N   . SER D  4  16  ? -24.294 43.561  85.759  1.00 93.13  ? 16  SER D N   1 
ATOM   5706  C CA  . SER D  4  16  ? -25.317 43.452  86.796  1.00 95.06  ? 16  SER D CA  1 
ATOM   5707  C C   . SER D  4  16  ? -25.141 44.548  87.850  1.00 96.75  ? 16  SER D C   1 
ATOM   5708  O O   . SER D  4  16  ? -24.042 45.089  87.998  1.00 96.08  ? 16  SER D O   1 
ATOM   5709  C CB  . SER D  4  16  ? -25.261 42.070  87.457  1.00 95.49  ? 16  SER D CB  1 
ATOM   5710  O OG  . SER D  4  16  ? -24.011 41.851  88.089  1.00 95.98  ? 16  SER D OG  1 
ATOM   5711  N N   . PRO D  4  17  ? -26.225 44.884  88.583  1.00 97.12  ? 17  PRO D N   1 
ATOM   5712  C CA  . PRO D  4  17  ? -26.128 45.806  89.720  1.00 97.90  ? 17  PRO D CA  1 
ATOM   5713  C C   . PRO D  4  17  ? -25.134 45.338  90.786  1.00 99.82  ? 17  PRO D C   1 
ATOM   5714  O O   . PRO D  4  17  ? -24.657 46.150  91.582  1.00 100.88 ? 17  PRO D O   1 
ATOM   5715  C CB  . PRO D  4  17  ? -27.549 45.810  90.285  1.00 98.48  ? 17  PRO D CB  1 
ATOM   5716  C CG  . PRO D  4  17  ? -28.411 45.520  89.107  1.00 97.00  ? 17  PRO D CG  1 
ATOM   5717  C CD  . PRO D  4  17  ? -27.629 44.539  88.283  1.00 96.38  ? 17  PRO D CD  1 
ATOM   5718  N N   . GLU D  4  18  ? -24.835 44.040  90.789  1.00 102.49 ? 18  GLU D N   1 
ATOM   5719  C CA  . GLU D  4  18  ? -23.846 43.452  91.692  1.00 106.56 ? 18  GLU D CA  1 
ATOM   5720  C C   . GLU D  4  18  ? -22.424 43.857  91.296  1.00 102.24 ? 18  GLU D C   1 
ATOM   5721  O O   . GLU D  4  18  ? -21.607 44.191  92.155  1.00 101.77 ? 18  GLU D O   1 
ATOM   5722  C CB  . GLU D  4  18  ? -23.974 41.925  91.707  1.00 116.17 ? 18  GLU D CB  1 
ATOM   5723  C CG  . GLU D  4  18  ? -25.334 41.407  92.157  1.00 127.28 ? 18  GLU D CG  1 
ATOM   5724  C CD  . GLU D  4  18  ? -25.543 39.934  91.847  1.00 135.40 ? 18  GLU D CD  1 
ATOM   5725  O OE1 . GLU D  4  18  ? -25.139 39.481  90.754  1.00 136.44 ? 18  GLU D OE1 1 
ATOM   5726  O OE2 . GLU D  4  18  ? -26.124 39.227  92.696  1.00 138.74 ? 18  GLU D OE2 1 
ATOM   5727  N N   . GLY D  4  19  ? -22.141 43.820  89.995  1.00 99.96  ? 19  GLY D N   1 
ATOM   5728  C CA  . GLY D  4  19  ? -20.835 44.213  89.464  1.00 99.02  ? 19  GLY D CA  1 
ATOM   5729  C C   . GLY D  4  19  ? -20.143 43.130  88.655  1.00 95.99  ? 19  GLY D C   1 
ATOM   5730  O O   . GLY D  4  19  ? -18.931 42.941  88.772  1.00 95.74  ? 19  GLY D O   1 
ATOM   5731  N N   . ARG D  4  20  ? -20.917 42.422  87.834  1.00 94.07  ? 20  ARG D N   1 
ATOM   5732  C CA  . ARG D  4  20  ? -20.399 41.345  86.982  1.00 92.19  ? 20  ARG D CA  1 
ATOM   5733  C C   . ARG D  4  20  ? -21.334 41.050  85.807  1.00 88.11  ? 20  ARG D C   1 
ATOM   5734  O O   . ARG D  4  20  ? -22.523 41.366  85.856  1.00 88.18  ? 20  ARG D O   1 
ATOM   5735  C CB  . ARG D  4  20  ? -20.128 40.070  87.798  1.00 94.72  ? 20  ARG D CB  1 
ATOM   5736  C CG  . ARG D  4  20  ? -21.228 39.679  88.774  1.00 99.97  ? 20  ARG D CG  1 
ATOM   5737  C CD  . ARG D  4  20  ? -20.688 38.754  89.853  1.00 108.78 ? 20  ARG D CD  1 
ATOM   5738  N NE  . ARG D  4  20  ? -21.639 38.564  90.946  1.00 117.83 ? 20  ARG D NE  1 
ATOM   5739  C CZ  . ARG D  4  20  ? -21.381 37.892  92.066  1.00 124.83 ? 20  ARG D CZ  1 
ATOM   5740  N NH1 . ARG D  4  20  ? -20.192 37.333  92.259  1.00 126.96 ? 20  ARG D NH1 1 
ATOM   5741  N NH2 . ARG D  4  20  ? -22.316 37.777  92.999  1.00 127.80 ? 20  ARG D NH2 1 
ATOM   5742  N N   . LEU D  4  21  ? -20.784 40.446  84.756  1.00 84.25  ? 21  LEU D N   1 
ATOM   5743  C CA  . LEU D  4  21  ? -21.549 40.120  83.553  1.00 82.47  ? 21  LEU D CA  1 
ATOM   5744  C C   . LEU D  4  21  ? -22.479 38.932  83.780  1.00 82.37  ? 21  LEU D C   1 
ATOM   5745  O O   . LEU D  4  21  ? -22.126 37.983  84.484  1.00 83.73  ? 21  LEU D O   1 
ATOM   5746  C CB  . LEU D  4  21  ? -20.610 39.835  82.376  1.00 81.24  ? 21  LEU D CB  1 
ATOM   5747  C CG  . LEU D  4  21  ? -19.736 40.978  81.846  1.00 81.03  ? 21  LEU D CG  1 
ATOM   5748  C CD1 . LEU D  4  21  ? -18.596 40.430  81.001  1.00 79.93  ? 21  LEU D CD1 1 
ATOM   5749  C CD2 . LEU D  4  21  ? -20.555 41.988  81.055  1.00 83.09  ? 21  LEU D CD2 1 
ATOM   5750  N N   . PHE D  4  22  ? -23.665 38.996  83.176  1.00 82.25  ? 22  PHE D N   1 
ATOM   5751  C CA  . PHE D  4  22  ? -24.675 37.946  83.314  1.00 83.09  ? 22  PHE D CA  1 
ATOM   5752  C C   . PHE D  4  22  ? -24.263 36.644  82.630  1.00 84.19  ? 22  PHE D C   1 
ATOM   5753  O O   . PHE D  4  22  ? -24.319 35.576  83.242  1.00 87.61  ? 22  PHE D O   1 
ATOM   5754  C CB  . PHE D  4  22  ? -26.028 38.417  82.769  1.00 83.78  ? 22  PHE D CB  1 
ATOM   5755  C CG  . PHE D  4  22  ? -26.706 39.450  83.624  1.00 85.32  ? 22  PHE D CG  1 
ATOM   5756  C CD1 . PHE D  4  22  ? -26.604 40.802  83.315  1.00 87.37  ? 22  PHE D CD1 1 
ATOM   5757  C CD2 . PHE D  4  22  ? -27.456 39.073  84.734  1.00 86.60  ? 22  PHE D CD2 1 
ATOM   5758  C CE1 . PHE D  4  22  ? -27.234 41.758  84.099  1.00 89.14  ? 22  PHE D CE1 1 
ATOM   5759  C CE2 . PHE D  4  22  ? -28.088 40.024  85.521  1.00 88.06  ? 22  PHE D CE2 1 
ATOM   5760  C CZ  . PHE D  4  22  ? -27.978 41.368  85.202  1.00 90.03  ? 22  PHE D CZ  1 
ATOM   5761  N N   . GLN D  4  23  ? -23.841 36.747  81.369  1.00 83.73  ? 23  GLN D N   1 
ATOM   5762  C CA  . GLN D  4  23  ? -23.473 35.585  80.552  1.00 84.75  ? 23  GLN D CA  1 
ATOM   5763  C C   . GLN D  4  23  ? -22.321 34.770  81.142  1.00 84.44  ? 23  GLN D C   1 
ATOM   5764  O O   . GLN D  4  23  ? -22.244 33.557  80.937  1.00 84.79  ? 23  GLN D O   1 
ATOM   5765  C CB  . GLN D  4  23  ? -23.131 36.017  79.122  1.00 87.70  ? 23  GLN D CB  1 
ATOM   5766  C CG  . GLN D  4  23  ? -24.325 36.492  78.303  1.00 92.42  ? 23  GLN D CG  1 
ATOM   5767  C CD  . GLN D  4  23  ? -25.288 35.373  77.943  1.00 94.77  ? 23  GLN D CD  1 
ATOM   5768  O OE1 . GLN D  4  23  ? -24.877 34.264  77.597  1.00 93.98  ? 23  GLN D OE1 1 
ATOM   5769  N NE2 . GLN D  4  23  ? -26.582 35.663  78.017  1.00 95.54  ? 23  GLN D NE2 1 
ATOM   5770  N N   . VAL D  4  24  ? -21.435 35.446  81.870  1.00 83.94  ? 24  VAL D N   1 
ATOM   5771  C CA  . VAL D  4  24  ? -20.307 34.797  82.538  1.00 83.83  ? 24  VAL D CA  1 
ATOM   5772  C C   . VAL D  4  24  ? -20.783 34.023  83.769  1.00 85.61  ? 24  VAL D C   1 
ATOM   5773  O O   . VAL D  4  24  ? -20.362 32.887  83.994  1.00 86.18  ? 24  VAL D O   1 
ATOM   5774  C CB  . VAL D  4  24  ? -19.216 35.819  82.938  1.00 82.86  ? 24  VAL D CB  1 
ATOM   5775  C CG1 . VAL D  4  24  ? -18.012 35.119  83.551  1.00 82.56  ? 24  VAL D CG1 1 
ATOM   5776  C CG2 . VAL D  4  24  ? -18.785 36.638  81.731  1.00 82.45  ? 24  VAL D CG2 1 
ATOM   5777  N N   . GLU D  4  25  ? -21.669 34.644  84.548  1.00 87.58  ? 25  GLU D N   1 
ATOM   5778  C CA  . GLU D  4  25  ? -22.208 34.041  85.770  1.00 89.91  ? 25  GLU D CA  1 
ATOM   5779  C C   . GLU D  4  25  ? -23.095 32.828  85.496  1.00 90.09  ? 25  GLU D C   1 
ATOM   5780  O O   . GLU D  4  25  ? -23.141 31.897  86.302  1.00 90.39  ? 25  GLU D O   1 
ATOM   5781  C CB  . GLU D  4  25  ? -22.975 35.079  86.596  1.00 93.17  ? 25  GLU D CB  1 
ATOM   5782  C CG  . GLU D  4  25  ? -22.091 36.079  87.330  1.00 99.80  ? 25  GLU D CG  1 
ATOM   5783  C CD  . GLU D  4  25  ? -21.290 35.454  88.462  1.00 106.73 ? 25  GLU D CD  1 
ATOM   5784  O OE1 . GLU D  4  25  ? -20.066 35.698  88.527  1.00 107.65 ? 25  GLU D OE1 1 
ATOM   5785  O OE2 . GLU D  4  25  ? -21.878 34.721  89.286  1.00 111.17 ? 25  GLU D OE2 1 
ATOM   5786  N N   . TYR D  4  26  ? -23.793 32.845  84.361  1.00 90.60  ? 26  TYR D N   1 
ATOM   5787  C CA  . TYR D  4  26  ? -24.626 31.715  83.949  1.00 91.26  ? 26  TYR D CA  1 
ATOM   5788  C C   . TYR D  4  26  ? -23.777 30.558  83.425  1.00 92.03  ? 26  TYR D C   1 
ATOM   5789  O O   . TYR D  4  26  ? -24.182 29.396  83.506  1.00 92.91  ? 26  TYR D O   1 
ATOM   5790  C CB  . TYR D  4  26  ? -25.651 32.136  82.889  1.00 91.06  ? 26  TYR D CB  1 
ATOM   5791  C CG  . TYR D  4  26  ? -26.583 33.264  83.293  1.00 92.14  ? 26  TYR D CG  1 
ATOM   5792  C CD1 . TYR D  4  26  ? -27.046 34.177  82.345  1.00 92.52  ? 26  TYR D CD1 1 
ATOM   5793  C CD2 . TYR D  4  26  ? -27.005 33.420  84.616  1.00 93.43  ? 26  TYR D CD2 1 
ATOM   5794  C CE1 . TYR D  4  26  ? -27.899 35.210  82.701  1.00 93.67  ? 26  TYR D CE1 1 
ATOM   5795  C CE2 . TYR D  4  26  ? -27.855 34.453  84.981  1.00 95.87  ? 26  TYR D CE2 1 
ATOM   5796  C CZ  . TYR D  4  26  ? -28.300 35.343  84.020  1.00 95.86  ? 26  TYR D CZ  1 
ATOM   5797  O OH  . TYR D  4  26  ? -29.147 36.366  84.378  1.00 97.09  ? 26  TYR D OH  1 
ATOM   5798  N N   . ALA D  4  27  ? -22.604 30.888  82.887  1.00 91.83  ? 27  ALA D N   1 
ATOM   5799  C CA  . ALA D  4  27  ? -21.651 29.892  82.398  1.00 92.55  ? 27  ALA D CA  1 
ATOM   5800  C C   . ALA D  4  27  ? -20.982 29.137  83.546  1.00 94.60  ? 27  ALA D C   1 
ATOM   5801  O O   . ALA D  4  27  ? -20.573 27.985  83.382  1.00 96.02  ? 27  ALA D O   1 
ATOM   5802  C CB  . ALA D  4  27  ? -20.608 30.549  81.507  1.00 90.76  ? 27  ALA D CB  1 
ATOM   5803  N N   . ILE D  4  28  ? -20.870 29.795  84.700  1.00 95.12  ? 28  ILE D N   1 
ATOM   5804  C CA  . ILE D  4  28  ? -20.378 29.161  85.927  1.00 96.96  ? 28  ILE D CA  1 
ATOM   5805  C C   . ILE D  4  28  ? -21.404 28.140  86.430  1.00 98.17  ? 28  ILE D C   1 
ATOM   5806  O O   . ILE D  4  28  ? -21.039 27.074  86.934  1.00 100.07 ? 28  ILE D O   1 
ATOM   5807  C CB  . ILE D  4  28  ? -20.066 30.205  87.033  1.00 97.64  ? 28  ILE D CB  1 
ATOM   5808  C CG1 . ILE D  4  28  ? -19.088 31.284  86.532  1.00 94.83  ? 28  ILE D CG1 1 
ATOM   5809  C CG2 . ILE D  4  28  ? -19.547 29.535  88.304  1.00 99.26  ? 28  ILE D CG2 1 
ATOM   5810  C CD1 . ILE D  4  28  ? -17.696 30.796  86.171  1.00 90.85  ? 28  ILE D CD1 1 
ATOM   5811  N N   . GLU D  4  29  ? -22.685 28.476  86.271  1.00 98.57  ? 29  GLU D N   1 
ATOM   5812  C CA  . GLU D  4  29  ? -23.793 27.598  86.655  1.00 100.30 ? 29  GLU D CA  1 
ATOM   5813  C C   . GLU D  4  29  ? -23.901 26.370  85.749  1.00 97.67  ? 29  GLU D C   1 
ATOM   5814  O O   . GLU D  4  29  ? -24.449 25.341  86.153  1.00 99.31  ? 29  GLU D O   1 
ATOM   5815  C CB  . GLU D  4  29  ? -25.118 28.370  86.648  1.00 102.87 ? 29  GLU D CB  1 
ATOM   5816  C CG  . GLU D  4  29  ? -25.229 29.463  87.705  1.00 107.80 ? 29  GLU D CG  1 
ATOM   5817  C CD  . GLU D  4  29  ? -25.389 28.922  89.116  1.00 113.96 ? 29  GLU D CD  1 
ATOM   5818  O OE1 . GLU D  4  29  ? -24.733 29.458  90.034  1.00 117.00 ? 29  GLU D OE1 1 
ATOM   5819  O OE2 . GLU D  4  29  ? -26.167 27.963  89.312  1.00 115.97 ? 29  GLU D OE2 1 
ATOM   5820  N N   . ALA D  4  30  ? -23.377 26.488  84.530  1.00 93.38  ? 30  ALA D N   1 
ATOM   5821  C CA  . ALA D  4  30  ? -23.391 25.397  83.554  1.00 91.07  ? 30  ALA D CA  1 
ATOM   5822  C C   . ALA D  4  30  ? -22.420 24.270  83.913  1.00 90.41  ? 30  ALA D C   1 
ATOM   5823  O O   . ALA D  4  30  ? -22.625 23.121  83.518  1.00 90.20  ? 30  ALA D O   1 
ATOM   5824  C CB  . ALA D  4  30  ? -23.095 25.932  82.160  1.00 89.07  ? 30  ALA D CB  1 
ATOM   5825  N N   . ILE D  4  31  ? -21.368 24.609  84.658  1.00 88.50  ? 31  ILE D N   1 
ATOM   5826  C CA  . ILE D  4  31  ? -20.362 23.637  85.093  1.00 87.52  ? 31  ILE D CA  1 
ATOM   5827  C C   . ILE D  4  31  ? -20.918 22.714  86.180  1.00 90.16  ? 31  ILE D C   1 
ATOM   5828  O O   . ILE D  4  31  ? -20.570 21.532  86.239  1.00 91.33  ? 31  ILE D O   1 
ATOM   5829  C CB  . ILE D  4  31  ? -19.081 24.329  85.615  1.00 85.61  ? 31  ILE D CB  1 
ATOM   5830  C CG1 . ILE D  4  31  ? -18.637 25.445  84.662  1.00 84.38  ? 31  ILE D CG1 1 
ATOM   5831  C CG2 . ILE D  4  31  ? -17.961 23.314  85.814  1.00 86.10  ? 31  ILE D CG2 1 
ATOM   5832  C CD1 . ILE D  4  31  ? -17.723 26.471  85.298  1.00 85.07  ? 31  ILE D CD1 1 
ATOM   5833  N N   . LYS D  4  32  ? -21.790 23.261  87.025  1.00 91.29  ? 32  LYS D N   1 
ATOM   5834  C CA  . LYS D  4  32  ? -22.382 22.525  88.146  1.00 95.73  ? 32  LYS D CA  1 
ATOM   5835  C C   . LYS D  4  32  ? -23.257 21.344  87.710  1.00 100.32 ? 32  LYS D C   1 
ATOM   5836  O O   . LYS D  4  32  ? -23.605 20.488  88.527  1.00 103.51 ? 32  LYS D O   1 
ATOM   5837  C CB  . LYS D  4  32  ? -23.181 23.476  89.044  1.00 95.42  ? 32  LYS D CB  1 
ATOM   5838  C CG  . LYS D  4  32  ? -22.333 24.512  89.768  1.00 91.83  ? 32  LYS D CG  1 
ATOM   5839  C CD  . LYS D  4  32  ? -23.196 25.459  90.586  1.00 91.13  ? 32  LYS D CD  1 
ATOM   5840  C CE  . LYS D  4  32  ? -22.350 26.508  91.289  1.00 85.54  ? 32  LYS D CE  1 
ATOM   5841  N NZ  . LYS D  4  32  ? -23.183 27.425  92.115  1.00 88.75  ? 32  LYS D NZ  1 
ATOM   5842  N N   . LEU D  4  33  ? -23.604 21.305  86.425  1.00 103.21 ? 33  LEU D N   1 
ATOM   5843  C CA  . LEU D  4  33  ? -24.387 20.209  85.857  1.00 109.01 ? 33  LEU D CA  1 
ATOM   5844  C C   . LEU D  4  33  ? -23.498 19.150  85.198  1.00 108.50 ? 33  LEU D C   1 
ATOM   5845  O O   . LEU D  4  33  ? -23.948 18.033  84.930  1.00 111.29 ? 33  LEU D O   1 
ATOM   5846  C CB  . LEU D  4  33  ? -25.411 20.745  84.849  1.00 114.03 ? 33  LEU D CB  1 
ATOM   5847  C CG  . LEU D  4  33  ? -26.559 21.614  85.378  1.00 117.35 ? 33  LEU D CG  1 
ATOM   5848  C CD1 . LEU D  4  33  ? -27.113 22.499  84.272  1.00 118.09 ? 33  LEU D CD1 1 
ATOM   5849  C CD2 . LEU D  4  33  ? -27.664 20.770  85.999  1.00 117.43 ? 33  LEU D CD2 1 
ATOM   5850  N N   . GLY D  4  34  ? -22.240 19.509  84.945  1.00 104.54 ? 34  GLY D N   1 
ATOM   5851  C CA  . GLY D  4  34  ? -21.278 18.611  84.304  1.00 101.85 ? 34  GLY D CA  1 
ATOM   5852  C C   . GLY D  4  34  ? -20.662 17.591  85.246  1.00 99.52  ? 34  GLY D C   1 
ATOM   5853  O O   . GLY D  4  34  ? -20.923 17.607  86.450  1.00 102.36 ? 34  GLY D O   1 
ATOM   5854  N N   . SER D  4  35  ? -19.839 16.706  84.688  1.00 96.07  ? 35  SER D N   1 
ATOM   5855  C CA  . SER D  4  35  ? -19.195 15.636  85.453  1.00 93.60  ? 35  SER D CA  1 
ATOM   5856  C C   . SER D  4  35  ? -18.024 16.142  86.296  1.00 91.86  ? 35  SER D C   1 
ATOM   5857  O O   . SER D  4  35  ? -17.377 17.130  85.943  1.00 90.96  ? 35  SER D O   1 
ATOM   5858  C CB  . SER D  4  35  ? -18.732 14.515  84.519  1.00 93.13  ? 35  SER D CB  1 
ATOM   5859  O OG  . SER D  4  35  ? -17.832 15.002  83.539  1.00 93.38  ? 35  SER D OG  1 
ATOM   5860  N N   . THR D  4  36  ? -17.759 15.454  87.405  1.00 90.23  ? 36  THR D N   1 
ATOM   5861  C CA  . THR D  4  36  ? -16.708 15.855  88.345  1.00 88.98  ? 36  THR D CA  1 
ATOM   5862  C C   . THR D  4  36  ? -15.305 15.412  87.910  1.00 88.29  ? 36  THR D C   1 
ATOM   5863  O O   . THR D  4  36  ? -15.133 14.346  87.315  1.00 87.25  ? 36  THR D O   1 
ATOM   5864  C CB  . THR D  4  36  ? -17.011 15.390  89.793  1.00 89.01  ? 36  THR D CB  1 
ATOM   5865  O OG1 . THR D  4  36  ? -15.964 15.824  90.671  1.00 86.95  ? 36  THR D OG1 1 
ATOM   5866  C CG2 . THR D  4  36  ? -17.148 13.870  89.880  1.00 91.42  ? 36  THR D CG2 1 
ATOM   5867  N N   . ALA D  4  37  ? -14.315 16.250  88.214  1.00 88.84  ? 37  ALA D N   1 
ATOM   5868  C CA  . ALA D  4  37  ? -12.916 15.986  87.874  1.00 89.71  ? 37  ALA D CA  1 
ATOM   5869  C C   . ALA D  4  37  ? -11.982 16.433  88.996  1.00 90.73  ? 37  ALA D C   1 
ATOM   5870  O O   . ALA D  4  37  ? -12.108 17.545  89.513  1.00 91.30  ? 37  ALA D O   1 
ATOM   5871  C CB  . ALA D  4  37  ? -12.547 16.676  86.568  1.00 89.28  ? 37  ALA D CB  1 
ATOM   5872  N N   . ILE D  4  38  ? -11.047 15.560  89.365  1.00 92.34  ? 38  ILE D N   1 
ATOM   5873  C CA  . ILE D  4  38  ? -10.108 15.832  90.456  1.00 94.32  ? 38  ILE D CA  1 
ATOM   5874  C C   . ILE D  4  38  ? -8.663  15.817  89.954  1.00 92.58  ? 38  ILE D C   1 
ATOM   5875  O O   . ILE D  4  38  ? -8.236  14.872  89.287  1.00 93.25  ? 38  ILE D O   1 
ATOM   5876  C CB  . ILE D  4  38  ? -10.278 14.825  91.622  1.00 97.26  ? 38  ILE D CB  1 
ATOM   5877  C CG1 . ILE D  4  38  ? -11.725 14.829  92.131  1.00 97.82  ? 38  ILE D CG1 1 
ATOM   5878  C CG2 . ILE D  4  38  ? -9.316  15.146  92.761  1.00 98.17  ? 38  ILE D CG2 1 
ATOM   5879  C CD1 . ILE D  4  38  ? -12.134 13.572  92.869  1.00 99.66  ? 38  ILE D CD1 1 
ATOM   5880  N N   . GLY D  4  39  ? -7.924  16.875  90.278  1.00 91.26  ? 39  GLY D N   1 
ATOM   5881  C CA  . GLY D  4  39  ? -6.509  16.983  89.931  1.00 92.11  ? 39  GLY D CA  1 
ATOM   5882  C C   . GLY D  4  39  ? -5.656  17.294  91.146  1.00 93.63  ? 39  GLY D C   1 
ATOM   5883  O O   . GLY D  4  39  ? -5.988  18.183  91.934  1.00 93.23  ? 39  GLY D O   1 
ATOM   5884  N N   . ILE D  4  40  ? -4.559  16.555  91.299  1.00 96.53  ? 40  ILE D N   1 
ATOM   5885  C CA  . ILE D  4  40  ? -3.649  16.725  92.435  1.00 98.79  ? 40  ILE D CA  1 
ATOM   5886  C C   . ILE D  4  40  ? -2.213  16.948  91.954  1.00 100.37 ? 40  ILE D C   1 
ATOM   5887  O O   . ILE D  4  40  ? -1.692  16.176  91.143  1.00 100.17 ? 40  ILE D O   1 
ATOM   5888  C CB  . ILE D  4  40  ? -3.710  15.517  93.405  1.00 99.26  ? 40  ILE D CB  1 
ATOM   5889  C CG1 . ILE D  4  40  ? -5.124  15.353  93.977  1.00 97.88  ? 40  ILE D CG1 1 
ATOM   5890  C CG2 . ILE D  4  40  ? -2.701  15.675  94.537  1.00 102.75 ? 40  ILE D CG2 1 
ATOM   5891  C CD1 . ILE D  4  40  ? -5.399  13.994  94.585  1.00 101.21 ? 40  ILE D CD1 1 
ATOM   5892  N N   . GLN D  4  41  ? -1.588  18.012  92.454  1.00 101.19 ? 41  GLN D N   1 
ATOM   5893  C CA  . GLN D  4  41  ? -0.193  18.318  92.148  1.00 102.34 ? 41  GLN D CA  1 
ATOM   5894  C C   . GLN D  4  41  ? 0.736   17.686  93.183  1.00 104.88 ? 41  GLN D C   1 
ATOM   5895  O O   . GLN D  4  41  ? 0.579   17.902  94.386  1.00 107.25 ? 41  GLN D O   1 
ATOM   5896  C CB  . GLN D  4  41  ? 0.029   19.832  92.089  1.00 103.33 ? 41  GLN D CB  1 
ATOM   5897  C CG  . GLN D  4  41  ? 1.420   20.243  91.623  1.00 103.58 ? 41  GLN D CG  1 
ATOM   5898  C CD  . GLN D  4  41  ? 1.711   21.716  91.842  1.00 105.22 ? 41  GLN D CD  1 
ATOM   5899  O OE1 . GLN D  4  41  ? 0.884   22.580  91.545  1.00 107.77 ? 41  GLN D OE1 1 
ATOM   5900  N NE2 . GLN D  4  41  ? 2.898   22.010  92.358  1.00 105.92 ? 41  GLN D NE2 1 
ATOM   5901  N N   . THR D  4  42  ? 1.700   16.909  92.701  1.00 106.95 ? 42  THR D N   1 
ATOM   5902  C CA  . THR D  4  42  ? 2.676   16.245  93.562  1.00 109.56 ? 42  THR D CA  1 
ATOM   5903  C C   . THR D  4  42  ? 4.085   16.715  93.197  1.00 111.70 ? 42  THR D C   1 
ATOM   5904  O O   . THR D  4  42  ? 4.300   17.280  92.122  1.00 110.03 ? 42  THR D O   1 
ATOM   5905  C CB  . THR D  4  42  ? 2.579   14.708  93.438  1.00 109.26 ? 42  THR D CB  1 
ATOM   5906  O OG1 . THR D  4  42  ? 1.208   14.322  93.281  1.00 109.51 ? 42  THR D OG1 1 
ATOM   5907  C CG2 . THR D  4  42  ? 3.147   14.022  94.669  1.00 110.33 ? 42  THR D CG2 1 
ATOM   5908  N N   . SER D  4  43  ? 5.036   16.483  94.100  1.00 113.92 ? 43  SER D N   1 
ATOM   5909  C CA  . SER D  4  43  ? 6.437   16.837  93.884  1.00 115.03 ? 43  SER D CA  1 
ATOM   5910  C C   . SER D  4  43  ? 7.094   15.987  92.790  1.00 113.53 ? 43  SER D C   1 
ATOM   5911  O O   . SER D  4  43  ? 8.132   16.366  92.243  1.00 114.17 ? 43  SER D O   1 
ATOM   5912  C CB  . SER D  4  43  ? 7.218   16.710  95.194  1.00 117.58 ? 43  SER D CB  1 
ATOM   5913  O OG  . SER D  4  43  ? 8.552   17.159  95.046  1.00 117.24 ? 43  SER D OG  1 
ATOM   5914  N N   . GLU D  4  44  ? 6.481   14.847  92.478  1.00 112.30 ? 44  GLU D N   1 
ATOM   5915  C CA  . GLU D  4  44  ? 7.001   13.928  91.462  1.00 113.38 ? 44  GLU D CA  1 
ATOM   5916  C C   . GLU D  4  44  ? 6.019   13.674  90.308  1.00 112.36 ? 44  GLU D C   1 
ATOM   5917  O O   . GLU D  4  44  ? 6.102   12.646  89.630  1.00 112.88 ? 44  GLU D O   1 
ATOM   5918  C CB  . GLU D  4  44  ? 7.461   12.610  92.106  1.00 115.47 ? 44  GLU D CB  1 
ATOM   5919  C CG  . GLU D  4  44  ? 6.432   11.939  93.007  1.00 119.19 ? 44  GLU D CG  1 
ATOM   5920  C CD  . GLU D  4  44  ? 6.978   10.722  93.734  1.00 123.74 ? 44  GLU D CD  1 
ATOM   5921  O OE1 . GLU D  4  44  ? 6.265   9.699   93.794  1.00 124.37 ? 44  GLU D OE1 1 
ATOM   5922  O OE2 . GLU D  4  44  ? 8.115   10.783  94.249  1.00 124.34 ? 44  GLU D OE2 1 
ATOM   5923  N N   . GLY D  4  45  ? 5.101   14.614  90.086  1.00 110.51 ? 45  GLY D N   1 
ATOM   5924  C CA  . GLY D  4  45  ? 4.151   14.519  88.976  1.00 107.96 ? 45  GLY D CA  1 
ATOM   5925  C C   . GLY D  4  45  ? 2.791   15.148  89.230  1.00 105.30 ? 45  GLY D C   1 
ATOM   5926  O O   . GLY D  4  45  ? 2.514   15.630  90.327  1.00 105.98 ? 45  GLY D O   1 
ATOM   5927  N N   . VAL D  4  46  ? 1.946   15.151  88.200  1.00 103.12 ? 46  VAL D N   1 
ATOM   5928  C CA  . VAL D  4  46  ? 0.575   15.656  88.305  1.00 101.88 ? 46  VAL D CA  1 
ATOM   5929  C C   . VAL D  4  46  ? -0.399  14.602  87.777  1.00 99.89  ? 46  VAL D C   1 
ATOM   5930  O O   . VAL D  4  46  ? -0.272  14.145  86.638  1.00 100.53 ? 46  VAL D O   1 
ATOM   5931  C CB  . VAL D  4  46  ? 0.379   16.986  87.534  1.00 99.29  ? 46  VAL D CB  1 
ATOM   5932  C CG1 . VAL D  4  46  ? -1.069  17.453  87.614  1.00 96.89  ? 46  VAL D CG1 1 
ATOM   5933  C CG2 . VAL D  4  46  ? 1.303   18.070  88.070  1.00 98.74  ? 46  VAL D CG2 1 
ATOM   5934  N N   . CYS D  4  47  ? -1.363  14.220  88.612  1.00 99.62  ? 47  CYS D N   1 
ATOM   5935  C CA  . CYS D  4  47  ? -2.375  13.236  88.231  1.00 99.67  ? 47  CYS D CA  1 
ATOM   5936  C C   . CYS D  4  47  ? -3.733  13.885  87.972  1.00 95.32  ? 47  CYS D C   1 
ATOM   5937  O O   . CYS D  4  47  ? -4.100  14.866  88.624  1.00 96.04  ? 47  CYS D O   1 
ATOM   5938  C CB  . CYS D  4  47  ? -2.499  12.142  89.297  1.00 104.06 ? 47  CYS D CB  1 
ATOM   5939  S SG  . CYS D  4  47  ? -3.008  12.724  90.931  1.00 109.41 ? 47  CYS D SG  1 
ATOM   5940  N N   . LEU D  4  48  ? -4.468  13.329  87.013  1.00 92.50  ? 48  LEU D N   1 
ATOM   5941  C CA  . LEU D  4  48  ? -5.798  13.821  86.657  1.00 90.38  ? 48  LEU D CA  1 
ATOM   5942  C C   . LEU D  4  48  ? -6.809  12.678  86.628  1.00 93.27  ? 48  LEU D C   1 
ATOM   5943  O O   . LEU D  4  48  ? -6.584  11.654  85.977  1.00 94.58  ? 48  LEU D O   1 
ATOM   5944  C CB  . LEU D  4  48  ? -5.767  14.540  85.302  1.00 84.68  ? 48  LEU D CB  1 
ATOM   5945  C CG  . LEU D  4  48  ? -4.981  15.851  85.179  1.00 79.94  ? 48  LEU D CG  1 
ATOM   5946  C CD1 . LEU D  4  48  ? -4.624  16.129  83.727  1.00 76.56  ? 48  LEU D CD1 1 
ATOM   5947  C CD2 . LEU D  4  48  ? -5.744  17.024  85.781  1.00 79.83  ? 48  LEU D CD2 1 
ATOM   5948  N N   . ALA D  4  49  ? -7.917  12.861  87.342  1.00 94.83  ? 49  ALA D N   1 
ATOM   5949  C CA  . ALA D  4  49  ? -8.977  11.858  87.415  1.00 96.84  ? 49  ALA D CA  1 
ATOM   5950  C C   . ALA D  4  49  ? -10.335 12.463  87.072  1.00 95.97  ? 49  ALA D C   1 
ATOM   5951  O O   . ALA D  4  49  ? -10.654 13.573  87.501  1.00 94.12  ? 49  ALA D O   1 
ATOM   5952  C CB  . ALA D  4  49  ? -9.009  11.220  88.796  1.00 98.19  ? 49  ALA D CB  1 
ATOM   5953  N N   . VAL D  4  50  ? -11.125 11.724  86.295  1.00 96.99  ? 50  VAL D N   1 
ATOM   5954  C CA  . VAL D  4  50  ? -12.450 12.177  85.860  1.00 98.30  ? 50  VAL D CA  1 
ATOM   5955  C C   . VAL D  4  50  ? -13.397 10.988  85.651  1.00 98.21  ? 50  VAL D C   1 
ATOM   5956  O O   . VAL D  4  50  ? -12.961 9.892   85.288  1.00 97.84  ? 50  VAL D O   1 
ATOM   5957  C CB  . VAL D  4  50  ? -12.358 13.060  84.582  1.00 96.95  ? 50  VAL D CB  1 
ATOM   5958  C CG1 . VAL D  4  50  ? -11.982 12.236  83.357  1.00 97.04  ? 50  VAL D CG1 1 
ATOM   5959  C CG2 . VAL D  4  50  ? -13.652 13.828  84.341  1.00 94.96  ? 50  VAL D CG2 1 
ATOM   5960  N N   . GLU D  4  51  ? -14.686 11.208  85.903  1.00 97.70  ? 51  GLU D N   1 
ATOM   5961  C CA  . GLU D  4  51  ? -15.709 10.198  85.633  1.00 98.14  ? 51  GLU D CA  1 
ATOM   5962  C C   . GLU D  4  51  ? -16.207 10.293  84.192  1.00 96.78  ? 51  GLU D C   1 
ATOM   5963  O O   . GLU D  4  51  ? -16.372 11.390  83.652  1.00 96.66  ? 51  GLU D O   1 
ATOM   5964  C CB  . GLU D  4  51  ? -16.877 10.300  86.625  1.00 98.98  ? 51  GLU D CB  1 
ATOM   5965  C CG  . GLU D  4  51  ? -17.626 11.627  86.634  1.00 99.37  ? 51  GLU D CG  1 
ATOM   5966  C CD  . GLU D  4  51  ? -18.974 11.547  87.333  1.00 102.28 ? 51  GLU D CD  1 
ATOM   5967  O OE1 . GLU D  4  51  ? -19.461 12.596  87.804  1.00 100.24 ? 51  GLU D OE1 1 
ATOM   5968  O OE2 . GLU D  4  51  ? -19.554 10.442  87.414  1.00 104.96 ? 51  GLU D OE2 1 
ATOM   5969  N N   . LYS D  4  52  ? -16.437 9.137   83.575  1.00 96.86  ? 52  LYS D N   1 
ATOM   5970  C CA  . LYS D  4  52  ? -16.928 9.078   82.199  1.00 98.04  ? 52  LYS D CA  1 
ATOM   5971  C C   . LYS D  4  52  ? -18.427 9.360   82.123  1.00 101.62 ? 52  LYS D C   1 
ATOM   5972  O O   . LYS D  4  52  ? -18.895 9.985   81.169  1.00 104.24 ? 52  LYS D O   1 
ATOM   5973  C CB  . LYS D  4  52  ? -16.611 7.721   81.563  1.00 97.10  ? 52  LYS D CB  1 
ATOM   5974  C CG  . LYS D  4  52  ? -15.141 7.512   81.233  1.00 94.84  ? 52  LYS D CG  1 
ATOM   5975  C CD  . LYS D  4  52  ? -14.911 6.167   80.565  1.00 96.18  ? 52  LYS D CD  1 
ATOM   5976  C CE  . LYS D  4  52  ? -13.438 5.945   80.264  1.00 97.54  ? 52  LYS D CE  1 
ATOM   5977  N NZ  . LYS D  4  52  ? -13.195 4.648   79.575  1.00 100.05 ? 52  LYS D NZ  1 
ATOM   5978  N N   . ARG D  4  53  ? -19.159 8.898   83.140  1.00 104.10 ? 53  ARG D N   1 
ATOM   5979  C CA  . ARG D  4  53  ? -20.622 9.016   83.219  1.00 106.97 ? 53  ARG D CA  1 
ATOM   5980  C C   . ARG D  4  53  ? -21.313 8.421   81.986  1.00 109.19 ? 53  ARG D C   1 
ATOM   5981  O O   . ARG D  4  53  ? -21.728 9.142   81.073  1.00 108.34 ? 53  ARG D O   1 
ATOM   5982  C CB  . ARG D  4  53  ? -21.053 10.470  83.473  1.00 104.74 ? 53  ARG D CB  1 
ATOM   5983  C CG  . ARG D  4  53  ? -22.500 10.630  83.918  1.00 105.33 ? 53  ARG D CG  1 
ATOM   5984  C CD  . ARG D  4  53  ? -22.850 12.086  84.181  1.00 104.88 ? 53  ARG D CD  1 
ATOM   5985  N NE  . ARG D  4  53  ? -22.296 12.568  85.446  1.00 105.39 ? 53  ARG D NE  1 
ATOM   5986  C CZ  . ARG D  4  53  ? -22.454 13.801  85.921  1.00 104.72 ? 53  ARG D CZ  1 
ATOM   5987  N NH1 . ARG D  4  53  ? -23.154 14.702  85.242  1.00 104.12 ? 53  ARG D NH1 1 
ATOM   5988  N NH2 . ARG D  4  53  ? -21.910 14.135  87.083  1.00 103.72 ? 53  ARG D NH2 1 
ATOM   5989  N N   . ILE D  4  54  ? -21.418 7.095   81.973  1.00 113.59 ? 54  ILE D N   1 
ATOM   5990  C CA  . ILE D  4  54  ? -22.019 6.367   80.858  1.00 115.76 ? 54  ILE D CA  1 
ATOM   5991  C C   . ILE D  4  54  ? -23.530 6.253   81.069  1.00 117.63 ? 54  ILE D C   1 
ATOM   5992  O O   . ILE D  4  54  ? -23.986 5.705   82.076  1.00 117.65 ? 54  ILE D O   1 
ATOM   5993  C CB  . ILE D  4  54  ? -21.389 4.962   80.672  1.00 115.81 ? 54  ILE D CB  1 
ATOM   5994  C CG1 . ILE D  4  54  ? -19.858 5.038   80.604  1.00 114.15 ? 54  ILE D CG1 1 
ATOM   5995  C CG2 . ILE D  4  54  ? -21.918 4.292   79.413  1.00 115.21 ? 54  ILE D CG2 1 
ATOM   5996  C CD1 . ILE D  4  54  ? -19.156 4.786   81.922  1.00 115.13 ? 54  ILE D CD1 1 
ATOM   5997  N N   . THR D  4  55  ? -24.293 6.781   80.115  1.00 117.76 ? 55  THR D N   1 
ATOM   5998  C CA  . THR D  4  55  ? -25.756 6.795   80.196  1.00 117.84 ? 55  THR D CA  1 
ATOM   5999  C C   . THR D  4  55  ? -26.371 5.435   79.868  1.00 117.74 ? 55  THR D C   1 
ATOM   6000  O O   . THR D  4  55  ? -27.331 5.011   80.514  1.00 120.49 ? 55  THR D O   1 
ATOM   6001  C CB  . THR D  4  55  ? -26.374 7.869   79.275  1.00 118.11 ? 55  THR D CB  1 
ATOM   6002  O OG1 . THR D  4  55  ? -25.883 7.702   77.940  1.00 118.42 ? 55  THR D OG1 1 
ATOM   6003  C CG2 . THR D  4  55  ? -26.032 9.270   79.769  1.00 118.05 ? 55  THR D CG2 1 
ATOM   6004  N N   . SER D  4  56  ? -25.814 4.762   78.863  1.00 116.54 ? 56  SER D N   1 
ATOM   6005  C CA  . SER D  4  56  ? -26.309 3.459   78.424  1.00 116.34 ? 56  SER D CA  1 
ATOM   6006  C C   . SER D  4  56  ? -25.152 2.497   78.153  1.00 115.28 ? 56  SER D C   1 
ATOM   6007  O O   . SER D  4  56  ? -24.159 2.887   77.536  1.00 114.92 ? 56  SER D O   1 
ATOM   6008  C CB  . SER D  4  56  ? -27.176 3.617   77.170  1.00 117.99 ? 56  SER D CB  1 
ATOM   6009  O OG  . SER D  4  56  ? -27.727 2.376   76.763  1.00 119.63 ? 56  SER D OG  1 
ATOM   6010  N N   . PRO D  4  57  ? -25.279 1.231   78.608  1.00 115.31 ? 57  PRO D N   1 
ATOM   6011  C CA  . PRO D  4  57  ? -24.246 0.205   78.407  1.00 115.44 ? 57  PRO D CA  1 
ATOM   6012  C C   . PRO D  4  57  ? -23.940 -0.089  76.935  1.00 117.16 ? 57  PRO D C   1 
ATOM   6013  O O   . PRO D  4  57  ? -22.943 -0.749  76.632  1.00 118.36 ? 57  PRO D O   1 
ATOM   6014  C CB  . PRO D  4  57  ? -24.845 -1.038  79.082  1.00 115.69 ? 57  PRO D CB  1 
ATOM   6015  C CG  . PRO D  4  57  ? -26.310 -0.772  79.163  1.00 116.44 ? 57  PRO D CG  1 
ATOM   6016  C CD  . PRO D  4  57  ? -26.416 0.705   79.383  1.00 116.63 ? 57  PRO D CD  1 
ATOM   6017  N N   . LEU D  4  58  ? -24.796 0.398   76.039  1.00 118.53 ? 58  LEU D N   1 
ATOM   6018  C CA  . LEU D  4  58  ? -24.602 0.248   74.597  1.00 120.83 ? 58  LEU D CA  1 
ATOM   6019  C C   . LEU D  4  58  ? -23.527 1.196   74.064  1.00 119.34 ? 58  LEU D C   1 
ATOM   6020  O O   . LEU D  4  58  ? -22.878 0.904   73.057  1.00 119.21 ? 58  LEU D O   1 
ATOM   6021  C CB  . LEU D  4  58  ? -25.920 0.481   73.855  1.00 122.72 ? 58  LEU D CB  1 
ATOM   6022  C CG  . LEU D  4  58  ? -27.068 -0.503  74.103  1.00 126.78 ? 58  LEU D CG  1 
ATOM   6023  C CD1 . LEU D  4  58  ? -28.408 0.156   73.813  1.00 127.22 ? 58  LEU D CD1 1 
ATOM   6024  C CD2 . LEU D  4  58  ? -26.899 -1.776  73.284  1.00 127.17 ? 58  LEU D CD2 1 
ATOM   6025  N N   . MET D  4  59  ? -23.351 2.328   74.743  1.00 117.32 ? 59  MET D N   1 
ATOM   6026  C CA  . MET D  4  59  ? -22.340 3.320   74.379  1.00 116.07 ? 59  MET D CA  1 
ATOM   6027  C C   . MET D  4  59  ? -20.939 2.825   74.736  1.00 116.86 ? 59  MET D C   1 
ATOM   6028  O O   . MET D  4  59  ? -20.728 2.257   75.811  1.00 118.42 ? 59  MET D O   1 
ATOM   6029  C CB  . MET D  4  59  ? -22.621 4.648   75.087  1.00 114.78 ? 59  MET D CB  1 
ATOM   6030  C CG  . MET D  4  59  ? -21.843 5.836   74.540  1.00 113.42 ? 59  MET D CG  1 
ATOM   6031  S SD  . MET D  4  59  ? -21.576 7.144   75.755  1.00 114.20 ? 59  MET D SD  1 
ATOM   6032  C CE  . MET D  4  59  ? -23.212 7.860   75.897  1.00 113.40 ? 59  MET D CE  1 
ATOM   6033  N N   . GLU D  4  60  ? -19.990 3.045   73.828  1.00 116.31 ? 60  GLU D N   1 
ATOM   6034  C CA  . GLU D  4  60  ? -18.594 2.666   74.044  1.00 119.24 ? 60  GLU D CA  1 
ATOM   6035  C C   . GLU D  4  60  ? -17.918 3.591   75.061  1.00 116.09 ? 60  GLU D C   1 
ATOM   6036  O O   . GLU D  4  60  ? -17.939 4.814   74.895  1.00 115.58 ? 60  GLU D O   1 
ATOM   6037  C CB  . GLU D  4  60  ? -17.818 2.669   72.722  1.00 122.02 ? 60  GLU D CB  1 
ATOM   6038  C CG  . GLU D  4  60  ? -18.099 1.476   71.817  1.00 130.31 ? 60  GLU D CG  1 
ATOM   6039  C CD  . GLU D  4  60  ? -17.428 0.195   72.285  1.00 136.07 ? 60  GLU D CD  1 
ATOM   6040  O OE1 . GLU D  4  60  ? -16.337 0.267   72.893  1.00 136.90 ? 60  GLU D OE1 1 
ATOM   6041  O OE2 . GLU D  4  60  ? -17.990 -0.892  72.035  1.00 133.38 ? 60  GLU D OE2 1 
ATOM   6042  N N   . PRO D  4  61  ? -17.324 3.007   76.121  1.00 113.13 ? 61  PRO D N   1 
ATOM   6043  C CA  . PRO D  4  61  ? -16.657 3.786   77.170  1.00 109.99 ? 61  PRO D CA  1 
ATOM   6044  C C   . PRO D  4  61  ? -15.332 4.405   76.719  1.00 105.97 ? 61  PRO D C   1 
ATOM   6045  O O   . PRO D  4  61  ? -14.917 5.430   77.263  1.00 102.73 ? 61  PRO D O   1 
ATOM   6046  C CB  . PRO D  4  61  ? -16.414 2.753   78.274  1.00 111.21 ? 61  PRO D CB  1 
ATOM   6047  C CG  . PRO D  4  61  ? -16.349 1.446   77.564  1.00 113.45 ? 61  PRO D CG  1 
ATOM   6048  C CD  . PRO D  4  61  ? -17.297 1.559   76.406  1.00 114.61 ? 61  PRO D CD  1 
ATOM   6049  N N   . SER D  4  62  ? -14.684 3.787   75.732  1.00 105.12 ? 62  SER D N   1 
ATOM   6050  C CA  . SER D  4  62  ? -13.406 4.271   75.205  1.00 100.77 ? 62  SER D CA  1 
ATOM   6051  C C   . SER D  4  62  ? -13.559 5.553   74.382  1.00 97.95  ? 62  SER D C   1 
ATOM   6052  O O   . SER D  4  62  ? -12.591 6.291   74.185  1.00 95.71  ? 62  SER D O   1 
ATOM   6053  C CB  . SER D  4  62  ? -12.722 3.184   74.370  1.00 101.82 ? 62  SER D CB  1 
ATOM   6054  O OG  . SER D  4  62  ? -13.531 2.790   73.276  1.00 103.24 ? 62  SER D OG  1 
ATOM   6055  N N   . SER D  4  63  ? -14.779 5.804   73.908  1.00 96.80  ? 63  SER D N   1 
ATOM   6056  C CA  . SER D  4  63  ? -15.095 6.995   73.123  1.00 94.97  ? 63  SER D CA  1 
ATOM   6057  C C   . SER D  4  63  ? -15.132 8.255   73.984  1.00 96.48  ? 63  SER D C   1 
ATOM   6058  O O   . SER D  4  63  ? -14.761 9.337   73.525  1.00 98.48  ? 63  SER D O   1 
ATOM   6059  C CB  . SER D  4  63  ? -16.437 6.816   72.411  1.00 93.34  ? 63  SER D CB  1 
ATOM   6060  O OG  . SER D  4  63  ? -16.732 7.924   71.579  1.00 94.56  ? 63  SER D OG  1 
ATOM   6061  N N   . ILE D  4  64  ? -15.586 8.106   75.227  1.00 99.03  ? 64  ILE D N   1 
ATOM   6062  C CA  . ILE D  4  64  ? -15.676 9.226   76.161  1.00 102.58 ? 64  ILE D CA  1 
ATOM   6063  C C   . ILE D  4  64  ? -14.289 9.582   76.690  1.00 102.43 ? 64  ILE D C   1 
ATOM   6064  O O   . ILE D  4  64  ? -13.757 8.909   77.578  1.00 104.98 ? 64  ILE D O   1 
ATOM   6065  C CB  . ILE D  4  64  ? -16.628 8.926   77.343  1.00 106.72 ? 64  ILE D CB  1 
ATOM   6066  C CG1 . ILE D  4  64  ? -17.923 8.269   76.852  1.00 109.16 ? 64  ILE D CG1 1 
ATOM   6067  C CG2 . ILE D  4  64  ? -16.926 10.203  78.123  1.00 107.10 ? 64  ILE D CG2 1 
ATOM   6068  C CD1 . ILE D  4  64  ? -18.654 7.476   77.916  1.00 111.63 ? 64  ILE D CD1 1 
ATOM   6069  N N   . GLU D  4  65  ? -13.706 10.636  76.125  1.00 101.31 ? 65  GLU D N   1 
ATOM   6070  C CA  . GLU D  4  65  ? -12.407 11.135  76.569  1.00 101.56 ? 65  GLU D CA  1 
ATOM   6071  C C   . GLU D  4  65  ? -12.524 12.560  77.106  1.00 99.17  ? 65  GLU D C   1 
ATOM   6072  O O   . GLU D  4  65  ? -12.897 13.484  76.380  1.00 99.63  ? 65  GLU D O   1 
ATOM   6073  C CB  . GLU D  4  65  ? -11.351 11.034  75.454  1.00 103.03 ? 65  GLU D CB  1 
ATOM   6074  C CG  . GLU D  4  65  ? -11.766 11.594  74.098  1.00 104.60 ? 65  GLU D CG  1 
ATOM   6075  C CD  . GLU D  4  65  ? -10.685 11.450  73.041  1.00 106.64 ? 65  GLU D CD  1 
ATOM   6076  O OE1 . GLU D  4  65  ? -9.510  11.765  73.328  1.00 103.13 ? 65  GLU D OE1 1 
ATOM   6077  O OE2 . GLU D  4  65  ? -11.014 11.027  71.912  1.00 109.17 ? 65  GLU D OE2 1 
ATOM   6078  N N   . LYS D  4  66  ? -12.217 12.718  78.390  1.00 94.28  ? 66  LYS D N   1 
ATOM   6079  C CA  . LYS D  4  66  ? -12.293 14.016  79.058  1.00 89.39  ? 66  LYS D CA  1 
ATOM   6080  C C   . LYS D  4  66  ? -10.915 14.514  79.490  1.00 88.21  ? 66  LYS D C   1 
ATOM   6081  O O   . LYS D  4  66  ? -10.765 15.659  79.922  1.00 89.10  ? 66  LYS D O   1 
ATOM   6082  C CB  . LYS D  4  66  ? -13.260 13.956  80.244  1.00 87.55  ? 66  LYS D CB  1 
ATOM   6083  C CG  . LYS D  4  66  ? -14.717 13.846  79.826  1.00 85.57  ? 66  LYS D CG  1 
ATOM   6084  C CD  . LYS D  4  66  ? -15.626 13.513  80.995  1.00 86.03  ? 66  LYS D CD  1 
ATOM   6085  C CE  . LYS D  4  66  ? -17.056 13.332  80.513  1.00 86.80  ? 66  LYS D CE  1 
ATOM   6086  N NZ  . LYS D  4  66  ? -17.978 12.925  81.607  1.00 89.42  ? 66  LYS D NZ  1 
ATOM   6087  N N   . ILE D  4  67  ? -9.917  13.642  79.373  1.00 88.13  ? 67  ILE D N   1 
ATOM   6088  C CA  . ILE D  4  67  ? -8.521  14.029  79.550  1.00 88.38  ? 67  ILE D CA  1 
ATOM   6089  C C   . ILE D  4  67  ? -7.790  13.860  78.220  1.00 88.41  ? 67  ILE D C   1 
ATOM   6090  O O   . ILE D  4  67  ? -7.736  12.760  77.665  1.00 89.30  ? 67  ILE D O   1 
ATOM   6091  C CB  . ILE D  4  67  ? -7.811  13.216  80.657  1.00 90.54  ? 67  ILE D CB  1 
ATOM   6092  C CG1 . ILE D  4  67  ? -8.614  13.255  81.962  1.00 92.07  ? 67  ILE D CG1 1 
ATOM   6093  C CG2 . ILE D  4  67  ? -6.403  13.755  80.886  1.00 90.98  ? 67  ILE D CG2 1 
ATOM   6094  C CD1 . ILE D  4  67  ? -8.198  12.214  82.982  1.00 94.94  ? 67  ILE D CD1 1 
ATOM   6095  N N   . VAL D  4  68  ? -7.246  14.962  77.712  1.00 86.94  ? 68  VAL D N   1 
ATOM   6096  C CA  . VAL D  4  68  ? -6.514  14.962  76.445  1.00 86.07  ? 68  VAL D CA  1 
ATOM   6097  C C   . VAL D  4  68  ? -5.169  15.670  76.582  1.00 84.16  ? 68  VAL D C   1 
ATOM   6098  O O   . VAL D  4  68  ? -5.017  16.576  77.405  1.00 83.99  ? 68  VAL D O   1 
ATOM   6099  C CB  . VAL D  4  68  ? -7.332  15.602  75.295  1.00 86.96  ? 68  VAL D CB  1 
ATOM   6100  C CG1 . VAL D  4  68  ? -8.362  14.620  74.754  1.00 89.82  ? 68  VAL D CG1 1 
ATOM   6101  C CG2 . VAL D  4  68  ? -7.996  16.899  75.741  1.00 83.79  ? 68  VAL D CG2 1 
ATOM   6102  N N   . GLU D  4  69  ? -4.197  15.245  75.779  1.00 82.73  ? 69  GLU D N   1 
ATOM   6103  C CA  . GLU D  4  69  ? -2.871  15.859  75.782  1.00 80.22  ? 69  GLU D CA  1 
ATOM   6104  C C   . GLU D  4  69  ? -2.788  17.048  74.827  1.00 77.18  ? 69  GLU D C   1 
ATOM   6105  O O   . GLU D  4  69  ? -3.231  16.972  73.678  1.00 77.30  ? 69  GLU D O   1 
ATOM   6106  C CB  . GLU D  4  69  ? -1.774  14.830  75.469  1.00 80.14  ? 69  GLU D CB  1 
ATOM   6107  C CG  . GLU D  4  69  ? -1.939  14.072  74.156  1.00 80.36  ? 69  GLU D CG  1 
ATOM   6108  C CD  . GLU D  4  69  ? -0.716  13.250  73.785  1.00 81.65  ? 69  GLU D CD  1 
ATOM   6109  O OE1 . GLU D  4  69  ? -0.892  12.154  73.214  1.00 86.84  ? 69  GLU D OE1 1 
ATOM   6110  O OE2 . GLU D  4  69  ? 0.421   13.695  74.059  1.00 79.98  ? 69  GLU D OE2 1 
ATOM   6111  N N   . ILE D  4  70  ? -2.231  18.147  75.326  1.00 73.92  ? 70  ILE D N   1 
ATOM   6112  C CA  . ILE D  4  70  ? -1.984  19.336  74.517  1.00 72.63  ? 70  ILE D CA  1 
ATOM   6113  C C   . ILE D  4  70  ? -0.605  19.206  73.874  1.00 73.35  ? 70  ILE D C   1 
ATOM   6114  O O   . ILE D  4  70  ? -0.436  19.460  72.678  1.00 73.25  ? 70  ILE D O   1 
ATOM   6115  C CB  . ILE D  4  70  ? -2.075  20.624  75.364  1.00 71.17  ? 70  ILE D CB  1 
ATOM   6116  C CG1 . ILE D  4  70  ? -3.444  20.713  76.045  1.00 69.69  ? 70  ILE D CG1 1 
ATOM   6117  C CG2 . ILE D  4  70  ? -1.826  21.859  74.506  1.00 72.09  ? 70  ILE D CG2 1 
ATOM   6118  C CD1 . ILE D  4  70  ? -3.477  21.625  77.250  1.00 71.82  ? 70  ILE D CD1 1 
ATOM   6119  N N   . ASP D  4  71  ? 0.369   18.801  74.684  1.00 75.59  ? 71  ASP D N   1 
ATOM   6120  C CA  . ASP D  4  71  ? 1.712   18.492  74.213  1.00 79.11  ? 71  ASP D CA  1 
ATOM   6121  C C   . ASP D  4  71  ? 2.169   17.188  74.870  1.00 80.19  ? 71  ASP D C   1 
ATOM   6122  O O   . ASP D  4  71  ? 1.380   16.519  75.544  1.00 80.34  ? 71  ASP D O   1 
ATOM   6123  C CB  . ASP D  4  71  ? 2.670   19.644  74.541  1.00 82.11  ? 71  ASP D CB  1 
ATOM   6124  C CG  . ASP D  4  71  ? 3.822   19.761  73.547  1.00 85.77  ? 71  ASP D CG  1 
ATOM   6125  O OD1 . ASP D  4  71  ? 4.092   18.792  72.803  1.00 84.26  ? 71  ASP D OD1 1 
ATOM   6126  O OD2 . ASP D  4  71  ? 4.465   20.832  73.513  1.00 86.96  ? 71  ASP D OD2 1 
ATOM   6127  N N   . ALA D  4  72  ? 3.434   16.827  74.672  1.00 81.05  ? 72  ALA D N   1 
ATOM   6128  C CA  . ALA D  4  72  ? 3.997   15.617  75.267  1.00 80.76  ? 72  ALA D CA  1 
ATOM   6129  C C   . ALA D  4  72  ? 4.282   15.782  76.763  1.00 81.09  ? 72  ALA D C   1 
ATOM   6130  O O   . ALA D  4  72  ? 4.599   14.808  77.450  1.00 84.87  ? 72  ALA D O   1 
ATOM   6131  C CB  . ALA D  4  72  ? 5.259   15.201  74.523  1.00 81.20  ? 72  ALA D CB  1 
ATOM   6132  N N   . HIS D  4  73  ? 4.152   17.010  77.263  1.00 79.68  ? 73  HIS D N   1 
ATOM   6133  C CA  . HIS D  4  73  ? 4.487   17.326  78.651  1.00 80.04  ? 73  HIS D CA  1 
ATOM   6134  C C   . HIS D  4  73  ? 3.365   17.977  79.421  1.00 79.35  ? 73  HIS D C   1 
ATOM   6135  O O   . HIS D  4  73  ? 3.523   18.285  80.604  1.00 80.35  ? 73  HIS D O   1 
ATOM   6136  C CB  . HIS D  4  73  ? 5.746   18.195  78.703  1.00 80.79  ? 73  HIS D CB  1 
ATOM   6137  C CG  . HIS D  4  73  ? 5.546   19.598  78.175  1.00 80.56  ? 73  HIS D CG  1 
ATOM   6138  N ND1 . HIS D  4  73  ? 5.274   19.854  76.882  1.00 80.36  ? 73  HIS D ND1 1 
ATOM   6139  C CD2 . HIS D  4  73  ? 5.598   20.832  78.818  1.00 79.79  ? 73  HIS D CD2 1 
ATOM   6140  C CE1 . HIS D  4  73  ? 5.149   21.182  76.707  1.00 78.22  ? 73  HIS D CE1 1 
ATOM   6141  N NE2 . HIS D  4  73  ? 5.351   21.780  77.891  1.00 78.09  ? 73  HIS D NE2 1 
ATOM   6142  N N   . ILE D  4  74  ? 2.228   18.198  78.762  1.00 79.21  ? 74  ILE D N   1 
ATOM   6143  C CA  . ILE D  4  74  ? 1.063   18.829  79.396  1.00 77.97  ? 74  ILE D CA  1 
ATOM   6144  C C   . ILE D  4  74  ? -0.238  18.096  79.057  1.00 78.42  ? 74  ILE D C   1 
ATOM   6145  O O   . ILE D  4  74  ? -0.541  17.853  77.885  1.00 77.71  ? 74  ILE D O   1 
ATOM   6146  C CB  . ILE D  4  74  ? 0.945   20.331  79.025  1.00 76.33  ? 74  ILE D CB  1 
ATOM   6147  C CG1 . ILE D  4  74  ? 2.086   21.136  79.659  1.00 76.41  ? 74  ILE D CG1 1 
ATOM   6148  C CG2 . ILE D  4  74  ? -0.397  20.903  79.470  1.00 76.15  ? 74  ILE D CG2 1 
ATOM   6149  C CD1 . ILE D  4  74  ? 2.254   22.534  79.102  1.00 75.50  ? 74  ILE D CD1 1 
ATOM   6150  N N   . GLY D  4  75  ? -0.993  17.745  80.096  1.00 78.75  ? 75  GLY D N   1 
ATOM   6151  C CA  . GLY D  4  75  ? -2.323  17.155  79.946  1.00 78.72  ? 75  GLY D CA  1 
ATOM   6152  C C   . GLY D  4  75  ? -3.404  18.089  80.460  1.00 76.97  ? 75  GLY D C   1 
ATOM   6153  O O   . GLY D  4  75  ? -3.129  18.979  81.269  1.00 77.08  ? 75  GLY D O   1 
ATOM   6154  N N   . CYS D  4  76  ? -4.635  17.886  79.995  1.00 76.62  ? 76  CYS D N   1 
ATOM   6155  C CA  . CYS D  4  76  ? -5.751  18.756  80.365  1.00 78.23  ? 76  CYS D CA  1 
ATOM   6156  C C   . CYS D  4  76  ? -7.044  17.985  80.622  1.00 78.58  ? 76  CYS D C   1 
ATOM   6157  O O   . CYS D  4  76  ? -7.451  17.152  79.810  1.00 78.83  ? 76  CYS D O   1 
ATOM   6158  C CB  . CYS D  4  76  ? -5.979  19.816  79.283  1.00 78.79  ? 76  CYS D CB  1 
ATOM   6159  S SG  . CYS D  4  76  ? -7.181  21.097  79.714  1.00 83.18  ? 76  CYS D SG  1 
ATOM   6160  N N   . ALA D  4  77  ? -7.679  18.274  81.757  1.00 77.85  ? 77  ALA D N   1 
ATOM   6161  C CA  . ALA D  4  77  ? -8.975  17.693  82.109  1.00 77.14  ? 77  ALA D CA  1 
ATOM   6162  C C   . ALA D  4  77  ? -10.081 18.739  81.988  1.00 78.04  ? 77  ALA D C   1 
ATOM   6163  O O   . ALA D  4  77  ? -9.906  19.890  82.394  1.00 77.30  ? 77  ALA D O   1 
ATOM   6164  C CB  . ALA D  4  77  ? -8.937  17.115  83.515  1.00 75.84  ? 77  ALA D CB  1 
ATOM   6165  N N   . MET D  4  78  ? -11.219 18.329  81.431  1.00 82.14  ? 78  MET D N   1 
ATOM   6166  C CA  . MET D  4  78  ? -12.325 19.250  81.159  1.00 86.44  ? 78  MET D CA  1 
ATOM   6167  C C   . MET D  4  78  ? -13.634 18.844  81.837  1.00 89.54  ? 78  MET D C   1 
ATOM   6168  O O   . MET D  4  78  ? -13.899 17.657  82.043  1.00 90.65  ? 78  MET D O   1 
ATOM   6169  C CB  . MET D  4  78  ? -12.521 19.429  79.646  1.00 88.68  ? 78  MET D CB  1 
ATOM   6170  C CG  . MET D  4  78  ? -12.762 18.145  78.864  1.00 91.60  ? 78  MET D CG  1 
ATOM   6171  S SD  . MET D  4  78  ? -12.200 18.282  77.156  1.00 95.04  ? 78  MET D SD  1 
ATOM   6172  C CE  . MET D  4  78  ? -12.903 16.801  76.438  1.00 96.33  ? 78  MET D CE  1 
ATOM   6173  N N   . SER D  4  79  ? -14.441 19.846  82.181  1.00 89.74  ? 79  SER D N   1 
ATOM   6174  C CA  . SER D  4  79  ? -15.734 19.635  82.828  1.00 90.16  ? 79  SER D CA  1 
ATOM   6175  C C   . SER D  4  79  ? -16.793 20.595  82.287  1.00 90.17  ? 79  SER D C   1 
ATOM   6176  O O   . SER D  4  79  ? -16.473 21.702  81.845  1.00 89.55  ? 79  SER D O   1 
ATOM   6177  C CB  . SER D  4  79  ? -15.605 19.791  84.346  1.00 90.42  ? 79  SER D CB  1 
ATOM   6178  O OG  . SER D  4  79  ? -16.850 19.586  84.991  1.00 90.21  ? 79  SER D OG  1 
ATOM   6179  N N   . GLY D  4  80  ? -18.051 20.162  82.330  1.00 91.18  ? 80  GLY D N   1 
ATOM   6180  C CA  . GLY D  4  80  ? -19.172 20.966  81.851  1.00 92.88  ? 80  GLY D CA  1 
ATOM   6181  C C   . GLY D  4  80  ? -19.620 20.555  80.462  1.00 93.31  ? 80  GLY D C   1 
ATOM   6182  O O   . GLY D  4  80  ? -19.975 19.397  80.235  1.00 95.13  ? 80  GLY D O   1 
ATOM   6183  N N   . LEU D  4  81  ? -19.602 21.509  79.535  1.00 88.74  ? 81  LEU D N   1 
ATOM   6184  C CA  . LEU D  4  81  ? -19.966 21.251  78.143  1.00 84.34  ? 81  LEU D CA  1 
ATOM   6185  C C   . LEU D  4  81  ? -18.752 20.771  77.348  1.00 83.35  ? 81  LEU D C   1 
ATOM   6186  O O   . LEU D  4  81  ? -17.826 21.542  77.082  1.00 81.75  ? 81  LEU D O   1 
ATOM   6187  C CB  . LEU D  4  81  ? -20.585 22.499  77.502  1.00 79.21  ? 81  LEU D CB  1 
ATOM   6188  C CG  . LEU D  4  81  ? -21.950 22.958  78.028  1.00 76.97  ? 81  LEU D CG  1 
ATOM   6189  C CD1 . LEU D  4  81  ? -22.151 24.445  77.780  1.00 76.11  ? 81  LEU D CD1 1 
ATOM   6190  C CD2 . LEU D  4  81  ? -23.088 22.151  77.419  1.00 77.31  ? 81  LEU D CD2 1 
ATOM   6191  N N   . ILE D  4  82  ? -18.771 19.492  76.979  1.00 83.20  ? 82  ILE D N   1 
ATOM   6192  C CA  . ILE D  4  82  ? -17.653 18.840  76.288  1.00 81.84  ? 82  ILE D CA  1 
ATOM   6193  C C   . ILE D  4  82  ? -17.426 19.418  74.884  1.00 80.91  ? 82  ILE D C   1 
ATOM   6194  O O   . ILE D  4  82  ? -16.280 19.584  74.455  1.00 79.78  ? 82  ILE D O   1 
ATOM   6195  C CB  . ILE D  4  82  ? -17.837 17.298  76.235  1.00 82.82  ? 82  ILE D CB  1 
ATOM   6196  C CG1 . ILE D  4  82  ? -17.767 16.690  77.641  1.00 84.86  ? 82  ILE D CG1 1 
ATOM   6197  C CG2 . ILE D  4  82  ? -16.780 16.635  75.363  1.00 83.60  ? 82  ILE D CG2 1 
ATOM   6198  C CD1 . ILE D  4  82  ? -19.103 16.559  78.343  1.00 86.88  ? 82  ILE D CD1 1 
ATOM   6199  N N   . ALA D  4  83  ? -18.519 19.735  74.191  1.00 80.65  ? 83  ALA D N   1 
ATOM   6200  C CA  . ALA D  4  83  ? -18.469 20.275  72.830  1.00 79.26  ? 83  ALA D CA  1 
ATOM   6201  C C   . ALA D  4  83  ? -17.678 21.582  72.733  1.00 79.23  ? 83  ALA D C   1 
ATOM   6202  O O   . ALA D  4  83  ? -16.877 21.760  71.812  1.00 78.32  ? 83  ALA D O   1 
ATOM   6203  C CB  . ALA D  4  83  ? -19.876 20.458  72.279  1.00 77.89  ? 83  ALA D CB  1 
ATOM   6204  N N   . ASP D  4  84  ? -17.902 22.482  73.690  1.00 78.77  ? 84  ASP D N   1 
ATOM   6205  C CA  . ASP D  4  84  ? -17.215 23.775  73.731  1.00 78.46  ? 84  ASP D CA  1 
ATOM   6206  C C   . ASP D  4  84  ? -15.752 23.640  74.145  1.00 78.70  ? 84  ASP D C   1 
ATOM   6207  O O   . ASP D  4  84  ? -14.913 24.459  73.761  1.00 79.41  ? 84  ASP D O   1 
ATOM   6208  C CB  . ASP D  4  84  ? -17.933 24.738  74.680  1.00 78.54  ? 84  ASP D CB  1 
ATOM   6209  C CG  . ASP D  4  84  ? -19.329 25.098  74.207  1.00 80.44  ? 84  ASP D CG  1 
ATOM   6210  O OD1 . ASP D  4  84  ? -19.496 25.457  73.023  1.00 81.21  ? 84  ASP D OD1 1 
ATOM   6211  O OD2 . ASP D  4  84  ? -20.264 25.036  75.030  1.00 81.38  ? 84  ASP D OD2 1 
ATOM   6212  N N   . ALA D  4  85  ? -15.459 22.604  74.929  1.00 78.57  ? 85  ALA D N   1 
ATOM   6213  C CA  . ALA D  4  85  ? -14.110 22.350  75.432  1.00 78.63  ? 85  ALA D CA  1 
ATOM   6214  C C   . ALA D  4  85  ? -13.137 21.952  74.323  1.00 80.65  ? 85  ALA D C   1 
ATOM   6215  O O   . ALA D  4  85  ? -11.989 22.400  74.312  1.00 79.81  ? 85  ALA D O   1 
ATOM   6216  C CB  . ALA D  4  85  ? -14.146 21.283  76.515  1.00 78.51  ? 85  ALA D CB  1 
ATOM   6217  N N   . LYS D  4  86  ? -13.608 21.124  73.392  1.00 83.96  ? 86  LYS D N   1 
ATOM   6218  C CA  . LYS D  4  86  ? -12.782 20.618  72.290  1.00 87.29  ? 86  LYS D CA  1 
ATOM   6219  C C   . LYS D  4  86  ? -12.311 21.717  71.333  1.00 83.73  ? 86  LYS D C   1 
ATOM   6220  O O   . LYS D  4  86  ? -11.357 21.521  70.578  1.00 84.43  ? 86  LYS D O   1 
ATOM   6221  C CB  . LYS D  4  86  ? -13.518 19.510  71.529  1.00 94.32  ? 86  LYS D CB  1 
ATOM   6222  C CG  . LYS D  4  86  ? -13.597 18.197  72.293  1.00 101.60 ? 86  LYS D CG  1 
ATOM   6223  C CD  . LYS D  4  86  ? -14.482 17.182  71.590  1.00 108.58 ? 86  LYS D CD  1 
ATOM   6224  C CE  . LYS D  4  86  ? -14.532 15.879  72.372  1.00 108.75 ? 86  LYS D CE  1 
ATOM   6225  N NZ  . LYS D  4  86  ? -15.531 14.924  71.818  1.00 108.52 ? 86  LYS D NZ  1 
ATOM   6226  N N   . THR D  4  87  ? -12.983 22.865  71.375  1.00 81.08  ? 87  THR D N   1 
ATOM   6227  C CA  . THR D  4  87  ? -12.575 24.041  70.610  1.00 79.25  ? 87  THR D CA  1 
ATOM   6228  C C   . THR D  4  87  ? -11.414 24.747  71.315  1.00 76.63  ? 87  THR D C   1 
ATOM   6229  O O   . THR D  4  87  ? -10.509 25.274  70.664  1.00 74.90  ? 87  THR D O   1 
ATOM   6230  C CB  . THR D  4  87  ? -13.749 25.027  70.413  1.00 80.14  ? 87  THR D CB  1 
ATOM   6231  O OG1 . THR D  4  87  ? -14.937 24.301  70.074  1.00 83.05  ? 87  THR D OG1 1 
ATOM   6232  C CG2 . THR D  4  87  ? -13.442 26.034  69.306  1.00 79.16  ? 87  THR D CG2 1 
ATOM   6233  N N   . LEU D  4  88  ? -11.447 24.740  72.648  1.00 74.52  ? 88  LEU D N   1 
ATOM   6234  C CA  . LEU D  4  88  ? -10.407 25.364  73.469  1.00 71.96  ? 88  LEU D CA  1 
ATOM   6235  C C   . LEU D  4  88  ? -9.121  24.539  73.500  1.00 71.07  ? 88  LEU D C   1 
ATOM   6236  O O   . LEU D  4  88  ? -8.022  25.096  73.485  1.00 71.61  ? 88  LEU D O   1 
ATOM   6237  C CB  . LEU D  4  88  ? -10.913 25.600  74.896  1.00 70.79  ? 88  LEU D CB  1 
ATOM   6238  C CG  . LEU D  4  88  ? -12.031 26.624  75.119  1.00 70.73  ? 88  LEU D CG  1 
ATOM   6239  C CD1 . LEU D  4  88  ? -12.704 26.383  76.461  1.00 71.20  ? 88  LEU D CD1 1 
ATOM   6240  C CD2 . LEU D  4  88  ? -11.513 28.052  75.027  1.00 70.87  ? 88  LEU D CD2 1 
ATOM   6241  N N   . ILE D  4  89  ? -9.270  23.216  73.553  1.00 70.59  ? 89  ILE D N   1 
ATOM   6242  C CA  . ILE D  4  89  ? -8.133  22.293  73.541  1.00 70.75  ? 89  ILE D CA  1 
ATOM   6243  C C   . ILE D  4  89  ? -7.402  22.331  72.194  1.00 71.57  ? 89  ILE D C   1 
ATOM   6244  O O   . ILE D  4  89  ? -6.169  22.321  72.151  1.00 72.63  ? 89  ILE D O   1 
ATOM   6245  C CB  . ILE D  4  89  ? -8.563  20.852  73.929  1.00 71.73  ? 89  ILE D CB  1 
ATOM   6246  C CG1 . ILE D  4  89  ? -8.478  20.654  75.446  1.00 73.81  ? 89  ILE D CG1 1 
ATOM   6247  C CG2 . ILE D  4  89  ? -7.696  19.796  73.255  1.00 72.39  ? 89  ILE D CG2 1 
ATOM   6248  C CD1 . ILE D  4  89  ? -9.701  21.104  76.218  1.00 74.87  ? 89  ILE D CD1 1 
ATOM   6249  N N   . ASP D  4  90  ? -8.171  22.396  71.108  1.00 72.10  ? 90  ASP D N   1 
ATOM   6250  C CA  . ASP D  4  90  ? -7.614  22.470  69.758  1.00 73.52  ? 90  ASP D CA  1 
ATOM   6251  C C   . ASP D  4  90  ? -6.804  23.749  69.555  1.00 73.30  ? 90  ASP D C   1 
ATOM   6252  O O   . ASP D  4  90  ? -5.764  23.731  68.897  1.00 73.05  ? 90  ASP D O   1 
ATOM   6253  C CB  . ASP D  4  90  ? -8.727  22.373  68.709  1.00 76.43  ? 90  ASP D CB  1 
ATOM   6254  C CG  . ASP D  4  90  ? -8.193  22.200  67.297  1.00 78.08  ? 90  ASP D CG  1 
ATOM   6255  O OD1 . ASP D  4  90  ? -7.257  21.394  67.101  1.00 78.47  ? 90  ASP D OD1 1 
ATOM   6256  O OD2 . ASP D  4  90  ? -8.717  22.865  66.378  1.00 80.34  ? 90  ASP D OD2 1 
ATOM   6257  N N   . LYS D  4  91  ? -7.288  24.848  70.132  1.00 73.51  ? 91  LYS D N   1 
ATOM   6258  C CA  . LYS D  4  91  ? -6.611  26.141  70.059  1.00 75.34  ? 91  LYS D CA  1 
ATOM   6259  C C   . LYS D  4  91  ? -5.330  26.133  70.896  1.00 75.29  ? 91  LYS D C   1 
ATOM   6260  O O   . LYS D  4  91  ? -4.334  26.761  70.527  1.00 77.98  ? 91  LYS D O   1 
ATOM   6261  C CB  . LYS D  4  91  ? -7.550  27.257  70.528  1.00 77.93  ? 91  LYS D CB  1 
ATOM   6262  C CG  . LYS D  4  91  ? -7.458  28.551  69.729  1.00 83.79  ? 91  LYS D CG  1 
ATOM   6263  C CD  . LYS D  4  91  ? -6.311  29.441  70.187  1.00 88.25  ? 91  LYS D CD  1 
ATOM   6264  C CE  . LYS D  4  91  ? -6.307  30.769  69.444  1.00 93.20  ? 91  LYS D CE  1 
ATOM   6265  N NZ  . LYS D  4  91  ? -5.903  30.627  68.017  1.00 93.32  ? 91  LYS D NZ  1 
ATOM   6266  N N   . ALA D  4  92  ? -5.368  25.415  72.017  1.00 73.41  ? 92  ALA D N   1 
ATOM   6267  C CA  . ALA D  4  92  ? -4.214  25.273  72.904  1.00 72.86  ? 92  ALA D CA  1 
ATOM   6268  C C   . ALA D  4  92  ? -3.113  24.413  72.283  1.00 73.67  ? 92  ALA D C   1 
ATOM   6269  O O   . ALA D  4  92  ? -1.927  24.641  72.531  1.00 74.25  ? 92  ALA D O   1 
ATOM   6270  C CB  . ALA D  4  92  ? -4.644  24.696  74.245  1.00 71.36  ? 92  ALA D CB  1 
ATOM   6271  N N   . ARG D  4  93  ? -3.518  23.426  71.483  1.00 74.15  ? 93  ARG D N   1 
ATOM   6272  C CA  . ARG D  4  93  ? -2.583  22.540  70.786  1.00 73.90  ? 93  ARG D CA  1 
ATOM   6273  C C   . ARG D  4  93  ? -1.808  23.270  69.690  1.00 73.77  ? 93  ARG D C   1 
ATOM   6274  O O   . ARG D  4  93  ? -0.636  22.973  69.452  1.00 73.67  ? 93  ARG D O   1 
ATOM   6275  C CB  . ARG D  4  93  ? -3.318  21.334  70.197  1.00 74.86  ? 93  ARG D CB  1 
ATOM   6276  C CG  . ARG D  4  93  ? -3.691  20.267  71.214  1.00 75.27  ? 93  ARG D CG  1 
ATOM   6277  C CD  . ARG D  4  93  ? -4.575  19.200  70.590  1.00 77.04  ? 93  ARG D CD  1 
ATOM   6278  N NE  . ARG D  4  93  ? -4.846  18.100  71.513  1.00 78.13  ? 93  ARG D NE  1 
ATOM   6279  C CZ  . ARG D  4  93  ? -5.636  17.063  71.243  1.00 81.27  ? 93  ARG D CZ  1 
ATOM   6280  N NH1 . ARG D  4  93  ? -6.250  16.969  70.070  1.00 82.10  ? 93  ARG D NH1 1 
ATOM   6281  N NH2 . ARG D  4  93  ? -5.814  16.115  72.152  1.00 82.43  ? 93  ARG D NH2 1 
ATOM   6282  N N   . VAL D  4  94  ? -2.469  24.220  69.030  1.00 73.05  ? 94  VAL D N   1 
ATOM   6283  C CA  . VAL D  4  94  ? -1.846  25.024  67.977  1.00 71.86  ? 94  VAL D CA  1 
ATOM   6284  C C   . VAL D  4  94  ? -0.844  26.014  68.577  1.00 73.36  ? 94  VAL D C   1 
ATOM   6285  O O   . VAL D  4  94  ? 0.258   26.181  68.051  1.00 73.04  ? 94  VAL D O   1 
ATOM   6286  C CB  . VAL D  4  94  ? -2.900  25.765  67.116  1.00 70.28  ? 94  VAL D CB  1 
ATOM   6287  C CG1 . VAL D  4  94  ? -2.233  26.639  66.061  1.00 70.10  ? 94  VAL D CG1 1 
ATOM   6288  C CG2 . VAL D  4  94  ? -3.840  24.773  66.448  1.00 69.70  ? 94  VAL D CG2 1 
ATOM   6289  N N   . GLU D  4  95  ? -1.231  26.646  69.686  1.00 76.03  ? 95  GLU D N   1 
ATOM   6290  C CA  . GLU D  4  95  ? -0.395  27.642  70.366  1.00 79.60  ? 95  GLU D CA  1 
ATOM   6291  C C   . GLU D  4  95  ? 0.936   27.076  70.863  1.00 75.37  ? 95  GLU D C   1 
ATOM   6292  O O   . GLU D  4  95  ? 1.955   27.773  70.846  1.00 73.47  ? 95  GLU D O   1 
ATOM   6293  C CB  . GLU D  4  95  ? -1.159  28.293  71.525  1.00 87.18  ? 95  GLU D CB  1 
ATOM   6294  C CG  . GLU D  4  95  ? -2.198  29.325  71.099  1.00 93.95  ? 95  GLU D CG  1 
ATOM   6295  C CD  . GLU D  4  95  ? -1.587  30.597  70.534  1.00 102.93 ? 95  GLU D CD  1 
ATOM   6296  O OE1 . GLU D  4  95  ? -0.583  31.090  71.095  1.00 102.41 ? 95  GLU D OE1 1 
ATOM   6297  O OE2 . GLU D  4  95  ? -2.120  31.112  69.528  1.00 105.25 ? 95  GLU D OE2 1 
ATOM   6298  N N   . THR D  4  96  ? 0.917   25.818  71.301  1.00 75.25  ? 96  THR D N   1 
ATOM   6299  C CA  . THR D  4  96  ? 2.129   25.122  71.744  1.00 74.55  ? 96  THR D CA  1 
ATOM   6300  C C   . THR D  4  96  ? 3.070   24.826  70.578  1.00 73.09  ? 96  THR D C   1 
ATOM   6301  O O   . THR D  4  96  ? 4.292   24.842  70.740  1.00 72.30  ? 96  THR D O   1 
ATOM   6302  C CB  . THR D  4  96  ? 1.808   23.806  72.484  1.00 75.55  ? 96  THR D CB  1 
ATOM   6303  O OG1 . THR D  4  96  ? 0.875   23.034  71.717  1.00 77.79  ? 96  THR D OG1 1 
ATOM   6304  C CG2 . THR D  4  96  ? 1.219   24.089  73.859  1.00 73.70  ? 96  THR D CG2 1 
ATOM   6305  N N   . GLN D  4  97  ? 2.492   24.561  69.408  1.00 71.24  ? 97  GLN D N   1 
ATOM   6306  C CA  . GLN D  4  97  ? 3.266   24.273  68.201  1.00 69.24  ? 97  GLN D CA  1 
ATOM   6307  C C   . GLN D  4  97  ? 3.731   25.547  67.495  1.00 66.35  ? 97  GLN D C   1 
ATOM   6308  O O   . GLN D  4  97  ? 4.755   25.543  66.808  1.00 65.65  ? 97  GLN D O   1 
ATOM   6309  C CB  . GLN D  4  97  ? 2.470   23.380  67.242  1.00 69.59  ? 97  GLN D CB  1 
ATOM   6310  C CG  . GLN D  4  97  ? 2.097   22.014  67.807  1.00 70.39  ? 97  GLN D CG  1 
ATOM   6311  C CD  . GLN D  4  97  ? 3.294   21.216  68.294  1.00 70.77  ? 97  GLN D CD  1 
ATOM   6312  O OE1 . GLN D  4  97  ? 4.294   21.071  67.587  1.00 72.69  ? 97  GLN D OE1 1 
ATOM   6313  N NE2 . GLN D  4  97  ? 3.193   20.684  69.507  1.00 69.43  ? 97  GLN D NE2 1 
ATOM   6314  N N   . ASN D  4  98  ? 2.972   26.629  67.666  1.00 65.28  ? 98  ASN D N   1 
ATOM   6315  C CA  . ASN D  4  98  ? 3.366   27.946  67.166  1.00 63.78  ? 98  ASN D CA  1 
ATOM   6316  C C   . ASN D  4  98  ? 4.572   28.485  67.928  1.00 62.71  ? 98  ASN D C   1 
ATOM   6317  O O   . ASN D  4  98  ? 5.445   29.133  67.347  1.00 62.39  ? 98  ASN D O   1 
ATOM   6318  C CB  . ASN D  4  98  ? 2.200   28.937  67.258  1.00 64.95  ? 98  ASN D CB  1 
ATOM   6319  C CG  . ASN D  4  98  ? 1.097   28.649  66.252  1.00 66.43  ? 98  ASN D CG  1 
ATOM   6320  O OD1 . ASN D  4  98  ? 1.247   27.816  65.357  1.00 67.27  ? 98  ASN D OD1 1 
ATOM   6321  N ND2 . ASN D  4  98  ? -0.025  29.346  66.397  1.00 67.05  ? 98  ASN D ND2 1 
ATOM   6322  N N   . HIS D  4  99  ? 4.609   28.204  69.229  1.00 62.66  ? 99  HIS D N   1 
ATOM   6323  C CA  . HIS D  4  99  ? 5.721   28.595  70.090  1.00 63.25  ? 99  HIS D CA  1 
ATOM   6324  C C   . HIS D  4  99  ? 6.925   27.727  69.851  1.00 63.27  ? 99  HIS D C   1 
ATOM   6325  O O   . HIS D  4  99  ? 8.062   28.187  69.974  1.00 63.74  ? 99  HIS D O   1 
ATOM   6326  C CB  . HIS D  4  99  ? 5.303   28.524  71.553  1.00 64.43  ? 99  HIS D CB  1 
ATOM   6327  C CG  . HIS D  4  99  ? 6.231   29.258  72.491  1.00 65.66  ? 99  HIS D CG  1 
ATOM   6328  N ND1 . HIS D  4  99  ? 7.366   28.711  72.962  1.00 65.51  ? 99  HIS D ND1 1 
ATOM   6329  C CD2 . HIS D  4  99  ? 6.146   30.531  73.051  1.00 66.19  ? 99  HIS D CD2 1 
ATOM   6330  C CE1 . HIS D  4  99  ? 7.983   29.588  73.775  1.00 66.58  ? 99  HIS D CE1 1 
ATOM   6331  N NE2 . HIS D  4  99  ? 7.235   30.702  73.829  1.00 67.58  ? 99  HIS D NE2 1 
ATOM   6332  N N   . TRP D  4  100 ? 6.679   26.462  69.511  1.00 63.72  ? 100 TRP D N   1 
ATOM   6333  C CA  . TRP D  4  100 ? 7.741   25.515  69.171  1.00 65.46  ? 100 TRP D CA  1 
ATOM   6334  C C   . TRP D  4  100 ? 8.397   25.863  67.862  1.00 65.75  ? 100 TRP D C   1 
ATOM   6335  O O   . TRP D  4  100 ? 9.609   25.700  67.707  1.00 67.02  ? 100 TRP D O   1 
ATOM   6336  C CB  . TRP D  4  100 ? 7.193   24.091  69.125  1.00 67.38  ? 100 TRP D CB  1 
ATOM   6337  C CG  . TRP D  4  100 ? 8.202   23.064  68.663  1.00 70.08  ? 100 TRP D CG  1 
ATOM   6338  C CD1 . TRP D  4  100 ? 9.125   22.370  69.440  1.00 72.36  ? 100 TRP D CD1 1 
ATOM   6339  C CD2 . TRP D  4  100 ? 8.427   22.585  67.288  1.00 71.61  ? 100 TRP D CD2 1 
ATOM   6340  N NE1 . TRP D  4  100 ? 9.878   21.522  68.668  1.00 74.44  ? 100 TRP D NE1 1 
ATOM   6341  C CE2 . TRP D  4  100 ? 9.513   21.601  67.370  1.00 73.53  ? 100 TRP D CE2 1 
ATOM   6342  C CE3 . TRP D  4  100 ? 7.861   22.863  66.047  1.00 71.58  ? 100 TRP D CE3 1 
ATOM   6343  C CZ2 . TRP D  4  100 ? 9.991   20.937  66.248  1.00 74.15  ? 100 TRP D CZ2 1 
ATOM   6344  C CZ3 . TRP D  4  100 ? 8.352   22.187  64.922  1.00 71.79  ? 100 TRP D CZ3 1 
ATOM   6345  C CH2 . TRP D  4  100 ? 9.391   21.248  65.023  1.00 72.40  ? 100 TRP D CH2 1 
ATOM   6346  N N   . PHE D  4  101 ? 7.599   26.341  66.910  1.00 63.71  ? 101 PHE D N   1 
ATOM   6347  C CA  . PHE D  4  101 ? 8.099   26.732  65.594  1.00 62.37  ? 101 PHE D CA  1 
ATOM   6348  C C   . PHE D  4  101 ? 8.977   27.980  65.670  1.00 62.11  ? 101 PHE D C   1 
ATOM   6349  O O   . PHE D  4  101 ? 9.971   28.091  64.948  1.00 63.45  ? 101 PHE D O   1 
ATOM   6350  C CB  . PHE D  4  101 ? 6.931   26.955  64.624  1.00 60.82  ? 101 PHE D CB  1 
ATOM   6351  C CG  . PHE D  4  101 ? 7.359   27.317  63.228  1.00 60.47  ? 101 PHE D CG  1 
ATOM   6352  C CD1 . PHE D  4  101 ? 7.775   26.334  62.336  1.00 60.90  ? 101 PHE D CD1 1 
ATOM   6353  C CD2 . PHE D  4  101 ? 7.345   28.642  62.803  1.00 59.54  ? 101 PHE D CD2 1 
ATOM   6354  C CE1 . PHE D  4  101 ? 8.173   26.666  61.051  1.00 61.65  ? 101 PHE D CE1 1 
ATOM   6355  C CE2 . PHE D  4  101 ? 7.741   28.980  61.518  1.00 59.05  ? 101 PHE D CE2 1 
ATOM   6356  C CZ  . PHE D  4  101 ? 8.156   27.990  60.641  1.00 60.06  ? 101 PHE D CZ  1 
ATOM   6357  N N   . THR D  4  102 ? 8.608   28.904  66.555  1.00 60.53  ? 102 THR D N   1 
ATOM   6358  C CA  . THR D  4  102 ? 9.270   30.203  66.651  1.00 59.08  ? 102 THR D CA  1 
ATOM   6359  C C   . THR D  4  102 ? 10.459  30.206  67.621  1.00 59.78  ? 102 THR D C   1 
ATOM   6360  O O   . THR D  4  102 ? 11.478  30.840  67.348  1.00 60.72  ? 102 THR D O   1 
ATOM   6361  C CB  . THR D  4  102 ? 8.267   31.314  67.041  1.00 57.31  ? 102 THR D CB  1 
ATOM   6362  O OG1 . THR D  4  102 ? 7.047   31.139  66.310  1.00 57.68  ? 102 THR D OG1 1 
ATOM   6363  C CG2 . THR D  4  102 ? 8.833   32.696  66.737  1.00 58.04  ? 102 THR D CG2 1 
ATOM   6364  N N   . TYR D  4  103 ? 10.334  29.492  68.738  1.00 60.16  ? 103 TYR D N   1 
ATOM   6365  C CA  . TYR D  4  103 ? 11.331  29.569  69.812  1.00 61.42  ? 103 TYR D CA  1 
ATOM   6366  C C   . TYR D  4  103 ? 12.131  28.284  70.042  1.00 63.30  ? 103 TYR D C   1 
ATOM   6367  O O   . TYR D  4  103 ? 13.065  28.271  70.849  1.00 64.59  ? 103 TYR D O   1 
ATOM   6368  C CB  . TYR D  4  103 ? 10.672  30.031  71.119  1.00 60.55  ? 103 TYR D CB  1 
ATOM   6369  C CG  . TYR D  4  103 ? 9.954   31.359  71.009  1.00 59.11  ? 103 TYR D CG  1 
ATOM   6370  C CD1 . TYR D  4  103 ? 8.580   31.412  70.783  1.00 59.36  ? 103 TYR D CD1 1 
ATOM   6371  C CD2 . TYR D  4  103 ? 10.649  32.562  71.126  1.00 59.88  ? 103 TYR D CD2 1 
ATOM   6372  C CE1 . TYR D  4  103 ? 7.917   32.625  70.680  1.00 60.45  ? 103 TYR D CE1 1 
ATOM   6373  C CE2 . TYR D  4  103 ? 9.995   33.781  71.023  1.00 61.42  ? 103 TYR D CE2 1 
ATOM   6374  C CZ  . TYR D  4  103 ? 8.629   33.806  70.800  1.00 61.55  ? 103 TYR D CZ  1 
ATOM   6375  O OH  . TYR D  4  103 ? 7.973   35.011  70.697  1.00 63.41  ? 103 TYR D OH  1 
ATOM   6376  N N   . ASN D  4  104 ? 11.765  27.219  69.327  1.00 63.56  ? 104 ASN D N   1 
ATOM   6377  C CA  . ASN D  4  104 ? 12.417  25.905  69.435  1.00 64.06  ? 104 ASN D CA  1 
ATOM   6378  C C   . ASN D  4  104 ? 12.471  25.366  70.869  1.00 65.41  ? 104 ASN D C   1 
ATOM   6379  O O   . ASN D  4  104 ? 13.496  24.840  71.314  1.00 66.54  ? 104 ASN D O   1 
ATOM   6380  C CB  . ASN D  4  104 ? 13.814  25.928  68.793  1.00 63.71  ? 104 ASN D CB  1 
ATOM   6381  C CG  . ASN D  4  104 ? 14.307  24.544  68.406  1.00 63.36  ? 104 ASN D CG  1 
ATOM   6382  O OD1 . ASN D  4  104 ? 13.555  23.724  67.876  1.00 64.07  ? 104 ASN D OD1 1 
ATOM   6383  N ND2 . ASN D  4  104 ? 15.583  24.280  68.665  1.00 62.85  ? 104 ASN D ND2 1 
ATOM   6384  N N   . GLU D  4  105 ? 11.356  25.509  71.584  1.00 66.45  ? 105 GLU D N   1 
ATOM   6385  C CA  . GLU D  4  105 ? 11.248  25.063  72.973  1.00 68.58  ? 105 GLU D CA  1 
ATOM   6386  C C   . GLU D  4  105 ? 9.796   24.810  73.377  1.00 69.84  ? 105 GLU D C   1 
ATOM   6387  O O   . GLU D  4  105 ? 8.868   25.351  72.772  1.00 70.22  ? 105 GLU D O   1 
ATOM   6388  C CB  . GLU D  4  105 ? 11.898  26.077  73.926  1.00 69.23  ? 105 GLU D CB  1 
ATOM   6389  C CG  . GLU D  4  105 ? 11.311  27.481  73.862  1.00 69.35  ? 105 GLU D CG  1 
ATOM   6390  C CD  . GLU D  4  105 ? 11.920  28.423  74.883  1.00 70.71  ? 105 GLU D CD  1 
ATOM   6391  O OE1 . GLU D  4  105 ? 13.163  28.560  74.911  1.00 71.18  ? 105 GLU D OE1 1 
ATOM   6392  O OE2 . GLU D  4  105 ? 11.151  29.035  75.651  1.00 73.25  ? 105 GLU D OE2 1 
ATOM   6393  N N   . THR D  4  106 ? 9.616   23.984  74.404  1.00 70.79  ? 106 THR D N   1 
ATOM   6394  C CA  . THR D  4  106 ? 8.291   23.673  74.938  1.00 71.43  ? 106 THR D CA  1 
ATOM   6395  C C   . THR D  4  106 ? 7.810   24.775  75.880  1.00 72.21  ? 106 THR D C   1 
ATOM   6396  O O   . THR D  4  106 ? 8.594   25.318  76.664  1.00 72.83  ? 106 THR D O   1 
ATOM   6397  C CB  . THR D  4  106 ? 8.284   22.323  75.686  1.00 70.62  ? 106 THR D CB  1 
ATOM   6398  O OG1 . THR D  4  106 ? 9.350   22.295  76.643  1.00 69.43  ? 106 THR D OG1 1 
ATOM   6399  C CG2 . THR D  4  106 ? 8.450   21.162  74.712  1.00 69.52  ? 106 THR D CG2 1 
ATOM   6400  N N   . MET D  4  107 ? 6.521   25.101  75.795  1.00 72.36  ? 107 MET D N   1 
ATOM   6401  C CA  . MET D  4  107 ? 5.918   26.133  76.643  1.00 72.15  ? 107 MET D CA  1 
ATOM   6402  C C   . MET D  4  107 ? 5.737   25.680  78.086  1.00 72.70  ? 107 MET D C   1 
ATOM   6403  O O   . MET D  4  107 ? 5.559   24.491  78.358  1.00 73.89  ? 107 MET D O   1 
ATOM   6404  C CB  . MET D  4  107 ? 4.566   26.585  76.082  1.00 71.57  ? 107 MET D CB  1 
ATOM   6405  C CG  . MET D  4  107 ? 4.652   27.741  75.101  1.00 72.58  ? 107 MET D CG  1 
ATOM   6406  S SD  . MET D  4  107 ? 3.204   28.819  75.114  1.00 75.05  ? 107 MET D SD  1 
ATOM   6407  C CE  . MET D  4  107 ? 1.977   27.803  74.300  1.00 72.57  ? 107 MET D CE  1 
ATOM   6408  N N   . THR D  4  108 ? 5.783   26.643  79.003  1.00 72.70  ? 108 THR D N   1 
ATOM   6409  C CA  . THR D  4  108 ? 5.496   26.394  80.414  1.00 73.00  ? 108 THR D CA  1 
ATOM   6410  C C   . THR D  4  108 ? 3.992   26.219  80.612  1.00 73.09  ? 108 THR D C   1 
ATOM   6411  O O   . THR D  4  108 ? 3.193   26.721  79.816  1.00 72.43  ? 108 THR D O   1 
ATOM   6412  C CB  . THR D  4  108 ? 6.012   27.536  81.316  1.00 73.10  ? 108 THR D CB  1 
ATOM   6413  O OG1 . THR D  4  108 ? 5.536   28.795  80.825  1.00 71.13  ? 108 THR D OG1 1 
ATOM   6414  C CG2 . THR D  4  108 ? 7.537   27.552  81.348  1.00 74.10  ? 108 THR D CG2 1 
ATOM   6415  N N   . VAL D  4  109 ? 3.615   25.504  81.671  1.00 75.32  ? 109 VAL D N   1 
ATOM   6416  C CA  . VAL D  4  109 ? 2.207   25.215  81.969  1.00 76.09  ? 109 VAL D CA  1 
ATOM   6417  C C   . VAL D  4  109 ? 1.402   26.502  82.175  1.00 76.61  ? 109 VAL D C   1 
ATOM   6418  O O   . VAL D  4  109 ? 0.245   26.590  81.760  1.00 77.07  ? 109 VAL D O   1 
ATOM   6419  C CB  . VAL D  4  109 ? 2.057   24.290  83.200  1.00 77.19  ? 109 VAL D CB  1 
ATOM   6420  C CG1 . VAL D  4  109 ? 0.645   23.727  83.283  1.00 76.54  ? 109 VAL D CG1 1 
ATOM   6421  C CG2 . VAL D  4  109 ? 3.063   23.149  83.145  1.00 78.56  ? 109 VAL D CG2 1 
ATOM   6422  N N   . GLU D  4  110 ? 2.032   27.495  82.800  1.00 77.89  ? 110 GLU D N   1 
ATOM   6423  C CA  . GLU D  4  110 ? 1.411   28.796  83.047  1.00 80.39  ? 110 GLU D CA  1 
ATOM   6424  C C   . GLU D  4  110 ? 1.129   29.555  81.747  1.00 77.99  ? 110 GLU D C   1 
ATOM   6425  O O   . GLU D  4  110 ? 0.112   30.244  81.635  1.00 77.69  ? 110 GLU D O   1 
ATOM   6426  C CB  . GLU D  4  110 ? 2.294   29.638  83.975  1.00 85.90  ? 110 GLU D CB  1 
ATOM   6427  C CG  . GLU D  4  110 ? 1.589   30.819  84.628  1.00 90.69  ? 110 GLU D CG  1 
ATOM   6428  C CD  . GLU D  4  110 ? 2.494   31.617  85.551  1.00 98.58  ? 110 GLU D CD  1 
ATOM   6429  O OE1 . GLU D  4  110 ? 3.678   31.827  85.208  1.00 99.57  ? 110 GLU D OE1 1 
ATOM   6430  O OE2 . GLU D  4  110 ? 2.016   32.045  86.623  1.00 101.16 ? 110 GLU D OE2 1 
ATOM   6431  N N   . SER D  4  111 ? 2.027   29.417  80.773  1.00 75.48  ? 111 SER D N   1 
ATOM   6432  C CA  . SER D  4  111 ? 1.907   30.104  79.484  1.00 72.46  ? 111 SER D CA  1 
ATOM   6433  C C   . SER D  4  111 ? 0.787   29.542  78.609  1.00 70.79  ? 111 SER D C   1 
ATOM   6434  O O   . SER D  4  111 ? 0.097   30.295  77.918  1.00 71.57  ? 111 SER D O   1 
ATOM   6435  C CB  . SER D  4  111 ? 3.235   30.063  78.725  1.00 70.65  ? 111 SER D CB  1 
ATOM   6436  O OG  . SER D  4  111 ? 4.248   30.752  79.434  1.00 71.02  ? 111 SER D OG  1 
ATOM   6437  N N   . VAL D  4  112 ? 0.620   28.220  78.638  1.00 68.46  ? 112 VAL D N   1 
ATOM   6438  C CA  . VAL D  4  112 ? -0.434  27.544  77.877  1.00 66.78  ? 112 VAL D CA  1 
ATOM   6439  C C   . VAL D  4  112 ? -1.808  27.901  78.445  1.00 67.22  ? 112 VAL D C   1 
ATOM   6440  O O   . VAL D  4  112 ? -2.751  28.155  77.692  1.00 67.13  ? 112 VAL D O   1 
ATOM   6441  C CB  . VAL D  4  112 ? -0.242  26.008  77.865  1.00 66.63  ? 112 VAL D CB  1 
ATOM   6442  C CG1 . VAL D  4  112 ? -1.304  25.330  77.009  1.00 66.15  ? 112 VAL D CG1 1 
ATOM   6443  C CG2 . VAL D  4  112 ? 1.144   25.646  77.354  1.00 69.28  ? 112 VAL D CG2 1 
ATOM   6444  N N   . THR D  4  113 ? -1.902  27.931  79.773  1.00 68.74  ? 113 THR D N   1 
ATOM   6445  C CA  . THR D  4  113 ? -3.129  28.311  80.470  1.00 70.79  ? 113 THR D CA  1 
ATOM   6446  C C   . THR D  4  113 ? -3.492  29.771  80.179  1.00 70.79  ? 113 THR D C   1 
ATOM   6447  O O   . THR D  4  113 ? -4.666  30.100  79.994  1.00 72.14  ? 113 THR D O   1 
ATOM   6448  C CB  . THR D  4  113 ? -3.003  28.088  81.994  1.00 73.06  ? 113 THR D CB  1 
ATOM   6449  O OG1 . THR D  4  113 ? -2.398  26.813  82.246  1.00 73.61  ? 113 THR D OG1 1 
ATOM   6450  C CG2 . THR D  4  113 ? -4.370  28.130  82.666  1.00 74.89  ? 113 THR D CG2 1 
ATOM   6451  N N   . GLN D  4  114 ? -2.474  30.630  80.125  1.00 70.53  ? 114 GLN D N   1 
ATOM   6452  C CA  . GLN D  4  114 ? -2.652  32.053  79.831  1.00 71.72  ? 114 GLN D CA  1 
ATOM   6453  C C   . GLN D  4  114 ? -3.135  32.278  78.397  1.00 71.20  ? 114 GLN D C   1 
ATOM   6454  O O   . GLN D  4  114 ? -3.892  33.214  78.133  1.00 72.20  ? 114 GLN D O   1 
ATOM   6455  C CB  . GLN D  4  114 ? -1.346  32.814  80.079  1.00 73.84  ? 114 GLN D CB  1 
ATOM   6456  C CG  . GLN D  4  114 ? -1.508  34.320  80.241  1.00 77.12  ? 114 GLN D CG  1 
ATOM   6457  C CD  . GLN D  4  114 ? -0.212  35.023  80.613  1.00 80.28  ? 114 GLN D CD  1 
ATOM   6458  O OE1 . GLN D  4  114 ? 0.152   36.031  80.009  1.00 82.08  ? 114 GLN D OE1 1 
ATOM   6459  N NE2 . GLN D  4  114 ? 0.490   34.493  81.610  1.00 81.97  ? 114 GLN D NE2 1 
ATOM   6460  N N   . ALA D  4  115 ? -2.694  31.412  77.485  1.00 70.25  ? 115 ALA D N   1 
ATOM   6461  C CA  . ALA D  4  115 ? -3.086  31.476  76.076  1.00 69.17  ? 115 ALA D CA  1 
ATOM   6462  C C   . ALA D  4  115 ? -4.572  31.170  75.875  1.00 70.31  ? 115 ALA D C   1 
ATOM   6463  O O   . ALA D  4  115 ? -5.231  31.791  75.039  1.00 71.93  ? 115 ALA D O   1 
ATOM   6464  C CB  . ALA D  4  115 ? -2.228  30.536  75.242  1.00 67.65  ? 115 ALA D CB  1 
ATOM   6465  N N   . VAL D  4  116 ? -5.086  30.213  76.647  1.00 70.38  ? 116 VAL D N   1 
ATOM   6466  C CA  . VAL D  4  116 ? -6.506  29.856  76.616  1.00 71.56  ? 116 VAL D CA  1 
ATOM   6467  C C   . VAL D  4  116 ? -7.335  30.921  77.341  1.00 73.77  ? 116 VAL D C   1 
ATOM   6468  O O   . VAL D  4  116 ? -8.475  31.198  76.958  1.00 75.96  ? 116 VAL D O   1 
ATOM   6469  C CB  . VAL D  4  116 ? -6.761  28.459  77.233  1.00 71.28  ? 116 VAL D CB  1 
ATOM   6470  C CG1 . VAL D  4  116 ? -8.215  28.039  77.058  1.00 72.56  ? 116 VAL D CG1 1 
ATOM   6471  C CG2 . VAL D  4  116 ? -5.846  27.418  76.604  1.00 69.87  ? 116 VAL D CG2 1 
ATOM   6472  N N   . SER D  4  117 ? -6.746  31.521  78.375  1.00 75.15  ? 117 SER D N   1 
ATOM   6473  C CA  . SER D  4  117 ? -7.405  32.561  79.170  1.00 77.59  ? 117 SER D CA  1 
ATOM   6474  C C   . SER D  4  117 ? -7.618  33.867  78.399  1.00 78.11  ? 117 SER D C   1 
ATOM   6475  O O   . SER D  4  117 ? -8.396  34.722  78.825  1.00 79.95  ? 117 SER D O   1 
ATOM   6476  C CB  . SER D  4  117 ? -6.619  32.831  80.456  1.00 80.24  ? 117 SER D CB  1 
ATOM   6477  O OG  . SER D  4  117 ? -6.593  31.682  81.286  1.00 82.08  ? 117 SER D OG  1 
ATOM   6478  N N   . ASN D  4  118 ? -6.924  34.012  77.271  1.00 77.87  ? 118 ASN D N   1 
ATOM   6479  C CA  . ASN D  4  118 ? -7.078  35.181  76.404  1.00 79.67  ? 118 ASN D CA  1 
ATOM   6480  C C   . ASN D  4  118 ? -8.375  35.157  75.593  1.00 80.27  ? 118 ASN D C   1 
ATOM   6481  O O   . ASN D  4  118 ? -8.845  36.199  75.131  1.00 81.83  ? 118 ASN D O   1 
ATOM   6482  C CB  . ASN D  4  118 ? -5.869  35.326  75.473  1.00 80.02  ? 118 ASN D CB  1 
ATOM   6483  C CG  . ASN D  4  118 ? -4.605  35.736  76.210  1.00 80.57  ? 118 ASN D CG  1 
ATOM   6484  O OD1 . ASN D  4  118 ? -4.641  36.553  77.133  1.00 80.22  ? 118 ASN D OD1 1 
ATOM   6485  N ND2 . ASN D  4  118 ? -3.475  35.176  75.794  1.00 81.40  ? 118 ASN D ND2 1 
ATOM   6486  N N   . LEU D  4  119 ? -8.946  33.965  75.431  1.00 80.99  ? 119 LEU D N   1 
ATOM   6487  C CA  . LEU D  4  119 ? -10.200 33.784  74.699  1.00 82.02  ? 119 LEU D CA  1 
ATOM   6488  C C   . LEU D  4  119 ? -11.407 33.762  75.642  1.00 84.45  ? 119 LEU D C   1 
ATOM   6489  O O   . LEU D  4  119 ? -12.431 33.144  75.340  1.00 84.00  ? 119 LEU D O   1 
ATOM   6490  C CB  . LEU D  4  119 ? -10.153 32.491  73.873  1.00 80.35  ? 119 LEU D CB  1 
ATOM   6491  C CG  . LEU D  4  119 ? -9.090  32.333  72.781  1.00 79.69  ? 119 LEU D CG  1 
ATOM   6492  C CD1 . LEU D  4  119 ? -8.934  30.865  72.421  1.00 80.63  ? 119 LEU D CD1 1 
ATOM   6493  C CD2 . LEU D  4  119 ? -9.419  33.161  71.546  1.00 81.49  ? 119 LEU D CD2 1 
ATOM   6494  N N   . ALA D  4  120 ? -11.282 34.450  76.775  1.00 87.07  ? 120 ALA D N   1 
ATOM   6495  C CA  . ALA D  4  120 ? -12.312 34.441  77.813  1.00 91.28  ? 120 ALA D CA  1 
ATOM   6496  C C   . ALA D  4  120 ? -13.503 35.337  77.479  1.00 92.24  ? 120 ALA D C   1 
ATOM   6497  O O   . ALA D  4  120 ? -14.613 34.846  77.260  1.00 93.67  ? 120 ALA D O   1 
ATOM   6498  C CB  . ALA D  4  120 ? -11.713 34.827  79.157  1.00 90.96  ? 120 ALA D CB  1 
ATOM   6499  N N   . LEU D  4  121 ? -13.266 36.647  77.444  1.00 90.06  ? 121 LEU D N   1 
ATOM   6500  C CA  . LEU D  4  121 ? -14.333 37.617  77.210  1.00 87.69  ? 121 LEU D CA  1 
ATOM   6501  C C   . LEU D  4  121 ? -14.241 38.229  75.811  1.00 86.95  ? 121 LEU D C   1 
ATOM   6502  O O   . LEU D  4  121 ? -14.350 39.447  75.638  1.00 87.92  ? 121 LEU D O   1 
ATOM   6503  C CB  . LEU D  4  121 ? -14.330 38.701  78.300  1.00 86.50  ? 121 LEU D CB  1 
ATOM   6504  C CG  . LEU D  4  121 ? -14.336 38.265  79.773  1.00 85.62  ? 121 LEU D CG  1 
ATOM   6505  C CD1 . LEU D  4  121 ? -14.317 39.478  80.689  1.00 84.50  ? 121 LEU D CD1 1 
ATOM   6506  C CD2 . LEU D  4  121 ? -15.523 37.372  80.105  1.00 83.80  ? 121 LEU D CD2 1 
ATOM   6507  N N   . GLN D  4  122 ? -14.046 37.364  74.818  1.00 85.48  ? 122 GLN D N   1 
ATOM   6508  C CA  . GLN D  4  122 ? -13.963 37.776  73.417  1.00 86.05  ? 122 GLN D CA  1 
ATOM   6509  C C   . GLN D  4  122 ? -15.289 37.541  72.686  1.00 83.98  ? 122 GLN D C   1 
ATOM   6510  O O   . GLN D  4  122 ? -15.313 37.272  71.480  1.00 85.31  ? 122 GLN D O   1 
ATOM   6511  C CB  . GLN D  4  122 ? -12.812 37.048  72.708  1.00 87.85  ? 122 GLN D CB  1 
ATOM   6512  C CG  . GLN D  4  122 ? -11.418 37.460  73.170  1.00 90.73  ? 122 GLN D CG  1 
ATOM   6513  C CD  . GLN D  4  122 ? -11.056 38.890  72.798  1.00 92.88  ? 122 GLN D CD  1 
ATOM   6514  O OE1 . GLN D  4  122 ? -11.353 39.357  71.696  1.00 93.13  ? 122 GLN D OE1 1 
ATOM   6515  N NE2 . GLN D  4  122 ? -10.401 39.588  73.717  1.00 93.73  ? 122 GLN D NE2 1 
ATOM   6516  N N   . PHE D  4  123 ? -16.387 37.646  73.432  1.00 81.84  ? 123 PHE D N   1 
ATOM   6517  C CA  . PHE D  4  123 ? -17.731 37.496  72.881  1.00 81.04  ? 123 PHE D CA  1 
ATOM   6518  C C   . PHE D  4  123 ? -18.449 38.842  72.808  1.00 81.19  ? 123 PHE D C   1 
ATOM   6519  O O   . PHE D  4  123 ? -18.250 39.709  73.663  1.00 83.24  ? 123 PHE D O   1 
ATOM   6520  C CB  . PHE D  4  123 ? -18.548 36.481  73.697  1.00 80.50  ? 123 PHE D CB  1 
ATOM   6521  C CG  . PHE D  4  123 ? -18.782 36.887  75.131  1.00 80.70  ? 123 PHE D CG  1 
ATOM   6522  C CD1 . PHE D  4  123 ? -19.972 37.502  75.507  1.00 80.17  ? 123 PHE D CD1 1 
ATOM   6523  C CD2 . PHE D  4  123 ? -17.821 36.641  76.107  1.00 80.41  ? 123 PHE D CD2 1 
ATOM   6524  C CE1 . PHE D  4  123 ? -20.194 37.875  76.825  1.00 79.90  ? 123 PHE D CE1 1 
ATOM   6525  C CE2 . PHE D  4  123 ? -18.036 37.013  77.425  1.00 79.53  ? 123 PHE D CE2 1 
ATOM   6526  C CZ  . PHE D  4  123 ? -19.225 37.629  77.785  1.00 79.38  ? 123 PHE D CZ  1 
ATOM   6527  N N   . GLY D  4  124 ? -19.280 39.009  71.783  1.00 80.70  ? 124 GLY D N   1 
ATOM   6528  C CA  . GLY D  4  124 ? -20.025 40.249  71.584  1.00 82.39  ? 124 GLY D CA  1 
ATOM   6529  C C   . GLY D  4  124 ? -20.881 40.235  70.333  1.00 84.80  ? 124 GLY D C   1 
ATOM   6530  O O   . GLY D  4  124 ? -20.707 39.383  69.459  1.00 85.66  ? 124 GLY D O   1 
ATOM   6531  N N   . GLU D  4  125 ? -21.805 41.189  70.251  1.00 89.06  ? 125 GLU D N   1 
ATOM   6532  C CA  . GLU D  4  125 ? -22.708 41.301  69.108  1.00 92.96  ? 125 GLU D CA  1 
ATOM   6533  C C   . GLU D  4  125 ? -22.190 42.315  68.088  1.00 98.63  ? 125 GLU D C   1 
ATOM   6534  O O   . GLU D  4  125 ? -21.831 41.946  66.968  1.00 101.15 ? 125 GLU D O   1 
ATOM   6535  C CB  . GLU D  4  125 ? -24.127 41.659  69.568  1.00 96.05  ? 125 GLU D CB  1 
ATOM   6536  C CG  . GLU D  4  125 ? -24.831 40.553  70.344  1.00 97.86  ? 125 GLU D CG  1 
ATOM   6537  C CD  . GLU D  4  125 ? -26.190 40.970  70.881  1.00 101.14 ? 125 GLU D CD  1 
ATOM   6538  O OE1 . GLU D  4  125 ? -27.162 40.209  70.687  1.00 100.19 ? 125 GLU D OE1 1 
ATOM   6539  O OE2 . GLU D  4  125 ? -26.291 42.054  71.497  1.00 103.55 ? 125 GLU D OE2 1 
ATOM   6540  N N   . GLU D  4  126 ? -22.144 43.585  68.485  1.00 102.61 ? 126 GLU D N   1 
ATOM   6541  C CA  . GLU D  4  126 ? -21.672 44.663  67.614  1.00 107.00 ? 126 GLU D CA  1 
ATOM   6542  C C   . GLU D  4  126 ? -20.154 44.824  67.671  1.00 109.91 ? 126 GLU D C   1 
ATOM   6543  O O   . GLU D  4  126 ? -19.511 44.388  68.630  1.00 109.76 ? 126 GLU D O   1 
ATOM   6544  C CB  . GLU D  4  126 ? -22.362 45.987  67.967  1.00 108.18 ? 126 GLU D CB  1 
ATOM   6545  C CG  . GLU D  4  126 ? -23.701 46.208  67.275  1.00 109.19 ? 126 GLU D CG  1 
ATOM   6546  C CD  . GLU D  4  126 ? -24.800 45.291  67.782  1.00 109.87 ? 126 GLU D CD  1 
ATOM   6547  O OE1 . GLU D  4  126 ? -25.016 45.230  69.012  1.00 107.68 ? 126 GLU D OE1 1 
ATOM   6548  O OE2 . GLU D  4  126 ? -25.457 44.637  66.946  1.00 110.76 ? 126 GLU D OE2 1 
ATOM   6549  N N   . ASP D  4  127 ? -19.601 45.453  66.632  1.00 111.88 ? 127 ASP D N   1 
ATOM   6550  C CA  . ASP D  4  127 ? -18.157 45.704  66.498  1.00 113.92 ? 127 ASP D CA  1 
ATOM   6551  C C   . ASP D  4  127 ? -17.315 44.421  66.530  1.00 114.62 ? 127 ASP D C   1 
ATOM   6552  O O   . ASP D  4  127 ? -16.200 44.406  67.061  1.00 116.75 ? 127 ASP D O   1 
ATOM   6553  C CB  . ASP D  4  127 ? -17.668 46.713  67.551  1.00 114.40 ? 127 ASP D CB  1 
ATOM   6554  C CG  . ASP D  4  127 ? -18.284 48.096  67.379  1.00 117.08 ? 127 ASP D CG  1 
ATOM   6555  O OD1 . ASP D  4  127 ? -19.413 48.202  66.852  1.00 119.14 ? 127 ASP D OD1 1 
ATOM   6556  O OD2 . ASP D  4  127 ? -17.636 49.082  67.785  1.00 115.42 ? 127 ASP D OD2 1 
ATOM   6557  N N   . ALA D  4  128 ? -17.857 43.354  65.948  1.00 116.10 ? 128 ALA D N   1 
ATOM   6558  C CA  . ALA D  4  128 ? -17.186 42.058  65.907  1.00 118.47 ? 128 ALA D CA  1 
ATOM   6559  C C   . ALA D  4  128 ? -17.194 41.470  64.497  1.00 121.13 ? 128 ALA D C   1 
ATOM   6560  O O   . ALA D  4  128 ? -17.970 41.899  63.639  1.00 122.09 ? 128 ALA D O   1 
ATOM   6561  C CB  . ALA D  4  128 ? -17.833 41.097  66.895  1.00 118.10 ? 128 ALA D CB  1 
ATOM   6562  N N   . ASP D  4  129 ? -16.320 40.490  64.270  1.00 122.29 ? 129 ASP D N   1 
ATOM   6563  C CA  . ASP D  4  129 ? -16.216 39.799  62.984  1.00 123.57 ? 129 ASP D CA  1 
ATOM   6564  C C   . ASP D  4  129 ? -17.459 38.947  62.698  1.00 125.29 ? 129 ASP D C   1 
ATOM   6565  O O   . ASP D  4  129 ? -18.145 38.528  63.633  1.00 123.12 ? 129 ASP D O   1 
ATOM   6566  C CB  . ASP D  4  129 ? -14.951 38.931  62.954  1.00 123.74 ? 129 ASP D CB  1 
ATOM   6567  C CG  . ASP D  4  129 ? -13.671 39.752  63.005  1.00 123.91 ? 129 ASP D CG  1 
ATOM   6568  O OD1 . ASP D  4  129 ? -13.613 40.826  62.366  1.00 123.31 ? 129 ASP D OD1 1 
ATOM   6569  O OD2 . ASP D  4  129 ? -12.715 39.317  63.680  1.00 126.44 ? 129 ASP D OD2 1 
ATOM   6570  N N   . PRO D  4  130 ? -17.759 38.697  61.404  1.00 128.12 ? 130 PRO D N   1 
ATOM   6571  C CA  . PRO D  4  130 ? -18.919 37.885  61.006  1.00 129.75 ? 130 PRO D CA  1 
ATOM   6572  C C   . PRO D  4  130 ? -18.979 36.506  61.672  1.00 129.11 ? 130 PRO D C   1 
ATOM   6573  O O   . PRO D  4  130 ? -20.071 36.005  61.949  1.00 129.54 ? 130 PRO D O   1 
ATOM   6574  C CB  . PRO D  4  130 ? -18.735 37.736  59.495  1.00 130.16 ? 130 PRO D CB  1 
ATOM   6575  C CG  . PRO D  4  130 ? -18.009 38.971  59.094  1.00 129.17 ? 130 PRO D CG  1 
ATOM   6576  C CD  . PRO D  4  130 ? -17.071 39.269  60.229  1.00 128.26 ? 130 PRO D CD  1 
ATOM   6577  N N   . GLY D  4  131 ? -17.816 35.907  61.922  1.00 126.17 ? 131 GLY D N   1 
ATOM   6578  C CA  . GLY D  4  131 ? -17.736 34.603  62.578  1.00 122.81 ? 131 GLY D CA  1 
ATOM   6579  C C   . GLY D  4  131 ? -17.125 34.666  63.966  1.00 116.16 ? 131 GLY D C   1 
ATOM   6580  O O   . GLY D  4  131 ? -16.251 33.863  64.302  1.00 115.54 ? 131 GLY D O   1 
ATOM   6581  N N   . ALA D  4  132 ? -17.586 35.622  64.769  1.00 108.12 ? 132 ALA D N   1 
ATOM   6582  C CA  . ALA D  4  132 ? -17.093 35.802  66.135  1.00 101.21 ? 132 ALA D CA  1 
ATOM   6583  C C   . ALA D  4  132 ? -18.000 35.121  67.159  1.00 96.31  ? 132 ALA D C   1 
ATOM   6584  O O   . ALA D  4  132 ? -19.114 34.701  66.834  1.00 97.40  ? 132 ALA D O   1 
ATOM   6585  C CB  . ALA D  4  132 ? -16.937 37.282  66.454  1.00 100.68 ? 132 ALA D CB  1 
ATOM   6586  N N   . MET D  4  133 ? -17.511 35.017  68.394  1.00 92.75  ? 133 MET D N   1 
ATOM   6587  C CA  . MET D  4  133 ? -18.241 34.368  69.482  1.00 90.20  ? 133 MET D CA  1 
ATOM   6588  C C   . MET D  4  133 ? -19.404 35.227  69.975  1.00 88.39  ? 133 MET D C   1 
ATOM   6589  O O   . MET D  4  133 ? -19.302 36.455  70.029  1.00 88.03  ? 133 MET D O   1 
ATOM   6590  C CB  . MET D  4  133 ? -17.299 34.045  70.648  1.00 90.05  ? 133 MET D CB  1 
ATOM   6591  C CG  . MET D  4  133 ? -16.055 33.240  70.284  1.00 90.47  ? 133 MET D CG  1 
ATOM   6592  S SD  . MET D  4  133 ? -16.352 31.492  69.947  1.00 87.28  ? 133 MET D SD  1 
ATOM   6593  C CE  . MET D  4  133 ? -16.548 31.492  68.165  1.00 88.09  ? 133 MET D CE  1 
ATOM   6594  N N   . SER D  4  134 ? -20.504 34.569  70.332  1.00 84.45  ? 134 SER D N   1 
ATOM   6595  C CA  . SER D  4  134 ? -21.695 35.246  70.844  1.00 83.93  ? 134 SER D CA  1 
ATOM   6596  C C   . SER D  4  134 ? -21.921 34.953  72.328  1.00 82.25  ? 134 SER D C   1 
ATOM   6597  O O   . SER D  4  134 ? -22.643 35.682  73.012  1.00 84.94  ? 134 SER D O   1 
ATOM   6598  C CB  . SER D  4  134 ? -22.931 34.838  70.036  1.00 82.82  ? 134 SER D CB  1 
ATOM   6599  O OG  . SER D  4  134 ? -23.175 33.446  70.138  1.00 81.78  ? 134 SER D OG  1 
ATOM   6600  N N   . ARG D  4  135 ? -21.295 33.883  72.812  1.00 77.94  ? 135 ARG D N   1 
ATOM   6601  C CA  . ARG D  4  135 ? -21.453 33.430  74.192  1.00 73.39  ? 135 ARG D CA  1 
ATOM   6602  C C   . ARG D  4  135 ? -20.130 32.904  74.756  1.00 70.21  ? 135 ARG D C   1 
ATOM   6603  O O   . ARG D  4  135 ? -19.292 32.407  73.999  1.00 70.55  ? 135 ARG D O   1 
ATOM   6604  C CB  . ARG D  4  135 ? -22.541 32.350  74.281  1.00 73.03  ? 135 ARG D CB  1 
ATOM   6605  C CG  . ARG D  4  135 ? -22.499 31.312  73.168  1.00 72.31  ? 135 ARG D CG  1 
ATOM   6606  C CD  . ARG D  4  135 ? -23.365 30.107  73.491  1.00 72.43  ? 135 ARG D CD  1 
ATOM   6607  N NE  . ARG D  4  135 ? -22.723 29.220  74.459  1.00 71.64  ? 135 ARG D NE  1 
ATOM   6608  C CZ  . ARG D  4  135 ? -21.962 28.175  74.142  1.00 69.69  ? 135 ARG D CZ  1 
ATOM   6609  N NH1 . ARG D  4  135 ? -21.735 27.861  72.872  1.00 68.55  ? 135 ARG D NH1 1 
ATOM   6610  N NH2 . ARG D  4  135 ? -21.428 27.438  75.105  1.00 71.67  ? 135 ARG D NH2 1 
ATOM   6611  N N   . PRO D  4  136 ? -19.935 33.015  76.087  1.00 67.85  ? 136 PRO D N   1 
ATOM   6612  C CA  . PRO D  4  136 ? -18.718 32.499  76.723  1.00 65.46  ? 136 PRO D CA  1 
ATOM   6613  C C   . PRO D  4  136 ? -18.648 30.973  76.692  1.00 65.94  ? 136 PRO D C   1 
ATOM   6614  O O   . PRO D  4  136 ? -19.667 30.308  76.491  1.00 67.45  ? 136 PRO D O   1 
ATOM   6615  C CB  . PRO D  4  136 ? -18.839 32.980  78.177  1.00 65.13  ? 136 PRO D CB  1 
ATOM   6616  C CG  . PRO D  4  136 ? -19.898 34.028  78.175  1.00 67.09  ? 136 PRO D CG  1 
ATOM   6617  C CD  . PRO D  4  136 ? -20.829 33.662  77.064  1.00 68.14  ? 136 PRO D CD  1 
ATOM   6618  N N   . PHE D  4  137 ? -17.448 30.433  76.884  1.00 66.19  ? 137 PHE D N   1 
ATOM   6619  C CA  . PHE D  4  137 ? -17.257 28.990  76.972  1.00 68.69  ? 137 PHE D CA  1 
ATOM   6620  C C   . PHE D  4  137 ? -17.611 28.499  78.373  1.00 70.55  ? 137 PHE D C   1 
ATOM   6621  O O   . PHE D  4  137 ? -16.961 28.871  79.353  1.00 72.86  ? 137 PHE D O   1 
ATOM   6622  C CB  . PHE D  4  137 ? -15.814 28.610  76.622  1.00 70.35  ? 137 PHE D CB  1 
ATOM   6623  C CG  . PHE D  4  137 ? -15.456 28.835  75.179  1.00 70.90  ? 137 PHE D CG  1 
ATOM   6624  C CD1 . PHE D  4  137 ? -14.928 30.053  74.759  1.00 70.89  ? 137 PHE D CD1 1 
ATOM   6625  C CD2 . PHE D  4  137 ? -15.637 27.827  74.238  1.00 71.10  ? 137 PHE D CD2 1 
ATOM   6626  C CE1 . PHE D  4  137 ? -14.596 30.263  73.429  1.00 70.62  ? 137 PHE D CE1 1 
ATOM   6627  C CE2 . PHE D  4  137 ? -15.305 28.030  72.906  1.00 70.47  ? 137 PHE D CE2 1 
ATOM   6628  C CZ  . PHE D  4  137 ? -14.785 29.250  72.501  1.00 70.26  ? 137 PHE D CZ  1 
ATOM   6629  N N   . GLY D  4  138 ? -18.651 27.673  78.462  1.00 70.46  ? 138 GLY D N   1 
ATOM   6630  C CA  . GLY D  4  138 ? -19.079 27.100  79.736  1.00 71.90  ? 138 GLY D CA  1 
ATOM   6631  C C   . GLY D  4  138 ? -18.269 25.869  80.094  1.00 72.44  ? 138 GLY D C   1 
ATOM   6632  O O   . GLY D  4  138 ? -18.817 24.772  80.222  1.00 71.90  ? 138 GLY D O   1 
ATOM   6633  N N   . VAL D  4  139 ? -16.960 26.057  80.249  1.00 72.61  ? 139 VAL D N   1 
ATOM   6634  C CA  . VAL D  4  139 ? -16.032 24.957  80.510  1.00 73.64  ? 139 VAL D CA  1 
ATOM   6635  C C   . VAL D  4  139 ? -15.050 25.317  81.625  1.00 75.31  ? 139 VAL D C   1 
ATOM   6636  O O   . VAL D  4  139 ? -14.441 26.389  81.607  1.00 75.16  ? 139 VAL D O   1 
ATOM   6637  C CB  . VAL D  4  139 ? -15.229 24.570  79.242  1.00 73.84  ? 139 VAL D CB  1 
ATOM   6638  C CG1 . VAL D  4  139 ? -14.327 23.375  79.516  1.00 75.49  ? 139 VAL D CG1 1 
ATOM   6639  C CG2 . VAL D  4  139 ? -16.155 24.270  78.071  1.00 74.93  ? 139 VAL D CG2 1 
ATOM   6640  N N   . ALA D  4  140 ? -14.912 24.416  82.595  1.00 77.36  ? 140 ALA D N   1 
ATOM   6641  C CA  . ALA D  4  140 ? -13.867 24.516  83.608  1.00 78.42  ? 140 ALA D CA  1 
ATOM   6642  C C   . ALA D  4  140 ? -12.742 23.542  83.264  1.00 79.23  ? 140 ALA D C   1 
ATOM   6643  O O   . ALA D  4  140 ? -12.994 22.369  82.978  1.00 81.36  ? 140 ALA D O   1 
ATOM   6644  C CB  . ALA D  4  140 ? -14.429 24.230  84.991  1.00 80.15  ? 140 ALA D CB  1 
ATOM   6645  N N   . LEU D  4  141 ? -11.507 24.035  83.289  1.00 77.98  ? 141 LEU D N   1 
ATOM   6646  C CA  . LEU D  4  141 ? -10.355 23.255  82.834  1.00 78.01  ? 141 LEU D CA  1 
ATOM   6647  C C   . LEU D  4  141 ? -9.298  23.046  83.917  1.00 77.26  ? 141 LEU D C   1 
ATOM   6648  O O   . LEU D  4  141 ? -9.108  23.896  84.790  1.00 77.79  ? 141 LEU D O   1 
ATOM   6649  C CB  . LEU D  4  141 ? -9.717  23.913  81.604  1.00 78.04  ? 141 LEU D CB  1 
ATOM   6650  C CG  . LEU D  4  141 ? -10.531 23.997  80.307  1.00 78.73  ? 141 LEU D CG  1 
ATOM   6651  C CD1 . LEU D  4  141 ? -9.956  25.059  79.382  1.00 78.97  ? 141 LEU D CD1 1 
ATOM   6652  C CD2 . LEU D  4  141 ? -10.594 22.650  79.601  1.00 78.95  ? 141 LEU D CD2 1 
ATOM   6653  N N   . LEU D  4  142 ? -8.616  21.904  83.844  1.00 76.80  ? 142 LEU D N   1 
ATOM   6654  C CA  . LEU D  4  142 ? -7.502  21.593  84.736  1.00 78.07  ? 142 LEU D CA  1 
ATOM   6655  C C   . LEU D  4  142 ? -6.234  21.289  83.939  1.00 78.72  ? 142 LEU D C   1 
ATOM   6656  O O   . LEU D  4  142 ? -6.076  20.192  83.397  1.00 78.73  ? 142 LEU D O   1 
ATOM   6657  C CB  . LEU D  4  142 ? -7.850  20.421  85.662  1.00 78.29  ? 142 LEU D CB  1 
ATOM   6658  C CG  . LEU D  4  142 ? -8.853  20.652  86.797  1.00 79.35  ? 142 LEU D CG  1 
ATOM   6659  C CD1 . LEU D  4  142 ? -9.325  19.319  87.358  1.00 80.59  ? 142 LEU D CD1 1 
ATOM   6660  C CD2 . LEU D  4  142 ? -8.266  21.520  87.902  1.00 80.43  ? 142 LEU D CD2 1 
ATOM   6661  N N   . PHE D  4  143 ? -5.340  22.273  83.869  1.00 79.55  ? 143 PHE D N   1 
ATOM   6662  C CA  . PHE D  4  143 ? -4.082  22.140  83.135  1.00 79.02  ? 143 PHE D CA  1 
ATOM   6663  C C   . PHE D  4  143 ? -2.987  21.563  84.027  1.00 79.17  ? 143 PHE D C   1 
ATOM   6664  O O   . PHE D  4  143 ? -2.485  22.240  84.927  1.00 80.72  ? 143 PHE D O   1 
ATOM   6665  C CB  . PHE D  4  143 ? -3.642  23.493  82.565  1.00 78.51  ? 143 PHE D CB  1 
ATOM   6666  C CG  . PHE D  4  143 ? -4.545  24.024  81.487  1.00 77.86  ? 143 PHE D CG  1 
ATOM   6667  C CD1 . PHE D  4  143 ? -5.634  24.829  81.805  1.00 78.04  ? 143 PHE D CD1 1 
ATOM   6668  C CD2 . PHE D  4  143 ? -4.302  23.728  80.151  1.00 76.94  ? 143 PHE D CD2 1 
ATOM   6669  C CE1 . PHE D  4  143 ? -6.466  25.323  80.812  1.00 78.25  ? 143 PHE D CE1 1 
ATOM   6670  C CE2 . PHE D  4  143 ? -5.131  24.219  79.153  1.00 76.57  ? 143 PHE D CE2 1 
ATOM   6671  C CZ  . PHE D  4  143 ? -6.214  25.017  79.483  1.00 77.46  ? 143 PHE D CZ  1 
ATOM   6672  N N   . GLY D  4  144 ? -2.625  20.308  83.772  1.00 78.33  ? 144 GLY D N   1 
ATOM   6673  C CA  . GLY D  4  144 ? -1.603  19.621  84.556  1.00 80.53  ? 144 GLY D CA  1 
ATOM   6674  C C   . GLY D  4  144 ? -0.436  19.152  83.711  1.00 81.06  ? 144 GLY D C   1 
ATOM   6675  O O   . GLY D  4  144 ? -0.603  18.320  82.818  1.00 81.11  ? 144 GLY D O   1 
ATOM   6676  N N   . GLY D  4  145 ? 0.748   19.688  83.999  1.00 80.70  ? 145 GLY D N   1 
ATOM   6677  C CA  . GLY D  4  145 ? 1.956   19.344  83.254  1.00 80.75  ? 145 GLY D CA  1 
ATOM   6678  C C   . GLY D  4  145 ? 3.249   19.627  83.995  1.00 82.29  ? 145 GLY D C   1 
ATOM   6679  O O   . GLY D  4  145 ? 3.245   20.242  85.065  1.00 82.06  ? 145 GLY D O   1 
ATOM   6680  N N   . VAL D  4  146 ? 4.359   19.173  83.415  1.00 85.14  ? 146 VAL D N   1 
ATOM   6681  C CA  . VAL D  4  146 ? 5.687   19.362  83.998  1.00 88.78  ? 146 VAL D CA  1 
ATOM   6682  C C   . VAL D  4  146 ? 6.569   20.181  83.056  1.00 90.20  ? 146 VAL D C   1 
ATOM   6683  O O   . VAL D  4  146 ? 6.725   19.838  81.881  1.00 90.40  ? 146 VAL D O   1 
ATOM   6684  C CB  . VAL D  4  146 ? 6.374   18.011  84.316  1.00 91.44  ? 146 VAL D CB  1 
ATOM   6685  C CG1 . VAL D  4  146 ? 7.739   18.230  84.955  1.00 93.09  ? 146 VAL D CG1 1 
ATOM   6686  C CG2 . VAL D  4  146 ? 5.501   17.159  85.227  1.00 92.70  ? 146 VAL D CG2 1 
ATOM   6687  N N   . ASP D  4  147 ? 7.133   21.267  83.581  1.00 90.86  ? 147 ASP D N   1 
ATOM   6688  C CA  . ASP D  4  147 ? 8.080   22.099  82.836  1.00 90.71  ? 147 ASP D CA  1 
ATOM   6689  C C   . ASP D  4  147 ? 9.409   22.237  83.588  1.00 91.40  ? 147 ASP D C   1 
ATOM   6690  O O   . ASP D  4  147 ? 9.771   21.364  84.381  1.00 91.55  ? 147 ASP D O   1 
ATOM   6691  C CB  . ASP D  4  147 ? 7.469   23.473  82.510  1.00 89.57  ? 147 ASP D CB  1 
ATOM   6692  C CG  . ASP D  4  147 ? 6.874   24.169  83.730  1.00 89.16  ? 147 ASP D CG  1 
ATOM   6693  O OD1 . ASP D  4  147 ? 7.308   23.901  84.871  1.00 92.49  ? 147 ASP D OD1 1 
ATOM   6694  O OD2 . ASP D  4  147 ? 5.964   25.002  83.539  1.00 85.12  ? 147 ASP D OD2 1 
ATOM   6695  N N   . GLU D  4  148 ? 10.127  23.330  83.336  1.00 92.25  ? 148 GLU D N   1 
ATOM   6696  C CA  . GLU D  4  148 ? 11.408  23.593  84.003  1.00 93.59  ? 148 GLU D CA  1 
ATOM   6697  C C   . GLU D  4  148 ? 11.257  24.066  85.454  1.00 93.41  ? 148 GLU D C   1 
ATOM   6698  O O   . GLU D  4  148 ? 12.220  24.033  86.224  1.00 94.74  ? 148 GLU D O   1 
ATOM   6699  C CB  . GLU D  4  148 ? 12.285  24.561  83.187  1.00 95.01  ? 148 GLU D CB  1 
ATOM   6700  C CG  . GLU D  4  148 ? 11.550  25.640  82.399  1.00 95.59  ? 148 GLU D CG  1 
ATOM   6701  C CD  . GLU D  4  148 ? 11.040  26.774  83.266  1.00 99.39  ? 148 GLU D CD  1 
ATOM   6702  O OE1 . GLU D  4  148 ? 11.729  27.811  83.359  1.00 98.83  ? 148 GLU D OE1 1 
ATOM   6703  O OE2 . GLU D  4  148 ? 9.950   26.627  83.853  1.00 100.87 ? 148 GLU D OE2 1 
ATOM   6704  N N   . LYS D  4  149 ? 10.051  24.498  85.820  1.00 92.65  ? 149 LYS D N   1 
ATOM   6705  C CA  . LYS D  4  149 ? 9.741   24.872  87.202  1.00 93.86  ? 149 LYS D CA  1 
ATOM   6706  C C   . LYS D  4  149 ? 9.275   23.674  88.032  1.00 94.31  ? 149 LYS D C   1 
ATOM   6707  O O   . LYS D  4  149 ? 9.202   23.751  89.261  1.00 95.47  ? 149 LYS D O   1 
ATOM   6708  C CB  . LYS D  4  149 ? 8.686   25.981  87.243  1.00 94.13  ? 149 LYS D CB  1 
ATOM   6709  C CG  . LYS D  4  149 ? 9.240   27.377  87.010  1.00 95.59  ? 149 LYS D CG  1 
ATOM   6710  C CD  . LYS D  4  149 ? 8.158   28.433  87.162  1.00 96.47  ? 149 LYS D CD  1 
ATOM   6711  C CE  . LYS D  4  149 ? 8.722   29.828  86.955  1.00 98.50  ? 149 LYS D CE  1 
ATOM   6712  N NZ  . LYS D  4  149 ? 7.688   30.880  87.151  1.00 99.30  ? 149 LYS D NZ  1 
ATOM   6713  N N   . GLY D  4  150 ? 8.964   22.572  87.352  1.00 94.04  ? 150 GLY D N   1 
ATOM   6714  C CA  . GLY D  4  150 ? 8.491   21.355  88.007  1.00 94.48  ? 150 GLY D CA  1 
ATOM   6715  C C   . GLY D  4  150 ? 7.047   21.027  87.665  1.00 94.71  ? 150 GLY D C   1 
ATOM   6716  O O   . GLY D  4  150 ? 6.462   21.658  86.780  1.00 96.53  ? 150 GLY D O   1 
ATOM   6717  N N   . PRO D  4  151 ? 6.463   20.031  88.359  1.00 91.43  ? 151 PRO D N   1 
ATOM   6718  C CA  . PRO D  4  151 ? 5.066   19.647  88.147  1.00 91.23  ? 151 PRO D CA  1 
ATOM   6719  C C   . PRO D  4  151 ? 4.102   20.731  88.627  1.00 91.67  ? 151 PRO D C   1 
ATOM   6720  O O   . PRO D  4  151 ? 4.173   21.159  89.783  1.00 93.74  ? 151 PRO D O   1 
ATOM   6721  C CB  . PRO D  4  151 ? 4.913   18.375  88.993  1.00 89.73  ? 151 PRO D CB  1 
ATOM   6722  C CG  . PRO D  4  151 ? 6.304   17.897  89.246  1.00 87.64  ? 151 PRO D CG  1 
ATOM   6723  C CD  . PRO D  4  151 ? 7.124   19.146  89.333  1.00 89.27  ? 151 PRO D CD  1 
ATOM   6724  N N   . GLN D  4  152 ? 3.217   21.171  87.735  1.00 90.27  ? 152 GLN D N   1 
ATOM   6725  C CA  . GLN D  4  152 ? 2.283   22.258  88.031  1.00 89.60  ? 152 GLN D CA  1 
ATOM   6726  C C   . GLN D  4  152 ? 0.845   21.914  87.648  1.00 86.34  ? 152 GLN D C   1 
ATOM   6727  O O   . GLN D  4  152 ? 0.605   21.161  86.701  1.00 86.29  ? 152 GLN D O   1 
ATOM   6728  C CB  . GLN D  4  152 ? 2.713   23.545  87.319  1.00 90.72  ? 152 GLN D CB  1 
ATOM   6729  C CG  . GLN D  4  152 ? 3.974   24.192  87.873  1.00 92.71  ? 152 GLN D CG  1 
ATOM   6730  C CD  . GLN D  4  152 ? 4.371   25.450  87.123  1.00 93.39  ? 152 GLN D CD  1 
ATOM   6731  O OE1 . GLN D  4  152 ? 4.548   26.511  87.721  1.00 92.76  ? 152 GLN D OE1 1 
ATOM   6732  N NE2 . GLN D  4  152 ? 4.508   25.340  85.806  1.00 92.45  ? 152 GLN D NE2 1 
ATOM   6733  N N   . LEU D  4  153 ? -0.102  22.478  88.394  1.00 84.36  ? 153 LEU D N   1 
ATOM   6734  C CA  . LEU D  4  153 ? -1.526  22.318  88.113  1.00 82.03  ? 153 LEU D CA  1 
ATOM   6735  C C   . LEU D  4  153 ? -2.225  23.677  88.116  1.00 81.12  ? 153 LEU D C   1 
ATOM   6736  O O   . LEU D  4  153 ? -2.048  24.471  89.042  1.00 83.12  ? 153 LEU D O   1 
ATOM   6737  C CB  . LEU D  4  153 ? -2.175  21.376  89.133  1.00 82.44  ? 153 LEU D CB  1 
ATOM   6738  C CG  . LEU D  4  153 ? -3.673  21.075  89.006  1.00 82.75  ? 153 LEU D CG  1 
ATOM   6739  C CD1 . LEU D  4  153 ? -3.953  20.067  87.900  1.00 82.59  ? 153 LEU D CD1 1 
ATOM   6740  C CD2 . LEU D  4  153 ? -4.217  20.573  90.333  1.00 85.35  ? 153 LEU D CD2 1 
ATOM   6741  N N   . PHE D  4  154 ? -3.013  23.932  87.074  1.00 79.74  ? 154 PHE D N   1 
ATOM   6742  C CA  . PHE D  4  154 ? -3.727  25.200  86.923  1.00 79.09  ? 154 PHE D CA  1 
ATOM   6743  C C   . PHE D  4  154 ? -5.222  24.996  86.697  1.00 78.55  ? 154 PHE D C   1 
ATOM   6744  O O   . PHE D  4  154 ? -5.636  24.038  86.041  1.00 77.79  ? 154 PHE D O   1 
ATOM   6745  C CB  . PHE D  4  154 ? -3.130  26.021  85.775  1.00 77.43  ? 154 PHE D CB  1 
ATOM   6746  C CG  . PHE D  4  154 ? -1.821  26.678  86.113  1.00 76.28  ? 154 PHE D CG  1 
ATOM   6747  C CD1 . PHE D  4  154 ? -0.619  25.997  85.943  1.00 76.32  ? 154 PHE D CD1 1 
ATOM   6748  C CD2 . PHE D  4  154 ? -1.788  27.981  86.598  1.00 76.97  ? 154 PHE D CD2 1 
ATOM   6749  C CE1 . PHE D  4  154 ? 0.589   26.602  86.255  1.00 76.61  ? 154 PHE D CE1 1 
ATOM   6750  C CE2 . PHE D  4  154 ? -0.583  28.592  86.911  1.00 77.55  ? 154 PHE D CE2 1 
ATOM   6751  C CZ  . PHE D  4  154 ? 0.607   27.901  86.739  1.00 78.10  ? 154 PHE D CZ  1 
ATOM   6752  N N   . HIS D  4  155 ? -6.020  25.909  87.246  1.00 80.19  ? 155 HIS D N   1 
ATOM   6753  C CA  . HIS D  4  155 ? -7.473  25.876  87.103  1.00 81.30  ? 155 HIS D CA  1 
ATOM   6754  C C   . HIS D  4  155 ? -7.964  27.086  86.359  1.00 82.49  ? 155 HIS D C   1 
ATOM   6755  O O   . HIS D  4  155 ? -7.550  28.211  86.648  1.00 84.25  ? 155 HIS D O   1 
ATOM   6756  C CB  . HIS D  4  155 ? -8.139  25.781  88.475  1.00 81.87  ? 155 HIS D CB  1 
ATOM   6757  C CG  . HIS D  4  155 ? -9.625  26.056  88.456  1.00 81.16  ? 155 HIS D CG  1 
ATOM   6758  N ND1 . HIS D  4  155 ? -10.146 27.235  88.841  1.00 80.92  ? 155 HIS D ND1 1 
ATOM   6759  C CD2 . HIS D  4  155 ? -10.700 25.257  88.072  1.00 81.18  ? 155 HIS D CD2 1 
ATOM   6760  C CE1 . HIS D  4  155 ? -11.486 27.195  88.715  1.00 80.95  ? 155 HIS D CE1 1 
ATOM   6761  N NE2 . HIS D  4  155 ? -11.823 25.984  88.245  1.00 81.18  ? 155 HIS D NE2 1 
ATOM   6762  N N   . MET D  4  156 ? -8.852  26.862  85.392  1.00 83.04  ? 156 MET D N   1 
ATOM   6763  C CA  . MET D  4  156 ? -9.437  27.949  84.610  1.00 84.05  ? 156 MET D CA  1 
ATOM   6764  C C   . MET D  4  156 ? -10.961 27.851  84.568  1.00 82.63  ? 156 MET D C   1 
ATOM   6765  O O   . MET D  4  156 ? -11.522 26.754  84.565  1.00 83.10  ? 156 MET D O   1 
ATOM   6766  C CB  . MET D  4  156 ? -8.869  27.960  83.188  1.00 85.36  ? 156 MET D CB  1 
ATOM   6767  C CG  . MET D  4  156 ? -8.894  29.329  82.525  1.00 88.50  ? 156 MET D CG  1 
ATOM   6768  S SD  . MET D  4  156 ? -8.680  29.270  80.736  1.00 91.83  ? 156 MET D SD  1 
ATOM   6769  C CE  . MET D  4  156 ? -10.315 28.759  80.210  1.00 88.13  ? 156 MET D CE  1 
ATOM   6770  N N   . ASP D  4  157 ? -11.617 29.009  84.536  1.00 80.89  ? 157 ASP D N   1 
ATOM   6771  C CA  . ASP D  4  157 ? -13.076 29.090  84.473  1.00 79.70  ? 157 ASP D CA  1 
ATOM   6772  C C   . ASP D  4  157 ? -13.523 30.071  83.377  1.00 78.67  ? 157 ASP D C   1 
ATOM   6773  O O   . ASP D  4  157 ? -12.707 30.860  82.894  1.00 79.37  ? 157 ASP D O   1 
ATOM   6774  C CB  . ASP D  4  157 ? -13.652 29.477  85.845  1.00 81.75  ? 157 ASP D CB  1 
ATOM   6775  C CG  . ASP D  4  157 ? -13.192 30.850  86.320  1.00 86.07  ? 157 ASP D CG  1 
ATOM   6776  O OD1 . ASP D  4  157 ? -13.969 31.507  87.045  1.00 88.65  ? 157 ASP D OD1 1 
ATOM   6777  O OD2 . ASP D  4  157 ? -12.066 31.273  85.979  1.00 89.13  ? 157 ASP D OD2 1 
ATOM   6778  N N   . PRO D  4  158 ? -14.812 30.015  82.970  1.00 76.67  ? 158 PRO D N   1 
ATOM   6779  C CA  . PRO D  4  158 ? -15.394 30.887  81.939  1.00 75.19  ? 158 PRO D CA  1 
ATOM   6780  C C   . PRO D  4  158 ? -15.005 32.367  82.015  1.00 76.19  ? 158 PRO D C   1 
ATOM   6781  O O   . PRO D  4  158 ? -14.981 33.043  80.984  1.00 77.90  ? 158 PRO D O   1 
ATOM   6782  C CB  . PRO D  4  158 ? -16.895 30.734  82.175  1.00 74.74  ? 158 PRO D CB  1 
ATOM   6783  C CG  . PRO D  4  158 ? -17.043 29.336  82.665  1.00 75.94  ? 158 PRO D CG  1 
ATOM   6784  C CD  . PRO D  4  158 ? -15.769 28.967  83.380  1.00 77.56  ? 158 PRO D CD  1 
ATOM   6785  N N   . SER D  4  159 ? -14.712 32.862  83.218  1.00 76.31  ? 159 SER D N   1 
ATOM   6786  C CA  . SER D  4  159 ? -14.315 34.259  83.411  1.00 76.99  ? 159 SER D CA  1 
ATOM   6787  C C   . SER D  4  159 ? -12.905 34.545  82.891  1.00 77.91  ? 159 SER D C   1 
ATOM   6788  O O   . SER D  4  159 ? -12.589 35.680  82.529  1.00 78.82  ? 159 SER D O   1 
ATOM   6789  C CB  . SER D  4  159 ? -14.423 34.654  84.886  1.00 77.41  ? 159 SER D CB  1 
ATOM   6790  O OG  . SER D  4  159 ? -13.462 33.972  85.672  1.00 77.68  ? 159 SER D OG  1 
ATOM   6791  N N   . GLY D  4  160 ? -12.067 33.511  82.862  1.00 79.26  ? 160 GLY D N   1 
ATOM   6792  C CA  . GLY D  4  160 ? -10.692 33.630  82.382  1.00 82.23  ? 160 GLY D CA  1 
ATOM   6793  C C   . GLY D  4  160 ? -9.678  33.829  83.491  1.00 85.40  ? 160 GLY D C   1 
ATOM   6794  O O   . GLY D  4  160 ? -8.506  34.110  83.229  1.00 84.93  ? 160 GLY D O   1 
ATOM   6795  N N   . THR D  4  161 ? -10.136 33.685  84.732  1.00 86.98  ? 161 THR D N   1 
ATOM   6796  C CA  . THR D  4  161 ? -9.277  33.816  85.902  1.00 89.08  ? 161 THR D CA  1 
ATOM   6797  C C   . THR D  4  161 ? -8.540  32.499  86.146  1.00 89.29  ? 161 THR D C   1 
ATOM   6798  O O   . THR D  4  161 ? -9.127  31.525  86.626  1.00 90.30  ? 161 THR D O   1 
ATOM   6799  C CB  . THR D  4  161 ? -10.088 34.223  87.152  1.00 90.50  ? 161 THR D CB  1 
ATOM   6800  O OG1 . THR D  4  161 ? -10.966 35.308  86.825  1.00 90.63  ? 161 THR D OG1 1 
ATOM   6801  C CG2 . THR D  4  161 ? -9.163  34.652  88.282  1.00 95.46  ? 161 THR D CG2 1 
ATOM   6802  N N   . PHE D  4  162 ? -7.256  32.476  85.799  1.00 89.84  ? 162 PHE D N   1 
ATOM   6803  C CA  . PHE D  4  162 ? -6.433  31.280  85.969  1.00 89.98  ? 162 PHE D CA  1 
ATOM   6804  C C   . PHE D  4  162 ? -5.507  31.392  87.178  1.00 90.89  ? 162 PHE D C   1 
ATOM   6805  O O   . PHE D  4  162 ? -4.935  32.453  87.440  1.00 91.41  ? 162 PHE D O   1 
ATOM   6806  C CB  . PHE D  4  162 ? -5.652  30.952  84.684  1.00 88.30  ? 162 PHE D CB  1 
ATOM   6807  C CG  . PHE D  4  162 ? -4.544  31.922  84.364  1.00 87.73  ? 162 PHE D CG  1 
ATOM   6808  C CD1 . PHE D  4  162 ? -3.226  31.627  84.702  1.00 87.06  ? 162 PHE D CD1 1 
ATOM   6809  C CD2 . PHE D  4  162 ? -4.811  33.120  83.707  1.00 86.91  ? 162 PHE D CD2 1 
ATOM   6810  C CE1 . PHE D  4  162 ? -2.200  32.512  84.406  1.00 86.98  ? 162 PHE D CE1 1 
ATOM   6811  C CE2 . PHE D  4  162 ? -3.789  34.009  83.408  1.00 87.36  ? 162 PHE D CE2 1 
ATOM   6812  C CZ  . PHE D  4  162 ? -2.482  33.704  83.758  1.00 86.89  ? 162 PHE D CZ  1 
ATOM   6813  N N   . VAL D  4  163 ? -5.374  30.289  87.912  1.00 92.03  ? 163 VAL D N   1 
ATOM   6814  C CA  . VAL D  4  163 ? -4.557  30.250  89.125  1.00 93.57  ? 163 VAL D CA  1 
ATOM   6815  C C   . VAL D  4  163 ? -3.956  28.858  89.354  1.00 93.37  ? 163 VAL D C   1 
ATOM   6816  O O   . VAL D  4  163 ? -4.552  27.843  88.981  1.00 92.29  ? 163 VAL D O   1 
ATOM   6817  C CB  . VAL D  4  163 ? -5.358  30.736  90.364  1.00 94.16  ? 163 VAL D CB  1 
ATOM   6818  C CG1 . VAL D  4  163 ? -6.383  29.701  90.816  1.00 93.09  ? 163 VAL D CG1 1 
ATOM   6819  C CG2 . VAL D  4  163 ? -4.425  31.123  91.503  1.00 96.34  ? 163 VAL D CG2 1 
ATOM   6820  N N   . GLN D  4  164 ? -2.767  28.824  89.953  1.00 94.36  ? 164 GLN D N   1 
ATOM   6821  C CA  . GLN D  4  164 ? -2.099  27.572  90.297  1.00 94.96  ? 164 GLN D CA  1 
ATOM   6822  C C   . GLN D  4  164 ? -2.770  26.923  91.508  1.00 96.93  ? 164 GLN D C   1 
ATOM   6823  O O   . GLN D  4  164 ? -3.122  27.604  92.473  1.00 97.70  ? 164 GLN D O   1 
ATOM   6824  C CB  . GLN D  4  164 ? -0.613  27.818  90.571  1.00 96.28  ? 164 GLN D CB  1 
ATOM   6825  C CG  . GLN D  4  164 ? 0.247   26.561  90.567  1.00 98.45  ? 164 GLN D CG  1 
ATOM   6826  C CD  . GLN D  4  164 ? 1.720   26.844  90.808  1.00 101.60 ? 164 GLN D CD  1 
ATOM   6827  O OE1 . GLN D  4  164 ? 2.107   27.958  91.165  1.00 103.14 ? 164 GLN D OE1 1 
ATOM   6828  N NE2 . GLN D  4  164 ? 2.552   25.827  90.615  1.00 103.30 ? 164 GLN D NE2 1 
ATOM   6829  N N   . CYS D  4  165 ? -2.951  25.606  91.442  1.00 96.75  ? 165 CYS D N   1 
ATOM   6830  C CA  . CYS D  4  165 ? -3.614  24.858  92.508  1.00 98.15  ? 165 CYS D CA  1 
ATOM   6831  C C   . CYS D  4  165 ? -2.824  23.617  92.908  1.00 98.48  ? 165 CYS D C   1 
ATOM   6832  O O   . CYS D  4  165 ? -2.214  22.960  92.063  1.00 96.46  ? 165 CYS D O   1 
ATOM   6833  C CB  . CYS D  4  165 ? -5.025  24.449  92.078  1.00 97.94  ? 165 CYS D CB  1 
ATOM   6834  S SG  . CYS D  4  165 ? -6.123  25.826  91.672  1.00 99.55  ? 165 CYS D SG  1 
ATOM   6835  N N   . ASP D  4  166 ? -2.840  23.310  94.203  1.00 100.02 ? 166 ASP D N   1 
ATOM   6836  C CA  . ASP D  4  166 ? -2.242  22.081  94.721  1.00 101.35 ? 166 ASP D CA  1 
ATOM   6837  C C   . ASP D  4  166 ? -3.215  20.915  94.558  1.00 98.10  ? 166 ASP D C   1 
ATOM   6838  O O   . ASP D  4  166 ? -2.820  19.814  94.169  1.00 97.62  ? 166 ASP D O   1 
ATOM   6839  C CB  . ASP D  4  166 ? -1.847  22.248  96.192  1.00 105.24 ? 166 ASP D CB  1 
ATOM   6840  C CG  . ASP D  4  166 ? -0.715  23.244  96.388  1.00 105.41 ? 166 ASP D CG  1 
ATOM   6841  O OD1 . ASP D  4  166 ? 0.336   23.101  95.728  1.00 105.55 ? 166 ASP D OD1 1 
ATOM   6842  O OD2 . ASP D  4  166 ? -0.873  24.165  97.216  1.00 107.59 ? 166 ASP D OD2 1 
ATOM   6843  N N   . ALA D  4  167 ? -4.486  21.173  94.862  1.00 96.94  ? 167 ALA D N   1 
ATOM   6844  C CA  . ALA D  4  167 ? -5.564  20.208  94.664  1.00 96.20  ? 167 ALA D CA  1 
ATOM   6845  C C   . ALA D  4  167 ? -6.858  20.947  94.338  1.00 94.47  ? 167 ALA D C   1 
ATOM   6846  O O   . ALA D  4  167 ? -7.280  21.837  95.082  1.00 96.53  ? 167 ALA D O   1 
ATOM   6847  C CB  . ALA D  4  167 ? -5.739  19.335  95.898  1.00 100.47 ? 167 ALA D CB  1 
ATOM   6848  N N   . ARG D  4  168 ? -7.479  20.577  93.220  1.00 92.38  ? 168 ARG D N   1 
ATOM   6849  C CA  . ARG D  4  168 ? -8.686  21.249  92.747  1.00 91.66  ? 168 ARG D CA  1 
ATOM   6850  C C   . ARG D  4  168 ? -9.724  20.255  92.230  1.00 90.44  ? 168 ARG D C   1 
ATOM   6851  O O   . ARG D  4  168 ? -9.383  19.277  91.560  1.00 89.80  ? 168 ARG D O   1 
ATOM   6852  C CB  . ARG D  4  168 ? -8.332  22.264  91.653  1.00 91.60  ? 168 ARG D CB  1 
ATOM   6853  C CG  . ARG D  4  168 ? -9.436  23.255  91.308  1.00 93.45  ? 168 ARG D CG  1 
ATOM   6854  C CD  . ARG D  4  168 ? -9.498  24.403  92.304  1.00 96.95  ? 168 ARG D CD  1 
ATOM   6855  N NE  . ARG D  4  168 ? -10.497 25.400  91.925  1.00 98.14  ? 168 ARG D NE  1 
ATOM   6856  C CZ  . ARG D  4  168 ? -10.621 26.598  92.490  1.00 100.89 ? 168 ARG D CZ  1 
ATOM   6857  N NH1 . ARG D  4  168 ? -9.803  26.972  93.466  1.00 105.23 ? 168 ARG D NH1 1 
ATOM   6858  N NH2 . ARG D  4  168 ? -11.564 27.430  92.072  1.00 103.40 ? 168 ARG D NH2 1 
ATOM   6859  N N   . ALA D  4  169 ? -10.988 20.519  92.550  1.00 90.47  ? 169 ALA D N   1 
ATOM   6860  C CA  . ALA D  4  169 ? -12.102 19.700  92.082  1.00 90.15  ? 169 ALA D CA  1 
ATOM   6861  C C   . ALA D  4  169 ? -13.154 20.557  91.382  1.00 89.10  ? 169 ALA D C   1 
ATOM   6862  O O   . ALA D  4  169 ? -13.560 21.602  91.895  1.00 89.53  ? 169 ALA D O   1 
ATOM   6863  C CB  . ALA D  4  169 ? -12.719 18.929  93.239  1.00 91.67  ? 169 ALA D CB  1 
ATOM   6864  N N   . ILE D  4  170 ? -13.584 20.106  90.205  1.00 88.55  ? 170 ILE D N   1 
ATOM   6865  C CA  . ILE D  4  170 ? -14.582 20.818  89.404  1.00 89.56  ? 170 ILE D CA  1 
ATOM   6866  C C   . ILE D  4  170 ? -15.621 19.865  88.821  1.00 91.96  ? 170 ILE D C   1 
ATOM   6867  O O   . ILE D  4  170 ? -15.275 18.806  88.294  1.00 91.30  ? 170 ILE D O   1 
ATOM   6868  C CB  . ILE D  4  170 ? -13.939 21.636  88.259  1.00 88.49  ? 170 ILE D CB  1 
ATOM   6869  C CG1 . ILE D  4  170 ? -12.806 20.843  87.590  1.00 87.16  ? 170 ILE D CG1 1 
ATOM   6870  C CG2 . ILE D  4  170 ? -13.435 22.975  88.781  1.00 88.34  ? 170 ILE D CG2 1 
ATOM   6871  C CD1 . ILE D  4  170 ? -12.555 21.208  86.142  1.00 85.00  ? 170 ILE D CD1 1 
ATOM   6872  N N   . GLY D  4  171 ? -16.892 20.249  88.919  1.00 97.02  ? 171 GLY D N   1 
ATOM   6873  C CA  . GLY D  4  171 ? -17.987 19.451  88.372  1.00 100.76 ? 171 GLY D CA  1 
ATOM   6874  C C   . GLY D  4  171 ? -19.280 19.573  89.156  1.00 108.71 ? 171 GLY D C   1 
ATOM   6875  O O   . GLY D  4  171 ? -19.601 20.643  89.679  1.00 109.65 ? 171 GLY D O   1 
ATOM   6876  N N   . SER D  4  172 ? -20.020 18.469  89.232  1.00 112.81 ? 172 SER D N   1 
ATOM   6877  C CA  . SER D  4  172 ? -21.300 18.427  89.938  1.00 115.22 ? 172 SER D CA  1 
ATOM   6878  C C   . SER D  4  172 ? -21.111 18.496  91.451  1.00 116.23 ? 172 SER D C   1 
ATOM   6879  O O   . SER D  4  172 ? -21.668 19.374  92.112  1.00 118.67 ? 172 SER D O   1 
ATOM   6880  C CB  . SER D  4  172 ? -22.093 17.174  89.552  1.00 115.69 ? 172 SER D CB  1 
ATOM   6881  O OG  . SER D  4  172 ? -21.354 15.996  89.827  1.00 119.39 ? 172 SER D OG  1 
ATOM   6882  N N   . ALA D  4  173 ? -20.321 17.569  91.988  1.00 113.92 ? 173 ALA D N   1 
ATOM   6883  C CA  . ALA D  4  173 ? -20.013 17.541  93.414  1.00 112.06 ? 173 ALA D CA  1 
ATOM   6884  C C   . ALA D  4  173 ? -18.649 18.177  93.679  1.00 109.93 ? 173 ALA D C   1 
ATOM   6885  O O   . ALA D  4  173 ? -17.736 17.536  94.207  1.00 107.87 ? 173 ALA D O   1 
ATOM   6886  C CB  . ALA D  4  173 ? -20.070 16.115  93.943  1.00 111.40 ? 173 ALA D CB  1 
ATOM   6887  N N   . SER D  4  174 ? -18.529 19.448  93.302  1.00 110.40 ? 174 SER D N   1 
ATOM   6888  C CA  . SER D  4  174 ? -17.291 20.207  93.454  1.00 109.18 ? 174 SER D CA  1 
ATOM   6889  C C   . SER D  4  174 ? -17.028 20.584  94.911  1.00 109.85 ? 174 SER D C   1 
ATOM   6890  O O   . SER D  4  174 ? -15.880 20.581  95.359  1.00 109.96 ? 174 SER D O   1 
ATOM   6891  C CB  . SER D  4  174 ? -17.334 21.463  92.578  1.00 109.53 ? 174 SER D CB  1 
ATOM   6892  O OG  . SER D  4  174 ? -16.148 22.225  92.707  1.00 110.62 ? 174 SER D OG  1 
ATOM   6893  N N   . GLU D  4  175 ? -18.096 20.903  95.640  1.00 110.71 ? 175 GLU D N   1 
ATOM   6894  C CA  . GLU D  4  175 ? -17.999 21.304  97.044  1.00 113.06 ? 175 GLU D CA  1 
ATOM   6895  C C   . GLU D  4  175 ? -17.680 20.128  97.966  1.00 110.32 ? 175 GLU D C   1 
ATOM   6896  O O   . GLU D  4  175 ? -16.948 20.282  98.946  1.00 109.26 ? 175 GLU D O   1 
ATOM   6897  C CB  . GLU D  4  175 ? -19.288 21.996  97.497  1.00 120.72 ? 175 GLU D CB  1 
ATOM   6898  C CG  . GLU D  4  175 ? -19.490 23.385  96.909  1.00 129.85 ? 175 GLU D CG  1 
ATOM   6899  C CD  . GLU D  4  175 ? -20.760 24.056  97.398  1.00 137.65 ? 175 GLU D CD  1 
ATOM   6900  O OE1 . GLU D  4  175 ? -20.665 25.171  97.953  1.00 139.64 ? 175 GLU D OE1 1 
ATOM   6901  O OE2 . GLU D  4  175 ? -21.852 23.473  97.232  1.00 140.06 ? 175 GLU D OE2 1 
ATOM   6902  N N   . GLY D  4  176 ? -18.233 18.961  97.642  1.00 109.31 ? 176 GLY D N   1 
ATOM   6903  C CA  . GLY D  4  176 ? -18.023 17.749  98.432  1.00 109.89 ? 176 GLY D CA  1 
ATOM   6904  C C   . GLY D  4  176 ? -16.642 17.144  98.261  1.00 110.96 ? 176 GLY D C   1 
ATOM   6905  O O   . GLY D  4  176 ? -16.056 16.643  99.223  1.00 113.88 ? 176 GLY D O   1 
ATOM   6906  N N   . ALA D  4  177 ? -16.126 17.192  97.035  1.00 111.41 ? 177 ALA D N   1 
ATOM   6907  C CA  . ALA D  4  177 ? -14.817 16.621  96.715  1.00 112.27 ? 177 ALA D CA  1 
ATOM   6908  C C   . ALA D  4  177 ? -13.658 17.493  97.200  1.00 113.94 ? 177 ALA D C   1 
ATOM   6909  O O   . ALA D  4  177 ? -12.613 16.973  97.597  1.00 113.90 ? 177 ALA D O   1 
ATOM   6910  C CB  . ALA D  4  177 ? -14.702 16.361  95.221  1.00 109.88 ? 177 ALA D CB  1 
ATOM   6911  N N   . GLN D  4  178 ? -13.851 18.811  97.164  1.00 115.20 ? 178 GLN D N   1 
ATOM   6912  C CA  . GLN D  4  178 ? -12.830 19.770  97.595  1.00 116.24 ? 178 GLN D CA  1 
ATOM   6913  C C   . GLN D  4  178 ? -12.565 19.671  99.098  1.00 118.25 ? 178 GLN D C   1 
ATOM   6914  O O   . GLN D  4  178 ? -11.414 19.745  99.534  1.00 119.66 ? 178 GLN D O   1 
ATOM   6915  C CB  . GLN D  4  178 ? -13.231 21.201  97.210  1.00 115.01 ? 178 GLN D CB  1 
ATOM   6916  C CG  . GLN D  4  178 ? -12.154 22.259  97.430  1.00 114.84 ? 178 GLN D CG  1 
ATOM   6917  C CD  . GLN D  4  178 ? -10.969 22.122  96.486  1.00 114.50 ? 178 GLN D CD  1 
ATOM   6918  O OE1 . GLN D  4  178 ? -11.124 21.770  95.315  1.00 113.27 ? 178 GLN D OE1 1 
ATOM   6919  N NE2 . GLN D  4  178 ? -9.777  22.411  96.994  1.00 115.19 ? 178 GLN D NE2 1 
ATOM   6920  N N   . SER D  4  179 ? -13.633 19.497  99.876  1.00 119.56 ? 179 SER D N   1 
ATOM   6921  C CA  . SER D  4  179 ? -13.535 19.347  101.329 1.00 121.57 ? 179 SER D CA  1 
ATOM   6922  C C   . SER D  4  179 ? -12.798 18.068  101.727 1.00 120.68 ? 179 SER D C   1 
ATOM   6923  O O   . SER D  4  179 ? -12.117 18.031  102.755 1.00 121.38 ? 179 SER D O   1 
ATOM   6924  C CB  . SER D  4  179 ? -14.924 19.384  101.971 1.00 121.72 ? 179 SER D CB  1 
ATOM   6925  O OG  . SER D  4  179 ? -15.750 18.350  101.465 1.00 122.33 ? 179 SER D OG  1 
ATOM   6926  N N   . SER D  4  180 ? -12.941 17.028  100.907 1.00 117.84 ? 180 SER D N   1 
ATOM   6927  C CA  . SER D  4  180 ? -12.242 15.760  101.113 1.00 115.32 ? 180 SER D CA  1 
ATOM   6928  C C   . SER D  4  180 ? -10.758 15.868  100.763 1.00 116.45 ? 180 SER D C   1 
ATOM   6929  O O   . SER D  4  180 ? -9.926  15.170  101.345 1.00 117.69 ? 180 SER D O   1 
ATOM   6930  C CB  . SER D  4  180 ? -12.898 14.647  100.293 1.00 110.69 ? 180 SER D CB  1 
ATOM   6931  O OG  . SER D  4  180 ? -14.242 14.444  100.690 1.00 111.20 ? 180 SER D OG  1 
ATOM   6932  N N   . LEU D  4  181 ? -10.438 16.743  99.811  1.00 115.75 ? 181 LEU D N   1 
ATOM   6933  C CA  . LEU D  4  181 ? -9.055  16.982  99.397  1.00 116.12 ? 181 LEU D CA  1 
ATOM   6934  C C   . LEU D  4  181 ? -8.284  17.822  100.415 1.00 118.72 ? 181 LEU D C   1 
ATOM   6935  O O   . LEU D  4  181 ? -7.058  17.724  100.505 1.00 120.06 ? 181 LEU D O   1 
ATOM   6936  C CB  . LEU D  4  181 ? -9.010  17.658  98.022  1.00 113.28 ? 181 LEU D CB  1 
ATOM   6937  C CG  . LEU D  4  181 ? -9.328  16.823  96.776  1.00 110.09 ? 181 LEU D CG  1 
ATOM   6938  C CD1 . LEU D  4  181 ? -9.709  17.725  95.613  1.00 107.76 ? 181 LEU D CD1 1 
ATOM   6939  C CD2 . LEU D  4  181 ? -8.165  15.917  96.396  1.00 106.51 ? 181 LEU D CD2 1 
ATOM   6940  N N   . GLN D  4  182 ? -9.008  18.642  101.175 1.00 121.65 ? 182 GLN D N   1 
ATOM   6941  C CA  . GLN D  4  182 ? -8.407  19.540  102.164 1.00 127.15 ? 182 GLN D CA  1 
ATOM   6942  C C   . GLN D  4  182 ? -7.843  18.811  103.384 1.00 130.70 ? 182 GLN D C   1 
ATOM   6943  O O   . GLN D  4  182 ? -6.910  19.298  104.025 1.00 134.23 ? 182 GLN D O   1 
ATOM   6944  C CB  . GLN D  4  182 ? -9.422  20.596  102.618 1.00 130.22 ? 182 GLN D CB  1 
ATOM   6945  C CG  . GLN D  4  182 ? -9.722  21.669  101.580 1.00 130.59 ? 182 GLN D CG  1 
ATOM   6946  C CD  . GLN D  4  182 ? -10.772 22.665  102.037 1.00 133.82 ? 182 GLN D CD  1 
ATOM   6947  O OE1 . GLN D  4  182 ? -11.715 22.317  102.750 1.00 134.96 ? 182 GLN D OE1 1 
ATOM   6948  N NE2 . GLN D  4  182 ? -10.618 23.916  101.616 1.00 134.80 ? 182 GLN D NE2 1 
ATOM   6949  N N   . GLU D  4  183 ? -8.410  17.647  103.693 1.00 133.85 ? 183 GLU D N   1 
ATOM   6950  C CA  . GLU D  4  183 ? -8.038  16.889  104.890 1.00 139.30 ? 183 GLU D CA  1 
ATOM   6951  C C   . GLU D  4  183 ? -7.060  15.741  104.618 1.00 138.63 ? 183 GLU D C   1 
ATOM   6952  O O   . GLU D  4  183 ? -6.603  15.076  105.552 1.00 142.81 ? 183 GLU D O   1 
ATOM   6953  C CB  . GLU D  4  183 ? -9.292  16.363  105.598 1.00 146.13 ? 183 GLU D CB  1 
ATOM   6954  C CG  . GLU D  4  183 ? -10.171 17.451  106.201 1.00 153.93 ? 183 GLU D CG  1 
ATOM   6955  C CD  . GLU D  4  183 ? -11.406 16.904  106.895 1.00 161.23 ? 183 GLU D CD  1 
ATOM   6956  O OE1 . GLU D  4  183 ? -11.798 17.468  107.937 1.00 163.23 ? 183 GLU D OE1 1 
ATOM   6957  O OE2 . GLU D  4  183 ? -11.988 15.912  106.404 1.00 164.67 ? 183 GLU D OE2 1 
ATOM   6958  N N   . VAL D  4  184 ? -6.736  15.519  103.345 1.00 132.10 ? 184 VAL D N   1 
ATOM   6959  C CA  . VAL D  4  184 ? -5.849  14.420  102.948 1.00 127.40 ? 184 VAL D CA  1 
ATOM   6960  C C   . VAL D  4  184 ? -4.505  14.924  102.408 1.00 125.34 ? 184 VAL D C   1 
ATOM   6961  O O   . VAL D  4  184 ? -3.452  14.379  102.749 1.00 126.40 ? 184 VAL D O   1 
ATOM   6962  C CB  . VAL D  4  184 ? -6.530  13.477  101.924 1.00 124.55 ? 184 VAL D CB  1 
ATOM   6963  C CG1 . VAL D  4  184 ? -5.576  12.384  101.460 1.00 123.36 ? 184 VAL D CG1 1 
ATOM   6964  C CG2 . VAL D  4  184 ? -7.784  12.851  102.521 1.00 124.99 ? 184 VAL D CG2 1 
ATOM   6965  N N   . TYR D  4  185 ? -4.550  15.967  101.581 1.00 124.59 ? 185 TYR D N   1 
ATOM   6966  C CA  . TYR D  4  185 ? -3.361  16.488  100.901 1.00 125.60 ? 185 TYR D CA  1 
ATOM   6967  C C   . TYR D  4  185 ? -2.359  17.156  101.843 1.00 126.62 ? 185 TYR D C   1 
ATOM   6968  O O   . TYR D  4  185 ? -2.740  17.912  102.740 1.00 128.55 ? 185 TYR D O   1 
ATOM   6969  C CB  . TYR D  4  185 ? -3.770  17.472  99.795  1.00 124.86 ? 185 TYR D CB  1 
ATOM   6970  C CG  . TYR D  4  185 ? -2.615  18.026  98.982  1.00 124.66 ? 185 TYR D CG  1 
ATOM   6971  C CD1 . TYR D  4  185 ? -2.194  17.395  97.813  1.00 122.27 ? 185 TYR D CD1 1 
ATOM   6972  C CD2 . TYR D  4  185 ? -1.948  19.187  99.378  1.00 125.09 ? 185 TYR D CD2 1 
ATOM   6973  C CE1 . TYR D  4  185 ? -1.140  17.898  97.068  1.00 121.33 ? 185 TYR D CE1 1 
ATOM   6974  C CE2 . TYR D  4  185 ? -0.893  19.698  98.639  1.00 123.91 ? 185 TYR D CE2 1 
ATOM   6975  C CZ  . TYR D  4  185 ? -0.493  19.051  97.485  1.00 125.01 ? 185 TYR D CZ  1 
ATOM   6976  O OH  . TYR D  4  185 ? 0.553   19.555  96.747  1.00 126.21 ? 185 TYR D OH  1 
ATOM   6977  N N   . HIS D  4  186 ? -1.079  16.861  101.623 1.00 129.03 ? 186 HIS D N   1 
ATOM   6978  C CA  . HIS D  4  186 ? 0.022   17.603  102.239 1.00 134.26 ? 186 HIS D CA  1 
ATOM   6979  C C   . HIS D  4  186 ? 1.186   17.707  101.284 1.00 135.77 ? 186 HIS D C   1 
ATOM   6980  O O   . HIS D  4  186 ? 1.219   17.022  100.257 1.00 133.47 ? 186 HIS D O   1 
ATOM   6981  C CB  . HIS D  4  186 ? 0.426   16.997  103.585 1.00 137.86 ? 186 HIS D CB  1 
ATOM   6982  C CG  . HIS D  4  186 ? 1.423   15.869  103.483 1.00 141.64 ? 186 HIS D CG  1 
ATOM   6983  N ND1 . HIS D  4  186 ? 1.071   14.620  103.131 1.00 143.09 ? 186 HIS D ND1 1 
ATOM   6984  C CD2 . HIS D  4  186 ? 2.796   15.840  103.719 1.00 143.89 ? 186 HIS D CD2 1 
ATOM   6985  C CE1 . HIS D  4  186 ? 2.162   13.831  103.133 1.00 143.61 ? 186 HIS D CE1 1 
ATOM   6986  N NE2 . HIS D  4  186 ? 3.217   14.579  103.492 1.00 145.33 ? 186 HIS D NE2 1 
ATOM   6987  N N   . LYS D  4  187 ? 2.150   18.563  101.619 1.00 138.33 ? 187 LYS D N   1 
ATOM   6988  C CA  . LYS D  4  187 ? 3.231   18.950  100.702 1.00 137.67 ? 187 LYS D CA  1 
ATOM   6989  C C   . LYS D  4  187 ? 4.171   17.819  100.270 1.00 135.77 ? 187 LYS D C   1 
ATOM   6990  O O   . LYS D  4  187 ? 4.651   17.812  99.134  1.00 133.24 ? 187 LYS D O   1 
ATOM   6991  C CB  . LYS D  4  187 ? 4.052   20.101  101.301 1.00 139.44 ? 187 LYS D CB  1 
ATOM   6992  C CG  . LYS D  4  187 ? 3.261   21.367  101.610 1.00 140.65 ? 187 LYS D CG  1 
ATOM   6993  C CD  . LYS D  4  187 ? 2.944   22.168  100.356 1.00 139.59 ? 187 LYS D CD  1 
ATOM   6994  C CE  . LYS D  4  187 ? 2.136   23.412  100.689 1.00 139.18 ? 187 LYS D CE  1 
ATOM   6995  N NZ  . LYS D  4  187 ? 1.813   24.207  99.472  1.00 135.86 ? 187 LYS D NZ  1 
ATOM   6996  N N   . SER D  4  188 ? 4.427   16.871  101.169 1.00 134.18 ? 188 SER D N   1 
ATOM   6997  C CA  . SER D  4  188 ? 5.448   15.844  100.942 1.00 130.83 ? 188 SER D CA  1 
ATOM   6998  C C   . SER D  4  188 ? 4.896   14.440  100.665 1.00 126.97 ? 188 SER D C   1 
ATOM   6999  O O   . SER D  4  188 ? 5.529   13.440  101.017 1.00 127.16 ? 188 SER D O   1 
ATOM   7000  C CB  . SER D  4  188 ? 6.428   15.807  102.123 1.00 132.07 ? 188 SER D CB  1 
ATOM   7001  O OG  . SER D  4  188 ? 7.051   17.065  102.314 1.00 132.29 ? 188 SER D OG  1 
ATOM   7002  N N   . MET D  4  189 ? 3.730   14.365  100.028 1.00 122.63 ? 189 MET D N   1 
ATOM   7003  C CA  . MET D  4  189 ? 3.136   13.073  99.672  1.00 120.75 ? 189 MET D CA  1 
ATOM   7004  C C   . MET D  4  189 ? 3.698   12.537  98.353  1.00 118.20 ? 189 MET D C   1 
ATOM   7005  O O   . MET D  4  189 ? 4.317   13.281  97.590  1.00 116.66 ? 189 MET D O   1 
ATOM   7006  C CB  . MET D  4  189 ? 1.602   13.156  99.639  1.00 118.56 ? 189 MET D CB  1 
ATOM   7007  C CG  . MET D  4  189 ? 1.015   14.056  98.560  1.00 115.22 ? 189 MET D CG  1 
ATOM   7008  S SD  . MET D  4  189 ? -0.773  14.259  98.712  1.00 110.85 ? 189 MET D SD  1 
ATOM   7009  C CE  . MET D  4  189 ? -1.362  12.610  98.332  1.00 111.71 ? 189 MET D CE  1 
ATOM   7010  N N   . THR D  4  190 ? 3.490   11.246  98.102  1.00 118.63 ? 190 THR D N   1 
ATOM   7011  C CA  . THR D  4  190 ? 3.984   10.597  96.884  1.00 117.60 ? 190 THR D CA  1 
ATOM   7012  C C   . THR D  4  190 ? 2.924   10.573  95.781  1.00 114.70 ? 190 THR D C   1 
ATOM   7013  O O   . THR D  4  190 ? 1.747   10.846  96.033  1.00 113.97 ? 190 THR D O   1 
ATOM   7014  C CB  . THR D  4  190 ? 4.479   9.159   97.157  1.00 120.65 ? 190 THR D CB  1 
ATOM   7015  O OG1 . THR D  4  190 ? 3.452   8.409   97.817  1.00 122.47 ? 190 THR D OG1 1 
ATOM   7016  C CG2 . THR D  4  190 ? 5.735   9.172   98.023  1.00 121.67 ? 190 THR D CG2 1 
ATOM   7017  N N   . LEU D  4  191 ? 3.356   10.248  94.562  1.00 112.80 ? 191 LEU D N   1 
ATOM   7018  C CA  . LEU D  4  191 ? 2.467   10.176  93.400  1.00 110.72 ? 191 LEU D CA  1 
ATOM   7019  C C   . LEU D  4  191 ? 1.485   9.008   93.502  1.00 111.75 ? 191 LEU D C   1 
ATOM   7020  O O   . LEU D  4  191 ? 0.339   9.120   93.064  1.00 112.45 ? 191 LEU D O   1 
ATOM   7021  C CB  . LEU D  4  191 ? 3.281   10.080  92.102  1.00 109.07 ? 191 LEU D CB  1 
ATOM   7022  C CG  . LEU D  4  191 ? 2.561   10.225  90.754  1.00 105.95 ? 191 LEU D CG  1 
ATOM   7023  C CD1 . LEU D  4  191 ? 2.088   11.653  90.517  1.00 105.00 ? 191 LEU D CD1 1 
ATOM   7024  C CD2 . LEU D  4  191 ? 3.466   9.769   89.619  1.00 103.61 ? 191 LEU D CD2 1 
ATOM   7025  N N   . LYS D  4  192 ? 1.942   7.897   94.079  1.00 113.01 ? 192 LYS D N   1 
ATOM   7026  C CA  . LYS D  4  192 ? 1.092   6.727   94.310  1.00 113.57 ? 192 LYS D CA  1 
ATOM   7027  C C   . LYS D  4  192 ? -0.024  7.026   95.309  1.00 114.54 ? 192 LYS D C   1 
ATOM   7028  O O   . LYS D  4  192 ? -1.134  6.507   95.178  1.00 115.51 ? 192 LYS D O   1 
ATOM   7029  C CB  . LYS D  4  192 ? 1.922   5.535   94.791  1.00 114.94 ? 192 LYS D CB  1 
ATOM   7030  C CG  . LYS D  4  192 ? 2.684   4.817   93.690  1.00 115.34 ? 192 LYS D CG  1 
ATOM   7031  C CD  . LYS D  4  192 ? 3.329   3.546   94.216  1.00 117.27 ? 192 LYS D CD  1 
ATOM   7032  C CE  . LYS D  4  192 ? 3.999   2.763   93.100  1.00 117.77 ? 192 LYS D CE  1 
ATOM   7033  N NZ  . LYS D  4  192 ? 4.601   1.498   93.603  1.00 119.25 ? 192 LYS D NZ  1 
ATOM   7034  N N   . GLU D  4  193 ? 0.282   7.861   96.301  1.00 116.22 ? 193 GLU D N   1 
ATOM   7035  C CA  . GLU D  4  193 ? -0.708  8.320   97.274  1.00 119.17 ? 193 GLU D CA  1 
ATOM   7036  C C   . GLU D  4  193 ? -1.676  9.325   96.655  1.00 118.46 ? 193 GLU D C   1 
ATOM   7037  O O   . GLU D  4  193 ? -2.837  9.403   97.058  1.00 118.59 ? 193 GLU D O   1 
ATOM   7038  C CB  . GLU D  4  193 ? -0.022  8.939   98.495  1.00 123.70 ? 193 GLU D CB  1 
ATOM   7039  C CG  . GLU D  4  193 ? 0.576   7.926   99.461  1.00 128.54 ? 193 GLU D CG  1 
ATOM   7040  C CD  . GLU D  4  193 ? 1.295   8.576   100.630 1.00 131.74 ? 193 GLU D CD  1 
ATOM   7041  O OE1 . GLU D  4  193 ? 0.773   9.566   101.187 1.00 131.57 ? 193 GLU D OE1 1 
ATOM   7042  O OE2 . GLU D  4  193 ? 2.384   8.088   101.000 1.00 131.22 ? 193 GLU D OE2 1 
ATOM   7043  N N   . ALA D  4  194 ? -1.187  10.090  95.678  1.00 117.93 ? 194 ALA D N   1 
ATOM   7044  C CA  . ALA D  4  194 ? -1.999  11.080  94.970  1.00 117.79 ? 194 ALA D CA  1 
ATOM   7045  C C   . ALA D  4  194 ? -3.047  10.426  94.072  1.00 118.35 ? 194 ALA D C   1 
ATOM   7046  O O   . ALA D  4  194 ? -4.171  10.919  93.964  1.00 116.46 ? 194 ALA D O   1 
ATOM   7047  C CB  . ALA D  4  194 ? -1.112  12.017  94.165  1.00 116.88 ? 194 ALA D CB  1 
ATOM   7048  N N   . ILE D  4  195 ? -2.670  9.321   93.431  1.00 119.55 ? 195 ILE D N   1 
ATOM   7049  C CA  . ILE D  4  195 ? -3.592  8.542   92.603  1.00 118.81 ? 195 ILE D CA  1 
ATOM   7050  C C   . ILE D  4  195 ? -4.584  7.787   93.492  1.00 119.84 ? 195 ILE D C   1 
ATOM   7051  O O   . ILE D  4  195 ? -5.776  7.720   93.184  1.00 118.51 ? 195 ILE D O   1 
ATOM   7052  C CB  . ILE D  4  195 ? -2.840  7.564   91.665  1.00 117.71 ? 195 ILE D CB  1 
ATOM   7053  C CG1 . ILE D  4  195 ? -1.869  8.330   90.756  1.00 113.88 ? 195 ILE D CG1 1 
ATOM   7054  C CG2 . ILE D  4  195 ? -3.819  6.757   90.818  1.00 118.25 ? 195 ILE D CG2 1 
ATOM   7055  C CD1 . ILE D  4  195 ? -0.740  7.489   90.196  1.00 111.50 ? 195 ILE D CD1 1 
ATOM   7056  N N   . LYS D  4  196 ? -4.084  7.239   94.599  1.00 121.43 ? 196 LYS D N   1 
ATOM   7057  C CA  . LYS D  4  196 ? -4.906  6.504   95.562  1.00 123.39 ? 196 LYS D CA  1 
ATOM   7058  C C   . LYS D  4  196 ? -5.977  7.395   96.193  1.00 121.59 ? 196 LYS D C   1 
ATOM   7059  O O   . LYS D  4  196 ? -7.151  7.024   96.226  1.00 122.05 ? 196 LYS D O   1 
ATOM   7060  C CB  . LYS D  4  196 ? -4.026  5.870   96.646  1.00 127.74 ? 196 LYS D CB  1 
ATOM   7061  C CG  . LYS D  4  196 ? -4.768  4.987   97.639  1.00 132.75 ? 196 LYS D CG  1 
ATOM   7062  C CD  . LYS D  4  196 ? -3.843  4.519   98.753  1.00 138.98 ? 196 LYS D CD  1 
ATOM   7063  C CE  . LYS D  4  196 ? -4.606  3.821   99.868  1.00 142.55 ? 196 LYS D CE  1 
ATOM   7064  N NZ  . LYS D  4  196 ? -5.139  2.493   99.455  1.00 143.88 ? 196 LYS D NZ  1 
ATOM   7065  N N   . SER D  4  197 ? -5.566  8.567   96.678  1.00 118.80 ? 197 SER D N   1 
ATOM   7066  C CA  . SER D  4  197 ? -6.472  9.509   97.340  1.00 117.47 ? 197 SER D CA  1 
ATOM   7067  C C   . SER D  4  197 ? -7.552  10.045  96.403  1.00 117.27 ? 197 SER D C   1 
ATOM   7068  O O   . SER D  4  197 ? -8.693  10.249  96.820  1.00 116.12 ? 197 SER D O   1 
ATOM   7069  C CB  . SER D  4  197 ? -5.690  10.675  97.951  1.00 115.91 ? 197 SER D CB  1 
ATOM   7070  O OG  . SER D  4  197 ? -4.756  10.216  98.911  1.00 117.49 ? 197 SER D OG  1 
ATOM   7071  N N   . SER D  4  198 ? -7.184  10.266  95.142  1.00 116.18 ? 198 SER D N   1 
ATOM   7072  C CA  . SER D  4  198 ? -8.107  10.790  94.136  1.00 116.70 ? 198 SER D CA  1 
ATOM   7073  C C   . SER D  4  198 ? -9.223  9.804   93.791  1.00 117.75 ? 198 SER D C   1 
ATOM   7074  O O   . SER D  4  198 ? -10.348 10.215  93.509  1.00 118.71 ? 198 SER D O   1 
ATOM   7075  C CB  . SER D  4  198 ? -7.352  11.195  92.867  1.00 114.93 ? 198 SER D CB  1 
ATOM   7076  O OG  . SER D  4  198 ? -6.683  10.086  92.293  1.00 118.12 ? 198 SER D OG  1 
ATOM   7077  N N   . LEU D  4  199 ? -8.905  8.511   93.821  1.00 117.84 ? 199 LEU D N   1 
ATOM   7078  C CA  . LEU D  4  199 ? -9.870  7.461   93.488  1.00 118.39 ? 199 LEU D CA  1 
ATOM   7079  C C   . LEU D  4  199 ? -10.877 7.194   94.608  1.00 119.44 ? 199 LEU D C   1 
ATOM   7080  O O   . LEU D  4  199 ? -12.038 6.878   94.337  1.00 119.71 ? 199 LEU D O   1 
ATOM   7081  C CB  . LEU D  4  199 ? -9.153  6.163   93.094  1.00 115.65 ? 199 LEU D CB  1 
ATOM   7082  C CG  . LEU D  4  199 ? -8.319  6.155   91.806  1.00 112.38 ? 199 LEU D CG  1 
ATOM   7083  C CD1 . LEU D  4  199 ? -7.511  4.871   91.694  1.00 112.16 ? 199 LEU D CD1 1 
ATOM   7084  C CD2 . LEU D  4  199 ? -9.178  6.364   90.566  1.00 108.65 ? 199 LEU D CD2 1 
ATOM   7085  N N   . ILE D  4  200 ? -10.429 7.316   95.858  1.00 118.99 ? 200 ILE D N   1 
ATOM   7086  C CA  . ILE D  4  200 ? -11.298 7.123   97.025  1.00 119.71 ? 200 ILE D CA  1 
ATOM   7087  C C   . ILE D  4  200 ? -12.325 8.254   97.130  1.00 116.05 ? 200 ILE D C   1 
ATOM   7088  O O   . ILE D  4  200 ? -13.483 8.022   97.483  1.00 117.59 ? 200 ILE D O   1 
ATOM   7089  C CB  . ILE D  4  200 ? -10.490 7.003   98.342  1.00 121.73 ? 200 ILE D CB  1 
ATOM   7090  C CG1 . ILE D  4  200 ? -9.418  5.915   98.224  1.00 121.45 ? 200 ILE D CG1 1 
ATOM   7091  C CG2 . ILE D  4  200 ? -11.410 6.689   99.518  1.00 123.11 ? 200 ILE D CG2 1 
ATOM   7092  C CD1 . ILE D  4  200 ? -8.315  6.006   99.260  1.00 121.66 ? 200 ILE D CD1 1 
ATOM   7093  N N   . ILE D  4  201 ? -11.894 9.473   96.812  1.00 109.79 ? 201 ILE D N   1 
ATOM   7094  C CA  . ILE D  4  201 ? -12.779 10.640  96.798  1.00 104.72 ? 201 ILE D CA  1 
ATOM   7095  C C   . ILE D  4  201 ? -13.715 10.597  95.585  1.00 106.02 ? 201 ILE D C   1 
ATOM   7096  O O   . ILE D  4  201 ? -14.858 11.057  95.657  1.00 105.80 ? 201 ILE D O   1 
ATOM   7097  C CB  . ILE D  4  201 ? -11.973 11.963  96.842  1.00 99.51  ? 201 ILE D CB  1 
ATOM   7098  C CG1 . ILE D  4  201 ? -11.155 12.037  98.137  1.00 100.01 ? 201 ILE D CG1 1 
ATOM   7099  C CG2 . ILE D  4  201 ? -12.892 13.175  96.733  1.00 99.66  ? 201 ILE D CG2 1 
ATOM   7100  C CD1 . ILE D  4  201 ? -10.072 13.094  98.147  1.00 100.11 ? 201 ILE D CD1 1 
ATOM   7101  N N   . LEU D  4  202 ? -13.227 10.023  94.486  1.00 107.50 ? 202 LEU D N   1 
ATOM   7102  C CA  . LEU D  4  202 ? -13.991 9.925   93.242  1.00 110.15 ? 202 LEU D CA  1 
ATOM   7103  C C   . LEU D  4  202 ? -15.186 8.973   93.345  1.00 114.45 ? 202 LEU D C   1 
ATOM   7104  O O   . LEU D  4  202 ? -16.230 9.225   92.744  1.00 115.16 ? 202 LEU D O   1 
ATOM   7105  C CB  . LEU D  4  202 ? -13.077 9.519   92.079  1.00 110.11 ? 202 LEU D CB  1 
ATOM   7106  C CG  . LEU D  4  202 ? -13.535 9.756   90.635  1.00 108.50 ? 202 LEU D CG  1 
ATOM   7107  C CD1 . LEU D  4  202 ? -13.713 11.236  90.322  1.00 106.22 ? 202 LEU D CD1 1 
ATOM   7108  C CD2 . LEU D  4  202 ? -12.543 9.128   89.668  1.00 106.76 ? 202 LEU D CD2 1 
ATOM   7109  N N   . LYS D  4  203 ? -15.032 7.887   94.102  1.00 118.90 ? 203 LYS D N   1 
ATOM   7110  C CA  . LYS D  4  203 ? -16.126 6.929   94.303  1.00 123.53 ? 203 LYS D CA  1 
ATOM   7111  C C   . LYS D  4  203 ? -17.179 7.437   95.293  1.00 125.87 ? 203 LYS D C   1 
ATOM   7112  O O   . LYS D  4  203 ? -18.329 6.992   95.267  1.00 128.30 ? 203 LYS D O   1 
ATOM   7113  C CB  . LYS D  4  203 ? -15.601 5.548   94.728  1.00 125.10 ? 203 LYS D CB  1 
ATOM   7114  C CG  . LYS D  4  203 ? -14.912 5.498   96.087  1.00 127.22 ? 203 LYS D CG  1 
ATOM   7115  C CD  . LYS D  4  203 ? -14.926 4.102   96.698  1.00 129.93 ? 203 LYS D CD  1 
ATOM   7116  C CE  . LYS D  4  203 ? -13.796 3.223   96.180  1.00 130.65 ? 203 LYS D CE  1 
ATOM   7117  N NZ  . LYS D  4  203 ? -14.126 2.572   94.881  1.00 129.25 ? 203 LYS D NZ  1 
ATOM   7118  N N   . GLN D  4  204 ? -16.776 8.367   96.158  1.00 125.86 ? 204 GLN D N   1 
ATOM   7119  C CA  . GLN D  4  204 ? -17.671 8.962   97.151  1.00 127.55 ? 204 GLN D CA  1 
ATOM   7120  C C   . GLN D  4  204 ? -18.660 9.940   96.520  1.00 124.22 ? 204 GLN D C   1 
ATOM   7121  O O   . GLN D  4  204 ? -19.805 10.047  96.964  1.00 121.92 ? 204 GLN D O   1 
ATOM   7122  C CB  . GLN D  4  204 ? -16.866 9.668   98.246  1.00 132.42 ? 204 GLN D CB  1 
ATOM   7123  C CG  . GLN D  4  204 ? -16.213 8.729   99.251  1.00 138.53 ? 204 GLN D CG  1 
ATOM   7124  C CD  . GLN D  4  204 ? -15.254 9.436   100.194 1.00 143.82 ? 204 GLN D CD  1 
ATOM   7125  O OE1 . GLN D  4  204 ? -14.176 8.924   100.495 1.00 144.71 ? 204 GLN D OE1 1 
ATOM   7126  N NE2 . GLN D  4  204 ? -15.642 10.617  100.668 1.00 145.52 ? 204 GLN D NE2 1 
ATOM   7127  N N   . VAL D  4  205 ? -18.210 10.645  95.484  1.00 117.54 ? 205 VAL D N   1 
ATOM   7128  C CA  . VAL D  4  205 ? -19.024 11.663  94.812  1.00 112.06 ? 205 VAL D CA  1 
ATOM   7129  C C   . VAL D  4  205 ? -19.861 11.100  93.655  1.00 110.82 ? 205 VAL D C   1 
ATOM   7130  O O   . VAL D  4  205 ? -20.805 11.746  93.193  1.00 110.69 ? 205 VAL D O   1 
ATOM   7131  C CB  . VAL D  4  205 ? -18.171 12.862  94.327  1.00 107.68 ? 205 VAL D CB  1 
ATOM   7132  C CG1 . VAL D  4  205 ? -17.627 13.646  95.514  1.00 107.89 ? 205 VAL D CG1 1 
ATOM   7133  C CG2 . VAL D  4  205 ? -17.038 12.406  93.415  1.00 105.84 ? 205 VAL D CG2 1 
ATOM   7134  N N   . MET D  4  206 ? -19.510 9.898   93.201  1.00 111.57 ? 206 MET D N   1 
ATOM   7135  C CA  . MET D  4  206 ? -20.222 9.231   92.110  1.00 114.12 ? 206 MET D CA  1 
ATOM   7136  C C   . MET D  4  206 ? -21.587 8.696   92.536  1.00 118.94 ? 206 MET D C   1 
ATOM   7137  O O   . MET D  4  206 ? -21.812 8.395   93.711  1.00 122.50 ? 206 MET D O   1 
ATOM   7138  C CB  . MET D  4  206 ? -19.389 8.076   91.553  1.00 114.65 ? 206 MET D CB  1 
ATOM   7139  C CG  . MET D  4  206 ? -18.377 8.465   90.491  1.00 112.11 ? 206 MET D CG  1 
ATOM   7140  S SD  . MET D  4  206 ? -17.628 6.997   89.760  1.00 111.75 ? 206 MET D SD  1 
ATOM   7141  C CE  . MET D  4  206 ? -16.164 7.695   89.013  1.00 106.03 ? 206 MET D CE  1 
ATOM   7142  N N   . GLU D  4  207 ? -22.489 8.580   91.563  1.00 121.23 ? 207 GLU D N   1 
ATOM   7143  C CA  . GLU D  4  207 ? -23.784 7.935   91.761  1.00 123.95 ? 207 GLU D CA  1 
ATOM   7144  C C   . GLU D  4  207 ? -23.697 6.457   91.384  1.00 122.85 ? 207 GLU D C   1 
ATOM   7145  O O   . GLU D  4  207 ? -24.349 5.610   91.997  1.00 124.07 ? 207 GLU D O   1 
ATOM   7146  C CB  . GLU D  4  207 ? -24.869 8.631   90.932  1.00 127.58 ? 207 GLU D CB  1 
ATOM   7147  C CG  . GLU D  4  207 ? -25.294 9.995   91.461  1.00 132.21 ? 207 GLU D CG  1 
ATOM   7148  C CD  . GLU D  4  207 ? -26.169 9.910   92.701  1.00 137.79 ? 207 GLU D CD  1 
ATOM   7149  O OE1 . GLU D  4  207 ? -25.916 10.671  93.659  1.00 139.61 ? 207 GLU D OE1 1 
ATOM   7150  O OE2 . GLU D  4  207 ? -27.109 9.087   92.721  1.00 139.35 ? 207 GLU D OE2 1 
ATOM   7151  N N   . GLU D  4  208 ? -22.883 6.166   90.372  1.00 122.97 ? 208 GLU D N   1 
ATOM   7152  C CA  . GLU D  4  208 ? -22.650 4.804   89.903  1.00 125.28 ? 208 GLU D CA  1 
ATOM   7153  C C   . GLU D  4  208 ? -21.292 4.327   90.415  1.00 124.95 ? 208 GLU D C   1 
ATOM   7154  O O   . GLU D  4  208 ? -20.336 5.104   90.460  1.00 122.18 ? 208 GLU D O   1 
ATOM   7155  C CB  . GLU D  4  208 ? -22.697 4.770   88.373  1.00 129.46 ? 208 GLU D CB  1 
ATOM   7156  C CG  . GLU D  4  208 ? -23.311 3.513   87.778  1.00 140.67 ? 208 GLU D CG  1 
ATOM   7157  C CD  . GLU D  4  208 ? -22.277 2.502   87.321  1.00 149.18 ? 208 GLU D CD  1 
ATOM   7158  O OE1 . GLU D  4  208 ? -22.189 2.259   86.099  1.00 154.72 ? 208 GLU D OE1 1 
ATOM   7159  O OE2 . GLU D  4  208 ? -21.553 1.952   88.176  1.00 147.26 ? 208 GLU D OE2 1 
ATOM   7160  N N   . LYS D  4  209 ? -21.214 3.054   90.804  1.00 127.93 ? 209 LYS D N   1 
ATOM   7161  C CA  . LYS D  4  209 ? -19.997 2.489   91.406  1.00 128.46 ? 209 LYS D CA  1 
ATOM   7162  C C   . LYS D  4  209 ? -18.778 2.534   90.478  1.00 123.20 ? 209 LYS D C   1 
ATOM   7163  O O   . LYS D  4  209 ? -18.909 2.431   89.256  1.00 124.11 ? 209 LYS D O   1 
ATOM   7164  C CB  . LYS D  4  209 ? -20.237 1.062   91.931  1.00 133.97 ? 209 LYS D CB  1 
ATOM   7165  C CG  . LYS D  4  209 ? -20.617 0.019   90.885  1.00 140.31 ? 209 LYS D CG  1 
ATOM   7166  C CD  . LYS D  4  209 ? -22.125 -0.139  90.755  1.00 145.89 ? 209 LYS D CD  1 
ATOM   7167  C CE  . LYS D  4  209 ? -22.490 -1.295  89.835  1.00 148.19 ? 209 LYS D CE  1 
ATOM   7168  N NZ  . LYS D  4  209 ? -22.128 -1.042  88.412  1.00 149.07 ? 209 LYS D NZ  1 
ATOM   7169  N N   . LEU D  4  210 ? -17.598 2.692   91.076  1.00 117.20 ? 210 LEU D N   1 
ATOM   7170  C CA  . LEU D  4  210 ? -16.352 2.865   90.329  1.00 110.76 ? 210 LEU D CA  1 
ATOM   7171  C C   . LEU D  4  210 ? -15.896 1.570   89.657  1.00 109.66 ? 210 LEU D C   1 
ATOM   7172  O O   . LEU D  4  210 ? -15.824 0.517   90.293  1.00 111.31 ? 210 LEU D O   1 
ATOM   7173  C CB  . LEU D  4  210 ? -15.251 3.417   91.246  1.00 108.01 ? 210 LEU D CB  1 
ATOM   7174  C CG  . LEU D  4  210 ? -14.090 4.192   90.610  1.00 105.41 ? 210 LEU D CG  1 
ATOM   7175  C CD1 . LEU D  4  210 ? -13.533 5.225   91.578  1.00 104.93 ? 210 LEU D CD1 1 
ATOM   7176  C CD2 . LEU D  4  210 ? -12.985 3.265   90.123  1.00 105.70 ? 210 LEU D CD2 1 
ATOM   7177  N N   . ASN D  4  211 ? -15.589 1.670   88.366  1.00 108.29 ? 211 ASN D N   1 
ATOM   7178  C CA  . ASN D  4  211 ? -15.145 0.531   87.567  1.00 110.47 ? 211 ASN D CA  1 
ATOM   7179  C C   . ASN D  4  211 ? -13.985 0.918   86.648  1.00 109.52 ? 211 ASN D C   1 
ATOM   7180  O O   . ASN D  4  211 ? -13.710 2.104   86.456  1.00 107.56 ? 211 ASN D O   1 
ATOM   7181  C CB  . ASN D  4  211 ? -16.318 -0.027  86.751  1.00 114.35 ? 211 ASN D CB  1 
ATOM   7182  C CG  . ASN D  4  211 ? -16.080 -1.448  86.271  1.00 119.46 ? 211 ASN D CG  1 
ATOM   7183  O OD1 . ASN D  4  211 ? -16.154 -1.729  85.075  1.00 121.45 ? 211 ASN D OD1 1 
ATOM   7184  N ND2 . ASN D  4  211 ? -15.795 -2.353  87.202  1.00 123.32 ? 211 ASN D ND2 1 
ATOM   7185  N N   . ALA D  4  212 ? -13.309 -0.087  86.092  1.00 111.34 ? 212 ALA D N   1 
ATOM   7186  C CA  . ALA D  4  212 ? -12.183 0.126   85.178  1.00 110.83 ? 212 ALA D CA  1 
ATOM   7187  C C   . ALA D  4  212 ? -12.601 0.829   83.884  1.00 110.65 ? 212 ALA D C   1 
ATOM   7188  O O   . ALA D  4  212 ? -11.860 1.664   83.360  1.00 111.65 ? 212 ALA D O   1 
ATOM   7189  C CB  . ALA D  4  212 ? -11.492 -1.195  84.870  1.00 112.90 ? 212 ALA D CB  1 
ATOM   7190  N N   . THR D  4  213 ? -13.785 0.487   83.380  1.00 111.17 ? 213 THR D N   1 
ATOM   7191  C CA  . THR D  4  213 ? -14.340 1.116   82.178  1.00 111.20 ? 213 THR D CA  1 
ATOM   7192  C C   . THR D  4  213 ? -15.333 2.226   82.544  1.00 110.47 ? 213 THR D C   1 
ATOM   7193  O O   . THR D  4  213 ? -16.373 2.390   81.898  1.00 111.60 ? 213 THR D O   1 
ATOM   7194  C CB  . THR D  4  213 ? -15.016 0.083   81.249  1.00 112.66 ? 213 THR D CB  1 
ATOM   7195  O OG1 . THR D  4  213 ? -15.974 -0.682  81.991  1.00 114.07 ? 213 THR D OG1 1 
ATOM   7196  C CG2 . THR D  4  213 ? -13.983 -0.855  80.638  1.00 114.43 ? 213 THR D CG2 1 
ATOM   7197  N N   . ASN D  4  214 ? -14.992 2.989   83.580  1.00 107.90 ? 214 ASN D N   1 
ATOM   7198  C CA  . ASN D  4  214 ? -15.852 4.050   84.098  1.00 105.80 ? 214 ASN D CA  1 
ATOM   7199  C C   . ASN D  4  214 ? -15.061 5.319   84.417  1.00 102.57 ? 214 ASN D C   1 
ATOM   7200  O O   . ASN D  4  214 ? -15.633 6.405   84.533  1.00 102.21 ? 214 ASN D O   1 
ATOM   7201  C CB  . ASN D  4  214 ? -16.598 3.554   85.344  1.00 107.96 ? 214 ASN D CB  1 
ATOM   7202  C CG  . ASN D  4  214 ? -17.761 4.450   85.731  1.00 110.37 ? 214 ASN D CG  1 
ATOM   7203  O OD1 . ASN D  4  214 ? -18.902 4.207   85.337  1.00 114.13 ? 214 ASN D OD1 1 
ATOM   7204  N ND2 . ASN D  4  214 ? -17.478 5.491   86.507  1.00 110.26 ? 214 ASN D ND2 1 
ATOM   7205  N N   . ILE D  4  215 ? -13.744 5.172   84.548  1.00 100.54 ? 215 ILE D N   1 
ATOM   7206  C CA  . ILE D  4  215 ? -12.863 6.278   84.932  1.00 98.77  ? 215 ILE D CA  1 
ATOM   7207  C C   . ILE D  4  215 ? -11.737 6.525   83.926  1.00 98.80  ? 215 ILE D C   1 
ATOM   7208  O O   . ILE D  4  215 ? -11.435 5.671   83.089  1.00 97.70  ? 215 ILE D O   1 
ATOM   7209  C CB  . ILE D  4  215 ? -12.243 6.057   86.333  1.00 98.09  ? 215 ILE D CB  1 
ATOM   7210  C CG1 . ILE D  4  215 ? -11.520 4.705   86.404  1.00 99.87  ? 215 ILE D CG1 1 
ATOM   7211  C CG2 . ILE D  4  215 ? -13.310 6.171   87.413  1.00 99.35  ? 215 ILE D CG2 1 
ATOM   7212  C CD1 . ILE D  4  215 ? -10.473 4.615   87.494  1.00 101.75 ? 215 ILE D CD1 1 
ATOM   7213  N N   . GLU D  4  216 ? -11.129 7.706   84.022  1.00 100.22 ? 216 GLU D N   1 
ATOM   7214  C CA  . GLU D  4  216 ? -9.938  8.049   83.248  1.00 103.20 ? 216 GLU D CA  1 
ATOM   7215  C C   . GLU D  4  216 ? -8.842  8.585   84.162  1.00 101.71 ? 216 GLU D C   1 
ATOM   7216  O O   . GLU D  4  216 ? -9.068  9.518   84.937  1.00 100.12 ? 216 GLU D O   1 
ATOM   7217  C CB  . GLU D  4  216 ? -10.266 9.076   82.163  1.00 106.42 ? 216 GLU D CB  1 
ATOM   7218  C CG  . GLU D  4  216 ? -10.785 8.476   80.868  1.00 112.76 ? 216 GLU D CG  1 
ATOM   7219  C CD  . GLU D  4  216 ? -10.975 9.513   79.776  1.00 116.38 ? 216 GLU D CD  1 
ATOM   7220  O OE1 . GLU D  4  216 ? -10.350 9.368   78.704  1.00 116.77 ? 216 GLU D OE1 1 
ATOM   7221  O OE2 . GLU D  4  216 ? -11.742 10.477  79.989  1.00 113.19 ? 216 GLU D OE2 1 
ATOM   7222  N N   . LEU D  4  217 ? -7.659  7.983   84.068  1.00 100.92 ? 217 LEU D N   1 
ATOM   7223  C CA  . LEU D  4  217 ? -6.509  8.399   84.864  1.00 100.50 ? 217 LEU D CA  1 
ATOM   7224  C C   . LEU D  4  217 ? -5.343  8.749   83.947  1.00 98.50  ? 217 LEU D C   1 
ATOM   7225  O O   . LEU D  4  217 ? -5.005  7.986   83.038  1.00 98.78  ? 217 LEU D O   1 
ATOM   7226  C CB  . LEU D  4  217 ? -6.105  7.287   85.845  1.00 102.61 ? 217 LEU D CB  1 
ATOM   7227  C CG  . LEU D  4  217 ? -5.554  7.591   87.251  1.00 104.13 ? 217 LEU D CG  1 
ATOM   7228  C CD1 . LEU D  4  217 ? -4.250  8.380   87.235  1.00 102.27 ? 217 LEU D CD1 1 
ATOM   7229  C CD2 . LEU D  4  217 ? -6.592  8.280   88.129  1.00 103.82 ? 217 LEU D CD2 1 
ATOM   7230  N N   . ALA D  4  218 ? -4.740  9.911   84.186  1.00 97.48  ? 218 ALA D N   1 
ATOM   7231  C CA  . ALA D  4  218 ? -3.575  10.352  83.424  1.00 97.57  ? 218 ALA D CA  1 
ATOM   7232  C C   . ALA D  4  218 ? -2.561  11.049  84.325  1.00 99.33  ? 218 ALA D C   1 
ATOM   7233  O O   . ALA D  4  218 ? -2.916  11.938  85.103  1.00 99.27  ? 218 ALA D O   1 
ATOM   7234  C CB  . ALA D  4  218 ? -3.995  11.265  82.282  1.00 95.39  ? 218 ALA D CB  1 
ATOM   7235  N N   . THR D  4  219 ? -1.302  10.633  84.215  1.00 102.49 ? 219 THR D N   1 
ATOM   7236  C CA  . THR D  4  219 ? -0.224  11.192  85.031  1.00 104.80 ? 219 THR D CA  1 
ATOM   7237  C C   . THR D  4  219 ? 0.878   11.809  84.176  1.00 104.85 ? 219 THR D C   1 
ATOM   7238  O O   . THR D  4  219 ? 1.349   11.199  83.212  1.00 104.30 ? 219 THR D O   1 
ATOM   7239  C CB  . THR D  4  219 ? 0.401   10.139  85.971  1.00 106.73 ? 219 THR D CB  1 
ATOM   7240  O OG1 . THR D  4  219 ? 0.769   8.975   85.219  1.00 107.18 ? 219 THR D OG1 1 
ATOM   7241  C CG2 . THR D  4  219 ? -0.576  9.744   87.071  1.00 107.51 ? 219 THR D CG2 1 
ATOM   7242  N N   . VAL D  4  220 ? 1.272   13.027  84.536  1.00 106.74 ? 220 VAL D N   1 
ATOM   7243  C CA  . VAL D  4  220 ? 2.393   13.708  83.894  1.00 107.32 ? 220 VAL D CA  1 
ATOM   7244  C C   . VAL D  4  220 ? 3.493   13.913  84.931  1.00 108.09 ? 220 VAL D C   1 
ATOM   7245  O O   . VAL D  4  220 ? 3.314   14.653  85.899  1.00 107.74 ? 220 VAL D O   1 
ATOM   7246  C CB  . VAL D  4  220 ? 1.983   15.068  83.285  1.00 105.93 ? 220 VAL D CB  1 
ATOM   7247  C CG1 . VAL D  4  220 ? 3.148   15.681  82.523  1.00 100.42 ? 220 VAL D CG1 1 
ATOM   7248  C CG2 . VAL D  4  220 ? 0.779   14.912  82.367  1.00 104.37 ? 220 VAL D CG2 1 
ATOM   7249  N N   . GLN D  4  221 ? 4.624   13.246  84.721  1.00 107.61 ? 221 GLN D N   1 
ATOM   7250  C CA  . GLN D  4  221 ? 5.743   13.280  85.663  1.00 107.90 ? 221 GLN D CA  1 
ATOM   7251  C C   . GLN D  4  221 ? 7.038   13.755  84.989  1.00 105.06 ? 221 GLN D C   1 
ATOM   7252  O O   . GLN D  4  221 ? 7.153   13.685  83.765  1.00 104.64 ? 221 GLN D O   1 
ATOM   7253  C CB  . GLN D  4  221 ? 5.931   11.903  86.317  1.00 111.32 ? 221 GLN D CB  1 
ATOM   7254  C CG  . GLN D  4  221 ? 6.070   10.739  85.343  1.00 116.59 ? 221 GLN D CG  1 
ATOM   7255  C CD  . GLN D  4  221 ? 5.974   9.384   86.022  1.00 121.09 ? 221 GLN D CD  1 
ATOM   7256  O OE1 . GLN D  4  221 ? 5.170   8.539   85.628  1.00 123.25 ? 221 GLN D OE1 1 
ATOM   7257  N NE2 . GLN D  4  221 ? 6.792   9.170   87.048  1.00 121.45 ? 221 GLN D NE2 1 
ATOM   7258  N N   . PRO D  4  222 ? 8.011   14.254  85.785  1.00 102.90 ? 222 PRO D N   1 
ATOM   7259  C CA  . PRO D  4  222 ? 9.301   14.700  85.238  1.00 102.58 ? 222 PRO D CA  1 
ATOM   7260  C C   . PRO D  4  222 ? 10.098  13.599  84.533  1.00 105.78 ? 222 PRO D C   1 
ATOM   7261  O O   . PRO D  4  222 ? 10.969  13.901  83.714  1.00 106.35 ? 222 PRO D O   1 
ATOM   7262  C CB  . PRO D  4  222 ? 10.060  15.181  86.479  1.00 100.91 ? 222 PRO D CB  1 
ATOM   7263  C CG  . PRO D  4  222 ? 8.996   15.558  87.447  1.00 99.84  ? 222 PRO D CG  1 
ATOM   7264  C CD  . PRO D  4  222 ? 7.901   14.557  87.225  1.00 101.75 ? 222 PRO D CD  1 
ATOM   7265  N N   . GLY D  4  223 ? 9.798   12.341  84.852  1.00 109.16 ? 223 GLY D N   1 
ATOM   7266  C CA  . GLY D  4  223 ? 10.484  11.198  84.256  1.00 112.98 ? 223 GLY D CA  1 
ATOM   7267  C C   . GLY D  4  223 ? 10.104  10.952  82.807  1.00 115.45 ? 223 GLY D C   1 
ATOM   7268  O O   . GLY D  4  223 ? 10.948  11.045  81.913  1.00 114.96 ? 223 GLY D O   1 
ATOM   7269  N N   . GLN D  4  224 ? 8.829   10.643  82.579  1.00 117.38 ? 224 GLN D N   1 
ATOM   7270  C CA  . GLN D  4  224 ? 8.332   10.298  81.244  1.00 117.31 ? 224 GLN D CA  1 
ATOM   7271  C C   . GLN D  4  224 ? 7.298   11.299  80.713  1.00 112.92 ? 224 GLN D C   1 
ATOM   7272  O O   . GLN D  4  224 ? 6.958   12.271  81.387  1.00 110.29 ? 224 GLN D O   1 
ATOM   7273  C CB  . GLN D  4  224 ? 7.760   8.872   81.236  1.00 120.45 ? 224 GLN D CB  1 
ATOM   7274  C CG  . GLN D  4  224 ? 6.626   8.635   82.225  1.00 123.24 ? 224 GLN D CG  1 
ATOM   7275  C CD  . GLN D  4  224 ? 6.042   7.238   82.134  1.00 128.39 ? 224 GLN D CD  1 
ATOM   7276  O OE1 . GLN D  4  224 ? 6.114   6.462   83.086  1.00 130.54 ? 224 GLN D OE1 1 
ATOM   7277  N NE2 . GLN D  4  224 ? 5.460   6.909   80.985  1.00 129.52 ? 224 GLN D NE2 1 
ATOM   7278  N N   . ASN D  4  225 ? 6.807   11.047  79.501  1.00 109.09 ? 225 ASN D N   1 
ATOM   7279  C CA  . ASN D  4  225 ? 5.806   11.899  78.858  1.00 105.04 ? 225 ASN D CA  1 
ATOM   7280  C C   . ASN D  4  225 ? 4.395   11.694  79.417  1.00 104.44 ? 225 ASN D C   1 
ATOM   7281  O O   . ASN D  4  225 ? 4.209   10.989  80.413  1.00 106.13 ? 225 ASN D O   1 
ATOM   7282  C CB  . ASN D  4  225 ? 5.813   11.670  77.341  1.00 102.98 ? 225 ASN D CB  1 
ATOM   7283  C CG  . ASN D  4  225 ? 7.104   12.124  76.682  1.00 105.19 ? 225 ASN D CG  1 
ATOM   7284  O OD1 . ASN D  4  225 ? 7.693   13.137  77.063  1.00 107.73 ? 225 ASN D OD1 1 
ATOM   7285  N ND2 . ASN D  4  225 ? 7.543   11.378  75.675  1.00 106.43 ? 225 ASN D ND2 1 
ATOM   7286  N N   . PHE D  4  226 ? 3.410   12.322  78.773  1.00 100.78 ? 226 PHE D N   1 
ATOM   7287  C CA  . PHE D  4  226 ? 1.998   12.153  79.117  1.00 97.16  ? 226 PHE D CA  1 
ATOM   7288  C C   . PHE D  4  226 ? 1.589   10.691  78.955  1.00 97.26  ? 226 PHE D C   1 
ATOM   7289  O O   . PHE D  4  226 ? 1.785   10.096  77.892  1.00 99.36  ? 226 PHE D O   1 
ATOM   7290  C CB  . PHE D  4  226 ? 1.122   13.060  78.241  1.00 92.93  ? 226 PHE D CB  1 
ATOM   7291  C CG  . PHE D  4  226 ? -0.359  12.900  78.475  1.00 89.29  ? 226 PHE D CG  1 
ATOM   7292  C CD1 . PHE D  4  226 ? -0.998  13.602  79.493  1.00 88.06  ? 226 PHE D CD1 1 
ATOM   7293  C CD2 . PHE D  4  226 ? -1.119  12.060  77.666  1.00 87.64  ? 226 PHE D CD2 1 
ATOM   7294  C CE1 . PHE D  4  226 ? -2.361  13.460  79.707  1.00 86.73  ? 226 PHE D CE1 1 
ATOM   7295  C CE2 . PHE D  4  226 ? -2.483  11.914  77.875  1.00 86.31  ? 226 PHE D CE2 1 
ATOM   7296  C CZ  . PHE D  4  226 ? -3.105  12.615  78.896  1.00 86.96  ? 226 PHE D CZ  1 
ATOM   7297  N N   . HIS D  4  227 ? 1.027   10.122  80.018  1.00 96.78  ? 227 HIS D N   1 
ATOM   7298  C CA  . HIS D  4  227 ? 0.645   8.715   80.025  1.00 98.40  ? 227 HIS D CA  1 
ATOM   7299  C C   . HIS D  4  227 ? -0.815  8.530   80.319  1.00 97.79  ? 227 HIS D C   1 
ATOM   7300  O O   . HIS D  4  227 ? -1.336  9.071   81.296  1.00 96.72  ? 227 HIS D O   1 
ATOM   7301  C CB  . HIS D  4  227 ? 1.491   7.939   81.029  1.00 101.67 ? 227 HIS D CB  1 
ATOM   7302  C CG  . HIS D  4  227 ? 1.280   6.445   80.978  1.00 103.93 ? 227 HIS D CG  1 
ATOM   7303  N ND1 . HIS D  4  227 ? 0.367   5.818   81.741  1.00 104.95 ? 227 HIS D ND1 1 
ATOM   7304  C CD2 . HIS D  4  227 ? 1.901   5.458   80.215  1.00 106.67 ? 227 HIS D CD2 1 
ATOM   7305  C CE1 . HIS D  4  227 ? 0.401   4.497   81.483  1.00 108.26 ? 227 HIS D CE1 1 
ATOM   7306  N NE2 . HIS D  4  227 ? 1.340   4.279   80.549  1.00 109.39 ? 227 HIS D NE2 1 
ATOM   7307  N N   . MET D  4  228 ? -1.482  7.760   79.463  1.00 99.40  ? 228 MET D N   1 
ATOM   7308  C CA  . MET D  4  228 ? -2.881  7.400   79.660  1.00 100.42 ? 228 MET D CA  1 
ATOM   7309  C C   . MET D  4  228 ? -2.968  5.974   80.198  1.00 101.47 ? 228 MET D C   1 
ATOM   7310  O O   . MET D  4  228 ? -2.438  5.040   79.592  1.00 103.35 ? 228 MET D O   1 
ATOM   7311  C CB  . MET D  4  228 ? -3.660  7.531   78.347  1.00 102.79 ? 228 MET D CB  1 
ATOM   7312  C CG  . MET D  4  228 ? -5.169  7.373   78.485  1.00 106.25 ? 228 MET D CG  1 
ATOM   7313  S SD  . MET D  4  228 ? -5.977  8.752   79.323  1.00 108.21 ? 228 MET D SD  1 
ATOM   7314  C CE  . MET D  4  228 ? -5.881  10.024  78.065  1.00 104.83 ? 228 MET D CE  1 
ATOM   7315  N N   . PHE D  4  229 ? -3.631  5.820   81.342  1.00 100.58 ? 229 PHE D N   1 
ATOM   7316  C CA  . PHE D  4  229 ? -3.775  4.518   81.989  1.00 101.18 ? 229 PHE D CA  1 
ATOM   7317  C C   . PHE D  4  229 ? -4.775  3.624   81.260  1.00 101.31 ? 229 PHE D C   1 
ATOM   7318  O O   . PHE D  4  229 ? -5.953  3.968   81.126  1.00 98.32  ? 229 PHE D O   1 
ATOM   7319  C CB  . PHE D  4  229 ? -4.177  4.685   83.459  1.00 101.91 ? 229 PHE D CB  1 
ATOM   7320  C CG  . PHE D  4  229 ? -3.025  4.996   84.374  1.00 104.00 ? 229 PHE D CG  1 
ATOM   7321  C CD1 . PHE D  4  229 ? -2.568  6.302   84.525  1.00 104.93 ? 229 PHE D CD1 1 
ATOM   7322  C CD2 . PHE D  4  229 ? -2.401  3.984   85.095  1.00 105.79 ? 229 PHE D CD2 1 
ATOM   7323  C CE1 . PHE D  4  229 ? -1.507  6.589   85.370  1.00 107.31 ? 229 PHE D CE1 1 
ATOM   7324  C CE2 . PHE D  4  229 ? -1.340  4.265   85.943  1.00 108.28 ? 229 PHE D CE2 1 
ATOM   7325  C CZ  . PHE D  4  229 ? -0.892  5.569   86.080  1.00 108.34 ? 229 PHE D CZ  1 
ATOM   7326  N N   . THR D  4  230 ? -4.287  2.481   80.784  1.00 103.52 ? 230 THR D N   1 
ATOM   7327  C CA  . THR D  4  230 ? -5.125  1.483   80.120  1.00 106.86 ? 230 THR D CA  1 
ATOM   7328  C C   . THR D  4  230 ? -5.872  0.633   81.148  1.00 109.24 ? 230 THR D C   1 
ATOM   7329  O O   . THR D  4  230 ? -5.526  0.636   82.333  1.00 108.90 ? 230 THR D O   1 
ATOM   7330  C CB  . THR D  4  230 ? -4.302  0.566   79.189  1.00 107.11 ? 230 THR D CB  1 
ATOM   7331  O OG1 . THR D  4  230 ? -3.203  -0.001  79.914  1.00 107.24 ? 230 THR D OG1 1 
ATOM   7332  C CG2 . THR D  4  230 ? -3.770  1.345   77.990  1.00 107.30 ? 230 THR D CG2 1 
ATOM   7333  N N   . LYS D  4  231 ? -6.886  -0.096  80.682  1.00 112.60 ? 231 LYS D N   1 
ATOM   7334  C CA  . LYS D  4  231 ? -7.748  -0.919  81.537  1.00 115.58 ? 231 LYS D CA  1 
ATOM   7335  C C   . LYS D  4  231 ? -6.973  -1.879  82.446  1.00 115.93 ? 231 LYS D C   1 
ATOM   7336  O O   . LYS D  4  231 ? -7.369  -2.111  83.590  1.00 116.31 ? 231 LYS D O   1 
ATOM   7337  C CB  . LYS D  4  231 ? -8.752  -1.699  80.680  1.00 119.44 ? 231 LYS D CB  1 
ATOM   7338  C CG  . LYS D  4  231 ? -9.967  -2.218  81.439  1.00 122.44 ? 231 LYS D CG  1 
ATOM   7339  C CD  . LYS D  4  231 ? -10.881 -3.058  80.557  1.00 126.09 ? 231 LYS D CD  1 
ATOM   7340  C CE  . LYS D  4  231 ? -10.550 -4.544  80.624  1.00 128.68 ? 231 LYS D CE  1 
ATOM   7341  N NZ  . LYS D  4  231 ? -9.338  -4.914  79.841  1.00 127.88 ? 231 LYS D NZ  1 
ATOM   7342  N N   . GLU D  4  232 ? -5.871  -2.423  81.931  1.00 117.20 ? 232 GLU D N   1 
ATOM   7343  C CA  . GLU D  4  232 ? -5.048  -3.387  82.666  1.00 117.60 ? 232 GLU D CA  1 
ATOM   7344  C C   . GLU D  4  232 ? -4.312  -2.758  83.850  1.00 114.06 ? 232 GLU D C   1 
ATOM   7345  O O   . GLU D  4  232 ? -4.322  -3.308  84.953  1.00 112.70 ? 232 GLU D O   1 
ATOM   7346  C CB  . GLU D  4  232 ? -4.048  -4.077  81.729  1.00 122.48 ? 232 GLU D CB  1 
ATOM   7347  C CG  . GLU D  4  232 ? -4.656  -5.117  80.795  1.00 128.58 ? 232 GLU D CG  1 
ATOM   7348  C CD  . GLU D  4  232 ? -5.385  -4.509  79.607  1.00 131.96 ? 232 GLU D CD  1 
ATOM   7349  O OE1 . GLU D  4  232 ? -4.880  -3.524  79.025  1.00 128.74 ? 232 GLU D OE1 1 
ATOM   7350  O OE2 . GLU D  4  232 ? -6.464  -5.026  79.249  1.00 134.73 ? 232 GLU D OE2 1 
ATOM   7351  N N   . GLU D  4  233 ? -3.682  -1.608  83.615  1.00 111.51 ? 233 GLU D N   1 
ATOM   7352  C CA  . GLU D  4  233 ? -2.921  -0.913  84.658  1.00 109.42 ? 233 GLU D CA  1 
ATOM   7353  C C   . GLU D  4  233 ? -3.797  -0.045  85.564  1.00 106.99 ? 233 GLU D C   1 
ATOM   7354  O O   . GLU D  4  233 ? -3.346  0.412   86.618  1.00 106.68 ? 233 GLU D O   1 
ATOM   7355  C CB  . GLU D  4  233 ? -1.763  -0.103  84.056  1.00 108.25 ? 233 GLU D CB  1 
ATOM   7356  C CG  . GLU D  4  233 ? -2.157  0.893   82.976  1.00 108.18 ? 233 GLU D CG  1 
ATOM   7357  C CD  . GLU D  4  233 ? -0.964  1.420   82.197  1.00 108.99 ? 233 GLU D CD  1 
ATOM   7358  O OE1 . GLU D  4  233 ? -1.115  1.673   80.984  1.00 108.97 ? 233 GLU D OE1 1 
ATOM   7359  O OE2 . GLU D  4  233 ? 0.125   1.580   82.790  1.00 109.24 ? 233 GLU D OE2 1 
ATOM   7360  N N   . LEU D  4  234 ? -5.042  0.179   85.148  1.00 106.90 ? 234 LEU D N   1 
ATOM   7361  C CA  . LEU D  4  234 ? -6.034  0.840   85.994  1.00 107.42 ? 234 LEU D CA  1 
ATOM   7362  C C   . LEU D  4  234 ? -6.434  -0.067  87.152  1.00 107.82 ? 234 LEU D C   1 
ATOM   7363  O O   . LEU D  4  234 ? -6.505  0.377   88.296  1.00 108.12 ? 234 LEU D O   1 
ATOM   7364  C CB  . LEU D  4  234 ? -7.272  1.241   85.185  1.00 107.51 ? 234 LEU D CB  1 
ATOM   7365  C CG  . LEU D  4  234 ? -7.248  2.577   84.436  1.00 106.40 ? 234 LEU D CG  1 
ATOM   7366  C CD1 . LEU D  4  234 ? -8.340  2.614   83.378  1.00 107.55 ? 234 LEU D CD1 1 
ATOM   7367  C CD2 . LEU D  4  234 ? -7.386  3.754   85.391  1.00 104.50 ? 234 LEU D CD2 1 
ATOM   7368  N N   . GLU D  4  235 ? -6.670  -1.342  86.845  1.00 108.81 ? 235 GLU D N   1 
ATOM   7369  C CA  . GLU D  4  235 ? -7.079  -2.339  87.840  1.00 109.34 ? 235 GLU D CA  1 
ATOM   7370  C C   . GLU D  4  235 ? -6.001  -2.619  88.889  1.00 110.56 ? 235 GLU D C   1 
ATOM   7371  O O   . GLU D  4  235 ? -6.278  -3.229  89.925  1.00 112.08 ? 235 GLU D O   1 
ATOM   7372  C CB  . GLU D  4  235 ? -7.496  -3.640  87.150  1.00 110.99 ? 235 GLU D CB  1 
ATOM   7373  C CG  . GLU D  4  235 ? -8.759  -3.514  86.310  1.00 112.08 ? 235 GLU D CG  1 
ATOM   7374  C CD  . GLU D  4  235 ? -9.154  -4.807  85.623  1.00 114.60 ? 235 GLU D CD  1 
ATOM   7375  O OE1 . GLU D  4  235 ? -8.269  -5.640  85.332  1.00 115.11 ? 235 GLU D OE1 1 
ATOM   7376  O OE2 . GLU D  4  235 ? -10.362 -4.987  85.366  1.00 116.18 ? 235 GLU D OE2 1 
ATOM   7377  N N   . GLU D  4  236 ? -4.779  -2.167  88.613  1.00 111.80 ? 236 GLU D N   1 
ATOM   7378  C CA  . GLU D  4  236 ? -3.658  -2.309  89.538  1.00 115.09 ? 236 GLU D CA  1 
ATOM   7379  C C   . GLU D  4  236 ? -3.793  -1.363  90.732  1.00 113.80 ? 236 GLU D C   1 
ATOM   7380  O O   . GLU D  4  236 ? -3.303  -1.660  91.823  1.00 118.14 ? 236 GLU D O   1 
ATOM   7381  C CB  . GLU D  4  236 ? -2.332  -2.061  88.813  1.00 119.38 ? 236 GLU D CB  1 
ATOM   7382  C CG  . GLU D  4  236 ? -1.122  -2.720  89.463  1.00 125.87 ? 236 GLU D CG  1 
ATOM   7383  C CD  . GLU D  4  236 ? -1.135  -4.236  89.350  1.00 133.04 ? 236 GLU D CD  1 
ATOM   7384  O OE1 . GLU D  4  236 ? -1.553  -4.760  88.295  1.00 135.03 ? 236 GLU D OE1 1 
ATOM   7385  O OE2 . GLU D  4  236 ? -0.718  -4.907  90.318  1.00 137.27 ? 236 GLU D OE2 1 
ATOM   7386  N N   . VAL D  4  237 ? -4.452  -0.226  90.516  1.00 111.35 ? 237 VAL D N   1 
ATOM   7387  C CA  . VAL D  4  237 ? -4.715  0.737   91.591  1.00 111.04 ? 237 VAL D CA  1 
ATOM   7388  C C   . VAL D  4  237 ? -6.173  0.703   92.069  1.00 112.93 ? 237 VAL D C   1 
ATOM   7389  O O   . VAL D  4  237 ? -6.518  1.331   93.074  1.00 113.64 ? 237 VAL D O   1 
ATOM   7390  C CB  . VAL D  4  237 ? -4.293  2.183   91.216  1.00 108.23 ? 237 VAL D CB  1 
ATOM   7391  C CG1 . VAL D  4  237 ? -2.776  2.307   91.178  1.00 107.10 ? 237 VAL D CG1 1 
ATOM   7392  C CG2 . VAL D  4  237 ? -4.910  2.623   89.894  1.00 106.91 ? 237 VAL D CG2 1 
ATOM   7393  N N   . ILE D  4  238 ? -7.015  -0.036  91.347  1.00 115.98 ? 238 ILE D N   1 
ATOM   7394  C CA  . ILE D  4  238 ? -8.413  -0.241  91.740  1.00 118.52 ? 238 ILE D CA  1 
ATOM   7395  C C   . ILE D  4  238 ? -8.519  -1.358  92.782  1.00 125.46 ? 238 ILE D C   1 
ATOM   7396  O O   . ILE D  4  238 ? -9.415  -1.336  93.631  1.00 127.08 ? 238 ILE D O   1 
ATOM   7397  C CB  . ILE D  4  238 ? -9.326  -0.537  90.518  1.00 116.13 ? 238 ILE D CB  1 
ATOM   7398  C CG1 . ILE D  4  238 ? -9.279  0.609   89.493  1.00 114.58 ? 238 ILE D CG1 1 
ATOM   7399  C CG2 . ILE D  4  238 ? -10.768 -0.806  90.941  1.00 116.01 ? 238 ILE D CG2 1 
ATOM   7400  C CD1 . ILE D  4  238 ? -9.527  1.998   90.050  1.00 112.77 ? 238 ILE D CD1 1 
ATOM   7401  N N   . LYS D  4  239 ? -7.595  -2.318  92.721  1.00 129.08 ? 239 LYS D N   1 
ATOM   7402  C CA  . LYS D  4  239 ? -7.563  -3.438  93.671  1.00 134.31 ? 239 LYS D CA  1 
ATOM   7403  C C   . LYS D  4  239 ? -7.342  -2.983  95.119  1.00 138.51 ? 239 LYS D C   1 
ATOM   7404  O O   . LYS D  4  239 ? -7.756  -3.663  96.061  1.00 141.25 ? 239 LYS D O   1 
ATOM   7405  C CB  . LYS D  4  239 ? -6.531  -4.498  93.254  1.00 132.67 ? 239 LYS D CB  1 
ATOM   7406  C CG  . LYS D  4  239 ? -5.071  -4.079  93.363  1.00 132.30 ? 239 LYS D CG  1 
ATOM   7407  C CD  . LYS D  4  239 ? -4.144  -5.264  93.137  1.00 132.25 ? 239 LYS D CD  1 
ATOM   7408  C CE  . LYS D  4  239 ? -2.716  -4.958  93.565  1.00 132.48 ? 239 LYS D CE  1 
ATOM   7409  N NZ  . LYS D  4  239 ? -2.020  -4.025  92.637  1.00 130.53 ? 239 LYS D NZ  1 
ATOM   7410  N N   . ASP D  4  240 ? -6.687  -1.833  95.280  1.00 141.71 ? 240 ASP D N   1 
ATOM   7411  C CA  . ASP D  4  240 ? -6.578  -1.164  96.572  1.00 147.40 ? 240 ASP D CA  1 
ATOM   7412  C C   . ASP D  4  240 ? -7.768  -0.221  96.749  1.00 149.70 ? 240 ASP D C   1 
ATOM   7413  O O   . ASP D  4  240 ? -7.668  0.985   96.503  1.00 147.53 ? 240 ASP D O   1 
ATOM   7414  C CB  . ASP D  4  240 ? -5.254  -0.398  96.681  1.00 147.79 ? 240 ASP D CB  1 
ATOM   7415  C CG  . ASP D  4  240 ? -4.048  -1.317  96.780  1.00 148.70 ? 240 ASP D CG  1 
ATOM   7416  O OD1 . ASP D  4  240 ? -3.190  -1.070  97.653  1.00 148.89 ? 240 ASP D OD1 1 
ATOM   7417  O OD2 . ASP D  4  240 ? -3.955  -2.282  95.992  1.00 145.13 ? 240 ASP D OD2 1 
ATOM   7418  N N   . ILE D  4  241 ? -8.897  -0.792  97.167  1.00 153.25 ? 241 ILE D N   1 
ATOM   7419  C CA  . ILE D  4  241 ? -10.157 -0.057  97.301  1.00 153.29 ? 241 ILE D CA  1 
ATOM   7420  C C   . ILE D  4  241 ? -10.118 0.889   98.501  1.00 154.48 ? 241 ILE D C   1 
ATOM   7421  O O   . ILE D  4  241 ? -10.441 2.072   98.387  1.00 154.79 ? 241 ILE D O   1 
ATOM   7422  C CB  . ILE D  4  241 ? -11.369 -1.014  97.426  1.00 153.66 ? 241 ILE D CB  1 
ATOM   7423  C CG1 . ILE D  4  241 ? -11.315 -2.105  96.347  1.00 151.37 ? 241 ILE D CG1 1 
ATOM   7424  C CG2 . ILE D  4  241 ? -12.680 -0.239  97.341  1.00 151.93 ? 241 ILE D CG2 1 
ATOM   7425  C CD1 . ILE D  4  241 ? -12.149 -3.333  96.652  1.00 153.63 ? 241 ILE D CD1 1 
ATOM   7426  O OXT . ILE D  4  241 ? -9.760  0.495   99.612  1.00 156.51 ? 241 ILE D OXT 1 
ATOM   7427  N N   . ASN E  5  4   ? -34.408 51.162  85.712  1.00 119.17 ? 4   ASN E N   1 
ATOM   7428  C CA  . ASN E  5  4   ? -35.303 49.991  85.484  1.00 121.47 ? 4   ASN E CA  1 
ATOM   7429  C C   . ASN E  5  4   ? -35.221 49.477  84.047  1.00 117.63 ? 4   ASN E C   1 
ATOM   7430  O O   . ASN E  5  4   ? -35.083 48.274  83.819  1.00 115.45 ? 4   ASN E O   1 
ATOM   7431  C CB  . ASN E  5  4   ? -36.749 50.340  85.854  1.00 126.01 ? 4   ASN E CB  1 
ATOM   7432  C CG  . ASN E  5  4   ? -37.613 49.111  86.063  1.00 129.06 ? 4   ASN E CG  1 
ATOM   7433  O OD1 . ASN E  5  4   ? -37.857 48.699  87.196  1.00 131.26 ? 4   ASN E OD1 1 
ATOM   7434  N ND2 . ASN E  5  4   ? -38.072 48.511  84.969  1.00 127.51 ? 4   ASN E ND2 1 
ATOM   7435  N N   . GLN E  5  5   ? -35.313 50.397  83.088  1.00 115.70 ? 5   GLN E N   1 
ATOM   7436  C CA  . GLN E  5  5   ? -35.179 50.067  81.669  1.00 112.31 ? 5   GLN E CA  1 
ATOM   7437  C C   . GLN E  5  5   ? -33.996 50.798  81.026  1.00 107.66 ? 5   GLN E C   1 
ATOM   7438  O O   . GLN E  5  5   ? -33.672 50.569  79.858  1.00 107.54 ? 5   GLN E O   1 
ATOM   7439  C CB  . GLN E  5  5   ? -36.481 50.356  80.904  1.00 113.97 ? 5   GLN E CB  1 
ATOM   7440  C CG  . GLN E  5  5   ? -36.864 51.828  80.789  1.00 115.80 ? 5   GLN E CG  1 
ATOM   7441  C CD  . GLN E  5  5   ? -37.989 52.230  81.727  1.00 120.11 ? 5   GLN E CD  1 
ATOM   7442  O OE1 . GLN E  5  5   ? -39.114 52.470  81.290  1.00 121.34 ? 5   GLN E OE1 1 
ATOM   7443  N NE2 . GLN E  5  5   ? -37.692 52.307  83.019  1.00 117.38 ? 5   GLN E NE2 1 
ATOM   7444  N N   . TYR E  5  6   ? -33.361 51.673  81.804  1.00 102.54 ? 6   TYR E N   1 
ATOM   7445  C CA  . TYR E  5  6   ? -32.227 52.470  81.338  1.00 98.59  ? 6   TYR E CA  1 
ATOM   7446  C C   . TYR E  5  6   ? -30.893 51.847  81.751  1.00 98.69  ? 6   TYR E C   1 
ATOM   7447  O O   . TYR E  5  6   ? -29.825 52.391  81.456  1.00 99.14  ? 6   TYR E O   1 
ATOM   7448  C CB  . TYR E  5  6   ? -32.324 53.902  81.880  1.00 96.53  ? 6   TYR E CB  1 
ATOM   7449  C CG  . TYR E  5  6   ? -33.691 54.539  81.740  1.00 96.85  ? 6   TYR E CG  1 
ATOM   7450  C CD1 . TYR E  5  6   ? -34.574 54.583  82.819  1.00 96.86  ? 6   TYR E CD1 1 
ATOM   7451  C CD2 . TYR E  5  6   ? -34.101 55.100  80.531  1.00 97.14  ? 6   TYR E CD2 1 
ATOM   7452  C CE1 . TYR E  5  6   ? -35.826 55.165  82.696  1.00 97.16  ? 6   TYR E CE1 1 
ATOM   7453  C CE2 . TYR E  5  6   ? -35.351 55.683  80.399  1.00 96.92  ? 6   TYR E CE2 1 
ATOM   7454  C CZ  . TYR E  5  6   ? -36.209 55.715  81.483  1.00 96.86  ? 6   TYR E CZ  1 
ATOM   7455  O OH  . TYR E  5  6   ? -37.450 56.295  81.353  1.00 97.25  ? 6   TYR E OH  1 
ATOM   7456  N N   . ASP E  5  7   ? -30.965 50.702  82.425  1.00 98.93  ? 7   ASP E N   1 
ATOM   7457  C CA  . ASP E  5  7   ? -29.786 50.048  82.991  1.00 99.16  ? 7   ASP E CA  1 
ATOM   7458  C C   . ASP E  5  7   ? -29.326 48.821  82.193  1.00 100.30 ? 7   ASP E C   1 
ATOM   7459  O O   . ASP E  5  7   ? -28.713 47.903  82.745  1.00 99.14  ? 7   ASP E O   1 
ATOM   7460  C CB  . ASP E  5  7   ? -30.042 49.683  84.462  1.00 98.16  ? 7   ASP E CB  1 
ATOM   7461  C CG  . ASP E  5  7   ? -31.170 48.671  84.638  1.00 98.90  ? 7   ASP E CG  1 
ATOM   7462  O OD1 . ASP E  5  7   ? -31.130 47.917  85.632  1.00 99.16  ? 7   ASP E OD1 1 
ATOM   7463  O OD2 . ASP E  5  7   ? -32.092 48.626  83.795  1.00 101.56 ? 7   ASP E OD2 1 
ATOM   7464  N N   . ASN E  5  8   ? -29.616 48.819  80.894  1.00 103.01 ? 8   ASN E N   1 
ATOM   7465  C CA  . ASN E  5  8   ? -29.249 47.705  80.018  1.00 106.49 ? 8   ASN E CA  1 
ATOM   7466  C C   . ASN E  5  8   ? -28.112 48.033  79.052  1.00 105.17 ? 8   ASN E C   1 
ATOM   7467  O O   . ASN E  5  8   ? -27.272 47.178  78.762  1.00 103.50 ? 8   ASN E O   1 
ATOM   7468  C CB  . ASN E  5  8   ? -30.472 47.203  79.242  1.00 109.17 ? 8   ASN E CB  1 
ATOM   7469  C CG  . ASN E  5  8   ? -31.506 46.544  80.138  1.00 111.57 ? 8   ASN E CG  1 
ATOM   7470  O OD1 . ASN E  5  8   ? -31.170 45.758  81.027  1.00 110.96 ? 8   ASN E OD1 1 
ATOM   7471  N ND2 . ASN E  5  8   ? -32.775 46.855  79.901  1.00 112.48 ? 8   ASN E ND2 1 
ATOM   7472  N N   . ASP E  5  9   ? -28.092 49.269  78.560  1.00 102.13 ? 9   ASP E N   1 
ATOM   7473  C CA  . ASP E  5  9   ? -27.077 49.715  77.608  1.00 97.05  ? 9   ASP E CA  1 
ATOM   7474  C C   . ASP E  5  9   ? -26.386 50.994  78.067  1.00 89.79  ? 9   ASP E C   1 
ATOM   7475  O O   . ASP E  5  9   ? -26.951 51.776  78.837  1.00 89.51  ? 9   ASP E O   1 
ATOM   7476  C CB  . ASP E  5  9   ? -27.699 49.925  76.224  1.00 99.73  ? 9   ASP E CB  1 
ATOM   7477  C CG  . ASP E  5  9   ? -28.207 48.635  75.608  1.00 103.41 ? 9   ASP E CG  1 
ATOM   7478  O OD1 . ASP E  5  9   ? -27.396 47.704  75.405  1.00 104.63 ? 9   ASP E OD1 1 
ATOM   7479  O OD2 . ASP E  5  9   ? -29.418 48.555  75.316  1.00 103.36 ? 9   ASP E OD2 1 
ATOM   7480  N N   . VAL E  5  10  ? -25.159 51.196  77.589  1.00 82.72  ? 10  VAL E N   1 
ATOM   7481  C CA  . VAL E  5  10  ? -24.400 52.417  77.872  1.00 79.55  ? 10  VAL E CA  1 
ATOM   7482  C C   . VAL E  5  10  ? -24.963 53.622  77.119  1.00 79.84  ? 10  VAL E C   1 
ATOM   7483  O O   . VAL E  5  10  ? -24.837 54.759  77.576  1.00 79.79  ? 10  VAL E O   1 
ATOM   7484  C CB  . VAL E  5  10  ? -22.892 52.263  77.553  1.00 76.31  ? 10  VAL E CB  1 
ATOM   7485  C CG1 . VAL E  5  10  ? -22.195 51.443  78.627  1.00 74.90  ? 10  VAL E CG1 1 
ATOM   7486  C CG2 . VAL E  5  10  ? -22.675 51.650  76.175  1.00 76.03  ? 10  VAL E CG2 1 
ATOM   7487  N N   . THR E  5  11  ? -25.587 53.357  75.972  1.00 80.13  ? 11  THR E N   1 
ATOM   7488  C CA  . THR E  5  11  ? -26.150 54.402  75.115  1.00 79.64  ? 11  THR E CA  1 
ATOM   7489  C C   . THR E  5  11  ? -27.401 55.059  75.701  1.00 79.96  ? 11  THR E C   1 
ATOM   7490  O O   . THR E  5  11  ? -27.712 56.207  75.378  1.00 79.63  ? 11  THR E O   1 
ATOM   7491  C CB  . THR E  5  11  ? -26.474 53.872  73.701  1.00 82.10  ? 11  THR E CB  1 
ATOM   7492  O OG1 . THR E  5  11  ? -27.249 52.670  73.799  1.00 83.51  ? 11  THR E OG1 1 
ATOM   7493  C CG2 . THR E  5  11  ? -25.195 53.585  72.928  1.00 80.79  ? 11  THR E CG2 1 
ATOM   7494  N N   . VAL E  5  12  ? -28.110 54.329  76.559  1.00 80.44  ? 12  VAL E N   1 
ATOM   7495  C CA  . VAL E  5  12  ? -29.346 54.825  77.162  1.00 82.31  ? 12  VAL E CA  1 
ATOM   7496  C C   . VAL E  5  12  ? -29.048 55.717  78.370  1.00 85.21  ? 12  VAL E C   1 
ATOM   7497  O O   . VAL E  5  12  ? -28.373 55.298  79.315  1.00 85.19  ? 12  VAL E O   1 
ATOM   7498  C CB  . VAL E  5  12  ? -30.295 53.672  77.568  1.00 82.67  ? 12  VAL E CB  1 
ATOM   7499  C CG1 . VAL E  5  12  ? -31.661 54.215  77.962  1.00 84.94  ? 12  VAL E CG1 1 
ATOM   7500  C CG2 . VAL E  5  12  ? -30.440 52.666  76.434  1.00 83.15  ? 12  VAL E CG2 1 
ATOM   7501  N N   . TRP E  5  13  ? -29.553 56.948  78.319  1.00 87.15  ? 13  TRP E N   1 
ATOM   7502  C CA  . TRP E  5  13  ? -29.389 57.914  79.404  1.00 87.84  ? 13  TRP E CA  1 
ATOM   7503  C C   . TRP E  5  13  ? -30.516 57.839  80.393  1.00 90.46  ? 13  TRP E C   1 
ATOM   7504  O O   . TRP E  5  13  ? -31.674 57.635  80.019  1.00 91.00  ? 13  TRP E O   1 
ATOM   7505  C CB  . TRP E  5  13  ? -29.291 59.332  78.850  1.00 87.48  ? 13  TRP E CB  1 
ATOM   7506  C CG  . TRP E  5  13  ? -27.933 59.696  78.300  1.00 85.28  ? 13  TRP E CG  1 
ATOM   7507  C CD1 . TRP E  5  13  ? -27.495 59.600  76.981  1.00 84.72  ? 13  TRP E CD1 1 
ATOM   7508  C CD2 . TRP E  5  13  ? -26.785 60.245  79.041  1.00 83.75  ? 13  TRP E CD2 1 
ATOM   7509  N NE1 . TRP E  5  13  ? -26.198 60.032  76.861  1.00 85.01  ? 13  TRP E NE1 1 
ATOM   7510  C CE2 . TRP E  5  13  ? -25.712 60.431  78.055  1.00 83.53  ? 13  TRP E CE2 1 
ATOM   7511  C CE3 . TRP E  5  13  ? -26.546 60.583  80.370  1.00 81.68  ? 13  TRP E CE3 1 
ATOM   7512  C CZ2 . TRP E  5  13  ? -24.468 60.935  78.409  1.00 81.22  ? 13  TRP E CZ2 1 
ATOM   7513  C CZ3 . TRP E  5  13  ? -25.286 61.090  80.713  1.00 80.15  ? 13  TRP E CZ3 1 
ATOM   7514  C CH2 . TRP E  5  13  ? -24.274 61.260  79.755  1.00 80.23  ? 13  TRP E CH2 1 
ATOM   7515  N N   . SER E  5  14  ? -30.177 58.007  81.669  1.00 90.70  ? 14  SER E N   1 
ATOM   7516  C CA  . SER E  5  14  ? -31.159 58.053  82.750  1.00 92.43  ? 14  SER E CA  1 
ATOM   7517  C C   . SER E  5  14  ? -31.827 59.430  82.804  1.00 93.32  ? 14  SER E C   1 
ATOM   7518  O O   . SER E  5  14  ? -31.180 60.438  82.506  1.00 93.22  ? 14  SER E O   1 
ATOM   7519  C CB  . SER E  5  14  ? -30.480 57.737  84.087  1.00 92.60  ? 14  SER E CB  1 
ATOM   7520  O OG  . SER E  5  14  ? -31.368 57.895  85.180  1.00 95.50  ? 14  SER E OG  1 
ATOM   7521  N N   . PRO E  5  15  ? -33.125 59.478  83.176  1.00 93.25  ? 15  PRO E N   1 
ATOM   7522  C CA  . PRO E  5  15  ? -33.843 60.748  83.356  1.00 93.64  ? 15  PRO E CA  1 
ATOM   7523  C C   . PRO E  5  15  ? -33.200 61.697  84.375  1.00 95.40  ? 15  PRO E C   1 
ATOM   7524  O O   . PRO E  5  15  ? -33.518 62.889  84.390  1.00 95.80  ? 15  PRO E O   1 
ATOM   7525  C CB  . PRO E  5  15  ? -35.221 60.301  83.847  1.00 91.81  ? 15  PRO E CB  1 
ATOM   7526  C CG  . PRO E  5  15  ? -35.401 58.954  83.242  1.00 90.47  ? 15  PRO E CG  1 
ATOM   7527  C CD  . PRO E  5  15  ? -34.039 58.324  83.279  1.00 92.27  ? 15  PRO E CD  1 
ATOM   7528  N N   . GLN E  5  16  ? -32.307 61.167  85.209  1.00 95.84  ? 16  GLN E N   1 
ATOM   7529  C CA  . GLN E  5  16  ? -31.573 61.966  86.191  1.00 97.07  ? 16  GLN E CA  1 
ATOM   7530  C C   . GLN E  5  16  ? -30.296 62.567  85.599  1.00 93.65  ? 16  GLN E C   1 
ATOM   7531  O O   . GLN E  5  16  ? -29.718 63.496  86.167  1.00 93.70  ? 16  GLN E O   1 
ATOM   7532  C CB  . GLN E  5  16  ? -31.236 61.121  87.423  1.00 102.08 ? 16  GLN E CB  1 
ATOM   7533  C CG  . GLN E  5  16  ? -32.447 60.689  88.240  1.00 108.24 ? 16  GLN E CG  1 
ATOM   7534  C CD  . GLN E  5  16  ? -32.105 59.676  89.318  1.00 112.88 ? 16  GLN E CD  1 
ATOM   7535  O OE1 . GLN E  5  16  ? -31.311 58.759  89.101  1.00 113.69 ? 16  GLN E OE1 1 
ATOM   7536  N NE2 . GLN E  5  16  ? -32.715 59.832  90.487  1.00 112.14 ? 16  GLN E NE2 1 
ATOM   7537  N N   . GLY E  5  17  ? -29.869 62.032  84.458  1.00 90.39  ? 17  GLY E N   1 
ATOM   7538  C CA  . GLY E  5  17  ? -28.652 62.484  83.785  1.00 88.22  ? 17  GLY E CA  1 
ATOM   7539  C C   . GLY E  5  17  ? -27.456 61.610  84.109  1.00 86.65  ? 17  GLY E C   1 
ATOM   7540  O O   . GLY E  5  17  ? -26.363 62.114  84.379  1.00 86.90  ? 17  GLY E O   1 
ATOM   7541  N N   . ARG E  5  18  ? -27.667 60.297  84.077  1.00 85.65  ? 18  ARG E N   1 
ATOM   7542  C CA  . ARG E  5  18  ? -26.638 59.321  84.433  1.00 84.66  ? 18  ARG E CA  1 
ATOM   7543  C C   . ARG E  5  18  ? -26.628 58.131  83.473  1.00 83.93  ? 18  ARG E C   1 
ATOM   7544  O O   . ARG E  5  18  ? -27.570 57.933  82.702  1.00 86.44  ? 18  ARG E O   1 
ATOM   7545  C CB  . ARG E  5  18  ? -26.855 58.825  85.867  1.00 86.02  ? 18  ARG E CB  1 
ATOM   7546  C CG  . ARG E  5  18  ? -26.430 59.805  86.951  1.00 89.67  ? 18  ARG E CG  1 
ATOM   7547  C CD  . ARG E  5  18  ? -27.167 59.550  88.258  1.00 93.75  ? 18  ARG E CD  1 
ATOM   7548  N NE  . ARG E  5  18  ? -26.857 58.242  88.836  1.00 96.28  ? 18  ARG E NE  1 
ATOM   7549  C CZ  . ARG E  5  18  ? -27.452 57.730  89.910  1.00 98.22  ? 18  ARG E CZ  1 
ATOM   7550  N NH1 . ARG E  5  18  ? -28.404 58.407  90.543  1.00 98.57  ? 18  ARG E NH1 1 
ATOM   7551  N NH2 . ARG E  5  18  ? -27.097 56.532  90.355  1.00 98.69  ? 18  ARG E NH2 1 
ATOM   7552  N N   . ILE E  5  19  ? -25.550 57.352  83.518  1.00 82.31  ? 19  ILE E N   1 
ATOM   7553  C CA  . ILE E  5  19  ? -25.475 56.083  82.798  1.00 82.58  ? 19  ILE E CA  1 
ATOM   7554  C C   . ILE E  5  19  ? -25.231 54.967  83.812  1.00 84.10  ? 19  ILE E C   1 
ATOM   7555  O O   . ILE E  5  19  ? -24.174 54.910  84.447  1.00 83.99  ? 19  ILE E O   1 
ATOM   7556  C CB  . ILE E  5  19  ? -24.383 56.090  81.702  1.00 81.59  ? 19  ILE E CB  1 
ATOM   7557  C CG1 . ILE E  5  19  ? -24.655 57.201  80.680  1.00 81.26  ? 19  ILE E CG1 1 
ATOM   7558  C CG2 . ILE E  5  19  ? -24.315 54.733  81.008  1.00 81.21  ? 19  ILE E CG2 1 
ATOM   7559  C CD1 . ILE E  5  19  ? -23.455 57.603  79.847  1.00 80.30  ? 19  ILE E CD1 1 
ATOM   7560  N N   . HIS E  5  20  ? -26.224 54.093  83.962  1.00 86.30  ? 20  HIS E N   1 
ATOM   7561  C CA  . HIS E  5  20  ? -26.201 53.044  84.984  1.00 88.36  ? 20  HIS E CA  1 
ATOM   7562  C C   . HIS E  5  20  ? -25.213 51.946  84.708  1.00 85.84  ? 20  HIS E C   1 
ATOM   7563  O O   . HIS E  5  20  ? -24.645 51.375  85.640  1.00 86.85  ? 20  HIS E O   1 
ATOM   7564  C CB  . HIS E  5  20  ? -27.596 52.463  85.186  1.00 91.81  ? 20  HIS E CB  1 
ATOM   7565  C CG  . HIS E  5  20  ? -28.563 53.417  85.848  1.00 95.63  ? 20  HIS E CG  1 
ATOM   7566  N ND1 . HIS E  5  20  ? -28.665 53.531  87.185  1.00 98.02  ? 20  HIS E ND1 1 
ATOM   7567  C CD2 . HIS E  5  20  ? -29.482 54.312  85.305  1.00 96.60  ? 20  HIS E CD2 1 
ATOM   7568  C CE1 . HIS E  5  20  ? -29.601 54.451  87.486  1.00 99.34  ? 20  HIS E CE1 1 
ATOM   7569  N NE2 . HIS E  5  20  ? -30.100 54.928  86.334  1.00 98.37  ? 20  HIS E NE2 1 
ATOM   7570  N N   . GLN E  5  21  ? -24.996 51.645  83.428  1.00 83.35  ? 21  GLN E N   1 
ATOM   7571  C CA  . GLN E  5  21  ? -24.066 50.589  83.021  1.00 80.08  ? 21  GLN E CA  1 
ATOM   7572  C C   . GLN E  5  21  ? -22.610 50.894  83.383  1.00 80.91  ? 21  GLN E C   1 
ATOM   7573  O O   . GLN E  5  21  ? -21.836 49.979  83.673  1.00 80.22  ? 21  GLN E O   1 
ATOM   7574  C CB  . GLN E  5  21  ? -24.199 50.295  81.524  1.00 76.33  ? 21  GLN E CB  1 
ATOM   7575  C CG  . GLN E  5  21  ? -25.353 49.367  81.174  1.00 74.64  ? 21  GLN E CG  1 
ATOM   7576  C CD  . GLN E  5  21  ? -25.112 47.936  81.620  1.00 73.12  ? 21  GLN E CD  1 
ATOM   7577  O OE1 . GLN E  5  21  ? -24.160 47.287  81.185  1.00 71.81  ? 21  GLN E OE1 1 
ATOM   7578  N NE2 . GLN E  5  21  ? -25.980 47.436  82.491  1.00 75.42  ? 21  GLN E NE2 1 
ATOM   7579  N N   . ILE E  5  22  ? -22.249 52.176  83.362  1.00 81.02  ? 22  ILE E N   1 
ATOM   7580  C CA  . ILE E  5  22  ? -20.929 52.623  83.812  1.00 80.57  ? 22  ILE E CA  1 
ATOM   7581  C C   . ILE E  5  22  ? -20.840 52.514  85.336  1.00 81.69  ? 22  ILE E C   1 
ATOM   7582  O O   . ILE E  5  22  ? -19.803 52.122  85.879  1.00 82.60  ? 22  ILE E O   1 
ATOM   7583  C CB  . ILE E  5  22  ? -20.617 54.066  83.346  1.00 80.05  ? 22  ILE E CB  1 
ATOM   7584  C CG1 . ILE E  5  22  ? -20.636 54.152  81.814  1.00 80.36  ? 22  ILE E CG1 1 
ATOM   7585  C CG2 . ILE E  5  22  ? -19.268 54.534  83.884  1.00 80.69  ? 22  ILE E CG2 1 
ATOM   7586  C CD1 . ILE E  5  22  ? -20.578 55.562  81.261  1.00 80.13  ? 22  ILE E CD1 1 
ATOM   7587  N N   . GLU E  5  23  ? -21.938 52.847  86.012  1.00 82.50  ? 23  GLU E N   1 
ATOM   7588  C CA  . GLU E  5  23  ? -22.022 52.766  87.472  1.00 84.59  ? 23  GLU E CA  1 
ATOM   7589  C C   . GLU E  5  23  ? -21.976 51.324  87.978  1.00 85.34  ? 23  GLU E C   1 
ATOM   7590  O O   . GLU E  5  23  ? -21.442 51.059  89.057  1.00 85.32  ? 23  GLU E O   1 
ATOM   7591  C CB  . GLU E  5  23  ? -23.282 53.470  87.984  1.00 87.64  ? 23  GLU E CB  1 
ATOM   7592  C CG  . GLU E  5  23  ? -23.265 54.984  87.816  1.00 90.18  ? 23  GLU E CG  1 
ATOM   7593  C CD  . GLU E  5  23  ? -24.502 55.666  88.375  1.00 93.81  ? 23  GLU E CD  1 
ATOM   7594  O OE1 . GLU E  5  23  ? -25.566 55.017  88.473  1.00 94.74  ? 23  GLU E OE1 1 
ATOM   7595  O OE2 . GLU E  5  23  ? -24.412 56.865  88.713  1.00 93.63  ? 23  GLU E OE2 1 
ATOM   7596  N N   . TYR E  5  24  ? -22.536 50.401  87.195  1.00 86.77  ? 24  TYR E N   1 
ATOM   7597  C CA  . TYR E  5  24  ? -22.497 48.975  87.522  1.00 88.71  ? 24  TYR E CA  1 
ATOM   7598  C C   . TYR E  5  24  ? -21.112 48.381  87.280  1.00 89.99  ? 24  TYR E C   1 
ATOM   7599  O O   . TYR E  5  24  ? -20.718 47.418  87.940  1.00 91.04  ? 24  TYR E O   1 
ATOM   7600  C CB  . TYR E  5  24  ? -23.543 48.191  86.722  1.00 89.15  ? 24  TYR E CB  1 
ATOM   7601  C CG  . TYR E  5  24  ? -24.987 48.531  87.035  1.00 90.64  ? 24  TYR E CG  1 
ATOM   7602  C CD1 . TYR E  5  24  ? -25.976 48.378  86.066  1.00 91.31  ? 24  TYR E CD1 1 
ATOM   7603  C CD2 . TYR E  5  24  ? -25.367 49.007  88.292  1.00 91.75  ? 24  TYR E CD2 1 
ATOM   7604  C CE1 . TYR E  5  24  ? -27.300 48.681  86.339  1.00 93.81  ? 24  TYR E CE1 1 
ATOM   7605  C CE2 . TYR E  5  24  ? -26.689 49.316  88.573  1.00 94.92  ? 24  TYR E CE2 1 
ATOM   7606  C CZ  . TYR E  5  24  ? -27.651 49.152  87.592  1.00 95.94  ? 24  TYR E CZ  1 
ATOM   7607  O OH  . TYR E  5  24  ? -28.966 49.455  87.861  1.00 98.24  ? 24  TYR E OH  1 
ATOM   7608  N N   . ALA E  5  25  ? -20.386 48.959  86.325  1.00 91.60  ? 25  ALA E N   1 
ATOM   7609  C CA  . ALA E  5  25  ? -19.015 48.553  86.028  1.00 93.84  ? 25  ALA E CA  1 
ATOM   7610  C C   . ALA E  5  25  ? -18.057 48.987  87.137  1.00 94.39  ? 25  ALA E C   1 
ATOM   7611  O O   . ALA E  5  25  ? -17.023 48.353  87.356  1.00 94.63  ? 25  ALA E O   1 
ATOM   7612  C CB  . ALA E  5  25  ? -18.573 49.117  84.687  1.00 92.72  ? 25  ALA E CB  1 
ATOM   7613  N N   . MET E  5  26  ? -18.415 50.067  87.832  1.00 93.63  ? 26  MET E N   1 
ATOM   7614  C CA  . MET E  5  26  ? -17.639 50.569  88.967  1.00 92.91  ? 26  MET E CA  1 
ATOM   7615  C C   . MET E  5  26  ? -17.773 49.672  90.196  1.00 92.58  ? 26  MET E C   1 
ATOM   7616  O O   . MET E  5  26  ? -16.908 49.679  91.075  1.00 92.61  ? 26  MET E O   1 
ATOM   7617  C CB  . MET E  5  26  ? -18.056 52.000  89.316  1.00 93.60  ? 26  MET E CB  1 
ATOM   7618  C CG  . MET E  5  26  ? -17.620 53.046  88.302  1.00 93.97  ? 26  MET E CG  1 
ATOM   7619  S SD  . MET E  5  26  ? -18.065 54.713  88.818  1.00 98.31  ? 26  MET E SD  1 
ATOM   7620  C CE  . MET E  5  26  ? -17.526 55.665  87.402  1.00 96.91  ? 26  MET E CE  1 
ATOM   7621  N N   . GLU E  5  27  ? -18.860 48.904  90.248  1.00 94.22  ? 27  GLU E N   1 
ATOM   7622  C CA  . GLU E  5  27  ? -19.108 47.959  91.338  1.00 96.78  ? 27  GLU E CA  1 
ATOM   7623  C C   . GLU E  5  27  ? -18.181 46.746  91.261  1.00 91.74  ? 27  GLU E C   1 
ATOM   7624  O O   . GLU E  5  27  ? -17.939 46.080  92.270  1.00 93.18  ? 27  GLU E O   1 
ATOM   7625  C CB  . GLU E  5  27  ? -20.573 47.505  91.342  1.00 102.11 ? 27  GLU E CB  1 
ATOM   7626  C CG  . GLU E  5  27  ? -21.595 48.611  91.583  1.00 112.24 ? 27  GLU E CG  1 
ATOM   7627  C CD  . GLU E  5  27  ? -21.708 49.014  93.042  1.00 119.34 ? 27  GLU E CD  1 
ATOM   7628  O OE1 . GLU E  5  27  ? -22.711 48.638  93.686  1.00 120.65 ? 27  GLU E OE1 1 
ATOM   7629  O OE2 . GLU E  5  27  ? -20.798 49.706  93.549  1.00 116.65 ? 27  GLU E OE2 1 
ATOM   7630  N N   . ALA E  5  28  ? -17.671 46.468  90.061  1.00 88.34  ? 28  ALA E N   1 
ATOM   7631  C CA  . ALA E  5  28  ? -16.717 45.381  89.835  1.00 87.43  ? 28  ALA E CA  1 
ATOM   7632  C C   . ALA E  5  28  ? -15.379 45.650  90.521  1.00 86.78  ? 28  ALA E C   1 
ATOM   7633  O O   . ALA E  5  28  ? -14.723 44.724  91.001  1.00 87.78  ? 28  ALA E O   1 
ATOM   7634  C CB  . ALA E  5  28  ? -16.512 45.157  88.344  1.00 86.83  ? 28  ALA E CB  1 
ATOM   7635  N N   . VAL E  5  29  ? -14.988 46.923  90.558  1.00 85.35  ? 29  VAL E N   1 
ATOM   7636  C CA  . VAL E  5  29  ? -13.752 47.359  91.211  1.00 83.64  ? 29  VAL E CA  1 
ATOM   7637  C C   . VAL E  5  29  ? -13.871 47.226  92.732  1.00 86.31  ? 29  VAL E C   1 
ATOM   7638  O O   . VAL E  5  29  ? -12.910 46.850  93.407  1.00 87.28  ? 29  VAL E O   1 
ATOM   7639  C CB  . VAL E  5  29  ? -13.392 48.817  90.834  1.00 81.30  ? 29  VAL E CB  1 
ATOM   7640  C CG1 . VAL E  5  29  ? -11.989 49.174  91.308  1.00 82.35  ? 29  VAL E CG1 1 
ATOM   7641  C CG2 . VAL E  5  29  ? -13.502 49.030  89.330  1.00 80.98  ? 29  VAL E CG2 1 
ATOM   7642  N N   . LYS E  5  30  ? -15.060 47.521  93.257  1.00 88.30  ? 30  LYS E N   1 
ATOM   7643  C CA  . LYS E  5  30  ? -15.325 47.466  94.697  1.00 90.61  ? 30  LYS E CA  1 
ATOM   7644  C C   . LYS E  5  30  ? -15.404 46.041  95.247  1.00 92.10  ? 30  LYS E C   1 
ATOM   7645  O O   . LYS E  5  30  ? -15.236 45.828  96.449  1.00 95.22  ? 30  LYS E O   1 
ATOM   7646  C CB  . LYS E  5  30  ? -16.610 48.226  95.043  1.00 92.16  ? 30  LYS E CB  1 
ATOM   7647  C CG  . LYS E  5  30  ? -16.510 49.738  94.915  1.00 92.97  ? 30  LYS E CG  1 
ATOM   7648  C CD  . LYS E  5  30  ? -17.770 50.412  95.438  1.00 93.64  ? 30  LYS E CD  1 
ATOM   7649  C CE  . LYS E  5  30  ? -17.799 51.894  95.097  1.00 95.60  ? 30  LYS E CE  1 
ATOM   7650  N NZ  . LYS E  5  30  ? -18.054 52.130  93.648  1.00 98.20  ? 30  LYS E NZ  1 
ATOM   7651  N N   . GLN E  5  31  ? -15.665 45.074  94.369  1.00 93.22  ? 31  GLN E N   1 
ATOM   7652  C CA  . GLN E  5  31  ? -15.775 43.670  94.774  1.00 96.68  ? 31  GLN E CA  1 
ATOM   7653  C C   . GLN E  5  31  ? -14.419 42.975  94.884  1.00 97.28  ? 31  GLN E C   1 
ATOM   7654  O O   . GLN E  5  31  ? -14.249 42.064  95.697  1.00 99.01  ? 31  GLN E O   1 
ATOM   7655  C CB  . GLN E  5  31  ? -16.698 42.898  93.829  1.00 100.69 ? 31  GLN E CB  1 
ATOM   7656  C CG  . GLN E  5  31  ? -18.173 43.217  94.021  1.00 103.97 ? 31  GLN E CG  1 
ATOM   7657  C CD  . GLN E  5  31  ? -19.097 42.186  93.401  1.00 108.63 ? 31  GLN E CD  1 
ATOM   7658  O OE1 . GLN E  5  31  ? -18.672 41.335  92.618  1.00 108.20 ? 31  GLN E OE1 1 
ATOM   7659  N NE2 . GLN E  5  31  ? -20.374 42.258  93.753  1.00 110.09 ? 31  GLN E NE2 1 
ATOM   7660  N N   . GLY E  5  32  ? -13.463 43.405  94.062  1.00 96.77  ? 32  GLY E N   1 
ATOM   7661  C CA  . GLY E  5  32  ? -12.094 42.895  94.123  1.00 97.60  ? 32  GLY E CA  1 
ATOM   7662  C C   . GLY E  5  32  ? -11.355 43.424  95.339  1.00 98.92  ? 32  GLY E C   1 
ATOM   7663  O O   . GLY E  5  32  ? -11.739 44.450  95.905  1.00 98.82  ? 32  GLY E O   1 
ATOM   7664  N N   . SER E  5  33  ? -10.295 42.723  95.738  1.00 99.64  ? 33  SER E N   1 
ATOM   7665  C CA  . SER E  5  33  ? -9.517  43.088  96.926  1.00 101.17 ? 33  SER E CA  1 
ATOM   7666  C C   . SER E  5  33  ? -8.795  44.423  96.780  1.00 100.43 ? 33  SER E C   1 
ATOM   7667  O O   . SER E  5  33  ? -8.448  44.839  95.671  1.00 99.53  ? 33  SER E O   1 
ATOM   7668  C CB  . SER E  5  33  ? -8.516  41.988  97.285  1.00 102.29 ? 33  SER E CB  1 
ATOM   7669  O OG  . SER E  5  33  ? -7.678  41.675  96.188  1.00 100.73 ? 33  SER E OG  1 
ATOM   7670  N N   . ALA E  5  34  ? -8.573  45.080  97.916  1.00 100.11 ? 34  ALA E N   1 
ATOM   7671  C CA  . ALA E  5  34  ? -7.982  46.414  97.956  1.00 99.28  ? 34  ALA E CA  1 
ATOM   7672  C C   . ALA E  5  34  ? -6.488  46.414  97.647  1.00 97.74  ? 34  ALA E C   1 
ATOM   7673  O O   . ALA E  5  34  ? -5.775  45.459  97.961  1.00 99.46  ? 34  ALA E O   1 
ATOM   7674  C CB  . ALA E  5  34  ? -8.245  47.064  99.305  1.00 101.65 ? 34  ALA E CB  1 
ATOM   7675  N N   . THR E  5  35  ? -6.034  47.497  97.021  1.00 95.12  ? 35  THR E N   1 
ATOM   7676  C CA  . THR E  5  35  ? -4.616  47.725  96.748  1.00 93.65  ? 35  THR E CA  1 
ATOM   7677  C C   . THR E  5  35  ? -4.266  49.191  97.009  1.00 93.40  ? 35  THR E C   1 
ATOM   7678  O O   . THR E  5  35  ? -5.067  50.085  96.732  1.00 92.76  ? 35  THR E O   1 
ATOM   7679  C CB  . THR E  5  35  ? -4.216  47.299  95.313  1.00 93.00  ? 35  THR E CB  1 
ATOM   7680  O OG1 . THR E  5  35  ? -2.862  47.689  95.049  1.00 94.10  ? 35  THR E OG1 1 
ATOM   7681  C CG2 . THR E  5  35  ? -5.139  47.918  94.259  1.00 90.68  ? 35  THR E CG2 1 
ATOM   7682  N N   . VAL E  5  36  ? -3.075  49.424  97.555  1.00 93.76  ? 36  VAL E N   1 
ATOM   7683  C CA  . VAL E  5  36  ? -2.639  50.768  97.941  1.00 93.97  ? 36  VAL E CA  1 
ATOM   7684  C C   . VAL E  5  36  ? -1.493  51.249  97.048  1.00 91.32  ? 36  VAL E C   1 
ATOM   7685  O O   . VAL E  5  36  ? -0.536  50.512  96.798  1.00 90.17  ? 36  VAL E O   1 
ATOM   7686  C CB  . VAL E  5  36  ? -2.214  50.825  99.429  1.00 96.82  ? 36  VAL E CB  1 
ATOM   7687  C CG1 . VAL E  5  36  ? -1.910  52.255  99.856  1.00 98.75  ? 36  VAL E CG1 1 
ATOM   7688  C CG2 . VAL E  5  36  ? -3.296  50.233  100.324 1.00 97.94  ? 36  VAL E CG2 1 
ATOM   7689  N N   . GLY E  5  37  ? -1.607  52.486  96.570  1.00 89.98  ? 37  GLY E N   1 
ATOM   7690  C CA  . GLY E  5  37  ? -0.573  53.106  95.745  1.00 89.73  ? 37  GLY E CA  1 
ATOM   7691  C C   . GLY E  5  37  ? -0.164  54.467  96.273  1.00 92.48  ? 37  GLY E C   1 
ATOM   7692  O O   . GLY E  5  37  ? -0.981  55.386  96.338  1.00 92.63  ? 37  GLY E O   1 
ATOM   7693  N N   . LEU E  5  38  ? 1.106   54.590  96.651  1.00 95.85  ? 38  LEU E N   1 
ATOM   7694  C CA  . LEU E  5  38  ? 1.650   55.838  97.194  1.00 98.86  ? 38  LEU E CA  1 
ATOM   7695  C C   . LEU E  5  38  ? 3.017   56.194  96.605  1.00 97.81  ? 38  LEU E C   1 
ATOM   7696  O O   . LEU E  5  38  ? 3.737   55.324  96.108  1.00 97.89  ? 38  LEU E O   1 
ATOM   7697  C CB  . LEU E  5  38  ? 1.716   55.791  98.730  1.00 100.68 ? 38  LEU E CB  1 
ATOM   7698  C CG  . LEU E  5  38  ? 1.958   54.479  99.492  1.00 104.15 ? 38  LEU E CG  1 
ATOM   7699  C CD1 . LEU E  5  38  ? 3.312   53.852  99.189  1.00 100.93 ? 38  LEU E CD1 1 
ATOM   7700  C CD2 . LEU E  5  38  ? 1.812   54.716  100.987 1.00 108.93 ? 38  LEU E CD2 1 
ATOM   7701  N N   . LYS E  5  39  ? 3.363   57.479  96.668  1.00 97.05  ? 39  LYS E N   1 
ATOM   7702  C CA  . LYS E  5  39  ? 4.627   57.980  96.123  1.00 94.98  ? 39  LYS E CA  1 
ATOM   7703  C C   . LYS E  5  39  ? 5.340   58.951  97.068  1.00 96.74  ? 39  LYS E C   1 
ATOM   7704  O O   . LYS E  5  39  ? 4.721   59.531  97.965  1.00 98.88  ? 39  LYS E O   1 
ATOM   7705  C CB  . LYS E  5  39  ? 4.405   58.641  94.755  1.00 90.96  ? 39  LYS E CB  1 
ATOM   7706  C CG  . LYS E  5  39  ? 3.501   59.866  94.776  1.00 88.79  ? 39  LYS E CG  1 
ATOM   7707  C CD  . LYS E  5  39  ? 3.514   60.588  93.439  1.00 84.56  ? 39  LYS E CD  1 
ATOM   7708  C CE  . LYS E  5  39  ? 2.705   61.873  93.501  1.00 82.75  ? 39  LYS E CE  1 
ATOM   7709  N NZ  . LYS E  5  39  ? 2.794   62.649  92.233  1.00 81.25  ? 39  LYS E NZ  1 
ATOM   7710  N N   . SER E  5  40  ? 6.643   59.118  96.851  1.00 96.96  ? 40  SER E N   1 
ATOM   7711  C CA  . SER E  5  40  ? 7.456   60.070  97.605  1.00 97.03  ? 40  SER E CA  1 
ATOM   7712  C C   . SER E  5  40  ? 8.007   61.151  96.673  1.00 95.98  ? 40  SER E C   1 
ATOM   7713  O O   . SER E  5  40  ? 7.250   61.782  95.933  1.00 96.60  ? 40  SER E O   1 
ATOM   7714  C CB  . SER E  5  40  ? 8.590   59.346  98.340  1.00 97.05  ? 40  SER E CB  1 
ATOM   7715  O OG  . SER E  5  40  ? 9.433   58.655  97.434  1.00 95.02  ? 40  SER E OG  1 
ATOM   7716  N N   . LYS E  5  41  ? 9.321   61.360  96.718  1.00 97.16  ? 41  LYS E N   1 
ATOM   7717  C CA  . LYS E  5  41  ? 9.997   62.298  95.824  1.00 98.51  ? 41  LYS E CA  1 
ATOM   7718  C C   . LYS E  5  41  ? 10.853  61.563  94.791  1.00 96.49  ? 41  LYS E C   1 
ATOM   7719  O O   . LYS E  5  41  ? 11.210  62.128  93.754  1.00 95.56  ? 41  LYS E O   1 
ATOM   7720  C CB  . LYS E  5  41  ? 10.850  63.296  96.619  1.00 102.81 ? 41  LYS E CB  1 
ATOM   7721  C CG  . LYS E  5  41  ? 12.005  62.675  97.397  1.00 107.08 ? 41  LYS E CG  1 
ATOM   7722  C CD  . LYS E  5  41  ? 13.024  63.714  97.842  1.00 113.10 ? 41  LYS E CD  1 
ATOM   7723  C CE  . LYS E  5  41  ? 12.637  64.361  99.162  1.00 118.32 ? 41  LYS E CE  1 
ATOM   7724  N NZ  . LYS E  5  41  ? 13.670  65.327  99.629  1.00 119.76 ? 41  LYS E NZ  1 
ATOM   7725  N N   . THR E  5  42  ? 11.172  60.302  95.082  1.00 96.27  ? 42  THR E N   1 
ATOM   7726  C CA  . THR E  5  42  ? 12.051  59.494  94.232  1.00 95.76  ? 42  THR E CA  1 
ATOM   7727  C C   . THR E  5  42  ? 11.466  58.124  93.882  1.00 95.55  ? 42  THR E C   1 
ATOM   7728  O O   . THR E  5  42  ? 11.901  57.493  92.916  1.00 97.15  ? 42  THR E O   1 
ATOM   7729  C CB  . THR E  5  42  ? 13.440  59.287  94.879  1.00 96.18  ? 42  THR E CB  1 
ATOM   7730  O OG1 . THR E  5  42  ? 13.282  58.879  96.244  1.00 95.95  ? 42  THR E OG1 1 
ATOM   7731  C CG2 . THR E  5  42  ? 14.264  60.569  94.825  1.00 97.28  ? 42  THR E CG2 1 
ATOM   7732  N N   . HIS E  5  43  ? 10.484  57.672  94.660  1.00 93.85  ? 43  HIS E N   1 
ATOM   7733  C CA  . HIS E  5  43  ? 9.915   56.333  94.490  1.00 91.84  ? 43  HIS E CA  1 
ATOM   7734  C C   . HIS E  5  43  ? 8.411   56.307  94.452  1.00 89.81  ? 43  HIS E C   1 
ATOM   7735  O O   . HIS E  5  43  ? 7.748   57.191  94.998  1.00 90.56  ? 43  HIS E O   1 
ATOM   7736  C CB  . HIS E  5  43  ? 10.420  55.401  95.587  1.00 94.05  ? 43  HIS E CB  1 
ATOM   7737  C CG  . HIS E  5  43  ? 11.887  55.066  95.474  1.00 96.66  ? 43  HIS E CG  1 
ATOM   7738  N ND1 . HIS E  5  43  ? 12.335  54.016  94.763  1.00 97.98  ? 43  HIS E ND1 1 
ATOM   7739  C CD2 . HIS E  5  43  ? 13.013  55.685  96.014  1.00 98.63  ? 43  HIS E CD2 1 
ATOM   7740  C CE1 . HIS E  5  43  ? 13.677  53.962  94.842  1.00 99.95  ? 43  HIS E CE1 1 
ATOM   7741  N NE2 . HIS E  5  43  ? 14.091  54.985  95.607  1.00 99.60  ? 43  HIS E NE2 1 
ATOM   7742  N N   . ALA E  5  44  ? 7.870   55.281  93.796  1.00 88.93  ? 44  ALA E N   1 
ATOM   7743  C CA  . ALA E  5  44  ? 6.433   55.015  93.772  1.00 88.58  ? 44  ALA E CA  1 
ATOM   7744  C C   . ALA E  5  44  ? 6.187   53.536  94.064  1.00 90.32  ? 44  ALA E C   1 
ATOM   7745  O O   . ALA E  5  44  ? 6.683   52.663  93.346  1.00 89.92  ? 44  ALA E O   1 
ATOM   7746  C CB  . ALA E  5  44  ? 5.838   55.410  92.429  1.00 85.30  ? 44  ALA E CB  1 
ATOM   7747  N N   . VAL E  5  45  ? 5.427   53.264  95.123  1.00 92.49  ? 45  VAL E N   1 
ATOM   7748  C CA  . VAL E  5  45  ? 5.230   51.898  95.617  1.00 92.36  ? 45  VAL E CA  1 
ATOM   7749  C C   . VAL E  5  45  ? 3.769   51.453  95.500  1.00 90.47  ? 45  VAL E C   1 
ATOM   7750  O O   . VAL E  5  45  ? 2.854   52.198  95.858  1.00 91.65  ? 45  VAL E O   1 
ATOM   7751  C CB  . VAL E  5  45  ? 5.710   51.751  97.086  1.00 93.35  ? 45  VAL E CB  1 
ATOM   7752  C CG1 . VAL E  5  45  ? 5.585   50.311  97.566  1.00 93.10  ? 45  VAL E CG1 1 
ATOM   7753  C CG2 . VAL E  5  45  ? 7.148   52.230  97.239  1.00 93.91  ? 45  VAL E CG2 1 
ATOM   7754  N N   . LEU E  5  46  ? 3.568   50.239  94.989  1.00 87.68  ? 46  LEU E N   1 
ATOM   7755  C CA  . LEU E  5  46  ? 2.248   49.610  94.945  1.00 85.47  ? 46  LEU E CA  1 
ATOM   7756  C C   . LEU E  5  46  ? 2.197   48.403  95.877  1.00 87.84  ? 46  LEU E C   1 
ATOM   7757  O O   . LEU E  5  46  ? 2.930   47.431  95.686  1.00 87.28  ? 46  LEU E O   1 
ATOM   7758  C CB  . LEU E  5  46  ? 1.893   49.171  93.519  1.00 80.66  ? 46  LEU E CB  1 
ATOM   7759  C CG  . LEU E  5  46  ? 1.596   50.215  92.439  1.00 77.79  ? 46  LEU E CG  1 
ATOM   7760  C CD1 . LEU E  5  46  ? 1.549   49.545  91.074  1.00 76.22  ? 46  LEU E CD1 1 
ATOM   7761  C CD2 . LEU E  5  46  ? 0.300   50.965  92.713  1.00 78.51  ? 46  LEU E CD2 1 
ATOM   7762  N N   . VAL E  5  47  ? 1.333   48.477  96.887  1.00 90.83  ? 47  VAL E N   1 
ATOM   7763  C CA  . VAL E  5  47  ? 1.130   47.370  97.823  1.00 93.57  ? 47  VAL E CA  1 
ATOM   7764  C C   . VAL E  5  47  ? -0.262  46.782  97.603  1.00 94.06  ? 47  VAL E C   1 
ATOM   7765  O O   . VAL E  5  47  ? -1.263  47.498  97.672  1.00 92.98  ? 47  VAL E O   1 
ATOM   7766  C CB  . VAL E  5  47  ? 1.297   47.814  99.296  1.00 96.28  ? 47  VAL E CB  1 
ATOM   7767  C CG1 . VAL E  5  47  ? 1.355   46.604  100.217 1.00 98.69  ? 47  VAL E CG1 1 
ATOM   7768  C CG2 . VAL E  5  47  ? 2.548   48.664  99.470  1.00 95.13  ? 47  VAL E CG2 1 
ATOM   7769  N N   . ALA E  5  48  ? -0.318  45.479  97.335  1.00 96.13  ? 48  ALA E N   1 
ATOM   7770  C CA  . ALA E  5  48  ? -1.574  44.820  96.978  1.00 99.29  ? 48  ALA E CA  1 
ATOM   7771  C C   . ALA E  5  48  ? -1.890  43.603  97.845  1.00 101.85 ? 48  ALA E C   1 
ATOM   7772  O O   . ALA E  5  48  ? -0.990  42.865  98.252  1.00 102.27 ? 48  ALA E O   1 
ATOM   7773  C CB  . ALA E  5  48  ? -1.562  44.434  95.506  1.00 99.74  ? 48  ALA E CB  1 
ATOM   7774  N N   . LEU E  5  49  ? -3.179  43.408  98.114  1.00 103.90 ? 49  LEU E N   1 
ATOM   7775  C CA  . LEU E  5  49  ? -3.664  42.262  98.879  1.00 106.00 ? 49  LEU E CA  1 
ATOM   7776  C C   . LEU E  5  49  ? -4.175  41.174  97.936  1.00 107.09 ? 49  LEU E C   1 
ATOM   7777  O O   . LEU E  5  49  ? -4.952  41.450  97.019  1.00 108.62 ? 49  LEU E O   1 
ATOM   7778  C CB  . LEU E  5  49  ? -4.770  42.696  99.849  1.00 107.18 ? 49  LEU E CB  1 
ATOM   7779  C CG  . LEU E  5  49  ? -5.278  41.697  100.895 1.00 107.72 ? 49  LEU E CG  1 
ATOM   7780  C CD1 . LEU E  5  49  ? -4.269  41.508  102.020 1.00 108.17 ? 49  LEU E CD1 1 
ATOM   7781  C CD2 . LEU E  5  49  ? -6.615  42.158  101.454 1.00 106.88 ? 49  LEU E CD2 1 
ATOM   7782  N N   . LYS E  5  50  ? -3.733  39.941  98.172  1.00 106.78 ? 50  LYS E N   1 
ATOM   7783  C CA  . LYS E  5  50  ? -4.078  38.808  97.313  1.00 106.67 ? 50  LYS E CA  1 
ATOM   7784  C C   . LYS E  5  50  ? -5.261  38.011  97.857  1.00 107.35 ? 50  LYS E C   1 
ATOM   7785  O O   . LYS E  5  50  ? -5.428  37.882  99.072  1.00 107.10 ? 50  LYS E O   1 
ATOM   7786  C CB  . LYS E  5  50  ? -2.872  37.883  97.140  1.00 106.27 ? 50  LYS E CB  1 
ATOM   7787  C CG  . LYS E  5  50  ? -1.701  38.488  96.383  1.00 104.47 ? 50  LYS E CG  1 
ATOM   7788  C CD  . LYS E  5  50  ? -0.528  37.521  96.352  1.00 102.79 ? 50  LYS E CD  1 
ATOM   7789  C CE  . LYS E  5  50  ? 0.565   37.995  95.411  1.00 101.73 ? 50  LYS E CE  1 
ATOM   7790  N NZ  . LYS E  5  50  ? 1.764   37.116  95.476  1.00 103.31 ? 50  LYS E NZ  1 
ATOM   7791  N N   . ARG E  5  51  ? -6.072  37.474  96.946  1.00 109.52 ? 51  ARG E N   1 
ATOM   7792  C CA  . ARG E  5  51  ? -7.223  36.646  97.310  1.00 111.37 ? 51  ARG E CA  1 
ATOM   7793  C C   . ARG E  5  51  ? -7.011  35.181  96.938  1.00 113.07 ? 51  ARG E C   1 
ATOM   7794  O O   . ARG E  5  51  ? -6.252  34.865  96.018  1.00 113.80 ? 51  ARG E O   1 
ATOM   7795  C CB  . ARG E  5  51  ? -8.502  37.157  96.641  1.00 110.49 ? 51  ARG E CB  1 
ATOM   7796  C CG  . ARG E  5  51  ? -8.972  38.518  97.120  1.00 110.04 ? 51  ARG E CG  1 
ATOM   7797  C CD  . ARG E  5  51  ? -10.361 38.834  96.590  1.00 112.09 ? 51  ARG E CD  1 
ATOM   7798  N NE  . ARG E  5  51  ? -11.407 38.434  97.528  1.00 116.40 ? 51  ARG E NE  1 
ATOM   7799  C CZ  . ARG E  5  51  ? -11.993 39.255  98.396  1.00 120.03 ? 51  ARG E CZ  1 
ATOM   7800  N NH1 . ARG E  5  51  ? -11.645 40.535  98.451  1.00 119.77 ? 51  ARG E NH1 1 
ATOM   7801  N NH2 . ARG E  5  51  ? -12.935 38.799  99.210  1.00 120.82 ? 51  ARG E NH2 1 
ATOM   7802  N N   . ALA E  5  52  ? -7.695  34.298  97.661  1.00 114.18 ? 52  ALA E N   1 
ATOM   7803  C CA  . ALA E  5  52  ? -7.680  32.868  97.374  1.00 116.22 ? 52  ALA E CA  1 
ATOM   7804  C C   . ALA E  5  52  ? -9.083  32.284  97.522  1.00 123.66 ? 52  ALA E C   1 
ATOM   7805  O O   . ALA E  5  52  ? -9.732  32.463  98.556  1.00 125.18 ? 52  ALA E O   1 
ATOM   7806  C CB  . ALA E  5  52  ? -6.699  32.149  98.288  1.00 114.23 ? 52  ALA E CB  1 
ATOM   7807  N N   . GLN E  5  53  ? -9.544  31.597  96.478  1.00 128.46 ? 53  GLN E N   1 
ATOM   7808  C CA  . GLN E  5  53  ? -10.860 30.954  96.480  1.00 132.89 ? 53  GLN E CA  1 
ATOM   7809  C C   . GLN E  5  53  ? -10.902 29.773  97.446  1.00 134.17 ? 53  GLN E C   1 
ATOM   7810  O O   . GLN E  5  53  ? -11.928 29.513  98.078  1.00 136.94 ? 53  GLN E O   1 
ATOM   7811  C CB  . GLN E  5  53  ? -11.247 30.501  95.070  1.00 137.94 ? 53  GLN E CB  1 
ATOM   7812  C CG  . GLN E  5  53  ? -11.623 31.636  94.130  1.00 142.63 ? 53  GLN E CG  1 
ATOM   7813  C CD  . GLN E  5  53  ? -12.042 31.152  92.753  1.00 146.68 ? 53  GLN E CD  1 
ATOM   7814  O OE1 . GLN E  5  53  ? -11.441 30.234  92.191  1.00 140.65 ? 53  GLN E OE1 1 
ATOM   7815  N NE2 . GLN E  5  53  ? -13.075 31.775  92.199  1.00 146.86 ? 53  GLN E NE2 1 
ATOM   7816  N N   . SER E  5  54  ? -9.779  29.065  97.547  1.00 134.84 ? 54  SER E N   1 
ATOM   7817  C CA  . SER E  5  54  ? -9.616  27.974  98.502  1.00 138.62 ? 54  SER E CA  1 
ATOM   7818  C C   . SER E  5  54  ? -8.206  27.993  99.091  1.00 140.15 ? 54  SER E C   1 
ATOM   7819  O O   . SER E  5  54  ? -7.284  28.557  98.495  1.00 138.93 ? 54  SER E O   1 
ATOM   7820  C CB  . SER E  5  54  ? -9.909  26.623  97.841  1.00 137.75 ? 54  SER E CB  1 
ATOM   7821  O OG  . SER E  5  54  ? -9.054  26.391  96.736  1.00 135.56 ? 54  SER E OG  1 
ATOM   7822  N N   . GLU E  5  55  ? -8.051  27.379  100.262 1.00 144.41 ? 55  GLU E N   1 
ATOM   7823  C CA  . GLU E  5  55  ? -6.760  27.317  100.954 1.00 145.53 ? 55  GLU E CA  1 
ATOM   7824  C C   . GLU E  5  55  ? -5.734  26.443  100.226 1.00 139.87 ? 55  GLU E C   1 
ATOM   7825  O O   . GLU E  5  55  ? -4.526  26.617  100.402 1.00 138.73 ? 55  GLU E O   1 
ATOM   7826  C CB  . GLU E  5  55  ? -6.938  26.845  102.403 1.00 152.27 ? 55  GLU E CB  1 
ATOM   7827  C CG  . GLU E  5  55  ? -7.637  25.500  102.562 1.00 155.39 ? 55  GLU E CG  1 
ATOM   7828  C CD  . GLU E  5  55  ? -7.631  24.991  103.992 1.00 162.59 ? 55  GLU E CD  1 
ATOM   7829  O OE1 . GLU E  5  55  ? -7.657  25.818  104.931 1.00 166.22 ? 55  GLU E OE1 1 
ATOM   7830  O OE2 . GLU E  5  55  ? -7.605  23.756  104.179 1.00 163.43 ? 55  GLU E OE2 1 
ATOM   7831  N N   . LEU E  5  56  ? -6.226  25.508  99.415  1.00 135.23 ? 56  LEU E N   1 
ATOM   7832  C CA  . LEU E  5  56  ? -5.373  24.634  98.611  1.00 130.30 ? 56  LEU E CA  1 
ATOM   7833  C C   . LEU E  5  56  ? -4.839  25.331  97.362  1.00 125.90 ? 56  LEU E C   1 
ATOM   7834  O O   . LEU E  5  56  ? -3.759  24.995  96.871  1.00 121.48 ? 56  LEU E O   1 
ATOM   7835  C CB  . LEU E  5  56  ? -6.128  23.356  98.224  1.00 129.19 ? 56  LEU E CB  1 
ATOM   7836  C CG  . LEU E  5  56  ? -5.950  22.077  99.056  1.00 128.65 ? 56  LEU E CG  1 
ATOM   7837  C CD1 . LEU E  5  56  ? -4.567  21.478  98.844  1.00 124.36 ? 56  LEU E CD1 1 
ATOM   7838  C CD2 . LEU E  5  56  ? -6.223  22.280  100.542 1.00 130.48 ? 56  LEU E CD2 1 
ATOM   7839  N N   . ALA E  5  57  ? -5.602  26.296  96.854  1.00 122.24 ? 57  ALA E N   1 
ATOM   7840  C CA  . ALA E  5  57  ? -5.206  27.072  95.683  1.00 117.00 ? 57  ALA E CA  1 
ATOM   7841  C C   . ALA E  5  57  ? -4.278  28.221  96.068  1.00 113.63 ? 57  ALA E C   1 
ATOM   7842  O O   . ALA E  5  57  ? -4.383  28.773  97.167  1.00 114.28 ? 57  ALA E O   1 
ATOM   7843  C CB  . ALA E  5  57  ? -6.435  27.602  94.961  1.00 115.55 ? 57  ALA E CB  1 
ATOM   7844  N N   . ALA E  5  58  ? -3.374  28.574  95.156  1.00 110.10 ? 58  ALA E N   1 
ATOM   7845  C CA  . ALA E  5  58  ? -2.446  29.685  95.364  1.00 107.09 ? 58  ALA E CA  1 
ATOM   7846  C C   . ALA E  5  58  ? -3.156  31.036  95.256  1.00 106.78 ? 58  ALA E C   1 
ATOM   7847  O O   . ALA E  5  58  ? -4.301  31.113  94.803  1.00 104.56 ? 58  ALA E O   1 
ATOM   7848  C CB  . ALA E  5  58  ? -1.289  29.604  94.377  1.00 104.58 ? 58  ALA E CB  1 
ATOM   7849  N N   . HIS E  5  59  ? -2.470  32.093  95.681  1.00 108.57 ? 59  HIS E N   1 
ATOM   7850  C CA  . HIS E  5  59  ? -3.031  33.441  95.671  1.00 110.69 ? 59  HIS E CA  1 
ATOM   7851  C C   . HIS E  5  59  ? -2.941  34.086  94.315  1.00 113.02 ? 59  HIS E C   1 
ATOM   7852  O O   . HIS E  5  59  ? -2.004  33.828  93.555  1.00 113.35 ? 59  HIS E O   1 
ATOM   7853  C CB  . HIS E  5  59  ? -2.350  34.305  96.725  1.00 110.95 ? 59  HIS E CB  1 
ATOM   7854  C CG  . HIS E  5  59  ? -2.692  33.915  98.145  1.00 112.60 ? 59  HIS E CG  1 
ATOM   7855  N ND1 . HIS E  5  59  ? -3.668  34.520  98.846  1.00 112.42 ? 59  HIS E ND1 1 
ATOM   7856  C CD2 . HIS E  5  59  ? -2.149  32.944  98.984  1.00 114.06 ? 59  HIS E CD2 1 
ATOM   7857  C CE1 . HIS E  5  59  ? -3.747  33.969  100.072 1.00 113.52 ? 59  HIS E CE1 1 
ATOM   7858  N NE2 . HIS E  5  59  ? -2.817  33.004  100.155 1.00 114.97 ? 59  HIS E NE2 1 
ATOM   7859  N N   . GLN E  5  60  ? -3.924  34.931  94.008  1.00 115.60 ? 60  GLN E N   1 
ATOM   7860  C CA  . GLN E  5  60  ? -4.025  35.603  92.710  1.00 118.12 ? 60  GLN E CA  1 
ATOM   7861  C C   . GLN E  5  60  ? -2.944  36.657  92.485  1.00 114.56 ? 60  GLN E C   1 
ATOM   7862  O O   . GLN E  5  60  ? -2.502  37.318  93.426  1.00 113.12 ? 60  GLN E O   1 
ATOM   7863  C CB  . GLN E  5  60  ? -5.408  36.241  92.549  1.00 120.96 ? 60  GLN E CB  1 
ATOM   7864  C CG  . GLN E  5  60  ? -6.441  35.343  91.887  1.00 123.51 ? 60  GLN E CG  1 
ATOM   7865  C CD  . GLN E  5  60  ? -6.259  35.248  90.382  1.00 121.25 ? 60  GLN E CD  1 
ATOM   7866  O OE1 . GLN E  5  60  ? -6.188  36.262  89.685  1.00 122.39 ? 60  GLN E OE1 1 
ATOM   7867  N NE2 . GLN E  5  60  ? -6.190  34.025  89.873  1.00 115.75 ? 60  GLN E NE2 1 
ATOM   7868  N N   . LYS E  5  61  ? -2.530  36.804  91.227  1.00 109.85 ? 61  LYS E N   1 
ATOM   7869  C CA  . LYS E  5  61  ? -1.581  37.842  90.829  1.00 103.31 ? 61  LYS E CA  1 
ATOM   7870  C C   . LYS E  5  61  ? -2.283  39.195  90.776  1.00 98.46  ? 61  LYS E C   1 
ATOM   7871  O O   . LYS E  5  61  ? -3.329  39.337  90.138  1.00 98.06  ? 61  LYS E O   1 
ATOM   7872  C CB  . LYS E  5  61  ? -0.956  37.515  89.469  1.00 103.01 ? 61  LYS E CB  1 
ATOM   7873  C CG  . LYS E  5  61  ? -0.039  36.300  89.472  1.00 107.07 ? 61  LYS E CG  1 
ATOM   7874  C CD  . LYS E  5  61  ? 0.541   36.021  88.092  1.00 112.66 ? 61  LYS E CD  1 
ATOM   7875  C CE  . LYS E  5  61  ? -0.457  35.316  87.185  1.00 116.69 ? 61  LYS E CE  1 
ATOM   7876  N NZ  . LYS E  5  61  ? 0.110   35.056  85.833  1.00 119.40 ? 61  LYS E NZ  1 
ATOM   7877  N N   . LYS E  5  62  ? -1.705  40.184  91.453  1.00 94.31  ? 62  LYS E N   1 
ATOM   7878  C CA  . LYS E  5  62  ? -2.315  41.510  91.556  1.00 92.71  ? 62  LYS E CA  1 
ATOM   7879  C C   . LYS E  5  62  ? -1.496  42.618  90.893  1.00 87.32  ? 62  LYS E C   1 
ATOM   7880  O O   . LYS E  5  62  ? -2.050  43.635  90.472  1.00 85.38  ? 62  LYS E O   1 
ATOM   7881  C CB  . LYS E  5  62  ? -2.600  41.863  93.021  1.00 96.52  ? 62  LYS E CB  1 
ATOM   7882  C CG  . LYS E  5  62  ? -3.794  41.135  93.632  1.00 99.71  ? 62  LYS E CG  1 
ATOM   7883  C CD  . LYS E  5  62  ? -5.132  41.649  93.109  1.00 102.20 ? 62  LYS E CD  1 
ATOM   7884  C CE  . LYS E  5  62  ? -5.661  42.829  93.913  1.00 103.48 ? 62  LYS E CE  1 
ATOM   7885  N NZ  . LYS E  5  62  ? -4.960  44.110  93.625  1.00 105.52 ? 62  LYS E NZ  1 
ATOM   7886  N N   . ILE E  5  63  ? -0.183  42.420  90.806  1.00 85.90  ? 63  ILE E N   1 
ATOM   7887  C CA  . ILE E  5  63  ? 0.708   43.401  90.186  1.00 84.02  ? 63  ILE E CA  1 
ATOM   7888  C C   . ILE E  5  63  ? 1.293   42.848  88.885  1.00 82.79  ? 63  ILE E C   1 
ATOM   7889  O O   . ILE E  5  63  ? 1.861   41.753  88.864  1.00 83.59  ? 63  ILE E O   1 
ATOM   7890  C CB  . ILE E  5  63  ? 1.829   43.854  91.153  1.00 84.18  ? 63  ILE E CB  1 
ATOM   7891  C CG1 . ILE E  5  63  ? 1.223   44.435  92.438  1.00 85.01  ? 63  ILE E CG1 1 
ATOM   7892  C CG2 . ILE E  5  63  ? 2.736   44.881  90.486  1.00 83.00  ? 63  ILE E CG2 1 
ATOM   7893  C CD1 . ILE E  5  63  ? 2.217   44.658  93.559  1.00 87.31  ? 63  ILE E CD1 1 
ATOM   7894  N N   . LEU E  5  64  ? 1.141   43.613  87.805  1.00 80.27  ? 64  LEU E N   1 
ATOM   7895  C CA  . LEU E  5  64  ? 1.595   43.196  86.479  1.00 80.25  ? 64  LEU E CA  1 
ATOM   7896  C C   . LEU E  5  64  ? 2.606   44.171  85.876  1.00 78.73  ? 64  LEU E C   1 
ATOM   7897  O O   . LEU E  5  64  ? 2.552   45.376  86.134  1.00 79.10  ? 64  LEU E O   1 
ATOM   7898  C CB  . LEU E  5  64  ? 0.400   43.030  85.534  1.00 81.08  ? 64  LEU E CB  1 
ATOM   7899  C CG  . LEU E  5  64  ? -0.603  41.906  85.820  1.00 83.92  ? 64  LEU E CG  1 
ATOM   7900  C CD1 . LEU E  5  64  ? -1.954  42.221  85.196  1.00 84.22  ? 64  LEU E CD1 1 
ATOM   7901  C CD2 . LEU E  5  64  ? -0.086  40.557  85.337  1.00 85.47  ? 64  LEU E CD2 1 
ATOM   7902  N N   . HIS E  5  65  ? 3.523   43.634  85.072  1.00 79.72  ? 65  HIS E N   1 
ATOM   7903  C CA  . HIS E  5  65  ? 4.523   44.436  84.367  1.00 80.32  ? 65  HIS E CA  1 
ATOM   7904  C C   . HIS E  5  65  ? 3.947   45.141  83.175  1.00 77.34  ? 65  HIS E C   1 
ATOM   7905  O O   . HIS E  5  65  ? 3.095   44.595  82.471  1.00 77.60  ? 65  HIS E O   1 
ATOM   7906  C CB  . HIS E  5  65  ? 5.687   43.561  83.915  1.00 85.00  ? 65  HIS E CB  1 
ATOM   7907  C CG  . HIS E  5  65  ? 6.834   43.516  84.892  1.00 91.37  ? 65  HIS E CG  1 
ATOM   7908  N ND1 . HIS E  5  65  ? 7.756   44.491  84.966  1.00 94.62  ? 65  HIS E ND1 1 
ATOM   7909  C CD2 . HIS E  5  65  ? 7.193   42.561  85.840  1.00 92.85  ? 65  HIS E CD2 1 
ATOM   7910  C CE1 . HIS E  5  65  ? 8.657   44.183  85.917  1.00 96.59  ? 65  HIS E CE1 1 
ATOM   7911  N NE2 . HIS E  5  65  ? 8.311   43.001  86.452  1.00 94.87  ? 65  HIS E NE2 1 
ATOM   7912  N N   . VAL E  5  66  ? 4.411   46.367  82.943  1.00 76.37  ? 66  VAL E N   1 
ATOM   7913  C CA  . VAL E  5  66  ? 4.042   47.133  81.751  1.00 76.02  ? 66  VAL E CA  1 
ATOM   7914  C C   . VAL E  5  66  ? 5.306   47.506  80.974  1.00 78.12  ? 66  VAL E C   1 
ATOM   7915  O O   . VAL E  5  66  ? 5.425   47.204  79.784  1.00 78.96  ? 66  VAL E O   1 
ATOM   7916  C CB  . VAL E  5  66  ? 3.220   48.397  82.102  1.00 74.92  ? 66  VAL E CB  1 
ATOM   7917  C CG1 . VAL E  5  66  ? 2.988   49.259  80.867  1.00 75.43  ? 66  VAL E CG1 1 
ATOM   7918  C CG2 . VAL E  5  66  ? 1.889   48.016  82.735  1.00 74.86  ? 66  VAL E CG2 1 
ATOM   7919  N N   . ASP E  5  67  ? 6.243   48.156  81.662  1.00 79.81  ? 67  ASP E N   1 
ATOM   7920  C CA  . ASP E  5  67  ? 7.526   48.546  81.082  1.00 81.79  ? 67  ASP E CA  1 
ATOM   7921  C C   . ASP E  5  67  ? 8.599   48.590  82.175  1.00 80.81  ? 67  ASP E C   1 
ATOM   7922  O O   . ASP E  5  67  ? 8.351   48.180  83.313  1.00 80.51  ? 67  ASP E O   1 
ATOM   7923  C CB  . ASP E  5  67  ? 7.403   49.906  80.376  1.00 82.89  ? 67  ASP E CB  1 
ATOM   7924  C CG  . ASP E  5  67  ? 8.403   50.078  79.235  1.00 83.68  ? 67  ASP E CG  1 
ATOM   7925  O OD1 . ASP E  5  67  ? 9.247   49.181  79.018  1.00 83.67  ? 67  ASP E OD1 1 
ATOM   7926  O OD2 . ASP E  5  67  ? 8.343   51.122  78.552  1.00 78.93  ? 67  ASP E OD2 1 
ATOM   7927  N N   . ASN E  5  68  ? 9.787   49.081  81.824  1.00 79.51  ? 68  ASN E N   1 
ATOM   7928  C CA  . ASN E  5  68  ? 10.897  49.206  82.768  1.00 78.78  ? 68  ASN E CA  1 
ATOM   7929  C C   . ASN E  5  68  ? 10.681  50.297  83.816  1.00 76.53  ? 68  ASN E C   1 
ATOM   7930  O O   . ASN E  5  68  ? 11.320  50.288  84.871  1.00 79.53  ? 68  ASN E O   1 
ATOM   7931  C CB  . ASN E  5  68  ? 12.211  49.457  82.018  1.00 80.81  ? 68  ASN E CB  1 
ATOM   7932  C CG  . ASN E  5  68  ? 12.648  48.268  81.180  1.00 80.66  ? 68  ASN E CG  1 
ATOM   7933  O OD1 . ASN E  5  68  ? 12.541  47.116  81.604  1.00 81.33  ? 68  ASN E OD1 1 
ATOM   7934  N ND2 . ASN E  5  68  ? 13.155  48.545  79.984  1.00 81.10  ? 68  ASN E ND2 1 
ATOM   7935  N N   . HIS E  5  69  ? 9.776   51.227  83.523  1.00 72.84  ? 69  HIS E N   1 
ATOM   7936  C CA  . HIS E  5  69  ? 9.524   52.372  84.396  1.00 72.16  ? 69  HIS E CA  1 
ATOM   7937  C C   . HIS E  5  69  ? 8.084   52.507  84.818  1.00 72.16  ? 69  HIS E C   1 
ATOM   7938  O O   . HIS E  5  69  ? 7.765   53.320  85.686  1.00 75.22  ? 69  HIS E O   1 
ATOM   7939  C CB  . HIS E  5  69  ? 10.014  53.660  83.733  1.00 69.62  ? 69  HIS E CB  1 
ATOM   7940  C CG  . HIS E  5  69  ? 9.281   54.012  82.459  1.00 66.67  ? 69  HIS E CG  1 
ATOM   7941  N ND1 . HIS E  5  69  ? 9.347   53.252  81.350  1.00 66.35  ? 69  HIS E ND1 1 
ATOM   7942  C CD2 . HIS E  5  69  ? 8.460   55.092  82.144  1.00 65.35  ? 69  HIS E CD2 1 
ATOM   7943  C CE1 . HIS E  5  69  ? 8.600   53.808  80.379  1.00 65.25  ? 69  HIS E CE1 1 
ATOM   7944  N NE2 . HIS E  5  69  ? 8.061   54.936  80.866  1.00 64.59  ? 69  HIS E NE2 1 
ATOM   7945  N N   . ILE E  5  70  ? 7.203   51.710  84.214  1.00 71.67  ? 70  ILE E N   1 
ATOM   7946  C CA  . ILE E  5  70  ? 5.768   51.756  84.513  1.00 71.57  ? 70  ILE E CA  1 
ATOM   7947  C C   . ILE E  5  70  ? 5.231   50.384  84.935  1.00 72.52  ? 70  ILE E C   1 
ATOM   7948  O O   . ILE E  5  70  ? 5.528   49.369  84.299  1.00 72.03  ? 70  ILE E O   1 
ATOM   7949  C CB  . ILE E  5  70  ? 4.958   52.321  83.318  1.00 69.79  ? 70  ILE E CB  1 
ATOM   7950  C CG1 . ILE E  5  70  ? 5.260   53.811  83.125  1.00 69.34  ? 70  ILE E CG1 1 
ATOM   7951  C CG2 . ILE E  5  70  ? 3.460   52.114  83.516  1.00 70.60  ? 70  ILE E CG2 1 
ATOM   7952  C CD1 . ILE E  5  70  ? 4.871   54.362  81.769  1.00 68.92  ? 70  ILE E CD1 1 
ATOM   7953  N N   . GLY E  5  71  ? 4.449   50.369  86.014  1.00 74.21  ? 71  GLY E N   1 
ATOM   7954  C CA  . GLY E  5  71  ? 3.796   49.154  86.506  1.00 75.56  ? 71  GLY E CA  1 
ATOM   7955  C C   . GLY E  5  71  ? 2.393   49.418  87.027  1.00 75.51  ? 71  GLY E C   1 
ATOM   7956  O O   . GLY E  5  71  ? 2.064   50.548  87.397  1.00 76.29  ? 71  GLY E O   1 
ATOM   7957  N N   . ILE E  5  72  ? 1.566   48.373  87.061  1.00 74.81  ? 72  ILE E N   1 
ATOM   7958  C CA  . ILE E  5  72  ? 0.159   48.504  87.465  1.00 74.15  ? 72  ILE E CA  1 
ATOM   7959  C C   . ILE E  5  72  ? -0.287  47.491  88.522  1.00 75.38  ? 72  ILE E C   1 
ATOM   7960  O O   . ILE E  5  72  ? 0.285   46.406  88.641  1.00 76.22  ? 72  ILE E O   1 
ATOM   7961  C CB  . ILE E  5  72  ? -0.808  48.408  86.257  1.00 72.42  ? 72  ILE E CB  1 
ATOM   7962  C CG1 . ILE E  5  72  ? -0.590  47.102  85.476  1.00 71.80  ? 72  ILE E CG1 1 
ATOM   7963  C CG2 . ILE E  5  72  ? -0.663  49.627  85.358  1.00 72.43  ? 72  ILE E CG2 1 
ATOM   7964  C CD1 . ILE E  5  72  ? -1.759  46.691  84.605  1.00 70.98  ? 72  ILE E CD1 1 
ATOM   7965  N N   . SER E  5  73  ? -1.313  47.868  89.281  1.00 76.91  ? 73  SER E N   1 
ATOM   7966  C CA  . SER E  5  73  ? -2.001  46.960  90.195  1.00 79.24  ? 73  SER E CA  1 
ATOM   7967  C C   . SER E  5  73  ? -3.501  47.017  89.912  1.00 80.47  ? 73  SER E C   1 
ATOM   7968  O O   . SER E  5  73  ? -4.103  48.094  89.937  1.00 80.27  ? 73  SER E O   1 
ATOM   7969  C CB  . SER E  5  73  ? -1.705  47.316  91.654  1.00 81.11  ? 73  SER E CB  1 
ATOM   7970  O OG  . SER E  5  73  ? -2.121  48.636  91.956  1.00 82.78  ? 73  SER E OG  1 
ATOM   7971  N N   . ILE E  5  74  ? -4.095  45.857  89.640  1.00 81.90  ? 74  ILE E N   1 
ATOM   7972  C CA  . ILE E  5  74  ? -5.475  45.791  89.146  1.00 83.24  ? 74  ILE E CA  1 
ATOM   7973  C C   . ILE E  5  74  ? -6.511  45.519  90.243  1.00 85.96  ? 74  ILE E C   1 
ATOM   7974  O O   . ILE E  5  74  ? -6.182  44.988  91.307  1.00 89.35  ? 74  ILE E O   1 
ATOM   7975  C CB  . ILE E  5  74  ? -5.631  44.776  87.974  1.00 81.95  ? 74  ILE E CB  1 
ATOM   7976  C CG1 . ILE E  5  74  ? -5.997  43.360  88.468  1.00 82.81  ? 74  ILE E CG1 1 
ATOM   7977  C CG2 . ILE E  5  74  ? -4.402  44.786  87.065  1.00 81.65  ? 74  ILE E CG2 1 
ATOM   7978  C CD1 . ILE E  5  74  ? -4.858  42.539  89.040  1.00 82.93  ? 74  ILE E CD1 1 
ATOM   7979  N N   . ALA E  5  75  ? -7.759  45.898  89.969  1.00 86.94  ? 75  ALA E N   1 
ATOM   7980  C CA  . ALA E  5  75  ? -8.885  45.643  90.867  1.00 90.01  ? 75  ALA E CA  1 
ATOM   7981  C C   . ALA E  5  75  ? -10.186 45.509  90.074  1.00 89.93  ? 75  ALA E C   1 
ATOM   7982  O O   . ALA E  5  75  ? -10.711 46.496  89.553  1.00 87.82  ? 75  ALA E O   1 
ATOM   7983  C CB  . ALA E  5  75  ? -9.000  46.744  91.913  1.00 89.50  ? 75  ALA E CB  1 
ATOM   7984  N N   . GLY E  5  76  ? -10.692 44.281  89.980  1.00 89.89  ? 76  GLY E N   1 
ATOM   7985  C CA  . GLY E  5  76  ? -11.923 44.000  89.244  1.00 87.22  ? 76  GLY E CA  1 
ATOM   7986  C C   . GLY E  5  76  ? -11.858 42.708  88.452  1.00 84.79  ? 76  GLY E C   1 
ATOM   7987  O O   . GLY E  5  76  ? -11.484 41.662  88.987  1.00 86.67  ? 76  GLY E O   1 
ATOM   7988  N N   . LEU E  5  77  ? -12.226 42.786  87.175  1.00 83.64  ? 77  LEU E N   1 
ATOM   7989  C CA  . LEU E  5  77  ? -12.197 41.630  86.276  1.00 84.26  ? 77  LEU E CA  1 
ATOM   7990  C C   . LEU E  5  77  ? -10.772 41.302  85.837  1.00 85.10  ? 77  LEU E C   1 
ATOM   7991  O O   . LEU E  5  77  ? -9.990  42.200  85.522  1.00 84.83  ? 77  LEU E O   1 
ATOM   7992  C CB  . LEU E  5  77  ? -13.081 41.874  85.048  1.00 82.51  ? 77  LEU E CB  1 
ATOM   7993  C CG  . LEU E  5  77  ? -14.602 41.897  85.239  1.00 81.12  ? 77  LEU E CG  1 
ATOM   7994  C CD1 . LEU E  5  77  ? -15.276 42.611  84.077  1.00 79.76  ? 77  LEU E CD1 1 
ATOM   7995  C CD2 . LEU E  5  77  ? -15.165 40.492  85.406  1.00 81.65  ? 77  LEU E CD2 1 
ATOM   7996  N N   . THR E  5  78  ? -10.452 40.010  85.812  1.00 85.97  ? 78  THR E N   1 
ATOM   7997  C CA  . THR E  5  78  ? -9.105  39.540  85.483  1.00 86.49  ? 78  THR E CA  1 
ATOM   7998  C C   . THR E  5  78  ? -8.800  39.655  83.986  1.00 85.96  ? 78  THR E C   1 
ATOM   7999  O O   . THR E  5  78  ? -7.699  40.058  83.603  1.00 85.00  ? 78  THR E O   1 
ATOM   8000  C CB  . THR E  5  78  ? -8.883  38.085  85.954  1.00 88.22  ? 78  THR E CB  1 
ATOM   8001  O OG1 . THR E  5  78  ? -9.440  37.912  87.263  1.00 90.70  ? 78  THR E OG1 1 
ATOM   8002  C CG2 . THR E  5  78  ? -7.395  37.746  85.996  1.00 87.63  ? 78  THR E CG2 1 
ATOM   8003  N N   . ALA E  5  79  ? -9.777  39.303  83.152  1.00 85.61  ? 79  ALA E N   1 
ATOM   8004  C CA  . ALA E  5  79  ? -9.612  39.335  81.698  1.00 84.66  ? 79  ALA E CA  1 
ATOM   8005  C C   . ALA E  5  79  ? -9.545  40.760  81.147  1.00 82.79  ? 79  ALA E C   1 
ATOM   8006  O O   . ALA E  5  79  ? -8.809  41.025  80.195  1.00 83.13  ? 79  ALA E O   1 
ATOM   8007  C CB  . ALA E  5  79  ? -10.720 38.546  81.017  1.00 83.68  ? 79  ALA E CB  1 
ATOM   8008  N N   . ASP E  5  80  ? -10.311 41.667  81.751  1.00 80.19  ? 80  ASP E N   1 
ATOM   8009  C CA  . ASP E  5  80  ? -10.286 43.083  81.381  1.00 77.42  ? 80  ASP E CA  1 
ATOM   8010  C C   . ASP E  5  80  ? -8.999  43.764  81.843  1.00 74.68  ? 80  ASP E C   1 
ATOM   8011  O O   . ASP E  5  80  ? -8.558  44.746  81.242  1.00 74.39  ? 80  ASP E O   1 
ATOM   8012  C CB  . ASP E  5  80  ? -11.506 43.815  81.949  1.00 77.90  ? 80  ASP E CB  1 
ATOM   8013  C CG  . ASP E  5  80  ? -12.777 43.545  81.158  1.00 79.24  ? 80  ASP E CG  1 
ATOM   8014  O OD1 . ASP E  5  80  ? -12.832 42.539  80.417  1.00 80.97  ? 80  ASP E OD1 1 
ATOM   8015  O OD2 . ASP E  5  80  ? -13.730 44.344  81.278  1.00 80.24  ? 80  ASP E OD2 1 
ATOM   8016  N N   . ALA E  5  81  ? -8.408  43.234  82.913  1.00 73.84  ? 81  ALA E N   1 
ATOM   8017  C CA  . ALA E  5  81  ? -7.140  43.732  83.438  1.00 72.22  ? 81  ALA E CA  1 
ATOM   8018  C C   . ALA E  5  81  ? -5.985  43.410  82.496  1.00 70.41  ? 81  ALA E C   1 
ATOM   8019  O O   . ALA E  5  81  ? -5.131  44.259  82.242  1.00 69.66  ? 81  ALA E O   1 
ATOM   8020  C CB  . ALA E  5  81  ? -6.876  43.151  84.817  1.00 74.74  ? 81  ALA E CB  1 
ATOM   8021  N N   . ARG E  5  82  ? -5.974  42.181  81.982  1.00 70.68  ? 82  ARG E N   1 
ATOM   8022  C CA  . ARG E  5  82  ? -4.932  41.719  81.065  1.00 71.36  ? 82  ARG E CA  1 
ATOM   8023  C C   . ARG E  5  82  ? -5.074  42.327  79.670  1.00 69.84  ? 82  ARG E C   1 
ATOM   8024  O O   . ARG E  5  82  ? -4.082  42.484  78.954  1.00 70.92  ? 82  ARG E O   1 
ATOM   8025  C CB  . ARG E  5  82  ? -4.926  40.190  80.980  1.00 76.63  ? 82  ARG E CB  1 
ATOM   8026  C CG  . ARG E  5  82  ? -4.314  39.509  82.195  1.00 82.22  ? 82  ARG E CG  1 
ATOM   8027  C CD  . ARG E  5  82  ? -4.201  38.004  82.009  1.00 88.74  ? 82  ARG E CD  1 
ATOM   8028  N NE  . ARG E  5  82  ? -5.474  37.317  82.224  1.00 93.67  ? 82  ARG E NE  1 
ATOM   8029  C CZ  . ARG E  5  82  ? -6.253  36.841  81.255  1.00 94.78  ? 82  ARG E CZ  1 
ATOM   8030  N NH1 . ARG E  5  82  ? -5.902  36.967  79.981  1.00 92.83  ? 82  ARG E NH1 1 
ATOM   8031  N NH2 . ARG E  5  82  ? -7.390  36.233  81.565  1.00 96.04  ? 82  ARG E NH2 1 
ATOM   8032  N N   . LEU E  5  83  ? -6.307  42.663  79.295  1.00 69.00  ? 83  LEU E N   1 
ATOM   8033  C CA  . LEU E  5  83  ? -6.593  43.272  77.996  1.00 67.95  ? 83  LEU E CA  1 
ATOM   8034  C C   . LEU E  5  83  ? -6.087  44.713  77.931  1.00 69.26  ? 83  LEU E C   1 
ATOM   8035  O O   . LEU E  5  83  ? -5.540  45.136  76.910  1.00 70.04  ? 83  LEU E O   1 
ATOM   8036  C CB  . LEU E  5  83  ? -8.095  43.211  77.689  1.00 67.14  ? 83  LEU E CB  1 
ATOM   8037  C CG  . LEU E  5  83  ? -8.550  43.396  76.237  1.00 65.88  ? 83  LEU E CG  1 
ATOM   8038  C CD1 . LEU E  5  83  ? -8.194  42.189  75.380  1.00 65.78  ? 83  LEU E CD1 1 
ATOM   8039  C CD2 . LEU E  5  83  ? -10.046 43.658  76.180  1.00 67.13  ? 83  LEU E CD2 1 
ATOM   8040  N N   . LEU E  5  84  ? -6.272  45.456  79.022  1.00 70.33  ? 84  LEU E N   1 
ATOM   8041  C CA  . LEU E  5  84  ? -5.754  46.821  79.131  1.00 72.15  ? 84  LEU E CA  1 
ATOM   8042  C C   . LEU E  5  84  ? -4.245  46.840  79.354  1.00 73.13  ? 84  LEU E C   1 
ATOM   8043  O O   . LEU E  5  84  ? -3.564  47.773  78.926  1.00 74.76  ? 84  LEU E O   1 
ATOM   8044  C CB  . LEU E  5  84  ? -6.456  47.591  80.254  1.00 72.59  ? 84  LEU E CB  1 
ATOM   8045  C CG  . LEU E  5  84  ? -7.829  48.212  79.976  1.00 73.10  ? 84  LEU E CG  1 
ATOM   8046  C CD1 . LEU E  5  84  ? -8.415  48.765  81.264  1.00 74.44  ? 84  LEU E CD1 1 
ATOM   8047  C CD2 . LEU E  5  84  ? -7.755  49.305  78.918  1.00 74.09  ? 84  LEU E CD2 1 
ATOM   8048  N N   . CYS E  5  85  ? -3.736  45.809  80.027  1.00 72.10  ? 85  CYS E N   1 
ATOM   8049  C CA  . CYS E  5  85  ? -2.303  45.664  80.281  1.00 71.91  ? 85  CYS E CA  1 
ATOM   8050  C C   . CYS E  5  85  ? -1.527  45.456  78.982  1.00 72.10  ? 85  CYS E C   1 
ATOM   8051  O O   . CYS E  5  85  ? -0.439  46.008  78.809  1.00 71.93  ? 85  CYS E O   1 
ATOM   8052  C CB  . CYS E  5  85  ? -2.042  44.508  81.250  1.00 71.04  ? 85  CYS E CB  1 
ATOM   8053  S SG  . CYS E  5  85  ? -0.344  44.406  81.860  1.00 73.09  ? 85  CYS E SG  1 
ATOM   8054  N N   . ASN E  5  86  ? -2.097  44.664  78.074  1.00 71.52  ? 86  ASN E N   1 
ATOM   8055  C CA  . ASN E  5  86  ? -1.508  44.429  76.756  1.00 71.90  ? 86  ASN E CA  1 
ATOM   8056  C C   . ASN E  5  86  ? -1.489  45.687  75.891  1.00 71.10  ? 86  ASN E C   1 
ATOM   8057  O O   . ASN E  5  86  ? -0.574  45.880  75.089  1.00 71.86  ? 86  ASN E O   1 
ATOM   8058  C CB  . ASN E  5  86  ? -2.234  43.293  76.030  1.00 74.38  ? 86  ASN E CB  1 
ATOM   8059  C CG  . ASN E  5  86  ? -1.969  41.934  76.654  1.00 77.20  ? 86  ASN E CG  1 
ATOM   8060  O OD1 . ASN E  5  86  ? -0.857  41.642  77.099  1.00 77.81  ? 86  ASN E OD1 1 
ATOM   8061  N ND2 . ASN E  5  86  ? -2.994  41.090  76.684  1.00 79.60  ? 86  ASN E ND2 1 
ATOM   8062  N N   . PHE E  5  87  ? -2.503  46.534  76.064  1.00 70.72  ? 87  PHE E N   1 
ATOM   8063  C CA  . PHE E  5  87  ? -2.573  47.823  75.379  1.00 71.91  ? 87  PHE E CA  1 
ATOM   8064  C C   . PHE E  5  87  ? -1.515  48.786  75.916  1.00 72.95  ? 87  PHE E C   1 
ATOM   8065  O O   . PHE E  5  87  ? -0.885  49.516  75.147  1.00 74.18  ? 87  PHE E O   1 
ATOM   8066  C CB  . PHE E  5  87  ? -3.977  48.430  75.510  1.00 71.99  ? 87  PHE E CB  1 
ATOM   8067  C CG  . PHE E  5  87  ? -4.075  49.857  75.038  1.00 72.51  ? 87  PHE E CG  1 
ATOM   8068  C CD1 . PHE E  5  87  ? -4.044  50.162  73.680  1.00 72.09  ? 87  PHE E CD1 1 
ATOM   8069  C CD2 . PHE E  5  87  ? -4.206  50.896  75.953  1.00 73.57  ? 87  PHE E CD2 1 
ATOM   8070  C CE1 . PHE E  5  87  ? -4.136  51.477  73.247  1.00 71.79  ? 87  PHE E CE1 1 
ATOM   8071  C CE2 . PHE E  5  87  ? -4.298  52.212  75.525  1.00 73.98  ? 87  PHE E CE2 1 
ATOM   8072  C CZ  . PHE E  5  87  ? -4.263  52.503  74.170  1.00 72.73  ? 87  PHE E CZ  1 
ATOM   8073  N N   . MET E  5  88  ? -1.330  48.777  77.235  1.00 73.31  ? 88  MET E N   1 
ATOM   8074  C CA  . MET E  5  88  ? -0.327  49.614  77.892  1.00 73.82  ? 88  MET E CA  1 
ATOM   8075  C C   . MET E  5  88  ? 1.093   49.173  77.539  1.00 73.53  ? 88  MET E C   1 
ATOM   8076  O O   . MET E  5  88  ? 1.989   50.007  77.400  1.00 73.96  ? 88  MET E O   1 
ATOM   8077  C CB  . MET E  5  88  ? -0.527  49.609  79.411  1.00 73.71  ? 88  MET E CB  1 
ATOM   8078  C CG  . MET E  5  88  ? -1.768  50.356  79.877  1.00 73.61  ? 88  MET E CG  1 
ATOM   8079  S SD  . MET E  5  88  ? -2.033  50.265  81.659  1.00 72.40  ? 88  MET E SD  1 
ATOM   8080  C CE  . MET E  5  88  ? -0.807  51.430  82.248  1.00 71.52  ? 88  MET E CE  1 
ATOM   8081  N N   . ARG E  5  89  ? 1.283   47.863  77.389  1.00 71.88  ? 89  ARG E N   1 
ATOM   8082  C CA  . ARG E  5  89  ? 2.570   47.297  76.983  1.00 70.37  ? 89  ARG E CA  1 
ATOM   8083  C C   . ARG E  5  89  ? 2.908   47.654  75.537  1.00 70.34  ? 89  ARG E C   1 
ATOM   8084  O O   . ARG E  5  89  ? 4.058   47.971  75.225  1.00 69.63  ? 89  ARG E O   1 
ATOM   8085  C CB  . ARG E  5  89  ? 2.576   45.776  77.165  1.00 69.21  ? 89  ARG E CB  1 
ATOM   8086  C CG  . ARG E  5  89  ? 2.723   45.312  78.606  1.00 68.67  ? 89  ARG E CG  1 
ATOM   8087  C CD  . ARG E  5  89  ? 2.444   43.823  78.729  1.00 68.97  ? 89  ARG E CD  1 
ATOM   8088  N NE  . ARG E  5  89  ? 2.485   43.368  80.118  1.00 69.92  ? 89  ARG E NE  1 
ATOM   8089  C CZ  . ARG E  5  89  ? 2.201   42.131  80.519  1.00 71.02  ? 89  ARG E CZ  1 
ATOM   8090  N NH1 . ARG E  5  89  ? 1.848   41.199  79.642  1.00 71.00  ? 89  ARG E NH1 1 
ATOM   8091  N NH2 . ARG E  5  89  ? 2.271   41.823  81.807  1.00 70.49  ? 89  ARG E NH2 1 
ATOM   8092  N N   . GLN E  5  90  ? 1.899   47.606  74.668  1.00 70.46  ? 90  GLN E N   1 
ATOM   8093  C CA  . GLN E  5  90  ? 2.069   47.885  73.241  1.00 70.83  ? 90  GLN E CA  1 
ATOM   8094  C C   . GLN E  5  90  ? 2.412   49.351  72.977  1.00 70.96  ? 90  GLN E C   1 
ATOM   8095  O O   . GLN E  5  90  ? 3.280   49.649  72.155  1.00 70.78  ? 90  GLN E O   1 
ATOM   8096  C CB  . GLN E  5  90  ? 0.812   47.480  72.460  1.00 72.34  ? 90  GLN E CB  1 
ATOM   8097  C CG  . GLN E  5  90  ? 0.985   47.437  70.945  1.00 73.91  ? 90  GLN E CG  1 
ATOM   8098  C CD  . GLN E  5  90  ? 1.913   46.328  70.479  1.00 76.10  ? 90  GLN E CD  1 
ATOM   8099  O OE1 . GLN E  5  90  ? 1.878   45.210  70.995  1.00 76.94  ? 90  GLN E OE1 1 
ATOM   8100  N NE2 . GLN E  5  90  ? 2.745   46.633  69.489  1.00 76.54  ? 90  GLN E NE2 1 
ATOM   8101  N N   . GLU E  5  91  ? 1.733   50.255  73.681  1.00 71.64  ? 91  GLU E N   1 
ATOM   8102  C CA  . GLU E  5  91  ? 1.960   51.695  73.537  1.00 72.54  ? 91  GLU E CA  1 
ATOM   8103  C C   . GLU E  5  91  ? 3.343   52.119  74.032  1.00 71.47  ? 91  GLU E C   1 
ATOM   8104  O O   . GLU E  5  91  ? 3.944   53.049  73.489  1.00 72.36  ? 91  GLU E O   1 
ATOM   8105  C CB  . GLU E  5  91  ? 0.867   52.494  74.257  1.00 73.00  ? 91  GLU E CB  1 
ATOM   8106  C CG  . GLU E  5  91  ? -0.493  52.469  73.570  1.00 74.86  ? 91  GLU E CG  1 
ATOM   8107  C CD  . GLU E  5  91  ? -0.489  53.141  72.206  1.00 77.89  ? 91  GLU E CD  1 
ATOM   8108  O OE1 . GLU E  5  91  ? 0.109   54.230  72.070  1.00 78.47  ? 91  GLU E OE1 1 
ATOM   8109  O OE2 . GLU E  5  91  ? -1.093  52.579  71.268  1.00 79.16  ? 91  GLU E OE2 1 
ATOM   8110  N N   . CYS E  5  92  ? 3.838   51.431  75.059  1.00 70.49  ? 92  CYS E N   1 
ATOM   8111  C CA  . CYS E  5  92  ? 5.184   51.664  75.581  1.00 69.14  ? 92  CYS E CA  1 
ATOM   8112  C C   . CYS E  5  92  ? 6.256   51.131  74.632  1.00 67.80  ? 92  CYS E C   1 
ATOM   8113  O O   . CYS E  5  92  ? 7.336   51.715  74.518  1.00 69.50  ? 92  CYS E O   1 
ATOM   8114  C CB  . CYS E  5  92  ? 5.343   51.036  76.967  1.00 69.05  ? 92  CYS E CB  1 
ATOM   8115  S SG  . CYS E  5  92  ? 4.475   51.915  78.286  1.00 68.26  ? 92  CYS E SG  1 
ATOM   8116  N N   . LEU E  5  93  ? 5.950   50.024  73.958  1.00 65.59  ? 93  LEU E N   1 
ATOM   8117  C CA  . LEU E  5  93  ? 6.859   49.429  72.979  1.00 64.08  ? 93  LEU E CA  1 
ATOM   8118  C C   . LEU E  5  93  ? 6.967   50.278  71.714  1.00 62.96  ? 93  LEU E C   1 
ATOM   8119  O O   . LEU E  5  93  ? 8.040   50.367  71.114  1.00 62.25  ? 93  LEU E O   1 
ATOM   8120  C CB  . LEU E  5  93  ? 6.426   48.002  72.626  1.00 63.96  ? 93  LEU E CB  1 
ATOM   8121  C CG  . LEU E  5  93  ? 6.761   46.882  73.617  1.00 64.69  ? 93  LEU E CG  1 
ATOM   8122  C CD1 . LEU E  5  93  ? 5.863   45.676  73.385  1.00 65.69  ? 93  LEU E CD1 1 
ATOM   8123  C CD2 . LEU E  5  93  ? 8.229   46.483  73.542  1.00 65.36  ? 93  LEU E CD2 1 
ATOM   8124  N N   . ASP E  5  94  ? 5.855   50.899  71.323  1.00 62.48  ? 94  ASP E N   1 
ATOM   8125  C CA  . ASP E  5  94  ? 5.808   51.765  70.144  1.00 61.83  ? 94  ASP E CA  1 
ATOM   8126  C C   . ASP E  5  94  ? 6.632   53.039  70.329  1.00 62.51  ? 94  ASP E C   1 
ATOM   8127  O O   . ASP E  5  94  ? 7.254   53.524  69.382  1.00 61.78  ? 94  ASP E O   1 
ATOM   8128  C CB  . ASP E  5  94  ? 4.360   52.120  69.790  1.00 61.55  ? 94  ASP E CB  1 
ATOM   8129  C CG  . ASP E  5  94  ? 3.567   50.925  69.282  1.00 62.35  ? 94  ASP E CG  1 
ATOM   8130  O OD1 . ASP E  5  94  ? 4.160   50.023  68.652  1.00 63.43  ? 94  ASP E OD1 1 
ATOM   8131  O OD2 . ASP E  5  94  ? 2.340   50.892  69.511  1.00 63.33  ? 94  ASP E OD2 1 
ATOM   8132  N N   . SER E  5  95  ? 6.630   53.569  71.550  1.00 62.76  ? 95  SER E N   1 
ATOM   8133  C CA  . SER E  5  95  ? 7.384   54.775  71.880  1.00 64.25  ? 95  SER E CA  1 
ATOM   8134  C C   . SER E  5  95  ? 8.888   54.508  71.911  1.00 64.72  ? 95  SER E C   1 
ATOM   8135  O O   . SER E  5  95  ? 9.683   55.356  71.502  1.00 65.47  ? 95  SER E O   1 
ATOM   8136  C CB  . SER E  5  95  ? 6.917   55.349  73.219  1.00 65.24  ? 95  SER E CB  1 
ATOM   8137  O OG  . SER E  5  95  ? 7.505   56.614  73.472  1.00 66.14  ? 95  SER E OG  1 
ATOM   8138  N N   . ARG E  5  96  ? 9.266   53.326  72.394  1.00 65.29  ? 96  ARG E N   1 
ATOM   8139  C CA  . ARG E  5  96  ? 10.669  52.911  72.440  1.00 66.44  ? 96  ARG E CA  1 
ATOM   8140  C C   . ARG E  5  96  ? 11.186  52.506  71.060  1.00 65.62  ? 96  ARG E C   1 
ATOM   8141  O O   . ARG E  5  96  ? 12.387  52.570  70.798  1.00 67.41  ? 96  ARG E O   1 
ATOM   8142  C CB  . ARG E  5  96  ? 10.867  51.765  73.436  1.00 67.87  ? 96  ARG E CB  1 
ATOM   8143  C CG  . ARG E  5  96  ? 10.742  52.177  74.894  1.00 69.40  ? 96  ARG E CG  1 
ATOM   8144  C CD  . ARG E  5  96  ? 10.991  51.002  75.825  1.00 70.33  ? 96  ARG E CD  1 
ATOM   8145  N NE  . ARG E  5  96  ? 10.811  51.369  77.229  1.00 70.72  ? 96  ARG E NE  1 
ATOM   8146  C CZ  . ARG E  5  96  ? 11.775  51.838  78.018  1.00 69.70  ? 96  ARG E CZ  1 
ATOM   8147  N NH1 . ARG E  5  96  ? 13.007  52.007  77.553  1.00 71.30  ? 96  ARG E NH1 1 
ATOM   8148  N NH2 . ARG E  5  96  ? 11.505  52.142  79.281  1.00 67.73  ? 96  ARG E NH2 1 
ATOM   8149  N N   . PHE E  5  97  ? 10.272  52.085  70.189  1.00 63.07  ? 97  PHE E N   1 
ATOM   8150  C CA  . PHE E  5  97  ? 10.614  51.707  68.820  1.00 60.71  ? 97  PHE E CA  1 
ATOM   8151  C C   . PHE E  5  97  ? 10.840  52.943  67.952  1.00 60.30  ? 97  PHE E C   1 
ATOM   8152  O O   . PHE E  5  97  ? 11.774  52.983  67.147  1.00 62.02  ? 97  PHE E O   1 
ATOM   8153  C CB  . PHE E  5  97  ? 9.514   50.823  68.217  1.00 58.54  ? 97  PHE E CB  1 
ATOM   8154  C CG  . PHE E  5  97  ? 9.882   50.203  66.895  1.00 57.10  ? 97  PHE E CG  1 
ATOM   8155  C CD1 . PHE E  5  97  ? 10.589  49.005  66.846  1.00 56.33  ? 97  PHE E CD1 1 
ATOM   8156  C CD2 . PHE E  5  97  ? 9.512   50.810  65.698  1.00 56.41  ? 97  PHE E CD2 1 
ATOM   8157  C CE1 . PHE E  5  97  ? 10.926  48.430  65.629  1.00 56.10  ? 97  PHE E CE1 1 
ATOM   8158  C CE2 . PHE E  5  97  ? 9.847   50.240  64.479  1.00 55.68  ? 97  PHE E CE2 1 
ATOM   8159  C CZ  . PHE E  5  97  ? 10.555  49.049  64.444  1.00 55.84  ? 97  PHE E CZ  1 
ATOM   8160  N N   . VAL E  5  98  ? 9.984   53.948  68.130  1.00 58.51  ? 98  VAL E N   1 
ATOM   8161  C CA  . VAL E  5  98  ? 9.997   55.148  67.294  1.00 57.15  ? 98  VAL E CA  1 
ATOM   8162  C C   . VAL E  5  98  ? 10.923  56.229  67.851  1.00 58.29  ? 98  VAL E C   1 
ATOM   8163  O O   . VAL E  5  98  ? 11.810  56.712  67.145  1.00 59.77  ? 98  VAL E O   1 
ATOM   8164  C CB  . VAL E  5  98  ? 8.568   55.709  67.084  1.00 55.70  ? 98  VAL E CB  1 
ATOM   8165  C CG1 . VAL E  5  98  ? 8.602   57.033  66.334  1.00 56.91  ? 98  VAL E CG1 1 
ATOM   8166  C CG2 . VAL E  5  98  ? 7.704   54.704  66.334  1.00 54.91  ? 98  VAL E CG2 1 
ATOM   8167  N N   . PHE E  5  99  ? 10.719  56.597  69.114  1.00 60.24  ? 99  PHE E N   1 
ATOM   8168  C CA  . PHE E  5  99  ? 11.438  57.720  69.722  1.00 63.44  ? 99  PHE E CA  1 
ATOM   8169  C C   . PHE E  5  99  ? 12.649  57.309  70.562  1.00 66.69  ? 99  PHE E C   1 
ATOM   8170  O O   . PHE E  5  99  ? 13.437  58.165  70.975  1.00 68.74  ? 99  PHE E O   1 
ATOM   8171  C CB  . PHE E  5  99  ? 10.480  58.575  70.560  1.00 62.93  ? 99  PHE E CB  1 
ATOM   8172  C CG  . PHE E  5  99  ? 9.385   59.223  69.760  1.00 62.62  ? 99  PHE E CG  1 
ATOM   8173  C CD1 . PHE E  5  99  ? 8.119   58.650  69.699  1.00 62.78  ? 99  PHE E CD1 1 
ATOM   8174  C CD2 . PHE E  5  99  ? 9.618   60.406  69.066  1.00 63.84  ? 99  PHE E CD2 1 
ATOM   8175  C CE1 . PHE E  5  99  ? 7.106   59.243  68.961  1.00 63.81  ? 99  PHE E CE1 1 
ATOM   8176  C CE2 . PHE E  5  99  ? 8.609   61.003  68.325  1.00 65.35  ? 99  PHE E CE2 1 
ATOM   8177  C CZ  . PHE E  5  99  ? 7.352   60.422  68.274  1.00 65.42  ? 99  PHE E CZ  1 
ATOM   8178  N N   . ASP E  5  100 ? 12.786  56.005  70.808  1.00 68.05  ? 100 ASP E N   1 
ATOM   8179  C CA  . ASP E  5  100 ? 13.866  55.432  71.631  1.00 70.43  ? 100 ASP E CA  1 
ATOM   8180  C C   . ASP E  5  100 ? 13.735  55.754  73.125  1.00 70.29  ? 100 ASP E C   1 
ATOM   8181  O O   . ASP E  5  100 ? 14.103  54.939  73.974  1.00 72.02  ? 100 ASP E O   1 
ATOM   8182  C CB  . ASP E  5  100 ? 15.254  55.829  71.103  1.00 73.60  ? 100 ASP E CB  1 
ATOM   8183  C CG  . ASP E  5  100 ? 16.379  55.020  71.730  1.00 78.30  ? 100 ASP E CG  1 
ATOM   8184  O OD1 . ASP E  5  100 ? 16.259  53.777  71.808  1.00 79.51  ? 100 ASP E OD1 1 
ATOM   8185  O OD2 . ASP E  5  100 ? 17.392  55.628  72.136  1.00 80.85  ? 100 ASP E OD2 1 
ATOM   8186  N N   . ARG E  5  101 ? 13.212  56.939  73.434  1.00 68.47  ? 101 ARG E N   1 
ATOM   8187  C CA  . ARG E  5  101 ? 12.990  57.374  74.813  1.00 66.98  ? 101 ARG E CA  1 
ATOM   8188  C C   . ARG E  5  101 ? 11.803  56.643  75.452  1.00 65.99  ? 101 ARG E C   1 
ATOM   8189  O O   . ARG E  5  101 ? 10.871  56.247  74.748  1.00 65.45  ? 101 ARG E O   1 
ATOM   8190  C CB  . ARG E  5  101 ? 12.795  58.900  74.875  1.00 65.95  ? 101 ARG E CB  1 
ATOM   8191  C CG  . ARG E  5  101 ? 11.615  59.448  74.078  1.00 65.64  ? 101 ARG E CG  1 
ATOM   8192  C CD  . ARG E  5  101 ? 10.373  59.608  74.943  1.00 65.65  ? 101 ARG E CD  1 
ATOM   8193  N NE  . ARG E  5  101 ? 9.142   59.598  74.153  1.00 66.25  ? 101 ARG E NE  1 
ATOM   8194  C CZ  . ARG E  5  101 ? 8.510   60.685  73.718  1.00 67.16  ? 101 ARG E CZ  1 
ATOM   8195  N NH1 . ARG E  5  101 ? 8.983   61.896  73.988  1.00 67.26  ? 101 ARG E NH1 1 
ATOM   8196  N NH2 . ARG E  5  101 ? 7.397   60.558  73.009  1.00 68.00  ? 101 ARG E NH2 1 
ATOM   8197  N N   . PRO E  5  102 ? 11.842  56.448  76.787  1.00 64.80  ? 102 PRO E N   1 
ATOM   8198  C CA  . PRO E  5  102 ? 10.695  55.868  77.492  1.00 63.46  ? 102 PRO E CA  1 
ATOM   8199  C C   . PRO E  5  102 ? 9.503   56.826  77.533  1.00 63.39  ? 102 PRO E C   1 
ATOM   8200  O O   . PRO E  5  102 ? 9.674   58.018  77.801  1.00 64.07  ? 102 PRO E O   1 
ATOM   8201  C CB  . PRO E  5  102 ? 11.235  55.612  78.904  1.00 62.47  ? 102 PRO E CB  1 
ATOM   8202  C CG  . PRO E  5  102 ? 12.400  56.527  79.049  1.00 63.11  ? 102 PRO E CG  1 
ATOM   8203  C CD  . PRO E  5  102 ? 13.002  56.629  77.680  1.00 64.52  ? 102 PRO E CD  1 
ATOM   8204  N N   . LEU E  5  103 ? 8.311   56.299  77.260  1.00 62.54  ? 103 LEU E N   1 
ATOM   8205  C CA  . LEU E  5  103 ? 7.084   57.095  77.237  1.00 62.45  ? 103 LEU E CA  1 
ATOM   8206  C C   . LEU E  5  103 ? 6.708   57.592  78.635  1.00 63.25  ? 103 LEU E C   1 
ATOM   8207  O O   . LEU E  5  103 ? 6.640   56.798  79.576  1.00 63.17  ? 103 LEU E O   1 
ATOM   8208  C CB  . LEU E  5  103 ? 5.929   56.282  76.637  1.00 61.50  ? 103 LEU E CB  1 
ATOM   8209  C CG  . LEU E  5  103 ? 4.594   56.980  76.350  1.00 60.58  ? 103 LEU E CG  1 
ATOM   8210  C CD1 . LEU E  5  103 ? 4.683   57.881  75.126  1.00 61.40  ? 103 LEU E CD1 1 
ATOM   8211  C CD2 . LEU E  5  103 ? 3.490   55.949  76.169  1.00 59.97  ? 103 LEU E CD2 1 
ATOM   8212  N N   . PRO E  5  104 ? 6.468   58.913  78.772  1.00 63.91  ? 104 PRO E N   1 
ATOM   8213  C CA  . PRO E  5  104 ? 6.060   59.505  80.050  1.00 64.93  ? 104 PRO E CA  1 
ATOM   8214  C C   . PRO E  5  104 ? 4.728   58.947  80.547  1.00 65.65  ? 104 PRO E C   1 
ATOM   8215  O O   . PRO E  5  104 ? 3.861   58.601  79.739  1.00 65.07  ? 104 PRO E O   1 
ATOM   8216  C CB  . PRO E  5  104 ? 5.922   60.995  79.722  1.00 65.96  ? 104 PRO E CB  1 
ATOM   8217  C CG  . PRO E  5  104 ? 6.771   61.203  78.514  1.00 65.61  ? 104 PRO E CG  1 
ATOM   8218  C CD  . PRO E  5  104 ? 6.633   59.937  77.725  1.00 64.01  ? 104 PRO E CD  1 
ATOM   8219  N N   . VAL E  5  105 ? 4.580   58.866  81.868  1.00 67.64  ? 105 VAL E N   1 
ATOM   8220  C CA  . VAL E  5  105 ? 3.395   58.279  82.500  1.00 67.61  ? 105 VAL E CA  1 
ATOM   8221  C C   . VAL E  5  105 ? 2.122   59.061  82.165  1.00 69.18  ? 105 VAL E C   1 
ATOM   8222  O O   . VAL E  5  105 ? 1.082   58.463  81.886  1.00 70.18  ? 105 VAL E O   1 
ATOM   8223  C CB  . VAL E  5  105 ? 3.557   58.168  84.034  1.00 68.13  ? 105 VAL E CB  1 
ATOM   8224  C CG1 . VAL E  5  105 ? 2.517   57.221  84.616  1.00 67.48  ? 105 VAL E CG1 1 
ATOM   8225  C CG2 . VAL E  5  105 ? 4.958   57.693  84.392  1.00 69.09  ? 105 VAL E CG2 1 
ATOM   8226  N N   . SER E  5  106 ? 2.222   60.391  82.176  1.00 70.59  ? 106 SER E N   1 
ATOM   8227  C CA  . SER E  5  106 ? 1.099   61.280  81.860  1.00 72.88  ? 106 SER E CA  1 
ATOM   8228  C C   . SER E  5  106 ? 0.533   61.046  80.457  1.00 71.41  ? 106 SER E C   1 
ATOM   8229  O O   . SER E  5  106 ? -0.663  61.235  80.224  1.00 72.48  ? 106 SER E O   1 
ATOM   8230  C CB  . SER E  5  106 ? 1.520   62.743  82.012  1.00 76.14  ? 106 SER E CB  1 
ATOM   8231  O OG  . SER E  5  106 ? 2.026   62.998  83.311  1.00 81.97  ? 106 SER E OG  1 
ATOM   8232  N N   . ARG E  5  107 ? 1.402   60.635  79.535  1.00 69.62  ? 107 ARG E N   1 
ATOM   8233  C CA  . ARG E  5  107 ? 1.014   60.342  78.157  1.00 67.94  ? 107 ARG E CA  1 
ATOM   8234  C C   . ARG E  5  107 ? 0.240   59.029  78.062  1.00 66.80  ? 107 ARG E C   1 
ATOM   8235  O O   . ARG E  5  107 ? -0.783  58.955  77.378  1.00 67.04  ? 107 ARG E O   1 
ATOM   8236  C CB  . ARG E  5  107 ? 2.249   60.279  77.249  1.00 67.63  ? 107 ARG E CB  1 
ATOM   8237  C CG  . ARG E  5  107 ? 3.155   61.500  77.303  1.00 68.17  ? 107 ARG E CG  1 
ATOM   8238  C CD  . ARG E  5  107 ? 2.700   62.600  76.357  1.00 70.11  ? 107 ARG E CD  1 
ATOM   8239  N NE  . ARG E  5  107 ? 3.582   63.765  76.422  1.00 72.27  ? 107 ARG E NE  1 
ATOM   8240  C CZ  . ARG E  5  107 ? 4.688   63.923  75.697  1.00 72.95  ? 107 ARG E CZ  1 
ATOM   8241  N NH1 . ARG E  5  107 ? 5.073   62.991  74.833  1.00 72.12  ? 107 ARG E NH1 1 
ATOM   8242  N NH2 . ARG E  5  107 ? 5.416   65.020  75.840  1.00 74.98  ? 107 ARG E NH2 1 
ATOM   8243  N N   . LEU E  5  108 ? 0.737   58.002  78.753  1.00 65.63  ? 108 LEU E N   1 
ATOM   8244  C CA  . LEU E  5  108 ? 0.158   56.658  78.705  1.00 64.66  ? 108 LEU E CA  1 
ATOM   8245  C C   . LEU E  5  108 ? -1.231  56.592  79.339  1.00 64.89  ? 108 LEU E C   1 
ATOM   8246  O O   . LEU E  5  108 ? -2.116  55.898  78.831  1.00 65.22  ? 108 LEU E O   1 
ATOM   8247  C CB  . LEU E  5  108 ? 1.099   55.644  79.370  1.00 63.75  ? 108 LEU E CB  1 
ATOM   8248  C CG  . LEU E  5  108 ? 0.761   54.150  79.276  1.00 63.71  ? 108 LEU E CG  1 
ATOM   8249  C CD1 . LEU E  5  108 ? 0.927   53.620  77.859  1.00 64.05  ? 108 LEU E CD1 1 
ATOM   8250  C CD2 . LEU E  5  108 ? 1.622   53.355  80.243  1.00 63.99  ? 108 LEU E CD2 1 
ATOM   8251  N N   . VAL E  5  109 ? -1.412  57.315  80.442  1.00 65.01  ? 109 VAL E N   1 
ATOM   8252  C CA  . VAL E  5  109 ? -2.697  57.373  81.144  1.00 65.39  ? 109 VAL E CA  1 
ATOM   8253  C C   . VAL E  5  109 ? -3.754  58.083  80.289  1.00 65.08  ? 109 VAL E C   1 
ATOM   8254  O O   . VAL E  5  109 ? -4.936  57.728  80.326  1.00 65.09  ? 109 VAL E O   1 
ATOM   8255  C CB  . VAL E  5  109 ? -2.559  58.044  82.532  1.00 66.81  ? 109 VAL E CB  1 
ATOM   8256  C CG1 . VAL E  5  109 ? -3.886  58.047  83.274  1.00 69.16  ? 109 VAL E CG1 1 
ATOM   8257  C CG2 . VAL E  5  109 ? -1.510  57.325  83.366  1.00 67.79  ? 109 VAL E CG2 1 
ATOM   8258  N N   . SER E  5  110 ? -3.314  59.072  79.511  1.00 64.65  ? 110 SER E N   1 
ATOM   8259  C CA  . SER E  5  110 ? -4.182  59.777  78.568  1.00 63.86  ? 110 SER E CA  1 
ATOM   8260  C C   . SER E  5  110 ? -4.630  58.870  77.422  1.00 63.58  ? 110 SER E C   1 
ATOM   8261  O O   . SER E  5  110 ? -5.713  59.058  76.864  1.00 63.83  ? 110 SER E O   1 
ATOM   8262  C CB  . SER E  5  110 ? -3.475  61.014  78.010  1.00 64.04  ? 110 SER E CB  1 
ATOM   8263  O OG  . SER E  5  110 ? -3.180  61.939  79.041  1.00 65.09  ? 110 SER E OG  1 
ATOM   8264  N N   . LEU E  5  111 ? -3.790  57.894  77.081  1.00 63.87  ? 111 LEU E N   1 
ATOM   8265  C CA  . LEU E  5  111 ? -4.102  56.914  76.039  1.00 64.29  ? 111 LEU E CA  1 
ATOM   8266  C C   . LEU E  5  111 ? -5.144  55.901  76.508  1.00 64.28  ? 111 LEU E C   1 
ATOM   8267  O O   . LEU E  5  111 ? -5.930  55.396  75.702  1.00 65.01  ? 111 LEU E O   1 
ATOM   8268  C CB  . LEU E  5  111 ? -2.834  56.194  75.569  1.00 64.05  ? 111 LEU E CB  1 
ATOM   8269  C CG  . LEU E  5  111 ? -1.790  57.002  74.789  1.00 64.28  ? 111 LEU E CG  1 
ATOM   8270  C CD1 . LEU E  5  111 ? -0.445  56.291  74.803  1.00 65.29  ? 111 LEU E CD1 1 
ATOM   8271  C CD2 . LEU E  5  111 ? -2.239  57.280  73.360  1.00 64.17  ? 111 LEU E CD2 1 
ATOM   8272  N N   . ILE E  5  112 ? -5.139  55.605  77.808  1.00 63.90  ? 112 ILE E N   1 
ATOM   8273  C CA  . ILE E  5  112 ? -6.146  54.732  78.419  1.00 63.55  ? 112 ILE E CA  1 
ATOM   8274  C C   . ILE E  5  112 ? -7.498  55.446  78.456  1.00 65.16  ? 112 ILE E C   1 
ATOM   8275  O O   . ILE E  5  112 ? -8.536  54.840  78.186  1.00 67.61  ? 112 ILE E O   1 
ATOM   8276  C CB  . ILE E  5  112 ? -5.744  54.284  79.846  1.00 61.81  ? 112 ILE E CB  1 
ATOM   8277  C CG1 . ILE E  5  112 ? -4.335  53.683  79.850  1.00 61.96  ? 112 ILE E CG1 1 
ATOM   8278  C CG2 . ILE E  5  112 ? -6.741  53.270  80.397  1.00 62.55  ? 112 ILE E CG2 1 
ATOM   8279  C CD1 . ILE E  5  112 ? -3.685  53.634  81.216  1.00 64.12  ? 112 ILE E CD1 1 
ATOM   8280  N N   . GLY E  5  113 ? -7.470  56.739  78.779  1.00 65.81  ? 113 GLY E N   1 
ATOM   8281  C CA  . GLY E  5  113 ? -8.673  57.571  78.803  1.00 67.38  ? 113 GLY E CA  1 
ATOM   8282  C C   . GLY E  5  113 ? -9.297  57.787  77.434  1.00 69.01  ? 113 GLY E C   1 
ATOM   8283  O O   . GLY E  5  113 ? -10.452 58.201  77.333  1.00 72.59  ? 113 GLY E O   1 
ATOM   8284  N N   . SER E  5  114 ? -8.528  57.511  76.382  1.00 69.26  ? 114 SER E N   1 
ATOM   8285  C CA  . SER E  5  114 ? -9.018  57.605  75.010  1.00 70.83  ? 114 SER E CA  1 
ATOM   8286  C C   . SER E  5  114 ? -9.625  56.287  74.537  1.00 72.33  ? 114 SER E C   1 
ATOM   8287  O O   . SER E  5  114 ? -10.612 56.285  73.800  1.00 72.96  ? 114 SER E O   1 
ATOM   8288  C CB  . SER E  5  114 ? -7.895  58.034  74.064  1.00 72.92  ? 114 SER E CB  1 
ATOM   8289  O OG  . SER E  5  114 ? -7.448  59.343  74.367  1.00 78.01  ? 114 SER E OG  1 
ATOM   8290  N N   . LYS E  5  115 ? -9.033  55.175  74.970  1.00 73.58  ? 115 LYS E N   1 
ATOM   8291  C CA  . LYS E  5  115 ? -9.478  53.841  74.565  1.00 75.22  ? 115 LYS E CA  1 
ATOM   8292  C C   . LYS E  5  115 ? -10.717 53.381  75.336  1.00 75.16  ? 115 LYS E C   1 
ATOM   8293  O O   . LYS E  5  115 ? -11.600 52.739  74.766  1.00 76.65  ? 115 LYS E O   1 
ATOM   8294  C CB  . LYS E  5  115 ? -8.345  52.822  74.729  1.00 75.52  ? 115 LYS E CB  1 
ATOM   8295  C CG  . LYS E  5  115 ? -8.567  51.518  73.977  1.00 76.38  ? 115 LYS E CG  1 
ATOM   8296  C CD  . LYS E  5  115 ? -7.565  50.456  74.396  1.00 75.99  ? 115 LYS E CD  1 
ATOM   8297  C CE  . LYS E  5  115 ? -7.772  49.157  73.631  1.00 77.36  ? 115 LYS E CE  1 
ATOM   8298  N NZ  . LYS E  5  115 ? -7.459  49.293  72.181  1.00 77.90  ? 115 LYS E NZ  1 
ATOM   8299  N N   . THR E  5  116 ? -10.773 53.713  76.625  1.00 74.51  ? 116 THR E N   1 
ATOM   8300  C CA  . THR E  5  116 ? -11.882 53.313  77.498  1.00 74.67  ? 116 THR E CA  1 
ATOM   8301  C C   . THR E  5  116 ? -13.155 54.126  77.221  1.00 73.03  ? 116 THR E C   1 
ATOM   8302  O O   . THR E  5  116 ? -14.261 53.706  77.576  1.00 73.06  ? 116 THR E O   1 
ATOM   8303  C CB  . THR E  5  116 ? -11.491 53.426  78.990  1.00 75.22  ? 116 THR E CB  1 
ATOM   8304  O OG1 . THR E  5  116 ? -10.152 52.951  79.177  1.00 73.05  ? 116 THR E OG1 1 
ATOM   8305  C CG2 . THR E  5  116 ? -12.433 52.608  79.869  1.00 76.80  ? 116 THR E CG2 1 
ATOM   8306  N N   . GLN E  5  117 ? -12.991 55.281  76.580  1.00 71.62  ? 117 GLN E N   1 
ATOM   8307  C CA  . GLN E  5  117 ? -14.108 56.162  76.246  1.00 69.97  ? 117 GLN E CA  1 
ATOM   8308  C C   . GLN E  5  117 ? -14.935 55.632  75.072  1.00 69.67  ? 117 GLN E C   1 
ATOM   8309  O O   . GLN E  5  117 ? -16.145 55.856  75.012  1.00 71.66  ? 117 GLN E O   1 
ATOM   8310  C CB  . GLN E  5  117 ? -13.591 57.570  75.934  1.00 69.88  ? 117 GLN E CB  1 
ATOM   8311  C CG  . GLN E  5  117 ? -14.588 58.690  76.200  1.00 69.20  ? 117 GLN E CG  1 
ATOM   8312  C CD  . GLN E  5  117 ? -15.597 58.880  75.080  1.00 69.26  ? 117 GLN E CD  1 
ATOM   8313  O OE1 . GLN E  5  117 ? -15.292 58.667  73.905  1.00 69.97  ? 117 GLN E OE1 1 
ATOM   8314  N NE2 . GLN E  5  117 ? -16.807 59.288  75.442  1.00 71.06  ? 117 GLN E NE2 1 
ATOM   8315  N N   . ILE E  5  118 ? -14.277 54.931  74.149  1.00 68.82  ? 118 ILE E N   1 
ATOM   8316  C CA  . ILE E  5  118 ? -14.922 54.437  72.925  1.00 69.48  ? 118 ILE E CA  1 
ATOM   8317  C C   . ILE E  5  118 ? -16.129 53.516  73.185  1.00 70.30  ? 118 ILE E C   1 
ATOM   8318  O O   . ILE E  5  118 ? -17.218 53.789  72.672  1.00 72.40  ? 118 ILE E O   1 
ATOM   8319  C CB  . ILE E  5  118 ? -13.906 53.782  71.950  1.00 70.42  ? 118 ILE E CB  1 
ATOM   8320  C CG1 . ILE E  5  118 ? -12.719 54.720  71.699  1.00 70.56  ? 118 ILE E CG1 1 
ATOM   8321  C CG2 . ILE E  5  118 ? -14.578 53.416  70.631  1.00 73.39  ? 118 ILE E CG2 1 
ATOM   8322  C CD1 . ILE E  5  118 ? -11.467 54.027  71.200  1.00 70.94  ? 118 ILE E CD1 1 
ATOM   8323  N N   . PRO E  5  119 ? -15.953 52.440  73.988  1.00 70.48  ? 119 PRO E N   1 
ATOM   8324  C CA  . PRO E  5  119 ? -17.060 51.493  74.178  1.00 72.12  ? 119 PRO E CA  1 
ATOM   8325  C C   . PRO E  5  119 ? -18.204 52.018  75.052  1.00 73.21  ? 119 PRO E C   1 
ATOM   8326  O O   . PRO E  5  119 ? -19.299 51.453  75.031  1.00 75.81  ? 119 PRO E O   1 
ATOM   8327  C CB  . PRO E  5  119 ? -16.385 50.299  74.856  1.00 72.72  ? 119 PRO E CB  1 
ATOM   8328  C CG  . PRO E  5  119 ? -15.240 50.892  75.595  1.00 70.29  ? 119 PRO E CG  1 
ATOM   8329  C CD  . PRO E  5  119 ? -14.749 52.019  74.734  1.00 69.51  ? 119 PRO E CD  1 
ATOM   8330  N N   . THR E  5  120 ? -17.951 53.087  75.804  1.00 72.92  ? 120 THR E N   1 
ATOM   8331  C CA  . THR E  5  120 ? -18.974 53.691  76.662  1.00 73.54  ? 120 THR E CA  1 
ATOM   8332  C C   . THR E  5  120 ? -19.972 54.541  75.867  1.00 73.85  ? 120 THR E C   1 
ATOM   8333  O O   . THR E  5  120 ? -20.962 55.028  76.421  1.00 74.23  ? 120 THR E O   1 
ATOM   8334  C CB  . THR E  5  120 ? -18.354 54.546  77.790  1.00 72.85  ? 120 THR E CB  1 
ATOM   8335  O OG1 . THR E  5  120 ? -17.487 55.538  77.227  1.00 71.76  ? 120 THR E OG1 1 
ATOM   8336  C CG2 . THR E  5  120 ? -17.564 53.677  78.762  1.00 71.94  ? 120 THR E CG2 1 
ATOM   8337  N N   . GLN E  5  121 ? -19.710 54.704  74.571  1.00 73.53  ? 121 GLN E N   1 
ATOM   8338  C CA  . GLN E  5  121 ? -20.549 55.528  73.702  1.00 72.94  ? 121 GLN E CA  1 
ATOM   8339  C C   . GLN E  5  121 ? -21.249 54.720  72.601  1.00 74.21  ? 121 GLN E C   1 
ATOM   8340  O O   . GLN E  5  121 ? -22.286 55.142  72.085  1.00 74.58  ? 121 GLN E O   1 
ATOM   8341  C CB  . GLN E  5  121 ? -19.723 56.670  73.099  1.00 72.39  ? 121 GLN E CB  1 
ATOM   8342  C CG  . GLN E  5  121 ? -20.546 57.844  72.587  1.00 72.14  ? 121 GLN E CG  1 
ATOM   8343  C CD  . GLN E  5  121 ? -19.748 59.130  72.463  1.00 72.66  ? 121 GLN E CD  1 
ATOM   8344  O OE1 . GLN E  5  121 ? -18.517 59.116  72.392  1.00 72.36  ? 121 GLN E OE1 1 
ATOM   8345  N NE2 . GLN E  5  121 ? -20.452 60.255  72.434  1.00 72.80  ? 121 GLN E NE2 1 
ATOM   8346  N N   . ARG E  5  122 ? -20.686 53.564  72.252  1.00 76.65  ? 122 ARG E N   1 
ATOM   8347  C CA  . ARG E  5  122 ? -21.251 52.710  71.202  1.00 79.13  ? 122 ARG E CA  1 
ATOM   8348  C C   . ARG E  5  122 ? -22.235 51.672  71.744  1.00 76.85  ? 122 ARG E C   1 
ATOM   8349  O O   . ARG E  5  122 ? -22.122 51.233  72.890  1.00 75.16  ? 122 ARG E O   1 
ATOM   8350  C CB  . ARG E  5  122 ? -20.144 52.015  70.402  1.00 84.38  ? 122 ARG E CB  1 
ATOM   8351  C CG  . ARG E  5  122 ? -19.356 52.933  69.482  1.00 91.93  ? 122 ARG E CG  1 
ATOM   8352  C CD  . ARG E  5  122 ? -18.872 52.179  68.255  1.00 100.71 ? 122 ARG E CD  1 
ATOM   8353  N NE  . ARG E  5  122 ? -17.865 52.928  67.505  1.00 108.61 ? 122 ARG E NE  1 
ATOM   8354  C CZ  . ARG E  5  122 ? -16.573 52.614  67.452  1.00 114.43 ? 122 ARG E CZ  1 
ATOM   8355  N NH1 . ARG E  5  122 ? -16.109 51.552  68.100  1.00 108.16 ? 122 ARG E NH1 1 
ATOM   8356  N NH2 . ARG E  5  122 ? -15.740 53.362  66.741  1.00 118.48 ? 122 ARG E NH2 1 
ATOM   8357  N N   . TYR E  5  123 ? -23.191 51.284  70.902  1.00 77.02  ? 123 TYR E N   1 
ATOM   8358  C CA  . TYR E  5  123 ? -24.206 50.292  71.255  1.00 78.35  ? 123 TYR E CA  1 
ATOM   8359  C C   . TYR E  5  123 ? -23.635 48.878  71.217  1.00 77.51  ? 123 TYR E C   1 
ATOM   8360  O O   . TYR E  5  123 ? -22.843 48.542  70.334  1.00 77.78  ? 123 TYR E O   1 
ATOM   8361  C CB  . TYR E  5  123 ? -25.407 50.402  70.309  1.00 80.43  ? 123 TYR E CB  1 
ATOM   8362  C CG  . TYR E  5  123 ? -26.626 49.612  70.740  1.00 85.16  ? 123 TYR E CG  1 
ATOM   8363  C CD1 . TYR E  5  123 ? -27.578 50.174  71.592  1.00 89.06  ? 123 TYR E CD1 1 
ATOM   8364  C CD2 . TYR E  5  123 ? -26.834 48.308  70.288  1.00 85.33  ? 123 TYR E CD2 1 
ATOM   8365  C CE1 . TYR E  5  123 ? -28.697 49.456  71.987  1.00 91.63  ? 123 TYR E CE1 1 
ATOM   8366  C CE2 . TYR E  5  123 ? -27.949 47.583  70.680  1.00 87.63  ? 123 TYR E CE2 1 
ATOM   8367  C CZ  . TYR E  5  123 ? -28.877 48.161  71.527  1.00 90.89  ? 123 TYR E CZ  1 
ATOM   8368  O OH  . TYR E  5  123 ? -29.986 47.445  71.916  1.00 91.90  ? 123 TYR E OH  1 
ATOM   8369  N N   . GLY E  5  124 ? -24.047 48.057  72.181  1.00 76.31  ? 124 GLY E N   1 
ATOM   8370  C CA  . GLY E  5  124 ? -23.602 46.666  72.269  1.00 74.54  ? 124 GLY E CA  1 
ATOM   8371  C C   . GLY E  5  124 ? -22.198 46.504  72.824  1.00 72.86  ? 124 GLY E C   1 
ATOM   8372  O O   . GLY E  5  124 ? -21.646 45.401  72.820  1.00 71.37  ? 124 GLY E O   1 
ATOM   8373  N N   . ARG E  5  125 ? -21.626 47.606  73.302  1.00 73.21  ? 125 ARG E N   1 
ATOM   8374  C CA  . ARG E  5  125 ? -20.282 47.613  73.870  1.00 73.62  ? 125 ARG E CA  1 
ATOM   8375  C C   . ARG E  5  125 ? -20.343 47.905  75.368  1.00 72.26  ? 125 ARG E C   1 
ATOM   8376  O O   . ARG E  5  125 ? -21.251 48.594  75.837  1.00 72.92  ? 125 ARG E O   1 
ATOM   8377  C CB  . ARG E  5  125 ? -19.399 48.644  73.157  1.00 76.80  ? 125 ARG E CB  1 
ATOM   8378  C CG  . ARG E  5  125 ? -19.309 48.474  71.644  1.00 81.38  ? 125 ARG E CG  1 
ATOM   8379  C CD  . ARG E  5  125 ? -18.272 47.437  71.232  1.00 86.57  ? 125 ARG E CD  1 
ATOM   8380  N NE  . ARG E  5  125 ? -16.922 47.997  71.171  1.00 88.31  ? 125 ARG E NE  1 
ATOM   8381  C CZ  . ARG E  5  125 ? -16.000 47.865  72.122  1.00 88.59  ? 125 ARG E CZ  1 
ATOM   8382  N NH1 . ARG E  5  125 ? -16.264 47.184  73.231  1.00 86.30  ? 125 ARG E NH1 1 
ATOM   8383  N NH2 . ARG E  5  125 ? -14.805 48.416  71.962  1.00 89.41  ? 125 ARG E NH2 1 
ATOM   8384  N N   . ARG E  5  126 ? -19.374 47.376  76.111  1.00 71.13  ? 126 ARG E N   1 
ATOM   8385  C CA  . ARG E  5  126 ? -19.334 47.530  77.565  1.00 69.83  ? 126 ARG E CA  1 
ATOM   8386  C C   . ARG E  5  126 ? -18.069 48.258  78.038  1.00 70.06  ? 126 ARG E C   1 
ATOM   8387  O O   . ARG E  5  126 ? -17.029 48.183  77.378  1.00 70.62  ? 126 ARG E O   1 
ATOM   8388  C CB  . ARG E  5  126 ? -19.453 46.163  78.253  1.00 69.40  ? 126 ARG E CB  1 
ATOM   8389  C CG  . ARG E  5  126 ? -18.266 45.236  78.032  1.00 70.04  ? 126 ARG E CG  1 
ATOM   8390  C CD  . ARG E  5  126 ? -18.194 44.159  79.099  1.00 70.64  ? 126 ARG E CD  1 
ATOM   8391  N NE  . ARG E  5  126 ? -16.835 43.644  79.253  1.00 70.70  ? 126 ARG E NE  1 
ATOM   8392  C CZ  . ARG E  5  126 ? -16.337 42.605  78.588  1.00 72.18  ? 126 ARG E CZ  1 
ATOM   8393  N NH1 . ARG E  5  126 ? -17.083 41.941  77.711  1.00 74.77  ? 126 ARG E NH1 1 
ATOM   8394  N NH2 . ARG E  5  126 ? -15.086 42.225  78.805  1.00 74.53  ? 126 ARG E NH2 1 
ATOM   8395  N N   . PRO E  5  127 ? -18.156 48.970  79.180  1.00 68.98  ? 127 PRO E N   1 
ATOM   8396  C CA  . PRO E  5  127 ? -16.971 49.596  79.769  1.00 70.06  ? 127 PRO E CA  1 
ATOM   8397  C C   . PRO E  5  127 ? -16.023 48.557  80.362  1.00 72.23  ? 127 PRO E C   1 
ATOM   8398  O O   . PRO E  5  127 ? -16.459 47.464  80.732  1.00 72.83  ? 127 PRO E O   1 
ATOM   8399  C CB  . PRO E  5  127 ? -17.550 50.473  80.889  1.00 69.46  ? 127 PRO E CB  1 
ATOM   8400  C CG  . PRO E  5  127 ? -19.005 50.602  80.587  1.00 68.34  ? 127 PRO E CG  1 
ATOM   8401  C CD  . PRO E  5  127 ? -19.376 49.310  79.932  1.00 68.38  ? 127 PRO E CD  1 
ATOM   8402  N N   . TYR E  5  128 ? -14.739 48.901  80.444  1.00 73.69  ? 128 TYR E N   1 
ATOM   8403  C CA  . TYR E  5  128 ? -13.736 48.026  81.047  1.00 75.04  ? 128 TYR E CA  1 
ATOM   8404  C C   . TYR E  5  128 ? -13.942 47.951  82.560  1.00 76.02  ? 128 TYR E C   1 
ATOM   8405  O O   . TYR E  5  128 ? -13.677 48.914  83.282  1.00 79.53  ? 128 TYR E O   1 
ATOM   8406  C CB  . TYR E  5  128 ? -12.319 48.511  80.716  1.00 74.93  ? 128 TYR E CB  1 
ATOM   8407  C CG  . TYR E  5  128 ? -11.913 48.334  79.266  1.00 74.72  ? 128 TYR E CG  1 
ATOM   8408  C CD1 . TYR E  5  128 ? -12.181 49.323  78.319  1.00 75.25  ? 128 TYR E CD1 1 
ATOM   8409  C CD2 . TYR E  5  128 ? -11.251 47.181  78.842  1.00 73.76  ? 128 TYR E CD2 1 
ATOM   8410  C CE1 . TYR E  5  128 ? -11.808 49.166  76.992  1.00 74.18  ? 128 TYR E CE1 1 
ATOM   8411  C CE2 . TYR E  5  128 ? -10.874 47.016  77.517  1.00 73.22  ? 128 TYR E CE2 1 
ATOM   8412  C CZ  . TYR E  5  128 ? -11.154 48.011  76.597  1.00 72.80  ? 128 TYR E CZ  1 
ATOM   8413  O OH  . TYR E  5  128 ? -10.782 47.854  75.280  1.00 71.72  ? 128 TYR E OH  1 
ATOM   8414  N N   . GLY E  5  129 ? -14.425 46.802  83.028  1.00 73.86  ? 129 GLY E N   1 
ATOM   8415  C CA  . GLY E  5  129 ? -14.744 46.609  84.441  1.00 73.64  ? 129 GLY E CA  1 
ATOM   8416  C C   . GLY E  5  129 ? -13.540 46.287  85.304  1.00 73.03  ? 129 GLY E C   1 
ATOM   8417  O O   . GLY E  5  129 ? -13.493 45.235  85.946  1.00 73.67  ? 129 GLY E O   1 
ATOM   8418  N N   . VAL E  5  130 ? -12.568 47.198  85.321  1.00 73.49  ? 130 VAL E N   1 
ATOM   8419  C CA  . VAL E  5  130 ? -11.352 47.040  86.123  1.00 75.37  ? 130 VAL E CA  1 
ATOM   8420  C C   . VAL E  5  130 ? -10.736 48.397  86.483  1.00 77.72  ? 130 VAL E C   1 
ATOM   8421  O O   . VAL E  5  130 ? -10.617 49.284  85.633  1.00 78.02  ? 130 VAL E O   1 
ATOM   8422  C CB  . VAL E  5  130 ? -10.318 46.103  85.435  1.00 74.46  ? 130 VAL E CB  1 
ATOM   8423  C CG1 . VAL E  5  130 ? -9.855  46.659  84.092  1.00 73.40  ? 130 VAL E CG1 1 
ATOM   8424  C CG2 . VAL E  5  130 ? -9.132  45.821  86.350  1.00 76.37  ? 130 VAL E CG2 1 
ATOM   8425  N N   . GLY E  5  131 ? -10.370 48.551  87.753  1.00 80.70  ? 131 GLY E N   1 
ATOM   8426  C CA  . GLY E  5  131 ? -9.698  49.755  88.235  1.00 82.24  ? 131 GLY E CA  1 
ATOM   8427  C C   . GLY E  5  131 ? -8.215  49.509  88.429  1.00 82.76  ? 131 GLY E C   1 
ATOM   8428  O O   . GLY E  5  131 ? -7.821  48.523  89.055  1.00 84.67  ? 131 GLY E O   1 
ATOM   8429  N N   . LEU E  5  132 ? -7.393  50.407  87.893  1.00 82.64  ? 132 LEU E N   1 
ATOM   8430  C CA  . LEU E  5  132 ? -5.942  50.242  87.934  1.00 83.52  ? 132 LEU E CA  1 
ATOM   8431  C C   . LEU E  5  132 ? -5.254  51.370  88.696  1.00 84.94  ? 132 LEU E C   1 
ATOM   8432  O O   . LEU E  5  132 ? -5.629  52.538  88.570  1.00 85.22  ? 132 LEU E O   1 
ATOM   8433  C CB  . LEU E  5  132 ? -5.362  50.159  86.515  1.00 81.66  ? 132 LEU E CB  1 
ATOM   8434  C CG  . LEU E  5  132 ? -6.093  49.362  85.428  1.00 80.20  ? 132 LEU E CG  1 
ATOM   8435  C CD1 . LEU E  5  132 ? -5.582  49.757  84.050  1.00 79.64  ? 132 LEU E CD1 1 
ATOM   8436  C CD2 . LEU E  5  132 ? -5.963  47.862  85.640  1.00 80.97  ? 132 LEU E CD2 1 
ATOM   8437  N N   . LEU E  5  133 ? -4.251  51.005  89.491  1.00 84.21  ? 133 LEU E N   1 
ATOM   8438  C CA  . LEU E  5  133 ? -3.358  51.978  90.112  1.00 83.30  ? 133 LEU E CA  1 
ATOM   8439  C C   . LEU E  5  133 ? -1.981  51.879  89.463  1.00 83.05  ? 133 LEU E C   1 
ATOM   8440  O O   . LEU E  5  133 ? -1.295  50.861  89.586  1.00 83.51  ? 133 LEU E O   1 
ATOM   8441  C CB  . LEU E  5  133 ? -3.271  51.771  91.627  1.00 81.57  ? 133 LEU E CB  1 
ATOM   8442  C CG  . LEU E  5  133 ? -4.481  52.162  92.483  1.00 80.17  ? 133 LEU E CG  1 
ATOM   8443  C CD1 . LEU E  5  133 ? -4.300  51.644  93.900  1.00 81.32  ? 133 LEU E CD1 1 
ATOM   8444  C CD2 . LEU E  5  133 ? -4.712  53.667  92.489  1.00 82.23  ? 133 LEU E CD2 1 
ATOM   8445  N N   . ILE E  5  134 ? -1.592  52.943  88.766  1.00 80.19  ? 134 ILE E N   1 
ATOM   8446  C CA  . ILE E  5  134 ? -0.384  52.939  87.945  1.00 77.60  ? 134 ILE E CA  1 
ATOM   8447  C C   . ILE E  5  134 ? 0.771   53.649  88.647  1.00 77.40  ? 134 ILE E C   1 
ATOM   8448  O O   . ILE E  5  134 ? 0.659   54.820  89.014  1.00 78.33  ? 134 ILE E O   1 
ATOM   8449  C CB  . ILE E  5  134 ? -0.637  53.591  86.565  1.00 76.20  ? 134 ILE E CB  1 
ATOM   8450  C CG1 . ILE E  5  134 ? -1.954  53.087  85.960  1.00 75.12  ? 134 ILE E CG1 1 
ATOM   8451  C CG2 . ILE E  5  134 ? 0.533   53.326  85.624  1.00 75.78  ? 134 ILE E CG2 1 
ATOM   8452  C CD1 . ILE E  5  134 ? -2.537  53.983  84.888  1.00 73.15  ? 134 ILE E CD1 1 
ATOM   8453  N N   . ALA E  5  135 ? 1.872   52.926  88.834  1.00 76.85  ? 135 ALA E N   1 
ATOM   8454  C CA  . ALA E  5  135 ? 3.099   53.498  89.379  1.00 76.77  ? 135 ALA E CA  1 
ATOM   8455  C C   . ALA E  5  135 ? 4.137   53.654  88.274  1.00 76.89  ? 135 ALA E C   1 
ATOM   8456  O O   . ALA E  5  135 ? 4.472   52.689  87.584  1.00 75.35  ? 135 ALA E O   1 
ATOM   8457  C CB  . ALA E  5  135 ? 3.643   52.635  90.506  1.00 75.73  ? 135 ALA E CB  1 
ATOM   8458  N N   . GLY E  5  136 ? 4.636   54.876  88.110  1.00 78.57  ? 136 GLY E N   1 
ATOM   8459  C CA  . GLY E  5  136 ? 5.596   55.177  87.055  1.00 79.45  ? 136 GLY E CA  1 
ATOM   8460  C C   . GLY E  5  136 ? 6.601   56.253  87.414  1.00 83.20  ? 136 GLY E C   1 
ATOM   8461  O O   . GLY E  5  136 ? 6.328   57.122  88.246  1.00 82.51  ? 136 GLY E O   1 
ATOM   8462  N N   . TYR E  5  137 ? 7.769   56.189  86.778  1.00 85.52  ? 137 TYR E N   1 
ATOM   8463  C CA  . TYR E  5  137 ? 8.822   57.177  86.983  1.00 87.73  ? 137 TYR E CA  1 
ATOM   8464  C C   . TYR E  5  137 ? 9.400   57.652  85.652  1.00 86.04  ? 137 TYR E C   1 
ATOM   8465  O O   . TYR E  5  137 ? 9.934   56.860  84.873  1.00 82.78  ? 137 TYR E O   1 
ATOM   8466  C CB  . TYR E  5  137 ? 9.931   56.612  87.879  1.00 90.47  ? 137 TYR E CB  1 
ATOM   8467  C CG  . TYR E  5  137 ? 10.904  57.655  88.390  1.00 93.07  ? 137 TYR E CG  1 
ATOM   8468  C CD1 . TYR E  5  137 ? 10.648  58.355  89.569  1.00 93.90  ? 137 TYR E CD1 1 
ATOM   8469  C CD2 . TYR E  5  137 ? 12.081  57.941  87.697  1.00 93.50  ? 137 TYR E CD2 1 
ATOM   8470  C CE1 . TYR E  5  137 ? 11.533  59.311  90.040  1.00 97.39  ? 137 TYR E CE1 1 
ATOM   8471  C CE2 . TYR E  5  137 ? 12.972  58.896  88.161  1.00 96.77  ? 137 TYR E CE2 1 
ATOM   8472  C CZ  . TYR E  5  137 ? 12.693  59.577  89.332  1.00 99.36  ? 137 TYR E CZ  1 
ATOM   8473  O OH  . TYR E  5  137 ? 13.573  60.525  89.798  1.00 103.29 ? 137 TYR E OH  1 
ATOM   8474  N N   . ASP E  5  138 ? 9.277   58.952  85.402  1.00 87.49  ? 138 ASP E N   1 
ATOM   8475  C CA  . ASP E  5  138 ? 9.852   59.584  84.217  1.00 90.15  ? 138 ASP E CA  1 
ATOM   8476  C C   . ASP E  5  138 ? 10.809  60.708  84.626  1.00 93.53  ? 138 ASP E C   1 
ATOM   8477  O O   . ASP E  5  138 ? 11.347  60.693  85.737  1.00 94.87  ? 138 ASP E O   1 
ATOM   8478  C CB  . ASP E  5  138 ? 8.747   60.093  83.277  1.00 89.90  ? 138 ASP E CB  1 
ATOM   8479  C CG  . ASP E  5  138 ? 7.621   60.813  84.012  1.00 90.62  ? 138 ASP E CG  1 
ATOM   8480  O OD1 . ASP E  5  138 ? 7.886   61.490  85.030  1.00 91.29  ? 138 ASP E OD1 1 
ATOM   8481  O OD2 . ASP E  5  138 ? 6.462   60.704  83.561  1.00 88.72  ? 138 ASP E OD2 1 
ATOM   8482  N N   . ASP E  5  139 ? 11.021  61.676  83.735  1.00 94.61  ? 139 ASP E N   1 
ATOM   8483  C CA  . ASP E  5  139 ? 11.891  62.818  84.028  1.00 95.62  ? 139 ASP E CA  1 
ATOM   8484  C C   . ASP E  5  139 ? 11.139  63.974  84.704  1.00 91.34  ? 139 ASP E C   1 
ATOM   8485  O O   . ASP E  5  139 ? 11.507  65.143  84.560  1.00 89.94  ? 139 ASP E O   1 
ATOM   8486  C CB  . ASP E  5  139 ? 12.641  63.280  82.768  1.00 98.77  ? 139 ASP E CB  1 
ATOM   8487  C CG  . ASP E  5  139 ? 11.718  63.541  81.592  1.00 103.03 ? 139 ASP E CG  1 
ATOM   8488  O OD1 . ASP E  5  139 ? 11.023  64.578  81.592  1.00 102.35 ? 139 ASP E OD1 1 
ATOM   8489  O OD2 . ASP E  5  139 ? 11.703  62.713  80.657  1.00 106.76 ? 139 ASP E OD2 1 
ATOM   8490  N N   . MET E  5  140 ? 10.091  63.625  85.449  1.00 86.54  ? 140 MET E N   1 
ATOM   8491  C CA  . MET E  5  140 ? 9.300   64.586  86.219  1.00 83.42  ? 140 MET E CA  1 
ATOM   8492  C C   . MET E  5  140 ? 9.112   64.131  87.666  1.00 80.61  ? 140 MET E C   1 
ATOM   8493  O O   . MET E  5  140 ? 8.633   64.893  88.508  1.00 80.61  ? 140 MET E O   1 
ATOM   8494  C CB  . MET E  5  140 ? 7.936   64.810  85.560  1.00 84.10  ? 140 MET E CB  1 
ATOM   8495  C CG  . MET E  5  140 ? 7.951   65.803  84.409  1.00 86.97  ? 140 MET E CG  1 
ATOM   8496  S SD  . MET E  5  140 ? 8.080   67.520  84.947  1.00 90.36  ? 140 MET E SD  1 
ATOM   8497  C CE  . MET E  5  140 ? 6.437   67.808  85.602  1.00 89.17  ? 140 MET E CE  1 
ATOM   8498  N N   . GLY E  5  141 ? 9.491   62.885  87.943  1.00 79.46  ? 141 GLY E N   1 
ATOM   8499  C CA  . GLY E  5  141 ? 9.378   62.308  89.281  1.00 79.87  ? 141 GLY E CA  1 
ATOM   8500  C C   . GLY E  5  141 ? 8.500   61.069  89.317  1.00 79.70  ? 141 GLY E C   1 
ATOM   8501  O O   . GLY E  5  141 ? 8.160   60.520  88.266  1.00 78.88  ? 141 GLY E O   1 
ATOM   8502  N N   . PRO E  5  142 ? 8.136   60.609  90.531  1.00 80.22  ? 142 PRO E N   1 
ATOM   8503  C CA  . PRO E  5  142 ? 7.239   59.464  90.685  1.00 79.23  ? 142 PRO E CA  1 
ATOM   8504  C C   . PRO E  5  142 ? 5.793   59.841  90.381  1.00 77.42  ? 142 PRO E C   1 
ATOM   8505  O O   . PRO E  5  142 ? 5.409   61.002  90.539  1.00 77.01  ? 142 PRO E O   1 
ATOM   8506  C CB  . PRO E  5  142 ? 7.381   59.089  92.168  1.00 81.02  ? 142 PRO E CB  1 
ATOM   8507  C CG  . PRO E  5  142 ? 8.531   59.885  92.689  1.00 84.06  ? 142 PRO E CG  1 
ATOM   8508  C CD  . PRO E  5  142 ? 8.600   61.109  91.834  1.00 82.62  ? 142 PRO E CD  1 
ATOM   8509  N N   . HIS E  5  143 ? 5.006   58.860  89.948  1.00 76.58  ? 143 HIS E N   1 
ATOM   8510  C CA  . HIS E  5  143 ? 3.607   59.086  89.599  1.00 76.50  ? 143 HIS E CA  1 
ATOM   8511  C C   . HIS E  5  143 ? 2.718   57.987  90.099  1.00 77.02  ? 143 HIS E C   1 
ATOM   8512  O O   . HIS E  5  143 ? 3.038   56.805  89.960  1.00 77.22  ? 143 HIS E O   1 
ATOM   8513  C CB  . HIS E  5  143 ? 3.445   59.226  88.088  1.00 76.42  ? 143 HIS E CB  1 
ATOM   8514  C CG  . HIS E  5  143 ? 4.113   60.451  87.511  1.00 77.84  ? 143 HIS E CG  1 
ATOM   8515  N ND1 . HIS E  5  143 ? 3.580   61.682  87.615  1.00 79.20  ? 143 HIS E ND1 1 
ATOM   8516  C CD2 . HIS E  5  143 ? 5.302   60.596  86.800  1.00 78.11  ? 143 HIS E CD2 1 
ATOM   8517  C CE1 . HIS E  5  143 ? 4.388   62.573  87.009  1.00 79.86  ? 143 HIS E CE1 1 
ATOM   8518  N NE2 . HIS E  5  143 ? 5.441   61.906  86.510  1.00 79.47  ? 143 HIS E NE2 1 
ATOM   8519  N N   . ILE E  5  144 ? 1.595   58.376  90.698  1.00 77.44  ? 144 ILE E N   1 
ATOM   8520  C CA  . ILE E  5  144 ? 0.536   57.436  91.056  1.00 77.89  ? 144 ILE E CA  1 
ATOM   8521  C C   . ILE E  5  144 ? -0.750  57.864  90.352  1.00 77.71  ? 144 ILE E C   1 
ATOM   8522  O O   . ILE E  5  144 ? -1.289  58.941  90.619  1.00 80.17  ? 144 ILE E O   1 
ATOM   8523  C CB  . ILE E  5  144 ? 0.331   57.327  92.590  1.00 79.13  ? 144 ILE E CB  1 
ATOM   8524  C CG1 . ILE E  5  144 ? 1.588   56.770  93.283  1.00 79.22  ? 144 ILE E CG1 1 
ATOM   8525  C CG2 . ILE E  5  144 ? -0.902  56.493  92.927  1.00 79.08  ? 144 ILE E CG2 1 
ATOM   8526  C CD1 . ILE E  5  144 ? 1.990   55.361  92.883  1.00 78.74  ? 144 ILE E CD1 1 
ATOM   8527  N N   . PHE E  5  145 ? -1.220  57.019  89.439  1.00 76.38  ? 145 PHE E N   1 
ATOM   8528  C CA  . PHE E  5  145 ? -2.412  57.311  88.649  1.00 76.55  ? 145 PHE E CA  1 
ATOM   8529  C C   . PHE E  5  145 ? -3.534  56.312  88.909  1.00 77.52  ? 145 PHE E C   1 
ATOM   8530  O O   . PHE E  5  145 ? -3.291  55.113  89.048  1.00 78.59  ? 145 PHE E O   1 
ATOM   8531  C CB  . PHE E  5  145 ? -2.074  57.352  87.156  1.00 74.67  ? 145 PHE E CB  1 
ATOM   8532  C CG  . PHE E  5  145 ? -1.495  58.661  86.697  1.00 74.14  ? 145 PHE E CG  1 
ATOM   8533  C CD1 . PHE E  5  145 ? -0.121  58.875  86.710  1.00 74.05  ? 145 PHE E CD1 1 
ATOM   8534  C CD2 . PHE E  5  145 ? -2.325  59.682  86.243  1.00 73.97  ? 145 PHE E CD2 1 
ATOM   8535  C CE1 . PHE E  5  145 ? 0.413   60.083  86.284  1.00 74.34  ? 145 PHE E CE1 1 
ATOM   8536  C CE2 . PHE E  5  145 ? -1.797  60.891  85.816  1.00 74.02  ? 145 PHE E CE2 1 
ATOM   8537  C CZ  . PHE E  5  145 ? -0.426  61.092  85.837  1.00 73.84  ? 145 PHE E CZ  1 
ATOM   8538  N N   . GLN E  5  146 ? -4.760  56.824  88.972  1.00 79.48  ? 146 GLN E N   1 
ATOM   8539  C CA  . GLN E  5  146 ? -5.944  56.003  89.193  1.00 81.09  ? 146 GLN E CA  1 
ATOM   8540  C C   . GLN E  5  146 ? -6.850  56.046  87.966  1.00 81.51  ? 146 GLN E C   1 
ATOM   8541  O O   . GLN E  5  146 ? -7.220  57.125  87.498  1.00 82.11  ? 146 GLN E O   1 
ATOM   8542  C CB  . GLN E  5  146 ? -6.703  56.492  90.432  1.00 83.66  ? 146 GLN E CB  1 
ATOM   8543  C CG  . GLN E  5  146 ? -7.895  55.631  90.830  1.00 86.36  ? 146 GLN E CG  1 
ATOM   8544  C CD  . GLN E  5  146 ? -8.863  56.337  91.767  1.00 89.81  ? 146 GLN E CD  1 
ATOM   8545  O OE1 . GLN E  5  146 ? -9.916  55.796  92.104  1.00 91.08  ? 146 GLN E OE1 1 
ATOM   8546  N NE2 . GLN E  5  146 ? -8.515  57.549  92.188  1.00 91.83  ? 146 GLN E NE2 1 
ATOM   8547  N N   . THR E  5  147 ? -7.194  54.870  87.446  1.00 82.17  ? 147 THR E N   1 
ATOM   8548  C CA  . THR E  5  147 ? -8.115  54.763  86.313  1.00 84.29  ? 147 THR E CA  1 
ATOM   8549  C C   . THR E  5  147 ? -9.374  53.995  86.703  1.00 86.25  ? 147 THR E C   1 
ATOM   8550  O O   . THR E  5  147 ? -9.306  52.992  87.416  1.00 86.13  ? 147 THR E O   1 
ATOM   8551  C CB  . THR E  5  147 ? -7.462  54.090  85.086  1.00 85.36  ? 147 THR E CB  1 
ATOM   8552  O OG1 . THR E  5  147 ? -6.906  52.827  85.466  1.00 86.08  ? 147 THR E OG1 1 
ATOM   8553  C CG2 . THR E  5  147 ? -6.365  54.973  84.500  1.00 84.97  ? 147 THR E CG2 1 
ATOM   8554  N N   . CYS E  5  148 ? -10.518 54.480  86.227  1.00 89.24  ? 148 CYS E N   1 
ATOM   8555  C CA  . CYS E  5  148 ? -11.815 53.879  86.527  1.00 92.69  ? 148 CYS E CA  1 
ATOM   8556  C C   . CYS E  5  148 ? -12.415 53.195  85.292  1.00 91.52  ? 148 CYS E C   1 
ATOM   8557  O O   . CYS E  5  148 ? -11.852 53.299  84.199  1.00 91.19  ? 148 CYS E O   1 
ATOM   8558  C CB  . CYS E  5  148 ? -12.768 54.950  87.068  1.00 97.52  ? 148 CYS E CB  1 
ATOM   8559  S SG  . CYS E  5  148 ? -12.353 55.537  88.726  1.00 104.47 ? 148 CYS E SG  1 
ATOM   8560  N N   . PRO E  5  149 ? -13.541 52.468  85.466  1.00 90.25  ? 149 PRO E N   1 
ATOM   8561  C CA  . PRO E  5  149 ? -14.308 51.964  84.322  1.00 88.20  ? 149 PRO E CA  1 
ATOM   8562  C C   . PRO E  5  149 ? -14.769 53.077  83.378  1.00 86.85  ? 149 PRO E C   1 
ATOM   8563  O O   . PRO E  5  149 ? -14.901 52.847  82.174  1.00 84.99  ? 149 PRO E O   1 
ATOM   8564  C CB  . PRO E  5  149 ? -15.511 51.294  84.982  1.00 89.60  ? 149 PRO E CB  1 
ATOM   8565  C CG  . PRO E  5  149 ? -14.979 50.817  86.286  1.00 90.48  ? 149 PRO E CG  1 
ATOM   8566  C CD  . PRO E  5  149 ? -14.016 51.879  86.734  1.00 91.12  ? 149 PRO E CD  1 
ATOM   8567  N N   . SER E  5  150 ? -15.019 54.262  83.931  1.00 87.40  ? 150 SER E N   1 
ATOM   8568  C CA  . SER E  5  150 ? -15.230 55.464  83.131  1.00 87.47  ? 150 SER E CA  1 
ATOM   8569  C C   . SER E  5  150 ? -13.875 56.019  82.700  1.00 90.48  ? 150 SER E C   1 
ATOM   8570  O O   . SER E  5  150 ? -12.884 55.881  83.422  1.00 94.09  ? 150 SER E O   1 
ATOM   8571  C CB  . SER E  5  150 ? -16.007 56.514  83.927  1.00 86.72  ? 150 SER E CB  1 
ATOM   8572  O OG  . SER E  5  150 ? -15.309 56.889  85.102  1.00 86.91  ? 150 SER E OG  1 
ATOM   8573  N N   . ALA E  5  151 ? -13.839 56.652  81.529  1.00 90.84  ? 151 ALA E N   1 
ATOM   8574  C CA  . ALA E  5  151 ? -12.592 57.148  80.935  1.00 91.38  ? 151 ALA E CA  1 
ATOM   8575  C C   . ALA E  5  151 ? -11.861 58.199  81.779  1.00 92.79  ? 151 ALA E C   1 
ATOM   8576  O O   . ALA E  5  151 ? -10.705 58.531  81.500  1.00 92.35  ? 151 ALA E O   1 
ATOM   8577  C CB  . ALA E  5  151 ? -12.856 57.681  79.536  1.00 86.43  ? 151 ALA E CB  1 
ATOM   8578  N N   . ASN E  5  152 ? -12.540 58.712  82.804  1.00 92.06  ? 152 ASN E N   1 
ATOM   8579  C CA  . ASN E  5  152 ? -11.970 59.697  83.718  1.00 90.31  ? 152 ASN E CA  1 
ATOM   8580  C C   . ASN E  5  152 ? -10.845 59.106  84.570  1.00 87.98  ? 152 ASN E C   1 
ATOM   8581  O O   . ASN E  5  152 ? -11.038 58.099  85.258  1.00 85.39  ? 152 ASN E O   1 
ATOM   8582  C CB  . ASN E  5  152 ? -13.069 60.290  84.609  1.00 91.84  ? 152 ASN E CB  1 
ATOM   8583  C CG  . ASN E  5  152 ? -12.572 61.430  85.483  1.00 93.50  ? 152 ASN E CG  1 
ATOM   8584  O OD1 . ASN E  5  152 ? -11.657 62.168  85.113  1.00 93.12  ? 152 ASN E OD1 1 
ATOM   8585  N ND2 . ASN E  5  152 ? -13.187 61.585  86.650  1.00 96.13  ? 152 ASN E ND2 1 
ATOM   8586  N N   . TYR E  5  153 ? -9.673  59.735  84.505  1.00 85.86  ? 153 TYR E N   1 
ATOM   8587  C CA  . TYR E  5  153 ? -8.507  59.303  85.277  1.00 84.44  ? 153 TYR E CA  1 
ATOM   8588  C C   . TYR E  5  153 ? -8.069  60.345  86.305  1.00 85.92  ? 153 TYR E C   1 
ATOM   8589  O O   . TYR E  5  153 ? -8.399  61.528  86.185  1.00 86.63  ? 153 TYR E O   1 
ATOM   8590  C CB  . TYR E  5  153 ? -7.340  58.921  84.355  1.00 82.08  ? 153 TYR E CB  1 
ATOM   8591  C CG  . TYR E  5  153 ? -6.944  59.979  83.344  1.00 81.83  ? 153 TYR E CG  1 
ATOM   8592  C CD1 . TYR E  5  153 ? -6.087  61.025  83.691  1.00 81.57  ? 153 TYR E CD1 1 
ATOM   8593  C CD2 . TYR E  5  153 ? -7.409  59.919  82.031  1.00 82.47  ? 153 TYR E CD2 1 
ATOM   8594  C CE1 . TYR E  5  153 ? -5.720  61.988  82.764  1.00 82.17  ? 153 TYR E CE1 1 
ATOM   8595  C CE2 . TYR E  5  153 ? -7.045  60.876  81.097  1.00 82.36  ? 153 TYR E CE2 1 
ATOM   8596  C CZ  . TYR E  5  153 ? -6.202  61.908  81.467  1.00 81.66  ? 153 TYR E CZ  1 
ATOM   8597  O OH  . TYR E  5  153 ? -5.841  62.859  80.540  1.00 82.40  ? 153 TYR E OH  1 
ATOM   8598  N N   . PHE E  5  154 ? -7.316  59.895  87.307  1.00 87.95  ? 154 PHE E N   1 
ATOM   8599  C CA  . PHE E  5  154 ? -6.907  60.747  88.421  1.00 91.12  ? 154 PHE E CA  1 
ATOM   8600  C C   . PHE E  5  154 ? -5.394  60.743  88.620  1.00 92.42  ? 154 PHE E C   1 
ATOM   8601  O O   . PHE E  5  154 ? -4.752  59.694  88.541  1.00 89.84  ? 154 PHE E O   1 
ATOM   8602  C CB  . PHE E  5  154 ? -7.587  60.293  89.718  1.00 92.30  ? 154 PHE E CB  1 
ATOM   8603  C CG  . PHE E  5  154 ? -9.086  60.201  89.628  1.00 92.55  ? 154 PHE E CG  1 
ATOM   8604  C CD1 . PHE E  5  154 ? -9.703  59.006  89.273  1.00 93.04  ? 154 PHE E CD1 1 
ATOM   8605  C CD2 . PHE E  5  154 ? -9.883  61.305  89.913  1.00 94.85  ? 154 PHE E CD2 1 
ATOM   8606  C CE1 . PHE E  5  154 ? -11.085 58.917  89.191  1.00 95.65  ? 154 PHE E CE1 1 
ATOM   8607  C CE2 . PHE E  5  154 ? -11.265 61.221  89.835  1.00 96.81  ? 154 PHE E CE2 1 
ATOM   8608  C CZ  . PHE E  5  154 ? -11.867 60.026  89.473  1.00 96.25  ? 154 PHE E CZ  1 
ATOM   8609  N N   . ASP E  5  155 ? -4.836  61.924  88.874  1.00 94.80  ? 155 ASP E N   1 
ATOM   8610  C CA  . ASP E  5  155 ? -3.441  62.055  89.283  1.00 94.76  ? 155 ASP E CA  1 
ATOM   8611  C C   . ASP E  5  155 ? -3.405  62.299  90.789  1.00 96.66  ? 155 ASP E C   1 
ATOM   8612  O O   . ASP E  5  155 ? -3.770  63.377  91.263  1.00 98.46  ? 155 ASP E O   1 
ATOM   8613  C CB  . ASP E  5  155 ? -2.748  63.192  88.523  1.00 93.32  ? 155 ASP E CB  1 
ATOM   8614  C CG  . ASP E  5  155 ? -1.271  63.324  88.874  1.00 93.59  ? 155 ASP E CG  1 
ATOM   8615  O OD1 . ASP E  5  155 ? -0.609  62.292  89.126  1.00 93.59  ? 155 ASP E OD1 1 
ATOM   8616  O OD2 . ASP E  5  155 ? -0.769  64.467  88.888  1.00 93.94  ? 155 ASP E OD2 1 
ATOM   8617  N N   . CYS E  5  156 ? -2.969  61.288  91.533  1.00 97.03  ? 156 CYS E N   1 
ATOM   8618  C CA  . CYS E  5  156 ? -3.056  61.312  92.992  1.00 99.27  ? 156 CYS E CA  1 
ATOM   8619  C C   . CYS E  5  156 ? -1.716  61.105  93.691  1.00 102.19 ? 156 CYS E C   1 
ATOM   8620  O O   . CYS E  5  156 ? -0.803  60.482  93.146  1.00 97.17  ? 156 CYS E O   1 
ATOM   8621  C CB  . CYS E  5  156 ? -4.071  60.272  93.475  1.00 98.39  ? 156 CYS E CB  1 
ATOM   8622  S SG  . CYS E  5  156 ? -3.935  58.663  92.664  1.00 92.71  ? 156 CYS E SG  1 
ATOM   8623  N N   . ARG E  5  157 ? -1.618  61.642  94.905  1.00 106.44 ? 157 ARG E N   1 
ATOM   8624  C CA  . ARG E  5  157 ? -0.435  61.499  95.749  1.00 109.10 ? 157 ARG E CA  1 
ATOM   8625  C C   . ARG E  5  157 ? -0.440  60.138  96.447  1.00 106.68 ? 157 ARG E C   1 
ATOM   8626  O O   . ARG E  5  157 ? 0.599   59.482  96.553  1.00 106.01 ? 157 ARG E O   1 
ATOM   8627  C CB  . ARG E  5  157 ? -0.383  62.647  96.763  1.00 117.10 ? 157 ARG E CB  1 
ATOM   8628  C CG  . ARG E  5  157 ? 0.859   62.697  97.642  1.00 124.70 ? 157 ARG E CG  1 
ATOM   8629  C CD  . ARG E  5  157 ? 1.304   64.129  97.914  1.00 132.16 ? 157 ARG E CD  1 
ATOM   8630  N NE  . ARG E  5  157 ? 0.192   65.078  97.987  1.00 140.99 ? 157 ARG E NE  1 
ATOM   8631  C CZ  . ARG E  5  157 ? -0.348  65.534  99.114  1.00 146.27 ? 157 ARG E CZ  1 
ATOM   8632  N NH1 . ARG E  5  157 ? 0.114   65.141  100.293 1.00 146.81 ? 157 ARG E NH1 1 
ATOM   8633  N NH2 . ARG E  5  157 ? -1.356  66.394  99.060  1.00 145.62 ? 157 ARG E NH2 1 
ATOM   8634  N N   . ALA E  5  158 ? -1.618  59.727  96.914  1.00 103.26 ? 158 ALA E N   1 
ATOM   8635  C CA  . ALA E  5  158 ? -1.826  58.410  97.514  1.00 99.68  ? 158 ALA E CA  1 
ATOM   8636  C C   . ALA E  5  158 ? -3.277  57.981  97.317  1.00 95.68  ? 158 ALA E C   1 
ATOM   8637  O O   . ALA E  5  158 ? -4.194  58.779  97.512  1.00 98.14  ? 158 ALA E O   1 
ATOM   8638  C CB  . ALA E  5  158 ? -1.471  58.431  98.994  1.00 103.65 ? 158 ALA E CB  1 
ATOM   8639  N N   . MET E  5  159 ? -3.483  56.725  96.923  1.00 91.67  ? 159 MET E N   1 
ATOM   8640  C CA  . MET E  5  159 ? -4.831  56.208  96.679  1.00 91.22  ? 159 MET E CA  1 
ATOM   8641  C C   . MET E  5  159 ? -4.945  54.710  96.958  1.00 90.36  ? 159 MET E C   1 
ATOM   8642  O O   . MET E  5  159 ? -3.980  53.960  96.791  1.00 89.30  ? 159 MET E O   1 
ATOM   8643  C CB  . MET E  5  159 ? -5.270  56.510  95.240  1.00 91.67  ? 159 MET E CB  1 
ATOM   8644  C CG  . MET E  5  159 ? -6.774  56.464  95.009  1.00 93.91  ? 159 MET E CG  1 
ATOM   8645  S SD  . MET E  5  159 ? -7.659  57.796  95.843  1.00 98.84  ? 159 MET E SD  1 
ATOM   8646  C CE  . MET E  5  159 ? -9.356  57.277  95.607  1.00 100.65 ? 159 MET E CE  1 
ATOM   8647  N N   . SER E  5  160 ? -6.134  54.291  97.387  1.00 91.73  ? 160 SER E N   1 
ATOM   8648  C CA  . SER E  5  160 ? -6.438  52.882  97.604  1.00 94.45  ? 160 SER E CA  1 
ATOM   8649  C C   . SER E  5  160 ? -7.840  52.552  97.100  1.00 96.57  ? 160 SER E C   1 
ATOM   8650  O O   . SER E  5  160 ? -8.816  53.201  97.487  1.00 99.44  ? 160 SER E O   1 
ATOM   8651  C CB  . SER E  5  160 ? -6.302  52.519  99.084  1.00 96.90  ? 160 SER E CB  1 
ATOM   8652  O OG  . SER E  5  160 ? -6.499  51.130  99.290  1.00 96.09  ? 160 SER E OG  1 
ATOM   8653  N N   . ILE E  5  161 ? -7.929  51.548  96.230  1.00 95.25  ? 161 ILE E N   1 
ATOM   8654  C CA  . ILE E  5  161 ? -9.209  51.123  95.653  1.00 95.28  ? 161 ILE E CA  1 
ATOM   8655  C C   . ILE E  5  161 ? -9.438  49.617  95.790  1.00 93.90  ? 161 ILE E C   1 
ATOM   8656  O O   . ILE E  5  161 ? -8.501  48.824  95.680  1.00 93.00  ? 161 ILE E O   1 
ATOM   8657  C CB  . ILE E  5  161 ? -9.354  51.540  94.168  1.00 94.51  ? 161 ILE E CB  1 
ATOM   8658  C CG1 . ILE E  5  161 ? -8.100  51.170  93.363  1.00 92.53  ? 161 ILE E CG1 1 
ATOM   8659  C CG2 . ILE E  5  161 ? -9.661  53.029  94.062  1.00 95.21  ? 161 ILE E CG2 1 
ATOM   8660  C CD1 . ILE E  5  161 ? -8.329  51.043  91.871  1.00 92.80  ? 161 ILE E CD1 1 
ATOM   8661  N N   . GLY E  5  162 ? -10.691 49.239  96.032  1.00 95.74  ? 162 GLY E N   1 
ATOM   8662  C CA  . GLY E  5  162 ? -11.072 47.836  96.182  1.00 98.93  ? 162 GLY E CA  1 
ATOM   8663  C C   . GLY E  5  162 ? -12.076 47.606  97.298  1.00 104.15 ? 162 GLY E C   1 
ATOM   8664  O O   . GLY E  5  162 ? -12.815 48.518  97.678  1.00 106.13 ? 162 GLY E O   1 
ATOM   8665  N N   . ALA E  5  163 ? -12.100 46.381  97.818  1.00 106.41 ? 163 ALA E N   1 
ATOM   8666  C CA  . ALA E  5  163 ? -13.004 46.009  98.904  1.00 108.11 ? 163 ALA E CA  1 
ATOM   8667  C C   . ALA E  5  163 ? -12.493 46.527  100.243 1.00 111.41 ? 163 ALA E C   1 
ATOM   8668  O O   . ALA E  5  163 ? -11.333 46.304  100.600 1.00 110.22 ? 163 ALA E O   1 
ATOM   8669  C CB  . ALA E  5  163 ? -13.194 44.499  98.950  1.00 107.30 ? 163 ALA E CB  1 
ATOM   8670  N N   . ARG E  5  164 ? -13.371 47.223  100.968 1.00 115.19 ? 164 ARG E N   1 
ATOM   8671  C CA  . ARG E  5  164 ? -13.055 47.822  102.273 1.00 118.03 ? 164 ARG E CA  1 
ATOM   8672  C C   . ARG E  5  164 ? -11.852 48.774  102.216 1.00 119.43 ? 164 ARG E C   1 
ATOM   8673  O O   . ARG E  5  164 ? -11.102 48.908  103.186 1.00 122.09 ? 164 ARG E O   1 
ATOM   8674  C CB  . ARG E  5  164 ? -12.859 46.735  103.343 1.00 118.30 ? 164 ARG E CB  1 
ATOM   8675  C CG  . ARG E  5  164 ? -14.151 46.076  103.803 1.00 119.61 ? 164 ARG E CG  1 
ATOM   8676  C CD  . ARG E  5  164 ? -13.895 44.780  104.557 1.00 120.72 ? 164 ARG E CD  1 
ATOM   8677  N NE  . ARG E  5  164 ? -13.683 43.646  103.657 1.00 120.66 ? 164 ARG E NE  1 
ATOM   8678  C CZ  . ARG E  5  164 ? -12.505 43.073  103.418 1.00 121.91 ? 164 ARG E CZ  1 
ATOM   8679  N NH1 . ARG E  5  164 ? -11.405 43.511  104.016 1.00 122.22 ? 164 ARG E NH1 1 
ATOM   8680  N NH2 . ARG E  5  164 ? -12.429 42.047  102.580 1.00 123.33 ? 164 ARG E NH2 1 
ATOM   8681  N N   . SER E  5  165 ? -11.695 49.444  101.075 1.00 119.86 ? 165 SER E N   1 
ATOM   8682  C CA  . SER E  5  165 ? -10.567 50.346  100.832 1.00 121.37 ? 165 SER E CA  1 
ATOM   8683  C C   . SER E  5  165 ? -10.767 51.739  101.438 1.00 123.90 ? 165 SER E C   1 
ATOM   8684  O O   . SER E  5  165 ? -9.863  52.578  101.388 1.00 124.57 ? 165 SER E O   1 
ATOM   8685  C CB  . SER E  5  165 ? -10.289 50.457  99.329  1.00 120.95 ? 165 SER E CB  1 
ATOM   8686  O OG  . SER E  5  165 ? -11.414 50.970  98.636  1.00 121.33 ? 165 SER E OG  1 
ATOM   8687  N N   . GLN E  5  166 ? -11.949 51.974  102.007 1.00 124.11 ? 166 GLN E N   1 
ATOM   8688  C CA  . GLN E  5  166 ? -12.271 53.242  102.664 1.00 126.38 ? 166 GLN E CA  1 
ATOM   8689  C C   . GLN E  5  166 ? -11.438 53.444  103.933 1.00 124.51 ? 166 GLN E C   1 
ATOM   8690  O O   . GLN E  5  166 ? -11.042 54.569  104.249 1.00 122.90 ? 166 GLN E O   1 
ATOM   8691  C CB  . GLN E  5  166 ? -13.772 53.313  102.981 1.00 130.74 ? 166 GLN E CB  1 
ATOM   8692  C CG  . GLN E  5  166 ? -14.259 54.653  103.525 1.00 135.29 ? 166 GLN E CG  1 
ATOM   8693  C CD  . GLN E  5  166 ? -14.094 55.800  102.541 1.00 139.49 ? 166 GLN E CD  1 
ATOM   8694  O OE1 . GLN E  5  166 ? -13.410 56.783  102.828 1.00 140.78 ? 166 GLN E OE1 1 
ATOM   8695  N NE2 . GLN E  5  166 ? -14.719 55.679  101.374 1.00 140.72 ? 166 GLN E NE2 1 
ATOM   8696  N N   . SER E  5  167 ? -11.175 52.348  104.644 1.00 123.29 ? 167 SER E N   1 
ATOM   8697  C CA  . SER E  5  167 ? -10.344 52.367  105.849 1.00 122.06 ? 167 SER E CA  1 
ATOM   8698  C C   . SER E  5  167 ? -8.886  52.694  105.524 1.00 119.98 ? 167 SER E C   1 
ATOM   8699  O O   . SER E  5  167 ? -8.195  53.335  106.319 1.00 120.98 ? 167 SER E O   1 
ATOM   8700  C CB  . SER E  5  167 ? -10.433 51.027  106.583 1.00 121.31 ? 167 SER E CB  1 
ATOM   8701  O OG  . SER E  5  167 ? -11.763 50.752  106.986 1.00 120.69 ? 167 SER E OG  1 
ATOM   8702  N N   . ALA E  5  168 ? -8.431  52.246  104.356 1.00 116.52 ? 168 ALA E N   1 
ATOM   8703  C CA  . ALA E  5  168 ? -7.092  52.557  103.860 1.00 114.01 ? 168 ALA E CA  1 
ATOM   8704  C C   . ALA E  5  168 ? -7.012  53.998  103.368 1.00 114.31 ? 168 ALA E C   1 
ATOM   8705  O O   . ALA E  5  168 ? -5.969  54.643  103.481 1.00 115.02 ? 168 ALA E O   1 
ATOM   8706  C CB  . ALA E  5  168 ? -6.707  51.599  102.745 1.00 113.00 ? 168 ALA E CB  1 
ATOM   8707  N N   . ARG E  5  169 ? -8.125  54.488  102.826 1.00 115.39 ? 169 ARG E N   1 
ATOM   8708  C CA  . ARG E  5  169 ? -8.219  55.840  102.280 1.00 116.72 ? 169 ARG E CA  1 
ATOM   8709  C C   . ARG E  5  169 ? -8.148  56.904  103.377 1.00 119.48 ? 169 ARG E C   1 
ATOM   8710  O O   . ARG E  5  169 ? -7.654  58.010  103.146 1.00 118.33 ? 169 ARG E O   1 
ATOM   8711  C CB  . ARG E  5  169 ? -9.518  55.986  101.485 1.00 116.58 ? 169 ARG E CB  1 
ATOM   8712  C CG  . ARG E  5  169 ? -9.463  56.996  100.350 1.00 112.80 ? 169 ARG E CG  1 
ATOM   8713  C CD  . ARG E  5  169 ? -10.684 56.873  99.452  1.00 111.38 ? 169 ARG E CD  1 
ATOM   8714  N NE  . ARG E  5  169 ? -10.735 55.581  98.768  1.00 110.55 ? 169 ARG E NE  1 
ATOM   8715  C CZ  . ARG E  5  169 ? -11.796 55.108  98.119  1.00 112.69 ? 169 ARG E CZ  1 
ATOM   8716  N NH1 . ARG E  5  169 ? -12.920 55.812  98.061  1.00 114.17 ? 169 ARG E NH1 1 
ATOM   8717  N NH2 . ARG E  5  169 ? -11.735 53.922  97.531  1.00 113.27 ? 169 ARG E NH2 1 
ATOM   8718  N N   . THR E  5  170 ? -8.642  56.558  104.565 1.00 123.20 ? 170 THR E N   1 
ATOM   8719  C CA  . THR E  5  170 ? -8.616  57.456  105.720 1.00 126.24 ? 170 THR E CA  1 
ATOM   8720  C C   . THR E  5  170 ? -7.218  57.568  106.331 1.00 127.79 ? 170 THR E C   1 
ATOM   8721  O O   . THR E  5  170 ? -6.828  58.640  106.800 1.00 130.08 ? 170 THR E O   1 
ATOM   8722  C CB  . THR E  5  170 ? -9.622  57.028  106.811 1.00 127.16 ? 170 THR E CB  1 
ATOM   8723  O OG1 . THR E  5  170 ? -9.465  55.632  107.096 1.00 126.45 ? 170 THR E OG1 1 
ATOM   8724  C CG2 . THR E  5  170 ? -11.054 57.294  106.361 1.00 126.25 ? 170 THR E CG2 1 
ATOM   8725  N N   . TYR E  5  171 ? -6.474  56.462  106.320 1.00 125.95 ? 171 TYR E N   1 
ATOM   8726  C CA  . TYR E  5  171 ? -5.108  56.428  106.847 1.00 126.06 ? 171 TYR E CA  1 
ATOM   8727  C C   . TYR E  5  171 ? -4.140  57.228  105.974 1.00 126.63 ? 171 TYR E C   1 
ATOM   8728  O O   . TYR E  5  171 ? -3.262  57.924  106.489 1.00 127.57 ? 171 TYR E O   1 
ATOM   8729  C CB  . TYR E  5  171 ? -4.619  54.980  107.005 1.00 124.56 ? 171 TYR E CB  1 
ATOM   8730  C CG  . TYR E  5  171 ? -3.159  54.855  107.399 1.00 125.36 ? 171 TYR E CG  1 
ATOM   8731  C CD1 . TYR E  5  171 ? -2.760  54.981  108.730 1.00 126.89 ? 171 TYR E CD1 1 
ATOM   8732  C CD2 . TYR E  5  171 ? -2.177  54.613  106.438 1.00 123.94 ? 171 TYR E CD2 1 
ATOM   8733  C CE1 . TYR E  5  171 ? -1.426  54.870  109.091 1.00 127.31 ? 171 TYR E CE1 1 
ATOM   8734  C CE2 . TYR E  5  171 ? -0.841  54.502  106.789 1.00 123.21 ? 171 TYR E CE2 1 
ATOM   8735  C CZ  . TYR E  5  171 ? -0.471  54.630  108.115 1.00 124.47 ? 171 TYR E CZ  1 
ATOM   8736  O OH  . TYR E  5  171 ? 0.855   54.519  108.463 1.00 122.03 ? 171 TYR E OH  1 
ATOM   8737  N N   . LEU E  5  172 ? -4.310  57.118  104.657 1.00 125.48 ? 172 LEU E N   1 
ATOM   8738  C CA  . LEU E  5  172 ? -3.469  57.828  103.693 1.00 124.48 ? 172 LEU E CA  1 
ATOM   8739  C C   . LEU E  5  172 ? -3.694  59.339  103.736 1.00 125.98 ? 172 LEU E C   1 
ATOM   8740  O O   . LEU E  5  172 ? -2.778  60.115  103.457 1.00 126.75 ? 172 LEU E O   1 
ATOM   8741  C CB  . LEU E  5  172 ? -3.714  57.303  102.273 1.00 122.10 ? 172 LEU E CB  1 
ATOM   8742  C CG  . LEU E  5  172 ? -3.294  55.868  101.931 1.00 121.68 ? 172 LEU E CG  1 
ATOM   8743  C CD1 . LEU E  5  172 ? -4.022  55.385  100.685 1.00 118.40 ? 172 LEU E CD1 1 
ATOM   8744  C CD2 . LEU E  5  172 ? -1.787  55.744  101.756 1.00 118.67 ? 172 LEU E CD2 1 
ATOM   8745  N N   . GLU E  5  173 ? -4.914  59.743  104.087 1.00 128.81 ? 173 GLU E N   1 
ATOM   8746  C CA  . GLU E  5  173 ? -5.290  61.155  104.159 1.00 133.48 ? 173 GLU E CA  1 
ATOM   8747  C C   . GLU E  5  173 ? -4.672  61.855  105.373 1.00 136.88 ? 173 GLU E C   1 
ATOM   8748  O O   . GLU E  5  173 ? -4.413  63.060  105.335 1.00 137.76 ? 173 GLU E O   1 
ATOM   8749  C CB  . GLU E  5  173 ? -6.815  61.295  104.182 1.00 138.48 ? 173 GLU E CB  1 
ATOM   8750  C CG  . GLU E  5  173 ? -7.330  62.669  103.772 1.00 141.96 ? 173 GLU E CG  1 
ATOM   8751  C CD  . GLU E  5  173 ? -8.847  62.760  103.762 1.00 145.60 ? 173 GLU E CD  1 
ATOM   8752  O OE1 . GLU E  5  173 ? -9.510  61.780  103.358 1.00 144.74 ? 173 GLU E OE1 1 
ATOM   8753  O OE2 . GLU E  5  173 ? -9.378  63.821  104.151 1.00 147.54 ? 173 GLU E OE2 1 
ATOM   8754  N N   . ARG E  5  174 ? -4.440  61.096  106.441 1.00 139.82 ? 174 ARG E N   1 
ATOM   8755  C CA  . ARG E  5  174 ? -3.860  61.638  107.671 1.00 144.16 ? 174 ARG E CA  1 
ATOM   8756  C C   . ARG E  5  174 ? -2.332  61.669  107.631 1.00 143.72 ? 174 ARG E C   1 
ATOM   8757  O O   . ARG E  5  174 ? -1.700  62.375  108.421 1.00 143.71 ? 174 ARG E O   1 
ATOM   8758  C CB  . ARG E  5  174 ? -4.343  60.849  108.894 1.00 147.01 ? 174 ARG E CB  1 
ATOM   8759  C CG  . ARG E  5  174 ? -5.847  60.897  109.118 1.00 150.11 ? 174 ARG E CG  1 
ATOM   8760  C CD  . ARG E  5  174 ? -6.228  60.376  110.494 1.00 157.04 ? 174 ARG E CD  1 
ATOM   8761  N NE  . ARG E  5  174 ? -6.019  61.379  111.537 1.00 164.26 ? 174 ARG E NE  1 
ATOM   8762  C CZ  . ARG E  5  174 ? -6.283  61.196  112.828 1.00 167.75 ? 174 ARG E CZ  1 
ATOM   8763  N NH1 . ARG E  5  174 ? -6.770  60.040  113.260 1.00 166.98 ? 174 ARG E NH1 1 
ATOM   8764  N NH2 . ARG E  5  174 ? -6.059  62.174  113.695 1.00 169.98 ? 174 ARG E NH2 1 
ATOM   8765  N N   . HIS E  5  175 ? -1.748  60.907  106.709 1.00 142.97 ? 175 HIS E N   1 
ATOM   8766  C CA  . HIS E  5  175 ? -0.294  60.827  106.566 1.00 145.40 ? 175 HIS E CA  1 
ATOM   8767  C C   . HIS E  5  175 ? 0.180   61.262  105.201 1.00 143.94 ? 175 HIS E C   1 
ATOM   8768  O O   . HIS E  5  175 ? 1.275   60.889  104.770 1.00 142.44 ? 175 HIS E O   1 
ATOM   8769  C CB  . HIS E  5  175 ? 0.190   59.411  106.870 1.00 147.42 ? 175 HIS E CB  1 
ATOM   8770  C CG  . HIS E  5  175 ? -0.047  58.976  108.296 1.00 147.90 ? 175 HIS E CG  1 
ATOM   8771  N ND1 . HIS E  5  175 ? 0.893   59.086  109.252 1.00 149.28 ? 175 HIS E ND1 1 
ATOM   8772  C CD2 . HIS E  5  175 ? -1.166  58.414  108.909 1.00 145.99 ? 175 HIS E CD2 1 
ATOM   8773  C CE1 . HIS E  5  175 ? 0.404   58.621  110.417 1.00 151.00 ? 175 HIS E CE1 1 
ATOM   8774  N NE2 . HIS E  5  175 ? -0.856  58.210  110.205 1.00 149.95 ? 175 HIS E NE2 1 
ATOM   8775  N N   . MET E  5  176 ? -0.634  62.067  104.517 1.00 142.40 ? 176 MET E N   1 
ATOM   8776  C CA  . MET E  5  176 ? -0.334  62.507  103.147 1.00 138.28 ? 176 MET E CA  1 
ATOM   8777  C C   . MET E  5  176 ? 0.854   63.465  103.045 1.00 138.16 ? 176 MET E C   1 
ATOM   8778  O O   . MET E  5  176 ? 1.592   63.441  102.057 1.00 136.90 ? 176 MET E O   1 
ATOM   8779  C CB  . MET E  5  176 ? -1.579  63.095  102.461 1.00 138.09 ? 176 MET E CB  1 
ATOM   8780  C CG  . MET E  5  176 ? -2.201  64.304  103.145 1.00 141.92 ? 176 MET E CG  1 
ATOM   8781  S SD  . MET E  5  176 ? -3.639  64.925  102.252 1.00 144.77 ? 176 MET E SD  1 
ATOM   8782  C CE  . MET E  5  176 ? -4.191  66.222  103.358 1.00 146.99 ? 176 MET E CE  1 
ATOM   8783  N N   . SER E  5  177 ? 1.033   64.300  104.067 1.00 136.91 ? 177 SER E N   1 
ATOM   8784  C CA  . SER E  5  177 ? 2.118   65.283  104.099 1.00 134.42 ? 177 SER E CA  1 
ATOM   8785  C C   . SER E  5  177 ? 3.468   64.651  104.443 1.00 132.78 ? 177 SER E C   1 
ATOM   8786  O O   . SER E  5  177 ? 4.520   65.244  104.194 1.00 130.96 ? 177 SER E O   1 
ATOM   8787  C CB  . SER E  5  177 ? 1.792   66.405  105.089 1.00 133.90 ? 177 SER E CB  1 
ATOM   8788  O OG  . SER E  5  177 ? 1.601   65.893  106.397 1.00 133.60 ? 177 SER E OG  1 
ATOM   8789  N N   . GLU E  5  178 ? 3.424   63.449  105.013 1.00 132.56 ? 178 GLU E N   1 
ATOM   8790  C CA  . GLU E  5  178 ? 4.625   62.729  105.436 1.00 133.19 ? 178 GLU E CA  1 
ATOM   8791  C C   . GLU E  5  178 ? 5.347   62.034  104.280 1.00 133.27 ? 178 GLU E C   1 
ATOM   8792  O O   . GLU E  5  178 ? 6.567   61.871  104.322 1.00 132.72 ? 178 GLU E O   1 
ATOM   8793  C CB  . GLU E  5  178 ? 4.272   61.696  106.512 1.00 134.17 ? 178 GLU E CB  1 
ATOM   8794  C CG  . GLU E  5  178 ? 3.874   62.287  107.859 1.00 136.95 ? 178 GLU E CG  1 
ATOM   8795  C CD  . GLU E  5  178 ? 5.063   62.636  108.736 1.00 138.30 ? 178 GLU E CD  1 
ATOM   8796  O OE1 . GLU E  5  178 ? 5.060   63.734  109.328 1.00 138.44 ? 178 GLU E OE1 1 
ATOM   8797  O OE2 . GLU E  5  178 ? 5.997   61.813  108.841 1.00 139.13 ? 178 GLU E OE2 1 
ATOM   8798  N N   . PHE E  5  179 ? 4.590   61.637  103.257 1.00 132.34 ? 179 PHE E N   1 
ATOM   8799  C CA  . PHE E  5  179 ? 5.106   60.806  102.161 1.00 129.90 ? 179 PHE E CA  1 
ATOM   8800  C C   . PHE E  5  179 ? 6.255   61.418  101.359 1.00 125.11 ? 179 PHE E C   1 
ATOM   8801  O O   . PHE E  5  179 ? 7.173   60.704  100.952 1.00 118.24 ? 179 PHE E O   1 
ATOM   8802  C CB  . PHE E  5  179 ? 3.977   60.393  101.204 1.00 128.53 ? 179 PHE E CB  1 
ATOM   8803  C CG  . PHE E  5  179 ? 2.917   59.534  101.838 1.00 132.81 ? 179 PHE E CG  1 
ATOM   8804  C CD1 . PHE E  5  179 ? 1.570   59.812  101.633 1.00 134.76 ? 179 PHE E CD1 1 
ATOM   8805  C CD2 . PHE E  5  179 ? 3.259   58.446  102.637 1.00 131.77 ? 179 PHE E CD2 1 
ATOM   8806  C CE1 . PHE E  5  179 ? 0.585   59.024  102.209 1.00 133.85 ? 179 PHE E CE1 1 
ATOM   8807  C CE2 . PHE E  5  179 ? 2.278   57.658  103.219 1.00 129.60 ? 179 PHE E CE2 1 
ATOM   8808  C CZ  . PHE E  5  179 ? 0.940   57.947  103.005 1.00 131.32 ? 179 PHE E CZ  1 
ATOM   8809  N N   . MET E  5  180 ? 6.201   62.731  101.140 1.00 125.39 ? 180 MET E N   1 
ATOM   8810  C CA  . MET E  5  180 ? 7.175   63.433  100.295 1.00 124.21 ? 180 MET E CA  1 
ATOM   8811  C C   . MET E  5  180 ? 8.631   63.284  100.744 1.00 123.54 ? 180 MET E C   1 
ATOM   8812  O O   . MET E  5  180 ? 9.529   63.159  99.909  1.00 121.35 ? 180 MET E O   1 
ATOM   8813  C CB  . MET E  5  180 ? 6.808   64.916  100.163 1.00 126.31 ? 180 MET E CB  1 
ATOM   8814  C CG  . MET E  5  180 ? 5.700   65.194  99.158  1.00 128.08 ? 180 MET E CG  1 
ATOM   8815  S SD  . MET E  5  180 ? 6.175   64.783  97.466  1.00 127.98 ? 180 MET E SD  1 
ATOM   8816  C CE  . MET E  5  180 ? 4.646   65.097  96.589  1.00 126.47 ? 180 MET E CE  1 
ATOM   8817  N N   . GLU E  5  181 ? 8.854   63.295  102.057 1.00 125.13 ? 181 GLU E N   1 
ATOM   8818  C CA  . GLU E  5  181 ? 10.204  63.217  102.618 1.00 124.78 ? 181 GLU E CA  1 
ATOM   8819  C C   . GLU E  5  181 ? 10.496  61.856  103.261 1.00 122.47 ? 181 GLU E C   1 
ATOM   8820  O O   . GLU E  5  181 ? 11.298  61.759  104.195 1.00 123.49 ? 181 GLU E O   1 
ATOM   8821  C CB  . GLU E  5  181 ? 10.431  64.351  103.628 1.00 126.47 ? 181 GLU E CB  1 
ATOM   8822  C CG  . GLU E  5  181 ? 10.354  65.757  103.044 1.00 127.24 ? 181 GLU E CG  1 
ATOM   8823  C CD  . GLU E  5  181 ? 11.522  66.097  102.132 1.00 125.39 ? 181 GLU E CD  1 
ATOM   8824  O OE1 . GLU E  5  181 ? 12.659  65.660  102.415 1.00 125.36 ? 181 GLU E OE1 1 
ATOM   8825  O OE2 . GLU E  5  181 ? 11.304  66.811  101.131 1.00 123.99 ? 181 GLU E OE2 1 
ATOM   8826  N N   . CYS E  5  182 ? 9.852   60.809  102.746 1.00 119.87 ? 182 CYS E N   1 
ATOM   8827  C CA  . CYS E  5  182 ? 9.999   59.459  103.290 1.00 119.15 ? 182 CYS E CA  1 
ATOM   8828  C C   . CYS E  5  182 ? 11.108  58.650  102.626 1.00 115.58 ? 182 CYS E C   1 
ATOM   8829  O O   . CYS E  5  182 ? 11.326  58.742  101.416 1.00 114.70 ? 182 CYS E O   1 
ATOM   8830  C CB  . CYS E  5  182 ? 8.678   58.689  103.203 1.00 122.77 ? 182 CYS E CB  1 
ATOM   8831  S SG  . CYS E  5  182 ? 7.632   58.819  104.671 1.00 128.90 ? 182 CYS E SG  1 
ATOM   8832  N N   . ASN E  5  183 ? 11.796  57.857  103.443 1.00 115.22 ? 183 ASN E N   1 
ATOM   8833  C CA  . ASN E  5  183 ? 12.794  56.898  102.982 1.00 114.29 ? 183 ASN E CA  1 
ATOM   8834  C C   . ASN E  5  183 ? 12.114  55.710  102.299 1.00 113.20 ? 183 ASN E C   1 
ATOM   8835  O O   . ASN E  5  183 ? 10.958  55.405  102.595 1.00 112.80 ? 183 ASN E O   1 
ATOM   8836  C CB  . ASN E  5  183 ? 13.637  56.435  104.178 1.00 117.66 ? 183 ASN E CB  1 
ATOM   8837  C CG  . ASN E  5  183 ? 14.638  55.353  103.819 1.00 120.54 ? 183 ASN E CG  1 
ATOM   8838  O OD1 . ASN E  5  183 ? 14.586  54.249  104.360 1.00 125.85 ? 183 ASN E OD1 1 
ATOM   8839  N ND2 . ASN E  5  183 ? 15.554  55.662  102.909 1.00 120.76 ? 183 ASN E ND2 1 
ATOM   8840  N N   . LEU E  5  184 ? 12.832  55.054  101.386 1.00 113.15 ? 184 LEU E N   1 
ATOM   8841  C CA  . LEU E  5  184 ? 12.308  53.907  100.633 1.00 112.36 ? 184 LEU E CA  1 
ATOM   8842  C C   . LEU E  5  184 ? 11.719  52.816  101.532 1.00 115.06 ? 184 LEU E C   1 
ATOM   8843  O O   . LEU E  5  184 ? 10.637  52.297  101.253 1.00 115.19 ? 184 LEU E O   1 
ATOM   8844  C CB  . LEU E  5  184 ? 13.392  53.320  99.715  1.00 110.83 ? 184 LEU E CB  1 
ATOM   8845  C CG  . LEU E  5  184 ? 13.076  52.069  98.881  1.00 107.41 ? 184 LEU E CG  1 
ATOM   8846  C CD1 . LEU E  5  184 ? 11.985  52.332  97.852  1.00 103.41 ? 184 LEU E CD1 1 
ATOM   8847  C CD2 . LEU E  5  184 ? 14.334  51.545  98.204  1.00 107.94 ? 184 LEU E CD2 1 
ATOM   8848  N N   . ASP E  5  185 ? 12.435  52.480  102.605 1.00 119.49 ? 185 ASP E N   1 
ATOM   8849  C CA  . ASP E  5  185 ? 11.985  51.469  103.562 1.00 125.06 ? 185 ASP E CA  1 
ATOM   8850  C C   . ASP E  5  185 ? 10.751  51.931  104.340 1.00 125.32 ? 185 ASP E C   1 
ATOM   8851  O O   . ASP E  5  185 ? 9.860   51.130  104.630 1.00 123.77 ? 185 ASP E O   1 
ATOM   8852  C CB  . ASP E  5  185 ? 13.116  51.104  104.529 1.00 132.41 ? 185 ASP E CB  1 
ATOM   8853  C CG  . ASP E  5  185 ? 12.786  49.896  105.390 1.00 135.32 ? 185 ASP E CG  1 
ATOM   8854  O OD1 . ASP E  5  185 ? 12.516  48.813  104.827 1.00 137.22 ? 185 ASP E OD1 1 
ATOM   8855  O OD2 . ASP E  5  185 ? 12.806  50.027  106.632 1.00 136.48 ? 185 ASP E OD2 1 
ATOM   8856  N N   . GLU E  5  186 ? 10.710  53.221  104.667 1.00 126.77 ? 186 GLU E N   1 
ATOM   8857  C CA  . GLU E  5  186 ? 9.591   53.810  105.403 1.00 129.43 ? 186 GLU E CA  1 
ATOM   8858  C C   . GLU E  5  186 ? 8.357   54.002  104.523 1.00 124.58 ? 186 GLU E C   1 
ATOM   8859  O O   . GLU E  5  186 ? 7.227   53.874  105.000 1.00 123.18 ? 186 GLU E O   1 
ATOM   8860  C CB  . GLU E  5  186 ? 10.000  55.146  106.029 1.00 134.22 ? 186 GLU E CB  1 
ATOM   8861  C CG  . GLU E  5  186 ? 11.021  55.028  107.151 1.00 139.55 ? 186 GLU E CG  1 
ATOM   8862  C CD  . GLU E  5  186 ? 11.401  56.369  107.751 1.00 143.08 ? 186 GLU E CD  1 
ATOM   8863  O OE1 . GLU E  5  186 ? 11.524  57.358  106.995 1.00 142.85 ? 186 GLU E OE1 1 
ATOM   8864  O OE2 . GLU E  5  186 ? 11.583  56.433  108.984 1.00 145.09 ? 186 GLU E OE2 1 
ATOM   8865  N N   . LEU E  5  187 ? 8.584   54.306  103.245 1.00 119.78 ? 187 LEU E N   1 
ATOM   8866  C CA  . LEU E  5  187 ? 7.510   54.538  102.276 1.00 112.68 ? 187 LEU E CA  1 
ATOM   8867  C C   . LEU E  5  187 ? 6.661   53.284  102.080 1.00 107.05 ? 187 LEU E C   1 
ATOM   8868  O O   . LEU E  5  187 ? 5.433   53.362  102.008 1.00 103.95 ? 187 LEU E O   1 
ATOM   8869  C CB  . LEU E  5  187 ? 8.093   54.975  100.926 1.00 109.98 ? 187 LEU E CB  1 
ATOM   8870  C CG  . LEU E  5  187 ? 7.450   56.080  100.073 1.00 107.32 ? 187 LEU E CG  1 
ATOM   8871  C CD1 . LEU E  5  187 ? 7.709   55.789  98.603  1.00 103.01 ? 187 LEU E CD1 1 
ATOM   8872  C CD2 . LEU E  5  187 ? 5.957   56.262  100.310 1.00 105.37 ? 187 LEU E CD2 1 
ATOM   8873  N N   . VAL E  5  188 ? 7.330   52.135  101.994 1.00 104.44 ? 188 VAL E N   1 
ATOM   8874  C CA  . VAL E  5  188 ? 6.666   50.842  101.830 1.00 101.50 ? 188 VAL E CA  1 
ATOM   8875  C C   . VAL E  5  188 ? 5.879   50.475  103.091 1.00 104.85 ? 188 VAL E C   1 
ATOM   8876  O O   . VAL E  5  188 ? 4.745   50.001  102.999 1.00 104.93 ? 188 VAL E O   1 
ATOM   8877  C CB  . VAL E  5  188 ? 7.673   49.723  101.469 1.00 99.26  ? 188 VAL E CB  1 
ATOM   8878  C CG1 . VAL E  5  188 ? 6.964   48.389  101.286 1.00 98.87  ? 188 VAL E CG1 1 
ATOM   8879  C CG2 . VAL E  5  188 ? 8.438   50.077  100.202 1.00 99.25  ? 188 VAL E CG2 1 
ATOM   8880  N N   . LYS E  5  189 ? 6.479   50.715  104.257 1.00 107.88 ? 189 LYS E N   1 
ATOM   8881  C CA  . LYS E  5  189 ? 5.842   50.436  105.551 1.00 111.22 ? 189 LYS E CA  1 
ATOM   8882  C C   . LYS E  5  189 ? 4.539   51.211  105.756 1.00 112.98 ? 189 LYS E C   1 
ATOM   8883  O O   . LYS E  5  189 ? 3.630   50.733  106.438 1.00 115.78 ? 189 LYS E O   1 
ATOM   8884  C CB  . LYS E  5  189 ? 6.812   50.704  106.705 1.00 112.03 ? 189 LYS E CB  1 
ATOM   8885  C CG  . LYS E  5  189 ? 7.861   49.621  106.897 1.00 111.62 ? 189 LYS E CG  1 
ATOM   8886  C CD  . LYS E  5  189 ? 8.811   49.963  108.034 1.00 112.00 ? 189 LYS E CD  1 
ATOM   8887  C CE  . LYS E  5  189 ? 9.894   48.907  108.198 1.00 112.55 ? 189 LYS E CE  1 
ATOM   8888  N NZ  . LYS E  5  189 ? 9.372   47.628  108.755 1.00 110.93 ? 189 LYS E NZ  1 
ATOM   8889  N N   . HIS E  5  190 ? 4.460   52.402  105.165 1.00 113.09 ? 190 HIS E N   1 
ATOM   8890  C CA  . HIS E  5  190 ? 3.229   53.192  105.151 1.00 115.73 ? 190 HIS E CA  1 
ATOM   8891  C C   . HIS E  5  190 ? 2.183   52.572  104.264 1.00 113.86 ? 190 HIS E C   1 
ATOM   8892  O O   . HIS E  5  190 ? 0.983   52.729  104.502 1.00 113.46 ? 190 HIS E O   1 
ATOM   8893  C CB  . HIS E  5  190 ? 3.513   54.621  104.702 1.00 118.99 ? 190 HIS E CB  1 
ATOM   8894  C CG  . HIS E  5  190 ? 3.940   55.541  105.822 1.00 122.92 ? 190 HIS E CG  1 
ATOM   8895  N ND1 . HIS E  5  190 ? 3.060   56.264  106.537 1.00 124.97 ? 190 HIS E ND1 1 
ATOM   8896  C CD2 . HIS E  5  190 ? 5.202   55.841  106.331 1.00 124.92 ? 190 HIS E CD2 1 
ATOM   8897  C CE1 . HIS E  5  190 ? 3.720   56.989  107.459 1.00 127.99 ? 190 HIS E CE1 1 
ATOM   8898  N NE2 . HIS E  5  190 ? 5.031   56.729  107.332 1.00 127.99 ? 190 HIS E NE2 1 
ATOM   8899  N N   . GLY E  5  191 ? 2.636   51.860  103.233 1.00 112.40 ? 191 GLY E N   1 
ATOM   8900  C CA  . GLY E  5  191 ? 1.748   51.181  102.292 1.00 109.99 ? 191 GLY E CA  1 
ATOM   8901  C C   . GLY E  5  191 ? 1.067   49.957  102.874 1.00 110.24 ? 191 GLY E C   1 
ATOM   8902  O O   . GLY E  5  191 ? -0.136  49.765  102.679 1.00 110.05 ? 191 GLY E O   1 
ATOM   8903  N N   . LEU E  5  192 ? 1.834   49.130  103.585 1.00 108.58 ? 192 LEU E N   1 
ATOM   8904  C CA  . LEU E  5  192 ? 1.296   47.919  104.212 1.00 110.06 ? 192 LEU E CA  1 
ATOM   8905  C C   . LEU E  5  192 ? 0.348   48.245  105.363 1.00 116.01 ? 192 LEU E C   1 
ATOM   8906  O O   . LEU E  5  192 ? -0.659  47.560  105.555 1.00 119.87 ? 192 LEU E O   1 
ATOM   8907  C CB  . LEU E  5  192 ? 2.410   46.997  104.719 1.00 107.95 ? 192 LEU E CB  1 
ATOM   8908  C CG  . LEU E  5  192 ? 3.476   46.473  103.761 1.00 105.07 ? 192 LEU E CG  1 
ATOM   8909  C CD1 . LEU E  5  192 ? 4.823   47.049  104.152 1.00 105.16 ? 192 LEU E CD1 1 
ATOM   8910  C CD2 . LEU E  5  192 ? 3.536   44.956  103.818 1.00 107.01 ? 192 LEU E CD2 1 
ATOM   8911  N N   . ARG E  5  193 ? 0.678   49.290  106.121 1.00 118.64 ? 193 ARG E N   1 
ATOM   8912  C CA  . ARG E  5  193 ? -0.131  49.722  107.260 1.00 123.31 ? 193 ARG E CA  1 
ATOM   8913  C C   . ARG E  5  193 ? -1.499  50.237  106.810 1.00 126.69 ? 193 ARG E C   1 
ATOM   8914  O O   . ARG E  5  193 ? -2.479  50.144  107.552 1.00 130.34 ? 193 ARG E O   1 
ATOM   8915  C CB  . ARG E  5  193 ? 0.607   50.789  108.073 1.00 122.31 ? 193 ARG E CB  1 
ATOM   8916  C CG  . ARG E  5  193 ? 0.217   50.827  109.544 1.00 124.51 ? 193 ARG E CG  1 
ATOM   8917  C CD  . ARG E  5  193 ? 1.055   51.816  110.342 1.00 123.71 ? 193 ARG E CD  1 
ATOM   8918  N NE  . ARG E  5  193 ? 2.451   51.397  110.486 1.00 119.48 ? 193 ARG E NE  1 
ATOM   8919  C CZ  . ARG E  5  193 ? 3.476   51.928  109.822 1.00 115.45 ? 193 ARG E CZ  1 
ATOM   8920  N NH1 . ARG E  5  193 ? 3.281   52.914  108.954 1.00 114.08 ? 193 ARG E NH1 1 
ATOM   8921  N NH2 . ARG E  5  193 ? 4.703   51.471  110.028 1.00 113.47 ? 193 ARG E NH2 1 
ATOM   8922  N N   . ALA E  5  194 ? -1.551  50.776  105.593 1.00 126.94 ? 194 ALA E N   1 
ATOM   8923  C CA  . ALA E  5  194 ? -2.808  51.179  104.966 1.00 128.53 ? 194 ALA E CA  1 
ATOM   8924  C C   . ALA E  5  194 ? -3.597  49.953  104.510 1.00 128.06 ? 194 ALA E C   1 
ATOM   8925  O O   . ALA E  5  194 ? -4.810  49.878  104.713 1.00 127.88 ? 194 ALA E O   1 
ATOM   8926  C CB  . ALA E  5  194 ? -2.544  52.112  103.794 1.00 126.71 ? 194 ALA E CB  1 
ATOM   8927  N N   . LEU E  5  195 ? -2.893  48.994  103.907 1.00 126.07 ? 195 LEU E N   1 
ATOM   8928  C CA  . LEU E  5  195 ? -3.495  47.752  103.417 1.00 126.47 ? 195 LEU E CA  1 
ATOM   8929  C C   . LEU E  5  195 ? -4.016  46.871  104.556 1.00 130.64 ? 195 LEU E C   1 
ATOM   8930  O O   . LEU E  5  195 ? -4.940  46.078  104.365 1.00 131.16 ? 195 LEU E O   1 
ATOM   8931  C CB  . LEU E  5  195 ? -2.484  46.972  102.567 1.00 121.56 ? 195 LEU E CB  1 
ATOM   8932  C CG  . LEU E  5  195 ? -2.993  45.834  101.673 1.00 117.02 ? 195 LEU E CG  1 
ATOM   8933  C CD1 . LEU E  5  195 ? -3.636  46.376  100.405 1.00 111.70 ? 195 LEU E CD1 1 
ATOM   8934  C CD2 . LEU E  5  195 ? -1.860  44.881  101.327 1.00 111.91 ? 195 LEU E CD2 1 
ATOM   8935  N N   . ARG E  5  196 ? -3.414  47.020  105.735 1.00 132.56 ? 196 ARG E N   1 
ATOM   8936  C CA  . ARG E  5  196 ? -3.808  46.269  106.925 1.00 134.67 ? 196 ARG E CA  1 
ATOM   8937  C C   . ARG E  5  196 ? -5.156  46.744  107.474 1.00 135.86 ? 196 ARG E C   1 
ATOM   8938  O O   . ARG E  5  196 ? -5.905  45.958  108.060 1.00 135.79 ? 196 ARG E O   1 
ATOM   8939  C CB  . ARG E  5  196 ? -2.730  46.395  108.003 1.00 134.76 ? 196 ARG E CB  1 
ATOM   8940  C CG  . ARG E  5  196 ? -2.798  45.341  109.097 1.00 136.87 ? 196 ARG E CG  1 
ATOM   8941  C CD  . ARG E  5  196 ? -1.980  45.761  110.307 1.00 139.38 ? 196 ARG E CD  1 
ATOM   8942  N NE  . ARG E  5  196 ? -0.544  45.765  110.037 1.00 139.17 ? 196 ARG E NE  1 
ATOM   8943  C CZ  . ARG E  5  196 ? 0.350   46.465  110.729 1.00 142.18 ? 196 ARG E CZ  1 
ATOM   8944  N NH1 . ARG E  5  196 ? -0.035  47.239  111.737 1.00 144.04 ? 196 ARG E NH1 1 
ATOM   8945  N NH2 . ARG E  5  196 ? 1.634   46.402  110.406 1.00 141.51 ? 196 ARG E NH2 1 
ATOM   8946  N N   . GLU E  5  197 ? -5.454  48.027  107.276 1.00 137.32 ? 197 GLU E N   1 
ATOM   8947  C CA  . GLU E  5  197 ? -6.699  48.636  107.753 1.00 141.89 ? 197 GLU E CA  1 
ATOM   8948  C C   . GLU E  5  197 ? -7.940  48.094  107.041 1.00 141.70 ? 197 GLU E C   1 
ATOM   8949  O O   . GLU E  5  197 ? -9.039  48.117  107.599 1.00 140.59 ? 197 GLU E O   1 
ATOM   8950  C CB  . GLU E  5  197 ? -6.640  50.163  107.620 1.00 143.50 ? 197 GLU E CB  1 
ATOM   8951  C CG  . GLU E  5  197 ? -5.651  50.846  108.557 1.00 144.98 ? 197 GLU E CG  1 
ATOM   8952  C CD  . GLU E  5  197 ? -6.054  50.764  110.020 1.00 145.91 ? 197 GLU E CD  1 
ATOM   8953  O OE1 . GLU E  5  197 ? -7.220  51.077  110.345 1.00 144.54 ? 197 GLU E OE1 1 
ATOM   8954  O OE2 . GLU E  5  197 ? -5.198  50.392  110.850 1.00 142.87 ? 197 GLU E OE2 1 
ATOM   8955  N N   . THR E  5  198 ? -7.754  47.611  105.813 1.00 137.79 ? 198 THR E N   1 
ATOM   8956  C CA  . THR E  5  198 ? -8.839  47.023  105.026 1.00 135.37 ? 198 THR E CA  1 
ATOM   8957  C C   . THR E  5  198 ? -9.312  45.706  105.639 1.00 136.35 ? 198 THR E C   1 
ATOM   8958  O O   . THR E  5  198 ? -10.514 45.441  105.708 1.00 136.64 ? 198 THR E O   1 
ATOM   8959  C CB  . THR E  5  198 ? -8.421  46.778  103.560 1.00 131.59 ? 198 THR E CB  1 
ATOM   8960  O OG1 . THR E  5  198 ? -7.401  45.772  103.508 1.00 132.80 ? 198 THR E OG1 1 
ATOM   8961  C CG2 . THR E  5  198 ? -7.898  48.057  102.921 1.00 124.54 ? 198 THR E CG2 1 
ATOM   8962  N N   . LEU E  5  199 ? -8.354  44.892  106.082 1.00 133.04 ? 199 LEU E N   1 
ATOM   8963  C CA  . LEU E  5  199 ? -8.634  43.604  106.714 1.00 131.57 ? 199 LEU E CA  1 
ATOM   8964  C C   . LEU E  5  199 ? -9.249  43.780  108.105 1.00 138.35 ? 199 LEU E C   1 
ATOM   8965  O O   . LEU E  5  199 ? -8.948  44.758  108.793 1.00 140.37 ? 199 LEU E O   1 
ATOM   8966  C CB  . LEU E  5  199 ? -7.351  42.770  106.814 1.00 122.08 ? 199 LEU E CB  1 
ATOM   8967  C CG  . LEU E  5  199 ? -6.740  42.193  105.532 1.00 111.32 ? 199 LEU E CG  1 
ATOM   8968  C CD1 . LEU E  5  199 ? -5.287  41.808  105.766 1.00 109.39 ? 199 LEU E CD1 1 
ATOM   8969  C CD2 . LEU E  5  199 ? -7.537  41.001  105.016 1.00 109.95 ? 199 LEU E CD2 1 
ATOM   8970  N N   . PRO E  5  200 ? -10.117 42.834  108.520 1.00 141.01 ? 200 PRO E N   1 
ATOM   8971  C CA  . PRO E  5  200 ? -10.686 42.851  109.872 1.00 145.54 ? 200 PRO E CA  1 
ATOM   8972  C C   . PRO E  5  200 ? -9.635  42.582  110.952 1.00 148.43 ? 200 PRO E C   1 
ATOM   8973  O O   . PRO E  5  200 ? -8.524  42.145  110.640 1.00 148.35 ? 200 PRO E O   1 
ATOM   8974  C CB  . PRO E  5  200 ? -11.716 41.714  109.837 1.00 145.32 ? 200 PRO E CB  1 
ATOM   8975  C CG  . PRO E  5  200 ? -11.262 40.818  108.736 1.00 141.80 ? 200 PRO E CG  1 
ATOM   8976  C CD  . PRO E  5  200 ? -10.681 41.740  107.707 1.00 138.94 ? 200 PRO E CD  1 
ATOM   8977  N N   . ALA E  5  201 ? -9.996  42.837  112.208 1.00 151.22 ? 201 ALA E N   1 
ATOM   8978  C CA  . ALA E  5  201 ? -9.084  42.678  113.346 1.00 152.76 ? 201 ALA E CA  1 
ATOM   8979  C C   . ALA E  5  201 ? -8.689  41.222  113.614 1.00 152.85 ? 201 ALA E C   1 
ATOM   8980  O O   . ALA E  5  201 ? -7.771  40.954  114.394 1.00 153.79 ? 201 ALA E O   1 
ATOM   8981  C CB  . ALA E  5  201 ? -9.688  43.305  114.595 1.00 154.17 ? 201 ALA E CB  1 
ATOM   8982  N N   . GLU E  5  202 ? -9.383  40.293  112.959 1.00 153.52 ? 202 GLU E N   1 
ATOM   8983  C CA  . GLU E  5  202 ? -9.145  38.859  113.120 1.00 155.90 ? 202 GLU E CA  1 
ATOM   8984  C C   . GLU E  5  202 ? -7.836  38.404  112.475 1.00 156.12 ? 202 GLU E C   1 
ATOM   8985  O O   . GLU E  5  202 ? -7.140  37.541  113.016 1.00 157.29 ? 202 GLU E O   1 
ATOM   8986  C CB  . GLU E  5  202 ? -10.309 38.057  112.532 1.00 158.57 ? 202 GLU E CB  1 
ATOM   8987  C CG  . GLU E  5  202 ? -11.657 38.321  113.187 1.00 163.01 ? 202 GLU E CG  1 
ATOM   8988  C CD  . GLU E  5  202 ? -12.825 37.853  112.339 1.00 165.44 ? 202 GLU E CD  1 
ATOM   8989  O OE1 . GLU E  5  202 ? -13.869 38.536  112.344 1.00 168.99 ? 202 GLU E OE1 1 
ATOM   8990  O OE2 . GLU E  5  202 ? -12.702 36.808  111.663 1.00 164.02 ? 202 GLU E OE2 1 
ATOM   8991  N N   . GLN E  5  203 ? -7.508  38.987  111.324 1.00 155.41 ? 203 GLN E N   1 
ATOM   8992  C CA  . GLN E  5  203 ? -6.336  38.580  110.546 1.00 154.00 ? 203 GLN E CA  1 
ATOM   8993  C C   . GLN E  5  203 ? -5.440  39.757  110.151 1.00 154.13 ? 203 GLN E C   1 
ATOM   8994  O O   . GLN E  5  203 ? -5.907  40.890  110.017 1.00 151.60 ? 203 GLN E O   1 
ATOM   8995  C CB  . GLN E  5  203 ? -6.764  37.791  109.301 1.00 151.46 ? 203 GLN E CB  1 
ATOM   8996  C CG  . GLN E  5  203 ? -7.716  38.532  108.368 1.00 148.39 ? 203 GLN E CG  1 
ATOM   8997  C CD  . GLN E  5  203 ? -8.149  37.701  107.173 1.00 145.88 ? 203 GLN E CD  1 
ATOM   8998  O OE1 . GLN E  5  203 ? -7.370  36.923  106.621 1.00 146.96 ? 203 GLN E OE1 1 
ATOM   8999  N NE2 . GLN E  5  203 ? -9.400  37.873  106.761 1.00 145.58 ? 203 GLN E NE2 1 
ATOM   9000  N N   . ASP E  5  204 ? -4.153  39.469  109.967 1.00 152.07 ? 204 ASP E N   1 
ATOM   9001  C CA  . ASP E  5  204 ? -3.176  40.468  109.532 1.00 147.10 ? 204 ASP E CA  1 
ATOM   9002  C C   . ASP E  5  204 ? -2.429  40.015  108.271 1.00 136.51 ? 204 ASP E C   1 
ATOM   9003  O O   . ASP E  5  204 ? -2.740  38.967  107.699 1.00 132.70 ? 204 ASP E O   1 
ATOM   9004  C CB  . ASP E  5  204 ? -2.196  40.804  110.667 1.00 151.59 ? 204 ASP E CB  1 
ATOM   9005  C CG  . ASP E  5  204 ? -1.348  39.614  111.089 1.00 154.07 ? 204 ASP E CG  1 
ATOM   9006  O OD1 . ASP E  5  204 ? -1.915  38.539  111.380 1.00 155.38 ? 204 ASP E OD1 1 
ATOM   9007  O OD2 . ASP E  5  204 ? -0.109  39.761  111.141 1.00 153.67 ? 204 ASP E OD2 1 
ATOM   9008  N N   . LEU E  5  205 ? -1.449  40.811  107.848 1.00 128.50 ? 205 LEU E N   1 
ATOM   9009  C CA  . LEU E  5  205 ? -0.699  40.550  106.618 1.00 119.94 ? 205 LEU E CA  1 
ATOM   9010  C C   . LEU E  5  205 ? 0.343   39.447  106.794 1.00 117.72 ? 205 LEU E C   1 
ATOM   9011  O O   . LEU E  5  205 ? 1.034   39.388  107.814 1.00 119.52 ? 205 LEU E O   1 
ATOM   9012  C CB  . LEU E  5  205 ? -0.017  41.830  106.122 1.00 116.14 ? 205 LEU E CB  1 
ATOM   9013  C CG  . LEU E  5  205 ? -0.847  43.109  105.965 1.00 113.71 ? 205 LEU E CG  1 
ATOM   9014  C CD1 . LEU E  5  205 ? 0.071   44.320  105.919 1.00 112.80 ? 205 LEU E CD1 1 
ATOM   9015  C CD2 . LEU E  5  205 ? -1.742  43.063  104.735 1.00 112.46 ? 205 LEU E CD2 1 
ATOM   9016  N N   . THR E  5  206 ? 0.444   38.578  105.790 1.00 113.57 ? 206 THR E N   1 
ATOM   9017  C CA  . THR E  5  206 ? 1.450   37.512  105.763 1.00 113.05 ? 206 THR E CA  1 
ATOM   9018  C C   . THR E  5  206 ? 2.238   37.525  104.449 1.00 112.97 ? 206 THR E C   1 
ATOM   9019  O O   . THR E  5  206 ? 1.957   38.327  103.556 1.00 111.35 ? 206 THR E O   1 
ATOM   9020  C CB  . THR E  5  206 ? 0.826   36.115  105.983 1.00 111.15 ? 206 THR E CB  1 
ATOM   9021  O OG1 . THR E  5  206 ? -0.336  35.966  105.159 1.00 111.35 ? 206 THR E OG1 1 
ATOM   9022  C CG2 . THR E  5  206 ? 0.442   35.914  107.444 1.00 112.93 ? 206 THR E CG2 1 
ATOM   9023  N N   . THR E  5  207 ? 3.218   36.630  104.342 1.00 116.00 ? 207 THR E N   1 
ATOM   9024  C CA  . THR E  5  207 ? 4.103   36.561  103.174 1.00 117.51 ? 207 THR E CA  1 
ATOM   9025  C C   . THR E  5  207 ? 3.414   36.050  101.906 1.00 116.67 ? 207 THR E C   1 
ATOM   9026  O O   . THR E  5  207 ? 3.878   36.315  100.794 1.00 117.35 ? 207 THR E O   1 
ATOM   9027  C CB  . THR E  5  207 ? 5.346   35.687  103.453 1.00 120.67 ? 207 THR E CB  1 
ATOM   9028  O OG1 . THR E  5  207 ? 4.937   34.420  103.983 1.00 122.59 ? 207 THR E OG1 1 
ATOM   9029  C CG2 . THR E  5  207 ? 6.281   36.370  104.445 1.00 120.21 ? 207 THR E CG2 1 
ATOM   9030  N N   . LYS E  5  208 ? 2.311   35.325  102.078 1.00 114.70 ? 208 LYS E N   1 
ATOM   9031  C CA  . LYS E  5  208 ? 1.637   34.658  100.961 1.00 114.13 ? 208 LYS E CA  1 
ATOM   9032  C C   . LYS E  5  208 ? 0.573   35.501  100.254 1.00 112.56 ? 208 LYS E C   1 
ATOM   9033  O O   . LYS E  5  208 ? 0.237   35.230  99.098  1.00 111.57 ? 208 LYS E O   1 
ATOM   9034  C CB  . LYS E  5  208 ? 1.039   33.322  101.412 1.00 115.53 ? 208 LYS E CB  1 
ATOM   9035  C CG  . LYS E  5  208 ? 2.080   32.249  101.681 1.00 117.88 ? 208 LYS E CG  1 
ATOM   9036  C CD  . LYS E  5  208 ? 1.458   30.863  101.697 1.00 120.21 ? 208 LYS E CD  1 
ATOM   9037  C CE  . LYS E  5  208 ? 2.533   29.797  101.822 1.00 122.90 ? 208 LYS E CE  1 
ATOM   9038  N NZ  . LYS E  5  208 ? 1.979   28.423  101.655 1.00 125.18 ? 208 LYS E NZ  1 
ATOM   9039  N N   . ASN E  5  209 ? 0.049   36.515  100.939 1.00 112.70 ? 209 ASN E N   1 
ATOM   9040  C CA  . ASN E  5  209 ? -1.018  37.349  100.375 1.00 113.05 ? 209 ASN E CA  1 
ATOM   9041  C C   . ASN E  5  209 ? -0.654  38.820  100.142 1.00 110.89 ? 209 ASN E C   1 
ATOM   9042  O O   . ASN E  5  209 ? -1.532  39.648  99.880  1.00 110.56 ? 209 ASN E O   1 
ATOM   9043  C CB  . ASN E  5  209 ? -2.308  37.226  101.205 1.00 118.03 ? 209 ASN E CB  1 
ATOM   9044  C CG  . ASN E  5  209 ? -2.084  37.456  102.691 1.00 121.41 ? 209 ASN E CG  1 
ATOM   9045  O OD1 . ASN E  5  209 ? -2.353  36.577  103.507 1.00 121.99 ? 209 ASN E OD1 1 
ATOM   9046  N ND2 . ASN E  5  209 ? -1.599  38.641  103.049 1.00 119.84 ? 209 ASN E ND2 1 
ATOM   9047  N N   . VAL E  5  210 ? 0.636   39.139  100.228 1.00 108.28 ? 210 VAL E N   1 
ATOM   9048  C CA  . VAL E  5  210 ? 1.110   40.511  100.029 1.00 104.56 ? 210 VAL E CA  1 
ATOM   9049  C C   . VAL E  5  210 ? 2.094   40.594  98.861  1.00 101.70 ? 210 VAL E C   1 
ATOM   9050  O O   . VAL E  5  210 ? 3.079   39.853  98.810  1.00 102.53 ? 210 VAL E O   1 
ATOM   9051  C CB  . VAL E  5  210 ? 1.739   41.095  101.319 1.00 105.56 ? 210 VAL E CB  1 
ATOM   9052  C CG1 . VAL E  5  210 ? 2.387   42.448  101.055 1.00 104.74 ? 210 VAL E CG1 1 
ATOM   9053  C CG2 . VAL E  5  210 ? 0.691   41.225  102.415 1.00 107.84 ? 210 VAL E CG2 1 
ATOM   9054  N N   . SER E  5  211 ? 1.805   41.495  97.924  1.00 98.36  ? 211 SER E N   1 
ATOM   9055  C CA  . SER E  5  211 ? 2.684   41.758  96.788  1.00 96.36  ? 211 SER E CA  1 
ATOM   9056  C C   . SER E  5  211 ? 3.070   43.234  96.749  1.00 93.74  ? 211 SER E C   1 
ATOM   9057  O O   . SER E  5  211 ? 2.224   44.110  96.949  1.00 92.93  ? 211 SER E O   1 
ATOM   9058  C CB  . SER E  5  211 ? 2.005   41.352  95.479  1.00 96.58  ? 211 SER E CB  1 
ATOM   9059  O OG  . SER E  5  211 ? 2.928   41.343  94.405  1.00 99.35  ? 211 SER E OG  1 
ATOM   9060  N N   . ILE E  5  212 ? 4.350   43.501  96.496  1.00 92.72  ? 212 ILE E N   1 
ATOM   9061  C CA  . ILE E  5  212 ? 4.871   44.870  96.465  1.00 92.29  ? 212 ILE E CA  1 
ATOM   9062  C C   . ILE E  5  212 ? 5.592   45.162  95.145  1.00 90.67  ? 212 ILE E C   1 
ATOM   9063  O O   . ILE E  5  212 ? 6.433   44.378  94.699  1.00 90.41  ? 212 ILE E O   1 
ATOM   9064  C CB  . ILE E  5  212 ? 5.796   45.159  97.675  1.00 93.82  ? 212 ILE E CB  1 
ATOM   9065  C CG1 . ILE E  5  212 ? 5.023   45.006  98.992  1.00 96.30  ? 212 ILE E CG1 1 
ATOM   9066  C CG2 . ILE E  5  212 ? 6.398   46.557  97.582  1.00 92.89  ? 212 ILE E CG2 1 
ATOM   9067  C CD1 . ILE E  5  212 ? 5.889   44.969  100.234 1.00 99.78  ? 212 ILE E CD1 1 
ATOM   9068  N N   . GLY E  5  213 ? 5.243   46.290  94.527  1.00 89.70  ? 213 GLY E N   1 
ATOM   9069  C CA  . GLY E  5  213 ? 5.885   46.746  93.296  1.00 88.89  ? 213 GLY E CA  1 
ATOM   9070  C C   . GLY E  5  213 ? 6.483   48.131  93.459  1.00 89.30  ? 213 GLY E C   1 
ATOM   9071  O O   . GLY E  5  213 ? 5.760   49.100  93.699  1.00 88.66  ? 213 GLY E O   1 
ATOM   9072  N N   . ILE E  5  214 ? 7.805   48.221  93.328  1.00 89.80  ? 214 ILE E N   1 
ATOM   9073  C CA  . ILE E  5  214 ? 8.528   49.479  93.533  1.00 90.30  ? 214 ILE E CA  1 
ATOM   9074  C C   . ILE E  5  214 ? 9.229   49.940  92.254  1.00 91.16  ? 214 ILE E C   1 
ATOM   9075  O O   . ILE E  5  214 ? 9.921   49.160  91.596  1.00 89.48  ? 214 ILE E O   1 
ATOM   9076  C CB  . ILE E  5  214 ? 9.556   49.367  94.687  1.00 90.48  ? 214 ILE E CB  1 
ATOM   9077  C CG1 . ILE E  5  214 ? 8.872   48.905  95.980  1.00 90.60  ? 214 ILE E CG1 1 
ATOM   9078  C CG2 . ILE E  5  214 ? 10.267  50.697  94.912  1.00 92.10  ? 214 ILE E CG2 1 
ATOM   9079  C CD1 . ILE E  5  214 ? 9.813   48.337  97.023  1.00 91.45  ? 214 ILE E CD1 1 
ATOM   9080  N N   . VAL E  5  215 ? 9.034   51.213  91.911  1.00 93.58  ? 215 VAL E N   1 
ATOM   9081  C CA  . VAL E  5  215 ? 9.706   51.837  90.771  1.00 95.77  ? 215 VAL E CA  1 
ATOM   9082  C C   . VAL E  5  215 ? 10.181  53.250  91.134  1.00 96.36  ? 215 VAL E C   1 
ATOM   9083  O O   . VAL E  5  215 ? 9.558   53.930  91.955  1.00 96.27  ? 215 VAL E O   1 
ATOM   9084  C CB  . VAL E  5  215 ? 8.807   51.836  89.505  1.00 95.61  ? 215 VAL E CB  1 
ATOM   9085  C CG1 . VAL E  5  215 ? 7.717   52.901  89.581  1.00 95.05  ? 215 VAL E CG1 1 
ATOM   9086  C CG2 . VAL E  5  215 ? 9.644   51.989  88.240  1.00 91.99  ? 215 VAL E CG2 1 
ATOM   9087  N N   . GLY E  5  216 ? 11.291  53.675  90.536  1.00 97.13  ? 216 GLY E N   1 
ATOM   9088  C CA  . GLY E  5  216 ? 11.835  55.009  90.782  1.00 98.21  ? 216 GLY E CA  1 
ATOM   9089  C C   . GLY E  5  216 ? 13.175  55.286  90.126  1.00 100.99 ? 216 GLY E C   1 
ATOM   9090  O O   . GLY E  5  216 ? 13.538  54.651  89.132  1.00 100.96 ? 216 GLY E O   1 
ATOM   9091  N N   . LYS E  5  217 ? 13.905  56.244  90.694  1.00 102.29 ? 217 LYS E N   1 
ATOM   9092  C CA  . LYS E  5  217 ? 15.208  56.667  90.178  1.00 103.14 ? 217 LYS E CA  1 
ATOM   9093  C C   . LYS E  5  217 ? 16.291  55.623  90.448  1.00 102.64 ? 217 LYS E C   1 
ATOM   9094  O O   . LYS E  5  217 ? 17.189  55.420  89.628  1.00 101.90 ? 217 LYS E O   1 
ATOM   9095  C CB  . LYS E  5  217 ? 15.610  58.006  90.807  1.00 106.61 ? 217 LYS E CB  1 
ATOM   9096  C CG  . LYS E  5  217 ? 16.811  58.682  90.157  1.00 111.30 ? 217 LYS E CG  1 
ATOM   9097  C CD  . LYS E  5  217 ? 17.425  59.744  91.061  1.00 116.87 ? 217 LYS E CD  1 
ATOM   9098  C CE  . LYS E  5  217 ? 16.640  61.047  91.034  1.00 117.98 ? 217 LYS E CE  1 
ATOM   9099  N NZ  . LYS E  5  217 ? 17.229  62.072  91.939  1.00 119.77 ? 217 LYS E NZ  1 
ATOM   9100  N N   . ASP E  5  218 ? 16.189  54.967  91.602  1.00 105.54 ? 218 ASP E N   1 
ATOM   9101  C CA  . ASP E  5  218 ? 17.196  54.016  92.066  1.00 107.98 ? 218 ASP E CA  1 
ATOM   9102  C C   . ASP E  5  218 ? 17.172  52.700  91.285  1.00 102.77 ? 218 ASP E C   1 
ATOM   9103  O O   . ASP E  5  218 ? 18.222  52.195  90.882  1.00 102.53 ? 218 ASP E O   1 
ATOM   9104  C CB  . ASP E  5  218 ? 17.008  53.757  93.565  1.00 115.53 ? 218 ASP E CB  1 
ATOM   9105  C CG  . ASP E  5  218 ? 18.206  53.082  94.204  1.00 126.38 ? 218 ASP E CG  1 
ATOM   9106  O OD1 . ASP E  5  218 ? 17.997  52.291  95.146  1.00 131.22 ? 218 ASP E OD1 1 
ATOM   9107  O OD2 . ASP E  5  218 ? 19.353  53.342  93.779  1.00 131.97 ? 218 ASP E OD2 1 
ATOM   9108  N N   . LEU E  5  219 ? 15.974  52.157  91.072  1.00 98.58  ? 219 LEU E N   1 
ATOM   9109  C CA  . LEU E  5  219 ? 15.811  50.872  90.389  1.00 94.28  ? 219 LEU E CA  1 
ATOM   9110  C C   . LEU E  5  219 ? 14.586  50.839  89.470  1.00 94.36  ? 219 LEU E C   1 
ATOM   9111  O O   . LEU E  5  219 ? 13.679  51.666  89.594  1.00 96.57  ? 219 LEU E O   1 
ATOM   9112  C CB  . LEU E  5  219 ? 15.747  49.719  91.404  1.00 90.05  ? 219 LEU E CB  1 
ATOM   9113  C CG  . LEU E  5  219 ? 14.543  49.595  92.350  1.00 86.53  ? 219 LEU E CG  1 
ATOM   9114  C CD1 . LEU E  5  219 ? 14.283  48.136  92.696  1.00 84.97  ? 219 LEU E CD1 1 
ATOM   9115  C CD2 . LEU E  5  219 ? 14.722  50.422  93.616  1.00 88.40  ? 219 LEU E CD2 1 
ATOM   9116  N N   . GLU E  5  220 ? 14.577  49.872  88.554  1.00 94.37  ? 220 GLU E N   1 
ATOM   9117  C CA  . GLU E  5  220 ? 13.444  49.638  87.659  1.00 94.29  ? 220 GLU E CA  1 
ATOM   9118  C C   . GLU E  5  220 ? 12.298  48.948  88.404  1.00 93.03  ? 220 GLU E C   1 
ATOM   9119  O O   . GLU E  5  220 ? 12.447  48.573  89.571  1.00 95.52  ? 220 GLU E O   1 
ATOM   9120  C CB  . GLU E  5  220 ? 13.882  48.798  86.455  1.00 96.04  ? 220 GLU E CB  1 
ATOM   9121  C CG  . GLU E  5  220 ? 14.839  49.511  85.509  1.00 101.61 ? 220 GLU E CG  1 
ATOM   9122  C CD  . GLU E  5  220 ? 15.359  48.614  84.400  1.00 106.07 ? 220 GLU E CD  1 
ATOM   9123  O OE1 . GLU E  5  220 ? 15.748  47.461  84.688  1.00 106.73 ? 220 GLU E OE1 1 
ATOM   9124  O OE2 . GLU E  5  220 ? 15.392  49.067  83.237  1.00 103.09 ? 220 GLU E OE2 1 
ATOM   9125  N N   . PHE E  5  221 ? 11.161  48.784  87.729  1.00 88.40  ? 221 PHE E N   1 
ATOM   9126  C CA  . PHE E  5  221 ? 9.985   48.155  88.330  1.00 86.91  ? 221 PHE E CA  1 
ATOM   9127  C C   . PHE E  5  221 ? 10.232  46.678  88.636  1.00 88.53  ? 221 PHE E C   1 
ATOM   9128  O O   . PHE E  5  221 ? 10.600  45.904  87.749  1.00 89.75  ? 221 PHE E O   1 
ATOM   9129  C CB  . PHE E  5  221 ? 8.755   48.328  87.431  1.00 83.64  ? 221 PHE E CB  1 
ATOM   9130  C CG  . PHE E  5  221 ? 7.456   47.982  88.106  1.00 82.35  ? 221 PHE E CG  1 
ATOM   9131  C CD1 . PHE E  5  221 ? 6.847   48.882  88.976  1.00 83.22  ? 221 PHE E CD1 1 
ATOM   9132  C CD2 . PHE E  5  221 ? 6.837   46.759  87.872  1.00 81.05  ? 221 PHE E CD2 1 
ATOM   9133  C CE1 . PHE E  5  221 ? 5.652   48.568  89.602  1.00 82.58  ? 221 PHE E CE1 1 
ATOM   9134  C CE2 . PHE E  5  221 ? 5.640   46.439  88.494  1.00 81.17  ? 221 PHE E CE2 1 
ATOM   9135  C CZ  . PHE E  5  221 ? 5.048   47.345  89.361  1.00 81.74  ? 221 PHE E CZ  1 
ATOM   9136  N N   . THR E  5  222 ? 10.037  46.306  89.899  1.00 90.84  ? 222 THR E N   1 
ATOM   9137  C CA  . THR E  5  222 ? 10.265  44.938  90.364  1.00 93.04  ? 222 THR E CA  1 
ATOM   9138  C C   . THR E  5  222 ? 9.131   44.496  91.290  1.00 93.76  ? 222 THR E C   1 
ATOM   9139  O O   . THR E  5  222 ? 8.694   45.258  92.155  1.00 94.03  ? 222 THR E O   1 
ATOM   9140  C CB  . THR E  5  222 ? 11.618  44.807  91.101  1.00 94.62  ? 222 THR E CB  1 
ATOM   9141  O OG1 . THR E  5  222 ? 12.628  45.544  90.401  1.00 93.07  ? 222 THR E OG1 1 
ATOM   9142  C CG2 . THR E  5  222 ? 12.046  43.345  91.204  1.00 96.12  ? 222 THR E CG2 1 
ATOM   9143  N N   . ILE E  5  223 ? 8.663   43.264  91.099  1.00 93.20  ? 223 ILE E N   1 
ATOM   9144  C CA  . ILE E  5  223 ? 7.573   42.708  91.903  1.00 93.39  ? 223 ILE E CA  1 
ATOM   9145  C C   . ILE E  5  223 ? 8.100   41.695  92.921  1.00 93.70  ? 223 ILE E C   1 
ATOM   9146  O O   . ILE E  5  223 ? 8.799   40.743  92.562  1.00 94.65  ? 223 ILE E O   1 
ATOM   9147  C CB  . ILE E  5  223 ? 6.485   42.053  91.019  1.00 92.59  ? 223 ILE E CB  1 
ATOM   9148  C CG1 . ILE E  5  223 ? 6.017   43.027  89.930  1.00 90.43  ? 223 ILE E CG1 1 
ATOM   9149  C CG2 . ILE E  5  223 ? 5.307   41.586  91.868  1.00 93.26  ? 223 ILE E CG2 1 
ATOM   9150  C CD1 . ILE E  5  223 ? 5.262   42.375  88.790  1.00 90.76  ? 223 ILE E CD1 1 
ATOM   9151  N N   . TYR E  5  224 ? 7.760   41.917  94.189  1.00 92.25  ? 224 TYR E N   1 
ATOM   9152  C CA  . TYR E  5  224 ? 8.139   41.020  95.279  1.00 92.72  ? 224 TYR E CA  1 
ATOM   9153  C C   . TYR E  5  224 ? 6.929   40.191  95.707  1.00 95.67  ? 224 TYR E C   1 
ATOM   9154  O O   . TYR E  5  224 ? 5.843   40.735  95.924  1.00 95.43  ? 224 TYR E O   1 
ATOM   9155  C CB  . TYR E  5  224 ? 8.700   41.817  96.463  1.00 90.20  ? 224 TYR E CB  1 
ATOM   9156  C CG  . TYR E  5  224 ? 9.800   42.792  96.088  1.00 88.62  ? 224 TYR E CG  1 
ATOM   9157  C CD1 . TYR E  5  224 ? 9.513   44.135  95.842  1.00 88.04  ? 224 TYR E CD1 1 
ATOM   9158  C CD2 . TYR E  5  224 ? 11.126  42.372  95.977  1.00 90.00  ? 224 TYR E CD2 1 
ATOM   9159  C CE1 . TYR E  5  224 ? 10.513  45.031  95.495  1.00 87.99  ? 224 TYR E CE1 1 
ATOM   9160  C CE2 . TYR E  5  224 ? 12.133  43.261  95.632  1.00 88.91  ? 224 TYR E CE2 1 
ATOM   9161  C CZ  . TYR E  5  224 ? 11.822  44.588  95.393  1.00 88.48  ? 224 TYR E CZ  1 
ATOM   9162  O OH  . TYR E  5  224 ? 12.818  45.473  95.050  1.00 89.61  ? 224 TYR E OH  1 
ATOM   9163  N N   . ASP E  5  225 ? 7.120   38.878  95.830  1.00 101.86 ? 225 ASP E N   1 
ATOM   9164  C CA  . ASP E  5  225 ? 5.999   37.954  96.024  1.00 112.25 ? 225 ASP E CA  1 
ATOM   9165  C C   . ASP E  5  225 ? 5.964   37.233  97.378  1.00 120.85 ? 225 ASP E C   1 
ATOM   9166  O O   . ASP E  5  225 ? 5.148   37.573  98.237  1.00 125.53 ? 225 ASP E O   1 
ATOM   9167  C CB  . ASP E  5  225 ? 5.933   36.940  94.872  1.00 115.08 ? 225 ASP E CB  1 
ATOM   9168  C CG  . ASP E  5  225 ? 5.572   37.583  93.542  1.00 117.22 ? 225 ASP E CG  1 
ATOM   9169  O OD1 . ASP E  5  225 ? 4.631   38.406  93.505  1.00 118.72 ? 225 ASP E OD1 1 
ATOM   9170  O OD2 . ASP E  5  225 ? 6.224   37.255  92.528  1.00 119.09 ? 225 ASP E OD2 1 
ATOM   9171  N N   . ASP E  5  226 ? 6.838   36.245  97.561  1.00 126.54 ? 226 ASP E N   1 
ATOM   9172  C CA  . ASP E  5  226 ? 6.765   35.357  98.726  1.00 132.44 ? 226 ASP E CA  1 
ATOM   9173  C C   . ASP E  5  226 ? 7.926   35.524  99.709  1.00 134.99 ? 226 ASP E C   1 
ATOM   9174  O O   . ASP E  5  226 ? 7.730   36.002  100.828 1.00 133.57 ? 226 ASP E O   1 
ATOM   9175  C CB  . ASP E  5  226 ? 6.643   33.893  98.281  1.00 133.00 ? 226 ASP E CB  1 
ATOM   9176  C CG  . ASP E  5  226 ? 5.372   33.623  97.490  1.00 130.63 ? 226 ASP E CG  1 
ATOM   9177  O OD1 . ASP E  5  226 ? 4.279   34.012  97.955  1.00 131.11 ? 226 ASP E OD1 1 
ATOM   9178  O OD2 . ASP E  5  226 ? 5.468   33.011  96.406  1.00 128.75 ? 226 ASP E OD2 1 
ATOM   9179  N N   . ASP E  5  227 ? 9.124   35.120  99.293  1.00 138.50 ? 227 ASP E N   1 
ATOM   9180  C CA  . ASP E  5  227 ? 10.316  35.235  100.135 1.00 142.81 ? 227 ASP E CA  1 
ATOM   9181  C C   . ASP E  5  227 ? 11.006  36.587  99.960  1.00 140.81 ? 227 ASP E C   1 
ATOM   9182  O O   . ASP E  5  227 ? 11.842  36.977  100.779 1.00 142.31 ? 227 ASP E O   1 
ATOM   9183  C CB  . ASP E  5  227 ? 11.295  34.090  99.847  1.00 147.62 ? 227 ASP E CB  1 
ATOM   9184  C CG  . ASP E  5  227 ? 10.771  32.735  100.305 1.00 151.00 ? 227 ASP E CG  1 
ATOM   9185  O OD1 . ASP E  5  227 ? 9.873   32.688  101.174 1.00 151.26 ? 227 ASP E OD1 1 
ATOM   9186  O OD2 . ASP E  5  227 ? 11.270  31.708  99.798  1.00 154.38 ? 227 ASP E OD2 1 
ATOM   9187  N N   . ASP E  5  228 ? 10.645  37.293  98.891  1.00 135.18 ? 228 ASP E N   1 
ATOM   9188  C CA  . ASP E  5  228 ? 11.195  38.615  98.593  1.00 128.92 ? 228 ASP E CA  1 
ATOM   9189  C C   . ASP E  5  228 ? 10.426  39.727  99.310  1.00 125.36 ? 228 ASP E C   1 
ATOM   9190  O O   . ASP E  5  228 ? 10.904  40.860  99.405  1.00 122.44 ? 228 ASP E O   1 
ATOM   9191  C CB  . ASP E  5  228 ? 11.192  38.868  97.081  1.00 123.10 ? 228 ASP E CB  1 
ATOM   9192  C CG  . ASP E  5  228 ? 12.010  37.846  96.309  1.00 126.95 ? 228 ASP E CG  1 
ATOM   9193  O OD1 . ASP E  5  228 ? 12.914  38.258  95.553  1.00 127.65 ? 228 ASP E OD1 1 
ATOM   9194  O OD2 . ASP E  5  228 ? 11.750  36.632  96.451  1.00 127.64 ? 228 ASP E OD2 1 
ATOM   9195  N N   . VAL E  5  229 ? 9.237   39.394  99.811  1.00 122.77 ? 229 VAL E N   1 
ATOM   9196  C CA  . VAL E  5  229 ? 8.370   40.355  100.494 1.00 120.49 ? 229 VAL E CA  1 
ATOM   9197  C C   . VAL E  5  229 ? 8.632   40.387  102.007 1.00 119.50 ? 229 VAL E C   1 
ATOM   9198  O O   . VAL E  5  229 ? 8.210   41.316  102.701 1.00 119.15 ? 229 VAL E O   1 
ATOM   9199  C CB  . VAL E  5  229 ? 6.874   40.074  100.189 1.00 119.31 ? 229 VAL E CB  1 
ATOM   9200  C CG1 . VAL E  5  229 ? 6.323   38.957  101.069 1.00 120.00 ? 229 VAL E CG1 1 
ATOM   9201  C CG2 . VAL E  5  229 ? 6.039   41.336  100.344 1.00 117.03 ? 229 VAL E CG2 1 
ATOM   9202  N N   . SER E  5  230 ? 9.346   39.376  102.500 1.00 118.00 ? 230 SER E N   1 
ATOM   9203  C CA  . SER E  5  230 ? 9.589   39.204  103.936 1.00 116.26 ? 230 SER E CA  1 
ATOM   9204  C C   . SER E  5  230 ? 10.542  40.215  104.594 1.00 116.74 ? 230 SER E C   1 
ATOM   9205  O O   . SER E  5  230 ? 10.398  40.485  105.788 1.00 118.87 ? 230 SER E O   1 
ATOM   9206  C CB  . SER E  5  230 ? 10.025  37.765  104.249 1.00 115.41 ? 230 SER E CB  1 
ATOM   9207  O OG  . SER E  5  230 ? 11.148  37.379  103.475 1.00 115.87 ? 230 SER E OG  1 
ATOM   9208  N N   . PRO E  5  231 ? 11.513  40.777  103.836 1.00 116.60 ? 231 PRO E N   1 
ATOM   9209  C CA  . PRO E  5  231 ? 12.304  41.867  104.427 1.00 117.11 ? 231 PRO E CA  1 
ATOM   9210  C C   . PRO E  5  231 ? 11.492  43.143  104.668 1.00 117.34 ? 231 PRO E C   1 
ATOM   9211  O O   . PRO E  5  231 ? 11.874  43.966  105.503 1.00 119.52 ? 231 PRO E O   1 
ATOM   9212  C CB  . PRO E  5  231 ? 13.390  42.126  103.377 1.00 115.39 ? 231 PRO E CB  1 
ATOM   9213  C CG  . PRO E  5  231 ? 13.495  40.850  102.617 1.00 114.86 ? 231 PRO E CG  1 
ATOM   9214  C CD  . PRO E  5  231 ? 12.089  40.336  102.551 1.00 115.88 ? 231 PRO E CD  1 
ATOM   9215  N N   . PHE E  5  232 ? 10.388  43.296  103.940 1.00 116.02 ? 232 PHE E N   1 
ATOM   9216  C CA  . PHE E  5  232 ? 9.504   44.453  104.086 1.00 115.03 ? 232 PHE E CA  1 
ATOM   9217  C C   . PHE E  5  232 ? 8.526   44.278  105.247 1.00 119.87 ? 232 PHE E C   1 
ATOM   9218  O O   . PHE E  5  232 ? 8.215   45.240  105.953 1.00 120.51 ? 232 PHE E O   1 
ATOM   9219  C CB  . PHE E  5  232 ? 8.731   44.711  102.787 1.00 109.10 ? 232 PHE E CB  1 
ATOM   9220  C CG  . PHE E  5  232 ? 9.607   45.012  101.603 1.00 103.31 ? 232 PHE E CG  1 
ATOM   9221  C CD1 . PHE E  5  232 ? 9.979   44.003  100.720 1.00 101.60 ? 232 PHE E CD1 1 
ATOM   9222  C CD2 . PHE E  5  232 ? 10.057  46.307  101.364 1.00 100.31 ? 232 PHE E CD2 1 
ATOM   9223  C CE1 . PHE E  5  232 ? 10.785  44.277  99.626  1.00 98.17  ? 232 PHE E CE1 1 
ATOM   9224  C CE2 . PHE E  5  232 ? 10.863  46.588  100.271 1.00 98.22  ? 232 PHE E CE2 1 
ATOM   9225  C CZ  . PHE E  5  232 ? 11.228  45.571  99.401  1.00 97.51  ? 232 PHE E CZ  1 
ATOM   9226  N N   . LEU E  5  233 ? 8.046   43.049  105.432 1.00 123.30 ? 233 LEU E N   1 
ATOM   9227  C CA  . LEU E  5  233 ? 7.086   42.727  106.490 1.00 128.71 ? 233 LEU E CA  1 
ATOM   9228  C C   . LEU E  5  233 ? 7.711   42.718  107.884 1.00 134.48 ? 233 LEU E C   1 
ATOM   9229  O O   . LEU E  5  233 ? 7.049   43.065  108.864 1.00 138.78 ? 233 LEU E O   1 
ATOM   9230  C CB  . LEU E  5  233 ? 6.406   41.383  106.210 1.00 126.50 ? 233 LEU E CB  1 
ATOM   9231  C CG  . LEU E  5  233 ? 5.237   41.371  105.221 1.00 123.22 ? 233 LEU E CG  1 
ATOM   9232  C CD1 . LEU E  5  233 ? 5.078   39.995  104.594 1.00 122.15 ? 233 LEU E CD1 1 
ATOM   9233  C CD2 . LEU E  5  233 ? 3.941   41.812  105.886 1.00 121.72 ? 233 LEU E CD2 1 
ATOM   9234  N N   . ASP E  5  234 ? 8.980   42.318  107.964 1.00 135.67 ? 234 ASP E N   1 
ATOM   9235  C CA  . ASP E  5  234 ? 9.708   42.275  109.232 1.00 135.92 ? 234 ASP E CA  1 
ATOM   9236  C C   . ASP E  5  234 ? 9.977   43.677  109.771 1.00 137.66 ? 234 ASP E C   1 
ATOM   9237  O O   . ASP E  5  234 ? 10.474  44.547  109.052 1.00 135.57 ? 234 ASP E O   1 
ATOM   9238  C CB  . ASP E  5  234 ? 11.019  41.495  109.083 1.00 133.61 ? 234 ASP E CB  1 
ATOM   9239  C CG  . ASP E  5  234 ? 10.799  40.000  108.893 1.00 130.16 ? 234 ASP E CG  1 
ATOM   9240  O OD1 . ASP E  5  234 ? 9.770   39.470  109.365 1.00 131.01 ? 234 ASP E OD1 1 
ATOM   9241  O OD2 . ASP E  5  234 ? 11.666  39.351  108.272 1.00 128.43 ? 234 ASP E OD2 1 
ATOM   9242  N N   . GLY E  5  235 ? 9.644   43.881  111.043 1.00 143.53 ? 235 GLY E N   1 
ATOM   9243  C CA  . GLY E  5  235 ? 9.725   45.197  111.671 1.00 148.98 ? 235 GLY E CA  1 
ATOM   9244  C C   . GLY E  5  235 ? 8.403   45.934  111.572 1.00 155.29 ? 235 GLY E C   1 
ATOM   9245  O O   . GLY E  5  235 ? 8.373   47.153  111.393 1.00 156.64 ? 235 GLY E O   1 
ATOM   9246  N N   . LEU E  5  236 ? 7.309   45.183  111.688 1.00 159.48 ? 236 LEU E N   1 
ATOM   9247  C CA  . LEU E  5  236 ? 5.962   45.736  111.593 1.00 162.81 ? 236 LEU E CA  1 
ATOM   9248  C C   . LEU E  5  236 ? 5.466   46.253  112.941 1.00 166.28 ? 236 LEU E C   1 
ATOM   9249  O O   . LEU E  5  236 ? 5.773   45.680  113.990 1.00 168.91 ? 236 LEU E O   1 
ATOM   9250  C CB  . LEU E  5  236 ? 4.981   44.696  111.023 1.00 163.64 ? 236 LEU E CB  1 
ATOM   9251  C CG  . LEU E  5  236 ? 4.547   43.480  111.858 1.00 166.80 ? 236 LEU E CG  1 
ATOM   9252  C CD1 . LEU E  5  236 ? 3.185   42.977  111.403 1.00 165.75 ? 236 LEU E CD1 1 
ATOM   9253  C CD2 . LEU E  5  236 ? 5.574   42.356  111.827 1.00 163.04 ? 236 LEU E CD2 1 
ATOM   9254  N N   . GLU E  5  237 ? 4.708   47.346  112.902 1.00 164.75 ? 237 GLU E N   1 
ATOM   9255  C CA  . GLU E  5  237 ? 4.033   47.864  114.088 1.00 164.68 ? 237 GLU E CA  1 
ATOM   9256  C C   . GLU E  5  237 ? 2.808   46.997  114.362 1.00 165.64 ? 237 GLU E C   1 
ATOM   9257  O O   . GLU E  5  237 ? 2.070   46.654  113.438 1.00 162.24 ? 237 GLU E O   1 
ATOM   9258  C CB  . GLU E  5  237 ? 3.629   49.326  113.890 1.00 164.73 ? 237 GLU E CB  1 
ATOM   9259  C CG  . GLU E  5  237 ? 4.804   50.292  113.800 1.00 165.99 ? 237 GLU E CG  1 
ATOM   9260  C CD  . GLU E  5  237 ? 4.380   51.742  113.636 1.00 167.34 ? 237 GLU E CD  1 
ATOM   9261  O OE1 . GLU E  5  237 ? 5.191   52.634  113.960 1.00 170.74 ? 237 GLU E OE1 1 
ATOM   9262  O OE2 . GLU E  5  237 ? 3.243   51.998  113.183 1.00 166.81 ? 237 GLU E OE2 1 
ATOM   9263  N N   . GLU E  5  238 ? 2.602   46.646  115.629 1.00 168.87 ? 238 GLU E N   1 
ATOM   9264  C CA  . GLU E  5  238 ? 1.552   45.698  116.021 1.00 172.39 ? 238 GLU E CA  1 
ATOM   9265  C C   . GLU E  5  238 ? 0.134   46.149  115.657 1.00 169.67 ? 238 GLU E C   1 
ATOM   9266  O O   . GLU E  5  238 ? -0.128  47.344  115.499 1.00 168.54 ? 238 GLU E O   1 
ATOM   9267  C CB  . GLU E  5  238 ? 1.651   45.363  117.515 1.00 177.16 ? 238 GLU E CB  1 
ATOM   9268  C CG  . GLU E  5  238 ? 2.887   44.555  117.897 1.00 181.19 ? 238 GLU E CG  1 
ATOM   9269  C CD  . GLU E  5  238 ? 2.964   43.205  117.201 1.00 181.59 ? 238 GLU E CD  1 
ATOM   9270  O OE1 . GLU E  5  238 ? 1.944   42.486  117.156 1.00 181.52 ? 238 GLU E OE1 1 
ATOM   9271  O OE2 . GLU E  5  238 ? 4.054   42.859  116.700 1.00 180.12 ? 238 GLU E OE2 1 
ATOM   9272  N N   . ARG E  5  239 ? -0.764  45.172  115.531 1.00 170.42 ? 239 ARG E N   1 
ATOM   9273  C CA  . ARG E  5  239 ? -2.138  45.381  115.067 1.00 171.97 ? 239 ARG E CA  1 
ATOM   9274  C C   . ARG E  5  239 ? -2.927  46.387  115.914 1.00 175.65 ? 239 ARG E C   1 
ATOM   9275  O O   . ARG E  5  239 ? -3.084  46.192  117.122 1.00 176.79 ? 239 ARG E O   1 
ATOM   9276  C CB  . ARG E  5  239 ? -2.884  44.040  115.019 1.00 170.19 ? 239 ARG E CB  1 
ATOM   9277  C CG  . ARG E  5  239 ? -4.194  44.054  114.243 1.00 164.90 ? 239 ARG E CG  1 
ATOM   9278  C CD  . ARG E  5  239 ? -3.952  43.874  112.753 1.00 155.42 ? 239 ARG E CD  1 
ATOM   9279  N NE  . ARG E  5  239 ? -5.191  43.713  111.996 1.00 148.05 ? 239 ARG E NE  1 
ATOM   9280  C CZ  . ARG E  5  239 ? -5.861  44.708  111.419 1.00 142.10 ? 239 ARG E CZ  1 
ATOM   9281  N NH1 . ARG E  5  239 ? -6.975  44.450  110.749 1.00 141.99 ? 239 ARG E NH1 1 
ATOM   9282  N NH2 . ARG E  5  239 ? -5.425  45.958  111.507 1.00 139.57 ? 239 ARG E NH2 1 
ATOM   9283  N N   . PRO E  5  240 ? -3.413  47.472  115.278 1.00 177.78 ? 240 PRO E N   1 
ATOM   9284  C CA  . PRO E  5  240 ? -4.303  48.421  115.934 1.00 178.89 ? 240 PRO E CA  1 
ATOM   9285  C C   . PRO E  5  240 ? -5.773  48.138  115.604 1.00 178.45 ? 240 PRO E C   1 
ATOM   9286  O O   . PRO E  5  240 ? -6.255  48.506  114.529 1.00 178.21 ? 240 PRO E O   1 
ATOM   9287  C CB  . PRO E  5  240 ? -3.859  49.772  115.355 1.00 178.23 ? 240 PRO E CB  1 
ATOM   9288  C CG  . PRO E  5  240 ? -3.079  49.454  114.110 1.00 176.99 ? 240 PRO E CG  1 
ATOM   9289  C CD  . PRO E  5  240 ? -3.007  47.961  113.950 1.00 176.33 ? 240 PRO E CD  1 
ATOM   9290  N N   . GLN E  5  241 ? -6.470  47.484  116.531 1.00 177.74 ? 241 GLN E N   1 
ATOM   9291  C CA  . GLN E  5  241 ? -7.867  47.094  116.329 1.00 175.84 ? 241 GLN E CA  1 
ATOM   9292  C C   . GLN E  5  241 ? -8.834