data_3UO8
# 
_entry.id   3UO8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UO8         
RCSB  RCSB069001   
WWPDB D_1000069001 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3UOA 
_pdbx_database_related.details        'P21 crystal form' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3UO8 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-16 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jeffrey, P.D.' 1 
'Yu, J.W.'      2 
'Shi, Y.'       3 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                21004 
_citation.page_last                 21009 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22158899 
_citation.pdbx_database_id_DOI      10.1073/pnas.1111708108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yu, J.W.'      1 
primary 'Jeffrey, P.D.' 2 
primary 'Ha, J.Y.'      3 
primary 'Yang, X.'      4 
primary 'Shi, Y.'       5 
# 
_cell.length_a           61.235 
_cell.length_b           61.158 
_cell.length_c           71.126 
_cell.angle_alpha        108.590 
_cell.angle_beta         97.230 
_cell.angle_gamma        117.230 
_cell.entry_id           3UO8 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         3UO8 
_symmetry.Int_Tables_number                1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Mucosa-associated lymphoid tissue lymphoma translocation protein 1' 44432.090 2   3.4.22.- ? 'UNP RESIDUES 339-719' 
? 
2 polymer syn Z-Val-Arg-Pro-DL-Arg-fluoromethylketone                              697.244   2   ?        ? ?                      
? 
3 water   nat water                                                                18.015    222 ?        ? ?                      
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MALT lymphoma-associated translocation, Paracaspase' 
2 'MALT1 Inhibitor, Z-VRPR-FMK'                         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGY
ENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAE
AFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRN
LQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSY
LVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRLEHHHHHH
;
;MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGY
ENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAE
AFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRN
LQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSY
LVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRLEHHHHHH
;
B,C ? 
2 'polypeptide(L)' no yes '(PHQ)VRPR(CF0)' XVRPRX L,M ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   ALA n 
1 4   LYS n 
1 5   ASP n 
1 6   LYS n 
1 7   VAL n 
1 8   ALA n 
1 9   LEU n 
1 10  LEU n 
1 11  ILE n 
1 12  GLY n 
1 13  ASN n 
1 14  MET n 
1 15  ASN n 
1 16  TYR n 
1 17  ARG n 
1 18  GLU n 
1 19  HIS n 
1 20  PRO n 
1 21  LYS n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  LEU n 
1 27  VAL n 
1 28  ASP n 
1 29  VAL n 
1 30  TYR n 
1 31  GLU n 
1 32  LEU n 
1 33  THR n 
1 34  ASN n 
1 35  LEU n 
1 36  LEU n 
1 37  ARG n 
1 38  GLN n 
1 39  LEU n 
1 40  ASP n 
1 41  PHE n 
1 42  LYS n 
1 43  VAL n 
1 44  VAL n 
1 45  SER n 
1 46  LEU n 
1 47  LEU n 
1 48  ASP n 
1 49  LEU n 
1 50  THR n 
1 51  GLU n 
1 52  TYR n 
1 53  GLU n 
1 54  MET n 
1 55  ARG n 
1 56  ASN n 
1 57  ALA n 
1 58  VAL n 
1 59  ASP n 
1 60  GLU n 
1 61  PHE n 
1 62  LEU n 
1 63  LEU n 
1 64  LEU n 
1 65  LEU n 
1 66  ASP n 
1 67  LYS n 
1 68  GLY n 
1 69  VAL n 
1 70  TYR n 
1 71  GLY n 
1 72  LEU n 
1 73  LEU n 
1 74  TYR n 
1 75  TYR n 
1 76  ALA n 
1 77  GLY n 
1 78  HIS n 
1 79  GLY n 
1 80  TYR n 
1 81  GLU n 
1 82  ASN n 
1 83  PHE n 
1 84  GLY n 
1 85  ASN n 
1 86  SER n 
1 87  PHE n 
1 88  MET n 
1 89  VAL n 
1 90  PRO n 
1 91  VAL n 
1 92  ASP n 
1 93  ALA n 
1 94  PRO n 
1 95  ASN n 
1 96  PRO n 
1 97  TYR n 
1 98  ARG n 
1 99  SER n 
1 100 GLU n 
1 101 ASN n 
1 102 CYS n 
1 103 LEU n 
1 104 CYS n 
1 105 VAL n 
1 106 GLN n 
1 107 ASN n 
1 108 ILE n 
1 109 LEU n 
1 110 LYS n 
1 111 LEU n 
1 112 MET n 
1 113 GLN n 
1 114 GLU n 
1 115 LYS n 
1 116 GLU n 
1 117 THR n 
1 118 GLY n 
1 119 LEU n 
1 120 ASN n 
1 121 VAL n 
1 122 PHE n 
1 123 LEU n 
1 124 LEU n 
1 125 ASP n 
1 126 MET n 
1 127 CYS n 
1 128 ARG n 
1 129 LYS n 
1 130 ARG n 
1 131 ASN n 
1 132 ASP n 
1 133 TYR n 
1 134 ASP n 
1 135 ASP n 
1 136 THR n 
1 137 ILE n 
1 138 PRO n 
1 139 ILE n 
1 140 LEU n 
1 141 ASP n 
1 142 ALA n 
1 143 LEU n 
1 144 LYS n 
1 145 VAL n 
1 146 THR n 
1 147 ALA n 
1 148 ASN n 
1 149 ILE n 
1 150 VAL n 
1 151 PHE n 
1 152 GLY n 
1 153 TYR n 
1 154 ALA n 
1 155 THR n 
1 156 CYS n 
1 157 GLN n 
1 158 GLY n 
1 159 ALA n 
1 160 GLU n 
1 161 ALA n 
1 162 PHE n 
1 163 GLU n 
1 164 ILE n 
1 165 GLN n 
1 166 HIS n 
1 167 SER n 
1 168 GLY n 
1 169 LEU n 
1 170 ALA n 
1 171 ASN n 
1 172 GLY n 
1 173 ILE n 
1 174 PHE n 
1 175 MET n 
1 176 LYS n 
1 177 PHE n 
1 178 LEU n 
1 179 LYS n 
1 180 ASP n 
1 181 ARG n 
1 182 LEU n 
1 183 LEU n 
1 184 GLU n 
1 185 ASP n 
1 186 LYS n 
1 187 LYS n 
1 188 ILE n 
1 189 THR n 
1 190 VAL n 
1 191 LEU n 
1 192 LEU n 
1 193 ASP n 
1 194 GLU n 
1 195 VAL n 
1 196 ALA n 
1 197 GLU n 
1 198 ASP n 
1 199 MET n 
1 200 GLY n 
1 201 LYS n 
1 202 CYS n 
1 203 HIS n 
1 204 LEU n 
1 205 THR n 
1 206 LYS n 
1 207 GLY n 
1 208 LYS n 
1 209 GLN n 
1 210 ALA n 
1 211 LEU n 
1 212 GLU n 
1 213 ILE n 
1 214 ARG n 
1 215 SER n 
1 216 SER n 
1 217 LEU n 
1 218 SER n 
1 219 GLU n 
1 220 LYS n 
1 221 ARG n 
1 222 ALA n 
1 223 LEU n 
1 224 THR n 
1 225 ASP n 
1 226 PRO n 
1 227 ILE n 
1 228 GLN n 
1 229 GLY n 
1 230 THR n 
1 231 GLU n 
1 232 TYR n 
1 233 SER n 
1 234 ALA n 
1 235 GLU n 
1 236 SER n 
1 237 LEU n 
1 238 VAL n 
1 239 ARG n 
1 240 ASN n 
1 241 LEU n 
1 242 GLN n 
1 243 TRP n 
1 244 ALA n 
1 245 LYS n 
1 246 ALA n 
1 247 HIS n 
1 248 GLU n 
1 249 LEU n 
1 250 PRO n 
1 251 GLU n 
1 252 SER n 
1 253 MET n 
1 254 CYS n 
1 255 LEU n 
1 256 LYS n 
1 257 PHE n 
1 258 ASP n 
1 259 CYS n 
1 260 GLY n 
1 261 VAL n 
1 262 GLN n 
1 263 ILE n 
1 264 GLN n 
1 265 LEU n 
1 266 GLY n 
1 267 PHE n 
1 268 ALA n 
1 269 ALA n 
1 270 GLU n 
1 271 PHE n 
1 272 SER n 
1 273 ASN n 
1 274 VAL n 
1 275 MET n 
1 276 ILE n 
1 277 ILE n 
1 278 TYR n 
1 279 THR n 
1 280 SER n 
1 281 ILE n 
1 282 VAL n 
1 283 TYR n 
1 284 LYS n 
1 285 PRO n 
1 286 PRO n 
1 287 GLU n 
1 288 ILE n 
1 289 ILE n 
1 290 MET n 
1 291 CYS n 
1 292 ASP n 
1 293 ALA n 
1 294 TYR n 
1 295 VAL n 
1 296 THR n 
1 297 ASP n 
1 298 PHE n 
1 299 PRO n 
1 300 LEU n 
1 301 ASP n 
1 302 LEU n 
1 303 ASP n 
1 304 ILE n 
1 305 ASP n 
1 306 PRO n 
1 307 LYS n 
1 308 ASP n 
1 309 ALA n 
1 310 ASN n 
1 311 LYS n 
1 312 GLY n 
1 313 THR n 
1 314 PRO n 
1 315 GLU n 
1 316 GLU n 
1 317 THR n 
1 318 GLY n 
1 319 SER n 
1 320 TYR n 
1 321 LEU n 
1 322 VAL n 
1 323 SER n 
1 324 LYS n 
1 325 ASP n 
1 326 LEU n 
1 327 PRO n 
1 328 LYS n 
1 329 HIS n 
1 330 CYS n 
1 331 LEU n 
1 332 TYR n 
1 333 THR n 
1 334 ARG n 
1 335 LEU n 
1 336 SER n 
1 337 SER n 
1 338 LEU n 
1 339 GLN n 
1 340 LYS n 
1 341 LEU n 
1 342 LYS n 
1 343 GLU n 
1 344 HIS n 
1 345 LEU n 
1 346 VAL n 
1 347 PHE n 
1 348 THR n 
1 349 VAL n 
1 350 CYS n 
1 351 LEU n 
1 352 SER n 
1 353 TYR n 
1 354 GLN n 
1 355 TYR n 
1 356 SER n 
1 357 GLY n 
1 358 LEU n 
1 359 GLU n 
1 360 ASP n 
1 361 THR n 
1 362 VAL n 
1 363 GLU n 
1 364 ASP n 
1 365 LYS n 
1 366 GLN n 
1 367 GLU n 
1 368 VAL n 
1 369 ASN n 
1 370 VAL n 
1 371 GLY n 
1 372 LYS n 
1 373 PRO n 
1 374 LEU n 
1 375 ILE n 
1 376 ALA n 
1 377 LYS n 
1 378 LEU n 
1 379 ASP n 
1 380 MET n 
1 381 HIS n 
1 382 ARG n 
1 383 LEU n 
1 384 GLU n 
1 385 HIS n 
1 386 HIS n 
1 387 HIS n 
1 388 HIS n 
1 389 HIS n 
1 390 HIS n 
2 1   PHQ n 
2 2   VAL n 
2 3   ARG n 
2 4   PRO n 
2 5   ARG n 
2 6   CF0 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MALT1, MLT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MALT1_HUMAN Q9UDY8 1 
;LAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYE
NFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEA
FEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNL
QWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYL
VSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
;
339 ? 
2 PDB 3UO8        3UO8   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UO8 B 2 ? 382 ? Q9UDY8 339 ? 719 ? 339 719 
2 1 3UO8 C 2 ? 382 ? Q9UDY8 339 ? 719 ? 339 719 
3 2 3UO8 L 1 ? 6   ? 3UO8   0   ? 5   ? 0   5   
4 2 3UO8 M 1 ? 6   ? 3UO8   0   ? 5   ? 0   5   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UO8 MET B 1   ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 338 1  
1 3UO8 LEU B 383 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 720 2  
1 3UO8 GLU B 384 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 721 3  
1 3UO8 HIS B 385 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 722 4  
1 3UO8 HIS B 386 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 723 5  
1 3UO8 HIS B 387 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 724 6  
1 3UO8 HIS B 388 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 725 7  
1 3UO8 HIS B 389 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 726 8  
1 3UO8 HIS B 390 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 727 9  
2 3UO8 MET C 1   ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 338 10 
2 3UO8 LEU C 383 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 720 11 
2 3UO8 GLU C 384 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 721 12 
2 3UO8 HIS C 385 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 722 13 
2 3UO8 HIS C 386 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 723 14 
2 3UO8 HIS C 387 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 724 15 
2 3UO8 HIS C 388 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 725 16 
2 3UO8 HIS C 389 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 726 17 
2 3UO8 HIS C 390 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 727 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                     'C4 H7 N O4'     133.103 
CF0 non-polymer         . fluoromethane            'Fluoro methyl group' 'C H3 F'         34.033  
CYS 'L-peptide linking' y CYSTEINE                 ?                     'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                     'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                     'C9 H11 N O2'    165.189 
PHQ non-polymer         . 'benzyl chlorocarbonate' ?                     'C8 H7 Cl O2'    170.593 
PRO 'L-peptide linking' y PROLINE                  ?                     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                     'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                     'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                     'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3UO8 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.475 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.36 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   47.78 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'0.1M MES (pH 6.0), 0.2M calcium acetate, 2% benzamidine, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-06-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Silicon 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97891 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength_list        0.97891 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.entry_id                     3UO8 
_reflns.d_resolution_high            1.900 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   63071 
_reflns.pdbx_Rmerge_I_obs            0.051 
_reflns.pdbx_netI_over_sigmaI        9.000 
_reflns.pdbx_chi_squared             0.996 
_reflns.pdbx_redundancy              2.700 
_reflns.percent_possible_obs         97.300 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   63071 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.900 1.970  ? ? ? ? 0.492 ? ? 1.161 2.700 ? ? ? 6288 ? ? ? ? 96.700 ? ? 1  1 
1.970 2.050  ? ? ? ? 0.346 ? ? 1.103 2.700 ? ? ? 6277 ? ? ? ? 96.900 ? ? 2  1 
2.050 2.140  ? ? ? ? 0.247 ? ? 1.084 2.700 ? ? ? 6282 ? ? ? ? 97.000 ? ? 3  1 
2.140 2.250  ? ? ? ? 0.174 ? ? 1.073 2.700 ? ? ? 6310 ? ? ? ? 97.300 ? ? 4  1 
2.250 2.390  ? ? ? ? 0.125 ? ? 1.031 2.700 ? ? ? 6283 ? ? ? ? 97.700 ? ? 5  1 
2.390 2.580  ? ? ? ? 0.095 ? ? 0.987 2.700 ? ? ? 6378 ? ? ? ? 97.900 ? ? 6  1 
2.580 2.840  ? ? ? ? 0.066 ? ? 0.953 2.700 ? ? ? 6378 ? ? ? ? 98.100 ? ? 7  1 
2.840 3.250  ? ? ? ? 0.044 ? ? 0.887 2.700 ? ? ? 6394 ? ? ? ? 98.600 ? ? 8  1 
3.250 4.090  ? ? ? ? 0.031 ? ? 0.847 2.700 ? ? ? 6367 ? ? ? ? 98.300 ? ? 9  1 
4.090 50.000 ? ? ? ? 0.029 ? ? 0.820 2.600 ? ? ? 6114 ? ? ? ? 94.300 ? ? 10 1 
# 
_refine.entry_id                                 3UO8 
_refine.ls_d_res_high                            1.9000 
_refine.ls_d_res_low                             34.2620 
_refine.pdbx_ls_sigma_F                          0.050 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    92.3200 
_refine.ls_number_reflns_obs                     59902 
_refine.ls_number_reflns_all                     59902 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.2089 
_refine.ls_R_factor_obs                          0.2089 
_refine.ls_R_factor_R_work                       0.2066 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2497 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0700 
_refine.ls_number_reflns_R_free                  3036 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               48.7393 
_refine.solvent_model_param_bsol                 50.4990 
_refine.solvent_model_param_ksol                 0.4360 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            7.0401 
_refine.aniso_B[2][2]                            -4.0201 
_refine.aniso_B[3][3]                            -3.0200 
_refine.aniso_B[1][2]                            6.3817 
_refine.aniso_B[1][3]                            -2.0965 
_refine.aniso_B[2][3]                            5.8794 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8035 
_refine.B_iso_max                                213.440 
_refine.B_iso_min                                12.870 
_refine.pdbx_overall_phase_error                 27.1700 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5782 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             222 
_refine_hist.number_atoms_total               6004 
_refine_hist.d_res_high                       1.9000 
_refine_hist.d_res_low                        34.2620 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           5883 0.006  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          7950 0.991  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     918  0.060  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      1012 0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 2208 13.126 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.9000 1.9297  22 78.0000 2179 . 0.2746 0.3972 . 111 . 2290 . 'X-RAY DIFFRACTION' . 
1.9297 1.9613  22 83.0000 2315 . 0.2415 0.2689 . 124 . 2439 . 'X-RAY DIFFRACTION' . 
1.9613 1.9951  22 85.0000 2395 . 0.2232 0.2935 . 137 . 2532 . 'X-RAY DIFFRACTION' . 
1.9951 2.0314  22 87.0000 2429 . 0.2189 0.2417 . 119 . 2548 . 'X-RAY DIFFRACTION' . 
2.0314 2.0705  22 87.0000 2433 . 0.2242 0.2736 . 138 . 2571 . 'X-RAY DIFFRACTION' . 
2.0705 2.1127  22 89.0000 2502 . 0.2130 0.2890 . 138 . 2640 . 'X-RAY DIFFRACTION' . 
2.1127 2.1587  22 91.0000 2533 . 0.2012 0.2421 . 134 . 2667 . 'X-RAY DIFFRACTION' . 
2.1587 2.2089  22 91.0000 2551 . 0.1974 0.2650 . 124 . 2675 . 'X-RAY DIFFRACTION' . 
2.2089 2.2641  22 92.0000 2618 . 0.1845 0.2526 . 138 . 2756 . 'X-RAY DIFFRACTION' . 
2.2641 2.3253  22 93.0000 2579 . 0.1826 0.2181 . 145 . 2724 . 'X-RAY DIFFRACTION' . 
2.3253 2.3937  22 94.0000 2616 . 0.1923 0.2441 . 134 . 2750 . 'X-RAY DIFFRACTION' . 
2.3937 2.4710  22 95.0000 2682 . 0.2021 0.2994 . 142 . 2824 . 'X-RAY DIFFRACTION' . 
2.4710 2.5592  22 96.0000 2677 . 0.2134 0.2648 . 152 . 2829 . 'X-RAY DIFFRACTION' . 
2.5592 2.6617  22 96.0000 2721 . 0.2123 0.2689 . 147 . 2868 . 'X-RAY DIFFRACTION' . 
2.6617 2.7828  22 97.0000 2727 . 0.2030 0.2741 . 118 . 2845 . 'X-RAY DIFFRACTION' . 
2.7828 2.9294  22 97.0000 2701 . 0.2184 0.2795 . 142 . 2843 . 'X-RAY DIFFRACTION' . 
2.9294 3.1128  22 98.0000 2752 . 0.2197 0.2610 . 124 . 2876 . 'X-RAY DIFFRACTION' . 
3.1128 3.3530  22 98.0000 2751 . 0.2217 0.2598 . 161 . 2912 . 'X-RAY DIFFRACTION' . 
3.3530 3.6900  22 98.0000 2743 . 0.2067 0.2604 . 141 . 2884 . 'X-RAY DIFFRACTION' . 
3.6900 4.2232  22 98.0000 2711 . 0.1835 0.1887 . 171 . 2882 . 'X-RAY DIFFRACTION' . 
4.2232 5.3175  22 96.0000 2684 . 0.1740 0.2027 . 149 . 2833 . 'X-RAY DIFFRACTION' . 
5.3175 34.2680 22 92.0000 2567 . 0.2466 0.2950 . 147 . 2714 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3UO8 
_struct.title                     'Crystal structure of the MALT1 paracaspase (P1 form)' 
_struct.pdbx_descriptor           
'Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (E.C.3.4.22.-), Z-Val-Arg-Pro-DL-Arg-fluoromethylketone' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UO8 
_struct_keywords.text            
'Paracaspase, Lymphoma, NF-KB Signalling, Caspase fold, Immunoglobulin Fold, HYDROLASE-HYDROLASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 24  ? LEU A 39  ? ALA B 361 LEU B 376 1 ? 16 
HELX_P HELX_P2  2  THR A 50  ? LEU A 65  ? THR B 387 LEU B 402 1 ? 16 
HELX_P HELX_P3  3  ARG A 98  ? CYS A 102 ? ARG B 435 CYS B 439 5 ? 5  
HELX_P HELX_P4  4  VAL A 105 ? GLU A 114 ? VAL B 442 GLU B 451 1 ? 10 
HELX_P HELX_P5  5  GLY A 172 ? LYS A 179 ? GLY B 509 LYS B 516 1 ? 8  
HELX_P HELX_P6  6  LYS A 187 ? GLY A 200 ? LYS B 524 GLY B 537 1 ? 14 
HELX_P HELX_P7  7  TRP A 243 ? HIS A 247 ? TRP B 580 HIS B 584 5 ? 5  
HELX_P HELX_P8  8  PRO A 299 ? ASP A 303 ? PRO B 636 ASP B 640 5 ? 5  
HELX_P HELX_P9  9  ASP A 305 ? ALA A 309 ? ASP B 642 ALA B 646 5 ? 5  
HELX_P HELX_P10 10 THR A 313 ? GLY A 318 ? THR B 650 GLY B 655 5 ? 6  
HELX_P HELX_P11 11 VAL A 322 ? LEU A 326 ? VAL B 659 LEU B 663 5 ? 5  
HELX_P HELX_P12 12 SER A 337 ? LEU A 341 ? SER B 674 LEU B 678 5 ? 5  
HELX_P HELX_P13 13 PRO A 373 ? LEU A 378 ? PRO B 710 LEU B 715 5 ? 6  
HELX_P HELX_P14 14 ALA B 24  ? LEU B 39  ? ALA C 361 LEU C 376 1 ? 16 
HELX_P HELX_P15 15 THR B 50  ? LEU B 64  ? THR C 387 LEU C 401 1 ? 15 
HELX_P HELX_P16 16 ARG B 98  ? CYS B 102 ? ARG C 435 CYS C 439 5 ? 5  
HELX_P HELX_P17 17 VAL B 105 ? GLU B 114 ? VAL C 442 GLU C 451 1 ? 10 
HELX_P HELX_P18 18 GLY B 172 ? LYS B 179 ? GLY C 509 LYS C 516 1 ? 8  
HELX_P HELX_P19 19 LYS B 187 ? GLY B 200 ? LYS C 524 GLY C 537 1 ? 14 
HELX_P HELX_P20 20 LEU B 241 ? ALA B 246 ? LEU C 578 ALA C 583 1 ? 6  
HELX_P HELX_P21 21 PRO B 299 ? ASP B 303 ? PRO C 636 ASP C 640 5 ? 5  
HELX_P HELX_P22 22 PRO B 314 ? GLY B 318 ? PRO C 651 GLY C 655 5 ? 5  
HELX_P HELX_P23 23 SER B 337 ? LEU B 341 ? SER C 674 LEU C 678 5 ? 5  
HELX_P HELX_P24 24 PRO B 373 ? ASP B 379 ? PRO C 710 ASP C 716 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 95 A . ? ASN 432 B PRO 96 A ? PRO 433 B 1 -0.98 
2 ASN 95 B . ? ASN 432 C PRO 96 B ? PRO 433 C 1 7.20  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 3  ? 
C ? 2  ? 
D ? 4  ? 
E ? 3  ? 
F ? 3  ? 
G ? 2  ? 
H ? 4  ? 
I ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? parallel      
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? parallel      
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
G 1  2  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LYS A 42  ? LEU A 47  ? LYS B 379 LEU B 384 
A 2  LYS A 6   ? GLY A 12  ? LYS B 343 GLY B 349 
A 3  TYR A 70  ? ALA A 76  ? TYR B 407 ALA B 413 
A 4  LEU A 119 ? ASP A 125 ? LEU B 456 ASP B 462 
A 5  ILE A 149 ? TYR A 153 ? ILE B 486 TYR B 490 
A 6  GLU A 212 ? SER A 215 ? GLU B 549 SER B 552 
A 7  GLU B 212 ? SER B 215 ? GLU C 549 SER C 552 
A 8  ILE B 149 ? TYR B 153 ? ILE C 486 TYR C 490 
A 9  LEU B 119 ? ASP B 125 ? LEU C 456 ASP C 462 
A 10 TYR B 70  ? ALA B 76  ? TYR C 407 ALA C 413 
A 11 LYS B 6   ? GLY B 12  ? LYS C 343 GLY C 349 
A 12 LYS B 42  ? LEU B 47  ? LYS C 379 LEU C 384 
B 1  GLY A 79  ? ASN A 82  ? GLY B 416 ASN B 419 
B 2  ASN A 85  ? MET A 88  ? ASN B 422 MET B 425 
B 3  LEU A 103 ? CYS A 104 ? LEU B 440 CYS B 441 
C 1  PHE A 162 ? GLU A 163 ? PHE B 499 GLU B 500 
C 2  ARG C 3   ? PRO C 4   ? ARG L 2   PRO L 3   
D 1  MET A 253 ? LYS A 256 ? MET B 590 LYS B 593 
D 2  GLN A 262 ? PHE A 271 ? GLN B 599 PHE B 608 
D 3  VAL A 274 ? TYR A 283 ? VAL B 611 TYR B 620 
D 4  LEU A 331 ? LEU A 335 ? LEU B 668 LEU B 672 
E 1  ILE A 288 ? THR A 296 ? ILE B 625 THR B 633 
E 2  VAL A 346 ? TYR A 355 ? VAL B 683 TYR B 692 
E 3  VAL A 362 ? ASN A 369 ? VAL B 699 ASN B 706 
F 1  GLY B 79  ? ASN B 82  ? GLY C 416 ASN C 419 
F 2  ASN B 85  ? MET B 88  ? ASN C 422 MET C 425 
F 3  LEU B 103 ? CYS B 104 ? LEU C 440 CYS C 441 
G 1  PHE B 162 ? GLU B 163 ? PHE C 499 GLU C 500 
G 2  ARG D 3   ? PRO D 4   ? ARG M 2   PRO M 3   
H 1  MET B 253 ? LYS B 256 ? MET C 590 LYS C 593 
H 2  GLN B 262 ? PHE B 271 ? GLN C 599 PHE C 608 
H 3  VAL B 274 ? TYR B 283 ? VAL C 611 TYR C 620 
H 4  LEU B 331 ? LEU B 335 ? LEU C 668 LEU C 672 
I 1  ILE B 288 ? THR B 296 ? ILE C 625 THR C 633 
I 2  VAL B 346 ? TYR B 355 ? VAL C 683 TYR C 692 
I 3  VAL B 362 ? ASN B 369 ? VAL C 699 ASN C 706 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 44  ? O VAL B 381 N LEU A 10  ? N LEU B 347 
A 2  3  N VAL A 7   ? N VAL B 344 O TYR A 70  ? O TYR B 407 
A 3  4  N TYR A 75  ? N TYR B 412 O ASP A 125 ? O ASP B 462 
A 4  5  N ASN A 120 ? N ASN B 457 O VAL A 150 ? O VAL B 487 
A 5  6  N PHE A 151 ? N PHE B 488 O ARG A 214 ? O ARG B 551 
A 6  7  N ILE A 213 ? N ILE B 550 O SER B 215 ? O SER C 552 
A 7  8  O GLU B 212 ? O GLU C 549 N TYR B 153 ? N TYR C 490 
A 8  9  O VAL B 150 ? O VAL C 487 N ASN B 120 ? N ASN C 457 
A 9  10 O ASP B 125 ? O ASP C 462 N TYR B 75  ? N TYR C 412 
A 10 11 O TYR B 70  ? O TYR C 407 N VAL B 7   ? N VAL C 344 
A 11 12 N LYS B 6   ? N LYS C 343 O LYS B 42  ? O LYS C 379 
B 1  2  N TYR A 80  ? N TYR B 417 O PHE A 87  ? O PHE B 424 
B 2  3  N MET A 88  ? N MET B 425 O LEU A 103 ? O LEU B 440 
C 1  2  N GLU A 163 ? N GLU B 500 O ARG C 3   ? O ARG L 2   
D 1  2  N MET A 253 ? N MET B 590 O LEU A 265 ? O LEU B 602 
D 2  3  N GLU A 270 ? N GLU B 607 O VAL A 274 ? O VAL B 611 
D 3  4  N MET A 275 ? N MET B 612 O LEU A 335 ? O LEU B 672 
E 1  2  N TYR A 294 ? N TYR B 631 O CYS A 350 ? O CYS B 687 
E 2  3  N LEU A 351 ? N LEU B 688 O ASP A 364 ? O ASP B 701 
F 1  2  N TYR B 80  ? N TYR C 417 O PHE B 87  ? O PHE C 424 
F 2  3  N MET B 88  ? N MET C 425 O LEU B 103 ? O LEU C 440 
G 1  2  N GLU B 163 ? N GLU C 500 O ARG D 3   ? O ARG M 2   
H 1  2  N MET B 253 ? N MET C 590 O LEU B 265 ? O LEU C 602 
H 2  3  N ALA B 268 ? N ALA C 605 O ILE B 276 ? O ILE C 613 
H 3  4  N MET B 275 ? N MET C 612 O LEU B 335 ? O LEU C 672 
I 1  2  N TYR B 294 ? N TYR C 631 O CYS B 350 ? O CYS C 687 
I 2  3  N PHE B 347 ? N PHE C 684 O VAL B 368 ? O VAL C 705 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR CHAIN L OF Z-VAL-ARG-PRO-DL-ARG-FLUOROMETHYLKETONE' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR CHAIN M OF Z-VAL-ARG-PRO-DL-ARG-FLUOROMETHYLKETONE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LEU A 22  ? LEU B 359 . ? 1_555 ? 
2  AC1 14 ALA A 24  ? ALA B 361 . ? 1_555 ? 
3  AC1 14 PRO A 25  ? PRO B 362 . ? 1_555 ? 
4  AC1 14 ASP A 28  ? ASP B 365 . ? 1_555 ? 
5  AC1 14 GLY A 77  ? GLY B 414 . ? 1_555 ? 
6  AC1 14 HIS A 78  ? HIS B 415 . ? 1_555 ? 
7  AC1 14 GLY A 79  ? GLY B 416 . ? 1_555 ? 
8  AC1 14 ASP A 125 ? ASP B 462 . ? 1_555 ? 
9  AC1 14 CYS A 127 ? CYS B 464 . ? 1_555 ? 
10 AC1 14 GLU A 160 ? GLU B 497 . ? 1_555 ? 
11 AC1 14 ALA A 161 ? ALA B 498 . ? 1_555 ? 
12 AC1 14 PHE A 162 ? PHE B 499 . ? 1_555 ? 
13 AC1 14 GLU A 163 ? GLU B 500 . ? 1_555 ? 
14 AC1 14 GLN A 165 ? GLN B 502 . ? 1_555 ? 
15 AC2 16 LYS B 23  ? LYS C 360 . ? 1_555 ? 
16 AC2 16 ALA B 24  ? ALA C 361 . ? 1_555 ? 
17 AC2 16 PRO B 25  ? PRO C 362 . ? 1_555 ? 
18 AC2 16 ASP B 28  ? ASP C 365 . ? 1_555 ? 
19 AC2 16 ALA B 76  ? ALA C 413 . ? 1_555 ? 
20 AC2 16 GLY B 77  ? GLY C 414 . ? 1_555 ? 
21 AC2 16 HIS B 78  ? HIS C 415 . ? 1_555 ? 
22 AC2 16 GLY B 79  ? GLY C 416 . ? 1_555 ? 
23 AC2 16 ASP B 125 ? ASP C 462 . ? 1_555 ? 
24 AC2 16 CYS B 127 ? CYS C 464 . ? 1_555 ? 
25 AC2 16 GLU B 160 ? GLU C 497 . ? 1_555 ? 
26 AC2 16 ALA B 161 ? ALA C 498 . ? 1_555 ? 
27 AC2 16 PHE B 162 ? PHE C 499 . ? 1_555 ? 
28 AC2 16 GLU B 163 ? GLU C 500 . ? 1_555 ? 
29 AC2 16 ILE B 164 ? ILE C 501 . ? 1_555 ? 
30 AC2 16 GLN B 165 ? GLN C 502 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3UO8 
_atom_sites.fract_transf_matrix[1][1]   0.016331 
_atom_sites.fract_transf_matrix[1][2]   0.008405 
_atom_sites.fract_transf_matrix[1][3]   0.006256 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018390 
_atom_sites.fract_transf_matrix[2][3]   0.008677 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015670 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . MET A 1 1   ? -27.898 16.364  4.125   1.00 38.51  ? 338 MET B N    1 
ATOM   2     C CA   . MET A 1 1   ? -26.773 16.408  3.200   1.00 42.32  ? 338 MET B CA   1 
ATOM   3     C C    . MET A 1 1   ? -27.012 17.499  2.159   1.00 44.67  ? 338 MET B C    1 
ATOM   4     O O    . MET A 1 1   ? -28.157 17.777  1.788   1.00 36.59  ? 338 MET B O    1 
ATOM   5     C CB   . MET A 1 1   ? -26.571 15.048  2.519   1.00 37.05  ? 338 MET B CB   1 
ATOM   6     C CG   . MET A 1 1   ? -26.313 13.885  3.480   1.00 37.46  ? 338 MET B CG   1 
ATOM   7     S SD   . MET A 1 1   ? -25.058 14.224  4.741   1.00 44.25  ? 338 MET B SD   1 
ATOM   8     C CE   . MET A 1 1   ? -23.568 14.442  3.769   1.00 36.53  ? 338 MET B CE   1 
ATOM   9     H HA   . MET A 1 1   ? -25.957 16.619  3.701   1.00 50.78  ? 338 MET B HA   1 
ATOM   10    H HB2  . MET A 1 1   ? -27.369 14.836  2.009   1.00 44.46  ? 338 MET B HB2  1 
ATOM   11    H HB3  . MET A 1 1   ? -25.810 15.110  1.922   1.00 44.46  ? 338 MET B HB3  1 
ATOM   12    H HG2  . MET A 1 1   ? -27.141 13.671  3.938   1.00 44.95  ? 338 MET B HG2  1 
ATOM   13    H HG3  . MET A 1 1   ? -26.016 13.118  2.966   1.00 44.95  ? 338 MET B HG3  1 
ATOM   14    H HE1  . MET A 1 1   ? -22.835 14.628  4.360   1.00 43.84  ? 338 MET B HE1  1 
ATOM   15    H HE2  . MET A 1 1   ? -23.396 13.636  3.277   1.00 43.84  ? 338 MET B HE2  1 
ATOM   16    H HE3  . MET A 1 1   ? -23.696 15.175  3.163   1.00 43.84  ? 338 MET B HE3  1 
ATOM   17    N N    . LEU A 1 2   ? -25.924 18.116  1.704   1.00 41.00  ? 339 LEU B N    1 
ATOM   18    C CA   . LEU A 1 2   ? -25.990 19.239  0.777   1.00 39.17  ? 339 LEU B CA   1 
ATOM   19    C C    . LEU A 1 2   ? -25.374 18.886  -0.576  1.00 38.29  ? 339 LEU B C    1 
ATOM   20    O O    . LEU A 1 2   ? -24.407 18.129  -0.647  1.00 34.09  ? 339 LEU B O    1 
ATOM   21    C CB   . LEU A 1 2   ? -25.241 20.433  1.368   1.00 48.44  ? 339 LEU B CB   1 
ATOM   22    C CG   . LEU A 1 2   ? -25.706 20.904  2.746   1.00 50.55  ? 339 LEU B CG   1 
ATOM   23    C CD1  . LEU A 1 2   ? -24.721 21.909  3.323   1.00 45.37  ? 339 LEU B CD1  1 
ATOM   24    C CD2  . LEU A 1 2   ? -27.104 21.498  2.659   1.00 58.80  ? 339 LEU B CD2  1 
ATOM   25    H H    . LEU A 1 2   ? -25.122 17.897  1.924   1.00 49.20  ? 339 LEU B H    1 
ATOM   26    H HA   . LEU A 1 2   ? -26.925 19.495  0.637   1.00 47.00  ? 339 LEU B HA   1 
ATOM   27    H HB2  . LEU A 1 2   ? -24.304 20.197  1.445   1.00 58.13  ? 339 LEU B HB2  1 
ATOM   28    H HB3  . LEU A 1 2   ? -25.335 21.183  0.760   1.00 58.13  ? 339 LEU B HB3  1 
ATOM   29    H HG   . LEU A 1 2   ? -25.741 20.142  3.345   1.00 60.66  ? 339 LEU B HG   1 
ATOM   30    H HD11 . LEU A 1 2   ? -25.032 22.190  4.187   1.00 54.44  ? 339 LEU B HD11 1 
ATOM   31    H HD12 . LEU A 1 2   ? -23.860 21.491  3.405   1.00 54.44  ? 339 LEU B HD12 1 
ATOM   32    H HD13 . LEU A 1 2   ? -24.664 22.664  2.733   1.00 54.44  ? 339 LEU B HD13 1 
ATOM   33    H HD21 . LEU A 1 2   ? -27.376 21.787  3.533   1.00 70.56  ? 339 LEU B HD21 1 
ATOM   34    H HD22 . LEU A 1 2   ? -27.089 22.245  2.057   1.00 70.56  ? 339 LEU B HD22 1 
ATOM   35    H HD23 . LEU A 1 2   ? -27.708 20.827  2.333   1.00 70.56  ? 339 LEU B HD23 1 
ATOM   36    N N    . ALA A 1 3   ? -25.939 19.435  -1.650  1.00 31.63  ? 340 ALA B N    1 
ATOM   37    C CA   . ALA A 1 3   ? -25.332 19.333  -2.971  1.00 27.87  ? 340 ALA B CA   1 
ATOM   38    C C    . ALA A 1 3   ? -24.707 20.686  -3.335  1.00 47.97  ? 340 ALA B C    1 
ATOM   39    O O    . ALA A 1 3   ? -25.208 21.726  -2.925  1.00 46.40  ? 340 ALA B O    1 
ATOM   40    C CB   . ALA A 1 3   ? -26.383 18.935  -4.005  1.00 24.86  ? 340 ALA B CB   1 
ATOM   41    H H    . ALA A 1 3   ? -26.679 19.874  -1.638  1.00 37.95  ? 340 ALA B H    1 
ATOM   42    H HA   . ALA A 1 3   ? -24.627 18.652  -2.960  1.00 33.44  ? 340 ALA B HA   1 
ATOM   43    H HB1  . ALA A 1 3   ? -25.965 18.873  -4.867  1.00 29.84  ? 340 ALA B HB1  1 
ATOM   44    H HB2  . ALA A 1 3   ? -26.756 18.085  -3.760  1.00 29.84  ? 340 ALA B HB2  1 
ATOM   45    H HB3  . ALA A 1 3   ? -27.072 19.603  -4.023  1.00 29.84  ? 340 ALA B HB3  1 
ATOM   46    N N    . LYS A 1 4   ? -23.609 20.680  -4.086  1.00 44.84  ? 341 LYS B N    1 
ATOM   47    C CA   . LYS A 1 4   ? -23.036 21.930  -4.578  1.00 35.53  ? 341 LYS B CA   1 
ATOM   48    C C    . LYS A 1 4   ? -23.829 22.391  -5.792  1.00 37.85  ? 341 LYS B C    1 
ATOM   49    O O    . LYS A 1 4   ? -23.937 23.593  -6.071  1.00 34.40  ? 341 LYS B O    1 
ATOM   50    C CB   . LYS A 1 4   ? -21.570 21.755  -4.968  1.00 49.73  ? 341 LYS B CB   1 
ATOM   51    C CG   . LYS A 1 4   ? -20.947 23.039  -5.507  1.00 65.38  ? 341 LYS B CG   1 
ATOM   52    C CD   . LYS A 1 4   ? -19.695 22.777  -6.323  1.00 73.52  ? 341 LYS B CD   1 
ATOM   53    C CE   . LYS A 1 4   ? -18.432 23.047  -5.519  1.00 76.71  ? 341 LYS B CE   1 
ATOM   54    N NZ   . LYS A 1 4   ? -17.207 22.854  -6.342  1.00 74.30  ? 341 LYS B NZ   1 
ATOM   55    H H    . LYS A 1 4   ? -23.180 19.973  -4.323  1.00 53.80  ? 341 LYS B H    1 
ATOM   56    H HA   . LYS A 1 4   ? -23.097 22.618  -3.883  1.00 42.64  ? 341 LYS B HA   1 
ATOM   57    H HB2  . LYS A 1 4   ? -21.065 21.482  -4.186  1.00 59.67  ? 341 LYS B HB2  1 
ATOM   58    H HB3  . LYS A 1 4   ? -21.505 21.077  -5.659  1.00 59.67  ? 341 LYS B HB3  1 
ATOM   59    H HG2  . LYS A 1 4   ? -21.590 23.487  -6.078  1.00 78.45  ? 341 LYS B HG2  1 
ATOM   60    H HG3  . LYS A 1 4   ? -20.706 23.611  -4.762  1.00 78.45  ? 341 LYS B HG3  1 
ATOM   61    H HD2  . LYS A 1 4   ? -19.684 21.848  -6.602  1.00 88.23  ? 341 LYS B HD2  1 
ATOM   62    H HD3  . LYS A 1 4   ? -19.692 23.360  -7.098  1.00 88.23  ? 341 LYS B HD3  1 
ATOM   63    H HE2  . LYS A 1 4   ? -18.443 23.964  -5.203  1.00 92.05  ? 341 LYS B HE2  1 
ATOM   64    H HE3  . LYS A 1 4   ? -18.393 22.433  -4.769  1.00 92.05  ? 341 LYS B HE3  1 
ATOM   65    H HZ1  . LYS A 1 4   ? -16.482 23.017  -5.852  1.00 89.16  ? 341 LYS B HZ1  1 
ATOM   66    H HZ2  . LYS A 1 4   ? -17.171 22.017  -6.642  1.00 89.16  ? 341 LYS B HZ2  1 
ATOM   67    H HZ3  . LYS A 1 4   ? -17.217 23.410  -7.037  1.00 89.16  ? 341 LYS B HZ3  1 
ATOM   68    N N    . ASP A 1 5   ? -24.360 21.409  -6.512  1.00 32.49  ? 342 ASP B N    1 
ATOM   69    C CA   . ASP A 1 5   ? -25.267 21.620  -7.639  1.00 33.16  ? 342 ASP B CA   1 
ATOM   70    C C    . ASP A 1 5   ? -25.827 20.245  -7.976  1.00 38.30  ? 342 ASP B C    1 
ATOM   71    O O    . ASP A 1 5   ? -25.351 19.224  -7.456  1.00 32.12  ? 342 ASP B O    1 
ATOM   72    C CB   . ASP A 1 5   ? -24.516 22.196  -8.843  1.00 37.45  ? 342 ASP B CB   1 
ATOM   73    C CG   . ASP A 1 5   ? -25.432 22.915  -9.836  1.00 45.26  ? 342 ASP B CG   1 
ATOM   74    O OD1  . ASP A 1 5   ? -26.674 22.809  -9.729  1.00 38.98  ? 342 ASP B OD1  1 
ATOM   75    O OD2  . ASP A 1 5   ? -24.891 23.583  -10.743 1.00 39.76  ? 342 ASP B OD2  1 
ATOM   76    H H    . ASP A 1 5   ? -24.203 20.577  -6.360  1.00 38.99  ? 342 ASP B H    1 
ATOM   77    H HA   . ASP A 1 5   ? -25.999 22.221  -7.387  1.00 39.79  ? 342 ASP B HA   1 
ATOM   78    H HB2  . ASP A 1 5   ? -23.857 22.834  -8.527  1.00 44.94  ? 342 ASP B HB2  1 
ATOM   79    H HB3  . ASP A 1 5   ? -24.074 21.472  -9.314  1.00 44.94  ? 342 ASP B HB3  1 
ATOM   80    N N    . LYS A 1 6   ? -26.834 20.196  -8.836  1.00 30.31  ? 343 LYS B N    1 
ATOM   81    C CA   . LYS A 1 6   ? -27.406 18.917  -9.222  1.00 33.42  ? 343 LYS B CA   1 
ATOM   82    C C    . LYS A 1 6   ? -27.640 18.904  -10.724 1.00 31.83  ? 343 LYS B C    1 
ATOM   83    O O    . LYS A 1 6   ? -28.383 19.727  -11.246 1.00 33.35  ? 343 LYS B O    1 
ATOM   84    C CB   . LYS A 1 6   ? -28.700 18.675  -8.445  1.00 30.46  ? 343 LYS B CB   1 
ATOM   85    C CG   . LYS A 1 6   ? -28.493 18.758  -6.932  1.00 28.88  ? 343 LYS B CG   1 
ATOM   86    C CD   . LYS A 1 6   ? -29.698 18.282  -6.162  1.00 31.48  ? 343 LYS B CD   1 
ATOM   87    C CE   . LYS A 1 6   ? -30.755 19.363  -6.078  1.00 27.75  ? 343 LYS B CE   1 
ATOM   88    N NZ   . LYS A 1 6   ? -31.977 18.864  -5.413  1.00 25.83  ? 343 LYS B NZ   1 
ATOM   89    H H    . LYS A 1 6   ? -27.200 20.881  -9.206  1.00 36.37  ? 343 LYS B H    1 
ATOM   90    H HA   . LYS A 1 6   ? -26.775 18.200  -9.002  1.00 40.11  ? 343 LYS B HA   1 
ATOM   91    H HB2  . LYS A 1 6   ? -29.352 19.347  -8.697  1.00 36.56  ? 343 LYS B HB2  1 
ATOM   92    H HB3  . LYS A 1 6   ? -29.035 17.789  -8.655  1.00 36.56  ? 343 LYS B HB3  1 
ATOM   93    H HG2  . LYS A 1 6   ? -27.738 18.201  -6.684  1.00 34.66  ? 343 LYS B HG2  1 
ATOM   94    H HG3  . LYS A 1 6   ? -28.322 19.680  -6.685  1.00 34.66  ? 343 LYS B HG3  1 
ATOM   95    H HD2  . LYS A 1 6   ? -30.084 17.514  -6.611  1.00 37.77  ? 343 LYS B HD2  1 
ATOM   96    H HD3  . LYS A 1 6   ? -29.431 18.047  -5.260  1.00 37.77  ? 343 LYS B HD3  1 
ATOM   97    H HE2  . LYS A 1 6   ? -30.411 20.110  -5.563  1.00 33.30  ? 343 LYS B HE2  1 
ATOM   98    H HE3  . LYS A 1 6   ? -30.992 19.652  -6.973  1.00 33.30  ? 343 LYS B HE3  1 
ATOM   99    H HZ1  . LYS A 1 6   ? -32.587 19.510  -5.371  1.00 30.99  ? 343 LYS B HZ1  1 
ATOM   100   H HZ2  . LYS A 1 6   ? -32.313 18.178  -5.869  1.00 30.99  ? 343 LYS B HZ2  1 
ATOM   101   H HZ3  . LYS A 1 6   ? -31.784 18.594  -4.586  1.00 30.99  ? 343 LYS B HZ3  1 
ATOM   102   N N    . VAL A 1 7   ? -26.999 17.964  -11.410 1.00 27.34  ? 344 VAL B N    1 
ATOM   103   C CA   . VAL A 1 7   ? -26.970 17.938  -12.870 1.00 22.20  ? 344 VAL B CA   1 
ATOM   104   C C    . VAL A 1 7   ? -27.364 16.564  -13.388 1.00 28.29  ? 344 VAL B C    1 
ATOM   105   O O    . VAL A 1 7   ? -26.946 15.551  -12.827 1.00 26.02  ? 344 VAL B O    1 
ATOM   106   C CB   . VAL A 1 7   ? -25.556 18.267  -13.394 1.00 29.32  ? 344 VAL B CB   1 
ATOM   107   C CG1  . VAL A 1 7   ? -25.506 18.152  -14.906 1.00 32.56  ? 344 VAL B CG1  1 
ATOM   108   C CG2  . VAL A 1 7   ? -25.122 19.658  -12.942 1.00 31.31  ? 344 VAL B CG2  1 
ATOM   109   H H    . VAL A 1 7   ? -26.564 17.318  -11.045 1.00 32.81  ? 344 VAL B H    1 
ATOM   110   H HA   . VAL A 1 7   ? -27.599 18.600  -13.225 1.00 26.64  ? 344 VAL B HA   1 
ATOM   111   H HB   . VAL A 1 7   ? -24.921 17.619  -13.023 1.00 35.18  ? 344 VAL B HB   1 
ATOM   112   H HG11 . VAL A 1 7   ? -24.619 18.361  -15.207 1.00 39.07  ? 344 VAL B HG11 1 
ATOM   113   H HG12 . VAL A 1 7   ? -25.735 17.254  -15.158 1.00 39.07  ? 344 VAL B HG12 1 
ATOM   114   H HG13 . VAL A 1 7   ? -26.135 18.769  -15.287 1.00 39.07  ? 344 VAL B HG13 1 
ATOM   115   H HG21 . VAL A 1 7   ? -24.242 19.836  -13.282 1.00 37.57  ? 344 VAL B HG21 1 
ATOM   116   H HG22 . VAL A 1 7   ? -25.742 20.305  -13.285 1.00 37.57  ? 344 VAL B HG22 1 
ATOM   117   H HG23 . VAL A 1 7   ? -25.115 19.686  -11.983 1.00 37.57  ? 344 VAL B HG23 1 
ATOM   118   N N    . ALA A 1 8   ? -28.146 16.526  -14.468 1.00 28.08  ? 345 ALA B N    1 
ATOM   119   C CA   . ALA A 1 8   ? -28.594 15.264  -15.044 1.00 25.45  ? 345 ALA B CA   1 
ATOM   120   C C    . ALA A 1 8   ? -28.515 15.275  -16.557 1.00 34.83  ? 345 ALA B C    1 
ATOM   121   O O    . ALA A 1 8   ? -28.927 16.239  -17.207 1.00 27.53  ? 345 ALA B O    1 
ATOM   122   C CB   . ALA A 1 8   ? -30.015 14.953  -14.626 1.00 22.18  ? 345 ALA B CB   1 
ATOM   123   H H    . ALA A 1 8   ? -28.430 17.223  -14.885 1.00 33.70  ? 345 ALA B H    1 
ATOM   124   H HA   . ALA A 1 8   ? -28.018 14.543  -14.717 1.00 30.55  ? 345 ALA B HA   1 
ATOM   125   H HB1  . ALA A 1 8   ? -30.281 14.119  -15.020 1.00 26.62  ? 345 ALA B HB1  1 
ATOM   126   H HB2  . ALA A 1 8   ? -30.052 14.889  -13.669 1.00 26.62  ? 345 ALA B HB2  1 
ATOM   127   H HB3  . ALA A 1 8   ? -30.592 15.657  -14.930 1.00 26.62  ? 345 ALA B HB3  1 
ATOM   128   N N    . LEU A 1 9   ? -28.004 14.182  -17.109 1.00 32.90  ? 346 LEU B N    1 
ATOM   129   C CA   . LEU A 1 9   ? -28.081 13.936  -18.539 1.00 28.46  ? 346 LEU B CA   1 
ATOM   130   C C    . LEU A 1 9   ? -29.055 12.788  -18.732 1.00 27.18  ? 346 LEU B C    1 
ATOM   131   O O    . LEU A 1 9   ? -28.883 11.733  -18.135 1.00 19.65  ? 346 LEU B O    1 
ATOM   132   C CB   . LEU A 1 9   ? -26.695 13.569  -19.090 1.00 21.48  ? 346 LEU B CB   1 
ATOM   133   C CG   . LEU A 1 9   ? -26.664 13.018  -20.517 1.00 23.08  ? 346 LEU B CG   1 
ATOM   134   C CD1  . LEU A 1 9   ? -27.159 14.086  -21.496 1.00 26.85  ? 346 LEU B CD1  1 
ATOM   135   C CD2  . LEU A 1 9   ? -25.264 12.558  -20.897 1.00 23.06  ? 346 LEU B CD2  1 
ATOM   136   H H    . LEU A 1 9   ? -27.603 13.561  -16.670 1.00 39.48  ? 346 LEU B H    1 
ATOM   137   H HA   . LEU A 1 9   ? -28.417 14.730  -19.005 1.00 34.15  ? 346 LEU B HA   1 
ATOM   138   H HB2  . LEU A 1 9   ? -26.140 14.364  -19.075 1.00 25.77  ? 346 LEU B HB2  1 
ATOM   139   H HB3  . LEU A 1 9   ? -26.306 12.894  -18.512 1.00 25.77  ? 346 LEU B HB3  1 
ATOM   140   H HG   . LEU A 1 9   ? -27.259 12.255  -20.576 1.00 27.70  ? 346 LEU B HG   1 
ATOM   141   H HD11 . LEU A 1 9   ? -27.134 13.729  -22.387 1.00 32.22  ? 346 LEU B HD11 1 
ATOM   142   H HD12 . LEU A 1 9   ? -28.058 14.329  -21.265 1.00 32.22  ? 346 LEU B HD12 1 
ATOM   143   H HD13 . LEU A 1 9   ? -26.586 14.855  -21.436 1.00 32.22  ? 346 LEU B HD13 1 
ATOM   144   H HD21 . LEU A 1 9   ? -25.280 12.220  -21.796 1.00 27.68  ? 346 LEU B HD21 1 
ATOM   145   H HD22 . LEU A 1 9   ? -24.663 13.305  -20.839 1.00 27.68  ? 346 LEU B HD22 1 
ATOM   146   H HD23 . LEU A 1 9   ? -24.987 11.867  -20.292 1.00 27.68  ? 346 LEU B HD23 1 
ATOM   147   N N    . LEU A 1 10  ? -30.100 12.998  -19.525 1.00 19.83  ? 347 LEU B N    1 
ATOM   148   C CA   . LEU A 1 10  ? -31.035 11.925  -19.866 1.00 19.72  ? 347 LEU B CA   1 
ATOM   149   C C    . LEU A 1 10  ? -31.001 11.708  -21.370 1.00 25.33  ? 347 LEU B C    1 
ATOM   150   O O    . LEU A 1 10  ? -31.122 12.656  -22.151 1.00 23.28  ? 347 LEU B O    1 
ATOM   151   C CB   . LEU A 1 10  ? -32.466 12.288  -19.480 1.00 20.81  ? 347 LEU B CB   1 
ATOM   152   C CG   . LEU A 1 10  ? -32.923 12.184  -18.029 1.00 23.12  ? 347 LEU B CG   1 
ATOM   153   C CD1  . LEU A 1 10  ? -31.966 12.896  -17.086 1.00 30.00  ? 347 LEU B CD1  1 
ATOM   154   C CD2  . LEU A 1 10  ? -34.351 12.753  -17.887 1.00 21.73  ? 347 LEU B CD2  1 
ATOM   155   H H    . LEU A 1 10  ? -30.293 13.756  -19.882 1.00 23.79  ? 347 LEU B H    1 
ATOM   156   H HA   . LEU A 1 10  ? -30.778 11.095  -19.414 1.00 23.66  ? 347 LEU B HA   1 
ATOM   157   H HB2  . LEU A 1 10  ? -32.613 13.209  -19.748 1.00 24.97  ? 347 LEU B HB2  1 
ATOM   158   H HB3  . LEU A 1 10  ? -33.058 11.717  -19.995 1.00 24.97  ? 347 LEU B HB3  1 
ATOM   159   H HG   . LEU A 1 10  ? -32.949 11.248  -17.776 1.00 27.74  ? 347 LEU B HG   1 
ATOM   160   H HD11 . LEU A 1 10  ? -32.291 12.806  -16.187 1.00 36.00  ? 347 LEU B HD11 1 
ATOM   161   H HD12 . LEU A 1 10  ? -31.097 12.497  -17.162 1.00 36.00  ? 347 LEU B HD12 1 
ATOM   162   H HD13 . LEU A 1 10  ? -31.923 13.824  -17.327 1.00 36.00  ? 347 LEU B HD13 1 
ATOM   163   H HD21 . LEU A 1 10  ? -34.625 12.681  -16.970 1.00 26.07  ? 347 LEU B HD21 1 
ATOM   164   H HD22 . LEU A 1 10  ? -34.348 13.674  -18.157 1.00 26.07  ? 347 LEU B HD22 1 
ATOM   165   H HD23 . LEU A 1 10  ? -34.945 12.248  -18.447 1.00 26.07  ? 347 LEU B HD23 1 
ATOM   166   N N    . ILE A 1 11  ? -30.861 10.458  -21.776 1.00 21.71  ? 348 ILE B N    1 
ATOM   167   C CA   . ILE A 1 11  ? -30.786 10.107  -23.185 1.00 22.40  ? 348 ILE B CA   1 
ATOM   168   C C    . ILE A 1 11  ? -31.797 9.005   -23.467 1.00 27.85  ? 348 ILE B C    1 
ATOM   169   O O    . ILE A 1 11  ? -31.891 8.033   -22.708 1.00 24.94  ? 348 ILE B O    1 
ATOM   170   C CB   . ILE A 1 11  ? -29.356 9.641   -23.546 1.00 26.61  ? 348 ILE B CB   1 
ATOM   171   C CG1  . ILE A 1 11  ? -28.383 10.825  -23.473 1.00 18.26  ? 348 ILE B CG1  1 
ATOM   172   C CG2  . ILE A 1 11  ? -29.325 8.997   -24.923 1.00 22.95  ? 348 ILE B CG2  1 
ATOM   173   C CD1  . ILE A 1 11  ? -26.923 10.401  -23.579 1.00 21.18  ? 348 ILE B CD1  1 
ATOM   174   H H    . ILE A 1 11  ? -30.807 9.783   -21.247 1.00 26.05  ? 348 ILE B H    1 
ATOM   175   H HA   . ILE A 1 11  ? -31.010 10.888  -23.733 1.00 26.88  ? 348 ILE B HA   1 
ATOM   176   H HB   . ILE A 1 11  ? -29.078 8.978   -22.894 1.00 31.93  ? 348 ILE B HB   1 
ATOM   177   H HG12 . ILE A 1 11  ? -28.572 11.434  -24.204 1.00 21.92  ? 348 ILE B HG12 1 
ATOM   178   H HG13 . ILE A 1 11  ? -28.502 11.279  -22.624 1.00 21.92  ? 348 ILE B HG13 1 
ATOM   179   H HG21 . ILE A 1 11  ? -28.428 8.719   -25.118 1.00 27.54  ? 348 ILE B HG21 1 
ATOM   180   H HG22 . ILE A 1 11  ? -29.912 8.237   -24.926 1.00 27.54  ? 348 ILE B HG22 1 
ATOM   181   H HG23 . ILE A 1 11  ? -29.618 9.639   -25.574 1.00 27.54  ? 348 ILE B HG23 1 
ATOM   182   H HD11 . ILE A 1 11  ? -26.367 11.182  -23.527 1.00 25.42  ? 348 ILE B HD11 1 
ATOM   183   H HD12 . ILE A 1 11  ? -26.718 9.804   -22.856 1.00 25.42  ? 348 ILE B HD12 1 
ATOM   184   H HD13 . ILE A 1 11  ? -26.787 9.957   -24.419 1.00 25.42  ? 348 ILE B HD13 1 
ATOM   185   N N    . GLY A 1 12  ? -32.561 9.164   -24.550 1.00 22.44  ? 349 GLY B N    1 
ATOM   186   C CA   . GLY A 1 12  ? -33.564 8.190   -24.943 1.00 23.91  ? 349 GLY B CA   1 
ATOM   187   C C    . GLY A 1 12  ? -33.437 7.827   -26.416 1.00 30.15  ? 349 GLY B C    1 
ATOM   188   O O    . GLY A 1 12  ? -33.721 8.650   -27.289 1.00 24.22  ? 349 GLY B O    1 
ATOM   189   H H    . GLY A 1 12  ? -32.512 9.842   -25.078 1.00 26.93  ? 349 GLY B H    1 
ATOM   190   H HA2  . GLY A 1 12  ? -33.461 7.383   -24.415 1.00 28.69  ? 349 GLY B HA2  1 
ATOM   191   H HA3  . GLY A 1 12  ? -34.450 8.552   -24.788 1.00 28.69  ? 349 GLY B HA3  1 
ATOM   192   N N    . ASN A 1 13  ? -33.014 6.597   -26.693 1.00 25.29  ? 350 ASN B N    1 
ATOM   193   C CA   . ASN A 1 13  ? -32.804 6.141   -28.070 1.00 28.68  ? 350 ASN B CA   1 
ATOM   194   C C    . ASN A 1 13  ? -33.936 5.249   -28.542 1.00 29.40  ? 350 ASN B C    1 
ATOM   195   O O    . ASN A 1 13  ? -34.316 4.285   -27.861 1.00 27.84  ? 350 ASN B O    1 
ATOM   196   C CB   . ASN A 1 13  ? -31.479 5.382   -28.193 1.00 25.51  ? 350 ASN B CB   1 
ATOM   197   C CG   . ASN A 1 13  ? -30.277 6.301   -28.166 1.00 33.77  ? 350 ASN B CG   1 
ATOM   198   O OD1  . ASN A 1 13  ? -30.392 7.484   -28.477 1.00 28.06  ? 350 ASN B OD1  1 
ATOM   199   N ND2  . ASN A 1 13  ? -29.109 5.762   -27.793 1.00 23.87  ? 350 ASN B ND2  1 
ATOM   200   H H    . ASN A 1 13  ? -32.840 6.000   -26.099 1.00 30.35  ? 350 ASN B H    1 
ATOM   201   H HA   . ASN A 1 13  ? -32.764 6.921   -28.663 1.00 34.42  ? 350 ASN B HA   1 
ATOM   202   H HB2  . ASN A 1 13  ? -31.399 4.762   -27.452 1.00 30.62  ? 350 ASN B HB2  1 
ATOM   203   H HB3  . ASN A 1 13  ? -31.468 4.898   -29.034 1.00 30.62  ? 350 ASN B HB3  1 
ATOM   204   H HD21 . ASN A 1 13  ? -29.068 4.929   -27.583 1.00 28.64  ? 350 ASN B HD21 1 
ATOM   205   H HD22 . ASN A 1 13  ? -28.401 6.249   -27.763 1.00 28.64  ? 350 ASN B HD22 1 
ATOM   206   N N    . MET A 1 14  ? -34.445 5.553   -29.730 1.00 21.99  ? 351 MET B N    1 
ATOM   207   C CA   . MET A 1 14  ? -35.640 4.903   -30.262 1.00 25.23  ? 351 MET B CA   1 
ATOM   208   C C    . MET A 1 14  ? -35.486 4.523   -31.719 1.00 30.25  ? 351 MET B C    1 
ATOM   209   O O    . MET A 1 14  ? -35.787 3.394   -32.107 1.00 32.36  ? 351 MET B O    1 
ATOM   210   C CB   . MET A 1 14  ? -36.824 5.859   -30.190 1.00 30.08  ? 351 MET B CB   1 
ATOM   211   C CG   . MET A 1 14  ? -37.330 6.116   -28.810 1.00 43.54  ? 351 MET B CG   1 
ATOM   212   S SD   . MET A 1 14  ? -38.534 7.449   -28.854 1.00 35.10  ? 351 MET B SD   1 
ATOM   213   C CE   . MET A 1 14  ? -39.545 6.975   -30.254 1.00 40.22  ? 351 MET B CE   1 
ATOM   214   H H    . MET A 1 14  ? -34.110 6.143   -30.258 1.00 26.39  ? 351 MET B H    1 
ATOM   215   H HA   . MET A 1 14  ? -35.847 4.106   -29.731 1.00 30.28  ? 351 MET B HA   1 
ATOM   216   H HB2  . MET A 1 14  ? -36.558 6.712   -30.569 1.00 36.10  ? 351 MET B HB2  1 
ATOM   217   H HB3  . MET A 1 14  ? -37.556 5.486   -30.707 1.00 36.10  ? 351 MET B HB3  1 
ATOM   218   H HG2  . MET A 1 14  ? -37.762 5.318   -28.467 1.00 52.25  ? 351 MET B HG2  1 
ATOM   219   H HG3  . MET A 1 14  ? -36.594 6.381   -28.237 1.00 52.25  ? 351 MET B HG3  1 
ATOM   220   H HE1  . MET A 1 14  ? -40.237 7.629   -30.374 1.00 48.27  ? 351 MET B HE1  1 
ATOM   221   H HE2  . MET A 1 14  ? -38.993 6.933   -31.038 1.00 48.27  ? 351 MET B HE2  1 
ATOM   222   H HE3  . MET A 1 14  ? -39.934 6.115   -30.080 1.00 48.27  ? 351 MET B HE3  1 
ATOM   223   N N    . ASN A 1 15  ? -35.056 5.493   -32.523 1.00 30.34  ? 352 ASN B N    1 
ATOM   224   C CA   . ASN A 1 15  ? -35.013 5.351   -33.975 1.00 33.46  ? 352 ASN B CA   1 
ATOM   225   C C    . ASN A 1 15  ? -33.759 4.620   -34.420 1.00 36.97  ? 352 ASN B C    1 
ATOM   226   O O    . ASN A 1 15  ? -32.903 5.204   -35.089 1.00 33.69  ? 352 ASN B O    1 
ATOM   227   C CB   . ASN A 1 15  ? -35.061 6.733   -34.644 1.00 33.43  ? 352 ASN B CB   1 
ATOM   228   C CG   . ASN A 1 15  ? -35.340 6.651   -36.140 1.00 51.38  ? 352 ASN B CG   1 
ATOM   229   O OD1  . ASN A 1 15  ? -35.853 5.643   -36.626 1.00 52.06  ? 352 ASN B OD1  1 
ATOM   230   N ND2  . ASN A 1 15  ? -35.009 7.719   -36.877 1.00 41.27  ? 352 ASN B ND2  1 
ATOM   231   H H    . ASN A 1 15  ? -34.778 6.258   -32.245 1.00 36.40  ? 352 ASN B H    1 
ATOM   232   H HA   . ASN A 1 15  ? -35.792 4.837   -34.273 1.00 40.16  ? 352 ASN B HA   1 
ATOM   233   H HB2  . ASN A 1 15  ? -35.767 7.257   -34.236 1.00 40.11  ? 352 ASN B HB2  1 
ATOM   234   H HB3  . ASN A 1 15  ? -34.206 7.174   -34.522 1.00 40.11  ? 352 ASN B HB3  1 
ATOM   235   H HD21 . ASN A 1 15  ? -34.658 8.408   -36.501 1.00 49.52  ? 352 ASN B HD21 1 
ATOM   236   H HD22 . ASN A 1 15  ? -35.149 7.716   -37.725 1.00 49.52  ? 352 ASN B HD22 1 
ATOM   237   N N    . TYR A 1 16  ? -33.654 3.346   -34.046 1.00 26.48  ? 353 TYR B N    1 
ATOM   238   C CA   . TYR A 1 16  ? -32.495 2.544   -34.405 1.00 27.91  ? 353 TYR B CA   1 
ATOM   239   C C    . TYR A 1 16  ? -32.529 2.197   -35.880 1.00 33.91  ? 353 TYR B C    1 
ATOM   240   O O    . TYR A 1 16  ? -33.549 1.766   -36.405 1.00 32.91  ? 353 TYR B O    1 
ATOM   241   C CB   . TYR A 1 16  ? -32.427 1.267   -33.560 1.00 25.08  ? 353 TYR B CB   1 
ATOM   242   C CG   . TYR A 1 16  ? -31.980 1.535   -32.137 1.00 27.04  ? 353 TYR B CG   1 
ATOM   243   C CD1  . TYR A 1 16  ? -32.894 1.930   -31.159 1.00 28.11  ? 353 TYR B CD1  1 
ATOM   244   C CD2  . TYR A 1 16  ? -30.646 1.409   -31.777 1.00 35.05  ? 353 TYR B CD2  1 
ATOM   245   C CE1  . TYR A 1 16  ? -32.484 2.186   -29.853 1.00 29.26  ? 353 TYR B CE1  1 
ATOM   246   C CE2  . TYR A 1 16  ? -30.224 1.655   -30.478 1.00 28.45  ? 353 TYR B CE2  1 
ATOM   247   C CZ   . TYR A 1 16  ? -31.143 2.048   -29.521 1.00 29.91  ? 353 TYR B CZ   1 
ATOM   248   O OH   . TYR A 1 16  ? -30.710 2.297   -28.234 1.00 24.08  ? 353 TYR B OH   1 
ATOM   249   H H    . TYR A 1 16  ? -34.243 2.925   -33.582 1.00 31.78  ? 353 TYR B H    1 
ATOM   250   H HA   . TYR A 1 16  ? -31.682 3.063   -34.235 1.00 33.50  ? 353 TYR B HA   1 
ATOM   251   H HB2  . TYR A 1 16  ? -33.307 0.861   -33.527 1.00 30.10  ? 353 TYR B HB2  1 
ATOM   252   H HB3  . TYR A 1 16  ? -31.793 0.654   -33.963 1.00 30.10  ? 353 TYR B HB3  1 
ATOM   253   H HD1  . TYR A 1 16  ? -33.792 2.025   -31.383 1.00 33.73  ? 353 TYR B HD1  1 
ATOM   254   H HD2  . TYR A 1 16  ? -30.023 1.147   -32.416 1.00 42.06  ? 353 TYR B HD2  1 
ATOM   255   H HE1  . TYR A 1 16  ? -33.102 2.448   -29.210 1.00 35.11  ? 353 TYR B HE1  1 
ATOM   256   H HE2  . TYR A 1 16  ? -29.326 1.565   -30.255 1.00 34.14  ? 353 TYR B HE2  1 
ATOM   257   H HH   . TYR A 1 16  ? -30.156 2.901   -28.237 1.00 28.90  ? 353 TYR B HH   1 
ATOM   258   N N    . ARG A 1 17  ? -31.393 2.360   -36.538 1.00 28.45  ? 354 ARG B N    1 
ATOM   259   C CA   . ARG A 1 17  ? -31.325 2.149   -37.978 1.00 38.20  ? 354 ARG B CA   1 
ATOM   260   C C    . ARG A 1 17  ? -31.280 0.665   -38.329 1.00 42.50  ? 354 ARG B C    1 
ATOM   261   O O    . ARG A 1 17  ? -31.882 0.245   -39.311 1.00 40.04  ? 354 ARG B O    1 
ATOM   262   C CB   . ARG A 1 17  ? -30.112 2.878   -38.551 1.00 48.61  ? 354 ARG B CB   1 
ATOM   263   C CG   . ARG A 1 17  ? -30.108 4.367   -38.231 1.00 56.38  ? 354 ARG B CG   1 
ATOM   264   C CD   . ARG A 1 17  ? -28.797 5.031   -38.626 1.00 76.15  ? 354 ARG B CD   1 
ATOM   265   N NE   . ARG A 1 17  ? -28.762 6.442   -38.242 1.00 79.34  ? 354 ARG B NE   1 
ATOM   266   C CZ   . ARG A 1 17  ? -27.706 7.234   -38.398 1.00 76.78  ? 354 ARG B CZ   1 
ATOM   267   N NH1  . ARG A 1 17  ? -26.588 6.759   -38.929 1.00 61.37  ? 354 ARG B NH1  1 
ATOM   268   N NH2  . ARG A 1 17  ? -27.767 8.505   -38.021 1.00 84.70  ? 354 ARG B NH2  1 
ATOM   269   H H    . ARG A 1 17  ? -30.648 2.593   -36.178 1.00 34.14  ? 354 ARG B H    1 
ATOM   270   H HA   . ARG A 1 17  ? -32.128 2.530   -38.392 1.00 45.84  ? 354 ARG B HA   1 
ATOM   271   H HB2  . ARG A 1 17  ? -29.306 2.490   -38.178 1.00 58.33  ? 354 ARG B HB2  1 
ATOM   272   H HB3  . ARG A 1 17  ? -30.112 2.779   -39.516 1.00 58.33  ? 354 ARG B HB3  1 
ATOM   273   H HG2  . ARG A 1 17  ? -30.825 4.799   -38.720 1.00 67.65  ? 354 ARG B HG2  1 
ATOM   274   H HG3  . ARG A 1 17  ? -30.233 4.488   -37.277 1.00 67.65  ? 354 ARG B HG3  1 
ATOM   275   H HD2  . ARG A 1 17  ? -28.064 4.578   -38.181 1.00 91.38  ? 354 ARG B HD2  1 
ATOM   276   H HD3  . ARG A 1 17  ? -28.690 4.977   -39.588 1.00 91.38  ? 354 ARG B HD3  1 
ATOM   277   H HE   . ARG A 1 17  ? -29.471 6.781   -37.893 1.00 95.21  ? 354 ARG B HE   1 
ATOM   278   H HH11 . ARG A 1 17  ? -26.545 5.936   -39.176 1.00 73.64  ? 354 ARG B HH11 1 
ATOM   279   H HH12 . ARG A 1 17  ? -25.907 7.273   -39.029 1.00 73.64  ? 354 ARG B HH12 1 
ATOM   280   H HH21 . ARG A 1 17  ? -28.491 8.816   -37.675 1.00 101.64 ? 354 ARG B HH21 1 
ATOM   281   H HH22 . ARG A 1 17  ? -27.083 9.017   -38.121 1.00 101.64 ? 354 ARG B HH22 1 
ATOM   282   N N    . GLU A 1 18  ? -30.594 -0.127  -37.506 1.00 35.99  ? 355 GLU B N    1 
ATOM   283   C CA   . GLU A 1 18  ? -30.370 -1.545  -37.795 1.00 41.19  ? 355 GLU B CA   1 
ATOM   284   C C    . GLU A 1 18  ? -30.920 -2.476  -36.713 1.00 38.05  ? 355 GLU B C    1 
ATOM   285   O O    . GLU A 1 18  ? -30.640 -3.673  -36.716 1.00 42.41  ? 355 GLU B O    1 
ATOM   286   C CB   . GLU A 1 18  ? -28.873 -1.809  -37.949 1.00 53.53  ? 355 GLU B CB   1 
ATOM   287   C CG   . GLU A 1 18  ? -28.217 -1.018  -39.065 1.00 58.45  ? 355 GLU B CG   1 
ATOM   288   C CD   . GLU A 1 18  ? -28.658 -1.472  -40.437 1.00 64.57  ? 355 GLU B CD   1 
ATOM   289   O OE1  . GLU A 1 18  ? -29.060 -2.646  -40.581 1.00 67.67  ? 355 GLU B OE1  1 
ATOM   290   O OE2  . GLU A 1 18  ? -28.603 -0.652  -41.375 1.00 79.50  ? 355 GLU B OE2  1 
ATOM   291   H H    . GLU A 1 18  ? -30.245 0.134   -36.765 1.00 43.19  ? 355 GLU B H    1 
ATOM   292   H HA   . GLU A 1 18  ? -30.808 -1.772  -38.642 1.00 49.43  ? 355 GLU B HA   1 
ATOM   293   H HB2  . GLU A 1 18  ? -28.428 -1.574  -37.120 1.00 64.24  ? 355 GLU B HB2  1 
ATOM   294   H HB3  . GLU A 1 18  ? -28.740 -2.751  -38.138 1.00 64.24  ? 355 GLU B HB3  1 
ATOM   295   H HG2  . GLU A 1 18  ? -28.451 -0.081  -38.969 1.00 70.14  ? 355 GLU B HG2  1 
ATOM   296   H HG3  . GLU A 1 18  ? -27.255 -1.127  -39.007 1.00 70.14  ? 355 GLU B HG3  1 
ATOM   297   N N    . HIS A 1 19  ? -31.693 -1.930  -35.785 1.00 34.19  ? 356 HIS B N    1 
ATOM   298   C CA   . HIS A 1 19  ? -32.257 -2.732  -34.696 1.00 36.52  ? 356 HIS B CA   1 
ATOM   299   C C    . HIS A 1 19  ? -33.707 -2.336  -34.440 1.00 38.07  ? 356 HIS B C    1 
ATOM   300   O O    . HIS A 1 19  ? -34.146 -1.263  -34.876 1.00 31.47  ? 356 HIS B O    1 
ATOM   301   C CB   . HIS A 1 19  ? -31.416 -2.578  -33.424 1.00 36.49  ? 356 HIS B CB   1 
ATOM   302   C CG   . HIS A 1 19  ? -29.994 -3.012  -33.599 1.00 43.18  ? 356 HIS B CG   1 
ATOM   303   N ND1  . HIS A 1 19  ? -28.957 -2.118  -33.764 1.00 43.03  ? 356 HIS B ND1  1 
ATOM   304   C CD2  . HIS A 1 19  ? -29.443 -4.244  -33.679 1.00 38.59  ? 356 HIS B CD2  1 
ATOM   305   C CE1  . HIS A 1 19  ? -27.827 -2.782  -33.922 1.00 38.35  ? 356 HIS B CE1  1 
ATOM   306   N NE2  . HIS A 1 19  ? -28.095 -4.074  -33.881 1.00 41.56  ? 356 HIS B NE2  1 
ATOM   307   H H    . HIS A 1 19  ? -31.910 -1.098  -35.758 1.00 41.03  ? 356 HIS B H    1 
ATOM   308   H HA   . HIS A 1 19  ? -32.243 -3.677  -34.956 1.00 43.83  ? 356 HIS B HA   1 
ATOM   309   H HB2  . HIS A 1 19  ? -31.413 -1.645  -33.160 1.00 43.79  ? 356 HIS B HB2  1 
ATOM   310   H HB3  . HIS A 1 19  ? -31.808 -3.119  -32.720 1.00 43.79  ? 356 HIS B HB3  1 
ATOM   311   H HD2  . HIS A 1 19  ? -29.893 -5.056  -33.612 1.00 46.31  ? 356 HIS B HD2  1 
ATOM   312   H HE1  . HIS A 1 19  ? -26.986 -2.404  -34.043 1.00 46.02  ? 356 HIS B HE1  1 
ATOM   313   N N    . PRO A 1 20  ? -34.455 -3.207  -33.740 1.00 32.51  ? 357 PRO B N    1 
ATOM   314   C CA   . PRO A 1 20  ? -35.872 -2.963  -33.468 1.00 35.08  ? 357 PRO B CA   1 
ATOM   315   C C    . PRO A 1 20  ? -36.055 -1.590  -32.849 1.00 38.06  ? 357 PRO B C    1 
ATOM   316   O O    . PRO A 1 20  ? -35.325 -1.219  -31.925 1.00 35.65  ? 357 PRO B O    1 
ATOM   317   C CB   . PRO A 1 20  ? -36.238 -4.066  -32.472 1.00 35.86  ? 357 PRO B CB   1 
ATOM   318   C CG   . PRO A 1 20  ? -35.228 -5.144  -32.717 1.00 40.36  ? 357 PRO B CG   1 
ATOM   319   C CD   . PRO A 1 20  ? -33.968 -4.427  -33.069 1.00 33.33  ? 357 PRO B CD   1 
ATOM   320   H HA   . PRO A 1 20  ? -36.411 -3.046  -34.282 1.00 42.10  ? 357 PRO B HA   1 
ATOM   321   H HB2  . PRO A 1 20  ? -36.168 -3.727  -31.566 1.00 43.04  ? 357 PRO B HB2  1 
ATOM   322   H HB3  . PRO A 1 20  ? -37.136 -4.387  -32.652 1.00 43.04  ? 357 PRO B HB3  1 
ATOM   323   H HG2  . PRO A 1 20  ? -35.110 -5.671  -31.911 1.00 48.43  ? 357 PRO B HG2  1 
ATOM   324   H HG3  . PRO A 1 20  ? -35.521 -5.704  -33.453 1.00 48.43  ? 357 PRO B HG3  1 
ATOM   325   H HD2  . PRO A 1 20  ? -33.473 -4.198  -32.266 1.00 39.99  ? 357 PRO B HD2  1 
ATOM   326   H HD3  . PRO A 1 20  ? -33.433 -4.959  -33.678 1.00 39.99  ? 357 PRO B HD3  1 
ATOM   327   N N    . LYS A 1 21  ? -37.011 -0.831  -33.366 1.00 36.62  ? 358 LYS B N    1 
ATOM   328   C CA   . LYS A 1 21  ? -37.237 0.511   -32.865 1.00 37.50  ? 358 LYS B CA   1 
ATOM   329   C C    . LYS A 1 21  ? -38.019 0.456   -31.553 1.00 33.57  ? 358 LYS B C    1 
ATOM   330   O O    . LYS A 1 21  ? -38.744 -0.505  -31.286 1.00 29.12  ? 358 LYS B O    1 
ATOM   331   C CB   . LYS A 1 21  ? -37.975 1.351   -33.901 1.00 33.47  ? 358 LYS B CB   1 
ATOM   332   C CG   . LYS A 1 21  ? -37.217 1.528   -35.227 1.00 41.32  ? 358 LYS B CG   1 
ATOM   333   C CD   . LYS A 1 21  ? -37.934 2.538   -36.125 1.00 45.45  ? 358 LYS B CD   1 
ATOM   334   C CE   . LYS A 1 21  ? -37.384 2.543   -37.544 1.00 52.70  ? 358 LYS B CE   1 
ATOM   335   N NZ   . LYS A 1 21  ? -35.921 2.774   -37.577 1.00 50.90  ? 358 LYS B NZ   1 
ATOM   336   H H    . LYS A 1 21  ? -37.537 -1.069  -34.003 1.00 43.95  ? 358 LYS B H    1 
ATOM   337   H HA   . LYS A 1 21  ? -36.372 0.937   -32.687 1.00 45.00  ? 358 LYS B HA   1 
ATOM   338   H HB2  . LYS A 1 21  ? -38.823 0.924   -34.100 1.00 40.17  ? 358 LYS B HB2  1 
ATOM   339   H HB3  . LYS A 1 21  ? -38.132 2.234   -33.531 1.00 40.17  ? 358 LYS B HB3  1 
ATOM   340   H HG2  . LYS A 1 21  ? -36.323 1.857   -35.047 1.00 49.59  ? 358 LYS B HG2  1 
ATOM   341   H HG3  . LYS A 1 21  ? -37.178 0.677   -35.692 1.00 49.59  ? 358 LYS B HG3  1 
ATOM   342   H HD2  . LYS A 1 21  ? -38.877 2.311   -36.168 1.00 54.53  ? 358 LYS B HD2  1 
ATOM   343   H HD3  . LYS A 1 21  ? -37.822 3.427   -35.755 1.00 54.53  ? 358 LYS B HD3  1 
ATOM   344   H HE2  . LYS A 1 21  ? -37.564 1.684   -37.958 1.00 63.24  ? 358 LYS B HE2  1 
ATOM   345   H HE3  . LYS A 1 21  ? -37.813 3.252   -38.049 1.00 63.24  ? 358 LYS B HE3  1 
ATOM   346   H HZ1  . LYS A 1 21  ? -35.632 2.771   -38.419 1.00 61.08  ? 358 LYS B HZ1  1 
ATOM   347   H HZ2  . LYS A 1 21  ? -35.729 3.560   -37.208 1.00 61.08  ? 358 LYS B HZ2  1 
ATOM   348   H HZ3  . LYS A 1 21  ? -35.502 2.132   -37.125 1.00 61.08  ? 358 LYS B HZ3  1 
ATOM   349   N N    . LEU A 1 22  ? -37.845 1.484   -30.731 1.00 26.86  ? 359 LEU B N    1 
ATOM   350   C CA   . LEU A 1 22  ? -38.561 1.587   -29.464 1.00 22.93  ? 359 LEU B CA   1 
ATOM   351   C C    . LEU A 1 22  ? -39.496 2.783   -29.538 1.00 30.54  ? 359 LEU B C    1 
ATOM   352   O O    . LEU A 1 22  ? -39.425 3.563   -30.489 1.00 30.15  ? 359 LEU B O    1 
ATOM   353   C CB   . LEU A 1 22  ? -37.579 1.745   -28.303 1.00 23.16  ? 359 LEU B CB   1 
ATOM   354   C CG   . LEU A 1 22  ? -36.572 0.596   -28.171 1.00 26.96  ? 359 LEU B CG   1 
ATOM   355   C CD1  . LEU A 1 22  ? -35.471 0.935   -27.169 1.00 22.57  ? 359 LEU B CD1  1 
ATOM   356   C CD2  . LEU A 1 22  ? -37.301 -0.667  -27.777 1.00 33.37  ? 359 LEU B CD2  1 
ATOM   357   H H    . LEU A 1 22  ? -37.312 2.142   -30.885 1.00 32.23  ? 359 LEU B H    1 
ATOM   358   H HA   . LEU A 1 22  ? -39.094 0.777   -29.318 1.00 27.51  ? 359 LEU B HA   1 
ATOM   359   H HB2  . LEU A 1 22  ? -37.077 2.566   -28.430 1.00 27.79  ? 359 LEU B HB2  1 
ATOM   360   H HB3  . LEU A 1 22  ? -38.082 1.794   -27.475 1.00 27.79  ? 359 LEU B HB3  1 
ATOM   361   H HG   . LEU A 1 22  ? -36.154 0.444   -29.033 1.00 32.35  ? 359 LEU B HG   1 
ATOM   362   H HD11 . LEU A 1 22  ? -34.862 0.196   -27.113 1.00 27.09  ? 359 LEU B HD11 1 
ATOM   363   H HD12 . LEU A 1 22  ? -35.007 1.720   -27.468 1.00 27.09  ? 359 LEU B HD12 1 
ATOM   364   H HD13 . LEU A 1 22  ? -35.870 1.097   -26.310 1.00 27.09  ? 359 LEU B HD13 1 
ATOM   365   H HD21 . LEU A 1 22  ? -36.665 -1.382  -27.696 1.00 40.05  ? 359 LEU B HD21 1 
ATOM   366   H HD22 . LEU A 1 22  ? -37.741 -0.524  -26.936 1.00 40.05  ? 359 LEU B HD22 1 
ATOM   367   H HD23 . LEU A 1 22  ? -37.947 -0.879  -28.454 1.00 40.05  ? 359 LEU B HD23 1 
ATOM   368   N N    . LYS A 1 23  ? -40.355 2.931   -28.533 1.00 26.87  ? 360 LYS B N    1 
ATOM   369   C CA   . LYS A 1 23  ? -41.380 3.980   -28.534 1.00 29.09  ? 360 LYS B CA   1 
ATOM   370   C C    . LYS A 1 23  ? -41.433 4.769   -27.227 1.00 29.41  ? 360 LYS B C    1 
ATOM   371   O O    . LYS A 1 23  ? -41.547 5.994   -27.236 1.00 26.40  ? 360 LYS B O    1 
ATOM   372   C CB   . LYS A 1 23  ? -42.755 3.365   -28.805 1.00 44.34  ? 360 LYS B CB   1 
ATOM   373   C CG   . LYS A 1 23  ? -43.859 4.394   -28.997 1.00 70.72  ? 360 LYS B CG   1 
ATOM   374   C CD   . LYS A 1 23  ? -43.661 5.203   -30.274 1.00 77.75  ? 360 LYS B CD   1 
ATOM   375   C CE   . LYS A 1 23  ? -44.583 6.415   -30.321 1.00 85.29  ? 360 LYS B CE   1 
ATOM   376   N NZ   . LYS A 1 23  ? -46.025 6.044   -30.324 1.00 89.99  ? 360 LYS B NZ   1 
ATOM   377   H H    . LYS A 1 23  ? -40.368 2.433   -27.832 1.00 32.24  ? 360 LYS B H    1 
ATOM   378   H HA   . LYS A 1 23  ? -41.185 4.611   -29.258 1.00 34.90  ? 360 LYS B HA   1 
ATOM   379   H HB2  . LYS A 1 23  ? -42.705 2.829   -29.612 1.00 53.21  ? 360 LYS B HB2  1 
ATOM   380   H HB3  . LYS A 1 23  ? -43.000 2.803   -28.053 1.00 53.21  ? 360 LYS B HB3  1 
ATOM   381   H HG2  . LYS A 1 23  ? -44.714 3.939   -29.057 1.00 84.87  ? 360 LYS B HG2  1 
ATOM   382   H HG3  . LYS A 1 23  ? -43.858 5.008   -28.246 1.00 84.87  ? 360 LYS B HG3  1 
ATOM   383   H HD2  . LYS A 1 23  ? -42.744 5.518   -30.313 1.00 93.30  ? 360 LYS B HD2  1 
ATOM   384   H HD3  . LYS A 1 23  ? -43.856 4.643   -31.041 1.00 93.30  ? 360 LYS B HD3  1 
ATOM   385   H HE2  . LYS A 1 23  ? -44.418 6.969   -29.542 1.00 102.34 ? 360 LYS B HE2  1 
ATOM   386   H HE3  . LYS A 1 23  ? -44.402 6.919   -31.130 1.00 102.34 ? 360 LYS B HE3  1 
ATOM   387   H HZ1  . LYS A 1 23  ? -46.528 6.778   -30.353 1.00 107.98 ? 360 LYS B HZ1  1 
ATOM   388   H HZ2  . LYS A 1 23  ? -46.208 5.541   -31.035 1.00 107.98 ? 360 LYS B HZ2  1 
ATOM   389   H HZ3  . LYS A 1 23  ? -46.223 5.586   -29.587 1.00 107.98 ? 360 LYS B HZ3  1 
ATOM   390   N N    . ALA A 1 24  ? -41.349 4.073   -26.100 1.00 29.70  ? 361 ALA B N    1 
ATOM   391   C CA   . ALA A 1 24  ? -41.535 4.724   -24.808 1.00 25.27  ? 361 ALA B CA   1 
ATOM   392   C C    . ALA A 1 24  ? -40.343 5.570   -24.324 1.00 24.03  ? 361 ALA B C    1 
ATOM   393   O O    . ALA A 1 24  ? -40.495 6.376   -23.406 1.00 29.95  ? 361 ALA B O    1 
ATOM   394   C CB   . ALA A 1 24  ? -41.926 3.695   -23.753 1.00 27.09  ? 361 ALA B CB   1 
ATOM   395   H H    . ALA A 1 24  ? -41.187 3.229   -26.054 1.00 35.64  ? 361 ALA B H    1 
ATOM   396   H HA   . ALA A 1 24  ? -42.293 5.338   -24.895 1.00 30.33  ? 361 ALA B HA   1 
ATOM   397   H HB1  . ALA A 1 24  ? -42.044 4.140   -22.910 1.00 32.51  ? 361 ALA B HB1  1 
ATOM   398   H HB2  . ALA A 1 24  ? -42.746 3.273   -24.018 1.00 32.51  ? 361 ALA B HB2  1 
ATOM   399   H HB3  . ALA A 1 24  ? -41.228 3.039   -23.682 1.00 32.51  ? 361 ALA B HB3  1 
ATOM   400   N N    . PRO A 1 25  ? -39.154 5.407   -24.926 1.00 20.25  ? 362 PRO B N    1 
ATOM   401   C CA   . PRO A 1 25  ? -38.093 6.255   -24.373 1.00 21.66  ? 362 PRO B CA   1 
ATOM   402   C C    . PRO A 1 25  ? -38.446 7.740   -24.437 1.00 23.66  ? 362 PRO B C    1 
ATOM   403   O O    . PRO A 1 25  ? -38.056 8.503   -23.565 1.00 22.94  ? 362 PRO B O    1 
ATOM   404   C CB   . PRO A 1 25  ? -36.893 5.940   -25.265 1.00 21.23  ? 362 PRO B CB   1 
ATOM   405   C CG   . PRO A 1 25  ? -37.106 4.494   -25.656 1.00 21.64  ? 362 PRO B CG   1 
ATOM   406   C CD   . PRO A 1 25  ? -38.620 4.369   -25.830 1.00 27.29  ? 362 PRO B CD   1 
ATOM   407   H HA   . PRO A 1 25  ? -37.893 6.001   -23.448 1.00 25.99  ? 362 PRO B HA   1 
ATOM   408   H HB2  . PRO A 1 25  ? -36.902 6.516   -26.046 1.00 25.47  ? 362 PRO B HB2  1 
ATOM   409   H HB3  . PRO A 1 25  ? -36.070 6.047   -24.763 1.00 25.47  ? 362 PRO B HB3  1 
ATOM   410   H HG2  . PRO A 1 25  ? -36.645 4.307   -26.489 1.00 25.97  ? 362 PRO B HG2  1 
ATOM   411   H HG3  . PRO A 1 25  ? -36.790 3.912   -24.947 1.00 25.97  ? 362 PRO B HG3  1 
ATOM   412   H HD2  . PRO A 1 25  ? -38.872 4.558   -26.748 1.00 32.75  ? 362 PRO B HD2  1 
ATOM   413   H HD3  . PRO A 1 25  ? -38.922 3.490   -25.552 1.00 32.75  ? 362 PRO B HD3  1 
ATOM   414   N N    . LEU A 1 26  ? -39.202 8.126   -25.454 1.00 23.73  ? 363 LEU B N    1 
ATOM   415   C CA   . LEU A 1 26  ? -39.600 9.511   -25.609 1.00 28.59  ? 363 LEU B CA   1 
ATOM   416   C C    . LEU A 1 26  ? -40.349 10.003  -24.366 1.00 30.83  ? 363 LEU B C    1 
ATOM   417   O O    . LEU A 1 26  ? -39.981 11.023  -23.758 1.00 28.52  ? 363 LEU B O    1 
ATOM   418   C CB   . LEU A 1 26  ? -40.471 9.658   -26.858 1.00 25.02  ? 363 LEU B CB   1 
ATOM   419   C CG   . LEU A 1 26  ? -40.827 11.116  -27.182 1.00 43.98  ? 363 LEU B CG   1 
ATOM   420   C CD1  . LEU A 1 26  ? -41.129 11.296  -28.671 1.00 44.22  ? 363 LEU B CD1  1 
ATOM   421   C CD2  . LEU A 1 26  ? -41.994 11.601  -26.332 1.00 48.50  ? 363 LEU B CD2  1 
ATOM   422   H H    . LEU A 1 26  ? -39.497 7.602   -26.069 1.00 28.48  ? 363 LEU B H    1 
ATOM   423   H HA   . LEU A 1 26  ? -38.800 10.066  -25.725 1.00 34.31  ? 363 LEU B HA   1 
ATOM   424   H HB2  . LEU A 1 26  ? -39.994 9.292   -27.619 1.00 30.02  ? 363 LEU B HB2  1 
ATOM   425   H HB3  . LEU A 1 26  ? -41.300 9.172   -26.723 1.00 30.02  ? 363 LEU B HB3  1 
ATOM   426   H HG   . LEU A 1 26  ? -40.062 11.673  -26.971 1.00 52.78  ? 363 LEU B HG   1 
ATOM   427   H HD11 . LEU A 1 26  ? -41.346 12.217  -28.836 1.00 53.07  ? 363 LEU B HD11 1 
ATOM   428   H HD12 . LEU A 1 26  ? -40.354 11.046  -29.179 1.00 53.07  ? 363 LEU B HD12 1 
ATOM   429   H HD13 . LEU A 1 26  ? -41.871 10.736  -28.909 1.00 53.07  ? 363 LEU B HD13 1 
ATOM   430   H HD21 . LEU A 1 26  ? -42.188 12.513  -26.560 1.00 58.20  ? 363 LEU B HD21 1 
ATOM   431   H HD22 . LEU A 1 26  ? -42.759 11.048  -26.509 1.00 58.20  ? 363 LEU B HD22 1 
ATOM   432   H HD23 . LEU A 1 26  ? -41.751 11.539  -25.405 1.00 58.20  ? 363 LEU B HD23 1 
ATOM   433   N N    . VAL A 1 27  ? -41.399 9.282   -23.990 1.00 23.21  ? 364 VAL B N    1 
ATOM   434   C CA   . VAL A 1 27  ? -42.235 9.688   -22.864 1.00 23.52  ? 364 VAL B CA   1 
ATOM   435   C C    . VAL A 1 27  ? -41.480 9.524   -21.540 1.00 26.38  ? 364 VAL B C    1 
ATOM   436   O O    . VAL A 1 27  ? -41.659 10.311  -20.609 1.00 26.59  ? 364 VAL B O    1 
ATOM   437   C CB   . VAL A 1 27  ? -43.566 8.892   -22.806 1.00 40.63  ? 364 VAL B CB   1 
ATOM   438   C CG1  . VAL A 1 27  ? -43.324 7.405   -22.948 1.00 46.38  ? 364 VAL B CG1  1 
ATOM   439   C CG2  . VAL A 1 27  ? -44.305 9.170   -21.499 1.00 37.28  ? 364 VAL B CG2  1 
ATOM   440   H H    . VAL A 1 27  ? -41.649 8.552   -24.370 1.00 27.86  ? 364 VAL B H    1 
ATOM   441   H HA   . VAL A 1 27  ? -42.459 10.636  -22.964 1.00 28.22  ? 364 VAL B HA   1 
ATOM   442   H HB   . VAL A 1 27  ? -44.142 9.177   -23.546 1.00 48.75  ? 364 VAL B HB   1 
ATOM   443   H HG11 . VAL A 1 27  ? -44.166 6.946   -22.908 1.00 55.66  ? 364 VAL B HG11 1 
ATOM   444   H HG12 . VAL A 1 27  ? -42.899 7.237   -23.792 1.00 55.66  ? 364 VAL B HG12 1 
ATOM   445   H HG13 . VAL A 1 27  ? -42.756 7.112   -22.231 1.00 55.66  ? 364 VAL B HG13 1 
ATOM   446   H HG21 . VAL A 1 27  ? -45.122 8.667   -21.490 1.00 44.74  ? 364 VAL B HG21 1 
ATOM   447   H HG22 . VAL A 1 27  ? -43.748 8.905   -20.764 1.00 44.74  ? 364 VAL B HG22 1 
ATOM   448   H HG23 . VAL A 1 27  ? -44.497 10.109  -21.443 1.00 44.74  ? 364 VAL B HG23 1 
ATOM   449   N N    . ASP A 1 28  ? -40.631 8.505   -21.458 1.00 17.78  ? 365 ASP B N    1 
ATOM   450   C CA   . ASP A 1 28  ? -39.894 8.242   -20.217 1.00 25.26  ? 365 ASP B CA   1 
ATOM   451   C C    . ASP A 1 28  ? -38.938 9.401   -19.937 1.00 23.57  ? 365 ASP B C    1 
ATOM   452   O O    . ASP A 1 28  ? -38.801 9.862   -18.811 1.00 25.55  ? 365 ASP B O    1 
ATOM   453   C CB   . ASP A 1 28  ? -39.090 6.943   -20.322 1.00 24.11  ? 365 ASP B CB   1 
ATOM   454   C CG   . ASP A 1 28  ? -39.957 5.688   -20.233 1.00 24.94  ? 365 ASP B CG   1 
ATOM   455   O OD1  . ASP A 1 28  ? -41.152 5.768   -19.859 1.00 25.30  ? 365 ASP B OD1  1 
ATOM   456   O OD2  . ASP A 1 28  ? -39.424 4.600   -20.533 1.00 28.93  ? 365 ASP B OD2  1 
ATOM   457   H H    . ASP A 1 28  ? -40.461 7.955   -22.097 1.00 21.34  ? 365 ASP B H    1 
ATOM   458   H HA   . ASP A 1 28  ? -40.523 8.164   -19.469 1.00 30.31  ? 365 ASP B HA   1 
ATOM   459   H HB2  . ASP A 1 28  ? -38.628 6.927   -21.176 1.00 28.93  ? 365 ASP B HB2  1 
ATOM   460   H HB3  . ASP A 1 28  ? -38.445 6.913   -19.598 1.00 28.93  ? 365 ASP B HB3  1 
ATOM   461   N N    . VAL A 1 29  ? -38.265 9.860   -20.980 1.00 22.43  ? 366 VAL B N    1 
ATOM   462   C CA   . VAL A 1 29  ? -37.288 10.919  -20.831 1.00 17.67  ? 366 VAL B CA   1 
ATOM   463   C C    . VAL A 1 29  ? -38.031 12.210  -20.525 1.00 25.00  ? 366 VAL B C    1 
ATOM   464   O O    . VAL A 1 29  ? -37.670 12.942  -19.613 1.00 20.22  ? 366 VAL B O    1 
ATOM   465   C CB   . VAL A 1 29  ? -36.415 11.062  -22.090 1.00 24.48  ? 366 VAL B CB   1 
ATOM   466   C CG1  . VAL A 1 29  ? -35.604 12.344  -22.038 1.00 19.58  ? 366 VAL B CG1  1 
ATOM   467   C CG2  . VAL A 1 29  ? -35.482 9.847   -22.207 1.00 30.93  ? 366 VAL B CG2  1 
ATOM   468   H H    . VAL A 1 29  ? -38.357 9.573   -21.786 1.00 26.91  ? 366 VAL B H    1 
ATOM   469   H HA   . VAL A 1 29  ? -36.703 10.715  -20.073 1.00 21.21  ? 366 VAL B HA   1 
ATOM   470   H HB   . VAL A 1 29  ? -36.988 11.090  -22.884 1.00 29.38  ? 366 VAL B HB   1 
ATOM   471   H HG11 . VAL A 1 29  ? -35.069 12.407  -22.833 1.00 23.50  ? 366 VAL B HG11 1 
ATOM   472   H HG12 . VAL A 1 29  ? -36.204 13.091  -21.987 1.00 23.50  ? 366 VAL B HG12 1 
ATOM   473   H HG13 . VAL A 1 29  ? -35.038 12.324  -21.263 1.00 23.50  ? 366 VAL B HG13 1 
ATOM   474   H HG21 . VAL A 1 29  ? -34.941 9.944   -22.994 1.00 37.11  ? 366 VAL B HG21 1 
ATOM   475   H HG22 . VAL A 1 29  ? -34.923 9.806   -21.428 1.00 37.11  ? 366 VAL B HG22 1 
ATOM   476   H HG23 . VAL A 1 29  ? -36.014 9.050   -22.271 1.00 37.11  ? 366 VAL B HG23 1 
ATOM   477   N N    . TYR A 1 30  ? -39.092 12.469  -21.272 1.00 22.02  ? 367 TYR B N    1 
ATOM   478   C CA   . TYR A 1 30  ? -39.838 13.700  -21.060 1.00 22.70  ? 367 TYR B CA   1 
ATOM   479   C C    . TYR A 1 30  ? -40.278 13.826  -19.605 1.00 27.88  ? 367 TYR B C    1 
ATOM   480   O O    . TYR A 1 30  ? -40.117 14.883  -18.984 1.00 26.88  ? 367 TYR B O    1 
ATOM   481   C CB   . TYR A 1 30  ? -41.064 13.753  -21.956 1.00 24.30  ? 367 TYR B CB   1 
ATOM   482   C CG   . TYR A 1 30  ? -41.700 15.122  -21.941 1.00 27.70  ? 367 TYR B CG   1 
ATOM   483   C CD1  . TYR A 1 30  ? -41.298 16.098  -22.838 1.00 32.57  ? 367 TYR B CD1  1 
ATOM   484   C CD2  . TYR A 1 30  ? -42.680 15.443  -21.007 1.00 37.61  ? 367 TYR B CD2  1 
ATOM   485   C CE1  . TYR A 1 30  ? -41.873 17.366  -22.828 1.00 35.06  ? 367 TYR B CE1  1 
ATOM   486   C CE2  . TYR A 1 30  ? -43.259 16.703  -20.986 1.00 46.77  ? 367 TYR B CE2  1 
ATOM   487   C CZ   . TYR A 1 30  ? -42.848 17.660  -21.900 1.00 45.22  ? 367 TYR B CZ   1 
ATOM   488   O OH   . TYR A 1 30  ? -43.413 18.914  -21.891 1.00 52.35  ? 367 TYR B OH   1 
ATOM   489   H H    . TYR A 1 30  ? -39.398 11.961  -21.895 1.00 26.43  ? 367 TYR B H    1 
ATOM   490   H HA   . TYR A 1 30  ? -39.266 14.466  -21.276 1.00 27.24  ? 367 TYR B HA   1 
ATOM   491   H HB2  . TYR A 1 30  ? -40.804 13.549  -22.868 1.00 29.16  ? 367 TYR B HB2  1 
ATOM   492   H HB3  . TYR A 1 30  ? -41.719 13.110  -21.642 1.00 29.16  ? 367 TYR B HB3  1 
ATOM   493   H HD1  . TYR A 1 30  ? -40.641 15.899  -23.466 1.00 39.08  ? 367 TYR B HD1  1 
ATOM   494   H HD2  . TYR A 1 30  ? -42.958 14.801  -20.395 1.00 45.14  ? 367 TYR B HD2  1 
ATOM   495   H HE1  . TYR A 1 30  ? -41.598 18.010  -23.440 1.00 42.07  ? 367 TYR B HE1  1 
ATOM   496   H HE2  . TYR A 1 30  ? -43.918 16.905  -20.362 1.00 56.13  ? 367 TYR B HE2  1 
ATOM   497   H HH   . TYR A 1 30  ? -43.284 19.275  -21.166 1.00 62.82  ? 367 TYR B HH   1 
ATOM   498   N N    . GLU A 1 31  ? -40.822 12.744  -19.053 1.00 26.47  ? 368 GLU B N    1 
ATOM   499   C CA   . GLU A 1 31  ? -41.422 12.823  -17.735 1.00 29.54  ? 368 GLU B CA   1 
ATOM   500   C C    . GLU A 1 31  ? -40.359 12.854  -16.642 1.00 30.49  ? 368 GLU B C    1 
ATOM   501   O O    . GLU A 1 31  ? -40.495 13.597  -15.686 1.00 23.45  ? 368 GLU B O    1 
ATOM   502   C CB   . GLU A 1 31  ? -42.423 11.689  -17.526 1.00 28.14  ? 368 GLU B CB   1 
ATOM   503   C CG   . GLU A 1 31  ? -43.635 11.792  -18.453 1.00 34.87  ? 368 GLU B CG   1 
ATOM   504   C CD   . GLU A 1 31  ? -44.702 10.741  -18.176 1.00 47.28  ? 368 GLU B CD   1 
ATOM   505   O OE1  . GLU A 1 31  ? -44.362 9.637   -17.698 1.00 45.20  ? 368 GLU B OE1  1 
ATOM   506   O OE2  . GLU A 1 31  ? -45.890 11.025  -18.441 1.00 62.65  ? 368 GLU B OE2  1 
ATOM   507   H H    . GLU A 1 31  ? -40.854 11.967  -19.418 1.00 31.76  ? 368 GLU B H    1 
ATOM   508   H HA   . GLU A 1 31  ? -41.921 13.664  -17.676 1.00 35.45  ? 368 GLU B HA   1 
ATOM   509   H HB2  . GLU A 1 31  ? -41.983 10.843  -17.701 1.00 33.76  ? 368 GLU B HB2  1 
ATOM   510   H HB3  . GLU A 1 31  ? -42.743 11.714  -16.611 1.00 33.76  ? 368 GLU B HB3  1 
ATOM   511   H HG2  . GLU A 1 31  ? -44.041 12.665  -18.342 1.00 41.85  ? 368 GLU B HG2  1 
ATOM   512   H HG3  . GLU A 1 31  ? -43.338 11.680  -19.370 1.00 41.85  ? 368 GLU B HG3  1 
ATOM   513   N N    . LEU A 1 32  ? -39.289 12.079  -16.787 1.00 27.30  ? 369 LEU B N    1 
ATOM   514   C CA   . LEU A 1 32  ? -38.205 12.145  -15.811 1.00 25.38  ? 369 LEU B CA   1 
ATOM   515   C C    . LEU A 1 32  ? -37.569 13.536  -15.824 1.00 20.63  ? 369 LEU B C    1 
ATOM   516   O O    . LEU A 1 32  ? -37.206 14.063  -14.781 1.00 24.54  ? 369 LEU B O    1 
ATOM   517   C CB   . LEU A 1 32  ? -37.147 11.070  -16.075 1.00 20.63  ? 369 LEU B CB   1 
ATOM   518   C CG   . LEU A 1 32  ? -36.030 11.001  -15.025 1.00 22.35  ? 369 LEU B CG   1 
ATOM   519   C CD1  . LEU A 1 32  ? -36.569 10.611  -13.643 1.00 18.41  ? 369 LEU B CD1  1 
ATOM   520   C CD2  . LEU A 1 32  ? -34.939 10.009  -15.463 1.00 23.33  ? 369 LEU B CD2  1 
ATOM   521   H H    . LEU A 1 32  ? -39.167 11.517  -17.427 1.00 32.76  ? 369 LEU B H    1 
ATOM   522   H HA   . LEU A 1 32  ? -38.574 11.990  -14.917 1.00 30.46  ? 369 LEU B HA   1 
ATOM   523   H HB2  . LEU A 1 32  ? -37.584 10.204  -16.097 1.00 24.75  ? 369 LEU B HB2  1 
ATOM   524   H HB3  . LEU A 1 32  ? -36.732 11.248  -16.933 1.00 24.75  ? 369 LEU B HB3  1 
ATOM   525   H HG   . LEU A 1 32  ? -35.621 11.877  -14.946 1.00 26.83  ? 369 LEU B HG   1 
ATOM   526   H HD11 . LEU A 1 32  ? -35.838 10.580  -13.021 1.00 22.09  ? 369 LEU B HD11 1 
ATOM   527   H HD12 . LEU A 1 32  ? -37.211 11.267  -13.362 1.00 22.09  ? 369 LEU B HD12 1 
ATOM   528   H HD13 . LEU A 1 32  ? -36.985 9.748   -13.703 1.00 22.09  ? 369 LEU B HD13 1 
ATOM   529   H HD21 . LEU A 1 32  ? -34.253 9.983   -14.791 1.00 28.00  ? 369 LEU B HD21 1 
ATOM   530   H HD22 . LEU A 1 32  ? -35.331 9.139   -15.565 1.00 28.00  ? 369 LEU B HD22 1 
ATOM   531   H HD23 . LEU A 1 32  ? -34.568 10.302  -16.299 1.00 28.00  ? 369 LEU B HD23 1 
ATOM   532   N N    . THR A 1 33  ? -37.446 14.137  -17.008 1.00 23.92  ? 370 THR B N    1 
ATOM   533   C CA   . THR A 1 33  ? -36.899 15.494  -17.113 1.00 22.57  ? 370 THR B CA   1 
ATOM   534   C C    . THR A 1 33  ? -37.675 16.457  -16.231 1.00 23.70  ? 370 THR B C    1 
ATOM   535   O O    . THR A 1 33  ? -37.092 17.251  -15.482 1.00 29.54  ? 370 THR B O    1 
ATOM   536   C CB   . THR A 1 33  ? -36.962 16.021  -18.570 1.00 24.41  ? 370 THR B CB   1 
ATOM   537   O OG1  . THR A 1 33  ? -36.015 15.305  -19.367 1.00 26.91  ? 370 THR B OG1  1 
ATOM   538   C CG2  . THR A 1 33  ? -36.647 17.524  -18.621 1.00 25.82  ? 370 THR B CG2  1 
ATOM   539   H H    . THR A 1 33  ? -37.669 13.786  -17.760 1.00 28.70  ? 370 THR B H    1 
ATOM   540   H HA   . THR A 1 33  ? -35.962 15.492  -16.824 1.00 27.08  ? 370 THR B HA   1 
ATOM   541   H HB   . THR A 1 33  ? -37.854 15.882  -18.926 1.00 29.30  ? 370 THR B HB   1 
ATOM   542   H HG1  . THR A 1 33  ? -36.191 14.504  -19.359 1.00 32.29  ? 370 THR B HG1  1 
ATOM   543   H HG21 . THR A 1 33  ? -36.689 17.838  -19.527 1.00 30.99  ? 370 THR B HG21 1 
ATOM   544   H HG22 . THR A 1 33  ? -37.283 18.011  -18.092 1.00 30.99  ? 370 THR B HG22 1 
ATOM   545   H HG23 . THR A 1 33  ? -35.765 17.686  -18.276 1.00 30.99  ? 370 THR B HG23 1 
ATOM   546   N N    . ASN A 1 34  ? -38.997 16.415  -16.331 1.00 24.67  ? 371 ASN B N    1 
ATOM   547   C CA   . ASN A 1 34  ? -39.803 17.367  -15.573 1.00 38.50  ? 371 ASN B CA   1 
ATOM   548   C C    . ASN A 1 34  ? -39.742 17.076  -14.077 1.00 32.44  ? 371 ASN B C    1 
ATOM   549   O O    . ASN A 1 34  ? -39.673 17.987  -13.256 1.00 23.82  ? 371 ASN B O    1 
ATOM   550   C CB   . ASN A 1 34  ? -41.245 17.388  -16.076 1.00 47.44  ? 371 ASN B CB   1 
ATOM   551   C CG   . ASN A 1 34  ? -41.354 17.926  -17.493 1.00 53.99  ? 371 ASN B CG   1 
ATOM   552   O OD1  . ASN A 1 34  ? -42.052 17.363  -18.337 1.00 56.03  ? 371 ASN B OD1  1 
ATOM   553   N ND2  . ASN A 1 34  ? -40.641 19.014  -17.764 1.00 48.20  ? 371 ASN B ND2  1 
ATOM   554   H H    . ASN A 1 34  ? -39.443 15.863  -16.817 1.00 29.60  ? 371 ASN B H    1 
ATOM   555   H HA   . ASN A 1 34  ? -39.433 18.264  -15.711 1.00 46.20  ? 371 ASN B HA   1 
ATOM   556   H HB2  . ASN A 1 34  ? -41.597 16.484  -16.069 1.00 56.92  ? 371 ASN B HB2  1 
ATOM   557   H HB3  . ASN A 1 34  ? -41.775 17.957  -15.496 1.00 56.92  ? 371 ASN B HB3  1 
ATOM   558   H HD21 . ASN A 1 34  ? -40.154 19.373  -17.152 1.00 57.85  ? 371 ASN B HD21 1 
ATOM   559   H HD22 . ASN A 1 34  ? -40.667 19.360  -18.551 1.00 57.85  ? 371 ASN B HD22 1 
ATOM   560   N N    . LEU A 1 35  ? -39.747 15.802  -13.711 1.00 27.56  ? 372 LEU B N    1 
ATOM   561   C CA   . LEU A 1 35  ? -39.624 15.460  -12.293 1.00 21.59  ? 372 LEU B CA   1 
ATOM   562   C C    . LEU A 1 35  ? -38.290 15.954  -11.733 1.00 32.00  ? 372 LEU B C    1 
ATOM   563   O O    . LEU A 1 35  ? -38.256 16.531  -10.643 1.00 28.18  ? 372 LEU B O    1 
ATOM   564   C CB   . LEU A 1 35  ? -39.793 13.957  -12.078 1.00 22.60  ? 372 LEU B CB   1 
ATOM   565   C CG   . LEU A 1 35  ? -41.230 13.513  -12.349 1.00 33.63  ? 372 LEU B CG   1 
ATOM   566   C CD1  . LEU A 1 35  ? -41.313 12.025  -12.546 1.00 35.50  ? 372 LEU B CD1  1 
ATOM   567   C CD2  . LEU A 1 35  ? -42.161 13.959  -11.227 1.00 34.38  ? 372 LEU B CD2  1 
ATOM   568   H H    . LEU A 1 35  ? -39.819 15.130  -14.243 1.00 33.07  ? 372 LEU B H    1 
ATOM   569   H HA   . LEU A 1 35  ? -40.340 15.912  -11.799 1.00 25.91  ? 372 LEU B HA   1 
ATOM   570   H HB2  . LEU A 1 35  ? -39.208 13.479  -12.686 1.00 27.11  ? 372 LEU B HB2  1 
ATOM   571   H HB3  . LEU A 1 35  ? -39.575 13.738  -11.159 1.00 27.11  ? 372 LEU B HB3  1 
ATOM   572   H HG   . LEU A 1 35  ? -41.535 13.934  -13.167 1.00 40.36  ? 372 LEU B HG   1 
ATOM   573   H HD11 . LEU A 1 35  ? -42.227 11.783  -12.713 1.00 42.59  ? 372 LEU B HD11 1 
ATOM   574   H HD12 . LEU A 1 35  ? -40.767 11.779  -13.296 1.00 42.59  ? 372 LEU B HD12 1 
ATOM   575   H HD13 . LEU A 1 35  ? -40.998 11.587  -11.752 1.00 42.59  ? 372 LEU B HD13 1 
ATOM   576   H HD21 . LEU A 1 35  ? -43.053 13.666  -11.427 1.00 41.26  ? 372 LEU B HD21 1 
ATOM   577   H HD22 . LEU A 1 35  ? -41.864 13.570  -10.402 1.00 41.26  ? 372 LEU B HD22 1 
ATOM   578   H HD23 . LEU A 1 35  ? -42.137 14.917  -11.165 1.00 41.26  ? 372 LEU B HD23 1 
ATOM   579   N N    . LEU A 1 36  ? -37.199 15.758  -12.477 1.00 24.64  ? 373 LEU B N    1 
ATOM   580   C CA   . LEU A 1 36  ? -35.886 16.208  -12.015 1.00 23.38  ? 373 LEU B CA   1 
ATOM   581   C C    . LEU A 1 36  ? -35.819 17.737  -11.928 1.00 32.42  ? 373 LEU B C    1 
ATOM   582   O O    . LEU A 1 36  ? -35.180 18.286  -11.028 1.00 25.23  ? 373 LEU B O    1 
ATOM   583   C CB   . LEU A 1 36  ? -34.767 15.665  -12.904 1.00 26.44  ? 373 LEU B CB   1 
ATOM   584   C CG   . LEU A 1 36  ? -34.574 14.149  -12.746 1.00 30.38  ? 373 LEU B CG   1 
ATOM   585   C CD1  . LEU A 1 36  ? -33.646 13.565  -13.807 1.00 25.59  ? 373 LEU B CD1  1 
ATOM   586   C CD2  . LEU A 1 36  ? -34.062 13.821  -11.354 1.00 36.22  ? 373 LEU B CD2  1 
ATOM   587   H H    . LEU A 1 36  ? -37.193 15.372  -13.246 1.00 29.56  ? 373 LEU B H    1 
ATOM   588   H HA   . LEU A 1 36  ? -35.739 15.856  -11.113 1.00 28.06  ? 373 LEU B HA   1 
ATOM   589   H HB2  . LEU A 1 36  ? -34.985 15.845  -13.832 1.00 31.72  ? 373 LEU B HB2  1 
ATOM   590   H HB3  . LEU A 1 36  ? -33.934 16.101  -12.667 1.00 31.72  ? 373 LEU B HB3  1 
ATOM   591   H HG   . LEU A 1 36  ? -35.437 13.719  -12.846 1.00 36.46  ? 373 LEU B HG   1 
ATOM   592   H HD11 . LEU A 1 36  ? -33.561 12.620  -13.662 1.00 30.70  ? 373 LEU B HD11 1 
ATOM   593   H HD12 . LEU A 1 36  ? -34.021 13.730  -14.675 1.00 30.70  ? 373 LEU B HD12 1 
ATOM   594   H HD13 . LEU A 1 36  ? -32.786 13.986  -13.736 1.00 30.70  ? 373 LEU B HD13 1 
ATOM   595   H HD21 . LEU A 1 36  ? -33.949 12.870  -11.279 1.00 43.46  ? 373 LEU B HD21 1 
ATOM   596   H HD22 . LEU A 1 36  ? -33.220 14.262  -11.219 1.00 43.46  ? 373 LEU B HD22 1 
ATOM   597   H HD23 . LEU A 1 36  ? -34.700 14.127  -10.706 1.00 43.46  ? 373 LEU B HD23 1 
ATOM   598   N N    . ARG A 1 37  ? -36.485 18.430  -12.845 1.00 31.28  ? 374 ARG B N    1 
ATOM   599   C CA   . ARG A 1 37  ? -36.533 19.887  -12.769 1.00 31.44  ? 374 ARG B CA   1 
ATOM   600   C C    . ARG A 1 37  ? -37.273 20.350  -11.517 1.00 35.45  ? 374 ARG B C    1 
ATOM   601   O O    . ARG A 1 37  ? -36.910 21.364  -10.927 1.00 31.12  ? 374 ARG B O    1 
ATOM   602   C CB   . ARG A 1 37  ? -37.128 20.490  -14.050 1.00 31.35  ? 374 ARG B CB   1 
ATOM   603   C CG   . ARG A 1 37  ? -36.118 20.404  -15.166 1.00 38.80  ? 374 ARG B CG   1 
ATOM   604   C CD   . ARG A 1 37  ? -36.532 21.049  -16.452 1.00 44.18  ? 374 ARG B CD   1 
ATOM   605   N NE   . ARG A 1 37  ? -35.396 21.029  -17.367 1.00 40.40  ? 374 ARG B NE   1 
ATOM   606   C CZ   . ARG A 1 37  ? -35.495 20.948  -18.687 1.00 42.93  ? 374 ARG B CZ   1 
ATOM   607   N NH1  . ARG A 1 37  ? -36.689 20.889  -19.267 1.00 46.66  ? 374 ARG B NH1  1 
ATOM   608   N NH2  . ARG A 1 37  ? -34.397 20.928  -19.424 1.00 35.88  ? 374 ARG B NH2  1 
ATOM   609   H H    . ARG A 1 37  ? -36.911 18.088  -13.509 1.00 37.53  ? 374 ARG B H    1 
ATOM   610   H HA   . ARG A 1 37  ? -35.614 20.217  -12.697 1.00 37.73  ? 374 ARG B HA   1 
ATOM   611   H HB2  . ARG A 1 37  ? -37.919 19.991  -14.309 1.00 37.62  ? 374 ARG B HB2  1 
ATOM   612   H HB3  . ARG A 1 37  ? -37.346 21.423  -13.901 1.00 37.62  ? 374 ARG B HB3  1 
ATOM   613   H HG2  . ARG A 1 37  ? -35.299 20.834  -14.874 1.00 46.56  ? 374 ARG B HG2  1 
ATOM   614   H HG3  . ARG A 1 37  ? -35.944 19.468  -15.352 1.00 46.56  ? 374 ARG B HG3  1 
ATOM   615   H HD2  . ARG A 1 37  ? -37.264 20.552  -16.850 1.00 53.02  ? 374 ARG B HD2  1 
ATOM   616   H HD3  . ARG A 1 37  ? -36.789 21.971  -16.291 1.00 53.02  ? 374 ARG B HD3  1 
ATOM   617   H HE   . ARG A 1 37  ? -34.608 21.073  -17.027 1.00 48.48  ? 374 ARG B HE   1 
ATOM   618   H HH11 . ARG A 1 37  ? -37.402 20.900  -18.785 1.00 55.99  ? 374 ARG B HH11 1 
ATOM   619   H HH12 . ARG A 1 37  ? -36.749 20.838  -20.123 1.00 55.99  ? 374 ARG B HH12 1 
ATOM   620   H HH21 . ARG A 1 37  ? -33.625 20.969  -19.047 1.00 43.05  ? 374 ARG B HH21 1 
ATOM   621   H HH22 . ARG A 1 37  ? -34.455 20.880  -20.281 1.00 43.05  ? 374 ARG B HH22 1 
ATOM   622   N N    . GLN A 1 38  ? -38.281 19.594  -11.091 1.00 23.23  ? 375 GLN B N    1 
ATOM   623   C CA   . GLN A 1 38  ? -38.969 19.894  -9.842  1.00 37.98  ? 375 GLN B CA   1 
ATOM   624   C C    . GLN A 1 38  ? -38.003 19.774  -8.663  1.00 46.56  ? 375 GLN B C    1 
ATOM   625   O O    . GLN A 1 38  ? -38.141 20.498  -7.681  1.00 30.20  ? 375 GLN B O    1 
ATOM   626   C CB   . GLN A 1 38  ? -40.163 18.961  -9.619  1.00 38.90  ? 375 GLN B CB   1 
ATOM   627   C CG   . GLN A 1 38  ? -41.275 19.082  -10.644 1.00 54.79  ? 375 GLN B CG   1 
ATOM   628   C CD   . GLN A 1 38  ? -42.546 18.382  -10.195 1.00 60.71  ? 375 GLN B CD   1 
ATOM   629   O OE1  . GLN A 1 38  ? -43.122 18.726  -9.164  1.00 63.46  ? 375 GLN B OE1  1 
ATOM   630   N NE2  . GLN A 1 38  ? -42.984 17.393  -10.963 1.00 56.20  ? 375 GLN B NE2  1 
ATOM   631   H H    . GLN A 1 38  ? -38.584 18.904  -11.505 1.00 27.87  ? 375 GLN B H    1 
ATOM   632   H HA   . GLN A 1 38  ? -39.303 20.815  -9.871  1.00 45.58  ? 375 GLN B HA   1 
ATOM   633   H HB2  . GLN A 1 38  ? -39.845 18.045  -9.640  1.00 46.68  ? 375 GLN B HB2  1 
ATOM   634   H HB3  . GLN A 1 38  ? -40.545 19.152  -8.749  1.00 46.68  ? 375 GLN B HB3  1 
ATOM   635   H HG2  . GLN A 1 38  ? -41.480 20.020  -10.783 1.00 65.75  ? 375 GLN B HG2  1 
ATOM   636   H HG3  . GLN A 1 38  ? -40.986 18.677  -11.477 1.00 65.75  ? 375 GLN B HG3  1 
ATOM   637   H HE21 . GLN A 1 38  ? -42.552 17.177  -11.675 1.00 67.44  ? 375 GLN B HE21 1 
ATOM   638   H HE22 . GLN A 1 38  ? -43.700 16.967  -10.749 1.00 67.44  ? 375 GLN B HE22 1 
ATOM   639   N N    . LEU A 1 39  ? -37.038 18.854  -8.759  1.00 29.79  ? 376 LEU B N    1 
ATOM   640   C CA   . LEU A 1 39  ? -36.047 18.665  -7.703  1.00 39.13  ? 376 LEU B CA   1 
ATOM   641   C C    . LEU A 1 39  ? -34.848 19.600  -7.866  1.00 40.12  ? 376 LEU B C    1 
ATOM   642   O O    . LEU A 1 39  ? -33.847 19.439  -7.180  1.00 32.93  ? 376 LEU B O    1 
ATOM   643   C CB   . LEU A 1 39  ? -35.577 17.193  -7.655  1.00 25.82  ? 376 LEU B CB   1 
ATOM   644   C CG   . LEU A 1 39  ? -36.692 16.202  -7.324  1.00 39.57  ? 376 LEU B CG   1 
ATOM   645   C CD1  . LEU A 1 39  ? -36.138 14.787  -7.138  1.00 33.99  ? 376 LEU B CD1  1 
ATOM   646   C CD2  . LEU A 1 39  ? -37.451 16.652  -6.083  1.00 51.01  ? 376 LEU B CD2  1 
ATOM   647   H H    . LEU A 1 39  ? -36.937 18.326  -9.431  1.00 35.75  ? 376 LEU B H    1 
ATOM   648   H HA   . LEU A 1 39  ? -36.467 18.870  -6.842  1.00 46.96  ? 376 LEU B HA   1 
ATOM   649   H HB2  . LEU A 1 39  ? -35.214 16.952  -8.522  1.00 30.98  ? 376 LEU B HB2  1 
ATOM   650   H HB3  . LEU A 1 39  ? -34.891 17.106  -6.975  1.00 30.98  ? 376 LEU B HB3  1 
ATOM   651   H HG   . LEU A 1 39  ? -37.320 16.180  -8.063  1.00 47.48  ? 376 LEU B HG   1 
ATOM   652   H HD11 . LEU A 1 39  ? -36.862 14.192  -6.932  1.00 40.79  ? 376 LEU B HD11 1 
ATOM   653   H HD12 . LEU A 1 39  ? -35.708 14.510  -7.951  1.00 40.79  ? 376 LEU B HD12 1 
ATOM   654   H HD13 . LEU A 1 39  ? -35.503 14.792  -6.418  1.00 40.79  ? 376 LEU B HD13 1 
ATOM   655   H HD21 . LEU A 1 39  ? -38.145 16.016  -5.894  1.00 61.21  ? 376 LEU B HD21 1 
ATOM   656   H HD22 . LEU A 1 39  ? -36.841 16.700  -5.344  1.00 61.21  ? 376 LEU B HD22 1 
ATOM   657   H HD23 . LEU A 1 39  ? -37.835 17.516  -6.249  1.00 61.21  ? 376 LEU B HD23 1 
ATOM   658   N N    . ASP A 1 40  ? -34.954 20.572  -8.773  1.00 32.84  ? 377 ASP B N    1 
ATOM   659   C CA   . ASP A 1 40  ? -33.913 21.589  -8.968  1.00 27.75  ? 377 ASP B CA   1 
ATOM   660   C C    . ASP A 1 40  ? -32.639 21.077  -9.675  1.00 37.76  ? 377 ASP B C    1 
ATOM   661   O O    . ASP A 1 40  ? -31.552 21.624  -9.479  1.00 33.15  ? 377 ASP B O    1 
ATOM   662   C CB   . ASP A 1 40  ? -33.538 22.238  -7.626  1.00 35.44  ? 377 ASP B CB   1 
ATOM   663   C CG   . ASP A 1 40  ? -34.596 23.212  -7.132  1.00 56.18  ? 377 ASP B CG   1 
ATOM   664   O OD1  . ASP A 1 40  ? -35.297 23.814  -7.977  1.00 53.08  ? 377 ASP B OD1  1 
ATOM   665   O OD2  . ASP A 1 40  ? -34.724 23.380  -5.901  1.00 54.68  ? 377 ASP B OD2  1 
ATOM   666   H H    . ASP A 1 40  ? -35.629 20.667  -9.297  1.00 39.40  ? 377 ASP B H    1 
ATOM   667   H HA   . ASP A 1 40  ? -34.288 22.297  -9.533  1.00 33.30  ? 377 ASP B HA   1 
ATOM   668   H HB2  . ASP A 1 40  ? -33.433 21.544  -6.957  1.00 42.53  ? 377 ASP B HB2  1 
ATOM   669   H HB3  . ASP A 1 40  ? -32.706 22.726  -7.733  1.00 42.53  ? 377 ASP B HB3  1 
ATOM   670   N N    . PHE A 1 41  ? -32.774 20.040  -10.498 1.00 36.66  ? 378 PHE B N    1 
ATOM   671   C CA   . PHE A 1 41  ? -31.673 19.598  -11.357 1.00 35.32  ? 378 PHE B CA   1 
ATOM   672   C C    . PHE A 1 41  ? -31.586 20.416  -12.639 1.00 37.56  ? 378 PHE B C    1 
ATOM   673   O O    . PHE A 1 41  ? -32.607 20.731  -13.235 1.00 28.01  ? 378 PHE B O    1 
ATOM   674   C CB   . PHE A 1 41  ? -31.872 18.142  -11.765 1.00 33.46  ? 378 PHE B CB   1 
ATOM   675   C CG   . PHE A 1 41  ? -31.352 17.155  -10.765 1.00 21.26  ? 378 PHE B CG   1 
ATOM   676   C CD1  . PHE A 1 41  ? -30.191 16.443  -11.015 1.00 27.65  ? 378 PHE B CD1  1 
ATOM   677   C CD2  . PHE A 1 41  ? -32.023 16.942  -9.578  1.00 28.59  ? 378 PHE B CD2  1 
ATOM   678   C CE1  . PHE A 1 41  ? -29.708 15.526  -10.086 1.00 25.52  ? 378 PHE B CE1  1 
ATOM   679   C CE2  . PHE A 1 41  ? -31.557 16.035  -8.650  1.00 30.92  ? 378 PHE B CE2  1 
ATOM   680   C CZ   . PHE A 1 41  ? -30.390 15.322  -8.902  1.00 32.05  ? 378 PHE B CZ   1 
ATOM   681   H H    . PHE A 1 41  ? -33.492 19.573  -10.578 1.00 43.99  ? 378 PHE B H    1 
ATOM   682   H HA   . PHE A 1 41  ? -30.824 19.677  -10.874 1.00 42.38  ? 378 PHE B HA   1 
ATOM   683   H HB2  . PHE A 1 41  ? -32.821 17.976  -11.879 1.00 40.15  ? 378 PHE B HB2  1 
ATOM   684   H HB3  . PHE A 1 41  ? -31.408 17.986  -12.603 1.00 40.15  ? 378 PHE B HB3  1 
ATOM   685   H HD1  . PHE A 1 41  ? -29.730 16.578  -11.812 1.00 33.18  ? 378 PHE B HD1  1 
ATOM   686   H HD2  . PHE A 1 41  ? -32.804 17.416  -9.403  1.00 34.30  ? 378 PHE B HD2  1 
ATOM   687   H HE1  . PHE A 1 41  ? -28.928 15.051  -10.262 1.00 30.62  ? 378 PHE B HE1  1 
ATOM   688   H HE2  . PHE A 1 41  ? -32.020 15.904  -7.855  1.00 37.11  ? 378 PHE B HE2  1 
ATOM   689   H HZ   . PHE A 1 41  ? -30.072 14.710  -8.279  1.00 38.46  ? 378 PHE B HZ   1 
ATOM   690   N N    . LYS A 1 42  ? -30.366 20.738  -13.061 1.00 35.13  ? 379 LYS B N    1 
ATOM   691   C CA   . LYS A 1 42  ? -30.113 21.182  -14.426 1.00 38.00  ? 379 LYS B CA   1 
ATOM   692   C C    . LYS A 1 42  ? -30.135 19.961  -15.338 1.00 35.82  ? 379 LYS B C    1 
ATOM   693   O O    . LYS A 1 42  ? -29.230 19.124  -15.275 1.00 29.21  ? 379 LYS B O    1 
ATOM   694   C CB   . LYS A 1 42  ? -28.740 21.849  -14.534 1.00 37.83  ? 379 LYS B CB   1 
ATOM   695   C CG   . LYS A 1 42  ? -28.585 23.128  -13.748 1.00 40.83  ? 379 LYS B CG   1 
ATOM   696   C CD   . LYS A 1 42  ? -27.113 23.470  -13.572 1.00 40.47  ? 379 LYS B CD   1 
ATOM   697   C CE   . LYS A 1 42  ? -26.925 24.871  -12.985 1.00 48.70  ? 379 LYS B CE   1 
ATOM   698   N NZ   . LYS A 1 42  ? -27.615 25.018  -11.673 1.00 56.04  ? 379 LYS B NZ   1 
ATOM   699   H H    . LYS A 1 42  ? -29.661 20.707  -12.570 1.00 42.16  ? 379 LYS B H    1 
ATOM   700   H HA   . LYS A 1 42  ? -30.804 21.815  -14.713 1.00 45.60  ? 379 LYS B HA   1 
ATOM   701   H HB2  . LYS A 1 42  ? -28.070 21.226  -14.213 1.00 45.40  ? 379 LYS B HB2  1 
ATOM   702   H HB3  . LYS A 1 42  ? -28.571 22.056  -15.466 1.00 45.40  ? 379 LYS B HB3  1 
ATOM   703   H HG2  . LYS A 1 42  ? -29.014 23.855  -14.226 1.00 49.00  ? 379 LYS B HG2  1 
ATOM   704   H HG3  . LYS A 1 42  ? -28.982 23.018  -12.870 1.00 49.00  ? 379 LYS B HG3  1 
ATOM   705   H HD2  . LYS A 1 42  ? -26.707 22.830  -12.967 1.00 48.57  ? 379 LYS B HD2  1 
ATOM   706   H HD3  . LYS A 1 42  ? -26.673 23.442  -14.436 1.00 48.57  ? 379 LYS B HD3  1 
ATOM   707   H HE2  . LYS A 1 42  ? -25.979 25.035  -12.849 1.00 58.44  ? 379 LYS B HE2  1 
ATOM   708   H HE3  . LYS A 1 42  ? -27.294 25.526  -13.597 1.00 58.44  ? 379 LYS B HE3  1 
ATOM   709   H HZ1  . LYS A 1 42  ? -27.490 25.840  -11.355 1.00 67.24  ? 379 LYS B HZ1  1 
ATOM   710   H HZ2  . LYS A 1 42  ? -28.488 24.876  -11.772 1.00 67.24  ? 379 LYS B HZ2  1 
ATOM   711   H HZ3  . LYS A 1 42  ? -27.290 24.430  -11.090 1.00 67.24  ? 379 LYS B HZ3  1 
ATOM   712   N N    . VAL A 1 43  ? -31.149 19.861  -16.194 1.00 28.58  ? 380 VAL B N    1 
ATOM   713   C CA   . VAL A 1 43  ? -31.340 18.658  -16.996 1.00 26.86  ? 380 VAL B CA   1 
ATOM   714   C C    . VAL A 1 43  ? -31.086 18.908  -18.473 1.00 32.46  ? 380 VAL B C    1 
ATOM   715   O O    . VAL A 1 43  ? -31.602 19.863  -19.044 1.00 37.65  ? 380 VAL B O    1 
ATOM   716   C CB   . VAL A 1 43  ? -32.774 18.104  -16.855 1.00 37.14  ? 380 VAL B CB   1 
ATOM   717   C CG1  . VAL A 1 43  ? -32.943 16.818  -17.668 1.00 34.86  ? 380 VAL B CG1  1 
ATOM   718   C CG2  . VAL A 1 43  ? -33.122 17.855  -15.404 1.00 29.88  ? 380 VAL B CG2  1 
ATOM   719   H H    . VAL A 1 43  ? -31.737 20.474  -16.328 1.00 34.30  ? 380 VAL B H    1 
ATOM   720   H HA   . VAL A 1 43  ? -30.715 17.967  -16.691 1.00 32.24  ? 380 VAL B HA   1 
ATOM   721   H HB   . VAL A 1 43  ? -33.406 18.767  -17.205 1.00 44.57  ? 380 VAL B HB   1 
ATOM   722   H HG11 . VAL A 1 43  ? -33.842 16.497  -17.562 1.00 41.84  ? 380 VAL B HG11 1 
ATOM   723   H HG12 . VAL A 1 43  ? -32.770 17.009  -18.593 1.00 41.84  ? 380 VAL B HG12 1 
ATOM   724   H HG13 . VAL A 1 43  ? -32.321 16.161  -17.347 1.00 41.84  ? 380 VAL B HG13 1 
ATOM   725   H HG21 . VAL A 1 43  ? -34.017 17.512  -15.352 1.00 35.86  ? 380 VAL B HG21 1 
ATOM   726   H HG22 . VAL A 1 43  ? -32.504 17.216  -15.041 1.00 35.86  ? 380 VAL B HG22 1 
ATOM   727   H HG23 . VAL A 1 43  ? -33.058 18.682  -14.921 1.00 35.86  ? 380 VAL B HG23 1 
ATOM   728   N N    . VAL A 1 44  ? -30.286 18.046  -19.091 1.00 26.69  ? 381 VAL B N    1 
ATOM   729   C CA   . VAL A 1 44  ? -30.210 17.989  -20.549 1.00 27.17  ? 381 VAL B CA   1 
ATOM   730   C C    . VAL A 1 44  ? -30.884 16.696  -20.960 1.00 25.13  ? 381 VAL B C    1 
ATOM   731   O O    . VAL A 1 44  ? -30.493 15.630  -20.503 1.00 27.38  ? 381 VAL B O    1 
ATOM   732   C CB   . VAL A 1 44  ? -28.755 18.007  -21.053 1.00 38.32  ? 381 VAL B CB   1 
ATOM   733   C CG1  . VAL A 1 44  ? -28.668 17.496  -22.505 1.00 28.23  ? 381 VAL B CG1  1 
ATOM   734   C CG2  . VAL A 1 44  ? -28.172 19.413  -20.918 1.00 42.27  ? 381 VAL B CG2  1 
ATOM   735   H H    . VAL A 1 44  ? -29.776 17.482  -18.690 1.00 32.03  ? 381 VAL B H    1 
ATOM   736   H HA   . VAL A 1 44  ? -30.696 18.744  -20.942 1.00 32.60  ? 381 VAL B HA   1 
ATOM   737   H HB   . VAL A 1 44  ? -28.220 17.407  -20.492 1.00 45.98  ? 381 VAL B HB   1 
ATOM   738   H HG11 . VAL A 1 44  ? -27.751 17.519  -22.790 1.00 33.88  ? 381 VAL B HG11 1 
ATOM   739   H HG12 . VAL A 1 44  ? -28.999 16.596  -22.540 1.00 33.88  ? 381 VAL B HG12 1 
ATOM   740   H HG13 . VAL A 1 44  ? -29.200 18.063  -23.068 1.00 33.88  ? 381 VAL B HG13 1 
ATOM   741   H HG21 . VAL A 1 44  ? -27.266 19.406  -21.236 1.00 50.72  ? 381 VAL B HG21 1 
ATOM   742   H HG22 . VAL A 1 44  ? -28.699 20.020  -21.442 1.00 50.72  ? 381 VAL B HG22 1 
ATOM   743   H HG23 . VAL A 1 44  ? -28.194 19.672  -19.994 1.00 50.72  ? 381 VAL B HG23 1 
ATOM   744   N N    . SER A 1 45  ? -31.919 16.781  -21.788 1.00 26.08  ? 382 SER B N    1 
ATOM   745   C CA   . SER A 1 45  ? -32.607 15.586  -22.255 1.00 25.95  ? 382 SER B CA   1 
ATOM   746   C C    . SER A 1 45  ? -32.457 15.498  -23.768 1.00 37.06  ? 382 SER B C    1 
ATOM   747   O O    . SER A 1 45  ? -32.683 16.470  -24.482 1.00 25.58  ? 382 SER B O    1 
ATOM   748   C CB   . SER A 1 45  ? -34.084 15.611  -21.861 1.00 29.12  ? 382 SER B CB   1 
ATOM   749   O OG   . SER A 1 45  ? -34.735 16.745  -22.402 1.00 30.37  ? 382 SER B OG   1 
ATOM   750   H H    . SER A 1 45  ? -32.242 17.518  -22.092 1.00 31.30  ? 382 SER B H    1 
ATOM   751   H HA   . SER A 1 45  ? -32.193 14.793  -21.855 1.00 31.14  ? 382 SER B HA   1 
ATOM   752   H HB2  . SER A 1 45  ? -34.514 14.809  -22.198 1.00 34.94  ? 382 SER B HB2  1 
ATOM   753   H HB3  . SER A 1 45  ? -34.151 15.641  -20.894 1.00 34.94  ? 382 SER B HB3  1 
ATOM   754   H HG   . SER A 1 45  ? -34.203 17.193  -22.836 1.00 36.44  ? 382 SER B HG   1 
ATOM   755   N N    . LEU A 1 46  ? -32.062 14.327  -24.252 1.00 20.13  ? 383 LEU B N    1 
ATOM   756   C CA   . LEU A 1 46  ? -31.750 14.158  -25.657 1.00 21.28  ? 383 LEU B CA   1 
ATOM   757   C C    . LEU A 1 46  ? -32.332 12.859  -26.204 1.00 31.35  ? 383 LEU B C    1 
ATOM   758   O O    . LEU A 1 46  ? -32.257 11.810  -25.553 1.00 26.82  ? 383 LEU B O    1 
ATOM   759   C CB   . LEU A 1 46  ? -30.228 14.180  -25.845 1.00 24.21  ? 383 LEU B CB   1 
ATOM   760   C CG   . LEU A 1 46  ? -29.560 15.545  -25.649 1.00 27.87  ? 383 LEU B CG   1 
ATOM   761   C CD1  . LEU A 1 46  ? -28.063 15.377  -25.524 1.00 28.95  ? 383 LEU B CD1  1 
ATOM   762   C CD2  . LEU A 1 46  ? -29.903 16.496  -26.804 1.00 25.94  ? 383 LEU B CD2  1 
ATOM   763   H H    . LEU A 1 46  ? -31.968 13.613  -23.782 1.00 24.15  ? 383 LEU B H    1 
ATOM   764   H HA   . LEU A 1 46  ? -32.133 14.903  -26.165 1.00 25.53  ? 383 LEU B HA   1 
ATOM   765   H HB2  . LEU A 1 46  ? -29.830 13.567  -25.207 1.00 29.05  ? 383 LEU B HB2  1 
ATOM   766   H HB3  . LEU A 1 46  ? -30.026 13.885  -26.747 1.00 29.05  ? 383 LEU B HB3  1 
ATOM   767   H HG   . LEU A 1 46  ? -29.888 15.942  -24.827 1.00 33.44  ? 383 LEU B HG   1 
ATOM   768   H HD11 . LEU A 1 46  ? -27.661 16.241  -25.401 1.00 34.75  ? 383 LEU B HD11 1 
ATOM   769   H HD12 . LEU A 1 46  ? -27.874 14.818  -24.767 1.00 34.75  ? 383 LEU B HD12 1 
ATOM   770   H HD13 . LEU A 1 46  ? -27.726 14.970  -26.325 1.00 34.75  ? 383 LEU B HD13 1 
ATOM   771   H HD21 . LEU A 1 46  ? -29.471 17.340  -26.652 1.00 31.13  ? 383 LEU B HD21 1 
ATOM   772   H HD22 . LEU A 1 46  ? -29.592 16.112  -27.627 1.00 31.13  ? 383 LEU B HD22 1 
ATOM   773   H HD23 . LEU A 1 46  ? -30.855 16.616  -26.838 1.00 31.13  ? 383 LEU B HD23 1 
ATOM   774   N N    . LEU A 1 47  ? -32.900 12.926  -27.404 1.00 29.08  ? 384 LEU B N    1 
ATOM   775   C CA   . LEU A 1 47  ? -33.442 11.740  -28.057 1.00 28.58  ? 384 LEU B CA   1 
ATOM   776   C C    . LEU A 1 47  ? -32.618 11.354  -29.278 1.00 29.02  ? 384 LEU B C    1 
ATOM   777   O O    . LEU A 1 47  ? -32.099 12.221  -29.994 1.00 28.07  ? 384 LEU B O    1 
ATOM   778   C CB   . LEU A 1 47  ? -34.878 11.978  -28.532 1.00 26.38  ? 384 LEU B CB   1 
ATOM   779   C CG   . LEU A 1 47  ? -35.947 12.404  -27.540 1.00 39.09  ? 384 LEU B CG   1 
ATOM   780   C CD1  . LEU A 1 47  ? -37.292 12.521  -28.285 1.00 27.21  ? 384 LEU B CD1  1 
ATOM   781   C CD2  . LEU A 1 47  ? -36.018 11.410  -26.364 1.00 32.04  ? 384 LEU B CD2  1 
ATOM   782   H H    . LEU A 1 47  ? -32.985 13.649  -27.862 1.00 34.90  ? 384 LEU B H    1 
ATOM   783   H HA   . LEU A 1 47  ? -33.441 10.988  -27.428 1.00 34.30  ? 384 LEU B HA   1 
ATOM   784   H HB2  . LEU A 1 47  ? -34.847 12.666  -29.215 1.00 31.65  ? 384 LEU B HB2  1 
ATOM   785   H HB3  . LEU A 1 47  ? -35.190 11.153  -28.936 1.00 31.65  ? 384 LEU B HB3  1 
ATOM   786   H HG   . LEU A 1 47  ? -35.721 13.278  -27.184 1.00 46.91  ? 384 LEU B HG   1 
ATOM   787   H HD11 . LEU A 1 47  ? -37.971 12.790  -27.662 1.00 32.65  ? 384 LEU B HD11 1 
ATOM   788   H HD12 . LEU A 1 47  ? -37.207 13.176  -28.981 1.00 32.65  ? 384 LEU B HD12 1 
ATOM   789   H HD13 . LEU A 1 47  ? -37.514 11.667  -28.663 1.00 32.65  ? 384 LEU B HD13 1 
ATOM   790   H HD21 . LEU A 1 47  ? -36.698 11.699  -25.752 1.00 38.45  ? 384 LEU B HD21 1 
ATOM   791   H HD22 . LEU A 1 47  ? -36.232 10.538  -26.705 1.00 38.45  ? 384 LEU B HD22 1 
ATOM   792   H HD23 . LEU A 1 47  ? -35.166 11.389  -25.922 1.00 38.45  ? 384 LEU B HD23 1 
ATOM   793   N N    . ASP A 1 48  ? -32.540 10.050  -29.523 1.00 22.29  ? 385 ASP B N    1 
ATOM   794   C CA   . ASP A 1 48  ? -32.013 9.506   -30.780 1.00 29.43  ? 385 ASP B CA   1 
ATOM   795   C C    . ASP A 1 48  ? -30.616 10.009  -31.111 1.00 34.89  ? 385 ASP B C    1 
ATOM   796   O O    . ASP A 1 48  ? -30.428 10.792  -32.049 1.00 30.16  ? 385 ASP B O    1 
ATOM   797   C CB   . ASP A 1 48  ? -32.979 9.823   -31.929 1.00 25.47  ? 385 ASP B CB   1 
ATOM   798   C CG   . ASP A 1 48  ? -34.268 9.017   -31.844 1.00 31.39  ? 385 ASP B CG   1 
ATOM   799   O OD1  . ASP A 1 48  ? -34.237 7.914   -31.248 1.00 33.62  ? 385 ASP B OD1  1 
ATOM   800   O OD2  . ASP A 1 48  ? -35.308 9.475   -32.366 1.00 33.31  ? 385 ASP B OD2  1 
ATOM   801   H H    . ASP A 1 48  ? -32.791 9.444   -28.966 1.00 26.74  ? 385 ASP B H    1 
ATOM   802   H HA   . ASP A 1 48  ? -31.962 8.530   -30.698 1.00 35.32  ? 385 ASP B HA   1 
ATOM   803   H HB2  . ASP A 1 48  ? -33.211 10.764  -31.898 1.00 30.56  ? 385 ASP B HB2  1 
ATOM   804   H HB3  . ASP A 1 48  ? -32.549 9.614   -32.773 1.00 30.56  ? 385 ASP B HB3  1 
ATOM   805   N N    . LEU A 1 49  ? -29.647 9.544   -30.332 1.00 23.54  ? 386 LEU B N    1 
ATOM   806   C CA   . LEU A 1 49  ? -28.254 9.938   -30.471 1.00 32.66  ? 386 LEU B CA   1 
ATOM   807   C C    . LEU A 1 49  ? -27.395 8.834   -31.058 1.00 41.65  ? 386 LEU B C    1 
ATOM   808   O O    . LEU A 1 49  ? -27.517 7.660   -30.690 1.00 29.11  ? 386 LEU B O    1 
ATOM   809   C CB   . LEU A 1 49  ? -27.679 10.353  -29.121 1.00 29.11  ? 386 LEU B CB   1 
ATOM   810   C CG   . LEU A 1 49  ? -28.239 11.635  -28.504 1.00 29.87  ? 386 LEU B CG   1 
ATOM   811   C CD1  . LEU A 1 49  ? -27.485 11.976  -27.193 1.00 20.99  ? 386 LEU B CD1  1 
ATOM   812   C CD2  . LEU A 1 49  ? -28.146 12.780  -29.503 1.00 28.94  ? 386 LEU B CD2  1 
ATOM   813   H H    . LEU A 1 49  ? -29.778 8.981   -29.695 1.00 28.25  ? 386 LEU B H    1 
ATOM   814   H HA   . LEU A 1 49  ? -28.202 10.712  -31.071 1.00 39.19  ? 386 LEU B HA   1 
ATOM   815   H HB2  . LEU A 1 49  ? -27.842 9.635   -28.489 1.00 34.93  ? 386 LEU B HB2  1 
ATOM   816   H HB3  . LEU A 1 49  ? -26.723 10.478  -29.224 1.00 34.93  ? 386 LEU B HB3  1 
ATOM   817   H HG   . LEU A 1 49  ? -29.175 11.501  -28.287 1.00 35.85  ? 386 LEU B HG   1 
ATOM   818   H HD11 . LEU A 1 49  ? -27.852 12.782  -26.822 1.00 25.19  ? 386 LEU B HD11 1 
ATOM   819   H HD12 . LEU A 1 49  ? -27.595 11.251  -26.573 1.00 25.19  ? 386 LEU B HD12 1 
ATOM   820   H HD13 . LEU A 1 49  ? -26.554 12.099  -27.391 1.00 25.19  ? 386 LEU B HD13 1 
ATOM   821   H HD21 . LEU A 1 49  ? -28.501 13.575  -29.100 1.00 34.73  ? 386 LEU B HD21 1 
ATOM   822   H HD22 . LEU A 1 49  ? -27.225 12.914  -29.738 1.00 34.73  ? 386 LEU B HD22 1 
ATOM   823   H HD23 . LEU A 1 49  ? -28.654 12.553  -30.285 1.00 34.73  ? 386 LEU B HD23 1 
ATOM   824   N N    . THR A 1 50  ? -26.532 9.241   -31.983 1.00 35.38  ? 387 THR B N    1 
ATOM   825   C CA   . THR A 1 50  ? -25.548 8.375   -32.605 1.00 35.37  ? 387 THR B CA   1 
ATOM   826   C C    . THR A 1 50  ? -24.432 8.186   -31.605 1.00 35.24  ? 387 THR B C    1 
ATOM   827   O O    . THR A 1 50  ? -24.430 8.835   -30.560 1.00 33.52  ? 387 THR B O    1 
ATOM   828   C CB   . THR A 1 50  ? -24.965 9.050   -33.866 1.00 38.31  ? 387 THR B CB   1 
ATOM   829   O OG1  . THR A 1 50  ? -24.297 10.263  -33.489 1.00 28.91  ? 387 THR B OG1  1 
ATOM   830   C CG2  . THR A 1 50  ? -26.074 9.392   -34.852 1.00 31.80  ? 387 THR B CG2  1 
ATOM   831   H H    . THR A 1 50  ? -26.500 10.050  -32.275 1.00 42.46  ? 387 THR B H    1 
ATOM   832   H HA   . THR A 1 50  ? -25.941 7.508   -32.839 1.00 42.44  ? 387 THR B HA   1 
ATOM   833   H HB   . THR A 1 50  ? -24.337 8.451   -34.298 1.00 45.97  ? 387 THR B HB   1 
ATOM   834   H HG1  . THR A 1 50  ? -23.984 10.629  -34.152 1.00 34.69  ? 387 THR B HG1  1 
ATOM   835   H HG21 . THR A 1 50  ? -25.702 9.811   -35.632 1.00 38.16  ? 387 THR B HG21 1 
ATOM   836   H HG22 . THR A 1 50  ? -26.535 8.593   -35.117 1.00 38.16  ? 387 THR B HG22 1 
ATOM   837   H HG23 . THR A 1 50  ? -26.701 9.994   -34.444 1.00 38.16  ? 387 THR B HG23 1 
ATOM   838   N N    . GLU A 1 51  ? -23.474 7.313   -31.909 1.00 35.56  ? 388 GLU B N    1 
ATOM   839   C CA   . GLU A 1 51  ? -22.388 7.074   -30.972 1.00 35.29  ? 388 GLU B CA   1 
ATOM   840   C C    . GLU A 1 51  ? -21.630 8.361   -30.678 1.00 34.08  ? 388 GLU B C    1 
ATOM   841   O O    . GLU A 1 51  ? -21.367 8.687   -29.520 1.00 29.02  ? 388 GLU B O    1 
ATOM   842   C CB   . GLU A 1 51  ? -21.407 6.022   -31.498 1.00 39.82  ? 388 GLU B CB   1 
ATOM   843   C CG   . GLU A 1 51  ? -20.326 5.710   -30.483 1.00 38.59  ? 388 GLU B CG   1 
ATOM   844   C CD   . GLU A 1 51  ? -19.102 5.020   -31.074 1.00 45.87  ? 388 GLU B CD   1 
ATOM   845   O OE1  . GLU A 1 51  ? -19.146 4.541   -32.232 1.00 34.05  ? 388 GLU B OE1  1 
ATOM   846   O OE2  . GLU A 1 51  ? -18.083 4.970   -30.359 1.00 43.53  ? 388 GLU B OE2  1 
ATOM   847   H H    . GLU A 1 51  ? -23.432 6.856   -32.636 1.00 42.67  ? 388 GLU B H    1 
ATOM   848   H HA   . GLU A 1 51  ? -22.763 6.744   -30.129 1.00 42.35  ? 388 GLU B HA   1 
ATOM   849   H HB2  . GLU A 1 51  ? -21.889 5.202   -31.689 1.00 47.78  ? 388 GLU B HB2  1 
ATOM   850   H HB3  . GLU A 1 51  ? -20.980 6.356   -32.302 1.00 47.78  ? 388 GLU B HB3  1 
ATOM   851   H HG2  . GLU A 1 51  ? -20.031 6.539   -30.076 1.00 46.31  ? 388 GLU B HG2  1 
ATOM   852   H HG3  . GLU A 1 51  ? -20.696 5.124   -29.803 1.00 46.31  ? 388 GLU B HG3  1 
ATOM   853   N N    . TYR A 1 52  ? -21.272 9.071   -31.743 1.00 41.06  ? 389 TYR B N    1 
ATOM   854   C CA   . TYR A 1 52  ? -20.524 10.322  -31.658 1.00 41.77  ? 389 TYR B CA   1 
ATOM   855   C C    . TYR A 1 52  ? -21.288 11.388  -30.871 1.00 33.42  ? 389 TYR B C    1 
ATOM   856   O O    . TYR A 1 52  ? -20.710 12.133  -30.080 1.00 27.95  ? 389 TYR B O    1 
ATOM   857   C CB   . TYR A 1 52  ? -20.221 10.818  -33.077 1.00 60.33  ? 389 TYR B CB   1 
ATOM   858   C CG   . TYR A 1 52  ? -19.612 12.198  -33.154 1.00 77.01  ? 389 TYR B CG   1 
ATOM   859   C CD1  . TYR A 1 52  ? -18.282 12.414  -32.820 1.00 81.29  ? 389 TYR B CD1  1 
ATOM   860   C CD2  . TYR A 1 52  ? -20.365 13.285  -33.582 1.00 79.99  ? 389 TYR B CD2  1 
ATOM   861   C CE1  . TYR A 1 52  ? -17.722 13.675  -32.897 1.00 83.01  ? 389 TYR B CE1  1 
ATOM   862   C CE2  . TYR A 1 52  ? -19.813 14.548  -33.662 1.00 83.03  ? 389 TYR B CE2  1 
ATOM   863   C CZ   . TYR A 1 52  ? -18.491 14.736  -33.319 1.00 87.38  ? 389 TYR B CZ   1 
ATOM   864   O OH   . TYR A 1 52  ? -17.936 15.991  -33.395 1.00 99.97  ? 389 TYR B OH   1 
ATOM   865   H H    . TYR A 1 52  ? -21.456 8.841   -32.551 1.00 49.27  ? 389 TYR B H    1 
ATOM   866   H HA   . TYR A 1 52  ? -19.673 10.158  -31.202 1.00 50.12  ? 389 TYR B HA   1 
ATOM   867   H HB2  . TYR A 1 52  ? -19.598 10.200  -33.493 1.00 72.40  ? 389 TYR B HB2  1 
ATOM   868   H HB3  . TYR A 1 52  ? -21.049 10.834  -33.582 1.00 72.40  ? 389 TYR B HB3  1 
ATOM   869   H HD1  . TYR A 1 52  ? -17.760 11.699  -32.534 1.00 97.55  ? 389 TYR B HD1  1 
ATOM   870   H HD2  . TYR A 1 52  ? -21.257 13.161  -33.814 1.00 95.99  ? 389 TYR B HD2  1 
ATOM   871   H HE1  . TYR A 1 52  ? -16.831 13.806  -32.666 1.00 99.61  ? 389 TYR B HE1  1 
ATOM   872   H HE2  . TYR A 1 52  ? -20.330 15.267  -33.946 1.00 99.63  ? 389 TYR B HE2  1 
ATOM   873   H HH   . TYR A 1 52  ? -18.342 16.507  -32.903 1.00 119.96 ? 389 TYR B HH   1 
ATOM   874   N N    . GLU A 1 53  ? -22.594 11.461  -31.086 1.00 27.73  ? 390 GLU B N    1 
ATOM   875   C CA   . GLU A 1 53  ? -23.422 12.407  -30.348 1.00 26.53  ? 390 GLU B CA   1 
ATOM   876   C C    . GLU A 1 53  ? -23.550 12.044  -28.863 1.00 31.53  ? 390 GLU B C    1 
ATOM   877   O O    . GLU A 1 53  ? -23.577 12.935  -28.021 1.00 22.65  ? 390 GLU B O    1 
ATOM   878   C CB   . GLU A 1 53  ? -24.794 12.516  -31.004 1.00 30.47  ? 390 GLU B CB   1 
ATOM   879   C CG   . GLU A 1 53  ? -24.725 13.160  -32.388 1.00 39.35  ? 390 GLU B CG   1 
ATOM   880   C CD   . GLU A 1 53  ? -25.952 12.891  -33.233 1.00 44.62  ? 390 GLU B CD   1 
ATOM   881   O OE1  . GLU A 1 53  ? -26.757 12.012  -32.865 1.00 32.89  ? 390 GLU B OE1  1 
ATOM   882   O OE2  . GLU A 1 53  ? -26.118 13.561  -34.269 1.00 43.61  ? 390 GLU B OE2  1 
ATOM   883   H H    . GLU A 1 53  ? -23.025 10.976  -31.650 1.00 33.28  ? 390 GLU B H    1 
ATOM   884   H HA   . GLU A 1 53  ? -23.002 13.291  -30.398 1.00 31.84  ? 390 GLU B HA   1 
ATOM   885   H HB2  . GLU A 1 53  ? -25.169 11.627  -31.104 1.00 36.56  ? 390 GLU B HB2  1 
ATOM   886   H HB3  . GLU A 1 53  ? -25.371 13.061  -30.446 1.00 36.56  ? 390 GLU B HB3  1 
ATOM   887   H HG2  . GLU A 1 53  ? -24.639 14.120  -32.283 1.00 47.22  ? 390 GLU B HG2  1 
ATOM   888   H HG3  . GLU A 1 53  ? -23.954 12.808  -32.860 1.00 47.22  ? 390 GLU B HG3  1 
ATOM   889   N N    . MET A 1 54  ? -23.611 10.746  -28.545 1.00 32.72  ? 391 MET B N    1 
ATOM   890   C CA   . MET A 1 54  ? -23.712 10.309  -27.145 1.00 31.69  ? 391 MET B CA   1 
ATOM   891   C C    . MET A 1 54  ? -22.441 10.673  -26.395 1.00 31.57  ? 391 MET B C    1 
ATOM   892   O O    . MET A 1 54  ? -22.494 11.182  -25.281 1.00 31.16  ? 391 MET B O    1 
ATOM   893   C CB   . MET A 1 54  ? -23.966 8.801   -27.040 1.00 32.16  ? 391 MET B CB   1 
ATOM   894   C CG   . MET A 1 54  ? -25.402 8.402   -27.352 1.00 27.90  ? 391 MET B CG   1 
ATOM   895   S SD   . MET A 1 54  ? -25.785 6.670   -27.036 1.00 27.90  ? 391 MET B SD   1 
ATOM   896   C CE   . MET A 1 54  ? -25.876 6.631   -25.237 1.00 33.26  ? 391 MET B CE   1 
ATOM   897   H H    . MET A 1 54  ? -23.596 10.103  -29.115 1.00 39.26  ? 391 MET B H    1 
ATOM   898   H HA   . MET A 1 54  ? -24.468 10.769  -26.725 1.00 38.02  ? 391 MET B HA   1 
ATOM   899   H HB2  . MET A 1 54  ? -23.386 8.341   -27.667 1.00 38.59  ? 391 MET B HB2  1 
ATOM   900   H HB3  . MET A 1 54  ? -23.767 8.513   -26.135 1.00 38.59  ? 391 MET B HB3  1 
ATOM   901   H HG2  . MET A 1 54  ? -25.998 8.938   -26.807 1.00 33.48  ? 391 MET B HG2  1 
ATOM   902   H HG3  . MET A 1 54  ? -25.574 8.574   -28.291 1.00 33.48  ? 391 MET B HG3  1 
ATOM   903   H HE1  . MET A 1 54  ? -26.079 5.737   -24.954 1.00 39.91  ? 391 MET B HE1  1 
ATOM   904   H HE2  . MET A 1 54  ? -25.030 6.905   -24.876 1.00 39.91  ? 391 MET B HE2  1 
ATOM   905   H HE3  . MET A 1 54  ? -26.566 7.232   -24.947 1.00 39.91  ? 391 MET B HE3  1 
ATOM   906   N N    . ARG A 1 55  ? -21.289 10.431  -27.009 1.00 28.09  ? 392 ARG B N    1 
ATOM   907   C CA   . ARG A 1 55  ? -20.038 10.808  -26.372 1.00 30.52  ? 392 ARG B CA   1 
ATOM   908   C C    . ARG A 1 55  ? -19.926 12.325  -26.220 1.00 24.82  ? 392 ARG B C    1 
ATOM   909   O O    . ARG A 1 55  ? -19.462 12.813  -25.192 1.00 33.68  ? 392 ARG B O    1 
ATOM   910   C CB   . ARG A 1 55  ? -18.842 10.247  -27.143 1.00 33.50  ? 392 ARG B CB   1 
ATOM   911   C CG   . ARG A 1 55  ? -18.725 8.722   -27.062 1.00 30.49  ? 392 ARG B CG   1 
ATOM   912   C CD   . ARG A 1 55  ? -17.473 8.243   -27.773 1.00 42.93  ? 392 ARG B CD   1 
ATOM   913   N NE   . ARG A 1 55  ? -17.540 6.823   -28.101 1.00 37.07  ? 392 ARG B NE   1 
ATOM   914   C CZ   . ARG A 1 55  ? -17.455 5.843   -27.205 1.00 44.12  ? 392 ARG B CZ   1 
ATOM   915   N NH1  . ARG A 1 55  ? -17.301 6.126   -25.923 1.00 39.44  ? 392 ARG B NH1  1 
ATOM   916   N NH2  . ARG A 1 55  ? -17.525 4.577   -27.587 1.00 39.39  ? 392 ARG B NH2  1 
ATOM   917   H H    . ARG A 1 55  ? -21.206 10.057  -27.779 1.00 33.71  ? 392 ARG B H    1 
ATOM   918   H HA   . ARG A 1 55  ? -20.018 10.419  -25.473 1.00 36.63  ? 392 ARG B HA   1 
ATOM   919   H HB2  . ARG A 1 55  ? -18.930 10.490  -28.078 1.00 40.20  ? 392 ARG B HB2  1 
ATOM   920   H HB3  . ARG A 1 55  ? -18.028 10.628  -26.778 1.00 40.20  ? 392 ARG B HB3  1 
ATOM   921   H HG2  . ARG A 1 55  ? -18.672 8.452   -26.132 1.00 36.58  ? 392 ARG B HG2  1 
ATOM   922   H HG3  . ARG A 1 55  ? -19.495 8.317   -27.489 1.00 36.58  ? 392 ARG B HG3  1 
ATOM   923   H HD2  . ARG A 1 55  ? -17.367 8.739   -28.600 1.00 51.51  ? 392 ARG B HD2  1 
ATOM   924   H HD3  . ARG A 1 55  ? -16.706 8.384   -27.197 1.00 51.51  ? 392 ARG B HD3  1 
ATOM   925   H HE   . ARG A 1 55  ? -17.640 6.605   -28.927 1.00 44.49  ? 392 ARG B HE   1 
ATOM   926   H HH11 . ARG A 1 55  ? -17.254 6.945   -25.666 1.00 47.33  ? 392 ARG B HH11 1 
ATOM   927   H HH12 . ARG A 1 55  ? -17.246 5.490   -25.346 1.00 47.33  ? 392 ARG B HH12 1 
ATOM   928   H HH21 . ARG A 1 55  ? -17.625 4.385   -28.419 1.00 47.26  ? 392 ARG B HH21 1 
ATOM   929   H HH22 . ARG A 1 55  ? -17.470 3.948   -27.004 1.00 47.26  ? 392 ARG B HH22 1 
ATOM   930   N N    . ASN A 1 56  ? -20.343 13.078  -27.233 1.00 28.24  ? 393 ASN B N    1 
ATOM   931   C CA   . ASN A 1 56  ? -20.322 14.535  -27.124 1.00 31.65  ? 393 ASN B CA   1 
ATOM   932   C C    . ASN A 1 56  ? -21.154 14.973  -25.919 1.00 36.48  ? 393 ASN B C    1 
ATOM   933   O O    . ASN A 1 56  ? -20.736 15.819  -25.130 1.00 35.66  ? 393 ASN B O    1 
ATOM   934   C CB   . ASN A 1 56  ? -20.880 15.206  -28.386 1.00 41.80  ? 393 ASN B CB   1 
ATOM   935   C CG   . ASN A 1 56  ? -19.887 15.235  -29.537 1.00 55.81  ? 393 ASN B CG   1 
ATOM   936   O OD1  . ASN A 1 56  ? -18.714 14.896  -29.383 1.00 46.46  ? 393 ASN B OD1  1 
ATOM   937   N ND2  . ASN A 1 56  ? -20.360 15.668  -30.702 1.00 62.79  ? 393 ASN B ND2  1 
ATOM   938   H H    . ASN A 1 56  ? -20.638 12.778  -27.983 1.00 33.89  ? 393 ASN B H    1 
ATOM   939   H HA   . ASN A 1 56  ? -19.400 14.840  -26.993 1.00 37.98  ? 393 ASN B HA   1 
ATOM   940   H HB2  . ASN A 1 56  ? -21.665 14.717  -28.681 1.00 50.16  ? 393 ASN B HB2  1 
ATOM   941   H HB3  . ASN A 1 56  ? -21.121 16.121  -28.175 1.00 50.16  ? 393 ASN B HB3  1 
ATOM   942   H HD21 . ASN A 1 56  ? -21.182 15.910  -30.770 1.00 75.34  ? 393 ASN B HD21 1 
ATOM   943   H HD22 . ASN A 1 56  ? -19.843 15.706  -31.389 1.00 75.34  ? 393 ASN B HD22 1 
ATOM   944   N N    . ALA A 1 57  ? -22.340 14.390  -25.789 1.00 28.20  ? 394 ALA B N    1 
ATOM   945   C CA   . ALA A 1 57  ? -23.268 14.773  -24.729 1.00 30.12  ? 394 ALA B CA   1 
ATOM   946   C C    . ALA A 1 57  ? -22.712 14.426  -23.343 1.00 26.90  ? 394 ALA B C    1 
ATOM   947   O O    . ALA A 1 57  ? -22.875 15.194  -22.394 1.00 27.92  ? 394 ALA B O    1 
ATOM   948   C CB   . ALA A 1 57  ? -24.609 14.104  -24.938 1.00 24.16  ? 394 ALA B CB   1 
ATOM   949   H H    . ALA A 1 57  ? -22.634 13.767  -26.304 1.00 33.84  ? 394 ALA B H    1 
ATOM   950   H HA   . ALA A 1 57  ? -23.407 15.742  -24.763 1.00 36.14  ? 394 ALA B HA   1 
ATOM   951   H HB1  . ALA A 1 57  ? -25.203 14.368  -24.232 1.00 28.99  ? 394 ALA B HB1  1 
ATOM   952   H HB2  . ALA A 1 57  ? -24.966 14.378  -25.786 1.00 28.99  ? 394 ALA B HB2  1 
ATOM   953   H HB3  . ALA A 1 57  ? -24.488 13.151  -24.926 1.00 28.99  ? 394 ALA B HB3  1 
ATOM   954   N N    . VAL A 1 58  ? -22.065 13.272  -23.220 1.00 33.00  ? 395 VAL B N    1 
ATOM   955   C CA   . VAL A 1 58  ? -21.465 12.901  -21.943 1.00 32.29  ? 395 VAL B CA   1 
ATOM   956   C C    . VAL A 1 58  ? -20.329 13.874  -21.622 1.00 34.33  ? 395 VAL B C    1 
ATOM   957   O O    . VAL A 1 58  ? -20.231 14.358  -20.500 1.00 32.03  ? 395 VAL B O    1 
ATOM   958   C CB   . VAL A 1 58  ? -20.989 11.437  -21.928 1.00 34.32  ? 395 VAL B CB   1 
ATOM   959   C CG1  . VAL A 1 58  ? -20.136 11.163  -20.698 1.00 31.59  ? 395 VAL B CG1  1 
ATOM   960   C CG2  . VAL A 1 58  ? -22.190 10.504  -21.960 1.00 33.47  ? 395 VAL B CG2  1 
ATOM   961   H H    . VAL A 1 58  ? -21.960 12.695  -23.849 1.00 39.60  ? 395 VAL B H    1 
ATOM   962   H HA   . VAL A 1 58  ? -22.143 12.997  -21.242 1.00 38.74  ? 395 VAL B HA   1 
ATOM   963   H HB   . VAL A 1 58  ? -20.445 11.265  -22.725 1.00 41.18  ? 395 VAL B HB   1 
ATOM   964   H HG11 . VAL A 1 58  ? -19.853 10.246  -20.713 1.00 37.91  ? 395 VAL B HG11 1 
ATOM   965   H HG12 . VAL A 1 58  ? -19.371 11.743  -20.714 1.00 37.91  ? 395 VAL B HG12 1 
ATOM   966   H HG13 . VAL A 1 58  ? -20.660 11.333  -19.912 1.00 37.91  ? 395 VAL B HG13 1 
ATOM   967   H HG21 . VAL A 1 58  ? -21.880 9.596   -21.950 1.00 40.16  ? 395 VAL B HG21 1 
ATOM   968   H HG22 . VAL A 1 58  ? -22.736 10.672  -21.188 1.00 40.16  ? 395 VAL B HG22 1 
ATOM   969   H HG23 . VAL A 1 58  ? -22.693 10.670  -22.760 1.00 40.16  ? 395 VAL B HG23 1 
ATOM   970   N N    . ASP A 1 59  ? -19.501 14.193  -22.614 1.00 33.04  ? 396 ASP B N    1 
ATOM   971   C CA   . ASP A 1 59  ? -18.463 15.215  -22.453 1.00 35.07  ? 396 ASP B CA   1 
ATOM   972   C C    . ASP A 1 59  ? -19.016 16.545  -21.919 1.00 37.40  ? 396 ASP B C    1 
ATOM   973   O O    . ASP A 1 59  ? -18.390 17.184  -21.075 1.00 36.14  ? 396 ASP B O    1 
ATOM   974   C CB   . ASP A 1 59  ? -17.744 15.470  -23.782 1.00 40.35  ? 396 ASP B CB   1 
ATOM   975   C CG   . ASP A 1 59  ? -16.819 14.331  -24.180 1.00 51.78  ? 396 ASP B CG   1 
ATOM   976   O OD1  . ASP A 1 59  ? -16.412 13.553  -23.293 1.00 53.13  ? 396 ASP B OD1  1 
ATOM   977   O OD2  . ASP A 1 59  ? -16.497 14.216  -25.382 1.00 52.89  ? 396 ASP B OD2  1 
ATOM   978   H H    . ASP A 1 59  ? -19.518 13.832  -23.395 1.00 39.65  ? 396 ASP B H    1 
ATOM   979   H HA   . ASP A 1 59  ? -17.798 14.889  -21.811 1.00 42.08  ? 396 ASP B HA   1 
ATOM   980   H HB2  . ASP A 1 59  ? -18.405 15.579  -24.483 1.00 48.42  ? 396 ASP B HB2  1 
ATOM   981   H HB3  . ASP A 1 59  ? -17.209 16.276  -23.702 1.00 48.42  ? 396 ASP B HB3  1 
ATOM   982   N N    . GLU A 1 60  ? -20.177 16.964  -22.420 1.00 34.06  ? 397 GLU B N    1 
ATOM   983   C CA   . GLU A 1 60  ? -20.811 18.215  -21.986 1.00 38.32  ? 397 GLU B CA   1 
ATOM   984   C C    . GLU A 1 60  ? -21.316 18.105  -20.554 1.00 43.00  ? 397 GLU B C    1 
ATOM   985   O O    . GLU A 1 60  ? -21.201 19.033  -19.751 1.00 43.93  ? 397 GLU B O    1 
ATOM   986   C CB   . GLU A 1 60  ? -21.987 18.549  -22.902 1.00 41.29  ? 397 GLU B CB   1 
ATOM   987   C CG   . GLU A 1 60  ? -21.574 19.054  -24.262 1.00 37.00  ? 397 GLU B CG   1 
ATOM   988   C CD   . GLU A 1 60  ? -20.862 20.394  -24.175 1.00 58.79  ? 397 GLU B CD   1 
ATOM   989   O OE1  . GLU A 1 60  ? -21.169 21.171  -23.241 1.00 53.76  ? 397 GLU B OE1  1 
ATOM   990   O OE2  . GLU A 1 60  ? -19.995 20.665  -25.032 1.00 67.95  ? 397 GLU B OE2  1 
ATOM   991   H H    . GLU A 1 60  ? -20.624 16.539  -23.019 1.00 40.87  ? 397 GLU B H    1 
ATOM   992   H HA   . GLU A 1 60  ? -20.160 18.947  -22.033 1.00 45.99  ? 397 GLU B HA   1 
ATOM   993   H HB2  . GLU A 1 60  ? -22.520 17.749  -23.031 1.00 49.55  ? 397 GLU B HB2  1 
ATOM   994   H HB3  . GLU A 1 60  ? -22.525 19.238  -22.480 1.00 49.55  ? 397 GLU B HB3  1 
ATOM   995   H HG2  . GLU A 1 60  ? -20.968 18.416  -24.669 1.00 44.39  ? 397 GLU B HG2  1 
ATOM   996   H HG3  . GLU A 1 60  ? -22.363 19.166  -24.814 1.00 44.39  ? 397 GLU B HG3  1 
ATOM   997   N N    . PHE A 1 61  ? -21.907 16.956  -20.262 1.00 27.55  ? 398 PHE B N    1 
ATOM   998   C CA   . PHE A 1 61  ? -22.383 16.620  -18.935 1.00 35.30  ? 398 PHE B CA   1 
ATOM   999   C C    . PHE A 1 61  ? -21.211 16.701  -17.959 1.00 35.47  ? 398 PHE B C    1 
ATOM   1000  O O    . PHE A 1 61  ? -21.300 17.345  -16.916 1.00 34.15  ? 398 PHE B O    1 
ATOM   1001  C CB   . PHE A 1 61  ? -22.971 15.207  -19.002 1.00 35.73  ? 398 PHE B CB   1 
ATOM   1002  C CG   . PHE A 1 61  ? -23.353 14.615  -17.674 1.00 33.40  ? 398 PHE B CG   1 
ATOM   1003  C CD1  . PHE A 1 61  ? -24.347 15.183  -16.897 1.00 27.15  ? 398 PHE B CD1  1 
ATOM   1004  C CD2  . PHE A 1 61  ? -22.749 13.444  -17.235 1.00 34.25  ? 398 PHE B CD2  1 
ATOM   1005  C CE1  . PHE A 1 61  ? -24.711 14.615  -15.687 1.00 28.30  ? 398 PHE B CE1  1 
ATOM   1006  C CE2  . PHE A 1 61  ? -23.109 12.868  -16.034 1.00 31.98  ? 398 PHE B CE2  1 
ATOM   1007  C CZ   . PHE A 1 61  ? -24.095 13.456  -15.254 1.00 27.36  ? 398 PHE B CZ   1 
ATOM   1008  H H    . PHE A 1 61  ? -22.048 16.335  -20.840 1.00 33.06  ? 398 PHE B H    1 
ATOM   1009  H HA   . PHE A 1 61  ? -23.081 17.248  -18.655 1.00 42.36  ? 398 PHE B HA   1 
ATOM   1010  H HB2  . PHE A 1 61  ? -23.770 15.231  -19.552 1.00 42.87  ? 398 PHE B HB2  1 
ATOM   1011  H HB3  . PHE A 1 61  ? -22.315 14.618  -19.407 1.00 42.87  ? 398 PHE B HB3  1 
ATOM   1012  H HD1  . PHE A 1 61  ? -24.766 15.963  -17.184 1.00 32.58  ? 398 PHE B HD1  1 
ATOM   1013  H HD2  . PHE A 1 61  ? -22.089 13.045  -17.754 1.00 41.10  ? 398 PHE B HD2  1 
ATOM   1014  H HE1  . PHE A 1 61  ? -25.373 15.011  -15.167 1.00 33.97  ? 398 PHE B HE1  1 
ATOM   1015  H HE2  . PHE A 1 61  ? -22.689 12.091  -15.746 1.00 38.38  ? 398 PHE B HE2  1 
ATOM   1016  H HZ   . PHE A 1 61  ? -24.336 13.074  -14.441 1.00 32.83  ? 398 PHE B HZ   1 
ATOM   1017  N N    . LEU A 1 62  ? -20.093 16.084  -18.322 1.00 33.17  ? 399 LEU B N    1 
ATOM   1018  C CA   . LEU A 1 62  ? -18.947 16.001  -17.421 1.00 39.58  ? 399 LEU B CA   1 
ATOM   1019  C C    . LEU A 1 62  ? -18.380 17.388  -17.153 1.00 36.25  ? 399 LEU B C    1 
ATOM   1020  O O    . LEU A 1 62  ? -17.873 17.653  -16.072 1.00 38.63  ? 399 LEU B O    1 
ATOM   1021  C CB   . LEU A 1 62  ? -17.867 15.067  -17.983 1.00 40.85  ? 399 LEU B CB   1 
ATOM   1022  C CG   . LEU A 1 62  ? -18.249 13.588  -18.048 1.00 37.21  ? 399 LEU B CG   1 
ATOM   1023  C CD1  . LEU A 1 62  ? -17.285 12.786  -18.911 1.00 33.98  ? 399 LEU B CD1  1 
ATOM   1024  C CD2  . LEU A 1 62  ? -18.314 12.991  -16.658 1.00 44.64  ? 399 LEU B CD2  1 
ATOM   1025  H H    . LEU A 1 62  ? -19.970 15.705  -19.084 1.00 39.80  ? 399 LEU B H    1 
ATOM   1026  H HA   . LEU A 1 62  ? -19.247 15.630  -16.564 1.00 47.50  ? 399 LEU B HA   1 
ATOM   1027  H HB2  . LEU A 1 62  ? -17.654 15.353  -18.885 1.00 49.02  ? 399 LEU B HB2  1 
ATOM   1028  H HB3  . LEU A 1 62  ? -17.078 15.140  -17.425 1.00 49.02  ? 399 LEU B HB3  1 
ATOM   1029  H HG   . LEU A 1 62  ? -19.131 13.511  -18.444 1.00 44.66  ? 399 LEU B HG   1 
ATOM   1030  H HD11 . LEU A 1 62  ? -17.565 11.868  -18.921 1.00 40.77  ? 399 LEU B HD11 1 
ATOM   1031  H HD12 . LEU A 1 62  ? -17.294 13.141  -19.802 1.00 40.77  ? 399 LEU B HD12 1 
ATOM   1032  H HD13 . LEU A 1 62  ? -16.402 12.856  -18.539 1.00 40.77  ? 399 LEU B HD13 1 
ATOM   1033  H HD21 . LEU A 1 62  ? -18.555 12.065  -16.726 1.00 53.57  ? 399 LEU B HD21 1 
ATOM   1034  H HD22 . LEU A 1 62  ? -17.454 13.077  -16.241 1.00 53.57  ? 399 LEU B HD22 1 
ATOM   1035  H HD23 . LEU A 1 62  ? -18.975 13.464  -16.146 1.00 53.57  ? 399 LEU B HD23 1 
ATOM   1036  N N    . LEU A 1 63  ? -18.483 18.281  -18.132 1.00 37.24  ? 400 LEU B N    1 
ATOM   1037  C CA   . LEU A 1 63  ? -18.077 19.674  -17.929 1.00 51.16  ? 400 LEU B CA   1 
ATOM   1038  C C    . LEU A 1 63  ? -18.870 20.344  -16.803 1.00 45.33  ? 400 LEU B C    1 
ATOM   1039  O O    . LEU A 1 63  ? -18.317 21.123  -16.029 1.00 46.29  ? 400 LEU B O    1 
ATOM   1040  C CB   . LEU A 1 63  ? -18.237 20.488  -19.217 1.00 57.10  ? 400 LEU B CB   1 
ATOM   1041  C CG   . LEU A 1 63  ? -17.136 20.348  -20.268 1.00 66.48  ? 400 LEU B CG   1 
ATOM   1042  C CD1  . LEU A 1 63  ? -17.264 21.464  -21.291 1.00 74.56  ? 400 LEU B CD1  1 
ATOM   1043  C CD2  . LEU A 1 63  ? -15.752 20.372  -19.632 1.00 68.18  ? 400 LEU B CD2  1 
ATOM   1044  H H    . LEU A 1 63  ? -18.782 18.110  -18.920 1.00 44.68  ? 400 LEU B H    1 
ATOM   1045  H HA   . LEU A 1 63  ? -17.130 19.692  -17.680 1.00 61.39  ? 400 LEU B HA   1 
ATOM   1046  H HB2  . LEU A 1 63  ? -19.070 20.225  -19.638 1.00 68.52  ? 400 LEU B HB2  1 
ATOM   1047  H HB3  . LEU A 1 63  ? -18.284 21.426  -18.976 1.00 68.52  ? 400 LEU B HB3  1 
ATOM   1048  H HG   . LEU A 1 63  ? -17.242 19.501  -20.730 1.00 79.78  ? 400 LEU B HG   1 
ATOM   1049  H HD11 . LEU A 1 63  ? -16.570 21.368  -21.946 1.00 89.47  ? 400 LEU B HD11 1 
ATOM   1050  H HD12 . LEU A 1 63  ? -18.124 21.403  -21.713 1.00 89.47  ? 400 LEU B HD12 1 
ATOM   1051  H HD13 . LEU A 1 63  ? -17.179 22.309  -20.843 1.00 89.47  ? 400 LEU B HD13 1 
ATOM   1052  H HD21 . LEU A 1 63  ? -15.090 20.282  -20.322 1.00 81.81  ? 400 LEU B HD21 1 
ATOM   1053  H HD22 . LEU A 1 63  ? -15.634 21.207  -19.172 1.00 81.81  ? 400 LEU B HD22 1 
ATOM   1054  H HD23 . LEU A 1 63  ? -15.680 19.643  -19.012 1.00 81.81  ? 400 LEU B HD23 1 
ATOM   1055  N N    . LEU A 1 64  ? -20.161 20.037  -16.713 1.00 38.68  ? 401 LEU B N    1 
ATOM   1056  C CA   . LEU A 1 64  ? -21.025 20.604  -15.675 1.00 39.10  ? 401 LEU B CA   1 
ATOM   1057  C C    . LEU A 1 64  ? -20.737 20.062  -14.271 1.00 46.89  ? 401 LEU B C    1 
ATOM   1058  O O    . LEU A 1 64  ? -21.214 20.617  -13.278 1.00 41.22  ? 401 LEU B O    1 
ATOM   1059  C CB   . LEU A 1 64  ? -22.491 20.334  -16.015 1.00 33.04  ? 401 LEU B CB   1 
ATOM   1060  C CG   . LEU A 1 64  ? -23.225 21.400  -16.835 1.00 53.97  ? 401 LEU B CG   1 
ATOM   1061  C CD1  . LEU A 1 64  ? -22.258 22.307  -17.583 1.00 54.75  ? 401 LEU B CD1  1 
ATOM   1062  C CD2  . LEU A 1 64  ? -24.206 20.739  -17.799 1.00 54.12  ? 401 LEU B CD2  1 
ATOM   1063  H H    . LEU A 1 64  ? -20.567 19.497  -17.246 1.00 46.41  ? 401 LEU B H    1 
ATOM   1064  H HA   . LEU A 1 64  ? -20.896 21.576  -15.653 1.00 46.93  ? 401 LEU B HA   1 
ATOM   1065  H HB2  . LEU A 1 64  ? -22.535 19.506  -16.519 1.00 39.65  ? 401 LEU B HB2  1 
ATOM   1066  H HB3  . LEU A 1 64  ? -22.978 20.228  -15.183 1.00 39.65  ? 401 LEU B HB3  1 
ATOM   1067  H HG   . LEU A 1 64  ? -23.739 21.956  -16.229 1.00 64.77  ? 401 LEU B HG   1 
ATOM   1068  H HD11 . LEU A 1 64  ? -22.761 22.956  -18.080 1.00 65.70  ? 401 LEU B HD11 1 
ATOM   1069  H HD12 . LEU A 1 64  ? -21.690 22.749  -16.948 1.00 65.70  ? 401 LEU B HD12 1 
ATOM   1070  H HD13 . LEU A 1 64  ? -21.729 21.774  -18.181 1.00 65.70  ? 401 LEU B HD13 1 
ATOM   1071  H HD21 . LEU A 1 64  ? -24.655 21.422  -18.303 1.00 64.95  ? 401 LEU B HD21 1 
ATOM   1072  H HD22 . LEU A 1 64  ? -23.720 20.161  -18.392 1.00 64.95  ? 401 LEU B HD22 1 
ATOM   1073  H HD23 . LEU A 1 64  ? -24.845 20.230  -17.295 1.00 64.95  ? 401 LEU B HD23 1 
ATOM   1074  N N    . LEU A 1 65  ? -19.971 18.977  -14.186 1.00 34.64  ? 402 LEU B N    1 
ATOM   1075  C CA   . LEU A 1 65  ? -19.701 18.339  -12.900 1.00 35.89  ? 402 LEU B CA   1 
ATOM   1076  C C    . LEU A 1 65  ? -18.436 18.893  -12.238 1.00 47.98  ? 402 LEU B C    1 
ATOM   1077  O O    . LEU A 1 65  ? -17.444 19.182  -12.906 1.00 55.48  ? 402 LEU B O    1 
ATOM   1078  C CB   . LEU A 1 65  ? -19.587 16.817  -13.077 1.00 32.29  ? 402 LEU B CB   1 
ATOM   1079  C CG   . LEU A 1 65  ? -20.795 16.115  -13.703 1.00 33.97  ? 402 LEU B CG   1 
ATOM   1080  C CD1  . LEU A 1 65  ? -20.631 14.582  -13.678 1.00 30.67  ? 402 LEU B CD1  1 
ATOM   1081  C CD2  . LEU A 1 65  ? -22.066 16.507  -12.989 1.00 31.90  ? 402 LEU B CD2  1 
ATOM   1082  H H    . LEU A 1 65  ? -19.596 18.592  -14.857 1.00 41.57  ? 402 LEU B H    1 
ATOM   1083  H HA   . LEU A 1 65  ? -20.455 18.514  -12.298 1.00 43.06  ? 402 LEU B HA   1 
ATOM   1084  H HB2  . LEU A 1 65  ? -18.821 16.634  -13.643 1.00 38.75  ? 402 LEU B HB2  1 
ATOM   1085  H HB3  . LEU A 1 65  ? -19.443 16.420  -12.204 1.00 38.75  ? 402 LEU B HB3  1 
ATOM   1086  H HG   . LEU A 1 65  ? -20.876 16.392  -14.629 1.00 40.76  ? 402 LEU B HG   1 
ATOM   1087  H HD11 . LEU A 1 65  ? -21.405 14.178  -14.077 1.00 36.80  ? 402 LEU B HD11 1 
ATOM   1088  H HD12 . LEU A 1 65  ? -19.844 14.344  -14.174 1.00 36.80  ? 402 LEU B HD12 1 
ATOM   1089  H HD13 . LEU A 1 65  ? -20.543 14.293  -12.767 1.00 36.80  ? 402 LEU B HD13 1 
ATOM   1090  H HD21 . LEU A 1 65  ? -22.807 16.055  -13.399 1.00 38.28  ? 402 LEU B HD21 1 
ATOM   1091  H HD22 . LEU A 1 65  ? -21.997 16.252  -12.066 1.00 38.28  ? 402 LEU B HD22 1 
ATOM   1092  H HD23 . LEU A 1 65  ? -22.183 17.457  -13.058 1.00 38.28  ? 402 LEU B HD23 1 
ATOM   1093  N N    . ASP A 1 66  ? -18.487 19.025  -10.916 1.00 41.50  ? 403 ASP B N    1 
ATOM   1094  C CA   . ASP A 1 66  ? -17.381 19.557  -10.128 1.00 43.36  ? 403 ASP B CA   1 
ATOM   1095  C C    . ASP A 1 66  ? -17.498 19.000  -8.714  1.00 33.80  ? 403 ASP B C    1 
ATOM   1096  O O    . ASP A 1 66  ? -18.416 18.238  -8.417  1.00 37.33  ? 403 ASP B O    1 
ATOM   1097  C CB   . ASP A 1 66  ? -17.448 21.088  -10.097 1.00 53.81  ? 403 ASP B CB   1 
ATOM   1098  C CG   . ASP A 1 66  ? -16.099 21.736  -9.815  1.00 72.55  ? 403 ASP B CG   1 
ATOM   1099  O OD1  . ASP A 1 66  ? -15.129 21.014  -9.499  1.00 66.76  ? 403 ASP B OD1  1 
ATOM   1100  O OD2  . ASP A 1 66  ? -16.013 22.982  -9.906  1.00 81.40  ? 403 ASP B OD2  1 
ATOM   1101  H H    . ASP A 1 66  ? -19.170 18.807  -10.441 1.00 49.80  ? 403 ASP B H    1 
ATOM   1102  H HA   . ASP A 1 66  ? -16.525 19.279  -10.515 1.00 52.04  ? 403 ASP B HA   1 
ATOM   1103  H HB2  . ASP A 1 66  ? -17.759 21.408  -10.958 1.00 64.57  ? 403 ASP B HB2  1 
ATOM   1104  H HB3  . ASP A 1 66  ? -18.063 21.363  -9.399  1.00 64.57  ? 403 ASP B HB3  1 
ATOM   1105  N N    . LYS A 1 67  ? -16.586 19.391  -7.833  1.00 37.32  ? 404 LYS B N    1 
ATOM   1106  C CA   . LYS A 1 67  ? -16.554 18.835  -6.489  1.00 45.51  ? 404 LYS B CA   1 
ATOM   1107  C C    . LYS A 1 67  ? -17.865 19.091  -5.756  1.00 44.07  ? 404 LYS B C    1 
ATOM   1108  O O    . LYS A 1 67  ? -18.326 20.229  -5.660  1.00 37.66  ? 404 LYS B O    1 
ATOM   1109  C CB   . LYS A 1 67  ? -15.385 19.416  -5.693  1.00 58.85  ? 404 LYS B CB   1 
ATOM   1110  C CG   . LYS A 1 67  ? -15.264 18.854  -4.288  1.00 64.36  ? 404 LYS B CG   1 
ATOM   1111  C CD   . LYS A 1 67  ? -13.995 19.333  -3.596  1.00 76.78  ? 404 LYS B CD   1 
ATOM   1112  C CE   . LYS A 1 67  ? -13.894 18.790  -2.173  1.00 81.64  ? 404 LYS B CE   1 
ATOM   1113  N NZ   . LYS A 1 67  ? -13.866 17.299  -2.128  1.00 79.00  ? 404 LYS B NZ   1 
ATOM   1114  H H    . LYS A 1 67  ? -15.976 19.977  -7.988  1.00 44.78  ? 404 LYS B H    1 
ATOM   1115  H HA   . LYS A 1 67  ? -16.425 17.865  -6.549  1.00 54.61  ? 404 LYS B HA   1 
ATOM   1116  H HB2  . LYS A 1 67  ? -14.559 19.222  -6.163  1.00 70.62  ? 404 LYS B HB2  1 
ATOM   1117  H HB3  . LYS A 1 67  ? -15.503 20.376  -5.620  1.00 70.62  ? 404 LYS B HB3  1 
ATOM   1118  H HG2  . LYS A 1 67  ? -16.025 19.145  -3.761  1.00 77.23  ? 404 LYS B HG2  1 
ATOM   1119  H HG3  . LYS A 1 67  ? -15.238 17.886  -4.333  1.00 77.23  ? 404 LYS B HG3  1 
ATOM   1120  H HD2  . LYS A 1 67  ? -13.222 19.025  -4.095  1.00 92.14  ? 404 LYS B HD2  1 
ATOM   1121  H HD3  . LYS A 1 67  ? -14.001 20.302  -3.552  1.00 92.14  ? 404 LYS B HD3  1 
ATOM   1122  H HE2  . LYS A 1 67  ? -13.077 19.118  -1.767  1.00 97.97  ? 404 LYS B HE2  1 
ATOM   1123  H HE3  . LYS A 1 67  ? -14.663 19.092  -1.664  1.00 97.97  ? 404 LYS B HE3  1 
ATOM   1124  H HZ1  . LYS A 1 67  ? -13.807 17.022  -1.284  1.00 94.79  ? 404 LYS B HZ1  1 
ATOM   1125  H HZ2  . LYS A 1 67  ? -14.610 16.970  -2.489  1.00 94.79  ? 404 LYS B HZ2  1 
ATOM   1126  H HZ3  . LYS A 1 67  ? -13.164 16.995  -2.582  1.00 94.79  ? 404 LYS B HZ3  1 
ATOM   1127  N N    . GLY A 1 68  ? -18.463 18.018  -5.252  1.00 37.13  ? 405 GLY B N    1 
ATOM   1128  C CA   . GLY A 1 68  ? -19.665 18.113  -4.451  1.00 33.37  ? 405 GLY B CA   1 
ATOM   1129  C C    . GLY A 1 68  ? -20.933 18.098  -5.274  1.00 28.57  ? 405 GLY B C    1 
ATOM   1130  O O    . GLY A 1 68  ? -22.024 18.023  -4.722  1.00 33.82  ? 405 GLY B O    1 
ATOM   1131  H H    . GLY A 1 68  ? -18.184 17.212  -5.365  1.00 44.56  ? 405 GLY B H    1 
ATOM   1132  H HA2  . GLY A 1 68  ? -19.696 17.369  -3.830  1.00 40.04  ? 405 GLY B HA2  1 
ATOM   1133  H HA3  . GLY A 1 68  ? -19.644 18.937  -3.939  1.00 40.04  ? 405 GLY B HA3  1 
ATOM   1134  N N    . VAL A 1 69  ? -20.796 18.172  -6.593  1.00 32.19  ? 406 VAL B N    1 
ATOM   1135  C CA   . VAL A 1 69  ? -21.957 18.228  -7.477  1.00 34.34  ? 406 VAL B CA   1 
ATOM   1136  C C    . VAL A 1 69  ? -22.595 16.852  -7.600  1.00 34.71  ? 406 VAL B C    1 
ATOM   1137  O O    . VAL A 1 69  ? -21.884 15.853  -7.743  1.00 37.52  ? 406 VAL B O    1 
ATOM   1138  C CB   . VAL A 1 69  ? -21.564 18.721  -8.888  1.00 37.63  ? 406 VAL B CB   1 
ATOM   1139  C CG1  . VAL A 1 69  ? -22.691 18.475  -9.878  1.00 35.33  ? 406 VAL B CG1  1 
ATOM   1140  C CG2  . VAL A 1 69  ? -21.183 20.207  -8.857  1.00 34.35  ? 406 VAL B CG2  1 
ATOM   1141  H H    . VAL A 1 69  ? -20.040 18.190  -7.003  1.00 38.63  ? 406 VAL B H    1 
ATOM   1142  H HA   . VAL A 1 69  ? -22.621 18.846  -7.106  1.00 41.21  ? 406 VAL B HA   1 
ATOM   1143  H HB   . VAL A 1 69  ? -20.781 18.216  -9.193  1.00 45.16  ? 406 VAL B HB   1 
ATOM   1144  H HG11 . VAL A 1 69  ? -22.420 18.790  -10.743 1.00 42.40  ? 406 VAL B HG11 1 
ATOM   1145  H HG12 . VAL A 1 69  ? -22.875 17.534  -9.914  1.00 42.40  ? 406 VAL B HG12 1 
ATOM   1146  H HG13 . VAL A 1 69  ? -23.472 18.951  -9.586  1.00 42.40  ? 406 VAL B HG13 1 
ATOM   1147  H HG21 . VAL A 1 69  ? -20.944 20.486  -9.744  1.00 41.22  ? 406 VAL B HG21 1 
ATOM   1148  H HG22 . VAL A 1 69  ? -21.936 20.715  -8.545  1.00 41.22  ? 406 VAL B HG22 1 
ATOM   1149  H HG23 . VAL A 1 69  ? -20.438 20.326  -8.263  1.00 41.22  ? 406 VAL B HG23 1 
ATOM   1150  N N    . TYR A 1 70  ? -23.926 16.795  -7.529  1.00 28.27  ? 407 TYR B N    1 
ATOM   1151  C CA   . TYR A 1 70  ? -24.650 15.548  -7.778  1.00 29.01  ? 407 TYR B CA   1 
ATOM   1152  C C    . TYR A 1 70  ? -24.827 15.368  -9.279  1.00 28.59  ? 407 TYR B C    1 
ATOM   1153  O O    . TYR A 1 70  ? -25.390 16.226  -9.940  1.00 30.30  ? 407 TYR B O    1 
ATOM   1154  C CB   . TYR A 1 70  ? -26.048 15.547  -7.149  1.00 29.77  ? 407 TYR B CB   1 
ATOM   1155  C CG   . TYR A 1 70  ? -26.112 15.478  -5.637  1.00 24.19  ? 407 TYR B CG   1 
ATOM   1156  C CD1  . TYR A 1 70  ? -27.323 15.219  -4.993  1.00 23.82  ? 407 TYR B CD1  1 
ATOM   1157  C CD2  . TYR A 1 70  ? -24.986 15.683  -4.859  1.00 25.70  ? 407 TYR B CD2  1 
ATOM   1158  C CE1  . TYR A 1 70  ? -27.402 15.154  -3.613  1.00 22.29  ? 407 TYR B CE1  1 
ATOM   1159  C CE2  . TYR A 1 70  ? -25.055 15.625  -3.471  1.00 24.92  ? 407 TYR B CE2  1 
ATOM   1160  C CZ   . TYR A 1 70  ? -26.269 15.362  -2.863  1.00 28.59  ? 407 TYR B CZ   1 
ATOM   1161  O OH   . TYR A 1 70  ? -26.348 15.300  -1.497  1.00 29.55  ? 407 TYR B OH   1 
ATOM   1162  H H    . TYR A 1 70  ? -24.432 17.463  -7.338  1.00 33.93  ? 407 TYR B H    1 
ATOM   1163  H HA   . TYR A 1 70  ? -24.141 14.789  -7.424  1.00 34.81  ? 407 TYR B HA   1 
ATOM   1164  H HB2  . TYR A 1 70  ? -26.502 16.361  -7.418  1.00 35.72  ? 407 TYR B HB2  1 
ATOM   1165  H HB3  . TYR A 1 70  ? -26.534 14.781  -7.492  1.00 35.72  ? 407 TYR B HB3  1 
ATOM   1166  H HD1  . TYR A 1 70  ? -28.089 15.080  -5.501  1.00 28.59  ? 407 TYR B HD1  1 
ATOM   1167  H HD2  . TYR A 1 70  ? -24.171 15.861  -5.270  1.00 30.84  ? 407 TYR B HD2  1 
ATOM   1168  H HE1  . TYR A 1 70  ? -28.216 14.979  -3.198  1.00 26.75  ? 407 TYR B HE1  1 
ATOM   1169  H HE2  . TYR A 1 70  ? -24.292 15.762  -2.957  1.00 29.91  ? 407 TYR B HE2  1 
ATOM   1170  H HH   . TYR A 1 70  ? -26.607 14.558  -1.264  1.00 35.46  ? 407 TYR B HH   1 
ATOM   1171  N N    . GLY A 1 71  ? -24.382 14.235  -9.803  1.00 25.82  ? 408 GLY B N    1 
ATOM   1172  C CA   . GLY A 1 71  ? -24.580 13.905  -11.202 1.00 25.67  ? 408 GLY B CA   1 
ATOM   1173  C C    . GLY A 1 71  ? -25.407 12.648  -11.388 1.00 30.89  ? 408 GLY B C    1 
ATOM   1174  O O    . GLY A 1 71  ? -25.168 11.627  -10.724 1.00 26.87  ? 408 GLY B O    1 
ATOM   1175  H H    . GLY A 1 71  ? -23.955 13.633  -9.361  1.00 30.98  ? 408 GLY B H    1 
ATOM   1176  H HA2  . GLY A 1 71  ? -25.032 14.639  -11.646 1.00 30.81  ? 408 GLY B HA2  1 
ATOM   1177  H HA3  . GLY A 1 71  ? -23.719 13.772  -11.627 1.00 30.81  ? 408 GLY B HA3  1 
ATOM   1178  N N    . LEU A 1 72  ? -26.373 12.720  -12.299 1.00 26.43  ? 409 LEU B N    1 
ATOM   1179  C CA   . LEU A 1 72  ? -27.294 11.623  -12.542 1.00 24.21  ? 409 LEU B CA   1 
ATOM   1180  C C    . LEU A 1 72  ? -27.390 11.350  -14.032 1.00 24.43  ? 409 LEU B C    1 
ATOM   1181  O O    . LEU A 1 72  ? -27.626 12.262  -14.816 1.00 25.13  ? 409 LEU B O    1 
ATOM   1182  C CB   . LEU A 1 72  ? -28.682 11.974  -11.987 1.00 20.16  ? 409 LEU B CB   1 
ATOM   1183  C CG   . LEU A 1 72  ? -29.783 10.915  -12.137 1.00 21.68  ? 409 LEU B CG   1 
ATOM   1184  C CD1  . LEU A 1 72  ? -30.832 11.136  -11.047 1.00 25.40  ? 409 LEU B CD1  1 
ATOM   1185  C CD2  . LEU A 1 72  ? -30.438 10.939  -13.518 1.00 23.52  ? 409 LEU B CD2  1 
ATOM   1186  H H    . LEU A 1 72  ? -26.515 13.406  -12.797 1.00 31.71  ? 409 LEU B H    1 
ATOM   1187  H HA   . LEU A 1 72  ? -26.970 10.813  -12.093 1.00 29.06  ? 409 LEU B HA   1 
ATOM   1188  H HB2  . LEU A 1 72  ? -28.590 12.157  -11.040 1.00 24.19  ? 409 LEU B HB2  1 
ATOM   1189  H HB3  . LEU A 1 72  ? -28.992 12.774  -12.439 1.00 24.19  ? 409 LEU B HB3  1 
ATOM   1190  H HG   . LEU A 1 72  ? -29.396 10.036  -12.005 1.00 26.02  ? 409 LEU B HG   1 
ATOM   1191  H HD11 . LEU A 1 72  ? -31.522 10.475  -11.139 1.00 30.48  ? 409 LEU B HD11 1 
ATOM   1192  H HD12 . LEU A 1 72  ? -30.412 11.054  -10.188 1.00 30.48  ? 409 LEU B HD12 1 
ATOM   1193  H HD13 . LEU A 1 72  ? -31.205 12.015  -11.147 1.00 30.48  ? 409 LEU B HD13 1 
ATOM   1194  H HD21 . LEU A 1 72  ? -31.115 10.260  -13.554 1.00 28.23  ? 409 LEU B HD21 1 
ATOM   1195  H HD22 . LEU A 1 72  ? -30.831 11.803  -13.662 1.00 28.23  ? 409 LEU B HD22 1 
ATOM   1196  H HD23 . LEU A 1 72  ? -29.768 10.770  -14.184 1.00 28.23  ? 409 LEU B HD23 1 
ATOM   1197  N N    . LEU A 1 73  ? -27.210 10.093  -14.428 1.00 20.15  ? 410 LEU B N    1 
ATOM   1198  C CA   . LEU A 1 73  ? -27.393 9.704   -15.819 1.00 24.34  ? 410 LEU B CA   1 
ATOM   1199  C C    . LEU A 1 73  ? -28.621 8.809   -15.905 1.00 23.67  ? 410 LEU B C    1 
ATOM   1200  O O    . LEU A 1 73  ? -28.718 7.846   -15.173 1.00 25.76  ? 410 LEU B O    1 
ATOM   1201  C CB   . LEU A 1 73  ? -26.157 8.945   -16.323 1.00 21.70  ? 410 LEU B CB   1 
ATOM   1202  C CG   . LEU A 1 73  ? -26.244 8.420   -17.758 1.00 25.28  ? 410 LEU B CG   1 
ATOM   1203  C CD1  . LEU A 1 73  ? -25.969 9.560   -18.715 1.00 27.21  ? 410 LEU B CD1  1 
ATOM   1204  C CD2  . LEU A 1 73  ? -25.256 7.276   -17.995 1.00 37.19  ? 410 LEU B CD2  1 
ATOM   1205  H H    . LEU A 1 73  ? -26.981 9.447   -13.909 1.00 24.18  ? 410 LEU B H    1 
ATOM   1206  H HA   . LEU A 1 73  ? -27.534 10.497  -16.377 1.00 29.20  ? 410 LEU B HA   1 
ATOM   1207  H HB2  . LEU A 1 73  ? -25.392 9.540   -16.278 1.00 26.04  ? 410 LEU B HB2  1 
ATOM   1208  H HB3  . LEU A 1 73  ? -26.008 8.182   -15.743 1.00 26.04  ? 410 LEU B HB3  1 
ATOM   1209  H HG   . LEU A 1 73  ? -27.140 8.090   -17.925 1.00 30.34  ? 410 LEU B HG   1 
ATOM   1210  H HD11 . LEU A 1 73  ? -26.023 9.232   -19.616 1.00 32.66  ? 410 LEU B HD11 1 
ATOM   1211  H HD12 . LEU A 1 73  ? -26.623 10.249  -18.577 1.00 32.66  ? 410 LEU B HD12 1 
ATOM   1212  H HD13 . LEU A 1 73  ? -25.089 9.906   -18.545 1.00 32.66  ? 410 LEU B HD13 1 
ATOM   1213  H HD21 . LEU A 1 73  ? -25.340 6.974   -18.903 1.00 44.63  ? 410 LEU B HD21 1 
ATOM   1214  H HD22 . LEU A 1 73  ? -24.365 7.595   -17.837 1.00 44.63  ? 410 LEU B HD22 1 
ATOM   1215  H HD23 . LEU A 1 73  ? -25.459 6.558   -17.391 1.00 44.63  ? 410 LEU B HD23 1 
ATOM   1216  N N    . TYR A 1 74  ? -29.575 9.131   -16.776 1.00 29.61  ? 411 TYR B N    1 
ATOM   1217  C CA   . TYR A 1 74  ? -30.663 8.196   -17.071 1.00 17.74  ? 411 TYR B CA   1 
ATOM   1218  C C    . TYR A 1 74  ? -30.568 7.843   -18.548 1.00 24.20  ? 411 TYR B C    1 
ATOM   1219  O O    . TYR A 1 74  ? -30.437 8.736   -19.390 1.00 21.20  ? 411 TYR B O    1 
ATOM   1220  C CB   . TYR A 1 74  ? -32.044 8.802   -16.764 1.00 19.73  ? 411 TYR B CB   1 
ATOM   1221  C CG   . TYR A 1 74  ? -33.205 7.968   -17.288 1.00 20.62  ? 411 TYR B CG   1 
ATOM   1222  C CD1  . TYR A 1 74  ? -33.660 6.849   -16.579 1.00 20.79  ? 411 TYR B CD1  1 
ATOM   1223  C CD2  . TYR A 1 74  ? -33.835 8.281   -18.485 1.00 24.65  ? 411 TYR B CD2  1 
ATOM   1224  C CE1  . TYR A 1 74  ? -34.726 6.080   -17.052 1.00 20.18  ? 411 TYR B CE1  1 
ATOM   1225  C CE2  . TYR A 1 74  ? -34.903 7.505   -18.968 1.00 25.17  ? 411 TYR B CE2  1 
ATOM   1226  C CZ   . TYR A 1 74  ? -35.331 6.396   -18.235 1.00 23.02  ? 411 TYR B CZ   1 
ATOM   1227  O OH   . TYR A 1 74  ? -36.381 5.612   -18.688 1.00 19.91  ? 411 TYR B OH   1 
ATOM   1228  H H    . TYR A 1 74  ? -29.616 9.874   -17.206 1.00 35.53  ? 411 TYR B H    1 
ATOM   1229  H HA   . TYR A 1 74  ? -30.552 7.378   -16.543 1.00 21.28  ? 411 TYR B HA   1 
ATOM   1230  H HB2  . TYR A 1 74  ? -32.145 8.881   -15.803 1.00 23.67  ? 411 TYR B HB2  1 
ATOM   1231  H HB3  . TYR A 1 74  ? -32.099 9.679   -17.175 1.00 23.67  ? 411 TYR B HB3  1 
ATOM   1232  H HD1  . TYR A 1 74  ? -33.254 6.621   -15.774 1.00 24.95  ? 411 TYR B HD1  1 
ATOM   1233  H HD2  . TYR A 1 74  ? -33.547 9.017   -18.975 1.00 29.58  ? 411 TYR B HD2  1 
ATOM   1234  H HE1  . TYR A 1 74  ? -35.013 5.339   -16.568 1.00 24.21  ? 411 TYR B HE1  1 
ATOM   1235  H HE2  . TYR A 1 74  ? -35.316 7.724   -19.771 1.00 30.20  ? 411 TYR B HE2  1 
ATOM   1236  H HH   . TYR A 1 74  ? -36.993 5.620   -18.143 1.00 23.89  ? 411 TYR B HH   1 
ATOM   1237  N N    . TYR A 1 75  ? -30.597 6.550   -18.861 1.00 18.74  ? 412 TYR B N    1 
ATOM   1238  C CA   . TYR A 1 75  ? -30.588 6.102   -20.251 1.00 24.29  ? 412 TYR B CA   1 
ATOM   1239  C C    . TYR A 1 75  ? -31.740 5.135   -20.515 1.00 23.36  ? 412 TYR B C    1 
ATOM   1240  O O    . TYR A 1 75  ? -31.896 4.149   -19.807 1.00 22.62  ? 412 TYR B O    1 
ATOM   1241  C CB   . TYR A 1 75  ? -29.260 5.417   -20.604 1.00 23.10  ? 412 TYR B CB   1 
ATOM   1242  C CG   . TYR A 1 75  ? -29.318 4.775   -21.961 1.00 20.99  ? 412 TYR B CG   1 
ATOM   1243  C CD1  . TYR A 1 75  ? -29.365 5.560   -23.121 1.00 19.82  ? 412 TYR B CD1  1 
ATOM   1244  C CD2  . TYR A 1 75  ? -29.352 3.397   -22.099 1.00 21.60  ? 412 TYR B CD2  1 
ATOM   1245  C CE1  . TYR A 1 75  ? -29.440 4.981   -24.367 1.00 24.53  ? 412 TYR B CE1  1 
ATOM   1246  C CE2  . TYR A 1 75  ? -29.426 2.806   -23.355 1.00 27.60  ? 412 TYR B CE2  1 
ATOM   1247  C CZ   . TYR A 1 75  ? -29.470 3.607   -24.481 1.00 28.55  ? 412 TYR B CZ   1 
ATOM   1248  O OH   . TYR A 1 75  ? -29.540 3.022   -25.720 1.00 25.64  ? 412 TYR B OH   1 
ATOM   1249  H H    . TYR A 1 75  ? -30.623 5.911   -18.286 1.00 22.49  ? 412 TYR B H    1 
ATOM   1250  H HA   . TYR A 1 75  ? -30.698 6.877   -20.840 1.00 29.15  ? 412 TYR B HA   1 
ATOM   1251  H HB2  . TYR A 1 75  ? -28.550 6.077   -20.610 1.00 27.72  ? 412 TYR B HB2  1 
ATOM   1252  H HB3  . TYR A 1 75  ? -29.071 4.726   -19.949 1.00 27.72  ? 412 TYR B HB3  1 
ATOM   1253  H HD1  . TYR A 1 75  ? -29.350 6.487   -23.047 1.00 23.78  ? 412 TYR B HD1  1 
ATOM   1254  H HD2  . TYR A 1 75  ? -29.328 2.859   -21.341 1.00 25.92  ? 412 TYR B HD2  1 
ATOM   1255  H HE1  . TYR A 1 75  ? -29.467 5.514   -25.129 1.00 29.44  ? 412 TYR B HE1  1 
ATOM   1256  H HE2  . TYR A 1 75  ? -29.446 1.880   -23.437 1.00 33.12  ? 412 TYR B HE2  1 
ATOM   1257  H HH   . TYR A 1 75  ? -30.219 2.566   -25.777 1.00 30.77  ? 412 TYR B HH   1 
ATOM   1258  N N    . ALA A 1 76  ? -32.540 5.432   -21.534 1.00 24.63  ? 413 ALA B N    1 
ATOM   1259  C CA   . ALA A 1 76  ? -33.644 4.584   -21.966 1.00 21.06  ? 413 ALA B CA   1 
ATOM   1260  C C    . ALA A 1 76  ? -33.394 4.191   -23.413 1.00 31.02  ? 413 ALA B C    1 
ATOM   1261  O O    . ALA A 1 76  ? -33.321 5.057   -24.268 1.00 24.71  ? 413 ALA B O    1 
ATOM   1262  C CB   . ALA A 1 76  ? -34.959 5.345   -21.880 1.00 13.65  ? 413 ALA B CB   1 
ATOM   1263  H H    . ALA A 1 76  ? -32.459 6.146   -22.007 1.00 29.56  ? 413 ALA B H    1 
ATOM   1264  H HA   . ALA A 1 76  ? -33.695 3.777   -21.412 1.00 25.27  ? 413 ALA B HA   1 
ATOM   1265  H HB1  . ALA A 1 76  ? -35.672 4.771   -22.168 1.00 16.38  ? 413 ALA B HB1  1 
ATOM   1266  H HB2  . ALA A 1 76  ? -35.103 5.617   -20.971 1.00 16.38  ? 413 ALA B HB2  1 
ATOM   1267  H HB3  . ALA A 1 76  ? -34.910 6.117   -22.449 1.00 16.38  ? 413 ALA B HB3  1 
ATOM   1268  N N    . GLY A 1 77  ? -33.272 2.900   -23.695 1.00 21.25  ? 414 GLY B N    1 
ATOM   1269  C CA   . GLY A 1 77  ? -33.021 2.453   -25.060 1.00 20.16  ? 414 GLY B CA   1 
ATOM   1270  C C    . GLY A 1 77  ? -32.336 1.101   -25.040 1.00 30.33  ? 414 GLY B C    1 
ATOM   1271  O O    . GLY A 1 77  ? -32.252 0.487   -23.988 1.00 24.17  ? 414 GLY B O    1 
ATOM   1272  H H    . GLY A 1 77  ? -33.330 2.265   -23.118 1.00 25.49  ? 414 GLY B H    1 
ATOM   1273  H HA2  . GLY A 1 77  ? -33.858 2.376   -25.543 1.00 24.20  ? 414 GLY B HA2  1 
ATOM   1274  H HA3  . GLY A 1 77  ? -32.450 3.089   -25.518 1.00 24.20  ? 414 GLY B HA3  1 
ATOM   1275  N N    . HIS A 1 78  ? -31.855 0.627   -26.186 1.00 21.03  ? 415 HIS B N    1 
ATOM   1276  C CA   . HIS A 1 78  ? -31.177 -0.673  -26.229 1.00 19.65  ? 415 HIS B CA   1 
ATOM   1277  C C    . HIS A 1 78  ? -29.866 -0.666  -25.452 1.00 25.82  ? 415 HIS B C    1 
ATOM   1278  O O    . HIS A 1 78  ? -29.104 0.297   -25.486 1.00 23.66  ? 415 HIS B O    1 
ATOM   1279  C CB   . HIS A 1 78  ? -30.914 -1.102  -27.675 1.00 26.54  ? 415 HIS B CB   1 
ATOM   1280  C CG   . HIS A 1 78  ? -32.143 -1.558  -28.386 1.00 28.21  ? 415 HIS B CG   1 
ATOM   1281  N ND1  . HIS A 1 78  ? -32.987 -2.513  -27.864 1.00 32.61  ? 415 HIS B ND1  1 
ATOM   1282  C CD2  . HIS A 1 78  ? -32.686 -1.176  -29.566 1.00 25.61  ? 415 HIS B CD2  1 
ATOM   1283  C CE1  . HIS A 1 78  ? -33.994 -2.706  -28.697 1.00 39.60  ? 415 HIS B CE1  1 
ATOM   1284  N NE2  . HIS A 1 78  ? -33.836 -1.905  -29.736 1.00 25.36  ? 415 HIS B NE2  1 
ATOM   1285  H H    . HIS A 1 78  ? -31.906 1.029   -26.944 1.00 25.23  ? 415 HIS B H    1 
ATOM   1286  H HA   . HIS A 1 78  ? -31.761 -1.345  -25.820 1.00 23.59  ? 415 HIS B HA   1 
ATOM   1287  H HB2  . HIS A 1 78  ? -30.548 -0.348  -28.165 1.00 31.84  ? 415 HIS B HB2  1 
ATOM   1288  H HB3  . HIS A 1 78  ? -30.279 -1.835  -27.675 1.00 31.84  ? 415 HIS B HB3  1 
ATOM   1289  H HD2  . HIS A 1 78  ? -32.343 -0.540  -30.152 1.00 30.73  ? 415 HIS B HD2  1 
ATOM   1290  H HE1  . HIS A 1 78  ? -34.696 -3.304  -28.573 1.00 47.52  ? 415 HIS B HE1  1 
ATOM   1291  N N    . GLY A 1 79  ? -29.603 -1.768  -24.758 1.00 33.59  ? 416 GLY B N    1 
ATOM   1292  C CA   . GLY A 1 79  ? -28.375 -1.912  -24.004 1.00 23.93  ? 416 GLY B CA   1 
ATOM   1293  C C    . GLY A 1 79  ? -27.999 -3.372  -23.875 1.00 27.14  ? 416 GLY B C    1 
ATOM   1294  O O    . GLY A 1 79  ? -28.766 -4.257  -24.252 1.00 26.75  ? 416 GLY B O    1 
ATOM   1295  H H    . GLY A 1 79  ? -30.127 -2.448  -24.709 1.00 40.31  ? 416 GLY B H    1 
ATOM   1296  H HA2  . GLY A 1 79  ? -27.655 -1.442  -24.454 1.00 28.72  ? 416 GLY B HA2  1 
ATOM   1297  H HA3  . GLY A 1 79  ? -28.487 -1.537  -23.116 1.00 28.72  ? 416 GLY B HA3  1 
ATOM   1298  N N    . TYR A 1 80  ? -26.807 -3.629  -23.360 1.00 19.52  ? 417 TYR B N    1 
ATOM   1299  C CA   . TYR A 1 80  ? -26.435 -4.998  -23.011 1.00 21.32  ? 417 TYR B CA   1 
ATOM   1300  C C    . TYR A 1 80  ? -25.371 -4.949  -21.940 1.00 28.19  ? 417 TYR B C    1 
ATOM   1301  O O    . TYR A 1 80  ? -24.906 -3.871  -21.570 1.00 27.08  ? 417 TYR B O    1 
ATOM   1302  C CB   . TYR A 1 80  ? -25.934 -5.767  -24.242 1.00 22.59  ? 417 TYR B CB   1 
ATOM   1303  C CG   . TYR A 1 80  ? -24.573 -5.349  -24.746 1.00 33.27  ? 417 TYR B CG   1 
ATOM   1304  C CD1  . TYR A 1 80  ? -24.439 -4.302  -25.655 1.00 40.33  ? 417 TYR B CD1  1 
ATOM   1305  C CD2  . TYR A 1 80  ? -23.421 -6.018  -24.343 1.00 38.74  ? 417 TYR B CD2  1 
ATOM   1306  C CE1  . TYR A 1 80  ? -23.202 -3.921  -26.128 1.00 33.72  ? 417 TYR B CE1  1 
ATOM   1307  C CE2  . TYR A 1 80  ? -22.175 -5.643  -24.816 1.00 41.04  ? 417 TYR B CE2  1 
ATOM   1308  C CZ   . TYR A 1 80  ? -22.074 -4.597  -25.712 1.00 46.48  ? 417 TYR B CZ   1 
ATOM   1309  O OH   . TYR A 1 80  ? -20.843 -4.210  -26.187 1.00 47.46  ? 417 TYR B OH   1 
ATOM   1310  H H    . TYR A 1 80  ? -26.200 -3.041  -23.203 1.00 23.42  ? 417 TYR B H    1 
ATOM   1311  H HA   . TYR A 1 80  ? -27.217 -5.466  -22.650 1.00 25.59  ? 417 TYR B HA   1 
ATOM   1312  H HB2  . TYR A 1 80  ? -25.887 -6.709  -24.019 1.00 27.11  ? 417 TYR B HB2  1 
ATOM   1313  H HB3  . TYR A 1 80  ? -26.566 -5.635  -24.966 1.00 27.11  ? 417 TYR B HB3  1 
ATOM   1314  H HD1  . TYR A 1 80  ? -25.197 -3.845  -25.940 1.00 48.40  ? 417 TYR B HD1  1 
ATOM   1315  H HD2  . TYR A 1 80  ? -23.489 -6.724  -23.741 1.00 46.49  ? 417 TYR B HD2  1 
ATOM   1316  H HE1  . TYR A 1 80  ? -23.129 -3.217  -26.731 1.00 40.46  ? 417 TYR B HE1  1 
ATOM   1317  H HE2  . TYR A 1 80  ? -21.412 -6.094  -24.535 1.00 49.24  ? 417 TYR B HE2  1 
ATOM   1318  H HH   . TYR A 1 80  ? -20.489 -4.831  -26.587 1.00 56.96  ? 417 TYR B HH   1 
ATOM   1319  N N    . GLU A 1 81  ? -24.991 -6.119  -21.445 1.00 24.48  ? 418 GLU B N    1 
ATOM   1320  C CA   . GLU A 1 81  ? -24.036 -6.217  -20.356 1.00 28.18  ? 418 GLU B CA   1 
ATOM   1321  C C    . GLU A 1 81  ? -23.176 -7.458  -20.571 1.00 22.63  ? 418 GLU B C    1 
ATOM   1322  O O    . GLU A 1 81  ? -23.695 -8.565  -20.690 1.00 25.81  ? 418 GLU B O    1 
ATOM   1323  C CB   . GLU A 1 81  ? -24.771 -6.305  -19.015 1.00 21.99  ? 418 GLU B CB   1 
ATOM   1324  C CG   . GLU A 1 81  ? -23.864 -6.126  -17.820 1.00 28.06  ? 418 GLU B CG   1 
ATOM   1325  C CD   . GLU A 1 81  ? -24.622 -5.665  -16.599 1.00 38.58  ? 418 GLU B CD   1 
ATOM   1326  O OE1  . GLU A 1 81  ? -25.419 -4.711  -16.718 1.00 35.05  ? 418 GLU B OE1  1 
ATOM   1327  O OE2  . GLU A 1 81  ? -24.427 -6.261  -15.526 1.00 31.96  ? 418 GLU B OE2  1 
ATOM   1328  H H    . GLU A 1 81  ? -25.276 -6.879  -21.728 1.00 29.37  ? 418 GLU B H    1 
ATOM   1329  H HA   . GLU A 1 81  ? -23.457 -5.426  -20.349 1.00 33.82  ? 418 GLU B HA   1 
ATOM   1330  H HB2  . GLU A 1 81  ? -25.448 -5.611  -18.982 1.00 26.39  ? 418 GLU B HB2  1 
ATOM   1331  H HB3  . GLU A 1 81  ? -25.190 -7.177  -18.944 1.00 26.39  ? 418 GLU B HB3  1 
ATOM   1332  H HG2  . GLU A 1 81  ? -23.442 -6.974  -17.611 1.00 33.68  ? 418 GLU B HG2  1 
ATOM   1333  H HG3  . GLU A 1 81  ? -23.191 -5.460  -18.028 1.00 33.68  ? 418 GLU B HG3  1 
ATOM   1334  N N    . ASN A 1 82  ? -21.868 -7.238  -20.673 1.00 29.74  ? 419 ASN B N    1 
ATOM   1335  C CA   . ASN A 1 82  ? -20.883 -8.311  -20.765 1.00 30.57  ? 419 ASN B CA   1 
ATOM   1336  C C    . ASN A 1 82  ? -19.855 -8.189  -19.663 1.00 38.39  ? 419 ASN B C    1 
ATOM   1337  O O    . ASN A 1 82  ? -19.192 -7.152  -19.541 1.00 31.56  ? 419 ASN B O    1 
ATOM   1338  C CB   . ASN A 1 82  ? -20.147 -8.250  -22.099 1.00 31.33  ? 419 ASN B CB   1 
ATOM   1339  C CG   . ASN A 1 82  ? -20.955 -8.823  -23.231 1.00 44.03  ? 419 ASN B CG   1 
ATOM   1340  O OD1  . ASN A 1 82  ? -22.158 -9.031  -23.098 1.00 41.23  ? 419 ASN B OD1  1 
ATOM   1341  N ND2  . ASN A 1 82  ? -20.299 -9.086  -24.356 1.00 56.86  ? 419 ASN B ND2  1 
ATOM   1342  H H    . ASN A 1 82  ? -21.518 -6.453  -20.692 1.00 35.69  ? 419 ASN B H    1 
ATOM   1343  H HA   . ASN A 1 82  ? -21.329 -9.180  -20.688 1.00 36.69  ? 419 ASN B HA   1 
ATOM   1344  H HB2  . ASN A 1 82  ? -19.949 -7.324  -22.309 1.00 37.60  ? 419 ASN B HB2  1 
ATOM   1345  H HB3  . ASN A 1 82  ? -19.324 -8.758  -22.029 1.00 37.60  ? 419 ASN B HB3  1 
ATOM   1346  H HD21 . ASN A 1 82  ? -19.455 -8.928  -24.409 1.00 68.24  ? 419 ASN B HD21 1 
ATOM   1347  H HD22 . ASN A 1 82  ? -20.718 -9.415  -25.031 1.00 68.24  ? 419 ASN B HD22 1 
ATOM   1348  N N    . PHE A 1 83  ? -19.729 -9.251  -18.870 1.00 40.53  ? 420 PHE B N    1 
ATOM   1349  C CA   . PHE A 1 83  ? -18.633 -9.396  -17.918 1.00 48.05  ? 420 PHE B CA   1 
ATOM   1350  C C    . PHE A 1 83  ? -18.617 -8.296  -16.867 1.00 44.91  ? 420 PHE B C    1 
ATOM   1351  O O    . PHE A 1 83  ? -17.553 -7.864  -16.427 1.00 51.30  ? 420 PHE B O    1 
ATOM   1352  C CB   . PHE A 1 83  ? -17.303 -9.421  -18.671 1.00 59.50  ? 420 PHE B CB   1 
ATOM   1353  C CG   . PHE A 1 83  ? -17.185 -10.559 -19.643 1.00 67.20  ? 420 PHE B CG   1 
ATOM   1354  C CD1  . PHE A 1 83  ? -16.798 -10.334 -20.954 1.00 74.80  ? 420 PHE B CD1  1 
ATOM   1355  C CD2  . PHE A 1 83  ? -17.465 -11.856 -19.243 1.00 67.03  ? 420 PHE B CD2  1 
ATOM   1356  C CE1  . PHE A 1 83  ? -16.692 -11.383 -21.849 1.00 73.85  ? 420 PHE B CE1  1 
ATOM   1357  C CE2  . PHE A 1 83  ? -17.360 -12.907 -20.130 1.00 68.92  ? 420 PHE B CE2  1 
ATOM   1358  C CZ   . PHE A 1 83  ? -16.973 -12.672 -21.435 1.00 73.60  ? 420 PHE B CZ   1 
ATOM   1359  H H    . PHE A 1 83  ? -20.278 -9.913  -18.866 1.00 48.63  ? 420 PHE B H    1 
ATOM   1360  H HA   . PHE A 1 83  ? -18.730 -10.253 -17.453 1.00 57.67  ? 420 PHE B HA   1 
ATOM   1361  H HB2  . PHE A 1 83  ? -17.210 -8.594  -19.170 1.00 71.40  ? 420 PHE B HB2  1 
ATOM   1362  H HB3  . PHE A 1 83  ? -16.580 -9.502  -18.029 1.00 71.40  ? 420 PHE B HB3  1 
ATOM   1363  H HD1  . PHE A 1 83  ? -16.608 -9.468  -21.236 1.00 89.76  ? 420 PHE B HD1  1 
ATOM   1364  H HD2  . PHE A 1 83  ? -17.726 -12.020 -18.365 1.00 80.44  ? 420 PHE B HD2  1 
ATOM   1365  H HE1  . PHE A 1 83  ? -16.431 -11.222 -22.727 1.00 88.62  ? 420 PHE B HE1  1 
ATOM   1366  H HE2  . PHE A 1 83  ? -17.550 -13.773 -19.849 1.00 82.70  ? 420 PHE B HE2  1 
ATOM   1367  H HZ   . PHE A 1 83  ? -16.902 -13.379 -22.034 1.00 88.32  ? 420 PHE B HZ   1 
ATOM   1368  N N    . GLY A 1 84  ? -19.799 -7.839  -16.476 1.00 43.64  ? 421 GLY B N    1 
ATOM   1369  C CA   . GLY A 1 84  ? -19.917 -6.829  -15.443 1.00 48.82  ? 421 GLY B CA   1 
ATOM   1370  C C    . GLY A 1 84  ? -19.966 -5.403  -15.965 1.00 44.28  ? 421 GLY B C    1 
ATOM   1371  O O    . GLY A 1 84  ? -20.231 -4.478  -15.196 1.00 49.16  ? 421 GLY B O    1 
ATOM   1372  H H    . GLY A 1 84  ? -20.552 -8.102  -16.797 1.00 52.37  ? 421 GLY B H    1 
ATOM   1373  H HA2  . GLY A 1 84  ? -20.726 -6.990  -14.933 1.00 58.58  ? 421 GLY B HA2  1 
ATOM   1374  H HA3  . GLY A 1 84  ? -19.161 -6.902  -14.840 1.00 58.58  ? 421 GLY B HA3  1 
ATOM   1375  N N    . ASN A 1 85  ? -19.707 -5.214  -17.260 1.00 28.64  ? 422 ASN B N    1 
ATOM   1376  C CA   . ASN A 1 85  ? -19.780 -3.875  -17.859 1.00 27.41  ? 422 ASN B CA   1 
ATOM   1377  C C    . ASN A 1 85  ? -21.078 -3.684  -18.650 1.00 31.05  ? 422 ASN B C    1 
ATOM   1378  O O    . ASN A 1 85  ? -21.407 -4.496  -19.503 1.00 28.64  ? 422 ASN B O    1 
ATOM   1379  C CB   . ASN A 1 85  ? -18.576 -3.647  -18.766 1.00 32.69  ? 422 ASN B CB   1 
ATOM   1380  C CG   . ASN A 1 85  ? -17.262 -3.696  -18.006 1.00 45.27  ? 422 ASN B CG   1 
ATOM   1381  O OD1  . ASN A 1 85  ? -16.408 -4.542  -18.272 1.00 48.81  ? 422 ASN B OD1  1 
ATOM   1382  N ND2  . ASN A 1 85  ? -17.102 -2.792  -17.045 1.00 38.50  ? 422 ASN B ND2  1 
ATOM   1383  H H    . ASN A 1 85  ? -19.488 -5.837  -17.811 1.00 34.36  ? 422 ASN B H    1 
ATOM   1384  H HA   . ASN A 1 85  ? -19.757 -3.203  -17.146 1.00 32.89  ? 422 ASN B HA   1 
ATOM   1385  H HB2  . ASN A 1 85  ? -18.556 -4.337  -19.447 1.00 39.23  ? 422 ASN B HB2  1 
ATOM   1386  H HB3  . ASN A 1 85  ? -18.652 -2.773  -19.180 1.00 39.23  ? 422 ASN B HB3  1 
ATOM   1387  H HD21 . ASN A 1 85  ? -17.725 -2.222  -16.883 1.00 46.20  ? 422 ASN B HD21 1 
ATOM   1388  H HD22 . ASN A 1 85  ? -16.376 -2.778  -16.585 1.00 46.20  ? 422 ASN B HD22 1 
ATOM   1389  N N    . SER A 1 86  ? -21.813 -2.619  -18.338 1.00 24.49  ? 423 SER B N    1 
ATOM   1390  C CA   . SER A 1 86  ? -23.052 -2.280  -19.027 1.00 28.86  ? 423 SER B CA   1 
ATOM   1391  C C    . SER A 1 86  ? -22.711 -1.385  -20.205 1.00 28.07  ? 423 SER B C    1 
ATOM   1392  O O    . SER A 1 86  ? -21.863 -0.518  -20.081 1.00 27.90  ? 423 SER B O    1 
ATOM   1393  C CB   . SER A 1 86  ? -23.984 -1.499  -18.098 1.00 26.97  ? 423 SER B CB   1 
ATOM   1394  O OG   . SER A 1 86  ? -24.219 -2.196  -16.886 1.00 32.03  ? 423 SER B OG   1 
ATOM   1395  H H    . SER A 1 86  ? -21.607 -2.064  -17.714 1.00 29.39  ? 423 SER B H    1 
ATOM   1396  H HA   . SER A 1 86  ? -23.504 -3.089  -19.346 1.00 34.63  ? 423 SER B HA   1 
ATOM   1397  H HB2  . SER A 1 86  ? -23.577 -0.643  -17.893 1.00 32.36  ? 423 SER B HB2  1 
ATOM   1398  H HB3  . SER A 1 86  ? -24.832 -1.361  -18.549 1.00 32.36  ? 423 SER B HB3  1 
ATOM   1399  H HG   . SER A 1 86  ? -23.811 -2.908  -16.887 1.00 38.44  ? 423 SER B HG   1 
ATOM   1400  N N    . PHE A 1 87  ? -23.392 -1.584  -21.329 1.00 26.86  ? 424 PHE B N    1 
ATOM   1401  C CA   . PHE A 1 87  ? -23.167 -0.777  -22.525 1.00 27.83  ? 424 PHE B CA   1 
ATOM   1402  C C    . PHE A 1 87  ? -24.470 -0.190  -23.031 1.00 25.50  ? 424 PHE B C    1 
ATOM   1403  O O    . PHE A 1 87  ? -25.501 -0.864  -23.073 1.00 24.41  ? 424 PHE B O    1 
ATOM   1404  C CB   . PHE A 1 87  ? -22.526 -1.613  -23.636 1.00 36.31  ? 424 PHE B CB   1 
ATOM   1405  C CG   . PHE A 1 87  ? -21.141 -2.091  -23.310 1.00 49.66  ? 424 PHE B CG   1 
ATOM   1406  C CD1  . PHE A 1 87  ? -20.036 -1.337  -23.652 1.00 48.31  ? 424 PHE B CD1  1 
ATOM   1407  C CD2  . PHE A 1 87  ? -20.947 -3.295  -22.654 1.00 51.77  ? 424 PHE B CD2  1 
ATOM   1408  C CE1  . PHE A 1 87  ? -18.761 -1.777  -23.350 1.00 43.90  ? 424 PHE B CE1  1 
ATOM   1409  C CE2  . PHE A 1 87  ? -19.676 -3.739  -22.353 1.00 53.91  ? 424 PHE B CE2  1 
ATOM   1410  C CZ   . PHE A 1 87  ? -18.586 -2.980  -22.696 1.00 54.50  ? 424 PHE B CZ   1 
ATOM   1411  H H    . PHE A 1 87  ? -23.997 -2.187  -21.426 1.00 32.23  ? 424 PHE B H    1 
ATOM   1412  H HA   . PHE A 1 87  ? -22.561 -0.038  -22.308 1.00 33.40  ? 424 PHE B HA   1 
ATOM   1413  H HB2  . PHE A 1 87  ? -23.079 -2.394  -23.798 1.00 43.57  ? 424 PHE B HB2  1 
ATOM   1414  H HB3  . PHE A 1 87  ? -22.473 -1.075  -24.441 1.00 43.57  ? 424 PHE B HB3  1 
ATOM   1415  H HD1  . PHE A 1 87  ? -20.151 -0.525  -24.091 1.00 57.97  ? 424 PHE B HD1  1 
ATOM   1416  H HD2  . PHE A 1 87  ? -21.683 -3.813  -22.418 1.00 62.13  ? 424 PHE B HD2  1 
ATOM   1417  H HE1  . PHE A 1 87  ? -18.023 -1.262  -23.584 1.00 52.68  ? 424 PHE B HE1  1 
ATOM   1418  H HE2  . PHE A 1 87  ? -19.558 -4.550  -21.912 1.00 64.69  ? 424 PHE B HE2  1 
ATOM   1419  H HZ   . PHE A 1 87  ? -17.729 -3.278  -22.493 1.00 65.40  ? 424 PHE B HZ   1 
ATOM   1420  N N    . MET A 1 88  ? -24.414 1.069   -23.432 1.00 27.59  ? 425 MET B N    1 
ATOM   1421  C CA   . MET A 1 88  ? -25.559 1.726   -24.040 1.00 33.05  ? 425 MET B CA   1 
ATOM   1422  C C    . MET A 1 88  ? -25.355 1.736   -25.551 1.00 30.26  ? 425 MET B C    1 
ATOM   1423  O O    . MET A 1 88  ? -24.278 2.079   -26.033 1.00 29.66  ? 425 MET B O    1 
ATOM   1424  C CB   . MET A 1 88  ? -25.697 3.142   -23.494 1.00 33.06  ? 425 MET B CB   1 
ATOM   1425  C CG   . MET A 1 88  ? -25.951 3.187   -21.989 1.00 25.03  ? 425 MET B CG   1 
ATOM   1426  S SD   . MET A 1 88  ? -25.903 4.867   -21.343 1.00 27.29  ? 425 MET B SD   1 
ATOM   1427  C CE   . MET A 1 88  ? -24.209 5.300   -21.731 1.00 27.24  ? 425 MET B CE   1 
ATOM   1428  H H    . MET A 1 88  ? -23.718 1.570   -23.363 1.00 33.11  ? 425 MET B H    1 
ATOM   1429  H HA   . MET A 1 88  ? -26.375 1.228   -23.823 1.00 39.66  ? 425 MET B HA   1 
ATOM   1430  H HB2  . MET A 1 88  ? -24.877 3.628   -23.673 1.00 39.67  ? 425 MET B HB2  1 
ATOM   1431  H HB3  . MET A 1 88  ? -26.442 3.578   -23.936 1.00 39.67  ? 425 MET B HB3  1 
ATOM   1432  H HG2  . MET A 1 88  ? -26.828 2.817   -21.804 1.00 30.03  ? 425 MET B HG2  1 
ATOM   1433  H HG3  . MET A 1 88  ? -25.268 2.669   -21.535 1.00 30.03  ? 425 MET B HG3  1 
ATOM   1434  H HE1  . MET A 1 88  ? -24.040 6.197   -21.433 1.00 32.69  ? 425 MET B HE1  1 
ATOM   1435  H HE2  . MET A 1 88  ? -23.621 4.689   -21.282 1.00 32.69  ? 425 MET B HE2  1 
ATOM   1436  H HE3  . MET A 1 88  ? -24.082 5.240   -22.680 1.00 32.69  ? 425 MET B HE3  1 
ATOM   1437  N N    . VAL A 1 89  ? -26.386 1.340   -26.291 1.00 21.69  ? 426 VAL B N    1 
ATOM   1438  C CA   . VAL A 1 89  ? -26.269 1.181   -27.740 1.00 30.08  ? 426 VAL B CA   1 
ATOM   1439  C C    . VAL A 1 89  ? -26.881 2.386   -28.460 1.00 28.50  ? 426 VAL B C    1 
ATOM   1440  O O    . VAL A 1 89  ? -28.067 2.653   -28.281 1.00 24.30  ? 426 VAL B O    1 
ATOM   1441  C CB   . VAL A 1 89  ? -27.022 -0.061  -28.220 1.00 26.75  ? 426 VAL B CB   1 
ATOM   1442  C CG1  . VAL A 1 89  ? -26.837 -0.239  -29.727 1.00 22.69  ? 426 VAL B CG1  1 
ATOM   1443  C CG2  . VAL A 1 89  ? -26.552 -1.322  -27.457 1.00 30.48  ? 426 VAL B CG2  1 
ATOM   1444  H H    . VAL A 1 89  ? -27.166 1.157   -25.979 1.00 26.03  ? 426 VAL B H    1 
ATOM   1445  H HA   . VAL A 1 89  ? -25.326 1.102   -27.995 1.00 36.10  ? 426 VAL B HA   1 
ATOM   1446  H HB   . VAL A 1 89  ? -27.978 0.059   -28.045 1.00 32.10  ? 426 VAL B HB   1 
ATOM   1447  H HG11 . VAL A 1 89  ? -27.316 -1.022  -30.010 1.00 27.23  ? 426 VAL B HG11 1 
ATOM   1448  H HG12 . VAL A 1 89  ? -27.181 0.536   -30.177 1.00 27.23  ? 426 VAL B HG12 1 
ATOM   1449  H HG13 . VAL A 1 89  ? -25.902 -0.341  -29.917 1.00 27.23  ? 426 VAL B HG13 1 
ATOM   1450  H HG21 . VAL A 1 89  ? -27.042 -2.083  -27.780 1.00 36.58  ? 426 VAL B HG21 1 
ATOM   1451  H HG22 . VAL A 1 89  ? -25.613 -1.448  -27.610 1.00 36.58  ? 426 VAL B HG22 1 
ATOM   1452  H HG23 . VAL A 1 89  ? -26.718 -1.200  -26.520 1.00 36.58  ? 426 VAL B HG23 1 
ATOM   1453  N N    . PRO A 1 90  ? -26.079 3.101   -29.274 1.00 37.10  ? 427 PRO B N    1 
ATOM   1454  C CA   . PRO A 1 90  ? -26.537 4.280   -30.030 1.00 36.35  ? 427 PRO B CA   1 
ATOM   1455  C C    . PRO A 1 90  ? -27.399 3.913   -31.238 1.00 35.68  ? 427 PRO B C    1 
ATOM   1456  O O    . PRO A 1 90  ? -27.345 2.773   -31.691 1.00 26.66  ? 427 PRO B O    1 
ATOM   1457  C CB   . PRO A 1 90  ? -25.230 4.941   -30.508 1.00 43.30  ? 427 PRO B CB   1 
ATOM   1458  C CG   . PRO A 1 90  ? -24.110 4.211   -29.821 1.00 48.19  ? 427 PRO B CG   1 
ATOM   1459  C CD   . PRO A 1 90  ? -24.640 2.853   -29.472 1.00 44.00  ? 427 PRO B CD   1 
ATOM   1460  H HA   . PRO A 1 90  ? -27.026 4.898   -29.448 1.00 43.62  ? 427 PRO B HA   1 
ATOM   1461  H HB2  . PRO A 1 90  ? -25.155 4.849   -31.471 1.00 51.96  ? 427 PRO B HB2  1 
ATOM   1462  H HB3  . PRO A 1 90  ? -25.230 5.878   -30.255 1.00 51.96  ? 427 PRO B HB3  1 
ATOM   1463  H HG2  . PRO A 1 90  ? -23.355 4.135   -30.424 1.00 57.83  ? 427 PRO B HG2  1 
ATOM   1464  H HG3  . PRO A 1 90  ? -23.856 4.692   -29.017 1.00 57.83  ? 427 PRO B HG3  1 
ATOM   1465  H HD2  . PRO A 1 90  ? -24.500 2.235   -30.207 1.00 52.80  ? 427 PRO B HD2  1 
ATOM   1466  H HD3  . PRO A 1 90  ? -24.235 2.531   -28.652 1.00 52.80  ? 427 PRO B HD3  1 
ATOM   1467  N N    . VAL A 1 91  ? -28.169 4.869   -31.759 1.00 23.13  ? 428 VAL B N    1 
ATOM   1468  C CA   . VAL A 1 91  ? -29.145 4.569   -32.803 1.00 25.32  ? 428 VAL B CA   1 
ATOM   1469  C C    . VAL A 1 91  ? -28.494 4.188   -34.140 1.00 22.46  ? 428 VAL B C    1 
ATOM   1470  O O    . VAL A 1 91  ? -29.153 3.643   -35.022 1.00 34.70  ? 428 VAL B O    1 
ATOM   1471  C CB   . VAL A 1 91  ? -30.160 5.730   -32.993 1.00 32.76  ? 428 VAL B CB   1 
ATOM   1472  C CG1  . VAL A 1 91  ? -31.000 5.890   -31.739 1.00 35.62  ? 428 VAL B CG1  1 
ATOM   1473  C CG2  . VAL A 1 91  ? -29.455 7.030   -33.328 1.00 30.93  ? 428 VAL B CG2  1 
ATOM   1474  H H    . VAL A 1 91  ? -28.146 5.696   -31.524 1.00 27.76  ? 428 VAL B H    1 
ATOM   1475  H HA   . VAL A 1 91  ? -29.662 3.789   -32.511 1.00 30.38  ? 428 VAL B HA   1 
ATOM   1476  H HB   . VAL A 1 91  ? -30.761 5.511   -33.735 1.00 39.32  ? 428 VAL B HB   1 
ATOM   1477  H HG11 . VAL A 1 91  ? -31.622 6.610   -31.870 1.00 42.74  ? 428 VAL B HG11 1 
ATOM   1478  H HG12 . VAL A 1 91  ? -31.475 5.072   -31.575 1.00 42.74  ? 428 VAL B HG12 1 
ATOM   1479  H HG13 . VAL A 1 91  ? -30.422 6.087   -30.999 1.00 42.74  ? 428 VAL B HG13 1 
ATOM   1480  H HG21 . VAL A 1 91  ? -30.112 7.722   -33.438 1.00 37.11  ? 428 VAL B HG21 1 
ATOM   1481  H HG22 . VAL A 1 91  ? -28.858 7.255   -32.611 1.00 37.11  ? 428 VAL B HG22 1 
ATOM   1482  H HG23 . VAL A 1 91  ? -28.961 6.915   -34.143 1.00 37.11  ? 428 VAL B HG23 1 
ATOM   1483  N N    . ASP A 1 92  ? -27.205 4.467   -34.283 1.00 34.52  ? 429 ASP B N    1 
ATOM   1484  C CA   . ASP A 1 92  ? -26.492 4.118   -35.509 1.00 44.97  ? 429 ASP B CA   1 
ATOM   1485  C C    . ASP A 1 92  ? -25.651 2.836   -35.375 1.00 40.10  ? 429 ASP B C    1 
ATOM   1486  O O    . ASP A 1 92  ? -24.844 2.530   -36.242 1.00 28.60  ? 429 ASP B O    1 
ATOM   1487  C CB   . ASP A 1 92  ? -25.612 5.284   -35.962 1.00 33.23  ? 429 ASP B CB   1 
ATOM   1488  C CG   . ASP A 1 92  ? -24.499 5.610   -34.977 1.00 44.84  ? 429 ASP B CG   1 
ATOM   1489  O OD1  . ASP A 1 92  ? -24.514 5.106   -33.828 1.00 39.74  ? 429 ASP B OD1  1 
ATOM   1490  O OD2  . ASP A 1 92  ? -23.607 6.396   -35.356 1.00 36.41  ? 429 ASP B OD2  1 
ATOM   1491  H H    . ASP A 1 92  ? -26.720 4.856   -33.689 1.00 41.42  ? 429 ASP B H    1 
ATOM   1492  H HA   . ASP A 1 92  ? -27.153 3.960   -36.215 1.00 53.96  ? 429 ASP B HA   1 
ATOM   1493  H HB2  . ASP A 1 92  ? -25.202 5.058   -36.811 1.00 39.88  ? 429 ASP B HB2  1 
ATOM   1494  H HB3  . ASP A 1 92  ? -26.164 6.076   -36.061 1.00 39.88  ? 429 ASP B HB3  1 
ATOM   1495  N N    . ALA A 1 93  ? -25.842 2.081   -34.301 1.00 34.71  ? 430 ALA B N    1 
ATOM   1496  C CA   . ALA A 1 93  ? -25.075 0.844   -34.108 1.00 35.06  ? 430 ALA B CA   1 
ATOM   1497  C C    . ALA A 1 93  ? -25.288 -0.130  -35.271 1.00 40.58  ? 430 ALA B C    1 
ATOM   1498  O O    . ALA A 1 93  ? -26.416 -0.355  -35.697 1.00 32.54  ? 430 ALA B O    1 
ATOM   1499  C CB   . ALA A 1 93  ? -25.461 0.177   -32.796 1.00 35.17  ? 430 ALA B CB   1 
ATOM   1500  H H    . ALA A 1 93  ? -26.402 2.256   -33.672 1.00 41.65  ? 430 ALA B H    1 
ATOM   1501  H HA   . ALA A 1 93  ? -24.120 1.063   -34.068 1.00 42.07  ? 430 ALA B HA   1 
ATOM   1502  H HB1  . ALA A 1 93  ? -24.948 -0.628  -32.693 1.00 42.21  ? 430 ALA B HB1  1 
ATOM   1503  H HB2  . ALA A 1 93  ? -25.274 0.780   -32.073 1.00 42.21  ? 430 ALA B HB2  1 
ATOM   1504  H HB3  . ALA A 1 93  ? -26.397 -0.032  -32.816 1.00 42.21  ? 430 ALA B HB3  1 
ATOM   1505  N N    . PRO A 1 94  ? -24.199 -0.720  -35.784 1.00 38.20  ? 431 PRO B N    1 
ATOM   1506  C CA   . PRO A 1 94  ? -24.351 -1.737  -36.828 1.00 43.97  ? 431 PRO B CA   1 
ATOM   1507  C C    . PRO A 1 94  ? -24.999 -2.999  -36.272 1.00 34.09  ? 431 PRO B C    1 
ATOM   1508  O O    . PRO A 1 94  ? -25.127 -3.130  -35.054 1.00 31.14  ? 431 PRO B O    1 
ATOM   1509  C CB   . PRO A 1 94  ? -22.906 -2.034  -37.234 1.00 52.56  ? 431 PRO B CB   1 
ATOM   1510  C CG   . PRO A 1 94  ? -22.102 -1.716  -36.022 1.00 48.64  ? 431 PRO B CG   1 
ATOM   1511  C CD   . PRO A 1 94  ? -22.791 -0.540  -35.390 1.00 39.96  ? 431 PRO B CD   1 
ATOM   1512  H HA   . PRO A 1 94  ? -24.859 -1.395  -37.593 1.00 52.77  ? 431 PRO B HA   1 
ATOM   1513  H HB2  . PRO A 1 94  ? -22.818 -2.970  -37.472 1.00 63.07  ? 431 PRO B HB2  1 
ATOM   1514  H HB3  . PRO A 1 94  ? -22.651 -1.464  -37.976 1.00 63.07  ? 431 PRO B HB3  1 
ATOM   1515  H HG2  . PRO A 1 94  ? -22.103 -2.478  -35.421 1.00 58.37  ? 431 PRO B HG2  1 
ATOM   1516  H HG3  . PRO A 1 94  ? -21.197 -1.485  -36.282 1.00 58.37  ? 431 PRO B HG3  1 
ATOM   1517  H HD2  . PRO A 1 94  ? -22.702 -0.574  -34.425 1.00 47.95  ? 431 PRO B HD2  1 
ATOM   1518  H HD3  . PRO A 1 94  ? -22.442 0.290   -35.751 1.00 47.95  ? 431 PRO B HD3  1 
ATOM   1519  N N    . ASN A 1 95  ? -25.406 -3.909  -37.149 1.00 34.18  ? 432 ASN B N    1 
ATOM   1520  C CA   . ASN A 1 95  ? -25.855 -5.228  -36.725 1.00 33.33  ? 432 ASN B CA   1 
ATOM   1521  C C    . ASN A 1 95  ? -25.077 -6.302  -37.470 1.00 43.66  ? 432 ASN B C    1 
ATOM   1522  O O    . ASN A 1 95  ? -25.149 -6.378  -38.695 1.00 44.56  ? 432 ASN B O    1 
ATOM   1523  C CB   . ASN A 1 95  ? -27.346 -5.411  -36.996 1.00 42.74  ? 432 ASN B CB   1 
ATOM   1524  C CG   . ASN A 1 95  ? -27.871 -6.732  -36.465 1.00 48.34  ? 432 ASN B CG   1 
ATOM   1525  O OD1  . ASN A 1 95  ? -27.332 -7.284  -35.504 1.00 51.22  ? 432 ASN B OD1  1 
ATOM   1526  N ND2  . ASN A 1 95  ? -28.923 -7.248  -37.088 1.00 53.15  ? 432 ASN B ND2  1 
ATOM   1527  H H    . ASN A 1 95  ? -25.430 -3.787  -38.000 1.00 41.01  ? 432 ASN B H    1 
ATOM   1528  H HA   . ASN A 1 95  ? -25.696 -5.336  -35.764 1.00 40.00  ? 432 ASN B HA   1 
ATOM   1529  H HB2  . ASN A 1 95  ? -27.837 -4.695  -36.563 1.00 51.29  ? 432 ASN B HB2  1 
ATOM   1530  H HB3  . ASN A 1 95  ? -27.499 -5.389  -37.954 1.00 51.29  ? 432 ASN B HB3  1 
ATOM   1531  H HD21 . ASN A 1 95  ? -29.272 -6.835  -37.757 1.00 63.79  ? 432 ASN B HD21 1 
ATOM   1532  H HD22 . ASN A 1 95  ? -29.257 -7.995  -36.823 1.00 63.79  ? 432 ASN B HD22 1 
ATOM   1533  N N    . PRO A 1 96  ? -24.329 -7.140  -36.737 1.00 47.71  ? 433 PRO B N    1 
ATOM   1534  C CA   . PRO A 1 96  ? -24.197 -7.076  -35.277 1.00 45.49  ? 433 PRO B CA   1 
ATOM   1535  C C    . PRO A 1 96  ? -23.348 -5.887  -34.848 1.00 41.96  ? 433 PRO B C    1 
ATOM   1536  O O    . PRO A 1 96  ? -22.781 -5.197  -35.694 1.00 36.72  ? 433 PRO B O    1 
ATOM   1537  C CB   . PRO A 1 96  ? -23.503 -8.396  -34.927 1.00 43.23  ? 433 PRO B CB   1 
ATOM   1538  C CG   . PRO A 1 96  ? -22.764 -8.779  -36.158 1.00 48.75  ? 433 PRO B CG   1 
ATOM   1539  C CD   . PRO A 1 96  ? -23.579 -8.270  -37.314 1.00 49.88  ? 433 PRO B CD   1 
ATOM   1540  H HA   . PRO A 1 96  ? -25.076 -7.035  -34.845 1.00 54.58  ? 433 PRO B HA   1 
ATOM   1541  H HB2  . PRO A 1 96  ? -22.890 -8.259  -34.188 1.00 51.88  ? 433 PRO B HB2  1 
ATOM   1542  H HB3  . PRO A 1 96  ? -24.167 -9.066  -34.703 1.00 51.88  ? 433 PRO B HB3  1 
ATOM   1543  H HG2  . PRO A 1 96  ? -21.888 -8.363  -36.152 1.00 58.51  ? 433 PRO B HG2  1 
ATOM   1544  H HG3  . PRO A 1 96  ? -22.682 -9.744  -36.199 1.00 58.51  ? 433 PRO B HG3  1 
ATOM   1545  H HD2  . PRO A 1 96  ? -22.998 -7.961  -38.027 1.00 59.86  ? 433 PRO B HD2  1 
ATOM   1546  H HD3  . PRO A 1 96  ? -24.189 -8.957  -37.625 1.00 59.86  ? 433 PRO B HD3  1 
ATOM   1547  N N    . TYR A 1 97  ? -23.277 -5.640  -33.547 1.00 32.50  ? 434 TYR B N    1 
ATOM   1548  C CA   . TYR A 1 97  ? -22.421 -4.587  -33.030 1.00 41.99  ? 434 TYR B CA   1 
ATOM   1549  C C    . TYR A 1 97  ? -21.564 -5.120  -31.900 1.00 41.24  ? 434 TYR B C    1 
ATOM   1550  O O    . TYR A 1 97  ? -21.726 -6.247  -31.464 1.00 40.16  ? 434 TYR B O    1 
ATOM   1551  C CB   . TYR A 1 97  ? -23.253 -3.409  -32.533 1.00 49.00  ? 434 TYR B CB   1 
ATOM   1552  C CG   . TYR A 1 97  ? -24.278 -3.781  -31.490 1.00 47.25  ? 434 TYR B CG   1 
ATOM   1553  C CD1  . TYR A 1 97  ? -25.566 -4.145  -31.857 1.00 46.06  ? 434 TYR B CD1  1 
ATOM   1554  C CD2  . TYR A 1 97  ? -23.960 -3.767  -30.141 1.00 45.12  ? 434 TYR B CD2  1 
ATOM   1555  C CE1  . TYR A 1 97  ? -26.512 -4.479  -30.912 1.00 35.68  ? 434 TYR B CE1  1 
ATOM   1556  C CE2  . TYR A 1 97  ? -24.903 -4.099  -29.181 1.00 35.52  ? 434 TYR B CE2  1 
ATOM   1557  C CZ   . TYR A 1 97  ? -26.176 -4.459  -29.572 1.00 35.41  ? 434 TYR B CZ   1 
ATOM   1558  O OH   . TYR A 1 97  ? -27.122 -4.795  -28.626 1.00 36.84  ? 434 TYR B OH   1 
ATOM   1559  H H    . TYR A 1 97  ? -23.714 -6.069  -32.943 1.00 39.01  ? 434 TYR B H    1 
ATOM   1560  H HA   . TYR A 1 97  ? -21.830 -4.268  -33.744 1.00 50.38  ? 434 TYR B HA   1 
ATOM   1561  H HB2  . TYR A 1 97  ? -22.659 -2.750  -32.142 1.00 58.79  ? 434 TYR B HB2  1 
ATOM   1562  H HB3  . TYR A 1 97  ? -23.725 -3.020  -33.286 1.00 58.79  ? 434 TYR B HB3  1 
ATOM   1563  H HD1  . TYR A 1 97  ? -25.797 -4.159  -32.758 1.00 55.27  ? 434 TYR B HD1  1 
ATOM   1564  H HD2  . TYR A 1 97  ? -23.103 -3.523  -29.875 1.00 54.14  ? 434 TYR B HD2  1 
ATOM   1565  H HE1  . TYR A 1 97  ? -27.371 -4.721  -31.175 1.00 42.82  ? 434 TYR B HE1  1 
ATOM   1566  H HE2  . TYR A 1 97  ? -24.677 -4.086  -28.279 1.00 42.62  ? 434 TYR B HE2  1 
ATOM   1567  H HH   . TYR A 1 97  ? -27.246 -4.165  -28.116 1.00 44.21  ? 434 TYR B HH   1 
ATOM   1568  N N    . ARG A 1 98  ? -20.659 -4.279  -31.427 1.00 30.51  ? 435 ARG B N    1 
ATOM   1569  C CA   . ARG A 1 98  ? -19.727 -4.638  -30.379 1.00 29.48  ? 435 ARG B CA   1 
ATOM   1570  C C    . ARG A 1 98  ? -19.456 -3.413  -29.511 1.00 38.95  ? 435 ARG B C    1 
ATOM   1571  O O    . ARG A 1 98  ? -20.018 -2.332  -29.745 1.00 33.17  ? 435 ARG B O    1 
ATOM   1572  C CB   . ARG A 1 98  ? -18.422 -5.142  -30.994 1.00 41.11  ? 435 ARG B CB   1 
ATOM   1573  C CG   . ARG A 1 98  ? -18.616 -5.938  -32.270 1.00 62.31  ? 435 ARG B CG   1 
ATOM   1574  C CD   . ARG A 1 98  ? -17.287 -6.255  -32.930 1.00 74.72  ? 435 ARG B CD   1 
ATOM   1575  N NE   . ARG A 1 98  ? -16.540 -7.263  -32.188 1.00 77.15  ? 435 ARG B NE   1 
ATOM   1576  C CZ   . ARG A 1 98  ? -15.258 -7.543  -32.390 1.00 84.82  ? 435 ARG B CZ   1 
ATOM   1577  N NH1  . ARG A 1 98  ? -14.569 -6.880  -33.308 1.00 84.14  ? 435 ARG B NH1  1 
ATOM   1578  N NH2  . ARG A 1 98  ? -14.661 -8.481  -31.667 1.00 85.93  ? 435 ARG B NH2  1 
ATOM   1579  H H    . ARG A 1 98  ? -20.565 -3.471  -31.707 1.00 36.61  ? 435 ARG B H    1 
ATOM   1580  H HA   . ARG A 1 98  ? -20.110 -5.346  -29.820 1.00 35.38  ? 435 ARG B HA   1 
ATOM   1581  H HB2  . ARG A 1 98  ? -17.859 -4.380  -31.203 1.00 49.33  ? 435 ARG B HB2  1 
ATOM   1582  H HB3  . ARG A 1 98  ? -17.974 -5.715  -30.352 1.00 49.33  ? 435 ARG B HB3  1 
ATOM   1583  H HG2  . ARG A 1 98  ? -19.060 -6.775  -32.061 1.00 74.77  ? 435 ARG B HG2  1 
ATOM   1584  H HG3  . ARG A 1 98  ? -19.150 -5.420  -32.893 1.00 74.77  ? 435 ARG B HG3  1 
ATOM   1585  H HD2  . ARG A 1 98  ? -17.447 -6.594  -33.824 1.00 89.67  ? 435 ARG B HD2  1 
ATOM   1586  H HD3  . ARG A 1 98  ? -16.749 -5.448  -32.969 1.00 89.67  ? 435 ARG B HD3  1 
ATOM   1587  H HE   . ARG A 1 98  ? -16.958 -7.706  -31.580 1.00 92.58  ? 435 ARG B HE   1 
ATOM   1588  H HH11 . ARG A 1 98  ? -14.954 -6.271  -33.778 1.00 100.97 ? 435 ARG B HH11 1 
ATOM   1589  H HH12 . ARG A 1 98  ? -13.738 -7.061  -33.436 1.00 100.97 ? 435 ARG B HH12 1 
ATOM   1590  H HH21 . ARG A 1 98  ? -15.106 -8.911  -31.069 1.00 103.12 ? 435 ARG B HH21 1 
ATOM   1591  H HH22 . ARG A 1 98  ? -13.830 -8.660  -31.795 1.00 103.12 ? 435 ARG B HH22 1 
ATOM   1592  N N    . SER A 1 99  ? -18.585 -3.585  -28.522 1.00 38.04  ? 436 SER B N    1 
ATOM   1593  C CA   . SER A 1 99  ? -18.354 -2.568  -27.506 1.00 44.38  ? 436 SER B CA   1 
ATOM   1594  C C    . SER A 1 99  ? -17.810 -1.280  -28.096 1.00 45.36  ? 436 SER B C    1 
ATOM   1595  O O    . SER A 1 99  ? -18.081 -0.192  -27.577 1.00 38.33  ? 436 SER B O    1 
ATOM   1596  C CB   . SER A 1 99  ? -17.414 -3.091  -26.416 1.00 52.21  ? 436 SER B CB   1 
ATOM   1597  O OG   . SER A 1 99  ? -16.246 -3.669  -26.968 1.00 46.13  ? 436 SER B OG   1 
ATOM   1598  H H    . SER A 1 99  ? -18.109 -4.294  -28.417 1.00 45.65  ? 436 SER B H    1 
ATOM   1599  H HA   . SER A 1 99  ? -19.210 -2.356  -27.078 1.00 53.25  ? 436 SER B HA   1 
ATOM   1600  H HB2  . SER A 1 99  ? -17.156 -2.352  -25.843 1.00 62.65  ? 436 SER B HB2  1 
ATOM   1601  H HB3  . SER A 1 99  ? -17.880 -3.764  -25.896 1.00 62.65  ? 436 SER B HB3  1 
ATOM   1602  H HG   . SER A 1 99  ? -16.272 -3.626  -27.787 1.00 55.36  ? 436 SER B HG   1 
ATOM   1603  N N    . GLU A 1 100 ? -17.052 -1.388  -29.183 1.00 31.35  ? 437 GLU B N    1 
ATOM   1604  C CA   . GLU A 1 100 ? -16.529 -0.185  -29.827 1.00 51.80  ? 437 GLU B CA   1 
ATOM   1605  C C    . GLU A 1 100 ? -17.623 0.723   -30.419 1.00 46.09  ? 437 GLU B C    1 
ATOM   1606  O O    . GLU A 1 100 ? -17.387 1.916   -30.664 1.00 38.78  ? 437 GLU B O    1 
ATOM   1607  C CB   . GLU A 1 100 ? -15.513 -0.562  -30.909 1.00 67.09  ? 437 GLU B CB   1 
ATOM   1608  C CG   . GLU A 1 100 ? -16.081 -1.401  -32.032 1.00 73.84  ? 437 GLU B CG   1 
ATOM   1609  C CD   . GLU A 1 100 ? -15.491 -2.791  -32.064 1.00 91.41  ? 437 GLU B CD   1 
ATOM   1610  O OE1  . GLU A 1 100 ? -15.534 -3.478  -31.020 1.00 91.29  ? 437 GLU B OE1  1 
ATOM   1611  O OE2  . GLU A 1 100 ? -14.976 -3.192  -33.131 1.00 99.60  ? 437 GLU B OE2  1 
ATOM   1612  H H    . GLU A 1 100 ? -16.830 -2.127  -29.561 1.00 37.62  ? 437 GLU B H    1 
ATOM   1613  H HA   . GLU A 1 100 ? -16.052 0.340   -29.151 1.00 62.16  ? 437 GLU B HA   1 
ATOM   1614  H HB2  . GLU A 1 100 ? -15.159 0.253   -31.300 1.00 80.51  ? 437 GLU B HB2  1 
ATOM   1615  H HB3  . GLU A 1 100 ? -14.794 -1.067  -30.499 1.00 80.51  ? 437 GLU B HB3  1 
ATOM   1616  H HG2  . GLU A 1 100 ? -17.040 -1.483  -31.912 1.00 88.61  ? 437 GLU B HG2  1 
ATOM   1617  H HG3  . GLU A 1 100 ? -15.887 -0.971  -32.879 1.00 88.61  ? 437 GLU B HG3  1 
ATOM   1618  N N    . ASN A 1 101 ? -18.810 0.177   -30.671 1.00 44.14  ? 438 ASN B N    1 
ATOM   1619  C CA   . ASN A 1 101 ? -19.904 0.997   -31.208 1.00 48.60  ? 438 ASN B CA   1 
ATOM   1620  C C    . ASN A 1 101 ? -20.766 1.619   -30.110 1.00 45.84  ? 438 ASN B C    1 
ATOM   1621  O O    . ASN A 1 101 ? -21.714 2.365   -30.397 1.00 28.35  ? 438 ASN B O    1 
ATOM   1622  C CB   . ASN A 1 101 ? -20.804 0.180   -32.140 1.00 46.59  ? 438 ASN B CB   1 
ATOM   1623  C CG   . ASN A 1 101 ? -20.037 -0.483  -33.267 1.00 49.47  ? 438 ASN B CG   1 
ATOM   1624  O OD1  . ASN A 1 101 ? -19.617 0.165   -34.226 1.00 40.82  ? 438 ASN B OD1  1 
ATOM   1625  N ND2  . ASN A 1 101 ? -19.865 -1.785  -33.159 1.00 29.53  ? 438 ASN B ND2  1 
ATOM   1626  H H    . ASN A 1 101 ? -19.010 -0.649  -30.543 1.00 52.96  ? 438 ASN B H    1 
ATOM   1627  H HA   . ASN A 1 101 ? -19.517 1.729   -31.733 1.00 58.33  ? 438 ASN B HA   1 
ATOM   1628  H HB2  . ASN A 1 101 ? -21.242 -0.516  -31.626 1.00 55.91  ? 438 ASN B HB2  1 
ATOM   1629  H HB3  . ASN A 1 101 ? -21.467 0.768   -32.534 1.00 55.91  ? 438 ASN B HB3  1 
ATOM   1630  H HD21 . ASN A 1 101 ? -20.181 -2.205  -32.479 1.00 35.44  ? 438 ASN B HD21 1 
ATOM   1631  H HD22 . ASN A 1 101 ? -19.437 -2.214  -33.769 1.00 35.44  ? 438 ASN B HD22 1 
ATOM   1632  N N    . CYS A 1 102 ? -20.428 1.323   -28.859 1.00 45.54  ? 439 CYS B N    1 
ATOM   1633  C CA   . CYS A 1 102 ? -21.290 1.653   -27.733 1.00 41.66  ? 439 CYS B CA   1 
ATOM   1634  C C    . CYS A 1 102 ? -20.564 2.424   -26.634 1.00 38.88  ? 439 CYS B C    1 
ATOM   1635  O O    . CYS A 1 102 ? -19.339 2.517   -26.634 1.00 28.07  ? 439 CYS B O    1 
ATOM   1636  C CB   . CYS A 1 102 ? -21.871 0.363   -27.152 1.00 31.51  ? 439 CYS B CB   1 
ATOM   1637  S SG   . CYS A 1 102 ? -22.800 -0.596  -28.361 1.00 33.70  ? 439 CYS B SG   1 
ATOM   1638  H H    . CYS A 1 102 ? -19.698 0.928   -28.635 1.00 54.65  ? 439 CYS B H    1 
ATOM   1639  H HA   . CYS A 1 102 ? -22.035 2.206   -28.051 1.00 50.00  ? 439 CYS B HA   1 
ATOM   1640  H HB2  . CYS A 1 102 ? -21.144 -0.191  -26.826 1.00 37.81  ? 439 CYS B HB2  1 
ATOM   1641  H HB3  . CYS A 1 102 ? -22.470 0.587   -26.423 1.00 37.81  ? 439 CYS B HB3  1 
ATOM   1642  H HG   . CYS A 1 102 ? -22.072 -0.892  -29.268 1.00 40.44  ? 439 CYS B HG   1 
ATOM   1643  N N    . LEU A 1 103 ? -21.331 2.965   -25.691 1.00 29.80  ? 440 LEU B N    1 
ATOM   1644  C CA   . LEU A 1 103 ? -20.756 3.635   -24.530 1.00 30.17  ? 440 LEU B CA   1 
ATOM   1645  C C    . LEU A 1 103 ? -20.815 2.741   -23.288 1.00 31.42  ? 440 LEU B C    1 
ATOM   1646  O O    . LEU A 1 103 ? -21.879 2.274   -22.898 1.00 30.22  ? 440 LEU B O    1 
ATOM   1647  C CB   . LEU A 1 103 ? -21.481 4.960   -24.262 1.00 29.04  ? 440 LEU B CB   1 
ATOM   1648  C CG   . LEU A 1 103 ? -21.010 6.132   -25.126 1.00 37.70  ? 440 LEU B CG   1 
ATOM   1649  C CD1  . LEU A 1 103 ? -21.572 6.028   -26.542 1.00 41.79  ? 440 LEU B CD1  1 
ATOM   1650  C CD2  . LEU A 1 103 ? -21.378 7.468   -24.478 1.00 33.22  ? 440 LEU B CD2  1 
ATOM   1651  H H    . LEU A 1 103 ? -22.191 2.957   -25.701 1.00 35.76  ? 440 LEU B H    1 
ATOM   1652  H HA   . LEU A 1 103 ? -19.815 3.837   -24.713 1.00 36.20  ? 440 LEU B HA   1 
ATOM   1653  H HB2  . LEU A 1 103 ? -22.428 4.834   -24.430 1.00 34.85  ? 440 LEU B HB2  1 
ATOM   1654  H HB3  . LEU A 1 103 ? -21.344 5.206   -23.334 1.00 34.85  ? 440 LEU B HB3  1 
ATOM   1655  H HG   . LEU A 1 103 ? -20.043 6.096   -25.193 1.00 45.24  ? 440 LEU B HG   1 
ATOM   1656  H HD11 . LEU A 1 103 ? -21.259 6.775   -27.057 1.00 50.15  ? 440 LEU B HD11 1 
ATOM   1657  H HD12 . LEU A 1 103 ? -21.271 5.207   -26.938 1.00 50.15  ? 440 LEU B HD12 1 
ATOM   1658  H HD13 . LEU A 1 103 ? -22.531 6.039   -26.498 1.00 50.15  ? 440 LEU B HD13 1 
ATOM   1659  H HD21 . LEU A 1 103 ? -21.071 8.183   -25.040 1.00 39.87  ? 440 LEU B HD21 1 
ATOM   1660  H HD22 . LEU A 1 103 ? -22.332 7.515   -24.380 1.00 39.87  ? 440 LEU B HD22 1 
ATOM   1661  H HD23 . LEU A 1 103 ? -20.956 7.524   -23.617 1.00 39.87  ? 440 LEU B HD23 1 
ATOM   1662  N N    . CYS A 1 104 ? -19.662 2.530   -22.666 1.00 23.85  ? 441 CYS B N    1 
ATOM   1663  C CA   . CYS A 1 104 ? -19.569 1.712   -21.467 1.00 30.43  ? 441 CYS B CA   1 
ATOM   1664  C C    . CYS A 1 104 ? -19.850 2.566   -20.239 1.00 21.55  ? 441 CYS B C    1 
ATOM   1665  O O    . CYS A 1 104 ? -19.153 3.548   -19.981 1.00 27.11  ? 441 CYS B O    1 
ATOM   1666  C CB   . CYS A 1 104 ? -18.179 1.100   -21.373 1.00 31.77  ? 441 CYS B CB   1 
ATOM   1667  S SG   . CYS A 1 104 ? -17.924 0.176   -19.861 1.00 35.50  ? 441 CYS B SG   1 
ATOM   1668  H H    . CYS A 1 104 ? -18.909 2.855   -22.924 1.00 28.61  ? 441 CYS B H    1 
ATOM   1669  H HA   . CYS A 1 104 ? -20.229 0.989   -21.507 1.00 36.51  ? 441 CYS B HA   1 
ATOM   1670  H HB2  . CYS A 1 104 ? -18.049 0.494   -22.119 1.00 38.12  ? 441 CYS B HB2  1 
ATOM   1671  H HB3  . CYS A 1 104 ? -17.519 1.810   -21.405 1.00 38.12  ? 441 CYS B HB3  1 
ATOM   1672  H HG   . CYS A 1 104 ? -16.811 -0.273  -19.860 1.00 42.60  ? 441 CYS B HG   1 
ATOM   1673  N N    . VAL A 1 105 ? -20.887 2.218   -19.488 1.00 25.04  ? 442 VAL B N    1 
ATOM   1674  C CA   . VAL A 1 105 ? -21.299 3.063   -18.356 1.00 25.34  ? 442 VAL B CA   1 
ATOM   1675  C C    . VAL A 1 105 ? -20.200 3.208   -17.300 1.00 27.04  ? 442 VAL B C    1 
ATOM   1676  O O    . VAL A 1 105 ? -20.065 4.260   -16.669 1.00 24.49  ? 442 VAL B O    1 
ATOM   1677  C CB   . VAL A 1 105 ? -22.584 2.542   -17.682 1.00 30.15  ? 442 VAL B CB   1 
ATOM   1678  C CG1  . VAL A 1 105 ? -22.872 3.332   -16.406 1.00 31.91  ? 442 VAL B CG1  1 
ATOM   1679  C CG2  . VAL A 1 105 ? -23.752 2.651   -18.639 1.00 29.39  ? 442 VAL B CG2  1 
ATOM   1680  H H    . VAL A 1 105 ? -21.365 1.512   -19.603 1.00 30.04  ? 442 VAL B H    1 
ATOM   1681  H HA   . VAL A 1 105 ? -21.493 3.961   -18.699 1.00 30.41  ? 442 VAL B HA   1 
ATOM   1682  H HB   . VAL A 1 105 ? -22.467 1.599   -17.442 1.00 36.18  ? 442 VAL B HB   1 
ATOM   1683  H HG11 . VAL A 1 105 ? -23.674 2.992   -16.003 1.00 38.29  ? 442 VAL B HG11 1 
ATOM   1684  H HG12 . VAL A 1 105 ? -22.133 3.230   -15.802 1.00 38.29  ? 442 VAL B HG12 1 
ATOM   1685  H HG13 . VAL A 1 105 ? -22.985 4.258   -16.632 1.00 38.29  ? 442 VAL B HG13 1 
ATOM   1686  H HG21 . VAL A 1 105 ? -24.543 2.323   -18.204 1.00 35.27  ? 442 VAL B HG21 1 
ATOM   1687  H HG22 . VAL A 1 105 ? -23.871 3.571   -18.883 1.00 35.27  ? 442 VAL B HG22 1 
ATOM   1688  H HG23 . VAL A 1 105 ? -23.566 2.125   -19.420 1.00 35.27  ? 442 VAL B HG23 1 
ATOM   1689  N N    . GLN A 1 106 ? -19.403 2.157   -17.118 1.00 25.13  ? 443 GLN B N    1 
ATOM   1690  C CA   . GLN A 1 106 ? -18.320 2.202   -16.147 1.00 31.02  ? 443 GLN B CA   1 
ATOM   1691  C C    . GLN A 1 106 ? -17.252 3.232   -16.507 1.00 26.49  ? 443 GLN B C    1 
ATOM   1692  O O    . GLN A 1 106 ? -16.643 3.819   -15.624 1.00 28.61  ? 443 GLN B O    1 
ATOM   1693  C CB   . GLN A 1 106 ? -17.695 0.810   -15.964 1.00 27.89  ? 443 GLN B CB   1 
ATOM   1694  C CG   . GLN A 1 106 ? -18.503 -0.078  -15.050 1.00 29.46  ? 443 GLN B CG   1 
ATOM   1695  C CD   . GLN A 1 106 ? -19.845 -0.497  -15.626 1.00 37.82  ? 443 GLN B CD   1 
ATOM   1696  O OE1  . GLN A 1 106 ? -20.020 -0.611  -16.841 1.00 34.63  ? 443 GLN B OE1  1 
ATOM   1697  N NE2  . GLN A 1 106 ? -20.801 -0.742  -14.744 1.00 40.77  ? 443 GLN B NE2  1 
ATOM   1698  H H    . GLN A 1 106 ? -19.469 1.412   -17.543 1.00 30.15  ? 443 GLN B H    1 
ATOM   1699  H HA   . GLN A 1 106 ? -18.697 2.466   -15.282 1.00 37.23  ? 443 GLN B HA   1 
ATOM   1700  H HB2  . GLN A 1 106 ? -17.634 0.375   -16.829 1.00 33.47  ? 443 GLN B HB2  1 
ATOM   1701  H HB3  . GLN A 1 106 ? -16.810 0.909   -15.580 1.00 33.47  ? 443 GLN B HB3  1 
ATOM   1702  H HG2  . GLN A 1 106 ? -17.994 -0.883  -14.868 1.00 35.35  ? 443 GLN B HG2  1 
ATOM   1703  H HG3  . GLN A 1 106 ? -18.672 0.398   -14.222 1.00 35.35  ? 443 GLN B HG3  1 
ATOM   1704  H HE21 . GLN A 1 106 ? -20.642 -0.659  -13.903 1.00 48.93  ? 443 GLN B HE21 1 
ATOM   1705  H HE22 . GLN A 1 106 ? -21.582 -0.983  -15.012 1.00 48.93  ? 443 GLN B HE22 1 
ATOM   1706  N N    . ASN A 1 107 ? -17.035 3.471   -17.795 1.00 25.79  ? 444 ASN B N    1 
ATOM   1707  C CA   . ASN A 1 107 ? -16.144 4.549   -18.212 1.00 28.33  ? 444 ASN B CA   1 
ATOM   1708  C C    . ASN A 1 107 ? -16.698 5.916   -17.809 1.00 28.42  ? 444 ASN B C    1 
ATOM   1709  O O    . ASN A 1 107 ? -15.966 6.801   -17.372 1.00 33.82  ? 444 ASN B O    1 
ATOM   1710  C CB   . ASN A 1 107 ? -15.951 4.526   -19.730 1.00 33.96  ? 444 ASN B CB   1 
ATOM   1711  C CG   . ASN A 1 107 ? -14.979 3.467   -20.175 1.00 46.77  ? 444 ASN B CG   1 
ATOM   1712  O OD1  . ASN A 1 107 ? -13.995 3.191   -19.494 1.00 53.66  ? 444 ASN B OD1  1 
ATOM   1713  N ND2  . ASN A 1 107 ? -15.242 2.871   -21.333 1.00 50.63  ? 444 ASN B ND2  1 
ATOM   1714  H H    . ASN A 1 107 ? -17.387 3.029   -18.443 1.00 30.95  ? 444 ASN B H    1 
ATOM   1715  H HA   . ASN A 1 107 ? -15.270 4.431   -17.786 1.00 34.00  ? 444 ASN B HA   1 
ATOM   1716  H HB2  . ASN A 1 107 ? -16.805 4.347   -20.155 1.00 40.75  ? 444 ASN B HB2  1 
ATOM   1717  H HB3  . ASN A 1 107 ? -15.610 5.387   -20.019 1.00 40.75  ? 444 ASN B HB3  1 
ATOM   1718  H HD21 . ASN A 1 107 ? -15.938 3.098   -21.784 1.00 60.76  ? 444 ASN B HD21 1 
ATOM   1719  H HD22 . ASN A 1 107 ? -14.717 2.259   -21.630 1.00 60.76  ? 444 ASN B HD22 1 
ATOM   1720  N N    . ILE A 1 108 ? -18.000 6.097   -17.971 1.00 26.92  ? 445 ILE B N    1 
ATOM   1721  C CA   . ILE A 1 108 ? -18.596 7.366   -17.606 1.00 26.85  ? 445 ILE B CA   1 
ATOM   1722  C C    . ILE A 1 108 ? -18.429 7.565   -16.099 1.00 30.38  ? 445 ILE B C    1 
ATOM   1723  O O    . ILE A 1 108 ? -18.054 8.641   -15.640 1.00 34.74  ? 445 ILE B O    1 
ATOM   1724  C CB   . ILE A 1 108 ? -20.071 7.424   -17.994 1.00 26.00  ? 445 ILE B CB   1 
ATOM   1725  C CG1  . ILE A 1 108 ? -20.237 7.157   -19.495 1.00 28.21  ? 445 ILE B CG1  1 
ATOM   1726  C CG2  . ILE A 1 108 ? -20.673 8.811   -17.635 1.00 26.45  ? 445 ILE B CG2  1 
ATOM   1727  C CD1  . ILE A 1 108 ? -21.697 7.208   -19.959 1.00 32.71  ? 445 ILE B CD1  1 
ATOM   1728  H H    . ILE A 1 108 ? -18.548 5.513   -18.285 1.00 32.31  ? 445 ILE B H    1 
ATOM   1729  H HA   . ILE A 1 108 ? -18.126 8.091   -18.068 1.00 32.22  ? 445 ILE B HA   1 
ATOM   1730  H HB   . ILE A 1 108 ? -20.550 6.740   -17.501 1.00 31.20  ? 445 ILE B HB   1 
ATOM   1731  H HG12 . ILE A 1 108 ? -19.743 7.828   -19.991 1.00 33.85  ? 445 ILE B HG12 1 
ATOM   1732  H HG13 . ILE A 1 108 ? -19.890 6.274   -19.698 1.00 33.85  ? 445 ILE B HG13 1 
ATOM   1733  H HG21 . ILE A 1 108 ? -21.599 8.824   -17.887 1.00 31.74  ? 445 ILE B HG21 1 
ATOM   1734  H HG22 . ILE A 1 108 ? -20.590 8.952   -16.689 1.00 31.74  ? 445 ILE B HG22 1 
ATOM   1735  H HG23 . ILE A 1 108 ? -20.194 9.492   -18.111 1.00 31.74  ? 445 ILE B HG23 1 
ATOM   1736  H HD11 . ILE A 1 108 ? -21.731 7.033   -20.902 1.00 39.25  ? 445 ILE B HD11 1 
ATOM   1737  H HD12 . ILE A 1 108 ? -22.198 6.541   -19.484 1.00 39.25  ? 445 ILE B HD12 1 
ATOM   1738  H HD13 . ILE A 1 108 ? -22.053 8.080   -19.774 1.00 39.25  ? 445 ILE B HD13 1 
ATOM   1739  N N    . LEU A 1 109 ? -18.679 6.509   -15.332 1.00 28.32  ? 446 LEU B N    1 
ATOM   1740  C CA   . LEU A 1 109 ? -18.580 6.588   -13.880 1.00 32.63  ? 446 LEU B CA   1 
ATOM   1741  C C    . LEU A 1 109 ? -17.191 7.033   -13.464 1.00 31.36  ? 446 LEU B C    1 
ATOM   1742  O O    . LEU A 1 109 ? -17.034 7.934   -12.642 1.00 36.29  ? 446 LEU B O    1 
ATOM   1743  C CB   . LEU A 1 109 ? -18.892 5.231   -13.248 1.00 28.95  ? 446 LEU B CB   1 
ATOM   1744  C CG   . LEU A 1 109 ? -18.645 5.144   -11.743 1.00 25.96  ? 446 LEU B CG   1 
ATOM   1745  C CD1  . LEU A 1 109 ? -19.297 6.305   -11.011 1.00 29.58  ? 446 LEU B CD1  1 
ATOM   1746  C CD2  . LEU A 1 109 ? -19.173 3.804   -11.225 1.00 30.07  ? 446 LEU B CD2  1 
ATOM   1747  H H    . LEU A 1 109 ? -18.908 5.734   -15.629 1.00 33.98  ? 446 LEU B H    1 
ATOM   1748  H HA   . LEU A 1 109 ? -19.228 7.242   -13.544 1.00 39.16  ? 446 LEU B HA   1 
ATOM   1749  H HB2  . LEU A 1 109 ? -19.827 5.027   -13.403 1.00 34.73  ? 446 LEU B HB2  1 
ATOM   1750  H HB3  . LEU A 1 109 ? -18.338 4.558   -13.674 1.00 34.73  ? 446 LEU B HB3  1 
ATOM   1751  H HG   . LEU A 1 109 ? -17.690 5.178   -11.574 1.00 31.15  ? 446 LEU B HG   1 
ATOM   1752  H HD11 . LEU A 1 109 ? -19.123 6.219   -10.071 1.00 35.49  ? 446 LEU B HD11 1 
ATOM   1753  H HD12 . LEU A 1 109 ? -18.927 7.128   -11.339 1.00 35.49  ? 446 LEU B HD12 1 
ATOM   1754  H HD13 . LEU A 1 109 ? -20.243 6.283   -11.172 1.00 35.49  ? 446 LEU B HD13 1 
ATOM   1755  H HD21 . LEU A 1 109 ? -19.017 3.751   -10.280 1.00 36.08  ? 446 LEU B HD21 1 
ATOM   1756  H HD22 . LEU A 1 109 ? -20.115 3.749   -11.406 1.00 36.08  ? 446 LEU B HD22 1 
ATOM   1757  H HD23 . LEU A 1 109 ? -18.711 3.092   -11.674 1.00 36.08  ? 446 LEU B HD23 1 
ATOM   1758  N N    . LYS A 1 110 ? -16.177 6.396   -14.036 1.00 31.92  ? 447 LYS B N    1 
ATOM   1759  C CA   . LYS A 1 110 ? -14.799 6.721   -13.696 1.00 30.98  ? 447 LYS B CA   1 
ATOM   1760  C C    . LYS A 1 110 ? -14.538 8.207   -13.941 1.00 36.62  ? 447 LYS B C    1 
ATOM   1761  O O    . LYS A 1 110 ? -13.954 8.884   -13.093 1.00 37.21  ? 447 LYS B O    1 
ATOM   1762  C CB   . LYS A 1 110 ? -13.830 5.848   -14.503 1.00 36.90  ? 447 LYS B CB   1 
ATOM   1763  C CG   . LYS A 1 110 ? -12.392 6.339   -14.497 1.00 51.17  ? 447 LYS B CG   1 
ATOM   1764  C CD   . LYS A 1 110 ? -11.493 5.423   -15.313 1.00 57.12  ? 447 LYS B CD   1 
ATOM   1765  C CE   . LYS A 1 110 ? -10.056 5.926   -15.347 1.00 69.53  ? 447 LYS B CE   1 
ATOM   1766  N NZ   . LYS A 1 110 ? -9.384  5.806   -14.022 1.00 74.46  ? 447 LYS B NZ   1 
ATOM   1767  H H    . LYS A 1 110 ? -16.260 5.773   -14.623 1.00 38.31  ? 447 LYS B H    1 
ATOM   1768  H HA   . LYS A 1 110 ? -14.652 6.539   -12.745 1.00 37.17  ? 447 LYS B HA   1 
ATOM   1769  H HB2  . LYS A 1 110 ? -13.837 4.952   -14.132 1.00 44.28  ? 447 LYS B HB2  1 
ATOM   1770  H HB3  . LYS A 1 110 ? -14.130 5.823   -15.425 1.00 44.28  ? 447 LYS B HB3  1 
ATOM   1771  H HG2  . LYS A 1 110 ? -12.355 7.227   -14.886 1.00 61.41  ? 447 LYS B HG2  1 
ATOM   1772  H HG3  . LYS A 1 110 ? -12.062 6.356   -13.585 1.00 61.41  ? 447 LYS B HG3  1 
ATOM   1773  H HD2  . LYS A 1 110 ? -11.495 4.537   -14.917 1.00 68.54  ? 447 LYS B HD2  1 
ATOM   1774  H HD3  . LYS A 1 110 ? -11.821 5.382   -16.225 1.00 68.54  ? 447 LYS B HD3  1 
ATOM   1775  H HE2  . LYS A 1 110 ? -9.551  5.402   -15.989 1.00 83.44  ? 447 LYS B HE2  1 
ATOM   1776  H HE3  . LYS A 1 110 ? -10.053 6.861   -15.603 1.00 83.44  ? 447 LYS B HE3  1 
ATOM   1777  H HZ1  . LYS A 1 110 ? -8.548  6.108   -14.076 1.00 89.35  ? 447 LYS B HZ1  1 
ATOM   1778  H HZ2  . LYS A 1 110 ? -9.824  6.284   -13.413 1.00 89.35  ? 447 LYS B HZ2  1 
ATOM   1779  H HZ3  . LYS A 1 110 ? -9.367  4.954   -13.765 1.00 89.35  ? 447 LYS B HZ3  1 
ATOM   1780  N N    . LEU A 1 111 ? -14.991 8.718   -15.085 1.00 33.98  ? 448 LEU B N    1 
ATOM   1781  C CA   . LEU A 1 111 ? -14.785 10.133  -15.424 1.00 36.98  ? 448 LEU B CA   1 
ATOM   1782  C C    . LEU A 1 111 ? -15.481 11.072  -14.433 1.00 28.88  ? 448 LEU B C    1 
ATOM   1783  O O    . LEU A 1 111 ? -14.945 12.121  -14.073 1.00 36.97  ? 448 LEU B O    1 
ATOM   1784  C CB   . LEU A 1 111 ? -15.249 10.420  -16.862 1.00 34.37  ? 448 LEU B CB   1 
ATOM   1785  C CG   . LEU A 1 111 ? -14.374 9.725   -17.913 1.00 44.42  ? 448 LEU B CG   1 
ATOM   1786  C CD1  . LEU A 1 111 ? -14.912 9.897   -19.325 1.00 31.85  ? 448 LEU B CD1  1 
ATOM   1787  C CD2  . LEU A 1 111 ? -12.938 10.228  -17.827 1.00 46.18  ? 448 LEU B CD2  1 
ATOM   1788  H H    . LEU A 1 111 ? -15.419 8.272   -15.683 1.00 40.78  ? 448 LEU B H    1 
ATOM   1789  H HA   . LEU A 1 111 ? -13.825 10.324  -15.383 1.00 44.38  ? 448 LEU B HA   1 
ATOM   1790  H HB2  . LEU A 1 111 ? -16.159 10.102  -16.971 1.00 41.24  ? 448 LEU B HB2  1 
ATOM   1791  H HB3  . LEU A 1 111 ? -15.210 11.376  -17.023 1.00 41.24  ? 448 LEU B HB3  1 
ATOM   1792  H HG   . LEU A 1 111 ? -14.361 8.774   -17.721 1.00 53.30  ? 448 LEU B HG   1 
ATOM   1793  H HD11 . LEU A 1 111 ? -14.328 9.445   -19.938 1.00 38.23  ? 448 LEU B HD11 1 
ATOM   1794  H HD12 . LEU A 1 111 ? -15.793 9.519   -19.371 1.00 38.23  ? 448 LEU B HD12 1 
ATOM   1795  H HD13 . LEU A 1 111 ? -14.945 10.834  -19.534 1.00 38.23  ? 448 LEU B HD13 1 
ATOM   1796  H HD21 . LEU A 1 111 ? -12.410 9.781   -18.492 1.00 55.41  ? 448 LEU B HD21 1 
ATOM   1797  H HD22 . LEU A 1 111 ? -12.929 11.175  -17.985 1.00 55.41  ? 448 LEU B HD22 1 
ATOM   1798  H HD23 . LEU A 1 111 ? -12.592 10.038  -16.952 1.00 55.41  ? 448 LEU B HD23 1 
ATOM   1799  N N    . MET A 1 112 ? -16.673 10.696  -13.994 1.00 32.41  ? 449 MET B N    1 
ATOM   1800  C CA   . MET A 1 112 ? -17.408 11.497  -13.020 1.00 32.31  ? 449 MET B CA   1 
ATOM   1801  C C    . MET A 1 112 ? -16.685 11.534  -11.670 1.00 39.77  ? 449 MET B C    1 
ATOM   1802  O O    . MET A 1 112 ? -16.637 12.572  -11.017 1.00 29.87  ? 449 MET B O    1 
ATOM   1803  C CB   . MET A 1 112 ? -18.824 10.947  -12.849 1.00 27.54  ? 449 MET B CB   1 
ATOM   1804  C CG   . MET A 1 112 ? -19.693 11.062  -14.095 1.00 23.93  ? 449 MET B CG   1 
ATOM   1805  S SD   . MET A 1 112 ? -21.184 10.060  -13.983 1.00 29.12  ? 449 MET B SD   1 
ATOM   1806  C CE   . MET A 1 112 ? -22.011 10.772  -12.571 1.00 29.09  ? 449 MET B CE   1 
ATOM   1807  H H    . MET A 1 112 ? -17.082 9.982   -14.244 1.00 38.89  ? 449 MET B H    1 
ATOM   1808  H HA   . MET A 1 112 ? -17.484 12.413  -13.361 1.00 38.77  ? 449 MET B HA   1 
ATOM   1809  H HB2  . MET A 1 112 ? -18.767 10.007  -12.615 1.00 33.05  ? 449 MET B HB2  1 
ATOM   1810  H HB3  . MET A 1 112 ? -19.264 11.435  -12.136 1.00 33.05  ? 449 MET B HB3  1 
ATOM   1811  H HG2  . MET A 1 112 ? -19.959 11.987  -14.211 1.00 28.72  ? 449 MET B HG2  1 
ATOM   1812  H HG3  . MET A 1 112 ? -19.185 10.762  -14.865 1.00 28.72  ? 449 MET B HG3  1 
ATOM   1813  H HE1  . MET A 1 112 ? -21.442 10.691  -11.802 1.00 34.90  ? 449 MET B HE1  1 
ATOM   1814  H HE2  . MET A 1 112 ? -22.190 11.698  -12.750 1.00 34.90  ? 449 MET B HE2  1 
ATOM   1815  H HE3  . MET A 1 112 ? -22.834 10.302  -12.421 1.00 34.90  ? 449 MET B HE3  1 
ATOM   1816  N N    . GLN A 1 113 ? -16.113 10.405  -11.249 1.00 34.21  ? 450 GLN B N    1 
ATOM   1817  C CA   . GLN A 1 113 ? -15.392 10.363  -9.979  1.00 38.34  ? 450 GLN B CA   1 
ATOM   1818  C C    . GLN A 1 113 ? -14.215 11.313  -9.968  1.00 35.71  ? 450 GLN B C    1 
ATOM   1819  O O    . GLN A 1 113 ? -13.856 11.853  -8.924  1.00 42.82  ? 450 GLN B O    1 
ATOM   1820  C CB   . GLN A 1 113 ? -14.894 8.946   -9.675  1.00 31.73  ? 450 GLN B CB   1 
ATOM   1821  C CG   . GLN A 1 113 ? -15.996 8.011   -9.289  1.00 29.07  ? 450 GLN B CG   1 
ATOM   1822  C CD   . GLN A 1 113 ? -15.478 6.624   -8.967  1.00 40.85  ? 450 GLN B CD   1 
ATOM   1823  O OE1  . GLN A 1 113 ? -15.101 5.869   -9.863  1.00 38.23  ? 450 GLN B OE1  1 
ATOM   1824  N NE2  . GLN A 1 113 ? -15.441 6.289   -7.681  1.00 34.41  ? 450 GLN B NE2  1 
ATOM   1825  H H    . GLN A 1 113 ? -16.129 9.659   -11.676 1.00 41.05  ? 450 GLN B H    1 
ATOM   1826  H HA   . GLN A 1 113 ? -16.001 10.630  -9.260  1.00 46.00  ? 450 GLN B HA   1 
ATOM   1827  H HB2  . GLN A 1 113 ? -14.460 8.587   -10.465 1.00 38.07  ? 450 GLN B HB2  1 
ATOM   1828  H HB3  . GLN A 1 113 ? -14.263 8.984   -8.939  1.00 38.07  ? 450 GLN B HB3  1 
ATOM   1829  H HG2  . GLN A 1 113 ? -16.446 8.357   -8.502  1.00 34.88  ? 450 GLN B HG2  1 
ATOM   1830  H HG3  . GLN A 1 113 ? -16.622 7.936   -10.026 1.00 34.88  ? 450 GLN B HG3  1 
ATOM   1831  H HE21 . GLN A 1 113 ? -15.704 6.849   -7.084  1.00 41.29  ? 450 GLN B HE21 1 
ATOM   1832  H HE22 . GLN A 1 113 ? -15.155 5.513   -7.447  1.00 41.29  ? 450 GLN B HE22 1 
ATOM   1833  N N    . GLU A 1 114 ? -13.603 11.505  -11.129 1.00 37.73  ? 451 GLU B N    1 
ATOM   1834  C CA   . GLU A 1 114 ? -12.453 12.391  -11.236 1.00 45.64  ? 451 GLU B CA   1 
ATOM   1835  C C    . GLU A 1 114 ? -12.850 13.857  -11.061 1.00 45.88  ? 451 GLU B C    1 
ATOM   1836  O O    . GLU A 1 114 ? -12.001 14.706  -10.803 1.00 48.58  ? 451 GLU B O    1 
ATOM   1837  C CB   . GLU A 1 114 ? -11.741 12.171  -12.570 1.00 47.72  ? 451 GLU B CB   1 
ATOM   1838  C CG   . GLU A 1 114 ? -10.978 10.849  -12.618 1.00 56.74  ? 451 GLU B CG   1 
ATOM   1839  C CD   . GLU A 1 114 ? -10.483 10.502  -14.008 1.00 63.60  ? 451 GLU B CD   1 
ATOM   1840  O OE1  . GLU A 1 114 ? -10.549 11.374  -14.902 1.00 68.52  ? 451 GLU B OE1  1 
ATOM   1841  O OE2  . GLU A 1 114 ? -10.031 9.353   -14.202 1.00 60.76  ? 451 GLU B OE2  1 
ATOM   1842  H H    . GLU A 1 114 ? -13.834 11.133  -11.870 1.00 45.27  ? 451 GLU B H    1 
ATOM   1843  H HA   . GLU A 1 114 ? -11.820 12.168  -10.522 1.00 54.77  ? 451 GLU B HA   1 
ATOM   1844  H HB2  . GLU A 1 114 ? -12.400 12.165  -13.282 1.00 57.27  ? 451 GLU B HB2  1 
ATOM   1845  H HB3  . GLU A 1 114 ? -11.106 12.890  -12.711 1.00 57.27  ? 451 GLU B HB3  1 
ATOM   1846  H HG2  . GLU A 1 114 ? -10.208 10.908  -12.033 1.00 68.09  ? 451 GLU B HG2  1 
ATOM   1847  H HG3  . GLU A 1 114 ? -11.565 10.136  -12.323 1.00 68.09  ? 451 GLU B HG3  1 
ATOM   1848  N N    . LYS A 1 115 ? -14.142 14.147  -11.186 1.00 43.54  ? 452 LYS B N    1 
ATOM   1849  C CA   . LYS A 1 115 ? -14.644 15.504  -10.955 1.00 41.06  ? 452 LYS B CA   1 
ATOM   1850  C C    . LYS A 1 115 ? -15.011 15.691  -9.482  1.00 42.28  ? 452 LYS B C    1 
ATOM   1851  O O    . LYS A 1 115 ? -15.480 16.754  -9.075  1.00 42.16  ? 452 LYS B O    1 
ATOM   1852  C CB   . LYS A 1 115 ? -15.861 15.777  -11.843 1.00 36.28  ? 452 LYS B CB   1 
ATOM   1853  C CG   . LYS A 1 115 ? -15.736 15.179  -13.238 1.00 51.06  ? 452 LYS B CG   1 
ATOM   1854  C CD   . LYS A 1 115 ? -15.772 16.231  -14.324 1.00 61.60  ? 452 LYS B CD   1 
ATOM   1855  C CE   . LYS A 1 115 ? -14.613 17.195  -14.220 1.00 62.33  ? 452 LYS B CE   1 
ATOM   1856  N NZ   . LYS A 1 115 ? -14.758 18.293  -15.215 1.00 73.67  ? 452 LYS B NZ   1 
ATOM   1857  H H    . LYS A 1 115 ? -14.750 13.579  -11.402 1.00 52.25  ? 452 LYS B H    1 
ATOM   1858  H HA   . LYS A 1 115 ? -13.945 16.151  -11.183 1.00 49.27  ? 452 LYS B HA   1 
ATOM   1859  H HB2  . LYS A 1 115 ? -16.648 15.394  -11.424 1.00 43.54  ? 452 LYS B HB2  1 
ATOM   1860  H HB3  . LYS A 1 115 ? -15.972 16.736  -11.939 1.00 43.54  ? 452 LYS B HB3  1 
ATOM   1861  H HG2  . LYS A 1 115 ? -14.892 14.706  -13.306 1.00 61.27  ? 452 LYS B HG2  1 
ATOM   1862  H HG3  . LYS A 1 115 ? -16.474 14.567  -13.388 1.00 61.27  ? 452 LYS B HG3  1 
ATOM   1863  H HD2  . LYS A 1 115 ? -15.727 15.797  -15.190 1.00 73.92  ? 452 LYS B HD2  1 
ATOM   1864  H HD3  . LYS A 1 115 ? -16.595 16.739  -14.247 1.00 73.92  ? 452 LYS B HD3  1 
ATOM   1865  H HE2  . LYS A 1 115 ? -14.596 17.586  -13.333 1.00 74.80  ? 452 LYS B HE2  1 
ATOM   1866  H HE3  . LYS A 1 115 ? -13.784 16.725  -14.400 1.00 74.80  ? 452 LYS B HE3  1 
ATOM   1867  H HZ1  . LYS A 1 115 ? -14.776 17.956  -16.039 1.00 88.41  ? 452 LYS B HZ1  1 
ATOM   1868  H HZ2  . LYS A 1 115 ? -15.514 18.739  -15.068 1.00 88.41  ? 452 LYS B HZ2  1 
ATOM   1869  H HZ3  . LYS A 1 115 ? -14.072 18.856  -15.148 1.00 88.41  ? 452 LYS B HZ3  1 
ATOM   1870  N N    . GLU A 1 116 ? -14.802 14.639  -8.696  1.00 30.62  ? 453 GLU B N    1 
ATOM   1871  C CA   . GLU A 1 116 ? -15.037 14.663  -7.254  1.00 41.30  ? 453 GLU B CA   1 
ATOM   1872  C C    . GLU A 1 116 ? -16.483 15.006  -6.919  1.00 37.73  ? 453 GLU B C    1 
ATOM   1873  O O    . GLU A 1 116 ? -16.763 15.704  -5.943  1.00 31.80  ? 453 GLU B O    1 
ATOM   1874  C CB   . GLU A 1 116 ? -14.099 15.656  -6.576  1.00 48.49  ? 453 GLU B CB   1 
ATOM   1875  C CG   . GLU A 1 116 ? -12.636 15.416  -6.878  1.00 61.58  ? 453 GLU B CG   1 
ATOM   1876  C CD   . GLU A 1 116 ? -11.746 16.426  -6.194  1.00 71.17  ? 453 GLU B CD   1 
ATOM   1877  O OE1  . GLU A 1 116 ? -11.345 16.165  -5.043  1.00 60.44  ? 453 GLU B OE1  1 
ATOM   1878  O OE2  . GLU A 1 116 ? -11.463 17.483  -6.800  1.00 71.38  ? 453 GLU B OE2  1 
ATOM   1879  H H    . GLU A 1 116 ? -14.517 13.880  -8.982  1.00 36.74  ? 453 GLU B H    1 
ATOM   1880  H HA   . GLU A 1 116 ? -14.847 13.774  -6.888  1.00 49.56  ? 453 GLU B HA   1 
ATOM   1881  H HB2  . GLU A 1 116 ? -14.321 16.551  -6.877  1.00 58.18  ? 453 GLU B HB2  1 
ATOM   1882  H HB3  . GLU A 1 116 ? -14.218 15.593  -5.616  1.00 58.18  ? 453 GLU B HB3  1 
ATOM   1883  H HG2  . GLU A 1 116 ? -12.387 14.532  -6.566  1.00 73.89  ? 453 GLU B HG2  1 
ATOM   1884  H HG3  . GLU A 1 116 ? -12.493 15.485  -7.835  1.00 73.89  ? 453 GLU B HG3  1 
ATOM   1885  N N    . THR A 1 117 ? -17.395 14.517  -7.748  1.00 34.72  ? 454 THR B N    1 
ATOM   1886  C CA   . THR A 1 117 ? -18.819 14.605  -7.474  1.00 35.05  ? 454 THR B CA   1 
ATOM   1887  C C    . THR A 1 117 ? -19.154 14.178  -6.041  1.00 39.75  ? 454 THR B C    1 
ATOM   1888  O O    . THR A 1 117 ? -18.463 13.342  -5.437  1.00 31.49  ? 454 THR B O    1 
ATOM   1889  C CB   . THR A 1 117 ? -19.593 13.701  -8.446  1.00 34.00  ? 454 THR B CB   1 
ATOM   1890  O OG1  . THR A 1 117 ? -18.999 12.391  -8.444  1.00 29.82  ? 454 THR B OG1  1 
ATOM   1891  C CG2  . THR A 1 117 ? -19.528 14.256  -9.852  1.00 28.98  ? 454 THR B CG2  1 
ATOM   1892  H H    . THR A 1 117 ? -17.209 14.122  -8.489  1.00 41.66  ? 454 THR B H    1 
ATOM   1893  H HA   . THR A 1 117 ? -19.120 15.529  -7.601  1.00 42.06  ? 454 THR B HA   1 
ATOM   1894  H HB   . THR A 1 117 ? -20.522 13.643  -8.174  1.00 40.80  ? 454 THR B HB   1 
ATOM   1895  H HG1  . THR A 1 117 ? -19.405 11.899  -8.960  1.00 35.79  ? 454 THR B HG1  1 
ATOM   1896  H HG21 . THR A 1 117 ? -20.014 13.686  -10.452 1.00 34.78  ? 454 THR B HG21 1 
ATOM   1897  H HG22 . THR A 1 117 ? -19.914 15.135  -9.876  1.00 34.78  ? 454 THR B HG22 1 
ATOM   1898  H HG23 . THR A 1 117 ? -18.615 14.309  -10.142 1.00 34.78  ? 454 THR B HG23 1 
ATOM   1899  N N    . GLY A 1 118 ? -20.217 14.759  -5.496  1.00 34.52  ? 455 GLY B N    1 
ATOM   1900  C CA   . GLY A 1 118 ? -20.731 14.339  -4.205  1.00 35.54  ? 455 GLY B CA   1 
ATOM   1901  C C    . GLY A 1 118 ? -21.644 13.125  -4.320  1.00 32.31  ? 455 GLY B C    1 
ATOM   1902  O O    . GLY A 1 118 ? -21.879 12.421  -3.343  1.00 28.66  ? 455 GLY B O    1 
ATOM   1903  H H    . GLY A 1 118 ? -20.658 15.402  -5.859  1.00 41.43  ? 455 GLY B H    1 
ATOM   1904  H HA2  . GLY A 1 118 ? -19.992 14.115  -3.619  1.00 42.64  ? 455 GLY B HA2  1 
ATOM   1905  H HA3  . GLY A 1 118 ? -21.234 15.066  -3.804  1.00 42.64  ? 455 GLY B HA3  1 
ATOM   1906  N N    . LEU A 1 119 ? -22.186 12.888  -5.509  1.00 27.31  ? 456 LEU B N    1 
ATOM   1907  C CA   . LEU A 1 119 ? -23.091 11.754  -5.710  1.00 28.69  ? 456 LEU B CA   1 
ATOM   1908  C C    . LEU A 1 119 ? -23.115 11.364  -7.184  1.00 29.19  ? 456 LEU B C    1 
ATOM   1909  O O    . LEU A 1 119 ? -23.132 12.226  -8.059  1.00 33.00  ? 456 LEU B O    1 
ATOM   1910  C CB   . LEU A 1 119 ? -24.511 12.097  -5.227  1.00 21.72  ? 456 LEU B CB   1 
ATOM   1911  C CG   . LEU A 1 119 ? -25.564 10.982  -5.314  1.00 26.35  ? 456 LEU B CG   1 
ATOM   1912  C CD1  . LEU A 1 119 ? -25.239 9.833   -4.338  1.00 23.96  ? 456 LEU B CD1  1 
ATOM   1913  C CD2  . LEU A 1 119 ? -26.975 11.523  -5.054  1.00 27.50  ? 456 LEU B CD2  1 
ATOM   1914  H H    . LEU A 1 119 ? -22.049 13.362  -6.213  1.00 32.77  ? 456 LEU B H    1 
ATOM   1915  H HA   . LEU A 1 119 ? -22.768 10.986  -5.193  1.00 34.43  ? 456 LEU B HA   1 
ATOM   1916  H HB2  . LEU A 1 119 ? -24.457 12.367  -4.297  1.00 26.06  ? 456 LEU B HB2  1 
ATOM   1917  H HB3  . LEU A 1 119 ? -24.838 12.841  -5.758  1.00 26.06  ? 456 LEU B HB3  1 
ATOM   1918  H HG   . LEU A 1 119 ? -25.552 10.616  -6.212  1.00 31.62  ? 456 LEU B HG   1 
ATOM   1919  H HD11 . LEU A 1 119 ? -25.915 9.155   -4.417  1.00 28.75  ? 456 LEU B HD11 1 
ATOM   1920  H HD12 . LEU A 1 119 ? -24.381 9.467   -4.561  1.00 28.75  ? 456 LEU B HD12 1 
ATOM   1921  H HD13 . LEU A 1 119 ? -25.226 10.178  -3.442  1.00 28.75  ? 456 LEU B HD13 1 
ATOM   1922  H HD21 . LEU A 1 119 ? -27.603 10.799  -5.116  1.00 32.99  ? 456 LEU B HD21 1 
ATOM   1923  H HD22 . LEU A 1 119 ? -27.005 11.907  -4.175  1.00 32.99  ? 456 LEU B HD22 1 
ATOM   1924  H HD23 . LEU A 1 119 ? -27.180 12.191  -5.712  1.00 32.99  ? 456 LEU B HD23 1 
ATOM   1925  N N    . ASN A 1 120 ? -23.092 10.063  -7.449  1.00 24.39  ? 457 ASN B N    1 
ATOM   1926  C CA   . ASN A 1 120 ? -23.170 9.546   -8.806  1.00 22.19  ? 457 ASN B CA   1 
ATOM   1927  C C    . ASN A 1 120 ? -24.322 8.575   -8.895  1.00 28.02  ? 457 ASN B C    1 
ATOM   1928  O O    . ASN A 1 120 ? -24.305 7.527   -8.244  1.00 25.70  ? 457 ASN B O    1 
ATOM   1929  C CB   . ASN A 1 120 ? -21.886 8.811   -9.189  1.00 24.74  ? 457 ASN B CB   1 
ATOM   1930  C CG   . ASN A 1 120 ? -20.660 9.664   -9.032  1.00 30.38  ? 457 ASN B CG   1 
ATOM   1931  O OD1  . ASN A 1 120 ? -20.418 10.568  -9.831  1.00 30.29  ? 457 ASN B OD1  1 
ATOM   1932  N ND2  . ASN A 1 120 ? -19.856 9.373   -8.005  1.00 28.54  ? 457 ASN B ND2  1 
ATOM   1933  H H    . ASN A 1 120 ? -23.030 9.450   -6.849  1.00 29.26  ? 457 ASN B H    1 
ATOM   1934  H HA   . ASN A 1 120 ? -23.320 10.280  -9.438  1.00 26.63  ? 457 ASN B HA   1 
ATOM   1935  H HB2  . ASN A 1 120 ? -21.786 8.032   -8.618  1.00 29.69  ? 457 ASN B HB2  1 
ATOM   1936  H HB3  . ASN A 1 120 ? -21.944 8.536   -10.118 1.00 29.69  ? 457 ASN B HB3  1 
ATOM   1937  H HD21 . ASN A 1 120 ? -20.053 8.725   -7.475  1.00 34.25  ? 457 ASN B HD21 1 
ATOM   1938  H HD22 . ASN A 1 120 ? -19.142 9.834   -7.874  1.00 34.25  ? 457 ASN B HD22 1 
ATOM   1939  N N    . VAL A 1 121 ? -25.325 8.920   -9.688  1.00 22.60  ? 458 VAL B N    1 
ATOM   1940  C CA   . VAL A 1 121 ? -26.494 8.065   -9.844  1.00 20.78  ? 458 VAL B CA   1 
ATOM   1941  C C    . VAL A 1 121 ? -26.674 7.691   -11.301 1.00 27.74  ? 458 VAL B C    1 
ATOM   1942  O O    . VAL A 1 121 ? -26.704 8.560   -12.176 1.00 25.52  ? 458 VAL B O    1 
ATOM   1943  C CB   . VAL A 1 121 ? -27.771 8.761   -9.353  1.00 20.74  ? 458 VAL B CB   1 
ATOM   1944  C CG1  . VAL A 1 121 ? -28.977 7.829   -9.519  1.00 24.05  ? 458 VAL B CG1  1 
ATOM   1945  C CG2  . VAL A 1 121 ? -27.603 9.174   -7.906  1.00 22.50  ? 458 VAL B CG2  1 
ATOM   1946  H H    . VAL A 1 121 ? -25.355 9.645   -10.148 1.00 27.12  ? 458 VAL B H    1 
ATOM   1947  H HA   . VAL A 1 121 ? -26.369 7.243   -9.326  1.00 24.94  ? 458 VAL B HA   1 
ATOM   1948  H HB   . VAL A 1 121 ? -27.927 9.567   -9.888  1.00 24.89  ? 458 VAL B HB   1 
ATOM   1949  H HG11 . VAL A 1 121 ? -29.765 8.280   -9.207  1.00 28.86  ? 458 VAL B HG11 1 
ATOM   1950  H HG12 . VAL A 1 121 ? -29.074 7.605   -10.447 1.00 28.86  ? 458 VAL B HG12 1 
ATOM   1951  H HG13 . VAL A 1 121 ? -28.830 7.033   -9.003  1.00 28.86  ? 458 VAL B HG13 1 
ATOM   1952  H HG21 . VAL A 1 121 ? -28.406 9.608   -7.610  1.00 27.00  ? 458 VAL B HG21 1 
ATOM   1953  H HG22 . VAL A 1 121 ? -27.439 8.391   -7.375  1.00 27.00  ? 458 VAL B HG22 1 
ATOM   1954  H HG23 . VAL A 1 121 ? -26.860 9.778   -7.837  1.00 27.00  ? 458 VAL B HG23 1 
ATOM   1955  N N    . PHE A 1 122 ? -26.778 6.389   -11.544 1.00 19.34  ? 459 PHE B N    1 
ATOM   1956  C CA   . PHE A 1 122 ? -27.062 5.839   -12.852 1.00 17.05  ? 459 PHE B CA   1 
ATOM   1957  C C    . PHE A 1 122 ? -28.365 5.077   -12.795 1.00 22.36  ? 459 PHE B C    1 
ATOM   1958  O O    . PHE A 1 122 ? -28.534 4.158   -11.992 1.00 22.16  ? 459 PHE B O    1 
ATOM   1959  C CB   . PHE A 1 122 ? -25.935 4.902   -13.290 1.00 18.35  ? 459 PHE B CB   1 
ATOM   1960  C CG   . PHE A 1 122 ? -24.587 5.559   -13.291 1.00 19.08  ? 459 PHE B CG   1 
ATOM   1961  C CD1  . PHE A 1 122 ? -24.058 6.079   -14.453 1.00 23.96  ? 459 PHE B CD1  1 
ATOM   1962  C CD2  . PHE A 1 122 ? -23.867 5.686   -12.116 1.00 32.63  ? 459 PHE B CD2  1 
ATOM   1963  C CE1  . PHE A 1 122 ? -22.827 6.694   -14.456 1.00 27.22  ? 459 PHE B CE1  1 
ATOM   1964  C CE2  . PHE A 1 122 ? -22.643 6.309   -12.112 1.00 43.27  ? 459 PHE B CE2  1 
ATOM   1965  C CZ   . PHE A 1 122 ? -22.125 6.822   -13.293 1.00 32.73  ? 459 PHE B CZ   1 
ATOM   1966  H H    . PHE A 1 122 ? -26.683 5.786   -10.938 1.00 23.20  ? 459 PHE B H    1 
ATOM   1967  H HA   . PHE A 1 122 ? -27.145 6.563   -13.507 1.00 20.45  ? 459 PHE B HA   1 
ATOM   1968  H HB2  . PHE A 1 122 ? -25.899 4.147   -12.683 1.00 22.02  ? 459 PHE B HB2  1 
ATOM   1969  H HB3  . PHE A 1 122 ? -26.116 4.593   -14.192 1.00 22.02  ? 459 PHE B HB3  1 
ATOM   1970  H HD1  . PHE A 1 122 ? -24.535 6.002   -15.248 1.00 28.75  ? 459 PHE B HD1  1 
ATOM   1971  H HD2  . PHE A 1 122 ? -24.217 5.349   -11.323 1.00 39.16  ? 459 PHE B HD2  1 
ATOM   1972  H HE1  . PHE A 1 122 ? -22.481 7.038   -15.248 1.00 32.66  ? 459 PHE B HE1  1 
ATOM   1973  H HE2  . PHE A 1 122 ? -22.163 6.386   -11.320 1.00 51.93  ? 459 PHE B HE2  1 
ATOM   1974  H HZ   . PHE A 1 122 ? -21.291 7.234   -13.295 1.00 39.27  ? 459 PHE B HZ   1 
ATOM   1975  N N    . LEU A 1 123 ? -29.292 5.479   -13.652 1.00 22.76  ? 460 LEU B N    1 
ATOM   1976  C CA   . LEU A 1 123 ? -30.555 4.796   -13.802 1.00 20.75  ? 460 LEU B CA   1 
ATOM   1977  C C    . LEU A 1 123 ? -30.552 4.280   -15.229 1.00 23.07  ? 460 LEU B C    1 
ATOM   1978  O O    . LEU A 1 123 ? -30.632 5.058   -16.190 1.00 23.36  ? 460 LEU B O    1 
ATOM   1979  C CB   . LEU A 1 123 ? -31.723 5.751   -13.573 1.00 17.77  ? 460 LEU B CB   1 
ATOM   1980  C CG   . LEU A 1 123 ? -31.617 6.527   -12.253 1.00 20.96  ? 460 LEU B CG   1 
ATOM   1981  C CD1  . LEU A 1 123 ? -32.745 7.559   -12.168 1.00 24.04  ? 460 LEU B CD1  1 
ATOM   1982  C CD2  . LEU A 1 123 ? -31.638 5.570   -11.051 1.00 20.91  ? 460 LEU B CD2  1 
ATOM   1983  H H    . LEU A 1 123 ? -29.206 6.162   -14.167 1.00 27.32  ? 460 LEU B H    1 
ATOM   1984  H HA   . LEU A 1 123 ? -30.616 4.043   -13.179 1.00 24.90  ? 460 LEU B HA   1 
ATOM   1985  H HB2  . LEU A 1 123 ? -31.749 6.395   -14.297 1.00 21.33  ? 460 LEU B HB2  1 
ATOM   1986  H HB3  . LEU A 1 123 ? -32.547 5.240   -13.554 1.00 21.33  ? 460 LEU B HB3  1 
ATOM   1987  H HG   . LEU A 1 123 ? -30.774 7.006   -12.238 1.00 25.15  ? 460 LEU B HG   1 
ATOM   1988  H HD11 . LEU A 1 123 ? -32.668 8.038   -11.340 1.00 28.85  ? 460 LEU B HD11 1 
ATOM   1989  H HD12 . LEU A 1 123 ? -32.667 8.168   -12.907 1.00 28.85  ? 460 LEU B HD12 1 
ATOM   1990  H HD13 . LEU A 1 123 ? -33.589 7.104   -12.207 1.00 28.85  ? 460 LEU B HD13 1 
ATOM   1991  H HD21 . LEU A 1 123 ? -31.570 6.084   -10.243 1.00 25.09  ? 460 LEU B HD21 1 
ATOM   1992  H HD22 . LEU A 1 123 ? -32.461 5.077   -11.059 1.00 25.09  ? 460 LEU B HD22 1 
ATOM   1993  H HD23 . LEU A 1 123 ? -30.894 4.967   -11.120 1.00 25.09  ? 460 LEU B HD23 1 
ATOM   1994  N N    . LEU A 1 124 ? -30.427 2.967   -15.368 1.00 18.30  ? 461 LEU B N    1 
ATOM   1995  C CA   . LEU A 1 124 ? -30.209 2.356   -16.670 1.00 18.05  ? 461 LEU B CA   1 
ATOM   1996  C C    . LEU A 1 124 ? -31.435 1.562   -17.073 1.00 19.60  ? 461 LEU B C    1 
ATOM   1997  O O    . LEU A 1 124 ? -31.712 0.501   -16.541 1.00 25.68  ? 461 LEU B O    1 
ATOM   1998  C CB   . LEU A 1 124 ? -28.950 1.475   -16.644 1.00 22.42  ? 461 LEU B CB   1 
ATOM   1999  C CG   . LEU A 1 124 ? -27.655 2.244   -16.344 1.00 25.19  ? 461 LEU B CG   1 
ATOM   2000  C CD1  . LEU A 1 124 ? -26.440 1.280   -16.261 1.00 28.16  ? 461 LEU B CD1  1 
ATOM   2001  C CD2  . LEU A 1 124 ? -27.399 3.341   -17.372 1.00 26.04  ? 461 LEU B CD2  1 
ATOM   2002  H H    . LEU A 1 124 ? -30.465 2.405   -14.719 1.00 21.96  ? 461 LEU B H    1 
ATOM   2003  H HA   . LEU A 1 124 ? -30.072 3.061   -17.336 1.00 21.66  ? 461 LEU B HA   1 
ATOM   2004  H HB2  . LEU A 1 124 ? -29.058 0.798   -15.957 1.00 26.90  ? 461 LEU B HB2  1 
ATOM   2005  H HB3  . LEU A 1 124 ? -28.848 1.050   -17.510 1.00 26.90  ? 461 LEU B HB3  1 
ATOM   2006  H HG   . LEU A 1 124 ? -27.746 2.672   -15.478 1.00 30.23  ? 461 LEU B HG   1 
ATOM   2007  H HD11 . LEU A 1 124 ? -25.649 1.790   -16.073 1.00 33.79  ? 461 LEU B HD11 1 
ATOM   2008  H HD12 . LEU A 1 124 ? -26.593 0.643   -15.559 1.00 33.79  ? 461 LEU B HD12 1 
ATOM   2009  H HD13 . LEU A 1 124 ? -26.344 0.825   -17.101 1.00 33.79  ? 461 LEU B HD13 1 
ATOM   2010  H HD21 . LEU A 1 124 ? -26.583 3.795   -17.148 1.00 31.25  ? 461 LEU B HD21 1 
ATOM   2011  H HD22 . LEU A 1 124 ? -27.324 2.943   -18.242 1.00 31.25  ? 461 LEU B HD22 1 
ATOM   2012  H HD23 . LEU A 1 124 ? -28.133 3.960   -17.357 1.00 31.25  ? 461 LEU B HD23 1 
ATOM   2013  N N    . ASP A 1 125 ? -32.182 2.111   -18.020 1.00 19.37  ? 462 ASP B N    1 
ATOM   2014  C CA   . ASP A 1 125 ? -33.461 1.551   -18.435 1.00 18.28  ? 462 ASP B CA   1 
ATOM   2015  C C    . ASP A 1 125 ? -33.260 0.794   -19.735 1.00 28.19  ? 462 ASP B C    1 
ATOM   2016  O O    . ASP A 1 125 ? -33.645 1.259   -20.803 1.00 26.32  ? 462 ASP B O    1 
ATOM   2017  C CB   . ASP A 1 125 ? -34.462 2.689   -18.631 1.00 20.72  ? 462 ASP B CB   1 
ATOM   2018  C CG   . ASP A 1 125 ? -35.891 2.254   -18.424 1.00 21.72  ? 462 ASP B CG   1 
ATOM   2019  O OD1  . ASP A 1 125 ? -36.208 1.062   -18.633 1.00 24.99  ? 462 ASP B OD1  1 
ATOM   2020  O OD2  . ASP A 1 125 ? -36.704 3.125   -18.062 1.00 21.52  ? 462 ASP B OD2  1 
ATOM   2021  H H    . ASP A 1 125 ? -31.966 2.825   -18.447 1.00 23.25  ? 462 ASP B H    1 
ATOM   2022  H HA   . ASP A 1 125 ? -33.800 0.936   -17.752 1.00 21.94  ? 462 ASP B HA   1 
ATOM   2023  H HB2  . ASP A 1 125 ? -34.268 3.394   -17.993 1.00 24.86  ? 462 ASP B HB2  1 
ATOM   2024  H HB3  . ASP A 1 125 ? -34.381 3.030   -19.535 1.00 24.86  ? 462 ASP B HB3  1 
ATOM   2025  N N    . MET A 1 126 ? -32.641 -0.381  -19.644 1.00 23.08  ? 463 MET B N    1 
ATOM   2026  C CA   . MET A 1 126 ? -32.180 -1.066  -20.836 1.00 25.12  ? 463 MET B CA   1 
ATOM   2027  C C    . MET A 1 126 ? -31.983 -2.532  -20.489 1.00 28.56  ? 463 MET B C    1 
ATOM   2028  O O    . MET A 1 126 ? -31.882 -2.900  -19.302 1.00 20.71  ? 463 MET B O    1 
ATOM   2029  C CB   . MET A 1 126 ? -30.852 -0.456  -21.296 1.00 19.82  ? 463 MET B CB   1 
ATOM   2030  C CG   . MET A 1 126 ? -29.715 -0.705  -20.304 1.00 17.34  ? 463 MET B CG   1 
ATOM   2031  S SD   . MET A 1 126 ? -28.205 0.188   -20.651 1.00 25.85  ? 463 MET B SD   1 
ATOM   2032  C CE   . MET A 1 126 ? -26.986 -0.998  -20.051 1.00 25.13  ? 463 MET B CE   1 
ATOM   2033  H H    . MET A 1 126 ? -32.479 -0.795  -18.908 1.00 27.69  ? 463 MET B H    1 
ATOM   2034  H HA   . MET A 1 126 ? -32.840 -0.975  -21.554 1.00 30.14  ? 463 MET B HA   1 
ATOM   2035  H HB2  . MET A 1 126 ? -30.601 -0.850  -22.146 1.00 23.78  ? 463 MET B HB2  1 
ATOM   2036  H HB3  . MET A 1 126 ? -30.961 0.503   -21.393 1.00 23.78  ? 463 MET B HB3  1 
ATOM   2037  H HG2  . MET A 1 126 ? -30.013 -0.443  -19.419 1.00 20.81  ? 463 MET B HG2  1 
ATOM   2038  H HG3  . MET A 1 126 ? -29.503 -1.652  -20.308 1.00 20.81  ? 463 MET B HG3  1 
ATOM   2039  H HE1  . MET A 1 126 ? -26.107 -0.634  -20.181 1.00 30.15  ? 463 MET B HE1  1 
ATOM   2040  H HE2  . MET A 1 126 ? -27.140 -1.158  -19.117 1.00 30.15  ? 463 MET B HE2  1 
ATOM   2041  H HE3  . MET A 1 126 ? -27.078 -1.816  -20.544 1.00 30.15  ? 463 MET B HE3  1 
ATOM   2042  N N    . CYS A 1 127 ? -31.940 -3.371  -21.515 1.00 23.33  ? 464 CYS B N    1 
ATOM   2043  C CA   . CYS A 1 127 ? -31.690 -4.798  -21.314 1.00 24.78  ? 464 CYS B CA   1 
ATOM   2044  C C    . CYS A 1 127 ? -30.254 -5.021  -20.852 1.00 25.55  ? 464 CYS B C    1 
ATOM   2045  O O    . CYS A 1 127 ? -29.390 -4.163  -21.032 1.00 20.84  ? 464 CYS B O    1 
ATOM   2046  C CB   . CYS A 1 127 ? -31.938 -5.575  -22.606 1.00 31.62  ? 464 CYS B CB   1 
ATOM   2047  S SG   . CYS A 1 127 ? -33.670 -5.695  -23.085 1.00 30.32  ? 464 CYS B SG   1 
ATOM   2048  H H    . CYS A 1 127 ? -32.050 -3.144  -22.337 1.00 28.00  ? 464 CYS B H    1 
ATOM   2049  H HA   . CYS A 1 127 ? -32.296 -5.142  -20.624 1.00 29.74  ? 464 CYS B HA   1 
ATOM   2050  H HB2  . CYS A 1 127 ? -31.462 -5.136  -23.328 1.00 37.95  ? 464 CYS B HB2  1 
ATOM   2051  H HB3  . CYS A 1 127 ? -31.600 -6.478  -22.494 1.00 37.95  ? 464 CYS B HB3  1 
ATOM   2052  H HG   . CYS A 1 127 ? -33.751 -6.320  -24.106 1.00 36.38  ? 464 CYS B HG   1 
ATOM   2053  N N    . ARG A 1 128 ? -29.998 -6.186  -20.259 1.00 24.68  ? 465 ARG B N    1 
ATOM   2054  C CA   . ARG A 1 128 ? -28.691 -6.468  -19.706 1.00 20.83  ? 465 ARG B CA   1 
ATOM   2055  C C    . ARG A 1 128 ? -28.275 -7.883  -20.091 1.00 33.46  ? 465 ARG B C    1 
ATOM   2056  O O    . ARG A 1 128 ? -27.590 -8.551  -19.330 1.00 29.87  ? 465 ARG B O    1 
ATOM   2057  C CB   . ARG A 1 128 ? -28.717 -6.334  -18.182 1.00 27.20  ? 465 ARG B CB   1 
ATOM   2058  C CG   . ARG A 1 128 ? -29.099 -4.957  -17.670 1.00 28.09  ? 465 ARG B CG   1 
ATOM   2059  C CD   . ARG A 1 128 ? -29.227 -4.954  -16.142 1.00 31.95  ? 465 ARG B CD   1 
ATOM   2060  N NE   . ARG A 1 128 ? -27.939 -5.171  -15.488 1.00 27.15  ? 465 ARG B NE   1 
ATOM   2061  C CZ   . ARG A 1 128 ? -27.770 -5.331  -14.179 1.00 27.12  ? 465 ARG B CZ   1 
ATOM   2062  N NH1  . ARG A 1 128 ? -28.814 -5.306  -13.361 1.00 23.05  ? 465 ARG B NH1  1 
ATOM   2063  N NH2  . ARG A 1 128 ? -26.554 -5.521  -13.687 1.00 23.06  ? 465 ARG B NH2  1 
ATOM   2064  H H    . ARG A 1 128 ? -30.568 -6.824  -20.168 1.00 29.61  ? 465 ARG B H    1 
ATOM   2065  H HA   . ARG A 1 128 ? -28.035 -5.837  -20.068 1.00 25.00  ? 465 ARG B HA   1 
ATOM   2066  H HB2  . ARG A 1 128 ? -29.360 -6.967  -17.827 1.00 32.64  ? 465 ARG B HB2  1 
ATOM   2067  H HB3  . ARG A 1 128 ? -27.833 -6.539  -17.839 1.00 32.64  ? 465 ARG B HB3  1 
ATOM   2068  H HG2  . ARG A 1 128 ? -28.413 -4.319  -17.921 1.00 33.71  ? 465 ARG B HG2  1 
ATOM   2069  H HG3  . ARG A 1 128 ? -29.954 -4.700  -18.049 1.00 33.71  ? 465 ARG B HG3  1 
ATOM   2070  H HD2  . ARG A 1 128 ? -29.573 -4.095  -15.853 1.00 38.34  ? 465 ARG B HD2  1 
ATOM   2071  H HD3  . ARG A 1 128 ? -29.828 -5.665  -15.871 1.00 38.34  ? 465 ARG B HD3  1 
ATOM   2072  H HE   . ARG A 1 128 ? -27.239 -5.196  -15.986 1.00 32.58  ? 465 ARG B HE   1 
ATOM   2073  H HH11 . ARG A 1 128 ? -29.605 -5.183  -13.677 1.00 27.66  ? 465 ARG B HH11 1 
ATOM   2074  H HH12 . ARG A 1 128 ? -28.700 -5.411  -12.515 1.00 27.66  ? 465 ARG B HH12 1 
ATOM   2075  H HH21 . ARG A 1 128 ? -25.875 -5.539  -14.215 1.00 27.67  ? 465 ARG B HH21 1 
ATOM   2076  H HH22 . ARG A 1 128 ? -26.443 -5.626  -12.841 1.00 27.67  ? 465 ARG B HH22 1 
ATOM   2077  N N    . LYS A 1 129 ? -28.704 -8.344  -21.264 1.00 36.66  ? 466 LYS B N    1 
ATOM   2078  C CA   . LYS A 1 129 ? -28.272 -9.650  -21.765 1.00 32.66  ? 466 LYS B CA   1 
ATOM   2079  C C    . LYS A 1 129 ? -26.875 -9.520  -22.337 1.00 33.02  ? 466 LYS B C    1 
ATOM   2080  O O    . LYS A 1 129 ? -26.409 -8.419  -22.609 1.00 26.17  ? 466 LYS B O    1 
ATOM   2081  C CB   . LYS A 1 129 ? -29.223 -10.172 -22.841 1.00 30.61  ? 466 LYS B CB   1 
ATOM   2082  C CG   . LYS A 1 129 ? -30.664 -10.277 -22.389 1.00 40.57  ? 466 LYS B CG   1 
ATOM   2083  C CD   . LYS A 1 129 ? -31.553 -10.836 -23.492 1.00 55.98  ? 466 LYS B CD   1 
ATOM   2084  C CE   . LYS A 1 129 ? -31.288 -12.319 -23.724 1.00 69.85  ? 466 LYS B CE   1 
ATOM   2085  N NZ   . LYS A 1 129 ? -31.938 -12.815 -24.971 1.00 78.84  ? 466 LYS B NZ   1 
ATOM   2086  H H    . LYS A 1 129 ? -29.243 -7.924  -21.787 1.00 43.99  ? 466 LYS B H    1 
ATOM   2087  H HA   . LYS A 1 129 ? -28.250 -10.295 -21.027 1.00 39.20  ? 466 LYS B HA   1 
ATOM   2088  H HB2  . LYS A 1 129 ? -29.195 -9.570  -23.601 1.00 36.73  ? 466 LYS B HB2  1 
ATOM   2089  H HB3  . LYS A 1 129 ? -28.933 -11.057 -23.111 1.00 36.73  ? 466 LYS B HB3  1 
ATOM   2090  H HG2  . LYS A 1 129 ? -30.718 -10.871 -21.624 1.00 48.68  ? 466 LYS B HG2  1 
ATOM   2091  H HG3  . LYS A 1 129 ? -30.991 -9.395  -22.153 1.00 48.68  ? 466 LYS B HG3  1 
ATOM   2092  H HD2  . LYS A 1 129 ? -32.484 -10.730 -23.238 1.00 67.18  ? 466 LYS B HD2  1 
ATOM   2093  H HD3  . LYS A 1 129 ? -31.375 -10.362 -24.319 1.00 67.18  ? 466 LYS B HD3  1 
ATOM   2094  H HE2  . LYS A 1 129 ? -30.332 -12.463 -23.805 1.00 83.82  ? 466 LYS B HE2  1 
ATOM   2095  H HE3  . LYS A 1 129 ? -31.641 -12.827 -22.977 1.00 83.82  ? 466 LYS B HE3  1 
ATOM   2096  H HZ1  . LYS A 1 129 ? -31.766 -13.681 -25.080 1.00 94.61  ? 466 LYS B HZ1  1 
ATOM   2097  H HZ2  . LYS A 1 129 ? -32.819 -12.699 -24.921 1.00 94.61  ? 466 LYS B HZ2  1 
ATOM   2098  H HZ3  . LYS A 1 129 ? -31.627 -12.367 -25.675 1.00 94.61  ? 466 LYS B HZ3  1 
ATOM   2099  N N    . ARG A 1 130 ? -26.201 -10.650 -22.516 1.00 32.53  ? 467 ARG B N    1 
ATOM   2100  C CA   . ARG A 1 130 ? -24.854 -10.650 -23.054 1.00 44.40  ? 467 ARG B CA   1 
ATOM   2101  C C    . ARG A 1 130 ? -24.867 -10.368 -24.558 1.00 36.90  ? 467 ARG B C    1 
ATOM   2102  O O    . ARG A 1 130 ? -25.861 -10.596 -25.245 1.00 35.67  ? 467 ARG B O    1 
ATOM   2103  C CB   . ARG A 1 130 ? -24.191 -12.004 -22.775 1.00 54.66  ? 467 ARG B CB   1 
ATOM   2104  C CG   . ARG A 1 130 ? -22.681 -11.940 -22.710 1.00 70.24  ? 467 ARG B CG   1 
ATOM   2105  C CD   . ARG A 1 130 ? -22.069 -13.314 -22.493 1.00 75.25  ? 467 ARG B CD   1 
ATOM   2106  N NE   . ARG A 1 130 ? -20.635 -13.303 -22.765 1.00 93.72  ? 467 ARG B NE   1 
ATOM   2107  C CZ   . ARG A 1 130 ? -20.106 -13.230 -23.984 1.00 108.66 ? 467 ARG B CZ   1 
ATOM   2108  N NH1  . ARG A 1 130 ? -20.891 -13.156 -25.050 1.00 110.82 ? 467 ARG B NH1  1 
ATOM   2109  N NH2  . ARG A 1 130 ? -18.790 -13.226 -24.145 1.00 115.32 ? 467 ARG B NH2  1 
ATOM   2110  H H    . ARG A 1 130 ? -26.507 -11.433 -22.332 1.00 39.04  ? 467 ARG B H    1 
ATOM   2111  H HA   . ARG A 1 130 ? -24.328 -9.951  -22.613 1.00 53.28  ? 467 ARG B HA   1 
ATOM   2112  H HB2  . ARG A 1 130 ? -24.511 -12.339 -21.923 1.00 65.59  ? 467 ARG B HB2  1 
ATOM   2113  H HB3  . ARG A 1 130 ? -24.432 -12.621 -23.484 1.00 65.59  ? 467 ARG B HB3  1 
ATOM   2114  H HG2  . ARG A 1 130 ? -22.339 -11.585 -23.545 1.00 84.29  ? 467 ARG B HG2  1 
ATOM   2115  H HG3  . ARG A 1 130 ? -22.417 -11.371 -21.970 1.00 84.29  ? 467 ARG B HG3  1 
ATOM   2116  H HD2  . ARG A 1 130 ? -22.202 -13.583 -21.571 1.00 90.30  ? 467 ARG B HD2  1 
ATOM   2117  H HD3  . ARG A 1 130 ? -22.488 -13.950 -23.094 1.00 90.30  ? 467 ARG B HD3  1 
ATOM   2118  H HE   . ARG A 1 130 ? -20.098 -13.308 -22.093 1.00 112.46 ? 467 ARG B HE   1 
ATOM   2119  H HH11 . ARG A 1 130 ? -21.745 -13.158 -24.955 1.00 132.99 ? 467 ARG B HH11 1 
ATOM   2120  H HH12 . ARG A 1 130 ? -20.545 -13.108 -25.836 1.00 132.99 ? 467 ARG B HH12 1 
ATOM   2121  H HH21 . ARG A 1 130 ? -18.273 -13.273 -23.459 1.00 138.38 ? 467 ARG B HH21 1 
ATOM   2122  H HH22 . ARG A 1 130 ? -18.453 -13.178 -24.935 1.00 138.38 ? 467 ARG B HH22 1 
ATOM   2123  N N    . ASN A 1 131 ? -23.754 -9.863  -25.066 1.00 42.99  ? 468 ASN B N    1 
ATOM   2124  C CA   . ASN A 1 131 ? -23.584 -9.651  -26.493 1.00 41.95  ? 468 ASN B CA   1 
ATOM   2125  C C    . ASN A 1 131 ? -22.556 -10.649 -27.001 1.00 44.87  ? 468 ASN B C    1 
ATOM   2126  O O    . ASN A 1 131 ? -21.363 -10.471 -26.778 1.00 39.86  ? 468 ASN B O    1 
ATOM   2127  C CB   . ASN A 1 131 ? -23.112 -8.226  -26.767 1.00 27.83  ? 468 ASN B CB   1 
ATOM   2128  C CG   . ASN A 1 131 ? -22.860 -7.974  -28.244 1.00 43.73  ? 468 ASN B CG   1 
ATOM   2129  O OD1  . ASN A 1 131 ? -23.143 -8.826  -29.085 1.00 52.62  ? 468 ASN B OD1  1 
ATOM   2130  N ND2  . ASN A 1 131 ? -22.333 -6.797  -28.564 1.00 35.85  ? 468 ASN B ND2  1 
ATOM   2131  H H    . ASN A 1 131 ? -23.072 -9.631  -24.597 1.00 51.59  ? 468 ASN B H    1 
ATOM   2132  H HA   . ASN A 1 131 ? -24.433 -9.802  -26.958 1.00 50.34  ? 468 ASN B HA   1 
ATOM   2133  H HB2  . ASN A 1 131 ? -23.791 -7.603  -26.467 1.00 33.40  ? 468 ASN B HB2  1 
ATOM   2134  H HB3  . ASN A 1 131 ? -22.282 -8.070  -26.289 1.00 33.40  ? 468 ASN B HB3  1 
ATOM   2135  H HD21 . ASN A 1 131 ? -22.153 -6.224  -27.948 1.00 43.02  ? 468 ASN B HD21 1 
ATOM   2136  H HD22 . ASN A 1 131 ? -22.173 -6.607  -29.388 1.00 43.02  ? 468 ASN B HD22 1 
ATOM   2137  N N    . ASP A 1 132 ? -23.017 -11.702 -27.669 1.00 53.76  ? 469 ASP B N    1 
ATOM   2138  C CA   . ASP A 1 132 ? -22.140 -12.806 -28.063 1.00 65.53  ? 469 ASP B CA   1 
ATOM   2139  C C    . ASP A 1 132 ? -21.088 -12.409 -29.105 1.00 66.39  ? 469 ASP B C    1 
ATOM   2140  O O    . ASP A 1 132 ? -20.048 -13.061 -29.221 1.00 71.61  ? 469 ASP B O    1 
ATOM   2141  C CB   . ASP A 1 132 ? -22.970 -13.993 -28.568 1.00 71.04  ? 469 ASP B CB   1 
ATOM   2142  C CG   . ASP A 1 132 ? -23.618 -14.780 -27.433 1.00 70.94  ? 469 ASP B CG   1 
ATOM   2143  O OD1  . ASP A 1 132 ? -23.016 -14.852 -26.340 1.00 59.14  ? 469 ASP B OD1  1 
ATOM   2144  O OD2  . ASP A 1 132 ? -24.725 -15.327 -27.631 1.00 70.41  ? 469 ASP B OD2  1 
ATOM   2145  H H    . ASP A 1 132 ? -23.837 -11.804 -27.908 1.00 64.52  ? 469 ASP B H    1 
ATOM   2146  H HA   . ASP A 1 132 ? -21.656 -13.109 -27.266 1.00 78.63  ? 469 ASP B HA   1 
ATOM   2147  H HB2  . ASP A 1 132 ? -23.675 -13.662 -29.146 1.00 85.24  ? 469 ASP B HB2  1 
ATOM   2148  H HB3  . ASP A 1 132 ? -22.392 -14.597 -29.060 1.00 85.24  ? 469 ASP B HB3  1 
ATOM   2149  N N    . TYR A 1 133 ? -21.354 -11.339 -29.849 1.00 55.59  ? 470 TYR B N    1 
ATOM   2150  C CA   . TYR A 1 133 ? -20.448 -10.896 -30.909 1.00 59.76  ? 470 TYR B CA   1 
ATOM   2151  C C    . TYR A 1 133 ? -19.336 -10.029 -30.343 1.00 66.07  ? 470 TYR B C    1 
ATOM   2152  O O    . TYR A 1 133 ? -18.306 -9.823  -30.982 1.00 71.83  ? 470 TYR B O    1 
ATOM   2153  C CB   . TYR A 1 133 ? -21.228 -10.132 -31.986 1.00 53.17  ? 470 TYR B CB   1 
ATOM   2154  C CG   . TYR A 1 133 ? -22.391 -10.932 -32.514 1.00 55.86  ? 470 TYR B CG   1 
ATOM   2155  C CD1  . TYR A 1 133 ? -23.563 -11.051 -31.777 1.00 60.53  ? 470 TYR B CD1  1 
ATOM   2156  C CD2  . TYR A 1 133 ? -22.308 -11.598 -33.729 1.00 58.38  ? 470 TYR B CD2  1 
ATOM   2157  C CE1  . TYR A 1 133 ? -24.626 -11.797 -32.239 1.00 64.35  ? 470 TYR B CE1  1 
ATOM   2158  C CE2  . TYR A 1 133 ? -23.368 -12.349 -34.202 1.00 63.95  ? 470 TYR B CE2  1 
ATOM   2159  C CZ   . TYR A 1 133 ? -24.524 -12.446 -33.452 1.00 69.19  ? 470 TYR B CZ   1 
ATOM   2160  O OH   . TYR A 1 133 ? -25.587 -13.189 -33.910 1.00 72.49  ? 470 TYR B OH   1 
ATOM   2161  H H    . TYR A 1 133 ? -22.055 -10.849 -29.761 1.00 66.70  ? 470 TYR B H    1 
ATOM   2162  H HA   . TYR A 1 133 ? -20.039 -11.681 -31.329 1.00 71.71  ? 470 TYR B HA   1 
ATOM   2163  H HB2  . TYR A 1 133 ? -21.574 -9.310  -31.606 1.00 63.80  ? 470 TYR B HB2  1 
ATOM   2164  H HB3  . TYR A 1 133 ? -20.635 -9.934  -32.728 1.00 63.80  ? 470 TYR B HB3  1 
ATOM   2165  H HD1  . TYR A 1 133 ? -23.632 -10.617 -30.958 1.00 72.64  ? 470 TYR B HD1  1 
ATOM   2166  H HD2  . TYR A 1 133 ? -21.529 -11.537 -34.234 1.00 70.05  ? 470 TYR B HD2  1 
ATOM   2167  H HE1  . TYR A 1 133 ? -25.405 -11.863 -31.736 1.00 77.22  ? 470 TYR B HE1  1 
ATOM   2168  H HE2  . TYR A 1 133 ? -23.303 -12.787 -35.019 1.00 76.74  ? 470 TYR B HE2  1 
ATOM   2169  H HH   . TYR A 1 133 ? -25.359 -13.971 -34.012 1.00 86.99  ? 470 TYR B HH   1 
ATOM   2170  N N    . ASP A 1 134 ? -19.548 -9.530  -29.133 1.00 60.82  ? 471 ASP B N    1 
ATOM   2171  C CA   . ASP A 1 134 ? -18.598 -8.625  -28.506 1.00 68.01  ? 471 ASP B CA   1 
ATOM   2172  C C    . ASP A 1 134 ? -17.692 -9.394  -27.561 1.00 80.71  ? 471 ASP B C    1 
ATOM   2173  O O    . ASP A 1 134 ? -18.017 -9.580  -26.389 1.00 76.58  ? 471 ASP B O    1 
ATOM   2174  C CB   . ASP A 1 134 ? -19.344 -7.522  -27.752 1.00 62.85  ? 471 ASP B CB   1 
ATOM   2175  C CG   . ASP A 1 134 ? -18.411 -6.569  -27.039 1.00 54.82  ? 471 ASP B CG   1 
ATOM   2176  O OD1  . ASP A 1 134 ? -17.272 -6.380  -27.511 1.00 57.58  ? 471 ASP B OD1  1 
ATOM   2177  O OD2  . ASP A 1 134 ? -18.816 -6.010  -26.001 1.00 44.08  ? 471 ASP B OD2  1 
ATOM   2178  H H    . ASP A 1 134 ? -20.239 -9.702  -28.651 1.00 72.98  ? 471 ASP B H    1 
ATOM   2179  H HA   . ASP A 1 134 ? -18.042 -8.208  -29.197 1.00 81.61  ? 471 ASP B HA   1 
ATOM   2180  H HB2  . ASP A 1 134 ? -19.872 -7.008  -28.383 1.00 75.42  ? 471 ASP B HB2  1 
ATOM   2181  H HB3  . ASP A 1 134 ? -19.923 -7.928  -27.088 1.00 75.42  ? 471 ASP B HB3  1 
ATOM   2182  N N    . ASP A 1 135 ? -16.555 -9.847  -28.076 1.00 105.12 ? 472 ASP B N    1 
ATOM   2183  C CA   . ASP A 1 135 ? -15.608 -10.595 -27.263 1.00 126.46 ? 472 ASP B CA   1 
ATOM   2184  C C    . ASP A 1 135 ? -14.387 -9.743  -26.935 1.00 133.22 ? 472 ASP B C    1 
ATOM   2185  O O    . ASP A 1 135 ? -13.249 -10.200 -27.045 1.00 141.92 ? 472 ASP B O    1 
ATOM   2186  C CB   . ASP A 1 135 ? -15.184 -11.883 -27.971 1.00 137.17 ? 472 ASP B CB   1 
ATOM   2187  C CG   . ASP A 1 135 ? -14.520 -12.873 -27.029 1.00 143.22 ? 472 ASP B CG   1 
ATOM   2188  O OD1  . ASP A 1 135 ? -14.839 -12.855 -25.821 1.00 139.59 ? 472 ASP B OD1  1 
ATOM   2189  O OD2  . ASP A 1 135 ? -13.681 -13.671 -27.497 1.00 149.30 ? 472 ASP B OD2  1 
ATOM   2190  H H    . ASP A 1 135 ? -16.309 -9.734  -28.892 1.00 126.14 ? 472 ASP B H    1 
ATOM   2191  H HA   . ASP A 1 135 ? -16.039 -10.842 -26.418 1.00 151.75 ? 472 ASP B HA   1 
ATOM   2192  H HB2  . ASP A 1 135 ? -15.969 -12.309 -28.350 1.00 164.60 ? 472 ASP B HB2  1 
ATOM   2193  H HB3  . ASP A 1 135 ? -14.551 -11.665 -28.673 1.00 164.60 ? 472 ASP B HB3  1 
ATOM   2194  N N    . THR A 1 136 ? -14.632 -8.498  -26.542 1.00 117.36 ? 473 THR B N    1 
ATOM   2195  C CA   . THR A 1 136 ? -13.575 -7.645  -26.022 1.00 115.15 ? 473 THR B CA   1 
ATOM   2196  C C    . THR A 1 136 ? -13.521 -7.846  -24.513 1.00 118.71 ? 473 THR B C    1 
ATOM   2197  O O    . THR A 1 136 ? -14.554 -7.997  -23.862 1.00 108.35 ? 473 THR B O    1 
ATOM   2198  C CB   . THR A 1 136 ? -13.822 -6.161  -26.351 1.00 107.11 ? 473 THR B CB   1 
ATOM   2199  O OG1  . THR A 1 136 ? -14.092 -6.020  -27.751 1.00 103.78 ? 473 THR B OG1  1 
ATOM   2200  C CG2  . THR A 1 136 ? -12.605 -5.318  -25.991 1.00 105.83 ? 473 THR B CG2  1 
ATOM   2201  H H    . THR A 1 136 ? -15.406 -8.124  -26.567 1.00 140.83 ? 473 THR B H    1 
ATOM   2202  H HA   . THR A 1 136 ? -12.714 -7.914  -26.406 1.00 138.18 ? 473 THR B HA   1 
ATOM   2203  H HB   . THR A 1 136 ? -14.581 -5.839  -25.841 1.00 128.53 ? 473 THR B HB   1 
ATOM   2204  H HG1  . THR A 1 136 ? -14.757 -6.455  -27.954 1.00 124.54 ? 473 THR B HG1  1 
ATOM   2205  H HG21 . THR A 1 136 ? -12.771 -4.396  -26.201 1.00 127.00 ? 473 THR B HG21 1 
ATOM   2206  H HG22 . THR A 1 136 ? -12.419 -5.396  -25.052 1.00 127.00 ? 473 THR B HG22 1 
ATOM   2207  H HG23 . THR A 1 136 ? -11.840 -5.618  -26.487 1.00 127.00 ? 473 THR B HG23 1 
ATOM   2208  N N    . ILE A 1 137 ? -12.316 -7.856  -23.959 1.00 143.21 ? 474 ILE B N    1 
ATOM   2209  C CA   . ILE A 1 137 ? -12.132 -8.153  -22.547 1.00 150.73 ? 474 ILE B CA   1 
ATOM   2210  C C    . ILE A 1 137 ? -11.355 -7.028  -21.875 1.00 143.51 ? 474 ILE B C    1 
ATOM   2211  O O    . ILE A 1 137 ? -10.324 -7.268  -21.245 1.00 146.14 ? 474 ILE B O    1 
ATOM   2212  C CB   . ILE A 1 137 ? -11.371 -9.480  -22.370 1.00 164.31 ? 474 ILE B CB   1 
ATOM   2213  C CG1  . ILE A 1 137 ? -11.928 -10.542 -23.322 1.00 171.35 ? 474 ILE B CG1  1 
ATOM   2214  C CG2  . ILE A 1 137 ? -11.460 -9.957  -20.936 1.00 164.68 ? 474 ILE B CG2  1 
ATOM   2215  C CD1  . ILE A 1 137 ? -11.119 -11.819 -23.350 1.00 177.87 ? 474 ILE B CD1  1 
ATOM   2216  H H    . ILE A 1 137 ? -11.585 -7.693  -24.382 1.00 171.85 ? 474 ILE B H    1 
ATOM   2217  H HA   . ILE A 1 137 ? -13.007 -8.234  -22.111 1.00 180.87 ? 474 ILE B HA   1 
ATOM   2218  H HB   . ILE A 1 137 ? -10.438 -9.330  -22.587 1.00 197.17 ? 474 ILE B HB   1 
ATOM   2219  H HG12 . ILE A 1 137 ? -12.830 -10.768 -23.045 1.00 205.62 ? 474 ILE B HG12 1 
ATOM   2220  H HG13 . ILE A 1 137 ? -11.941 -10.179 -24.222 1.00 205.62 ? 474 ILE B HG13 1 
ATOM   2221  H HG21 . ILE A 1 137 ? -10.979 -10.783 -20.851 1.00 197.62 ? 474 ILE B HG21 1 
ATOM   2222  H HG22 . ILE A 1 137 ? -11.073 -9.292  -20.361 1.00 197.62 ? 474 ILE B HG22 1 
ATOM   2223  H HG23 . ILE A 1 137 ? -12.383 -10.090 -20.708 1.00 197.62 ? 474 ILE B HG23 1 
ATOM   2224  H HD11 . ILE A 1 137 ? -11.527 -12.433 -23.966 1.00 213.44 ? 474 ILE B HD11 1 
ATOM   2225  H HD12 . ILE A 1 137 ? -10.225 -11.616 -23.634 1.00 213.44 ? 474 ILE B HD12 1 
ATOM   2226  H HD13 . ILE A 1 137 ? -11.105 -12.199 -22.469 1.00 213.44 ? 474 ILE B HD13 1 
ATOM   2227  N N    . PRO A 1 138 ? -11.856 -5.788  -22.000 1.00 125.02 ? 475 PRO B N    1 
ATOM   2228  C CA   . PRO A 1 138 ? -11.124 -4.607  -21.541 1.00 112.90 ? 475 PRO B CA   1 
ATOM   2229  C C    . PRO A 1 138 ? -11.296 -4.357  -20.050 1.00 105.14 ? 475 PRO B C    1 
ATOM   2230  O O    . PRO A 1 138 ? -12.363 -3.918  -19.624 1.00 93.62  ? 475 PRO B O    1 
ATOM   2231  C CB   . PRO A 1 138 ? -11.777 -3.481  -22.337 1.00 109.79 ? 475 PRO B CB   1 
ATOM   2232  C CG   . PRO A 1 138 ? -13.198 -3.916  -22.467 1.00 111.43 ? 475 PRO B CG   1 
ATOM   2233  C CD   . PRO A 1 138 ? -13.188 -5.430  -22.518 1.00 118.25 ? 475 PRO B CD   1 
ATOM   2234  H HA   . PRO A 1 138 ? -10.173 -4.671  -21.767 1.00 135.48 ? 475 PRO B HA   1 
ATOM   2235  H HB2  . PRO A 1 138 ? -11.713 -2.648  -21.846 1.00 131.75 ? 475 PRO B HB2  1 
ATOM   2236  H HB3  . PRO A 1 138 ? -11.357 -3.405  -23.208 1.00 131.75 ? 475 PRO B HB3  1 
ATOM   2237  H HG2  . PRO A 1 138 ? -13.701 -3.607  -21.698 1.00 133.71 ? 475 PRO B HG2  1 
ATOM   2238  H HG3  . PRO A 1 138 ? -13.573 -3.552  -23.285 1.00 133.71 ? 475 PRO B HG3  1 
ATOM   2239  H HD2  . PRO A 1 138 ? -13.882 -5.791  -21.944 1.00 141.90 ? 475 PRO B HD2  1 
ATOM   2240  H HD3  . PRO A 1 138 ? -13.289 -5.737  -23.433 1.00 141.90 ? 475 PRO B HD3  1 
ATOM   2241  N N    . ILE A 1 139 ? -10.259 -4.638  -19.268 1.00 122.20 ? 476 ILE B N    1 
ATOM   2242  C CA   . ILE A 1 139 ? -10.295 -4.355  -17.840 1.00 117.05 ? 476 ILE B CA   1 
ATOM   2243  C C    . ILE A 1 139 ? -9.994  -2.878  -17.606 1.00 105.63 ? 476 ILE B C    1 
ATOM   2244  O O    . ILE A 1 139 ? -8.957  -2.367  -18.030 1.00 109.05 ? 476 ILE B O    1 
ATOM   2245  C CB   . ILE A 1 139 ? -9.300  -5.236  -17.046 1.00 123.12 ? 476 ILE B CB   1 
ATOM   2246  C CG1  . ILE A 1 139 ? -7.852  -4.918  -17.433 1.00 128.62 ? 476 ILE B CG1  1 
ATOM   2247  C CG2  . ILE A 1 139 ? -9.598  -6.709  -17.278 1.00 125.97 ? 476 ILE B CG2  1 
ATOM   2248  C CD1  . ILE A 1 139 ? -6.824  -5.735  -16.677 1.00 131.40 ? 476 ILE B CD1  1 
ATOM   2249  H H    . ILE A 1 139 ? -9.524  -4.993  -19.540 1.00 146.64 ? 476 ILE B H    1 
ATOM   2250  H HA   . ILE A 1 139 ? -11.197 -4.537  -17.502 1.00 140.46 ? 476 ILE B HA   1 
ATOM   2251  H HB   . ILE A 1 139 ? -9.411  -5.047  -16.101 1.00 147.75 ? 476 ILE B HB   1 
ATOM   2252  H HG12 . ILE A 1 139 ? -7.736  -5.096  -18.379 1.00 154.35 ? 476 ILE B HG12 1 
ATOM   2253  H HG13 . ILE A 1 139 ? -7.679  -3.981  -17.250 1.00 154.35 ? 476 ILE B HG13 1 
ATOM   2254  H HG21 . ILE A 1 139 ? -8.971  -7.237  -16.778 1.00 151.16 ? 476 ILE B HG21 1 
ATOM   2255  H HG22 . ILE A 1 139 ? -10.492 -6.897  -16.983 1.00 151.16 ? 476 ILE B HG22 1 
ATOM   2256  H HG23 . ILE A 1 139 ? -9.514  -6.901  -18.214 1.00 151.16 ? 476 ILE B HG23 1 
ATOM   2257  H HD11 . ILE A 1 139 ? -5.946  -5.482  -16.972 1.00 157.68 ? 476 ILE B HD11 1 
ATOM   2258  H HD12 . ILE A 1 139 ? -6.917  -5.563  -15.738 1.00 157.68 ? 476 ILE B HD12 1 
ATOM   2259  H HD13 . ILE A 1 139 ? -6.974  -6.667  -16.856 1.00 157.68 ? 476 ILE B HD13 1 
ATOM   2260  N N    . LEU A 1 140 ? -10.922 -2.191  -16.950 1.00 89.13  ? 477 LEU B N    1 
ATOM   2261  C CA   . LEU A 1 140 ? -10.739 -0.787  -16.614 1.00 72.48  ? 477 LEU B CA   1 
ATOM   2262  C C    . LEU A 1 140 ? -9.991  -0.685  -15.295 1.00 64.14  ? 477 LEU B C    1 
ATOM   2263  O O    . LEU A 1 140 ? -9.935  -1.650  -14.531 1.00 53.48  ? 477 LEU B O    1 
ATOM   2264  C CB   . LEU A 1 140 ? -12.092 -0.080  -16.487 1.00 65.99  ? 477 LEU B CB   1 
ATOM   2265  C CG   . LEU A 1 140 ? -12.986 -0.018  -17.730 1.00 65.54  ? 477 LEU B CG   1 
ATOM   2266  C CD1  . LEU A 1 140 ? -13.763 -1.311  -17.924 1.00 59.11  ? 477 LEU B CD1  1 
ATOM   2267  C CD2  . LEU A 1 140 ? -13.946 1.156   -17.615 1.00 62.22  ? 477 LEU B CD2  1 
ATOM   2268  H H    . LEU A 1 140 ? -11.672 -2.518  -16.687 1.00 106.96 ? 477 LEU B H    1 
ATOM   2269  H HA   . LEU A 1 140 ? -10.213 -0.343  -17.312 1.00 86.98  ? 477 LEU B HA   1 
ATOM   2270  H HB2  . LEU A 1 140 ? -12.601 -0.530  -15.795 1.00 79.19  ? 477 LEU B HB2  1 
ATOM   2271  H HB3  . LEU A 1 140 ? -11.926 0.836   -16.213 1.00 79.19  ? 477 LEU B HB3  1 
ATOM   2272  H HG   . LEU A 1 140 ? -12.431 0.121   -18.514 1.00 78.65  ? 477 LEU B HG   1 
ATOM   2273  H HD11 . LEU A 1 140 ? -14.309 -1.233  -18.710 1.00 70.93  ? 477 LEU B HD11 1 
ATOM   2274  H HD12 . LEU A 1 140 ? -13.142 -2.036  -18.028 1.00 70.93  ? 477 LEU B HD12 1 
ATOM   2275  H HD13 . LEU A 1 140 ? -14.317 -1.461  -17.155 1.00 70.93  ? 477 LEU B HD13 1 
ATOM   2276  H HD21 . LEU A 1 140 ? -14.500 1.184   -18.399 1.00 74.66  ? 477 LEU B HD21 1 
ATOM   2277  H HD22 . LEU A 1 140 ? -14.490 1.039   -16.833 1.00 74.66  ? 477 LEU B HD22 1 
ATOM   2278  H HD23 . LEU A 1 140 ? -13.439 1.968   -17.543 1.00 74.66  ? 477 LEU B HD23 1 
ATOM   2279  N N    . ASP A 1 141 ? -9.417  0.483   -15.027 1.00 65.33  ? 478 ASP B N    1 
ATOM   2280  C CA   . ASP A 1 141 ? -8.783  0.730   -13.739 1.00 66.93  ? 478 ASP B CA   1 
ATOM   2281  C C    . ASP A 1 141 ? -9.801  0.482   -12.639 1.00 60.24  ? 478 ASP B C    1 
ATOM   2282  O O    . ASP A 1 141 ? -10.985 0.766   -12.810 1.00 46.37  ? 478 ASP B O    1 
ATOM   2283  C CB   . ASP A 1 141 ? -8.288  2.174   -13.639 1.00 72.29  ? 478 ASP B CB   1 
ATOM   2284  C CG   . ASP A 1 141 ? -7.287  2.527   -14.716 1.00 79.75  ? 478 ASP B CG   1 
ATOM   2285  O OD1  . ASP A 1 141 ? -7.711  3.012   -15.788 1.00 84.37  ? 478 ASP B OD1  1 
ATOM   2286  O OD2  . ASP A 1 141 ? -6.078  2.329   -14.486 1.00 76.03  ? 478 ASP B OD2  1 
ATOM   2287  H H    . ASP A 1 141 ? -9.382  1.147   -15.573 1.00 78.40  ? 478 ASP B H    1 
ATOM   2288  H HA   . ASP A 1 141 ? -8.024  0.122   -13.616 1.00 80.32  ? 478 ASP B HA   1 
ATOM   2289  H HB2  . ASP A 1 141 ? -9.046  2.774   -13.726 1.00 86.75  ? 478 ASP B HB2  1 
ATOM   2290  H HB3  . ASP A 1 141 ? -7.860  2.303   -12.778 1.00 86.75  ? 478 ASP B HB3  1 
ATOM   2291  N N    . ALA A 1 142 ? -9.347  -0.048  -11.511 1.00 55.20  ? 479 ALA B N    1 
ATOM   2292  C CA   . ALA A 1 142 ? -10.216 -0.180  -10.355 1.00 56.36  ? 479 ALA B CA   1 
ATOM   2293  C C    . ALA A 1 142 ? -10.723 1.206   -9.973  1.00 48.52  ? 479 ALA B C    1 
ATOM   2294  O O    . ALA A 1 142 ? -9.940  2.143   -9.832  1.00 45.09  ? 479 ALA B O    1 
ATOM   2295  C CB   . ALA A 1 142 ? -9.469  -0.808  -9.200  1.00 52.20  ? 479 ALA B CB   1 
ATOM   2296  H H    . ALA A 1 142 ? -8.545  -0.336  -11.391 1.00 66.25  ? 479 ALA B H    1 
ATOM   2297  H HA   . ALA A 1 142 ? -10.983 -0.746  -10.580 1.00 67.63  ? 479 ALA B HA   1 
ATOM   2298  H HB1  . ALA A 1 142 ? -10.063 -0.885  -8.450  1.00 62.64  ? 479 ALA B HB1  1 
ATOM   2299  H HB2  . ALA A 1 142 ? -9.161  -1.678  -9.465  1.00 62.64  ? 479 ALA B HB2  1 
ATOM   2300  H HB3  . ALA A 1 142 ? -8.722  -0.251  -8.972  1.00 62.64  ? 479 ALA B HB3  1 
ATOM   2301  N N    . LEU A 1 143 ? -12.036 1.338   -9.825  1.00 48.03  ? 480 LEU B N    1 
ATOM   2302  C CA   . LEU A 1 143 ? -12.629 2.602   -9.414  1.00 50.40  ? 480 LEU B CA   1 
ATOM   2303  C C    . LEU A 1 143 ? -12.228 2.919   -7.984  1.00 49.28  ? 480 LEU B C    1 
ATOM   2304  O O    . LEU A 1 143 ? -12.020 2.012   -7.170  1.00 46.66  ? 480 LEU B O    1 
ATOM   2305  C CB   . LEU A 1 143 ? -14.151 2.535   -9.515  1.00 57.85  ? 480 LEU B CB   1 
ATOM   2306  C CG   . LEU A 1 143 ? -14.686 2.181   -10.902 1.00 61.63  ? 480 LEU B CG   1 
ATOM   2307  C CD1  . LEU A 1 143 ? -16.146 1.761   -10.822 1.00 69.69  ? 480 LEU B CD1  1 
ATOM   2308  C CD2  . LEU A 1 143 ? -14.499 3.345   -11.863 1.00 56.50  ? 480 LEU B CD2  1 
ATOM   2309  H H    . LEU A 1 143 ? -12.607 0.709   -9.957  1.00 57.64  ? 480 LEU B H    1 
ATOM   2310  H HA   . LEU A 1 143 ? -12.307 3.322   -9.996  1.00 60.48  ? 480 LEU B HA   1 
ATOM   2311  H HB2  . LEU A 1 143 ? -14.472 1.861   -8.896  1.00 69.43  ? 480 LEU B HB2  1 
ATOM   2312  H HB3  . LEU A 1 143 ? -14.515 3.400   -9.272  1.00 69.43  ? 480 LEU B HB3  1 
ATOM   2313  H HG   . LEU A 1 143 ? -14.181 1.428   -11.248 1.00 73.95  ? 480 LEU B HG   1 
ATOM   2314  H HD11 . LEU A 1 143 ? -16.458 1.544   -11.704 1.00 83.62  ? 480 LEU B HD11 1 
ATOM   2315  H HD12 . LEU A 1 143 ? -16.220 0.993   -10.251 1.00 83.62  ? 480 LEU B HD12 1 
ATOM   2316  H HD13 . LEU A 1 143 ? -16.661 2.487   -10.462 1.00 83.62  ? 480 LEU B HD13 1 
ATOM   2317  H HD21 . LEU A 1 143 ? -14.842 3.097   -12.725 1.00 67.81  ? 480 LEU B HD21 1 
ATOM   2318  H HD22 . LEU A 1 143 ? -14.976 4.107   -11.527 1.00 67.81  ? 480 LEU B HD22 1 
ATOM   2319  H HD23 . LEU A 1 143 ? -13.562 3.548   -11.929 1.00 67.81  ? 480 LEU B HD23 1 
ATOM   2320  N N    . LYS A 1 144 ? -12.126 4.205   -7.674  1.00 31.76  ? 481 LYS B N    1 
ATOM   2321  C CA   . LYS A 1 144 ? -11.814 4.619   -6.316  1.00 41.86  ? 481 LYS B CA   1 
ATOM   2322  C C    . LYS A 1 144 ? -13.014 4.350   -5.413  1.00 42.24  ? 481 LYS B C    1 
ATOM   2323  O O    . LYS A 1 144 ? -14.148 4.248   -5.883  1.00 36.86  ? 481 LYS B O    1 
ATOM   2324  C CB   . LYS A 1 144 ? -11.431 6.101   -6.261  1.00 51.65  ? 481 LYS B CB   1 
ATOM   2325  C CG   . LYS A 1 144 ? -10.862 6.523   -4.912  1.00 70.90  ? 481 LYS B CG   1 
ATOM   2326  C CD   . LYS A 1 144 ? -10.559 8.012   -4.849  1.00 89.37  ? 481 LYS B CD   1 
ATOM   2327  C CE   . LYS A 1 144 ? -10.033 8.413   -3.474  1.00 97.74  ? 481 LYS B CE   1 
ATOM   2328  N NZ   . LYS A 1 144 ? -11.022 8.157   -2.386  1.00 97.69  ? 481 LYS B NZ   1 
ATOM   2329  H H    . LYS A 1 144 ? -12.232 4.854   -8.228  1.00 38.11  ? 481 LYS B H    1 
ATOM   2330  H HA   . LYS A 1 144 ? -11.056 4.094   -5.984  1.00 50.23  ? 481 LYS B HA   1 
ATOM   2331  H HB2  . LYS A 1 144 ? -10.758 6.277   -6.937  1.00 61.98  ? 481 LYS B HB2  1 
ATOM   2332  H HB3  . LYS A 1 144 ? -12.221 6.637   -6.433  1.00 61.98  ? 481 LYS B HB3  1 
ATOM   2333  H HG2  . LYS A 1 144 ? -11.508 6.318   -4.218  1.00 85.09  ? 481 LYS B HG2  1 
ATOM   2334  H HG3  . LYS A 1 144 ? -10.036 6.041   -4.751  1.00 85.09  ? 481 LYS B HG3  1 
ATOM   2335  H HD2  . LYS A 1 144 ? -9.883  8.229   -5.509  1.00 107.25 ? 481 LYS B HD2  1 
ATOM   2336  H HD3  . LYS A 1 144 ? -11.372 8.512   -5.022  1.00 107.25 ? 481 LYS B HD3  1 
ATOM   2337  H HE2  . LYS A 1 144 ? -9.233  7.900   -3.279  1.00 117.28 ? 481 LYS B HE2  1 
ATOM   2338  H HE3  . LYS A 1 144 ? -9.828  9.361   -3.477  1.00 117.28 ? 481 LYS B HE3  1 
ATOM   2339  H HZ1  . LYS A 1 144 ? -10.681 8.402   -1.601  1.00 117.22 ? 481 LYS B HZ1  1 
ATOM   2340  H HZ2  . LYS A 1 144 ? -11.766 8.622   -2.536  1.00 117.22 ? 481 LYS B HZ2  1 
ATOM   2341  H HZ3  . LYS A 1 144 ? -11.223 7.290   -2.356  1.00 117.22 ? 481 LYS B HZ3  1 
ATOM   2342  N N    . VAL A 1 145 ? -12.757 4.230   -4.116  1.00 39.94  ? 482 VAL B N    1 
ATOM   2343  C CA   . VAL A 1 145 ? -13.822 4.033   -3.145  1.00 43.29  ? 482 VAL B CA   1 
ATOM   2344  C C    . VAL A 1 145 ? -14.299 5.401   -2.675  1.00 38.96  ? 482 VAL B C    1 
ATOM   2345  O O    . VAL A 1 145 ? -13.694 6.021   -1.798  1.00 38.02  ? 482 VAL B O    1 
ATOM   2346  C CB   . VAL A 1 145 ? -13.346 3.162   -1.953  1.00 39.70  ? 482 VAL B CB   1 
ATOM   2347  C CG1  . VAL A 1 145 ? -14.467 2.956   -0.944  1.00 31.00  ? 482 VAL B CG1  1 
ATOM   2348  C CG2  . VAL A 1 145 ? -12.835 1.813   -2.456  1.00 31.88  ? 482 VAL B CG2  1 
ATOM   2349  H H    . VAL A 1 145 ? -11.970 4.260   -3.773  1.00 47.93  ? 482 VAL B H    1 
ATOM   2350  H HA   . VAL A 1 145 ? -14.573 3.576   -3.578  1.00 51.95  ? 482 VAL B HA   1 
ATOM   2351  H HB   . VAL A 1 145 ? -12.606 3.617   -1.498  1.00 47.65  ? 482 VAL B HB   1 
ATOM   2352  H HG11 . VAL A 1 145 ? -14.141 2.416   -0.221  1.00 37.21  ? 482 VAL B HG11 1 
ATOM   2353  H HG12 . VAL A 1 145 ? -14.749 3.812   -0.612  1.00 37.21  ? 482 VAL B HG12 1 
ATOM   2354  H HG13 . VAL A 1 145 ? -15.200 2.515   -1.378  1.00 37.21  ? 482 VAL B HG13 1 
ATOM   2355  H HG21 . VAL A 1 145 ? -12.545 1.289   -1.706  1.00 38.26  ? 482 VAL B HG21 1 
ATOM   2356  H HG22 . VAL A 1 145 ? -13.547 1.361   -2.916  1.00 38.26  ? 482 VAL B HG22 1 
ATOM   2357  H HG23 . VAL A 1 145 ? -12.100 1.961   -3.056  1.00 38.26  ? 482 VAL B HG23 1 
ATOM   2358  N N    . THR A 1 146 ? -15.381 5.874   -3.284  1.00 31.99  ? 483 THR B N    1 
ATOM   2359  C CA   . THR A 1 146 ? -15.910 7.192   -2.974  1.00 41.12  ? 483 THR B CA   1 
ATOM   2360  C C    . THR A 1 146 ? -17.235 7.071   -2.229  1.00 33.98  ? 483 THR B C    1 
ATOM   2361  O O    . THR A 1 146 ? -17.767 8.053   -1.719  1.00 27.75  ? 483 THR B O    1 
ATOM   2362  C CB   . THR A 1 146 ? -16.051 8.066   -4.243  1.00 40.34  ? 483 THR B CB   1 
ATOM   2363  O OG1  . THR A 1 146 ? -16.760 7.353   -5.261  1.00 34.60  ? 483 THR B OG1  1 
ATOM   2364  C CG2  . THR A 1 146 ? -14.676 8.445   -4.775  1.00 46.35  ? 483 THR B CG2  1 
ATOM   2365  H H    . THR A 1 146 ? -15.828 5.447   -3.883  1.00 38.39  ? 483 THR B H    1 
ATOM   2366  H HA   . THR A 1 146 ? -15.279 7.644   -2.376  1.00 49.35  ? 483 THR B HA   1 
ATOM   2367  H HB   . THR A 1 146 ? -16.531 8.880   -4.023  1.00 48.41  ? 483 THR B HB   1 
ATOM   2368  H HG1  . THR A 1 146 ? -17.510 7.154   -4.993  1.00 41.52  ? 483 THR B HG1  1 
ATOM   2369  H HG21 . THR A 1 146 ? -14.768 8.988   -5.562  1.00 55.62  ? 483 THR B HG21 1 
ATOM   2370  H HG22 . THR A 1 146 ? -14.192 8.940   -4.110  1.00 55.62  ? 483 THR B HG22 1 
ATOM   2371  H HG23 . THR A 1 146 ? -14.181 7.654   -4.997  1.00 55.62  ? 483 THR B HG23 1 
ATOM   2372  N N    . ALA A 1 147 ? -17.759 5.854   -2.136  1.00 27.83  ? 484 ALA B N    1 
ATOM   2373  C CA   . ALA A 1 147 ? -18.876 5.610   -1.238  1.00 26.43  ? 484 ALA B CA   1 
ATOM   2374  C C    . ALA A 1 147 ? -20.030 6.574   -1.510  1.00 19.85  ? 484 ALA B C    1 
ATOM   2375  O O    . ALA A 1 147 ? -20.631 7.107   -0.572  1.00 25.44  ? 484 ALA B O    1 
ATOM   2376  C CB   . ALA A 1 147 ? -18.405 5.771   0.207   1.00 26.59  ? 484 ALA B CB   1 
ATOM   2377  H H    . ALA A 1 147 ? -17.491 5.165   -2.574  1.00 33.40  ? 484 ALA B H    1 
ATOM   2378  H HA   . ALA A 1 147 ? -19.200 4.693   -1.359  1.00 31.72  ? 484 ALA B HA   1 
ATOM   2379  H HB1  . ALA A 1 147 ? -19.146 5.609   0.796   1.00 31.90  ? 484 ALA B HB1  1 
ATOM   2380  H HB2  . ALA A 1 147 ? -17.704 5.139   0.380   1.00 31.90  ? 484 ALA B HB2  1 
ATOM   2381  H HB3  . ALA A 1 147 ? -18.078 6.665   0.331   1.00 31.90  ? 484 ALA B HB3  1 
ATOM   2382  N N    . ASN A 1 148 ? -20.343 6.775   -2.786  1.00 29.32  ? 485 ASN B N    1 
ATOM   2383  C CA   . ASN A 1 148 ? -21.358 7.747   -3.186  1.00 30.82  ? 485 ASN B CA   1 
ATOM   2384  C C    . ASN A 1 148 ? -21.934 7.390   -4.544  1.00 30.48  ? 485 ASN B C    1 
ATOM   2385  O O    . ASN A 1 148 ? -22.348 8.264   -5.309  1.00 30.95  ? 485 ASN B O    1 
ATOM   2386  C CB   . ASN A 1 148 ? -20.754 9.153   -3.244  1.00 29.35  ? 485 ASN B CB   1 
ATOM   2387  C CG   . ASN A 1 148 ? -19.658 9.268   -4.283  1.00 30.74  ? 485 ASN B CG   1 
ATOM   2388  O OD1  . ASN A 1 148 ? -19.308 8.285   -4.933  1.00 29.70  ? 485 ASN B OD1  1 
ATOM   2389  N ND2  . ASN A 1 148 ? -19.117 10.475  -4.455  1.00 28.96  ? 485 ASN B ND2  1 
ATOM   2390  H H    . ASN A 1 148 ? -19.979 6.359   -3.445  1.00 35.19  ? 485 ASN B H    1 
ATOM   2391  H HA   . ASN A 1 148 ? -22.086 7.749   -2.530  1.00 36.99  ? 485 ASN B HA   1 
ATOM   2392  H HB2  . ASN A 1 148 ? -21.451 9.788   -3.471  1.00 35.22  ? 485 ASN B HB2  1 
ATOM   2393  H HB3  . ASN A 1 148 ? -20.373 9.371   -2.379  1.00 35.22  ? 485 ASN B HB3  1 
ATOM   2394  H HD21 . ASN A 1 148 ? -19.393 11.141  -3.987  1.00 34.75  ? 485 ASN B HD21 1 
ATOM   2395  H HD22 . ASN A 1 148 ? -18.491 10.587  -5.034  1.00 34.75  ? 485 ASN B HD22 1 
ATOM   2396  N N    . ILE A 1 149 ? -21.954 6.097   -4.841  1.00 22.50  ? 486 ILE B N    1 
ATOM   2397  C CA   . ILE A 1 149 ? -22.385 5.614   -6.137  1.00 24.36  ? 486 ILE B CA   1 
ATOM   2398  C C    . ILE A 1 149 ? -23.685 4.837   -5.982  1.00 28.34  ? 486 ILE B C    1 
ATOM   2399  O O    . ILE A 1 149 ? -23.773 3.957   -5.128  1.00 26.52  ? 486 ILE B O    1 
ATOM   2400  C CB   . ILE A 1 149 ? -21.298 4.701   -6.738  1.00 29.05  ? 486 ILE B CB   1 
ATOM   2401  C CG1  . ILE A 1 149 ? -20.021 5.510   -7.001  1.00 25.87  ? 486 ILE B CG1  1 
ATOM   2402  C CG2  . ILE A 1 149 ? -21.786 4.036   -8.013  1.00 21.11  ? 486 ILE B CG2  1 
ATOM   2403  C CD1  . ILE A 1 149 ? -18.777 4.638   -7.192  1.00 30.35  ? 486 ILE B CD1  1 
ATOM   2404  H H    . ILE A 1 149 ? -21.718 5.473   -4.298  1.00 27.00  ? 486 ILE B H    1 
ATOM   2405  H HA   . ILE A 1 149 ? -22.537 6.370   -6.743  1.00 29.23  ? 486 ILE B HA   1 
ATOM   2406  H HB   . ILE A 1 149 ? -21.092 4.007   -6.092  1.00 34.86  ? 486 ILE B HB   1 
ATOM   2407  H HG12 . ILE A 1 149 ? -20.142 6.036   -7.807  1.00 31.04  ? 486 ILE B HG12 1 
ATOM   2408  H HG13 . ILE A 1 149 ? -19.860 6.096   -6.245  1.00 31.04  ? 486 ILE B HG13 1 
ATOM   2409  H HG21 . ILE A 1 149 ? -21.088 3.476   -8.360  1.00 25.33  ? 486 ILE B HG21 1 
ATOM   2410  H HG22 . ILE A 1 149 ? -22.561 3.506   -7.811  1.00 25.33  ? 486 ILE B HG22 1 
ATOM   2411  H HG23 . ILE A 1 149 ? -22.011 4.715   -8.653  1.00 25.33  ? 486 ILE B HG23 1 
ATOM   2412  H HD11 . ILE A 1 149 ? -18.020 5.206   -7.351  1.00 36.42  ? 486 ILE B HD11 1 
ATOM   2413  H HD12 . ILE A 1 149 ? -18.636 4.118   -6.398  1.00 36.42  ? 486 ILE B HD12 1 
ATOM   2414  H HD13 . ILE A 1 149 ? -18.916 4.058   -7.944  1.00 36.42  ? 486 ILE B HD13 1 
ATOM   2415  N N    . VAL A 1 150 ? -24.701 5.158   -6.787  1.00 18.99  ? 487 VAL B N    1 
ATOM   2416  C CA   . VAL A 1 150 ? -25.940 4.380   -6.757  1.00 18.25  ? 487 VAL B CA   1 
ATOM   2417  C C    . VAL A 1 150 ? -26.382 4.043   -8.179  1.00 23.18  ? 487 VAL B C    1 
ATOM   2418  O O    . VAL A 1 150 ? -26.469 4.931   -9.029  1.00 22.78  ? 487 VAL B O    1 
ATOM   2419  C CB   . VAL A 1 150 ? -27.061 5.124   -5.974  1.00 20.71  ? 487 VAL B CB   1 
ATOM   2420  C CG1  . VAL A 1 150 ? -28.339 4.299   -5.927  1.00 17.99  ? 487 VAL B CG1  1 
ATOM   2421  C CG2  . VAL A 1 150 ? -26.579 5.447   -4.540  1.00 18.23  ? 487 VAL B CG2  1 
ATOM   2422  H H    . VAL A 1 150 ? -24.699 5.809   -7.349  1.00 22.79  ? 487 VAL B H    1 
ATOM   2423  H HA   . VAL A 1 150 ? -25.766 3.534   -6.293  1.00 21.90  ? 487 VAL B HA   1 
ATOM   2424  H HB   . VAL A 1 150 ? -27.261 5.970   -6.427  1.00 24.85  ? 487 VAL B HB   1 
ATOM   2425  H HG11 . VAL A 1 150 ? -29.007 4.785   -5.438  1.00 21.59  ? 487 VAL B HG11 1 
ATOM   2426  H HG12 . VAL A 1 150 ? -28.640 4.138   -6.824  1.00 21.59  ? 487 VAL B HG12 1 
ATOM   2427  H HG13 . VAL A 1 150 ? -28.155 3.464   -5.488  1.00 21.59  ? 487 VAL B HG13 1 
ATOM   2428  H HG21 . VAL A 1 150 ? -27.280 5.906   -4.071  1.00 21.88  ? 487 VAL B HG21 1 
ATOM   2429  H HG22 . VAL A 1 150 ? -26.365 4.627   -4.091  1.00 21.88  ? 487 VAL B HG22 1 
ATOM   2430  H HG23 . VAL A 1 150 ? -25.799 6.005   -4.592  1.00 21.88  ? 487 VAL B HG23 1 
ATOM   2431  N N    . PHE A 1 151 ? -26.604 2.750   -8.436  1.00 20.12  ? 488 PHE B N    1 
ATOM   2432  C CA   . PHE A 1 151 ? -27.206 2.266   -9.677  1.00 20.45  ? 488 PHE B CA   1 
ATOM   2433  C C    . PHE A 1 151 ? -28.617 1.772   -9.411  1.00 24.52  ? 488 PHE B C    1 
ATOM   2434  O O    . PHE A 1 151 ? -28.849 0.991   -8.474  1.00 22.23  ? 488 PHE B O    1 
ATOM   2435  C CB   . PHE A 1 151 ? -26.417 1.086   -10.263 1.00 21.64  ? 488 PHE B CB   1 
ATOM   2436  C CG   . PHE A 1 151 ? -25.170 1.478   -11.010 1.00 25.01  ? 488 PHE B CG   1 
ATOM   2437  C CD1  . PHE A 1 151 ? -25.119 1.395   -12.390 1.00 24.47  ? 488 PHE B CD1  1 
ATOM   2438  C CD2  . PHE A 1 151 ? -24.036 1.899   -10.329 1.00 33.41  ? 488 PHE B CD2  1 
ATOM   2439  C CE1  . PHE A 1 151 ? -23.966 1.754   -13.083 1.00 23.74  ? 488 PHE B CE1  1 
ATOM   2440  C CE2  . PHE A 1 151 ? -22.885 2.253   -11.015 1.00 37.41  ? 488 PHE B CE2  1 
ATOM   2441  C CZ   . PHE A 1 151 ? -22.852 2.180   -12.396 1.00 34.56  ? 488 PHE B CZ   1 
ATOM   2442  H H    . PHE A 1 151 ? -26.408 2.118   -7.887  1.00 24.14  ? 488 PHE B H    1 
ATOM   2443  H HA   . PHE A 1 151 ? -27.239 2.988   -10.339 1.00 24.53  ? 488 PHE B HA   1 
ATOM   2444  H HB2  . PHE A 1 151 ? -26.153 0.499   -9.537  1.00 25.97  ? 488 PHE B HB2  1 
ATOM   2445  H HB3  . PHE A 1 151 ? -26.991 0.605   -10.879 1.00 25.97  ? 488 PHE B HB3  1 
ATOM   2446  H HD1  . PHE A 1 151 ? -25.870 1.113   -12.861 1.00 29.36  ? 488 PHE B HD1  1 
ATOM   2447  H HD2  . PHE A 1 151 ? -24.053 1.955   -9.401  1.00 40.09  ? 488 PHE B HD2  1 
ATOM   2448  H HE1  . PHE A 1 151 ? -23.946 1.701   -14.011 1.00 28.49  ? 488 PHE B HE1  1 
ATOM   2449  H HE2  . PHE A 1 151 ? -22.135 2.541   -10.546 1.00 44.89  ? 488 PHE B HE2  1 
ATOM   2450  H HZ   . PHE A 1 151 ? -22.080 2.415   -12.858 1.00 41.48  ? 488 PHE B HZ   1 
ATOM   2451  N N    . GLY A 1 152 ? -29.558 2.239   -10.229 1.00 19.46  ? 489 GLY B N    1 
ATOM   2452  C CA   . GLY A 1 152 ? -30.860 1.616   -10.362 1.00 18.39  ? 489 GLY B CA   1 
ATOM   2453  C C    . GLY A 1 152 ? -30.976 1.078   -11.786 1.00 21.39  ? 489 GLY B C    1 
ATOM   2454  O O    . GLY A 1 152 ? -31.095 1.856   -12.742 1.00 21.53  ? 489 GLY B O    1 
ATOM   2455  H H    . GLY A 1 152 ? -29.457 2.933   -10.727 1.00 23.35  ? 489 GLY B H    1 
ATOM   2456  H HA2  . GLY A 1 152 ? -30.950 0.883   -9.733  1.00 22.07  ? 489 GLY B HA2  1 
ATOM   2457  H HA3  . GLY A 1 152 ? -31.563 2.265   -10.205 1.00 22.07  ? 489 GLY B HA3  1 
ATOM   2458  N N    . TYR A 1 153 ? -30.897 -0.248  -11.926 1.00 19.70  ? 490 TYR B N    1 
ATOM   2459  C CA   . TYR A 1 153 ? -31.059 -0.923  -13.211 1.00 18.01  ? 490 TYR B CA   1 
ATOM   2460  C C    . TYR A 1 153 ? -32.517 -1.317  -13.359 1.00 21.60  ? 490 TYR B C    1 
ATOM   2461  O O    . TYR A 1 153 ? -33.102 -1.866  -12.426 1.00 23.42  ? 490 TYR B O    1 
ATOM   2462  C CB   . TYR A 1 153 ? -30.241 -2.226  -13.271 1.00 25.35  ? 490 TYR B CB   1 
ATOM   2463  C CG   . TYR A 1 153 ? -28.736 -2.119  -13.094 1.00 26.68  ? 490 TYR B CG   1 
ATOM   2464  C CD1  . TYR A 1 153 ? -27.888 -2.020  -14.190 1.00 27.13  ? 490 TYR B CD1  1 
ATOM   2465  C CD2  . TYR A 1 153 ? -28.164 -2.179  -11.833 1.00 26.32  ? 490 TYR B CD2  1 
ATOM   2466  C CE1  . TYR A 1 153 ? -26.507 -1.957  -14.030 1.00 23.70  ? 490 TYR B CE1  1 
ATOM   2467  C CE2  . TYR A 1 153 ? -26.789 -2.117  -11.662 1.00 24.92  ? 490 TYR B CE2  1 
ATOM   2468  C CZ   . TYR A 1 153 ? -25.970 -2.008  -12.761 1.00 25.18  ? 490 TYR B CZ   1 
ATOM   2469  O OH   . TYR A 1 153 ? -24.609 -1.943  -12.570 1.00 26.50  ? 490 TYR B OH   1 
ATOM   2470  H H    . TYR A 1 153 ? -30.746 -0.787  -11.274 1.00 23.64  ? 490 TYR B H    1 
ATOM   2471  H HA   . TYR A 1 153 ? -30.799 -0.334  -13.949 1.00 21.61  ? 490 TYR B HA   1 
ATOM   2472  H HB2  . TYR A 1 153 ? -30.567 -2.817  -12.575 1.00 30.42  ? 490 TYR B HB2  1 
ATOM   2473  H HB3  . TYR A 1 153 ? -30.396 -2.637  -14.136 1.00 30.42  ? 490 TYR B HB3  1 
ATOM   2474  H HD1  . TYR A 1 153 ? -28.251 -1.990  -15.046 1.00 32.56  ? 490 TYR B HD1  1 
ATOM   2475  H HD2  . TYR A 1 153 ? -28.713 -2.258  -11.086 1.00 31.58  ? 490 TYR B HD2  1 
ATOM   2476  H HE1  . TYR A 1 153 ? -25.951 -1.881  -14.772 1.00 28.44  ? 490 TYR B HE1  1 
ATOM   2477  H HE2  . TYR A 1 153 ? -26.422 -2.149  -10.808 1.00 29.91  ? 490 TYR B HE2  1 
ATOM   2478  H HH   . TYR A 1 153 ? -24.317 -1.237  -12.869 1.00 31.80  ? 490 TYR B HH   1 
ATOM   2479  N N    . ALA A 1 154 ? -33.107 -1.075  -14.523 1.00 20.08  ? 491 ALA B N    1 
ATOM   2480  C CA   . ALA A 1 154 ? -34.505 -1.417  -14.737 1.00 20.66  ? 491 ALA B CA   1 
ATOM   2481  C C    . ALA A 1 154 ? -34.715 -2.924  -14.608 1.00 21.21  ? 491 ALA B C    1 
ATOM   2482  O O    . ALA A 1 154 ? -35.803 -3.383  -14.262 1.00 21.69  ? 491 ALA B O    1 
ATOM   2483  C CB   . ALA A 1 154 ? -34.966 -0.947  -16.108 1.00 25.53  ? 491 ALA B CB   1 
ATOM   2484  H H    . ALA A 1 154 ? -32.722 -0.714  -15.201 1.00 24.10  ? 491 ALA B H    1 
ATOM   2485  H HA   . ALA A 1 154 ? -35.054 -0.972  -14.059 1.00 24.79  ? 491 ALA B HA   1 
ATOM   2486  H HB1  . ALA A 1 154 ? -35.889 -1.184  -16.226 1.00 30.64  ? 491 ALA B HB1  1 
ATOM   2487  H HB2  . ALA A 1 154 ? -34.863 0.006   -16.162 1.00 30.64  ? 491 ALA B HB2  1 
ATOM   2488  H HB3  . ALA A 1 154 ? -34.430 -1.373  -16.781 1.00 30.64  ? 491 ALA B HB3  1 
ATOM   2489  N N    . THR A 1 155 ? -33.670 -3.692  -14.880 1.00 22.24  ? 492 THR B N    1 
ATOM   2490  C CA   . THR A 1 155 ? -33.801 -5.137  -14.854 1.00 25.14  ? 492 THR B CA   1 
ATOM   2491  C C    . THR A 1 155 ? -32.528 -5.772  -14.306 1.00 26.91  ? 492 THR B C    1 
ATOM   2492  O O    . THR A 1 155 ? -31.569 -5.067  -13.996 1.00 21.27  ? 492 THR B O    1 
ATOM   2493  C CB   . THR A 1 155 ? -34.164 -5.683  -16.253 1.00 24.82  ? 492 THR B CB   1 
ATOM   2494  O OG1  . THR A 1 155 ? -34.708 -7.000  -16.122 1.00 30.79  ? 492 THR B OG1  1 
ATOM   2495  C CG2  . THR A 1 155 ? -32.948 -5.693  -17.179 1.00 25.14  ? 492 THR B CG2  1 
ATOM   2496  H H    . THR A 1 155 ? -32.884 -3.405  -15.080 1.00 26.69  ? 492 THR B H    1 
ATOM   2497  H HA   . THR A 1 155 ? -34.534 -5.373  -14.247 1.00 30.17  ? 492 THR B HA   1 
ATOM   2498  H HB   . THR A 1 155 ? -34.835 -5.106  -16.650 1.00 29.78  ? 492 THR B HB   1 
ATOM   2499  H HG1  . THR A 1 155 ? -34.904 -7.297  -16.861 1.00 36.94  ? 492 THR B HG1  1 
ATOM   2500  H HG21 . THR A 1 155 ? -33.195 -6.035  -18.041 1.00 30.17  ? 492 THR B HG21 1 
ATOM   2501  H HG22 . THR A 1 155 ? -32.608 -4.801  -17.283 1.00 30.17  ? 492 THR B HG22 1 
ATOM   2502  H HG23 . THR A 1 155 ? -32.259 -6.249  -16.809 1.00 30.17  ? 492 THR B HG23 1 
ATOM   2503  N N    . CYS A 1 156 ? -32.535 -7.096  -14.142 1.00 21.33  ? 493 CYS B N    1 
ATOM   2504  C CA   . CYS A 1 156 ? -31.384 -7.789  -13.563 1.00 28.44  ? 493 CYS B CA   1 
ATOM   2505  C C    . CYS A 1 156 ? -30.391 -8.188  -14.644 1.00 35.73  ? 493 CYS B C    1 
ATOM   2506  O O    . CYS A 1 156 ? -30.714 -8.182  -15.831 1.00 26.26  ? 493 CYS B O    1 
ATOM   2507  C CB   . CYS A 1 156 ? -31.840 -9.023  -12.775 1.00 23.85  ? 493 CYS B CB   1 
ATOM   2508  S SG   . CYS A 1 156 ? -32.678 -8.545  -11.234 1.00 30.59  ? 493 CYS B SG   1 
ATOM   2509  H H    . CYS A 1 156 ? -33.189 -7.612  -14.356 1.00 25.60  ? 493 CYS B H    1 
ATOM   2510  H HA   . CYS A 1 156 ? -30.928 -7.184  -12.941 1.00 34.13  ? 493 CYS B HA   1 
ATOM   2511  H HB2  . CYS A 1 156 ? -32.461 -9.536  -13.315 1.00 28.62  ? 493 CYS B HB2  1 
ATOM   2512  H HB3  . CYS A 1 156 ? -31.066 -9.562  -12.547 1.00 28.62  ? 493 CYS B HB3  1 
ATOM   2513  H HG   . CYS A 1 156 ? -33.640 -7.879  -11.503 1.00 36.71  ? 493 CYS B HG   1 
ATOM   2514  N N    . GLN A 1 157 ? -29.171 -8.508  -14.234 1.00 27.15  ? 494 GLN B N    1 
ATOM   2515  C CA   . GLN A 1 157 ? -28.167 -8.969  -15.172 1.00 33.11  ? 494 GLN B CA   1 
ATOM   2516  C C    . GLN A 1 157 ? -28.741 -10.156 -15.928 1.00 33.25  ? 494 GLN B C    1 
ATOM   2517  O O    . GLN A 1 157 ? -29.359 -11.038 -15.334 1.00 30.11  ? 494 GLN B O    1 
ATOM   2518  C CB   . GLN A 1 157 ? -26.881 -9.352  -14.444 1.00 41.28  ? 494 GLN B CB   1 
ATOM   2519  C CG   . GLN A 1 157 ? -25.720 -9.646  -15.372 1.00 45.76  ? 494 GLN B CG   1 
ATOM   2520  C CD   . GLN A 1 157 ? -24.395 -9.724  -14.641 1.00 50.96  ? 494 GLN B CD   1 
ATOM   2521  O OE1  . GLN A 1 157 ? -24.207 -10.566 -13.760 1.00 44.23  ? 494 GLN B OE1  1 
ATOM   2522  N NE2  . GLN A 1 157 ? -23.463 -8.846  -15.008 1.00 47.95  ? 494 GLN B NE2  1 
ATOM   2523  H H    . GLN A 1 157 ? -28.903 -8.467  -13.418 1.00 32.58  ? 494 GLN B H    1 
ATOM   2524  H HA   . GLN A 1 157 ? -27.964 -8.257  -15.814 1.00 39.73  ? 494 GLN B HA   1 
ATOM   2525  H HB2  . GLN A 1 157 ? -26.619 -8.619  -13.865 1.00 49.54  ? 494 GLN B HB2  1 
ATOM   2526  H HB3  . GLN A 1 157 ? -27.046 -10.147 -13.914 1.00 49.54  ? 494 GLN B HB3  1 
ATOM   2527  H HG2  . GLN A 1 157 ? -25.873 -10.499 -15.809 1.00 54.92  ? 494 GLN B HG2  1 
ATOM   2528  H HG3  . GLN A 1 157 ? -25.657 -8.940  -16.034 1.00 54.92  ? 494 GLN B HG3  1 
ATOM   2529  H HE21 . GLN A 1 157 ? -23.630 -8.276  -15.629 1.00 57.54  ? 494 GLN B HE21 1 
ATOM   2530  H HE22 . GLN A 1 157 ? -22.694 -8.849  -14.623 1.00 57.54  ? 494 GLN B HE22 1 
ATOM   2531  N N    . GLY A 1 158 ? -28.583 -10.144 -17.248 1.00 32.59  ? 495 GLY B N    1 
ATOM   2532  C CA   . GLY A 1 158 ? -28.974 -11.267 -18.082 1.00 32.40  ? 495 GLY B CA   1 
ATOM   2533  C C    . GLY A 1 158 ? -30.459 -11.306 -18.382 1.00 37.58  ? 495 GLY B C    1 
ATOM   2534  O O    . GLY A 1 158 ? -30.952 -12.272 -18.952 1.00 41.32  ? 495 GLY B O    1 
ATOM   2535  H H    . GLY A 1 158 ? -28.247 -9.485  -17.687 1.00 39.11  ? 495 GLY B H    1 
ATOM   2536  H HA2  . GLY A 1 158 ? -28.495 -11.222 -18.925 1.00 38.88  ? 495 GLY B HA2  1 
ATOM   2537  H HA3  . GLY A 1 158 ? -28.732 -12.095 -17.638 1.00 38.88  ? 495 GLY B HA3  1 
ATOM   2538  N N    . ALA A 1 159 ? -31.175 -10.257 -17.989 1.00 26.85  ? 496 ALA B N    1 
ATOM   2539  C CA   . ALA A 1 159 ? -32.619 -10.190 -18.198 1.00 34.36  ? 496 ALA B CA   1 
ATOM   2540  C C    . ALA A 1 159 ? -32.912 -8.991  -19.095 1.00 29.94  ? 496 ALA B C    1 
ATOM   2541  O O    . ALA A 1 159 ? -32.012 -8.226  -19.388 1.00 27.76  ? 496 ALA B O    1 
ATOM   2542  C CB   . ALA A 1 159 ? -33.334 -10.039 -16.869 1.00 37.56  ? 496 ALA B CB   1 
ATOM   2543  H H    . ALA A 1 159 ? -30.847 -9.567  -17.596 1.00 32.22  ? 496 ALA B H    1 
ATOM   2544  H HA   . ALA A 1 159 ? -32.934 -11.006 -18.640 1.00 41.23  ? 496 ALA B HA   1 
ATOM   2545  H HB1  . ALA A 1 159 ? -34.280 -9.996  -17.027 1.00 45.08  ? 496 ALA B HB1  1 
ATOM   2546  H HB2  . ALA A 1 159 ? -33.128 -10.795 -16.316 1.00 45.08  ? 496 ALA B HB2  1 
ATOM   2547  H HB3  . ALA A 1 159 ? -33.037 -9.231  -16.445 1.00 45.08  ? 496 ALA B HB3  1 
ATOM   2548  N N    . GLU A 1 160 ? -34.163 -8.839  -19.520 1.00 30.96  ? 497 GLU B N    1 
ATOM   2549  C CA   . GLU A 1 160 ? -34.570 -7.723  -20.379 1.00 31.68  ? 497 GLU B CA   1 
ATOM   2550  C C    . GLU A 1 160 ? -35.384 -6.691  -19.604 1.00 32.64  ? 497 GLU B C    1 
ATOM   2551  O O    . GLU A 1 160 ? -36.010 -7.028  -18.605 1.00 28.10  ? 497 GLU B O    1 
ATOM   2552  C CB   . GLU A 1 160 ? -35.409 -8.248  -21.545 1.00 32.67  ? 497 GLU B CB   1 
ATOM   2553  C CG   . GLU A 1 160 ? -34.650 -9.158  -22.489 1.00 31.63  ? 497 GLU B CG   1 
ATOM   2554  C CD   . GLU A 1 160 ? -35.553 -9.854  -23.484 1.00 40.15  ? 497 GLU B CD   1 
ATOM   2555  O OE1  . GLU A 1 160 ? -36.707 -10.181 -23.132 1.00 36.21  ? 497 GLU B OE1  1 
ATOM   2556  O OE2  . GLU A 1 160 ? -35.099 -10.074 -24.620 1.00 41.52  ? 497 GLU B OE2  1 
ATOM   2557  H H    . GLU A 1 160 ? -34.806 -9.376  -19.324 1.00 37.15  ? 497 GLU B H    1 
ATOM   2558  H HA   . GLU A 1 160 ? -33.774 -7.282  -20.742 1.00 38.02  ? 497 GLU B HA   1 
ATOM   2559  H HB2  . GLU A 1 160 ? -36.159 -8.750  -21.189 1.00 39.20  ? 497 GLU B HB2  1 
ATOM   2560  H HB3  . GLU A 1 160 ? -35.735 -7.493  -22.060 1.00 39.20  ? 497 GLU B HB3  1 
ATOM   2561  H HG2  . GLU A 1 160 ? -34.006 -8.630  -22.987 1.00 37.95  ? 497 GLU B HG2  1 
ATOM   2562  H HG3  . GLU A 1 160 ? -34.192 -9.839  -21.972 1.00 37.95  ? 497 GLU B HG3  1 
ATOM   2563  N N    . ALA A 1 161 ? -35.368 -5.439  -20.072 1.00 24.98  ? 498 ALA B N    1 
ATOM   2564  C CA   . ALA A 1 161 ? -36.241 -4.391  -19.554 1.00 29.78  ? 498 ALA B CA   1 
ATOM   2565  C C    . ALA A 1 161 ? -37.297 -4.095  -20.607 1.00 26.78  ? 498 ALA B C    1 
ATOM   2566  O O    . ALA A 1 161 ? -37.015 -4.110  -21.803 1.00 30.26  ? 498 ALA B O    1 
ATOM   2567  C CB   . ALA A 1 161 ? -35.448 -3.130  -19.240 1.00 29.68  ? 498 ALA B CB   1 
ATOM   2568  H H    . ALA A 1 161 ? -34.847 -5.171  -20.702 1.00 29.97  ? 498 ALA B H    1 
ATOM   2569  H HA   . ALA A 1 161 ? -36.685 -4.699  -18.737 1.00 35.74  ? 498 ALA B HA   1 
ATOM   2570  H HB1  . ALA A 1 161 ? -36.047 -2.461  -18.902 1.00 35.62  ? 498 ALA B HB1  1 
ATOM   2571  H HB2  . ALA A 1 161 ? -34.782 -3.337  -18.580 1.00 35.62  ? 498 ALA B HB2  1 
ATOM   2572  H HB3  . ALA A 1 161 ? -35.026 -2.818  -20.044 1.00 35.62  ? 498 ALA B HB3  1 
ATOM   2573  N N    . PHE A 1 162 ? -38.515 -3.814  -20.172 1.00 23.24  ? 499 PHE B N    1 
ATOM   2574  C CA   . PHE A 1 162 ? -39.628 -3.792  -21.108 1.00 22.28  ? 499 PHE B CA   1 
ATOM   2575  C C    . PHE A 1 162 ? -40.356 -2.452  -21.172 1.00 28.30  ? 499 PHE B C    1 
ATOM   2576  O O    . PHE A 1 162 ? -40.289 -1.632  -20.253 1.00 22.10  ? 499 PHE B O    1 
ATOM   2577  C CB   . PHE A 1 162 ? -40.626 -4.882  -20.745 1.00 26.92  ? 499 PHE B CB   1 
ATOM   2578  C CG   . PHE A 1 162 ? -40.073 -6.276  -20.875 1.00 38.96  ? 499 PHE B CG   1 
ATOM   2579  C CD1  . PHE A 1 162 ? -39.493 -6.906  -19.788 1.00 38.04  ? 499 PHE B CD1  1 
ATOM   2580  C CD2  . PHE A 1 162 ? -40.126 -6.951  -22.090 1.00 39.06  ? 499 PHE B CD2  1 
ATOM   2581  C CE1  . PHE A 1 162 ? -38.980 -8.189  -19.899 1.00 35.12  ? 499 PHE B CE1  1 
ATOM   2582  C CE2  . PHE A 1 162 ? -39.624 -8.238  -22.206 1.00 35.54  ? 499 PHE B CE2  1 
ATOM   2583  C CZ   . PHE A 1 162 ? -39.044 -8.854  -21.110 1.00 41.70  ? 499 PHE B CZ   1 
ATOM   2584  H H    . PHE A 1 162 ? -38.723 -3.636  -19.356 1.00 27.89  ? 499 PHE B H    1 
ATOM   2585  H HA   . PHE A 1 162 ? -39.286 -3.987  -22.005 1.00 26.73  ? 499 PHE B HA   1 
ATOM   2586  H HB2  . PHE A 1 162 ? -40.904 -4.758  -19.824 1.00 32.30  ? 499 PHE B HB2  1 
ATOM   2587  H HB3  . PHE A 1 162 ? -41.394 -4.812  -21.333 1.00 32.30  ? 499 PHE B HB3  1 
ATOM   2588  H HD1  . PHE A 1 162 ? -39.449 -6.463  -18.971 1.00 45.65  ? 499 PHE B HD1  1 
ATOM   2589  H HD2  . PHE A 1 162 ? -40.516 -6.541  -22.828 1.00 46.87  ? 499 PHE B HD2  1 
ATOM   2590  H HE1  . PHE A 1 162 ? -38.595 -8.602  -19.161 1.00 42.14  ? 499 PHE B HE1  1 
ATOM   2591  H HE2  . PHE A 1 162 ? -39.664 -8.682  -23.022 1.00 42.65  ? 499 PHE B HE2  1 
ATOM   2592  H HZ   . PHE A 1 162 ? -38.701 -9.716  -21.187 1.00 50.04  ? 499 PHE B HZ   1 
ATOM   2593  N N    . GLU A 1 163 ? -41.041 -2.258  -22.290 1.00 28.80  ? 500 GLU B N    1 
ATOM   2594  C CA   . GLU A 1 163 ? -42.042 -1.211  -22.442 1.00 34.72  ? 500 GLU B CA   1 
ATOM   2595  C C    . GLU A 1 163 ? -43.214 -1.885  -23.138 1.00 41.00  ? 500 GLU B C    1 
ATOM   2596  O O    . GLU A 1 163 ? -43.048 -2.942  -23.745 1.00 51.36  ? 500 GLU B O    1 
ATOM   2597  C CB   . GLU A 1 163 ? -41.501 -0.062  -23.283 1.00 28.03  ? 500 GLU B CB   1 
ATOM   2598  C CG   . GLU A 1 163 ? -41.198 -0.448  -24.722 1.00 28.57  ? 500 GLU B CG   1 
ATOM   2599  C CD   . GLU A 1 163 ? -40.564 0.683   -25.508 1.00 28.79  ? 500 GLU B CD   1 
ATOM   2600  O OE1  . GLU A 1 163 ? -39.552 1.250   -25.045 1.00 23.12  ? 500 GLU B OE1  1 
ATOM   2601  O OE2  . GLU A 1 163 ? -41.077 1.011   -26.591 1.00 25.88  ? 500 GLU B OE2  1 
ATOM   2602  H H    . GLU A 1 163 ? -40.939 -2.736  -22.998 1.00 34.55  ? 500 GLU B H    1 
ATOM   2603  H HA   . GLU A 1 163 ? -42.327 -0.875  -21.567 1.00 41.66  ? 500 GLU B HA   1 
ATOM   2604  H HB2  . GLU A 1 163 ? -42.158 0.651   -23.300 1.00 33.64  ? 500 GLU B HB2  1 
ATOM   2605  H HB3  . GLU A 1 163 ? -40.678 0.258   -22.883 1.00 33.64  ? 500 GLU B HB3  1 
ATOM   2606  H HG2  . GLU A 1 163 ? -40.583 -1.198  -24.725 1.00 34.28  ? 500 GLU B HG2  1 
ATOM   2607  H HG3  . GLU A 1 163 ? -42.025 -0.695  -25.164 1.00 34.28  ? 500 GLU B HG3  1 
ATOM   2608  N N    . ILE A 1 164 ? -44.395 -1.291  -23.050 1.00 27.21  ? 501 ILE B N    1 
ATOM   2609  C CA   . ILE A 1 164 ? -45.600 -1.948  -23.544 1.00 50.07  ? 501 ILE B CA   1 
ATOM   2610  C C    . ILE A 1 164 ? -45.876 -1.674  -25.020 1.00 60.21  ? 501 ILE B C    1 
ATOM   2611  O O    . ILE A 1 164 ? -46.248 -0.563  -25.394 1.00 63.24  ? 501 ILE B O    1 
ATOM   2612  C CB   . ILE A 1 164 ? -46.836 -1.520  -22.739 1.00 58.19  ? 501 ILE B CB   1 
ATOM   2613  C CG1  . ILE A 1 164 ? -46.553 -1.613  -21.237 1.00 56.30  ? 501 ILE B CG1  1 
ATOM   2614  C CG2  . ILE A 1 164 ? -48.030 -2.392  -23.116 1.00 56.84  ? 501 ILE B CG2  1 
ATOM   2615  C CD1  . ILE A 1 164 ? -47.350 -0.630  -20.411 1.00 56.24  ? 501 ILE B CD1  1 
ATOM   2616  H H    . ILE A 1 164 ? -44.528 -0.512  -22.712 1.00 32.65  ? 501 ILE B H    1 
ATOM   2617  H HA   . ILE A 1 164 ? -45.494 -2.916  -23.436 1.00 60.08  ? 501 ILE B HA   1 
ATOM   2618  H HB   . ILE A 1 164 ? -47.045 -0.599  -22.958 1.00 69.83  ? 501 ILE B HB   1 
ATOM   2619  H HG12 . ILE A 1 164 ? -46.773 -2.506  -20.931 1.00 67.56  ? 501 ILE B HG12 1 
ATOM   2620  H HG13 . ILE A 1 164 ? -45.611 -1.435  -21.084 1.00 67.56  ? 501 ILE B HG13 1 
ATOM   2621  H HG21 . ILE A 1 164 ? -48.794 -2.113  -22.605 1.00 68.21  ? 501 ILE B HG21 1 
ATOM   2622  H HG22 . ILE A 1 164 ? -48.207 -2.290  -24.054 1.00 68.21  ? 501 ILE B HG22 1 
ATOM   2623  H HG23 . ILE A 1 164 ? -47.821 -3.308  -22.920 1.00 68.21  ? 501 ILE B HG23 1 
ATOM   2624  H HD11 . ILE A 1 164 ? -47.123 -0.744  -19.485 1.00 67.48  ? 501 ILE B HD11 1 
ATOM   2625  H HD12 . ILE A 1 164 ? -47.136 0.262   -20.694 1.00 67.48  ? 501 ILE B HD12 1 
ATOM   2626  H HD13 . ILE A 1 164 ? -48.286 -0.799  -20.542 1.00 67.48  ? 501 ILE B HD13 1 
ATOM   2627  N N    . GLN A 1 165 ? -45.680 -2.700  -25.848 1.00 61.50  ? 502 GLN B N    1 
ATOM   2628  C CA   . GLN A 1 165 ? -46.138 -2.705  -27.242 1.00 72.20  ? 502 GLN B CA   1 
ATOM   2629  C C    . GLN A 1 165 ? -47.480 -1.998  -27.414 1.00 87.80  ? 502 GLN B C    1 
ATOM   2630  O O    . GLN A 1 165 ? -48.391 -2.169  -26.602 1.00 88.25  ? 502 GLN B O    1 
ATOM   2631  C CB   . GLN A 1 165 ? -46.298 -4.143  -27.759 1.00 69.42  ? 502 GLN B CB   1 
ATOM   2632  C CG   . GLN A 1 165 ? -45.010 -4.920  -27.989 1.00 64.07  ? 502 GLN B CG   1 
ATOM   2633  C CD   . GLN A 1 165 ? -45.192 -6.050  -28.998 1.00 64.98  ? 502 GLN B CD   1 
ATOM   2634  O OE1  . GLN A 1 165 ? -45.690 -5.835  -30.104 1.00 58.27  ? 502 GLN B OE1  1 
ATOM   2635  N NE2  . GLN A 1 165 ? -44.800 -7.259  -28.616 1.00 69.32  ? 502 GLN B NE2  1 
ATOM   2636  H H    . GLN A 1 165 ? -45.274 -3.424  -25.621 1.00 73.80  ? 502 GLN B H    1 
ATOM   2637  H HA   . GLN A 1 165 ? -45.475 -2.249  -27.801 1.00 86.64  ? 502 GLN B HA   1 
ATOM   2638  H HB2  . GLN A 1 165 ? -46.825 -4.642  -27.115 1.00 83.31  ? 502 GLN B HB2  1 
ATOM   2639  H HB3  . GLN A 1 165 ? -46.771 -4.112  -28.605 1.00 83.31  ? 502 GLN B HB3  1 
ATOM   2640  H HG2  . GLN A 1 165 ? -44.332 -4.317  -28.329 1.00 76.89  ? 502 GLN B HG2  1 
ATOM   2641  H HG3  . GLN A 1 165 ? -44.720 -5.309  -27.149 1.00 76.89  ? 502 GLN B HG3  1 
ATOM   2642  H HE21 . GLN A 1 165 ? -44.464 -7.374  -27.833 1.00 83.18  ? 502 GLN B HE21 1 
ATOM   2643  H HE22 . GLN A 1 165 ? -44.883 -7.927  -29.151 1.00 83.18  ? 502 GLN B HE22 1 
ATOM   2644  N N    . HIS A 1 166 ? -47.601 -1.227  -28.492 1.00 110.94 ? 503 HIS B N    1 
ATOM   2645  C CA   . HIS A 1 166 ? -48.859 -0.578  -28.844 1.00 127.31 ? 503 HIS B CA   1 
ATOM   2646  C C    . HIS A 1 166 ? -49.552 -0.023  -27.606 1.00 128.45 ? 503 HIS B C    1 
ATOM   2647  O O    . HIS A 1 166 ? -50.588 -0.539  -27.188 1.00 133.10 ? 503 HIS B O    1 
ATOM   2648  C CB   . HIS A 1 166 ? -49.790 -1.577  -29.536 1.00 140.72 ? 503 HIS B CB   1 
ATOM   2649  C CG   . HIS A 1 166 ? -49.107 -2.449  -30.544 1.00 147.36 ? 503 HIS B CG   1 
ATOM   2650  N ND1  . HIS A 1 166 ? -48.719 -3.742  -30.268 1.00 150.60 ? 503 HIS B ND1  1 
ATOM   2651  C CD2  . HIS A 1 166 ? -48.746 -2.215  -31.828 1.00 149.09 ? 503 HIS B CD2  1 
ATOM   2652  C CE1  . HIS A 1 166 ? -48.147 -4.267  -31.337 1.00 151.91 ? 503 HIS B CE1  1 
ATOM   2653  N NE2  . HIS A 1 166 ? -48.151 -3.361  -32.298 1.00 150.77 ? 503 HIS B NE2  1 
ATOM   2654  H H    . HIS A 1 166 ? -46.960 -1.063  -29.041 1.00 133.13 ? 503 HIS B H    1 
ATOM   2655  H HA   . HIS A 1 166 ? -48.683 0.163   -29.461 1.00 152.78 ? 503 HIS B HA   1 
ATOM   2656  H HB2  . HIS A 1 166 ? -50.183 -2.155  -28.863 1.00 168.86 ? 503 HIS B HB2  1 
ATOM   2657  H HB3  . HIS A 1 166 ? -50.489 -1.086  -29.995 1.00 168.86 ? 503 HIS B HB3  1 
ATOM   2658  H HD2  . HIS A 1 166 ? -48.877 -1.426  -32.303 1.00 178.90 ? 503 HIS B HD2  1 
ATOM   2659  H HE1  . HIS A 1 166 ? -47.801 -5.127  -31.402 1.00 182.29 ? 503 HIS B HE1  1 
ATOM   2660  N N    . SER A 1 167 ? -48.984 1.024   -27.017 1.00 128.29 ? 504 SER B N    1 
ATOM   2661  C CA   . SER A 1 167 ? -49.519 1.563   -25.772 1.00 123.11 ? 504 SER B CA   1 
ATOM   2662  C C    . SER A 1 167 ? -49.461 3.087   -25.722 1.00 109.80 ? 504 SER B C    1 
ATOM   2663  O O    . SER A 1 167 ? -49.345 3.673   -24.649 1.00 105.21 ? 504 SER B O    1 
ATOM   2664  C CB   . SER A 1 167 ? -48.763 0.975   -24.579 1.00 127.75 ? 504 SER B CB   1 
ATOM   2665  O OG   . SER A 1 167 ? -49.350 1.371   -23.352 1.00 130.43 ? 504 SER B OG   1 
ATOM   2666  H H    . SER A 1 167 ? -48.292 1.438   -27.315 1.00 153.95 ? 504 SER B H    1 
ATOM   2667  H HA   . SER A 1 167 ? -50.459 1.297   -25.692 1.00 147.73 ? 504 SER B HA   1 
ATOM   2668  H HB2  . SER A 1 167 ? -48.785 0.007   -24.640 1.00 153.30 ? 504 SER B HB2  1 
ATOM   2669  H HB3  . SER A 1 167 ? -47.845 1.287   -24.604 1.00 153.30 ? 504 SER B HB3  1 
ATOM   2670  H HG   . SER A 1 167 ? -49.999 1.852   -23.494 1.00 156.52 ? 504 SER B HG   1 
ATOM   2671  N N    . GLY A 1 168 ? -49.546 3.721   -26.886 1.00 101.33 ? 505 GLY B N    1 
ATOM   2672  C CA   . GLY A 1 168 ? -49.611 5.170   -26.971 1.00 87.87  ? 505 GLY B CA   1 
ATOM   2673  C C    . GLY A 1 168 ? -48.531 5.899   -26.194 1.00 74.40  ? 505 GLY B C    1 
ATOM   2674  O O    . GLY A 1 168 ? -47.350 5.837   -26.538 1.00 68.31  ? 505 GLY B O    1 
ATOM   2675  H H    . GLY A 1 168 ? -49.567 3.327   -27.650 1.00 121.60 ? 505 GLY B H    1 
ATOM   2676  H HA2  . GLY A 1 168 ? -49.541 5.435   -27.902 1.00 105.44 ? 505 GLY B HA2  1 
ATOM   2677  H HA3  . GLY A 1 168 ? -50.472 5.467   -26.638 1.00 105.44 ? 505 GLY B HA3  1 
ATOM   2678  N N    . LEU A 1 169 ? -48.941 6.594   -25.136 1.00 61.71  ? 506 LEU B N    1 
ATOM   2679  C CA   . LEU A 1 169 ? -48.038 7.459   -24.388 1.00 58.86  ? 506 LEU B CA   1 
ATOM   2680  C C    . LEU A 1 169 ? -47.637 6.838   -23.049 1.00 53.86  ? 506 LEU B C    1 
ATOM   2681  O O    . LEU A 1 169 ? -47.163 7.531   -22.151 1.00 48.12  ? 506 LEU B O    1 
ATOM   2682  C CB   . LEU A 1 169 ? -48.706 8.817   -24.162 1.00 72.53  ? 506 LEU B CB   1 
ATOM   2683  C CG   . LEU A 1 169 ? -47.794 10.012  -23.875 1.00 79.98  ? 506 LEU B CG   1 
ATOM   2684  C CD1  . LEU A 1 169 ? -48.236 11.215  -24.702 1.00 80.03  ? 506 LEU B CD1  1 
ATOM   2685  C CD2  . LEU A 1 169 ? -47.773 10.351  -22.384 1.00 78.82  ? 506 LEU B CD2  1 
ATOM   2686  H H    . LEU A 1 169 ? -49.744 6.580   -24.830 1.00 74.05  ? 506 LEU B H    1 
ATOM   2687  H HA   . LEU A 1 169 ? -47.223 7.603   -24.913 1.00 70.63  ? 506 LEU B HA   1 
ATOM   2688  H HB2  . LEU A 1 169 ? -49.218 9.035   -24.957 1.00 87.04  ? 506 LEU B HB2  1 
ATOM   2689  H HB3  . LEU A 1 169 ? -49.310 8.732   -23.408 1.00 87.04  ? 506 LEU B HB3  1 
ATOM   2690  H HG   . LEU A 1 169 ? -46.889 9.785   -24.140 1.00 95.97  ? 506 LEU B HG   1 
ATOM   2691  H HD11 . LEU A 1 169 ? -47.655 11.955  -24.511 1.00 96.03  ? 506 LEU B HD11 1 
ATOM   2692  H HD12 . LEU A 1 169 ? -48.184 10.989  -25.634 1.00 96.03  ? 506 LEU B HD12 1 
ATOM   2693  H HD13 . LEU A 1 169 ? -49.140 11.439  -24.469 1.00 96.03  ? 506 LEU B HD13 1 
ATOM   2694  H HD21 . LEU A 1 169 ? -47.192 11.102  -22.243 1.00 94.58  ? 506 LEU B HD21 1 
ATOM   2695  H HD22 . LEU A 1 169 ? -48.664 10.567  -22.100 1.00 94.58  ? 506 LEU B HD22 1 
ATOM   2696  H HD23 . LEU A 1 169 ? -47.449 9.590   -21.895 1.00 94.58  ? 506 LEU B HD23 1 
ATOM   2697  N N    . ALA A 1 170 ? -47.824 5.529   -22.921 1.00 44.78  ? 507 ALA B N    1 
ATOM   2698  C CA   . ALA A 1 170 ? -47.506 4.836   -21.680 1.00 48.48  ? 507 ALA B CA   1 
ATOM   2699  C C    . ALA A 1 170 ? -45.997 4.814   -21.475 1.00 43.08  ? 507 ALA B C    1 
ATOM   2700  O O    . ALA A 1 170 ? -45.230 4.846   -22.439 1.00 40.80  ? 507 ALA B O    1 
ATOM   2701  C CB   . ALA A 1 170 ? -48.056 3.424   -21.711 1.00 50.29  ? 507 ALA B CB   1 
ATOM   2702  H H    . ALA A 1 170 ? -48.134 5.019   -23.540 1.00 53.74  ? 507 ALA B H    1 
ATOM   2703  H HA   . ALA A 1 170 ? -47.915 5.311   -20.927 1.00 58.18  ? 507 ALA B HA   1 
ATOM   2704  H HB1  . ALA A 1 170 ? -47.837 2.985   -20.886 1.00 60.35  ? 507 ALA B HB1  1 
ATOM   2705  H HB2  . ALA A 1 170 ? -49.010 3.462   -21.818 1.00 60.35  ? 507 ALA B HB2  1 
ATOM   2706  H HB3  . ALA A 1 170 ? -47.662 2.951   -22.448 1.00 60.35  ? 507 ALA B HB3  1 
ATOM   2707  N N    . ASN A 1 171 ? -45.578 4.780   -20.218 1.00 43.66  ? 508 ASN B N    1 
ATOM   2708  C CA   . ASN A 1 171 ? -44.166 4.670   -19.890 1.00 43.16  ? 508 ASN B CA   1 
ATOM   2709  C C    . ASN A 1 171 ? -43.663 3.247   -20.096 1.00 39.00  ? 508 ASN B C    1 
ATOM   2710  O O    . ASN A 1 171 ? -44.449 2.304   -20.178 1.00 39.40  ? 508 ASN B O    1 
ATOM   2711  C CB   . ASN A 1 171 ? -43.931 5.068   -18.430 1.00 43.71  ? 508 ASN B CB   1 
ATOM   2712  C CG   . ASN A 1 171 ? -44.174 6.544   -18.180 1.00 39.34  ? 508 ASN B CG   1 
ATOM   2713  O OD1  . ASN A 1 171 ? -43.330 7.378   -18.490 1.00 34.41  ? 508 ASN B OD1  1 
ATOM   2714  N ND2  . ASN A 1 171 ? -45.327 6.869   -17.602 1.00 38.24  ? 508 ASN B ND2  1 
ATOM   2715  H H    . ASN A 1 171 ? -46.095 4.819   -19.532 1.00 52.39  ? 508 ASN B H    1 
ATOM   2716  H HA   . ASN A 1 171 ? -43.648 5.271   -20.466 1.00 51.80  ? 508 ASN B HA   1 
ATOM   2717  H HB2  . ASN A 1 171 ? -44.536 4.564   -17.864 1.00 52.45  ? 508 ASN B HB2  1 
ATOM   2718  H HB3  . ASN A 1 171 ? -43.012 4.871   -18.192 1.00 52.45  ? 508 ASN B HB3  1 
ATOM   2719  H HD21 . ASN A 1 171 ? -45.890 6.255   -17.390 1.00 45.89  ? 508 ASN B HD21 1 
ATOM   2720  H HD22 . ASN A 1 171 ? -45.509 7.694   -17.440 1.00 45.89  ? 508 ASN B HD22 1 
ATOM   2721  N N    . GLY A 1 172 ? -42.347 3.098   -20.179 1.00 31.05  ? 509 GLY B N    1 
ATOM   2722  C CA   . GLY A 1 172 ? -41.731 1.798   -20.056 1.00 27.35  ? 509 GLY B CA   1 
ATOM   2723  C C    . GLY A 1 172 ? -42.011 1.345   -18.632 1.00 28.39  ? 509 GLY B C    1 
ATOM   2724  O O    . GLY A 1 172 ? -42.473 2.130   -17.813 1.00 26.64  ? 509 GLY B O    1 
ATOM   2725  H H    . GLY A 1 172 ? -41.790 3.741   -20.308 1.00 37.26  ? 509 GLY B H    1 
ATOM   2726  H HA2  . GLY A 1 172 ? -42.122 1.170   -20.684 1.00 32.82  ? 509 GLY B HA2  1 
ATOM   2727  H HA3  . GLY A 1 172 ? -40.773 1.854   -20.201 1.00 32.82  ? 509 GLY B HA3  1 
ATOM   2728  N N    . ILE A 1 173 ? -41.745 0.087   -18.322 1.00 24.25  ? 510 ILE B N    1 
ATOM   2729  C CA   . ILE A 1 173 ? -42.092 -0.425  -16.986 1.00 22.74  ? 510 ILE B CA   1 
ATOM   2730  C C    . ILE A 1 173 ? -41.340 0.266   -15.843 1.00 25.58  ? 510 ILE B C    1 
ATOM   2731  O O    . ILE A 1 173 ? -41.928 0.594   -14.805 1.00 25.88  ? 510 ILE B O    1 
ATOM   2732  C CB   . ILE A 1 173 ? -41.933 -1.955  -16.921 1.00 29.57  ? 510 ILE B CB   1 
ATOM   2733  C CG1  . ILE A 1 173 ? -43.090 -2.611  -17.675 1.00 39.21  ? 510 ILE B CG1  1 
ATOM   2734  C CG2  . ILE A 1 173 ? -41.958 -2.448  -15.478 1.00 26.26  ? 510 ILE B CG2  1 
ATOM   2735  C CD1  . ILE A 1 173 ? -42.676 -3.333  -18.899 1.00 54.03  ? 510 ILE B CD1  1 
ATOM   2736  H H    . ILE A 1 173 ? -41.374 -0.485  -18.846 1.00 29.10  ? 510 ILE B H    1 
ATOM   2737  H HA   . ILE A 1 173 ? -43.044 -0.240  -16.841 1.00 27.28  ? 510 ILE B HA   1 
ATOM   2738  H HB   . ILE A 1 173 ? -41.093 -2.209  -17.334 1.00 35.48  ? 510 ILE B HB   1 
ATOM   2739  H HG12 . ILE A 1 173 ? -43.522 -3.250  -17.087 1.00 47.05  ? 510 ILE B HG12 1 
ATOM   2740  H HG13 . ILE A 1 173 ? -43.722 -1.924  -17.935 1.00 47.05  ? 510 ILE B HG13 1 
ATOM   2741  H HG21 . ILE A 1 173 ? -41.857 -3.403  -15.473 1.00 31.52  ? 510 ILE B HG21 1 
ATOM   2742  H HG22 . ILE A 1 173 ? -41.237 -2.039  -14.995 1.00 31.52  ? 510 ILE B HG22 1 
ATOM   2743  H HG23 . ILE A 1 173 ? -42.798 -2.206  -15.080 1.00 31.52  ? 510 ILE B HG23 1 
ATOM   2744  H HD11 . ILE A 1 173 ? -43.453 -3.715  -19.313 1.00 64.84  ? 510 ILE B HD11 1 
ATOM   2745  H HD12 . ILE A 1 173 ? -42.256 -2.713  -19.499 1.00 64.84  ? 510 ILE B HD12 1 
ATOM   2746  H HD13 . ILE A 1 173 ? -42.057 -4.026  -18.658 1.00 64.84  ? 510 ILE B HD13 1 
ATOM   2747  N N    . PHE A 1 174 ? -40.047 0.495   -16.023 1.00 24.17  ? 511 PHE B N    1 
ATOM   2748  C CA   . PHE A 1 174 ? -39.242 1.127   -14.986 1.00 25.16  ? 511 PHE B CA   1 
ATOM   2749  C C    . PHE A 1 174 ? -39.793 2.524   -14.635 1.00 25.50  ? 511 PHE B C    1 
ATOM   2750  O O    . PHE A 1 174 ? -40.072 2.812   -13.482 1.00 26.83  ? 511 PHE B O    1 
ATOM   2751  C CB   . PHE A 1 174 ? -37.789 1.211   -15.451 1.00 28.26  ? 511 PHE B CB   1 
ATOM   2752  C CG   . PHE A 1 174 ? -36.840 1.795   -14.435 1.00 26.93  ? 511 PHE B CG   1 
ATOM   2753  C CD1  . PHE A 1 174 ? -36.843 1.367   -13.123 1.00 30.37  ? 511 PHE B CD1  1 
ATOM   2754  C CD2  . PHE A 1 174 ? -35.899 2.733   -14.817 1.00 32.36  ? 511 PHE B CD2  1 
ATOM   2755  C CE1  . PHE A 1 174 ? -35.955 1.896   -12.211 1.00 28.14  ? 511 PHE B CE1  1 
ATOM   2756  C CE2  . PHE A 1 174 ? -35.003 3.257   -13.902 1.00 35.62  ? 511 PHE B CE2  1 
ATOM   2757  C CZ   . PHE A 1 174 ? -35.030 2.830   -12.601 1.00 28.54  ? 511 PHE B CZ   1 
ATOM   2758  H H    . PHE A 1 174 ? -39.610 0.295   -16.736 1.00 29.01  ? 511 PHE B H    1 
ATOM   2759  H HA   . PHE A 1 174 ? -39.272 0.576   -14.176 1.00 30.19  ? 511 PHE B HA   1 
ATOM   2760  H HB2  . PHE A 1 174 ? -37.479 0.317   -15.663 1.00 33.91  ? 511 PHE B HB2  1 
ATOM   2761  H HB3  . PHE A 1 174 ? -37.749 1.767   -16.244 1.00 33.91  ? 511 PHE B HB3  1 
ATOM   2762  H HD1  . PHE A 1 174 ? -37.463 0.731   -12.847 1.00 36.44  ? 511 PHE B HD1  1 
ATOM   2763  H HD2  . PHE A 1 174 ? -35.873 3.024   -15.700 1.00 38.83  ? 511 PHE B HD2  1 
ATOM   2764  H HE1  . PHE A 1 174 ? -35.973 1.606   -11.327 1.00 33.77  ? 511 PHE B HE1  1 
ATOM   2765  H HE2  . PHE A 1 174 ? -34.383 3.895   -14.171 1.00 42.75  ? 511 PHE B HE2  1 
ATOM   2766  H HZ   . PHE A 1 174 ? -34.435 3.185   -11.980 1.00 34.25  ? 511 PHE B HZ   1 
ATOM   2767  N N    . MET A 1 175 ? -39.969 3.387   -15.624 1.00 28.15  ? 512 MET B N    1 
ATOM   2768  C CA   . MET A 1 175 ? -40.426 4.756   -15.337 1.00 23.93  ? 512 MET B CA   1 
ATOM   2769  C C    . MET A 1 175 ? -41.850 4.754   -14.764 1.00 25.79  ? 512 MET B C    1 
ATOM   2770  O O    . MET A 1 175 ? -42.210 5.614   -13.956 1.00 23.74  ? 512 MET B O    1 
ATOM   2771  C CB   . MET A 1 175 ? -40.349 5.627   -16.590 1.00 27.61  ? 512 MET B CB   1 
ATOM   2772  C CG   . MET A 1 175 ? -40.521 7.128   -16.317 1.00 32.99  ? 512 MET B CG   1 
ATOM   2773  S SD   . MET A 1 175 ? -39.270 7.793   -15.186 1.00 26.98  ? 512 MET B SD   1 
ATOM   2774  C CE   . MET A 1 175 ? -37.780 7.529   -16.137 1.00 28.14  ? 512 MET B CE   1 
ATOM   2775  H H    . MET A 1 175 ? -39.836 3.219   -16.457 1.00 33.78  ? 512 MET B H    1 
ATOM   2776  H HA   . MET A 1 175 ? -39.825 5.148   -14.670 1.00 28.71  ? 512 MET B HA   1 
ATOM   2777  H HB2  . MET A 1 175 ? -39.482 5.500   -17.006 1.00 33.13  ? 512 MET B HB2  1 
ATOM   2778  H HB3  . MET A 1 175 ? -41.050 5.356   -17.202 1.00 33.13  ? 512 MET B HB3  1 
ATOM   2779  H HG2  . MET A 1 175 ? -40.452 7.610   -17.156 1.00 39.59  ? 512 MET B HG2  1 
ATOM   2780  H HG3  . MET A 1 175 ? -41.393 7.278   -15.920 1.00 39.59  ? 512 MET B HG3  1 
ATOM   2781  H HE1  . MET A 1 175 ? -37.027 7.847   -15.634 1.00 33.76  ? 512 MET B HE1  1 
ATOM   2782  H HE2  . MET A 1 175 ? -37.683 6.590   -16.312 1.00 33.76  ? 512 MET B HE2  1 
ATOM   2783  H HE3  . MET A 1 175 ? -37.848 8.011   -16.965 1.00 33.76  ? 512 MET B HE3  1 
ATOM   2784  N N    . LYS A 1 176 ? -42.657 3.784   -15.182 1.00 28.54  ? 513 LYS B N    1 
ATOM   2785  C CA   . LYS A 1 176 ? -44.025 3.672   -14.693 1.00 28.52  ? 513 LYS B CA   1 
ATOM   2786  C C    . LYS A 1 176 ? -44.056 3.658   -13.165 1.00 32.73  ? 513 LYS B C    1 
ATOM   2787  O O    . LYS A 1 176 ? -44.941 4.244   -12.540 1.00 27.07  ? 513 LYS B O    1 
ATOM   2788  C CB   . LYS A 1 176 ? -44.674 2.394   -15.226 1.00 31.70  ? 513 LYS B CB   1 
ATOM   2789  C CG   . LYS A 1 176 ? -46.083 2.152   -14.707 1.00 36.52  ? 513 LYS B CG   1 
ATOM   2790  C CD   . LYS A 1 176 ? -46.583 0.771   -15.108 1.00 43.38  ? 513 LYS B CD   1 
ATOM   2791  C CE   . LYS A 1 176 ? -47.900 0.418   -14.419 1.00 56.20  ? 513 LYS B CE   1 
ATOM   2792  N NZ   . LYS A 1 176 ? -49.047 1.238   -14.903 1.00 61.04  ? 513 LYS B NZ   1 
ATOM   2793  H H    . LYS A 1 176 ? -42.436 3.177   -15.749 1.00 34.24  ? 513 LYS B H    1 
ATOM   2794  H HA   . LYS A 1 176 ? -44.547 4.439   -15.007 1.00 34.22  ? 513 LYS B HA   1 
ATOM   2795  H HB2  . LYS A 1 176 ? -44.721 2.448   -16.193 1.00 38.05  ? 513 LYS B HB2  1 
ATOM   2796  H HB3  . LYS A 1 176 ? -44.129 1.635   -14.966 1.00 38.05  ? 513 LYS B HB3  1 
ATOM   2797  H HG2  . LYS A 1 176 ? -46.082 2.207   -13.738 1.00 43.82  ? 513 LYS B HG2  1 
ATOM   2798  H HG3  . LYS A 1 176 ? -46.682 2.815   -15.082 1.00 43.82  ? 513 LYS B HG3  1 
ATOM   2799  H HD2  . LYS A 1 176 ? -46.728 0.751   -16.067 1.00 52.05  ? 513 LYS B HD2  1 
ATOM   2800  H HD3  . LYS A 1 176 ? -45.922 0.107   -14.856 1.00 52.05  ? 513 LYS B HD3  1 
ATOM   2801  H HE2  . LYS A 1 176 ? -48.105 -0.515  -14.590 1.00 67.44  ? 513 LYS B HE2  1 
ATOM   2802  H HE3  . LYS A 1 176 ? -47.807 0.567   -13.465 1.00 67.44  ? 513 LYS B HE3  1 
ATOM   2803  H HZ1  . LYS A 1 176 ? -49.791 1.001   -14.478 1.00 73.25  ? 513 LYS B HZ1  1 
ATOM   2804  H HZ2  . LYS A 1 176 ? -48.889 2.100   -14.752 1.00 73.25  ? 513 LYS B HZ2  1 
ATOM   2805  H HZ3  . LYS A 1 176 ? -49.161 1.114   -15.777 1.00 73.25  ? 513 LYS B HZ3  1 
ATOM   2806  N N    . PHE A 1 177 ? -43.084 2.989   -12.558 1.00 28.75  ? 514 PHE B N    1 
ATOM   2807  C CA   . PHE A 1 177 ? -43.053 2.898   -11.109 1.00 23.18  ? 514 PHE B CA   1 
ATOM   2808  C C    . PHE A 1 177 ? -42.122 3.948   -10.507 1.00 25.26  ? 514 PHE B C    1 
ATOM   2809  O O    . PHE A 1 177 ? -42.388 4.461   -9.427  1.00 32.15  ? 514 PHE B O    1 
ATOM   2810  C CB   . PHE A 1 177 ? -42.674 1.467   -10.686 1.00 28.30  ? 514 PHE B CB   1 
ATOM   2811  C CG   . PHE A 1 177 ? -43.688 0.443   -11.116 1.00 28.79  ? 514 PHE B CG   1 
ATOM   2812  C CD1  . PHE A 1 177 ? -44.885 0.308   -10.428 1.00 34.68  ? 514 PHE B CD1  1 
ATOM   2813  C CD2  . PHE A 1 177 ? -43.470 -0.347  -12.225 1.00 31.33  ? 514 PHE B CD2  1 
ATOM   2814  C CE1  . PHE A 1 177 ? -45.832 -0.619  -10.824 1.00 35.27  ? 514 PHE B CE1  1 
ATOM   2815  C CE2  . PHE A 1 177 ? -44.423 -1.270  -12.639 1.00 32.76  ? 514 PHE B CE2  1 
ATOM   2816  C CZ   . PHE A 1 177 ? -45.600 -1.412  -11.932 1.00 32.20  ? 514 PHE B CZ   1 
ATOM   2817  H H    . PHE A 1 177 ? -42.439 2.585   -12.958 1.00 34.50  ? 514 PHE B H    1 
ATOM   2818  H HA   . PHE A 1 177 ? -43.955 3.075   -10.767 1.00 27.81  ? 514 PHE B HA   1 
ATOM   2819  H HB2  . PHE A 1 177 ? -41.823 1.234   -11.090 1.00 33.96  ? 514 PHE B HB2  1 
ATOM   2820  H HB3  . PHE A 1 177 ? -42.603 1.432   -9.720  1.00 33.96  ? 514 PHE B HB3  1 
ATOM   2821  H HD1  . PHE A 1 177 ? -45.046 0.836   -9.680  1.00 41.62  ? 514 PHE B HD1  1 
ATOM   2822  H HD2  . PHE A 1 177 ? -42.678 -0.257  -12.704 1.00 37.59  ? 514 PHE B HD2  1 
ATOM   2823  H HE1  . PHE A 1 177 ? -46.626 -0.706  -10.348 1.00 42.32  ? 514 PHE B HE1  1 
ATOM   2824  H HE2  . PHE A 1 177 ? -44.259 -1.806  -13.382 1.00 39.31  ? 514 PHE B HE2  1 
ATOM   2825  H HZ   . PHE A 1 177 ? -46.235 -2.034  -12.203 1.00 38.64  ? 514 PHE B HZ   1 
ATOM   2826  N N    . LEU A 1 178 ? -41.052 4.298   -11.215 1.00 25.27  ? 515 LEU B N    1 
ATOM   2827  C CA   . LEU A 1 178 ? -40.099 5.281   -10.693 1.00 24.01  ? 515 LEU B CA   1 
ATOM   2828  C C    . LEU A 1 178 ? -40.782 6.635   -10.535 1.00 25.01  ? 515 LEU B C    1 
ATOM   2829  O O    . LEU A 1 178 ? -40.541 7.358   -9.567  1.00 28.66  ? 515 LEU B O    1 
ATOM   2830  C CB   . LEU A 1 178 ? -38.896 5.434   -11.623 1.00 21.42  ? 515 LEU B CB   1 
ATOM   2831  C CG   . LEU A 1 178 ? -37.826 6.432   -11.161 1.00 26.98  ? 515 LEU B CG   1 
ATOM   2832  C CD1  . LEU A 1 178 ? -37.128 5.919   -9.891  1.00 32.50  ? 515 LEU B CD1  1 
ATOM   2833  C CD2  . LEU A 1 178 ? -36.802 6.685   -12.265 1.00 28.56  ? 515 LEU B CD2  1 
ATOM   2834  H H    . LEU A 1 178 ? -40.854 3.987   -11.992 1.00 30.33  ? 515 LEU B H    1 
ATOM   2835  H HA   . LEU A 1 178 ? -39.778 4.990   -9.815  1.00 28.82  ? 515 LEU B HA   1 
ATOM   2836  H HB2  . LEU A 1 178 ? -38.466 4.569   -11.713 1.00 25.70  ? 515 LEU B HB2  1 
ATOM   2837  H HB3  . LEU A 1 178 ? -39.214 5.729   -12.490 1.00 25.70  ? 515 LEU B HB3  1 
ATOM   2838  H HG   . LEU A 1 178 ? -38.253 7.277   -10.949 1.00 32.38  ? 515 LEU B HG   1 
ATOM   2839  H HD11 . LEU A 1 178 ? -36.465 6.558   -9.620  1.00 39.00  ? 515 LEU B HD11 1 
ATOM   2840  H HD12 . LEU A 1 178 ? -37.783 5.813   -9.197  1.00 39.00  ? 515 LEU B HD12 1 
ATOM   2841  H HD13 . LEU A 1 178 ? -36.713 5.075   -10.082 1.00 39.00  ? 515 LEU B HD13 1 
ATOM   2842  H HD21 . LEU A 1 178 ? -36.148 7.311   -11.947 1.00 34.27  ? 515 LEU B HD21 1 
ATOM   2843  H HD22 . LEU A 1 178 ? -36.376 5.854   -12.492 1.00 34.27  ? 515 LEU B HD22 1 
ATOM   2844  H HD23 . LEU A 1 178 ? -37.252 7.043   -13.034 1.00 34.27  ? 515 LEU B HD23 1 
ATOM   2845  N N    . LYS A 1 179 ? -41.648 6.951   -11.494 1.00 28.28  ? 516 LYS B N    1 
ATOM   2846  C CA   . LYS A 1 179 ? -42.275 8.261   -11.604 1.00 29.71  ? 516 LYS B CA   1 
ATOM   2847  C C    . LYS A 1 179 ? -43.050 8.621   -10.345 1.00 31.29  ? 516 LYS B C    1 
ATOM   2848  O O    . LYS A 1 179 ? -43.115 9.791   -9.965  1.00 34.63  ? 516 LYS B O    1 
ATOM   2849  C CB   . LYS A 1 179 ? -43.216 8.270   -12.820 1.00 29.33  ? 516 LYS B CB   1 
ATOM   2850  C CG   . LYS A 1 179 ? -43.503 9.621   -13.398 1.00 55.21  ? 516 LYS B CG   1 
ATOM   2851  C CD   . LYS A 1 179 ? -44.308 9.494   -14.683 1.00 63.68  ? 516 LYS B CD   1 
ATOM   2852  C CE   . LYS A 1 179 ? -45.438 8.484   -14.538 1.00 62.02  ? 516 LYS B CE   1 
ATOM   2853  N NZ   . LYS A 1 179 ? -46.572 8.794   -15.456 1.00 61.26  ? 516 LYS B NZ   1 
ATOM   2854  H H    . LYS A 1 179 ? -41.894 6.405   -12.111 1.00 33.94  ? 516 LYS B H    1 
ATOM   2855  H HA   . LYS A 1 179 ? -41.583 8.941   -11.745 1.00 35.65  ? 516 LYS B HA   1 
ATOM   2856  H HB2  . LYS A 1 179 ? -42.817 7.732   -13.522 1.00 35.20  ? 516 LYS B HB2  1 
ATOM   2857  H HB3  . LYS A 1 179 ? -44.064 7.881   -12.556 1.00 35.20  ? 516 LYS B HB3  1 
ATOM   2858  H HG2  . LYS A 1 179 ? -44.020 10.141  -12.762 1.00 66.25  ? 516 LYS B HG2  1 
ATOM   2859  H HG3  . LYS A 1 179 ? -42.667 10.069  -13.602 1.00 66.25  ? 516 LYS B HG3  1 
ATOM   2860  H HD2  . LYS A 1 179 ? -44.697 10.355  -14.903 1.00 76.42  ? 516 LYS B HD2  1 
ATOM   2861  H HD3  . LYS A 1 179 ? -43.725 9.197   -15.398 1.00 76.42  ? 516 LYS B HD3  1 
ATOM   2862  H HE2  . LYS A 1 179 ? -45.106 7.599   -14.754 1.00 74.43  ? 516 LYS B HE2  1 
ATOM   2863  H HE3  . LYS A 1 179 ? -45.771 8.504   -13.627 1.00 74.43  ? 516 LYS B HE3  1 
ATOM   2864  H HZ1  . LYS A 1 179 ? -47.219 8.192   -15.355 1.00 73.51  ? 516 LYS B HZ1  1 
ATOM   2865  H HZ2  . LYS A 1 179 ? -46.898 9.602   -15.275 1.00 73.51  ? 516 LYS B HZ2  1 
ATOM   2866  H HZ3  . LYS A 1 179 ? -46.292 8.778   -16.301 1.00 73.51  ? 516 LYS B HZ3  1 
ATOM   2867  N N    . ASP A 1 180 ? -43.633 7.616   -9.699  1.00 29.20  ? 517 ASP B N    1 
ATOM   2868  C CA   . ASP A 1 180 ? -44.462 7.840   -8.509  1.00 36.91  ? 517 ASP B CA   1 
ATOM   2869  C C    . ASP A 1 180 ? -43.677 7.845   -7.197  1.00 38.34  ? 517 ASP B C    1 
ATOM   2870  O O    . ASP A 1 180 ? -44.271 7.894   -6.118  1.00 44.56  ? 517 ASP B O    1 
ATOM   2871  C CB   . ASP A 1 180 ? -45.549 6.770   -8.412  1.00 42.75  ? 517 ASP B CB   1 
ATOM   2872  C CG   . ASP A 1 180 ? -46.556 6.856   -9.536  1.00 48.92  ? 517 ASP B CG   1 
ATOM   2873  O OD1  . ASP A 1 180 ? -46.667 7.937   -10.154 1.00 44.38  ? 517 ASP B OD1  1 
ATOM   2874  O OD2  . ASP A 1 180 ? -47.235 5.840   -9.794  1.00 50.78  ? 517 ASP B OD2  1 
ATOM   2875  H H    . ASP A 1 180 ? -43.566 6.790   -9.927  1.00 35.04  ? 517 ASP B H    1 
ATOM   2876  H HA   . ASP A 1 180 ? -44.905 8.710   -8.594  1.00 44.29  ? 517 ASP B HA   1 
ATOM   2877  H HB2  . ASP A 1 180 ? -45.135 5.894   -8.447  1.00 51.30  ? 517 ASP B HB2  1 
ATOM   2878  H HB3  . ASP A 1 180 ? -46.026 6.878   -7.574  1.00 51.30  ? 517 ASP B HB3  1 
ATOM   2879  N N    . ARG A 1 181 ? -42.353 7.776   -7.280  1.00 28.10  ? 518 ARG B N    1 
ATOM   2880  C CA   . ARG A 1 181 ? -41.520 7.762   -6.081  1.00 26.69  ? 518 ARG B CA   1 
ATOM   2881  C C    . ARG A 1 181 ? -40.434 8.830   -6.110  1.00 27.06  ? 518 ARG B C    1 
ATOM   2882  O O    . ARG A 1 181 ? -39.871 9.169   -5.071  1.00 27.04  ? 518 ARG B O    1 
ATOM   2883  C CB   . ARG A 1 181 ? -40.854 6.386   -5.916  1.00 28.65  ? 518 ARG B CB   1 
ATOM   2884  C CG   . ARG A 1 181 ? -41.825 5.248   -5.660  1.00 42.50  ? 518 ARG B CG   1 
ATOM   2885  C CD   . ARG A 1 181 ? -42.230 5.175   -4.202  1.00 46.71  ? 518 ARG B CD   1 
ATOM   2886  N NE   . ARG A 1 181 ? -43.023 3.982   -3.916  1.00 30.38  ? 518 ARG B NE   1 
ATOM   2887  C CZ   . ARG A 1 181 ? -43.689 3.783   -2.785  1.00 40.27  ? 518 ARG B CZ   1 
ATOM   2888  N NH1  . ARG A 1 181 ? -43.652 4.697   -1.826  1.00 39.36  ? 518 ARG B NH1  1 
ATOM   2889  N NH2  . ARG A 1 181 ? -44.391 2.670   -2.607  1.00 41.87  ? 518 ARG B NH2  1 
ATOM   2890  H H    . ARG A 1 181 ? -41.911 7.737   -8.017  1.00 33.72  ? 518 ARG B H    1 
ATOM   2891  H HA   . ARG A 1 181 ? -42.085 7.923   -5.296  1.00 32.03  ? 518 ARG B HA   1 
ATOM   2892  H HB2  . ARG A 1 181 ? -40.364 6.179   -6.727  1.00 34.38  ? 518 ARG B HB2  1 
ATOM   2893  H HB3  . ARG A 1 181 ? -40.242 6.426   -5.164  1.00 34.38  ? 518 ARG B HB3  1 
ATOM   2894  H HG2  . ARG A 1 181 ? -42.625 5.386   -6.191  1.00 51.00  ? 518 ARG B HG2  1 
ATOM   2895  H HG3  . ARG A 1 181 ? -41.404 4.408   -5.901  1.00 51.00  ? 518 ARG B HG3  1 
ATOM   2896  H HD2  . ARG A 1 181 ? -41.433 5.148   -3.651  1.00 56.06  ? 518 ARG B HD2  1 
ATOM   2897  H HD3  . ARG A 1 181 ? -42.765 5.953   -3.980  1.00 56.06  ? 518 ARG B HD3  1 
ATOM   2898  H HE   . ARG A 1 181 ? -43.034 3.355   -4.505  1.00 36.46  ? 518 ARG B HE   1 
ATOM   2899  H HH11 . ARG A 1 181 ? -43.200 5.419   -1.939  1.00 47.24  ? 518 ARG B HH11 1 
ATOM   2900  H HH12 . ARG A 1 181 ? -44.083 4.568   -1.093  1.00 47.24  ? 518 ARG B HH12 1 
ATOM   2901  H HH21 . ARG A 1 181 ? -44.415 2.073   -3.226  1.00 50.24  ? 518 ARG B HH21 1 
ATOM   2902  H HH22 . ARG A 1 181 ? -44.818 2.544   -1.872  1.00 50.24  ? 518 ARG B HH22 1 
ATOM   2903  N N    . LEU A 1 182 ? -40.147 9.369   -7.291  1.00 24.86  ? 519 LEU B N    1 
ATOM   2904  C CA   . LEU A 1 182 ? -38.920 10.131  -7.485  1.00 30.85  ? 519 LEU B CA   1 
ATOM   2905  C C    . LEU A 1 182 ? -38.835 11.367  -6.588  1.00 33.26  ? 519 LEU B C    1 
ATOM   2906  O O    . LEU A 1 182 ? -37.740 11.774  -6.191  1.00 26.82  ? 519 LEU B O    1 
ATOM   2907  C CB   . LEU A 1 182 ? -38.757 10.537  -8.950  1.00 37.12  ? 519 LEU B CB   1 
ATOM   2908  C CG   . LEU A 1 182 ? -37.315 10.955  -9.231  1.00 40.27  ? 519 LEU B CG   1 
ATOM   2909  C CD1  . LEU A 1 182 ? -36.441 9.711   -9.351  1.00 30.93  ? 519 LEU B CD1  1 
ATOM   2910  C CD2  . LEU A 1 182 ? -37.208 11.840  -10.473 1.00 44.38  ? 519 LEU B CD2  1 
ATOM   2911  H H    . LEU A 1 182 ? -40.643 9.309   -7.992  1.00 29.84  ? 519 LEU B H    1 
ATOM   2912  H HA   . LEU A 1 182 ? -38.162 9.553   -7.257  1.00 37.02  ? 519 LEU B HA   1 
ATOM   2913  H HB2  . LEU A 1 182 ? -38.976 9.784   -9.521  1.00 44.55  ? 519 LEU B HB2  1 
ATOM   2914  H HB3  . LEU A 1 182 ? -39.338 11.290  -9.144  1.00 44.55  ? 519 LEU B HB3  1 
ATOM   2915  H HG   . LEU A 1 182 ? -36.990 11.470  -8.476  1.00 48.32  ? 519 LEU B HG   1 
ATOM   2916  H HD11 . LEU A 1 182 ? -35.536 9.981   -9.527  1.00 37.12  ? 519 LEU B HD11 1 
ATOM   2917  H HD12 . LEU A 1 182 ? -36.482 9.220   -8.527  1.00 37.12  ? 519 LEU B HD12 1 
ATOM   2918  H HD13 . LEU A 1 182 ? -36.767 9.169   -10.073 1.00 37.12  ? 519 LEU B HD13 1 
ATOM   2919  H HD21 . LEU A 1 182 ? -36.287 12.076  -10.609 1.00 53.26  ? 519 LEU B HD21 1 
ATOM   2920  H HD22 . LEU A 1 182 ? -37.537 11.353  -11.232 1.00 53.26  ? 519 LEU B HD22 1 
ATOM   2921  H HD23 . LEU A 1 182 ? -37.733 12.632  -10.338 1.00 53.26  ? 519 LEU B HD23 1 
ATOM   2922  N N    . LEU A 1 183 ? -39.989 11.935  -6.250  1.00 29.55  ? 520 LEU B N    1 
ATOM   2923  C CA   . LEU A 1 183 ? -40.049 13.195  -5.510  1.00 33.49  ? 520 LEU B CA   1 
ATOM   2924  C C    . LEU A 1 183 ? -39.998 12.995  -3.994  1.00 38.84  ? 520 LEU B C    1 
ATOM   2925  O O    . LEU A 1 183 ? -39.906 13.961  -3.246  1.00 33.00  ? 520 LEU B O    1 
ATOM   2926  C CB   . LEU A 1 183 ? -41.319 13.973  -5.877  1.00 33.33  ? 520 LEU B CB   1 
ATOM   2927  C CG   . LEU A 1 183 ? -41.510 14.295  -7.364  1.00 39.40  ? 520 LEU B CG   1 
ATOM   2928  C CD1  . LEU A 1 183 ? -42.835 15.020  -7.592  1.00 37.57  ? 520 LEU B CD1  1 
ATOM   2929  C CD2  . LEU A 1 183 ? -40.348 15.116  -7.897  1.00 38.22  ? 520 LEU B CD2  1 
ATOM   2930  H H    . LEU A 1 183 ? -40.761 11.607  -6.439  1.00 35.46  ? 520 LEU B H    1 
ATOM   2931  H HA   . LEU A 1 183 ? -39.279 13.745  -5.764  1.00 40.18  ? 520 LEU B HA   1 
ATOM   2932  H HB2  . LEU A 1 183 ? -42.087 13.452  -5.594  1.00 39.99  ? 520 LEU B HB2  1 
ATOM   2933  H HB3  . LEU A 1 183 ? -41.309 14.816  -5.398  1.00 39.99  ? 520 LEU B HB3  1 
ATOM   2934  H HG   . LEU A 1 183 ? -41.538 13.464  -7.862  1.00 47.28  ? 520 LEU B HG   1 
ATOM   2935  H HD11 . LEU A 1 183 ? -42.929 15.210  -8.528  1.00 45.08  ? 520 LEU B HD11 1 
ATOM   2936  H HD12 . LEU A 1 183 ? -43.553 14.455  -7.298  1.00 45.08  ? 520 LEU B HD12 1 
ATOM   2937  H HD13 . LEU A 1 183 ? -42.834 15.838  -7.090  1.00 45.08  ? 520 LEU B HD13 1 
ATOM   2938  H HD21 . LEU A 1 183 ? -40.498 15.300  -8.828  1.00 45.87  ? 520 LEU B HD21 1 
ATOM   2939  H HD22 . LEU A 1 183 ? -40.295 15.938  -7.405  1.00 45.87  ? 520 LEU B HD22 1 
ATOM   2940  H HD23 . LEU A 1 183 ? -39.537 14.615  -7.789  1.00 45.87  ? 520 LEU B HD23 1 
ATOM   2941  N N    . GLU A 1 184 ? -40.056 11.748  -3.536  1.00 34.50  ? 521 GLU B N    1 
ATOM   2942  C CA   . GLU A 1 184 ? -40.003 11.488  -2.106  1.00 39.20  ? 521 GLU B CA   1 
ATOM   2943  C C    . GLU A 1 184 ? -38.716 12.048  -1.526  1.00 36.28  ? 521 GLU B C    1 
ATOM   2944  O O    . GLU A 1 184 ? -37.666 11.994  -2.163  1.00 37.51  ? 521 GLU B O    1 
ATOM   2945  C CB   . GLU A 1 184 ? -40.103 9.991   -1.815  1.00 36.72  ? 521 GLU B CB   1 
ATOM   2946  C CG   . GLU A 1 184 ? -41.461 9.404   -2.115  1.00 32.91  ? 521 GLU B CG   1 
ATOM   2947  C CD   . GLU A 1 184 ? -41.550 7.951   -1.725  1.00 36.93  ? 521 GLU B CD   1 
ATOM   2948  O OE1  . GLU A 1 184 ? -40.541 7.400   -1.236  1.00 37.38  ? 521 GLU B OE1  1 
ATOM   2949  O OE2  . GLU A 1 184 ? -42.622 7.356   -1.915  1.00 33.96  ? 521 GLU B OE2  1 
ATOM   2950  H H    . GLU A 1 184 ? -40.124 11.046  -4.027  1.00 41.40  ? 521 GLU B H    1 
ATOM   2951  H HA   . GLU A 1 184 ? -40.757 11.936  -1.669  1.00 47.05  ? 521 GLU B HA   1 
ATOM   2952  H HB2  . GLU A 1 184 ? -39.451 9.523   -2.359  1.00 44.07  ? 521 GLU B HB2  1 
ATOM   2953  H HB3  . GLU A 1 184 ? -39.916 9.842   -0.875  1.00 44.07  ? 521 GLU B HB3  1 
ATOM   2954  H HG2  . GLU A 1 184 ? -42.136 9.892   -1.617  1.00 39.49  ? 521 GLU B HG2  1 
ATOM   2955  H HG3  . GLU A 1 184 ? -41.635 9.473   -3.067  1.00 39.49  ? 521 GLU B HG3  1 
ATOM   2956  N N    . ASP A 1 185 ? -38.810 12.597  -0.320  1.00 29.70  ? 522 ASP B N    1 
ATOM   2957  C CA   . ASP A 1 185 ? -37.640 13.105  0.388   1.00 33.18  ? 522 ASP B CA   1 
ATOM   2958  C C    . ASP A 1 185 ? -37.029 11.978  1.206   1.00 36.98  ? 522 ASP B C    1 
ATOM   2959  O O    . ASP A 1 185 ? -37.152 11.935  2.441   1.00 29.94  ? 522 ASP B O    1 
ATOM   2960  C CB   . ASP A 1 185 ? -38.018 14.286  1.290   1.00 39.28  ? 522 ASP B CB   1 
ATOM   2961  C CG   . ASP A 1 185 ? -36.804 14.956  1.907   1.00 45.11  ? 522 ASP B CG   1 
ATOM   2962  O OD1  . ASP A 1 185 ? -35.698 14.842  1.337   1.00 36.34  ? 522 ASP B OD1  1 
ATOM   2963  O OD2  . ASP A 1 185 ? -36.951 15.588  2.967   1.00 50.39  ? 522 ASP B OD2  1 
ATOM   2964  H H    . ASP A 1 185 ? -39.547 12.688  0.114   1.00 35.64  ? 522 ASP B H    1 
ATOM   2965  H HA   . ASP A 1 185 ? -36.974 13.413  -0.262  1.00 39.81  ? 522 ASP B HA   1 
ATOM   2966  H HB2  . ASP A 1 185 ? -38.492 14.948  0.764   1.00 47.14  ? 522 ASP B HB2  1 
ATOM   2967  H HB3  . ASP A 1 185 ? -38.584 13.966  2.010   1.00 47.14  ? 522 ASP B HB3  1 
ATOM   2968  N N    . LYS A 1 186 ? -36.361 11.073  0.498   1.00 27.97  ? 523 LYS B N    1 
ATOM   2969  C CA   . LYS A 1 186 ? -35.768 9.880   1.095   1.00 26.34  ? 523 LYS B CA   1 
ATOM   2970  C C    . LYS A 1 186 ? -34.425 9.591   0.418   1.00 31.87  ? 523 LYS B C    1 
ATOM   2971  O O    . LYS A 1 186 ? -34.236 9.911   -0.757  1.00 29.72  ? 523 LYS B O    1 
ATOM   2972  C CB   . LYS A 1 186 ? -36.703 8.685   0.900   1.00 29.62  ? 523 LYS B CB   1 
ATOM   2973  C CG   . LYS A 1 186 ? -37.807 8.578   1.936   1.00 43.65  ? 523 LYS B CG   1 
ATOM   2974  C CD   . LYS A 1 186 ? -38.821 7.513   1.563   1.00 40.18  ? 523 LYS B CD   1 
ATOM   2975  C CE   . LYS A 1 186 ? -40.107 7.680   2.364   1.00 44.40  ? 523 LYS B CE   1 
ATOM   2976  N NZ   . LYS A 1 186 ? -41.160 6.715   1.942   1.00 42.10  ? 523 LYS B NZ   1 
ATOM   2977  H H    . LYS A 1 186 ? -36.236 11.128  -0.351  1.00 33.56  ? 523 LYS B H    1 
ATOM   2978  H HA   . LYS A 1 186 ? -35.621 10.020  2.054   1.00 31.61  ? 523 LYS B HA   1 
ATOM   2979  H HB2  . LYS A 1 186 ? -37.123 8.759   0.029   1.00 35.55  ? 523 LYS B HB2  1 
ATOM   2980  H HB3  . LYS A 1 186 ? -36.179 7.870   0.943   1.00 35.55  ? 523 LYS B HB3  1 
ATOM   2981  H HG2  . LYS A 1 186 ? -37.419 8.341   2.793   1.00 52.38  ? 523 LYS B HG2  1 
ATOM   2982  H HG3  . LYS A 1 186 ? -38.269 9.428   2.000   1.00 52.38  ? 523 LYS B HG3  1 
ATOM   2983  H HD2  . LYS A 1 186 ? -39.036 7.589   0.620   1.00 48.21  ? 523 LYS B HD2  1 
ATOM   2984  H HD3  . LYS A 1 186 ? -38.453 6.636   1.755   1.00 48.21  ? 523 LYS B HD3  1 
ATOM   2985  H HE2  . LYS A 1 186 ? -39.918 7.529   3.303   1.00 53.28  ? 523 LYS B HE2  1 
ATOM   2986  H HE3  . LYS A 1 186 ? -40.449 8.578   2.232   1.00 53.28  ? 523 LYS B HE3  1 
ATOM   2987  H HZ1  . LYS A 1 186 ? -41.896 6.838   2.427   1.00 50.52  ? 523 LYS B HZ1  1 
ATOM   2988  H HZ2  . LYS A 1 186 ? -41.356 6.837   1.082   1.00 50.52  ? 523 LYS B HZ2  1 
ATOM   2989  H HZ3  . LYS A 1 186 ? -40.872 5.881   2.058   1.00 50.52  ? 523 LYS B HZ3  1 
ATOM   2990  N N    . LYS A 1 187 ? -33.491 8.999   1.156   1.00 28.25  ? 524 LYS B N    1 
ATOM   2991  C CA   . LYS A 1 187 ? -32.214 8.588   0.576   1.00 25.48  ? 524 LYS B CA   1 
ATOM   2992  C C    . LYS A 1 187 ? -32.519 7.862   -0.718  1.00 24.08  ? 524 LYS B C    1 
ATOM   2993  O O    . LYS A 1 187 ? -33.456 7.070   -0.774  1.00 23.36  ? 524 LYS B O    1 
ATOM   2994  C CB   . LYS A 1 187 ? -31.449 7.659   1.532   1.00 32.76  ? 524 LYS B CB   1 
ATOM   2995  C CG   . LYS A 1 187 ? -30.010 7.422   1.121   1.00 32.74  ? 524 LYS B CG   1 
ATOM   2996  C CD   . LYS A 1 187 ? -29.247 6.565   2.139   1.00 29.89  ? 524 LYS B CD   1 
ATOM   2997  C CE   . LYS A 1 187 ? -27.919 6.092   1.563   1.00 23.94  ? 524 LYS B CE   1 
ATOM   2998  N NZ   . LYS A 1 187 ? -27.204 5.155   2.508   1.00 29.11  ? 524 LYS B NZ   1 
ATOM   2999  H H    . LYS A 1 187 ? -33.570 8.824   1.994   1.00 33.90  ? 524 LYS B H    1 
ATOM   3000  H HA   . LYS A 1 187 ? -31.663 9.374   0.381   1.00 30.58  ? 524 LYS B HA   1 
ATOM   3001  H HB2  . LYS A 1 187 ? -31.444 8.056   2.417   1.00 39.31  ? 524 LYS B HB2  1 
ATOM   3002  H HB3  . LYS A 1 187 ? -31.896 6.799   1.559   1.00 39.31  ? 524 LYS B HB3  1 
ATOM   3003  H HG2  . LYS A 1 187 ? -29.995 6.961   0.268   1.00 39.29  ? 524 LYS B HG2  1 
ATOM   3004  H HG3  . LYS A 1 187 ? -29.556 8.276   1.046   1.00 39.29  ? 524 LYS B HG3  1 
ATOM   3005  H HD2  . LYS A 1 187 ? -29.066 7.092   2.933   1.00 35.87  ? 524 LYS B HD2  1 
ATOM   3006  H HD3  . LYS A 1 187 ? -29.777 5.785   2.365   1.00 35.87  ? 524 LYS B HD3  1 
ATOM   3007  H HE2  . LYS A 1 187 ? -28.082 5.620   0.732   1.00 28.73  ? 524 LYS B HE2  1 
ATOM   3008  H HE3  . LYS A 1 187 ? -27.348 6.860   1.406   1.00 28.73  ? 524 LYS B HE3  1 
ATOM   3009  H HZ1  . LYS A 1 187 ? -26.432 4.893   2.149   1.00 34.93  ? 524 LYS B HZ1  1 
ATOM   3010  H HZ2  . LYS A 1 187 ? -27.039 5.568   3.279   1.00 34.93  ? 524 LYS B HZ2  1 
ATOM   3011  H HZ3  . LYS A 1 187 ? -27.708 4.439   2.665   1.00 34.93  ? 524 LYS B HZ3  1 
ATOM   3012  N N    . ILE A 1 188 ? -31.740 8.137   -1.762  1.00 24.25  ? 525 ILE B N    1 
ATOM   3013  C CA   . ILE A 1 188 ? -32.013 7.581   -3.088  1.00 26.53  ? 525 ILE B CA   1 
ATOM   3014  C C    . ILE A 1 188 ? -32.069 6.035   -3.084  1.00 25.14  ? 525 ILE B C    1 
ATOM   3015  O O    . ILE A 1 188 ? -32.870 5.426   -3.783  1.00 24.85  ? 525 ILE B O    1 
ATOM   3016  C CB   . ILE A 1 188 ? -30.977 8.093   -4.126  1.00 22.27  ? 525 ILE B CB   1 
ATOM   3017  C CG1  . ILE A 1 188 ? -31.289 7.536   -5.518  1.00 22.92  ? 525 ILE B CG1  1 
ATOM   3018  C CG2  . ILE A 1 188 ? -29.556 7.732   -3.697  1.00 24.59  ? 525 ILE B CG2  1 
ATOM   3019  C CD1  . ILE A 1 188 ? -32.745 7.732   -5.966  1.00 25.33  ? 525 ILE B CD1  1 
ATOM   3020  H H    . ILE A 1 188 ? -31.045 8.643   -1.730  1.00 29.10  ? 525 ILE B H    1 
ATOM   3021  H HA   . ILE A 1 188 ? -32.893 7.901   -3.376  1.00 31.83  ? 525 ILE B HA   1 
ATOM   3022  H HB   . ILE A 1 188 ? -31.043 9.060   -4.167  1.00 26.73  ? 525 ILE B HB   1 
ATOM   3023  H HG12 . ILE A 1 188 ? -30.719 7.979   -6.165  1.00 27.50  ? 525 ILE B HG12 1 
ATOM   3024  H HG13 . ILE A 1 188 ? -31.106 6.583   -5.519  1.00 27.50  ? 525 ILE B HG13 1 
ATOM   3025  H HG21 . ILE A 1 188 ? -28.939 8.059   -4.355  1.00 29.51  ? 525 ILE B HG21 1 
ATOM   3026  H HG22 . ILE A 1 188 ? -29.374 8.137   -2.846  1.00 29.51  ? 525 ILE B HG22 1 
ATOM   3027  H HG23 . ILE A 1 188 ? -29.485 6.777   -3.627  1.00 29.51  ? 525 ILE B HG23 1 
ATOM   3028  H HD11 . ILE A 1 188 ? -32.855 7.356   -6.843  1.00 30.40  ? 525 ILE B HD11 1 
ATOM   3029  H HD12 . ILE A 1 188 ? -33.326 7.287   -5.344  1.00 30.40  ? 525 ILE B HD12 1 
ATOM   3030  H HD13 . ILE A 1 188 ? -32.942 8.671   -5.985  1.00 30.40  ? 525 ILE B HD13 1 
ATOM   3031  N N    . THR A 1 189 ? -31.235 5.400   -2.278  1.00 23.62  ? 526 THR B N    1 
ATOM   3032  C CA   . THR A 1 189 ? -31.278 3.935   -2.170  1.00 27.00  ? 526 THR B CA   1 
ATOM   3033  C C    . THR A 1 189 ? -32.624 3.422   -1.657  1.00 25.83  ? 526 THR B C    1 
ATOM   3034  O O    . THR A 1 189 ? -33.168 2.447   -2.180  1.00 22.93  ? 526 THR B O    1 
ATOM   3035  C CB   . THR A 1 189 ? -30.196 3.448   -1.239  1.00 28.63  ? 526 THR B CB   1 
ATOM   3036  O OG1  . THR A 1 189 ? -30.278 4.176   -0.008  1.00 27.72  ? 526 THR B OG1  1 
ATOM   3037  C CG2  . THR A 1 189 ? -28.835 3.667   -1.874  1.00 20.66  ? 526 THR B CG2  1 
ATOM   3038  H H    . THR A 1 189 ? -30.640 5.779   -1.786  1.00 28.34  ? 526 THR B H    1 
ATOM   3039  H HA   . THR A 1 189 ? -31.119 3.544   -3.054  1.00 32.41  ? 526 THR B HA   1 
ATOM   3040  H HB   . THR A 1 189 ? -30.312 2.500   -1.069  1.00 34.35  ? 526 THR B HB   1 
ATOM   3041  H HG1  . THR A 1 189 ? -29.694 3.920   0.509   1.00 33.26  ? 526 THR B HG1  1 
ATOM   3042  H HG21 . THR A 1 189 ? -28.144 3.357   -1.284  1.00 24.80  ? 526 THR B HG21 1 
ATOM   3043  H HG22 . THR A 1 189 ? -28.777 3.184   -2.702  1.00 24.80  ? 526 THR B HG22 1 
ATOM   3044  H HG23 . THR A 1 189 ? -28.701 4.602   -2.048  1.00 24.80  ? 526 THR B HG23 1 
ATOM   3045  N N    . VAL A 1 190 ? -33.157 4.084   -0.633  1.00 26.50  ? 527 VAL B N    1 
ATOM   3046  C CA   . VAL A 1 190 ? -34.435 3.705   -0.040  1.00 29.07  ? 527 VAL B CA   1 
ATOM   3047  C C    . VAL A 1 190 ? -35.552 3.902   -1.052  1.00 27.89  ? 527 VAL B C    1 
ATOM   3048  O O    . VAL A 1 190 ? -36.468 3.077   -1.162  1.00 23.98  ? 527 VAL B O    1 
ATOM   3049  C CB   . VAL A 1 190 ? -34.730 4.565   1.217   1.00 40.90  ? 527 VAL B CB   1 
ATOM   3050  C CG1  . VAL A 1 190 ? -36.150 4.350   1.706   1.00 38.51  ? 527 VAL B CG1  1 
ATOM   3051  C CG2  . VAL A 1 190 ? -33.721 4.259   2.314   1.00 32.00  ? 527 VAL B CG2  1 
ATOM   3052  H H    . VAL A 1 190 ? -32.791 4.767   -0.259  1.00 31.80  ? 527 VAL B H    1 
ATOM   3053  H HA   . VAL A 1 190 ? -34.411 2.762   0.223   1.00 34.88  ? 527 VAL B HA   1 
ATOM   3054  H HB   . VAL A 1 190 ? -34.636 5.512   0.980   1.00 49.08  ? 527 VAL B HB   1 
ATOM   3055  H HG11 . VAL A 1 190 ? -36.299 4.895   2.482   1.00 46.21  ? 527 VAL B HG11 1 
ATOM   3056  H HG12 . VAL A 1 190 ? -36.762 4.598   1.009   1.00 46.21  ? 527 VAL B HG12 1 
ATOM   3057  H HG13 . VAL A 1 190 ? -36.266 3.423   1.929   1.00 46.21  ? 527 VAL B HG13 1 
ATOM   3058  H HG21 . VAL A 1 190 ? -33.920 4.801   3.081   1.00 38.40  ? 527 VAL B HG21 1 
ATOM   3059  H HG22 . VAL A 1 190 ? -33.782 3.329   2.543   1.00 38.40  ? 527 VAL B HG22 1 
ATOM   3060  H HG23 . VAL A 1 190 ? -32.839 4.460   1.991   1.00 38.40  ? 527 VAL B HG23 1 
ATOM   3061  N N    . LEU A 1 191 ? -35.459 5.003   -1.795  1.00 20.07  ? 528 LEU B N    1 
ATOM   3062  C CA   . LEU A 1 191 ? -36.433 5.327   -2.831  1.00 30.25  ? 528 LEU B CA   1 
ATOM   3063  C C    . LEU A 1 191 ? -36.483 4.194   -3.861  1.00 26.59  ? 528 LEU B C    1 
ATOM   3064  O O    . LEU A 1 191 ? -37.545 3.664   -4.187  1.00 24.20  ? 528 LEU B O    1 
ATOM   3065  C CB   . LEU A 1 191 ? -36.012 6.636   -3.497  1.00 27.46  ? 528 LEU B CB   1 
ATOM   3066  C CG   . LEU A 1 191 ? -37.012 7.384   -4.365  1.00 37.49  ? 528 LEU B CG   1 
ATOM   3067  C CD1  . LEU A 1 191 ? -36.646 8.866   -4.345  1.00 24.13  ? 528 LEU B CD1  1 
ATOM   3068  C CD2  . LEU A 1 191 ? -37.013 6.810   -5.776  1.00 33.55  ? 528 LEU B CD2  1 
ATOM   3069  H H    . LEU A 1 191 ? -34.831 5.585   -1.716  1.00 24.09  ? 528 LEU B H    1 
ATOM   3070  H HA   . LEU A 1 191 ? -37.322 5.440   -2.435  1.00 36.30  ? 528 LEU B HA   1 
ATOM   3071  H HB2  . LEU A 1 191 ? -35.742 7.249   -2.795  1.00 32.96  ? 528 LEU B HB2  1 
ATOM   3072  H HB3  . LEU A 1 191 ? -35.245 6.446   -4.059  1.00 32.96  ? 528 LEU B HB3  1 
ATOM   3073  H HG   . LEU A 1 191 ? -37.902 7.283   -3.992  1.00 44.99  ? 528 LEU B HG   1 
ATOM   3074  H HD11 . LEU A 1 191 ? -37.271 9.349   -4.890  1.00 28.95  ? 528 LEU B HD11 1 
ATOM   3075  H HD12 . LEU A 1 191 ? -36.685 9.184   -3.440  1.00 28.95  ? 528 LEU B HD12 1 
ATOM   3076  H HD13 . LEU A 1 191 ? -35.757 8.972   -4.692  1.00 28.95  ? 528 LEU B HD13 1 
ATOM   3077  H HD21 . LEU A 1 191 ? -37.649 7.292   -6.309  1.00 40.26  ? 528 LEU B HD21 1 
ATOM   3078  H HD22 . LEU A 1 191 ? -36.134 6.902   -6.151  1.00 40.26  ? 528 LEU B HD22 1 
ATOM   3079  H HD23 . LEU A 1 191 ? -37.256 5.882   -5.735  1.00 40.26  ? 528 LEU B HD23 1 
ATOM   3080  N N    . LEU A 1 192 ? -35.321 3.816   -4.363  1.00 24.34  ? 529 LEU B N    1 
ATOM   3081  C CA   . LEU A 1 192 ? -35.234 2.736   -5.353  1.00 20.56  ? 529 LEU B CA   1 
ATOM   3082  C C    . LEU A 1 192 ? -35.710 1.388   -4.802  1.00 22.47  ? 529 LEU B C    1 
ATOM   3083  O O    . LEU A 1 192 ? -36.338 0.623   -5.519  1.00 24.73  ? 529 LEU B O    1 
ATOM   3084  C CB   . LEU A 1 192 ? -33.803 2.637   -5.887  1.00 17.91  ? 529 LEU B CB   1 
ATOM   3085  C CG   . LEU A 1 192 ? -33.417 3.831   -6.775  1.00 24.45  ? 529 LEU B CG   1 
ATOM   3086  C CD1  . LEU A 1 192 ? -31.941 3.817   -7.142  1.00 20.02  ? 529 LEU B CD1  1 
ATOM   3087  C CD2  . LEU A 1 192 ? -34.264 3.840   -8.043  1.00 27.02  ? 529 LEU B CD2  1 
ATOM   3088  H H    . LEU A 1 192 ? -34.563 4.163   -4.152  1.00 29.21  ? 529 LEU B H    1 
ATOM   3089  H HA   . LEU A 1 192 ? -35.814 2.963   -6.110  1.00 24.68  ? 529 LEU B HA   1 
ATOM   3090  H HB2  . LEU A 1 192 ? -33.187 2.609   -5.137  1.00 21.49  ? 529 LEU B HB2  1 
ATOM   3091  H HB3  . LEU A 1 192 ? -33.718 1.828   -6.416  1.00 21.49  ? 529 LEU B HB3  1 
ATOM   3092  H HG   . LEU A 1 192 ? -33.596 4.652   -6.291  1.00 29.34  ? 529 LEU B HG   1 
ATOM   3093  H HD11 . LEU A 1 192 ? -31.749 4.578   -7.695  1.00 24.03  ? 529 LEU B HD11 1 
ATOM   3094  H HD12 . LEU A 1 192 ? -31.419 3.857   -6.337  1.00 24.03  ? 529 LEU B HD12 1 
ATOM   3095  H HD13 . LEU A 1 192 ? -31.745 3.008   -7.620  1.00 24.03  ? 529 LEU B HD13 1 
ATOM   3096  H HD21 . LEU A 1 192 ? -34.008 4.592   -8.583  1.00 32.42  ? 529 LEU B HD21 1 
ATOM   3097  H HD22 . LEU A 1 192 ? -34.113 3.024   -8.525  1.00 32.42  ? 529 LEU B HD22 1 
ATOM   3098  H HD23 . LEU A 1 192 ? -35.190 3.911   -7.800  1.00 32.42  ? 529 LEU B HD23 1 
ATOM   3099  N N    . ASP A 1 193 ? -35.425 1.117   -3.526  1.00 19.26  ? 530 ASP B N    1 
ATOM   3100  C CA   . ASP A 1 193 ? -35.867 -0.114  -2.858  1.00 29.20  ? 530 ASP B CA   1 
ATOM   3101  C C    . ASP A 1 193 ? -37.391 -0.143  -2.882  1.00 25.01  ? 530 ASP B C    1 
ATOM   3102  O O    . ASP A 1 193 ? -37.998 -1.198  -3.042  1.00 27.00  ? 530 ASP B O    1 
ATOM   3103  C CB   . ASP A 1 193 ? -35.334 -0.131  -1.412  1.00 30.09  ? 530 ASP B CB   1 
ATOM   3104  C CG   . ASP A 1 193 ? -35.323 -1.531  -0.765  1.00 38.31  ? 530 ASP B CG   1 
ATOM   3105  O OD1  . ASP A 1 193 ? -35.490 -2.569  -1.446  1.00 26.02  ? 530 ASP B OD1  1 
ATOM   3106  O OD2  . ASP A 1 193 ? -35.112 -1.585  0.466   1.00 40.31  ? 530 ASP B OD2  1 
ATOM   3107  H H    . ASP A 1 193 ? -34.970 1.639   -3.016  1.00 23.11  ? 530 ASP B H    1 
ATOM   3108  H HA   . ASP A 1 193 ? -35.524 -0.898  -3.336  1.00 35.04  ? 530 ASP B HA   1 
ATOM   3109  H HB2  . ASP A 1 193 ? -34.423 0.203   -1.411  1.00 36.11  ? 530 ASP B HB2  1 
ATOM   3110  H HB3  . ASP A 1 193 ? -35.894 0.443   -0.866  1.00 36.11  ? 530 ASP B HB3  1 
ATOM   3111  N N    . GLU A 1 194 ? -38.010 1.028   -2.746  1.00 23.86  ? 531 GLU B N    1 
ATOM   3112  C CA   . GLU A 1 194 ? -39.467 1.112   -2.780  1.00 26.54  ? 531 GLU B CA   1 
ATOM   3113  C C    . GLU A 1 194 ? -39.975 0.845   -4.197  1.00 25.56  ? 531 GLU B C    1 
ATOM   3114  O O    . GLU A 1 194 ? -40.943 0.112   -4.393  1.00 27.36  ? 531 GLU B O    1 
ATOM   3115  C CB   . GLU A 1 194 ? -39.938 2.477   -2.290  1.00 32.54  ? 531 GLU B CB   1 
ATOM   3116  C CG   . GLU A 1 194 ? -39.705 2.699   -0.803  1.00 34.48  ? 531 GLU B CG   1 
ATOM   3117  C CD   . GLU A 1 194 ? -40.057 4.110   -0.375  1.00 43.03  ? 531 GLU B CD   1 
ATOM   3118  O OE1  . GLU A 1 194 ? -40.256 4.966   -1.262  1.00 40.41  ? 531 GLU B OE1  1 
ATOM   3119  O OE2  . GLU A 1 194 ? -40.138 4.362   0.842   1.00 39.66  ? 531 GLU B OE2  1 
ATOM   3120  H H    . GLU A 1 194 ? -37.613 1.783   -2.634  1.00 28.64  ? 531 GLU B H    1 
ATOM   3121  H HA   . GLU A 1 194 ? -39.842 0.429   -2.187  1.00 31.84  ? 531 GLU B HA   1 
ATOM   3122  H HB2  . GLU A 1 194 ? -39.457 3.167   -2.773  1.00 39.05  ? 531 GLU B HB2  1 
ATOM   3123  H HB3  . GLU A 1 194 ? -40.890 2.560   -2.458  1.00 39.05  ? 531 GLU B HB3  1 
ATOM   3124  H HG2  . GLU A 1 194 ? -40.259 2.082   -0.299  1.00 41.38  ? 531 GLU B HG2  1 
ATOM   3125  H HG3  . GLU A 1 194 ? -38.768 2.547   -0.602  1.00 41.38  ? 531 GLU B HG3  1 
ATOM   3126  N N    . VAL A 1 195 ? -39.306 1.418   -5.187  1.00 20.93  ? 532 VAL B N    1 
ATOM   3127  C CA   . VAL A 1 195 ? -39.669 1.151   -6.567  1.00 19.90  ? 532 VAL B CA   1 
ATOM   3128  C C    . VAL A 1 195 ? -39.546 -0.344  -6.848  1.00 27.37  ? 532 VAL B C    1 
ATOM   3129  O O    . VAL A 1 195 ? -40.406 -0.938  -7.492  1.00 26.19  ? 532 VAL B O    1 
ATOM   3130  C CB   . VAL A 1 195 ? -38.795 1.947   -7.556  1.00 26.24  ? 532 VAL B CB   1 
ATOM   3131  C CG1  . VAL A 1 195 ? -39.163 1.601   -8.984  1.00 24.90  ? 532 VAL B CG1  1 
ATOM   3132  C CG2  . VAL A 1 195 ? -38.954 3.460   -7.318  1.00 22.58  ? 532 VAL B CG2  1 
ATOM   3133  H H    . VAL A 1 195 ? -38.646 1.960   -5.088  1.00 25.12  ? 532 VAL B H    1 
ATOM   3134  H HA   . VAL A 1 195 ? -40.604 1.411   -6.709  1.00 23.87  ? 532 VAL B HA   1 
ATOM   3135  H HB   . VAL A 1 195 ? -37.854 1.712   -7.417  1.00 31.49  ? 532 VAL B HB   1 
ATOM   3136  H HG11 . VAL A 1 195 ? -38.607 2.108   -9.581  1.00 29.88  ? 532 VAL B HG11 1 
ATOM   3137  H HG12 . VAL A 1 195 ? -39.023 0.662   -9.124  1.00 29.88  ? 532 VAL B HG12 1 
ATOM   3138  H HG13 . VAL A 1 195 ? -40.086 1.821   -9.131  1.00 29.88  ? 532 VAL B HG13 1 
ATOM   3139  H HG21 . VAL A 1 195 ? -38.402 3.934   -7.944  1.00 27.09  ? 532 VAL B HG21 1 
ATOM   3140  H HG22 . VAL A 1 195 ? -39.875 3.701   -7.445  1.00 27.09  ? 532 VAL B HG22 1 
ATOM   3141  H HG23 . VAL A 1 195 ? -38.683 3.665   -6.421  1.00 27.09  ? 532 VAL B HG23 1 
ATOM   3142  N N    . ALA A 1 196 ? -38.479 -0.962  -6.353  1.00 21.90  ? 533 ALA B N    1 
ATOM   3143  C CA   . ALA A 1 196 ? -38.295 -2.388  -6.591  1.00 21.33  ? 533 ALA B CA   1 
ATOM   3144  C C    . ALA A 1 196 ? -39.531 -3.140  -6.103  1.00 19.38  ? 533 ALA B C    1 
ATOM   3145  O O    . ALA A 1 196 ? -40.024 -4.048  -6.772  1.00 27.94  ? 533 ALA B O    1 
ATOM   3146  C CB   . ALA A 1 196 ? -37.023 -2.897  -5.891  1.00 22.67  ? 533 ALA B CB   1 
ATOM   3147  H H    . ALA A 1 196 ? -37.860 -0.588  -5.888  1.00 26.29  ? 533 ALA B H    1 
ATOM   3148  H HA   . ALA A 1 196 ? -38.200 -2.546  -7.553  1.00 25.60  ? 533 ALA B HA   1 
ATOM   3149  H HB1  . ALA A 1 196 ? -36.927 -3.837  -6.063  1.00 27.20  ? 533 ALA B HB1  1 
ATOM   3150  H HB2  . ALA A 1 196 ? -36.265 -2.421  -6.237  1.00 27.20  ? 533 ALA B HB2  1 
ATOM   3151  H HB3  . ALA A 1 196 ? -37.104 -2.744  -4.947  1.00 27.20  ? 533 ALA B HB3  1 
ATOM   3152  N N    . GLU A 1 197 ? -40.052 -2.760  -4.940  1.00 22.03  ? 534 GLU B N    1 
ATOM   3153  C CA   . GLU A 1 197 ? -41.189 -3.484  -4.379  1.00 20.93  ? 534 GLU B CA   1 
ATOM   3154  C C    . GLU A 1 197 ? -42.469 -3.189  -5.163  1.00 25.53  ? 534 GLU B C    1 
ATOM   3155  O O    . GLU A 1 197 ? -43.303 -4.066  -5.321  1.00 29.02  ? 534 GLU B O    1 
ATOM   3156  C CB   . GLU A 1 197 ? -41.385 -3.145  -2.900  1.00 30.75  ? 534 GLU B CB   1 
ATOM   3157  C CG   . GLU A 1 197 ? -40.229 -3.623  -2.042  1.00 36.79  ? 534 GLU B CG   1 
ATOM   3158  C CD   . GLU A 1 197 ? -40.291 -3.105  -0.625  1.00 40.78  ? 534 GLU B CD   1 
ATOM   3159  O OE1  . GLU A 1 197 ? -41.262 -2.399  -0.273  1.00 41.56  ? 534 GLU B OE1  1 
ATOM   3160  O OE2  . GLU A 1 197 ? -39.350 -3.400  0.130   1.00 31.46  ? 534 GLU B OE2  1 
ATOM   3161  H H    . GLU A 1 197 ? -39.773 -2.101  -4.464  1.00 26.44  ? 534 GLU B H    1 
ATOM   3162  H HA   . GLU A 1 197 ? -41.013 -4.445  -4.444  1.00 25.11  ? 534 GLU B HA   1 
ATOM   3163  H HB2  . GLU A 1 197 ? -41.456 -2.183  -2.801  1.00 36.90  ? 534 GLU B HB2  1 
ATOM   3164  H HB3  . GLU A 1 197 ? -42.194 -3.574  -2.580  1.00 36.90  ? 534 GLU B HB3  1 
ATOM   3165  H HG2  . GLU A 1 197 ? -40.242 -4.592  -2.007  1.00 44.15  ? 534 GLU B HG2  1 
ATOM   3166  H HG3  . GLU A 1 197 ? -39.397 -3.317  -2.436  1.00 44.15  ? 534 GLU B HG3  1 
ATOM   3167  N N    . ASP A 1 198 ? -42.617 -1.960  -5.645  1.00 29.38  ? 535 ASP B N    1 
ATOM   3168  C CA   . ASP A 1 198 ? -43.750 -1.621  -6.505  1.00 32.82  ? 535 ASP B CA   1 
ATOM   3169  C C    . ASP A 1 198 ? -43.713 -2.494  -7.760  1.00 28.58  ? 535 ASP B C    1 
ATOM   3170  O O    . ASP A 1 198 ? -44.720 -3.053  -8.171  1.00 30.98  ? 535 ASP B O    1 
ATOM   3171  C CB   . ASP A 1 198 ? -43.695 -0.153  -6.918  1.00 27.54  ? 535 ASP B CB   1 
ATOM   3172  C CG   . ASP A 1 198 ? -43.914 0.807   -5.752  1.00 35.53  ? 535 ASP B CG   1 
ATOM   3173  O OD1  . ASP A 1 198 ? -44.407 0.380   -4.685  1.00 33.67  ? 535 ASP B OD1  1 
ATOM   3174  O OD2  . ASP A 1 198 ? -43.594 2.003   -5.915  1.00 33.89  ? 535 ASP B OD2  1 
ATOM   3175  H H    . ASP A 1 198 ? -42.080 -1.306  -5.492  1.00 35.25  ? 535 ASP B H    1 
ATOM   3176  H HA   . ASP A 1 198 ? -44.591 -1.786  -6.029  1.00 39.38  ? 535 ASP B HA   1 
ATOM   3177  H HB2  . ASP A 1 198 ? -42.823 0.034   -7.299  1.00 33.05  ? 535 ASP B HB2  1 
ATOM   3178  H HB3  . ASP A 1 198 ? -44.387 0.015   -7.577  1.00 33.05  ? 535 ASP B HB3  1 
ATOM   3179  N N    . MET A 1 199 ? -42.539 -2.605  -8.370  1.00 29.30  ? 536 MET B N    1 
ATOM   3180  C CA   . MET A 1 199 ? -42.389 -3.404  -9.579  1.00 35.57  ? 536 MET B CA   1 
ATOM   3181  C C    . MET A 1 199 ? -42.674 -4.871  -9.311  1.00 35.79  ? 536 MET B C    1 
ATOM   3182  O O    . MET A 1 199 ? -43.090 -5.593  -10.210 1.00 31.41  ? 536 MET B O    1 
ATOM   3183  C CB   . MET A 1 199 ? -40.981 -3.272  -10.146 1.00 32.92  ? 536 MET B CB   1 
ATOM   3184  C CG   . MET A 1 199 ? -40.698 -1.949  -10.810 1.00 34.72  ? 536 MET B CG   1 
ATOM   3185  S SD   . MET A 1 199 ? -39.084 -1.959  -11.613 1.00 51.26  ? 536 MET B SD   1 
ATOM   3186  C CE   . MET A 1 199 ? -39.118 -3.592  -12.348 1.00 16.04  ? 536 MET B CE   1 
ATOM   3187  H H    . MET A 1 199 ? -41.814 -2.228  -8.104  1.00 35.16  ? 536 MET B H    1 
ATOM   3188  H HA   . MET A 1 199 ? -43.018 -3.077  -10.255 1.00 42.69  ? 536 MET B HA   1 
ATOM   3189  H HB2  . MET A 1 199 ? -40.344 -3.381  -9.423  1.00 39.50  ? 536 MET B HB2  1 
ATOM   3190  H HB3  . MET A 1 199 ? -40.847 -3.968  -10.808 1.00 39.50  ? 536 MET B HB3  1 
ATOM   3191  H HG2  . MET A 1 199 ? -41.373 -1.776  -11.485 1.00 41.66  ? 536 MET B HG2  1 
ATOM   3192  H HG3  . MET A 1 199 ? -40.702 -1.246  -10.142 1.00 41.66  ? 536 MET B HG3  1 
ATOM   3193  H HE1  . MET A 1 199 ? -38.296 -3.739  -12.822 1.00 19.24  ? 536 MET B HE1  1 
ATOM   3194  H HE2  . MET A 1 199 ? -39.217 -4.246  -11.652 1.00 19.24  ? 536 MET B HE2  1 
ATOM   3195  H HE3  . MET A 1 199 ? -39.860 -3.645  -12.955 1.00 19.24  ? 536 MET B HE3  1 
ATOM   3196  N N    . GLY A 1 200 ? -42.435 -5.313  -8.080  1.00 28.23  ? 537 GLY B N    1 
ATOM   3197  C CA   . GLY A 1 200 ? -42.666 -6.701  -7.717  1.00 43.22  ? 537 GLY B CA   1 
ATOM   3198  C C    . GLY A 1 200 ? -44.145 -7.034  -7.678  1.00 53.33  ? 537 GLY B C    1 
ATOM   3199  O O    . GLY A 1 200 ? -44.528 -8.178  -7.438  1.00 57.65  ? 537 GLY B O    1 
ATOM   3200  H H    . GLY A 1 200 ? -42.138 -4.825  -7.436  1.00 33.88  ? 537 GLY B H    1 
ATOM   3201  H HA2  . GLY A 1 200 ? -42.235 -7.281  -8.364  1.00 51.87  ? 537 GLY B HA2  1 
ATOM   3202  H HA3  . GLY A 1 200 ? -42.286 -6.876  -6.842  1.00 51.87  ? 537 GLY B HA3  1 
ATOM   3203  N N    . LYS A 1 201 ? -44.977 -6.021  -7.904  1.00 45.95  ? 538 LYS B N    1 
ATOM   3204  C CA   . LYS A 1 201 ? -46.426 -6.191  -7.939  1.00 43.18  ? 538 LYS B CA   1 
ATOM   3205  C C    . LYS A 1 201 ? -46.951 -6.083  -9.367  1.00 43.40  ? 538 LYS B C    1 
ATOM   3206  O O    . LYS A 1 201 ? -48.116 -6.364  -9.641  1.00 48.01  ? 538 LYS B O    1 
ATOM   3207  C CB   . LYS A 1 201 ? -47.095 -5.146  -7.048  1.00 43.01  ? 538 LYS B CB   1 
ATOM   3208  C CG   . LYS A 1 201 ? -46.592 -5.192  -5.606  1.00 55.31  ? 538 LYS B CG   1 
ATOM   3209  C CD   . LYS A 1 201 ? -47.344 -4.234  -4.702  1.00 61.10  ? 538 LYS B CD   1 
ATOM   3210  C CE   . LYS A 1 201 ? -46.820 -4.291  -3.271  1.00 65.90  ? 538 LYS B CE   1 
ATOM   3211  N NZ   . LYS A 1 201 ? -47.678 -3.522  -2.325  1.00 70.85  ? 538 LYS B NZ   1 
ATOM   3212  H H    . LYS A 1 201 ? -44.721 -5.212  -8.042  1.00 55.14  ? 538 LYS B H    1 
ATOM   3213  H HA   . LYS A 1 201 ? -46.656 -7.079  -7.595  1.00 51.81  ? 538 LYS B HA   1 
ATOM   3214  H HB2  . LYS A 1 201 ? -46.909 -4.262  -7.403  1.00 51.61  ? 538 LYS B HB2  1 
ATOM   3215  H HB3  . LYS A 1 201 ? -48.052 -5.305  -7.038  1.00 51.61  ? 538 LYS B HB3  1 
ATOM   3216  H HG2  . LYS A 1 201 ? -46.709 -6.090  -5.258  1.00 66.37  ? 538 LYS B HG2  1 
ATOM   3217  H HG3  . LYS A 1 201 ? -45.653 -4.948  -5.589  1.00 66.37  ? 538 LYS B HG3  1 
ATOM   3218  H HD2  . LYS A 1 201 ? -47.232 -3.328  -5.031  1.00 73.33  ? 538 LYS B HD2  1 
ATOM   3219  H HD3  . LYS A 1 201 ? -48.284 -4.474  -4.692  1.00 73.33  ? 538 LYS B HD3  1 
ATOM   3220  H HE2  . LYS A 1 201 ? -46.800 -5.215  -2.977  1.00 79.08  ? 538 LYS B HE2  1 
ATOM   3221  H HE3  . LYS A 1 201 ? -45.927 -3.913  -3.244  1.00 79.08  ? 538 LYS B HE3  1 
ATOM   3222  H HZ1  . LYS A 1 201 ? -47.346 -3.576  -1.501  1.00 85.02  ? 538 LYS B HZ1  1 
ATOM   3223  H HZ2  . LYS A 1 201 ? -47.709 -2.667  -2.570  1.00 85.02  ? 538 LYS B HZ2  1 
ATOM   3224  H HZ3  . LYS A 1 201 ? -48.504 -3.854  -2.327  1.00 85.02  ? 538 LYS B HZ3  1 
ATOM   3225  N N    . CYS A 1 202 ? -46.085 -5.672  -10.282 1.00 46.87  ? 539 CYS B N    1 
ATOM   3226  C CA   . CYS A 1 202 ? -46.453 -5.614  -11.684 1.00 47.94  ? 539 CYS B CA   1 
ATOM   3227  C C    . CYS A 1 202 ? -46.559 -7.022  -12.260 1.00 61.74  ? 539 CYS B C    1 
ATOM   3228  O O    . CYS A 1 202 ? -45.549 -7.692  -12.471 1.00 63.71  ? 539 CYS B O    1 
ATOM   3229  C CB   . CYS A 1 202 ? -45.427 -4.807  -12.470 1.00 27.63  ? 539 CYS B CB   1 
ATOM   3230  S SG   . CYS A 1 202 ? -45.863 -4.659  -14.218 1.00 47.45  ? 539 CYS B SG   1 
ATOM   3231  H H    . CYS A 1 202 ? -45.279 -5.422  -10.116 1.00 56.25  ? 539 CYS B H    1 
ATOM   3232  H HA   . CYS A 1 202 ? -47.325 -5.177  -11.774 1.00 57.53  ? 539 CYS B HA   1 
ATOM   3233  H HB2  . CYS A 1 202 ? -45.373 -3.913  -12.096 1.00 33.16  ? 539 CYS B HB2  1 
ATOM   3234  H HB3  . CYS A 1 202 ? -44.565 -5.246  -12.410 1.00 33.16  ? 539 CYS B HB3  1 
ATOM   3235  H HG   . CYS A 1 202 ? -45.019 -4.015  -14.777 1.00 56.94  ? 539 CYS B HG   1 
ATOM   3236  N N    . HIS A 1 203 ? -47.789 -7.461  -12.516 1.00 61.61  ? 540 HIS B N    1 
ATOM   3237  C CA   . HIS A 1 203 ? -48.049 -8.819  -12.989 1.00 65.48  ? 540 HIS B CA   1 
ATOM   3238  C C    . HIS A 1 203 ? -47.389 -9.095  -14.334 1.00 60.67  ? 540 HIS B C    1 
ATOM   3239  O O    . HIS A 1 203 ? -46.930 -10.208 -14.599 1.00 56.32  ? 540 HIS B O    1 
ATOM   3240  C CB   . HIS A 1 203 ? -49.556 -9.053  -13.111 1.00 75.10  ? 540 HIS B CB   1 
ATOM   3241  C CG   . HIS A 1 203 ? -50.295 -8.936  -11.814 1.00 79.40  ? 540 HIS B CG   1 
ATOM   3242  N ND1  . HIS A 1 203 ? -50.185 -9.873  -10.808 1.00 85.57  ? 540 HIS B ND1  1 
ATOM   3243  C CD2  . HIS A 1 203 ? -51.158 -7.997  -11.361 1.00 76.80  ? 540 HIS B CD2  1 
ATOM   3244  C CE1  . HIS A 1 203 ? -50.946 -9.513  -9.790  1.00 86.02  ? 540 HIS B CE1  1 
ATOM   3245  N NE2  . HIS A 1 203 ? -51.548 -8.379  -10.100 1.00 85.06  ? 540 HIS B NE2  1 
ATOM   3246  H H    . HIS A 1 203 ? -48.499 -6.985  -12.422 1.00 73.93  ? 540 HIS B H    1 
ATOM   3247  H HA   . HIS A 1 203 ? -47.693 -9.458  -12.338 1.00 78.57  ? 540 HIS B HA   1 
ATOM   3248  H HB2  . HIS A 1 203 ? -49.926 -8.398  -13.722 1.00 90.12  ? 540 HIS B HB2  1 
ATOM   3249  H HB3  . HIS A 1 203 ? -49.706 -9.947  -13.457 1.00 90.12  ? 540 HIS B HB3  1 
ATOM   3250  H HD2  . HIS A 1 203 ? -51.435 -7.235  -11.817 1.00 92.16  ? 540 HIS B HD2  1 
ATOM   3251  H HE1  . HIS A 1 203 ? -51.043 -9.980  -8.992  1.00 103.22 ? 540 HIS B HE1  1 
ATOM   3252  N N    . LEU A 1 204 ? -47.338 -8.073  -15.180 1.00 55.61  ? 541 LEU B N    1 
ATOM   3253  C CA   . LEU A 1 204 ? -46.858 -8.232  -16.547 1.00 63.79  ? 541 LEU B CA   1 
ATOM   3254  C C    . LEU A 1 204 ? -45.408 -8.719  -16.625 1.00 62.17  ? 541 LEU B C    1 
ATOM   3255  O O    . LEU A 1 204 ? -45.060 -9.501  -17.513 1.00 66.98  ? 541 LEU B O    1 
ATOM   3256  C CB   . LEU A 1 204 ? -46.998 -6.908  -17.303 1.00 67.50  ? 541 LEU B CB   1 
ATOM   3257  C CG   . LEU A 1 204 ? -46.663 -6.966  -18.792 1.00 75.74  ? 541 LEU B CG   1 
ATOM   3258  C CD1  . LEU A 1 204 ? -47.678 -7.825  -19.534 1.00 85.31  ? 541 LEU B CD1  1 
ATOM   3259  C CD2  . LEU A 1 204 ? -46.609 -5.564  -19.379 1.00 77.49  ? 541 LEU B CD2  1 
ATOM   3260  H H    . LEU A 1 204 ? -47.578 -7.271  -14.984 1.00 66.73  ? 541 LEU B H    1 
ATOM   3261  H HA   . LEU A 1 204 ? -47.418 -8.895  -17.001 1.00 76.54  ? 541 LEU B HA   1 
ATOM   3262  H HB2  . LEU A 1 204 ? -47.915 -6.604  -17.223 1.00 81.00  ? 541 LEU B HB2  1 
ATOM   3263  H HB3  . LEU A 1 204 ? -46.404 -6.258  -16.897 1.00 81.00  ? 541 LEU B HB3  1 
ATOM   3264  H HG   . LEU A 1 204 ? -45.789 -7.372  -18.904 1.00 90.89  ? 541 LEU B HG   1 
ATOM   3265  H HD11 . LEU A 1 204 ? -47.447 -7.846  -20.466 1.00 102.37 ? 541 LEU B HD11 1 
ATOM   3266  H HD12 . LEU A 1 204 ? -47.659 -8.713  -19.171 1.00 102.37 ? 541 LEU B HD12 1 
ATOM   3267  H HD13 . LEU A 1 204 ? -48.551 -7.443  -19.421 1.00 102.37 ? 541 LEU B HD13 1 
ATOM   3268  H HD21 . LEU A 1 204 ? -46.397 -5.625  -20.314 1.00 92.99  ? 541 LEU B HD21 1 
ATOM   3269  H HD22 . LEU A 1 204 ? -47.464 -5.144  -19.263 1.00 92.99  ? 541 LEU B HD22 1 
ATOM   3270  H HD23 . LEU A 1 204 ? -45.931 -5.060  -18.922 1.00 92.99  ? 541 LEU B HD23 1 
ATOM   3271  N N    . THR A 1 205 ? -44.569 -8.267  -15.695 1.00 46.88  ? 542 THR B N    1 
ATOM   3272  C CA   . THR A 1 205 ? -43.130 -8.471  -15.816 1.00 53.20  ? 542 THR B CA   1 
ATOM   3273  C C    . THR A 1 205 ? -42.539 -9.450  -14.801 1.00 60.09  ? 542 THR B C    1 
ATOM   3274  O O    . THR A 1 205 ? -41.366 -9.792  -14.892 1.00 54.55  ? 542 THR B O    1 
ATOM   3275  C CB   . THR A 1 205 ? -42.372 -7.131  -15.705 1.00 53.57  ? 542 THR B CB   1 
ATOM   3276  O OG1  . THR A 1 205 ? -42.789 -6.436  -14.522 1.00 51.77  ? 542 THR B OG1  1 
ATOM   3277  C CG2  . THR A 1 205 ? -42.645 -6.266  -16.926 1.00 58.37  ? 542 THR B CG2  1 
ATOM   3278  H H    . THR A 1 205 ? -44.808 -7.840  -14.988 1.00 56.25  ? 542 THR B H    1 
ATOM   3279  H HA   . THR A 1 205 ? -42.948 -8.834  -16.708 1.00 63.84  ? 542 THR B HA   1 
ATOM   3280  H HB   . THR A 1 205 ? -41.419 -7.303  -15.658 1.00 64.28  ? 542 THR B HB   1 
ATOM   3281  H HG1  . THR A 1 205 ? -43.594 -6.286  -14.554 1.00 62.13  ? 542 THR B HG1  1 
ATOM   3282  H HG21 . THR A 1 205 ? -42.171 -5.434  -16.851 1.00 70.04  ? 542 THR B HG21 1 
ATOM   3283  H HG22 . THR A 1 205 ? -42.355 -6.720  -17.721 1.00 70.04  ? 542 THR B HG22 1 
ATOM   3284  H HG23 . THR A 1 205 ? -43.585 -6.084  -16.996 1.00 70.04  ? 542 THR B HG23 1 
ATOM   3285  N N    . LYS A 1 206 ? -43.343 -9.907  -13.846 1.00 57.23  ? 543 LYS B N    1 
ATOM   3286  C CA   . LYS A 1 206 ? -42.859 -10.857 -12.844 1.00 60.95  ? 543 LYS B CA   1 
ATOM   3287  C C    . LYS A 1 206 ? -42.152 -12.044 -13.503 1.00 56.66  ? 543 LYS B C    1 
ATOM   3288  O O    . LYS A 1 206 ? -42.662 -12.641 -14.450 1.00 52.62  ? 543 LYS B O    1 
ATOM   3289  C CB   . LYS A 1 206 ? -44.012 -11.341 -11.960 1.00 61.36  ? 543 LYS B CB   1 
ATOM   3290  C CG   . LYS A 1 206 ? -44.718 -10.211 -11.228 1.00 67.51  ? 543 LYS B CG   1 
ATOM   3291  C CD   . LYS A 1 206 ? -45.929 -10.687 -10.438 1.00 77.14  ? 543 LYS B CD   1 
ATOM   3292  C CE   . LYS A 1 206 ? -45.529 -11.375 -9.142  1.00 82.08  ? 543 LYS B CE   1 
ATOM   3293  N NZ   . LYS A 1 206 ? -46.715 -11.675 -8.292  1.00 87.42  ? 543 LYS B NZ   1 
ATOM   3294  H H    . LYS A 1 206 ? -44.169 -9.685  -13.754 1.00 68.67  ? 543 LYS B H    1 
ATOM   3295  H HA   . LYS A 1 206 ? -42.209 -10.404 -12.267 1.00 73.14  ? 543 LYS B HA   1 
ATOM   3296  H HB2  . LYS A 1 206 ? -44.666 -11.792 -12.515 1.00 73.63  ? 543 LYS B HB2  1 
ATOM   3297  H HB3  . LYS A 1 206 ? -43.662 -11.955 -11.295 1.00 73.63  ? 543 LYS B HB3  1 
ATOM   3298  H HG2  . LYS A 1 206 ? -44.097 -9.800  -10.607 1.00 81.01  ? 543 LYS B HG2  1 
ATOM   3299  H HG3  . LYS A 1 206 ? -45.021 -9.556  -11.876 1.00 81.01  ? 543 LYS B HG3  1 
ATOM   3300  H HD2  . LYS A 1 206 ? -46.485 -9.924  -10.216 1.00 92.57  ? 543 LYS B HD2  1 
ATOM   3301  H HD3  . LYS A 1 206 ? -46.431 -11.321 -10.974 1.00 92.57  ? 543 LYS B HD3  1 
ATOM   3302  H HE2  . LYS A 1 206 ? -45.084 -12.212 -9.349  1.00 98.50  ? 543 LYS B HE2  1 
ATOM   3303  H HE3  . LYS A 1 206 ? -44.935 -10.794 -8.642  1.00 98.50  ? 543 LYS B HE3  1 
ATOM   3304  H HZ1  . LYS A 1 206 ? -46.456 -12.077 -7.541  1.00 104.91 ? 543 LYS B HZ1  1 
ATOM   3305  H HZ2  . LYS A 1 206 ? -47.139 -10.921 -8.085  1.00 104.91 ? 543 LYS B HZ2  1 
ATOM   3306  H HZ3  . LYS A 1 206 ? -47.274 -12.211 -8.729  1.00 104.91 ? 543 LYS B HZ3  1 
ATOM   3307  N N    . GLY A 1 207 ? -40.965 -12.368 -13.003 1.00 63.58  ? 544 GLY B N    1 
ATOM   3308  C CA   . GLY A 1 207 ? -40.182 -13.464 -13.538 1.00 60.82  ? 544 GLY B CA   1 
ATOM   3309  C C    . GLY A 1 207 ? -39.376 -13.090 -14.768 1.00 54.96  ? 544 GLY B C    1 
ATOM   3310  O O    . GLY A 1 207 ? -38.683 -13.934 -15.334 1.00 50.04  ? 544 GLY B O    1 
ATOM   3311  H H    . GLY A 1 207 ? -40.590 -11.960 -12.345 1.00 76.30  ? 544 GLY B H    1 
ATOM   3312  H HA2  . GLY A 1 207 ? -39.568 -13.781 -12.857 1.00 72.98  ? 544 GLY B HA2  1 
ATOM   3313  H HA3  . GLY A 1 207 ? -40.776 -14.194 -13.775 1.00 72.98  ? 544 GLY B HA3  1 
ATOM   3314  N N    . LYS A 1 208 ? -39.454 -11.826 -15.182 1.00 47.22  ? 545 LYS B N    1 
ATOM   3315  C CA   . LYS A 1 208 ? -38.773 -11.379 -16.394 1.00 47.08  ? 545 LYS B CA   1 
ATOM   3316  C C    . LYS A 1 208 ? -38.030 -10.059 -16.177 1.00 41.10  ? 545 LYS B C    1 
ATOM   3317  O O    . LYS A 1 208 ? -36.949 -9.856  -16.733 1.00 36.13  ? 545 LYS B O    1 
ATOM   3318  C CB   . LYS A 1 208 ? -39.769 -11.230 -17.553 1.00 58.66  ? 545 LYS B CB   1 
ATOM   3319  C CG   . LYS A 1 208 ? -40.550 -12.500 -17.872 1.00 72.83  ? 545 LYS B CG   1 
ATOM   3320  C CD   . LYS A 1 208 ? -41.294 -12.398 -19.199 1.00 83.70  ? 545 LYS B CD   1 
ATOM   3321  C CE   . LYS A 1 208 ? -42.271 -11.232 -19.218 1.00 86.90  ? 545 LYS B CE   1 
ATOM   3322  N NZ   . LYS A 1 208 ? -43.194 -11.295 -20.388 1.00 86.14  ? 545 LYS B NZ   1 
ATOM   3323  H H    . LYS A 1 208 ? -39.896 -11.209 -14.778 1.00 56.67  ? 545 LYS B H    1 
ATOM   3324  H HA   . LYS A 1 208 ? -38.112 -12.055 -16.652 1.00 56.49  ? 545 LYS B HA   1 
ATOM   3325  H HB2  . LYS A 1 208 ? -40.410 -10.538 -17.326 1.00 70.39  ? 545 LYS B HB2  1 
ATOM   3326  H HB3  . LYS A 1 208 ? -39.281 -10.975 -18.352 1.00 70.39  ? 545 LYS B HB3  1 
ATOM   3327  H HG2  . LYS A 1 208 ? -39.933 -13.246 -17.928 1.00 87.40  ? 545 LYS B HG2  1 
ATOM   3328  H HG3  . LYS A 1 208 ? -41.202 -12.657 -17.172 1.00 87.40  ? 545 LYS B HG3  1 
ATOM   3329  H HD2  . LYS A 1 208 ? -40.653 -12.267 -19.915 1.00 100.45 ? 545 LYS B HD2  1 
ATOM   3330  H HD3  . LYS A 1 208 ? -41.796 -13.215 -19.346 1.00 100.45 ? 545 LYS B HD3  1 
ATOM   3331  H HE2  . LYS A 1 208 ? -42.806 -11.252 -18.409 1.00 104.28 ? 545 LYS B HE2  1 
ATOM   3332  H HE3  . LYS A 1 208 ? -41.774 -10.401 -19.270 1.00 104.28 ? 545 LYS B HE3  1 
ATOM   3333  H HZ1  . LYS A 1 208 ? -43.752 -10.602 -20.373 1.00 103.36 ? 545 LYS B HZ1  1 
ATOM   3334  H HZ2  . LYS A 1 208 ? -42.727 -11.273 -21.145 1.00 103.36 ? 545 LYS B HZ2  1 
ATOM   3335  H HZ3  . LYS A 1 208 ? -43.667 -12.048 -20.362 1.00 103.36 ? 545 LYS B HZ3  1 
ATOM   3336  N N    . GLN A 1 209 ? -38.613 -9.167  -15.378 1.00 33.38  ? 546 GLN B N    1 
ATOM   3337  C CA   . GLN A 1 209 ? -37.975 -7.906  -15.042 1.00 35.28  ? 546 GLN B CA   1 
ATOM   3338  C C    . GLN A 1 209 ? -38.146 -7.528  -13.573 1.00 27.99  ? 546 GLN B C    1 
ATOM   3339  O O    . GLN A 1 209 ? -39.256 -7.413  -13.056 1.00 31.66  ? 546 GLN B O    1 
ATOM   3340  C CB   . GLN A 1 209 ? -38.521 -6.772  -15.909 1.00 30.61  ? 546 GLN B CB   1 
ATOM   3341  C CG   . GLN A 1 209 ? -38.040 -5.411  -15.454 1.00 21.51  ? 546 GLN B CG   1 
ATOM   3342  C CD   . GLN A 1 209 ? -38.421 -4.298  -16.429 1.00 27.62  ? 546 GLN B CD   1 
ATOM   3343  O OE1  . GLN A 1 209 ? -39.198 -4.511  -17.368 1.00 26.38  ? 546 GLN B OE1  1 
ATOM   3344  N NE2  . GLN A 1 209 ? -37.873 -3.112  -16.211 1.00 26.43  ? 546 GLN B NE2  1 
ATOM   3345  H H    . GLN A 1 209 ? -39.385 -9.274  -15.015 1.00 40.05  ? 546 GLN B H    1 
ATOM   3346  H HA   . GLN A 1 209 ? -37.014 -7.983  -15.221 1.00 42.34  ? 546 GLN B HA   1 
ATOM   3347  H HB2  . GLN A 1 209 ? -38.228 -6.904  -16.825 1.00 36.73  ? 546 GLN B HB2  1 
ATOM   3348  H HB3  . GLN A 1 209 ? -39.490 -6.779  -15.866 1.00 36.73  ? 546 GLN B HB3  1 
ATOM   3349  H HG2  . GLN A 1 209 ? -38.439 -5.206  -14.594 1.00 25.81  ? 546 GLN B HG2  1 
ATOM   3350  H HG3  . GLN A 1 209 ? -37.074 -5.425  -15.378 1.00 25.81  ? 546 GLN B HG3  1 
ATOM   3351  H HE21 . GLN A 1 209 ? -37.335 -3.002  -15.549 1.00 31.71  ? 546 GLN B HE21 1 
ATOM   3352  H HE22 . GLN A 1 209 ? -38.054 -2.452  -16.732 1.00 31.71  ? 546 GLN B HE22 1 
ATOM   3353  N N    . ALA A 1 210 ? -37.025 -7.319  -12.910 1.00 27.51  ? 547 ALA B N    1 
ATOM   3354  C CA   . ALA A 1 210 ? -37.040 -6.826  -11.550 1.00 25.87  ? 547 ALA B CA   1 
ATOM   3355  C C    . ALA A 1 210 ? -35.906 -5.842  -11.460 1.00 27.09  ? 547 ALA B C    1 
ATOM   3356  O O    . ALA A 1 210 ? -34.854 -6.040  -12.067 1.00 25.21  ? 547 ALA B O    1 
ATOM   3357  C CB   . ALA A 1 210 ? -36.856 -7.964  -10.551 1.00 30.32  ? 547 ALA B CB   1 
ATOM   3358  H H    . ALA A 1 210 ? -36.238 -7.456  -13.228 1.00 33.01  ? 547 ALA B H    1 
ATOM   3359  H HA   . ALA A 1 210 ? -37.885 -6.365  -11.364 1.00 31.04  ? 547 ALA B HA   1 
ATOM   3360  H HB1  . ALA A 1 210 ? -36.871 -7.603  -9.661  1.00 36.38  ? 547 ALA B HB1  1 
ATOM   3361  H HB2  . ALA A 1 210 ? -37.571 -8.595  -10.661 1.00 36.38  ? 547 ALA B HB2  1 
ATOM   3362  H HB3  . ALA A 1 210 ? -36.013 -8.391  -10.717 1.00 36.38  ? 547 ALA B HB3  1 
ATOM   3363  N N    . LEU A 1 211 ? -36.138 -4.766  -10.723 1.00 18.87  ? 548 LEU B N    1 
ATOM   3364  C CA   . LEU A 1 211 ? -35.126 -3.753  -10.497 1.00 17.27  ? 548 LEU B CA   1 
ATOM   3365  C C    . LEU A 1 211 ? -33.929 -4.384  -9.789  1.00 25.17  ? 548 LEU B C    1 
ATOM   3366  O O    . LEU A 1 211 ? -34.104 -5.268  -8.960  1.00 26.66  ? 548 LEU B O    1 
ATOM   3367  C CB   . LEU A 1 211 ? -35.716 -2.663  -9.607  1.00 26.29  ? 548 LEU B CB   1 
ATOM   3368  C CG   . LEU A 1 211 ? -35.193 -1.251  -9.845  1.00 39.53  ? 548 LEU B CG   1 
ATOM   3369  C CD1  . LEU A 1 211 ? -36.202 -0.226  -9.355  1.00 45.79  ? 548 LEU B CD1  1 
ATOM   3370  C CD2  . LEU A 1 211 ? -33.862 -1.078  -9.153  1.00 43.19  ? 548 LEU B CD2  1 
ATOM   3371  H H    . LEU A 1 211 ? -36.888 -4.599  -10.337 1.00 22.64  ? 548 LEU B H    1 
ATOM   3372  H HA   . LEU A 1 211 ? -34.836 -3.361  -11.347 1.00 20.73  ? 548 LEU B HA   1 
ATOM   3373  H HB2  . LEU A 1 211 ? -36.676 -2.643  -9.744  1.00 31.55  ? 548 LEU B HB2  1 
ATOM   3374  H HB3  . LEU A 1 211 ? -35.527 -2.889  -8.682  1.00 31.55  ? 548 LEU B HB3  1 
ATOM   3375  H HG   . LEU A 1 211 ? -35.061 -1.116  -10.796 1.00 47.44  ? 548 LEU B HG   1 
ATOM   3376  H HD11 . LEU A 1 211 ? -35.855 0.654   -9.514  1.00 54.95  ? 548 LEU B HD11 1 
ATOM   3377  H HD12 . LEU A 1 211 ? -37.025 -0.345  -9.835  1.00 54.95  ? 548 LEU B HD12 1 
ATOM   3378  H HD13 . LEU A 1 211 ? -36.349 -0.356  -8.416  1.00 54.95  ? 548 LEU B HD13 1 
ATOM   3379  H HD21 . LEU A 1 211 ? -33.543 -0.186  -9.309  1.00 51.83  ? 548 LEU B HD21 1 
ATOM   3380  H HD22 . LEU A 1 211 ? -33.978 -1.224  -8.211  1.00 51.83  ? 548 LEU B HD22 1 
ATOM   3381  H HD23 . LEU A 1 211 ? -33.240 -1.716  -9.509  1.00 51.83  ? 548 LEU B HD23 1 
ATOM   3382  N N    . GLU A 1 212 ? -32.722 -3.968  -10.160 1.00 22.88  ? 549 GLU B N    1 
ATOM   3383  C CA   . GLU A 1 212 ? -31.545 -4.254  -9.354  1.00 31.79  ? 549 GLU B CA   1 
ATOM   3384  C C    . GLU A 1 212 ? -30.982 -2.952  -8.845  1.00 26.25  ? 549 GLU B C    1 
ATOM   3385  O O    . GLU A 1 212 ? -30.859 -1.994  -9.601  1.00 24.00  ? 549 GLU B O    1 
ATOM   3386  C CB   . GLU A 1 212 ? -30.432 -5.007  -10.111 1.00 20.00  ? 549 GLU B CB   1 
ATOM   3387  C CG   . GLU A 1 212 ? -29.210 -5.166  -9.169  1.00 27.71  ? 549 GLU B CG   1 
ATOM   3388  C CD   . GLU A 1 212 ? -28.071 -6.003  -9.724  1.00 30.19  ? 549 GLU B CD   1 
ATOM   3389  O OE1  . GLU A 1 212 ? -28.045 -6.284  -10.927 1.00 27.19  ? 549 GLU B OE1  1 
ATOM   3390  O OE2  . GLU A 1 212 ? -27.185 -6.374  -8.936  1.00 33.82  ? 549 GLU B OE2  1 
ATOM   3391  H H    . GLU A 1 212 ? -32.559 -3.517  -10.874 1.00 27.45  ? 549 GLU B H    1 
ATOM   3392  H HA   . GLU A 1 212 ? -31.808 -4.797  -8.581  1.00 38.14  ? 549 GLU B HA   1 
ATOM   3393  H HB2  . GLU A 1 212 ? -30.747 -5.888  -10.367 1.00 24.00  ? 549 GLU B HB2  1 
ATOM   3394  H HB3  . GLU A 1 212 ? -30.162 -4.497  -10.891 1.00 24.00  ? 549 GLU B HB3  1 
ATOM   3395  H HG2  . GLU A 1 212 ? -28.855 -4.285  -8.972  1.00 33.26  ? 549 GLU B HG2  1 
ATOM   3396  H HG3  . GLU A 1 212 ? -29.507 -5.587  -8.347  1.00 33.26  ? 549 GLU B HG3  1 
ATOM   3397  N N    . ILE A 1 213 ? -30.637 -2.917  -7.560  1.00 17.90  ? 550 ILE B N    1 
ATOM   3398  C CA   . ILE A 1 213 ? -30.023 -1.740  -6.956  1.00 18.22  ? 550 ILE B CA   1 
ATOM   3399  C C    . ILE A 1 213 ? -28.609 -2.120  -6.556  1.00 22.22  ? 550 ILE B C    1 
ATOM   3400  O O    . ILE A 1 213 ? -28.398 -3.196  -6.002  1.00 20.05  ? 550 ILE B O    1 
ATOM   3401  C CB   . ILE A 1 213 ? -30.816 -1.296  -5.714  1.00 26.46  ? 550 ILE B CB   1 
ATOM   3402  C CG1  . ILE A 1 213 ? -32.209 -0.818  -6.137  1.00 33.61  ? 550 ILE B CG1  1 
ATOM   3403  C CG2  . ILE A 1 213 ? -30.072 -0.222  -4.931  1.00 24.55  ? 550 ILE B CG2  1 
ATOM   3404  C CD1  . ILE A 1 213 ? -33.230 -0.844  -5.019  1.00 37.61  ? 550 ILE B CD1  1 
ATOM   3405  H H    . ILE A 1 213 ? -30.750 -3.569  -7.011  1.00 21.48  ? 550 ILE B H    1 
ATOM   3406  H HA   . ILE A 1 213 ? -29.990 -1.003  -7.601  1.00 21.86  ? 550 ILE B HA   1 
ATOM   3407  H HB   . ILE A 1 213 ? -30.926 -2.067  -5.136  1.00 31.75  ? 550 ILE B HB   1 
ATOM   3408  H HG12 . ILE A 1 213 ? -32.143 0.095   -6.456  1.00 40.34  ? 550 ILE B HG12 1 
ATOM   3409  H HG13 . ILE A 1 213 ? -32.534 -1.393  -6.848  1.00 40.34  ? 550 ILE B HG13 1 
ATOM   3410  H HG21 . ILE A 1 213 ? -30.597 0.027   -4.167  1.00 29.46  ? 550 ILE B HG21 1 
ATOM   3411  H HG22 . ILE A 1 213 ? -29.225 -0.575  -4.646  1.00 29.46  ? 550 ILE B HG22 1 
ATOM   3412  H HG23 . ILE A 1 213 ? -29.935 0.540   -5.498  1.00 29.46  ? 550 ILE B HG23 1 
ATOM   3413  H HD11 . ILE A 1 213 ? -34.072 -0.534  -5.359  1.00 45.13  ? 550 ILE B HD11 1 
ATOM   3414  H HD12 . ILE A 1 213 ? -33.318 -1.745  -4.698  1.00 45.13  ? 550 ILE B HD12 1 
ATOM   3415  H HD13 . ILE A 1 213 ? -32.931 -0.271  -4.310  1.00 45.13  ? 550 ILE B HD13 1 
ATOM   3416  N N    . ARG A 1 214 ? -27.637 -1.276  -6.888  1.00 21.26  ? 551 ARG B N    1 
ATOM   3417  C CA   . ARG A 1 214 ? -26.277 -1.439  -6.385  1.00 19.07  ? 551 ARG B CA   1 
ATOM   3418  C C    . ARG A 1 214 ? -25.854 -0.136  -5.768  1.00 24.04  ? 551 ARG B C    1 
ATOM   3419  O O    . ARG A 1 214 ? -25.973 0.916   -6.401  1.00 27.63  ? 551 ARG B O    1 
ATOM   3420  C CB   . ARG A 1 214 ? -25.301 -1.794  -7.502  1.00 19.36  ? 551 ARG B CB   1 
ATOM   3421  C CG   . ARG A 1 214 ? -25.682 -3.032  -8.289  1.00 28.32  ? 551 ARG B CG   1 
ATOM   3422  C CD   . ARG A 1 214 ? -24.571 -3.444  -9.253  1.00 28.31  ? 551 ARG B CD   1 
ATOM   3423  N NE   . ARG A 1 214 ? -24.896 -4.697  -9.935  1.00 32.04  ? 551 ARG B NE   1 
ATOM   3424  C CZ   . ARG A 1 214 ? -24.117 -5.279  -10.840 1.00 27.77  ? 551 ARG B CZ   1 
ATOM   3425  N NH1  . ARG A 1 214 ? -22.958 -4.725  -11.171 1.00 30.15  ? 551 ARG B NH1  1 
ATOM   3426  N NH2  . ARG A 1 214 ? -24.499 -6.414  -11.413 1.00 30.56  ? 551 ARG B NH2  1 
ATOM   3427  H H    . ARG A 1 214 ? -27.740 -0.598  -7.406  1.00 25.51  ? 551 ARG B H    1 
ATOM   3428  H HA   . ARG A 1 214 ? -26.252 -2.141  -5.701  1.00 22.88  ? 551 ARG B HA   1 
ATOM   3429  H HB2  . ARG A 1 214 ? -25.257 -1.051  -8.124  1.00 23.23  ? 551 ARG B HB2  1 
ATOM   3430  H HB3  . ARG A 1 214 ? -24.426 -1.949  -7.114  1.00 23.23  ? 551 ARG B HB3  1 
ATOM   3431  H HG2  . ARG A 1 214 ? -25.839 -3.766  -7.675  1.00 33.99  ? 551 ARG B HG2  1 
ATOM   3432  H HG3  . ARG A 1 214 ? -26.482 -2.850  -8.807  1.00 33.99  ? 551 ARG B HG3  1 
ATOM   3433  H HD2  . ARG A 1 214 ? -24.456 -2.752  -9.924  1.00 33.97  ? 551 ARG B HD2  1 
ATOM   3434  H HD3  . ARG A 1 214 ? -23.747 -3.571  -8.757  1.00 33.97  ? 551 ARG B HD3  1 
ATOM   3435  H HE   . ARG A 1 214 ? -25.639 -5.081  -9.737  1.00 38.45  ? 551 ARG B HE   1 
ATOM   3436  H HH11 . ARG A 1 214 ? -22.712 -3.988  -10.801 1.00 36.19  ? 551 ARG B HH11 1 
ATOM   3437  H HH12 . ARG A 1 214 ? -22.452 -5.101  -11.756 1.00 36.19  ? 551 ARG B HH12 1 
ATOM   3438  H HH21 . ARG A 1 214 ? -25.250 -6.774  -11.196 1.00 36.67  ? 551 ARG B HH21 1 
ATOM   3439  H HH22 . ARG A 1 214 ? -23.993 -6.793  -11.996 1.00 36.67  ? 551 ARG B HH22 1 
ATOM   3440  N N    . SER A 1 215 ? -25.346 -0.172  -4.542  1.00 14.20  ? 552 SER B N    1 
ATOM   3441  C CA   . SER A 1 215 ? -24.987 1.080   -3.899  1.00 18.59  ? 552 SER B CA   1 
ATOM   3442  C C    . SER A 1 215 ? -23.819 0.925   -2.956  1.00 22.01  ? 552 SER B C    1 
ATOM   3443  O O    . SER A 1 215 ? -23.733 -0.056  -2.230  1.00 22.21  ? 552 SER B O    1 
ATOM   3444  C CB   . SER A 1 215 ? -26.173 1.634   -3.117  1.00 20.32  ? 552 SER B CB   1 
ATOM   3445  O OG   . SER A 1 215 ? -25.759 2.724   -2.298  1.00 23.22  ? 552 SER B OG   1 
ATOM   3446  H H    . SER A 1 215 ? -25.204 -0.882  -4.077  1.00 17.03  ? 552 SER B H    1 
ATOM   3447  H HA   . SER A 1 215 ? -24.741 1.734   -4.585  1.00 22.31  ? 552 SER B HA   1 
ATOM   3448  H HB2  . SER A 1 215 ? -26.848 1.945   -3.742  1.00 24.38  ? 552 SER B HB2  1 
ATOM   3449  H HB3  . SER A 1 215 ? -26.538 0.934   -2.554  1.00 24.38  ? 552 SER B HB3  1 
ATOM   3450  H HG   . SER A 1 215 ? -26.400 3.019   -1.879  1.00 27.86  ? 552 SER B HG   1 
ATOM   3451  N N    . SER A 1 216 ? -22.931 1.910   -2.985  1.00 18.16  ? 553 SER B N    1 
ATOM   3452  C CA   . SER A 1 216 ? -21.938 2.092   -1.942  1.00 24.58  ? 553 SER B CA   1 
ATOM   3453  C C    . SER A 1 216 ? -22.117 3.453   -1.252  1.00 28.10  ? 553 SER B C    1 
ATOM   3454  O O    . SER A 1 216 ? -21.218 3.921   -0.547  1.00 27.96  ? 553 SER B O    1 
ATOM   3455  C CB   . SER A 1 216 ? -20.536 1.994   -2.547  1.00 26.55  ? 553 SER B CB   1 
ATOM   3456  O OG   . SER A 1 216 ? -20.360 2.976   -3.554  1.00 26.13  ? 553 SER B OG   1 
ATOM   3457  H H    . SER A 1 216 ? -22.884 2.497   -3.612  1.00 21.79  ? 553 SER B H    1 
ATOM   3458  H HA   . SER A 1 216 ? -22.036 1.387   -1.269  1.00 29.50  ? 553 SER B HA   1 
ATOM   3459  H HB2  . SER A 1 216 ? -19.878 2.135   -1.848  1.00 31.86  ? 553 SER B HB2  1 
ATOM   3460  H HB3  . SER A 1 216 ? -20.421 1.114   -2.939  1.00 31.86  ? 553 SER B HB3  1 
ATOM   3461  H HG   . SER A 1 216 ? -19.607 2.918   -3.874  1.00 31.36  ? 553 SER B HG   1 
ATOM   3462  N N    . LEU A 1 217 ? -23.267 4.096   -1.463  1.00 30.23  ? 554 LEU B N    1 
ATOM   3463  C CA   . LEU A 1 217 ? -23.541 5.400   -0.851  1.00 28.93  ? 554 LEU B CA   1 
ATOM   3464  C C    . LEU A 1 217 ? -23.632 5.305   0.681   1.00 30.23  ? 554 LEU B C    1 
ATOM   3465  O O    . LEU A 1 217 ? -24.575 4.725   1.218   1.00 25.47  ? 554 LEU B O    1 
ATOM   3466  C CB   . LEU A 1 217 ? -24.843 5.989   -1.406  1.00 21.83  ? 554 LEU B CB   1 
ATOM   3467  C CG   . LEU A 1 217 ? -25.293 7.317   -0.783  1.00 26.29  ? 554 LEU B CG   1 
ATOM   3468  C CD1  . LEU A 1 217 ? -24.246 8.406   -0.980  1.00 23.81  ? 554 LEU B CD1  1 
ATOM   3469  C CD2  . LEU A 1 217 ? -26.631 7.766   -1.381  1.00 23.16  ? 554 LEU B CD2  1 
ATOM   3470  H H    . LEU A 1 217 ? -23.906 3.800   -1.957  1.00 36.28  ? 554 LEU B H    1 
ATOM   3471  H HA   . LEU A 1 217 ? -22.811 6.016   -1.073  1.00 34.71  ? 554 LEU B HA   1 
ATOM   3472  H HB2  . LEU A 1 217 ? -24.730 6.139   -2.357  1.00 26.19  ? 554 LEU B HB2  1 
ATOM   3473  H HB3  . LEU A 1 217 ? -25.555 5.346   -1.262  1.00 26.19  ? 554 LEU B HB3  1 
ATOM   3474  H HG   . LEU A 1 217 ? -25.418 7.191   0.170   1.00 31.55  ? 554 LEU B HG   1 
ATOM   3475  H HD11 . LEU A 1 217 ? -24.563 9.219   -0.578  1.00 28.57  ? 554 LEU B HD11 1 
ATOM   3476  H HD12 . LEU A 1 217 ? -23.427 8.131   -0.561  1.00 28.57  ? 554 LEU B HD12 1 
ATOM   3477  H HD13 . LEU A 1 217 ? -24.106 8.539   -1.920  1.00 28.57  ? 554 LEU B HD13 1 
ATOM   3478  H HD21 . LEU A 1 217 ? -26.890 8.597   -0.976  1.00 27.79  ? 554 LEU B HD21 1 
ATOM   3479  H HD22 . LEU A 1 217 ? -26.527 7.881   -2.328  1.00 27.79  ? 554 LEU B HD22 1 
ATOM   3480  H HD23 . LEU A 1 217 ? -27.293 7.094   -1.203  1.00 27.79  ? 554 LEU B HD23 1 
ATOM   3481  N N    . SER A 1 218 ? -22.661 5.891   1.373   1.00 26.14  ? 555 SER B N    1 
ATOM   3482  C CA   . SER A 1 218 ? -22.582 5.793   2.833   1.00 36.61  ? 555 SER B CA   1 
ATOM   3483  C C    . SER A 1 218 ? -23.032 7.069   3.554   1.00 32.92  ? 555 SER B C    1 
ATOM   3484  O O    . SER A 1 218 ? -22.787 7.226   4.753   1.00 31.57  ? 555 SER B O    1 
ATOM   3485  C CB   . SER A 1 218 ? -21.152 5.442   3.265   1.00 29.94  ? 555 SER B CB   1 
ATOM   3486  O OG   . SER A 1 218 ? -20.232 6.402   2.776   1.00 35.70  ? 555 SER B OG   1 
ATOM   3487  H H    . SER A 1 218 ? -22.029 6.356   1.020   1.00 31.36  ? 555 SER B H    1 
ATOM   3488  H HA   . SER A 1 218 ? -23.168 5.065   3.128   1.00 43.93  ? 555 SER B HA   1 
ATOM   3489  H HB2  . SER A 1 218 ? -21.109 5.428   4.234   1.00 35.92  ? 555 SER B HB2  1 
ATOM   3490  H HB3  . SER A 1 218 ? -20.919 4.570   2.910   1.00 35.92  ? 555 SER B HB3  1 
ATOM   3491  H HG   . SER A 1 218 ? -19.471 6.207   3.011   1.00 42.84  ? 555 SER B HG   1 
ATOM   3492  N N    . GLU A 1 219 ? -23.679 7.976   2.826   1.00 31.45  ? 556 GLU B N    1 
ATOM   3493  C CA   . GLU A 1 219 ? -24.262 9.175   3.433   1.00 33.44  ? 556 GLU B CA   1 
ATOM   3494  C C    . GLU A 1 219 ? -25.732 9.265   3.042   1.00 29.26  ? 556 GLU B C    1 
ATOM   3495  O O    . GLU A 1 219 ? -26.140 8.694   2.039   1.00 22.44  ? 556 GLU B O    1 
ATOM   3496  C CB   . GLU A 1 219 ? -23.515 10.422  2.972   1.00 37.95  ? 556 GLU B CB   1 
ATOM   3497  C CG   . GLU A 1 219 ? -22.072 10.490  3.444   1.00 55.05  ? 556 GLU B CG   1 
ATOM   3498  C CD   . GLU A 1 219 ? -21.893 11.387  4.657   1.00 71.94  ? 556 GLU B CD   1 
ATOM   3499  O OE1  . GLU A 1 219 ? -22.639 11.217  5.646   1.00 70.22  ? 556 GLU B OE1  1 
ATOM   3500  O OE2  . GLU A 1 219 ? -21.011 12.272  4.614   1.00 78.06  ? 556 GLU B OE2  1 
ATOM   3501  H H    . GLU A 1 219 ? -23.796 7.922   1.976   1.00 37.74  ? 556 GLU B H    1 
ATOM   3502  H HA   . GLU A 1 219 ? -24.200 9.114   4.409   1.00 40.13  ? 556 GLU B HA   1 
ATOM   3503  H HB2  . GLU A 1 219 ? -23.510 10.441  2.002   1.00 45.54  ? 556 GLU B HB2  1 
ATOM   3504  H HB3  . GLU A 1 219 ? -23.975 11.205  3.313   1.00 45.54  ? 556 GLU B HB3  1 
ATOM   3505  H HG2  . GLU A 1 219 ? -21.776 9.598   3.683   1.00 66.06  ? 556 GLU B HG2  1 
ATOM   3506  H HG3  . GLU A 1 219 ? -21.521 10.841  2.727   1.00 66.06  ? 556 GLU B HG3  1 
ATOM   3507  N N    . LYS A 1 220 ? -26.531 9.983   3.820   1.00 28.12  ? 557 LYS B N    1 
ATOM   3508  C CA   . LYS A 1 220 ? -27.963 10.007  3.567   1.00 31.10  ? 557 LYS B CA   1 
ATOM   3509  C C    . LYS A 1 220 ? -28.291 11.030  2.488   1.00 37.04  ? 557 LYS B C    1 
ATOM   3510  O O    . LYS A 1 220 ? -29.033 11.979  2.744   1.00 33.21  ? 557 LYS B O    1 
ATOM   3511  C CB   . LYS A 1 220 ? -28.733 10.349  4.844   1.00 36.34  ? 557 LYS B CB   1 
ATOM   3512  C CG   . LYS A 1 220 ? -28.664 9.306   5.941   1.00 43.03  ? 557 LYS B CG   1 
ATOM   3513  C CD   . LYS A 1 220 ? -29.709 9.580   7.021   1.00 62.34  ? 557 LYS B CD   1 
ATOM   3514  C CE   . LYS A 1 220 ? -29.819 8.429   8.021   1.00 60.01  ? 557 LYS B CE   1 
ATOM   3515  N NZ   . LYS A 1 220 ? -28.720 8.441   9.011   1.00 64.33  ? 557 LYS B NZ   1 
ATOM   3516  H H    . LYS A 1 220 ? -26.275 10.457  4.490   1.00 33.75  ? 557 LYS B H    1 
ATOM   3517  H HA   . LYS A 1 220 ? -28.254 9.125   3.257   1.00 37.32  ? 557 LYS B HA   1 
ATOM   3518  H HB2  . LYS A 1 220 ? -28.378 11.176  5.205   1.00 43.61  ? 557 LYS B HB2  1 
ATOM   3519  H HB3  . LYS A 1 220 ? -29.668 10.471  4.615   1.00 43.61  ? 557 LYS B HB3  1 
ATOM   3520  H HG2  . LYS A 1 220 ? -28.837 8.429   5.564   1.00 51.63  ? 557 LYS B HG2  1 
ATOM   3521  H HG3  . LYS A 1 220 ? -27.786 9.329   6.353   1.00 51.63  ? 557 LYS B HG3  1 
ATOM   3522  H HD2  . LYS A 1 220 ? -29.460 10.381  7.508   1.00 74.81  ? 557 LYS B HD2  1 
ATOM   3523  H HD3  . LYS A 1 220 ? -30.576 9.699   6.602   1.00 74.81  ? 557 LYS B HD3  1 
ATOM   3524  H HE2  . LYS A 1 220 ? -30.658 8.504   8.501   1.00 72.01  ? 557 LYS B HE2  1 
ATOM   3525  H HE3  . LYS A 1 220 ? -29.784 7.587   7.541   1.00 72.01  ? 557 LYS B HE3  1 
ATOM   3526  H HZ1  . LYS A 1 220 ? -27.936 8.367   8.596   1.00 77.20  ? 557 LYS B HZ1  1 
ATOM   3527  H HZ2  . LYS A 1 220 ? -28.733 9.203   9.470   1.00 77.20  ? 557 LYS B HZ2  1 
ATOM   3528  H HZ3  . LYS A 1 220 ? -28.813 7.760   9.577   1.00 77.20  ? 557 LYS B HZ3  1 
ATOM   3529  N N    . ARG A 1 221 ? -27.745 10.848  1.286   1.00 34.01  ? 558 ARG B N    1 
ATOM   3530  C CA   . ARG A 1 221 ? -27.988 11.800  0.197   1.00 26.90  ? 558 ARG B CA   1 
ATOM   3531  C C    . ARG A 1 221 ? -29.241 11.438  -0.571  1.00 33.76  ? 558 ARG B C    1 
ATOM   3532  O O    . ARG A 1 221 ? -29.578 10.263  -0.704  1.00 24.46  ? 558 ARG B O    1 
ATOM   3533  C CB   . ARG A 1 221 ? -26.785 11.875  -0.737  1.00 29.13  ? 558 ARG B CB   1 
ATOM   3534  C CG   . ARG A 1 221 ? -25.513 12.268  -0.017  1.00 31.55  ? 558 ARG B CG   1 
ATOM   3535  C CD   . ARG A 1 221 ? -24.391 12.609  -0.961  1.00 34.41  ? 558 ARG B CD   1 
ATOM   3536  N NE   . ARG A 1 221 ? -23.194 12.974  -0.214  1.00 37.47  ? 558 ARG B NE   1 
ATOM   3537  C CZ   . ARG A 1 221 ? -22.961 14.181  0.292   1.00 42.63  ? 558 ARG B CZ   1 
ATOM   3538  N NH1  . ARG A 1 221 ? -23.840 15.164  0.122   1.00 34.07  ? 558 ARG B NH1  1 
ATOM   3539  N NH2  . ARG A 1 221 ? -21.844 14.409  0.963   1.00 40.09  ? 558 ARG B NH2  1 
ATOM   3540  H H    . ARG A 1 221 ? -27.235 10.188  1.075   1.00 40.81  ? 558 ARG B H    1 
ATOM   3541  H HA   . ARG A 1 221 ? -28.121 12.691  0.583   1.00 32.28  ? 558 ARG B HA   1 
ATOM   3542  H HB2  . ARG A 1 221 ? -26.644 11.005  -1.142  1.00 34.96  ? 558 ARG B HB2  1 
ATOM   3543  H HB3  . ARG A 1 221 ? -26.958 12.537  -1.424  1.00 34.96  ? 558 ARG B HB3  1 
ATOM   3544  H HG2  . ARG A 1 221 ? -25.689 13.046  0.533   1.00 37.86  ? 558 ARG B HG2  1 
ATOM   3545  H HG3  . ARG A 1 221 ? -25.222 11.527  0.538   1.00 37.86  ? 558 ARG B HG3  1 
ATOM   3546  H HD2  . ARG A 1 221 ? -24.186 11.839  -1.513  1.00 41.30  ? 558 ARG B HD2  1 
ATOM   3547  H HD3  . ARG A 1 221 ? -24.650 13.363  -1.513  1.00 41.30  ? 558 ARG B HD3  1 
ATOM   3548  H HE   . ARG A 1 221 ? -22.597 12.367  -0.092  1.00 44.97  ? 558 ARG B HE   1 
ATOM   3549  H HH11 . ARG A 1 221 ? -24.568 15.019  -0.312  1.00 40.88  ? 558 ARG B HH11 1 
ATOM   3550  H HH12 . ARG A 1 221 ? -23.682 15.943  0.450   1.00 40.88  ? 558 ARG B HH12 1 
ATOM   3551  H HH21 . ARG A 1 221 ? -21.271 13.777  1.073   1.00 48.11  ? 558 ARG B HH21 1 
ATOM   3552  H HH22 . ARG A 1 221 ? -21.689 15.191  1.287   1.00 48.11  ? 558 ARG B HH22 1 
ATOM   3553  N N    . ALA A 1 222 ? -29.925 12.465  -1.075  1.00 28.67  ? 559 ALA B N    1 
ATOM   3554  C CA   . ALA A 1 222 ? -31.197 12.300  -1.761  1.00 35.11  ? 559 ALA B CA   1 
ATOM   3555  C C    . ALA A 1 222 ? -31.285 13.308  -2.898  1.00 26.77  ? 559 ALA B C    1 
ATOM   3556  O O    . ALA A 1 222 ? -30.585 14.323  -2.890  1.00 32.06  ? 559 ALA B O    1 
ATOM   3557  C CB   . ALA A 1 222 ? -32.354 12.500  -0.793  1.00 36.00  ? 559 ALA B CB   1 
ATOM   3558  H H    . ALA A 1 222 ? -29.663 13.283  -1.029  1.00 34.41  ? 559 ALA B H    1 
ATOM   3559  H HA   . ALA A 1 222 ? -31.255 11.397  -2.137  1.00 42.14  ? 559 ALA B HA   1 
ATOM   3560  H HB1  . ALA A 1 222 ? -33.181 12.387  -1.267  1.00 43.20  ? 559 ALA B HB1  1 
ATOM   3561  H HB2  . ALA A 1 222 ? -32.288 11.851  -0.089  1.00 43.20  ? 559 ALA B HB2  1 
ATOM   3562  H HB3  . ALA A 1 222 ? -32.305 13.386  -0.427  1.00 43.20  ? 559 ALA B HB3  1 
ATOM   3563  N N    . LEU A 1 223 ? -32.153 13.029  -3.864  1.00 22.01  ? 560 LEU B N    1 
ATOM   3564  C CA   . LEU A 1 223 ? -32.270 13.867  -5.051  1.00 29.00  ? 560 LEU B CA   1 
ATOM   3565  C C    . LEU A 1 223 ? -32.901 15.206  -4.681  1.00 28.98  ? 560 LEU B C    1 
ATOM   3566  O O    . LEU A 1 223 ? -32.887 16.133  -5.468  1.00 26.27  ? 560 LEU B O    1 
ATOM   3567  C CB   . LEU A 1 223 ? -33.113 13.172  -6.128  1.00 18.58  ? 560 LEU B CB   1 
ATOM   3568  C CG   . LEU A 1 223 ? -32.649 11.777  -6.566  1.00 26.20  ? 560 LEU B CG   1 
ATOM   3569  C CD1  . LEU A 1 223 ? -33.520 11.294  -7.732  1.00 27.99  ? 560 LEU B CD1  1 
ATOM   3570  C CD2  . LEU A 1 223 ? -31.166 11.776  -6.960  1.00 25.12  ? 560 LEU B CD2  1 
ATOM   3571  H H    . LEU A 1 223 ? -32.688 12.356  -3.856  1.00 26.41  ? 560 LEU B H    1 
ATOM   3572  H HA   . LEU A 1 223 ? -31.378 14.036  -5.419  1.00 34.80  ? 560 LEU B HA   1 
ATOM   3573  H HB2  . LEU A 1 223 ? -34.019 13.082  -5.793  1.00 22.29  ? 560 LEU B HB2  1 
ATOM   3574  H HB3  . LEU A 1 223 ? -33.118 13.735  -6.918  1.00 22.29  ? 560 LEU B HB3  1 
ATOM   3575  H HG   . LEU A 1 223 ? -32.764 11.158  -5.828  1.00 31.44  ? 560 LEU B HG   1 
ATOM   3576  H HD11 . LEU A 1 223 ? -33.226 10.421  -8.002  1.00 33.59  ? 560 LEU B HD11 1 
ATOM   3577  H HD12 . LEU A 1 223 ? -34.435 11.257  -7.443  1.00 33.59  ? 560 LEU B HD12 1 
ATOM   3578  H HD13 . LEU A 1 223 ? -33.433 11.910  -8.463  1.00 33.59  ? 560 LEU B HD13 1 
ATOM   3579  H HD21 . LEU A 1 223 ? -30.914 10.888  -7.227  1.00 30.14  ? 560 LEU B HD21 1 
ATOM   3580  H HD22 . LEU A 1 223 ? -31.036 12.386  -7.689  1.00 30.14  ? 560 LEU B HD22 1 
ATOM   3581  H HD23 . LEU A 1 223 ? -30.642 12.051  -6.204  1.00 30.14  ? 560 LEU B HD23 1 
ATOM   3582  N N    . THR A 1 224 ? -33.438 15.264  -3.469  1.00 31.80  ? 561 THR B N    1 
ATOM   3583  C CA   . THR A 1 224 ? -34.082 16.440  -2.917  1.00 32.52  ? 561 THR B CA   1 
ATOM   3584  C C    . THR A 1 224 ? -33.123 17.343  -2.150  1.00 30.18  ? 561 THR B C    1 
ATOM   3585  O O    . THR A 1 224 ? -33.519 18.428  -1.709  1.00 31.01  ? 561 THR B O    1 
ATOM   3586  C CB   . THR A 1 224 ? -35.185 16.016  -1.933  1.00 39.40  ? 561 THR B CB   1 
ATOM   3587  O OG1  . THR A 1 224 ? -34.664 15.007  -1.048  1.00 31.58  ? 561 THR B OG1  1 
ATOM   3588  C CG2  . THR A 1 224 ? -36.396 15.466  -2.679  1.00 32.18  ? 561 THR B CG2  1 
ATOM   3589  H H    . THR A 1 224 ? -33.439 14.598  -2.925  1.00 38.16  ? 561 THR B H    1 
ATOM   3590  H HA   . THR A 1 224 ? -34.491 16.961  -3.639  1.00 39.03  ? 561 THR B HA   1 
ATOM   3591  H HB   . THR A 1 224 ? -35.468 16.785  -1.415  1.00 47.28  ? 561 THR B HB   1 
ATOM   3592  H HG1  . THR A 1 224 ? -35.244 14.773  -0.518  1.00 37.89  ? 561 THR B HG1  1 
ATOM   3593  H HG21 . THR A 1 224 ? -37.076 15.205  -2.054  1.00 38.62  ? 561 THR B HG21 1 
ATOM   3594  H HG22 . THR A 1 224 ? -36.753 16.137  -3.266  1.00 38.62  ? 561 THR B HG22 1 
ATOM   3595  H HG23 . THR A 1 224 ? -36.141 14.700  -3.200  1.00 38.62  ? 561 THR B HG23 1 
ATOM   3596  N N    . ASP A 1 225 ? -31.871 16.920  -1.969  1.00 23.01  ? 562 ASP B N    1 
ATOM   3597  C CA   . ASP A 1 225 ? -30.947 17.708  -1.145  1.00 34.69  ? 562 ASP B CA   1 
ATOM   3598  C C    . ASP A 1 225 ? -30.832 19.153  -1.632  1.00 36.91  ? 562 ASP B C    1 
ATOM   3599  O O    . ASP A 1 225 ? -30.804 19.395  -2.829  1.00 30.53  ? 562 ASP B O    1 
ATOM   3600  C CB   . ASP A 1 225 ? -29.561 17.075  -1.110  1.00 26.02  ? 562 ASP B CB   1 
ATOM   3601  C CG   . ASP A 1 225 ? -29.534 15.764  -0.311  1.00 26.26  ? 562 ASP B CG   1 
ATOM   3602  O OD1  . ASP A 1 225 ? -30.472 15.518  0.474   1.00 30.93  ? 562 ASP B OD1  1 
ATOM   3603  O OD2  . ASP A 1 225 ? -28.578 14.986  -0.463  1.00 30.00  ? 562 ASP B OD2  1 
ATOM   3604  H H    . ASP A 1 225 ? -31.537 16.201  -2.301  1.00 27.61  ? 562 ASP B H    1 
ATOM   3605  H HA   . ASP A 1 225 ? -31.287 17.730  -0.227  1.00 41.63  ? 562 ASP B HA   1 
ATOM   3606  H HB2  . ASP A 1 225 ? -29.278 16.879  -2.017  1.00 31.23  ? 562 ASP B HB2  1 
ATOM   3607  H HB3  . ASP A 1 225 ? -28.940 17.693  -0.694  1.00 31.23  ? 562 ASP B HB3  1 
ATOM   3608  N N    . PRO A 1 226 ? -30.745 20.108  -0.695  1.00 34.18  ? 563 PRO B N    1 
ATOM   3609  C CA   . PRO A 1 226 ? -30.581 21.529  -1.024  1.00 39.87  ? 563 PRO B CA   1 
ATOM   3610  C C    . PRO A 1 226 ? -29.281 21.784  -1.772  1.00 36.12  ? 563 PRO B C    1 
ATOM   3611  O O    . PRO A 1 226 ? -28.272 21.139  -1.486  1.00 35.39  ? 563 PRO B O    1 
ATOM   3612  C CB   . PRO A 1 226 ? -30.522 22.207  0.352   1.00 42.94  ? 563 PRO B CB   1 
ATOM   3613  C CG   . PRO A 1 226 ? -31.172 21.266  1.283   1.00 41.10  ? 563 PRO B CG   1 
ATOM   3614  C CD   . PRO A 1 226 ? -30.862 19.893  0.759   1.00 43.24  ? 563 PRO B CD   1 
ATOM   3615  H HA   . PRO A 1 226 ? -31.344 21.868  -1.537  1.00 47.85  ? 563 PRO B HA   1 
ATOM   3616  H HB2  . PRO A 1 226 ? -29.597 22.352  0.604   1.00 51.53  ? 563 PRO B HB2  1 
ATOM   3617  H HB3  . PRO A 1 226 ? -31.005 23.047  0.322   1.00 51.53  ? 563 PRO B HB3  1 
ATOM   3618  H HG2  . PRO A 1 226 ? -30.804 21.382  2.173   1.00 49.32  ? 563 PRO B HG2  1 
ATOM   3619  H HG3  . PRO A 1 226 ? -32.130 21.422  1.287   1.00 49.32  ? 563 PRO B HG3  1 
ATOM   3620  H HD2  . PRO A 1 226 ? -30.022 19.573  1.122   1.00 51.89  ? 563 PRO B HD2  1 
ATOM   3621  H HD3  . PRO A 1 226 ? -31.591 19.283  0.954   1.00 51.89  ? 563 PRO B HD3  1 
ATOM   3622  N N    . ILE A 1 227 ? -29.304 22.693  -2.738  1.00 37.78  ? 564 ILE B N    1 
ATOM   3623  C CA   . ILE A 1 227 ? -28.074 23.154  -3.359  1.00 36.16  ? 564 ILE B CA   1 
ATOM   3624  C C    . ILE A 1 227 ? -27.545 24.323  -2.544  1.00 48.03  ? 564 ILE B C    1 
ATOM   3625  O O    . ILE A 1 227 ? -28.217 25.342  -2.418  1.00 46.72  ? 564 ILE B O    1 
ATOM   3626  C CB   . ILE A 1 227 ? -28.315 23.614  -4.791  1.00 41.74  ? 564 ILE B CB   1 
ATOM   3627  C CG1  . ILE A 1 227 ? -28.918 22.477  -5.610  1.00 40.87  ? 564 ILE B CG1  1 
ATOM   3628  C CG2  . ILE A 1 227 ? -27.011 24.098  -5.416  1.00 50.77  ? 564 ILE B CG2  1 
ATOM   3629  C CD1  . ILE A 1 227 ? -29.541 22.931  -6.915  1.00 42.27  ? 564 ILE B CD1  1 
ATOM   3630  H H    . ILE A 1 227 ? -30.018 23.057  -3.050  1.00 45.33  ? 564 ILE B H    1 
ATOM   3631  H HA   . ILE A 1 227 ? -27.407 22.436  -3.360  1.00 43.39  ? 564 ILE B HA   1 
ATOM   3632  H HB   . ILE A 1 227 ? -28.944 24.352  -4.777  1.00 50.09  ? 564 ILE B HB   1 
ATOM   3633  H HG12 . ILE A 1 227 ? -28.219 21.839  -5.822  1.00 49.04  ? 564 ILE B HG12 1 
ATOM   3634  H HG13 . ILE A 1 227 ? -29.610 22.046  -5.085  1.00 49.04  ? 564 ILE B HG13 1 
ATOM   3635  H HG21 . ILE A 1 227 ? -27.184 24.383  -6.316  1.00 60.92  ? 564 ILE B HG21 1 
ATOM   3636  H HG22 . ILE A 1 227 ? -26.671 24.833  -4.899  1.00 60.92  ? 564 ILE B HG22 1 
ATOM   3637  H HG23 . ILE A 1 227 ? -26.378 23.377  -5.416  1.00 60.92  ? 564 ILE B HG23 1 
ATOM   3638  H HD11 . ILE A 1 227 ? -29.897 22.167  -7.373  1.00 50.72  ? 564 ILE B HD11 1 
ATOM   3639  H HD12 . ILE A 1 227 ? -30.244 23.556  -6.723  1.00 50.72  ? 564 ILE B HD12 1 
ATOM   3640  H HD13 . ILE A 1 227 ? -28.866 23.351  -7.453  1.00 50.72  ? 564 ILE B HD13 1 
ATOM   3641  N N    . GLN A 1 228 ? -26.352 24.180  -1.979  1.00 40.78  ? 565 GLN B N    1 
ATOM   3642  C CA   . GLN A 1 228 ? -25.753 25.275  -1.222  1.00 58.90  ? 565 GLN B CA   1 
ATOM   3643  C C    . GLN A 1 228 ? -24.267 25.377  -1.515  1.00 62.26  ? 565 GLN B C    1 
ATOM   3644  O O    . GLN A 1 228 ? -23.547 24.386  -1.420  1.00 56.11  ? 565 GLN B O    1 
ATOM   3645  C CB   . GLN A 1 228 ? -25.980 25.076  0.278   1.00 67.15  ? 565 GLN B CB   1 
ATOM   3646  H H    . GLN A 1 228 ? -25.871 23.468  -2.018  1.00 48.94  ? 565 GLN B H    1 
ATOM   3647  H HA   . GLN A 1 228 ? -26.176 26.119  -1.487  1.00 70.68  ? 565 GLN B HA   1 
ATOM   3648  N N    . TRP A 1 243 ? -27.630 24.850  -17.456 1.00 112.14 ? 580 TRP B N    1 
ATOM   3649  C CA   . TRP A 1 243 ? -27.324 24.573  -18.854 1.00 109.24 ? 580 TRP B CA   1 
ATOM   3650  C C    . TRP A 1 243 ? -26.661 25.775  -19.515 1.00 102.01 ? 580 TRP B C    1 
ATOM   3651  O O    . TRP A 1 243 ? -25.722 25.630  -20.296 1.00 100.76 ? 580 TRP B O    1 
ATOM   3652  C CB   . TRP A 1 243 ? -28.600 24.201  -19.611 1.00 109.42 ? 580 TRP B CB   1 
ATOM   3653  H HA   . TRP A 1 243 ? -26.705 23.815  -18.905 1.00 131.08 ? 580 TRP B HA   1 
ATOM   3654  N N    . ALA A 1 244 ? -27.156 26.965  -19.196 1.00 93.40  ? 581 ALA B N    1 
ATOM   3655  C CA   . ALA A 1 244 ? -26.615 28.191  -19.763 1.00 84.70  ? 581 ALA B CA   1 
ATOM   3656  C C    . ALA A 1 244 ? -26.736 28.180  -21.288 1.00 84.34  ? 581 ALA B C    1 
ATOM   3657  O O    . ALA A 1 244 ? -27.806 28.450  -21.831 1.00 78.15  ? 581 ALA B O    1 
ATOM   3658  C CB   . ALA A 1 244 ? -25.167 28.374  -19.337 1.00 71.41  ? 581 ALA B CB   1 
ATOM   3659  H H    . ALA A 1 244 ? -27.809 27.088  -18.650 1.00 112.08 ? 581 ALA B H    1 
ATOM   3660  H HA   . ALA A 1 244 ? -27.130 28.953  -19.424 1.00 101.64 ? 581 ALA B HA   1 
ATOM   3661  H HB1  . ALA A 1 244 ? -24.829 29.187  -19.720 1.00 85.70  ? 581 ALA B HB1  1 
ATOM   3662  H HB2  . ALA A 1 244 ? -25.128 28.423  -18.379 1.00 85.70  ? 581 ALA B HB2  1 
ATOM   3663  H HB3  . ALA A 1 244 ? -24.653 27.626  -19.649 1.00 85.70  ? 581 ALA B HB3  1 
ATOM   3664  N N    . LYS A 1 245 ? -25.646 27.846  -21.974 1.00 105.66 ? 582 LYS B N    1 
ATOM   3665  C CA   . LYS A 1 245 ? -25.609 27.908  -23.434 1.00 106.51 ? 582 LYS B CA   1 
ATOM   3666  C C    . LYS A 1 245 ? -26.253 26.689  -24.094 1.00 96.36  ? 582 LYS B C    1 
ATOM   3667  O O    . LYS A 1 245 ? -26.254 26.569  -25.321 1.00 86.52  ? 582 LYS B O    1 
ATOM   3668  C CB   . LYS A 1 245 ? -24.162 28.042  -23.916 1.00 108.20 ? 582 LYS B CB   1 
ATOM   3669  H H    . LYS A 1 245 ? -24.911 27.580  -21.616 1.00 126.79 ? 582 LYS B H    1 
ATOM   3670  H HA   . LYS A 1 245 ? -26.100 28.703  -23.729 1.00 127.81 ? 582 LYS B HA   1 
ATOM   3671  N N    . ALA A 1 246 ? -26.805 25.792  -23.283 1.00 90.96  ? 583 ALA B N    1 
ATOM   3672  C CA   . ALA A 1 246 ? -27.336 24.531  -23.792 1.00 84.36  ? 583 ALA B CA   1 
ATOM   3673  C C    . ALA A 1 246 ? -28.847 24.557  -24.049 1.00 79.82  ? 583 ALA B C    1 
ATOM   3674  O O    . ALA A 1 246 ? -29.373 23.665  -24.716 1.00 76.10  ? 583 ALA B O    1 
ATOM   3675  C CB   . ALA A 1 246 ? -26.984 23.395  -22.839 1.00 80.14  ? 583 ALA B CB   1 
ATOM   3676  H H    . ALA A 1 246 ? -26.885 25.889  -22.432 1.00 109.15 ? 583 ALA B H    1 
ATOM   3677  H HA   . ALA A 1 246 ? -26.900 24.338  -24.649 1.00 101.23 ? 583 ALA B HA   1 
ATOM   3678  H HB1  . ALA A 1 246 ? -27.339 22.574  -23.187 1.00 96.17  ? 583 ALA B HB1  1 
ATOM   3679  H HB2  . ALA A 1 246 ? -26.029 23.334  -22.766 1.00 96.17  ? 583 ALA B HB2  1 
ATOM   3680  H HB3  . ALA A 1 246 ? -27.368 23.579  -21.979 1.00 96.17  ? 583 ALA B HB3  1 
ATOM   3681  N N    . HIS A 1 247 ? -29.541 25.571  -23.533 1.00 58.58  ? 584 HIS B N    1 
ATOM   3682  C CA   . HIS A 1 247 ? -30.991 25.640  -23.689 1.00 63.67  ? 584 HIS B CA   1 
ATOM   3683  C C    . HIS A 1 247 ? -31.489 27.032  -24.112 1.00 60.93  ? 584 HIS B C    1 
ATOM   3684  O O    . HIS A 1 247 ? -32.499 27.518  -23.606 1.00 44.13  ? 584 HIS B O    1 
ATOM   3685  C CB   . HIS A 1 247 ? -31.686 25.190  -22.399 1.00 71.57  ? 584 HIS B CB   1 
ATOM   3686  C CG   . HIS A 1 247 ? -31.287 25.980  -21.192 1.00 99.32  ? 584 HIS B CG   1 
ATOM   3687  N ND1  . HIS A 1 247 ? -30.717 27.233  -21.276 1.00 109.51 ? 584 HIS B ND1  1 
ATOM   3688  C CD2  . HIS A 1 247 ? -31.372 25.695  -19.871 1.00 108.32 ? 584 HIS B CD2  1 
ATOM   3689  C CE1  . HIS A 1 247 ? -30.470 27.685  -20.060 1.00 114.21 ? 584 HIS B CE1  1 
ATOM   3690  N NE2  . HIS A 1 247 ? -30.857 26.771  -19.189 1.00 111.84 ? 584 HIS B NE2  1 
ATOM   3691  H H    . HIS A 1 247 ? -29.199 26.225  -23.091 1.00 70.30  ? 584 HIS B H    1 
ATOM   3692  H HA   . HIS A 1 247 ? -31.253 25.012  -24.395 1.00 76.41  ? 584 HIS B HA   1 
ATOM   3693  H HB2  . HIS A 1 247 ? -32.645 25.283  -22.512 1.00 85.88  ? 584 HIS B HB2  1 
ATOM   3694  H HB3  . HIS A 1 247 ? -31.463 24.261  -22.232 1.00 85.88  ? 584 HIS B HB3  1 
ATOM   3695  H HD2  . HIS A 1 247 ? -31.714 24.916  -19.495 1.00 129.98 ? 584 HIS B HD2  1 
ATOM   3696  H HE1  . HIS A 1 247 ? -30.088 28.507  -19.852 1.00 137.05 ? 584 HIS B HE1  1 
ATOM   3697  N N    . GLU A 1 248 ? -30.788 27.660  -25.053 1.00 64.32  ? 585 GLU B N    1 
ATOM   3698  C CA   . GLU A 1 248 ? -31.233 28.933  -25.618 1.00 67.44  ? 585 GLU B CA   1 
ATOM   3699  C C    . GLU A 1 248 ? -32.350 28.703  -26.630 1.00 62.16  ? 585 GLU B C    1 
ATOM   3700  O O    . GLU A 1 248 ? -32.200 27.923  -27.563 1.00 57.24  ? 585 GLU B O    1 
ATOM   3701  C CB   . GLU A 1 248 ? -30.072 29.656  -26.308 1.00 72.15  ? 585 GLU B CB   1 
ATOM   3702  C CG   . GLU A 1 248 ? -28.888 29.947  -25.404 1.00 80.93  ? 585 GLU B CG   1 
ATOM   3703  C CD   . GLU A 1 248 ? -29.208 30.980  -24.344 1.00 94.14  ? 585 GLU B CD   1 
ATOM   3704  O OE1  . GLU A 1 248 ? -30.269 31.632  -24.449 1.00 91.86  ? 585 GLU B OE1  1 
ATOM   3705  O OE2  . GLU A 1 248 ? -28.398 31.139  -23.405 1.00 100.83 ? 585 GLU B OE2  1 
ATOM   3706  H H    . GLU A 1 248 ? -30.049 27.369  -25.382 1.00 77.19  ? 585 GLU B H    1 
ATOM   3707  H HA   . GLU A 1 248 ? -31.576 29.507  -24.901 1.00 80.92  ? 585 GLU B HA   1 
ATOM   3708  H HB2  . GLU A 1 248 ? -29.755 29.106  -27.041 1.00 86.58  ? 585 GLU B HB2  1 
ATOM   3709  H HB3  . GLU A 1 248 ? -30.395 30.504  -26.652 1.00 86.58  ? 585 GLU B HB3  1 
ATOM   3710  H HG2  . GLU A 1 248 ? -28.622 29.129  -24.957 1.00 97.12  ? 585 GLU B HG2  1 
ATOM   3711  H HG3  . GLU A 1 248 ? -28.154 30.285  -25.942 1.00 97.12  ? 585 GLU B HG3  1 
ATOM   3712  N N    . LEU A 1 249 ? -33.471 29.388  -26.448 1.00 57.20  ? 586 LEU B N    1 
ATOM   3713  C CA   . LEU A 1 249 ? -34.576 29.303  -27.388 1.00 52.45  ? 586 LEU B CA   1 
ATOM   3714  C C    . LEU A 1 249 ? -34.670 30.639  -28.115 1.00 60.27  ? 586 LEU B C    1 
ATOM   3715  O O    . LEU A 1 249 ? -34.535 31.693  -27.488 1.00 53.22  ? 586 LEU B O    1 
ATOM   3716  C CB   . LEU A 1 249 ? -35.873 29.008  -26.634 1.00 65.15  ? 586 LEU B CB   1 
ATOM   3717  C CG   . LEU A 1 249 ? -36.966 28.186  -27.318 1.00 65.71  ? 586 LEU B CG   1 
ATOM   3718  C CD1  . LEU A 1 249 ? -36.406 26.924  -27.956 1.00 56.54  ? 586 LEU B CD1  1 
ATOM   3719  C CD2  . LEU A 1 249 ? -38.038 27.827  -26.295 1.00 60.66  ? 586 LEU B CD2  1 
ATOM   3720  H H    . LEU A 1 249 ? -33.616 29.912  -25.782 1.00 68.64  ? 586 LEU B H    1 
ATOM   3721  H HA   . LEU A 1 249 ? -34.412 28.590  -28.041 1.00 62.94  ? 586 LEU B HA   1 
ATOM   3722  H HB2  . LEU A 1 249 ? -35.638 28.535  -25.820 1.00 78.18  ? 586 LEU B HB2  1 
ATOM   3723  H HB3  . LEU A 1 249 ? -36.274 29.859  -26.396 1.00 78.18  ? 586 LEU B HB3  1 
ATOM   3724  H HG   . LEU A 1 249 ? -37.379 28.721  -28.014 1.00 78.86  ? 586 LEU B HG   1 
ATOM   3725  H HD11 . LEU A 1 249 ? -37.123 26.440  -28.372 1.00 67.84  ? 586 LEU B HD11 1 
ATOM   3726  H HD12 . LEU A 1 249 ? -35.752 27.171  -28.614 1.00 67.84  ? 586 LEU B HD12 1 
ATOM   3727  H HD13 . LEU A 1 249 ? -35.998 26.384  -27.275 1.00 67.84  ? 586 LEU B HD13 1 
ATOM   3728  H HD21 . LEU A 1 249 ? -38.723 27.311  -26.728 1.00 72.79  ? 586 LEU B HD21 1 
ATOM   3729  H HD22 . LEU A 1 249 ? -37.638 27.313  -25.590 1.00 72.79  ? 586 LEU B HD22 1 
ATOM   3730  H HD23 . LEU A 1 249 ? -38.414 28.636  -25.939 1.00 72.79  ? 586 LEU B HD23 1 
ATOM   3731  N N    . PRO A 1 250 ? -34.875 30.611  -29.445 1.00 57.64  ? 587 PRO B N    1 
ATOM   3732  C CA   . PRO A 1 250 ? -35.079 31.899  -30.111 1.00 60.84  ? 587 PRO B CA   1 
ATOM   3733  C C    . PRO A 1 250 ? -36.315 32.558  -29.524 1.00 59.44  ? 587 PRO B C    1 
ATOM   3734  O O    . PRO A 1 250 ? -37.208 31.835  -29.089 1.00 37.37  ? 587 PRO B O    1 
ATOM   3735  C CB   . PRO A 1 250 ? -35.309 31.514  -31.580 1.00 54.80  ? 587 PRO B CB   1 
ATOM   3736  C CG   . PRO A 1 250 ? -34.821 30.101  -31.703 1.00 57.56  ? 587 PRO B CG   1 
ATOM   3737  C CD   . PRO A 1 250 ? -35.024 29.477  -30.369 1.00 52.46  ? 587 PRO B CD   1 
ATOM   3738  H HA   . PRO A 1 250 ? -34.296 32.482  -30.023 1.00 73.01  ? 587 PRO B HA   1 
ATOM   3739  H HB2  . PRO A 1 250 ? -36.255 31.568  -31.787 1.00 65.76  ? 587 PRO B HB2  1 
ATOM   3740  H HB3  . PRO A 1 250 ? -34.798 32.104  -32.156 1.00 65.76  ? 587 PRO B HB3  1 
ATOM   3741  H HG2  . PRO A 1 250 ? -35.339 29.637  -32.379 1.00 69.07  ? 587 PRO B HG2  1 
ATOM   3742  H HG3  . PRO A 1 250 ? -33.879 30.103  -31.938 1.00 69.07  ? 587 PRO B HG3  1 
ATOM   3743  H HD2  . PRO A 1 250 ? -35.915 29.100  -30.304 1.00 62.95  ? 587 PRO B HD2  1 
ATOM   3744  H HD3  . PRO A 1 250 ? -34.341 28.810  -30.200 1.00 62.95  ? 587 PRO B HD3  1 
ATOM   3745  N N    . GLU A 1 251 ? -36.367 33.886  -29.503 1.00 55.19  ? 588 GLU B N    1 
ATOM   3746  C CA   . GLU A 1 251 ? -37.524 34.590  -28.966 1.00 53.75  ? 588 GLU B CA   1 
ATOM   3747  C C    . GLU A 1 251 ? -38.638 34.537  -30.000 1.00 43.01  ? 588 GLU B C    1 
ATOM   3748  O O    . GLU A 1 251 ? -38.355 34.477  -31.187 1.00 36.58  ? 588 GLU B O    1 
ATOM   3749  C CB   . GLU A 1 251 ? -37.178 36.053  -28.666 1.00 69.84  ? 588 GLU B CB   1 
ATOM   3750  C CG   . GLU A 1 251 ? -35.721 36.304  -28.288 1.00 89.81  ? 588 GLU B CG   1 
ATOM   3751  C CD   . GLU A 1 251 ? -34.828 36.556  -29.499 1.00 97.40  ? 588 GLU B CD   1 
ATOM   3752  O OE1  . GLU A 1 251 ? -33.897 35.754  -29.734 1.00 96.47  ? 588 GLU B OE1  1 
ATOM   3753  O OE2  . GLU A 1 251 ? -35.053 37.560  -30.211 1.00 99.69  ? 588 GLU B OE2  1 
ATOM   3754  H H    . GLU A 1 251 ? -35.744 34.402  -29.795 1.00 66.23  ? 588 GLU B H    1 
ATOM   3755  H HA   . GLU A 1 251 ? -37.830 34.157  -28.142 1.00 64.50  ? 588 GLU B HA   1 
ATOM   3756  H HB2  . GLU A 1 251 ? -37.372 36.584  -29.454 1.00 83.81  ? 588 GLU B HB2  1 
ATOM   3757  H HB3  . GLU A 1 251 ? -37.728 36.355  -27.926 1.00 83.81  ? 588 GLU B HB3  1 
ATOM   3758  H HG2  . GLU A 1 251 ? -35.674 37.085  -27.714 1.00 107.77 ? 588 GLU B HG2  1 
ATOM   3759  H HG3  . GLU A 1 251 ? -35.377 35.527  -27.820 1.00 107.77 ? 588 GLU B HG3  1 
ATOM   3760  N N    . SER A 1 252 ? -39.893 34.541  -29.554 1.00 43.27  ? 589 SER B N    1 
ATOM   3761  C CA   . SER A 1 252 ? -41.018 34.784  -30.454 1.00 57.28  ? 589 SER B CA   1 
ATOM   3762  C C    . SER A 1 252 ? -40.706 35.996  -31.312 1.00 62.37  ? 589 SER B C    1 
ATOM   3763  O O    . SER A 1 252 ? -40.112 36.961  -30.835 1.00 60.56  ? 589 SER B O    1 
ATOM   3764  C CB   . SER A 1 252 ? -42.305 35.062  -29.672 1.00 57.13  ? 589 SER B CB   1 
ATOM   3765  O OG   . SER A 1 252 ? -42.889 33.867  -29.188 1.00 59.78  ? 589 SER B OG   1 
ATOM   3766  H H    . SER A 1 252 ? -40.119 34.405  -28.735 1.00 51.93  ? 589 SER B H    1 
ATOM   3767  H HA   . SER A 1 252 ? -41.158 34.008  -31.035 1.00 68.73  ? 589 SER B HA   1 
ATOM   3768  H HB2  . SER A 1 252 ? -42.096 35.636  -28.918 1.00 68.56  ? 589 SER B HB2  1 
ATOM   3769  H HB3  . SER A 1 252 ? -42.939 35.505  -30.258 1.00 68.56  ? 589 SER B HB3  1 
ATOM   3770  H HG   . SER A 1 252 ? -43.576 34.039  -28.773 1.00 71.73  ? 589 SER B HG   1 
ATOM   3771  N N    . MET A 1 253 ? -41.105 35.944  -32.577 1.00 59.02  ? 590 MET B N    1 
ATOM   3772  C CA   . MET A 1 253 ? -40.908 37.068  -33.475 1.00 60.18  ? 590 MET B CA   1 
ATOM   3773  C C    . MET A 1 253 ? -42.167 37.318  -34.287 1.00 52.68  ? 590 MET B C    1 
ATOM   3774  O O    . MET A 1 253 ? -42.975 36.415  -34.511 1.00 42.70  ? 590 MET B O    1 
ATOM   3775  C CB   . MET A 1 253 ? -39.700 36.842  -34.397 1.00 62.05  ? 590 MET B CB   1 
ATOM   3776  C CG   . MET A 1 253 ? -39.434 35.398  -34.777 1.00 65.39  ? 590 MET B CG   1 
ATOM   3777  S SD   . MET A 1 253 ? -37.743 35.162  -35.382 1.00 61.67  ? 590 MET B SD   1 
ATOM   3778  C CE   . MET A 1 253 ? -37.763 36.191  -36.851 1.00 53.11  ? 590 MET B CE   1 
ATOM   3779  H H    . MET A 1 253 ? -41.493 35.267  -32.938 1.00 70.82  ? 590 MET B H    1 
ATOM   3780  H HA   . MET A 1 253 ? -40.722 37.866  -32.938 1.00 72.21  ? 590 MET B HA   1 
ATOM   3781  H HB2  . MET A 1 253 ? -39.843 37.338  -35.218 1.00 74.46  ? 590 MET B HB2  1 
ATOM   3782  H HB3  . MET A 1 253 ? -38.906 37.177  -33.950 1.00 74.46  ? 590 MET B HB3  1 
ATOM   3783  H HG2  . MET A 1 253 ? -39.558 34.834  -33.998 1.00 78.47  ? 590 MET B HG2  1 
ATOM   3784  H HG3  . MET A 1 253 ? -40.047 35.135  -35.482 1.00 78.47  ? 590 MET B HG3  1 
ATOM   3785  H HE1  . MET A 1 253 ? -36.902 36.150  -37.273 1.00 63.73  ? 590 MET B HE1  1 
ATOM   3786  H HE2  . MET A 1 253 ? -38.438 35.866  -37.451 1.00 63.73  ? 590 MET B HE2  1 
ATOM   3787  H HE3  . MET A 1 253 ? -37.960 37.095  -36.595 1.00 63.73  ? 590 MET B HE3  1 
ATOM   3788  N N    . CYS A 1 254 ? -42.328 38.560  -34.717 1.00 39.63  ? 591 CYS B N    1 
ATOM   3789  C CA   . CYS A 1 254 ? -43.496 38.959  -35.473 1.00 40.10  ? 591 CYS B CA   1 
ATOM   3790  C C    . CYS A 1 254 ? -43.006 39.476  -36.806 1.00 48.75  ? 591 CYS B C    1 
ATOM   3791  O O    . CYS A 1 254 ? -42.456 40.571  -36.896 1.00 55.46  ? 591 CYS B O    1 
ATOM   3792  C CB   . CYS A 1 254 ? -44.270 40.037  -34.719 1.00 44.35  ? 591 CYS B CB   1 
ATOM   3793  S SG   . CYS A 1 254 ? -45.862 40.478  -35.453 1.00 56.58  ? 591 CYS B SG   1 
ATOM   3794  H H    . CYS A 1 254 ? -41.766 39.197  -34.580 1.00 47.56  ? 591 CYS B H    1 
ATOM   3795  H HA   . CYS A 1 254 ? -44.081 38.187  -35.623 1.00 48.11  ? 591 CYS B HA   1 
ATOM   3796  H HB2  . CYS A 1 254 ? -44.439 39.722  -33.818 1.00 53.22  ? 591 CYS B HB2  1 
ATOM   3797  H HB3  . CYS A 1 254 ? -43.728 40.841  -34.688 1.00 53.22  ? 591 CYS B HB3  1 
ATOM   3798  H HG   . CYS A 1 254 ? -46.379 41.328  -34.783 1.00 67.90  ? 591 CYS B HG   1 
ATOM   3799  N N    . LEU A 1 255 ? -43.179 38.660  -37.837 1.00 41.59  ? 592 LEU B N    1 
ATOM   3800  C CA   . LEU A 1 255 ? -42.705 38.994  -39.163 1.00 43.07  ? 592 LEU B CA   1 
ATOM   3801  C C    . LEU A 1 255 ? -43.738 39.836  -39.868 1.00 45.72  ? 592 LEU B C    1 
ATOM   3802  O O    . LEU A 1 255 ? -44.879 39.412  -40.029 1.00 37.80  ? 592 LEU B O    1 
ATOM   3803  C CB   . LEU A 1 255 ? -42.460 37.720  -39.969 1.00 40.99  ? 592 LEU B CB   1 
ATOM   3804  C CG   . LEU A 1 255 ? -41.415 36.773  -39.377 1.00 47.89  ? 592 LEU B CG   1 
ATOM   3805  C CD1  . LEU A 1 255 ? -41.210 35.560  -40.278 1.00 48.16  ? 592 LEU B CD1  1 
ATOM   3806  C CD2  . LEU A 1 255 ? -40.115 37.526  -39.167 1.00 53.47  ? 592 LEU B CD2  1 
ATOM   3807  H H    . LEU A 1 255 ? -43.575 37.898  -37.790 1.00 49.91  ? 592 LEU B H    1 
ATOM   3808  H HA   . LEU A 1 255 ? -41.868 39.499  -39.102 1.00 51.68  ? 592 LEU B HA   1 
ATOM   3809  H HB2  . LEU A 1 255 ? -43.295 37.230  -40.034 1.00 49.19  ? 592 LEU B HB2  1 
ATOM   3810  H HB3  . LEU A 1 255 ? -42.159 37.969  -40.857 1.00 49.19  ? 592 LEU B HB3  1 
ATOM   3811  H HG   . LEU A 1 255 ? -41.724 36.459  -38.513 1.00 57.47  ? 592 LEU B HG   1 
ATOM   3812  H HD11 . LEU A 1 255 ? -40.551 34.985  -39.882 1.00 57.79  ? 592 LEU B HD11 1 
ATOM   3813  H HD12 . LEU A 1 255 ? -42.044 35.092  -40.365 1.00 57.79  ? 592 LEU B HD12 1 
ATOM   3814  H HD13 . LEU A 1 255 ? -40.910 35.858  -41.140 1.00 57.79  ? 592 LEU B HD13 1 
ATOM   3815  H HD21 . LEU A 1 255 ? -39.463 36.926  -38.796 1.00 64.16  ? 592 LEU B HD21 1 
ATOM   3816  H HD22 . LEU A 1 255 ? -39.807 37.860  -40.013 1.00 64.16  ? 592 LEU B HD22 1 
ATOM   3817  H HD23 . LEU A 1 255 ? -40.271 38.256  -38.563 1.00 64.16  ? 592 LEU B HD23 1 
ATOM   3818  N N    . LYS A 1 256 ? -43.338 41.028  -40.288 1.00 52.03  ? 593 LYS B N    1 
ATOM   3819  C CA   . LYS A 1 256 ? -44.201 41.867  -41.094 1.00 45.16  ? 593 LYS B CA   1 
ATOM   3820  C C    . LYS A 1 256 ? -43.784 41.752  -42.552 1.00 48.56  ? 593 LYS B C    1 
ATOM   3821  O O    . LYS A 1 256 ? -42.648 42.062  -42.907 1.00 59.34  ? 593 LYS B O    1 
ATOM   3822  C CB   . LYS A 1 256 ? -44.132 43.324  -40.633 1.00 51.92  ? 593 LYS B CB   1 
ATOM   3823  C CG   . LYS A 1 256 ? -45.039 44.250  -41.445 1.00 71.99  ? 593 LYS B CG   1 
ATOM   3824  C CD   . LYS A 1 256 ? -44.899 45.713  -41.042 1.00 79.78  ? 593 LYS B CD   1 
ATOM   3825  C CE   . LYS A 1 256 ? -45.800 46.600  -41.894 1.00 83.51  ? 593 LYS B CE   1 
ATOM   3826  N NZ   . LYS A 1 256 ? -45.665 48.050  -41.574 1.00 84.74  ? 593 LYS B NZ   1 
ATOM   3827  H H    . LYS A 1 256 ? -42.568 41.372  -40.119 1.00 62.44  ? 593 LYS B H    1 
ATOM   3828  H HA   . LYS A 1 256 ? -45.127 41.559  -41.011 1.00 54.20  ? 593 LYS B HA   1 
ATOM   3829  H HB2  . LYS A 1 256 ? -44.406 43.374  -39.704 1.00 62.30  ? 593 LYS B HB2  1 
ATOM   3830  H HB3  . LYS A 1 256 ? -43.220 43.641  -40.727 1.00 62.30  ? 593 LYS B HB3  1 
ATOM   3831  H HG2  . LYS A 1 256 ? -44.809 44.174  -42.384 1.00 86.39  ? 593 LYS B HG2  1 
ATOM   3832  H HG3  . LYS A 1 256 ? -45.963 43.988  -41.306 1.00 86.39  ? 593 LYS B HG3  1 
ATOM   3833  H HD2  . LYS A 1 256 ? -45.157 45.817  -40.113 1.00 95.74  ? 593 LYS B HD2  1 
ATOM   3834  H HD3  . LYS A 1 256 ? -43.980 45.996  -41.172 1.00 95.74  ? 593 LYS B HD3  1 
ATOM   3835  H HE2  . LYS A 1 256 ? -45.569 46.478  -42.828 1.00 100.22 ? 593 LYS B HE2  1 
ATOM   3836  H HE3  . LYS A 1 256 ? -46.724 46.346  -41.745 1.00 100.22 ? 593 LYS B HE3  1 
ATOM   3837  H HZ1  . LYS A 1 256 ? -46.207 48.528  -42.093 1.00 101.69 ? 593 LYS B HZ1  1 
ATOM   3838  H HZ2  . LYS A 1 256 ? -45.879 48.194  -40.722 1.00 101.69 ? 593 LYS B HZ2  1 
ATOM   3839  H HZ3  . LYS A 1 256 ? -44.826 48.315  -41.710 1.00 101.69 ? 593 LYS B HZ3  1 
ATOM   3840  N N    . PHE A 1 257 ? -44.706 41.296  -43.393 1.00 32.34  ? 594 PHE B N    1 
ATOM   3841  C CA   . PHE A 1 257 ? -44.457 41.212  -44.822 1.00 34.40  ? 594 PHE B CA   1 
ATOM   3842  C C    . PHE A 1 257 ? -44.786 42.524  -45.525 1.00 40.68  ? 594 PHE B C    1 
ATOM   3843  O O    . PHE A 1 257 ? -45.424 43.406  -44.948 1.00 47.88  ? 594 PHE B O    1 
ATOM   3844  C CB   . PHE A 1 257 ? -45.268 40.075  -45.434 1.00 41.10  ? 594 PHE B CB   1 
ATOM   3845  C CG   . PHE A 1 257 ? -44.715 38.726  -45.123 1.00 43.20  ? 594 PHE B CG   1 
ATOM   3846  C CD1  . PHE A 1 257 ? -44.789 38.220  -43.842 1.00 45.21  ? 594 PHE B CD1  1 
ATOM   3847  C CD2  . PHE A 1 257 ? -44.106 37.968  -46.106 1.00 41.59  ? 594 PHE B CD2  1 
ATOM   3848  C CE1  . PHE A 1 257 ? -44.265 36.971  -43.545 1.00 46.49  ? 594 PHE B CE1  1 
ATOM   3849  C CE2  . PHE A 1 257 ? -43.581 36.725  -45.815 1.00 43.31  ? 594 PHE B CE2  1 
ATOM   3850  C CZ   . PHE A 1 257 ? -43.665 36.225  -44.535 1.00 43.23  ? 594 PHE B CZ   1 
ATOM   3851  H H    . PHE A 1 257 ? -45.488 41.028  -43.157 1.00 38.80  ? 594 PHE B H    1 
ATOM   3852  H HA   . PHE A 1 257 ? -43.508 41.020  -44.970 1.00 41.28  ? 594 PHE B HA   1 
ATOM   3853  H HB2  . PHE A 1 257 ? -46.173 40.114  -45.089 1.00 49.32  ? 594 PHE B HB2  1 
ATOM   3854  H HB3  . PHE A 1 257 ? -45.276 40.179  -46.399 1.00 49.32  ? 594 PHE B HB3  1 
ATOM   3855  H HD1  . PHE A 1 257 ? -45.193 38.722  -43.172 1.00 54.25  ? 594 PHE B HD1  1 
ATOM   3856  H HD2  . PHE A 1 257 ? -44.046 38.301  -46.973 1.00 49.91  ? 594 PHE B HD2  1 
ATOM   3857  H HE1  . PHE A 1 257 ? -44.323 36.636  -42.679 1.00 55.79  ? 594 PHE B HE1  1 
ATOM   3858  H HE2  . PHE A 1 257 ? -43.177 36.222  -46.485 1.00 51.97  ? 594 PHE B HE2  1 
ATOM   3859  H HZ   . PHE A 1 257 ? -43.315 35.387  -44.338 1.00 51.87  ? 594 PHE B HZ   1 
ATOM   3860  N N    . ASP A 1 258 ? -44.356 42.641  -46.778 1.00 49.62  ? 595 ASP B N    1 
ATOM   3861  C CA   . ASP A 1 258 ? -44.526 43.881  -47.533 1.00 42.44  ? 595 ASP B CA   1 
ATOM   3862  C C    . ASP A 1 258 ? -45.991 44.290  -47.646 1.00 48.53  ? 595 ASP B C    1 
ATOM   3863  O O    . ASP A 1 258 ? -46.312 45.469  -47.536 1.00 50.70  ? 595 ASP B O    1 
ATOM   3864  C CB   . ASP A 1 258 ? -43.922 43.742  -48.929 1.00 56.69  ? 595 ASP B CB   1 
ATOM   3865  C CG   . ASP A 1 258 ? -42.414 43.643  -48.900 1.00 61.31  ? 595 ASP B CG   1 
ATOM   3866  O OD1  . ASP A 1 258 ? -41.804 44.144  -47.929 1.00 53.29  ? 595 ASP B OD1  1 
ATOM   3867  O OD2  . ASP A 1 258 ? -41.845 43.064  -49.850 1.00 67.08  ? 595 ASP B OD2  1 
ATOM   3868  H H    . ASP A 1 258 ? -43.961 42.015  -47.216 1.00 59.54  ? 595 ASP B H    1 
ATOM   3869  H HA   . ASP A 1 258 ? -44.049 44.600  -47.069 1.00 50.93  ? 595 ASP B HA   1 
ATOM   3870  H HB2  . ASP A 1 258 ? -44.269 42.938  -49.346 1.00 68.03  ? 595 ASP B HB2  1 
ATOM   3871  H HB3  . ASP A 1 258 ? -44.162 44.520  -49.457 1.00 68.03  ? 595 ASP B HB3  1 
ATOM   3872  N N    . CYS A 1 259 ? -46.871 43.313  -47.848 1.00 47.34  ? 596 CYS B N    1 
ATOM   3873  C CA   . CYS A 1 259 ? -48.288 43.579  -48.096 1.00 42.76  ? 596 CYS B CA   1 
ATOM   3874  C C    . CYS A 1 259 ? -49.056 43.982  -46.834 1.00 41.68  ? 596 CYS B C    1 
ATOM   3875  O O    . CYS A 1 259 ? -50.260 44.228  -46.885 1.00 49.08  ? 596 CYS B O    1 
ATOM   3876  C CB   . CYS A 1 259 ? -48.951 42.344  -48.698 1.00 38.23  ? 596 CYS B CB   1 
ATOM   3877  S SG   . CYS A 1 259 ? -48.923 40.883  -47.592 1.00 45.13  ? 596 CYS B SG   1 
ATOM   3878  H H    . CYS A 1 259 ? -46.671 42.477  -47.847 1.00 56.80  ? 596 CYS B H    1 
ATOM   3879  H HA   . CYS A 1 259 ? -48.367 44.311  -48.744 1.00 51.31  ? 596 CYS B HA   1 
ATOM   3880  H HB2  . CYS A 1 259 ? -49.878 42.550  -48.895 1.00 45.87  ? 596 CYS B HB2  1 
ATOM   3881  H HB3  . CYS A 1 259 ? -48.486 42.107  -49.516 1.00 45.87  ? 596 CYS B HB3  1 
ATOM   3882  H HG   . CYS A 1 259 ? -49.462 39.964  -48.144 1.00 54.16  ? 596 CYS B HG   1 
ATOM   3883  N N    . GLY A 1 260 ? -48.369 44.045  -45.701 1.00 37.52  ? 597 GLY B N    1 
ATOM   3884  C CA   . GLY A 1 260 ? -49.018 44.416  -44.455 1.00 42.33  ? 597 GLY B CA   1 
ATOM   3885  C C    . GLY A 1 260 ? -49.359 43.251  -43.534 1.00 40.28  ? 597 GLY B C    1 
ATOM   3886  O O    . GLY A 1 260 ? -49.524 43.456  -42.335 1.00 47.84  ? 597 GLY B O    1 
ATOM   3887  H H    . GLY A 1 260 ? -47.528 43.877  -45.628 1.00 45.02  ? 597 GLY B H    1 
ATOM   3888  H HA2  . GLY A 1 260 ? -48.438 45.022  -43.968 1.00 50.80  ? 597 GLY B HA2  1 
ATOM   3889  H HA3  . GLY A 1 260 ? -49.841 44.888  -44.658 1.00 50.80  ? 597 GLY B HA3  1 
ATOM   3890  N N    . VAL A 1 261 ? -49.487 42.039  -44.077 1.00 41.04  ? 598 VAL B N    1 
ATOM   3891  C CA   . VAL A 1 261 ? -49.763 40.865  -43.245 1.00 42.00  ? 598 VAL B CA   1 
ATOM   3892  C C    . VAL A 1 261 ? -48.660 40.715  -42.213 1.00 42.90  ? 598 VAL B C    1 
ATOM   3893  O O    . VAL A 1 261 ? -47.493 40.954  -42.511 1.00 36.78  ? 598 VAL B O    1 
ATOM   3894  C CB   . VAL A 1 261 ? -49.841 39.548  -44.065 1.00 32.65  ? 598 VAL B CB   1 
ATOM   3895  C CG1  . VAL A 1 261 ? -49.993 38.352  -43.145 1.00 29.70  ? 598 VAL B CG1  1 
ATOM   3896  C CG2  . VAL A 1 261 ? -51.001 39.593  -45.040 1.00 43.80  ? 598 VAL B CG2  1 
ATOM   3897  H H    . VAL A 1 261 ? -49.419 41.870  -44.918 1.00 49.25  ? 598 VAL B H    1 
ATOM   3898  H HA   . VAL A 1 261 ? -50.614 40.990  -42.775 1.00 50.40  ? 598 VAL B HA   1 
ATOM   3899  H HB   . VAL A 1 261 ? -49.013 39.437  -44.578 1.00 39.18  ? 598 VAL B HB   1 
ATOM   3900  H HG11 . VAL A 1 261 ? -50.039 37.554  -43.676 1.00 35.64  ? 598 VAL B HG11 1 
ATOM   3901  H HG12 . VAL A 1 261 ? -49.236 38.312  -42.557 1.00 35.64  ? 598 VAL B HG12 1 
ATOM   3902  H HG13 . VAL A 1 261 ? -50.800 38.452  -42.635 1.00 35.64  ? 598 VAL B HG13 1 
ATOM   3903  H HG21 . VAL A 1 261 ? -51.026 38.770  -45.533 1.00 52.56  ? 598 VAL B HG21 1 
ATOM   3904  H HG22 . VAL A 1 261 ? -51.817 39.706  -44.548 1.00 52.56  ? 598 VAL B HG22 1 
ATOM   3905  H HG23 . VAL A 1 261 ? -50.875 40.331  -45.641 1.00 52.56  ? 598 VAL B HG23 1 
ATOM   3906  N N    . GLN A 1 262 ? -49.034 40.327  -40.998 1.00 32.44  ? 599 GLN B N    1 
ATOM   3907  C CA   . GLN A 1 262 ? -48.056 40.026  -39.962 1.00 34.06  ? 599 GLN B CA   1 
ATOM   3908  C C    . GLN A 1 262 ? -48.247 38.597  -39.469 1.00 38.69  ? 599 GLN B C    1 
ATOM   3909  O O    . GLN A 1 262 ? -49.369 38.127  -39.302 1.00 39.08  ? 599 GLN B O    1 
ATOM   3910  C CB   . GLN A 1 262 ? -48.169 41.026  -38.811 1.00 40.73  ? 599 GLN B CB   1 
ATOM   3911  C CG   . GLN A 1 262 ? -47.734 42.431  -39.202 1.00 52.70  ? 599 GLN B CG   1 
ATOM   3912  C CD   . GLN A 1 262 ? -47.792 43.410  -38.051 1.00 66.25  ? 599 GLN B CD   1 
ATOM   3913  O OE1  . GLN A 1 262 ? -47.581 43.041  -36.898 1.00 71.21  ? 599 GLN B OE1  1 
ATOM   3914  N NE2  . GLN A 1 262 ? -48.081 44.669  -38.358 1.00 70.06  ? 599 GLN B NE2  1 
ATOM   3915  H H    . GLN A 1 262 ? -49.851 40.230  -40.749 1.00 38.93  ? 599 GLN B H    1 
ATOM   3916  H HA   . GLN A 1 262 ? -47.155 40.099  -40.341 1.00 40.88  ? 599 GLN B HA   1 
ATOM   3917  H HB2  . GLN A 1 262 ? -49.093 41.068  -38.520 1.00 48.88  ? 599 GLN B HB2  1 
ATOM   3918  H HB3  . GLN A 1 262 ? -47.604 40.730  -38.080 1.00 48.88  ? 599 GLN B HB3  1 
ATOM   3919  H HG2  . GLN A 1 262 ? -46.819 42.400  -39.523 1.00 63.25  ? 599 GLN B HG2  1 
ATOM   3920  H HG3  . GLN A 1 262 ? -48.320 42.758  -39.903 1.00 63.25  ? 599 GLN B HG3  1 
ATOM   3921  H HE21 . GLN A 1 262 ? -48.224 44.889  -39.177 1.00 84.07  ? 599 GLN B HE21 1 
ATOM   3922  H HE22 . GLN A 1 262 ? -48.126 45.263  -37.739 1.00 84.07  ? 599 GLN B HE22 1 
ATOM   3923  N N    . ILE A 1 263 ? -47.134 37.912  -39.244 1.00 35.90  ? 600 ILE B N    1 
ATOM   3924  C CA   . ILE A 1 263 ? -47.137 36.492  -38.916 1.00 37.49  ? 600 ILE B CA   1 
ATOM   3925  C C    . ILE A 1 263 ? -46.346 36.265  -37.635 1.00 39.96  ? 600 ILE B C    1 
ATOM   3926  O O    . ILE A 1 263 ? -45.190 36.665  -37.537 1.00 37.11  ? 600 ILE B O    1 
ATOM   3927  C CB   . ILE A 1 263 ? -46.510 35.691  -40.064 1.00 40.66  ? 600 ILE B CB   1 
ATOM   3928  C CG1  . ILE A 1 263 ? -47.358 35.868  -41.331 1.00 45.95  ? 600 ILE B CG1  1 
ATOM   3929  C CG2  . ILE A 1 263 ? -46.390 34.222  -39.709 1.00 41.52  ? 600 ILE B CG2  1 
ATOM   3930  C CD1  . ILE A 1 263 ? -46.801 35.169  -42.538 1.00 57.18  ? 600 ILE B CD1  1 
ATOM   3931  H H    . ILE A 1 263 ? -46.346 38.256  -39.275 1.00 43.08  ? 600 ILE B H    1 
ATOM   3932  H HA   . ILE A 1 263 ? -48.057 36.183  -38.780 1.00 44.99  ? 600 ILE B HA   1 
ATOM   3933  H HB   . ILE A 1 263 ? -45.622 36.041  -40.235 1.00 48.79  ? 600 ILE B HB   1 
ATOM   3934  H HG12 . ILE A 1 263 ? -48.245 35.512  -41.165 1.00 55.14  ? 600 ILE B HG12 1 
ATOM   3935  H HG13 . ILE A 1 263 ? -47.417 36.814  -41.537 1.00 55.14  ? 600 ILE B HG13 1 
ATOM   3936  H HG21 . ILE A 1 263 ? -45.995 33.754  -40.447 1.00 49.82  ? 600 ILE B HG21 1 
ATOM   3937  H HG22 . ILE A 1 263 ? -45.836 34.134  -38.930 1.00 49.82  ? 600 ILE B HG22 1 
ATOM   3938  H HG23 . ILE A 1 263 ? -47.266 33.872  -39.529 1.00 49.82  ? 600 ILE B HG23 1 
ATOM   3939  H HD11 . ILE A 1 263 ? -47.383 35.325  -43.285 1.00 68.62  ? 600 ILE B HD11 1 
ATOM   3940  H HD12 . ILE A 1 263 ? -45.927 35.517  -42.725 1.00 68.62  ? 600 ILE B HD12 1 
ATOM   3941  H HD13 . ILE A 1 263 ? -46.747 34.228  -42.356 1.00 68.62  ? 600 ILE B HD13 1 
ATOM   3942  N N    . GLN A 1 264 ? -46.976 35.646  -36.642 1.00 31.31  ? 601 GLN B N    1 
ATOM   3943  C CA   . GLN A 1 264 ? -46.272 35.323  -35.423 1.00 42.72  ? 601 GLN B CA   1 
ATOM   3944  C C    . GLN A 1 264 ? -45.594 33.975  -35.581 1.00 42.55  ? 601 GLN B C    1 
ATOM   3945  O O    . GLN A 1 264 ? -46.199 33.015  -36.057 1.00 33.87  ? 601 GLN B O    1 
ATOM   3946  C CB   . GLN A 1 264 ? -47.219 35.289  -34.225 1.00 49.42  ? 601 GLN B CB   1 
ATOM   3947  C CG   . GLN A 1 264 ? -46.508 35.042  -32.908 1.00 54.63  ? 601 GLN B CG   1 
ATOM   3948  C CD   . GLN A 1 264 ? -47.476 34.831  -31.758 1.00 75.56  ? 601 GLN B CD   1 
ATOM   3949  O OE1  . GLN A 1 264 ? -47.948 35.790  -31.146 1.00 83.58  ? 601 GLN B OE1  1 
ATOM   3950  N NE2  . GLN A 1 264 ? -47.780 33.569  -31.462 1.00 77.13  ? 601 GLN B NE2  1 
ATOM   3951  H H    . GLN A 1 264 ? -47.802 35.408  -36.655 1.00 37.57  ? 601 GLN B H    1 
ATOM   3952  H HA   . GLN A 1 264 ? -45.583 35.999  -35.254 1.00 51.26  ? 601 GLN B HA   1 
ATOM   3953  H HB2  . GLN A 1 264 ? -47.677 36.141  -34.162 1.00 59.30  ? 601 GLN B HB2  1 
ATOM   3954  H HB3  . GLN A 1 264 ? -47.863 34.576  -34.354 1.00 59.30  ? 601 GLN B HB3  1 
ATOM   3955  H HG2  . GLN A 1 264 ? -45.959 34.247  -32.989 1.00 65.56  ? 601 GLN B HG2  1 
ATOM   3956  H HG3  . GLN A 1 264 ? -45.954 35.810  -32.698 1.00 65.56  ? 601 GLN B HG3  1 
ATOM   3957  H HE21 . GLN A 1 264 ? -47.432 32.925  -31.914 1.00 92.56  ? 601 GLN B HE21 1 
ATOM   3958  H HE22 . GLN A 1 264 ? -48.323 33.397  -30.818 1.00 92.56  ? 601 GLN B HE22 1 
ATOM   3959  N N    . LEU A 1 265 ? -44.333 33.930  -35.173 1.00 42.68  ? 602 LEU B N    1 
ATOM   3960  C CA   . LEU A 1 265 ? -43.513 32.730  -35.204 1.00 40.82  ? 602 LEU B CA   1 
ATOM   3961  C C    . LEU A 1 265 ? -43.074 32.464  -33.772 1.00 42.91  ? 602 LEU B C    1 
ATOM   3962  O O    . LEU A 1 265 ? -42.405 33.304  -33.172 1.00 37.00  ? 602 LEU B O    1 
ATOM   3963  C CB   . LEU A 1 265 ? -42.299 32.992  -36.097 1.00 54.35  ? 602 LEU B CB   1 
ATOM   3964  C CG   . LEU A 1 265 ? -41.412 31.832  -36.544 1.00 65.98  ? 602 LEU B CG   1 
ATOM   3965  C CD1  . LEU A 1 265 ? -42.233 30.689  -37.102 1.00 73.28  ? 602 LEU B CD1  1 
ATOM   3966  C CD2  . LEU A 1 265 ? -40.420 32.329  -37.586 1.00 65.37  ? 602 LEU B CD2  1 
ATOM   3967  H H    . LEU A 1 265 ? -43.915 34.614  -34.861 1.00 51.22  ? 602 LEU B H    1 
ATOM   3968  H HA   . LEU A 1 265 ? -44.022 31.966  -35.546 1.00 48.99  ? 602 LEU B HA   1 
ATOM   3969  H HB2  . LEU A 1 265 ? -42.620 33.418  -36.906 1.00 65.22  ? 602 LEU B HB2  1 
ATOM   3970  H HB3  . LEU A 1 265 ? -41.721 33.613  -35.627 1.00 65.22  ? 602 LEU B HB3  1 
ATOM   3971  H HG   . LEU A 1 265 ? -40.911 31.501  -35.782 1.00 79.18  ? 602 LEU B HG   1 
ATOM   3972  H HD11 . LEU A 1 265 ? -41.641 29.982  -37.371 1.00 87.94  ? 602 LEU B HD11 1 
ATOM   3973  H HD12 . LEU A 1 265 ? -42.832 30.374  -36.422 1.00 87.94  ? 602 LEU B HD12 1 
ATOM   3974  H HD13 . LEU A 1 265 ? -42.732 31.004  -37.859 1.00 87.94  ? 602 LEU B HD13 1 
ATOM   3975  H HD21 . LEU A 1 265 ? -39.865 31.597  -37.863 1.00 78.45  ? 602 LEU B HD21 1 
ATOM   3976  H HD22 . LEU A 1 265 ? -40.905 32.676  -38.338 1.00 78.45  ? 602 LEU B HD22 1 
ATOM   3977  H HD23 . LEU A 1 265 ? -39.880 33.021  -37.197 1.00 78.45  ? 602 LEU B HD23 1 
ATOM   3978  N N    . GLY A 1 266 ? -43.471 31.319  -33.215 1.00 35.13  ? 603 GLY B N    1 
ATOM   3979  C CA   . GLY A 1 266 ? -43.129 30.971  -31.845 1.00 42.39  ? 603 GLY B CA   1 
ATOM   3980  C C    . GLY A 1 266 ? -42.346 29.676  -31.783 1.00 45.17  ? 603 GLY B C    1 
ATOM   3981  O O    . GLY A 1 266 ? -42.444 28.844  -32.691 1.00 36.67  ? 603 GLY B O    1 
ATOM   3982  H H    . GLY A 1 266 ? -43.943 30.724  -33.618 1.00 42.16  ? 603 GLY B H    1 
ATOM   3983  H HA2  . GLY A 1 266 ? -42.593 31.678  -31.453 1.00 50.87  ? 603 GLY B HA2  1 
ATOM   3984  H HA3  . GLY A 1 266 ? -43.940 30.870  -31.322 1.00 50.87  ? 603 GLY B HA3  1 
ATOM   3985  N N    . PHE A 1 267 ? -41.574 29.501  -30.711 1.00 33.02  ? 604 PHE B N    1 
ATOM   3986  C CA   . PHE A 1 267 ? -40.700 28.342  -30.581 1.00 32.52  ? 604 PHE B CA   1 
ATOM   3987  C C    . PHE A 1 267 ? -40.852 27.719  -29.201 1.00 43.19  ? 604 PHE B C    1 
ATOM   3988  O O    . PHE A 1 267 ? -40.891 28.437  -28.199 1.00 42.85  ? 604 PHE B O    1 
ATOM   3989  C CB   . PHE A 1 267 ? -39.243 28.760  -30.770 1.00 40.92  ? 604 PHE B CB   1 
ATOM   3990  C CG   . PHE A 1 267 ? -39.007 29.632  -31.973 1.00 41.61  ? 604 PHE B CG   1 
ATOM   3991  C CD1  . PHE A 1 267 ? -39.292 30.992  -31.931 1.00 47.28  ? 604 PHE B CD1  1 
ATOM   3992  C CD2  . PHE A 1 267 ? -38.486 29.099  -33.138 1.00 43.83  ? 604 PHE B CD2  1 
ATOM   3993  C CE1  . PHE A 1 267 ? -39.067 31.794  -33.028 1.00 47.11  ? 604 PHE B CE1  1 
ATOM   3994  C CE2  . PHE A 1 267 ? -38.262 29.898  -34.242 1.00 43.93  ? 604 PHE B CE2  1 
ATOM   3995  C CZ   . PHE A 1 267 ? -38.552 31.249  -34.187 1.00 42.13  ? 604 PHE B CZ   1 
ATOM   3996  H H    . PHE A 1 267 ? -41.540 30.042  -30.043 1.00 39.62  ? 604 PHE B H    1 
ATOM   3997  H HA   . PHE A 1 267 ? -40.929 27.673  -31.259 1.00 39.02  ? 604 PHE B HA   1 
ATOM   3998  H HB2  . PHE A 1 267 ? -38.956 29.253  -29.986 1.00 49.11  ? 604 PHE B HB2  1 
ATOM   3999  H HB3  . PHE A 1 267 ? -38.700 27.962  -30.872 1.00 49.11  ? 604 PHE B HB3  1 
ATOM   4000  H HD1  . PHE A 1 267 ? -39.638 31.364  -31.153 1.00 56.74  ? 604 PHE B HD1  1 
ATOM   4001  H HD2  . PHE A 1 267 ? -38.289 28.191  -33.179 1.00 52.60  ? 604 PHE B HD2  1 
ATOM   4002  H HE1  . PHE A 1 267 ? -39.265 32.702  -32.989 1.00 56.53  ? 604 PHE B HE1  1 
ATOM   4003  H HE2  . PHE A 1 267 ? -37.913 29.528  -35.021 1.00 52.72  ? 604 PHE B HE2  1 
ATOM   4004  H HZ   . PHE A 1 267 ? -38.401 31.788  -34.929 1.00 50.55  ? 604 PHE B HZ   1 
ATOM   4005  N N    . ALA A 1 268 ? -40.910 26.388  -29.154 1.00 36.04  ? 605 ALA B N    1 
ATOM   4006  C CA   . ALA A 1 268 ? -41.071 25.653  -27.901 1.00 38.64  ? 605 ALA B CA   1 
ATOM   4007  C C    . ALA A 1 268 ? -40.054 24.532  -27.837 1.00 46.47  ? 605 ALA B C    1 
ATOM   4008  O O    . ALA A 1 268 ? -39.827 23.836  -28.821 1.00 40.68  ? 605 ALA B O    1 
ATOM   4009  C CB   . ALA A 1 268 ? -42.470 25.072  -27.801 1.00 34.90  ? 605 ALA B CB   1 
ATOM   4010  H H    . ALA A 1 268 ? -40.858 25.881  -29.847 1.00 43.25  ? 605 ALA B H    1 
ATOM   4011  H HA   . ALA A 1 268 ? -40.925 26.256  -27.142 1.00 46.37  ? 605 ALA B HA   1 
ATOM   4012  H HB1  . ALA A 1 268 ? -42.551 24.595  -26.972 1.00 41.88  ? 605 ALA B HB1  1 
ATOM   4013  H HB2  . ALA A 1 268 ? -43.108 25.789  -27.831 1.00 41.88  ? 605 ALA B HB2  1 
ATOM   4014  H HB3  . ALA A 1 268 ? -42.613 24.475  -28.539 1.00 41.88  ? 605 ALA B HB3  1 
ATOM   4015  N N    . ALA A 1 269 ? -39.445 24.351  -26.675 1.00 40.03  ? 606 ALA B N    1 
ATOM   4016  C CA   . ALA A 1 269 ? -38.562 23.222  -26.467 1.00 33.43  ? 606 ALA B CA   1 
ATOM   4017  C C    . ALA A 1 269 ? -39.364 22.001  -25.988 1.00 48.64  ? 606 ALA B C    1 
ATOM   4018  O O    . ALA A 1 269 ? -40.216 22.112  -25.105 1.00 46.65  ? 606 ALA B O    1 
ATOM   4019  C CB   . ALA A 1 269 ? -37.483 23.585  -25.459 1.00 55.60  ? 606 ALA B CB   1 
ATOM   4020  H H    . ALA A 1 269 ? -39.528 24.868  -25.993 1.00 48.03  ? 606 ALA B H    1 
ATOM   4021  H HA   . ALA A 1 269 ? -38.126 22.991  -27.314 1.00 40.12  ? 606 ALA B HA   1 
ATOM   4022  H HB1  . ALA A 1 269 ? -36.907 22.828  -25.332 1.00 66.72  ? 606 ALA B HB1  1 
ATOM   4023  H HB2  . ALA A 1 269 ? -36.978 24.328  -25.796 1.00 66.72  ? 606 ALA B HB2  1 
ATOM   4024  H HB3  . ALA A 1 269 ? -37.900 23.822  -24.628 1.00 66.72  ? 606 ALA B HB3  1 
ATOM   4025  N N    . GLU A 1 270 ? -39.083 20.844  -26.583 1.00 43.39  ? 607 GLU B N    1 
ATOM   4026  C CA   . GLU A 1 270 ? -39.710 19.577  -26.204 1.00 47.55  ? 607 GLU B CA   1 
ATOM   4027  C C    . GLU A 1 270 ? -38.650 18.639  -25.602 1.00 43.03  ? 607 GLU B C    1 
ATOM   4028  O O    . GLU A 1 270 ? -38.911 17.896  -24.657 1.00 32.41  ? 607 GLU B O    1 
ATOM   4029  C CB   . GLU A 1 270 ? -40.370 18.932  -27.430 1.00 44.21  ? 607 GLU B CB   1 
ATOM   4030  C CG   . GLU A 1 270 ? -41.037 17.597  -27.151 1.00 38.64  ? 607 GLU B CG   1 
ATOM   4031  C CD   . GLU A 1 270 ? -41.555 16.915  -28.407 1.00 38.97  ? 607 GLU B CD   1 
ATOM   4032  O OE1  . GLU A 1 270 ? -41.754 17.611  -29.424 1.00 36.52  ? 607 GLU B OE1  1 
ATOM   4033  O OE2  . GLU A 1 270 ? -41.760 15.678  -28.383 1.00 28.47  ? 607 GLU B OE2  1 
ATOM   4034  H H    . GLU A 1 270 ? -38.517 20.765  -27.226 1.00 52.06  ? 607 GLU B H    1 
ATOM   4035  H HA   . GLU A 1 270 ? -40.401 19.741  -25.529 1.00 57.05  ? 607 GLU B HA   1 
ATOM   4036  H HB2  . GLU A 1 270 ? -41.048 19.536  -27.771 1.00 53.05  ? 607 GLU B HB2  1 
ATOM   4037  H HB3  . GLU A 1 270 ? -39.691 18.787  -28.108 1.00 53.05  ? 607 GLU B HB3  1 
ATOM   4038  H HG2  . GLU A 1 270 ? -40.393 17.004  -26.733 1.00 46.36  ? 607 GLU B HG2  1 
ATOM   4039  H HG3  . GLU A 1 270 ? -41.790 17.739  -26.556 1.00 46.36  ? 607 GLU B HG3  1 
ATOM   4040  N N    . PHE A 1 271 ? -37.461 18.674  -26.191 1.00 26.55  ? 608 PHE B N    1 
ATOM   4041  C CA   . PHE A 1 271 ? -36.263 18.095  -25.607 1.00 23.64  ? 608 PHE B CA   1 
ATOM   4042  C C    . PHE A 1 271 ? -35.141 19.092  -25.869 1.00 27.86  ? 608 PHE B C    1 
ATOM   4043  O O    . PHE A 1 271 ? -35.362 20.099  -26.545 1.00 36.38  ? 608 PHE B O    1 
ATOM   4044  C CB   . PHE A 1 271 ? -35.967 16.725  -26.234 1.00 24.73  ? 608 PHE B CB   1 
ATOM   4045  C CG   . PHE A 1 271 ? -37.010 15.687  -25.921 1.00 31.80  ? 608 PHE B CG   1 
ATOM   4046  C CD1  . PHE A 1 271 ? -36.852 14.832  -24.836 1.00 33.21  ? 608 PHE B CD1  1 
ATOM   4047  C CD2  . PHE A 1 271 ? -38.165 15.589  -26.684 1.00 28.30  ? 608 PHE B CD2  1 
ATOM   4048  C CE1  . PHE A 1 271 ? -37.817 13.886  -24.538 1.00 31.19  ? 608 PHE B CE1  1 
ATOM   4049  C CE2  . PHE A 1 271 ? -39.132 14.648  -26.392 1.00 28.71  ? 608 PHE B CE2  1 
ATOM   4050  C CZ   . PHE A 1 271 ? -38.966 13.801  -25.308 1.00 27.37  ? 608 PHE B CZ   1 
ATOM   4051  H H    . PHE A 1 271 ? -37.321 19.041  -26.956 1.00 31.87  ? 608 PHE B H    1 
ATOM   4052  H HA   . PHE A 1 271 ? -36.377 17.988  -24.640 1.00 28.37  ? 608 PHE B HA   1 
ATOM   4053  H HB2  . PHE A 1 271 ? -35.924 16.823  -27.198 1.00 29.68  ? 608 PHE B HB2  1 
ATOM   4054  H HB3  . PHE A 1 271 ? -35.116 16.402  -25.898 1.00 29.68  ? 608 PHE B HB3  1 
ATOM   4055  H HD1  . PHE A 1 271 ? -36.087 14.890  -24.312 1.00 39.85  ? 608 PHE B HD1  1 
ATOM   4056  H HD2  . PHE A 1 271 ? -38.285 16.160  -27.409 1.00 33.96  ? 608 PHE B HD2  1 
ATOM   4057  H HE1  . PHE A 1 271 ? -37.701 13.316  -23.812 1.00 37.43  ? 608 PHE B HE1  1 
ATOM   4058  H HE2  . PHE A 1 271 ? -39.899 14.591  -26.914 1.00 34.46  ? 608 PHE B HE2  1 
ATOM   4059  H HZ   . PHE A 1 271 ? -39.612 13.162  -25.112 1.00 32.85  ? 608 PHE B HZ   1 
ATOM   4060  N N    . SER A 1 272 ? -33.955 18.848  -25.322 1.00 28.21  ? 609 SER B N    1 
ATOM   4061  C CA   . SER A 1 272 ? -32.825 19.728  -25.596 1.00 29.54  ? 609 SER B CA   1 
ATOM   4062  C C    . SER A 1 272 ? -32.436 19.651  -27.072 1.00 42.93  ? 609 SER B C    1 
ATOM   4063  O O    . SER A 1 272 ? -31.710 20.510  -27.560 1.00 36.47  ? 609 SER B O    1 
ATOM   4064  C CB   . SER A 1 272 ? -31.615 19.385  -24.721 1.00 36.22  ? 609 SER B CB   1 
ATOM   4065  O OG   . SER A 1 272 ? -31.947 19.381  -23.344 1.00 34.30  ? 609 SER B OG   1 
ATOM   4066  H H    . SER A 1 272 ? -33.780 18.190  -24.796 1.00 33.86  ? 609 SER B H    1 
ATOM   4067  H HA   . SER A 1 272 ? -33.087 20.651  -25.400 1.00 35.45  ? 609 SER B HA   1 
ATOM   4068  H HB2  . SER A 1 272 ? -31.290 18.505  -24.968 1.00 43.47  ? 609 SER B HB2  1 
ATOM   4069  H HB3  . SER A 1 272 ? -30.922 20.046  -24.874 1.00 43.47  ? 609 SER B HB3  1 
ATOM   4070  H HG   . SER A 1 272 ? -31.285 19.195  -22.896 1.00 41.16  ? 609 SER B HG   1 
ATOM   4071  N N    . ASN A 1 273 ? -32.906 18.628  -27.787 1.00 33.54  ? 610 ASN B N    1 
ATOM   4072  C CA   . ASN A 1 273 ? -32.648 18.564  -29.226 1.00 39.26  ? 610 ASN B CA   1 
ATOM   4073  C C    . ASN A 1 273 ? -33.904 18.420  -30.076 1.00 32.91  ? 610 ASN B C    1 
ATOM   4074  O O    . ASN A 1 273 ? -33.826 18.010  -31.236 1.00 25.13  ? 610 ASN B O    1 
ATOM   4075  C CB   . ASN A 1 273 ? -31.650 17.455  -29.567 1.00 30.28  ? 610 ASN B CB   1 
ATOM   4076  C CG   . ASN A 1 273 ? -32.184 16.070  -29.290 1.00 29.42  ? 610 ASN B CG   1 
ATOM   4077  O OD1  . ASN A 1 273 ? -33.073 15.869  -28.453 1.00 32.28  ? 610 ASN B OD1  1 
ATOM   4078  N ND2  . ASN A 1 273 ? -31.616 15.089  -29.976 1.00 28.40  ? 610 ASN B ND2  1 
ATOM   4079  H H    . ASN A 1 273 ? -33.367 17.974  -27.472 1.00 40.24  ? 610 ASN B H    1 
ATOM   4080  H HA   . ASN A 1 273 ? -32.228 19.410  -29.488 1.00 47.11  ? 610 ASN B HA   1 
ATOM   4081  H HB2  . ASN A 1 273 ? -31.431 17.508  -30.511 1.00 36.33  ? 610 ASN B HB2  1 
ATOM   4082  H HB3  . ASN A 1 273 ? -30.848 17.578  -29.035 1.00 36.33  ? 610 ASN B HB3  1 
ATOM   4083  H HD21 . ASN A 1 273 ? -30.987 15.264  -30.535 1.00 34.08  ? 610 ASN B HD21 1 
ATOM   4084  H HD22 . ASN A 1 273 ? -31.877 14.277  -29.863 1.00 34.08  ? 610 ASN B HD22 1 
ATOM   4085  N N    . VAL A 1 274 ? -35.058 18.765  -29.511 1.00 30.43  ? 611 VAL B N    1 
ATOM   4086  C CA   . VAL A 1 274 ? -36.299 18.791  -30.286 1.00 23.19  ? 611 VAL B CA   1 
ATOM   4087  C C    . VAL A 1 274 ? -37.078 20.080  -29.991 1.00 35.44  ? 611 VAL B C    1 
ATOM   4088  O O    . VAL A 1 274 ? -37.437 20.335  -28.848 1.00 34.39  ? 611 VAL B O    1 
ATOM   4089  C CB   . VAL A 1 274 ? -37.189 17.580  -29.966 1.00 27.10  ? 611 VAL B CB   1 
ATOM   4090  C CG1  . VAL A 1 274 ? -38.428 17.588  -30.849 1.00 32.33  ? 611 VAL B CG1  1 
ATOM   4091  C CG2  . VAL A 1 274 ? -36.385 16.259  -30.122 1.00 20.62  ? 611 VAL B CG2  1 
ATOM   4092  H H    . VAL A 1 274 ? -35.151 18.988  -28.685 1.00 36.51  ? 611 VAL B H    1 
ATOM   4093  H HA   . VAL A 1 274 ? -36.085 18.772  -31.243 1.00 27.83  ? 611 VAL B HA   1 
ATOM   4094  H HB   . VAL A 1 274 ? -37.484 17.643  -29.033 1.00 32.52  ? 611 VAL B HB   1 
ATOM   4095  H HG11 . VAL A 1 274 ? -38.970 16.825  -30.634 1.00 38.80  ? 611 VAL B HG11 1 
ATOM   4096  H HG12 . VAL A 1 274 ? -38.921 18.396  -30.688 1.00 38.80  ? 611 VAL B HG12 1 
ATOM   4097  H HG13 . VAL A 1 274 ? -38.156 17.548  -31.769 1.00 38.80  ? 611 VAL B HG13 1 
ATOM   4098  H HG21 . VAL A 1 274 ? -36.960 15.518  -29.917 1.00 24.74  ? 611 VAL B HG21 1 
ATOM   4099  H HG22 . VAL A 1 274 ? -36.072 16.190  -31.027 1.00 24.74  ? 611 VAL B HG22 1 
ATOM   4100  H HG23 . VAL A 1 274 ? -35.640 16.273  -29.517 1.00 24.74  ? 611 VAL B HG23 1 
ATOM   4101  N N    . MET A 1 275 ? -37.328 20.879  -31.024 1.00 29.64  ? 612 MET B N    1 
ATOM   4102  C CA   . MET A 1 275 ? -38.020 22.171  -30.880 1.00 28.41  ? 612 MET B CA   1 
ATOM   4103  C C    . MET A 1 275 ? -39.239 22.176  -31.794 1.00 36.09  ? 612 MET B C    1 
ATOM   4104  O O    . MET A 1 275 ? -39.187 21.633  -32.888 1.00 35.45  ? 612 MET B O    1 
ATOM   4105  C CB   . MET A 1 275 ? -37.077 23.317  -31.267 1.00 30.04  ? 612 MET B CB   1 
ATOM   4106  C CG   . MET A 1 275 ? -37.661 24.728  -31.091 1.00 39.94  ? 612 MET B CG   1 
ATOM   4107  S SD   . MET A 1 275 ? -36.485 26.053  -31.465 1.00 41.51  ? 612 MET B SD   1 
ATOM   4108  C CE   . MET A 1 275 ? -36.299 25.888  -33.238 1.00 45.08  ? 612 MET B CE   1 
ATOM   4109  H H    . MET A 1 275 ? -37.106 20.698  -31.835 1.00 35.57  ? 612 MET B H    1 
ATOM   4110  H HA   . MET A 1 275 ? -38.302 22.295  -29.950 1.00 34.09  ? 612 MET B HA   1 
ATOM   4111  H HB2  . MET A 1 275 ? -36.280 23.260  -30.717 1.00 36.05  ? 612 MET B HB2  1 
ATOM   4112  H HB3  . MET A 1 275 ? -36.835 23.215  -32.201 1.00 36.05  ? 612 MET B HB3  1 
ATOM   4113  H HG2  . MET A 1 275 ? -38.421 24.829  -31.686 1.00 47.93  ? 612 MET B HG2  1 
ATOM   4114  H HG3  . MET A 1 275 ? -37.947 24.836  -30.170 1.00 47.93  ? 612 MET B HG3  1 
ATOM   4115  H HE1  . MET A 1 275 ? -35.684 26.555  -33.550 1.00 54.10  ? 612 MET B HE1  1 
ATOM   4116  H HE2  . MET A 1 275 ? -35.961 25.012  -33.436 1.00 54.10  ? 612 MET B HE2  1 
ATOM   4117  H HE3  . MET A 1 275 ? -37.155 26.011  -33.654 1.00 54.10  ? 612 MET B HE3  1 
ATOM   4118  N N    . ILE A 1 276 ? -40.333 22.778  -31.338 1.00 30.52  ? 613 ILE B N    1 
ATOM   4119  C CA   . ILE A 1 276 ? -41.533 22.928  -32.145 1.00 32.68  ? 613 ILE B CA   1 
ATOM   4120  C C    . ILE A 1 276 ? -41.632 24.381  -32.567 1.00 36.96  ? 613 ILE B C    1 
ATOM   4121  O O    . ILE A 1 276 ? -41.532 25.277  -31.737 1.00 37.20  ? 613 ILE B O    1 
ATOM   4122  C CB   . ILE A 1 276 ? -42.802 22.566  -31.345 1.00 34.09  ? 613 ILE B CB   1 
ATOM   4123  C CG1  . ILE A 1 276 ? -42.720 21.128  -30.820 1.00 46.46  ? 613 ILE B CG1  1 
ATOM   4124  C CG2  . ILE A 1 276 ? -44.039 22.747  -32.206 1.00 40.42  ? 613 ILE B CG2  1 
ATOM   4125  C CD1  . ILE A 1 276 ? -42.899 20.074  -31.884 1.00 48.09  ? 613 ILE B CD1  1 
ATOM   4126  H H    . ILE A 1 276 ? -40.403 23.114  -30.550 1.00 36.62  ? 613 ILE B H    1 
ATOM   4127  H HA   . ILE A 1 276 ? -41.480 22.361  -32.943 1.00 39.22  ? 613 ILE B HA   1 
ATOM   4128  H HB   . ILE A 1 276 ? -42.867 23.166  -30.586 1.00 40.91  ? 613 ILE B HB   1 
ATOM   4129  H HG12 . ILE A 1 276 ? -41.849 20.994  -30.414 1.00 55.75  ? 613 ILE B HG12 1 
ATOM   4130  H HG13 . ILE A 1 276 ? -43.414 20.998  -30.155 1.00 55.75  ? 613 ILE B HG13 1 
ATOM   4131  H HG21 . ILE A 1 276 ? -44.815 22.517  -31.690 1.00 48.51  ? 613 ILE B HG21 1 
ATOM   4132  H HG22 . ILE A 1 276 ? -44.091 23.664  -32.487 1.00 48.51  ? 613 ILE B HG22 1 
ATOM   4133  H HG23 . ILE A 1 276 ? -43.972 22.173  -32.972 1.00 48.51  ? 613 ILE B HG23 1 
ATOM   4134  H HD11 . ILE A 1 276 ? -42.835 19.206  -31.478 1.00 57.71  ? 613 ILE B HD11 1 
ATOM   4135  H HD12 . ILE A 1 276 ? -43.763 20.183  -32.289 1.00 57.71  ? 613 ILE B HD12 1 
ATOM   4136  H HD13 . ILE A 1 276 ? -42.211 20.178  -32.545 1.00 57.71  ? 613 ILE B HD13 1 
ATOM   4137  N N    . ILE A 1 277 ? -41.785 24.614  -33.864 1.00 24.88  ? 614 ILE B N    1 
ATOM   4138  C CA   . ILE A 1 277 ? -42.076 25.941  -34.371 1.00 28.89  ? 614 ILE B CA   1 
ATOM   4139  C C    . ILE A 1 277 ? -43.557 25.967  -34.692 1.00 37.83  ? 614 ILE B C    1 
ATOM   4140  O O    . ILE A 1 277 ? -44.124 24.968  -35.134 1.00 34.90  ? 614 ILE B O    1 
ATOM   4141  C CB   . ILE A 1 277 ? -41.253 26.241  -35.648 1.00 31.91  ? 614 ILE B CB   1 
ATOM   4142  C CG1  . ILE A 1 277 ? -39.758 26.164  -35.322 1.00 39.47  ? 614 ILE B CG1  1 
ATOM   4143  C CG2  . ILE A 1 277 ? -41.610 27.599  -36.219 1.00 34.36  ? 614 ILE B CG2  1 
ATOM   4144  C CD1  . ILE A 1 277 ? -38.857 26.329  -36.515 1.00 43.67  ? 614 ILE B CD1  1 
ATOM   4145  H H    . ILE A 1 277 ? -41.724 24.012  -34.475 1.00 29.85  ? 614 ILE B H    1 
ATOM   4146  H HA   . ILE A 1 277 ? -41.879 26.618  -33.690 1.00 34.67  ? 614 ILE B HA   1 
ATOM   4147  H HB   . ILE A 1 277 ? -41.458 25.565  -36.313 1.00 38.29  ? 614 ILE B HB   1 
ATOM   4148  H HG12 . ILE A 1 277 ? -39.541 26.867  -34.689 1.00 47.36  ? 614 ILE B HG12 1 
ATOM   4149  H HG13 . ILE A 1 277 ? -39.569 25.299  -34.927 1.00 47.36  ? 614 ILE B HG13 1 
ATOM   4150  H HG21 . ILE A 1 277 ? -41.084 27.754  -37.007 1.00 41.23  ? 614 ILE B HG21 1 
ATOM   4151  H HG22 . ILE A 1 277 ? -42.544 27.609  -36.440 1.00 41.23  ? 614 ILE B HG22 1 
ATOM   4152  H HG23 . ILE A 1 277 ? -41.422 28.273  -35.561 1.00 41.23  ? 614 ILE B HG23 1 
ATOM   4153  H HD11 . ILE A 1 277 ? -37.943 26.268  -36.227 1.00 52.40  ? 614 ILE B HD11 1 
ATOM   4154  H HD12 . ILE A 1 277 ? -39.048 25.633  -37.148 1.00 52.40  ? 614 ILE B HD12 1 
ATOM   4155  H HD13 . ILE A 1 277 ? -39.019 27.187  -36.913 1.00 52.40  ? 614 ILE B HD13 1 
ATOM   4156  N N    . TYR A 1 278 ? -44.200 27.099  -34.454 1.00 42.95  ? 615 TYR B N    1 
ATOM   4157  C CA   . TYR A 1 278 ? -45.586 27.244  -34.853 1.00 43.20  ? 615 TYR B CA   1 
ATOM   4158  C C    . TYR A 1 278 ? -45.818 28.649  -35.393 1.00 39.86  ? 615 TYR B C    1 
ATOM   4159  O O    . TYR A 1 278 ? -45.181 29.605  -34.959 1.00 32.42  ? 615 TYR B O    1 
ATOM   4160  C CB   . TYR A 1 278 ? -46.536 26.911  -33.697 1.00 41.33  ? 615 TYR B CB   1 
ATOM   4161  C CG   . TYR A 1 278 ? -46.236 27.635  -32.406 1.00 48.88  ? 615 TYR B CG   1 
ATOM   4162  C CD1  . TYR A 1 278 ? -46.816 28.863  -32.126 1.00 58.72  ? 615 TYR B CD1  1 
ATOM   4163  C CD2  . TYR A 1 278 ? -45.382 27.081  -31.461 1.00 52.08  ? 615 TYR B CD2  1 
ATOM   4164  C CE1  . TYR A 1 278 ? -46.545 29.527  -30.946 1.00 62.33  ? 615 TYR B CE1  1 
ATOM   4165  C CE2  . TYR A 1 278 ? -45.107 27.736  -30.278 1.00 54.90  ? 615 TYR B CE2  1 
ATOM   4166  C CZ   . TYR A 1 278 ? -45.692 28.957  -30.025 1.00 66.26  ? 615 TYR B CZ   1 
ATOM   4167  O OH   . TYR A 1 278 ? -45.420 29.614  -28.846 1.00 76.14  ? 615 TYR B OH   1 
ATOM   4168  H H    . TYR A 1 278 ? -43.862 27.789  -34.067 1.00 51.54  ? 615 TYR B H    1 
ATOM   4169  H HA   . TYR A 1 278 ? -45.770 26.612  -35.580 1.00 51.84  ? 615 TYR B HA   1 
ATOM   4170  H HB2  . TYR A 1 278 ? -47.440 27.145  -33.961 1.00 49.60  ? 615 TYR B HB2  1 
ATOM   4171  H HB3  . TYR A 1 278 ? -46.486 25.959  -33.518 1.00 49.60  ? 615 TYR B HB3  1 
ATOM   4172  H HD1  . TYR A 1 278 ? -47.391 29.249  -32.746 1.00 70.47  ? 615 TYR B HD1  1 
ATOM   4173  H HD2  . TYR A 1 278 ? -44.986 26.257  -31.630 1.00 62.50  ? 615 TYR B HD2  1 
ATOM   4174  H HE1  . TYR A 1 278 ? -46.939 30.351  -30.772 1.00 74.80  ? 615 TYR B HE1  1 
ATOM   4175  H HE2  . TYR A 1 278 ? -44.531 27.354  -29.655 1.00 65.88  ? 615 TYR B HE2  1 
ATOM   4176  H HH   . TYR A 1 278 ? -44.616 29.766  -28.788 1.00 91.36  ? 615 TYR B HH   1 
ATOM   4177  N N    . THR A 1 279 ? -46.703 28.755  -36.375 1.00 39.08  ? 616 THR B N    1 
ATOM   4178  C CA   . THR A 1 279 ? -46.964 30.028  -37.028 1.00 38.18  ? 616 THR B CA   1 
ATOM   4179  C C    . THR A 1 279 ? -48.451 30.302  -37.004 1.00 39.94  ? 616 THR B C    1 
ATOM   4180  O O    . THR A 1 279 ? -49.255 29.373  -36.983 1.00 40.32  ? 616 THR B O    1 
ATOM   4181  C CB   . THR A 1 279 ? -46.503 30.004  -38.490 1.00 41.33  ? 616 THR B CB   1 
ATOM   4182  O OG1  . THR A 1 279 ? -47.126 28.905  -39.164 1.00 41.50  ? 616 THR B OG1  1 
ATOM   4183  C CG2  . THR A 1 279 ? -44.997 29.853  -38.569 1.00 45.78  ? 616 THR B CG2  1 
ATOM   4184  H H    . THR A 1 279 ? -47.168 28.101  -36.683 1.00 46.89  ? 616 THR B H    1 
ATOM   4185  H HA   . THR A 1 279 ? -46.497 30.750  -36.557 1.00 45.82  ? 616 THR B HA   1 
ATOM   4186  H HB   . THR A 1 279 ? -46.754 30.835  -38.923 1.00 49.60  ? 616 THR B HB   1 
ATOM   4187  H HG1  . THR A 1 279 ? -46.885 28.884  -39.948 1.00 49.80  ? 616 THR B HG1  1 
ATOM   4188  H HG21 . THR A 1 279 ? -44.717 29.838  -39.488 1.00 54.93  ? 616 THR B HG21 1 
ATOM   4189  H HG22 . THR A 1 279 ? -44.570 30.589  -38.125 1.00 54.93  ? 616 THR B HG22 1 
ATOM   4190  H HG23 . THR A 1 279 ? -44.727 29.034  -38.148 1.00 54.93  ? 616 THR B HG23 1 
ATOM   4191  N N    . SER A 1 280 ? -48.811 31.580  -37.001 1.00 40.41  ? 617 SER B N    1 
ATOM   4192  C CA   . SER A 1 280 ? -50.205 31.990  -37.110 1.00 46.63  ? 617 SER B CA   1 
ATOM   4193  C C    . SER A 1 280 ? -50.285 33.395  -37.696 1.00 42.83  ? 617 SER B C    1 
ATOM   4194  O O    . SER A 1 280 ? -49.356 34.191  -37.546 1.00 40.65  ? 617 SER B O    1 
ATOM   4195  C CB   . SER A 1 280 ? -50.865 31.970  -35.737 1.00 53.11  ? 617 SER B CB   1 
ATOM   4196  O OG   . SER A 1 280 ? -50.210 32.868  -34.863 1.00 52.27  ? 617 SER B OG   1 
ATOM   4197  H H    . SER A 1 280 ? -48.259 32.237  -36.936 1.00 48.49  ? 617 SER B H    1 
ATOM   4198  H HA   . SER A 1 280 ? -50.686 31.374  -37.701 1.00 55.96  ? 617 SER B HA   1 
ATOM   4199  H HB2  . SER A 1 280 ? -51.794 32.235  -35.827 1.00 63.74  ? 617 SER B HB2  1 
ATOM   4200  H HB3  . SER A 1 280 ? -50.809 31.073  -35.371 1.00 63.74  ? 617 SER B HB3  1 
ATOM   4201  H HG   . SER A 1 280 ? -50.568 32.853  -34.125 1.00 62.72  ? 617 SER B HG   1 
ATOM   4202  N N    . ILE A 1 281 ? -51.391 33.700  -38.369 1.00 42.03  ? 618 ILE B N    1 
ATOM   4203  C CA   . ILE A 1 281 ? -51.623 35.055  -38.848 1.00 42.94  ? 618 ILE B CA   1 
ATOM   4204  C C    . ILE A 1 281 ? -52.076 35.911  -37.672 1.00 52.99  ? 618 ILE B C    1 
ATOM   4205  O O    . ILE A 1 281 ? -53.096 35.625  -37.045 1.00 48.27  ? 618 ILE B O    1 
ATOM   4206  C CB   . ILE A 1 281 ? -52.694 35.096  -39.955 1.00 46.08  ? 618 ILE B CB   1 
ATOM   4207  C CG1  . ILE A 1 281 ? -52.331 34.125  -41.073 1.00 45.19  ? 618 ILE B CG1  1 
ATOM   4208  C CG2  . ILE A 1 281 ? -52.836 36.513  -40.513 1.00 52.13  ? 618 ILE B CG2  1 
ATOM   4209  C CD1  . ILE A 1 281 ? -50.972 34.384  -41.667 1.00 51.96  ? 618 ILE B CD1  1 
ATOM   4210  H H    . ILE A 1 281 ? -52.018 33.143  -38.559 1.00 50.43  ? 618 ILE B H    1 
ATOM   4211  H HA   . ILE A 1 281 ? -50.789 35.426  -39.204 1.00 51.53  ? 618 ILE B HA   1 
ATOM   4212  H HB   . ILE A 1 281 ? -53.544 34.826  -39.574 1.00 55.29  ? 618 ILE B HB   1 
ATOM   4213  H HG12 . ILE A 1 281 ? -52.334 33.223  -40.718 1.00 54.22  ? 618 ILE B HG12 1 
ATOM   4214  H HG13 . ILE A 1 281 ? -52.987 34.204  -41.783 1.00 54.22  ? 618 ILE B HG13 1 
ATOM   4215  H HG21 . ILE A 1 281 ? -53.508 36.512  -41.199 1.00 62.56  ? 618 ILE B HG21 1 
ATOM   4216  H HG22 . ILE A 1 281 ? -53.095 37.104  -39.802 1.00 62.56  ? 618 ILE B HG22 1 
ATOM   4217  H HG23 . ILE A 1 281 ? -51.993 36.790  -40.879 1.00 62.56  ? 618 ILE B HG23 1 
ATOM   4218  H HD11 . ILE A 1 281 ? -50.807 33.741  -42.361 1.00 62.35  ? 618 ILE B HD11 1 
ATOM   4219  H HD12 . ILE A 1 281 ? -50.955 35.272  -42.032 1.00 62.35  ? 618 ILE B HD12 1 
ATOM   4220  H HD13 . ILE A 1 281 ? -50.308 34.300  -40.979 1.00 62.35  ? 618 ILE B HD13 1 
ATOM   4221  N N    . VAL A 1 282 ? -51.304 36.947  -37.361 1.00 45.60  ? 619 VAL B N    1 
ATOM   4222  C CA   . VAL A 1 282 ? -51.674 37.866  -36.295 1.00 47.52  ? 619 VAL B CA   1 
ATOM   4223  C C    . VAL A 1 282 ? -52.301 39.136  -36.857 1.00 51.90  ? 619 VAL B C    1 
ATOM   4224  O O    . VAL A 1 282 ? -52.943 39.887  -36.124 1.00 53.71  ? 619 VAL B O    1 
ATOM   4225  C CB   . VAL A 1 282 ? -50.473 38.240  -35.418 1.00 48.30  ? 619 VAL B CB   1 
ATOM   4226  C CG1  . VAL A 1 282 ? -49.888 36.986  -34.772 1.00 54.11  ? 619 VAL B CG1  1 
ATOM   4227  C CG2  . VAL A 1 282 ? -49.419 38.975  -36.228 1.00 47.05  ? 619 VAL B CG2  1 
ATOM   4228  H H    . VAL A 1 282 ? -50.562 37.137  -37.751 1.00 54.73  ? 619 VAL B H    1 
ATOM   4229  H HA   . VAL A 1 282 ? -52.340 37.432  -35.722 1.00 57.02  ? 619 VAL B HA   1 
ATOM   4230  H HB   . VAL A 1 282 ? -50.774 38.837  -34.702 1.00 57.97  ? 619 VAL B HB   1 
ATOM   4231  H HG11 . VAL A 1 282 ? -49.138 37.236  -34.227 1.00 64.94  ? 619 VAL B HG11 1 
ATOM   4232  H HG12 . VAL A 1 282 ? -50.563 36.570  -34.230 1.00 64.94  ? 619 VAL B HG12 1 
ATOM   4233  H HG13 . VAL A 1 282 ? -49.604 36.382  -35.462 1.00 64.94  ? 619 VAL B HG13 1 
ATOM   4234  H HG21 . VAL A 1 282 ? -48.681 39.195  -35.654 1.00 56.46  ? 619 VAL B HG21 1 
ATOM   4235  H HG22 . VAL A 1 282 ? -49.120 38.405  -36.941 1.00 56.46  ? 619 VAL B HG22 1 
ATOM   4236  H HG23 . VAL A 1 282 ? -49.805 39.776  -36.588 1.00 56.46  ? 619 VAL B HG23 1 
ATOM   4237  N N    . TYR A 1 283 ? -52.114 39.385  -38.149 1.00 48.70  ? 620 TYR B N    1 
ATOM   4238  C CA   . TYR A 1 283 ? -52.754 40.543  -38.784 1.00 46.11  ? 620 TYR B CA   1 
ATOM   4239  C C    . TYR A 1 283 ? -52.874 40.421  -40.301 1.00 46.69  ? 620 TYR B C    1 
ATOM   4240  O O    . TYR A 1 283 ? -51.893 40.181  -40.992 1.00 36.55  ? 620 TYR B O    1 
ATOM   4241  C CB   . TYR A 1 283 ? -52.004 41.833  -38.457 1.00 46.48  ? 620 TYR B CB   1 
ATOM   4242  C CG   . TYR A 1 283 ? -52.598 43.030  -39.170 1.00 56.62  ? 620 TYR B CG   1 
ATOM   4243  C CD1  . TYR A 1 283 ? -52.061 43.492  -40.363 1.00 61.50  ? 620 TYR B CD1  1 
ATOM   4244  C CD2  . TYR A 1 283 ? -53.715 43.677  -38.662 1.00 75.17  ? 620 TYR B CD2  1 
ATOM   4245  C CE1  . TYR A 1 283 ? -52.615 44.585  -41.024 1.00 71.30  ? 620 TYR B CE1  1 
ATOM   4246  C CE2  . TYR A 1 283 ? -54.274 44.768  -39.312 1.00 78.26  ? 620 TYR B CE2  1 
ATOM   4247  C CZ   . TYR A 1 283 ? -53.721 45.216  -40.490 1.00 76.52  ? 620 TYR B CZ   1 
ATOM   4248  O OH   . TYR A 1 283 ? -54.280 46.296  -41.133 1.00 82.11  ? 620 TYR B OH   1 
ATOM   4249  H H    . TYR A 1 283 ? -51.630 38.908  -38.677 1.00 58.44  ? 620 TYR B H    1 
ATOM   4250  H HA   . TYR A 1 283 ? -53.661 40.631  -38.424 1.00 55.33  ? 620 TYR B HA   1 
ATOM   4251  H HB2  . TYR A 1 283 ? -52.051 41.996  -37.502 1.00 55.77  ? 620 TYR B HB2  1 
ATOM   4252  H HB3  . TYR A 1 283 ? -51.079 41.743  -38.735 1.00 55.77  ? 620 TYR B HB3  1 
ATOM   4253  H HD1  . TYR A 1 283 ? -51.316 43.070  -40.723 1.00 73.80  ? 620 TYR B HD1  1 
ATOM   4254  H HD2  . TYR A 1 283 ? -54.091 43.379  -37.865 1.00 90.20  ? 620 TYR B HD2  1 
ATOM   4255  H HE1  . TYR A 1 283 ? -52.242 44.889  -41.820 1.00 85.56  ? 620 TYR B HE1  1 
ATOM   4256  H HE2  . TYR A 1 283 ? -55.019 45.193  -38.955 1.00 93.92  ? 620 TYR B HE2  1 
ATOM   4257  H HH   . TYR A 1 283 ? -54.260 46.954  -40.645 1.00 98.54  ? 620 TYR B HH   1 
ATOM   4258  N N    . LYS A 1 284 ? -54.085 40.622  -40.811 1.00 51.29  ? 621 LYS B N    1 
ATOM   4259  C CA   . LYS A 1 284 ? -54.336 40.607  -42.244 1.00 54.92  ? 621 LYS B CA   1 
ATOM   4260  C C    . LYS A 1 284 ? -55.060 41.886  -42.653 1.00 59.34  ? 621 LYS B C    1 
ATOM   4261  O O    . LYS A 1 284 ? -56.203 42.102  -42.260 1.00 60.95  ? 621 LYS B O    1 
ATOM   4262  C CB   . LYS A 1 284 ? -55.183 39.395  -42.624 1.00 60.85  ? 621 LYS B CB   1 
ATOM   4263  C CG   . LYS A 1 284 ? -55.634 39.394  -44.075 1.00 66.98  ? 621 LYS B CG   1 
ATOM   4264  C CD   . LYS A 1 284 ? -56.506 38.191  -44.390 1.00 74.09  ? 621 LYS B CD   1 
ATOM   4265  C CE   . LYS A 1 284 ? -57.788 38.205  -43.578 1.00 83.28  ? 621 LYS B CE   1 
ATOM   4266  N NZ   . LYS A 1 284 ? -58.648 37.030  -43.878 1.00 90.18  ? 621 LYS B NZ   1 
ATOM   4267  H H    . LYS A 1 284 ? -54.787 40.772  -40.339 1.00 61.55  ? 621 LYS B H    1 
ATOM   4268  H HA   . LYS A 1 284 ? -53.485 40.560  -42.728 1.00 65.90  ? 621 LYS B HA   1 
ATOM   4269  H HB2  . LYS A 1 284 ? -54.663 38.591  -42.474 1.00 73.02  ? 621 LYS B HB2  1 
ATOM   4270  H HB3  . LYS A 1 284 ? -55.977 39.382  -42.067 1.00 73.02  ? 621 LYS B HB3  1 
ATOM   4271  H HG2  . LYS A 1 284 ? -56.150 40.197  -44.251 1.00 80.38  ? 621 LYS B HG2  1 
ATOM   4272  H HG3  . LYS A 1 284 ? -54.855 39.363  -44.652 1.00 80.38  ? 621 LYS B HG3  1 
ATOM   4273  H HD2  . LYS A 1 284 ? -56.742 38.204  -45.331 1.00 88.91  ? 621 LYS B HD2  1 
ATOM   4274  H HD3  . LYS A 1 284 ? -56.020 37.379  -44.177 1.00 88.91  ? 621 LYS B HD3  1 
ATOM   4275  H HE2  . LYS A 1 284 ? -57.567 38.185  -42.634 1.00 99.94  ? 621 LYS B HE2  1 
ATOM   4276  H HE3  . LYS A 1 284 ? -58.289 39.008  -43.788 1.00 99.94  ? 621 LYS B HE3  1 
ATOM   4277  H HZ1  . LYS A 1 284 ? -59.391 37.064  -43.389 1.00 108.21 ? 621 LYS B HZ1  1 
ATOM   4278  H HZ2  . LYS A 1 284 ? -58.869 37.027  -44.741 1.00 108.21 ? 621 LYS B HZ2  1 
ATOM   4279  H HZ3  . LYS A 1 284 ? -58.211 36.277  -43.689 1.00 108.21 ? 621 LYS B HZ3  1 
ATOM   4280  N N    . PRO A 1 285 ? -54.392 42.738  -43.444 1.00 56.58  ? 622 PRO B N    1 
ATOM   4281  C CA   . PRO A 1 285 ? -54.983 44.019  -43.848 1.00 61.18  ? 622 PRO B CA   1 
ATOM   4282  C C    . PRO A 1 285 ? -56.387 43.846  -44.415 1.00 60.05  ? 622 PRO B C    1 
ATOM   4283  O O    . PRO A 1 285 ? -56.676 42.804  -44.998 1.00 55.75  ? 622 PRO B O    1 
ATOM   4284  C CB   . PRO A 1 285 ? -54.026 44.517  -44.935 1.00 61.26  ? 622 PRO B CB   1 
ATOM   4285  C CG   . PRO A 1 285 ? -52.714 43.891  -44.594 1.00 54.26  ? 622 PRO B CG   1 
ATOM   4286  C CD   . PRO A 1 285 ? -53.048 42.540  -44.018 1.00 50.47  ? 622 PRO B CD   1 
ATOM   4287  H HA   . PRO A 1 285 ? -54.997 44.651  -43.099 1.00 73.42  ? 622 PRO B HA   1 
ATOM   4288  H HB2  . PRO A 1 285 ? -54.334 44.220  -45.805 1.00 73.51  ? 622 PRO B HB2  1 
ATOM   4289  H HB3  . PRO A 1 285 ? -53.966 45.485  -44.901 1.00 73.51  ? 622 PRO B HB3  1 
ATOM   4290  H HG2  . PRO A 1 285 ? -52.179 43.798  -45.398 1.00 65.12  ? 622 PRO B HG2  1 
ATOM   4291  H HG3  . PRO A 1 285 ? -52.253 44.438  -43.938 1.00 65.12  ? 622 PRO B HG3  1 
ATOM   4292  H HD2  . PRO A 1 285 ? -53.075 41.870  -44.720 1.00 60.56  ? 622 PRO B HD2  1 
ATOM   4293  H HD3  . PRO A 1 285 ? -52.415 42.302  -43.323 1.00 60.56  ? 622 PRO B HD3  1 
ATOM   4294  N N    . PRO A 1 286 ? -57.254 44.858  -44.243 1.00 73.12  ? 623 PRO B N    1 
ATOM   4295  C CA   . PRO A 1 286 ? -58.629 44.785  -44.753 1.00 75.03  ? 623 PRO B CA   1 
ATOM   4296  C C    . PRO A 1 286 ? -58.677 44.498  -46.253 1.00 67.61  ? 623 PRO B C    1 
ATOM   4297  O O    . PRO A 1 286 ? -59.574 43.799  -46.722 1.00 67.41  ? 623 PRO B O    1 
ATOM   4298  C CB   . PRO A 1 286 ? -59.187 46.184  -44.465 1.00 81.51  ? 623 PRO B CB   1 
ATOM   4299  C CG   . PRO A 1 286 ? -58.346 46.722  -43.363 1.00 84.42  ? 623 PRO B CG   1 
ATOM   4300  C CD   . PRO A 1 286 ? -56.980 46.138  -43.565 1.00 78.83  ? 623 PRO B CD   1 
ATOM   4301  H HA   . PRO A 1 286 ? -59.148 44.112  -44.265 1.00 90.03  ? 623 PRO B HA   1 
ATOM   4302  H HB2  . PRO A 1 286 ? -59.106 46.737  -45.257 1.00 97.81  ? 623 PRO B HB2  1 
ATOM   4303  H HB3  . PRO A 1 286 ? -60.113 46.116  -44.186 1.00 97.81  ? 623 PRO B HB3  1 
ATOM   4304  H HG2  . PRO A 1 286 ? -58.315 47.690  -43.421 1.00 101.31 ? 623 PRO B HG2  1 
ATOM   4305  H HG3  . PRO A 1 286 ? -58.713 46.443  -42.509 1.00 101.31 ? 623 PRO B HG3  1 
ATOM   4306  H HD2  . PRO A 1 286 ? -56.446 46.714  -44.134 1.00 94.60  ? 623 PRO B HD2  1 
ATOM   4307  H HD3  . PRO A 1 286 ? -56.548 45.982  -42.711 1.00 94.60  ? 623 PRO B HD3  1 
ATOM   4308  N N    . GLU A 1 287 ? -57.700 45.020  -46.987 1.00 67.83  ? 624 GLU B N    1 
ATOM   4309  C CA   . GLU A 1 287 ? -57.689 44.932  -48.443 1.00 65.89  ? 624 GLU B CA   1 
ATOM   4310  C C    . GLU A 1 287 ? -57.225 43.569  -48.949 1.00 58.53  ? 624 GLU B C    1 
ATOM   4311  O O    . GLU A 1 287 ? -57.169 43.333  -50.156 1.00 52.38  ? 624 GLU B O    1 
ATOM   4312  C CB   . GLU A 1 287 ? -56.784 46.014  -49.026 1.00 70.20  ? 624 GLU B CB   1 
ATOM   4313  C CG   . GLU A 1 287 ? -57.179 47.436  -48.653 1.00 76.82  ? 624 GLU B CG   1 
ATOM   4314  C CD   . GLU A 1 287 ? -56.537 47.922  -47.361 1.00 82.31  ? 624 GLU B CD   1 
ATOM   4315  O OE1  . GLU A 1 287 ? -55.855 47.121  -46.679 1.00 61.42  ? 624 GLU B OE1  1 
ATOM   4316  O OE2  . GLU A 1 287 ? -56.713 49.117  -47.037 1.00 91.30  ? 624 GLU B OE2  1 
ATOM   4317  H H    . GLU A 1 287 ? -57.023 45.438  -46.660 1.00 81.39  ? 624 GLU B H    1 
ATOM   4318  H HA   . GLU A 1 287 ? -58.598 45.084  -48.778 1.00 79.07  ? 624 GLU B HA   1 
ATOM   4319  H HB2  . GLU A 1 287 ? -55.880 45.867  -48.707 1.00 84.24  ? 624 GLU B HB2  1 
ATOM   4320  H HB3  . GLU A 1 287 ? -56.804 45.947  -49.994 1.00 84.24  ? 624 GLU B HB3  1 
ATOM   4321  H HG2  . GLU A 1 287 ? -56.906 48.035  -49.365 1.00 92.19  ? 624 GLU B HG2  1 
ATOM   4322  H HG3  . GLU A 1 287 ? -58.142 47.475  -48.540 1.00 92.19  ? 624 GLU B HG3  1 
ATOM   4323  N N    . ILE A 1 288 ? -56.864 42.683  -48.026 1.00 56.19  ? 625 ILE B N    1 
ATOM   4324  C CA   . ILE A 1 288 ? -56.495 41.316  -48.376 1.00 50.18  ? 625 ILE B CA   1 
ATOM   4325  C C    . ILE A 1 288 ? -57.568 40.351  -47.869 1.00 51.73  ? 625 ILE B C    1 
ATOM   4326  O O    . ILE A 1 288 ? -57.937 40.370  -46.695 1.00 68.32  ? 625 ILE B O    1 
ATOM   4327  C CB   . ILE A 1 288 ? -55.096 40.945  -47.817 1.00 53.74  ? 625 ILE B CB   1 
ATOM   4328  C CG1  . ILE A 1 288 ? -54.016 41.694  -48.606 1.00 54.21  ? 625 ILE B CG1  1 
ATOM   4329  C CG2  . ILE A 1 288 ? -54.857 39.453  -47.915 1.00 41.31  ? 625 ILE B CG2  1 
ATOM   4330  C CD1  . ILE A 1 288 ? -52.659 41.729  -47.938 1.00 45.94  ? 625 ILE B CD1  1 
ATOM   4331  H H    . ILE A 1 288 ? -56.825 42.851  -47.183 1.00 67.42  ? 625 ILE B H    1 
ATOM   4332  H HA   . ILE A 1 288 ? -56.458 41.238  -49.352 1.00 60.21  ? 625 ILE B HA   1 
ATOM   4333  H HB   . ILE A 1 288 ? -55.048 41.211  -46.885 1.00 64.49  ? 625 ILE B HB   1 
ATOM   4334  H HG12 . ILE A 1 288 ? -53.908 41.264  -49.469 1.00 65.06  ? 625 ILE B HG12 1 
ATOM   4335  H HG13 . ILE A 1 288 ? -54.305 42.611  -48.733 1.00 65.06  ? 625 ILE B HG13 1 
ATOM   4336  H HG21 . ILE A 1 288 ? -53.986 39.253  -47.563 1.00 49.57  ? 625 ILE B HG21 1 
ATOM   4337  H HG22 . ILE A 1 288 ? -55.530 38.995  -47.406 1.00 49.57  ? 625 ILE B HG22 1 
ATOM   4338  H HG23 . ILE A 1 288 ? -54.906 39.189  -48.837 1.00 49.57  ? 625 ILE B HG23 1 
ATOM   4339  H HD11 . ILE A 1 288 ? -52.048 42.214  -48.497 1.00 55.13  ? 625 ILE B HD11 1 
ATOM   4340  H HD12 . ILE A 1 288 ? -52.742 42.165  -47.086 1.00 55.13  ? 625 ILE B HD12 1 
ATOM   4341  H HD13 . ILE A 1 288 ? -52.348 40.829  -47.816 1.00 55.13  ? 625 ILE B HD13 1 
ATOM   4342  N N    . ILE A 1 289 ? -58.062 39.517  -48.779 1.00 51.93  ? 626 ILE B N    1 
ATOM   4343  C CA   . ILE A 1 289 ? -59.223 38.667  -48.538 1.00 63.42  ? 626 ILE B CA   1 
ATOM   4344  C C    . ILE A 1 289 ? -58.840 37.331  -47.936 1.00 69.93  ? 626 ILE B C    1 
ATOM   4345  O O    . ILE A 1 289 ? -59.582 36.770  -47.131 1.00 78.16  ? 626 ILE B O    1 
ATOM   4346  C CB   . ILE A 1 289 ? -59.983 38.382  -49.850 1.00 62.54  ? 626 ILE B CB   1 
ATOM   4347  C CG1  . ILE A 1 289 ? -59.024 37.839  -50.919 1.00 58.28  ? 626 ILE B CG1  1 
ATOM   4348  C CG2  . ILE A 1 289 ? -60.675 39.637  -50.332 1.00 60.32  ? 626 ILE B CG2  1 
ATOM   4349  C CD1  . ILE A 1 289 ? -59.667 37.610  -52.276 1.00 70.38  ? 626 ILE B CD1  1 
ATOM   4350  H H    . ILE A 1 289 ? -57.731 39.424  -49.567 1.00 62.32  ? 626 ILE B H    1 
ATOM   4351  H HA   . ILE A 1 289 ? -59.833 39.120  -47.920 1.00 76.11  ? 626 ILE B HA   1 
ATOM   4352  H HB   . ILE A 1 289 ? -60.658 37.708  -49.673 1.00 75.05  ? 626 ILE B HB   1 
ATOM   4353  H HG12 . ILE A 1 289 ? -58.300 38.474  -51.039 1.00 69.93  ? 626 ILE B HG12 1 
ATOM   4354  H HG13 . ILE A 1 289 ? -58.667 36.990  -50.615 1.00 69.93  ? 626 ILE B HG13 1 
ATOM   4355  H HG21 . ILE A 1 289 ? -61.142 39.441  -51.148 1.00 72.38  ? 626 ILE B HG21 1 
ATOM   4356  H HG22 . ILE A 1 289 ? -61.296 39.928  -49.661 1.00 72.38  ? 626 ILE B HG22 1 
ATOM   4357  H HG23 . ILE A 1 289 ? -60.015 40.317  -50.487 1.00 72.38  ? 626 ILE B HG23 1 
ATOM   4358  H HD11 . ILE A 1 289 ? -59.004 37.273  -52.883 1.00 84.45  ? 626 ILE B HD11 1 
ATOM   4359  H HD12 . ILE A 1 289 ? -60.379 36.973  -52.180 1.00 84.45  ? 626 ILE B HD12 1 
ATOM   4360  H HD13 . ILE A 1 289 ? -60.015 38.444  -52.601 1.00 84.45  ? 626 ILE B HD13 1 
ATOM   4361  N N    . MET A 1 290 ? -57.689 36.814  -48.341 1.00 73.01  ? 627 MET B N    1 
ATOM   4362  C CA   . MET A 1 290 ? -57.225 35.528  -47.845 1.00 78.82  ? 627 MET B CA   1 
ATOM   4363  C C    . MET A 1 290 ? -55.707 35.484  -47.831 1.00 66.75  ? 627 MET B C    1 
ATOM   4364  O O    . MET A 1 290 ? -55.051 36.079  -48.687 1.00 54.43  ? 627 MET B O    1 
ATOM   4365  C CB   . MET A 1 290 ? -57.772 34.405  -48.725 1.00 84.31  ? 627 MET B CB   1 
ATOM   4366  C CG   . MET A 1 290 ? -57.382 33.016  -48.271 1.00 86.17  ? 627 MET B CG   1 
ATOM   4367  S SD   . MET A 1 290 ? -58.471 31.755  -48.952 1.00 124.47 ? 627 MET B SD   1 
ATOM   4368  C CE   . MET A 1 290 ? -60.015 32.194  -48.155 1.00 77.21  ? 627 MET B CE   1 
ATOM   4369  H H    . MET A 1 290 ? -57.157 37.189  -48.904 1.00 87.61  ? 627 MET B H    1 
ATOM   4370  H HA   . MET A 1 290 ? -57.560 35.395  -46.934 1.00 94.59  ? 627 MET B HA   1 
ATOM   4371  H HB2  . MET A 1 290 ? -58.741 34.455  -48.725 1.00 101.17 ? 627 MET B HB2  1 
ATOM   4372  H HB3  . MET A 1 290 ? -57.437 34.526  -49.627 1.00 101.17 ? 627 MET B HB3  1 
ATOM   4373  H HG2  . MET A 1 290 ? -56.478 32.826  -48.567 1.00 103.41 ? 627 MET B HG2  1 
ATOM   4374  H HG3  . MET A 1 290 ? -57.433 32.970  -47.304 1.00 103.41 ? 627 MET B HG3  1 
ATOM   4375  H HE1  . MET A 1 290 ? -60.698 31.583  -48.440 1.00 92.65  ? 627 MET B HE1  1 
ATOM   4376  H HE2  . MET A 1 290 ? -59.902 32.139  -47.204 1.00 92.65  ? 627 MET B HE2  1 
ATOM   4377  H HE3  . MET A 1 290 ? -60.251 33.090  -48.406 1.00 92.65  ? 627 MET B HE3  1 
ATOM   4378  N N    . CYS A 1 291 ? -55.149 34.789  -46.846 1.00 68.98  ? 628 CYS B N    1 
ATOM   4379  C CA   . CYS A 1 291 ? -53.712 34.571  -46.809 1.00 59.66  ? 628 CYS B CA   1 
ATOM   4380  C C    . CYS A 1 291 ? -53.355 33.362  -45.949 1.00 55.27  ? 628 CYS B C    1 
ATOM   4381  O O    . CYS A 1 291 ? -53.976 33.113  -44.918 1.00 56.62  ? 628 CYS B O    1 
ATOM   4382  C CB   . CYS A 1 291 ? -52.985 35.819  -46.302 1.00 62.48  ? 628 CYS B CB   1 
ATOM   4383  S SG   . CYS A 1 291 ? -53.284 36.206  -44.567 1.00 55.19  ? 628 CYS B SG   1 
ATOM   4384  H H    . CYS A 1 291 ? -55.580 34.436  -46.190 1.00 82.77  ? 628 CYS B H    1 
ATOM   4385  H HA   . CYS A 1 291 ? -53.398 34.392  -47.720 1.00 71.60  ? 628 CYS B HA   1 
ATOM   4386  H HB2  . CYS A 1 291 ? -52.030 35.689  -46.414 1.00 74.97  ? 628 CYS B HB2  1 
ATOM   4387  H HB3  . CYS A 1 291 ? -53.275 36.581  -46.827 1.00 74.97  ? 628 CYS B HB3  1 
ATOM   4388  H HG   . CYS A 1 291 ? -52.916 35.284  -43.892 1.00 66.23  ? 628 CYS B HG   1 
ATOM   4389  N N    . ASP A 1 292 ? -52.360 32.610  -46.408 1.00 43.79  ? 629 ASP B N    1 
ATOM   4390  C CA   . ASP A 1 292 ? -51.818 31.472  -45.682 1.00 48.17  ? 629 ASP B CA   1 
ATOM   4391  C C    . ASP A 1 292 ? -50.327 31.674  -45.509 1.00 39.67  ? 629 ASP B C    1 
ATOM   4392  O O    . ASP A 1 292 ? -49.671 32.268  -46.359 1.00 38.69  ? 629 ASP B O    1 
ATOM   4393  C CB   . ASP A 1 292 ? -52.053 30.174  -46.456 1.00 63.14  ? 629 ASP B CB   1 
ATOM   4394  C CG   . ASP A 1 292 ? -53.419 29.578  -46.200 1.00 77.28  ? 629 ASP B CG   1 
ATOM   4395  O OD1  . ASP A 1 292 ? -54.003 29.009  -47.148 1.00 82.63  ? 629 ASP B OD1  1 
ATOM   4396  O OD2  . ASP A 1 292 ? -53.903 29.671  -45.052 1.00 81.62  ? 629 ASP B OD2  1 
ATOM   4397  H H    . ASP A 1 292 ? -51.972 32.745  -47.164 1.00 52.55  ? 629 ASP B H    1 
ATOM   4398  H HA   . ASP A 1 292 ? -52.239 31.402  -44.799 1.00 57.80  ? 629 ASP B HA   1 
ATOM   4399  H HB2  . ASP A 1 292 ? -51.978 30.355  -47.406 1.00 75.77  ? 629 ASP B HB2  1 
ATOM   4400  H HB3  . ASP A 1 292 ? -51.387 29.522  -46.188 1.00 75.77  ? 629 ASP B HB3  1 
ATOM   4401  N N    . ALA A 1 293 ? -49.787 31.174  -44.409 1.00 45.31  ? 630 ALA B N    1 
ATOM   4402  C CA   . ALA A 1 293 ? -48.362 31.268  -44.161 1.00 39.63  ? 630 ALA B CA   1 
ATOM   4403  C C    . ALA A 1 293 ? -47.872 29.880  -43.792 1.00 43.08  ? 630 ALA B C    1 
ATOM   4404  O O    . ALA A 1 293 ? -48.570 29.140  -43.102 1.00 41.33  ? 630 ALA B O    1 
ATOM   4405  C CB   . ALA A 1 293 ? -48.087 32.249  -43.039 1.00 41.90  ? 630 ALA B CB   1 
ATOM   4406  H H    . ALA A 1 293 ? -50.227 30.773  -43.789 1.00 54.37  ? 630 ALA B H    1 
ATOM   4407  H HA   . ALA A 1 293 ? -47.898 31.568  -44.971 1.00 47.56  ? 630 ALA B HA   1 
ATOM   4408  H HB1  . ALA A 1 293 ? -47.140 32.297  -42.891 1.00 50.27  ? 630 ALA B HB1  1 
ATOM   4409  H HB2  . ALA A 1 293 ? -48.424 33.112  -43.289 1.00 50.27  ? 630 ALA B HB2  1 
ATOM   4410  H HB3  . ALA A 1 293 ? -48.529 31.943  -42.243 1.00 50.27  ? 630 ALA B HB3  1 
ATOM   4411  N N    . TYR A 1 294 ? -46.689 29.512  -44.265 1.00 39.46  ? 631 TYR B N    1 
ATOM   4412  C CA   . TYR A 1 294 ? -46.132 28.208  -43.926 1.00 41.15  ? 631 TYR B CA   1 
ATOM   4413  C C    . TYR A 1 294 ? -44.607 28.263  -43.896 1.00 36.36  ? 631 TYR B C    1 
ATOM   4414  O O    . TYR A 1 294 ? -44.007 29.213  -44.385 1.00 38.30  ? 631 TYR B O    1 
ATOM   4415  C CB   . TYR A 1 294 ? -46.631 27.148  -44.910 1.00 37.75  ? 631 TYR B CB   1 
ATOM   4416  C CG   . TYR A 1 294 ? -46.234 27.388  -46.346 1.00 42.69  ? 631 TYR B CG   1 
ATOM   4417  C CD1  . TYR A 1 294 ? -47.086 28.044  -47.223 1.00 51.82  ? 631 TYR B CD1  1 
ATOM   4418  C CD2  . TYR A 1 294 ? -45.008 26.952  -46.826 1.00 47.30  ? 631 TYR B CD2  1 
ATOM   4419  C CE1  . TYR A 1 294 ? -46.725 28.263  -48.544 1.00 56.84  ? 631 TYR B CE1  1 
ATOM   4420  C CE2  . TYR A 1 294 ? -44.637 27.167  -48.142 1.00 55.35  ? 631 TYR B CE2  1 
ATOM   4421  C CZ   . TYR A 1 294 ? -45.500 27.818  -48.995 1.00 58.63  ? 631 TYR B CZ   1 
ATOM   4422  O OH   . TYR A 1 294 ? -45.131 28.030  -50.301 1.00 68.84  ? 631 TYR B OH   1 
ATOM   4423  H H    . TYR A 1 294 ? -46.193 29.992  -44.778 1.00 47.35  ? 631 TYR B H    1 
ATOM   4424  H HA   . TYR A 1 294 ? -46.441 27.956  -43.031 1.00 49.38  ? 631 TYR B HA   1 
ATOM   4425  H HB2  . TYR A 1 294 ? -46.272 26.286  -44.646 1.00 45.30  ? 631 TYR B HB2  1 
ATOM   4426  H HB3  . TYR A 1 294 ? -47.600 27.122  -44.874 1.00 45.30  ? 631 TYR B HB3  1 
ATOM   4427  H HD1  . TYR A 1 294 ? -47.913 28.342  -46.920 1.00 62.18  ? 631 TYR B HD1  1 
ATOM   4428  H HD2  . TYR A 1 294 ? -44.424 26.510  -46.254 1.00 56.76  ? 631 TYR B HD2  1 
ATOM   4429  H HE1  . TYR A 1 294 ? -47.305 28.704  -49.121 1.00 68.21  ? 631 TYR B HE1  1 
ATOM   4430  H HE2  . TYR A 1 294 ? -43.812 26.869  -48.449 1.00 66.42  ? 631 TYR B HE2  1 
ATOM   4431  H HH   . TYR A 1 294 ? -44.995 27.312  -50.674 1.00 82.61  ? 631 TYR B HH   1 
ATOM   4432  N N    . VAL A 1 295 ? -43.976 27.259  -43.298 1.00 34.03  ? 632 VAL B N    1 
ATOM   4433  C CA   . VAL A 1 295 ? -42.519 27.248  -43.228 1.00 29.53  ? 632 VAL B CA   1 
ATOM   4434  C C    . VAL A 1 295 ? -41.966 26.202  -44.181 1.00 33.31  ? 632 VAL B C    1 
ATOM   4435  O O    . VAL A 1 295 ? -42.638 25.230  -44.491 1.00 34.85  ? 632 VAL B O    1 
ATOM   4436  C CB   . VAL A 1 295 ? -42.020 27.032  -41.799 1.00 32.02  ? 632 VAL B CB   1 
ATOM   4437  C CG1  . VAL A 1 295 ? -42.441 28.213  -40.927 1.00 32.74  ? 632 VAL B CG1  1 
ATOM   4438  C CG2  . VAL A 1 295 ? -42.547 25.713  -41.230 1.00 35.18  ? 632 VAL B CG2  1 
ATOM   4439  H H    . VAL A 1 295 ? -44.359 26.583  -42.930 1.00 40.84  ? 632 VAL B H    1 
ATOM   4440  H HA   . VAL A 1 295 ? -42.187 28.122  -43.525 1.00 35.44  ? 632 VAL B HA   1 
ATOM   4441  H HB   . VAL A 1 295 ? -41.041 26.991  -41.804 1.00 38.42  ? 632 VAL B HB   1 
ATOM   4442  H HG11 . VAL A 1 295 ? -42.124 28.069  -40.032 1.00 39.28  ? 632 VAL B HG11 1 
ATOM   4443  H HG12 . VAL A 1 295 ? -42.057 29.017  -41.285 1.00 39.28  ? 632 VAL B HG12 1 
ATOM   4444  H HG13 . VAL A 1 295 ? -43.398 28.278  -40.929 1.00 39.28  ? 632 VAL B HG13 1 
ATOM   4445  H HG21 . VAL A 1 295 ? -42.218 25.606  -40.335 1.00 42.22  ? 632 VAL B HG21 1 
ATOM   4446  H HG22 . VAL A 1 295 ? -43.507 25.736  -41.227 1.00 42.22  ? 632 VAL B HG22 1 
ATOM   4447  H HG23 . VAL A 1 295 ? -42.238 24.991  -41.782 1.00 42.22  ? 632 VAL B HG23 1 
ATOM   4448  N N    . THR A 1 296 ? -40.761 26.447  -44.689 1.00 43.98  ? 633 THR B N    1 
ATOM   4449  C CA   . THR A 1 296 ? -40.132 25.567  -45.668 1.00 42.39  ? 633 THR B CA   1 
ATOM   4450  C C    . THR A 1 296 ? -38.641 25.821  -45.712 1.00 40.84  ? 633 THR B C    1 
ATOM   4451  O O    . THR A 1 296 ? -38.128 26.700  -45.019 1.00 29.23  ? 633 THR B O    1 
ATOM   4452  C CB   . THR A 1 296 ? -40.655 25.808  -47.111 1.00 48.90  ? 633 THR B CB   1 
ATOM   4453  O OG1  . THR A 1 296 ? -40.546 27.200  -47.448 1.00 44.95  ? 633 THR B OG1  1 
ATOM   4454  C CG2  . THR A 1 296 ? -42.095 25.358  -47.253 1.00 58.49  ? 633 THR B CG2  1 
ATOM   4455  H H    . THR A 1 296 ? -40.280 27.128  -44.477 1.00 52.78  ? 633 THR B H    1 
ATOM   4456  H HA   . THR A 1 296 ? -40.289 24.630  -45.425 1.00 50.86  ? 633 THR B HA   1 
ATOM   4457  H HB   . THR A 1 296 ? -40.118 25.291  -47.731 1.00 58.68  ? 633 THR B HB   1 
ATOM   4458  H HG1  . THR A 1 296 ? -40.822 27.327  -48.209 1.00 53.94  ? 633 THR B HG1  1 
ATOM   4459  H HG21 . THR A 1 296 ? -42.400 25.515  -48.150 1.00 70.19  ? 633 THR B HG21 1 
ATOM   4460  H HG22 . THR A 1 296 ? -42.166 24.421  -47.059 1.00 70.19  ? 633 THR B HG22 1 
ATOM   4461  H HG23 . THR A 1 296 ? -42.653 25.847  -46.644 1.00 70.19  ? 633 THR B HG23 1 
ATOM   4462  N N    . ASP A 1 297 ? -37.955 25.060  -46.560 1.00 50.20  ? 634 ASP B N    1 
ATOM   4463  C CA   . ASP A 1 297 ? -36.535 25.269  -46.819 1.00 51.33  ? 634 ASP B CA   1 
ATOM   4464  C C    . ASP A 1 297 ? -35.732 25.274  -45.522 1.00 40.94  ? 634 ASP B C    1 
ATOM   4465  O O    . ASP A 1 297 ? -34.914 26.164  -45.287 1.00 37.62  ? 634 ASP B O    1 
ATOM   4466  C CB   . ASP A 1 297 ? -36.303 26.581  -47.574 1.00 50.81  ? 634 ASP B CB   1 
ATOM   4467  C CG   . ASP A 1 297 ? -36.982 26.612  -48.939 1.00 63.42  ? 634 ASP B CG   1 
ATOM   4468  O OD1  . ASP A 1 297 ? -37.277 25.539  -49.507 1.00 52.91  ? 634 ASP B OD1  1 
ATOM   4469  O OD2  . ASP A 1 297 ? -37.213 27.728  -49.455 1.00 78.74  ? 634 ASP B OD2  1 
ATOM   4470  H H    . ASP A 1 297 ? -38.296 24.407  -47.004 1.00 60.25  ? 634 ASP B H    1 
ATOM   4471  H HA   . ASP A 1 297 ? -36.203 24.536  -47.378 1.00 61.59  ? 634 ASP B HA   1 
ATOM   4472  H HB2  . ASP A 1 297 ? -36.658 27.315  -47.048 1.00 60.98  ? 634 ASP B HB2  1 
ATOM   4473  H HB3  . ASP A 1 297 ? -35.351 26.702  -47.711 1.00 60.98  ? 634 ASP B HB3  1 
ATOM   4474  N N    . PHE A 1 298 ? -35.977 24.278  -44.680 1.00 33.75  ? 635 PHE B N    1 
ATOM   4475  C CA   . PHE A 1 298 ? -35.160 24.069  -43.492 1.00 38.38  ? 635 PHE B CA   1 
ATOM   4476  C C    . PHE A 1 298 ? -33.828 23.470  -43.918 1.00 46.08  ? 635 PHE B C    1 
ATOM   4477  O O    . PHE A 1 298 ? -33.744 22.833  -44.964 1.00 45.03  ? 635 PHE B O    1 
ATOM   4478  C CB   . PHE A 1 298 ? -35.877 23.140  -42.504 1.00 37.13  ? 635 PHE B CB   1 
ATOM   4479  C CG   . PHE A 1 298 ? -37.056 23.784  -41.829 1.00 35.93  ? 635 PHE B CG   1 
ATOM   4480  C CD1  . PHE A 1 298 ? -38.341 23.569  -42.293 1.00 39.72  ? 635 PHE B CD1  1 
ATOM   4481  C CD2  . PHE A 1 298 ? -36.870 24.633  -40.753 1.00 30.66  ? 635 PHE B CD2  1 
ATOM   4482  C CE1  . PHE A 1 298 ? -39.430 24.177  -41.684 1.00 36.23  ? 635 PHE B CE1  1 
ATOM   4483  C CE2  . PHE A 1 298 ? -37.949 25.250  -40.141 1.00 28.70  ? 635 PHE B CE2  1 
ATOM   4484  C CZ   . PHE A 1 298 ? -39.234 25.023  -40.615 1.00 30.77  ? 635 PHE B CZ   1 
ATOM   4485  H H    . PHE A 1 298 ? -36.614 23.708  -44.774 1.00 40.50  ? 635 PHE B H    1 
ATOM   4486  H HA   . PHE A 1 298 ? -34.992 24.928  -43.051 1.00 46.05  ? 635 PHE B HA   1 
ATOM   4487  H HB2  . PHE A 1 298 ? -36.197 22.359  -42.983 1.00 44.56  ? 635 PHE B HB2  1 
ATOM   4488  H HB3  . PHE A 1 298 ? -35.250 22.870  -41.815 1.00 44.56  ? 635 PHE B HB3  1 
ATOM   4489  H HD1  . PHE A 1 298 ? -38.478 23.004  -43.020 1.00 47.67  ? 635 PHE B HD1  1 
ATOM   4490  H HD2  . PHE A 1 298 ? -36.010 24.793  -40.437 1.00 36.80  ? 635 PHE B HD2  1 
ATOM   4491  H HE1  . PHE A 1 298 ? -40.290 24.022  -42.003 1.00 43.48  ? 635 PHE B HE1  1 
ATOM   4492  H HE2  . PHE A 1 298 ? -37.813 25.815  -39.415 1.00 34.44  ? 635 PHE B HE2  1 
ATOM   4493  H HZ   . PHE A 1 298 ? -39.962 25.428  -40.200 1.00 36.93  ? 635 PHE B HZ   1 
ATOM   4494  N N    . PRO A 1 299 ? -32.778 23.676  -43.112 1.00 44.77  ? 636 PRO B N    1 
ATOM   4495  C CA   . PRO A 1 299 ? -31.474 23.084  -43.440 1.00 45.69  ? 636 PRO B CA   1 
ATOM   4496  C C    . PRO A 1 299 ? -31.597 21.584  -43.683 1.00 41.33  ? 636 PRO B C    1 
ATOM   4497  O O    . PRO A 1 299 ? -32.261 20.891  -42.912 1.00 44.13  ? 636 PRO B O    1 
ATOM   4498  C CB   . PRO A 1 299 ? -30.634 23.358  -42.190 1.00 50.91  ? 636 PRO B CB   1 
ATOM   4499  C CG   . PRO A 1 299 ? -31.289 24.541  -41.537 1.00 55.60  ? 636 PRO B CG   1 
ATOM   4500  C CD   . PRO A 1 299 ? -32.756 24.408  -41.834 1.00 49.20  ? 636 PRO B CD   1 
ATOM   4501  H HA   . PRO A 1 299 ? -31.072 23.522  -44.219 1.00 54.83  ? 636 PRO B HA   1 
ATOM   4502  H HB2  . PRO A 1 299 ? -30.656 22.586  -41.603 1.00 61.10  ? 636 PRO B HB2  1 
ATOM   4503  H HB3  . PRO A 1 299 ? -29.723 23.569  -42.447 1.00 61.10  ? 636 PRO B HB3  1 
ATOM   4504  H HG2  . PRO A 1 299 ? -31.131 24.514  -40.581 1.00 66.72  ? 636 PRO B HG2  1 
ATOM   4505  H HG3  . PRO A 1 299 ? -30.937 25.360  -41.919 1.00 66.72  ? 636 PRO B HG3  1 
ATOM   4506  H HD2  . PRO A 1 299 ? -33.196 23.892  -41.141 1.00 59.04  ? 636 PRO B HD2  1 
ATOM   4507  H HD3  . PRO A 1 299 ? -33.161 25.284  -41.939 1.00 59.04  ? 636 PRO B HD3  1 
ATOM   4508  N N    . LEU A 1 300 ? -30.964 21.093  -44.743 1.00 35.62  ? 637 LEU B N    1 
ATOM   4509  C CA   . LEU A 1 300 ? -31.053 19.682  -45.115 1.00 36.82  ? 637 LEU B CA   1 
ATOM   4510  C C    . LEU A 1 300 ? -30.626 18.738  -43.987 1.00 32.29  ? 637 LEU B C    1 
ATOM   4511  O O    . LEU A 1 300 ? -31.110 17.607  -43.906 1.00 34.98  ? 637 LEU B O    1 
ATOM   4512  C CB   . LEU A 1 300 ? -30.188 19.420  -46.350 1.00 53.48  ? 637 LEU B CB   1 
ATOM   4513  C CG   . LEU A 1 300 ? -30.811 19.699  -47.718 1.00 58.23  ? 637 LEU B CG   1 
ATOM   4514  C CD1  . LEU A 1 300 ? -31.996 20.642  -47.622 1.00 50.67  ? 637 LEU B CD1  1 
ATOM   4515  C CD2  . LEU A 1 300 ? -29.751 20.260  -48.655 1.00 60.37  ? 637 LEU B CD2  1 
ATOM   4516  H H    . LEU A 1 300 ? -30.470 21.560  -45.269 1.00 42.74  ? 637 LEU B H    1 
ATOM   4517  H HA   . LEU A 1 300 ? -31.981 19.473  -45.348 1.00 44.19  ? 637 LEU B HA   1 
ATOM   4518  H HB2  . LEU A 1 300 ? -29.393 19.971  -46.282 1.00 64.17  ? 637 LEU B HB2  1 
ATOM   4519  H HB3  . LEU A 1 300 ? -29.928 18.485  -46.341 1.00 64.17  ? 637 LEU B HB3  1 
ATOM   4520  H HG   . LEU A 1 300 ? -31.128 18.862  -48.094 1.00 69.88  ? 637 LEU B HG   1 
ATOM   4521  H HD11 . LEU A 1 300 ? -32.352 20.786  -48.501 1.00 60.80  ? 637 LEU B HD11 1 
ATOM   4522  H HD12 . LEU A 1 300 ? -32.664 20.246  -47.058 1.00 60.80  ? 637 LEU B HD12 1 
ATOM   4523  H HD13 . LEU A 1 300 ? -31.701 21.475  -47.246 1.00 60.80  ? 637 LEU B HD13 1 
ATOM   4524  H HD21 . LEU A 1 300 ? -30.151 20.432  -49.510 1.00 72.44  ? 637 LEU B HD21 1 
ATOM   4525  H HD22 . LEU A 1 300 ? -29.407 21.075  -48.283 1.00 72.44  ? 637 LEU B HD22 1 
ATOM   4526  H HD23 . LEU A 1 300 ? -29.044 19.617  -48.746 1.00 72.44  ? 637 LEU B HD23 1 
ATOM   4527  N N    . ASP A 1 301 ? -29.725 19.200  -43.125 1.00 37.68  ? 638 ASP B N    1 
ATOM   4528  C CA   . ASP A 1 301 ? -29.229 18.383  -42.012 1.00 46.83  ? 638 ASP B CA   1 
ATOM   4529  C C    . ASP A 1 301 ? -30.370 17.860  -41.135 1.00 45.63  ? 638 ASP B C    1 
ATOM   4530  O O    . ASP A 1 301 ? -30.358 16.717  -40.694 1.00 36.89  ? 638 ASP B O    1 
ATOM   4531  C CB   . ASP A 1 301 ? -28.278 19.201  -41.135 1.00 60.14  ? 638 ASP B CB   1 
ATOM   4532  C CG   . ASP A 1 301 ? -26.955 19.494  -41.814 1.00 71.12  ? 638 ASP B CG   1 
ATOM   4533  O OD1  . ASP A 1 301 ? -26.437 20.621  -41.642 1.00 65.38  ? 638 ASP B OD1  1 
ATOM   4534  O OD2  . ASP A 1 301 ? -26.428 18.596  -42.505 1.00 74.06  ? 638 ASP B OD2  1 
ATOM   4535  H H    . ASP A 1 301 ? -29.380 19.987  -43.160 1.00 45.22  ? 638 ASP B H    1 
ATOM   4536  H HA   . ASP A 1 301 ? -28.737 17.614  -42.368 1.00 56.20  ? 638 ASP B HA   1 
ATOM   4537  H HB2  . ASP A 1 301 ? -28.698 20.048  -40.919 1.00 72.16  ? 638 ASP B HB2  1 
ATOM   4538  H HB3  . ASP A 1 301 ? -28.094 18.705  -40.322 1.00 72.16  ? 638 ASP B HB3  1 
ATOM   4539  N N    . LEU A 1 302 ? -31.356 18.708  -40.878 1.00 50.33  ? 639 LEU B N    1 
ATOM   4540  C CA   . LEU A 1 302 ? -32.455 18.344  -39.991 1.00 51.23  ? 639 LEU B CA   1 
ATOM   4541  C C    . LEU A 1 302 ? -33.425 17.345  -40.640 1.00 51.66  ? 639 LEU B C    1 
ATOM   4542  O O    . LEU A 1 302 ? -34.340 16.838  -39.989 1.00 36.13  ? 639 LEU B O    1 
ATOM   4543  C CB   . LEU A 1 302 ? -33.178 19.613  -39.538 1.00 37.24  ? 639 LEU B CB   1 
ATOM   4544  C CG   . LEU A 1 302 ? -32.244 20.567  -38.788 1.00 37.04  ? 639 LEU B CG   1 
ATOM   4545  C CD1  . LEU A 1 302 ? -32.962 21.832  -38.376 1.00 39.51  ? 639 LEU B CD1  1 
ATOM   4546  C CD2  . LEU A 1 302 ? -31.639 19.872  -37.564 1.00 35.47  ? 639 LEU B CD2  1 
ATOM   4547  H H    . LEU A 1 302 ? -31.413 19.501  -41.204 1.00 60.40  ? 639 LEU B H    1 
ATOM   4548  H HA   . LEU A 1 302 ? -32.082 17.915  -39.193 1.00 61.48  ? 639 LEU B HA   1 
ATOM   4549  H HB2  . LEU A 1 302 ? -33.525 20.078  -40.315 1.00 44.68  ? 639 LEU B HB2  1 
ATOM   4550  H HB3  . LEU A 1 302 ? -33.904 19.371  -38.942 1.00 44.68  ? 639 LEU B HB3  1 
ATOM   4551  H HG   . LEU A 1 302 ? -31.515 20.818  -39.377 1.00 44.44  ? 639 LEU B HG   1 
ATOM   4552  H HD11 . LEU A 1 302 ? -32.346 22.403  -37.910 1.00 47.41  ? 639 LEU B HD11 1 
ATOM   4553  H HD12 . LEU A 1 302 ? -33.290 22.276  -39.161 1.00 47.41  ? 639 LEU B HD12 1 
ATOM   4554  H HD13 . LEU A 1 302 ? -33.694 21.602  -37.799 1.00 47.41  ? 639 LEU B HD13 1 
ATOM   4555  H HD21 . LEU A 1 302 ? -31.059 20.487  -37.111 1.00 42.56  ? 639 LEU B HD21 1 
ATOM   4556  H HD22 . LEU A 1 302 ? -32.349 19.598  -36.978 1.00 42.56  ? 639 LEU B HD22 1 
ATOM   4557  H HD23 . LEU A 1 302 ? -31.141 19.105  -37.856 1.00 42.56  ? 639 LEU B HD23 1 
ATOM   4558  N N    . ASP A 1 303 ? -33.211 17.069  -41.923 1.00 50.64  ? 640 ASP B N    1 
ATOM   4559  C CA   . ASP A 1 303 ? -33.953 16.035  -42.644 1.00 57.62  ? 640 ASP B CA   1 
ATOM   4560  C C    . ASP A 1 303 ? -35.460 16.160  -42.461 1.00 58.94  ? 640 ASP B C    1 
ATOM   4561  O O    . ASP A 1 303 ? -36.160 15.157  -42.329 1.00 59.67  ? 640 ASP B O    1 
ATOM   4562  C CB   . ASP A 1 303 ? -33.493 14.641  -42.199 1.00 62.42  ? 640 ASP B CB   1 
ATOM   4563  H H    . ASP A 1 303 ? -32.629 17.475  -42.409 1.00 60.76  ? 640 ASP B H    1 
ATOM   4564  H HA   . ASP A 1 303 ? -33.761 16.121  -43.601 1.00 69.14  ? 640 ASP B HA   1 
ATOM   4565  N N    . ILE A 1 304 ? -35.959 17.390  -42.455 1.00 54.98  ? 641 ILE B N    1 
ATOM   4566  C CA   . ILE A 1 304 ? -37.389 17.611  -42.307 1.00 62.23  ? 641 ILE B CA   1 
ATOM   4567  C C    . ILE A 1 304 ? -38.124 17.204  -43.575 1.00 71.96  ? 641 ILE B C    1 
ATOM   4568  O O    . ILE A 1 304 ? -37.765 17.616  -44.676 1.00 73.00  ? 641 ILE B O    1 
ATOM   4569  C CB   . ILE A 1 304 ? -37.717 19.078  -41.965 1.00 58.12  ? 641 ILE B CB   1 
ATOM   4570  C CG1  . ILE A 1 304 ? -37.465 19.345  -40.479 1.00 57.61  ? 641 ILE B CG1  1 
ATOM   4571  C CG2  . ILE A 1 304 ? -39.166 19.397  -42.294 1.00 60.99  ? 641 ILE B CG2  1 
ATOM   4572  C CD1  . ILE A 1 304 ? -36.135 19.985  -40.200 1.00 59.09  ? 641 ILE B CD1  1 
ATOM   4573  H H    . ILE A 1 304 ? -35.494 18.109  -42.536 1.00 65.98  ? 641 ILE B H    1 
ATOM   4574  H HA   . ILE A 1 304 ? -37.721 17.051  -41.574 1.00 74.68  ? 641 ILE B HA   1 
ATOM   4575  H HB   . ILE A 1 304 ? -37.142 19.658  -42.490 1.00 69.74  ? 641 ILE B HB   1 
ATOM   4576  H HG12 . ILE A 1 304 ? -38.156 19.939  -40.146 1.00 69.13  ? 641 ILE B HG12 1 
ATOM   4577  H HG13 . ILE A 1 304 ? -37.495 18.503  -40.000 1.00 69.13  ? 641 ILE B HG13 1 
ATOM   4578  H HG21 . ILE A 1 304 ? -39.342 20.314  -42.072 1.00 73.19  ? 641 ILE B HG21 1 
ATOM   4579  H HG22 . ILE A 1 304 ? -39.313 19.253  -43.232 1.00 73.19  ? 641 ILE B HG22 1 
ATOM   4580  H HG23 . ILE A 1 304 ? -39.737 18.820  -41.780 1.00 73.19  ? 641 ILE B HG23 1 
ATOM   4581  H HD11 . ILE A 1 304 ? -36.047 20.122  -39.254 1.00 70.91  ? 641 ILE B HD11 1 
ATOM   4582  H HD12 . ILE A 1 304 ? -35.437 19.405  -40.514 1.00 70.91  ? 641 ILE B HD12 1 
ATOM   4583  H HD13 . ILE A 1 304 ? -36.092 20.828  -40.659 1.00 70.91  ? 641 ILE B HD13 1 
ATOM   4584  N N    . ASP A 1 305 ? -39.151 16.380  -43.410 1.00 90.35  ? 642 ASP B N    1 
ATOM   4585  C CA   . ASP A 1 305 ? -39.994 15.981  -44.525 1.00 94.53  ? 642 ASP B CA   1 
ATOM   4586  C C    . ASP A 1 305 ? -41.162 16.953  -44.581 1.00 87.21  ? 642 ASP B C    1 
ATOM   4587  O O    . ASP A 1 305 ? -41.887 17.100  -43.602 1.00 89.09  ? 642 ASP B O    1 
ATOM   4588  C CB   . ASP A 1 305 ? -40.497 14.554  -44.321 1.00 104.25 ? 642 ASP B CB   1 
ATOM   4589  C CG   . ASP A 1 305 ? -40.909 13.885  -45.617 1.00 108.35 ? 642 ASP B CG   1 
ATOM   4590  O OD1  . ASP A 1 305 ? -41.763 12.974  -45.571 1.00 107.62 ? 642 ASP B OD1  1 
ATOM   4591  O OD2  . ASP A 1 305 ? -40.374 14.264  -46.680 1.00 109.22 ? 642 ASP B OD2  1 
ATOM   4592  H H    . ASP A 1 305 ? -39.381 16.035  -42.656 1.00 108.42 ? 642 ASP B H    1 
ATOM   4593  H HA   . ASP A 1 305 ? -39.492 16.031  -45.365 1.00 113.44 ? 642 ASP B HA   1 
ATOM   4594  H HB2  . ASP A 1 305 ? -39.790 14.023  -43.921 1.00 125.10 ? 642 ASP B HB2  1 
ATOM   4595  H HB3  . ASP A 1 305 ? -41.270 14.572  -43.734 1.00 125.10 ? 642 ASP B HB3  1 
ATOM   4596  N N    . PRO A 1 306 ? -41.342 17.633  -45.722 1.00 67.56  ? 643 PRO B N    1 
ATOM   4597  C CA   . PRO A 1 306 ? -42.358 18.689  -45.802 1.00 62.19  ? 643 PRO B CA   1 
ATOM   4598  C C    . PRO A 1 306 ? -43.788 18.165  -45.665 1.00 68.49  ? 643 PRO B C    1 
ATOM   4599  O O    . PRO A 1 306 ? -44.703 18.953  -45.403 1.00 59.53  ? 643 PRO B O    1 
ATOM   4600  C CB   . PRO A 1 306 ? -42.122 19.307  -47.182 1.00 62.09  ? 643 PRO B CB   1 
ATOM   4601  C CG   . PRO A 1 306 ? -41.442 18.245  -47.972 1.00 66.61  ? 643 PRO B CG   1 
ATOM   4602  C CD   . PRO A 1 306 ? -40.645 17.424  -47.000 1.00 65.32  ? 643 PRO B CD   1 
ATOM   4603  H HA   . PRO A 1 306 ? -42.196 19.368  -45.114 1.00 74.62  ? 643 PRO B HA   1 
ATOM   4604  H HB2  . PRO A 1 306 ? -42.973 19.542  -47.585 1.00 74.51  ? 643 PRO B HB2  1 
ATOM   4605  H HB3  . PRO A 1 306 ? -41.554 20.089  -47.098 1.00 74.51  ? 643 PRO B HB3  1 
ATOM   4606  H HG2  . PRO A 1 306 ? -42.108 17.694  -48.413 1.00 79.93  ? 643 PRO B HG2  1 
ATOM   4607  H HG3  . PRO A 1 306 ? -40.856 18.656  -48.627 1.00 79.93  ? 643 PRO B HG3  1 
ATOM   4608  H HD2  . PRO A 1 306 ? -40.670 16.487  -47.250 1.00 78.38  ? 643 PRO B HD2  1 
ATOM   4609  H HD3  . PRO A 1 306 ? -39.735 17.754  -46.946 1.00 78.38  ? 643 PRO B HD3  1 
ATOM   4610  N N    . LYS A 1 307 ? -43.975 16.856  -45.828 1.00 76.13  ? 644 LYS B N    1 
ATOM   4611  C CA   . LYS A 1 307 ? -45.283 16.243  -45.617 1.00 76.58  ? 644 LYS B CA   1 
ATOM   4612  C C    . LYS A 1 307 ? -45.593 16.190  -44.128 1.00 72.00  ? 644 LYS B C    1 
ATOM   4613  O O    . LYS A 1 307 ? -46.741 16.021  -43.729 1.00 76.87  ? 644 LYS B O    1 
ATOM   4614  C CB   . LYS A 1 307 ? -45.322 14.833  -46.206 1.00 80.60  ? 644 LYS B CB   1 
ATOM   4615  C CG   . LYS A 1 307 ? -45.200 14.787  -47.722 1.00 80.97  ? 644 LYS B CG   1 
ATOM   4616  C CD   . LYS A 1 307 ? -46.389 15.456  -48.396 1.00 85.55  ? 644 LYS B CD   1 
ATOM   4617  C CE   . LYS A 1 307 ? -46.253 15.446  -49.912 1.00 88.22  ? 644 LYS B CE   1 
ATOM   4618  N NZ   . LYS A 1 307 ? -46.162 14.062  -50.461 1.00 90.82  ? 644 LYS B NZ   1 
ATOM   4619  H H    . LYS A 1 307 ? -43.360 16.302  -46.061 1.00 91.36  ? 644 LYS B H    1 
ATOM   4620  H HA   . LYS A 1 307 ? -45.971 16.783  -46.058 1.00 91.89  ? 644 LYS B HA   1 
ATOM   4621  H HB2  . LYS A 1 307 ? -44.587 14.320  -45.836 1.00 96.72  ? 644 LYS B HB2  1 
ATOM   4622  H HB3  . LYS A 1 307 ? -46.165 14.418  -45.965 1.00 96.72  ? 644 LYS B HB3  1 
ATOM   4623  H HG2  . LYS A 1 307 ? -44.395 15.254  -47.993 1.00 97.16  ? 644 LYS B HG2  1 
ATOM   4624  H HG3  . LYS A 1 307 ? -45.167 13.862  -48.013 1.00 97.16  ? 644 LYS B HG3  1 
ATOM   4625  H HD2  . LYS A 1 307 ? -47.200 14.978  -48.161 1.00 102.66 ? 644 LYS B HD2  1 
ATOM   4626  H HD3  . LYS A 1 307 ? -46.445 16.378  -48.102 1.00 102.66 ? 644 LYS B HD3  1 
ATOM   4627  H HE2  . LYS A 1 307 ? -47.030 15.875  -50.304 1.00 105.87 ? 644 LYS B HE2  1 
ATOM   4628  H HE3  . LYS A 1 307 ? -45.447 15.923  -50.162 1.00 105.87 ? 644 LYS B HE3  1 
ATOM   4629  H HZ1  . LYS A 1 307 ? -46.083 14.091  -51.347 1.00 108.98 ? 644 LYS B HZ1  1 
ATOM   4630  H HZ2  . LYS A 1 307 ? -45.452 13.647  -50.121 1.00 108.98 ? 644 LYS B HZ2  1 
ATOM   4631  H HZ3  . LYS A 1 307 ? -46.894 13.603  -50.250 1.00 108.98 ? 644 LYS B HZ3  1 
ATOM   4632  N N    . ASP A 1 308 ? -44.553 16.341  -43.316 1.00 56.83  ? 645 ASP B N    1 
ATOM   4633  C CA   . ASP A 1 308 ? -44.673 16.282  -41.863 1.00 56.98  ? 645 ASP B CA   1 
ATOM   4634  C C    . ASP A 1 308 ? -44.722 17.677  -41.234 1.00 54.66  ? 645 ASP B C    1 
ATOM   4635  O O    . ASP A 1 308 ? -44.923 17.812  -40.027 1.00 54.35  ? 645 ASP B O    1 
ATOM   4636  C CB   . ASP A 1 308 ? -43.489 15.507  -41.277 1.00 56.20  ? 645 ASP B CB   1 
ATOM   4637  C CG   . ASP A 1 308 ? -43.294 14.148  -41.934 1.00 65.06  ? 645 ASP B CG   1 
ATOM   4638  O OD1  . ASP A 1 308 ? -42.133 13.696  -42.030 1.00 65.81  ? 645 ASP B OD1  1 
ATOM   4639  O OD2  . ASP A 1 308 ? -44.299 13.533  -42.355 1.00 63.93  ? 645 ASP B OD2  1 
ATOM   4640  H H    . ASP A 1 308 ? -43.750 16.482  -43.589 1.00 68.19  ? 645 ASP B H    1 
ATOM   4641  H HA   . ASP A 1 308 ? -45.497 15.808  -41.626 1.00 68.38  ? 645 ASP B HA   1 
ATOM   4642  H HB2  . ASP A 1 308 ? -42.678 16.023  -41.408 1.00 67.44  ? 645 ASP B HB2  1 
ATOM   4643  H HB3  . ASP A 1 308 ? -43.643 15.364  -40.330 1.00 67.44  ? 645 ASP B HB3  1 
ATOM   4644  N N    . ALA A 1 309 ? -44.538 18.710  -42.049 1.00 52.53  ? 646 ALA B N    1 
ATOM   4645  C CA   . ALA A 1 309 ? -44.503 20.083  -41.546 1.00 43.75  ? 646 ALA B CA   1 
ATOM   4646  C C    . ALA A 1 309 ? -45.854 20.783  -41.704 1.00 48.37  ? 646 ALA B C    1 
ATOM   4647  O O    . ALA A 1 309 ? -46.740 20.297  -42.407 1.00 54.20  ? 646 ALA B O    1 
ATOM   4648  C CB   . ALA A 1 309 ? -43.411 20.873  -42.255 1.00 41.51  ? 646 ALA B CB   1 
ATOM   4649  H H    . ALA A 1 309 ? -44.429 18.645  -42.900 1.00 63.03  ? 646 ALA B H    1 
ATOM   4650  H HA   . ALA A 1 309 ? -44.286 20.063  -40.591 1.00 52.51  ? 646 ALA B HA   1 
ATOM   4651  H HB1  . ALA A 1 309 ? -43.403 21.770  -41.913 1.00 49.81  ? 646 ALA B HB1  1 
ATOM   4652  H HB2  . ALA A 1 309 ? -42.565 20.452  -42.090 1.00 49.81  ? 646 ALA B HB2  1 
ATOM   4653  H HB3  . ALA A 1 309 ? -43.595 20.883  -43.197 1.00 49.81  ? 646 ALA B HB3  1 
ATOM   4654  N N    . ASN A 1 310 ? -45.994 21.931  -41.043 1.00 38.97  ? 647 ASN B N    1 
ATOM   4655  C CA   . ASN A 1 310 ? -47.198 22.757  -41.137 1.00 36.36  ? 647 ASN B CA   1 
ATOM   4656  C C    . ASN A 1 310 ? -48.493 21.984  -40.943 1.00 44.27  ? 647 ASN B C    1 
ATOM   4657  O O    . ASN A 1 310 ? -49.409 22.077  -41.759 1.00 43.85  ? 647 ASN B O    1 
ATOM   4658  C CB   . ASN A 1 310 ? -47.241 23.481  -42.482 1.00 31.43  ? 647 ASN B CB   1 
ATOM   4659  C CG   . ASN A 1 310 ? -46.017 24.318  -42.711 1.00 36.24  ? 647 ASN B CG   1 
ATOM   4660  O OD1  . ASN A 1 310 ? -45.846 25.354  -42.080 1.00 34.38  ? 647 ASN B OD1  1 
ATOM   4661  N ND2  . ASN A 1 310 ? -45.145 23.870  -43.607 1.00 34.20  ? 647 ASN B ND2  1 
ATOM   4662  H H    . ASN A 1 310 ? -45.393 22.260  -40.523 1.00 46.77  ? 647 ASN B H    1 
ATOM   4663  H HA   . ASN A 1 310 ? -47.158 23.441  -40.437 1.00 43.63  ? 647 ASN B HA   1 
ATOM   4664  H HB2  . ASN A 1 310 ? -47.296 22.825  -43.195 1.00 37.72  ? 647 ASN B HB2  1 
ATOM   4665  H HB3  . ASN A 1 310 ? -48.015 24.065  -42.505 1.00 37.72  ? 647 ASN B HB3  1 
ATOM   4666  H HD21 . ASN A 1 310 ? -45.296 23.133  -44.023 1.00 41.04  ? 647 ASN B HD21 1 
ATOM   4667  H HD22 . ASN A 1 310 ? -44.429 24.317  -43.770 1.00 41.04  ? 647 ASN B HD22 1 
ATOM   4668  N N    . LYS A 1 311 ? -48.565 21.235  -39.849 1.00 36.63  ? 648 LYS B N    1 
ATOM   4669  C CA   . LYS A 1 311 ? -49.749 20.472  -39.524 1.00 38.99  ? 648 LYS B CA   1 
ATOM   4670  C C    . LYS A 1 311 ? -50.625 21.320  -38.630 1.00 43.11  ? 648 LYS B C    1 
ATOM   4671  O O    . LYS A 1 311 ? -50.136 22.235  -37.977 1.00 35.32  ? 648 LYS B O    1 
ATOM   4672  C CB   . LYS A 1 311 ? -49.344 19.187  -38.801 1.00 43.58  ? 648 LYS B CB   1 
ATOM   4673  C CG   . LYS A 1 311 ? -48.378 18.337  -39.596 1.00 40.47  ? 648 LYS B CG   1 
ATOM   4674  C CD   . LYS A 1 311 ? -49.077 17.656  -40.757 1.00 52.13  ? 648 LYS B CD   1 
ATOM   4675  C CE   . LYS A 1 311 ? -48.272 16.469  -41.266 1.00 56.87  ? 648 LYS B CE   1 
ATOM   4676  N NZ   . LYS A 1 311 ? -48.952 15.777  -42.393 1.00 70.42  ? 648 LYS B NZ   1 
ATOM   4677  H H    . LYS A 1 311 ? -47.929 21.155  -39.275 1.00 43.96  ? 648 LYS B H    1 
ATOM   4678  H HA   . LYS A 1 311 ? -50.242 20.244  -40.339 1.00 46.79  ? 648 LYS B HA   1 
ATOM   4679  H HB2  . LYS A 1 311 ? -48.916 19.419  -37.962 1.00 52.30  ? 648 LYS B HB2  1 
ATOM   4680  H HB3  . LYS A 1 311 ? -50.138 18.657  -38.632 1.00 52.30  ? 648 LYS B HB3  1 
ATOM   4681  H HG2  . LYS A 1 311 ? -47.672 18.900  -39.952 1.00 48.57  ? 648 LYS B HG2  1 
ATOM   4682  H HG3  . LYS A 1 311 ? -48.003 17.652  -39.020 1.00 48.57  ? 648 LYS B HG3  1 
ATOM   4683  H HD2  . LYS A 1 311 ? -49.944 17.334  -40.464 1.00 62.56  ? 648 LYS B HD2  1 
ATOM   4684  H HD3  . LYS A 1 311 ? -49.181 18.289  -41.485 1.00 62.56  ? 648 LYS B HD3  1 
ATOM   4685  H HE2  . LYS A 1 311 ? -47.408 16.781  -41.579 1.00 68.25  ? 648 LYS B HE2  1 
ATOM   4686  H HE3  . LYS A 1 311 ? -48.156 15.830  -40.545 1.00 68.25  ? 648 LYS B HE3  1 
ATOM   4687  H HZ1  . LYS A 1 311 ? -49.747 15.476  -42.130 1.00 84.51  ? 648 LYS B HZ1  1 
ATOM   4688  H HZ2  . LYS A 1 311 ? -49.066 16.342  -43.071 1.00 84.51  ? 648 LYS B HZ2  1 
ATOM   4689  H HZ3  . LYS A 1 311 ? -48.459 15.090  -42.669 1.00 84.51  ? 648 LYS B HZ3  1 
ATOM   4690  N N    . GLY A 1 312 ? -51.919 21.017  -38.599 1.00 50.92  ? 649 GLY B N    1 
ATOM   4691  C CA   . GLY A 1 312 ? -52.866 21.797  -37.822 1.00 53.04  ? 649 GLY B CA   1 
ATOM   4692  C C    . GLY A 1 312 ? -52.798 21.526  -36.330 1.00 55.77  ? 649 GLY B C    1 
ATOM   4693  O O    . GLY A 1 312 ? -53.369 22.271  -35.532 1.00 53.37  ? 649 GLY B O    1 
ATOM   4694  H H    . GLY A 1 312 ? -52.273 20.358  -39.024 1.00 61.11  ? 649 GLY B H    1 
ATOM   4695  H HA2  . GLY A 1 312 ? -52.696 22.741  -37.966 1.00 63.65  ? 649 GLY B HA2  1 
ATOM   4696  H HA3  . GLY A 1 312 ? -53.766 21.600  -38.125 1.00 63.65  ? 649 GLY B HA3  1 
ATOM   4697  N N    . THR A 1 313 ? -52.095 20.463  -35.949 1.00 62.38  ? 650 THR B N    1 
ATOM   4698  C CA   . THR A 1 313 ? -52.016 20.062  -34.551 1.00 66.06  ? 650 THR B CA   1 
ATOM   4699  C C    . THR A 1 313 ? -50.613 19.561  -34.210 1.00 50.74  ? 650 THR B C    1 
ATOM   4700  O O    . THR A 1 313 ? -49.975 18.902  -35.030 1.00 43.02  ? 650 THR B O    1 
ATOM   4701  C CB   . THR A 1 313 ? -53.032 18.941  -34.249 1.00 76.45  ? 650 THR B CB   1 
ATOM   4702  O OG1  . THR A 1 313 ? -54.286 19.251  -34.871 1.00 82.02  ? 650 THR B OG1  1 
ATOM   4703  C CG2  . THR A 1 313 ? -53.238 18.780  -32.752 1.00 75.91  ? 650 THR B CG2  1 
ATOM   4704  H H    . THR A 1 313 ? -51.654 19.956  -36.485 1.00 74.85  ? 650 THR B H    1 
ATOM   4705  H HA   . THR A 1 313 ? -52.220 20.830  -33.977 1.00 79.27  ? 650 THR B HA   1 
ATOM   4706  H HB   . THR A 1 313 ? -52.698 18.102  -34.603 1.00 91.74  ? 650 THR B HB   1 
ATOM   4707  H HG1  . THR A 1 313 ? -54.189 19.315  -35.683 1.00 98.42  ? 650 THR B HG1  1 
ATOM   4708  H HG21 . THR A 1 313 ? -53.873 18.079  -32.582 1.00 91.09  ? 650 THR B HG21 1 
ATOM   4709  H HG22 . THR A 1 313 ? -52.406 18.556  -32.329 1.00 91.09  ? 650 THR B HG22 1 
ATOM   4710  H HG23 . THR A 1 313 ? -53.569 19.599  -32.377 1.00 91.09  ? 650 THR B HG23 1 
ATOM   4711  N N    . PRO A 1 314 ? -50.126 19.877  -32.997 1.00 42.23  ? 651 PRO B N    1 
ATOM   4712  C CA   . PRO A 1 314 ? -48.816 19.360  -32.591 1.00 41.66  ? 651 PRO B CA   1 
ATOM   4713  C C    . PRO A 1 314 ? -48.765 17.841  -32.669 1.00 49.72  ? 651 PRO B C    1 
ATOM   4714  O O    . PRO A 1 314 ? -47.727 17.272  -33.000 1.00 43.39  ? 651 PRO B O    1 
ATOM   4715  C CB   . PRO A 1 314 ? -48.687 19.810  -31.129 1.00 38.74  ? 651 PRO B CB   1 
ATOM   4716  C CG   . PRO A 1 314 ? -49.648 20.917  -30.953 1.00 37.44  ? 651 PRO B CG   1 
ATOM   4717  C CD   . PRO A 1 314 ? -50.763 20.679  -31.935 1.00 41.57  ? 651 PRO B CD   1 
ATOM   4718  H HA   . PRO A 1 314 ? -48.097 19.753  -33.129 1.00 49.99  ? 651 PRO B HA   1 
ATOM   4719  H HB2  . PRO A 1 314 ? -48.909 19.070  -30.542 1.00 46.49  ? 651 PRO B HB2  1 
ATOM   4720  H HB3  . PRO A 1 314 ? -47.782 20.116  -30.963 1.00 46.49  ? 651 PRO B HB3  1 
ATOM   4721  H HG2  . PRO A 1 314 ? -49.989 20.906  -30.045 1.00 44.93  ? 651 PRO B HG2  1 
ATOM   4722  H HG3  . PRO A 1 314 ? -49.207 21.760  -31.140 1.00 44.93  ? 651 PRO B HG3  1 
ATOM   4723  H HD2  . PRO A 1 314 ? -51.479 20.176  -31.516 1.00 49.89  ? 651 PRO B HD2  1 
ATOM   4724  H HD3  . PRO A 1 314 ? -51.082 21.522  -32.293 1.00 49.89  ? 651 PRO B HD3  1 
ATOM   4725  N N    . GLU A 1 315 ? -49.883 17.191  -32.371 1.00 58.77  ? 652 GLU B N    1 
ATOM   4726  C CA   . GLU A 1 315 ? -49.923 15.735  -32.355 1.00 64.64  ? 652 GLU B CA   1 
ATOM   4727  C C    . GLU A 1 315 ? -49.541 15.145  -33.710 1.00 55.18  ? 652 GLU B C    1 
ATOM   4728  O O    . GLU A 1 315 ? -48.918 14.091  -33.780 1.00 42.84  ? 652 GLU B O    1 
ATOM   4729  C CB   . GLU A 1 315 ? -51.308 15.240  -31.923 1.00 76.14  ? 652 GLU B CB   1 
ATOM   4730  C CG   . GLU A 1 315 ? -51.574 15.398  -30.430 1.00 82.39  ? 652 GLU B CG   1 
ATOM   4731  C CD   . GLU A 1 315 ? -52.710 16.357  -30.134 1.00 93.17  ? 652 GLU B CD   1 
ATOM   4732  O OE1  . GLU A 1 315 ? -53.833 16.125  -30.629 1.00 100.46 ? 652 GLU B OE1  1 
ATOM   4733  O OE2  . GLU A 1 315 ? -52.481 17.345  -29.405 1.00 93.21  ? 652 GLU B OE2  1 
ATOM   4734  H H    . GLU A 1 315 ? -50.630 17.568  -32.173 1.00 70.52  ? 652 GLU B H    1 
ATOM   4735  H HA   . GLU A 1 315 ? -49.274 15.411  -31.697 1.00 77.57  ? 652 GLU B HA   1 
ATOM   4736  H HB2  . GLU A 1 315 ? -51.984 15.746  -32.400 1.00 91.37  ? 652 GLU B HB2  1 
ATOM   4737  H HB3  . GLU A 1 315 ? -51.386 14.298  -32.141 1.00 91.37  ? 652 GLU B HB3  1 
ATOM   4738  H HG2  . GLU A 1 315 ? -51.807 14.533  -30.058 1.00 98.86  ? 652 GLU B HG2  1 
ATOM   4739  H HG3  . GLU A 1 315 ? -50.774 15.739  -30.001 1.00 98.86  ? 652 GLU B HG3  1 
ATOM   4740  N N    . GLU A 1 316 ? -49.898 15.834  -34.788 1.00 49.09  ? 653 GLU B N    1 
ATOM   4741  C CA   . GLU A 1 316 ? -49.670 15.310  -36.130 1.00 39.69  ? 653 GLU B CA   1 
ATOM   4742  C C    . GLU A 1 316 ? -48.214 15.381  -36.574 1.00 42.48  ? 653 GLU B C    1 
ATOM   4743  O O    . GLU A 1 316 ? -47.860 14.835  -37.621 1.00 45.73  ? 653 GLU B O    1 
ATOM   4744  C CB   . GLU A 1 316 ? -50.534 16.066  -37.139 1.00 50.04  ? 653 GLU B CB   1 
ATOM   4745  C CG   . GLU A 1 316 ? -52.013 16.029  -36.820 1.00 56.88  ? 653 GLU B CG   1 
ATOM   4746  C CD   . GLU A 1 316 ? -52.834 16.809  -37.819 1.00 61.22  ? 653 GLU B CD   1 
ATOM   4747  O OE1  . GLU A 1 316 ? -53.479 17.796  -37.403 1.00 63.37  ? 653 GLU B OE1  1 
ATOM   4748  O OE2  . GLU A 1 316 ? -52.831 16.433  -39.015 1.00 53.24  ? 653 GLU B OE2  1 
ATOM   4749  H H    . GLU A 1 316 ? -50.273 16.607  -34.770 1.00 58.91  ? 653 GLU B H    1 
ATOM   4750  H HA   . GLU A 1 316 ? -49.942 14.369  -36.150 1.00 47.63  ? 653 GLU B HA   1 
ATOM   4751  H HB2  . GLU A 1 316 ? -50.257 16.996  -37.154 1.00 60.05  ? 653 GLU B HB2  1 
ATOM   4752  H HB3  . GLU A 1 316 ? -50.410 15.671  -38.016 1.00 60.05  ? 653 GLU B HB3  1 
ATOM   4753  H HG2  . GLU A 1 316 ? -52.317 15.109  -36.832 1.00 68.25  ? 653 GLU B HG2  1 
ATOM   4754  H HG3  . GLU A 1 316 ? -52.158 16.417  -35.943 1.00 68.25  ? 653 GLU B HG3  1 
ATOM   4755  N N    . THR A 1 317 ? -47.373 16.059  -35.798 1.00 44.90  ? 654 THR B N    1 
ATOM   4756  C CA   . THR A 1 317 ? -45.957 16.158  -36.134 1.00 45.23  ? 654 THR B CA   1 
ATOM   4757  C C    . THR A 1 317 ? -45.160 15.085  -35.399 1.00 47.89  ? 654 THR B C    1 
ATOM   4758  O O    . THR A 1 317 ? -43.945 14.985  -35.566 1.00 39.41  ? 654 THR B O    1 
ATOM   4759  C CB   . THR A 1 317 ? -45.365 17.531  -35.760 1.00 43.85  ? 654 THR B CB   1 
ATOM   4760  O OG1  . THR A 1 317 ? -45.334 17.662  -34.336 1.00 40.88  ? 654 THR B OG1  1 
ATOM   4761  C CG2  . THR A 1 317 ? -46.188 18.682  -36.363 1.00 37.98  ? 654 THR B CG2  1 
ATOM   4762  H H    . THR A 1 317 ? -47.596 16.469  -35.076 1.00 53.88  ? 654 THR B H    1 
ATOM   4763  H HA   . THR A 1 317 ? -45.842 16.023  -37.098 1.00 54.28  ? 654 THR B HA   1 
ATOM   4764  H HB   . THR A 1 317 ? -44.461 17.593  -36.105 1.00 52.62  ? 654 THR B HB   1 
ATOM   4765  H HG1  . THR A 1 317 ? -46.093 17.603  -34.033 1.00 49.05  ? 654 THR B HG1  1 
ATOM   4766  H HG21 . THR A 1 317 ? -45.801 19.526  -36.116 1.00 45.58  ? 654 THR B HG21 1 
ATOM   4767  H HG22 . THR A 1 317 ? -46.198 18.611  -37.320 1.00 45.58  ? 654 THR B HG22 1 
ATOM   4768  H HG23 . THR A 1 317 ? -47.090 18.646  -36.037 1.00 45.58  ? 654 THR B HG23 1 
ATOM   4769  N N    . GLY A 1 318 ? -45.843 14.293  -34.577 1.00 50.97  ? 655 GLY B N    1 
ATOM   4770  C CA   . GLY A 1 318 ? -45.188 13.260  -33.797 1.00 55.46  ? 655 GLY B CA   1 
ATOM   4771  C C    . GLY A 1 318 ? -44.649 13.811  -32.492 1.00 50.68  ? 655 GLY B C    1 
ATOM   4772  O O    . GLY A 1 318 ? -43.760 13.223  -31.877 1.00 39.65  ? 655 GLY B O    1 
ATOM   4773  H H    . GLY A 1 318 ? -46.693 14.337  -34.456 1.00 61.16  ? 655 GLY B H    1 
ATOM   4774  H HA2  . GLY A 1 318 ? -45.820 12.551  -33.598 1.00 66.56  ? 655 GLY B HA2  1 
ATOM   4775  H HA3  . GLY A 1 318 ? -44.451 12.886  -34.304 1.00 66.56  ? 655 GLY B HA3  1 
ATOM   4776  N N    . SER A 1 319 ? -45.198 14.944  -32.066 1.00 37.68  ? 656 SER B N    1 
ATOM   4777  C CA   . SER A 1 319 ? -44.760 15.596  -30.838 1.00 37.67  ? 656 SER B CA   1 
ATOM   4778  C C    . SER A 1 319 ? -45.461 15.012  -29.612 1.00 51.97  ? 656 SER B C    1 
ATOM   4779  O O    . SER A 1 319 ? -46.620 14.605  -29.680 1.00 53.34  ? 656 SER B O    1 
ATOM   4780  C CB   . SER A 1 319 ? -45.033 17.101  -30.916 1.00 47.44  ? 656 SER B CB   1 
ATOM   4781  O OG   . SER A 1 319 ? -44.589 17.760  -29.739 1.00 46.74  ? 656 SER B OG   1 
ATOM   4782  H H    . SER A 1 319 ? -45.831 15.358  -32.474 1.00 45.22  ? 656 SER B H    1 
ATOM   4783  H HA   . SER A 1 319 ? -43.795 15.464  -30.730 1.00 45.20  ? 656 SER B HA   1 
ATOM   4784  H HB2  . SER A 1 319 ? -44.561 17.468  -31.680 1.00 56.93  ? 656 SER B HB2  1 
ATOM   4785  H HB3  . SER A 1 319 ? -45.987 17.244  -31.016 1.00 56.93  ? 656 SER B HB3  1 
ATOM   4786  H HG   . SER A 1 319 ? -44.262 17.216  -29.220 1.00 56.09  ? 656 SER B HG   1 
ATOM   4787  N N    . TYR A 1 320 ? -44.740 14.969  -28.496 1.00 67.23  ? 657 TYR B N    1 
ATOM   4788  C CA   . TYR A 1 320 ? -45.312 14.560  -27.220 1.00 65.03  ? 657 TYR B CA   1 
ATOM   4789  C C    . TYR A 1 320 ? -46.232 15.657  -26.708 1.00 62.49  ? 657 TYR B C    1 
ATOM   4790  O O    . TYR A 1 320 ? -47.193 15.395  -25.988 1.00 59.36  ? 657 TYR B O    1 
ATOM   4791  C CB   . TYR A 1 320 ? -44.205 14.309  -26.198 1.00 58.18  ? 657 TYR B CB   1 
ATOM   4792  C CG   . TYR A 1 320 ? -44.717 13.932  -24.830 1.00 67.56  ? 657 TYR B CG   1 
ATOM   4793  C CD1  . TYR A 1 320 ? -44.749 12.606  -24.424 1.00 67.17  ? 657 TYR B CD1  1 
ATOM   4794  C CD2  . TYR A 1 320 ? -45.172 14.901  -23.945 1.00 77.84  ? 657 TYR B CD2  1 
ATOM   4795  C CE1  . TYR A 1 320 ? -45.219 12.253  -23.169 1.00 70.81  ? 657 TYR B CE1  1 
ATOM   4796  C CE2  . TYR A 1 320 ? -45.643 14.559  -22.690 1.00 84.10  ? 657 TYR B CE2  1 
ATOM   4797  C CZ   . TYR A 1 320 ? -45.664 13.233  -22.306 1.00 77.77  ? 657 TYR B CZ   1 
ATOM   4798  O OH   . TYR A 1 320 ? -46.132 12.887  -21.057 1.00 82.26  ? 657 TYR B OH   1 
ATOM   4799  H H    . TYR A 1 320 ? -43.906 15.175  -28.453 1.00 80.68  ? 657 TYR B H    1 
ATOM   4800  H HA   . TYR A 1 320 ? -45.832 13.737  -27.335 1.00 78.03  ? 657 TYR B HA   1 
ATOM   4801  H HB2  . TYR A 1 320 ? -43.645 13.583  -26.516 1.00 69.82  ? 657 TYR B HB2  1 
ATOM   4802  H HB3  . TYR A 1 320 ? -43.676 15.116  -26.105 1.00 69.82  ? 657 TYR B HB3  1 
ATOM   4803  H HD1  . TYR A 1 320 ? -44.449 11.943  -25.002 1.00 80.61  ? 657 TYR B HD1  1 
ATOM   4804  H HD2  . TYR A 1 320 ? -45.158 15.796  -24.200 1.00 93.41  ? 657 TYR B HD2  1 
ATOM   4805  H HE1  . TYR A 1 320 ? -45.233 11.360  -22.910 1.00 84.97  ? 657 TYR B HE1  1 
ATOM   4806  H HE2  . TYR A 1 320 ? -45.943 15.219  -22.107 1.00 100.92 ? 657 TYR B HE2  1 
ATOM   4807  H HH   . TYR A 1 320 ? -46.911 13.127  -20.973 1.00 98.71  ? 657 TYR B HH   1 
ATOM   4808  N N    . LEU A 1 321 ? -45.916 16.891  -27.085 1.00 62.39  ? 658 LEU B N    1 
ATOM   4809  C CA   . LEU A 1 321 ? -46.721 18.043  -26.720 1.00 58.97  ? 658 LEU B CA   1 
ATOM   4810  C C    . LEU A 1 321 ? -48.112 17.955  -27.348 1.00 61.75  ? 658 LEU B C    1 
ATOM   4811  O O    . LEU A 1 321 ? -48.265 17.519  -28.493 1.00 59.44  ? 658 LEU B O    1 
ATOM   4812  C CB   . LEU A 1 321 ? -46.004 19.321  -27.153 1.00 57.91  ? 658 LEU B CB   1 
ATOM   4813  C CG   . LEU A 1 321 ? -44.701 19.598  -26.402 1.00 54.49  ? 658 LEU B CG   1 
ATOM   4814  C CD1  . LEU A 1 321 ? -44.031 20.850  -26.939 1.00 55.33  ? 658 LEU B CD1  1 
ATOM   4815  C CD2  . LEU A 1 321 ? -44.958 19.729  -24.910 1.00 50.68  ? 658 LEU B CD2  1 
ATOM   4816  H H    . LEU A 1 321 ? -45.227 17.086  -27.561 1.00 74.87  ? 658 LEU B H    1 
ATOM   4817  H HA   . LEU A 1 321 ? -46.826 18.067  -25.746 1.00 70.76  ? 658 LEU B HA   1 
ATOM   4818  H HB2  . LEU A 1 321 ? -45.791 19.253  -28.097 1.00 69.49  ? 658 LEU B HB2  1 
ATOM   4819  H HB3  . LEU A 1 321 ? -46.596 20.075  -27.005 1.00 69.49  ? 658 LEU B HB3  1 
ATOM   4820  H HG   . LEU A 1 321 ? -44.094 18.853  -26.537 1.00 65.38  ? 658 LEU B HG   1 
ATOM   4821  H HD11 . LEU A 1 321 ? -43.218 21.002  -26.452 1.00 66.39  ? 658 LEU B HD11 1 
ATOM   4822  H HD12 . LEU A 1 321 ? -43.837 20.725  -27.871 1.00 66.39  ? 658 LEU B HD12 1 
ATOM   4823  H HD13 . LEU A 1 321 ? -44.625 21.596  -26.825 1.00 66.39  ? 658 LEU B HD13 1 
ATOM   4824  H HD21 . LEU A 1 321 ? -44.126 19.902  -24.464 1.00 60.81  ? 658 LEU B HD21 1 
ATOM   4825  H HD22 . LEU A 1 321 ? -45.568 20.455  -24.761 1.00 60.81  ? 658 LEU B HD22 1 
ATOM   4826  H HD23 . LEU A 1 321 ? -45.339 18.909  -24.586 1.00 60.81  ? 658 LEU B HD23 1 
ATOM   4827  N N    . VAL A 1 322 ? -49.123 18.341  -26.574 1.00 68.30  ? 659 VAL B N    1 
ATOM   4828  C CA   . VAL A 1 322 ? -50.506 18.345  -27.036 1.00 71.25  ? 659 VAL B CA   1 
ATOM   4829  C C    . VAL A 1 322 ? -51.030 19.772  -27.185 1.00 71.93  ? 659 VAL B C    1 
ATOM   4830  O O    . VAL A 1 322 ? -50.385 20.727  -26.761 1.00 66.71  ? 659 VAL B O    1 
ATOM   4831  C CB   . VAL A 1 322 ? -51.407 17.562  -26.064 1.00 76.64  ? 659 VAL B CB   1 
ATOM   4832  C CG1  . VAL A 1 322 ? -50.906 16.132  -25.928 1.00 71.52  ? 659 VAL B CG1  1 
ATOM   4833  C CG2  . VAL A 1 322 ? -51.447 18.247  -24.705 1.00 76.34  ? 659 VAL B CG2  1 
ATOM   4834  H H    . VAL A 1 322 ? -49.030 18.611  -25.763 1.00 81.96  ? 659 VAL B H    1 
ATOM   4835  H HA   . VAL A 1 322 ? -50.553 17.910  -27.913 1.00 85.50  ? 659 VAL B HA   1 
ATOM   4836  H HB   . VAL A 1 322 ? -52.319 17.535  -26.421 1.00 91.97  ? 659 VAL B HB   1 
ATOM   4837  H HG11 . VAL A 1 322 ? -51.477 15.657  -25.320 1.00 85.82  ? 659 VAL B HG11 1 
ATOM   4838  H HG12 . VAL A 1 322 ? -50.924 15.711  -26.791 1.00 85.82  ? 659 VAL B HG12 1 
ATOM   4839  H HG13 . VAL A 1 322 ? -50.007 16.147  -25.590 1.00 85.82  ? 659 VAL B HG13 1 
ATOM   4840  H HG21 . VAL A 1 322 ? -52.014 17.742  -24.117 1.00 91.61  ? 659 VAL B HG21 1 
ATOM   4841  H HG22 . VAL A 1 322 ? -50.556 18.286  -24.348 1.00 91.61  ? 659 VAL B HG22 1 
ATOM   4842  H HG23 . VAL A 1 322 ? -51.796 19.135  -24.813 1.00 91.61  ? 659 VAL B HG23 1 
ATOM   4843  N N    . SER A 1 323 ? -52.206 19.911  -27.787 1.00 78.94  ? 660 SER B N    1 
ATOM   4844  C CA   . SER A 1 323 ? -52.730 21.226  -28.149 1.00 72.88  ? 660 SER B CA   1 
ATOM   4845  C C    . SER A 1 323 ? -52.828 22.184  -26.958 1.00 77.04  ? 660 SER B C    1 
ATOM   4846  O O    . SER A 1 323 ? -52.786 23.400  -27.133 1.00 80.54  ? 660 SER B O    1 
ATOM   4847  C CB   . SER A 1 323 ? -54.100 21.081  -28.820 1.00 67.41  ? 660 SER B CB   1 
ATOM   4848  O OG   . SER A 1 323 ? -53.992 20.414  -30.069 1.00 55.67  ? 660 SER B OG   1 
ATOM   4849  H H    . SER A 1 323 ? -52.723 19.257  -27.998 1.00 94.73  ? 660 SER B H    1 
ATOM   4850  H HA   . SER A 1 323 ? -52.124 21.631  -28.803 1.00 87.46  ? 660 SER B HA   1 
ATOM   4851  H HB2  . SER A 1 323 ? -54.683 20.568  -28.239 1.00 80.90  ? 660 SER B HB2  1 
ATOM   4852  H HB3  . SER A 1 323 ? -54.474 21.964  -28.966 1.00 80.90  ? 660 SER B HB3  1 
ATOM   4853  H HG   . SER A 1 323 ? -54.732 20.344  -30.415 1.00 66.80  ? 660 SER B HG   1 
ATOM   4854  N N    . LYS A 1 324 ? -52.944 21.640  -25.751 1.00 79.89  ? 661 LYS B N    1 
ATOM   4855  C CA   . LYS A 1 324 ? -53.171 22.465  -24.569 1.00 84.35  ? 661 LYS B CA   1 
ATOM   4856  C C    . LYS A 1 324 ? -51.894 23.029  -23.935 1.00 78.13  ? 661 LYS B C    1 
ATOM   4857  O O    . LYS A 1 324 ? -51.974 23.898  -23.068 1.00 78.68  ? 661 LYS B O    1 
ATOM   4858  C CB   . LYS A 1 324 ? -53.973 21.684  -23.526 1.00 100.52 ? 661 LYS B CB   1 
ATOM   4859  C CG   . LYS A 1 324 ? -55.408 21.400  -23.952 1.00 118.63 ? 661 LYS B CG   1 
ATOM   4860  C CD   . LYS A 1 324 ? -56.205 20.724  -22.845 1.00 131.68 ? 661 LYS B CD   1 
ATOM   4861  C CE   . LYS A 1 324 ? -55.633 19.359  -22.496 1.00 135.02 ? 661 LYS B CE   1 
ATOM   4862  N NZ   . LYS A 1 324 ? -56.419 18.682  -21.429 1.00 139.08 ? 661 LYS B NZ   1 
ATOM   4863  H H    . LYS A 1 324 ? -52.895 20.796  -25.589 1.00 95.87  ? 661 LYS B H    1 
ATOM   4864  H HA   . LYS A 1 324 ? -53.719 23.232  -24.838 1.00 101.22 ? 661 LYS B HA   1 
ATOM   4865  H HB2  . LYS A 1 324 ? -53.536 20.833  -23.367 1.00 120.63 ? 661 LYS B HB2  1 
ATOM   4866  H HB3  . LYS A 1 324 ? -54.003 22.198  -22.704 1.00 120.63 ? 661 LYS B HB3  1 
ATOM   4867  H HG2  . LYS A 1 324 ? -55.846 22.237  -24.173 1.00 142.36 ? 661 LYS B HG2  1 
ATOM   4868  H HG3  . LYS A 1 324 ? -55.401 20.812  -24.723 1.00 142.36 ? 661 LYS B HG3  1 
ATOM   4869  H HD2  . LYS A 1 324 ? -56.178 21.277  -22.049 1.00 158.02 ? 661 LYS B HD2  1 
ATOM   4870  H HD3  . LYS A 1 324 ? -57.121 20.603  -23.139 1.00 158.02 ? 661 LYS B HD3  1 
ATOM   4871  H HE2  . LYS A 1 324 ? -55.648 18.796  -23.286 1.00 162.02 ? 661 LYS B HE2  1 
ATOM   4872  H HE3  . LYS A 1 324 ? -54.723 19.466  -22.179 1.00 162.02 ? 661 LYS B HE3  1 
ATOM   4873  H HZ1  . LYS A 1 324 ? -56.062 17.887  -21.246 1.00 166.90 ? 661 LYS B HZ1  1 
ATOM   4874  H HZ2  . LYS A 1 324 ? -56.417 19.177  -20.689 1.00 166.90 ? 661 LYS B HZ2  1 
ATOM   4875  H HZ3  . LYS A 1 324 ? -57.260 18.566  -21.697 1.00 166.90 ? 661 LYS B HZ3  1 
ATOM   4876  N N    . ASP A 1 325 ? -50.725 22.549  -24.354 1.00 74.95  ? 662 ASP B N    1 
ATOM   4877  C CA   . ASP A 1 325 ? -49.465 23.095  -23.847 1.00 72.54  ? 662 ASP B CA   1 
ATOM   4878  C C    . ASP A 1 325 ? -48.881 24.138  -24.796 1.00 63.34  ? 662 ASP B C    1 
ATOM   4879  O O    . ASP A 1 325 ? -47.832 24.719  -24.515 1.00 59.74  ? 662 ASP B O    1 
ATOM   4880  C CB   . ASP A 1 325 ? -48.420 21.996  -23.627 1.00 75.00  ? 662 ASP B CB   1 
ATOM   4881  C CG   . ASP A 1 325 ? -48.939 20.840  -22.793 1.00 77.96  ? 662 ASP B CG   1 
ATOM   4882  O OD1  . ASP A 1 325 ? -49.487 21.095  -21.700 1.00 77.49  ? 662 ASP B OD1  1 
ATOM   4883  O OD2  . ASP A 1 325 ? -48.786 19.674  -23.228 1.00 73.51  ? 662 ASP B OD2  1 
ATOM   4884  H H    . ASP A 1 325 ? -50.633 21.914  -24.927 1.00 89.94  ? 662 ASP B H    1 
ATOM   4885  H HA   . ASP A 1 325 ? -49.631 23.531  -22.985 1.00 87.04  ? 662 ASP B HA   1 
ATOM   4886  H HB2  . ASP A 1 325 ? -48.147 21.644  -24.489 1.00 90.00  ? 662 ASP B HB2  1 
ATOM   4887  H HB3  . ASP A 1 325 ? -47.655 22.376  -23.168 1.00 90.00  ? 662 ASP B HB3  1 
ATOM   4888  N N    . LEU A 1 326 ? -49.550 24.361  -25.925 1.00 65.83  ? 663 LEU B N    1 
ATOM   4889  C CA   . LEU A 1 326 ? -49.093 25.334  -26.914 1.00 59.94  ? 663 LEU B CA   1 
ATOM   4890  C C    . LEU A 1 326 ? -50.237 26.224  -27.384 1.00 68.42  ? 663 LEU B C    1 
ATOM   4891  O O    . LEU A 1 326 ? -51.403 25.833  -27.312 1.00 68.59  ? 663 LEU B O    1 
ATOM   4892  C CB   . LEU A 1 326 ? -48.499 24.620  -28.129 1.00 53.88  ? 663 LEU B CB   1 
ATOM   4893  C CG   . LEU A 1 326 ? -47.101 24.029  -27.973 1.00 56.26  ? 663 LEU B CG   1 
ATOM   4894  C CD1  . LEU A 1 326 ? -46.692 23.319  -29.248 1.00 48.73  ? 663 LEU B CD1  1 
ATOM   4895  C CD2  . LEU A 1 326 ? -46.101 25.116  -27.615 1.00 61.66  ? 663 LEU B CD2  1 
ATOM   4896  H H    . LEU A 1 326 ? -50.278 23.959  -26.142 1.00 79.00  ? 663 LEU B H    1 
ATOM   4897  H HA   . LEU A 1 326 ? -48.400 25.902  -26.518 1.00 71.92  ? 663 LEU B HA   1 
ATOM   4898  H HB2  . LEU A 1 326 ? -49.092 23.891  -28.369 1.00 64.66  ? 663 LEU B HB2  1 
ATOM   4899  H HB3  . LEU A 1 326 ? -48.460 25.255  -28.862 1.00 64.66  ? 663 LEU B HB3  1 
ATOM   4900  H HG   . LEU A 1 326 ? -47.110 23.378  -27.254 1.00 67.52  ? 663 LEU B HG   1 
ATOM   4901  H HD11 . LEU A 1 326 ? -45.812 22.953  -29.133 1.00 58.48  ? 663 LEU B HD11 1 
ATOM   4902  H HD12 . LEU A 1 326 ? -47.319 22.614  -29.427 1.00 58.48  ? 663 LEU B HD12 1 
ATOM   4903  H HD13 . LEU A 1 326 ? -46.693 23.950  -29.971 1.00 58.48  ? 663 LEU B HD13 1 
ATOM   4904  H HD21 . LEU A 1 326 ? -45.231 24.721  -27.523 1.00 73.99  ? 663 LEU B HD21 1 
ATOM   4905  H HD22 . LEU A 1 326 ? -46.090 25.772  -28.316 1.00 73.99  ? 663 LEU B HD22 1 
ATOM   4906  H HD23 . LEU A 1 326 ? -46.366 25.523  -26.788 1.00 73.99  ? 663 LEU B HD23 1 
ATOM   4907  N N    . PRO A 1 327 ? -49.906 27.423  -27.887 1.00 67.30  ? 664 PRO B N    1 
ATOM   4908  C CA   . PRO A 1 327 ? -50.957 28.298  -28.421 1.00 66.99  ? 664 PRO B CA   1 
ATOM   4909  C C    . PRO A 1 327 ? -51.811 27.540  -29.428 1.00 60.90  ? 664 PRO B C    1 
ATOM   4910  O O    . PRO A 1 327 ? -51.308 26.613  -30.062 1.00 60.78  ? 664 PRO B O    1 
ATOM   4911  C CB   . PRO A 1 327 ? -50.170 29.420  -29.101 1.00 64.22  ? 664 PRO B CB   1 
ATOM   4912  C CG   . PRO A 1 327 ? -48.859 29.447  -28.378 1.00 61.78  ? 664 PRO B CG   1 
ATOM   4913  C CD   . PRO A 1 327 ? -48.564 28.013  -28.037 1.00 58.62  ? 664 PRO B CD   1 
ATOM   4914  H HA   . PRO A 1 327 ? -51.517 28.661  -27.703 1.00 80.39  ? 664 PRO B HA   1 
ATOM   4915  H HB2  . PRO A 1 327 ? -50.042 29.211  -30.040 1.00 77.06  ? 664 PRO B HB2  1 
ATOM   4916  H HB3  . PRO A 1 327 ? -50.640 30.262  -28.996 1.00 77.06  ? 664 PRO B HB3  1 
ATOM   4917  H HG2  . PRO A 1 327 ? -48.172 29.809  -28.959 1.00 74.14  ? 664 PRO B HG2  1 
ATOM   4918  H HG3  . PRO A 1 327 ? -48.941 29.981  -27.572 1.00 74.14  ? 664 PRO B HG3  1 
ATOM   4919  H HD2  . PRO A 1 327 ? -48.084 27.584  -28.762 1.00 70.34  ? 664 PRO B HD2  1 
ATOM   4920  H HD3  . PRO A 1 327 ? -48.074 27.957  -27.202 1.00 70.34  ? 664 PRO B HD3  1 
ATOM   4921  N N    . LYS A 1 328 ? -53.078 27.912  -29.561 1.00 53.51  ? 665 LYS B N    1 
ATOM   4922  C CA   . LYS A 1 328 ? -53.986 27.192  -30.446 1.00 66.69  ? 665 LYS B CA   1 
ATOM   4923  C C    . LYS A 1 328 ? -54.050 27.839  -31.822 1.00 66.49  ? 665 LYS B C    1 
ATOM   4924  O O    . LYS A 1 328 ? -53.614 28.973  -32.003 1.00 60.43  ? 665 LYS B O    1 
ATOM   4925  C CB   . LYS A 1 328 ? -55.397 27.142  -29.849 1.00 83.73  ? 665 LYS B CB   1 
ATOM   4926  C CG   . LYS A 1 328 ? -55.487 26.436  -28.504 1.00 92.07  ? 665 LYS B CG   1 
ATOM   4927  C CD   . LYS A 1 328 ? -55.162 27.376  -27.354 1.00 95.79  ? 665 LYS B CD   1 
ATOM   4928  C CE   . LYS A 1 328 ? -55.176 26.648  -26.022 1.00 98.57  ? 665 LYS B CE   1 
ATOM   4929  N NZ   . LYS A 1 328 ? -54.095 25.633  -25.940 1.00 94.18  ? 665 LYS B NZ   1 
ATOM   4930  H H    . LYS A 1 328 ? -53.437 28.578  -29.152 1.00 64.21  ? 665 LYS B H    1 
ATOM   4931  H HA   . LYS A 1 328 ? -53.667 26.272  -30.555 1.00 80.02  ? 665 LYS B HA   1 
ATOM   4932  H HB2  . LYS A 1 328 ? -55.714 28.050  -29.726 1.00 100.48 ? 665 LYS B HB2  1 
ATOM   4933  H HB3  . LYS A 1 328 ? -55.979 26.673  -30.467 1.00 100.48 ? 665 LYS B HB3  1 
ATOM   4934  H HG2  . LYS A 1 328 ? -56.389 26.103  -28.378 1.00 110.49 ? 665 LYS B HG2  1 
ATOM   4935  H HG3  . LYS A 1 328 ? -54.852 25.703  -28.485 1.00 110.49 ? 665 LYS B HG3  1 
ATOM   4936  H HD2  . LYS A 1 328 ? -54.277 27.751  -27.487 1.00 114.94 ? 665 LYS B HD2  1 
ATOM   4937  H HD3  . LYS A 1 328 ? -55.824 28.084  -27.321 1.00 114.94 ? 665 LYS B HD3  1 
ATOM   4938  H HE2  . LYS A 1 328 ? -55.046 27.289  -25.306 1.00 118.29 ? 665 LYS B HE2  1 
ATOM   4939  H HE3  . LYS A 1 328 ? -56.027 26.194  -25.915 1.00 118.29 ? 665 LYS B HE3  1 
ATOM   4940  H HZ1  . LYS A 1 328 ? -54.125 25.221  -25.152 1.00 113.01 ? 665 LYS B HZ1  1 
ATOM   4941  H HZ2  . LYS A 1 328 ? -54.195 25.030  -26.586 1.00 113.01 ? 665 LYS B HZ2  1 
ATOM   4942  H HZ3  . LYS A 1 328 ? -53.302 26.027  -26.031 1.00 113.01 ? 665 LYS B HZ3  1 
ATOM   4943  N N    . HIS A 1 329 ? -54.585 27.096  -32.787 1.00 75.32  ? 666 HIS B N    1 
ATOM   4944  C CA   . HIS A 1 329 ? -54.944 27.643  -34.092 1.00 77.13  ? 666 HIS B CA   1 
ATOM   4945  C C    . HIS A 1 329 ? -53.736 28.141  -34.887 1.00 64.78  ? 666 HIS B C    1 
ATOM   4946  O O    . HIS A 1 329 ? -53.824 29.118  -35.640 1.00 51.78  ? 666 HIS B O    1 
ATOM   4947  C CB   . HIS A 1 329 ? -55.976 28.756  -33.909 1.00 89.78  ? 666 HIS B CB   1 
ATOM   4948  C CG   . HIS A 1 329 ? -57.103 28.378  -32.999 1.00 103.05 ? 666 HIS B CG   1 
ATOM   4949  N ND1  . HIS A 1 329 ? -58.051 27.439  -33.341 1.00 110.83 ? 666 HIS B ND1  1 
ATOM   4950  C CD2  . HIS A 1 329 ? -57.423 28.798  -31.751 1.00 109.84 ? 666 HIS B CD2  1 
ATOM   4951  C CE1  . HIS A 1 329 ? -58.912 27.302  -32.348 1.00 117.85 ? 666 HIS B CE1  1 
ATOM   4952  N NE2  . HIS A 1 329 ? -58.553 28.116  -31.371 1.00 116.48 ? 666 HIS B NE2  1 
ATOM   4953  H H    . HIS A 1 329 ? -54.753 26.256  -32.708 1.00 90.39  ? 666 HIS B H    1 
ATOM   4954  H HA   . HIS A 1 329 ? -55.368 26.934  -34.618 1.00 92.56  ? 666 HIS B HA   1 
ATOM   4955  H HB2  . HIS A 1 329 ? -55.535 29.533  -33.531 1.00 107.73 ? 666 HIS B HB2  1 
ATOM   4956  H HB3  . HIS A 1 329 ? -56.354 28.979  -34.774 1.00 107.73 ? 666 HIS B HB3  1 
ATOM   4957  H HD2  . HIS A 1 329 ? -56.965 29.432  -31.248 1.00 131.81 ? 666 HIS B HD2  1 
ATOM   4958  H HE1  . HIS A 1 329 ? -59.646 26.731  -32.338 1.00 141.42 ? 666 HIS B HE1  1 
ATOM   4959  N N    . CYS A 1 330 ? -52.614 27.448  -34.719 1.00 60.47  ? 667 CYS B N    1 
ATOM   4960  C CA   . CYS A 1 330 ? -51.416 27.707  -35.498 1.00 50.80  ? 667 CYS B CA   1 
ATOM   4961  C C    . CYS A 1 330 ? -51.167 26.523  -36.427 1.00 47.48  ? 667 CYS B C    1 
ATOM   4962  O O    . CYS A 1 330 ? -51.956 25.579  -36.466 1.00 53.95  ? 667 CYS B O    1 
ATOM   4963  C CB   . CYS A 1 330 ? -50.213 27.884  -34.568 1.00 50.28  ? 667 CYS B CB   1 
ATOM   4964  S SG   . CYS A 1 330 ? -50.334 29.254  -33.379 1.00 49.87  ? 667 CYS B SG   1 
ATOM   4965  H H    . CYS A 1 330 ? -52.524 26.812  -34.148 1.00 72.57  ? 667 CYS B H    1 
ATOM   4966  H HA   . CYS A 1 330 ? -51.531 28.519  -36.035 1.00 60.96  ? 667 CYS B HA   1 
ATOM   4967  H HB2  . CYS A 1 330 ? -50.096 27.067  -34.059 1.00 60.34  ? 667 CYS B HB2  1 
ATOM   4968  H HB3  . CYS A 1 330 ? -49.425 28.041  -35.113 1.00 60.34  ? 667 CYS B HB3  1 
ATOM   4969  H HG   . CYS A 1 330 ? -51.288 29.076  -32.674 1.00 59.85  ? 667 CYS B HG   1 
ATOM   4970  N N    . LEU A 1 331 ? -50.074 26.586  -37.183 1.00 35.84  ? 668 LEU B N    1 
ATOM   4971  C CA   . LEU A 1 331 ? -49.530 25.413  -37.854 1.00 35.24  ? 668 LEU B CA   1 
ATOM   4972  C C    . LEU A 1 331 ? -48.220 25.063  -37.155 1.00 37.73  ? 668 LEU B C    1 
ATOM   4973  O O    . LEU A 1 331 ? -47.420 25.946  -36.859 1.00 38.58  ? 668 LEU B O    1 
ATOM   4974  C CB   . LEU A 1 331 ? -49.270 25.691  -39.329 1.00 38.52  ? 668 LEU B CB   1 
ATOM   4975  C CG   . LEU A 1 331 ? -50.513 26.045  -40.143 1.00 46.86  ? 668 LEU B CG   1 
ATOM   4976  C CD1  . LEU A 1 331 ? -50.146 26.320  -41.597 1.00 42.50  ? 668 LEU B CD1  1 
ATOM   4977  C CD2  . LEU A 1 331 ? -51.536 24.922  -40.042 1.00 57.40  ? 668 LEU B CD2  1 
ATOM   4978  H H    . LEU A 1 331 ? -49.625 27.306  -37.324 1.00 43.01  ? 668 LEU B H    1 
ATOM   4979  H HA   . LEU A 1 331 ? -50.151 24.659  -37.773 1.00 42.29  ? 668 LEU B HA   1 
ATOM   4980  H HB2  . LEU A 1 331 ? -48.652 26.436  -39.399 1.00 46.22  ? 668 LEU B HB2  1 
ATOM   4981  H HB3  . LEU A 1 331 ? -48.873 24.901  -39.728 1.00 46.22  ? 668 LEU B HB3  1 
ATOM   4982  H HG   . LEU A 1 331 ? -50.913 26.849  -39.777 1.00 56.23  ? 668 LEU B HG   1 
ATOM   4983  H HD11 . LEU A 1 331 ? -50.944 26.539  -42.084 1.00 51.00  ? 668 LEU B HD11 1 
ATOM   4984  H HD12 . LEU A 1 331 ? -49.530 27.055  -41.630 1.00 51.00  ? 668 LEU B HD12 1 
ATOM   4985  H HD13 . LEU A 1 331 ? -49.740 25.534  -41.970 1.00 51.00  ? 668 LEU B HD13 1 
ATOM   4986  H HD21 . LEU A 1 331 ? -52.310 25.159  -40.558 1.00 68.87  ? 668 LEU B HD21 1 
ATOM   4987  H HD22 . LEU A 1 331 ? -51.147 24.115  -40.386 1.00 68.87  ? 668 LEU B HD22 1 
ATOM   4988  H HD23 . LEU A 1 331 ? -51.779 24.804  -39.121 1.00 68.87  ? 668 LEU B HD23 1 
ATOM   4989  N N    . TYR A 1 332 ? -48.000 23.781  -36.897 1.00 31.81  ? 669 TYR B N    1 
ATOM   4990  C CA   . TYR A 1 332 ? -46.841 23.346  -36.124 1.00 36.75  ? 669 TYR B CA   1 
ATOM   4991  C C    . TYR A 1 332 ? -45.901 22.481  -36.957 1.00 37.21  ? 669 TYR B C    1 
ATOM   4992  O O    . TYR A 1 332 ? -46.328 21.754  -37.849 1.00 39.48  ? 669 TYR B O    1 
ATOM   4993  C CB   . TYR A 1 332 ? -47.308 22.576  -34.889 1.00 39.42  ? 669 TYR B CB   1 
ATOM   4994  C CG   . TYR A 1 332 ? -48.466 23.243  -34.204 1.00 41.12  ? 669 TYR B CG   1 
ATOM   4995  C CD1  . TYR A 1 332 ? -48.268 24.063  -33.101 1.00 43.43  ? 669 TYR B CD1  1 
ATOM   4996  C CD2  . TYR A 1 332 ? -49.764 23.085  -34.684 1.00 38.42  ? 669 TYR B CD2  1 
ATOM   4997  C CE1  . TYR A 1 332 ? -49.332 24.696  -32.483 1.00 48.82  ? 669 TYR B CE1  1 
ATOM   4998  C CE2  . TYR A 1 332 ? -50.832 23.709  -34.071 1.00 44.14  ? 669 TYR B CE2  1 
ATOM   4999  C CZ   . TYR A 1 332 ? -50.612 24.514  -32.972 1.00 49.99  ? 669 TYR B CZ   1 
ATOM   5000  O OH   . TYR A 1 332 ? -51.677 25.139  -32.362 1.00 49.43  ? 669 TYR B OH   1 
ATOM   5001  H H    . TYR A 1 332 ? -48.508 23.139  -37.159 1.00 38.17  ? 669 TYR B H    1 
ATOM   5002  H HA   . TYR A 1 332 ? -46.342 24.134  -35.822 1.00 44.09  ? 669 TYR B HA   1 
ATOM   5003  H HB2  . TYR A 1 332 ? -47.589 21.687  -35.157 1.00 47.30  ? 669 TYR B HB2  1 
ATOM   5004  H HB3  . TYR A 1 332 ? -46.576 22.517  -34.256 1.00 47.30  ? 669 TYR B HB3  1 
ATOM   5005  H HD1  . TYR A 1 332 ? -47.407 24.188  -32.772 1.00 52.11  ? 669 TYR B HD1  1 
ATOM   5006  H HD2  . TYR A 1 332 ? -49.915 22.543  -35.425 1.00 46.10  ? 669 TYR B HD2  1 
ATOM   5007  H HE1  . TYR A 1 332 ? -49.187 25.238  -31.741 1.00 58.58  ? 669 TYR B HE1  1 
ATOM   5008  H HE2  . TYR A 1 332 ? -51.694 23.590  -34.399 1.00 52.97  ? 669 TYR B HE2  1 
ATOM   5009  H HH   . TYR A 1 332 ? -51.575 25.953  -32.385 1.00 59.32  ? 669 TYR B HH   1 
ATOM   5010  N N    . THR A 1 333 ? -44.615 22.567  -36.644 1.00 29.72  ? 670 THR B N    1 
ATOM   5011  C CA   . THR A 1 333 ? -43.578 21.837  -37.361 1.00 23.74  ? 670 THR B CA   1 
ATOM   5012  C C    . THR A 1 333 ? -42.596 21.347  -36.309 1.00 28.47  ? 670 THR B C    1 
ATOM   5013  O O    . THR A 1 333 ? -42.199 22.118  -35.443 1.00 35.18  ? 670 THR B O    1 
ATOM   5014  C CB   . THR A 1 333 ? -42.870 22.755  -38.380 1.00 35.05  ? 670 THR B CB   1 
ATOM   5015  O OG1  . THR A 1 333 ? -43.797 23.125  -39.406 1.00 28.79  ? 670 THR B OG1  1 
ATOM   5016  C CG2  . THR A 1 333 ? -41.679 22.064  -39.015 1.00 40.92  ? 670 THR B CG2  1 
ATOM   5017  H H    . THR A 1 333 ? -44.311 23.054  -36.003 1.00 35.66  ? 670 THR B H    1 
ATOM   5018  H HA   . THR A 1 333 ? -43.964 21.068  -37.829 1.00 28.48  ? 670 THR B HA   1 
ATOM   5019  H HB   . THR A 1 333 ? -42.554 23.554  -37.929 1.00 42.06  ? 670 THR B HB   1 
ATOM   5020  H HG1  . THR A 1 333 ? -44.434 23.524  -39.078 1.00 34.54  ? 670 THR B HG1  1 
ATOM   5021  H HG21 . THR A 1 333 ? -41.255 22.653  -39.644 1.00 49.11  ? 670 THR B HG21 1 
ATOM   5022  H HG22 . THR A 1 333 ? -41.042 21.820  -38.339 1.00 49.11  ? 670 THR B HG22 1 
ATOM   5023  H HG23 . THR A 1 333 ? -41.966 21.272  -39.474 1.00 49.11  ? 670 THR B HG23 1 
ATOM   5024  N N    . ARG A 1 334 ? -42.232 20.067  -36.357 1.00 26.29  ? 671 ARG B N    1 
ATOM   5025  C CA   . ARG A 1 334 ? -41.318 19.502  -35.361 1.00 30.37  ? 671 ARG B CA   1 
ATOM   5026  C C    . ARG A 1 334 ? -39.885 19.413  -35.891 1.00 34.91  ? 671 ARG B C    1 
ATOM   5027  O O    . ARG A 1 334 ? -39.626 18.783  -36.910 1.00 37.24  ? 671 ARG B O    1 
ATOM   5028  C CB   . ARG A 1 334 ? -41.802 18.118  -34.920 1.00 29.20  ? 671 ARG B CB   1 
ATOM   5029  C CG   . ARG A 1 334 ? -41.123 17.573  -33.633 1.00 25.32  ? 671 ARG B CG   1 
ATOM   5030  C CD   . ARG A 1 334 ? -41.910 16.381  -33.106 1.00 35.91  ? 671 ARG B CD   1 
ATOM   5031  N NE   . ARG A 1 334 ? -41.386 15.812  -31.862 1.00 37.19  ? 671 ARG B NE   1 
ATOM   5032  C CZ   . ARG A 1 334 ? -40.496 14.827  -31.815 1.00 38.94  ? 671 ARG B CZ   1 
ATOM   5033  N NH1  . ARG A 1 334 ? -40.014 14.321  -32.949 1.00 26.45  ? 671 ARG B NH1  1 
ATOM   5034  N NH2  . ARG A 1 334 ? -40.087 14.352  -30.637 1.00 38.76  ? 671 ARG B NH2  1 
ATOM   5035  H H    . ARG A 1 334 ? -42.497 19.506  -36.952 1.00 31.54  ? 671 ARG B H    1 
ATOM   5036  H HA   . ARG A 1 334 ? -41.310 20.083  -34.573 1.00 36.44  ? 671 ARG B HA   1 
ATOM   5037  H HB2  . ARG A 1 334 ? -42.756 18.164  -34.752 1.00 35.04  ? 671 ARG B HB2  1 
ATOM   5038  H HB3  . ARG A 1 334 ? -41.627 17.486  -35.635 1.00 35.04  ? 671 ARG B HB3  1 
ATOM   5039  H HG2  . ARG A 1 334 ? -40.220 17.282  -33.838 1.00 30.38  ? 671 ARG B HG2  1 
ATOM   5040  H HG3  . ARG A 1 334 ? -41.113 18.263  -32.951 1.00 30.38  ? 671 ARG B HG3  1 
ATOM   5041  H HD2  . ARG A 1 334 ? -42.824 16.661  -32.941 1.00 43.10  ? 671 ARG B HD2  1 
ATOM   5042  H HD3  . ARG A 1 334 ? -41.899 15.680  -33.778 1.00 43.10  ? 671 ARG B HD3  1 
ATOM   5043  H HE   . ARG A 1 334 ? -41.737 16.073  -31.121 1.00 44.62  ? 671 ARG B HE   1 
ATOM   5044  H HH11 . ARG A 1 334 ? -40.285 14.627  -33.706 1.00 31.74  ? 671 ARG B HH11 1 
ATOM   5045  H HH12 . ARG A 1 334 ? -39.435 13.686  -32.925 1.00 31.74  ? 671 ARG B HH12 1 
ATOM   5046  H HH21 . ARG A 1 334 ? -40.397 14.685  -29.907 1.00 46.52  ? 671 ARG B HH21 1 
ATOM   5047  H HH22 . ARG A 1 334 ? -39.503 13.721  -30.607 1.00 46.52  ? 671 ARG B HH22 1 
ATOM   5048  N N    . LEU A 1 335 ? -38.954 20.054  -35.194 1.00 28.92  ? 672 LEU B N    1 
ATOM   5049  C CA   . LEU A 1 335 ? -37.551 20.017  -35.584 1.00 32.81  ? 672 LEU B CA   1 
ATOM   5050  C C    . LEU A 1 335 ? -36.787 19.185  -34.571 1.00 38.30  ? 672 LEU B C    1 
ATOM   5051  O O    . LEU A 1 335 ? -36.391 19.690  -33.520 1.00 36.35  ? 672 LEU B O    1 
ATOM   5052  C CB   . LEU A 1 335 ? -36.954 21.425  -35.640 1.00 30.56  ? 672 LEU B CB   1 
ATOM   5053  C CG   . LEU A 1 335 ? -37.781 22.505  -36.338 1.00 43.39  ? 672 LEU B CG   1 
ATOM   5054  C CD1  . LEU A 1 335 ? -36.915 23.740  -36.604 1.00 44.15  ? 672 LEU B CD1  1 
ATOM   5055  C CD2  . LEU A 1 335 ? -38.377 21.978  -37.626 1.00 41.96  ? 672 LEU B CD2  1 
ATOM   5056  H H    . LEU A 1 335 ? -39.111 20.519  -34.487 1.00 34.71  ? 672 LEU B H    1 
ATOM   5057  H HA   . LEU A 1 335 ? -37.462 19.600  -36.467 1.00 39.38  ? 672 LEU B HA   1 
ATOM   5058  H HB2  . LEU A 1 335 ? -36.803 21.725  -34.730 1.00 36.68  ? 672 LEU B HB2  1 
ATOM   5059  H HB3  . LEU A 1 335 ? -36.103 21.373  -36.104 1.00 36.68  ? 672 LEU B HB3  1 
ATOM   5060  H HG   . LEU A 1 335 ? -38.511 22.769  -35.756 1.00 52.07  ? 672 LEU B HG   1 
ATOM   5061  H HD11 . LEU A 1 335 ? -37.448 24.408  -37.041 1.00 52.98  ? 672 LEU B HD11 1 
ATOM   5062  H HD12 . LEU A 1 335 ? -36.589 24.079  -35.766 1.00 52.98  ? 672 LEU B HD12 1 
ATOM   5063  H HD13 . LEU A 1 335 ? -36.178 23.490  -37.165 1.00 52.98  ? 672 LEU B HD13 1 
ATOM   5064  H HD21 . LEU A 1 335 ? -38.889 22.675  -38.041 1.00 50.35  ? 672 LEU B HD21 1 
ATOM   5065  H HD22 . LEU A 1 335 ? -37.665 21.703  -38.209 1.00 50.35  ? 672 LEU B HD22 1 
ATOM   5066  H HD23 . LEU A 1 335 ? -38.944 21.230  -37.425 1.00 50.35  ? 672 LEU B HD23 1 
ATOM   5067  N N    . SER A 1 336 ? -36.610 17.904  -34.874 1.00 35.52  ? 673 SER B N    1 
ATOM   5068  C CA   . SER A 1 336 ? -35.805 17.032  -34.036 1.00 34.22  ? 673 SER B CA   1 
ATOM   5069  C C    . SER A 1 336 ? -34.368 17.020  -34.557 1.00 39.19  ? 673 SER B C    1 
ATOM   5070  O O    . SER A 1 336 ? -34.072 17.615  -35.596 1.00 34.80  ? 673 SER B O    1 
ATOM   5071  C CB   . SER A 1 336 ? -36.397 15.619  -34.016 1.00 33.18  ? 673 SER B CB   1 
ATOM   5072  O OG   . SER A 1 336 ? -36.652 15.154  -35.329 1.00 40.88  ? 673 SER B OG   1 
ATOM   5073  H H    . SER A 1 336 ? -36.948 17.515  -35.563 1.00 42.62  ? 673 SER B H    1 
ATOM   5074  H HA   . SER A 1 336 ? -35.798 17.377  -33.119 1.00 41.07  ? 673 SER B HA   1 
ATOM   5075  H HB2  . SER A 1 336 ? -35.767 15.020  -33.586 1.00 39.81  ? 673 SER B HB2  1 
ATOM   5076  H HB3  . SER A 1 336 ? -37.231 15.635  -33.520 1.00 39.81  ? 673 SER B HB3  1 
ATOM   5077  H HG   . SER A 1 336 ? -36.968 14.398  -35.303 1.00 49.05  ? 673 SER B HG   1 
ATOM   5078  N N    . SER A 1 337 ? -33.473 16.368  -33.819 1.00 32.08  ? 674 SER B N    1 
ATOM   5079  C CA   . SER A 1 337 ? -32.090 16.218  -34.253 1.00 38.67  ? 674 SER B CA   1 
ATOM   5080  C C    . SER A 1 337 ? -31.359 17.550  -34.390 1.00 39.60  ? 674 SER B C    1 
ATOM   5081  O O    . SER A 1 337 ? -30.570 17.734  -35.314 1.00 41.22  ? 674 SER B O    1 
ATOM   5082  C CB   . SER A 1 337 ? -32.044 15.479  -35.591 1.00 47.84  ? 674 SER B CB   1 
ATOM   5083  O OG   . SER A 1 337 ? -32.675 14.214  -35.488 1.00 56.16  ? 674 SER B OG   1 
ATOM   5084  H H    . SER A 1 337 ? -33.644 16.003  -33.059 1.00 38.50  ? 674 SER B H    1 
ATOM   5085  H HA   . SER A 1 337 ? -31.608 15.677  -33.593 1.00 46.40  ? 674 SER B HA   1 
ATOM   5086  H HB2  . SER A 1 337 ? -32.505 16.008  -36.261 1.00 57.41  ? 674 SER B HB2  1 
ATOM   5087  H HB3  . SER A 1 337 ? -31.118 15.350  -35.850 1.00 57.41  ? 674 SER B HB3  1 
ATOM   5088  H HG   . SER A 1 337 ? -32.955 14.101  -34.726 1.00 67.39  ? 674 SER B HG   1 
ATOM   5089  N N    . LEU A 1 338 ? -31.608 18.475  -33.472 1.00 38.04  ? 675 LEU B N    1 
ATOM   5090  C CA   . LEU A 1 338 ? -30.979 19.789  -33.536 1.00 40.39  ? 675 LEU B CA   1 
ATOM   5091  C C    . LEU A 1 338 ? -29.461 19.710  -33.359 1.00 39.26  ? 675 LEU B C    1 
ATOM   5092  O O    . LEU A 1 338 ? -28.740 20.628  -33.741 1.00 40.47  ? 675 LEU B O    1 
ATOM   5093  C CB   . LEU A 1 338 ? -31.581 20.723  -32.485 1.00 37.98  ? 675 LEU B CB   1 
ATOM   5094  C CG   . LEU A 1 338 ? -33.009 21.205  -32.761 1.00 41.77  ? 675 LEU B CG   1 
ATOM   5095  C CD1  . LEU A 1 338 ? -33.534 22.001  -31.585 1.00 40.38  ? 675 LEU B CD1  1 
ATOM   5096  C CD2  . LEU A 1 338 ? -33.073 22.039  -34.051 1.00 30.28  ? 675 LEU B CD2  1 
ATOM   5097  H H    . LEU A 1 338 ? -32.137 18.368  -32.802 1.00 45.64  ? 675 LEU B H    1 
ATOM   5098  H HA   . LEU A 1 338 ? -31.156 20.179  -34.418 1.00 48.47  ? 675 LEU B HA   1 
ATOM   5099  H HB2  . LEU A 1 338 ? -31.592 20.259  -31.634 1.00 45.58  ? 675 LEU B HB2  1 
ATOM   5100  H HB3  . LEU A 1 338 ? -31.018 21.510  -32.416 1.00 45.58  ? 675 LEU B HB3  1 
ATOM   5101  H HG   . LEU A 1 338 ? -33.583 20.432  -32.878 1.00 50.12  ? 675 LEU B HG   1 
ATOM   5102  H HD11 . LEU A 1 338 ? -34.428 22.292  -31.780 1.00 48.46  ? 675 LEU B HD11 1 
ATOM   5103  H HD12 . LEU A 1 338 ? -33.534 21.441  -30.805 1.00 48.46  ? 675 LEU B HD12 1 
ATOM   5104  H HD13 . LEU A 1 338 ? -32.965 22.761  -31.444 1.00 48.46  ? 675 LEU B HD13 1 
ATOM   5105  H HD21 . LEU A 1 338 ? -33.979 22.324  -34.194 1.00 36.33  ? 675 LEU B HD21 1 
ATOM   5106  H HD22 . LEU A 1 338 ? -32.500 22.803  -33.958 1.00 36.33  ? 675 LEU B HD22 1 
ATOM   5107  H HD23 . LEU A 1 338 ? -32.780 21.497  -34.788 1.00 36.33  ? 675 LEU B HD23 1 
ATOM   5108  N N    . GLN A 1 339 ? -28.979 18.616  -32.780 1.00 37.42  ? 676 GLN B N    1 
ATOM   5109  C CA   . GLN A 1 339 ? -27.549 18.428  -32.560 1.00 41.09  ? 676 GLN B CA   1 
ATOM   5110  C C    . GLN A 1 339 ? -26.804 18.225  -33.874 1.00 43.68  ? 676 GLN B C    1 
ATOM   5111  O O    . GLN A 1 339 ? -25.585 18.355  -33.928 1.00 42.18  ? 676 GLN B O    1 
ATOM   5112  C CB   . GLN A 1 339 ? -27.291 17.226  -31.634 1.00 41.86  ? 676 GLN B CB   1 
ATOM   5113  C CG   . GLN A 1 339 ? -27.394 15.862  -32.311 1.00 33.18  ? 676 GLN B CG   1 
ATOM   5114  C CD   . GLN A 1 339 ? -28.805 15.322  -32.336 1.00 34.00  ? 676 GLN B CD   1 
ATOM   5115  O OE1  . GLN A 1 339 ? -29.757 16.030  -32.038 1.00 30.03  ? 676 GLN B OE1  1 
ATOM   5116  N NE2  . GLN A 1 339 ? -28.943 14.054  -32.679 1.00 31.46  ? 676 GLN B NE2  1 
ATOM   5117  H H    . GLN A 1 339 ? -29.464 17.962  -32.503 1.00 44.91  ? 676 GLN B H    1 
ATOM   5118  H HA   . GLN A 1 339 ? -27.186 19.228  -32.126 1.00 49.31  ? 676 GLN B HA   1 
ATOM   5119  H HB2  . GLN A 1 339 ? -26.396 17.305  -31.268 1.00 50.23  ? 676 GLN B HB2  1 
ATOM   5120  H HB3  . GLN A 1 339 ? -27.940 17.245  -30.914 1.00 50.23  ? 676 GLN B HB3  1 
ATOM   5121  H HG2  . GLN A 1 339 ? -27.087 15.941  -33.228 1.00 39.82  ? 676 GLN B HG2  1 
ATOM   5122  H HG3  . GLN A 1 339 ? -26.839 15.228  -31.829 1.00 39.82  ? 676 GLN B HG3  1 
ATOM   5123  H HE21 . GLN A 1 339 ? -28.250 13.583  -32.873 1.00 37.75  ? 676 GLN B HE21 1 
ATOM   5124  H HE22 . GLN A 1 339 ? -29.726 13.700  -32.709 1.00 37.75  ? 676 GLN B HE22 1 
ATOM   5125  N N    . LYS A 1 340 ? -27.539 17.882  -34.926 1.00 41.54  ? 677 LYS B N    1 
ATOM   5126  C CA   . LYS A 1 340 ? -26.947 17.694  -36.246 1.00 38.71  ? 677 LYS B CA   1 
ATOM   5127  C C    . LYS A 1 340 ? -26.737 19.025  -36.960 1.00 47.85  ? 677 LYS B C    1 
ATOM   5128  O O    . LYS A 1 340 ? -25.947 19.114  -37.900 1.00 38.72  ? 677 LYS B O    1 
ATOM   5129  C CB   . LYS A 1 340 ? -27.831 16.782  -37.097 1.00 40.81  ? 677 LYS B CB   1 
ATOM   5130  C CG   . LYS A 1 340 ? -27.889 15.356  -36.582 1.00 37.69  ? 677 LYS B CG   1 
ATOM   5131  C CD   . LYS A 1 340 ? -28.937 14.523  -37.295 1.00 39.77  ? 677 LYS B CD   1 
ATOM   5132  C CE   . LYS A 1 340 ? -29.184 13.204  -36.567 1.00 48.56  ? 677 LYS B CE   1 
ATOM   5133  N NZ   . LYS A 1 340 ? -27.937 12.399  -36.422 1.00 54.93  ? 677 LYS B NZ   1 
ATOM   5134  H H    . LYS A 1 340 ? -28.388 17.751  -34.901 1.00 49.85  ? 677 LYS B H    1 
ATOM   5135  H HA   . LYS A 1 340 ? -26.073 17.262  -36.146 1.00 46.46  ? 677 LYS B HA   1 
ATOM   5136  H HB2  . LYS A 1 340 ? -28.734 17.135  -37.101 1.00 48.98  ? 677 LYS B HB2  1 
ATOM   5137  H HB3  . LYS A 1 340 ? -27.480 16.759  -38.001 1.00 48.98  ? 677 LYS B HB3  1 
ATOM   5138  H HG2  . LYS A 1 340 ? -27.026 14.935  -36.717 1.00 45.23  ? 677 LYS B HG2  1 
ATOM   5139  H HG3  . LYS A 1 340 ? -28.109 15.369  -35.637 1.00 45.23  ? 677 LYS B HG3  1 
ATOM   5140  H HD2  . LYS A 1 340 ? -29.772 15.015  -37.327 1.00 47.72  ? 677 LYS B HD2  1 
ATOM   5141  H HD3  . LYS A 1 340 ? -28.630 14.322  -38.193 1.00 47.72  ? 677 LYS B HD3  1 
ATOM   5142  H HE2  . LYS A 1 340 ? -29.527 13.390  -35.679 1.00 58.27  ? 677 LYS B HE2  1 
ATOM   5143  H HE3  . LYS A 1 340 ? -29.826 12.678  -37.070 1.00 58.27  ? 677 LYS B HE3  1 
ATOM   5144  H HZ1  . LYS A 1 340 ? -28.113 11.639  -35.995 1.00 65.91  ? 677 LYS B HZ1  1 
ATOM   5145  H HZ2  . LYS A 1 340 ? -27.603 12.209  -37.225 1.00 65.91  ? 677 LYS B HZ2  1 
ATOM   5146  H HZ3  . LYS A 1 340 ? -27.331 12.858  -35.958 1.00 65.91  ? 677 LYS B HZ3  1 
ATOM   5147  N N    . LEU A 1 341 ? -27.448 20.055  -36.514 1.00 41.99  ? 678 LEU B N    1 
ATOM   5148  C CA   . LEU A 1 341 ? -27.347 21.376  -37.130 1.00 53.04  ? 678 LEU B CA   1 
ATOM   5149  C C    . LEU A 1 341 ? -25.906 21.869  -37.088 1.00 61.00  ? 678 LEU B C    1 
ATOM   5150  O O    . LEU A 1 341 ? -25.409 22.248  -36.030 1.00 58.10  ? 678 LEU B O    1 
ATOM   5151  C CB   . LEU A 1 341 ? -28.253 22.361  -36.396 1.00 47.18  ? 678 LEU B CB   1 
ATOM   5152  C CG   . LEU A 1 341 ? -28.515 23.707  -37.062 1.00 55.92  ? 678 LEU B CG   1 
ATOM   5153  C CD1  . LEU A 1 341 ? -29.284 23.517  -38.357 1.00 60.03  ? 678 LEU B CD1  1 
ATOM   5154  C CD2  . LEU A 1 341 ? -29.276 24.613  -36.107 1.00 58.82  ? 678 LEU B CD2  1 
ATOM   5155  H H    . LEU A 1 341 ? -27.998 20.016  -35.854 1.00 50.39  ? 678 LEU B H    1 
ATOM   5156  H HA   . LEU A 1 341 ? -27.633 21.325  -38.066 1.00 63.64  ? 678 LEU B HA   1 
ATOM   5157  H HB2  . LEU A 1 341 ? -29.116 21.935  -36.266 1.00 56.62  ? 678 LEU B HB2  1 
ATOM   5158  H HB3  . LEU A 1 341 ? -27.857 22.544  -35.530 1.00 56.62  ? 678 LEU B HB3  1 
ATOM   5159  H HG   . LEU A 1 341 ? -27.667 24.130  -37.272 1.00 67.10  ? 678 LEU B HG   1 
ATOM   5160  H HD11 . LEU A 1 341 ? -29.437 24.375  -38.758 1.00 72.03  ? 678 LEU B HD11 1 
ATOM   5161  H HD12 . LEU A 1 341 ? -28.768 22.965  -38.949 1.00 72.03  ? 678 LEU B HD12 1 
ATOM   5162  H HD13 . LEU A 1 341 ? -30.123 23.092  -38.162 1.00 72.03  ? 678 LEU B HD13 1 
ATOM   5163  H HD21 . LEU A 1 341 ? -29.434 25.457  -36.537 1.00 70.59  ? 678 LEU B HD21 1 
ATOM   5164  H HD22 . LEU A 1 341 ? -30.111 24.198  -35.882 1.00 70.59  ? 678 LEU B HD22 1 
ATOM   5165  H HD23 . LEU A 1 341 ? -28.750 24.743  -35.314 1.00 70.59  ? 678 LEU B HD23 1 
ATOM   5166  N N    . LYS A 1 342 ? -25.246 21.866  -38.243 1.00 68.84  ? 679 LYS B N    1 
ATOM   5167  C CA   . LYS A 1 342 ? -23.855 22.296  -38.343 1.00 77.19  ? 679 LYS B CA   1 
ATOM   5168  C C    . LYS A 1 342 ? -23.760 23.816  -38.416 1.00 79.80  ? 679 LYS B C    1 
ATOM   5169  O O    . LYS A 1 342 ? -22.924 24.431  -37.753 1.00 78.41  ? 679 LYS B O    1 
ATOM   5170  C CB   . LYS A 1 342 ? -23.202 21.693  -39.588 1.00 81.52  ? 679 LYS B CB   1 
ATOM   5171  C CG   . LYS A 1 342 ? -23.323 20.183  -39.691 1.00 77.58  ? 679 LYS B CG   1 
ATOM   5172  C CD   . LYS A 1 342 ? -23.001 19.705  -41.097 1.00 83.45  ? 679 LYS B CD   1 
ATOM   5173  C CE   . LYS A 1 342 ? -23.246 18.211  -41.248 1.00 85.96  ? 679 LYS B CE   1 
ATOM   5174  N NZ   . LYS A 1 342 ? -22.228 17.395  -40.528 1.00 85.30  ? 679 LYS B NZ   1 
ATOM   5175  H H    . LYS A 1 342 ? -25.586 21.616  -38.992 1.00 82.61  ? 679 LYS B H    1 
ATOM   5176  H HA   . LYS A 1 342 ? -23.361 21.992  -37.554 1.00 92.63  ? 679 LYS B HA   1 
ATOM   5177  H HB2  . LYS A 1 342 ? -23.620 22.076  -40.375 1.00 97.82  ? 679 LYS B HB2  1 
ATOM   5178  H HB3  . LYS A 1 342 ? -22.257 21.912  -39.580 1.00 97.82  ? 679 LYS B HB3  1 
ATOM   5179  H HG2  . LYS A 1 342 ? -22.699 19.767  -39.076 1.00 93.09  ? 679 LYS B HG2  1 
ATOM   5180  H HG3  . LYS A 1 342 ? -24.232 19.918  -39.480 1.00 93.09  ? 679 LYS B HG3  1 
ATOM   5181  H HD2  . LYS A 1 342 ? -23.567 20.171  -41.732 1.00 100.14 ? 679 LYS B HD2  1 
ATOM   5182  H HD3  . LYS A 1 342 ? -22.066 19.880  -41.289 1.00 100.14 ? 679 LYS B HD3  1 
ATOM   5183  H HE2  . LYS A 1 342 ? -24.118 17.995  -40.884 1.00 103.15 ? 679 LYS B HE2  1 
ATOM   5184  H HE3  . LYS A 1 342 ? -23.209 17.977  -42.189 1.00 103.15 ? 679 LYS B HE3  1 
ATOM   5185  H HZ1  . LYS A 1 342 ? -22.400 16.529  -40.637 1.00 102.36 ? 679 LYS B HZ1  1 
ATOM   5186  H HZ2  . LYS A 1 342 ? -21.416 17.571  -40.847 1.00 102.36 ? 679 LYS B HZ2  1 
ATOM   5187  H HZ3  . LYS A 1 342 ? -22.244 17.587  -39.659 1.00 102.36 ? 679 LYS B HZ3  1 
ATOM   5188  N N    . GLU A 1 343 ? -24.621 24.417  -39.232 1.00 79.16  ? 680 GLU B N    1 
ATOM   5189  C CA   . GLU A 1 343 ? -24.606 25.858  -39.429 1.00 80.23  ? 680 GLU B CA   1 
ATOM   5190  C C    . GLU A 1 343 ? -25.777 26.510  -38.703 1.00 70.29  ? 680 GLU B C    1 
ATOM   5191  O O    . GLU A 1 343 ? -26.170 26.070  -37.623 1.00 66.81  ? 680 GLU B O    1 
ATOM   5192  C CB   . GLU A 1 343 ? -24.649 26.189  -40.922 1.00 89.12  ? 680 GLU B CB   1 
ATOM   5193  H H    . GLU A 1 343 ? -25.226 24.007  -39.686 1.00 94.99  ? 680 GLU B H    1 
ATOM   5194  H HA   . GLU A 1 343 ? -23.776 26.224  -39.059 1.00 96.27  ? 680 GLU B HA   1 
ATOM   5195  N N    . HIS A 1 344 ? -26.331 27.559  -39.301 1.00 64.78  ? 681 HIS B N    1 
ATOM   5196  C CA   . HIS A 1 344 ? -27.424 28.309  -38.690 1.00 58.25  ? 681 HIS B CA   1 
ATOM   5197  C C    . HIS A 1 344 ? -28.789 27.779  -39.110 1.00 43.99  ? 681 HIS B C    1 
ATOM   5198  O O    . HIS A 1 344 ? -28.991 27.396  -40.262 1.00 41.37  ? 681 HIS B O    1 
ATOM   5199  C CB   . HIS A 1 344 ? -27.314 29.788  -39.065 1.00 56.20  ? 681 HIS B CB   1 
ATOM   5200  C CG   . HIS A 1 344 ? -26.242 30.517  -38.321 1.00 73.35  ? 681 HIS B CG   1 
ATOM   5201  N ND1  . HIS A 1 344 ? -25.667 31.679  -38.789 1.00 75.67  ? 681 HIS B ND1  1 
ATOM   5202  C CD2  . HIS A 1 344 ? -25.643 30.250  -37.136 1.00 77.64  ? 681 HIS B CD2  1 
ATOM   5203  C CE1  . HIS A 1 344 ? -24.758 32.096  -37.925 1.00 78.66  ? 681 HIS B CE1  1 
ATOM   5204  N NE2  . HIS A 1 344 ? -24.725 31.248  -36.913 1.00 84.62  ? 681 HIS B NE2  1 
ATOM   5205  H H    . HIS A 1 344 ? -26.088 27.861  -40.069 1.00 77.73  ? 681 HIS B H    1 
ATOM   5206  H HA   . HIS A 1 344 ? -27.356 28.236  -37.715 1.00 69.90  ? 681 HIS B HA   1 
ATOM   5207  H HB2  . HIS A 1 344 ? -27.118 29.857  -40.013 1.00 67.44  ? 681 HIS B HB2  1 
ATOM   5208  H HB3  . HIS A 1 344 ? -28.159 30.224  -38.871 1.00 67.44  ? 681 HIS B HB3  1 
ATOM   5209  H HD2  . HIS A 1 344 ? -25.820 29.528  -36.578 1.00 93.17  ? 681 HIS B HD2  1 
ATOM   5210  H HE1  . HIS A 1 344 ? -24.232 32.858  -38.014 1.00 94.40  ? 681 HIS B HE1  1 
ATOM   5211  N N    . LEU A 1 345 ? -29.724 27.768  -38.168 1.00 43.14  ? 682 LEU B N    1 
ATOM   5212  C CA   . LEU A 1 345 ? -31.099 27.385  -38.454 1.00 42.50  ? 682 LEU B CA   1 
ATOM   5213  C C    . LEU A 1 345 ? -31.753 28.490  -39.268 1.00 44.63  ? 682 LEU B C    1 
ATOM   5214  O O    . LEU A 1 345 ? -32.268 29.458  -38.710 1.00 35.97  ? 682 LEU B O    1 
ATOM   5215  C CB   . LEU A 1 345 ? -31.882 27.148  -37.156 1.00 40.49  ? 682 LEU B CB   1 
ATOM   5216  C CG   . LEU A 1 345 ? -33.365 26.794  -37.318 1.00 38.93  ? 682 LEU B CG   1 
ATOM   5217  C CD1  . LEU A 1 345 ? -33.533 25.642  -38.297 1.00 36.01  ? 682 LEU B CD1  1 
ATOM   5218  C CD2  . LEU A 1 345 ? -33.998 26.446  -35.969 1.00 45.34  ? 682 LEU B CD2  1 
ATOM   5219  H H    . LEU A 1 345 ? -29.585 27.981  -37.346 1.00 51.77  ? 682 LEU B H    1 
ATOM   5220  H HA   . LEU A 1 345 ? -31.108 26.560  -38.982 1.00 51.01  ? 682 LEU B HA   1 
ATOM   5221  H HB2  . LEU A 1 345 ? -31.462 26.417  -36.676 1.00 48.58  ? 682 LEU B HB2  1 
ATOM   5222  H HB3  . LEU A 1 345 ? -31.835 27.954  -36.620 1.00 48.58  ? 682 LEU B HB3  1 
ATOM   5223  H HG   . LEU A 1 345 ? -33.834 27.562  -37.678 1.00 46.72  ? 682 LEU B HG   1 
ATOM   5224  H HD11 . LEU A 1 345 ? -34.468 25.438  -38.381 1.00 43.21  ? 682 LEU B HD11 1 
ATOM   5225  H HD12 . LEU A 1 345 ? -33.176 25.902  -39.149 1.00 43.21  ? 682 LEU B HD12 1 
ATOM   5226  H HD13 . LEU A 1 345 ? -33.060 24.876  -37.962 1.00 43.21  ? 682 LEU B HD13 1 
ATOM   5227  H HD21 . LEU A 1 345 ? -34.923 26.230  -36.105 1.00 54.40  ? 682 LEU B HD21 1 
ATOM   5228  H HD22 . LEU A 1 345 ? -33.537 25.693  -35.593 1.00 54.40  ? 682 LEU B HD22 1 
ATOM   5229  H HD23 . LEU A 1 345 ? -33.921 27.203  -35.384 1.00 54.40  ? 682 LEU B HD23 1 
ATOM   5230  N N    . VAL A 1 346 ? -31.700 28.354  -40.590 1.00 43.81  ? 683 VAL B N    1 
ATOM   5231  C CA   . VAL A 1 346 ? -32.320 29.318  -41.488 1.00 48.58  ? 683 VAL B CA   1 
ATOM   5232  C C    . VAL A 1 346 ? -33.451 28.624  -42.216 1.00 48.61  ? 683 VAL B C    1 
ATOM   5233  O O    . VAL A 1 346 ? -33.270 27.540  -42.773 1.00 45.74  ? 683 VAL B O    1 
ATOM   5234  C CB   . VAL A 1 346 ? -31.322 29.843  -42.535 1.00 48.22  ? 683 VAL B CB   1 
ATOM   5235  C CG1  . VAL A 1 346 ? -31.974 30.903  -43.411 1.00 56.40  ? 683 VAL B CG1  1 
ATOM   5236  C CG2  . VAL A 1 346 ? -30.083 30.393  -41.857 1.00 53.02  ? 683 VAL B CG2  1 
ATOM   5237  H H    . VAL A 1 346 ? -31.306 27.705  -40.994 1.00 52.57  ? 683 VAL B H    1 
ATOM   5238  H HA   . VAL A 1 346 ? -32.680 30.074  -40.978 1.00 58.30  ? 683 VAL B HA   1 
ATOM   5239  H HB   . VAL A 1 346 ? -31.046 29.100  -43.113 1.00 57.86  ? 683 VAL B HB   1 
ATOM   5240  H HG11 . VAL A 1 346 ? -31.332 31.214  -44.055 1.00 67.68  ? 683 VAL B HG11 1 
ATOM   5241  H HG12 . VAL A 1 346 ? -32.728 30.516  -43.861 1.00 67.68  ? 683 VAL B HG12 1 
ATOM   5242  H HG13 . VAL A 1 346 ? -32.261 31.632  -42.857 1.00 67.68  ? 683 VAL B HG13 1 
ATOM   5243  H HG21 . VAL A 1 346 ? -29.476 30.713  -42.528 1.00 63.62  ? 683 VAL B HG21 1 
ATOM   5244  H HG22 . VAL A 1 346 ? -30.339 31.112  -41.276 1.00 63.62  ? 683 VAL B HG22 1 
ATOM   5245  H HG23 . VAL A 1 346 ? -29.669 29.692  -41.348 1.00 63.62  ? 683 VAL B HG23 1 
ATOM   5246  N N    . PHE A 1 347 ? -34.627 29.230  -42.197 1.00 38.36  ? 684 PHE B N    1 
ATOM   5247  C CA   . PHE A 1 347 ? -35.755 28.678  -42.923 1.00 31.45  ? 684 PHE B CA   1 
ATOM   5248  C C    . PHE A 1 347 ? -36.564 29.811  -43.526 1.00 34.62  ? 684 PHE B C    1 
ATOM   5249  O O    . PHE A 1 347 ? -36.243 30.981  -43.341 1.00 38.56  ? 684 PHE B O    1 
ATOM   5250  C CB   . PHE A 1 347 ? -36.625 27.783  -42.023 1.00 34.16  ? 684 PHE B CB   1 
ATOM   5251  C CG   . PHE A 1 347 ? -37.069 28.441  -40.740 1.00 40.58  ? 684 PHE B CG   1 
ATOM   5252  C CD1  . PHE A 1 347 ? -38.383 28.846  -40.569 1.00 40.82  ? 684 PHE B CD1  1 
ATOM   5253  C CD2  . PHE A 1 347 ? -36.175 28.633  -39.696 1.00 41.06  ? 684 PHE B CD2  1 
ATOM   5254  C CE1  . PHE A 1 347 ? -38.798 29.441  -39.383 1.00 41.38  ? 684 PHE B CE1  1 
ATOM   5255  C CE2  . PHE A 1 347 ? -36.585 29.227  -38.510 1.00 44.83  ? 684 PHE B CE2  1 
ATOM   5256  C CZ   . PHE A 1 347 ? -37.896 29.631  -38.354 1.00 44.03  ? 684 PHE B CZ   1 
ATOM   5257  H H    . PHE A 1 347 ? -34.797 29.958  -41.772 1.00 46.03  ? 684 PHE B H    1 
ATOM   5258  H HA   . PHE A 1 347 ? -35.418 28.125  -43.659 1.00 37.74  ? 684 PHE B HA   1 
ATOM   5259  H HB2  . PHE A 1 347 ? -37.421 27.528  -42.515 1.00 40.99  ? 684 PHE B HB2  1 
ATOM   5260  H HB3  . PHE A 1 347 ? -36.117 26.991  -41.789 1.00 40.99  ? 684 PHE B HB3  1 
ATOM   5261  H HD1  . PHE A 1 347 ? -38.995 28.720  -41.258 1.00 48.98  ? 684 PHE B HD1  1 
ATOM   5262  H HD2  . PHE A 1 347 ? -35.290 28.363  -39.793 1.00 49.27  ? 684 PHE B HD2  1 
ATOM   5263  H HE1  . PHE A 1 347 ? -39.682 29.712  -39.283 1.00 49.65  ? 684 PHE B HE1  1 
ATOM   5264  H HE2  . PHE A 1 347 ? -35.975 29.354  -37.820 1.00 53.80  ? 684 PHE B HE2  1 
ATOM   5265  H HZ   . PHE A 1 347 ? -38.171 30.031  -37.560 1.00 52.84  ? 684 PHE B HZ   1 
ATOM   5266  N N    . THR A 1 348 ? -37.601 29.455  -44.264 1.00 39.10  ? 685 THR B N    1 
ATOM   5267  C CA   . THR A 1 348 ? -38.359 30.428  -45.022 1.00 45.61  ? 685 THR B CA   1 
ATOM   5268  C C    . THR A 1 348 ? -39.797 30.438  -44.554 1.00 46.46  ? 685 THR B C    1 
ATOM   5269  O O    . THR A 1 348 ? -40.428 29.393  -44.429 1.00 37.96  ? 685 THR B O    1 
ATOM   5270  C CB   . THR A 1 348 ? -38.331 30.087  -46.510 1.00 47.38  ? 685 THR B CB   1 
ATOM   5271  O OG1  . THR A 1 348 ? -36.986 30.181  -46.985 1.00 46.92  ? 685 THR B OG1  1 
ATOM   5272  C CG2  . THR A 1 348 ? -39.225 31.038  -47.302 1.00 43.43  ? 685 THR B CG2  1 
ATOM   5273  H H    . THR A 1 348 ? -37.887 28.648  -44.343 1.00 46.91  ? 685 THR B H    1 
ATOM   5274  H HA   . THR A 1 348 ? -37.977 31.322  -44.894 1.00 54.73  ? 685 THR B HA   1 
ATOM   5275  H HB   . THR A 1 348 ? -38.656 29.182  -46.640 1.00 56.86  ? 685 THR B HB   1 
ATOM   5276  H HG1  . THR A 1 348 ? -36.957 30.000  -47.784 1.00 56.31  ? 685 THR B HG1  1 
ATOM   5277  H HG21 . THR A 1 348 ? -39.198 30.813  -48.235 1.00 52.12  ? 685 THR B HG21 1 
ATOM   5278  H HG22 . THR A 1 348 ? -40.130 30.973  -46.991 1.00 52.12  ? 685 THR B HG22 1 
ATOM   5279  H HG23 . THR A 1 348 ? -38.921 31.942  -47.191 1.00 52.12  ? 685 THR B HG23 1 
ATOM   5280  N N    . VAL A 1 349 ? -40.311 31.625  -44.278 1.00 44.35  ? 686 VAL B N    1 
ATOM   5281  C CA   . VAL A 1 349 ? -41.730 31.777  -44.020 1.00 40.39  ? 686 VAL B CA   1 
ATOM   5282  C C    . VAL A 1 349 ? -42.383 32.267  -45.295 1.00 39.26  ? 686 VAL B C    1 
ATOM   5283  O O    . VAL A 1 349 ? -42.153 33.397  -45.725 1.00 44.30  ? 686 VAL B O    1 
ATOM   5284  C CB   . VAL A 1 349 ? -41.986 32.771  -42.890 1.00 40.07  ? 686 VAL B CB   1 
ATOM   5285  C CG1  . VAL A 1 349 ? -43.444 32.720  -42.466 1.00 45.59  ? 686 VAL B CG1  1 
ATOM   5286  C CG2  . VAL A 1 349 ? -41.074 32.459  -41.732 1.00 31.58  ? 686 VAL B CG2  1 
ATOM   5287  H H    . VAL A 1 349 ? -39.861 32.356  -44.235 1.00 53.22  ? 686 VAL B H    1 
ATOM   5288  H HA   . VAL A 1 349 ? -42.119 30.912  -43.776 1.00 48.47  ? 686 VAL B HA   1 
ATOM   5289  H HB   . VAL A 1 349 ? -41.787 33.678  -43.204 1.00 48.08  ? 686 VAL B HB   1 
ATOM   5290  H HG11 . VAL A 1 349 ? -43.584 33.351  -41.756 1.00 54.71  ? 686 VAL B HG11 1 
ATOM   5291  H HG12 . VAL A 1 349 ? -43.996 32.946  -43.218 1.00 54.71  ? 686 VAL B HG12 1 
ATOM   5292  H HG13 . VAL A 1 349 ? -43.650 31.833  -42.162 1.00 54.71  ? 686 VAL B HG13 1 
ATOM   5293  H HG21 . VAL A 1 349 ? -41.241 33.087  -41.026 1.00 37.89  ? 686 VAL B HG21 1 
ATOM   5294  H HG22 . VAL A 1 349 ? -41.253 31.566  -41.426 1.00 37.89  ? 686 VAL B HG22 1 
ATOM   5295  H HG23 . VAL A 1 349 ? -40.163 32.528  -42.025 1.00 37.89  ? 686 VAL B HG23 1 
ATOM   5296  N N    . CYS A 1 350 ? -43.173 31.402  -45.917 1.00 35.31  ? 687 CYS B N    1 
ATOM   5297  C CA   . CYS A 1 350 ? -43.883 31.763  -47.133 1.00 40.10  ? 687 CYS B CA   1 
ATOM   5298  C C    . CYS A 1 350 ? -45.258 32.305  -46.810 1.00 43.20  ? 687 CYS B C    1 
ATOM   5299  O O    . CYS A 1 350 ? -45.915 31.850  -45.873 1.00 39.58  ? 687 CYS B O    1 
ATOM   5300  C CB   . CYS A 1 350 ? -44.004 30.558  -48.058 1.00 50.69  ? 687 CYS B CB   1 
ATOM   5301  S SG   . CYS A 1 350 ? -42.408 29.899  -48.568 1.00 52.93  ? 687 CYS B SG   1 
ATOM   5302  H H    . CYS A 1 350 ? -43.315 30.596  -45.653 1.00 42.38  ? 687 CYS B H    1 
ATOM   5303  H HA   . CYS A 1 350 ? -43.382 32.462  -47.604 1.00 48.13  ? 687 CYS B HA   1 
ATOM   5304  H HB2  . CYS A 1 350 ? -44.485 29.853  -47.596 1.00 60.83  ? 687 CYS B HB2  1 
ATOM   5305  H HB3  . CYS A 1 350 ? -44.488 30.821  -48.856 1.00 60.83  ? 687 CYS B HB3  1 
ATOM   5306  H HG   . CYS A 1 350 ? -42.586 28.958  -49.290 1.00 63.51  ? 687 CYS B HG   1 
ATOM   5307  N N    . LEU A 1 351 ? -45.675 33.291  -47.598 1.00 43.02  ? 688 LEU B N    1 
ATOM   5308  C CA   . LEU A 1 351 ? -46.980 33.909  -47.464 1.00 39.50  ? 688 LEU B CA   1 
ATOM   5309  C C    . LEU A 1 351 ? -47.697 33.918  -48.812 1.00 42.86  ? 688 LEU B C    1 
ATOM   5310  O O    . LEU A 1 351 ? -47.160 34.405  -49.808 1.00 43.24  ? 688 LEU B O    1 
ATOM   5311  C CB   . LEU A 1 351 ? -46.824 35.346  -46.966 1.00 35.12  ? 688 LEU B CB   1 
ATOM   5312  C CG   . LEU A 1 351 ? -48.134 36.110  -46.799 1.00 44.72  ? 688 LEU B CG   1 
ATOM   5313  C CD1  . LEU A 1 351 ? -48.849 35.645  -45.535 1.00 40.95  ? 688 LEU B CD1  1 
ATOM   5314  C CD2  . LEU A 1 351 ? -47.870 37.611  -46.765 1.00 37.43  ? 688 LEU B CD2  1 
ATOM   5315  H H    . LEU A 1 351 ? -45.202 33.626  -48.234 1.00 51.63  ? 688 LEU B H    1 
ATOM   5316  H HA   . LEU A 1 351 ? -47.521 33.406  -46.820 1.00 47.40  ? 688 LEU B HA   1 
ATOM   5317  H HB2  . LEU A 1 351 ? -46.383 35.327  -46.102 1.00 42.15  ? 688 LEU B HB2  1 
ATOM   5318  H HB3  . LEU A 1 351 ? -46.277 35.835  -47.600 1.00 42.15  ? 688 LEU B HB3  1 
ATOM   5319  H HG   . LEU A 1 351 ? -48.710 35.922  -47.557 1.00 53.66  ? 688 LEU B HG   1 
ATOM   5320  H HD11 . LEU A 1 351 ? -49.670 36.134  -45.444 1.00 49.14  ? 688 LEU B HD11 1 
ATOM   5321  H HD12 . LEU A 1 351 ? -49.032 34.706  -45.608 1.00 49.14  ? 688 LEU B HD12 1 
ATOM   5322  H HD13 . LEU A 1 351 ? -48.282 35.811  -44.778 1.00 49.14  ? 688 LEU B HD13 1 
ATOM   5323  H HD21 . LEU A 1 351 ? -48.705 38.073  -46.660 1.00 44.92  ? 688 LEU B HD21 1 
ATOM   5324  H HD22 . LEU A 1 351 ? -47.290 37.809  -46.025 1.00 44.92  ? 688 LEU B HD22 1 
ATOM   5325  H HD23 . LEU A 1 351 ? -47.451 37.873  -47.588 1.00 44.92  ? 688 LEU B HD23 1 
ATOM   5326  N N    . SER A 1 352 ? -48.904 33.369  -48.849 1.00 34.27  ? 689 SER B N    1 
ATOM   5327  C CA   . SER A 1 352 ? -49.767 33.528  -50.014 1.00 36.43  ? 689 SER B CA   1 
ATOM   5328  C C    . SER A 1 352 ? -50.942 34.413  -49.627 1.00 40.98  ? 689 SER B C    1 
ATOM   5329  O O    . SER A 1 352 ? -51.491 34.271  -48.538 1.00 40.68  ? 689 SER B O    1 
ATOM   5330  C CB   . SER A 1 352 ? -50.260 32.176  -50.512 1.00 45.91  ? 689 SER B CB   1 
ATOM   5331  O OG   . SER A 1 352 ? -49.177 31.402  -50.995 1.00 56.57  ? 689 SER B OG   1 
ATOM   5332  H H    . SER A 1 352 ? -49.248 32.899  -48.216 1.00 41.13  ? 689 SER B H    1 
ATOM   5333  H HA   . SER A 1 352 ? -49.269 33.966  -50.736 1.00 43.72  ? 689 SER B HA   1 
ATOM   5334  H HB2  . SER A 1 352 ? -50.684 31.703  -49.779 1.00 55.09  ? 689 SER B HB2  1 
ATOM   5335  H HB3  . SER A 1 352 ? -50.896 32.315  -51.231 1.00 55.09  ? 689 SER B HB3  1 
ATOM   5336  H HG   . SER A 1 352 ? -49.449 30.676  -51.262 1.00 67.88  ? 689 SER B HG   1 
ATOM   5337  N N    . TYR A 1 353 ? -51.318 35.337  -50.508 1.00 46.12  ? 690 TYR B N    1 
ATOM   5338  C CA   . TYR A 1 353 ? -52.425 36.238  -50.221 1.00 43.66  ? 690 TYR B CA   1 
ATOM   5339  C C    . TYR A 1 353 ? -53.093 36.724  -51.493 1.00 41.49  ? 690 TYR B C    1 
ATOM   5340  O O    . TYR A 1 353 ? -52.595 36.496  -52.591 1.00 42.40  ? 690 TYR B O    1 
ATOM   5341  C CB   . TYR A 1 353 ? -51.959 37.441  -49.399 1.00 45.25  ? 690 TYR B CB   1 
ATOM   5342  C CG   . TYR A 1 353 ? -50.817 38.231  -50.002 1.00 43.94  ? 690 TYR B CG   1 
ATOM   5343  C CD1  . TYR A 1 353 ? -49.499 37.850  -49.788 1.00 45.94  ? 690 TYR B CD1  1 
ATOM   5344  C CD2  . TYR A 1 353 ? -51.056 39.377  -50.764 1.00 53.75  ? 690 TYR B CD2  1 
ATOM   5345  C CE1  . TYR A 1 353 ? -48.451 38.567  -50.324 1.00 49.81  ? 690 TYR B CE1  1 
ATOM   5346  C CE2  . TYR A 1 353 ? -50.009 40.106  -51.308 1.00 51.77  ? 690 TYR B CE2  1 
ATOM   5347  C CZ   . TYR A 1 353 ? -48.708 39.694  -51.079 1.00 53.78  ? 690 TYR B CZ   1 
ATOM   5348  O OH   . TYR A 1 353 ? -47.655 40.401  -51.605 1.00 51.72  ? 690 TYR B OH   1 
ATOM   5349  H H    . TYR A 1 353 ? -50.948 35.461  -51.275 1.00 55.35  ? 690 TYR B H    1 
ATOM   5350  H HA   . TYR A 1 353 ? -53.097 35.756  -49.695 1.00 52.39  ? 690 TYR B HA   1 
ATOM   5351  H HB2  . TYR A 1 353 ? -52.708 38.047  -49.289 1.00 54.30  ? 690 TYR B HB2  1 
ATOM   5352  H HB3  . TYR A 1 353 ? -51.667 37.124  -48.529 1.00 54.30  ? 690 TYR B HB3  1 
ATOM   5353  H HD1  . TYR A 1 353 ? -49.320 37.092  -49.280 1.00 55.12  ? 690 TYR B HD1  1 
ATOM   5354  H HD2  . TYR A 1 353 ? -51.932 39.651  -50.915 1.00 64.50  ? 690 TYR B HD2  1 
ATOM   5355  H HE1  . TYR A 1 353 ? -47.575 38.295  -50.174 1.00 59.77  ? 690 TYR B HE1  1 
ATOM   5356  H HE2  . TYR A 1 353 ? -50.179 40.866  -51.817 1.00 62.12  ? 690 TYR B HE2  1 
ATOM   5357  H HH   . TYR A 1 353 ? -47.664 41.170  -51.320 1.00 62.06  ? 690 TYR B HH   1 
ATOM   5358  N N    . GLN A 1 354 ? -54.220 37.405  -51.336 1.00 49.26  ? 691 GLN B N    1 
ATOM   5359  C CA   . GLN A 1 354 ? -54.947 37.942  -52.482 1.00 46.54  ? 691 GLN B CA   1 
ATOM   5360  C C    . GLN A 1 354 ? -55.672 39.222  -52.080 1.00 54.93  ? 691 GLN B C    1 
ATOM   5361  O O    . GLN A 1 354 ? -56.254 39.292  -51.002 1.00 66.69  ? 691 GLN B O    1 
ATOM   5362  C CB   . GLN A 1 354 ? -55.953 36.908  -52.988 1.00 50.78  ? 691 GLN B CB   1 
ATOM   5363  C CG   . GLN A 1 354 ? -56.567 37.252  -54.341 1.00 44.80  ? 691 GLN B CG   1 
ATOM   5364  C CD   . GLN A 1 354 ? -57.572 36.211  -54.801 1.00 63.05  ? 691 GLN B CD   1 
ATOM   5365  O OE1  . GLN A 1 354 ? -57.805 35.211  -54.118 1.00 68.24  ? 691 GLN B OE1  1 
ATOM   5366  N NE2  . GLN A 1 354 ? -58.175 36.442  -55.966 1.00 63.84  ? 691 GLN B NE2  1 
ATOM   5367  H H    . GLN A 1 354 ? -54.587 37.570  -50.576 1.00 59.12  ? 691 GLN B H    1 
ATOM   5368  H HA   . GLN A 1 354 ? -54.319 38.150  -53.204 1.00 55.85  ? 691 GLN B HA   1 
ATOM   5369  H HB2  . GLN A 1 354 ? -55.504 36.053  -53.075 1.00 60.94  ? 691 GLN B HB2  1 
ATOM   5370  H HB3  . GLN A 1 354 ? -56.676 36.836  -52.345 1.00 60.94  ? 691 GLN B HB3  1 
ATOM   5371  H HG2  . GLN A 1 354 ? -57.025 38.104  -54.274 1.00 53.76  ? 691 GLN B HG2  1 
ATOM   5372  H HG3  . GLN A 1 354 ? -55.862 37.304  -55.005 1.00 53.76  ? 691 GLN B HG3  1 
ATOM   5373  H HE21 . GLN A 1 354 ? -57.988 37.151  -56.415 1.00 76.61  ? 691 GLN B HE21 1 
ATOM   5374  H HE22 . GLN A 1 354 ? -58.753 35.882  -56.270 1.00 76.61  ? 691 GLN B HE22 1 
ATOM   5375  N N    . TYR A 1 355 ? -55.631 40.234  -52.944 1.00 53.21  ? 692 TYR B N    1 
ATOM   5376  C CA   . TYR A 1 355 ? -56.296 41.502  -52.667 1.00 62.20  ? 692 TYR B CA   1 
ATOM   5377  C C    . TYR A 1 355 ? -57.771 41.430  -53.059 1.00 64.37  ? 692 TYR B C    1 
ATOM   5378  O O    . TYR A 1 355 ? -58.116 40.803  -54.055 1.00 54.40  ? 692 TYR B O    1 
ATOM   5379  C CB   . TYR A 1 355 ? -55.623 42.636  -53.451 1.00 61.71  ? 692 TYR B CB   1 
ATOM   5380  C CG   . TYR A 1 355 ? -54.228 42.995  -52.984 1.00 56.08  ? 692 TYR B CG   1 
ATOM   5381  C CD1  . TYR A 1 355 ? -53.105 42.557  -53.675 1.00 53.88  ? 692 TYR B CD1  1 
ATOM   5382  C CD2  . TYR A 1 355 ? -54.035 43.788  -51.861 1.00 52.50  ? 692 TYR B CD2  1 
ATOM   5383  C CE1  . TYR A 1 355 ? -51.825 42.889  -53.249 1.00 54.36  ? 692 TYR B CE1  1 
ATOM   5384  C CE2  . TYR A 1 355 ? -52.764 44.129  -51.434 1.00 57.80  ? 692 TYR B CE2  1 
ATOM   5385  C CZ   . TYR A 1 355 ? -51.664 43.677  -52.131 1.00 53.09  ? 692 TYR B CZ   1 
ATOM   5386  O OH   . TYR A 1 355 ? -50.400 44.017  -51.702 1.00 51.59  ? 692 TYR B OH   1 
ATOM   5387  H H    . TYR A 1 355 ? -55.223 40.210  -53.701 1.00 63.85  ? 692 TYR B H    1 
ATOM   5388  H HA   . TYR A 1 355 ? -56.236 41.704  -51.710 1.00 74.64  ? 692 TYR B HA   1 
ATOM   5389  H HB2  . TYR A 1 355 ? -55.562 42.372  -54.382 1.00 74.05  ? 692 TYR B HB2  1 
ATOM   5390  H HB3  . TYR A 1 355 ? -56.172 43.432  -53.374 1.00 74.05  ? 692 TYR B HB3  1 
ATOM   5391  H HD1  . TYR A 1 355 ? -53.212 42.025  -54.430 1.00 64.66  ? 692 TYR B HD1  1 
ATOM   5392  H HD2  . TYR A 1 355 ? -54.774 44.096  -51.387 1.00 63.00  ? 692 TYR B HD2  1 
ATOM   5393  H HE1  . TYR A 1 355 ? -51.082 42.587  -53.720 1.00 65.23  ? 692 TYR B HE1  1 
ATOM   5394  H HE2  . TYR A 1 355 ? -52.652 44.659  -50.678 1.00 69.36  ? 692 TYR B HE2  1 
ATOM   5395  H HH   . TYR A 1 355 ? -50.279 43.739  -50.940 1.00 61.90  ? 692 TYR B HH   1 
ATOM   5396  N N    . SER A 1 356 ? -58.640 42.064  -52.275 1.00 70.02  ? 693 SER B N    1 
ATOM   5397  C CA   . SER A 1 356 ? -60.022 42.277  -52.692 1.00 79.10  ? 693 SER B CA   1 
ATOM   5398  C C    . SER A 1 356 ? -60.018 42.848  -54.100 1.00 73.13  ? 693 SER B C    1 
ATOM   5399  O O    . SER A 1 356 ? -59.204 43.711  -54.413 1.00 71.39  ? 693 SER B O    1 
ATOM   5400  C CB   . SER A 1 356 ? -60.727 43.266  -51.759 1.00 87.09  ? 693 SER B CB   1 
ATOM   5401  O OG   . SER A 1 356 ? -61.378 42.607  -50.690 1.00 90.90  ? 693 SER B OG   1 
ATOM   5402  H H    . SER A 1 356 ? -58.453 42.379  -51.497 1.00 84.02  ? 693 SER B H    1 
ATOM   5403  H HA   . SER A 1 356 ? -60.511 41.428  -52.690 1.00 94.92  ? 693 SER B HA   1 
ATOM   5404  H HB2  . SER A 1 356 ? -60.067 43.876  -51.394 1.00 104.51 ? 693 SER B HB2  1 
ATOM   5405  H HB3  . SER A 1 356 ? -61.386 43.761  -52.270 1.00 104.51 ? 693 SER B HB3  1 
ATOM   5406  H HG   . SER A 1 356 ? -61.748 43.156  -50.206 1.00 109.08 ? 693 SER B HG   1 
ATOM   5407  N N    . GLY A 1 357 ? -60.912 42.358  -54.952 1.00 81.48  ? 694 GLY B N    1 
ATOM   5408  C CA   . GLY A 1 357 ? -61.082 42.928  -56.277 1.00 84.58  ? 694 GLY B CA   1 
ATOM   5409  C C    . GLY A 1 357 ? -60.129 42.388  -57.329 1.00 82.74  ? 694 GLY B C    1 
ATOM   5410  O O    . GLY A 1 357 ? -60.351 42.585  -58.523 1.00 87.11  ? 694 GLY B O    1 
ATOM   5411  H H    . GLY A 1 357 ? -61.432 41.694  -54.784 1.00 97.77  ? 694 GLY B H    1 
ATOM   5412  H HA2  . GLY A 1 357 ? -61.988 42.759  -56.579 1.00 101.50 ? 694 GLY B HA2  1 
ATOM   5413  H HA3  . GLY A 1 357 ? -60.957 43.889  -56.225 1.00 101.50 ? 694 GLY B HA3  1 
ATOM   5414  N N    . LEU A 1 358 ? -59.068 41.714  -56.897 1.00 69.85  ? 695 LEU B N    1 
ATOM   5415  C CA   . LEU A 1 358 ? -58.099 41.148  -57.833 1.00 70.23  ? 695 LEU B CA   1 
ATOM   5416  C C    . LEU A 1 358 ? -58.271 39.641  -57.955 1.00 70.15  ? 695 LEU B C    1 
ATOM   5417  O O    . LEU A 1 358 ? -58.999 39.024  -57.178 1.00 78.20  ? 695 LEU B O    1 
ATOM   5418  C CB   . LEU A 1 358 ? -56.668 41.484  -57.408 1.00 68.43  ? 695 LEU B CB   1 
ATOM   5419  C CG   . LEU A 1 358 ? -56.215 42.903  -57.754 1.00 75.22  ? 695 LEU B CG   1 
ATOM   5420  C CD1  . LEU A 1 358 ? -57.048 43.931  -57.011 1.00 78.73  ? 695 LEU B CD1  1 
ATOM   5421  C CD2  . LEU A 1 358 ? -54.737 43.091  -57.454 1.00 69.92  ? 695 LEU B CD2  1 
ATOM   5422  H H    . LEU A 1 358 ? -58.885 41.570  -56.069 1.00 83.82  ? 695 LEU B H    1 
ATOM   5423  H HA   . LEU A 1 358 ? -58.249 41.540  -58.718 1.00 84.28  ? 695 LEU B HA   1 
ATOM   5424  H HB2  . LEU A 1 358 ? -56.598 41.380  -56.447 1.00 82.12  ? 695 LEU B HB2  1 
ATOM   5425  H HB3  . LEU A 1 358 ? -56.062 40.867  -57.848 1.00 82.12  ? 695 LEU B HB3  1 
ATOM   5426  H HG   . LEU A 1 358 ? -56.344 43.049  -58.705 1.00 90.26  ? 695 LEU B HG   1 
ATOM   5427  H HD11 . LEU A 1 358 ? -56.743 44.810  -57.246 1.00 94.47  ? 695 LEU B HD11 1 
ATOM   5428  H HD12 . LEU A 1 358 ? -57.969 43.825  -57.261 1.00 94.47  ? 695 LEU B HD12 1 
ATOM   5429  H HD13 . LEU A 1 358 ? -56.947 43.790  -56.066 1.00 94.47  ? 695 LEU B HD13 1 
ATOM   5430  H HD21 . LEU A 1 358 ? -54.484 43.989  -57.681 1.00 83.90  ? 695 LEU B HD21 1 
ATOM   5431  H HD22 . LEU A 1 358 ? -54.586 42.935  -56.519 1.00 83.90  ? 695 LEU B HD22 1 
ATOM   5432  H HD23 . LEU A 1 358 ? -54.230 42.466  -57.977 1.00 83.90  ? 695 LEU B HD23 1 
ATOM   5433  N N    . GLU A 1 359 ? -57.591 39.055  -58.936 1.00 69.49  ? 696 GLU B N    1 
ATOM   5434  C CA   . GLU A 1 359 ? -57.770 37.643  -59.262 1.00 74.07  ? 696 GLU B CA   1 
ATOM   5435  C C    . GLU A 1 359 ? -56.488 36.842  -59.072 1.00 72.67  ? 696 GLU B C    1 
ATOM   5436  O O    . GLU A 1 359 ? -56.521 35.614  -59.020 1.00 77.47  ? 696 GLU B O    1 
ATOM   5437  C CB   . GLU A 1 359 ? -58.240 37.503  -60.711 1.00 74.87  ? 696 GLU B CB   1 
ATOM   5438  C CG   . GLU A 1 359 ? -59.460 38.344  -61.042 1.00 82.12  ? 696 GLU B CG   1 
ATOM   5439  C CD   . GLU A 1 359 ? -59.938 38.155  -62.469 1.00 87.57  ? 696 GLU B CD   1 
ATOM   5440  O OE1  . GLU A 1 359 ? -59.379 37.292  -63.182 1.00 84.97  ? 696 GLU B OE1  1 
ATOM   5441  O OE2  . GLU A 1 359 ? -60.877 38.872  -62.874 1.00 93.02  ? 696 GLU B OE2  1 
ATOM   5442  H H    . GLU A 1 359 ? -57.015 39.457  -59.432 1.00 83.39  ? 696 GLU B H    1 
ATOM   5443  H HA   . GLU A 1 359 ? -58.459 37.262  -58.678 1.00 88.89  ? 696 GLU B HA   1 
ATOM   5444  H HB2  . GLU A 1 359 ? -57.521 37.779  -61.301 1.00 89.84  ? 696 GLU B HB2  1 
ATOM   5445  H HB3  . GLU A 1 359 ? -58.466 36.575  -60.878 1.00 89.84  ? 696 GLU B HB3  1 
ATOM   5446  H HG2  . GLU A 1 359 ? -60.186 38.094  -60.448 1.00 98.55  ? 696 GLU B HG2  1 
ATOM   5447  H HG3  . GLU A 1 359 ? -59.240 39.281  -60.921 1.00 98.55  ? 696 GLU B HG3  1 
ATOM   5448  N N    . ASP A 1 360 ? -55.362 37.540  -58.974 1.00 77.17  ? 697 ASP B N    1 
ATOM   5449  C CA   . ASP A 1 360 ? -54.061 36.887  -58.899 1.00 77.02  ? 697 ASP B CA   1 
ATOM   5450  C C    . ASP A 1 360 ? -53.675 36.536  -57.459 1.00 72.09  ? 697 ASP B C    1 
ATOM   5451  O O    . ASP A 1 360 ? -53.780 37.365  -56.556 1.00 62.41  ? 697 ASP B O    1 
ATOM   5452  C CB   . ASP A 1 360 ? -52.992 37.792  -59.521 1.00 77.51  ? 697 ASP B CB   1 
ATOM   5453  H H    . ASP A 1 360 ? -55.325 38.398  -58.948 1.00 92.60  ? 697 ASP B H    1 
ATOM   5454  H HA   . ASP A 1 360 ? -54.092 36.055  -59.415 1.00 92.42  ? 697 ASP B HA   1 
ATOM   5455  N N    . THR A 1 361 ? -53.244 35.296  -57.249 1.00 76.34  ? 698 THR B N    1 
ATOM   5456  C CA   . THR A 1 361 ? -52.678 34.894  -55.969 1.00 74.80  ? 698 THR B CA   1 
ATOM   5457  C C    . THR A 1 361 ? -51.233 35.359  -55.920 1.00 72.85  ? 698 THR B C    1 
ATOM   5458  O O    . THR A 1 361 ? -50.420 34.973  -56.761 1.00 79.38  ? 698 THR B O    1 
ATOM   5459  C CB   . THR A 1 361 ? -52.728 33.368  -55.770 1.00 80.24  ? 698 THR B CB   1 
ATOM   5460  O OG1  . THR A 1 361 ? -54.083 32.956  -55.554 1.00 84.11  ? 698 THR B OG1  1 
ATOM   5461  C CG2  . THR A 1 361 ? -51.883 32.950  -54.569 1.00 78.44  ? 698 THR B CG2  1 
ATOM   5462  H H    . THR A 1 361 ? -53.268 34.668  -57.835 1.00 91.60  ? 698 THR B H    1 
ATOM   5463  H HA   . THR A 1 361 ? -53.172 35.323  -55.240 1.00 89.75  ? 698 THR B HA   1 
ATOM   5464  H HB   . THR A 1 361 ? -52.378 32.927  -56.560 1.00 96.29  ? 698 THR B HB   1 
ATOM   5465  H HG1  . THR A 1 361 ? -54.115 32.144  -55.447 1.00 100.93 ? 698 THR B HG1  1 
ATOM   5466  H HG21 . THR A 1 361 ? -51.922 31.998  -54.456 1.00 94.13  ? 698 THR B HG21 1 
ATOM   5467  H HG22 . THR A 1 361 ? -50.969 33.211  -54.705 1.00 94.13  ? 698 THR B HG22 1 
ATOM   5468  H HG23 . THR A 1 361 ? -52.212 33.373  -53.773 1.00 94.13  ? 698 THR B HG23 1 
ATOM   5469  N N    . VAL A 1 362 ? -50.926 36.201  -54.937 1.00 54.50  ? 699 VAL B N    1 
ATOM   5470  C CA   . VAL A 1 362 ? -49.596 36.780  -54.800 1.00 47.44  ? 699 VAL B CA   1 
ATOM   5471  C C    . VAL A 1 362 ? -48.798 35.980  -53.794 1.00 53.66  ? 699 VAL B C    1 
ATOM   5472  O O    . VAL A 1 362 ? -49.340 35.533  -52.780 1.00 61.60  ? 699 VAL B O    1 
ATOM   5473  C CB   . VAL A 1 362 ? -49.676 38.241  -54.337 1.00 51.04  ? 699 VAL B CB   1 
ATOM   5474  C CG1  . VAL A 1 362 ? -48.285 38.837  -54.185 1.00 56.06  ? 699 VAL B CG1  1 
ATOM   5475  C CG2  . VAL A 1 362 ? -50.509 39.059  -55.321 1.00 56.27  ? 699 VAL B CG2  1 
ATOM   5476  H H    . VAL A 1 362 ? -51.479 36.455  -54.330 1.00 65.40  ? 699 VAL B H    1 
ATOM   5477  H HA   . VAL A 1 362 ? -49.132 36.750  -55.663 1.00 56.93  ? 699 VAL B HA   1 
ATOM   5478  H HB   . VAL A 1 362 ? -50.118 38.276  -53.463 1.00 61.25  ? 699 VAL B HB   1 
ATOM   5479  H HG11 . VAL A 1 362 ? -48.366 39.749  -53.896 1.00 67.27  ? 699 VAL B HG11 1 
ATOM   5480  H HG12 . VAL A 1 362 ? -47.797 38.329  -53.533 1.00 67.27  ? 699 VAL B HG12 1 
ATOM   5481  H HG13 . VAL A 1 362 ? -47.835 38.801  -55.033 1.00 67.27  ? 699 VAL B HG13 1 
ATOM   5482  H HG21 . VAL A 1 362 ? -50.548 39.968  -55.016 1.00 67.52  ? 699 VAL B HG21 1 
ATOM   5483  H HG22 . VAL A 1 362 ? -50.096 39.021  -56.187 1.00 67.52  ? 699 VAL B HG22 1 
ATOM   5484  H HG23 . VAL A 1 362 ? -51.394 38.689  -55.363 1.00 67.52  ? 699 VAL B HG23 1 
ATOM   5485  N N    . GLU A 1 363 ? -47.513 35.791  -54.070 1.00 48.75  ? 700 GLU B N    1 
ATOM   5486  C CA   . GLU A 1 363 ? -46.681 34.975  -53.192 1.00 58.38  ? 700 GLU B CA   1 
ATOM   5487  C C    . GLU A 1 363 ? -45.391 35.686  -52.815 1.00 59.75  ? 700 GLU B C    1 
ATOM   5488  O O    . GLU A 1 363 ? -44.601 36.079  -53.680 1.00 50.48  ? 700 GLU B O    1 
ATOM   5489  C CB   . GLU A 1 363 ? -46.386 33.629  -53.850 1.00 66.90  ? 700 GLU B CB   1 
ATOM   5490  C CG   . GLU A 1 363 ? -47.648 32.851  -54.181 1.00 78.70  ? 700 GLU B CG   1 
ATOM   5491  C CD   . GLU A 1 363 ? -47.375 31.603  -54.987 1.00 92.06  ? 700 GLU B CD   1 
ATOM   5492  O OE1  . GLU A 1 363 ? -47.282 30.515  -54.376 1.00 94.96  ? 700 GLU B OE1  1 
ATOM   5493  O OE2  . GLU A 1 363 ? -47.261 31.709  -56.230 1.00 91.81  ? 700 GLU B OE2  1 
ATOM   5494  H H    . GLU A 1 363 ? -47.102 36.118  -54.751 1.00 58.50  ? 700 GLU B H    1 
ATOM   5495  H HA   . GLU A 1 363 ? -47.176 34.799  -52.364 1.00 70.05  ? 700 GLU B HA   1 
ATOM   5496  H HB2  . GLU A 1 363 ? -45.902 33.781  -54.677 1.00 80.28  ? 700 GLU B HB2  1 
ATOM   5497  H HB3  . GLU A 1 363 ? -45.852 33.091  -53.245 1.00 80.28  ? 700 GLU B HB3  1 
ATOM   5498  H HG2  . GLU A 1 363 ? -48.081 32.585  -53.355 1.00 94.44  ? 700 GLU B HG2  1 
ATOM   5499  H HG3  . GLU A 1 363 ? -48.241 33.418  -54.699 1.00 94.44  ? 700 GLU B HG3  1 
ATOM   5500  N N    . ASP A 1 364 ? -45.197 35.860  -51.512 1.00 48.39  ? 701 ASP B N    1 
ATOM   5501  C CA   . ASP A 1 364 ? -44.012 36.512  -50.986 1.00 48.09  ? 701 ASP B CA   1 
ATOM   5502  C C    . ASP A 1 364 ? -43.331 35.535  -50.044 1.00 50.51  ? 701 ASP B C    1 
ATOM   5503  O O    . ASP A 1 364 ? -43.978 34.641  -49.490 1.00 36.08  ? 701 ASP B O    1 
ATOM   5504  C CB   . ASP A 1 364 ? -44.400 37.787  -50.240 1.00 50.05  ? 701 ASP B CB   1 
ATOM   5505  C CG   . ASP A 1 364 ? -43.200 38.641  -49.866 1.00 57.78  ? 701 ASP B CG   1 
ATOM   5506  O OD1  . ASP A 1 364 ? -42.128 38.501  -50.493 1.00 48.17  ? 701 ASP B OD1  1 
ATOM   5507  O OD2  . ASP A 1 364 ? -43.336 39.471  -48.944 1.00 68.88  ? 701 ASP B OD2  1 
ATOM   5508  H H    . ASP A 1 364 ? -45.750 35.604  -50.905 1.00 58.07  ? 701 ASP B H    1 
ATOM   5509  H HA   . ASP A 1 364 ? -43.398 36.739  -51.715 1.00 57.70  ? 701 ASP B HA   1 
ATOM   5510  H HB2  . ASP A 1 364 ? -44.982 38.318  -50.805 1.00 60.06  ? 701 ASP B HB2  1 
ATOM   5511  H HB3  . ASP A 1 364 ? -44.862 37.545  -49.422 1.00 60.06  ? 701 ASP B HB3  1 
ATOM   5512  N N    . LYS A 1 365 ? -42.026 35.678  -49.867 1.00 46.33  ? 702 LYS B N    1 
ATOM   5513  C CA   . LYS A 1 365 ? -41.330 34.815  -48.921 1.00 43.62  ? 702 LYS B CA   1 
ATOM   5514  C C    . LYS A 1 365 ? -40.261 35.608  -48.204 1.00 39.11  ? 702 LYS B C    1 
ATOM   5515  O O    . LYS A 1 365 ? -39.851 36.672  -48.660 1.00 42.54  ? 702 LYS B O    1 
ATOM   5516  C CB   . LYS A 1 365 ? -40.730 33.589  -49.620 1.00 42.13  ? 702 LYS B CB   1 
ATOM   5517  C CG   . LYS A 1 365 ? -39.489 33.868  -50.451 1.00 56.05  ? 702 LYS B CG   1 
ATOM   5518  C CD   . LYS A 1 365 ? -38.829 32.567  -50.893 1.00 67.45  ? 702 LYS B CD   1 
ATOM   5519  C CE   . LYS A 1 365 ? -39.811 31.664  -51.629 1.00 77.11  ? 702 LYS B CE   1 
ATOM   5520  N NZ   . LYS A 1 365 ? -39.245 30.311  -51.906 1.00 84.11  ? 702 LYS B NZ   1 
ATOM   5521  H H    . LYS A 1 365 ? -41.530 36.252  -50.271 1.00 55.59  ? 702 LYS B H    1 
ATOM   5522  H HA   . LYS A 1 365 ? -41.970 34.497  -48.250 1.00 52.35  ? 702 LYS B HA   1 
ATOM   5523  H HB2  . LYS A 1 365 ? -40.490 32.936  -48.945 1.00 50.56  ? 702 LYS B HB2  1 
ATOM   5524  H HB3  . LYS A 1 365 ? -41.400 33.214  -50.212 1.00 50.56  ? 702 LYS B HB3  1 
ATOM   5525  H HG2  . LYS A 1 365 ? -39.737 34.370  -51.242 1.00 67.26  ? 702 LYS B HG2  1 
ATOM   5526  H HG3  . LYS A 1 365 ? -38.851 34.369  -49.919 1.00 67.26  ? 702 LYS B HG3  1 
ATOM   5527  H HD2  . LYS A 1 365 ? -38.094 32.770  -51.493 1.00 80.94  ? 702 LYS B HD2  1 
ATOM   5528  H HD3  . LYS A 1 365 ? -38.505 32.091  -50.113 1.00 80.94  ? 702 LYS B HD3  1 
ATOM   5529  H HE2  . LYS A 1 365 ? -40.606 31.552  -51.086 1.00 92.54  ? 702 LYS B HE2  1 
ATOM   5530  H HE3  . LYS A 1 365 ? -40.042 32.073  -52.478 1.00 92.54  ? 702 LYS B HE3  1 
ATOM   5531  H HZ1  . LYS A 1 365 ? -39.844 29.813  -52.335 1.00 100.93 ? 702 LYS B HZ1  1 
ATOM   5532  H HZ2  . LYS A 1 365 ? -38.515 30.384  -52.410 1.00 100.93 ? 702 LYS B HZ2  1 
ATOM   5533  H HZ3  . LYS A 1 365 ? -39.029 29.909  -51.142 1.00 100.93 ? 702 LYS B HZ3  1 
ATOM   5534  N N    . GLN A 1 366 ? -39.810 35.078  -47.079 1.00 37.75  ? 703 GLN B N    1 
ATOM   5535  C CA   . GLN A 1 366 ? -38.889 35.792  -46.219 1.00 48.55  ? 703 GLN B CA   1 
ATOM   5536  C C    . GLN A 1 366 ? -37.992 34.813  -45.477 1.00 39.05  ? 703 GLN B C    1 
ATOM   5537  O O    . GLN A 1 366 ? -38.479 33.935  -44.754 1.00 39.17  ? 703 GLN B O    1 
ATOM   5538  C CB   . GLN A 1 366 ? -39.687 36.641  -45.228 1.00 56.40  ? 703 GLN B CB   1 
ATOM   5539  C CG   . GLN A 1 366 ? -38.939 37.050  -43.974 1.00 56.32  ? 703 GLN B CG   1 
ATOM   5540  C CD   . GLN A 1 366 ? -39.594 38.241  -43.295 1.00 61.93  ? 703 GLN B CD   1 
ATOM   5541  O OE1  . GLN A 1 366 ? -40.677 38.672  -43.693 1.00 68.21  ? 703 GLN B OE1  1 
ATOM   5542  N NE2  . GLN A 1 366 ? -38.939 38.782  -42.275 1.00 64.96  ? 703 GLN B NE2  1 
ATOM   5543  H H    . GLN A 1 366 ? -40.025 34.297  -46.791 1.00 45.30  ? 703 GLN B H    1 
ATOM   5544  H HA   . GLN A 1 366 ? -38.326 36.386  -46.758 1.00 58.26  ? 703 GLN B HA   1 
ATOM   5545  H HB2  . GLN A 1 366 ? -39.969 37.453  -45.677 1.00 67.68  ? 703 GLN B HB2  1 
ATOM   5546  H HB3  . GLN A 1 366 ? -40.467 36.136  -44.950 1.00 67.68  ? 703 GLN B HB3  1 
ATOM   5547  H HG2  . GLN A 1 366 ? -38.935 36.308  -43.349 1.00 67.59  ? 703 GLN B HG2  1 
ATOM   5548  H HG3  . GLN A 1 366 ? -38.031 37.296  -44.209 1.00 67.59  ? 703 GLN B HG3  1 
ATOM   5549  H HE21 . GLN A 1 366 ? -38.182 38.456  -42.029 1.00 77.95  ? 703 GLN B HE21 1 
ATOM   5550  H HE22 . GLN A 1 366 ? -39.272 39.458  -41.860 1.00 77.95  ? 703 GLN B HE22 1 
ATOM   5551  N N    . GLU A 1 367 ? -36.683 34.967  -45.650 1.00 38.22  ? 704 GLU B N    1 
ATOM   5552  C CA   . GLU A 1 367 ? -35.715 34.146  -44.924 1.00 39.70  ? 704 GLU B CA   1 
ATOM   5553  C C    . GLU A 1 367 ? -35.681 34.575  -43.469 1.00 37.89  ? 704 GLU B C    1 
ATOM   5554  O O    . GLU A 1 367 ? -35.770 35.756  -43.167 1.00 43.51  ? 704 GLU B O    1 
ATOM   5555  C CB   . GLU A 1 367 ? -34.313 34.273  -45.529 1.00 49.36  ? 704 GLU B CB   1 
ATOM   5556  C CG   . GLU A 1 367 ? -33.787 32.974  -46.132 1.00 64.37  ? 704 GLU B CG   1 
ATOM   5557  C CD   . GLU A 1 367 ? -32.280 32.978  -46.361 1.00 66.22  ? 704 GLU B CD   1 
ATOM   5558  O OE1  . GLU A 1 367 ? -31.615 33.988  -46.047 1.00 57.63  ? 704 GLU B OE1  1 
ATOM   5559  O OE2  . GLU A 1 367 ? -31.758 31.957  -46.857 1.00 73.23  ? 704 GLU B OE2  1 
ATOM   5560  H H    . GLU A 1 367 ? -36.327 35.540  -46.184 1.00 45.86  ? 704 GLU B H    1 
ATOM   5561  H HA   . GLU A 1 367 ? -35.988 33.205  -44.964 1.00 47.64  ? 704 GLU B HA   1 
ATOM   5562  H HB2  . GLU A 1 367 ? -34.335 34.940  -46.234 1.00 59.23  ? 704 GLU B HB2  1 
ATOM   5563  H HB3  . GLU A 1 367 ? -33.695 34.550  -44.834 1.00 59.23  ? 704 GLU B HB3  1 
ATOM   5564  H HG2  . GLU A 1 367 ? -33.994 32.243  -45.529 1.00 77.24  ? 704 GLU B HG2  1 
ATOM   5565  H HG3  . GLU A 1 367 ? -34.218 32.828  -46.988 1.00 77.24  ? 704 GLU B HG3  1 
ATOM   5566  N N    . VAL A 1 368 ? -35.555 33.606  -42.568 1.00 40.26  ? 705 VAL B N    1 
ATOM   5567  C CA   . VAL A 1 368 ? -35.439 33.892  -41.141 1.00 40.97  ? 705 VAL B CA   1 
ATOM   5568  C C    . VAL A 1 368 ? -34.268 33.097  -40.608 1.00 42.03  ? 705 VAL B C    1 
ATOM   5569  O O    . VAL A 1 368 ? -34.081 31.944  -40.982 1.00 46.52  ? 705 VAL B O    1 
ATOM   5570  C CB   . VAL A 1 368 ? -36.701 33.495  -40.353 1.00 43.95  ? 705 VAL B CB   1 
ATOM   5571  C CG1  . VAL A 1 368 ? -36.482 33.724  -38.870 1.00 46.95  ? 705 VAL B CG1  1 
ATOM   5572  C CG2  . VAL A 1 368 ? -37.913 34.281  -40.830 1.00 42.65  ? 705 VAL B CG2  1 
ATOM   5573  H H    . VAL A 1 368 ? -35.535 32.768  -42.758 1.00 48.31  ? 705 VAL B H    1 
ATOM   5574  H HA   . VAL A 1 368 ? -35.265 34.846  -41.004 1.00 49.17  ? 705 VAL B HA   1 
ATOM   5575  H HB   . VAL A 1 368 ? -36.881 32.542  -40.491 1.00 52.74  ? 705 VAL B HB   1 
ATOM   5576  H HG11 . VAL A 1 368 ? -37.277 33.471  -38.394 1.00 56.34  ? 705 VAL B HG11 1 
ATOM   5577  H HG12 . VAL A 1 368 ? -35.741 33.187  -38.578 1.00 56.34  ? 705 VAL B HG12 1 
ATOM   5578  H HG13 . VAL A 1 368 ? -36.292 34.653  -38.722 1.00 56.34  ? 705 VAL B HG13 1 
ATOM   5579  H HG21 . VAL A 1 368 ? -38.680 34.011  -40.320 1.00 51.18  ? 705 VAL B HG21 1 
ATOM   5580  H HG22 . VAL A 1 368 ? -37.747 35.218  -40.702 1.00 51.18  ? 705 VAL B HG22 1 
ATOM   5581  H HG23 . VAL A 1 368 ? -38.057 34.098  -41.761 1.00 51.18  ? 705 VAL B HG23 1 
ATOM   5582  N N    . ASN A 1 369 ? -33.486 33.711  -39.732 1.00 45.95  ? 706 ASN B N    1 
ATOM   5583  C CA   . ASN A 1 369 ? -32.280 33.081  -39.212 1.00 46.32  ? 706 ASN B CA   1 
ATOM   5584  C C    . ASN A 1 369 ? -32.244 33.230  -37.703 1.00 49.30  ? 706 ASN B C    1 
ATOM   5585  O O    . ASN A 1 369 ? -32.060 34.335  -37.191 1.00 52.55  ? 706 ASN B O    1 
ATOM   5586  C CB   . ASN A 1 369 ? -31.043 33.732  -39.833 1.00 54.35  ? 706 ASN B CB   1 
ATOM   5587  C CG   . ASN A 1 369 ? -29.750 33.097  -39.365 1.00 54.89  ? 706 ASN B CG   1 
ATOM   5588  O OD1  . ASN A 1 369 ? -29.722 32.392  -38.359 1.00 38.36  ? 706 ASN B OD1  1 
ATOM   5589  N ND2  . ASN A 1 369 ? -28.666 33.351  -40.093 1.00 55.21  ? 706 ASN B ND2  1 
ATOM   5590  H H    . ASN A 1 369 ? -33.631 34.499  -39.420 1.00 55.14  ? 706 ASN B H    1 
ATOM   5591  H HA   . ASN A 1 369 ? -32.281 32.127  -39.436 1.00 55.59  ? 706 ASN B HA   1 
ATOM   5592  H HB2  . ASN A 1 369 ? -31.089 33.642  -40.797 1.00 65.22  ? 706 ASN B HB2  1 
ATOM   5593  H HB3  . ASN A 1 369 ? -31.023 34.670  -39.587 1.00 65.22  ? 706 ASN B HB3  1 
ATOM   5594  H HD21 . ASN A 1 369 ? -28.724 33.853  -40.789 1.00 66.25  ? 706 ASN B HD21 1 
ATOM   5595  H HD22 . ASN A 1 369 ? -27.908 33.014  -39.868 1.00 66.25  ? 706 ASN B HD22 1 
ATOM   5596  N N    . VAL A 1 370 ? -32.429 32.121  -36.992 1.00 41.63  ? 707 VAL B N    1 
ATOM   5597  C CA   . VAL A 1 370 ? -32.485 32.155  -35.529 1.00 45.63  ? 707 VAL B CA   1 
ATOM   5598  C C    . VAL A 1 370 ? -31.245 31.539  -34.888 1.00 56.87  ? 707 VAL B C    1 
ATOM   5599  O O    . VAL A 1 370 ? -31.237 31.244  -33.695 1.00 59.51  ? 707 VAL B O    1 
ATOM   5600  C CB   . VAL A 1 370 ? -33.743 31.447  -34.990 1.00 36.45  ? 707 VAL B CB   1 
ATOM   5601  C CG1  . VAL A 1 370 ? -34.999 32.159  -35.486 1.00 40.65  ? 707 VAL B CG1  1 
ATOM   5602  C CG2  . VAL A 1 370 ? -33.757 29.968  -35.387 1.00 40.07  ? 707 VAL B CG2  1 
ATOM   5603  H H    . VAL A 1 370 ? -32.525 31.336  -37.331 1.00 49.96  ? 707 VAL B H    1 
ATOM   5604  H HA   . VAL A 1 370 ? -32.530 33.092  -35.243 1.00 54.76  ? 707 VAL B HA   1 
ATOM   5605  H HB   . VAL A 1 370 ? -33.738 31.494  -34.011 1.00 43.75  ? 707 VAL B HB   1 
ATOM   5606  H HG11 . VAL A 1 370 ? -35.772 31.706  -35.142 1.00 48.78  ? 707 VAL B HG11 1 
ATOM   5607  H HG12 . VAL A 1 370 ? -34.986 33.067  -35.175 1.00 48.78  ? 707 VAL B HG12 1 
ATOM   5608  H HG13 . VAL A 1 370 ? -35.009 32.142  -36.446 1.00 48.78  ? 707 VAL B HG13 1 
ATOM   5609  H HG21 . VAL A 1 370 ? -34.551 29.558  -35.037 1.00 48.09  ? 707 VAL B HG21 1 
ATOM   5610  H HG22 . VAL A 1 370 ? -33.749 29.902  -36.345 1.00 48.09  ? 707 VAL B HG22 1 
ATOM   5611  H HG23 . VAL A 1 370 ? -32.978 29.540  -35.023 1.00 48.09  ? 707 VAL B HG23 1 
ATOM   5612  N N    . GLY A 1 371 ? -30.202 31.350  -35.691 1.00 55.42  ? 708 GLY B N    1 
ATOM   5613  C CA   . GLY A 1 371 ? -28.933 30.846  -35.200 1.00 56.97  ? 708 GLY B CA   1 
ATOM   5614  C C    . GLY A 1 371 ? -29.001 29.381  -34.805 1.00 49.90  ? 708 GLY B C    1 
ATOM   5615  O O    . GLY A 1 371 ? -29.693 28.584  -35.435 1.00 40.62  ? 708 GLY B O    1 
ATOM   5616  H H    . GLY A 1 371 ? -30.208 31.509  -36.536 1.00 66.51  ? 708 GLY B H    1 
ATOM   5617  H HA2  . GLY A 1 371 ? -28.258 30.947  -35.889 1.00 68.37  ? 708 GLY B HA2  1 
ATOM   5618  H HA3  . GLY A 1 371 ? -28.660 31.361  -34.425 1.00 68.37  ? 708 GLY B HA3  1 
ATOM   5619  N N    . LYS A 1 372 ? -28.272 29.028  -33.754 1.00 35.83  ? 709 LYS B N    1 
ATOM   5620  C CA   . LYS A 1 372 ? -28.228 27.651  -33.290 1.00 55.86  ? 709 LYS B CA   1 
ATOM   5621  C C    . LYS A 1 372 ? -28.966 27.529  -31.954 1.00 49.49  ? 709 LYS B C    1 
ATOM   5622  O O    . LYS A 1 372 ? -28.450 27.935  -30.913 1.00 52.87  ? 709 LYS B O    1 
ATOM   5623  C CB   . LYS A 1 372 ? -26.775 27.182  -33.180 1.00 66.08  ? 709 LYS B CB   1 
ATOM   5624  C CG   . LYS A 1 372 ? -26.035 27.214  -34.518 1.00 63.32  ? 709 LYS B CG   1 
ATOM   5625  C CD   . LYS A 1 372 ? -24.563 26.868  -34.371 1.00 68.48  ? 709 LYS B CD   1 
ATOM   5626  C CE   . LYS A 1 372 ? -23.904 26.669  -35.727 1.00 67.44  ? 709 LYS B CE   1 
ATOM   5627  N NZ   . LYS A 1 372 ? -22.464 26.306  -35.611 1.00 68.48  ? 709 LYS B NZ   1 
ATOM   5628  H H    . LYS A 1 372 ? -27.792 29.571  -33.291 1.00 42.99  ? 709 LYS B H    1 
ATOM   5629  H HA   . LYS A 1 372 ? -28.684 27.078  -33.941 1.00 67.03  ? 709 LYS B HA   1 
ATOM   5630  H HB2  . LYS A 1 372 ? -26.302 27.762  -32.563 1.00 79.30  ? 709 LYS B HB2  1 
ATOM   5631  H HB3  . LYS A 1 372 ? -26.762 26.269  -32.853 1.00 79.30  ? 709 LYS B HB3  1 
ATOM   5632  H HG2  . LYS A 1 372 ? -26.439 26.569  -35.119 1.00 75.99  ? 709 LYS B HG2  1 
ATOM   5633  H HG3  . LYS A 1 372 ? -26.099 28.106  -34.894 1.00 75.99  ? 709 LYS B HG3  1 
ATOM   5634  H HD2  . LYS A 1 372 ? -24.107 27.591  -33.914 1.00 82.18  ? 709 LYS B HD2  1 
ATOM   5635  H HD3  . LYS A 1 372 ? -24.477 26.044  -33.867 1.00 82.18  ? 709 LYS B HD3  1 
ATOM   5636  H HE2  . LYS A 1 372 ? -24.357 25.952  -36.199 1.00 80.93  ? 709 LYS B HE2  1 
ATOM   5637  H HE3  . LYS A 1 372 ? -23.967 27.493  -36.235 1.00 80.93  ? 709 LYS B HE3  1 
ATOM   5638  H HZ1  . LYS A 1 372 ? -22.112 26.198  -36.420 1.00 82.17  ? 709 LYS B HZ1  1 
ATOM   5639  H HZ2  . LYS A 1 372 ? -22.022 26.951  -35.186 1.00 82.17  ? 709 LYS B HZ2  1 
ATOM   5640  H HZ3  . LYS A 1 372 ? -22.378 25.547  -35.154 1.00 82.17  ? 709 LYS B HZ3  1 
ATOM   5641  N N    . PRO A 1 373 ? -30.195 26.993  -31.991 1.00 48.59  ? 710 PRO B N    1 
ATOM   5642  C CA   . PRO A 1 373 ? -31.033 26.885  -30.797 1.00 50.21  ? 710 PRO B CA   1 
ATOM   5643  C C    . PRO A 1 373 ? -30.709 25.647  -29.981 1.00 44.48  ? 710 PRO B C    1 
ATOM   5644  O O    . PRO A 1 373 ? -30.116 24.693  -30.495 1.00 30.24  ? 710 PRO B O    1 
ATOM   5645  C CB   . PRO A 1 373 ? -32.435 26.750  -31.383 1.00 50.47  ? 710 PRO B CB   1 
ATOM   5646  C CG   . PRO A 1 373 ? -32.211 25.979  -32.634 1.00 53.76  ? 710 PRO B CG   1 
ATOM   5647  C CD   . PRO A 1 373 ? -30.895 26.485  -33.185 1.00 53.57  ? 710 PRO B CD   1 
ATOM   5648  H HA   . PRO A 1 373 ? -30.971 27.690  -30.242 1.00 60.25  ? 710 PRO B HA   1 
ATOM   5649  H HB2  . PRO A 1 373 ? -33.005 26.261  -30.769 1.00 60.56  ? 710 PRO B HB2  1 
ATOM   5650  H HB3  . PRO A 1 373 ? -32.801 27.628  -31.575 1.00 60.56  ? 710 PRO B HB3  1 
ATOM   5651  H HG2  . PRO A 1 373 ? -32.155 25.033  -32.428 1.00 64.51  ? 710 PRO B HG2  1 
ATOM   5652  H HG3  . PRO A 1 373 ? -32.933 26.153  -33.258 1.00 64.51  ? 710 PRO B HG3  1 
ATOM   5653  H HD2  . PRO A 1 373 ? -30.395 25.757  -33.586 1.00 64.29  ? 710 PRO B HD2  1 
ATOM   5654  H HD3  . PRO A 1 373 ? -31.048 27.203  -33.819 1.00 64.29  ? 710 PRO B HD3  1 
ATOM   5655  N N    . LEU A 1 374 ? -31.110 25.676  -28.717 1.00 40.81  ? 711 LEU B N    1 
ATOM   5656  C CA   . LEU A 1 374 ? -30.938 24.550  -27.826 1.00 43.67  ? 711 LEU B CA   1 
ATOM   5657  C C    . LEU A 1 374 ? -29.560 23.930  -28.037 1.00 51.47  ? 711 LEU B C    1 
ATOM   5658  O O    . LEU A 1 374 ? -28.576 24.649  -28.223 1.00 46.65  ? 711 LEU B O    1 
ATOM   5659  C CB   . LEU A 1 374 ? -32.070 23.547  -28.053 1.00 41.28  ? 711 LEU B CB   1 
ATOM   5660  C CG   . LEU A 1 374 ? -33.460 24.187  -27.945 1.00 40.46  ? 711 LEU B CG   1 
ATOM   5661  C CD1  . LEU A 1 374 ? -34.565 23.177  -28.183 1.00 39.51  ? 711 LEU B CD1  1 
ATOM   5662  C CD2  . LEU A 1 374 ? -33.635 24.842  -26.587 1.00 49.88  ? 711 LEU B CD2  1 
ATOM   5663  H H    . LEU A 1 374 ? -31.491 26.353  -28.349 1.00 48.97  ? 711 LEU B H    1 
ATOM   5664  H HA   . LEU A 1 374 ? -30.992 24.864  -26.899 1.00 52.41  ? 711 LEU B HA   1 
ATOM   5665  H HB2  . LEU A 1 374 ? -31.982 23.167  -28.941 1.00 49.54  ? 711 LEU B HB2  1 
ATOM   5666  H HB3  . LEU A 1 374 ? -32.009 22.846  -27.385 1.00 49.54  ? 711 LEU B HB3  1 
ATOM   5667  H HG   . LEU A 1 374 ? -33.539 24.878  -28.621 1.00 48.56  ? 711 LEU B HG   1 
ATOM   5668  H HD11 . LEU A 1 374 ? -35.414 23.620  -28.106 1.00 47.42  ? 711 LEU B HD11 1 
ATOM   5669  H HD12 . LEU A 1 374 ? -34.466 22.808  -29.063 1.00 47.42  ? 711 LEU B HD12 1 
ATOM   5670  H HD13 . LEU A 1 374 ? -34.498 22.481  -27.526 1.00 47.42  ? 711 LEU B HD13 1 
ATOM   5671  H HD21 . LEU A 1 374 ? -34.510 25.235  -26.541 1.00 59.85  ? 711 LEU B HD21 1 
ATOM   5672  H HD22 . LEU A 1 374 ? -33.540 24.174  -25.904 1.00 59.85  ? 711 LEU B HD22 1 
ATOM   5673  H HD23 . LEU A 1 374 ? -32.964 25.520  -26.478 1.00 59.85  ? 711 LEU B HD23 1 
ATOM   5674  N N    . ILE A 1 375 ? -29.486 22.605  -28.027 1.00 39.24  ? 712 ILE B N    1 
ATOM   5675  C CA   . ILE A 1 375 ? -28.198 21.923  -27.951 1.00 42.59  ? 712 ILE B CA   1 
ATOM   5676  C C    . ILE A 1 375 ? -27.309 22.186  -29.175 1.00 45.88  ? 712 ILE B C    1 
ATOM   5677  O O    . ILE A 1 375 ? -26.103 21.961  -29.122 1.00 41.13  ? 712 ILE B O    1 
ATOM   5678  C CB   . ILE A 1 375 ? -28.385 20.395  -27.742 1.00 42.95  ? 712 ILE B CB   1 
ATOM   5679  C CG1  . ILE A 1 375 ? -27.197 19.812  -26.976 1.00 44.34  ? 712 ILE B CG1  1 
ATOM   5680  C CG2  . ILE A 1 375 ? -28.583 19.689  -29.073 1.00 53.15  ? 712 ILE B CG2  1 
ATOM   5681  C CD1  . ILE A 1 375 ? -27.394 19.816  -25.472 1.00 49.12  ? 712 ILE B CD1  1 
ATOM   5682  H H    . ILE A 1 375 ? -30.165 22.078  -28.063 1.00 47.09  ? 712 ILE B H    1 
ATOM   5683  H HA   . ILE A 1 375 ? -27.718 22.265  -27.168 1.00 51.10  ? 712 ILE B HA   1 
ATOM   5684  H HB   . ILE A 1 375 ? -29.184 20.260  -27.208 1.00 51.53  ? 712 ILE B HB   1 
ATOM   5685  H HG12 . ILE A 1 375 ? -27.062 18.893  -27.257 1.00 53.21  ? 712 ILE B HG12 1 
ATOM   5686  H HG13 . ILE A 1 375 ? -26.407 20.338  -27.174 1.00 53.21  ? 712 ILE B HG13 1 
ATOM   5687  H HG21 . ILE A 1 375 ? -28.696 18.749  -28.914 1.00 63.78  ? 712 ILE B HG21 1 
ATOM   5688  H HG22 . ILE A 1 375 ? -29.364 20.046  -29.502 1.00 63.78  ? 712 ILE B HG22 1 
ATOM   5689  H HG23 . ILE A 1 375 ? -27.810 19.838  -29.623 1.00 63.78  ? 712 ILE B HG23 1 
ATOM   5690  H HD11 . ILE A 1 375 ? -26.616 19.439  -25.055 1.00 58.95  ? 712 ILE B HD11 1 
ATOM   5691  H HD12 . ILE A 1 375 ? -27.519 20.720  -25.176 1.00 58.95  ? 712 ILE B HD12 1 
ATOM   5692  H HD13 . ILE A 1 375 ? -28.168 19.290  -25.258 1.00 58.95  ? 712 ILE B HD13 1 
ATOM   5693  N N    . ALA A 1 376 ? -27.899 22.664  -30.271 1.00 56.65  ? 713 ALA B N    1 
ATOM   5694  C CA   . ALA A 1 376 ? -27.126 23.010  -31.470 1.00 59.76  ? 713 ALA B CA   1 
ATOM   5695  C C    . ALA A 1 376 ? -26.056 24.047  -31.140 1.00 68.98  ? 713 ALA B C    1 
ATOM   5696  O O    . ALA A 1 376 ? -25.046 24.160  -31.837 1.00 76.13  ? 713 ALA B O    1 
ATOM   5697  C CB   . ALA A 1 376 ? -28.048 23.546  -32.579 1.00 47.78  ? 713 ALA B CB   1 
ATOM   5698  H H    . ALA A 1 376 ? -28.745 22.797  -30.349 1.00 67.98  ? 713 ALA B H    1 
ATOM   5699  H HA   . ALA A 1 376 ? -26.679 22.206  -31.807 1.00 71.71  ? 713 ALA B HA   1 
ATOM   5700  H HB1  . ALA A 1 376 ? -27.517 23.764  -33.348 1.00 57.33  ? 713 ALA B HB1  1 
ATOM   5701  H HB2  . ALA A 1 376 ? -28.691 22.869  -32.805 1.00 57.33  ? 713 ALA B HB2  1 
ATOM   5702  H HB3  . ALA A 1 376 ? -28.498 24.331  -32.258 1.00 57.33  ? 713 ALA B HB3  1 
ATOM   5703  N N    . LYS A 1 377 ? -26.293 24.801  -30.072 1.00 53.75  ? 714 LYS B N    1 
ATOM   5704  C CA   . LYS A 1 377 ? -25.416 25.889  -29.667 1.00 48.72  ? 714 LYS B CA   1 
ATOM   5705  C C    . LYS A 1 377 ? -24.002 25.412  -29.372 1.00 57.04  ? 714 LYS B C    1 
ATOM   5706  O O    . LYS A 1 377 ? -23.044 26.173  -29.515 1.00 55.15  ? 714 LYS B O    1 
ATOM   5707  C CB   . LYS A 1 377 ? -25.991 26.587  -28.434 1.00 51.58  ? 714 LYS B CB   1 
ATOM   5708  H H    . LYS A 1 377 ? -26.973 24.698  -29.555 1.00 64.51  ? 714 LYS B H    1 
ATOM   5709  H HA   . LYS A 1 377 ? -25.368 26.546  -30.392 1.00 58.46  ? 714 LYS B HA   1 
ATOM   5710  N N    . LEU A 1 378 ? -23.877 24.154  -28.958 1.00 66.17  ? 715 LEU B N    1 
ATOM   5711  C CA   . LEU A 1 378 ? -22.585 23.586  -28.590 1.00 74.03  ? 715 LEU B CA   1 
ATOM   5712  C C    . LEU A 1 378 ? -21.952 24.397  -27.465 1.00 84.80  ? 715 LEU B C    1 
ATOM   5713  O O    . LEU A 1 378 ? -21.115 23.893  -26.717 1.00 95.73  ? 715 LEU B O    1 
ATOM   5714  C CB   . LEU A 1 378 ? -21.649 23.543  -29.800 1.00 75.65  ? 715 LEU B CB   1 
ATOM   5715  C CG   . LEU A 1 378 ? -22.031 22.561  -30.909 1.00 77.73  ? 715 LEU B CG   1 
ATOM   5716  C CD1  . LEU A 1 378 ? -21.437 22.985  -32.246 1.00 79.72  ? 715 LEU B CD1  1 
ATOM   5717  C CD2  . LEU A 1 378 ? -21.592 21.152  -30.542 1.00 82.12  ? 715 LEU B CD2  1 
ATOM   5718  H H    . LEU A 1 378 ? -24.533 23.603  -28.881 1.00 79.41  ? 715 LEU B H    1 
ATOM   5719  H HA   . LEU A 1 378 ? -22.715 22.669  -28.270 1.00 88.83  ? 715 LEU B HA   1 
ATOM   5720  H HB2  . LEU A 1 378 ? -21.621 24.428  -30.195 1.00 90.78  ? 715 LEU B HB2  1 
ATOM   5721  H HB3  . LEU A 1 378 ? -20.763 23.299  -29.491 1.00 90.78  ? 715 LEU B HB3  1 
ATOM   5722  H HG   . LEU A 1 378 ? -22.996 22.556  -31.002 1.00 93.27  ? 715 LEU B HG   1 
ATOM   5723  H HD11 . LEU A 1 378 ? -21.696 22.350  -32.918 1.00 95.66  ? 715 LEU B HD11 1 
ATOM   5724  H HD12 . LEU A 1 378 ? -21.771 23.856  -32.474 1.00 95.66  ? 715 LEU B HD12 1 
ATOM   5725  H HD13 . LEU A 1 378 ? -20.481 23.011  -32.169 1.00 95.66  ? 715 LEU B HD13 1 
ATOM   5726  H HD21 . LEU A 1 378 ? -21.840 20.553  -31.250 1.00 98.54  ? 715 LEU B HD21 1 
ATOM   5727  H HD22 . LEU A 1 378 ? -20.639 21.143  -30.424 1.00 98.54  ? 715 LEU B HD22 1 
ATOM   5728  H HD23 . LEU A 1 378 ? -22.026 20.892  -29.726 1.00 98.54  ? 715 LEU B HD23 1 
ATOM   5729  N N    . MET B 1 1   ? -43.657 -11.087 5.850   1.00 44.09  ? 338 MET C N    1 
ATOM   5730  C CA   . MET B 1 1   ? -43.254 -12.179 4.980   1.00 41.06  ? 338 MET C CA   1 
ATOM   5731  C C    . MET B 1 1   ? -42.869 -13.389 5.836   1.00 43.82  ? 338 MET C C    1 
ATOM   5732  O O    . MET B 1 1   ? -42.461 -13.240 6.996   1.00 40.53  ? 338 MET C O    1 
ATOM   5733  C CB   . MET B 1 1   ? -42.082 -11.744 4.098   1.00 36.68  ? 338 MET C CB   1 
ATOM   5734  C CG   . MET B 1 1   ? -42.373 -10.495 3.253   1.00 40.67  ? 338 MET C CG   1 
ATOM   5735  S SD   . MET B 1 1   ? -43.763 -10.720 2.121   1.00 49.41  ? 338 MET C SD   1 
ATOM   5736  C CE   . MET B 1 1   ? -43.161 -12.108 1.163   1.00 44.23  ? 338 MET C CE   1 
ATOM   5737  H HA   . MET B 1 1   ? -44.003 -12.422 4.397   1.00 49.27  ? 338 MET C HA   1 
ATOM   5738  H HB2  . MET B 1 1   ? -41.320 -11.547 4.665   1.00 44.02  ? 338 MET C HB2  1 
ATOM   5739  H HB3  . MET B 1 1   ? -41.862 -12.468 3.491   1.00 44.02  ? 338 MET C HB3  1 
ATOM   5740  H HG2  . MET B 1 1   ? -42.585 -9.756  3.844   1.00 48.81  ? 338 MET C HG2  1 
ATOM   5741  H HG3  . MET B 1 1   ? -41.588 -10.282 2.724   1.00 48.81  ? 338 MET C HG3  1 
ATOM   5742  H HE1  . MET B 1 1   ? -43.819 -12.341 0.504   1.00 53.07  ? 338 MET C HE1  1 
ATOM   5743  H HE2  . MET B 1 1   ? -42.340 -11.858 0.733   1.00 53.07  ? 338 MET C HE2  1 
ATOM   5744  H HE3  . MET B 1 1   ? -43.010 -12.851 1.752   1.00 53.07  ? 338 MET C HE3  1 
ATOM   5745  N N    . LEU B 1 2   ? -43.005 -14.583 5.262   1.00 38.49  ? 339 LEU C N    1 
ATOM   5746  C CA   . LEU B 1 2   ? -42.743 -15.824 5.989   1.00 42.00  ? 339 LEU C CA   1 
ATOM   5747  C C    . LEU B 1 2   ? -41.616 -16.631 5.347   1.00 39.78  ? 339 LEU C C    1 
ATOM   5748  O O    . LEU B 1 2   ? -41.417 -16.585 4.130   1.00 32.28  ? 339 LEU C O    1 
ATOM   5749  C CB   . LEU B 1 2   ? -44.010 -16.679 6.042   1.00 50.37  ? 339 LEU C CB   1 
ATOM   5750  C CG   . LEU B 1 2   ? -45.267 -16.004 6.599   1.00 60.36  ? 339 LEU C CG   1 
ATOM   5751  C CD1  . LEU B 1 2   ? -46.411 -17.002 6.709   1.00 63.48  ? 339 LEU C CD1  1 
ATOM   5752  C CD2  . LEU B 1 2   ? -44.987 -15.368 7.952   1.00 63.29  ? 339 LEU C CD2  1 
ATOM   5753  H H    . LEU B 1 2   ? -43.250 -14.702 4.447   1.00 46.19  ? 339 LEU C H    1 
ATOM   5754  H HA   . LEU B 1 2   ? -42.480 -15.609 6.909   1.00 50.40  ? 339 LEU C HA   1 
ATOM   5755  H HB2  . LEU B 1 2   ? -44.216 -16.972 5.141   1.00 60.44  ? 339 LEU C HB2  1 
ATOM   5756  H HB3  . LEU B 1 2   ? -43.830 -17.454 6.598   1.00 60.44  ? 339 LEU C HB3  1 
ATOM   5757  H HG   . LEU B 1 2   ? -45.541 -15.300 5.990   1.00 72.44  ? 339 LEU C HG   1 
ATOM   5758  H HD11 . LEU B 1 2   ? -47.184 -16.554 7.060   1.00 76.18  ? 339 LEU C HD11 1 
ATOM   5759  H HD12 . LEU B 1 2   ? -46.604 -17.354 5.836   1.00 76.18  ? 339 LEU C HD12 1 
ATOM   5760  H HD13 . LEU B 1 2   ? -46.150 -17.714 7.298   1.00 76.18  ? 339 LEU C HD13 1 
ATOM   5761  H HD21 . LEU B 1 2   ? -45.791 -14.954 8.274   1.00 75.94  ? 339 LEU C HD21 1 
ATOM   5762  H HD22 . LEU B 1 2   ? -44.702 -16.050 8.564   1.00 75.94  ? 339 LEU C HD22 1 
ATOM   5763  H HD23 . LEU B 1 2   ? -44.297 -14.708 7.850   1.00 75.94  ? 339 LEU C HD23 1 
ATOM   5764  N N    . ALA B 1 3   ? -40.883 -17.372 6.176   1.00 29.42  ? 340 ALA C N    1 
ATOM   5765  C CA   . ALA B 1 3   ? -39.826 -18.253 5.697   1.00 35.32  ? 340 ALA C CA   1 
ATOM   5766  C C    . ALA B 1 3   ? -40.217 -19.694 6.005   1.00 42.34  ? 340 ALA C C    1 
ATOM   5767  O O    . ALA B 1 3   ? -40.756 -19.971 7.075   1.00 41.90  ? 340 ALA C O    1 
ATOM   5768  C CB   . ALA B 1 3   ? -38.501 -17.902 6.371   1.00 32.09  ? 340 ALA C CB   1 
ATOM   5769  H H    . ALA B 1 3   ? -40.982 -17.381 7.030   1.00 35.30  ? 340 ALA C H    1 
ATOM   5770  H HA   . ALA B 1 3   ? -39.724 -18.154 4.728   1.00 42.38  ? 340 ALA C HA   1 
ATOM   5771  H HB1  . ALA B 1 3   ? -37.818 -18.493 6.043   1.00 38.51  ? 340 ALA C HB1  1 
ATOM   5772  H HB2  . ALA B 1 3   ? -38.276 -16.993 6.161   1.00 38.51  ? 340 ALA C HB2  1 
ATOM   5773  H HB3  . ALA B 1 3   ? -38.596 -18.006 7.320   1.00 38.51  ? 340 ALA C HB3  1 
ATOM   5774  N N    . LYS B 1 4   ? -39.966 -20.610 5.074   1.00 35.60  ? 341 LYS C N    1 
ATOM   5775  C CA   . LYS B 1 4   ? -40.292 -22.018 5.304   1.00 41.97  ? 341 LYS C CA   1 
ATOM   5776  C C    . LYS B 1 4   ? -39.306 -22.615 6.307   1.00 42.01  ? 341 LYS C C    1 
ATOM   5777  O O    . LYS B 1 4   ? -39.645 -23.519 7.071   1.00 34.27  ? 341 LYS C O    1 
ATOM   5778  C CB   . LYS B 1 4   ? -40.266 -22.812 3.997   1.00 43.54  ? 341 LYS C CB   1 
ATOM   5779  C CG   . LYS B 1 4   ? -40.646 -24.278 4.177   1.00 75.99  ? 341 LYS C CG   1 
ATOM   5780  C CD   . LYS B 1 4   ? -40.307 -25.113 2.951   1.00 92.91  ? 341 LYS C CD   1 
ATOM   5781  C CE   . LYS B 1 4   ? -40.328 -26.603 3.268   1.00 102.69 ? 341 LYS C CE   1 
ATOM   5782  N NZ   . LYS B 1 4   ? -39.241 -26.993 4.213   1.00 102.54 ? 341 LYS C NZ   1 
ATOM   5783  H H    . LYS B 1 4   ? -39.610 -20.446 4.309   1.00 42.72  ? 341 LYS C H    1 
ATOM   5784  H HA   . LYS B 1 4   ? -41.193 -22.082 5.683   1.00 50.36  ? 341 LYS C HA   1 
ATOM   5785  H HB2  . LYS B 1 4   ? -40.896 -22.414 3.375   1.00 52.24  ? 341 LYS C HB2  1 
ATOM   5786  H HB3  . LYS B 1 4   ? -39.370 -22.779 3.626   1.00 52.24  ? 341 LYS C HB3  1 
ATOM   5787  H HG2  . LYS B 1 4   ? -40.160 -24.641 4.933   1.00 91.18  ? 341 LYS C HG2  1 
ATOM   5788  H HG3  . LYS B 1 4   ? -41.601 -24.342 4.331   1.00 91.18  ? 341 LYS C HG3  1 
ATOM   5789  H HD2  . LYS B 1 4   ? -40.961 -24.941 2.256   1.00 111.49 ? 341 LYS C HD2  1 
ATOM   5790  H HD3  . LYS B 1 4   ? -39.418 -24.881 2.641   1.00 111.49 ? 341 LYS C HD3  1 
ATOM   5791  H HE2  . LYS B 1 4   ? -41.178 -26.829 3.677   1.00 123.22 ? 341 LYS C HE2  1 
ATOM   5792  H HE3  . LYS B 1 4   ? -40.208 -27.105 2.447   1.00 123.22 ? 341 LYS C HE3  1 
ATOM   5793  H HZ1  . LYS B 1 4   ? -39.280 -27.866 4.378   1.00 123.05 ? 341 LYS C HZ1  1 
ATOM   5794  H HZ2  . LYS B 1 4   ? -38.447 -26.800 3.859   1.00 123.05 ? 341 LYS C HZ2  1 
ATOM   5795  H HZ3  . LYS B 1 4   ? -39.331 -26.549 4.979   1.00 123.05 ? 341 LYS C HZ3  1 
ATOM   5796  N N    . ASP B 1 5   ? -38.078 -22.108 6.268   1.00 34.95  ? 342 ASP C N    1 
ATOM   5797  C CA   . ASP B 1 5   ? -37.051 -22.401 7.265   1.00 41.35  ? 342 ASP C CA   1 
ATOM   5798  C C    . ASP B 1 5   ? -35.998 -21.308 7.065   1.00 33.74  ? 342 ASP C C    1 
ATOM   5799  O O    . ASP B 1 5   ? -36.116 -20.500 6.156   1.00 35.23  ? 342 ASP C O    1 
ATOM   5800  C CB   . ASP B 1 5   ? -36.461 -23.812 7.064   1.00 36.61  ? 342 ASP C CB   1 
ATOM   5801  C CG   . ASP B 1 5   ? -35.713 -24.335 8.299   1.00 48.15  ? 342 ASP C CG   1 
ATOM   5802  O OD1  . ASP B 1 5   ? -35.541 -23.568 9.266   1.00 31.45  ? 342 ASP C OD1  1 
ATOM   5803  O OD2  . ASP B 1 5   ? -35.284 -25.516 8.301   1.00 38.08  ? 342 ASP C OD2  1 
ATOM   5804  H H    . ASP B 1 5   ? -37.807 -21.574 5.652   1.00 41.95  ? 342 ASP C H    1 
ATOM   5805  H HA   . ASP B 1 5   ? -37.424 -22.330 8.168   1.00 49.62  ? 342 ASP C HA   1 
ATOM   5806  H HB2  . ASP B 1 5   ? -37.182 -24.430 6.868   1.00 43.93  ? 342 ASP C HB2  1 
ATOM   5807  H HB3  . ASP B 1 5   ? -35.835 -23.790 6.323   1.00 43.93  ? 342 ASP C HB3  1 
ATOM   5808  N N    . LYS B 1 6   ? -34.988 -21.248 7.918   1.00 28.19  ? 343 LYS C N    1 
ATOM   5809  C CA   . LYS B 1 6   ? -33.918 -20.276 7.728   1.00 30.95  ? 343 LYS C CA   1 
ATOM   5810  C C    . LYS B 1 6   ? -32.606 -20.972 8.041   1.00 36.77  ? 343 LYS C C    1 
ATOM   5811  O O    . LYS B 1 6   ? -32.413 -21.486 9.139   1.00 35.25  ? 343 LYS C O    1 
ATOM   5812  C CB   . LYS B 1 6   ? -34.130 -19.049 8.621   1.00 31.19  ? 343 LYS C CB   1 
ATOM   5813  C CG   . LYS B 1 6   ? -35.495 -18.391 8.428   1.00 29.44  ? 343 LYS C CG   1 
ATOM   5814  C CD   . LYS B 1 6   ? -35.597 -17.041 9.128   1.00 33.09  ? 343 LYS C CD   1 
ATOM   5815  C CE   . LYS B 1 6   ? -35.643 -17.216 10.655  1.00 41.39  ? 343 LYS C CE   1 
ATOM   5816  N NZ   . LYS B 1 6   ? -35.995 -15.940 11.356  1.00 33.48  ? 343 LYS C NZ   1 
ATOM   5817  H H    . LYS B 1 6   ? -34.895 -21.753 8.609   1.00 33.83  ? 343 LYS C H    1 
ATOM   5818  H HA   . LYS B 1 6   ? -33.902 -19.983 6.793   1.00 37.14  ? 343 LYS C HA   1 
ATOM   5819  H HB2  . LYS B 1 6   ? -34.058 -19.320 9.550   1.00 37.43  ? 343 LYS C HB2  1 
ATOM   5820  H HB3  . LYS B 1 6   ? -33.449 -18.389 8.415   1.00 37.43  ? 343 LYS C HB3  1 
ATOM   5821  H HG2  . LYS B 1 6   ? -35.648 -18.251 7.480   1.00 35.32  ? 343 LYS C HG2  1 
ATOM   5822  H HG3  . LYS B 1 6   ? -36.181 -18.972 8.793   1.00 35.32  ? 343 LYS C HG3  1 
ATOM   5823  H HD2  . LYS B 1 6   ? -34.821 -16.503 8.905   1.00 39.71  ? 343 LYS C HD2  1 
ATOM   5824  H HD3  . LYS B 1 6   ? -36.410 -16.593 8.847   1.00 39.71  ? 343 LYS C HD3  1 
ATOM   5825  H HE2  . LYS B 1 6   ? -36.314 -17.880 10.880  1.00 49.66  ? 343 LYS C HE2  1 
ATOM   5826  H HE3  . LYS B 1 6   ? -34.771 -17.503 10.969  1.00 49.66  ? 343 LYS C HE3  1 
ATOM   5827  H HZ1  . LYS B 1 6   ? -36.014 -16.072 12.236  1.00 40.18  ? 343 LYS C HZ1  1 
ATOM   5828  H HZ2  . LYS B 1 6   ? -35.390 -15.314 11.170  1.00 40.18  ? 343 LYS C HZ2  1 
ATOM   5829  H HZ3  . LYS B 1 6   ? -36.795 -15.657 11.088  1.00 40.18  ? 343 LYS C HZ3  1 
ATOM   5830  N N    . VAL B 1 7   ? -31.716 -20.982 7.061   1.00 25.10  ? 344 VAL C N    1 
ATOM   5831  C CA   . VAL B 1 7   ? -30.504 -21.783 7.089   1.00 24.06  ? 344 VAL C CA   1 
ATOM   5832  C C    . VAL B 1 7   ? -29.307 -20.920 6.732   1.00 27.72  ? 344 VAL C C    1 
ATOM   5833  O O    . VAL B 1 7   ? -29.382 -20.132 5.805   1.00 20.33  ? 344 VAL C O    1 
ATOM   5834  C CB   . VAL B 1 7   ? -30.592 -22.901 6.038   1.00 26.86  ? 344 VAL C CB   1 
ATOM   5835  C CG1  . VAL B 1 7   ? -29.376 -23.816 6.134   1.00 32.15  ? 344 VAL C CG1  1 
ATOM   5836  C CG2  . VAL B 1 7   ? -31.890 -23.690 6.203   1.00 29.56  ? 344 VAL C CG2  1 
ATOM   5837  H H    . VAL B 1 7   ? -31.796 -20.515 6.343   1.00 30.12  ? 344 VAL C H    1 
ATOM   5838  H HA   . VAL B 1 7   ? -30.372 -22.176 7.977   1.00 28.87  ? 344 VAL C HA   1 
ATOM   5839  H HB   . VAL B 1 7   ? -30.596 -22.498 5.145   1.00 32.23  ? 344 VAL C HB   1 
ATOM   5840  H HG11 . VAL B 1 7   ? -29.451 -24.505 5.470   1.00 38.58  ? 344 VAL C HG11 1 
ATOM   5841  H HG12 . VAL B 1 7   ? -28.583 -23.297 5.979   1.00 38.58  ? 344 VAL C HG12 1 
ATOM   5842  H HG13 . VAL B 1 7   ? -29.347 -24.206 7.010   1.00 38.58  ? 344 VAL C HG13 1 
ATOM   5843  H HG21 . VAL B 1 7   ? -31.921 -24.381 5.537   1.00 35.48  ? 344 VAL C HG21 1 
ATOM   5844  H HG22 . VAL B 1 7   ? -31.910 -24.079 7.080   1.00 35.48  ? 344 VAL C HG22 1 
ATOM   5845  H HG23 . VAL B 1 7   ? -32.633 -23.094 6.091   1.00 35.48  ? 344 VAL C HG23 1 
ATOM   5846  N N    . ALA B 1 8   ? -28.197 -21.066 7.445   1.00 23.36  ? 345 ALA C N    1 
ATOM   5847  C CA   . ALA B 1 8   ? -27.006 -20.290 7.111   1.00 28.87  ? 345 ALA C CA   1 
ATOM   5848  C C    . ALA B 1 8   ? -25.734 -21.131 7.174   1.00 31.60  ? 345 ALA C C    1 
ATOM   5849  O O    . ALA B 1 8   ? -25.592 -22.023 8.021   1.00 28.73  ? 345 ALA C O    1 
ATOM   5850  C CB   . ALA B 1 8   ? -26.883 -19.074 8.022   1.00 25.29  ? 345 ALA C CB   1 
ATOM   5851  H H    . ALA B 1 8   ? -28.106 -21.597 8.115   1.00 28.04  ? 345 ALA C H    1 
ATOM   5852  H HA   . ALA B 1 8   ? -27.096 -19.962 6.192   1.00 34.64  ? 345 ALA C HA   1 
ATOM   5853  H HB1  . ALA B 1 8   ? -26.094 -18.582 7.782   1.00 30.34  ? 345 ALA C HB1  1 
ATOM   5854  H HB2  . ALA B 1 8   ? -27.660 -18.521 7.910   1.00 30.34  ? 345 ALA C HB2  1 
ATOM   5855  H HB3  . ALA B 1 8   ? -26.820 -19.371 8.932   1.00 30.34  ? 345 ALA C HB3  1 
ATOM   5856  N N    . LEU B 1 9   ? -24.816 -20.841 6.261   1.00 21.24  ? 346 LEU C N    1 
ATOM   5857  C CA   . LEU B 1 9   ? -23.490 -21.449 6.265   1.00 27.26  ? 346 LEU C CA   1 
ATOM   5858  C C    . LEU B 1 9   ? -22.514 -20.306 6.433   1.00 23.68  ? 346 LEU C C    1 
ATOM   5859  O O    . LEU B 1 9   ? -22.532 -19.370 5.635   1.00 21.58  ? 346 LEU C O    1 
ATOM   5860  C CB   . LEU B 1 9   ? -23.224 -22.185 4.939   1.00 20.03  ? 346 LEU C CB   1 
ATOM   5861  C CG   . LEU B 1 9   ? -21.785 -22.687 4.739   1.00 23.92  ? 346 LEU C CG   1 
ATOM   5862  C CD1  . LEU B 1 9   ? -21.410 -23.702 5.821   1.00 26.50  ? 346 LEU C CD1  1 
ATOM   5863  C CD2  . LEU B 1 9   ? -21.612 -23.304 3.360   1.00 21.80  ? 346 LEU C CD2  1 
ATOM   5864  H H    . LEU B 1 9   ? -24.939 -20.285 5.617   1.00 25.49  ? 346 LEU C H    1 
ATOM   5865  H HA   . LEU B 1 9   ? -23.398 -22.074 7.014   1.00 32.71  ? 346 LEU C HA   1 
ATOM   5866  H HB2  . LEU B 1 9   ? -23.810 -22.956 4.894   1.00 24.03  ? 346 LEU C HB2  1 
ATOM   5867  H HB3  . LEU B 1 9   ? -23.426 -21.581 4.207   1.00 24.03  ? 346 LEU C HB3  1 
ATOM   5868  H HG   . LEU B 1 9   ? -21.176 -21.936 4.809   1.00 28.70  ? 346 LEU C HG   1 
ATOM   5869  H HD11 . LEU B 1 9   ? -20.509 -23.999 5.672   1.00 31.80  ? 346 LEU C HD11 1 
ATOM   5870  H HD12 . LEU B 1 9   ? -21.479 -23.282 6.681   1.00 31.80  ? 346 LEU C HD12 1 
ATOM   5871  H HD13 . LEU B 1 9   ? -22.013 -24.448 5.771   1.00 31.80  ? 346 LEU C HD13 1 
ATOM   5872  H HD21 . LEU B 1 9   ? -20.706 -23.607 3.266   1.00 26.16  ? 346 LEU C HD21 1 
ATOM   5873  H HD22 . LEU B 1 9   ? -22.217 -24.044 3.272   1.00 26.16  ? 346 LEU C HD22 1 
ATOM   5874  H HD23 . LEU B 1 9   ? -21.807 -22.640 2.695   1.00 26.16  ? 346 LEU C HD23 1 
ATOM   5875  N N    . LEU B 1 10  ? -21.698 -20.366 7.484   1.00 18.75  ? 347 LEU C N    1 
ATOM   5876  C CA   . LEU B 1 10  ? -20.666 -19.369 7.739   1.00 22.26  ? 347 LEU C CA   1 
ATOM   5877  C C    . LEU B 1 10  ? -19.306 -20.047 7.626   1.00 23.61  ? 347 LEU C C    1 
ATOM   5878  O O    . LEU B 1 10  ? -19.059 -21.065 8.280   1.00 25.75  ? 347 LEU C O    1 
ATOM   5879  C CB   . LEU B 1 10  ? -20.802 -18.783 9.149   1.00 22.60  ? 347 LEU C CB   1 
ATOM   5880  C CG   . LEU B 1 10  ? -21.813 -17.655 9.374   1.00 28.29  ? 347 LEU C CG   1 
ATOM   5881  C CD1  . LEU B 1 10  ? -23.150 -17.945 8.699   1.00 22.58  ? 347 LEU C CD1  1 
ATOM   5882  C CD2  . LEU B 1 10  ? -21.997 -17.421 10.871  1.00 32.52  ? 347 LEU C CD2  1 
ATOM   5883  H H    . LEU B 1 10  ? -21.725 -20.991 8.075   1.00 22.50  ? 347 LEU C H    1 
ATOM   5884  H HA   . LEU B 1 10  ? -20.722 -18.646 7.081   1.00 26.72  ? 347 LEU C HA   1 
ATOM   5885  H HB2  . LEU B 1 10  ? -21.049 -19.505 9.748   1.00 27.12  ? 347 LEU C HB2  1 
ATOM   5886  H HB3  . LEU B 1 10  ? -19.934 -18.438 9.412   1.00 27.12  ? 347 LEU C HB3  1 
ATOM   5887  H HG   . LEU B 1 10  ? -21.459 -16.838 8.989   1.00 33.95  ? 347 LEU C HG   1 
ATOM   5888  H HD11 . LEU B 1 10  ? -23.750 -17.214 8.866   1.00 27.10  ? 347 LEU C HD11 1 
ATOM   5889  H HD12 . LEU B 1 10  ? -23.008 -18.043 7.755   1.00 27.10  ? 347 LEU C HD12 1 
ATOM   5890  H HD13 . LEU B 1 10  ? -23.513 -18.756 9.062   1.00 27.10  ? 347 LEU C HD13 1 
ATOM   5891  H HD21 . LEU B 1 10  ? -22.632 -16.713 11.001  1.00 39.02  ? 347 LEU C HD21 1 
ATOM   5892  H HD22 . LEU B 1 10  ? -22.321 -18.230 11.275  1.00 39.02  ? 347 LEU C HD22 1 
ATOM   5893  H HD23 . LEU B 1 10  ? -21.152 -17.178 11.256  1.00 39.02  ? 347 LEU C HD23 1 
ATOM   5894  N N    . ILE B 1 11  ? -18.433 -19.486 6.793   1.00 17.39  ? 348 ILE C N    1 
ATOM   5895  C CA   . ILE B 1 11  ? -17.075 -19.984 6.651   1.00 20.32  ? 348 ILE C CA   1 
ATOM   5896  C C    . ILE B 1 11  ? -16.080 -18.879 6.946   1.00 24.62  ? 348 ILE C C    1 
ATOM   5897  O O    . ILE B 1 11  ? -16.202 -17.769 6.426   1.00 25.75  ? 348 ILE C O    1 
ATOM   5898  C CB   . ILE B 1 11  ? -16.842 -20.533 5.220   1.00 27.19  ? 348 ILE C CB   1 
ATOM   5899  C CG1  . ILE B 1 11  ? -17.628 -21.834 5.030   1.00 21.73  ? 348 ILE C CG1  1 
ATOM   5900  C CG2  . ILE B 1 11  ? -15.360 -20.752 4.967   1.00 20.94  ? 348 ILE C CG2  1 
ATOM   5901  C CD1  . ILE B 1 11  ? -17.879 -22.192 3.567   1.00 22.45  ? 348 ILE C CD1  1 
ATOM   5902  H H    . ILE B 1 11  ? -18.608 -18.808 6.295   1.00 20.87  ? 348 ILE C H    1 
ATOM   5903  H HA   . ILE B 1 11  ? -16.927 -20.712 7.289   1.00 24.39  ? 348 ILE C HA   1 
ATOM   5904  H HB   . ILE B 1 11  ? -17.169 -19.879 4.582   1.00 32.63  ? 348 ILE C HB   1 
ATOM   5905  H HG12 . ILE B 1 11  ? -17.130 -22.562 5.432   1.00 26.08  ? 348 ILE C HG12 1 
ATOM   5906  H HG13 . ILE B 1 11  ? -18.490 -21.745 5.465   1.00 26.08  ? 348 ILE C HG13 1 
ATOM   5907  H HG21 . ILE B 1 11  ? -15.242 -21.091 4.076   1.00 25.12  ? 348 ILE C HG21 1 
ATOM   5908  H HG22 . ILE B 1 11  ? -14.900 -19.915 5.062   1.00 25.12  ? 348 ILE C HG22 1 
ATOM   5909  H HG23 . ILE B 1 11  ? -15.025 -21.385 5.606   1.00 25.12  ? 348 ILE C HG23 1 
ATOM   5910  H HD11 . ILE B 1 11  ? -18.374 -23.013 3.527   1.00 26.94  ? 348 ILE C HD11 1 
ATOM   5911  H HD12 . ILE B 1 11  ? -18.382 -21.486 3.155   1.00 26.94  ? 348 ILE C HD12 1 
ATOM   5912  H HD13 . ILE B 1 11  ? -17.035 -22.295 3.122   1.00 26.94  ? 348 ILE C HD13 1 
ATOM   5913  N N    . GLY B 1 12  ? -15.106 -19.176 7.803   1.00 18.95  ? 349 GLY C N    1 
ATOM   5914  C CA   . GLY B 1 12  ? -14.032 -18.252 8.104   1.00 19.38  ? 349 GLY C CA   1 
ATOM   5915  C C    . GLY B 1 12  ? -12.676 -18.886 7.866   1.00 28.37  ? 349 GLY C C    1 
ATOM   5916  O O    . GLY B 1 12  ? -12.304 -19.838 8.548   1.00 26.24  ? 349 GLY C O    1 
ATOM   5917  H H    . GLY B 1 12  ? -15.049 -19.922 8.228   1.00 22.74  ? 349 GLY C H    1 
ATOM   5918  H HA2  . GLY B 1 12  ? -14.111 -17.465 7.541   1.00 23.25  ? 349 GLY C HA2  1 
ATOM   5919  H HA3  . GLY B 1 12  ? -14.088 -17.976 9.032   1.00 23.25  ? 349 GLY C HA3  1 
ATOM   5920  N N    . ASN B 1 13  ? -11.934 -18.363 6.895   1.00 21.43  ? 350 ASN C N    1 
ATOM   5921  C CA   . ASN B 1 13  ? -10.614 -18.893 6.572   1.00 28.12  ? 350 ASN C CA   1 
ATOM   5922  C C    . ASN B 1 13  ? -9.522  -17.938 7.037   1.00 33.56  ? 350 ASN C C    1 
ATOM   5923  O O    . ASN B 1 13  ? -9.537  -16.761 6.698   1.00 28.78  ? 350 ASN C O    1 
ATOM   5924  C CB   . ASN B 1 13  ? -10.488 -19.143 5.070   1.00 24.21  ? 350 ASN C CB   1 
ATOM   5925  C CG   . ASN B 1 13  ? -11.288 -20.337 4.606   1.00 28.13  ? 350 ASN C CG   1 
ATOM   5926  O OD1  . ASN B 1 13  ? -11.642 -21.220 5.402   1.00 23.76  ? 350 ASN C OD1  1 
ATOM   5927  N ND2  . ASN B 1 13  ? -11.579 -20.383 3.303   1.00 23.39  ? 350 ASN C ND2  1 
ATOM   5928  H H    . ASN B 1 13  ? -12.173 -17.697 6.406   1.00 25.71  ? 350 ASN C H    1 
ATOM   5929  H HA   . ASN B 1 13  ? -10.489 -19.748 7.035   1.00 33.74  ? 350 ASN C HA   1 
ATOM   5930  H HB2  . ASN B 1 13  ? -10.810 -18.362 4.592   1.00 29.05  ? 350 ASN C HB2  1 
ATOM   5931  H HB3  . ASN B 1 13  ? -9.556  -19.303 4.853   1.00 29.05  ? 350 ASN C HB3  1 
ATOM   5932  H HD21 . ASN B 1 13  ? -11.314 -19.754 2.781   1.00 28.07  ? 350 ASN C HD21 1 
ATOM   5933  H HD22 . ASN B 1 13  ? -12.033 -21.042 2.987   1.00 28.07  ? 350 ASN C HD22 1 
ATOM   5934  N N    . MET B 1 14  ? -8.575  -18.446 7.820   1.00 29.93  ? 351 MET C N    1 
ATOM   5935  C CA   . MET B 1 14  ? -7.508  -17.605 8.356   1.00 24.76  ? 351 MET C CA   1 
ATOM   5936  C C    . MET B 1 14  ? -6.145  -18.258 8.192   1.00 27.12  ? 351 MET C C    1 
ATOM   5937  O O    . MET B 1 14  ? -5.161  -17.604 7.898   1.00 24.05  ? 351 MET C O    1 
ATOM   5938  C CB   . MET B 1 14  ? -7.697  -17.399 9.850   1.00 39.42  ? 351 MET C CB   1 
ATOM   5939  C CG   . MET B 1 14  ? -9.095  -17.163 10.312  1.00 54.33  ? 351 MET C CG   1 
ATOM   5940  S SD   . MET B 1 14  ? -9.194  -17.566 12.063  1.00 36.82  ? 351 MET C SD   1 
ATOM   5941  C CE   . MET B 1 14  ? -7.730  -16.763 12.700  1.00 66.76  ? 351 MET C CE   1 
ATOM   5942  H H    . MET B 1 14  ? -8.527  -19.272 8.055   1.00 35.91  ? 351 MET C H    1 
ATOM   5943  H HA   . MET B 1 14  ? -7.516  -16.732 7.911   1.00 29.71  ? 351 MET C HA   1 
ATOM   5944  H HB2  . MET B 1 14  ? -7.371  -18.189 10.310  1.00 47.31  ? 351 MET C HB2  1 
ATOM   5945  H HB3  . MET B 1 14  ? -7.171  -16.630 10.121  1.00 47.31  ? 351 MET C HB3  1 
ATOM   5946  H HG2  . MET B 1 14  ? -9.329  -16.229 10.192  1.00 65.20  ? 351 MET C HG2  1 
ATOM   5947  H HG3  . MET B 1 14  ? -9.705  -17.737 9.823   1.00 65.20  ? 351 MET C HG3  1 
ATOM   5948  H HE1  . MET B 1 14  ? -7.678  -16.914 13.646  1.00 80.12  ? 351 MET C HE1  1 
ATOM   5949  H HE2  . MET B 1 14  ? -6.958  -17.132 12.265  1.00 80.12  ? 351 MET C HE2  1 
ATOM   5950  H HE3  . MET B 1 14  ? -7.788  -15.822 12.521  1.00 80.12  ? 351 MET C HE3  1 
ATOM   5951  N N    . ASN B 1 15  ? -6.085  -19.557 8.442   1.00 28.30  ? 352 ASN C N    1 
ATOM   5952  C CA   . ASN B 1 15  ? -4.807  -20.247 8.461   1.00 28.03  ? 352 ASN C CA   1 
ATOM   5953  C C    . ASN B 1 15  ? -4.398  -20.743 7.068   1.00 28.11  ? 352 ASN C C    1 
ATOM   5954  O O    . ASN B 1 15  ? -4.357  -21.948 6.778   1.00 26.96  ? 352 ASN C O    1 
ATOM   5955  C CB   . ASN B 1 15  ? -4.859  -21.337 9.545   1.00 26.16  ? 352 ASN C CB   1 
ATOM   5956  C CG   . ASN B 1 15  ? -4.869  -20.728 10.947  1.00 48.34  ? 352 ASN C CG   1 
ATOM   5957  O OD1  . ASN B 1 15  ? -4.061  -19.843 11.250  1.00 44.81  ? 352 ASN C OD1  1 
ATOM   5958  N ND2  . ASN B 1 15  ? -5.819  -21.145 11.780  1.00 46.40  ? 352 ASN C ND2  1 
ATOM   5959  H H    . ASN B 1 15  ? -6.764  -20.059 8.604   1.00 33.96  ? 352 ASN C H    1 
ATOM   5960  H HA   . ASN B 1 15  ? -4.123  -19.604 8.741   1.00 33.63  ? 352 ASN C HA   1 
ATOM   5961  H HB2  . ASN B 1 15  ? -5.668  -21.861 9.435   1.00 31.39  ? 352 ASN C HB2  1 
ATOM   5962  H HB3  . ASN B 1 15  ? -4.077  -21.906 9.466   1.00 31.39  ? 352 ASN C HB3  1 
ATOM   5963  H HD21 . ASN B 1 15  ? -6.391  -21.732 11.521  1.00 55.68  ? 352 ASN C HD21 1 
ATOM   5964  H HD22 . ASN B 1 15  ? -5.860  -20.827 12.578  1.00 55.68  ? 352 ASN C HD22 1 
ATOM   5965  N N    . TYR B 1 16  ? -4.098  -19.773 6.199   1.00 29.41  ? 353 TYR C N    1 
ATOM   5966  C CA   . TYR B 1 16  ? -3.694  -20.043 4.822   1.00 28.16  ? 353 TYR C CA   1 
ATOM   5967  C C    . TYR B 1 16  ? -2.275  -20.593 4.746   1.00 35.97  ? 353 TYR C C    1 
ATOM   5968  O O    . TYR B 1 16  ? -1.373  -20.062 5.382   1.00 33.60  ? 353 TYR C O    1 
ATOM   5969  C CB   . TYR B 1 16  ? -3.785  -18.760 3.998   1.00 30.55  ? 353 TYR C CB   1 
ATOM   5970  C CG   . TYR B 1 16  ? -5.204  -18.410 3.633   1.00 29.52  ? 353 TYR C CG   1 
ATOM   5971  C CD1  . TYR B 1 16  ? -6.001  -17.660 4.493   1.00 26.57  ? 353 TYR C CD1  1 
ATOM   5972  C CD2  . TYR B 1 16  ? -5.752  -18.843 2.431   1.00 33.77  ? 353 TYR C CD2  1 
ATOM   5973  C CE1  . TYR B 1 16  ? -7.319  -17.337 4.153   1.00 25.63  ? 353 TYR C CE1  1 
ATOM   5974  C CE2  . TYR B 1 16  ? -7.057  -18.535 2.083   1.00 28.60  ? 353 TYR C CE2  1 
ATOM   5975  C CZ   . TYR B 1 16  ? -7.837  -17.785 2.950   1.00 26.83  ? 353 TYR C CZ   1 
ATOM   5976  O OH   . TYR B 1 16  ? -9.135  -17.487 2.596   1.00 23.17  ? 353 TYR C OH   1 
ATOM   5977  H H    . TYR B 1 16  ? -4.124  -18.935 6.390   1.00 35.29  ? 353 TYR C H    1 
ATOM   5978  H HA   . TYR B 1 16  ? -4.302  -20.705 4.430   1.00 33.79  ? 353 TYR C HA   1 
ATOM   5979  H HB2  . TYR B 1 16  ? -3.417  -18.026 4.514   1.00 36.66  ? 353 TYR C HB2  1 
ATOM   5980  H HB3  . TYR B 1 16  ? -3.282  -18.874 3.177   1.00 36.66  ? 353 TYR C HB3  1 
ATOM   5981  H HD1  . TYR B 1 16  ? -5.650  -17.362 5.301   1.00 31.89  ? 353 TYR C HD1  1 
ATOM   5982  H HD2  . TYR B 1 16  ? -5.232  -19.348 1.849   1.00 40.52  ? 353 TYR C HD2  1 
ATOM   5983  H HE1  . TYR B 1 16  ? -7.845  -16.836 4.734   1.00 30.76  ? 353 TYR C HE1  1 
ATOM   5984  H HE2  . TYR B 1 16  ? -7.409  -18.833 1.275   1.00 34.32  ? 353 TYR C HE2  1 
ATOM   5985  H HH   . TYR B 1 16  ? -9.562  -18.179 2.492   1.00 27.81  ? 353 TYR C HH   1 
ATOM   5986  N N    . ARG B 1 17  ? -2.081  -21.639 3.947   1.00 26.92  ? 354 ARG C N    1 
ATOM   5987  C CA   . ARG B 1 17  ? -0.789  -22.310 3.868   1.00 34.38  ? 354 ARG C CA   1 
ATOM   5988  C C    . ARG B 1 17  ? 0.237   -21.480 3.108   1.00 39.13  ? 354 ARG C C    1 
ATOM   5989  O O    . ARG B 1 17  ? 1.394   -21.394 3.519   1.00 35.36  ? 354 ARG C O    1 
ATOM   5990  C CB   . ARG B 1 17  ? -0.956  -23.693 3.232   1.00 51.29  ? 354 ARG C CB   1 
ATOM   5991  C CG   . ARG B 1 17  ? -1.827  -24.627 4.071   1.00 58.24  ? 354 ARG C CG   1 
ATOM   5992  C CD   . ARG B 1 17  ? -2.215  -25.908 3.345   1.00 76.21  ? 354 ARG C CD   1 
ATOM   5993  N NE   . ARG B 1 17  ? -3.254  -26.637 4.077   1.00 85.07  ? 354 ARG C NE   1 
ATOM   5994  C CZ   . ARG B 1 17  ? -3.773  -27.802 3.697   1.00 92.44  ? 354 ARG C CZ   1 
ATOM   5995  N NH1  . ARG B 1 17  ? -3.355  -28.394 2.584   1.00 99.52  ? 354 ARG C NH1  1 
ATOM   5996  N NH2  . ARG B 1 17  ? -4.714  -28.379 4.435   1.00 86.10  ? 354 ARG C NH2  1 
ATOM   5997  H H    . ARG B 1 17  ? -2.685  -21.979 3.438   1.00 32.30  ? 354 ARG C H    1 
ATOM   5998  H HA   . ARG B 1 17  ? -0.448  -22.441 4.777   1.00 41.26  ? 354 ARG C HA   1 
ATOM   5999  H HB2  . ARG B 1 17  ? -1.375  -23.593 2.363   1.00 61.55  ? 354 ARG C HB2  1 
ATOM   6000  H HB3  . ARG B 1 17  ? -0.083  -24.104 3.135   1.00 61.55  ? 354 ARG C HB3  1 
ATOM   6001  H HG2  . ARG B 1 17  ? -1.339  -24.876 4.872   1.00 69.89  ? 354 ARG C HG2  1 
ATOM   6002  H HG3  . ARG B 1 17  ? -2.643  -24.163 4.313   1.00 69.89  ? 354 ARG C HG3  1 
ATOM   6003  H HD2  . ARG B 1 17  ? -2.560  -25.686 2.465   1.00 91.45  ? 354 ARG C HD2  1 
ATOM   6004  H HD3  . ARG B 1 17  ? -1.437  -26.482 3.266   1.00 91.45  ? 354 ARG C HD3  1 
ATOM   6005  H HE   . ARG B 1 17  ? -3.549  -26.286 4.805   1.00 102.08 ? 354 ARG C HE   1 
ATOM   6006  H HH11 . ARG B 1 17  ? -2.746  -28.024 2.102   1.00 119.42 ? 354 ARG C HH11 1 
ATOM   6007  H HH12 . ARG B 1 17  ? -3.695  -29.147 2.344   1.00 119.42 ? 354 ARG C HH12 1 
ATOM   6008  H HH21 . ARG B 1 17  ? -4.987  -27.999 5.157   1.00 103.32 ? 354 ARG C HH21 1 
ATOM   6009  H HH22 . ARG B 1 17  ? -5.050  -29.132 4.192   1.00 103.32 ? 354 ARG C HH22 1 
ATOM   6010  N N    . GLU B 1 18  ? -0.205  -20.830 2.030   1.00 35.72  ? 355 GLU C N    1 
ATOM   6011  C CA   . GLU B 1 18  ? 0.703   -20.157 1.102   1.00 36.11  ? 355 GLU C CA   1 
ATOM   6012  C C    . GLU B 1 18  ? 0.363   -18.685 0.896   1.00 38.45  ? 355 GLU C C    1 
ATOM   6013  O O    . GLU B 1 18  ? 0.811   -18.070 -0.070  1.00 39.13  ? 355 GLU C O    1 
ATOM   6014  C CB   . GLU B 1 18  ? 0.668   -20.872 -0.245  1.00 47.39  ? 355 GLU C CB   1 
ATOM   6015  C CG   . GLU B 1 18  ? 1.075   -22.328 -0.157  1.00 43.12  ? 355 GLU C CG   1 
ATOM   6016  C CD   . GLU B 1 18  ? 2.506   -22.507 0.328   1.00 63.94  ? 355 GLU C CD   1 
ATOM   6017  O OE1  . GLU B 1 18  ? 3.261   -21.509 0.376   1.00 60.61  ? 355 GLU C OE1  1 
ATOM   6018  O OE2  . GLU B 1 18  ? 2.875   -23.653 0.661   1.00 73.41  ? 355 GLU C OE2  1 
ATOM   6019  H H    . GLU B 1 18  ? -1.034  -20.764 1.813   1.00 42.86  ? 355 GLU C H    1 
ATOM   6020  H HA   . GLU B 1 18  ? 1.616   -20.212 1.452   1.00 43.33  ? 355 GLU C HA   1 
ATOM   6021  H HB2  . GLU B 1 18  ? -0.234  -20.835 -0.598  1.00 56.87  ? 355 GLU C HB2  1 
ATOM   6022  H HB3  . GLU B 1 18  ? 1.280   -20.427 -0.853  1.00 56.87  ? 355 GLU C HB3  1 
ATOM   6023  H HG2  . GLU B 1 18  ? 0.488   -22.784 0.465   1.00 51.74  ? 355 GLU C HG2  1 
ATOM   6024  H HG3  . GLU B 1 18  ? 1.004   -22.731 -1.037  1.00 51.74  ? 355 GLU C HG3  1 
ATOM   6025  N N    . HIS B 1 19  ? -0.428  -18.130 1.806   1.00 33.57  ? 356 HIS C N    1 
ATOM   6026  C CA   . HIS B 1 19  ? -0.866  -16.739 1.711   1.00 34.10  ? 356 HIS C CA   1 
ATOM   6027  C C    . HIS B 1 19  ? -0.880  -16.100 3.091   1.00 39.14  ? 356 HIS C C    1 
ATOM   6028  O O    . HIS B 1 19  ? -0.830  -16.802 4.103   1.00 36.86  ? 356 HIS C O    1 
ATOM   6029  C CB   . HIS B 1 19  ? -2.248  -16.679 1.061   1.00 31.33  ? 356 HIS C CB   1 
ATOM   6030  C CG   . HIS B 1 19  ? -2.258  -17.201 -0.342  1.00 36.84  ? 356 HIS C CG   1 
ATOM   6031  N ND1  . HIS B 1 19  ? -2.824  -18.409 -0.684  1.00 44.29  ? 356 HIS C ND1  1 
ATOM   6032  C CD2  . HIS B 1 19  ? -1.720  -16.702 -1.479  1.00 34.73  ? 356 HIS C CD2  1 
ATOM   6033  C CE1  . HIS B 1 19  ? -2.658  -18.621 -1.977  1.00 43.15  ? 356 HIS C CE1  1 
ATOM   6034  N NE2  . HIS B 1 19  ? -1.992  -17.599 -2.483  1.00 49.04  ? 356 HIS C NE2  1 
ATOM   6035  H H    . HIS B 1 19  ? -0.729  -18.542 2.498   1.00 40.29  ? 356 HIS C H    1 
ATOM   6036  H HA   . HIS B 1 19  ? -0.239  -16.240 1.147   1.00 40.92  ? 356 HIS C HA   1 
ATOM   6037  H HB2  . HIS B 1 19  ? -2.865  -17.215 1.583   1.00 37.60  ? 356 HIS C HB2  1 
ATOM   6038  H HB3  . HIS B 1 19  ? -2.546  -15.757 1.039   1.00 37.60  ? 356 HIS C HB3  1 
ATOM   6039  H HD2  . HIS B 1 19  ? -1.265  -15.896 -1.567  1.00 41.68  ? 356 HIS C HD2  1 
ATOM   6040  H HE1  . HIS B 1 19  ? -2.961  -19.362 -2.450  1.00 51.78  ? 356 HIS C HE1  1 
ATOM   6041  N N    . PRO B 1 20  ? -0.915  -14.761 3.144   1.00 40.97  ? 357 PRO C N    1 
ATOM   6042  C CA   . PRO B 1 20  ? -0.932  -14.099 4.453   1.00 37.25  ? 357 PRO C CA   1 
ATOM   6043  C C    . PRO B 1 20  ? -2.070  -14.623 5.316   1.00 37.74  ? 357 PRO C C    1 
ATOM   6044  O O    . PRO B 1 20  ? -3.190  -14.775 4.824   1.00 30.23  ? 357 PRO C O    1 
ATOM   6045  C CB   . PRO B 1 20  ? -1.156  -12.626 4.102   1.00 41.36  ? 357 PRO C CB   1 
ATOM   6046  C CG   . PRO B 1 20  ? -0.608  -12.486 2.716   1.00 49.26  ? 357 PRO C CG   1 
ATOM   6047  C CD   . PRO B 1 20  ? -0.876  -13.799 2.028   1.00 41.76  ? 357 PRO C CD   1 
ATOM   6048  H HA   . PRO B 1 20  ? -0.076  -14.210 4.917   1.00 44.70  ? 357 PRO C HA   1 
ATOM   6049  H HB2  . PRO B 1 20  ? -2.104  -12.424 4.121   1.00 49.63  ? 357 PRO C HB2  1 
ATOM   6050  H HB3  . PRO B 1 20  ? -0.670  -12.062 4.724   1.00 49.63  ? 357 PRO C HB3  1 
ATOM   6051  H HG2  . PRO B 1 20  ? -1.065  -11.763 2.258   1.00 59.11  ? 357 PRO C HG2  1 
ATOM   6052  H HG3  . PRO B 1 20  ? 0.345   -12.313 2.760   1.00 59.11  ? 357 PRO C HG3  1 
ATOM   6053  H HD2  . PRO B 1 20  ? -1.732  -13.774 1.572   1.00 50.12  ? 357 PRO C HD2  1 
ATOM   6054  H HD3  . PRO B 1 20  ? -0.153  -14.016 1.419   1.00 50.12  ? 357 PRO C HD3  1 
ATOM   6055  N N    . LYS B 1 21  ? -1.785  -14.911 6.583   1.00 31.92  ? 358 LYS C N    1 
ATOM   6056  C CA   . LYS B 1 21  ? -2.801  -15.457 7.465   1.00 41.16  ? 358 LYS C CA   1 
ATOM   6057  C C    . LYS B 1 21  ? -3.637  -14.335 8.061   1.00 38.65  ? 358 LYS C C    1 
ATOM   6058  O O    . LYS B 1 21  ? -3.168  -13.202 8.204   1.00 32.55  ? 358 LYS C O    1 
ATOM   6059  C CB   . LYS B 1 21  ? -2.165  -16.295 8.572   1.00 37.97  ? 358 LYS C CB   1 
ATOM   6060  C CG   . LYS B 1 21  ? -1.277  -17.424 8.057   1.00 37.41  ? 358 LYS C CG   1 
ATOM   6061  C CD   . LYS B 1 21  ? -0.915  -18.398 9.186   1.00 50.52  ? 358 LYS C CD   1 
ATOM   6062  C CE   . LYS B 1 21  ? 0.280   -19.269 8.828   1.00 58.12  ? 358 LYS C CE   1 
ATOM   6063  N NZ   . LYS B 1 21  ? 0.139   -19.925 7.501   1.00 48.55  ? 358 LYS C NZ   1 
ATOM   6064  H H    . LYS B 1 21  ? -1.016  -14.798 6.950   1.00 38.31  ? 358 LYS C H    1 
ATOM   6065  H HA   . LYS B 1 21  ? -3.396  -16.039 6.947   1.00 49.39  ? 358 LYS C HA   1 
ATOM   6066  H HB2  . LYS B 1 21  ? -1.617  -15.716 9.126   1.00 45.57  ? 358 LYS C HB2  1 
ATOM   6067  H HB3  . LYS B 1 21  ? -2.869  -16.692 9.108   1.00 45.57  ? 358 LYS C HB3  1 
ATOM   6068  H HG2  . LYS B 1 21  ? -1.750  -17.917 7.369   1.00 44.90  ? 358 LYS C HG2  1 
ATOM   6069  H HG3  . LYS B 1 21  ? -0.456  -17.051 7.701   1.00 44.90  ? 358 LYS C HG3  1 
ATOM   6070  H HD2  . LYS B 1 21  ? -0.693  -17.892 9.983   1.00 60.62  ? 358 LYS C HD2  1 
ATOM   6071  H HD3  . LYS B 1 21  ? -1.672  -18.979 9.359   1.00 60.62  ? 358 LYS C HD3  1 
ATOM   6072  H HE2  . LYS B 1 21  ? 1.078   -18.717 8.806   1.00 69.74  ? 358 LYS C HE2  1 
ATOM   6073  H HE3  . LYS B 1 21  ? 0.376   -19.964 9.498   1.00 69.74  ? 358 LYS C HE3  1 
ATOM   6074  H HZ1  . LYS B 1 21  ? 0.856   -20.424 7.330   1.00 58.27  ? 358 LYS C HZ1  1 
ATOM   6075  H HZ2  . LYS B 1 21  ? -0.583  -20.446 7.495   1.00 58.27  ? 358 LYS C HZ2  1 
ATOM   6076  H HZ3  . LYS B 1 21  ? 0.056   -19.309 6.864   1.00 58.27  ? 358 LYS C HZ3  1 
ATOM   6077  N N    . LEU B 1 22  ? -4.880  -14.665 8.394   1.00 32.66  ? 359 LEU C N    1 
ATOM   6078  C CA   . LEU B 1 22  ? -5.803  -13.722 9.008   1.00 36.94  ? 359 LEU C CA   1 
ATOM   6079  C C    . LEU B 1 22  ? -6.066  -14.119 10.455  1.00 43.63  ? 359 LEU C C    1 
ATOM   6080  O O    . LEU B 1 22  ? -5.723  -15.224 10.884  1.00 33.96  ? 359 LEU C O    1 
ATOM   6081  C CB   . LEU B 1 22  ? -7.119  -13.713 8.237   1.00 31.94  ? 359 LEU C CB   1 
ATOM   6082  C CG   . LEU B 1 22  ? -6.984  -13.304 6.775   1.00 31.58  ? 359 LEU C CG   1 
ATOM   6083  C CD1  . LEU B 1 22  ? -8.333  -13.447 6.060   1.00 27.36  ? 359 LEU C CD1  1 
ATOM   6084  C CD2  . LEU B 1 22  ? -6.470  -11.880 6.707   1.00 35.00  ? 359 LEU C CD2  1 
ATOM   6085  H H    . LEU B 1 22  ? -5.218  -15.447 8.271   1.00 39.20  ? 359 LEU C H    1 
ATOM   6086  H HA   . LEU B 1 22  ? -5.419  -12.821 8.990   1.00 44.33  ? 359 LEU C HA   1 
ATOM   6087  H HB2  . LEU B 1 22  ? -7.499  -14.605 8.260   1.00 38.33  ? 359 LEU C HB2  1 
ATOM   6088  H HB3  . LEU B 1 22  ? -7.725  -13.088 8.664   1.00 38.33  ? 359 LEU C HB3  1 
ATOM   6089  H HG   . LEU B 1 22  ? -6.341  -13.883 6.336   1.00 37.89  ? 359 LEU C HG   1 
ATOM   6090  H HD11 . LEU B 1 22  ? -8.229  -13.185 5.142   1.00 32.84  ? 359 LEU C HD11 1 
ATOM   6091  H HD12 . LEU B 1 22  ? -8.618  -14.362 6.110   1.00 32.84  ? 359 LEU C HD12 1 
ATOM   6092  H HD13 . LEU B 1 22  ? -8.976  -12.880 6.492   1.00 32.84  ? 359 LEU C HD13 1 
ATOM   6093  H HD21 . LEU B 1 22  ? -6.385  -11.623 5.786   1.00 42.00  ? 359 LEU C HD21 1 
ATOM   6094  H HD22 . LEU B 1 22  ? -7.093  -11.302 7.153   1.00 42.00  ? 359 LEU C HD22 1 
ATOM   6095  H HD23 . LEU B 1 22  ? -5.614  -11.836 7.140   1.00 42.00  ? 359 LEU C HD23 1 
ATOM   6096  N N    . LYS B 1 23  ? -6.699  -13.221 11.196  1.00 27.52  ? 360 LYS C N    1 
ATOM   6097  C CA   . LYS B 1 23  ? -6.926  -13.419 12.617  1.00 27.93  ? 360 LYS C CA   1 
ATOM   6098  C C    . LYS B 1 23  ? -8.401  -13.278 12.981  1.00 32.83  ? 360 LYS C C    1 
ATOM   6099  O O    . LYS B 1 23  ? -8.937  -14.084 13.736  1.00 27.79  ? 360 LYS C O    1 
ATOM   6100  C CB   . LYS B 1 23  ? -6.094  -12.408 13.408  1.00 32.90  ? 360 LYS C CB   1 
ATOM   6101  C CG   . LYS B 1 23  ? -4.606  -12.452 13.075  1.00 53.32  ? 360 LYS C CG   1 
ATOM   6102  C CD   . LYS B 1 23  ? -3.989  -13.800 13.424  1.00 72.75  ? 360 LYS C CD   1 
ATOM   6103  C CE   . LYS B 1 23  ? -4.033  -14.068 14.921  1.00 83.78  ? 360 LYS C CE   1 
ATOM   6104  N NZ   . LYS B 1 23  ? -3.329  -15.332 15.293  1.00 83.83  ? 360 LYS C NZ   1 
ATOM   6105  H H    . LYS B 1 23  ? -7.010  -12.478 10.894  1.00 33.03  ? 360 LYS C H    1 
ATOM   6106  H HA   . LYS B 1 23  ? -6.633  -14.320 12.867  1.00 33.51  ? 360 LYS C HA   1 
ATOM   6107  H HB2  . LYS B 1 23  ? -6.417  -11.514 13.211  1.00 39.47  ? 360 LYS C HB2  1 
ATOM   6108  H HB3  . LYS B 1 23  ? -6.193  -12.593 14.355  1.00 39.47  ? 360 LYS C HB3  1 
ATOM   6109  H HG2  . LYS B 1 23  ? -4.487  -12.301 12.124  1.00 63.98  ? 360 LYS C HG2  1 
ATOM   6110  H HG3  . LYS B 1 23  ? -4.145  -11.766 13.583  1.00 63.98  ? 360 LYS C HG3  1 
ATOM   6111  H HD2  . LYS B 1 23  ? -4.484  -14.503 12.975  1.00 87.30  ? 360 LYS C HD2  1 
ATOM   6112  H HD3  . LYS B 1 23  ? -3.062  -13.809 13.142  1.00 87.30  ? 360 LYS C HD3  1 
ATOM   6113  H HE2  . LYS B 1 23  ? -3.603  -13.335 15.388  1.00 100.54 ? 360 LYS C HE2  1 
ATOM   6114  H HE3  . LYS B 1 23  ? -4.958  -14.145 15.203  1.00 100.54 ? 360 LYS C HE3  1 
ATOM   6115  H HZ1  . LYS B 1 23  ? -3.374  -15.457 16.173  1.00 100.60 ? 360 LYS C HZ1  1 
ATOM   6116  H HZ2  . LYS B 1 23  ? -3.709  -16.024 14.883  1.00 100.60 ? 360 LYS C HZ2  1 
ATOM   6117  H HZ3  . LYS B 1 23  ? -2.474  -15.285 15.051  1.00 100.60 ? 360 LYS C HZ3  1 
ATOM   6118  N N    . ALA B 1 24  ? -9.063  -12.263 12.431  1.00 27.91  ? 361 ALA C N    1 
ATOM   6119  C CA   . ALA B 1 24  ? -10.416 -11.928 12.861  1.00 25.98  ? 361 ALA C CA   1 
ATOM   6120  C C    . ALA B 1 24  ? -11.551 -12.798 12.291  1.00 30.35  ? 361 ALA C C    1 
ATOM   6121  O O    . ALA B 1 24  ? -12.668 -12.723 12.787  1.00 27.95  ? 361 ALA C O    1 
ATOM   6122  C CB   . ALA B 1 24  ? -10.703 -10.453 12.574  1.00 33.30  ? 361 ALA C CB   1 
ATOM   6123  H H    . ALA B 1 24  ? -8.753  -11.756 11.810  1.00 33.49  ? 361 ALA C H    1 
ATOM   6124  H HA   . ALA B 1 24  ? -10.448 -12.035 13.835  1.00 31.18  ? 361 ALA C HA   1 
ATOM   6125  H HB1  . ALA B 1 24  ? -11.595 -10.247 12.862  1.00 39.96  ? 361 ALA C HB1  1 
ATOM   6126  H HB2  . ALA B 1 24  ? -10.070 -9.913  13.054  1.00 39.96  ? 361 ALA C HB2  1 
ATOM   6127  H HB3  . ALA B 1 24  ? -10.619 -10.296 11.631  1.00 39.96  ? 361 ALA C HB3  1 
ATOM   6128  N N    . PRO B 1 25  ? -11.293 -13.609 11.245  1.00 27.65  ? 362 PRO C N    1 
ATOM   6129  C CA   . PRO B 1 25  ? -12.449 -14.408 10.810  1.00 27.36  ? 362 PRO C CA   1 
ATOM   6130  C C    . PRO B 1 25  ? -12.979 -15.287 11.923  1.00 31.14  ? 362 PRO C C    1 
ATOM   6131  O O    . PRO B 1 25  ? -14.155 -15.623 11.924  1.00 25.01  ? 362 PRO C O    1 
ATOM   6132  C CB   . PRO B 1 25  ? -11.886 -15.261 9.668   1.00 23.23  ? 362 PRO C CB   1 
ATOM   6133  C CG   . PRO B 1 25  ? -10.776 -14.407 9.096   1.00 25.46  ? 362 PRO C CG   1 
ATOM   6134  C CD   . PRO B 1 25  ? -10.164 -13.706 10.301  1.00 27.42  ? 362 PRO C CD   1 
ATOM   6135  H HA   . PRO B 1 25  ? -13.164 -13.830 10.471  1.00 32.84  ? 362 PRO C HA   1 
ATOM   6136  H HB2  . PRO B 1 25  ? -11.537 -16.095 10.019  1.00 27.87  ? 362 PRO C HB2  1 
ATOM   6137  H HB3  . PRO B 1 25  ? -12.576 -15.424 9.005   1.00 27.87  ? 362 PRO C HB3  1 
ATOM   6138  H HG2  . PRO B 1 25  ? -10.120 -14.971 8.658   1.00 30.55  ? 362 PRO C HG2  1 
ATOM   6139  H HG3  . PRO B 1 25  ? -11.146 -13.761 8.474   1.00 30.55  ? 362 PRO C HG3  1 
ATOM   6140  H HD2  . PRO B 1 25  ? -9.451  -14.243 10.680  1.00 32.90  ? 362 PRO C HD2  1 
ATOM   6141  H HD3  . PRO B 1 25  ? -9.852  -12.821 10.055  1.00 32.90  ? 362 PRO C HD3  1 
ATOM   6142  N N    . LEU B 1 26  ? -12.117 -15.647 12.864  1.00 25.31  ? 363 LEU C N    1 
ATOM   6143  C CA   . LEU B 1 26  ? -12.524 -16.524 13.957  1.00 28.46  ? 363 LEU C CA   1 
ATOM   6144  C C    . LEU B 1 26  ? -13.645 -15.854 14.754  1.00 29.80  ? 363 LEU C C    1 
ATOM   6145  O O    . LEU B 1 26  ? -14.735 -16.403 14.898  1.00 29.62  ? 363 LEU C O    1 
ATOM   6146  C CB   . LEU B 1 26  ? -11.329 -16.849 14.861  1.00 29.09  ? 363 LEU C CB   1 
ATOM   6147  C CG   . LEU B 1 26  ? -11.536 -18.042 15.814  1.00 40.25  ? 363 LEU C CG   1 
ATOM   6148  C CD1  . LEU B 1 26  ? -10.211 -18.529 16.393  1.00 39.39  ? 363 LEU C CD1  1 
ATOM   6149  C CD2  . LEU B 1 26  ? -12.506 -17.695 16.930  1.00 40.13  ? 363 LEU C CD2  1 
ATOM   6150  H H    . LEU B 1 26  ? -11.294 -15.400 12.895  1.00 30.38  ? 363 LEU C H    1 
ATOM   6151  H HA   . LEU B 1 26  ? -12.869 -17.364 13.588  1.00 34.15  ? 363 LEU C HA   1 
ATOM   6152  H HB2  . LEU B 1 26  ? -10.564 -17.053 14.300  1.00 34.90  ? 363 LEU C HB2  1 
ATOM   6153  H HB3  . LEU B 1 26  ? -11.133 -16.071 15.406  1.00 34.90  ? 363 LEU C HB3  1 
ATOM   6154  H HG   . LEU B 1 26  ? -11.921 -18.776 15.309  1.00 48.31  ? 363 LEU C HG   1 
ATOM   6155  H HD11 . LEU B 1 26  ? -10.381 -19.270 16.980  1.00 47.27  ? 363 LEU C HD11 1 
ATOM   6156  H HD12 . LEU B 1 26  ? -9.638  -18.805 15.674  1.00 47.27  ? 363 LEU C HD12 1 
ATOM   6157  H HD13 . LEU B 1 26  ? -9.802  -17.812 16.882  1.00 47.27  ? 363 LEU C HD13 1 
ATOM   6158  H HD21 . LEU B 1 26  ? -12.611 -18.459 17.502  1.00 48.16  ? 363 LEU C HD21 1 
ATOM   6159  H HD22 . LEU B 1 26  ? -12.154 -16.956 17.432  1.00 48.16  ? 363 LEU C HD22 1 
ATOM   6160  H HD23 . LEU B 1 26  ? -13.353 -17.456 16.545  1.00 48.16  ? 363 LEU C HD23 1 
ATOM   6161  N N    . VAL B 1 27  ? -13.387 -14.652 15.248  1.00 27.16  ? 364 VAL C N    1 
ATOM   6162  C CA   . VAL B 1 27  ? -14.366 -13.962 16.086  1.00 28.02  ? 364 VAL C CA   1 
ATOM   6163  C C    . VAL B 1 27  ? -15.554 -13.452 15.257  1.00 27.14  ? 364 VAL C C    1 
ATOM   6164  O O    . VAL B 1 27  ? -16.683 -13.386 15.751  1.00 24.88  ? 364 VAL C O    1 
ATOM   6165  C CB   . VAL B 1 27  ? -13.715 -12.816 16.879  1.00 43.36  ? 364 VAL C CB   1 
ATOM   6166  C CG1  . VAL B 1 27  ? -13.137 -11.779 15.940  1.00 35.06  ? 364 VAL C CG1  1 
ATOM   6167  C CG2  . VAL B 1 27  ? -14.724 -12.188 17.835  1.00 56.69  ? 364 VAL C CG2  1 
ATOM   6168  H H    . VAL B 1 27  ? -12.659 -14.213 15.116  1.00 32.59  ? 364 VAL C H    1 
ATOM   6169  H HA   . VAL B 1 27  ? -14.720 -14.604 16.737  1.00 33.63  ? 364 VAL C HA   1 
ATOM   6170  H HB   . VAL B 1 27  ? -12.980 -13.180 17.415  1.00 52.03  ? 364 VAL C HB   1 
ATOM   6171  H HG11 . VAL B 1 27  ? -12.738 -11.076 16.459  1.00 42.08  ? 364 VAL C HG11 1 
ATOM   6172  H HG12 . VAL B 1 27  ? -12.472 -12.195 15.386  1.00 42.08  ? 364 VAL C HG12 1 
ATOM   6173  H HG13 . VAL B 1 27  ? -13.842 -11.423 15.395  1.00 42.08  ? 364 VAL C HG13 1 
ATOM   6174  H HG21 . VAL B 1 27  ? -14.295 -11.477 18.318  1.00 68.03  ? 364 VAL C HG21 1 
ATOM   6175  H HG22 . VAL B 1 27  ? -15.461 -11.841 17.327  1.00 68.03  ? 364 VAL C HG22 1 
ATOM   6176  H HG23 . VAL B 1 27  ? -15.034 -12.859 18.447  1.00 68.03  ? 364 VAL C HG23 1 
ATOM   6177  N N    . ASP B 1 28  ? -15.308 -13.131 13.988  1.00 25.91  ? 365 ASP C N    1 
ATOM   6178  C CA   . ASP B 1 28  ? -16.385 -12.683 13.093  1.00 27.60  ? 365 ASP C CA   1 
ATOM   6179  C C    . ASP B 1 28  ? -17.415 -13.805 12.897  1.00 26.47  ? 365 ASP C C    1 
ATOM   6180  O O    . ASP B 1 28  ? -18.622 -13.590 12.992  1.00 24.95  ? 365 ASP C O    1 
ATOM   6181  C CB   . ASP B 1 28  ? -15.817 -12.243 11.740  1.00 23.59  ? 365 ASP C CB   1 
ATOM   6182  C CG   . ASP B 1 28  ? -15.131 -10.880 11.801  1.00 25.32  ? 365 ASP C CG   1 
ATOM   6183  O OD1  . ASP B 1 28  ? -15.207 -10.225 12.855  1.00 25.91  ? 365 ASP C OD1  1 
ATOM   6184  O OD2  . ASP B 1 28  ? -14.521 -10.458 10.794  1.00 24.23  ? 365 ASP C OD2  1 
ATOM   6185  H H    . ASP B 1 28  ? -14.533 -13.163 13.618  1.00 31.09  ? 365 ASP C H    1 
ATOM   6186  H HA   . ASP B 1 28  ? -16.842 -11.916 13.498  1.00 33.13  ? 365 ASP C HA   1 
ATOM   6187  H HB2  . ASP B 1 28  ? -15.163 -12.896 11.445  1.00 28.31  ? 365 ASP C HB2  1 
ATOM   6188  H HB3  . ASP B 1 28  ? -16.542 -12.186 11.097  1.00 28.31  ? 365 ASP C HB3  1 
ATOM   6189  N N    . VAL B 1 29  ? -16.936 -15.017 12.649  1.00 21.36  ? 366 VAL C N    1 
ATOM   6190  C CA   . VAL B 1 29  ? -17.844 -16.136 12.406  1.00 21.26  ? 366 VAL C CA   1 
ATOM   6191  C C    . VAL B 1 29  ? -18.515 -16.541 13.718  1.00 25.51  ? 366 VAL C C    1 
ATOM   6192  O O    . VAL B 1 29  ? -19.708 -16.830 13.765  1.00 27.00  ? 366 VAL C O    1 
ATOM   6193  C CB   . VAL B 1 29  ? -17.095 -17.327 11.764  1.00 26.93  ? 366 VAL C CB   1 
ATOM   6194  C CG1  . VAL B 1 29  ? -17.883 -18.616 11.924  1.00 26.46  ? 366 VAL C CG1  1 
ATOM   6195  C CG2  . VAL B 1 29  ? -16.805 -17.030 10.272  1.00 25.17  ? 366 VAL C CG2  1 
ATOM   6196  H H    . VAL B 1 29  ? -16.101 -15.220 12.616  1.00 25.63  ? 366 VAL C H    1 
ATOM   6197  H HA   . VAL B 1 29  ? -18.544 -15.848 11.784  1.00 25.52  ? 366 VAL C HA   1 
ATOM   6198  H HB   . VAL B 1 29  ? -16.236 -17.443 12.220  1.00 32.32  ? 366 VAL C HB   1 
ATOM   6199  H HG11 . VAL B 1 29  ? -17.393 -19.334 11.516  1.00 31.75  ? 366 VAL C HG11 1 
ATOM   6200  H HG12 . VAL B 1 29  ? -18.006 -18.793 12.859  1.00 31.75  ? 366 VAL C HG12 1 
ATOM   6201  H HG13 . VAL B 1 29  ? -18.736 -18.516 11.494  1.00 31.75  ? 366 VAL C HG13 1 
ATOM   6202  H HG21 . VAL B 1 29  ? -16.341 -17.778 9.889   1.00 30.20  ? 366 VAL C HG21 1 
ATOM   6203  H HG22 . VAL B 1 29  ? -17.637 -16.891 9.814   1.00 30.20  ? 366 VAL C HG22 1 
ATOM   6204  H HG23 . VAL B 1 29  ? -16.261 -16.241 10.211  1.00 30.20  ? 366 VAL C HG23 1 
ATOM   6205  N N    . TYR B 1 30  ? -17.756 -16.543 14.801  1.00 24.72  ? 367 TYR C N    1 
ATOM   6206  C CA   . TYR B 1 30  ? -18.336 -16.921 16.081  1.00 28.64  ? 367 TYR C CA   1 
ATOM   6207  C C    . TYR B 1 30  ? -19.531 -16.025 16.436  1.00 27.88  ? 367 TYR C C    1 
ATOM   6208  O O    . TYR B 1 30  ? -20.614 -16.513 16.787  1.00 31.40  ? 367 TYR C O    1 
ATOM   6209  C CB   . TYR B 1 30  ? -17.276 -16.863 17.173  1.00 32.24  ? 367 TYR C CB   1 
ATOM   6210  C CG   . TYR B 1 30  ? -17.745 -17.427 18.481  1.00 32.25  ? 367 TYR C CG   1 
ATOM   6211  C CD1  . TYR B 1 30  ? -17.607 -18.780 18.758  1.00 36.20  ? 367 TYR C CD1  1 
ATOM   6212  C CD2  . TYR B 1 30  ? -18.320 -16.611 19.447  1.00 37.93  ? 367 TYR C CD2  1 
ATOM   6213  C CE1  . TYR B 1 30  ? -18.024 -19.305 19.957  1.00 45.33  ? 367 TYR C CE1  1 
ATOM   6214  C CE2  . TYR B 1 30  ? -18.745 -17.129 20.652  1.00 39.30  ? 367 TYR C CE2  1 
ATOM   6215  C CZ   . TYR B 1 30  ? -18.592 -18.480 20.903  1.00 45.05  ? 367 TYR C CZ   1 
ATOM   6216  O OH   . TYR B 1 30  ? -19.007 -19.020 22.099  1.00 48.81  ? 367 TYR C OH   1 
ATOM   6217  H H    . TYR B 1 30  ? -16.922 -16.335 14.826  1.00 29.67  ? 367 TYR C H    1 
ATOM   6218  H HA   . TYR B 1 30  ? -18.659 -17.845 16.022  1.00 34.37  ? 367 TYR C HA   1 
ATOM   6219  H HB2  . TYR B 1 30  ? -16.502 -17.374 16.888  1.00 38.69  ? 367 TYR C HB2  1 
ATOM   6220  H HB3  . TYR B 1 30  ? -17.025 -15.938 17.320  1.00 38.69  ? 367 TYR C HB3  1 
ATOM   6221  H HD1  . TYR B 1 30  ? -17.221 -19.340 18.123  1.00 43.44  ? 367 TYR C HD1  1 
ATOM   6222  H HD2  . TYR B 1 30  ? -18.419 -15.702 19.279  1.00 45.52  ? 367 TYR C HD2  1 
ATOM   6223  H HE1  . TYR B 1 30  ? -17.925 -20.214 20.129  1.00 54.40  ? 367 TYR C HE1  1 
ATOM   6224  H HE2  . TYR B 1 30  ? -19.128 -16.574 21.293  1.00 47.16  ? 367 TYR C HE2  1 
ATOM   6225  H HH   . TYR B 1 30  ? -19.812 -18.897 22.198  1.00 58.57  ? 367 TYR C HH   1 
ATOM   6226  N N    . GLU B 1 31  ? -19.337 -14.716 16.328  1.00 23.74  ? 368 GLU C N    1 
ATOM   6227  C CA   . GLU B 1 31  ? -20.337 -13.756 16.774  1.00 34.67  ? 368 GLU C CA   1 
ATOM   6228  C C    . GLU B 1 31  ? -21.539 -13.695 15.832  1.00 24.79  ? 368 GLU C C    1 
ATOM   6229  O O    . GLU B 1 31  ? -22.675 -13.540 16.277  1.00 25.02  ? 368 GLU C O    1 
ATOM   6230  C CB   . GLU B 1 31  ? -19.698 -12.376 16.939  1.00 39.97  ? 368 GLU C CB   1 
ATOM   6231  C CG   . GLU B 1 31  ? -18.624 -12.352 18.036  1.00 47.43  ? 368 GLU C CG   1 
ATOM   6232  C CD   . GLU B 1 31  ? -18.089 -10.961 18.327  1.00 57.36  ? 368 GLU C CD   1 
ATOM   6233  O OE1  . GLU B 1 31  ? -18.360 -10.031 17.539  1.00 60.87  ? 368 GLU C OE1  1 
ATOM   6234  O OE2  . GLU B 1 31  ? -17.399 -10.800 19.353  1.00 65.05  ? 368 GLU C OE2  1 
ATOM   6235  H H    . GLU B 1 31  ? -18.629 -14.356 15.997  1.00 28.49  ? 368 GLU C H    1 
ATOM   6236  H HA   . GLU B 1 31  ? -20.666 -14.036 17.654  1.00 41.60  ? 368 GLU C HA   1 
ATOM   6237  H HB2  . GLU B 1 31  ? -19.280 -12.118 16.102  1.00 47.97  ? 368 GLU C HB2  1 
ATOM   6238  H HB3  . GLU B 1 31  ? -20.386 -11.735 17.178  1.00 47.97  ? 368 GLU C HB3  1 
ATOM   6239  H HG2  . GLU B 1 31  ? -19.005 -12.702 18.856  1.00 56.92  ? 368 GLU C HG2  1 
ATOM   6240  H HG3  . GLU B 1 31  ? -17.877 -12.905 17.756  1.00 56.92  ? 368 GLU C HG3  1 
ATOM   6241  N N    . LEU B 1 32  ? -21.297 -13.831 14.535  1.00 29.39  ? 369 LEU C N    1 
ATOM   6242  C CA   . LEU B 1 32  ? -22.397 -13.851 13.585  1.00 30.93  ? 369 LEU C CA   1 
ATOM   6243  C C    . LEU B 1 32  ? -23.203 -15.144 13.754  1.00 31.17  ? 369 LEU C C    1 
ATOM   6244  O O    . LEU B 1 32  ? -24.427 -15.150 13.623  1.00 24.98  ? 369 LEU C O    1 
ATOM   6245  C CB   . LEU B 1 32  ? -21.880 -13.687 12.147  1.00 24.42  ? 369 LEU C CB   1 
ATOM   6246  C CG   . LEU B 1 32  ? -22.989 -13.599 11.099  1.00 25.08  ? 369 LEU C CG   1 
ATOM   6247  C CD1  . LEU B 1 32  ? -23.804 -12.324 11.303  1.00 17.03  ? 369 LEU C CD1  1 
ATOM   6248  C CD2  . LEU B 1 32  ? -22.417 -13.667 9.685   1.00 27.71  ? 369 LEU C CD2  1 
ATOM   6249  H H    . LEU B 1 32  ? -20.517 -13.912 14.184  1.00 35.27  ? 369 LEU C H    1 
ATOM   6250  H HA   . LEU B 1 32  ? -22.994 -13.098 13.777  1.00 37.12  ? 369 LEU C HA   1 
ATOM   6251  H HB2  . LEU B 1 32  ? -21.357 -12.872 12.093  1.00 29.30  ? 369 LEU C HB2  1 
ATOM   6252  H HB3  . LEU B 1 32  ? -21.324 -14.451 11.926  1.00 29.30  ? 369 LEU C HB3  1 
ATOM   6253  H HG   . LEU B 1 32  ? -23.588 -14.354 11.213  1.00 30.09  ? 369 LEU C HG   1 
ATOM   6254  H HD11 . LEU B 1 32  ? -24.494 -12.286 10.637  1.00 20.43  ? 369 LEU C HD11 1 
ATOM   6255  H HD12 . LEU B 1 32  ? -24.194 -12.340 12.180  1.00 20.43  ? 369 LEU C HD12 1 
ATOM   6256  H HD13 . LEU B 1 32  ? -23.222 -11.566 11.216  1.00 20.43  ? 369 LEU C HD13 1 
ATOM   6257  H HD21 . LEU B 1 32  ? -23.137 -13.608 9.053   1.00 33.25  ? 369 LEU C HD21 1 
ATOM   6258  H HD22 . LEU B 1 32  ? -21.810 -12.933 9.558   1.00 33.25  ? 369 LEU C HD22 1 
ATOM   6259  H HD23 . LEU B 1 32  ? -21.952 -14.499 9.576   1.00 33.25  ? 369 LEU C HD23 1 
ATOM   6260  N N    . THR B 1 33  ? -22.527 -16.247 14.062  1.00 23.68  ? 370 THR C N    1 
ATOM   6261  C CA   . THR B 1 33  ? -23.241 -17.488 14.282  1.00 27.51  ? 370 THR C CA   1 
ATOM   6262  C C    . THR B 1 33  ? -24.245 -17.332 15.430  1.00 28.35  ? 370 THR C C    1 
ATOM   6263  O O    . THR B 1 33  ? -25.404 -17.739 15.324  1.00 29.15  ? 370 THR C O    1 
ATOM   6264  C CB   . THR B 1 33  ? -22.291 -18.620 14.657  1.00 29.82  ? 370 THR C CB   1 
ATOM   6265  O OG1  . THR B 1 33  ? -21.480 -18.964 13.523  1.00 26.34  ? 370 THR C OG1  1 
ATOM   6266  C CG2  . THR B 1 33  ? -23.093 -19.824 15.132  1.00 24.98  ? 370 THR C CG2  1 
ATOM   6267  H H    . THR B 1 33  ? -21.672 -16.298 14.148  1.00 28.41  ? 370 THR C H    1 
ATOM   6268  H HA   . THR B 1 33  ? -23.726 -17.740 13.469  1.00 33.01  ? 370 THR C HA   1 
ATOM   6269  H HB   . THR B 1 33  ? -21.719 -18.330 15.384  1.00 35.78  ? 370 THR C HB   1 
ATOM   6270  H HG1  . THR B 1 33  ? -21.042 -18.313 13.285  1.00 31.61  ? 370 THR C HG1  1 
ATOM   6271  H HG21 . THR B 1 33  ? -22.500 -20.541 15.369  1.00 29.98  ? 370 THR C HG21 1 
ATOM   6272  H HG22 . THR B 1 33  ? -23.618 -19.587 15.899  1.00 29.98  ? 370 THR C HG22 1 
ATOM   6273  H HG23 . THR B 1 33  ? -23.679 -20.124 14.433  1.00 29.98  ? 370 THR C HG23 1 
ATOM   6274  N N    . ASN B 1 34  ? -23.781 -16.764 16.535  1.00 22.75  ? 371 ASN C N    1 
ATOM   6275  C CA   . ASN B 1 34  ? -24.645 -16.542 17.688  1.00 27.78  ? 371 ASN C CA   1 
ATOM   6276  C C    . ASN B 1 34  ? -25.826 -15.617 17.365  1.00 28.30  ? 371 ASN C C    1 
ATOM   6277  O O    . ASN B 1 34  ? -26.953 -15.887 17.781  1.00 32.34  ? 371 ASN C O    1 
ATOM   6278  C CB   . ASN B 1 34  ? -23.843 -15.982 18.863  1.00 32.68  ? 371 ASN C CB   1 
ATOM   6279  C CG   . ASN B 1 34  ? -22.824 -16.984 19.416  1.00 49.97  ? 371 ASN C CG   1 
ATOM   6280  O OD1  . ASN B 1 34  ? -21.884 -16.598 20.109  1.00 59.61  ? 371 ASN C OD1  1 
ATOM   6281  N ND2  . ASN B 1 34  ? -23.003 -18.270 19.099  1.00 36.61  ? 371 ASN C ND2  1 
ATOM   6282  H H    . ASN B 1 34  ? -22.970 -16.498 16.643  1.00 27.30  ? 371 ASN C H    1 
ATOM   6283  H HA   . ASN B 1 34  ? -25.015 -17.405 17.969  1.00 33.34  ? 371 ASN C HA   1 
ATOM   6284  H HB2  . ASN B 1 34  ? -23.360 -15.195 18.568  1.00 39.21  ? 371 ASN C HB2  1 
ATOM   6285  H HB3  . ASN B 1 34  ? -24.454 -15.748 19.579  1.00 39.21  ? 371 ASN C HB3  1 
ATOM   6286  H HD21 . ASN B 1 34  ? -23.667 -18.503 18.605  1.00 43.93  ? 371 ASN C HD21 1 
ATOM   6287  H HD22 . ASN B 1 34  ? -22.453 -18.865 19.390  1.00 43.93  ? 371 ASN C HD22 1 
ATOM   6288  N N    . LEU B 1 35  ? -25.571 -14.541 16.626  1.00 29.70  ? 372 LEU C N    1 
ATOM   6289  C CA   . LEU B 1 35  ? -26.635 -13.607 16.240  1.00 30.73  ? 372 LEU C CA   1 
ATOM   6290  C C    . LEU B 1 35  ? -27.673 -14.293 15.347  1.00 28.43  ? 372 LEU C C    1 
ATOM   6291  O O    . LEU B 1 35  ? -28.874 -14.146 15.558  1.00 29.03  ? 372 LEU C O    1 
ATOM   6292  C CB   . LEU B 1 35  ? -26.063 -12.377 15.526  1.00 27.95  ? 372 LEU C CB   1 
ATOM   6293  C CG   . LEU B 1 35  ? -25.162 -11.454 16.356  1.00 33.00  ? 372 LEU C CG   1 
ATOM   6294  C CD1  . LEU B 1 35  ? -24.444 -10.466 15.449  1.00 33.86  ? 372 LEU C CD1  1 
ATOM   6295  C CD2  . LEU B 1 35  ? -25.952 -10.711 17.430  1.00 39.71  ? 372 LEU C CD2  1 
ATOM   6296  H H    . LEU B 1 35  ? -24.791 -14.326 16.333  1.00 35.64  ? 372 LEU C H    1 
ATOM   6297  H HA   . LEU B 1 35  ? -27.093 -13.299 17.049  1.00 36.88  ? 372 LEU C HA   1 
ATOM   6298  H HB2  . LEU B 1 35  ? -25.540 -12.683 14.769  1.00 33.54  ? 372 LEU C HB2  1 
ATOM   6299  H HB3  . LEU B 1 35  ? -26.806 -11.841 15.206  1.00 33.54  ? 372 LEU C HB3  1 
ATOM   6300  H HG   . LEU B 1 35  ? -24.489 -11.992 16.801  1.00 39.61  ? 372 LEU C HG   1 
ATOM   6301  H HD11 . LEU B 1 35  ? -23.886 -9.898  15.986  1.00 40.64  ? 372 LEU C HD11 1 
ATOM   6302  H HD12 . LEU B 1 35  ? -23.907 -10.953 14.820  1.00 40.64  ? 372 LEU C HD12 1 
ATOM   6303  H HD13 . LEU B 1 35  ? -25.097 -9.938  14.984  1.00 40.64  ? 372 LEU C HD13 1 
ATOM   6304  H HD21 . LEU B 1 35  ? -25.353 -10.147 17.925  1.00 47.65  ? 372 LEU C HD21 1 
ATOM   6305  H HD22 . LEU B 1 35  ? -26.629 -10.178 17.007  1.00 47.65  ? 372 LEU C HD22 1 
ATOM   6306  H HD23 . LEU B 1 35  ? -26.359 -11.352 18.018  1.00 47.65  ? 372 LEU C HD23 1 
ATOM   6307  N N    . LEU B 1 36  ? -27.207 -15.061 14.366  1.00 28.37  ? 373 LEU C N    1 
ATOM   6308  C CA   . LEU B 1 36  ? -28.114 -15.791 13.486  1.00 26.13  ? 373 LEU C CA   1 
ATOM   6309  C C    . LEU B 1 36  ? -28.925 -16.848 14.242  1.00 33.32  ? 373 LEU C C    1 
ATOM   6310  O O    . LEU B 1 36  ? -30.095 -17.054 13.937  1.00 28.89  ? 373 LEU C O    1 
ATOM   6311  C CB   . LEU B 1 36  ? -27.361 -16.406 12.301  1.00 22.24  ? 373 LEU C CB   1 
ATOM   6312  C CG   . LEU B 1 36  ? -26.999 -15.386 11.196  1.00 29.28  ? 373 LEU C CG   1 
ATOM   6313  C CD1  . LEU B 1 36  ? -26.009 -15.951 10.177  1.00 26.76  ? 373 LEU C CD1  1 
ATOM   6314  C CD2  . LEU B 1 36  ? -28.247 -14.900 10.465  1.00 26.39  ? 373 LEU C CD2  1 
ATOM   6315  H H    . LEU B 1 36  ? -26.374 -15.176 14.189  1.00 34.04  ? 373 LEU C H    1 
ATOM   6316  H HA   . LEU B 1 36  ? -28.756 -15.150 13.115  1.00 31.36  ? 373 LEU C HA   1 
ATOM   6317  H HB2  . LEU B 1 36  ? -26.535 -16.798 12.626  1.00 26.69  ? 373 LEU C HB2  1 
ATOM   6318  H HB3  . LEU B 1 36  ? -27.916 -17.093 11.901  1.00 26.69  ? 373 LEU C HB3  1 
ATOM   6319  H HG   . LEU B 1 36  ? -26.583 -14.614 11.612  1.00 35.14  ? 373 LEU C HG   1 
ATOM   6320  H HD11 . LEU B 1 36  ? -25.821 -15.279 9.518   1.00 32.11  ? 373 LEU C HD11 1 
ATOM   6321  H HD12 . LEU B 1 36  ? -25.201 -16.200 10.632  1.00 32.11  ? 373 LEU C HD12 1 
ATOM   6322  H HD13 . LEU B 1 36  ? -26.399 -16.722 9.758   1.00 32.11  ? 373 LEU C HD13 1 
ATOM   6323  H HD21 . LEU B 1 36  ? -27.987 -14.271 9.789   1.00 31.66  ? 373 LEU C HD21 1 
ATOM   6324  H HD22 . LEU B 1 36  ? -28.686 -15.653 10.062  1.00 31.66  ? 373 LEU C HD22 1 
ATOM   6325  H HD23 . LEU B 1 36  ? -28.834 -14.478 11.097  1.00 31.66  ? 373 LEU C HD23 1 
ATOM   6326  N N    . ARG B 1 37  ? -28.321 -17.512 15.230  1.00 27.25  ? 374 ARG C N    1 
ATOM   6327  C CA   . ARG B 1 37  ? -29.078 -18.449 16.049  1.00 28.81  ? 374 ARG C CA   1 
ATOM   6328  C C    . ARG B 1 37  ? -30.145 -17.731 16.875  1.00 34.59  ? 374 ARG C C    1 
ATOM   6329  O O    . ARG B 1 37  ? -31.220 -18.280 17.114  1.00 36.05  ? 374 ARG C O    1 
ATOM   6330  C CB   . ARG B 1 37  ? -28.144 -19.274 16.949  1.00 32.81  ? 374 ARG C CB   1 
ATOM   6331  C CG   . ARG B 1 37  ? -27.340 -20.293 16.153  1.00 31.50  ? 374 ARG C CG   1 
ATOM   6332  C CD   . ARG B 1 37  ? -26.631 -21.326 17.028  1.00 37.03  ? 374 ARG C CD   1 
ATOM   6333  N NE   . ARG B 1 37  ? -26.041 -22.362 16.182  1.00 42.72  ? 374 ARG C NE   1 
ATOM   6334  C CZ   . ARG B 1 37  ? -24.799 -22.827 16.292  1.00 49.03  ? 374 ARG C CZ   1 
ATOM   6335  N NH1  . ARG B 1 37  ? -23.982 -22.375 17.243  1.00 40.19  ? 374 ARG C NH1  1 
ATOM   6336  N NH2  . ARG B 1 37  ? -24.380 -23.762 15.449  1.00 50.28  ? 374 ARG C NH2  1 
ATOM   6337  H H    . ARG B 1 37  ? -27.491 -17.438 15.441  1.00 32.70  ? 374 ARG C H    1 
ATOM   6338  H HA   . ARG B 1 37  ? -29.541 -19.076 15.455  1.00 34.57  ? 374 ARG C HA   1 
ATOM   6339  H HB2  . ARG B 1 37  ? -27.521 -18.677 17.393  1.00 39.37  ? 374 ARG C HB2  1 
ATOM   6340  H HB3  . ARG B 1 37  ? -28.675 -19.752 17.605  1.00 39.37  ? 374 ARG C HB3  1 
ATOM   6341  H HG2  . ARG B 1 37  ? -27.939 -20.769 15.557  1.00 37.80  ? 374 ARG C HG2  1 
ATOM   6342  H HG3  . ARG B 1 37  ? -26.664 -19.826 15.637  1.00 37.80  ? 374 ARG C HG3  1 
ATOM   6343  H HD2  . ARG B 1 37  ? -25.922 -20.896 17.531  1.00 44.44  ? 374 ARG C HD2  1 
ATOM   6344  H HD3  . ARG B 1 37  ? -27.271 -21.742 17.627  1.00 44.44  ? 374 ARG C HD3  1 
ATOM   6345  H HE   . ARG B 1 37  ? -26.536 -22.698 15.564  1.00 51.26  ? 374 ARG C HE   1 
ATOM   6346  H HH11 . ARG B 1 37  ? -24.252 -21.767 17.788  1.00 48.23  ? 374 ARG C HH11 1 
ATOM   6347  H HH12 . ARG B 1 37  ? -23.183 -22.686 17.307  1.00 48.23  ? 374 ARG C HH12 1 
ATOM   6348  H HH21 . ARG B 1 37  ? -24.908 -24.059 14.839  1.00 60.34  ? 374 ARG C HH21 1 
ATOM   6349  H HH22 . ARG B 1 37  ? -23.582 -24.076 15.517  1.00 60.34  ? 374 ARG C HH22 1 
ATOM   6350  N N    . GLN B 1 38  ? -29.861 -16.511 17.317  1.00 25.23  ? 375 GLN C N    1 
ATOM   6351  C CA   . GLN B 1 38  ? -30.899 -15.720 17.983  1.00 38.44  ? 375 GLN C CA   1 
ATOM   6352  C C    . GLN B 1 38  ? -32.050 -15.477 17.013  1.00 37.37  ? 375 GLN C C    1 
ATOM   6353  O O    . GLN B 1 38  ? -33.201 -15.392 17.417  1.00 40.67  ? 375 GLN C O    1 
ATOM   6354  C CB   . GLN B 1 38  ? -30.362 -14.375 18.480  1.00 38.17  ? 375 GLN C CB   1 
ATOM   6355  C CG   . GLN B 1 38  ? -29.317 -14.490 19.582  1.00 43.01  ? 375 GLN C CG   1 
ATOM   6356  C CD   . GLN B 1 38  ? -28.908 -13.137 20.133  1.00 47.61  ? 375 GLN C CD   1 
ATOM   6357  O OE1  . GLN B 1 38  ? -27.724 -12.849 20.285  1.00 55.78  ? 375 GLN C OE1  1 
ATOM   6358  N NE2  . GLN B 1 38  ? -29.892 -12.301 20.442  1.00 51.42  ? 375 GLN C NE2  1 
ATOM   6359  H H    . GLN B 1 38  ? -29.096 -16.123 17.248  1.00 30.27  ? 375 GLN C H    1 
ATOM   6360  H HA   . GLN B 1 38  ? -31.243 -16.218 18.753  1.00 46.13  ? 375 GLN C HA   1 
ATOM   6361  H HB2  . GLN B 1 38  ? -29.955 -13.908 17.735  1.00 45.81  ? 375 GLN C HB2  1 
ATOM   6362  H HB3  . GLN B 1 38  ? -31.103 -13.855 18.829  1.00 45.81  ? 375 GLN C HB3  1 
ATOM   6363  H HG2  . GLN B 1 38  ? -29.681 -15.015 20.312  1.00 51.61  ? 375 GLN C HG2  1 
ATOM   6364  H HG3  . GLN B 1 38  ? -28.525 -14.921 19.225  1.00 51.61  ? 375 GLN C HG3  1 
ATOM   6365  H HE21 . GLN B 1 38  ? -30.711 -12.538 20.327  1.00 61.70  ? 375 GLN C HE21 1 
ATOM   6366  H HE22 . GLN B 1 38  ? -29.711 -11.522 20.758  1.00 61.70  ? 375 GLN C HE22 1 
ATOM   6367  N N    . LEU B 1 39  ? -31.734 -15.367 15.727  1.00 33.80  ? 376 LEU C N    1 
ATOM   6368  C CA   . LEU B 1 39  ? -32.752 -15.142 14.706  1.00 30.54  ? 376 LEU C CA   1 
ATOM   6369  C C    . LEU B 1 39  ? -33.441 -16.432 14.271  1.00 34.57  ? 376 LEU C C    1 
ATOM   6370  O O    . LEU B 1 39  ? -34.224 -16.424 13.331  1.00 30.40  ? 376 LEU C O    1 
ATOM   6371  C CB   . LEU B 1 39  ? -32.132 -14.457 13.480  1.00 34.99  ? 376 LEU C CB   1 
ATOM   6372  C CG   . LEU B 1 39  ? -31.661 -13.025 13.728  1.00 29.49  ? 376 LEU C CG   1 
ATOM   6373  C CD1  . LEU B 1 39  ? -30.848 -12.487 12.561  1.00 30.06  ? 376 LEU C CD1  1 
ATOM   6374  C CD2  . LEU B 1 39  ? -32.865 -12.141 14.000  1.00 34.70  ? 376 LEU C CD2  1 
ATOM   6375  H H    . LEU B 1 39  ? -30.933 -15.420 15.418  1.00 40.56  ? 376 LEU C H    1 
ATOM   6376  H HA   . LEU B 1 39  ? -33.438 -14.544 15.070  1.00 36.65  ? 376 LEU C HA   1 
ATOM   6377  H HB2  . LEU B 1 39  ? -31.364 -14.974 13.191  1.00 41.98  ? 376 LEU C HB2  1 
ATOM   6378  H HB3  . LEU B 1 39  ? -32.794 -14.431 12.771  1.00 41.98  ? 376 LEU C HB3  1 
ATOM   6379  H HG   . LEU B 1 39  ? -31.096 -13.012 14.517  1.00 35.39  ? 376 LEU C HG   1 
ATOM   6380  H HD11 . LEU B 1 39  ? -30.574 -11.589 12.759  1.00 36.07  ? 376 LEU C HD11 1 
ATOM   6381  H HD12 . LEU B 1 39  ? -30.077 -13.045 12.434  1.00 36.07  ? 376 LEU C HD12 1 
ATOM   6382  H HD13 . LEU B 1 39  ? -31.393 -12.497 11.770  1.00 36.07  ? 376 LEU C HD13 1 
ATOM   6383  H HD21 . LEU B 1 39  ? -32.563 -11.243 14.156  1.00 41.64  ? 376 LEU C HD21 1 
ATOM   6384  H HD22 . LEU B 1 39  ? -33.448 -12.164 13.238  1.00 41.64  ? 376 LEU C HD22 1 
ATOM   6385  H HD23 . LEU B 1 39  ? -33.325 -12.471 14.775  1.00 41.64  ? 376 LEU C HD23 1 
ATOM   6386  N N    . ASP B 1 40  ? -33.134 -17.538 14.941  1.00 32.72  ? 377 ASP C N    1 
ATOM   6387  C CA   . ASP B 1 40  ? -33.772 -18.826 14.650  1.00 30.89  ? 377 ASP C CA   1 
ATOM   6388  C C    . ASP B 1 40  ? -33.248 -19.487 13.367  1.00 34.12  ? 377 ASP C C    1 
ATOM   6389  O O    . ASP B 1 40  ? -33.871 -20.406 12.836  1.00 31.24  ? 377 ASP C O    1 
ATOM   6390  C CB   . ASP B 1 40  ? -35.292 -18.663 14.581  1.00 30.86  ? 377 ASP C CB   1 
ATOM   6391  C CG   . ASP B 1 40  ? -35.894 -18.281 15.924  1.00 46.45  ? 377 ASP C CG   1 
ATOM   6392  O OD1  . ASP B 1 40  ? -35.511 -18.891 16.942  1.00 58.96  ? 377 ASP C OD1  1 
ATOM   6393  O OD2  . ASP B 1 40  ? -36.734 -17.363 15.967  1.00 45.28  ? 377 ASP C OD2  1 
ATOM   6394  H H    . ASP B 1 40  ? -32.554 -17.573 15.575  1.00 39.27  ? 377 ASP C H    1 
ATOM   6395  H HA   . ASP B 1 40  ? -33.578 -19.437 15.391  1.00 37.07  ? 377 ASP C HA   1 
ATOM   6396  H HB2  . ASP B 1 40  ? -35.507 -17.964 13.944  1.00 37.04  ? 377 ASP C HB2  1 
ATOM   6397  H HB3  . ASP B 1 40  ? -35.689 -19.503 14.300  1.00 37.04  ? 377 ASP C HB3  1 
ATOM   6398  N N    . PHE B 1 41  ? -32.110 -19.015 12.869  1.00 36.72  ? 378 PHE C N    1 
ATOM   6399  C CA   . PHE B 1 41  ? -31.427 -19.689 11.761  1.00 34.87  ? 378 PHE C CA   1 
ATOM   6400  C C    . PHE B 1 41  ? -30.775 -20.991 12.214  1.00 37.43  ? 378 PHE C C    1 
ATOM   6401  O O    . PHE B 1 41  ? -30.177 -21.054 13.281  1.00 34.46  ? 378 PHE C O    1 
ATOM   6402  C CB   . PHE B 1 41  ? -30.339 -18.791 11.193  1.00 32.15  ? 378 PHE C CB   1 
ATOM   6403  C CG   . PHE B 1 41  ? -30.825 -17.831 10.156  1.00 31.41  ? 378 PHE C CG   1 
ATOM   6404  C CD1  . PHE B 1 41  ? -30.634 -18.097 8.807   1.00 32.40  ? 378 PHE C CD1  1 
ATOM   6405  C CD2  . PHE B 1 41  ? -31.465 -16.658 10.523  1.00 34.09  ? 378 PHE C CD2  1 
ATOM   6406  C CE1  . PHE B 1 41  ? -31.072 -17.209 7.845   1.00 30.45  ? 378 PHE C CE1  1 
ATOM   6407  C CE2  . PHE B 1 41  ? -31.904 -15.759 9.564   1.00 24.92  ? 378 PHE C CE2  1 
ATOM   6408  C CZ   . PHE B 1 41  ? -31.715 -16.036 8.226   1.00 24.43  ? 378 PHE C CZ   1 
ATOM   6409  H H    . PHE B 1 41  ? -31.711 -18.307 13.151  1.00 44.06  ? 378 PHE C H    1 
ATOM   6410  H HA   . PHE B 1 41  ? -32.071 -19.891 11.051  1.00 41.84  ? 378 PHE C HA   1 
ATOM   6411  H HB2  . PHE B 1 41  ? -29.951 -18.274 11.916  1.00 38.59  ? 378 PHE C HB2  1 
ATOM   6412  H HB3  . PHE B 1 41  ? -29.657 -19.348 10.785  1.00 38.59  ? 378 PHE C HB3  1 
ATOM   6413  H HD1  . PHE B 1 41  ? -30.204 -18.881 8.549   1.00 38.88  ? 378 PHE C HD1  1 
ATOM   6414  H HD2  . PHE B 1 41  ? -31.595 -16.468 11.424  1.00 40.91  ? 378 PHE C HD2  1 
ATOM   6415  H HE1  . PHE B 1 41  ? -30.942 -17.397 6.943   1.00 36.54  ? 378 PHE C HE1  1 
ATOM   6416  H HE2  . PHE B 1 41  ? -32.336 -14.977 9.821   1.00 29.90  ? 378 PHE C HE2  1 
ATOM   6417  H HZ   . PHE B 1 41  ? -32.012 -15.437 7.581   1.00 29.32  ? 378 PHE C HZ   1 
ATOM   6418  N N    . LYS B 1 42  ? -30.887 -22.027 11.391  1.00 34.44  ? 379 LYS C N    1 
ATOM   6419  C CA   . LYS B 1 42  ? -30.092 -23.232 11.565  1.00 34.08  ? 379 LYS C CA   1 
ATOM   6420  C C    . LYS B 1 42  ? -28.721 -22.950 10.963  1.00 35.05  ? 379 LYS C C    1 
ATOM   6421  O O    . LYS B 1 42  ? -28.584 -22.861 9.741   1.00 33.41  ? 379 LYS C O    1 
ATOM   6422  C CB   . LYS B 1 42  ? -30.774 -24.408 10.864  1.00 32.70  ? 379 LYS C CB   1 
ATOM   6423  C CG   . LYS B 1 42  ? -32.228 -24.599 11.291  1.00 42.90  ? 379 LYS C CG   1 
ATOM   6424  C CD   . LYS B 1 42  ? -32.943 -25.648 10.457  1.00 52.91  ? 379 LYS C CD   1 
ATOM   6425  C CE   . LYS B 1 42  ? -34.233 -26.113 11.134  1.00 54.78  ? 379 LYS C CE   1 
ATOM   6426  N NZ   . LYS B 1 42  ? -35.063 -24.981 11.660  1.00 44.30  ? 379 LYS C NZ   1 
ATOM   6427  H H    . LYS B 1 42  ? -31.422 -22.055 10.718  1.00 41.32  ? 379 LYS C H    1 
ATOM   6428  H HA   . LYS B 1 42  ? -29.991 -23.437 12.517  1.00 40.90  ? 379 LYS C HA   1 
ATOM   6429  H HB2  . LYS B 1 42  ? -30.762 -24.255 9.907   1.00 39.24  ? 379 LYS C HB2  1 
ATOM   6430  H HB3  . LYS B 1 42  ? -30.292 -25.223 11.075  1.00 39.24  ? 379 LYS C HB3  1 
ATOM   6431  H HG2  . LYS B 1 42  ? -32.252 -24.884 12.218  1.00 51.48  ? 379 LYS C HG2  1 
ATOM   6432  H HG3  . LYS B 1 42  ? -32.702 -23.759 11.188  1.00 51.48  ? 379 LYS C HG3  1 
ATOM   6433  H HD2  . LYS B 1 42  ? -33.172 -25.270 9.593   1.00 63.49  ? 379 LYS C HD2  1 
ATOM   6434  H HD3  . LYS B 1 42  ? -32.364 -26.418 10.344  1.00 63.49  ? 379 LYS C HD3  1 
ATOM   6435  H HE2  . LYS B 1 42  ? -34.769 -26.601 10.489  1.00 65.74  ? 379 LYS C HE2  1 
ATOM   6436  H HE3  . LYS B 1 42  ? -34.007 -26.690 11.880  1.00 65.74  ? 379 LYS C HE3  1 
ATOM   6437  H HZ1  . LYS B 1 42  ? -35.801 -25.299 12.044  1.00 53.16  ? 379 LYS C HZ1  1 
ATOM   6438  H HZ2  . LYS B 1 42  ? -34.600 -24.519 12.263  1.00 53.16  ? 379 LYS C HZ2  1 
ATOM   6439  H HZ3  . LYS B 1 42  ? -35.295 -24.438 10.994  1.00 53.16  ? 379 LYS C HZ3  1 
ATOM   6440  N N    . VAL B 1 43  ? -27.709 -22.795 11.814  1.00 26.96  ? 380 VAL C N    1 
ATOM   6441  C CA   . VAL B 1 43  ? -26.417 -22.289 11.365  1.00 25.58  ? 380 VAL C CA   1 
ATOM   6442  C C    . VAL B 1 43  ? -25.329 -23.355 11.423  1.00 34.17  ? 380 VAL C C    1 
ATOM   6443  O O    . VAL B 1 43  ? -25.167 -24.003 12.439  1.00 32.34  ? 380 VAL C O    1 
ATOM   6444  C CB   . VAL B 1 43  ? -25.941 -21.119 12.247  1.00 30.86  ? 380 VAL C CB   1 
ATOM   6445  C CG1  . VAL B 1 43  ? -24.614 -20.583 11.737  1.00 27.46  ? 380 VAL C CG1  1 
ATOM   6446  C CG2  . VAL B 1 43  ? -26.994 -20.007 12.325  1.00 25.82  ? 380 VAL C CG2  1 
ATOM   6447  H H    . VAL B 1 43  ? -27.746 -22.974 12.654  1.00 32.35  ? 380 VAL C H    1 
ATOM   6448  H HA   . VAL B 1 43  ? -26.492 -21.972 10.441  1.00 30.69  ? 380 VAL C HA   1 
ATOM   6449  H HB   . VAL B 1 43  ? -25.795 -21.453 13.157  1.00 37.04  ? 380 VAL C HB   1 
ATOM   6450  H HG11 . VAL B 1 43  ? -24.335 -19.856 12.299  1.00 32.95  ? 380 VAL C HG11 1 
ATOM   6451  H HG12 . VAL B 1 43  ? -23.962 -21.287 11.764  1.00 32.95  ? 380 VAL C HG12 1 
ATOM   6452  H HG13 . VAL B 1 43  ? -24.728 -20.275 10.835  1.00 32.95  ? 380 VAL C HG13 1 
ATOM   6453  H HG21 . VAL B 1 43  ? -26.661 -19.300 12.881  1.00 30.99  ? 380 VAL C HG21 1 
ATOM   6454  H HG22 . VAL B 1 43  ? -27.164 -19.676 11.440  1.00 30.99  ? 380 VAL C HG22 1 
ATOM   6455  H HG23 . VAL B 1 43  ? -27.801 -20.367 12.700  1.00 30.99  ? 380 VAL C HG23 1 
ATOM   6456  N N    . VAL B 1 44  ? -24.572 -23.523 10.341  1.00 20.41  ? 381 VAL C N    1 
ATOM   6457  C CA   . VAL B 1 44  ? -23.347 -24.321 10.395  1.00 28.90  ? 381 VAL C CA   1 
ATOM   6458  C C    . VAL B 1 44  ? -22.179 -23.357 10.262  1.00 26.86  ? 381 VAL C C    1 
ATOM   6459  O O    . VAL B 1 44  ? -22.122 -22.597 9.308   1.00 28.62  ? 381 VAL C O    1 
ATOM   6460  C CB   . VAL B 1 44  ? -23.311 -25.377 9.286   1.00 33.52  ? 381 VAL C CB   1 
ATOM   6461  C CG1  . VAL B 1 44  ? -21.867 -25.804 8.968   1.00 27.48  ? 381 VAL C CG1  1 
ATOM   6462  C CG2  . VAL B 1 44  ? -24.167 -26.582 9.699   1.00 39.44  ? 381 VAL C CG2  1 
ATOM   6463  H H    . VAL B 1 44  ? -24.744 -23.189 9.568   1.00 24.50  ? 381 VAL C H    1 
ATOM   6464  H HA   . VAL B 1 44  ? -23.284 -24.773 11.262  1.00 34.68  ? 381 VAL C HA   1 
ATOM   6465  H HB   . VAL B 1 44  ? -23.700 -24.996 8.471   1.00 40.22  ? 381 VAL C HB   1 
ATOM   6466  H HG11 . VAL B 1 44  ? -21.882 -26.464 8.271   1.00 32.97  ? 381 VAL C HG11 1 
ATOM   6467  H HG12 . VAL B 1 44  ? -21.371 -25.034 8.679   1.00 32.97  ? 381 VAL C HG12 1 
ATOM   6468  H HG13 . VAL B 1 44  ? -21.468 -26.172 9.760   1.00 32.97  ? 381 VAL C HG13 1 
ATOM   6469  H HG21 . VAL B 1 44  ? -24.139 -27.239 8.999   1.00 47.33  ? 381 VAL C HG21 1 
ATOM   6470  H HG22 . VAL B 1 44  ? -23.812 -26.953 10.510  1.00 47.33  ? 381 VAL C HG22 1 
ATOM   6471  H HG23 . VAL B 1 44  ? -25.070 -26.290 9.839   1.00 47.33  ? 381 VAL C HG23 1 
ATOM   6472  N N    . SER B 1 45  ? -21.277 -23.350 11.239  1.00 24.14  ? 382 SER C N    1 
ATOM   6473  C CA   . SER B 1 45  ? -20.126 -22.446 11.204  1.00 24.55  ? 382 SER C CA   1 
ATOM   6474  C C    . SER B 1 45  ? -18.842 -23.261 11.122  1.00 29.08  ? 382 SER C C    1 
ATOM   6475  O O    . SER B 1 45  ? -18.631 -24.166 11.913  1.00 24.88  ? 382 SER C O    1 
ATOM   6476  C CB   . SER B 1 45  ? -20.103 -21.522 12.435  1.00 23.95  ? 382 SER C CB   1 
ATOM   6477  O OG   . SER B 1 45  ? -19.936 -22.246 13.640  1.00 31.93  ? 382 SER C OG   1 
ATOM   6478  H H    . SER B 1 45  ? -21.307 -23.857 11.933  1.00 28.97  ? 382 SER C H    1 
ATOM   6479  H HA   . SER B 1 45  ? -20.183 -21.884 10.402  1.00 29.46  ? 382 SER C HA   1 
ATOM   6480  H HB2  . SER B 1 45  ? -19.368 -20.897 12.342  1.00 28.74  ? 382 SER C HB2  1 
ATOM   6481  H HB3  . SER B 1 45  ? -20.943 -21.038 12.476  1.00 28.74  ? 382 SER C HB3  1 
ATOM   6482  H HG   . SER B 1 45  ? -19.878 -23.048 13.480  1.00 38.31  ? 382 SER C HG   1 
ATOM   6483  N N    . LEU B 1 46  ? -17.996 -22.939 10.150  1.00 24.34  ? 383 LEU C N    1 
ATOM   6484  C CA   . LEU B 1 46  ? -16.802 -23.712 9.880   1.00 20.01  ? 383 LEU C CA   1 
ATOM   6485  C C    . LEU B 1 46  ? -15.581 -22.812 9.702   1.00 25.64  ? 383 LEU C C    1 
ATOM   6486  O O    . LEU B 1 46  ? -15.653 -21.758 9.072   1.00 27.76  ? 383 LEU C O    1 
ATOM   6487  C CB   . LEU B 1 46  ? -17.023 -24.570 8.629   1.00 19.12  ? 383 LEU C CB   1 
ATOM   6488  C CG   . LEU B 1 46  ? -18.155 -25.592 8.753   1.00 18.47  ? 383 LEU C CG   1 
ATOM   6489  C CD1  . LEU B 1 46  ? -18.522 -26.144 7.374   1.00 23.66  ? 383 LEU C CD1  1 
ATOM   6490  C CD2  . LEU B 1 46  ? -17.759 -26.721 9.707   1.00 23.11  ? 383 LEU C CD2  1 
ATOM   6491  H H    . LEU B 1 46  ? -18.097 -22.264 9.627   1.00 29.20  ? 383 LEU C H    1 
ATOM   6492  H HA   . LEU B 1 46  ? -16.631 -24.313 10.636  1.00 24.01  ? 383 LEU C HA   1 
ATOM   6493  H HB2  . LEU B 1 46  ? -17.236 -23.984 7.885   1.00 22.94  ? 383 LEU C HB2  1 
ATOM   6494  H HB3  . LEU B 1 46  ? -16.206 -25.057 8.438   1.00 22.94  ? 383 LEU C HB3  1 
ATOM   6495  H HG   . LEU B 1 46  ? -18.938 -25.152 9.118   1.00 22.17  ? 383 LEU C HG   1 
ATOM   6496  H HD11 . LEU B 1 46  ? -19.232 -26.782 7.473   1.00 28.39  ? 383 LEU C HD11 1 
ATOM   6497  H HD12 . LEU B 1 46  ? -18.809 -25.419 6.814   1.00 28.39  ? 383 LEU C HD12 1 
ATOM   6498  H HD13 . LEU B 1 46  ? -17.751 -26.569 6.992   1.00 28.39  ? 383 LEU C HD13 1 
ATOM   6499  H HD21 . LEU B 1 46  ? -18.484 -27.347 9.767   1.00 27.74  ? 383 LEU C HD21 1 
ATOM   6500  H HD22 . LEU B 1 46  ? -16.976 -27.158 9.364   1.00 27.74  ? 383 LEU C HD22 1 
ATOM   6501  H HD23 . LEU B 1 46  ? -17.574 -26.348 10.572  1.00 27.74  ? 383 LEU C HD23 1 
ATOM   6502  N N    . LEU B 1 47  ? -14.454 -23.247 10.246  1.00 21.56  ? 384 LEU C N    1 
ATOM   6503  C CA   . LEU B 1 47  ? -13.219 -22.475 10.200  1.00 25.01  ? 384 LEU C CA   1 
ATOM   6504  C C    . LEU B 1 47  ? -12.144 -23.229 9.417   1.00 29.06  ? 384 LEU C C    1 
ATOM   6505  O O    . LEU B 1 47  ? -11.959 -24.424 9.636   1.00 26.18  ? 384 LEU C O    1 
ATOM   6506  C CB   . LEU B 1 47  ? -12.746 -22.254 11.642  1.00 28.04  ? 384 LEU C CB   1 
ATOM   6507  C CG   . LEU B 1 47  ? -11.529 -21.385 11.936  1.00 50.20  ? 384 LEU C CG   1 
ATOM   6508  C CD1  . LEU B 1 47  ? -11.824 -19.918 11.676  1.00 48.47  ? 384 LEU C CD1  1 
ATOM   6509  C CD2  . LEU B 1 47  ? -11.121 -21.591 13.391  1.00 59.88  ? 384 LEU C CD2  1 
ATOM   6510  H H    . LEU B 1 47  ? -14.376 -23.999 10.656  1.00 25.87  ? 384 LEU C H    1 
ATOM   6511  H HA   . LEU B 1 47  ? -13.378 -21.606 9.775   1.00 30.01  ? 384 LEU C HA   1 
ATOM   6512  H HB2  . LEU B 1 47  ? -13.486 -21.861 12.131  1.00 33.65  ? 384 LEU C HB2  1 
ATOM   6513  H HB3  . LEU B 1 47  ? -12.555 -23.127 12.020  1.00 33.65  ? 384 LEU C HB3  1 
ATOM   6514  H HG   . LEU B 1 47  ? -10.792 -21.657 11.368  1.00 60.24  ? 384 LEU C HG   1 
ATOM   6515  H HD11 . LEU B 1 47  ? -11.038 -19.402 11.871  1.00 58.17  ? 384 LEU C HD11 1 
ATOM   6516  H HD12 . LEU B 1 47  ? -12.067 -19.807 10.754  1.00 58.17  ? 384 LEU C HD12 1 
ATOM   6517  H HD13 . LEU B 1 47  ? -12.547 -19.639 12.242  1.00 58.17  ? 384 LEU C HD13 1 
ATOM   6518  H HD21 . LEU B 1 47  ? -10.354 -21.045 13.580  1.00 71.86  ? 384 LEU C HD21 1 
ATOM   6519  H HD22 . LEU B 1 47  ? -11.852 -21.338 13.960  1.00 71.86  ? 384 LEU C HD22 1 
ATOM   6520  H HD23 . LEU B 1 47  ? -10.905 -22.517 13.527  1.00 71.86  ? 384 LEU C HD23 1 
ATOM   6521  N N    . ASP B 1 48  ? -11.448 -22.542 8.509   1.00 20.03  ? 385 ASP C N    1 
ATOM   6522  C CA   . ASP B 1 48  ? -10.234 -23.081 7.865   1.00 23.01  ? 385 ASP C CA   1 
ATOM   6523  C C    . ASP B 1 48  ? -10.492 -24.287 6.977   1.00 35.14  ? 385 ASP C C    1 
ATOM   6524  O O    . ASP B 1 48  ? -10.036 -25.410 7.273   1.00 25.36  ? 385 ASP C O    1 
ATOM   6525  C CB   . ASP B 1 48  ? -9.193  -23.455 8.930   1.00 29.83  ? 385 ASP C CB   1 
ATOM   6526  C CG   . ASP B 1 48  ? -8.517  -22.239 9.517   1.00 37.71  ? 385 ASP C CG   1 
ATOM   6527  O OD1  . ASP B 1 48  ? -8.355  -21.257 8.777   1.00 30.00  ? 385 ASP C OD1  1 
ATOM   6528  O OD2  . ASP B 1 48  ? -8.154  -22.250 10.704  1.00 29.14  ? 385 ASP C OD2  1 
ATOM   6529  H H    . ASP B 1 48  ? -11.657 -21.751 8.242   1.00 24.04  ? 385 ASP C H    1 
ATOM   6530  H HA   . ASP B 1 48  ? -9.843  -22.380 7.303   1.00 27.61  ? 385 ASP C HA   1 
ATOM   6531  H HB2  . ASP B 1 48  ? -9.632  -23.933 9.650   1.00 35.80  ? 385 ASP C HB2  1 
ATOM   6532  H HB3  . ASP B 1 48  ? -8.510  -24.013 8.525   1.00 35.80  ? 385 ASP C HB3  1 
ATOM   6533  N N    . LEU B 1 49  ? -11.199 -24.051 5.878   1.00 22.95  ? 386 LEU C N    1 
ATOM   6534  C CA   . LEU B 1 49  ? -11.573 -25.118 4.963   1.00 24.79  ? 386 LEU C CA   1 
ATOM   6535  C C    . LEU B 1 49  ? -10.764 -25.086 3.670   1.00 33.74  ? 386 LEU C C    1 
ATOM   6536  O O    . LEU B 1 49  ? -10.505 -24.020 3.102   1.00 30.11  ? 386 LEU C O    1 
ATOM   6537  C CB   . LEU B 1 49  ? -13.058 -25.025 4.626   1.00 21.56  ? 386 LEU C CB   1 
ATOM   6538  C CG   . LEU B 1 49  ? -14.022 -25.050 5.812   1.00 29.54  ? 386 LEU C CG   1 
ATOM   6539  C CD1  . LEU B 1 49  ? -15.460 -24.957 5.301   1.00 21.54  ? 386 LEU C CD1  1 
ATOM   6540  C CD2  . LEU B 1 49  ? -13.807 -26.314 6.673   1.00 26.90  ? 386 LEU C CD2  1 
ATOM   6541  H H    . LEU B 1 49  ? -11.476 -23.273 5.638   1.00 27.54  ? 386 LEU C H    1 
ATOM   6542  H HA   . LEU B 1 49  ? -11.414 -25.982 5.399   1.00 29.74  ? 386 LEU C HA   1 
ATOM   6543  H HB2  . LEU B 1 49  ? -13.209 -24.194 4.149   1.00 25.88  ? 386 LEU C HB2  1 
ATOM   6544  H HB3  . LEU B 1 49  ? -13.287 -25.772 4.052   1.00 25.88  ? 386 LEU C HB3  1 
ATOM   6545  H HG   . LEU B 1 49  ? -13.853 -24.276 6.371   1.00 35.45  ? 386 LEU C HG   1 
ATOM   6546  H HD11 . LEU B 1 49  ? -16.059 -24.973 6.051   1.00 25.85  ? 386 LEU C HD11 1 
ATOM   6547  H HD12 . LEU B 1 49  ? -15.566 -24.136 4.815   1.00 25.85  ? 386 LEU C HD12 1 
ATOM   6548  H HD13 . LEU B 1 49  ? -15.636 -25.704 4.725   1.00 25.85  ? 386 LEU C HD13 1 
ATOM   6549  H HD21 . LEU B 1 49  ? -14.425 -26.300 7.407   1.00 32.28  ? 386 LEU C HD21 1 
ATOM   6550  H HD22 . LEU B 1 49  ? -13.959 -27.091 6.131   1.00 32.28  ? 386 LEU C HD22 1 
ATOM   6551  H HD23 . LEU B 1 49  ? -12.905 -26.316 7.004   1.00 32.28  ? 386 LEU C HD23 1 
ATOM   6552  N N    . THR B 1 50  ? -10.372 -26.275 3.219   1.00 26.91  ? 387 THR C N    1 
ATOM   6553  C CA   . THR B 1 50  ? -9.702  -26.453 1.952   1.00 25.22  ? 387 THR C CA   1 
ATOM   6554  C C    . THR B 1 50  ? -10.758 -26.346 0.867   1.00 25.68  ? 387 THR C C    1 
ATOM   6555  O O    . THR B 1 50  ? -11.946 -26.229 1.171   1.00 27.29  ? 387 THR C O    1 
ATOM   6556  C CB   . THR B 1 50  ? -9.054  -27.844 1.879   1.00 23.14  ? 387 THR C CB   1 
ATOM   6557  O OG1  . THR B 1 50  ? -10.083 -28.844 1.832   1.00 28.05  ? 387 THR C OG1  1 
ATOM   6558  C CG2  . THR B 1 50  ? -8.177  -28.077 3.102   1.00 31.24  ? 387 THR C CG2  1 
ATOM   6559  H H    . THR B 1 50  ? -10.491 -27.011 3.649   1.00 32.29  ? 387 THR C H    1 
ATOM   6560  H HA   . THR B 1 50  ? -9.020  -25.761 1.819   1.00 30.27  ? 387 THR C HA   1 
ATOM   6561  H HB   . THR B 1 50  ? -8.501  -27.906 1.085   1.00 27.77  ? 387 THR C HB   1 
ATOM   6562  H HG1  . THR B 1 50  ? -9.747  -29.591 1.794   1.00 33.66  ? 387 THR C HG1  1 
ATOM   6563  H HG21 . THR B 1 50  ? -7.774  -28.946 3.055   1.00 37.49  ? 387 THR C HG21 1 
ATOM   6564  H HG22 . THR B 1 50  ? -7.485  -27.413 3.141   1.00 37.49  ? 387 THR C HG22 1 
ATOM   6565  H HG23 . THR B 1 50  ? -8.708  -28.022 3.901   1.00 37.49  ? 387 THR C HG23 1 
ATOM   6566  N N    . GLU B 1 51  ? -10.349 -26.414 -0.396  1.00 26.63  ? 388 GLU C N    1 
ATOM   6567  C CA   . GLU B 1 51  ? -11.316 -26.271 -1.485  1.00 30.84  ? 388 GLU C CA   1 
ATOM   6568  C C    . GLU B 1 51  ? -12.360 -27.369 -1.406  1.00 28.80  ? 388 GLU C C    1 
ATOM   6569  O O    . GLU B 1 51  ? -13.559 -27.130 -1.491  1.00 26.51  ? 388 GLU C O    1 
ATOM   6570  C CB   . GLU B 1 51  ? -10.637 -26.331 -2.850  1.00 32.25  ? 388 GLU C CB   1 
ATOM   6571  C CG   . GLU B 1 51  ? -11.597 -25.973 -3.987  1.00 32.85  ? 388 GLU C CG   1 
ATOM   6572  C CD   . GLU B 1 51  ? -11.187 -26.531 -5.342  1.00 33.71  ? 388 GLU C CD   1 
ATOM   6573  O OE1  . GLU B 1 51  ? -9.976  -26.752 -5.581  1.00 27.97  ? 388 GLU C OE1  1 
ATOM   6574  O OE2  . GLU B 1 51  ? -12.095 -26.758 -6.170  1.00 28.98  ? 388 GLU C OE2  1 
ATOM   6575  H H    . GLU B 1 51  ? -9.537  -26.539 -0.647  1.00 31.96  ? 388 GLU C H    1 
ATOM   6576  H HA   . GLU B 1 51  ? -11.771 -25.406 -1.404  1.00 37.00  ? 388 GLU C HA   1 
ATOM   6577  H HB2  . GLU B 1 51  ? -9.900  -25.701 -2.867  1.00 38.69  ? 388 GLU C HB2  1 
ATOM   6578  H HB3  . GLU B 1 51  ? -10.311 -27.232 -3.003  1.00 38.69  ? 388 GLU C HB3  1 
ATOM   6579  H HG2  . GLU B 1 51  ? -12.476 -26.325 -3.775  1.00 39.42  ? 388 GLU C HG2  1 
ATOM   6580  H HG3  . GLU B 1 51  ? -11.640 -25.007 -4.065  1.00 39.42  ? 388 GLU C HG3  1 
ATOM   6581  N N    . TYR B 1 52  ? -11.880 -28.596 -1.248  1.00 32.32  ? 389 TYR C N    1 
ATOM   6582  C CA   . TYR B 1 52  ? -12.740 -29.757 -1.151  1.00 22.27  ? 389 TYR C CA   1 
ATOM   6583  C C    . TYR B 1 52  ? -13.731 -29.660 0.011   1.00 24.59  ? 389 TYR C C    1 
ATOM   6584  O O    . TYR B 1 52  ? -14.895 -30.023 -0.137  1.00 25.39  ? 389 TYR C O    1 
ATOM   6585  C CB   . TYR B 1 52  ? -11.853 -30.999 -0.979  1.00 30.65  ? 389 TYR C CB   1 
ATOM   6586  C CG   . TYR B 1 52  ? -12.582 -32.273 -0.678  1.00 43.42  ? 389 TYR C CG   1 
ATOM   6587  C CD1  . TYR B 1 52  ? -13.273 -32.956 -1.670  1.00 48.94  ? 389 TYR C CD1  1 
ATOM   6588  C CD2  . TYR B 1 52  ? -12.545 -32.824 0.599   1.00 54.83  ? 389 TYR C CD2  1 
ATOM   6589  C CE1  . TYR B 1 52  ? -13.928 -34.147 -1.391  1.00 57.55  ? 389 TYR C CE1  1 
ATOM   6590  C CE2  . TYR B 1 52  ? -13.192 -34.009 0.886   1.00 61.16  ? 389 TYR C CE2  1 
ATOM   6591  C CZ   . TYR B 1 52  ? -13.879 -34.669 -0.110  1.00 62.77  ? 389 TYR C CZ   1 
ATOM   6592  O OH   . TYR B 1 52  ? -14.521 -35.850 0.188   1.00 62.61  ? 389 TYR C OH   1 
ATOM   6593  H H    . TYR B 1 52  ? -11.042 -28.781 -1.193  1.00 38.78  ? 389 TYR C H    1 
ATOM   6594  H HA   . TYR B 1 52  ? -13.249 -29.854 -1.983  1.00 26.72  ? 389 TYR C HA   1 
ATOM   6595  H HB2  . TYR B 1 52  ? -11.353 -31.135 -1.799  1.00 36.78  ? 389 TYR C HB2  1 
ATOM   6596  H HB3  . TYR B 1 52  ? -11.236 -30.837 -0.248  1.00 36.78  ? 389 TYR C HB3  1 
ATOM   6597  H HD1  . TYR B 1 52  ? -13.303 -32.607 -2.531  1.00 58.73  ? 389 TYR C HD1  1 
ATOM   6598  H HD2  . TYR B 1 52  ? -12.079 -32.384 1.272   1.00 65.80  ? 389 TYR C HD2  1 
ATOM   6599  H HE1  . TYR B 1 52  ? -14.392 -34.594 -2.061  1.00 69.06  ? 389 TYR C HE1  1 
ATOM   6600  H HE2  . TYR B 1 52  ? -13.162 -34.361 1.746   1.00 73.40  ? 389 TYR C HE2  1 
ATOM   6601  H HH   . TYR B 1 52  ? -15.082 -35.725 0.773   1.00 75.13  ? 389 TYR C HH   1 
ATOM   6602  N N    . GLU B 1 53  ? -13.274 -29.186 1.168   1.00 20.39  ? 390 GLU C N    1 
ATOM   6603  C CA   . GLU B 1 53  ? -14.156 -29.077 2.332   1.00 19.49  ? 390 GLU C CA   1 
ATOM   6604  C C    . GLU B 1 53  ? -15.176 -27.935 2.118   1.00 23.49  ? 390 GLU C C    1 
ATOM   6605  O O    . GLU B 1 53  ? -16.342 -28.043 2.498   1.00 22.34  ? 390 GLU C O    1 
ATOM   6606  C CB   . GLU B 1 53  ? -13.340 -28.849 3.599   1.00 26.87  ? 390 GLU C CB   1 
ATOM   6607  C CG   . GLU B 1 53  ? -12.521 -30.088 4.002   1.00 30.26  ? 390 GLU C CG   1 
ATOM   6608  C CD   . GLU B 1 53  ? -11.337 -29.734 4.863   1.00 32.40  ? 390 GLU C CD   1 
ATOM   6609  O OE1  . GLU B 1 53  ? -11.084 -28.526 5.072   1.00 29.33  ? 390 GLU C OE1  1 
ATOM   6610  O OE2  . GLU B 1 53  ? -10.662 -30.663 5.346   1.00 30.77  ? 390 GLU C OE2  1 
ATOM   6611  H H    . GLU B 1 53  ? -12.467 -28.924 1.306   1.00 24.47  ? 390 GLU C H    1 
ATOM   6612  H HA   . GLU B 1 53  ? -14.654 -29.915 2.437   1.00 23.38  ? 390 GLU C HA   1 
ATOM   6613  H HB2  . GLU B 1 53  ? -12.723 -28.116 3.451   1.00 32.24  ? 390 GLU C HB2  1 
ATOM   6614  H HB3  . GLU B 1 53  ? -13.942 -28.636 4.330   1.00 32.24  ? 390 GLU C HB3  1 
ATOM   6615  H HG2  . GLU B 1 53  ? -13.088 -30.694 4.505   1.00 36.32  ? 390 GLU C HG2  1 
ATOM   6616  H HG3  . GLU B 1 53  ? -12.193 -30.525 3.202   1.00 36.32  ? 390 GLU C HG3  1 
ATOM   6617  N N    . MET B 1 54  ? -14.742 -26.862 1.475   1.00 27.98  ? 391 MET C N    1 
ATOM   6618  C CA   . MET B 1 54  ? -15.672 -25.777 1.175   1.00 30.49  ? 391 MET C CA   1 
ATOM   6619  C C    . MET B 1 54  ? -16.804 -26.296 0.292   1.00 28.87  ? 391 MET C C    1 
ATOM   6620  O O    . MET B 1 54  ? -17.973 -26.064 0.571   1.00 24.35  ? 391 MET C O    1 
ATOM   6621  C CB   . MET B 1 54  ? -14.949 -24.604 0.535   1.00 29.22  ? 391 MET C CB   1 
ATOM   6622  C CG   . MET B 1 54  ? -14.182 -23.780 1.543   1.00 23.80  ? 391 MET C CG   1 
ATOM   6623  S SD   . MET B 1 54  ? -13.439 -22.288 0.866   1.00 25.25  ? 391 MET C SD   1 
ATOM   6624  C CE   . MET B 1 54  ? -14.883 -21.209 0.681   1.00 20.86  ? 391 MET C CE   1 
ATOM   6625  H H    . MET B 1 54  ? -13.936 -26.736 1.204   1.00 33.58  ? 391 MET C H    1 
ATOM   6626  H HA   . MET B 1 54  ? -16.059 -25.459 2.018   1.00 36.59  ? 391 MET C HA   1 
ATOM   6627  H HB2  . MET B 1 54  ? -14.319 -24.939 -0.122  1.00 35.06  ? 391 MET C HB2  1 
ATOM   6628  H HB3  . MET B 1 54  ? -15.600 -24.026 0.106   1.00 35.06  ? 391 MET C HB3  1 
ATOM   6629  H HG2  . MET B 1 54  ? -14.787 -23.513 2.252   1.00 28.56  ? 391 MET C HG2  1 
ATOM   6630  H HG3  . MET B 1 54  ? -13.468 -24.325 1.911   1.00 28.56  ? 391 MET C HG3  1 
ATOM   6631  H HE1  . MET B 1 54  ? -14.598 -20.367 0.319   1.00 25.04  ? 391 MET C HE1  1 
ATOM   6632  H HE2  . MET B 1 54  ? -15.510 -21.627 0.086   1.00 25.04  ? 391 MET C HE2  1 
ATOM   6633  H HE3  . MET B 1 54  ? -15.286 -21.077 1.542   1.00 25.04  ? 391 MET C HE3  1 
ATOM   6634  N N    . ARG B 1 55  ? -16.458 -27.049 -0.743  1.00 23.77  ? 392 ARG C N    1 
ATOM   6635  C CA   . ARG B 1 55  ? -17.470 -27.588 -1.645  1.00 25.48  ? 392 ARG C CA   1 
ATOM   6636  C C    . ARG B 1 55  ? -18.431 -28.556 -0.959  1.00 29.79  ? 392 ARG C C    1 
ATOM   6637  O O    . ARG B 1 55  ? -19.628 -28.549 -1.249  1.00 24.88  ? 392 ARG C O    1 
ATOM   6638  C CB   . ARG B 1 55  ? -16.808 -28.239 -2.867  1.00 27.04  ? 392 ARG C CB   1 
ATOM   6639  C CG   . ARG B 1 55  ? -16.111 -27.221 -3.775  1.00 29.10  ? 392 ARG C CG   1 
ATOM   6640  C CD   . ARG B 1 55  ? -15.720 -27.808 -5.130  1.00 28.11  ? 392 ARG C CD   1 
ATOM   6641  N NE   . ARG B 1 55  ? -14.817 -26.924 -5.859  1.00 31.49  ? 392 ARG C NE   1 
ATOM   6642  C CZ   . ARG B 1 55  ? -15.205 -25.826 -6.512  1.00 37.68  ? 392 ARG C CZ   1 
ATOM   6643  N NH1  . ARG B 1 55  ? -16.483 -25.473 -6.529  1.00 31.24  ? 392 ARG C NH1  1 
ATOM   6644  N NH2  . ARG B 1 55  ? -14.319 -25.074 -7.144  1.00 31.45  ? 392 ARG C NH2  1 
ATOM   6645  H H    . ARG B 1 55  ? -15.650 -27.263 -0.945  1.00 28.52  ? 392 ARG C H    1 
ATOM   6646  H HA   . ARG B 1 55  ? -18.008 -26.839 -1.976  1.00 30.58  ? 392 ARG C HA   1 
ATOM   6647  H HB2  . ARG B 1 55  ? -16.143 -28.877 -2.564  1.00 32.44  ? 392 ARG C HB2  1 
ATOM   6648  H HB3  . ARG B 1 55  ? -17.488 -28.692 -3.391  1.00 32.44  ? 392 ARG C HB3  1 
ATOM   6649  H HG2  . ARG B 1 55  ? -16.710 -26.475 -3.933  1.00 34.92  ? 392 ARG C HG2  1 
ATOM   6650  H HG3  . ARG B 1 55  ? -15.302 -26.910 -3.338  1.00 34.92  ? 392 ARG C HG3  1 
ATOM   6651  H HD2  . ARG B 1 55  ? -15.270 -28.656 -4.994  1.00 33.73  ? 392 ARG C HD2  1 
ATOM   6652  H HD3  . ARG B 1 55  ? -16.519 -27.935 -5.666  1.00 33.73  ? 392 ARG C HD3  1 
ATOM   6653  H HE   . ARG B 1 55  ? -13.981 -27.124 -5.869  1.00 37.79  ? 392 ARG C HE   1 
ATOM   6654  H HH11 . ARG B 1 55  ? -17.067 -25.953 -6.120  1.00 37.49  ? 392 ARG C HH11 1 
ATOM   6655  H HH12 . ARG B 1 55  ? -16.727 -24.765 -6.951  1.00 37.49  ? 392 ARG C HH12 1 
ATOM   6656  H HH21 . ARG B 1 55  ? -13.487 -25.293 -7.140  1.00 37.74  ? 392 ARG C HH21 1 
ATOM   6657  H HH22 . ARG B 1 55  ? -14.575 -24.368 -7.564  1.00 37.74  ? 392 ARG C HH22 1 
ATOM   6658  N N    . ASN B 1 56  ? -17.920 -29.391 -0.051  1.00 29.25  ? 393 ASN C N    1 
ATOM   6659  C CA   . ASN B 1 56  ? -18.781 -30.321 0.673   1.00 32.75  ? 393 ASN C CA   1 
ATOM   6660  C C    . ASN B 1 56  ? -19.737 -29.575 1.586   1.00 30.10  ? 393 ASN C C    1 
ATOM   6661  O O    . ASN B 1 56  ? -20.911 -29.918 1.675   1.00 31.55  ? 393 ASN C O    1 
ATOM   6662  C CB   . ASN B 1 56  ? -17.955 -31.305 1.502   1.00 33.49  ? 393 ASN C CB   1 
ATOM   6663  C CG   . ASN B 1 56  ? -17.322 -32.380 0.652   1.00 44.44  ? 393 ASN C CG   1 
ATOM   6664  O OD1  . ASN B 1 56  ? -17.796 -32.673 -0.443  1.00 50.62  ? 393 ASN C OD1  1 
ATOM   6665  N ND2  . ASN B 1 56  ? -16.243 -32.974 1.148   1.00 44.50  ? 393 ASN C ND2  1 
ATOM   6666  H H    . ASN B 1 56  ? -17.087 -29.437 0.160   1.00 35.10  ? 393 ASN C H    1 
ATOM   6667  H HA   . ASN B 1 56  ? -19.312 -30.835 0.029   1.00 39.30  ? 393 ASN C HA   1 
ATOM   6668  H HB2  . ASN B 1 56  ? -17.246 -30.822 1.954   1.00 40.18  ? 393 ASN C HB2  1 
ATOM   6669  H HB3  . ASN B 1 56  ? -18.532 -31.735 2.152   1.00 40.18  ? 393 ASN C HB3  1 
ATOM   6670  H HD21 . ASN B 1 56  ? -15.940 -32.740 1.918   1.00 53.39  ? 393 ASN C HD21 1 
ATOM   6671  H HD22 . ASN B 1 56  ? -15.849 -33.593 0.700   1.00 53.39  ? 393 ASN C HD22 1 
ATOM   6672  N N    . ALA B 1 57  ? -19.220 -28.560 2.270   1.00 28.81  ? 394 ALA C N    1 
ATOM   6673  C CA   . ALA B 1 57  ? -20.045 -27.737 3.153   1.00 26.37  ? 394 ALA C CA   1 
ATOM   6674  C C    . ALA B 1 57  ? -21.156 -27.051 2.358   1.00 25.96  ? 394 ALA C C    1 
ATOM   6675  O O    . ALA B 1 57  ? -22.311 -27.055 2.775   1.00 23.56  ? 394 ALA C O    1 
ATOM   6676  C CB   . ALA B 1 57  ? -19.194 -26.720 3.883   1.00 20.17  ? 394 ALA C CB   1 
ATOM   6677  H H    . ALA B 1 57  ? -18.393 -28.325 2.241   1.00 34.57  ? 394 ALA C H    1 
ATOM   6678  H HA   . ALA B 1 57  ? -20.467 -28.315 3.824   1.00 31.64  ? 394 ALA C HA   1 
ATOM   6679  H HB1  . ALA B 1 57  ? -19.759 -26.194 4.455   1.00 24.21  ? 394 ALA C HB1  1 
ATOM   6680  H HB2  . ALA B 1 57  ? -18.536 -27.182 4.408   1.00 24.21  ? 394 ALA C HB2  1 
ATOM   6681  H HB3  . ALA B 1 57  ? -18.762 -26.154 3.239   1.00 24.21  ? 394 ALA C HB3  1 
ATOM   6682  N N    . VAL B 1 58  ? -20.814 -26.476 1.207   1.00 29.96  ? 395 VAL C N    1 
ATOM   6683  C CA   . VAL B 1 58  ? -21.833 -25.855 0.355   1.00 28.49  ? 395 VAL C CA   1 
ATOM   6684  C C    . VAL B 1 58  ? -22.890 -26.871 -0.080  1.00 33.99  ? 395 VAL C C    1 
ATOM   6685  O O    . VAL B 1 58  ? -24.073 -26.540 -0.129  1.00 31.58  ? 395 VAL C O    1 
ATOM   6686  C CB   . VAL B 1 58  ? -21.230 -25.190 -0.887  1.00 27.98  ? 395 VAL C CB   1 
ATOM   6687  C CG1  . VAL B 1 58  ? -22.347 -24.717 -1.849  1.00 23.38  ? 395 VAL C CG1  1 
ATOM   6688  C CG2  . VAL B 1 58  ? -20.346 -24.033 -0.471  1.00 24.32  ? 395 VAL C CG2  1 
ATOM   6689  H H    . VAL B 1 58  ? -20.012 -26.430 0.898   1.00 35.95  ? 395 VAL C H    1 
ATOM   6690  H HA   . VAL B 1 58  ? -22.288 -25.158 0.872   1.00 34.19  ? 395 VAL C HA   1 
ATOM   6691  H HB   . VAL B 1 58  ? -20.674 -25.843 -1.363  1.00 33.57  ? 395 VAL C HB   1 
ATOM   6692  H HG11 . VAL B 1 58  ? -21.944 -24.305 -2.617  1.00 28.06  ? 395 VAL C HG11 1 
ATOM   6693  H HG12 . VAL B 1 58  ? -22.868 -25.476 -2.120  1.00 28.06  ? 395 VAL C HG12 1 
ATOM   6694  H HG13 . VAL B 1 58  ? -22.904 -24.083 -1.392  1.00 28.06  ? 395 VAL C HG13 1 
ATOM   6695  H HG21 . VAL B 1 58  ? -19.974 -23.625 -1.257  1.00 29.18  ? 395 VAL C HG21 1 
ATOM   6696  H HG22 . VAL B 1 58  ? -20.876 -23.393 0.010   1.00 29.18  ? 395 VAL C HG22 1 
ATOM   6697  H HG23 . VAL B 1 58  ? -19.641 -24.364 0.091   1.00 29.18  ? 395 VAL C HG23 1 
ATOM   6698  N N    . ASP B 1 59  ? -22.479 -28.108 -0.369  1.00 32.01  ? 396 ASP C N    1 
ATOM   6699  C CA   . ASP B 1 59  ? -23.434 -29.134 -0.786  1.00 34.82  ? 396 ASP C CA   1 
ATOM   6700  C C    . ASP B 1 59  ? -24.365 -29.523 0.355   1.00 33.48  ? 396 ASP C C    1 
ATOM   6701  O O    . ASP B 1 59  ? -25.536 -29.810 0.131   1.00 36.68  ? 396 ASP C O    1 
ATOM   6702  C CB   . ASP B 1 59  ? -22.714 -30.379 -1.323  1.00 42.19  ? 396 ASP C CB   1 
ATOM   6703  C CG   . ASP B 1 59  ? -21.961 -30.103 -2.610  1.00 51.41  ? 396 ASP C CG   1 
ATOM   6704  O OD1  . ASP B 1 59  ? -22.307 -29.123 -3.302  1.00 59.02  ? 396 ASP C OD1  1 
ATOM   6705  O OD2  . ASP B 1 59  ? -21.025 -30.860 -2.932  1.00 59.18  ? 396 ASP C OD2  1 
ATOM   6706  H H    . ASP B 1 59  ? -21.662 -28.375 -0.332  1.00 38.42  ? 396 ASP C H    1 
ATOM   6707  H HA   . ASP B 1 59  ? -23.986 -28.773 -1.512  1.00 41.79  ? 396 ASP C HA   1 
ATOM   6708  H HB2  . ASP B 1 59  ? -22.075 -30.686 -0.661  1.00 50.63  ? 396 ASP C HB2  1 
ATOM   6709  H HB3  . ASP B 1 59  ? -23.368 -31.073 -1.500  1.00 50.63  ? 396 ASP C HB3  1 
ATOM   6710  N N    . GLU B 1 60  ? -23.844 -29.528 1.579   1.00 26.04  ? 397 GLU C N    1 
ATOM   6711  C CA   . GLU B 1 60  ? -24.657 -29.834 2.755   1.00 28.64  ? 397 GLU C CA   1 
ATOM   6712  C C    . GLU B 1 60  ? -25.652 -28.712 2.995   1.00 30.62  ? 397 GLU C C    1 
ATOM   6713  O O    . GLU B 1 60  ? -26.819 -28.947 3.310   1.00 36.06  ? 397 GLU C O    1 
ATOM   6714  C CB   . GLU B 1 60  ? -23.766 -30.022 3.983   1.00 31.78  ? 397 GLU C CB   1 
ATOM   6715  C CG   . GLU B 1 60  ? -22.860 -31.251 3.894   1.00 35.70  ? 397 GLU C CG   1 
ATOM   6716  C CD   . GLU B 1 60  ? -23.620 -32.578 4.032   1.00 51.92  ? 397 GLU C CD   1 
ATOM   6717  O OE1  . GLU B 1 60  ? -24.655 -32.621 4.733   1.00 42.64  ? 397 GLU C OE1  1 
ATOM   6718  O OE2  . GLU B 1 60  ? -23.174 -33.585 3.441   1.00 50.80  ? 397 GLU C OE2  1 
ATOM   6719  H H    . GLU B 1 60  ? -23.020 -29.359 1.757   1.00 31.24  ? 397 GLU C H    1 
ATOM   6720  H HA   . GLU B 1 60  ? -25.155 -30.663 2.601   1.00 34.37  ? 397 GLU C HA   1 
ATOM   6721  H HB2  . GLU B 1 60  ? -23.199 -29.242 4.082   1.00 38.13  ? 397 GLU C HB2  1 
ATOM   6722  H HB3  . GLU B 1 60  ? -24.329 -30.123 4.766   1.00 38.13  ? 397 GLU C HB3  1 
ATOM   6723  H HG2  . GLU B 1 60  ? -22.415 -31.251 3.032   1.00 42.84  ? 397 GLU C HG2  1 
ATOM   6724  H HG3  . GLU B 1 60  ? -22.203 -31.209 4.606   1.00 42.84  ? 397 GLU C HG3  1 
ATOM   6725  N N    . PHE B 1 61  ? -25.165 -27.488 2.839   1.00 29.99  ? 398 PHE C N    1 
ATOM   6726  C CA   . PHE B 1 61  ? -25.985 -26.287 2.935   1.00 26.78  ? 398 PHE C CA   1 
ATOM   6727  C C    . PHE B 1 61  ? -27.155 -26.381 1.958   1.00 27.57  ? 398 PHE C C    1 
ATOM   6728  O O    . PHE B 1 61  ? -28.302 -26.123 2.319   1.00 38.89  ? 398 PHE C O    1 
ATOM   6729  C CB   . PHE B 1 61  ? -25.085 -25.082 2.630   1.00 27.41  ? 398 PHE C CB   1 
ATOM   6730  C CG   . PHE B 1 61  ? -25.800 -23.761 2.544   1.00 27.12  ? 398 PHE C CG   1 
ATOM   6731  C CD1  . PHE B 1 61  ? -26.608 -23.311 3.576   1.00 26.29  ? 398 PHE C CD1  1 
ATOM   6732  C CD2  . PHE B 1 61  ? -25.598 -22.934 1.439   1.00 28.55  ? 398 PHE C CD2  1 
ATOM   6733  C CE1  . PHE B 1 61  ? -27.242 -22.073 3.493   1.00 30.31  ? 398 PHE C CE1  1 
ATOM   6734  C CE2  . PHE B 1 61  ? -26.227 -21.699 1.350   1.00 29.84  ? 398 PHE C CE2  1 
ATOM   6735  C CZ   . PHE B 1 61  ? -27.048 -21.268 2.380   1.00 29.85  ? 398 PHE C CZ   1 
ATOM   6736  H H    . PHE B 1 61  ? -24.338 -27.323 2.673   1.00 35.99  ? 398 PHE C H    1 
ATOM   6737  H HA   . PHE B 1 61  ? -26.338 -26.197 3.844   1.00 32.14  ? 398 PHE C HA   1 
ATOM   6738  H HB2  . PHE B 1 61  ? -24.419 -25.009 3.332   1.00 32.89  ? 398 PHE C HB2  1 
ATOM   6739  H HB3  . PHE B 1 61  ? -24.645 -25.233 1.779   1.00 32.89  ? 398 PHE C HB3  1 
ATOM   6740  H HD1  . PHE B 1 61  ? -26.742 -23.848 4.323   1.00 31.55  ? 398 PHE C HD1  1 
ATOM   6741  H HD2  . PHE B 1 61  ? -25.049 -23.220 0.745   1.00 34.26  ? 398 PHE C HD2  1 
ATOM   6742  H HE1  . PHE B 1 61  ? -27.793 -21.785 4.184   1.00 36.37  ? 398 PHE C HE1  1 
ATOM   6743  H HE2  . PHE B 1 61  ? -26.096 -21.162 0.602   1.00 35.81  ? 398 PHE C HE2  1 
ATOM   6744  H HZ   . PHE B 1 61  ? -27.472 -20.442 2.324   1.00 35.82  ? 398 PHE C HZ   1 
ATOM   6745  N N    . LEU B 1 62  ? -26.870 -26.779 0.724   1.00 26.83  ? 399 LEU C N    1 
ATOM   6746  C CA   . LEU B 1 62  ? -27.892 -26.783 -0.318  1.00 43.37  ? 399 LEU C CA   1 
ATOM   6747  C C    . LEU B 1 62  ? -28.948 -27.845 -0.040  1.00 41.57  ? 399 LEU C C    1 
ATOM   6748  O O    . LEU B 1 62  ? -30.104 -27.697 -0.440  1.00 38.53  ? 399 LEU C O    1 
ATOM   6749  C CB   . LEU B 1 62  ? -27.267 -27.006 -1.699  1.00 38.29  ? 399 LEU C CB   1 
ATOM   6750  C CG   . LEU B 1 62  ? -26.309 -25.916 -2.184  1.00 34.54  ? 399 LEU C CG   1 
ATOM   6751  C CD1  . LEU B 1 62  ? -25.511 -26.373 -3.402  1.00 28.58  ? 399 LEU C CD1  1 
ATOM   6752  C CD2  . LEU B 1 62  ? -27.070 -24.637 -2.498  1.00 42.90  ? 399 LEU C CD2  1 
ATOM   6753  H H    . LEU B 1 62  ? -26.096 -27.050 0.464   1.00 32.20  ? 399 LEU C H    1 
ATOM   6754  H HA   . LEU B 1 62  ? -28.338 -25.911 -0.327  1.00 52.05  ? 399 LEU C HA   1 
ATOM   6755  H HB2  . LEU B 1 62  ? -26.770 -27.839 -1.678  1.00 45.95  ? 399 LEU C HB2  1 
ATOM   6756  H HB3  . LEU B 1 62  ? -27.982 -27.073 -2.350  1.00 45.95  ? 399 LEU C HB3  1 
ATOM   6757  H HG   . LEU B 1 62  ? -25.678 -25.718 -1.475  1.00 41.45  ? 399 LEU C HG   1 
ATOM   6758  H HD11 . LEU B 1 62  ? -24.925 -25.664 -3.675  1.00 34.29  ? 399 LEU C HD11 1 
ATOM   6759  H HD12 . LEU B 1 62  ? -24.999 -27.150 -3.167  1.00 34.29  ? 399 LEU C HD12 1 
ATOM   6760  H HD13 . LEU B 1 62  ? -26.121 -26.585 -4.113  1.00 34.29  ? 399 LEU C HD13 1 
ATOM   6761  H HD21 . LEU B 1 62  ? -26.448 -23.971 -2.799  1.00 51.48  ? 399 LEU C HD21 1 
ATOM   6762  H HD22 . LEU B 1 62  ? -27.715 -24.819 -3.185  1.00 51.48  ? 399 LEU C HD22 1 
ATOM   6763  H HD23 . LEU B 1 62  ? -27.514 -24.335 -1.702  1.00 51.48  ? 399 LEU C HD23 1 
ATOM   6764  N N    . LEU B 1 63  ? -28.552 -28.910 0.652   1.00 34.42  ? 400 LEU C N    1 
ATOM   6765  C CA   . LEU B 1 63  ? -29.472 -29.996 0.976   1.00 35.50  ? 400 LEU C CA   1 
ATOM   6766  C C    . LEU B 1 63  ? -30.586 -29.525 1.896   1.00 36.71  ? 400 LEU C C    1 
ATOM   6767  O O    . LEU B 1 63  ? -31.708 -30.036 1.847   1.00 45.62  ? 400 LEU C O    1 
ATOM   6768  C CB   . LEU B 1 63  ? -28.726 -31.150 1.651   1.00 42.54  ? 400 LEU C CB   1 
ATOM   6769  C CG   . LEU B 1 63  ? -27.903 -32.090 0.768   1.00 55.18  ? 400 LEU C CG   1 
ATOM   6770  C CD1  . LEU B 1 63  ? -27.531 -33.340 1.567   1.00 53.36  ? 400 LEU C CD1  1 
ATOM   6771  C CD2  . LEU B 1 63  ? -28.667 -32.475 -0.488  1.00 59.69  ? 400 LEU C CD2  1 
ATOM   6772  H H    . LEU B 1 63  ? -27.753 -29.028 0.947   1.00 41.30  ? 400 LEU C H    1 
ATOM   6773  H HA   . LEU B 1 63  ? -29.877 -30.333 0.150   1.00 42.60  ? 400 LEU C HA   1 
ATOM   6774  H HB2  . LEU B 1 63  ? -28.116 -30.770 2.303   1.00 51.05  ? 400 LEU C HB2  1 
ATOM   6775  H HB3  . LEU B 1 63  ? -29.380 -31.698 2.113   1.00 51.05  ? 400 LEU C HB3  1 
ATOM   6776  H HG   . LEU B 1 63  ? -27.084 -31.644 0.501   1.00 66.22  ? 400 LEU C HG   1 
ATOM   6777  H HD11 . LEU B 1 63  ? -27.015 -33.925 1.008   1.00 64.04  ? 400 LEU C HD11 1 
ATOM   6778  H HD12 . LEU B 1 63  ? -27.014 -33.078 2.333   1.00 64.04  ? 400 LEU C HD12 1 
ATOM   6779  H HD13 . LEU B 1 63  ? -28.335 -33.781 1.850   1.00 64.04  ? 400 LEU C HD13 1 
ATOM   6780  H HD21 . LEU B 1 63  ? -28.123 -33.063 -1.016  1.00 71.63  ? 400 LEU C HD21 1 
ATOM   6781  H HD22 . LEU B 1 63  ? -29.480 -32.919 -0.235  1.00 71.63  ? 400 LEU C HD22 1 
ATOM   6782  H HD23 . LEU B 1 63  ? -28.870 -31.680 -0.986  1.00 71.63  ? 400 LEU C HD23 1 
ATOM   6783  N N    . LEU B 1 64  ? -30.264 -28.565 2.756   1.00 27.02  ? 401 LEU C N    1 
ATOM   6784  C CA   . LEU B 1 64  ? -31.248 -28.005 3.676   1.00 36.85  ? 401 LEU C CA   1 
ATOM   6785  C C    . LEU B 1 64  ? -32.102 -26.916 3.019   1.00 53.59  ? 401 LEU C C    1 
ATOM   6786  O O    . LEU B 1 64  ? -33.080 -26.450 3.607   1.00 56.58  ? 401 LEU C O    1 
ATOM   6787  C CB   . LEU B 1 64  ? -30.546 -27.433 4.902   1.00 38.80  ? 401 LEU C CB   1 
ATOM   6788  C CG   . LEU B 1 64  ? -30.735 -28.252 6.174   1.00 63.38  ? 401 LEU C CG   1 
ATOM   6789  C CD1  . LEU B 1 64  ? -29.871 -29.506 6.137   1.00 57.46  ? 401 LEU C CD1  1 
ATOM   6790  C CD2  . LEU B 1 64  ? -30.412 -27.395 7.379   1.00 73.78  ? 401 LEU C CD2  1 
ATOM   6791  H H    . LEU B 1 64  ? -29.480 -28.219 2.826   1.00 32.42  ? 401 LEU C H    1 
ATOM   6792  H HA   . LEU B 1 64  ? -31.847 -28.720 3.976   1.00 44.22  ? 401 LEU C HA   1 
ATOM   6793  H HB2  . LEU B 1 64  ? -29.595 -27.384 4.721   1.00 46.56  ? 401 LEU C HB2  1 
ATOM   6794  H HB3  . LEU B 1 64  ? -30.893 -26.543 5.071   1.00 46.56  ? 401 LEU C HB3  1 
ATOM   6795  H HG   . LEU B 1 64  ? -31.663 -28.527 6.239   1.00 76.06  ? 401 LEU C HG   1 
ATOM   6796  H HD11 . LEU B 1 64  ? -30.008 -30.003 6.947   1.00 68.95  ? 401 LEU C HD11 1 
ATOM   6797  H HD12 . LEU B 1 64  ? -30.125 -30.038 5.379   1.00 68.95  ? 401 LEU C HD12 1 
ATOM   6798  H HD13 . LEU B 1 64  ? -28.949 -29.249 6.062   1.00 68.95  ? 401 LEU C HD13 1 
ATOM   6799  H HD21 . LEU B 1 64  ? -30.533 -27.918 8.175   1.00 88.53  ? 401 LEU C HD21 1 
ATOM   6800  H HD22 . LEU B 1 64  ? -29.501 -27.099 7.317   1.00 88.53  ? 401 LEU C HD22 1 
ATOM   6801  H HD23 . LEU B 1 64  ? -31.002 -26.638 7.391   1.00 88.53  ? 401 LEU C HD23 1 
ATOM   6802  N N    . LEU B 1 65  ? -31.730 -26.505 1.810   1.00 47.70  ? 402 LEU C N    1 
ATOM   6803  C CA   . LEU B 1 65  ? -32.491 -25.482 1.090   1.00 43.46  ? 402 LEU C CA   1 
ATOM   6804  C C    . LEU B 1 65  ? -33.619 -26.103 0.270   1.00 47.30  ? 402 LEU C C    1 
ATOM   6805  O O    . LEU B 1 65  ? -33.415 -27.078 -0.451  1.00 41.72  ? 402 LEU C O    1 
ATOM   6806  C CB   . LEU B 1 65  ? -31.579 -24.661 0.179   1.00 35.70  ? 402 LEU C CB   1 
ATOM   6807  C CG   . LEU B 1 65  ? -30.488 -23.813 0.842   1.00 32.51  ? 402 LEU C CG   1 
ATOM   6808  C CD1  . LEU B 1 65  ? -29.903 -22.830 -0.179  1.00 26.42  ? 402 LEU C CD1  1 
ATOM   6809  C CD2  . LEU B 1 65  ? -31.008 -23.074 2.064   1.00 30.55  ? 402 LEU C CD2  1 
ATOM   6810  H H    . LEU B 1 65  ? -31.043 -26.799 1.384   1.00 57.24  ? 402 LEU C H    1 
ATOM   6811  H HA   . LEU B 1 65  ? -32.895 -24.871 1.742   1.00 52.15  ? 402 LEU C HA   1 
ATOM   6812  H HB2  . LEU B 1 65  ? -31.133 -25.272 -0.428  1.00 42.85  ? 402 LEU C HB2  1 
ATOM   6813  H HB3  . LEU B 1 65  ? -32.135 -24.054 -0.334  1.00 42.85  ? 402 LEU C HB3  1 
ATOM   6814  H HG   . LEU B 1 65  ? -29.771 -24.399 1.133   1.00 39.01  ? 402 LEU C HG   1 
ATOM   6815  H HD11 . LEU B 1 65  ? -29.221 -22.305 0.248   1.00 31.70  ? 402 LEU C HD11 1 
ATOM   6816  H HD12 . LEU B 1 65  ? -29.526 -23.325 -0.909  1.00 31.70  ? 402 LEU C HD12 1 
ATOM   6817  H HD13 . LEU B 1 65  ? -30.605 -22.258 -0.498  1.00 31.70  ? 402 LEU C HD13 1 
ATOM   6818  H HD21 . LEU B 1 65  ? -30.294 -22.559 2.445   1.00 36.66  ? 402 LEU C HD21 1 
ATOM   6819  H HD22 . LEU B 1 65  ? -31.725 -22.494 1.796   1.00 36.66  ? 402 LEU C HD22 1 
ATOM   6820  H HD23 . LEU B 1 65  ? -31.328 -23.715 2.704   1.00 36.66  ? 402 LEU C HD23 1 
ATOM   6821  N N    . ASP B 1 66  ? -34.811 -25.524 0.382   1.00 39.36  ? 403 ASP C N    1 
ATOM   6822  C CA   . ASP B 1 66  ? -35.971 -26.005 -0.357  1.00 41.04  ? 403 ASP C CA   1 
ATOM   6823  C C    . ASP B 1 66  ? -36.878 -24.822 -0.646  1.00 38.20  ? 403 ASP C C    1 
ATOM   6824  O O    . ASP B 1 66  ? -36.522 -23.677 -0.366  1.00 39.26  ? 403 ASP C O    1 
ATOM   6825  C CB   . ASP B 1 66  ? -36.720 -27.079 0.449   1.00 35.77  ? 403 ASP C CB   1 
ATOM   6826  C CG   . ASP B 1 66  ? -37.451 -28.077 -0.436  1.00 58.26  ? 403 ASP C CG   1 
ATOM   6827  O OD1  . ASP B 1 66  ? -37.682 -27.783 -1.630  1.00 58.46  ? 403 ASP C OD1  1 
ATOM   6828  O OD2  . ASP B 1 66  ? -37.803 -29.163 0.071   1.00 75.19  ? 403 ASP C OD2  1 
ATOM   6829  H H    . ASP B 1 66  ? -34.974 -24.846 0.884   1.00 47.23  ? 403 ASP C H    1 
ATOM   6830  H HA   . ASP B 1 66  ? -35.682 -26.396 -1.208  1.00 49.24  ? 403 ASP C HA   1 
ATOM   6831  H HB2  . ASP B 1 66  ? -36.082 -27.569 0.990   1.00 42.92  ? 403 ASP C HB2  1 
ATOM   6832  H HB3  . ASP B 1 66  ? -37.375 -26.646 1.018   1.00 42.92  ? 403 ASP C HB3  1 
ATOM   6833  N N    . LYS B 1 67  ? -38.048 -25.093 -1.204  1.00 35.52  ? 404 LYS C N    1 
ATOM   6834  C CA   . LYS B 1 67  ? -38.948 -24.034 -1.633  1.00 55.68  ? 404 LYS C CA   1 
ATOM   6835  C C    . LYS B 1 67  ? -39.351 -23.172 -0.448  1.00 42.94  ? 404 LYS C C    1 
ATOM   6836  O O    . LYS B 1 67  ? -39.825 -23.688 0.559   1.00 36.34  ? 404 LYS C O    1 
ATOM   6837  C CB   . LYS B 1 67  ? -40.190 -24.639 -2.287  1.00 74.33  ? 404 LYS C CB   1 
ATOM   6838  C CG   . LYS B 1 67  ? -41.021 -23.655 -3.093  1.00 81.02  ? 404 LYS C CG   1 
ATOM   6839  C CD   . LYS B 1 67  ? -42.116 -24.381 -3.856  1.00 93.10  ? 404 LYS C CD   1 
ATOM   6840  C CE   . LYS B 1 67  ? -42.709 -23.515 -4.947  1.00 102.78 ? 404 LYS C CE   1 
ATOM   6841  N NZ   . LYS B 1 67  ? -43.564 -24.311 -5.871  1.00 113.29 ? 404 LYS C NZ   1 
ATOM   6842  H H    . LYS B 1 67  ? -38.347 -25.887 -1.346  1.00 42.62  ? 404 LYS C H    1 
ATOM   6843  H HA   . LYS B 1 67  ? -38.496 -23.466 -2.291  1.00 66.81  ? 404 LYS C HA   1 
ATOM   6844  H HB2  . LYS B 1 67  ? -39.910 -25.348 -2.887  1.00 89.20  ? 404 LYS C HB2  1 
ATOM   6845  H HB3  . LYS B 1 67  ? -40.759 -25.005 -1.592  1.00 89.20  ? 404 LYS C HB3  1 
ATOM   6846  H HG2  . LYS B 1 67  ? -41.437 -23.016 -2.493  1.00 97.22  ? 404 LYS C HG2  1 
ATOM   6847  H HG3  . LYS B 1 67  ? -40.452 -23.199 -3.732  1.00 97.22  ? 404 LYS C HG3  1 
ATOM   6848  H HD2  . LYS B 1 67  ? -41.743 -25.176 -4.268  1.00 111.72 ? 404 LYS C HD2  1 
ATOM   6849  H HD3  . LYS B 1 67  ? -42.826 -24.624 -3.241  1.00 111.72 ? 404 LYS C HD3  1 
ATOM   6850  H HE2  . LYS B 1 67  ? -43.258 -22.824 -4.545  1.00 123.33 ? 404 LYS C HE2  1 
ATOM   6851  H HE3  . LYS B 1 67  ? -41.992 -23.117 -5.465  1.00 123.33 ? 404 LYS C HE3  1 
ATOM   6852  H HZ1  . LYS B 1 67  ? -43.902 -23.784 -6.503  1.00 135.95 ? 404 LYS C HZ1  1 
ATOM   6853  H HZ2  . LYS B 1 67  ? -43.081 -24.952 -6.256  1.00 135.95 ? 404 LYS C HZ2  1 
ATOM   6854  H HZ3  . LYS B 1 67  ? -44.233 -24.686 -5.419  1.00 135.95 ? 404 LYS C HZ3  1 
ATOM   6855  N N    . GLY B 1 68  ? -39.148 -21.862 -0.565  1.00 39.48  ? 405 GLY C N    1 
ATOM   6856  C CA   . GLY B 1 68  ? -39.544 -20.929 0.475   1.00 41.14  ? 405 GLY C CA   1 
ATOM   6857  C C    . GLY B 1 68  ? -38.488 -20.704 1.544   1.00 38.80  ? 405 GLY C C    1 
ATOM   6858  O O    . GLY B 1 68  ? -38.607 -19.793 2.364   1.00 29.34  ? 405 GLY C O    1 
ATOM   6859  H H    . GLY B 1 68  ? -38.778 -21.488 -1.245  1.00 47.37  ? 405 GLY C H    1 
ATOM   6860  H HA2  . GLY B 1 68  ? -39.751 -20.072 0.071   1.00 49.37  ? 405 GLY C HA2  1 
ATOM   6861  H HA3  . GLY B 1 68  ? -40.346 -21.260 0.909   1.00 49.37  ? 405 GLY C HA3  1 
ATOM   6862  N N    . VAL B 1 69  ? -37.444 -21.526 1.538   1.00 32.34  ? 406 VAL C N    1 
ATOM   6863  C CA   . VAL B 1 69  ? -36.408 -21.440 2.568   1.00 28.39  ? 406 VAL C CA   1 
ATOM   6864  C C    . VAL B 1 69  ? -35.524 -20.208 2.377   1.00 27.91  ? 406 VAL C C    1 
ATOM   6865  O O    . VAL B 1 69  ? -35.226 -19.821 1.250   1.00 34.74  ? 406 VAL C O    1 
ATOM   6866  C CB   . VAL B 1 69  ? -35.540 -22.706 2.578   1.00 36.33  ? 406 VAL C CB   1 
ATOM   6867  C CG1  . VAL B 1 69  ? -34.369 -22.552 3.542   1.00 37.70  ? 406 VAL C CG1  1 
ATOM   6868  C CG2  . VAL B 1 69  ? -36.394 -23.926 2.948   1.00 39.09  ? 406 VAL C CG2  1 
ATOM   6869  H H    . VAL B 1 69  ? -37.310 -22.140 0.951   1.00 38.81  ? 406 VAL C H    1 
ATOM   6870  H HA   . VAL B 1 69  ? -36.839 -21.366 3.444   1.00 34.06  ? 406 VAL C HA   1 
ATOM   6871  H HB   . VAL B 1 69  ? -35.176 -22.852 1.680   1.00 43.60  ? 406 VAL C HB   1 
ATOM   6872  H HG11 . VAL B 1 69  ? -33.845 -23.356 3.528   1.00 45.25  ? 406 VAL C HG11 1 
ATOM   6873  H HG12 . VAL B 1 69  ? -33.832 -21.806 3.264   1.00 45.25  ? 406 VAL C HG12 1 
ATOM   6874  H HG13 . VAL B 1 69  ? -34.711 -22.399 4.426   1.00 45.25  ? 406 VAL C HG13 1 
ATOM   6875  H HG21 . VAL B 1 69  ? -35.838 -24.708 2.950   1.00 46.91  ? 406 VAL C HG21 1 
ATOM   6876  H HG22 . VAL B 1 69  ? -36.771 -23.789 3.820   1.00 46.91  ? 406 VAL C HG22 1 
ATOM   6877  H HG23 . VAL B 1 69  ? -37.095 -24.024 2.299   1.00 46.91  ? 406 VAL C HG23 1 
ATOM   6878  N N    . TYR B 1 70  ? -35.127 -19.580 3.482   1.00 24.37  ? 407 TYR C N    1 
ATOM   6879  C CA   . TYR B 1 70  ? -34.170 -18.482 3.435   1.00 30.62  ? 407 TYR C CA   1 
ATOM   6880  C C    . TYR B 1 70  ? -32.782 -19.079 3.578   1.00 32.13  ? 407 TYR C C    1 
ATOM   6881  O O    . TYR B 1 70  ? -32.535 -19.842 4.506   1.00 30.52  ? 407 TYR C O    1 
ATOM   6882  C CB   . TYR B 1 70  ? -34.393 -17.494 4.584   1.00 25.17  ? 407 TYR C CB   1 
ATOM   6883  C CG   . TYR B 1 70  ? -35.617 -16.603 4.474   1.00 31.06  ? 407 TYR C CG   1 
ATOM   6884  C CD1  . TYR B 1 70  ? -35.766 -15.503 5.311   1.00 27.61  ? 407 TYR C CD1  1 
ATOM   6885  C CD2  . TYR B 1 70  ? -36.619 -16.858 3.548   1.00 30.64  ? 407 TYR C CD2  1 
ATOM   6886  C CE1  . TYR B 1 70  ? -36.879 -14.676 5.225   1.00 25.35  ? 407 TYR C CE1  1 
ATOM   6887  C CE2  . TYR B 1 70  ? -37.733 -16.034 3.459   1.00 30.60  ? 407 TYR C CE2  1 
ATOM   6888  C CZ   . TYR B 1 70  ? -37.853 -14.951 4.307   1.00 27.76  ? 407 TYR C CZ   1 
ATOM   6889  O OH   . TYR B 1 70  ? -38.951 -14.128 4.233   1.00 32.00  ? 407 TYR C OH   1 
ATOM   6890  H H    . TYR B 1 70  ? -35.399 -19.774 4.275   1.00 29.25  ? 407 TYR C H    1 
ATOM   6891  H HA   . TYR B 1 70  ? -34.235 -18.008 2.580   1.00 36.74  ? 407 TYR C HA   1 
ATOM   6892  H HB2  . TYR B 1 70  ? -34.477 -18.000 5.408   1.00 30.20  ? 407 TYR C HB2  1 
ATOM   6893  H HB3  . TYR B 1 70  ? -33.618 -16.914 4.641   1.00 30.20  ? 407 TYR C HB3  1 
ATOM   6894  H HD1  . TYR B 1 70  ? -35.106 -15.315 5.938   1.00 33.13  ? 407 TYR C HD1  1 
ATOM   6895  H HD2  . TYR B 1 70  ? -36.542 -17.588 2.978   1.00 36.76  ? 407 TYR C HD2  1 
ATOM   6896  H HE1  . TYR B 1 70  ? -36.964 -13.945 5.793   1.00 30.41  ? 407 TYR C HE1  1 
ATOM   6897  H HE2  . TYR B 1 70  ? -38.399 -16.216 2.836   1.00 36.72  ? 407 TYR C HE2  1 
ATOM   6898  H HH   . TYR B 1 70  ? -39.634 -14.557 4.382   1.00 38.40  ? 407 TYR C HH   1 
ATOM   6899  N N    . GLY B 1 71  ? -31.879 -18.741 2.665   1.00 23.23  ? 408 GLY C N    1 
ATOM   6900  C CA   . GLY B 1 71  ? -30.521 -19.253 2.724   1.00 24.42  ? 408 GLY C CA   1 
ATOM   6901  C C    . GLY B 1 71  ? -29.544 -18.100 2.780   1.00 26.09  ? 408 GLY C C    1 
ATOM   6902  O O    . GLY B 1 71  ? -29.640 -17.162 1.990   1.00 23.26  ? 408 GLY C O    1 
ATOM   6903  H H    . GLY B 1 71  ? -32.030 -18.216 2.001   1.00 27.87  ? 408 GLY C H    1 
ATOM   6904  H HA2  . GLY B 1 71  ? -30.407 -19.802 3.515   1.00 29.30  ? 408 GLY C HA2  1 
ATOM   6905  H HA3  . GLY B 1 71  ? -30.333 -19.788 1.937   1.00 29.30  ? 408 GLY C HA3  1 
ATOM   6906  N N    . LEU B 1 72  ? -28.609 -18.168 3.715   1.00 28.45  ? 409 LEU C N    1 
ATOM   6907  C CA   . LEU B 1 72  ? -27.639 -17.100 3.901   1.00 26.85  ? 409 LEU C CA   1 
ATOM   6908  C C    . LEU B 1 72  ? -26.244 -17.705 3.933   1.00 26.16  ? 409 LEU C C    1 
ATOM   6909  O O    . LEU B 1 72  ? -26.012 -18.720 4.590   1.00 19.76  ? 409 LEU C O    1 
ATOM   6910  C CB   . LEU B 1 72  ? -27.927 -16.319 5.204   1.00 18.41  ? 409 LEU C CB   1 
ATOM   6911  C CG   . LEU B 1 72  ? -26.963 -15.161 5.506   1.00 19.08  ? 409 LEU C CG   1 
ATOM   6912  C CD1  . LEU B 1 72  ? -27.670 -14.063 6.289   1.00 25.68  ? 409 LEU C CD1  1 
ATOM   6913  C CD2  . LEU B 1 72  ? -25.712 -15.649 6.273   1.00 18.54  ? 409 LEU C CD2  1 
ATOM   6914  H H    . LEU B 1 72  ? -28.514 -18.827 4.260   1.00 34.14  ? 409 LEU C H    1 
ATOM   6915  H HA   . LEU B 1 72  ? -27.690 -16.476 3.147   1.00 32.22  ? 409 LEU C HA   1 
ATOM   6916  H HB2  . LEU B 1 72  ? -28.821 -15.947 5.148   1.00 22.09  ? 409 LEU C HB2  1 
ATOM   6917  H HB3  . LEU B 1 72  ? -27.881 -16.938 5.949   1.00 22.09  ? 409 LEU C HB3  1 
ATOM   6918  H HG   . LEU B 1 72  ? -26.663 -14.779 4.666   1.00 22.90  ? 409 LEU C HG   1 
ATOM   6919  H HD11 . LEU B 1 72  ? -27.048 -13.354 6.464   1.00 30.82  ? 409 LEU C HD11 1 
ATOM   6920  H HD12 . LEU B 1 72  ? -28.406 -13.732 5.768   1.00 30.82  ? 409 LEU C HD12 1 
ATOM   6921  H HD13 . LEU B 1 72  ? -27.993 -14.428 7.116   1.00 30.82  ? 409 LEU C HD13 1 
ATOM   6922  H HD21 . LEU B 1 72  ? -25.137 -14.899 6.442   1.00 22.25  ? 409 LEU C HD21 1 
ATOM   6923  H HD22 . LEU B 1 72  ? -25.989 -16.043 7.103   1.00 22.25  ? 409 LEU C HD22 1 
ATOM   6924  H HD23 . LEU B 1 72  ? -25.252 -16.301 5.738   1.00 22.25  ? 409 LEU C HD23 1 
ATOM   6925  N N    . LEU B 1 73  ? -25.317 -17.087 3.214   1.00 17.66  ? 410 LEU C N    1 
ATOM   6926  C CA   . LEU B 1 73  ? -23.932 -17.521 3.244   1.00 19.78  ? 410 LEU C CA   1 
ATOM   6927  C C    . LEU B 1 73  ? -23.098 -16.353 3.692   1.00 21.76  ? 410 LEU C C    1 
ATOM   6928  O O    . LEU B 1 73  ? -23.238 -15.256 3.162   1.00 27.64  ? 410 LEU C O    1 
ATOM   6929  C CB   . LEU B 1 73  ? -23.461 -17.997 1.864   1.00 22.46  ? 410 LEU C CB   1 
ATOM   6930  C CG   . LEU B 1 73  ? -21.945 -18.229 1.764   1.00 28.28  ? 410 LEU C CG   1 
ATOM   6931  C CD1  . LEU B 1 73  ? -21.595 -19.599 2.274   1.00 34.48  ? 410 LEU C CD1  1 
ATOM   6932  C CD2  . LEU B 1 73  ? -21.447 -18.061 0.323   1.00 28.40  ? 410 LEU C CD2  1 
ATOM   6933  H H    . LEU B 1 73  ? -25.466 -16.414 2.700   1.00 21.20  ? 410 LEU C H    1 
ATOM   6934  H HA   . LEU B 1 73  ? -23.824 -18.253 3.887   1.00 23.73  ? 410 LEU C HA   1 
ATOM   6935  H HB2  . LEU B 1 73  ? -23.903 -18.835 1.657   1.00 26.95  ? 410 LEU C HB2  1 
ATOM   6936  H HB3  . LEU B 1 73  ? -23.702 -17.328 1.205   1.00 26.95  ? 410 LEU C HB3  1 
ATOM   6937  H HG   . LEU B 1 73  ? -21.488 -17.577 2.318   1.00 33.93  ? 410 LEU C HG   1 
ATOM   6938  H HD11 . LEU B 1 73  ? -20.646 -19.725 2.204   1.00 41.37  ? 410 LEU C HD11 1 
ATOM   6939  H HD12 . LEU B 1 73  ? -21.867 -19.670 3.192   1.00 41.37  ? 410 LEU C HD12 1 
ATOM   6940  H HD13 . LEU B 1 73  ? -22.053 -20.256 1.745   1.00 41.37  ? 410 LEU C HD13 1 
ATOM   6941  H HD21 . LEU B 1 73  ? -20.500 -18.213 0.300   1.00 34.08  ? 410 LEU C HD21 1 
ATOM   6942  H HD22 . LEU B 1 73  ? -21.895 -18.698 -0.239  1.00 34.08  ? 410 LEU C HD22 1 
ATOM   6943  H HD23 . LEU B 1 73  ? -21.643 -17.169 0.027   1.00 34.08  ? 410 LEU C HD23 1 
ATOM   6944  N N    . TYR B 1 74  ? -22.252 -16.569 4.691   1.00 22.39  ? 411 TYR C N    1 
ATOM   6945  C CA   . TYR B 1 74  ? -21.314 -15.544 5.110   1.00 16.88  ? 411 TYR C CA   1 
ATOM   6946  C C    . TYR B 1 74  ? -19.933 -16.099 4.940   1.00 24.54  ? 411 TYR C C    1 
ATOM   6947  O O    . TYR B 1 74  ? -19.667 -17.249 5.321   1.00 22.73  ? 411 TYR C O    1 
ATOM   6948  C CB   . TYR B 1 74  ? -21.525 -15.142 6.569   1.00 16.80  ? 411 TYR C CB   1 
ATOM   6949  C CG   . TYR B 1 74  ? -20.386 -14.315 7.134   1.00 20.99  ? 411 TYR C CG   1 
ATOM   6950  C CD1  . TYR B 1 74  ? -20.346 -12.938 6.954   1.00 20.88  ? 411 TYR C CD1  1 
ATOM   6951  C CD2  . TYR B 1 74  ? -19.357 -14.908 7.859   1.00 22.87  ? 411 TYR C CD2  1 
ATOM   6952  C CE1  . TYR B 1 74  ? -19.306 -12.175 7.470   1.00 20.44  ? 411 TYR C CE1  1 
ATOM   6953  C CE2  . TYR B 1 74  ? -18.306 -14.144 8.377   1.00 20.57  ? 411 TYR C CE2  1 
ATOM   6954  C CZ   . TYR B 1 74  ? -18.297 -12.768 8.163   1.00 21.14  ? 411 TYR C CZ   1 
ATOM   6955  O OH   . TYR B 1 74  ? -17.266 -11.988 8.651   1.00 19.51  ? 411 TYR C OH   1 
ATOM   6956  H H    . TYR B 1 74  ? -22.203 -17.301 5.140   1.00 26.87  ? 411 TYR C H    1 
ATOM   6957  H HA   . TYR B 1 74  ? -21.410 -14.750 4.543   1.00 20.25  ? 411 TYR C HA   1 
ATOM   6958  H HB2  . TYR B 1 74  ? -22.337 -14.616 6.636   1.00 20.16  ? 411 TYR C HB2  1 
ATOM   6959  H HB3  . TYR B 1 74  ? -21.606 -15.945 7.107   1.00 20.16  ? 411 TYR C HB3  1 
ATOM   6960  H HD1  . TYR B 1 74  ? -21.025 -12.520 6.474   1.00 25.06  ? 411 TYR C HD1  1 
ATOM   6961  H HD2  . TYR B 1 74  ? -19.362 -15.828 7.992   1.00 27.44  ? 411 TYR C HD2  1 
ATOM   6962  H HE1  . TYR B 1 74  ? -19.292 -11.256 7.328   1.00 24.53  ? 411 TYR C HE1  1 
ATOM   6963  H HE2  . TYR B 1 74  ? -17.617 -14.551 8.851   1.00 24.68  ? 411 TYR C HE2  1 
ATOM   6964  H HH   . TYR B 1 74  ? -17.562 -11.426 9.170   1.00 23.42  ? 411 TYR C HH   1 
ATOM   6965  N N    . TYR B 1 75  ? -19.051 -15.304 4.354   1.00 19.22  ? 412 TYR C N    1 
ATOM   6966  C CA   . TYR B 1 75  ? -17.685 -15.756 4.168   1.00 19.01  ? 412 TYR C CA   1 
ATOM   6967  C C    . TYR B 1 75  ? -16.699 -14.688 4.615   1.00 24.53  ? 412 TYR C C    1 
ATOM   6968  O O    . TYR B 1 75  ? -16.762 -13.544 4.170   1.00 22.63  ? 412 TYR C O    1 
ATOM   6969  C CB   . TYR B 1 75  ? -17.428 -16.141 2.708   1.00 22.17  ? 412 TYR C CB   1 
ATOM   6970  C CG   . TYR B 1 75  ? -15.979 -16.448 2.457   1.00 21.16  ? 412 TYR C CG   1 
ATOM   6971  C CD1  . TYR B 1 75  ? -15.412 -17.650 2.916   1.00 18.91  ? 412 TYR C CD1  1 
ATOM   6972  C CD2  . TYR B 1 75  ? -15.162 -15.548 1.786   1.00 19.14  ? 412 TYR C CD2  1 
ATOM   6973  C CE1  . TYR B 1 75  ? -14.081 -17.934 2.699   1.00 17.71  ? 412 TYR C CE1  1 
ATOM   6974  C CE2  . TYR B 1 75  ? -13.824 -15.824 1.581   1.00 27.51  ? 412 TYR C CE2  1 
ATOM   6975  C CZ   . TYR B 1 75  ? -13.292 -17.024 2.043   1.00 25.47  ? 412 TYR C CZ   1 
ATOM   6976  O OH   . TYR B 1 75  ? -11.963 -17.309 1.834   1.00 20.68  ? 412 TYR C OH   1 
ATOM   6977  H H    . TYR B 1 75  ? -19.214 -14.512 4.061   1.00 23.07  ? 412 TYR C H    1 
ATOM   6978  H HA   . TYR B 1 75  ? -17.536 -16.552 4.720   1.00 22.82  ? 412 TYR C HA   1 
ATOM   6979  H HB2  . TYR B 1 75  ? -17.947 -16.931 2.491   1.00 26.61  ? 412 TYR C HB2  1 
ATOM   6980  H HB3  . TYR B 1 75  ? -17.686 -15.403 2.134   1.00 26.61  ? 412 TYR C HB3  1 
ATOM   6981  H HD1  . TYR B 1 75  ? -15.944 -18.265 3.367   1.00 22.70  ? 412 TYR C HD1  1 
ATOM   6982  H HD2  . TYR B 1 75  ? -15.517 -14.743 1.485   1.00 22.97  ? 412 TYR C HD2  1 
ATOM   6983  H HE1  . TYR B 1 75  ? -13.717 -18.732 3.008   1.00 21.25  ? 412 TYR C HE1  1 
ATOM   6984  H HE2  . TYR B 1 75  ? -13.284 -15.216 1.130   1.00 33.01  ? 412 TYR C HE2  1 
ATOM   6985  H HH   . TYR B 1 75  ? -11.494 -16.742 2.195   1.00 24.81  ? 412 TYR C HH   1 
ATOM   6986  N N    . ALA B 1 76  ? -15.791 -15.057 5.511   1.00 18.87  ? 413 ALA C N    1 
ATOM   6987  C CA   . ALA B 1 76  ? -14.718 -14.163 5.915   1.00 17.06  ? 413 ALA C CA   1 
ATOM   6988  C C    . ALA B 1 76  ? -13.418 -14.841 5.561   1.00 26.14  ? 413 ALA C C    1 
ATOM   6989  O O    . ALA B 1 76  ? -13.154 -15.951 6.024   1.00 23.26  ? 413 ALA C O    1 
ATOM   6990  C CB   . ALA B 1 76  ? -14.783 -13.880 7.418   1.00 21.15  ? 413 ALA C CB   1 
ATOM   6991  H H    . ALA B 1 76  ? -15.776 -15.824 5.900   1.00 22.64  ? 413 ALA C H    1 
ATOM   6992  H HA   . ALA B 1 76  ? -14.783 -13.317 5.426   1.00 20.47  ? 413 ALA C HA   1 
ATOM   6993  H HB1  . ALA B 1 76  ? -14.065 -13.289 7.655   1.00 25.38  ? 413 ALA C HB1  1 
ATOM   6994  H HB2  . ALA B 1 76  ? -15.627 -13.470 7.622   1.00 25.38  ? 413 ALA C HB2  1 
ATOM   6995  H HB3  . ALA B 1 76  ? -14.698 -14.709 7.895   1.00 25.38  ? 413 ALA C HB3  1 
ATOM   6996  N N    . GLY B 1 77  ? -12.603 -14.191 4.739   1.00 23.99  ? 414 GLY C N    1 
ATOM   6997  C CA   . GLY B 1 77  ? -11.324 -14.771 4.343   1.00 25.86  ? 414 GLY C CA   1 
ATOM   6998  C C    . GLY B 1 77  ? -10.802 -14.076 3.098   1.00 34.88  ? 414 GLY C C    1 
ATOM   6999  O O    . GLY B 1 77  ? -11.325 -13.023 2.714   1.00 25.36  ? 414 GLY C O    1 
ATOM   7000  H H    . GLY B 1 77  ? -12.764 -13.418 4.398   1.00 28.79  ? 414 GLY C H    1 
ATOM   7001  H HA2  . GLY B 1 77  ? -10.676 -14.664 5.058   1.00 31.04  ? 414 GLY C HA2  1 
ATOM   7002  H HA3  . GLY B 1 77  ? -11.432 -15.716 4.155   1.00 31.04  ? 414 GLY C HA3  1 
ATOM   7003  N N    . HIS B 1 78  ? -9.776  -14.648 2.469   1.00 24.66  ? 415 HIS C N    1 
ATOM   7004  C CA   . HIS B 1 78  ? -9.266  -14.097 1.213   1.00 17.51  ? 415 HIS C CA   1 
ATOM   7005  C C    . HIS B 1 78  ? -10.249 -14.346 0.083   1.00 18.96  ? 415 HIS C C    1 
ATOM   7006  O O    . HIS B 1 78  ? -10.923 -15.370 0.036   1.00 27.16  ? 415 HIS C O    1 
ATOM   7007  C CB   . HIS B 1 78  ? -7.895  -14.672 0.842   1.00 25.85  ? 415 HIS C CB   1 
ATOM   7008  C CG   . HIS B 1 78  ? -6.794  -14.197 1.733   1.00 40.77  ? 415 HIS C CG   1 
ATOM   7009  N ND1  . HIS B 1 78  ? -6.530  -12.859 1.935   1.00 40.46  ? 415 HIS C ND1  1 
ATOM   7010  C CD2  . HIS B 1 78  ? -5.909  -14.877 2.500   1.00 30.40  ? 415 HIS C CD2  1 
ATOM   7011  C CE1  . HIS B 1 78  ? -5.525  -12.737 2.785   1.00 40.29  ? 415 HIS C CE1  1 
ATOM   7012  N NE2  . HIS B 1 78  ? -5.132  -13.946 3.144   1.00 28.86  ? 415 HIS C NE2  1 
ATOM   7013  H H    . HIS B 1 78  ? -9.362  -15.350 2.744   1.00 29.59  ? 415 HIS C H    1 
ATOM   7014  H HA   . HIS B 1 78  ? -9.166  -13.127 1.314   1.00 21.01  ? 415 HIS C HA   1 
ATOM   7015  H HB2  . HIS B 1 78  ? -7.932  -15.639 0.903   1.00 31.01  ? 415 HIS C HB2  1 
ATOM   7016  H HB3  . HIS B 1 78  ? -7.678  -14.406 -0.066  1.00 31.01  ? 415 HIS C HB3  1 
ATOM   7017  H HD2  . HIS B 1 78  ? -5.842  -15.802 2.579   1.00 36.48  ? 415 HIS C HD2  1 
ATOM   7018  H HE1  . HIS B 1 78  ? -5.154  -11.936 3.077   1.00 48.35  ? 415 HIS C HE1  1 
ATOM   7019  N N    . GLY B 1 79  ? -10.332 -13.379 -0.824  1.00 27.68  ? 416 GLY C N    1 
ATOM   7020  C CA   . GLY B 1 79  ? -11.238 -13.472 -1.952  1.00 19.62  ? 416 GLY C CA   1 
ATOM   7021  C C    . GLY B 1 79  ? -10.705 -12.617 -3.070  1.00 22.20  ? 416 GLY C C    1 
ATOM   7022  O O    . GLY B 1 79  ? -9.732  -11.883 -2.896  1.00 29.01  ? 416 GLY C O    1 
ATOM   7023  H H    . GLY B 1 79  ? -9.869  -12.654 -0.804  1.00 33.22  ? 416 GLY C H    1 
ATOM   7024  H HA2  . GLY B 1 79  ? -11.302 -14.391 -2.255  1.00 23.55  ? 416 GLY C HA2  1 
ATOM   7025  H HA3  . GLY B 1 79  ? -12.120 -13.156 -1.701  1.00 23.55  ? 416 GLY C HA3  1 
ATOM   7026  N N    . TYR B 1 80  ? -11.325 -12.725 -4.235  1.00 25.54  ? 417 TYR C N    1 
ATOM   7027  C CA   . TYR B 1 80  ? -10.993 -11.827 -5.320  1.00 23.83  ? 417 TYR C CA   1 
ATOM   7028  C C    . TYR B 1 80  ? -12.180 -11.766 -6.251  1.00 28.28  ? 417 TYR C C    1 
ATOM   7029  O O    . TYR B 1 80  ? -13.178 -12.451 -6.047  1.00 23.33  ? 417 TYR C O    1 
ATOM   7030  C CB   . TYR B 1 80  ? -9.725  -12.277 -6.056  1.00 25.64  ? 417 TYR C CB   1 
ATOM   7031  C CG   . TYR B 1 80  ? -9.892  -13.441 -7.006  1.00 30.00  ? 417 TYR C CG   1 
ATOM   7032  C CD1  . TYR B 1 80  ? -9.574  -14.736 -6.607  1.00 37.70  ? 417 TYR C CD1  1 
ATOM   7033  C CD2  . TYR B 1 80  ? -10.336 -13.245 -8.311  1.00 28.35  ? 417 TYR C CD2  1 
ATOM   7034  C CE1  . TYR B 1 80  ? -9.709  -15.798 -7.463  1.00 33.42  ? 417 TYR C CE1  1 
ATOM   7035  C CE2  . TYR B 1 80  ? -10.468 -14.304 -9.187  1.00 31.24  ? 417 TYR C CE2  1 
ATOM   7036  C CZ   . TYR B 1 80  ? -10.150 -15.585 -8.753  1.00 45.27  ? 417 TYR C CZ   1 
ATOM   7037  O OH   . TYR B 1 80  ? -10.272 -16.656 -9.603  1.00 35.44  ? 417 TYR C OH   1 
ATOM   7038  H H    . TYR B 1 80  ? -11.934 -13.304 -4.420  1.00 30.64  ? 417 TYR C H    1 
ATOM   7039  H HA   . TYR B 1 80  ? -10.837 -10.928 -4.960  1.00 28.60  ? 417 TYR C HA   1 
ATOM   7040  H HB2  . TYR B 1 80  ? -9.389  -11.528 -6.572  1.00 30.77  ? 417 TYR C HB2  1 
ATOM   7041  H HB3  . TYR B 1 80  ? -9.064  -12.536 -5.394  1.00 30.77  ? 417 TYR C HB3  1 
ATOM   7042  H HD1  . TYR B 1 80  ? -9.274  -14.885 -5.739  1.00 45.24  ? 417 TYR C HD1  1 
ATOM   7043  H HD2  . TYR B 1 80  ? -10.545 -12.386 -8.599  1.00 34.02  ? 417 TYR C HD2  1 
ATOM   7044  H HE1  . TYR B 1 80  ? -9.494  -16.657 -7.180  1.00 40.11  ? 417 TYR C HE1  1 
ATOM   7045  H HE2  . TYR B 1 80  ? -10.768 -14.163 -10.055 1.00 37.49  ? 417 TYR C HE2  1 
ATOM   7046  H HH   . TYR B 1 80  ? -9.788  -16.551 -10.257 1.00 42.52  ? 417 TYR C HH   1 
ATOM   7047  N N    . GLU B 1 81  ? -12.083 -10.932 -7.270  1.00 28.00  ? 418 GLU C N    1 
ATOM   7048  C CA   . GLU B 1 81  ? -13.211 -10.733 -8.147  1.00 28.50  ? 418 GLU C CA   1 
ATOM   7049  C C    . GLU B 1 81  ? -12.708 -10.350 -9.526  1.00 30.86  ? 418 GLU C C    1 
ATOM   7050  O O    . GLU B 1 81  ? -11.981 -9.355  -9.680  1.00 24.62  ? 418 GLU C O    1 
ATOM   7051  C CB   . GLU B 1 81  ? -14.135 -9.650  -7.573  1.00 27.80  ? 418 GLU C CB   1 
ATOM   7052  C CG   . GLU B 1 81  ? -15.463 -9.532  -8.305  1.00 29.32  ? 418 GLU C CG   1 
ATOM   7053  C CD   . GLU B 1 81  ? -16.508 -8.787  -7.493  1.00 36.51  ? 418 GLU C CD   1 
ATOM   7054  O OE1  . GLU B 1 81  ? -16.653 -9.091  -6.288  1.00 31.81  ? 418 GLU C OE1  1 
ATOM   7055  O OE2  . GLU B 1 81  ? -17.176 -7.898  -8.055  1.00 30.58  ? 418 GLU C OE2  1 
ATOM   7056  H H    . GLU B 1 81  ? -11.382 -10.476 -7.472  1.00 33.61  ? 418 GLU C H    1 
ATOM   7057  H HA   . GLU B 1 81  ? -13.719 -11.567 -8.221  1.00 34.20  ? 418 GLU C HA   1 
ATOM   7058  H HB2  . GLU B 1 81  ? -14.325 -9.860  -6.645  1.00 33.36  ? 418 GLU C HB2  1 
ATOM   7059  H HB3  . GLU B 1 81  ? -13.686 -8.792  -7.631  1.00 33.36  ? 418 GLU C HB3  1 
ATOM   7060  H HG2  . GLU B 1 81  ? -15.325 -9.048  -9.134  1.00 35.19  ? 418 GLU C HG2  1 
ATOM   7061  H HG3  . GLU B 1 81  ? -15.803 -10.421 -8.491  1.00 35.19  ? 418 GLU C HG3  1 
ATOM   7062  N N    . ASN B 1 82  ? -13.075 -11.174 -10.507 1.00 29.88  ? 419 ASN C N    1 
ATOM   7063  C CA   . ASN B 1 82  ? -12.767 -10.930 -11.916 1.00 32.37  ? 419 ASN C CA   1 
ATOM   7064  C C    . ASN B 1 82  ? -14.049 -10.900 -12.756 1.00 33.80  ? 419 ASN C C    1 
ATOM   7065  O O    . ASN B 1 82  ? -14.883 -11.802 -12.671 1.00 30.31  ? 419 ASN C O    1 
ATOM   7066  C CB   . ASN B 1 82  ? -11.833 -12.021 -12.457 1.00 27.73  ? 419 ASN C CB   1 
ATOM   7067  C CG   . ASN B 1 82  ? -10.426 -11.906 -11.907 1.00 31.46  ? 419 ASN C CG   1 
ATOM   7068  O OD1  . ASN B 1 82  ? -10.214 -11.316 -10.855 1.00 36.63  ? 419 ASN C OD1  1 
ATOM   7069  N ND2  . ASN B 1 82  ? -9.457  -12.457 -12.626 1.00 39.43  ? 419 ASN C ND2  1 
ATOM   7070  H H    . ASN B 1 82  ? -13.516 -11.901 -10.378 1.00 35.86  ? 419 ASN C H    1 
ATOM   7071  H HA   . ASN B 1 82  ? -12.317 -10.064 -12.006 1.00 38.84  ? 419 ASN C HA   1 
ATOM   7072  H HB2  . ASN B 1 82  ? -12.183 -12.890 -12.207 1.00 33.27  ? 419 ASN C HB2  1 
ATOM   7073  H HB3  . ASN B 1 82  ? -11.785 -11.947 -13.423 1.00 33.27  ? 419 ASN C HB3  1 
ATOM   7074  H HD21 . ASN B 1 82  ? -9.643  -12.856 -13.365 1.00 47.32  ? 419 ASN C HD21 1 
ATOM   7075  H HD22 . ASN B 1 82  ? -8.643  -12.417 -12.353 1.00 47.32  ? 419 ASN C HD22 1 
ATOM   7076  N N    . PHE B 1 83  ? -14.212 -9.852  -13.548 1.00 42.69  ? 420 PHE C N    1 
ATOM   7077  C CA   . PHE B 1 83  ? -15.324 -9.779  -14.488 1.00 49.05  ? 420 PHE C CA   1 
ATOM   7078  C C    . PHE B 1 83  ? -16.672 -10.065 -13.829 1.00 34.50  ? 420 PHE C C    1 
ATOM   7079  O O    . PHE B 1 83  ? -17.502 -10.788 -14.374 1.00 47.51  ? 420 PHE C O    1 
ATOM   7080  C CB   . PHE B 1 83  ? -15.065 -10.754 -15.631 1.00 61.44  ? 420 PHE C CB   1 
ATOM   7081  C CG   . PHE B 1 83  ? -13.854 -10.399 -16.445 1.00 70.71  ? 420 PHE C CG   1 
ATOM   7082  C CD1  . PHE B 1 83  ? -12.971 -11.376 -16.875 1.00 63.40  ? 420 PHE C CD1  1 
ATOM   7083  C CD2  . PHE B 1 83  ? -13.598 -9.074  -16.774 1.00 73.37  ? 420 PHE C CD2  1 
ATOM   7084  C CE1  . PHE B 1 83  ? -11.856 -11.040 -17.622 1.00 67.01  ? 420 PHE C CE1  1 
ATOM   7085  C CE2  . PHE B 1 83  ? -12.486 -8.734  -17.519 1.00 75.18  ? 420 PHE C CE2  1 
ATOM   7086  C CZ   . PHE B 1 83  ? -11.612 -9.720  -17.940 1.00 75.96  ? 420 PHE C CZ   1 
ATOM   7087  H H    . PHE B 1 83  ? -13.692 -9.167  -13.563 1.00 51.23  ? 420 PHE C H    1 
ATOM   7088  H HA   . PHE B 1 83  ? -15.360 -8.875  -14.865 1.00 58.86  ? 420 PHE C HA   1 
ATOM   7089  H HB2  . PHE B 1 83  ? -14.928 -11.641 -15.263 1.00 73.73  ? 420 PHE C HB2  1 
ATOM   7090  H HB3  . PHE B 1 83  ? -15.833 -10.757 -16.223 1.00 73.73  ? 420 PHE C HB3  1 
ATOM   7091  H HD1  . PHE B 1 83  ? -13.130 -12.267 -16.660 1.00 76.08  ? 420 PHE C HD1  1 
ATOM   7092  H HD2  . PHE B 1 83  ? -14.182 -8.409  -16.490 1.00 88.05  ? 420 PHE C HD2  1 
ATOM   7093  H HE1  . PHE B 1 83  ? -11.270 -11.703 -17.906 1.00 80.41  ? 420 PHE C HE1  1 
ATOM   7094  H HE2  . PHE B 1 83  ? -12.323 -7.844  -17.734 1.00 90.22  ? 420 PHE C HE2  1 
ATOM   7095  H HZ   . PHE B 1 83  ? -10.864 -9.494  -18.444 1.00 91.15  ? 420 PHE C HZ   1 
ATOM   7096  N N    . GLY B 1 84  ? -16.874 -9.511  -12.644 1.00 27.34  ? 421 GLY C N    1 
ATOM   7097  C CA   . GLY B 1 84  ? -18.163 -9.598  -11.986 1.00 30.55  ? 421 GLY C CA   1 
ATOM   7098  C C    . GLY B 1 84  ? -18.421 -10.849 -11.169 1.00 35.26  ? 421 GLY C C    1 
ATOM   7099  O O    . GLY B 1 84  ? -19.440 -10.918 -10.486 1.00 43.63  ? 421 GLY C O    1 
ATOM   7100  H H    . GLY B 1 84  ? -16.278 -9.079  -12.199 1.00 32.80  ? 421 GLY C H    1 
ATOM   7101  H HA2  . GLY B 1 84  ? -18.259 -8.836  -11.394 1.00 36.66  ? 421 GLY C HA2  1 
ATOM   7102  H HA3  . GLY B 1 84  ? -18.858 -9.539  -12.659 1.00 36.66  ? 421 GLY C HA3  1 
ATOM   7103  N N    . ASN B 1 85  ? -17.524 -11.837 -11.230 1.00 30.36  ? 422 ASN C N    1 
ATOM   7104  C CA   . ASN B 1 85  ? -17.662 -13.035 -10.406 1.00 26.99  ? 422 ASN C CA   1 
ATOM   7105  C C    . ASN B 1 85  ? -16.706 -12.976 -9.216  1.00 23.98  ? 422 ASN C C    1 
ATOM   7106  O O    . ASN B 1 85  ? -15.510 -12.720 -9.385  1.00 28.47  ? 422 ASN C O    1 
ATOM   7107  C CB   . ASN B 1 85  ? -17.386 -14.298 -11.224 1.00 32.46  ? 422 ASN C CB   1 
ATOM   7108  C CG   . ASN B 1 85  ? -18.334 -14.450 -12.392 1.00 40.65  ? 422 ASN C CG   1 
ATOM   7109  O OD1  . ASN B 1 85  ? -17.909 -14.623 -13.529 1.00 46.87  ? 422 ASN C OD1  1 
ATOM   7110  N ND2  . ASN B 1 85  ? -19.630 -14.364 -12.117 1.00 34.04  ? 422 ASN C ND2  1 
ATOM   7111  H H    . ASN B 1 85  ? -16.831 -11.835 -11.739 1.00 36.43  ? 422 ASN C H    1 
ATOM   7112  H HA   . ASN B 1 85  ? -18.578 -13.086 -10.062 1.00 32.39  ? 422 ASN C HA   1 
ATOM   7113  H HB2  . ASN B 1 85  ? -16.482 -14.257 -11.574 1.00 38.95  ? 422 ASN C HB2  1 
ATOM   7114  H HB3  . ASN B 1 85  ? -17.487 -15.074 -10.652 1.00 38.95  ? 422 ASN C HB3  1 
ATOM   7115  H HD21 . ASN B 1 85  ? -19.889 -14.229 -11.308 1.00 40.84  ? 422 ASN C HD21 1 
ATOM   7116  H HD22 . ASN B 1 85  ? -20.209 -14.444 -12.747 1.00 40.84  ? 422 ASN C HD22 1 
ATOM   7117  N N    . SER B 1 86  ? -17.251 -13.185 -8.024  1.00 26.68  ? 423 SER C N    1 
ATOM   7118  C CA   . SER B 1 86  ? -16.470 -13.184 -6.798  1.00 29.49  ? 423 SER C CA   1 
ATOM   7119  C C    . SER B 1 86  ? -16.033 -14.610 -6.526  1.00 27.65  ? 423 SER C C    1 
ATOM   7120  O O    . SER B 1 86  ? -16.813 -15.522 -6.714  1.00 24.38  ? 423 SER C O    1 
ATOM   7121  C CB   . SER B 1 86  ? -17.319 -12.714 -5.622  1.00 32.17  ? 423 SER C CB   1 
ATOM   7122  O OG   . SER B 1 86  ? -17.980 -11.490 -5.911  1.00 33.57  ? 423 SER C OG   1 
ATOM   7123  H H    . SER B 1 86  ? -18.089 -13.333 -7.899  1.00 32.02  ? 423 SER C H    1 
ATOM   7124  H HA   . SER B 1 86  ? -15.682 -12.608 -6.889  1.00 35.39  ? 423 SER C HA   1 
ATOM   7125  H HB2  . SER B 1 86  ? -17.985 -13.391 -5.426  1.00 38.61  ? 423 SER C HB2  1 
ATOM   7126  H HB3  . SER B 1 86  ? -16.744 -12.585 -4.852  1.00 38.61  ? 423 SER C HB3  1 
ATOM   7127  H HG   . SER B 1 86  ? -17.791 -11.241 -6.669  1.00 40.28  ? 423 SER C HG   1 
ATOM   7128  N N    . PHE B 1 87  ? -14.808 -14.789 -6.051  1.00 22.43  ? 424 PHE C N    1 
ATOM   7129  C CA   . PHE B 1 87  ? -14.294 -16.130 -5.733  1.00 22.23  ? 424 PHE C CA   1 
ATOM   7130  C C    . PHE B 1 87  ? -13.797 -16.155 -4.299  1.00 23.79  ? 424 PHE C C    1 
ATOM   7131  O O    . PHE B 1 87  ? -13.240 -15.171 -3.824  1.00 27.67  ? 424 PHE C O    1 
ATOM   7132  C CB   . PHE B 1 87  ? -13.148 -16.489 -6.672  1.00 26.21  ? 424 PHE C CB   1 
ATOM   7133  C CG   . PHE B 1 87  ? -13.561 -16.604 -8.111  1.00 39.82  ? 424 PHE C CG   1 
ATOM   7134  C CD1  . PHE B 1 87  ? -13.818 -17.843 -8.676  1.00 38.73  ? 424 PHE C CD1  1 
ATOM   7135  C CD2  . PHE B 1 87  ? -13.699 -15.472 -8.897  1.00 32.73  ? 424 PHE C CD2  1 
ATOM   7136  C CE1  . PHE B 1 87  ? -14.204 -17.949 -10.003 1.00 42.84  ? 424 PHE C CE1  1 
ATOM   7137  C CE2  . PHE B 1 87  ? -14.083 -15.575 -10.224 1.00 45.51  ? 424 PHE C CE2  1 
ATOM   7138  C CZ   . PHE B 1 87  ? -14.336 -16.811 -10.775 1.00 42.38  ? 424 PHE C CZ   1 
ATOM   7139  H H    . PHE B 1 87  ? -14.248 -14.154 -5.901  1.00 26.91  ? 424 PHE C H    1 
ATOM   7140  H HA   . PHE B 1 87  ? -15.008 -16.794 -5.834  1.00 26.68  ? 424 PHE C HA   1 
ATOM   7141  H HB2  . PHE B 1 87  ? -12.467 -15.801 -6.612  1.00 31.45  ? 424 PHE C HB2  1 
ATOM   7142  H HB3  . PHE B 1 87  ? -12.777 -17.343 -6.401  1.00 31.45  ? 424 PHE C HB3  1 
ATOM   7143  H HD1  . PHE B 1 87  ? -13.731 -18.611 -8.159  1.00 46.47  ? 424 PHE C HD1  1 
ATOM   7144  H HD2  . PHE B 1 87  ? -13.530 -14.634 -8.530  1.00 39.28  ? 424 PHE C HD2  1 
ATOM   7145  H HE1  . PHE B 1 87  ? -14.373 -18.785 -10.374 1.00 51.41  ? 424 PHE C HE1  1 
ATOM   7146  H HE2  . PHE B 1 87  ? -14.172 -14.808 -10.742 1.00 54.62  ? 424 PHE C HE2  1 
ATOM   7147  H HZ   . PHE B 1 87  ? -14.593 -16.880 -11.666 1.00 50.85  ? 424 PHE C HZ   1 
ATOM   7148  N N    . MET B 1 88  ? -14.008 -17.275 -3.611  1.00 21.73  ? 425 MET C N    1 
ATOM   7149  C CA   . MET B 1 88  ? -13.568 -17.424 -2.230  1.00 24.11  ? 425 MET C CA   1 
ATOM   7150  C C    . MET B 1 88  ? -12.377 -18.374 -2.237  1.00 26.69  ? 425 MET C C    1 
ATOM   7151  O O    . MET B 1 88  ? -12.447 -19.448 -2.826  1.00 26.36  ? 425 MET C O    1 
ATOM   7152  C CB   . MET B 1 88  ? -14.703 -17.985 -1.368  1.00 26.98  ? 425 MET C CB   1 
ATOM   7153  C CG   . MET B 1 88  ? -15.916 -17.048 -1.279  1.00 21.97  ? 425 MET C CG   1 
ATOM   7154  S SD   . MET B 1 88  ? -17.301 -17.824 -0.435  1.00 25.87  ? 425 MET C SD   1 
ATOM   7155  C CE   . MET B 1 88  ? -17.625 -19.191 -1.559  1.00 22.40  ? 425 MET C CE   1 
ATOM   7156  H H    . MET B 1 88  ? -14.406 -17.969 -3.927  1.00 26.07  ? 425 MET C H    1 
ATOM   7157  H HA   . MET B 1 88  ? -13.298 -16.553 -1.870  1.00 28.93  ? 425 MET C HA   1 
ATOM   7158  H HB2  . MET B 1 88  ? -15.003 -18.825 -1.751  1.00 32.38  ? 425 MET C HB2  1 
ATOM   7159  H HB3  . MET B 1 88  ? -14.372 -18.132 -0.469  1.00 32.38  ? 425 MET C HB3  1 
ATOM   7160  H HG2  . MET B 1 88  ? -15.668 -16.252 -0.784  1.00 26.37  ? 425 MET C HG2  1 
ATOM   7161  H HG3  . MET B 1 88  ? -16.202 -16.811 -2.175  1.00 26.37  ? 425 MET C HG3  1 
ATOM   7162  H HE1  . MET B 1 88  ? -18.363 -19.704 -1.221  1.00 26.88  ? 425 MET C HE1  1 
ATOM   7163  H HE2  . MET B 1 88  ? -17.841 -18.838 -2.425  1.00 26.88  ? 425 MET C HE2  1 
ATOM   7164  H HE3  . MET B 1 88  ? -16.841 -19.741 -1.614  1.00 26.88  ? 425 MET C HE3  1 
ATOM   7165  N N    . VAL B 1 89  ? -11.292 -17.963 -1.585  1.00 23.31  ? 426 VAL C N    1 
ATOM   7166  C CA   . VAL B 1 89  ? -10.005 -18.644 -1.672  1.00 23.17  ? 426 VAL C CA   1 
ATOM   7167  C C    . VAL B 1 89  ? -9.838  -19.593 -0.473  1.00 24.16  ? 426 VAL C C    1 
ATOM   7168  O O    . VAL B 1 89  ? -9.743  -19.135 0.653   1.00 26.22  ? 426 VAL C O    1 
ATOM   7169  C CB   . VAL B 1 89  ? -8.848  -17.622 -1.623  1.00 24.82  ? 426 VAL C CB   1 
ATOM   7170  C CG1  . VAL B 1 89  ? -7.499  -18.332 -1.692  1.00 32.56  ? 426 VAL C CG1  1 
ATOM   7171  C CG2  . VAL B 1 89  ? -8.984  -16.568 -2.758  1.00 23.82  ? 426 VAL C CG2  1 
ATOM   7172  H H    . VAL B 1 89  ? -11.277 -17.272 -1.073  1.00 27.97  ? 426 VAL C H    1 
ATOM   7173  H HA   . VAL B 1 89  ? -9.948  -19.159 -2.504  1.00 27.80  ? 426 VAL C HA   1 
ATOM   7174  H HB   . VAL B 1 89  ? -8.888  -17.144 -0.768  1.00 29.79  ? 426 VAL C HB   1 
ATOM   7175  H HG11 . VAL B 1 89  ? -6.799  -17.676 -1.659  1.00 39.07  ? 426 VAL C HG11 1 
ATOM   7176  H HG12 . VAL B 1 89  ? -7.422  -18.930 -0.945  1.00 39.07  ? 426 VAL C HG12 1 
ATOM   7177  H HG13 . VAL B 1 89  ? -7.448  -18.825 -2.514  1.00 39.07  ? 426 VAL C HG13 1 
ATOM   7178  H HG21 . VAL B 1 89  ? -8.252  -15.949 -2.699  1.00 28.58  ? 426 VAL C HG21 1 
ATOM   7179  H HG22 . VAL B 1 89  ? -8.966  -17.018 -3.606  1.00 28.58  ? 426 VAL C HG22 1 
ATOM   7180  H HG23 . VAL B 1 89  ? -9.816  -16.101 -2.652  1.00 28.58  ? 426 VAL C HG23 1 
ATOM   7181  N N    . PRO B 1 90  ? -9.803  -20.911 -0.720  1.00 29.14  ? 427 PRO C N    1 
ATOM   7182  C CA   . PRO B 1 90  ? -9.653  -21.912 0.354   1.00 25.59  ? 427 PRO C CA   1 
ATOM   7183  C C    . PRO B 1 90  ? -8.248  -21.892 0.974   1.00 21.09  ? 427 PRO C C    1 
ATOM   7184  O O    . PRO B 1 90  ? -7.305  -21.448 0.313   1.00 22.96  ? 427 PRO C O    1 
ATOM   7185  C CB   . PRO B 1 90  ? -9.901  -23.247 -0.366  1.00 23.04  ? 427 PRO C CB   1 
ATOM   7186  C CG   . PRO B 1 90  ? -10.469 -22.874 -1.740  1.00 39.79  ? 427 PRO C CG   1 
ATOM   7187  C CD   . PRO B 1 90  ? -9.872  -21.542 -2.049  1.00 23.92  ? 427 PRO C CD   1 
ATOM   7188  H HA   . PRO B 1 90  ? -10.329 -21.780 1.052   1.00 30.71  ? 427 PRO C HA   1 
ATOM   7189  H HB2  . PRO B 1 90  ? -9.062  -23.725 -0.462  1.00 27.65  ? 427 PRO C HB2  1 
ATOM   7190  H HB3  . PRO B 1 90  ? -10.540 -23.774 0.137   1.00 27.65  ? 427 PRO C HB3  1 
ATOM   7191  H HG2  . PRO B 1 90  ? -10.198 -23.534 -2.397  1.00 47.75  ? 427 PRO C HG2  1 
ATOM   7192  H HG3  . PRO B 1 90  ? -11.436 -22.814 -1.690  1.00 47.75  ? 427 PRO C HG3  1 
ATOM   7193  H HD2  . PRO B 1 90  ? -8.983  -21.646 -2.424  1.00 28.71  ? 427 PRO C HD2  1 
ATOM   7194  H HD3  . PRO B 1 90  ? -10.454 -21.036 -2.638  1.00 28.71  ? 427 PRO C HD3  1 
ATOM   7195  N N    . VAL B 1 91  ? -8.099  -22.379 2.211   1.00 25.73  ? 428 VAL C N    1 
ATOM   7196  C CA   . VAL B 1 91  ? -6.820  -22.259 2.915   1.00 30.90  ? 428 VAL C CA   1 
ATOM   7197  C C    . VAL B 1 91  ? -5.699  -23.071 2.254   1.00 31.67  ? 428 VAL C C    1 
ATOM   7198  O O    . VAL B 1 91  ? -4.514  -22.841 2.518   1.00 29.89  ? 428 VAL C O    1 
ATOM   7199  C CB   . VAL B 1 91  ? -6.932  -22.659 4.422   1.00 29.09  ? 428 VAL C CB   1 
ATOM   7200  C CG1  . VAL B 1 91  ? -7.893  -21.730 5.151   1.00 37.86  ? 428 VAL C CG1  1 
ATOM   7201  C CG2  . VAL B 1 91  ? -7.362  -24.125 4.585   1.00 29.58  ? 428 VAL C CG2  1 
ATOM   7202  H H    . VAL B 1 91  ? -8.716  -22.778 2.659   1.00 30.88  ? 428 VAL C H    1 
ATOM   7203  H HA   . VAL B 1 91  ? -6.548  -21.318 2.888   1.00 37.08  ? 428 VAL C HA   1 
ATOM   7204  H HB   . VAL B 1 91  ? -6.050  -22.561 4.838   1.00 34.91  ? 428 VAL C HB   1 
ATOM   7205  H HG11 . VAL B 1 91  ? -7.945  -21.995 6.072   1.00 45.43  ? 428 VAL C HG11 1 
ATOM   7206  H HG12 . VAL B 1 91  ? -7.566  -20.830 5.087   1.00 45.43  ? 428 VAL C HG12 1 
ATOM   7207  H HG13 . VAL B 1 91  ? -8.760  -21.794 4.742   1.00 45.43  ? 428 VAL C HG13 1 
ATOM   7208  H HG21 . VAL B 1 91  ? -7.419  -24.331 5.521   1.00 35.50  ? 428 VAL C HG21 1 
ATOM   7209  H HG22 . VAL B 1 91  ? -8.219  -24.247 4.170   1.00 35.50  ? 428 VAL C HG22 1 
ATOM   7210  H HG23 . VAL B 1 91  ? -6.710  -24.690 4.164   1.00 35.50  ? 428 VAL C HG23 1 
ATOM   7211  N N    . ASP B 1 92  ? -6.064  -24.023 1.406   1.00 26.66  ? 429 ASP C N    1 
ATOM   7212  C CA   . ASP B 1 92  ? -5.052  -24.826 0.714   1.00 46.14  ? 429 ASP C CA   1 
ATOM   7213  C C    . ASP B 1 92  ? -4.757  -24.274 -0.678  1.00 41.64  ? 429 ASP C C    1 
ATOM   7214  O O    . ASP B 1 92  ? -4.251  -24.982 -1.538  1.00 32.37  ? 429 ASP C O    1 
ATOM   7215  C CB   . ASP B 1 92  ? -5.460  -26.307 0.633   1.00 46.47  ? 429 ASP C CB   1 
ATOM   7216  C CG   . ASP B 1 92  ? -6.699  -26.542 -0.220  1.00 35.55  ? 429 ASP C CG   1 
ATOM   7217  O OD1  . ASP B 1 92  ? -7.508  -25.616 -0.405  1.00 30.28  ? 429 ASP C OD1  1 
ATOM   7218  O OD2  . ASP B 1 92  ? -6.885  -27.673 -0.700  1.00 30.40  ? 429 ASP C OD2  1 
ATOM   7219  H H    . ASP B 1 92  ? -6.877  -24.226 1.213   1.00 32.00  ? 429 ASP C H    1 
ATOM   7220  H HA   . ASP B 1 92  ? -4.219  -24.781 1.229   1.00 55.37  ? 429 ASP C HA   1 
ATOM   7221  H HB2  . ASP B 1 92  ? -4.730  -26.814 0.245   1.00 55.77  ? 429 ASP C HB2  1 
ATOM   7222  H HB3  . ASP B 1 92  ? -5.649  -26.631 1.528   1.00 55.77  ? 429 ASP C HB3  1 
ATOM   7223  N N    . ALA B 1 93  ? -5.057  -23.000 -0.892  1.00 34.40  ? 430 ALA C N    1 
ATOM   7224  C CA   . ALA B 1 93  ? -4.869  -22.388 -2.208  1.00 31.47  ? 430 ALA C CA   1 
ATOM   7225  C C    . ALA B 1 93  ? -3.387  -22.258 -2.556  1.00 31.06  ? 430 ALA C C    1 
ATOM   7226  O O    . ALA B 1 93  ? -2.605  -21.708 -1.779  1.00 40.25  ? 430 ALA C O    1 
ATOM   7227  C CB   . ALA B 1 93  ? -5.537  -21.023 -2.252  1.00 32.20  ? 430 ALA C CB   1 
ATOM   7228  H H    . ALA B 1 93  ? -5.370  -22.465 -0.295  1.00 41.28  ? 430 ALA C H    1 
ATOM   7229  H HA   . ALA B 1 93  ? -5.292  -22.955 -2.887  1.00 37.76  ? 430 ALA C HA   1 
ATOM   7230  H HB1  . ALA B 1 93  ? -5.404  -20.639 -3.121  1.00 38.64  ? 430 ALA C HB1  1 
ATOM   7231  H HB2  . ALA B 1 93  ? -6.476  -21.130 -2.081  1.00 38.64  ? 430 ALA C HB2  1 
ATOM   7232  H HB3  . ALA B 1 93  ? -5.143  -20.462 -1.581  1.00 38.64  ? 430 ALA C HB3  1 
ATOM   7233  N N    . PRO B 1 94  ? -2.994  -22.753 -3.736  1.00 28.48  ? 431 PRO C N    1 
ATOM   7234  C CA   . PRO B 1 94  ? -1.609  -22.575 -4.184  1.00 52.48  ? 431 PRO C CA   1 
ATOM   7235  C C    . PRO B 1 94  ? -1.265  -21.098 -4.313  1.00 56.54  ? 431 PRO C C    1 
ATOM   7236  O O    . PRO B 1 94  ? -2.169  -20.257 -4.325  1.00 43.86  ? 431 PRO C O    1 
ATOM   7237  C CB   . PRO B 1 94  ? -1.592  -23.217 -5.577  1.00 66.27  ? 431 PRO C CB   1 
ATOM   7238  C CG   . PRO B 1 94  ? -2.864  -23.966 -5.708  1.00 64.33  ? 431 PRO C CG   1 
ATOM   7239  C CD   . PRO B 1 94  ? -3.845  -23.341 -4.782  1.00 44.10  ? 431 PRO C CD   1 
ATOM   7240  H HA   . PRO B 1 94  ? -0.975  -23.028 -3.589  1.00 62.98  ? 431 PRO C HA   1 
ATOM   7241  H HB2  . PRO B 1 94  ? -1.536  -22.523 -6.252  1.00 79.53  ? 431 PRO C HB2  1 
ATOM   7242  H HB3  . PRO B 1 94  ? -0.835  -23.820 -5.646  1.00 79.53  ? 431 PRO C HB3  1 
ATOM   7243  H HG2  . PRO B 1 94  ? -3.179  -23.904 -6.624  1.00 77.20  ? 431 PRO C HG2  1 
ATOM   7244  H HG3  . PRO B 1 94  ? -2.716  -24.893 -5.466  1.00 77.20  ? 431 PRO C HG3  1 
ATOM   7245  H HD2  . PRO B 1 94  ? -4.349  -22.649 -5.238  1.00 52.92  ? 431 PRO C HD2  1 
ATOM   7246  H HD3  . PRO B 1 94  ? -4.430  -24.016 -4.403  1.00 52.92  ? 431 PRO C HD3  1 
ATOM   7247  N N    . ASN B 1 95  ? 0.024   -20.792 -4.422  1.00 54.43  ? 432 ASN C N    1 
ATOM   7248  C CA   . ASN B 1 95  ? 0.473   -19.434 -4.700  1.00 52.30  ? 432 ASN C CA   1 
ATOM   7249  C C    . ASN B 1 95  ? 1.401   -19.440 -5.907  1.00 51.19  ? 432 ASN C C    1 
ATOM   7250  O O    . ASN B 1 95  ? 2.548   -19.842 -5.790  1.00 39.26  ? 432 ASN C O    1 
ATOM   7251  C CB   . ASN B 1 95  ? 1.208   -18.841 -3.498  1.00 48.06  ? 432 ASN C CB   1 
ATOM   7252  C CG   . ASN B 1 95  ? 1.651   -17.409 -3.744  1.00 56.42  ? 432 ASN C CG   1 
ATOM   7253  O OD1  . ASN B 1 95  ? 1.037   -16.691 -4.535  1.00 57.07  ? 432 ASN C OD1  1 
ATOM   7254  N ND2  . ASN B 1 95  ? 2.722   -16.990 -3.080  1.00 55.08  ? 432 ASN C ND2  1 
ATOM   7255  H H    . ASN B 1 95  ? 0.664   -21.360 -4.338  1.00 65.32  ? 432 ASN C H    1 
ATOM   7256  H HA   . ASN B 1 95  ? -0.301  -18.868 -4.904  1.00 62.75  ? 432 ASN C HA   1 
ATOM   7257  H HB2  . ASN B 1 95  ? 0.615   -18.845 -2.730  1.00 57.68  ? 432 ASN C HB2  1 
ATOM   7258  H HB3  . ASN B 1 95  ? 1.997   -19.373 -3.313  1.00 57.68  ? 432 ASN C HB3  1 
ATOM   7259  H HD21 . ASN B 1 95  ? 3.129   -17.522 -2.541  1.00 66.10  ? 432 ASN C HD21 1 
ATOM   7260  H HD22 . ASN B 1 95  ? 3.008   -16.186 -3.189  1.00 66.10  ? 432 ASN C HD22 1 
ATOM   7261  N N    . PRO B 1 96  ? 0.916   -18.977 -7.071  1.00 47.89  ? 433 PRO C N    1 
ATOM   7262  C CA   . PRO B 1 96  ? -0.383  -18.324 -7.267  1.00 41.91  ? 433 PRO C CA   1 
ATOM   7263  C C    . PRO B 1 96  ? -1.531  -19.320 -7.371  1.00 43.79  ? 433 PRO C C    1 
ATOM   7264  O O    . PRO B 1 96  ? -1.297  -20.524 -7.492  1.00 39.40  ? 433 PRO C O    1 
ATOM   7265  C CB   . PRO B 1 96  ? -0.211  -17.588 -8.608  1.00 52.41  ? 433 PRO C CB   1 
ATOM   7266  C CG   . PRO B 1 96  ? 1.090   -18.120 -9.227  1.00 64.37  ? 433 PRO C CG   1 
ATOM   7267  C CD   . PRO B 1 96  ? 1.588   -19.236 -8.354  1.00 50.89  ? 433 PRO C CD   1 
ATOM   7268  H HA   . PRO B 1 96  ? -0.563  -17.679 -6.552  1.00 50.30  ? 433 PRO C HA   1 
ATOM   7269  H HB2  . PRO B 1 96  ? -0.966  -17.783 -9.184  1.00 62.89  ? 433 PRO C HB2  1 
ATOM   7270  H HB3  . PRO B 1 96  ? -0.144  -16.634 -8.446  1.00 62.89  ? 433 PRO C HB3  1 
ATOM   7271  H HG2  . PRO B 1 96  ? 0.907   -18.450 -10.121 1.00 77.25  ? 433 PRO C HG2  1 
ATOM   7272  H HG3  . PRO B 1 96  ? 1.744   -17.404 -9.261  1.00 77.25  ? 433 PRO C HG3  1 
ATOM   7273  H HD2  . PRO B 1 96  ? 1.316   -20.095 -8.713  1.00 61.07  ? 433 PRO C HD2  1 
ATOM   7274  H HD3  . PRO B 1 96  ? 2.551   -19.182 -8.250  1.00 61.07  ? 433 PRO C HD3  1 
ATOM   7275  N N    . TYR B 1 97  ? -2.759  -18.815 -7.328  1.00 33.77  ? 434 TYR C N    1 
ATOM   7276  C CA   . TYR B 1 97  ? -3.932  -19.638 -7.540  1.00 46.93  ? 434 TYR C CA   1 
ATOM   7277  C C    . TYR B 1 97  ? -4.804  -19.030 -8.632  1.00 45.81  ? 434 TYR C C    1 
ATOM   7278  O O    . TYR B 1 97  ? -4.626  -17.879 -9.038  1.00 41.79  ? 434 TYR C O    1 
ATOM   7279  C CB   . TYR B 1 97  ? -4.730  -19.781 -6.242  1.00 51.17  ? 434 TYR C CB   1 
ATOM   7280  C CG   . TYR B 1 97  ? -5.150  -18.453 -5.664  1.00 41.72  ? 434 TYR C CG   1 
ATOM   7281  C CD1  . TYR B 1 97  ? -4.419  -17.848 -4.653  1.00 35.23  ? 434 TYR C CD1  1 
ATOM   7282  C CD2  . TYR B 1 97  ? -6.265  -17.784 -6.158  1.00 34.04  ? 434 TYR C CD2  1 
ATOM   7283  C CE1  . TYR B 1 97  ? -4.802  -16.621 -4.130  1.00 44.40  ? 434 TYR C CE1  1 
ATOM   7284  C CE2  . TYR B 1 97  ? -6.657  -16.575 -5.639  1.00 31.72  ? 434 TYR C CE2  1 
ATOM   7285  C CZ   . TYR B 1 97  ? -5.922  -15.987 -4.636  1.00 33.09  ? 434 TYR C CZ   1 
ATOM   7286  O OH   . TYR B 1 97  ? -6.318  -14.764 -4.138  1.00 30.20  ? 434 TYR C OH   1 
ATOM   7287  H H    . TYR B 1 97  ? -2.936  -17.987 -7.176  1.00 40.52  ? 434 TYR C H    1 
ATOM   7288  H HA   . TYR B 1 97  ? -3.654  -20.532 -7.831  1.00 56.31  ? 434 TYR C HA   1 
ATOM   7289  H HB2  . TYR B 1 97  ? -5.532  -20.297 -6.419  1.00 61.41  ? 434 TYR C HB2  1 
ATOM   7290  H HB3  . TYR B 1 97  ? -4.182  -20.234 -5.583  1.00 61.41  ? 434 TYR C HB3  1 
ATOM   7291  H HD1  . TYR B 1 97  ? -3.665  -18.276 -4.314  1.00 42.27  ? 434 TYR C HD1  1 
ATOM   7292  H HD2  . TYR B 1 97  ? -6.768  -18.174 -6.837  1.00 40.85  ? 434 TYR C HD2  1 
ATOM   7293  H HE1  . TYR B 1 97  ? -4.306  -16.226 -3.449  1.00 53.28  ? 434 TYR C HE1  1 
ATOM   7294  H HE2  . TYR B 1 97  ? -7.406  -16.143 -5.981  1.00 38.06  ? 434 TYR C HE2  1 
ATOM   7295  H HH   . TYR B 1 97  ? -5.722  -14.212 -4.245  1.00 36.24  ? 434 TYR C HH   1 
ATOM   7296  N N    . ARG B 1 98  ? -5.753  -19.823 -9.098  1.00 32.88  ? 435 ARG C N    1 
ATOM   7297  C CA   . ARG B 1 98  ? -6.615  -19.449 -10.194 1.00 52.20  ? 435 ARG C CA   1 
ATOM   7298  C C    . ARG B 1 98  ? -8.021  -19.905 -9.830  1.00 42.04  ? 435 ARG C C    1 
ATOM   7299  O O    . ARG B 1 98  ? -8.252  -20.351 -8.703  1.00 27.92  ? 435 ARG C O    1 
ATOM   7300  C CB   . ARG B 1 98  ? -6.103  -20.088 -11.484 1.00 68.04  ? 435 ARG C CB   1 
ATOM   7301  C CG   . ARG B 1 98  ? -4.674  -19.660 -11.804 1.00 86.31  ? 435 ARG C CG   1 
ATOM   7302  C CD   . ARG B 1 98  ? -4.060  -20.420 -12.965 1.00 99.30  ? 435 ARG C CD   1 
ATOM   7303  N NE   . ARG B 1 98  ? -2.798  -19.810 -13.380 1.00 106.55 ? 435 ARG C NE   1 
ATOM   7304  C CZ   . ARG B 1 98  ? -1.635  -19.993 -12.762 1.00 108.09 ? 435 ARG C CZ   1 
ATOM   7305  N NH1  . ARG B 1 98  ? -1.558  -20.774 -11.693 1.00 105.37 ? 435 ARG C NH1  1 
ATOM   7306  N NH2  . ARG B 1 98  ? -0.544  -19.390 -13.212 1.00 107.20 ? 435 ARG C NH2  1 
ATOM   7307  H H    . ARG B 1 98  ? -5.919  -20.606 -8.783  1.00 39.46  ? 435 ARG C H    1 
ATOM   7308  H HA   . ARG B 1 98  ? -6.616  -18.475 -10.300 1.00 62.64  ? 435 ARG C HA   1 
ATOM   7309  H HB2  . ARG B 1 98  ? -6.116  -21.053 -11.389 1.00 81.65  ? 435 ARG C HB2  1 
ATOM   7310  H HB3  . ARG B 1 98  ? -6.672  -19.817 -12.221 1.00 81.65  ? 435 ARG C HB3  1 
ATOM   7311  H HG2  . ARG B 1 98  ? -4.672  -18.717 -12.032 1.00 103.57 ? 435 ARG C HG2  1 
ATOM   7312  H HG3  . ARG B 1 98  ? -4.119  -19.811 -11.023 1.00 103.57 ? 435 ARG C HG3  1 
ATOM   7313  H HD2  . ARG B 1 98  ? -3.883  -21.334 -12.694 1.00 119.15 ? 435 ARG C HD2  1 
ATOM   7314  H HD3  . ARG B 1 98  ? -4.670  -20.403 -13.719 1.00 119.15 ? 435 ARG C HD3  1 
ATOM   7315  H HE   . ARG B 1 98  ? -2.808  -19.298 -14.070 1.00 127.87 ? 435 ARG C HE   1 
ATOM   7316  H HH11 . ARG B 1 98  ? -2.264  -21.166 -11.396 1.00 126.45 ? 435 ARG C HH11 1 
ATOM   7317  H HH12 . ARG B 1 98  ? -0.803  -20.889 -11.298 1.00 126.45 ? 435 ARG C HH12 1 
ATOM   7318  H HH21 . ARG B 1 98  ? -0.588  -18.882 -13.905 1.00 128.64 ? 435 ARG C HH21 1 
ATOM   7319  H HH22 . ARG B 1 98  ? 0.209   -19.509 -12.814 1.00 128.64 ? 435 ARG C HH22 1 
ATOM   7320  N N    . SER B 1 99  ? -8.962  -19.777 -10.757 1.00 37.84  ? 436 SER C N    1 
ATOM   7321  C CA   . SER B 1 99  ? -10.372 -19.996 -10.442 1.00 44.24  ? 436 SER C CA   1 
ATOM   7322  C C    . SER B 1 99  ? -10.651 -21.439 -10.048 1.00 39.81  ? 436 SER C C    1 
ATOM   7323  O O    . SER B 1 99  ? -11.532 -21.718 -9.228  1.00 33.11  ? 436 SER C O    1 
ATOM   7324  C CB   . SER B 1 99  ? -11.250 -19.618 -11.632 1.00 37.00  ? 436 SER C CB   1 
ATOM   7325  O OG   . SER B 1 99  ? -10.871 -20.333 -12.794 1.00 36.12  ? 436 SER C OG   1 
ATOM   7326  H H    . SER B 1 99  ? -8.813  -19.563 -11.577 1.00 45.41  ? 436 SER C H    1 
ATOM   7327  H HA   . SER B 1 99  ? -10.622 -19.423 -9.688  1.00 53.09  ? 436 SER C HA   1 
ATOM   7328  H HB2  . SER B 1 99  ? -12.173 -19.827 -11.421 1.00 44.40  ? 436 SER C HB2  1 
ATOM   7329  H HB3  . SER B 1 99  ? -11.156 -18.668 -11.802 1.00 44.40  ? 436 SER C HB3  1 
ATOM   7330  H HG   . SER B 1 99  ? -11.351 -20.119 -13.424 1.00 43.34  ? 436 SER C HG   1 
ATOM   7331  N N    . GLU B 1 100 ? -9.895  -22.350 -10.645 1.00 34.31  ? 437 GLU C N    1 
ATOM   7332  C CA   . GLU B 1 100 ? -10.057 -23.776 -10.404 1.00 33.95  ? 437 GLU C CA   1 
ATOM   7333  C C    . GLU B 1 100 ? -9.773  -24.157 -8.953  1.00 30.30  ? 437 GLU C C    1 
ATOM   7334  O O    . GLU B 1 100 ? -10.205 -25.219 -8.495  1.00 36.64  ? 437 GLU C O    1 
ATOM   7335  C CB   . GLU B 1 100 ? -9.118  -24.564 -11.317 1.00 47.29  ? 437 GLU C CB   1 
ATOM   7336  C CG   . GLU B 1 100 ? -7.662  -24.131 -11.207 1.00 62.84  ? 437 GLU C CG   1 
ATOM   7337  C CD   . GLU B 1 100 ? -7.206  -23.280 -12.382 1.00 77.50  ? 437 GLU C CD   1 
ATOM   7338  O OE1  . GLU B 1 100 ? -7.940  -22.342 -12.775 1.00 64.91  ? 437 GLU C OE1  1 
ATOM   7339  O OE2  . GLU B 1 100 ? -6.107  -23.552 -12.915 1.00 88.11  ? 437 GLU C OE2  1 
ATOM   7340  H H    . GLU B 1 100 ? -9.269  -22.163 -11.204 1.00 41.17  ? 437 GLU C H    1 
ATOM   7341  H HA   . GLU B 1 100 ? -10.978 -24.036 -10.614 1.00 40.74  ? 437 GLU C HA   1 
ATOM   7342  H HB2  . GLU B 1 100 ? -9.168  -25.503 -11.083 1.00 56.75  ? 437 GLU C HB2  1 
ATOM   7343  H HB3  . GLU B 1 100 ? -9.397  -24.438 -12.238 1.00 56.75  ? 437 GLU C HB3  1 
ATOM   7344  H HG2  . GLU B 1 100 ? -7.548  -23.608 -10.398 1.00 75.41  ? 437 GLU C HG2  1 
ATOM   7345  H HG3  . GLU B 1 100 ? -7.100  -24.920 -11.173 1.00 75.41  ? 437 GLU C HG3  1 
ATOM   7346  N N    . ASN B 1 101 ? -9.032  -23.313 -8.241  1.00 26.83  ? 438 ASN C N    1 
ATOM   7347  C CA   . ASN B 1 101 ? -8.720  -23.568 -6.825  1.00 41.39  ? 438 ASN C CA   1 
ATOM   7348  C C    . ASN B 1 101 ? -9.737  -22.954 -5.861  1.00 42.16  ? 438 ASN C C    1 
ATOM   7349  O O    . ASN B 1 101 ? -9.672  -23.191 -4.652  1.00 24.16  ? 438 ASN C O    1 
ATOM   7350  C CB   . ASN B 1 101 ? -7.344  -23.000 -6.460  1.00 40.34  ? 438 ASN C CB   1 
ATOM   7351  C CG   . ASN B 1 101 ? -6.224  -23.577 -7.298  1.00 53.60  ? 438 ASN C CG   1 
ATOM   7352  O OD1  . ASN B 1 101 ? -5.955  -24.779 -7.268  1.00 57.15  ? 438 ASN C OD1  1 
ATOM   7353  N ND2  . ASN B 1 101 ? -5.537  -22.710 -8.024  1.00 40.75  ? 438 ASN C ND2  1 
ATOM   7354  H H    . ASN B 1 101 ? -8.695  -22.584 -8.549  1.00 32.20  ? 438 ASN C H    1 
ATOM   7355  H HA   . ASN B 1 101 ? -8.700  -24.535 -6.670  1.00 49.67  ? 438 ASN C HA   1 
ATOM   7356  H HB2  . ASN B 1 101 ? -7.354  -22.039 -6.595  1.00 48.41  ? 438 ASN C HB2  1 
ATOM   7357  H HB3  . ASN B 1 101 ? -7.156  -23.202 -5.530  1.00 48.41  ? 438 ASN C HB3  1 
ATOM   7358  H HD21 . ASN B 1 101 ? -5.739  -21.875 -8.000  1.00 48.90  ? 438 ASN C HD21 1 
ATOM   7359  H HD22 . ASN B 1 101 ? -4.889  -22.983 -8.520  1.00 48.90  ? 438 ASN C HD22 1 
ATOM   7360  N N    . CYS B 1 102 ? -10.657 -22.151 -6.390  1.00 30.13  ? 439 CYS C N    1 
ATOM   7361  C CA   . CYS B 1 102 ? -11.540 -21.345 -5.548  1.00 26.72  ? 439 CYS C CA   1 
ATOM   7362  C C    . CYS B 1 102 ? -13.005 -21.656 -5.815  1.00 26.17  ? 439 CYS C C    1 
ATOM   7363  O O    . CYS B 1 102 ? -13.342 -22.304 -6.810  1.00 28.18  ? 439 CYS C O    1 
ATOM   7364  C CB   . CYS B 1 102 ? -11.276 -19.859 -5.800  1.00 29.47  ? 439 CYS C CB   1 
ATOM   7365  S SG   . CYS B 1 102 ? -9.565  -19.369 -5.524  1.00 31.11  ? 439 CYS C SG   1 
ATOM   7366  H H    . CYS B 1 102 ? -10.791 -22.055 -7.234  1.00 36.16  ? 439 CYS C H    1 
ATOM   7367  H HA   . CYS B 1 102 ? -11.352 -21.536 -4.605  1.00 32.06  ? 439 CYS C HA   1 
ATOM   7368  H HB2  . CYS B 1 102 ? -11.498 -19.654 -6.722  1.00 35.36  ? 439 CYS C HB2  1 
ATOM   7369  H HB3  . CYS B 1 102 ? -11.834 -19.337 -5.203  1.00 35.36  ? 439 CYS C HB3  1 
ATOM   7370  H HG   . CYS B 1 102 ? -8.856  -19.993 -6.264  1.00 37.33  ? 439 CYS C HG   1 
ATOM   7371  N N    . LEU B 1 103 ? -13.872 -21.206 -4.916  1.00 26.01  ? 440 LEU C N    1 
ATOM   7372  C CA   . LEU B 1 103 ? -15.307 -21.322 -5.126  1.00 29.52  ? 440 LEU C CA   1 
ATOM   7373  C C    . LEU B 1 103 ? -15.863 -19.999 -5.661  1.00 22.19  ? 440 LEU C C    1 
ATOM   7374  O O    . LEU B 1 103 ? -15.647 -18.953 -5.069  1.00 23.54  ? 440 LEU C O    1 
ATOM   7375  C CB   . LEU B 1 103 ? -16.013 -21.665 -3.824  1.00 23.76  ? 440 LEU C CB   1 
ATOM   7376  C CG   . LEU B 1 103 ? -16.002 -23.136 -3.421  1.00 29.40  ? 440 LEU C CG   1 
ATOM   7377  C CD1  . LEU B 1 103 ? -14.576 -23.595 -3.138  1.00 37.72  ? 440 LEU C CD1  1 
ATOM   7378  C CD2  . LEU B 1 103 ? -16.906 -23.348 -2.200  1.00 31.32  ? 440 LEU C CD2  1 
ATOM   7379  H H    . LEU B 1 103 ? -13.653 -20.829 -4.175  1.00 31.21  ? 440 LEU C H    1 
ATOM   7380  H HA   . LEU B 1 103 ? -15.490 -22.028 -5.780  1.00 35.42  ? 440 LEU C HA   1 
ATOM   7381  H HB2  . LEU B 1 103 ? -15.589 -21.166 -3.108  1.00 28.52  ? 440 LEU C HB2  1 
ATOM   7382  H HB3  . LEU B 1 103 ? -16.941 -21.393 -3.900  1.00 28.52  ? 440 LEU C HB3  1 
ATOM   7383  H HG   . LEU B 1 103 ? -16.352 -23.669 -4.152  1.00 35.28  ? 440 LEU C HG   1 
ATOM   7384  H HD11 . LEU B 1 103 ? -14.591 -24.522 -2.887  1.00 45.26  ? 440 LEU C HD11 1 
ATOM   7385  H HD12 . LEU B 1 103 ? -14.048 -23.479 -3.931  1.00 45.26  ? 440 LEU C HD12 1 
ATOM   7386  H HD13 . LEU B 1 103 ? -14.214 -23.067 -2.423  1.00 45.26  ? 440 LEU C HD13 1 
ATOM   7387  H HD21 . LEU B 1 103 ? -16.890 -24.277 -1.958  1.00 37.59  ? 440 LEU C HD21 1 
ATOM   7388  H HD22 . LEU B 1 103 ? -16.578 -22.814 -1.473  1.00 37.59  ? 440 LEU C HD22 1 
ATOM   7389  H HD23 . LEU B 1 103 ? -17.801 -23.083 -2.425  1.00 37.59  ? 440 LEU C HD23 1 
ATOM   7390  N N    . CYS B 1 104 ? -16.592 -20.069 -6.761  1.00 22.46  ? 441 CYS C N    1 
ATOM   7391  C CA   . CYS B 1 104 ? -17.224 -18.882 -7.338  1.00 29.85  ? 441 CYS C CA   1 
ATOM   7392  C C    . CYS B 1 104 ? -18.595 -18.712 -6.709  1.00 24.05  ? 441 CYS C C    1 
ATOM   7393  O O    . CYS B 1 104 ? -19.421 -19.615 -6.781  1.00 27.22  ? 441 CYS C O    1 
ATOM   7394  C CB   . CYS B 1 104 ? -17.352 -19.052 -8.849  1.00 35.38  ? 441 CYS C CB   1 
ATOM   7395  S SG   . CYS B 1 104 ? -18.310 -17.757 -9.660  1.00 33.60  ? 441 CYS C SG   1 
ATOM   7396  H H    . CYS B 1 104 ? -16.741 -20.793 -7.200  1.00 26.95  ? 441 CYS C H    1 
ATOM   7397  H HA   . CYS B 1 104 ? -16.684 -18.087 -7.149  1.00 35.82  ? 441 CYS C HA   1 
ATOM   7398  H HB2  . CYS B 1 104 ? -16.464 -19.050 -9.239  1.00 42.46  ? 441 CYS C HB2  1 
ATOM   7399  H HB3  . CYS B 1 104 ? -17.788 -19.900 -9.031  1.00 42.46  ? 441 CYS C HB3  1 
ATOM   7400  H HG   . CYS B 1 104 ? -18.351 -17.981 -10.838 1.00 40.32  ? 441 CYS C HG   1 
ATOM   7401  N N    . VAL B 1 105 ? -18.833 -17.569 -6.078  1.00 26.48  ? 442 VAL C N    1 
ATOM   7402  C CA   . VAL B 1 105 ? -20.090 -17.326 -5.361  1.00 25.45  ? 442 VAL C CA   1 
ATOM   7403  C C    . VAL B 1 105 ? -21.297 -17.423 -6.297  1.00 26.02  ? 442 VAL C C    1 
ATOM   7404  O O    . VAL B 1 105 ? -22.359 -17.914 -5.916  1.00 29.15  ? 442 VAL C O    1 
ATOM   7405  C CB   . VAL B 1 105 ? -20.079 -15.934 -4.690  1.00 32.98  ? 442 VAL C CB   1 
ATOM   7406  C CG1  . VAL B 1 105 ? -21.428 -15.620 -4.065  1.00 36.09  ? 442 VAL C CG1  1 
ATOM   7407  C CG2  . VAL B 1 105 ? -18.978 -15.871 -3.646  1.00 22.49  ? 442 VAL C CG2  1 
ATOM   7408  H H    . VAL B 1 105 ? -18.281 -16.910 -6.047  1.00 31.78  ? 442 VAL C H    1 
ATOM   7409  H HA   . VAL B 1 105 ? -20.194 -18.002 -4.659  1.00 30.53  ? 442 VAL C HA   1 
ATOM   7410  H HB   . VAL B 1 105 ? -19.893 -15.252 -5.369  1.00 39.58  ? 442 VAL C HB   1 
ATOM   7411  H HG11 . VAL B 1 105 ? -21.389 -14.752 -3.658  1.00 43.31  ? 442 VAL C HG11 1 
ATOM   7412  H HG12 . VAL B 1 105 ? -22.100 -15.631 -4.751  1.00 43.31  ? 442 VAL C HG12 1 
ATOM   7413  H HG13 . VAL B 1 105 ? -21.627 -16.285 -3.401  1.00 43.31  ? 442 VAL C HG13 1 
ATOM   7414  H HG21 . VAL B 1 105 ? -18.984 -15.002 -3.238  1.00 26.99  ? 442 VAL C HG21 1 
ATOM   7415  H HG22 . VAL B 1 105 ? -19.139 -16.545 -2.982  1.00 26.99  ? 442 VAL C HG22 1 
ATOM   7416  H HG23 . VAL B 1 105 ? -18.133 -16.027 -4.073  1.00 26.99  ? 442 VAL C HG23 1 
ATOM   7417  N N    . GLN B 1 106 ? -21.123 -16.966 -7.530  1.00 24.85  ? 443 GLN C N    1 
ATOM   7418  C CA   . GLN B 1 106 ? -22.188 -17.033 -8.521  1.00 22.51  ? 443 GLN C CA   1 
ATOM   7419  C C    . GLN B 1 106 ? -22.671 -18.452 -8.778  1.00 29.56  ? 443 GLN C C    1 
ATOM   7420  O O    . GLN B 1 106 ? -23.859 -18.663 -8.994  1.00 27.82  ? 443 GLN C O    1 
ATOM   7421  C CB   . GLN B 1 106 ? -21.751 -16.372 -9.835  1.00 30.35  ? 443 GLN C CB   1 
ATOM   7422  C CG   . GLN B 1 106 ? -21.883 -14.858 -9.791  1.00 32.62  ? 443 GLN C CG   1 
ATOM   7423  C CD   . GLN B 1 106 ? -21.046 -14.211 -8.695  1.00 36.11  ? 443 GLN C CD   1 
ATOM   7424  O OE1  . GLN B 1 106 ? -19.897 -14.590 -8.457  1.00 27.98  ? 443 GLN C OE1  1 
ATOM   7425  N NE2  . GLN B 1 106 ? -21.617 -13.216 -8.034  1.00 34.78  ? 443 GLN C NE2  1 
ATOM   7426  H H    . GLN B 1 106 ? -20.395 -16.610 -7.819  1.00 29.82  ? 443 GLN C H    1 
ATOM   7427  H HA   . GLN B 1 106 ? -22.954 -16.524 -8.181  1.00 27.01  ? 443 GLN C HA   1 
ATOM   7428  H HB2  . GLN B 1 106 ? -20.821 -16.589 -10.005 1.00 36.42  ? 443 GLN C HB2  1 
ATOM   7429  H HB3  . GLN B 1 106 ? -22.308 -16.703 -10.557 1.00 36.42  ? 443 GLN C HB3  1 
ATOM   7430  H HG2  . GLN B 1 106 ? -21.593 -14.493 -10.642 1.00 39.15  ? 443 GLN C HG2  1 
ATOM   7431  H HG3  . GLN B 1 106 ? -22.812 -14.628 -9.632  1.00 39.15  ? 443 GLN C HG3  1 
ATOM   7432  H HE21 . GLN B 1 106 ? -22.417 -12.970 -8.235  1.00 41.74  ? 443 GLN C HE21 1 
ATOM   7433  H HE22 . GLN B 1 106 ? -21.189 -12.815 -7.405  1.00 41.74  ? 443 GLN C HE22 1 
ATOM   7434  N N    . ASN B 1 107 ? -21.760 -19.425 -8.747  1.00 24.18  ? 444 ASN C N    1 
ATOM   7435  C CA   . ASN B 1 107 ? -22.151 -20.810 -8.969  1.00 24.04  ? 444 ASN C CA   1 
ATOM   7436  C C    . ASN B 1 107 ? -23.030 -21.291 -7.827  1.00 27.95  ? 444 ASN C C    1 
ATOM   7437  O O    . ASN B 1 107 ? -23.980 -22.043 -8.035  1.00 29.18  ? 444 ASN C O    1 
ATOM   7438  C CB   . ASN B 1 107 ? -20.914 -21.707 -9.150  1.00 26.02  ? 444 ASN C CB   1 
ATOM   7439  C CG   . ASN B 1 107 ? -20.281 -21.545 -10.534 1.00 39.51  ? 444 ASN C CG   1 
ATOM   7440  O OD1  . ASN B 1 107 ? -20.729 -20.726 -11.336 1.00 52.19  ? 444 ASN C OD1  1 
ATOM   7441  N ND2  . ASN B 1 107 ? -19.239 -22.316 -10.813 1.00 40.44  ? 444 ASN C ND2  1 
ATOM   7442  H H    . ASN B 1 107 ? -20.921 -19.309 -8.600  1.00 29.02  ? 444 ASN C H    1 
ATOM   7443  H HA   . ASN B 1 107 ? -22.679 -20.860 -9.794  1.00 28.85  ? 444 ASN C HA   1 
ATOM   7444  H HB2  . ASN B 1 107 ? -20.250 -21.470 -8.484  1.00 31.23  ? 444 ASN C HB2  1 
ATOM   7445  H HB3  . ASN B 1 107 ? -21.176 -22.635 -9.045  1.00 31.23  ? 444 ASN C HB3  1 
ATOM   7446  H HD21 . ASN B 1 107 ? -18.949 -22.875 -10.227 1.00 48.53  ? 444 ASN C HD21 1 
ATOM   7447  H HD22 . ASN B 1 107 ? -18.854 -22.257 -11.579 1.00 48.53  ? 444 ASN C HD22 1 
ATOM   7448  N N    . ILE B 1 108 ? -22.729 -20.823 -6.622  1.00 28.91  ? 445 ILE C N    1 
ATOM   7449  C CA   . ILE B 1 108 ? -23.510 -21.197 -5.452  1.00 25.14  ? 445 ILE C CA   1 
ATOM   7450  C C    . ILE B 1 108 ? -24.916 -20.585 -5.533  1.00 28.06  ? 445 ILE C C    1 
ATOM   7451  O O    . ILE B 1 108 ? -25.910 -21.261 -5.280  1.00 26.81  ? 445 ILE C O    1 
ATOM   7452  C CB   . ILE B 1 108 ? -22.815 -20.732 -4.171  1.00 23.60  ? 445 ILE C CB   1 
ATOM   7453  C CG1  . ILE B 1 108 ? -21.357 -21.228 -4.146  1.00 27.76  ? 445 ILE C CG1  1 
ATOM   7454  C CG2  . ILE B 1 108 ? -23.603 -21.191 -2.958  1.00 21.71  ? 445 ILE C CG2  1 
ATOM   7455  C CD1  . ILE B 1 108 ? -20.580 -20.849 -2.900  1.00 25.22  ? 445 ILE C CD1  1 
ATOM   7456  H H    . ILE B 1 108 ? -22.076 -20.288 -6.455  1.00 34.69  ? 445 ILE C H    1 
ATOM   7457  H HA   . ILE B 1 108 ? -23.598 -22.172 -5.419  1.00 30.17  ? 445 ILE C HA   1 
ATOM   7458  H HB   . ILE B 1 108 ? -22.801 -19.763 -4.170  1.00 28.32  ? 445 ILE C HB   1 
ATOM   7459  H HG12 . ILE B 1 108 ? -21.358 -22.196 -4.207  1.00 33.32  ? 445 ILE C HG12 1 
ATOM   7460  H HG13 . ILE B 1 108 ? -20.890 -20.853 -4.909  1.00 33.32  ? 445 ILE C HG13 1 
ATOM   7461  H HG21 . ILE B 1 108 ? -23.155 -20.892 -2.164  1.00 26.05  ? 445 ILE C HG21 1 
ATOM   7462  H HG22 . ILE B 1 108 ? -24.485 -20.814 -2.999  1.00 26.05  ? 445 ILE C HG22 1 
ATOM   7463  H HG23 . ILE B 1 108 ? -23.656 -22.149 -2.965  1.00 26.05  ? 445 ILE C HG23 1 
ATOM   7464  H HD11 . ILE B 1 108 ? -19.688 -21.197 -2.971  1.00 30.27  ? 445 ILE C HD11 1 
ATOM   7465  H HD12 . ILE B 1 108 ? -20.553 -19.892 -2.828  1.00 30.27  ? 445 ILE C HD12 1 
ATOM   7466  H HD13 . ILE B 1 108 ? -21.018 -21.224 -2.132  1.00 30.27  ? 445 ILE C HD13 1 
ATOM   7467  N N    . LEU B 1 109 ? -24.986 -19.305 -5.894  1.00 25.15  ? 446 LEU C N    1 
ATOM   7468  C CA   . LEU B 1 109 ? -26.261 -18.601 -6.026  1.00 26.59  ? 446 LEU C CA   1 
ATOM   7469  C C    . LEU B 1 109 ? -27.153 -19.347 -7.012  1.00 28.31  ? 446 LEU C C    1 
ATOM   7470  O O    . LEU B 1 109 ? -28.349 -19.510 -6.790  1.00 27.62  ? 446 LEU C O    1 
ATOM   7471  C CB   . LEU B 1 109 ? -26.020 -17.152 -6.494  1.00 31.10  ? 446 LEU C CB   1 
ATOM   7472  C CG   . LEU B 1 109 ? -27.245 -16.349 -6.946  1.00 29.53  ? 446 LEU C CG   1 
ATOM   7473  C CD1  . LEU B 1 109 ? -28.254 -16.275 -5.829  1.00 25.02  ? 446 LEU C CD1  1 
ATOM   7474  C CD2  . LEU B 1 109 ? -26.867 -14.932 -7.440  1.00 27.69  ? 446 LEU C CD2  1 
ATOM   7475  H H    . LEU B 1 109 ? -24.301 -18.816 -6.071  1.00 30.18  ? 446 LEU C H    1 
ATOM   7476  H HA   . LEU B 1 109 ? -26.712 -18.576 -5.156  1.00 31.91  ? 446 LEU C HA   1 
ATOM   7477  H HB2  . LEU B 1 109 ? -25.613 -16.663 -5.762  1.00 37.32  ? 446 LEU C HB2  1 
ATOM   7478  H HB3  . LEU B 1 109 ? -25.404 -17.177 -7.243  1.00 37.32  ? 446 LEU C HB3  1 
ATOM   7479  H HG   . LEU B 1 109 ? -27.663 -16.815 -7.687  1.00 35.44  ? 446 LEU C HG   1 
ATOM   7480  H HD11 . LEU B 1 109 ? -29.014 -15.769 -6.128  1.00 30.02  ? 446 LEU C HD11 1 
ATOM   7481  H HD12 . LEU B 1 109 ? -28.525 -17.165 -5.594  1.00 30.02  ? 446 LEU C HD12 1 
ATOM   7482  H HD13 . LEU B 1 109 ? -27.850 -15.843 -5.072  1.00 30.02  ? 446 LEU C HD13 1 
ATOM   7483  H HD21 . LEU B 1 109 ? -27.666 -14.473 -7.710  1.00 33.23  ? 446 LEU C HD21 1 
ATOM   7484  H HD22 . LEU B 1 109 ? -26.441 -14.456 -6.724  1.00 33.23  ? 446 LEU C HD22 1 
ATOM   7485  H HD23 . LEU B 1 109 ? -26.267 -15.011 -8.184  1.00 33.23  ? 446 LEU C HD23 1 
ATOM   7486  N N    . LYS B 1 110 ? -26.551 -19.829 -8.094  1.00 31.25  ? 447 LYS C N    1 
ATOM   7487  C CA   . LYS B 1 110 ? -27.296 -20.538 -9.122  1.00 33.80  ? 447 LYS C CA   1 
ATOM   7488  C C    . LYS B 1 110 ? -27.914 -21.833 -8.562  1.00 36.66  ? 447 LYS C C    1 
ATOM   7489  O O    . LYS B 1 110 ? -29.080 -22.143 -8.831  1.00 30.04  ? 447 LYS C O    1 
ATOM   7490  C CB   . LYS B 1 110 ? -26.378 -20.820 -10.321 1.00 38.59  ? 447 LYS C CB   1 
ATOM   7491  C CG   . LYS B 1 110 ? -27.077 -21.400 -11.534 1.00 50.93  ? 447 LYS C CG   1 
ATOM   7492  C CD   . LYS B 1 110 ? -26.155 -21.389 -12.744 1.00 64.21  ? 447 LYS C CD   1 
ATOM   7493  C CE   . LYS B 1 110 ? -26.906 -21.663 -14.041 1.00 71.66  ? 447 LYS C CE   1 
ATOM   7494  N NZ   . LYS B 1 110 ? -27.417 -23.058 -14.133 1.00 71.31  ? 447 LYS C NZ   1 
ATOM   7495  H H    . LYS B 1 110 ? -25.710 -19.756 -8.256  1.00 37.50  ? 447 LYS C H    1 
ATOM   7496  H HA   . LYS B 1 110 ? -28.029 -19.967 -9.433  1.00 40.55  ? 447 LYS C HA   1 
ATOM   7497  H HB2  . LYS B 1 110 ? -25.961 -19.988 -10.593 1.00 46.30  ? 447 LYS C HB2  1 
ATOM   7498  H HB3  . LYS B 1 110 ? -25.696 -21.452 -10.046 1.00 46.30  ? 447 LYS C HB3  1 
ATOM   7499  H HG2  . LYS B 1 110 ? -27.333 -22.317 -11.351 1.00 61.11  ? 447 LYS C HG2  1 
ATOM   7500  H HG3  . LYS B 1 110 ? -27.860 -20.865 -11.741 1.00 61.11  ? 447 LYS C HG3  1 
ATOM   7501  H HD2  . LYS B 1 110 ? -25.735 -20.518 -12.817 1.00 77.05  ? 447 LYS C HD2  1 
ATOM   7502  H HD3  . LYS B 1 110 ? -25.480 -22.077 -12.636 1.00 77.05  ? 447 LYS C HD3  1 
ATOM   7503  H HE2  . LYS B 1 110 ? -27.665 -21.062 -14.098 1.00 85.99  ? 447 LYS C HE2  1 
ATOM   7504  H HE3  . LYS B 1 110 ? -26.307 -21.513 -14.789 1.00 85.99  ? 447 LYS C HE3  1 
ATOM   7505  H HZ1  . LYS B 1 110 ? -27.847 -23.174 -14.904 1.00 85.57  ? 447 LYS C HZ1  1 
ATOM   7506  H HZ2  . LYS B 1 110 ? -26.739 -23.633 -14.092 1.00 85.57  ? 447 LYS C HZ2  1 
ATOM   7507  H HZ3  . LYS B 1 110 ? -27.977 -23.222 -13.461 1.00 85.57  ? 447 LYS C HZ3  1 
ATOM   7508  N N    . LEU B 1 111 ? -27.148 -22.573 -7.764  1.00 36.10  ? 448 LEU C N    1 
ATOM   7509  C CA   . LEU B 1 111 ? -27.646 -23.811 -7.152  1.00 36.11  ? 448 LEU C CA   1 
ATOM   7510  C C    . LEU B 1 111 ? -28.742 -23.539 -6.122  1.00 27.70  ? 448 LEU C C    1 
ATOM   7511  O O    . LEU B 1 111 ? -29.715 -24.288 -6.029  1.00 30.75  ? 448 LEU C O    1 
ATOM   7512  C CB   . LEU B 1 111 ? -26.498 -24.590 -6.503  1.00 30.19  ? 448 LEU C CB   1 
ATOM   7513  C CG   . LEU B 1 111 ? -25.502 -25.144 -7.528  1.00 41.73  ? 448 LEU C CG   1 
ATOM   7514  C CD1  . LEU B 1 111 ? -24.238 -25.642 -6.861  1.00 44.41  ? 448 LEU C CD1  1 
ATOM   7515  C CD2  . LEU B 1 111 ? -26.155 -26.251 -8.350  1.00 42.92  ? 448 LEU C CD2  1 
ATOM   7516  H H    . LEU B 1 111 ? -26.335 -22.383 -7.558  1.00 43.32  ? 448 LEU C H    1 
ATOM   7517  H HA   . LEU B 1 111 ? -28.030 -24.376 -7.855  1.00 43.33  ? 448 LEU C HA   1 
ATOM   7518  H HB2  . LEU B 1 111 ? -26.015 -24.000 -5.903  1.00 36.23  ? 448 LEU C HB2  1 
ATOM   7519  H HB3  . LEU B 1 111 ? -26.866 -25.339 -6.007  1.00 36.23  ? 448 LEU C HB3  1 
ATOM   7520  H HG   . LEU B 1 111 ? -25.253 -24.431 -8.137  1.00 50.08  ? 448 LEU C HG   1 
ATOM   7521  H HD11 . LEU B 1 111 ? -23.642 -25.979 -7.534  1.00 53.29  ? 448 LEU C HD11 1 
ATOM   7522  H HD12 . LEU B 1 111 ? -23.824 -24.913 -6.392  1.00 53.29  ? 448 LEU C HD12 1 
ATOM   7523  H HD13 . LEU B 1 111 ? -24.465 -26.342 -6.244  1.00 53.29  ? 448 LEU C HD13 1 
ATOM   7524  H HD21 . LEU B 1 111 ? -25.517 -26.585 -8.986  1.00 51.51  ? 448 LEU C HD21 1 
ATOM   7525  H HD22 . LEU B 1 111 ? -26.430 -26.957 -7.760  1.00 51.51  ? 448 LEU C HD22 1 
ATOM   7526  H HD23 . LEU B 1 111 ? -26.917 -25.891 -8.809  1.00 51.51  ? 448 LEU C HD23 1 
ATOM   7527  N N    . MET B 1 112 ? -28.586 -22.464 -5.359  1.00 27.50  ? 449 MET C N    1 
ATOM   7528  C CA   . MET B 1 112 ? -29.600 -22.054 -4.392  1.00 30.13  ? 449 MET C CA   1 
ATOM   7529  C C    . MET B 1 112 ? -30.911 -21.712 -5.099  1.00 34.25  ? 449 MET C C    1 
ATOM   7530  O O    . MET B 1 112 ? -31.972 -22.112 -4.639  1.00 28.70  ? 449 MET C O    1 
ATOM   7531  C CB   . MET B 1 112 ? -29.116 -20.861 -3.556  1.00 25.07  ? 449 MET C CB   1 
ATOM   7532  C CG   . MET B 1 112 ? -27.887 -21.158 -2.691  1.00 29.12  ? 449 MET C CG   1 
ATOM   7533  S SD   . MET B 1 112 ? -27.184 -19.683 -1.916  1.00 26.43  ? 449 MET C SD   1 
ATOM   7534  C CE   . MET B 1 112 ? -28.513 -19.237 -0.793  1.00 21.93  ? 449 MET C CE   1 
ATOM   7535  H H    . MET B 1 112 ? -27.897 -21.951 -5.382  1.00 33.00  ? 449 MET C H    1 
ATOM   7536  H HA   . MET B 1 112 ? -29.763 -22.799 -3.776  1.00 36.16  ? 449 MET C HA   1 
ATOM   7537  H HB2  . MET B 1 112 ? -28.886 -20.134 -4.156  1.00 30.08  ? 449 MET C HB2  1 
ATOM   7538  H HB3  . MET B 1 112 ? -29.833 -20.583 -2.965  1.00 30.08  ? 449 MET C HB3  1 
ATOM   7539  H HG2  . MET B 1 112 ? -28.141 -21.773 -1.985  1.00 34.94  ? 449 MET C HG2  1 
ATOM   7540  H HG3  . MET B 1 112 ? -27.201 -21.559 -3.247  1.00 34.94  ? 449 MET C HG3  1 
ATOM   7541  H HE1  . MET B 1 112 ? -29.309 -19.068 -1.303  1.00 26.31  ? 449 MET C HE1  1 
ATOM   7542  H HE2  . MET B 1 112 ? -28.663 -19.963 -0.183  1.00 26.31  ? 449 MET C HE2  1 
ATOM   7543  H HE3  . MET B 1 112 ? -28.261 -18.448 -0.307  1.00 26.31  ? 449 MET C HE3  1 
ATOM   7544  N N    . GLN B 1 113 ? -30.850 -20.988 -6.217  1.00 32.22  ? 450 GLN C N    1 
ATOM   7545  C CA   . GLN B 1 113 ? -32.069 -20.631 -6.941  1.00 35.18  ? 450 GLN C CA   1 
ATOM   7546  C C    . GLN B 1 113 ? -32.763 -21.873 -7.458  1.00 39.83  ? 450 GLN C C    1 
ATOM   7547  O O    . GLN B 1 113 ? -33.987 -21.920 -7.546  1.00 34.81  ? 450 GLN C O    1 
ATOM   7548  C CB   . GLN B 1 113 ? -31.773 -19.716 -8.127  1.00 30.32  ? 450 GLN C CB   1 
ATOM   7549  C CG   . GLN B 1 113 ? -31.367 -18.321 -7.743  1.00 28.56  ? 450 GLN C CG   1 
ATOM   7550  C CD   . GLN B 1 113 ? -30.950 -17.529 -8.951  1.00 42.63  ? 450 GLN C CD   1 
ATOM   7551  O OE1  . GLN B 1 113 ? -29.918 -17.808 -9.562  1.00 48.85  ? 450 GLN C OE1  1 
ATOM   7552  N NE2  . GLN B 1 113 ? -31.770 -16.558 -9.331  1.00 27.94  ? 450 GLN C NE2  1 
ATOM   7553  H H    . GLN B 1 113 ? -30.124 -20.694 -6.573  1.00 38.66  ? 450 GLN C H    1 
ATOM   7554  H HA   . GLN B 1 113 ? -32.682 -20.164 -6.335  1.00 42.22  ? 450 GLN C HA   1 
ATOM   7555  H HB2  . GLN B 1 113 ? -31.049 -20.102 -8.644  1.00 36.39  ? 450 GLN C HB2  1 
ATOM   7556  H HB3  . GLN B 1 113 ? -32.569 -19.651 -8.676  1.00 36.39  ? 450 GLN C HB3  1 
ATOM   7557  H HG2  . GLN B 1 113 ? -32.119 -17.871 -7.326  1.00 34.27  ? 450 GLN C HG2  1 
ATOM   7558  H HG3  . GLN B 1 113 ? -30.616 -18.362 -7.130  1.00 34.27  ? 450 GLN C HG3  1 
ATOM   7559  H HE21 . GLN B 1 113 ? -32.494 -16.411 -8.892  1.00 33.53  ? 450 GLN C HE21 1 
ATOM   7560  H HE22 . GLN B 1 113 ? -31.576 -16.076 -10.016 1.00 33.53  ? 450 GLN C HE22 1 
ATOM   7561  N N    . GLU B 1 114 ? -31.974 -22.880 -7.815  1.00 31.67  ? 451 GLU C N    1 
ATOM   7562  C CA   . GLU B 1 114 ? -32.537 -24.110 -8.359  1.00 35.97  ? 451 GLU C CA   1 
ATOM   7563  C C    . GLU B 1 114 ? -33.329 -24.859 -7.300  1.00 39.84  ? 451 GLU C C    1 
ATOM   7564  O O    . GLU B 1 114 ? -34.008 -25.838 -7.600  1.00 37.32  ? 451 GLU C O    1 
ATOM   7565  C CB   . GLU B 1 114 ? -31.436 -24.995 -8.947  1.00 42.15  ? 451 GLU C CB   1 
ATOM   7566  C CG   . GLU B 1 114 ? -30.918 -24.494 -10.291 1.00 45.55  ? 451 GLU C CG   1 
ATOM   7567  C CD   . GLU B 1 114 ? -29.654 -25.202 -10.743 1.00 64.59  ? 451 GLU C CD   1 
ATOM   7568  O OE1  . GLU B 1 114 ? -29.446 -26.371 -10.351 1.00 68.87  ? 451 GLU C OE1  1 
ATOM   7569  O OE2  . GLU B 1 114 ? -28.866 -24.585 -11.490 1.00 70.63  ? 451 GLU C OE2  1 
ATOM   7570  H H    . GLU B 1 114 ? -31.116 -22.878 -7.753  1.00 38.00  ? 451 GLU C H    1 
ATOM   7571  H HA   . GLU B 1 114 ? -33.153 -23.879 -9.085  1.00 43.17  ? 451 GLU C HA   1 
ATOM   7572  H HB2  . GLU B 1 114 ? -30.688 -25.020 -8.329  1.00 50.58  ? 451 GLU C HB2  1 
ATOM   7573  H HB3  . GLU B 1 114 ? -31.787 -25.890 -9.077  1.00 50.58  ? 451 GLU C HB3  1 
ATOM   7574  H HG2  . GLU B 1 114 ? -31.599 -24.639 -10.966 1.00 54.66  ? 451 GLU C HG2  1 
ATOM   7575  H HG3  . GLU B 1 114 ? -30.720 -23.547 -10.219 1.00 54.66  ? 451 GLU C HG3  1 
ATOM   7576  N N    . LYS B 1 115 ? -33.251 -24.386 -6.062  1.00 38.67  ? 452 LYS C N    1 
ATOM   7577  C CA   . LYS B 1 115 ? -33.994 -24.987 -4.961  1.00 42.16  ? 452 LYS C CA   1 
ATOM   7578  C C    . LYS B 1 115 ? -35.237 -24.160 -4.654  1.00 46.56  ? 452 LYS C C    1 
ATOM   7579  O O    . LYS B 1 115 ? -36.014 -24.497 -3.760  1.00 37.42  ? 452 LYS C O    1 
ATOM   7580  C CB   . LYS B 1 115 ? -33.110 -25.068 -3.717  1.00 45.40  ? 452 LYS C CB   1 
ATOM   7581  C CG   . LYS B 1 115 ? -31.659 -25.404 -4.024  1.00 52.64  ? 452 LYS C CG   1 
ATOM   7582  C CD   . LYS B 1 115 ? -31.232 -26.703 -3.383  1.00 53.64  ? 452 LYS C CD   1 
ATOM   7583  C CE   . LYS B 1 115 ? -32.028 -27.883 -3.902  1.00 54.30  ? 452 LYS C CE   1 
ATOM   7584  N NZ   . LYS B 1 115 ? -31.541 -29.162 -3.311  1.00 60.64  ? 452 LYS C NZ   1 
ATOM   7585  H H    . LYS B 1 115 ? -32.770 -23.711 -5.831  1.00 46.40  ? 452 LYS C H    1 
ATOM   7586  H HA   . LYS B 1 115 ? -34.273 -25.894 -5.207  1.00 50.59  ? 452 LYS C HA   1 
ATOM   7587  H HB2  . LYS B 1 115 ? -33.128 -24.211 -3.264  1.00 54.47  ? 452 LYS C HB2  1 
ATOM   7588  H HB3  . LYS B 1 115 ? -33.457 -25.758 -3.130  1.00 54.47  ? 452 LYS C HB3  1 
ATOM   7589  H HG2  . LYS B 1 115 ? -31.549 -25.490 -4.984  1.00 63.16  ? 452 LYS C HG2  1 
ATOM   7590  H HG3  . LYS B 1 115 ? -31.090 -24.696 -3.684  1.00 63.16  ? 452 LYS C HG3  1 
ATOM   7591  H HD2  . LYS B 1 115 ? -30.295 -26.861 -3.579  1.00 64.37  ? 452 LYS C HD2  1 
ATOM   7592  H HD3  . LYS B 1 115 ? -31.368 -26.644 -2.424  1.00 64.37  ? 452 LYS C HD3  1 
ATOM   7593  H HE2  . LYS B 1 115 ? -32.962 -27.772 -3.661  1.00 65.16  ? 452 LYS C HE2  1 
ATOM   7594  H HE3  . LYS B 1 115 ? -31.933 -27.937 -4.866  1.00 65.16  ? 452 LYS C HE3  1 
ATOM   7595  H HZ1  . LYS B 1 115 ? -32.018 -29.844 -3.625  1.00 72.77  ? 452 LYS C HZ1  1 
ATOM   7596  H HZ2  . LYS B 1 115 ? -30.685 -29.287 -3.521  1.00 72.77  ? 452 LYS C HZ2  1 
ATOM   7597  H HZ3  . LYS B 1 115 ? -31.621 -29.138 -2.425  1.00 72.77  ? 452 LYS C HZ3  1 
ATOM   7598  N N    . GLU B 1 116 ? -35.403 -23.066 -5.394  1.00 39.06  ? 453 GLU C N    1 
ATOM   7599  C CA   . GLU B 1 116 ? -36.558 -22.189 -5.244  1.00 34.59  ? 453 GLU C CA   1 
ATOM   7600  C C    . GLU B 1 116 ? -36.624 -21.620 -3.837  1.00 34.58  ? 453 GLU C C    1 
ATOM   7601  O O    . GLU B 1 116 ? -37.683 -21.618 -3.209  1.00 30.15  ? 453 GLU C O    1 
ATOM   7602  C CB   . GLU B 1 116 ? -37.851 -22.950 -5.546  1.00 41.92  ? 453 GLU C CB   1 
ATOM   7603  C CG   . GLU B 1 116 ? -37.922 -23.524 -6.948  1.00 56.80  ? 453 GLU C CG   1 
ATOM   7604  C CD   . GLU B 1 116 ? -39.205 -24.291 -7.193  1.00 69.26  ? 453 GLU C CD   1 
ATOM   7605  O OE1  . GLU B 1 116 ? -40.291 -23.687 -7.080  1.00 62.55  ? 453 GLU C OE1  1 
ATOM   7606  O OE2  . GLU B 1 116 ? -39.126 -25.501 -7.487  1.00 83.15  ? 453 GLU C OE2  1 
ATOM   7607  H H    . GLU B 1 116 ? -34.850 -22.806 -5.999  1.00 46.87  ? 453 GLU C H    1 
ATOM   7608  H HA   . GLU B 1 116 ? -36.484 -21.443 -5.875  1.00 41.51  ? 453 GLU C HA   1 
ATOM   7609  H HB2  . GLU B 1 116 ? -37.931 -23.688 -4.921  1.00 50.30  ? 453 GLU C HB2  1 
ATOM   7610  H HB3  . GLU B 1 116 ? -38.601 -22.345 -5.437  1.00 50.30  ? 453 GLU C HB3  1 
ATOM   7611  H HG2  . GLU B 1 116 ? -37.878 -22.799 -7.591  1.00 68.16  ? 453 GLU C HG2  1 
ATOM   7612  H HG3  . GLU B 1 116 ? -37.178 -24.132 -7.080  1.00 68.16  ? 453 GLU C HG3  1 
ATOM   7613  N N    . THR B 1 117 ? -35.483 -21.166 -3.336  1.00 32.95  ? 454 THR C N    1 
ATOM   7614  C CA   . THR B 1 117 ? -35.428 -20.487 -2.050  1.00 39.67  ? 454 THR C CA   1 
ATOM   7615  C C    . THR B 1 117 ? -36.319 -19.251 -2.029  1.00 38.02  ? 454 THR C C    1 
ATOM   7616  O O    . THR B 1 117 ? -36.564 -18.622 -3.066  1.00 25.94  ? 454 THR C O    1 
ATOM   7617  C CB   . THR B 1 117 ? -33.999 -20.034 -1.749  1.00 37.97  ? 454 THR C CB   1 
ATOM   7618  O OG1  . THR B 1 117 ? -33.446 -19.417 -2.921  1.00 27.11  ? 454 THR C OG1  1 
ATOM   7619  C CG2  . THR B 1 117 ? -33.136 -21.217 -1.361  1.00 35.12  ? 454 THR C CG2  1 
ATOM   7620  H H    . THR B 1 117 ? -34.720 -21.240 -3.725  1.00 39.54  ? 454 THR C H    1 
ATOM   7621  H HA   . THR B 1 117 ? -35.720 -21.098 -1.341  1.00 47.60  ? 454 THR C HA   1 
ATOM   7622  H HB   . THR B 1 117 ? -34.004 -19.398 -1.016  1.00 45.56  ? 454 THR C HB   1 
ATOM   7623  H HG1  . THR B 1 117 ? -32.679 -19.169 -2.772  1.00 32.53  ? 454 THR C HG1  1 
ATOM   7624  H HG21 . THR B 1 117 ? -32.242 -20.923 -1.174  1.00 42.14  ? 454 THR C HG21 1 
ATOM   7625  H HG22 . THR B 1 117 ? -33.495 -21.641 -0.578  1.00 42.14  ? 454 THR C HG22 1 
ATOM   7626  H HG23 . THR B 1 117 ? -33.112 -21.854 -2.079  1.00 42.14  ? 454 THR C HG23 1 
ATOM   7627  N N    . GLY B 1 118 ? -36.804 -18.902 -0.841  1.00 33.37  ? 455 GLY C N    1 
ATOM   7628  C CA   . GLY B 1 118 ? -37.556 -17.673 -0.662  1.00 42.92  ? 455 GLY C CA   1 
ATOM   7629  C C    . GLY B 1 118 ? -36.674 -16.435 -0.599  1.00 33.94  ? 455 GLY C C    1 
ATOM   7630  O O    . GLY B 1 118 ? -37.114 -15.339 -0.930  1.00 28.32  ? 455 GLY C O    1 
ATOM   7631  H H    . GLY B 1 118 ? -36.708 -19.364 -0.123  1.00 40.04  ? 455 GLY C H    1 
ATOM   7632  H HA2  . GLY B 1 118 ? -38.178 -17.567 -1.399  1.00 51.50  ? 455 GLY C HA2  1 
ATOM   7633  H HA3  . GLY B 1 118 ? -38.066 -17.727 0.162   1.00 51.50  ? 455 GLY C HA3  1 
ATOM   7634  N N    . LEU B 1 119 ? -35.431 -16.607 -0.156  1.00 22.06  ? 456 LEU C N    1 
ATOM   7635  C CA   . LEU B 1 119 ? -34.500 -15.494 0.002   1.00 28.34  ? 456 LEU C CA   1 
ATOM   7636  C C    . LEU B 1 119 ? -33.073 -16.017 -0.108  1.00 28.13  ? 456 LEU C C    1 
ATOM   7637  O O    . LEU B 1 119 ? -32.766 -17.068 0.448   1.00 28.40  ? 456 LEU C O    1 
ATOM   7638  C CB   . LEU B 1 119 ? -34.705 -14.805 1.359   1.00 18.15  ? 456 LEU C CB   1 
ATOM   7639  C CG   . LEU B 1 119 ? -33.762 -13.643 1.693   1.00 28.35  ? 456 LEU C CG   1 
ATOM   7640  C CD1  . LEU B 1 119 ? -34.001 -12.485 0.739   1.00 25.45  ? 456 LEU C CD1  1 
ATOM   7641  C CD2  . LEU B 1 119 ? -33.933 -13.168 3.148   1.00 19.98  ? 456 LEU C CD2  1 
ATOM   7642  H H    . LEU B 1 119 ? -35.099 -17.369 0.063   1.00 26.47  ? 456 LEU C H    1 
ATOM   7643  H HA   . LEU B 1 119 ? -34.649 -14.836 -0.709  1.00 34.01  ? 456 LEU C HA   1 
ATOM   7644  H HB2  . LEU B 1 119 ? -35.610 -14.458 1.389   1.00 21.77  ? 456 LEU C HB2  1 
ATOM   7645  H HB3  . LEU B 1 119 ? -34.595 -15.472 2.056   1.00 21.77  ? 456 LEU C HB3  1 
ATOM   7646  H HG   . LEU B 1 119 ? -32.845 -13.938 1.580   1.00 34.02  ? 456 LEU C HG   1 
ATOM   7647  H HD11 . LEU B 1 119 ? -33.403 -11.768 0.962   1.00 30.54  ? 456 LEU C HD11 1 
ATOM   7648  H HD12 . LEU B 1 119 ? -33.837 -12.781 -0.159  1.00 30.54  ? 456 LEU C HD12 1 
ATOM   7649  H HD13 . LEU B 1 119 ? -34.911 -12.192 0.826   1.00 30.54  ? 456 LEU C HD13 1 
ATOM   7650  H HD21 . LEU B 1 119 ? -33.327 -12.443 3.313   1.00 23.98  ? 456 LEU C HD21 1 
ATOM   7651  H HD22 . LEU B 1 119 ? -34.838 -12.875 3.275   1.00 23.98  ? 456 LEU C HD22 1 
ATOM   7652  H HD23 . LEU B 1 119 ? -33.739 -13.899 3.739   1.00 23.98  ? 456 LEU C HD23 1 
ATOM   7653  N N    . ASN B 1 120 ? -32.222 -15.294 -0.842  1.00 21.29  ? 457 ASN C N    1 
ATOM   7654  C CA   . ASN B 1 120 ? -30.798 -15.609 -0.967  1.00 19.49  ? 457 ASN C CA   1 
ATOM   7655  C C    . ASN B 1 120 ? -29.966 -14.443 -0.510  1.00 25.18  ? 457 ASN C C    1 
ATOM   7656  O O    . ASN B 1 120 ? -29.987 -13.389 -1.132  1.00 23.49  ? 457 ASN C O    1 
ATOM   7657  C CB   . ASN B 1 120 ? -30.421 -15.880 -2.421  1.00 21.60  ? 457 ASN C CB   1 
ATOM   7658  C CG   . ASN B 1 120 ? -31.259 -16.951 -3.043  1.00 25.69  ? 457 ASN C CG   1 
ATOM   7659  O OD1  . ASN B 1 120 ? -31.200 -18.108 -2.631  1.00 22.81  ? 457 ASN C OD1  1 
ATOM   7660  N ND2  . ASN B 1 120 ? -32.021 -16.588 -4.074  1.00 23.49  ? 457 ASN C ND2  1 
ATOM   7661  H H    . ASN B 1 120 ? -32.455 -14.597 -1.288  1.00 25.55  ? 457 ASN C H    1 
ATOM   7662  H HA   . ASN B 1 120 ? -30.577 -16.395 -0.426  1.00 23.38  ? 457 ASN C HA   1 
ATOM   7663  H HB2  . ASN B 1 120 ? -30.542 -15.067 -2.936  1.00 25.91  ? 457 ASN C HB2  1 
ATOM   7664  H HB3  . ASN B 1 120 ? -29.494 -16.163 -2.460  1.00 25.91  ? 457 ASN C HB3  1 
ATOM   7665  H HD21 . ASN B 1 120 ? -32.014 -15.773 -4.348  1.00 28.18  ? 457 ASN C HD21 1 
ATOM   7666  H HD22 . ASN B 1 120 ? -32.521 -17.169 -4.465  1.00 28.18  ? 457 ASN C HD22 1 
ATOM   7667  N N    . VAL B 1 121 ? -29.218 -14.622 0.564   1.00 25.55  ? 458 VAL C N    1 
ATOM   7668  C CA   . VAL B 1 121 ? -28.376 -13.551 1.066   1.00 20.05  ? 458 VAL C CA   1 
ATOM   7669  C C    . VAL B 1 121 ? -26.924 -13.990 1.098   1.00 25.48  ? 458 VAL C C    1 
ATOM   7670  O O    . VAL B 1 121 ? -26.602 -15.041 1.663   1.00 24.47  ? 458 VAL C O    1 
ATOM   7671  C CB   . VAL B 1 121 ? -28.759 -13.201 2.487   1.00 15.37  ? 458 VAL C CB   1 
ATOM   7672  C CG1  . VAL B 1 121 ? -27.839 -12.127 3.038   1.00 21.03  ? 458 VAL C CG1  1 
ATOM   7673  C CG2  . VAL B 1 121 ? -30.230 -12.763 2.539   1.00 21.68  ? 458 VAL C CG2  1 
ATOM   7674  H H    . VAL B 1 121 ? -29.178 -15.351 1.019   1.00 30.66  ? 458 VAL C H    1 
ATOM   7675  H HA   . VAL B 1 121 ? -28.463 -12.755 0.501   1.00 24.06  ? 458 VAL C HA   1 
ATOM   7676  H HB   . VAL B 1 121 ? -28.662 -13.999 3.048   1.00 18.45  ? 458 VAL C HB   1 
ATOM   7677  H HG11 . VAL B 1 121 ? -28.101 -11.923 3.938   1.00 25.23  ? 458 VAL C HG11 1 
ATOM   7678  H HG12 . VAL B 1 121 ? -26.936 -12.453 3.025   1.00 25.23  ? 458 VAL C HG12 1 
ATOM   7679  H HG13 . VAL B 1 121 ? -27.912 -11.342 2.489   1.00 25.23  ? 458 VAL C HG13 1 
ATOM   7680  H HG21 . VAL B 1 121 ? -30.459 -12.545 3.445   1.00 26.02  ? 458 VAL C HG21 1 
ATOM   7681  H HG22 . VAL B 1 121 ? -30.346 -11.993 1.977   1.00 26.02  ? 458 VAL C HG22 1 
ATOM   7682  H HG23 . VAL B 1 121 ? -30.782 -13.484 2.226   1.00 26.02  ? 458 VAL C HG23 1 
ATOM   7683  N N    . PHE B 1 122 ? -26.051 -13.183 0.508   1.00 17.92  ? 459 PHE C N    1 
ATOM   7684  C CA   . PHE B 1 122 ? -24.616 -13.414 0.586   1.00 21.71  ? 459 PHE C CA   1 
ATOM   7685  C C    . PHE B 1 122 ? -23.963 -12.245 1.290   1.00 23.69  ? 459 PHE C C    1 
ATOM   7686  O O    . PHE B 1 122 ? -24.172 -11.096 0.919   1.00 20.92  ? 459 PHE C O    1 
ATOM   7687  C CB   . PHE B 1 122 ? -24.035 -13.601 -0.818  1.00 22.33  ? 459 PHE C CB   1 
ATOM   7688  C CG   . PHE B 1 122 ? -24.692 -14.710 -1.580  1.00 25.98  ? 459 PHE C CG   1 
ATOM   7689  C CD1  . PHE B 1 122 ? -24.059 -15.923 -1.750  1.00 33.16  ? 459 PHE C CD1  1 
ATOM   7690  C CD2  . PHE B 1 122 ? -25.966 -14.546 -2.094  1.00 36.22  ? 459 PHE C CD2  1 
ATOM   7691  C CE1  . PHE B 1 122 ? -24.676 -16.947 -2.443  1.00 34.77  ? 459 PHE C CE1  1 
ATOM   7692  C CE2  . PHE B 1 122 ? -26.582 -15.565 -2.786  1.00 39.08  ? 459 PHE C CE2  1 
ATOM   7693  C CZ   . PHE B 1 122 ? -25.936 -16.764 -2.958  1.00 29.74  ? 459 PHE C CZ   1 
ATOM   7694  H H    . PHE B 1 122 ? -26.267 -12.486 0.052   1.00 21.50  ? 459 PHE C H    1 
ATOM   7695  H HA   . PHE B 1 122 ? -24.443 -14.227 1.106   1.00 26.05  ? 459 PHE C HA   1 
ATOM   7696  H HB2  . PHE B 1 122 ? -24.156 -12.780 -1.320  1.00 26.79  ? 459 PHE C HB2  1 
ATOM   7697  H HB3  . PHE B 1 122 ? -23.091 -13.808 -0.743  1.00 26.79  ? 459 PHE C HB3  1 
ATOM   7698  H HD1  . PHE B 1 122 ? -23.205 -16.049 -1.405  1.00 39.79  ? 459 PHE C HD1  1 
ATOM   7699  H HD2  . PHE B 1 122 ? -26.407 -13.735 -1.981  1.00 43.47  ? 459 PHE C HD2  1 
ATOM   7700  H HE1  . PHE B 1 122 ? -24.238 -17.760 -2.560  1.00 41.73  ? 459 PHE C HE1  1 
ATOM   7701  H HE2  . PHE B 1 122 ? -27.436 -15.442 -3.134  1.00 46.89  ? 459 PHE C HE2  1 
ATOM   7702  H HZ   . PHE B 1 122 ? -26.352 -17.453 -3.424  1.00 35.69  ? 459 PHE C HZ   1 
ATOM   7703  N N    . LEU B 1 123 ? -23.205 -12.536 2.345   1.00 18.64  ? 460 LEU C N    1 
ATOM   7704  C CA   . LEU B 1 123 ? -22.447 -11.508 3.023   1.00 19.57  ? 460 LEU C CA   1 
ATOM   7705  C C    . LEU B 1 123 ? -20.988 -11.876 2.839   1.00 25.85  ? 460 LEU C C    1 
ATOM   7706  O O    . LEU B 1 123 ? -20.485 -12.826 3.448   1.00 24.30  ? 460 LEU C O    1 
ATOM   7707  C CB   . LEU B 1 123 ? -22.838 -11.434 4.503   1.00 25.44  ? 460 LEU C CB   1 
ATOM   7708  C CG   . LEU B 1 123 ? -24.343 -11.245 4.727   1.00 22.62  ? 460 LEU C CG   1 
ATOM   7709  C CD1  . LEU B 1 123 ? -24.678 -11.394 6.195   1.00 22.95  ? 460 LEU C CD1  1 
ATOM   7710  C CD2  . LEU B 1 123 ? -24.828 -9.888  4.193   1.00 19.97  ? 460 LEU C CD2  1 
ATOM   7711  H H    . LEU B 1 123 ? -23.118 -13.322 2.682   1.00 22.37  ? 460 LEU C H    1 
ATOM   7712  H HA   . LEU B 1 123 ? -22.612 -10.637 2.605   1.00 23.49  ? 460 LEU C HA   1 
ATOM   7713  H HB2  . LEU B 1 123 ? -22.573 -12.259 4.939   1.00 30.53  ? 460 LEU C HB2  1 
ATOM   7714  H HB3  . LEU B 1 123 ? -22.379 -10.683 4.912   1.00 30.53  ? 460 LEU C HB3  1 
ATOM   7715  H HG   . LEU B 1 123 ? -24.819 -11.939 4.244   1.00 27.15  ? 460 LEU C HG   1 
ATOM   7716  H HD11 . LEU B 1 123 ? -25.623 -11.273 6.313   1.00 27.54  ? 460 LEU C HD11 1 
ATOM   7717  H HD12 . LEU B 1 123 ? -24.422 -12.273 6.486   1.00 27.54  ? 460 LEU C HD12 1 
ATOM   7718  H HD13 . LEU B 1 123 ? -24.197 -10.730 6.694   1.00 27.54  ? 460 LEU C HD13 1 
ATOM   7719  H HD21 . LEU B 1 123 ? -25.771 -9.809  4.351   1.00 23.96  ? 460 LEU C HD21 1 
ATOM   7720  H HD22 . LEU B 1 123 ? -24.358 -9.187  4.651   1.00 23.96  ? 460 LEU C HD22 1 
ATOM   7721  H HD23 . LEU B 1 123 ? -24.648 -9.841  3.251   1.00 23.96  ? 460 LEU C HD23 1 
ATOM   7722  N N    . LEU B 1 124 ? -20.314 -11.135 1.975   1.00 22.97  ? 461 LEU C N    1 
ATOM   7723  C CA   . LEU B 1 124 ? -18.986 -11.524 1.536   1.00 24.77  ? 461 LEU C CA   1 
ATOM   7724  C C    . LEU B 1 124 ? -17.928 -10.609 2.134   1.00 26.16  ? 461 LEU C C    1 
ATOM   7725  O O    . LEU B 1 124 ? -17.761 -9.466  1.716   1.00 23.97  ? 461 LEU C O    1 
ATOM   7726  C CB   . LEU B 1 124 ? -18.941 -11.519 0.011   1.00 19.88  ? 461 LEU C CB   1 
ATOM   7727  C CG   . LEU B 1 124 ? -19.878 -12.522 -0.655  1.00 18.66  ? 461 LEU C CG   1 
ATOM   7728  C CD1  . LEU B 1 124 ? -19.721 -12.493 -2.174  1.00 24.99  ? 461 LEU C CD1  1 
ATOM   7729  C CD2  . LEU B 1 124 ? -19.568 -13.943 -0.136  1.00 19.93  ? 461 LEU C CD2  1 
ATOM   7730  H H    . LEU B 1 124 ? -20.603 -10.403 1.627   1.00 27.57  ? 461 LEU C H    1 
ATOM   7731  H HA   . LEU B 1 124 ? -18.804 -12.437 1.842   1.00 29.72  ? 461 LEU C HA   1 
ATOM   7732  H HB2  . LEU B 1 124 ? -19.185 -10.635 -0.304  1.00 23.85  ? 461 LEU C HB2  1 
ATOM   7733  H HB3  . LEU B 1 124 ? -18.037 -11.729 -0.273  1.00 23.85  ? 461 LEU C HB3  1 
ATOM   7734  H HG   . LEU B 1 124 ? -20.798 -12.306 -0.435  1.00 22.40  ? 461 LEU C HG   1 
ATOM   7735  H HD11 . LEU B 1 124 ? -20.323 -13.133 -2.562  1.00 29.99  ? 461 LEU C HD11 1 
ATOM   7736  H HD12 . LEU B 1 124 ? -19.930 -11.612 -2.492  1.00 29.99  ? 461 LEU C HD12 1 
ATOM   7737  H HD13 . LEU B 1 124 ? -18.815 -12.717 -2.398  1.00 29.99  ? 461 LEU C HD13 1 
ATOM   7738  H HD21 . LEU B 1 124 ? -20.161 -14.567 -0.559  1.00 23.92  ? 461 LEU C HD21 1 
ATOM   7739  H HD22 . LEU B 1 124 ? -18.657 -14.161 -0.348  1.00 23.92  ? 461 LEU C HD22 1 
ATOM   7740  H HD23 . LEU B 1 124 ? -19.696 -13.962 0.816   1.00 23.92  ? 461 LEU C HD23 1 
ATOM   7741  N N    . ASP B 1 125 ? -17.219 -11.133 3.130   1.00 17.90  ? 462 ASP C N    1 
ATOM   7742  C CA   . ASP B 1 125 ? -16.292 -10.346 3.938   1.00 21.05  ? 462 ASP C CA   1 
ATOM   7743  C C    . ASP B 1 125 ? -14.862 -10.637 3.491   1.00 29.64  ? 462 ASP C C    1 
ATOM   7744  O O    . ASP B 1 125 ? -14.101 -11.327 4.190   1.00 25.81  ? 462 ASP C O    1 
ATOM   7745  C CB   . ASP B 1 125 ? -16.502 -10.692 5.419   1.00 25.71  ? 462 ASP C CB   1 
ATOM   7746  C CG   . ASP B 1 125 ? -15.976 -9.630  6.366   1.00 25.07  ? 462 ASP C CG   1 
ATOM   7747  O OD1  . ASP B 1 125 ? -15.152 -8.785  5.947   1.00 24.61  ? 462 ASP C OD1  1 
ATOM   7748  O OD2  . ASP B 1 125 ? -16.376 -9.655  7.558   1.00 25.55  ? 462 ASP C OD2  1 
ATOM   7749  H H    . ASP B 1 125 ? -17.258 -11.960 3.361   1.00 21.49  ? 462 ASP C H    1 
ATOM   7750  H HA   . ASP B 1 125 ? -16.473 -9.391  3.811   1.00 25.26  ? 462 ASP C HA   1 
ATOM   7751  H HB2  . ASP B 1 125 ? -17.451 -10.796 5.586   1.00 30.85  ? 462 ASP C HB2  1 
ATOM   7752  H HB3  . ASP B 1 125 ? -16.039 -11.522 5.616   1.00 30.85  ? 462 ASP C HB3  1 
ATOM   7753  N N    . MET B 1 126 ? -14.510 -10.110 2.316   1.00 25.22  ? 463 MET C N    1 
ATOM   7754  C CA   . MET B 1 126 ? -13.254 -10.452 1.636   1.00 23.52  ? 463 MET C CA   1 
ATOM   7755  C C    . MET B 1 126 ? -12.881 -9.323  0.684   1.00 30.55  ? 463 MET C C    1 
ATOM   7756  O O    . MET B 1 126 ? -13.726 -8.522  0.341   1.00 20.77  ? 463 MET C O    1 
ATOM   7757  C CB   . MET B 1 126 ? -13.450 -11.729 0.811   1.00 22.27  ? 463 MET C CB   1 
ATOM   7758  C CG   . MET B 1 126 ? -14.456 -11.567 -0.313  1.00 24.22  ? 463 MET C CG   1 
ATOM   7759  S SD   . MET B 1 126 ? -15.007 -13.084 -1.085  1.00 25.72  ? 463 MET C SD   1 
ATOM   7760  C CE   . MET B 1 126 ? -15.054 -12.604 -2.812  1.00 28.09  ? 463 MET C CE   1 
ATOM   7761  H H    . MET B 1 126 ? -14.990 -9.542  1.884   1.00 30.26  ? 463 MET C H    1 
ATOM   7762  H HA   . MET B 1 126 ? -12.540 -10.595 2.291   1.00 28.22  ? 463 MET C HA   1 
ATOM   7763  H HB2  . MET B 1 126 ? -12.600 -11.981 0.417   1.00 26.72  ? 463 MET C HB2  1 
ATOM   7764  H HB3  . MET B 1 126 ? -13.766 -12.435 1.395   1.00 26.72  ? 463 MET C HB3  1 
ATOM   7765  H HG2  . MET B 1 126 ? -15.241 -11.120 0.041   1.00 29.07  ? 463 MET C HG2  1 
ATOM   7766  H HG3  . MET B 1 126 ? -14.056 -11.017 -1.005  1.00 29.07  ? 463 MET C HG3  1 
ATOM   7767  H HE1  . MET B 1 126 ? -15.343 -13.354 -3.336  1.00 33.71  ? 463 MET C HE1  1 
ATOM   7768  H HE2  . MET B 1 126 ? -15.670 -11.875 -2.916  1.00 33.71  ? 463 MET C HE2  1 
ATOM   7769  H HE3  . MET B 1 126 ? -14.175 -12.332 -3.084  1.00 33.71  ? 463 MET C HE3  1 
ATOM   7770  N N    . CYS B 1 127 ? -11.632 -9.273  0.240   1.00 32.38  ? 464 CYS C N    1 
ATOM   7771  C CA   . CYS B 1 127 ? -11.240 -8.327  -0.804  1.00 27.28  ? 464 CYS C CA   1 
ATOM   7772  C C    . CYS B 1 127 ? -11.868 -8.689  -2.142  1.00 26.92  ? 464 CYS C C    1 
ATOM   7773  O O    . CYS B 1 127 ? -12.292 -9.818  -2.361  1.00 22.21  ? 464 CYS C O    1 
ATOM   7774  C CB   . CYS B 1 127 ? -9.727  -8.294  -0.955  1.00 30.03  ? 464 CYS C CB   1 
ATOM   7775  S SG   . CYS B 1 127 ? -8.877  -7.784  0.531   1.00 31.15  ? 464 CYS C SG   1 
ATOM   7776  H H    . CYS B 1 127 ? -10.992 -9.773  0.524   1.00 38.85  ? 464 CYS C H    1 
ATOM   7777  H HA   . CYS B 1 127 ? -11.544 -7.429  -0.556  1.00 32.74  ? 464 CYS C HA   1 
ATOM   7778  H HB2  . CYS B 1 127 ? -9.415  -9.183  -1.186  1.00 36.04  ? 464 CYS C HB2  1 
ATOM   7779  H HB3  . CYS B 1 127 ? -9.495  -7.669  -1.660  1.00 36.04  ? 464 CYS C HB3  1 
ATOM   7780  H HG   . CYS B 1 127 ? -7.695  -7.786  0.325   1.00 37.38  ? 464 CYS C HG   1 
ATOM   7781  N N    . ARG B 1 128 ? -11.925 -7.714  -3.038  1.00 28.10  ? 465 ARG C N    1 
ATOM   7782  C CA   . ARG B 1 128 ? -12.540 -7.909  -4.341  1.00 29.65  ? 465 ARG C CA   1 
ATOM   7783  C C    . ARG B 1 128 ? -11.623 -7.404  -5.443  1.00 29.77  ? 465 ARG C C    1 
ATOM   7784  O O    . ARG B 1 128 ? -12.087 -6.971  -6.496  1.00 30.71  ? 465 ARG C O    1 
ATOM   7785  C CB   . ARG B 1 128 ? -13.874 -7.166  -4.391  1.00 30.29  ? 465 ARG C CB   1 
ATOM   7786  C CG   . ARG B 1 128 ? -14.902 -7.684  -3.390  1.00 32.02  ? 465 ARG C CG   1 
ATOM   7787  C CD   . ARG B 1 128 ? -16.144 -6.796  -3.359  1.00 28.46  ? 465 ARG C CD   1 
ATOM   7788  N NE   . ARG B 1 128 ? -16.889 -6.857  -4.611  1.00 27.55  ? 465 ARG C NE   1 
ATOM   7789  C CZ   . ARG B 1 128 ? -17.925 -6.072  -4.907  1.00 27.44  ? 465 ARG C CZ   1 
ATOM   7790  N NH1  . ARG B 1 128 ? -18.339 -5.163  -4.030  1.00 19.44  ? 465 ARG C NH1  1 
ATOM   7791  N NH2  . ARG B 1 128 ? -18.541 -6.195  -6.080  1.00 27.93  ? 465 ARG C NH2  1 
ATOM   7792  H H    . ARG B 1 128 ? -11.612 -6.923  -2.914  1.00 33.73  ? 465 ARG C H    1 
ATOM   7793  H HA   . ARG B 1 128 ? -12.708 -8.864  -4.486  1.00 35.58  ? 465 ARG C HA   1 
ATOM   7794  H HB2  . ARG B 1 128 ? -13.718 -6.228  -4.198  1.00 36.34  ? 465 ARG C HB2  1 
ATOM   7795  H HB3  . ARG B 1 128 ? -14.252 -7.260  -5.280  1.00 36.34  ? 465 ARG C HB3  1 
ATOM   7796  H HG2  . ARG B 1 128 ? -15.174 -8.580  -3.643  1.00 38.42  ? 465 ARG C HG2  1 
ATOM   7797  H HG3  . ARG B 1 128 ? -14.510 -7.690  -2.502  1.00 38.42  ? 465 ARG C HG3  1 
ATOM   7798  H HD2  . ARG B 1 128 ? -16.729 -7.091  -2.644  1.00 34.15  ? 465 ARG C HD2  1 
ATOM   7799  H HD3  . ARG B 1 128 ? -15.874 -5.876  -3.212  1.00 34.15  ? 465 ARG C HD3  1 
ATOM   7800  H HE   . ARG B 1 128 ? -16.643 -7.436  -5.197  1.00 33.06  ? 465 ARG C HE   1 
ATOM   7801  H HH11 . ARG B 1 128 ? -17.939 -5.083  -3.273  1.00 23.33  ? 465 ARG C HH11 1 
ATOM   7802  H HH12 . ARG B 1 128 ? -19.007 -4.656  -4.219  1.00 23.33  ? 465 ARG C HH12 1 
ATOM   7803  H HH21 . ARG B 1 128 ? -18.274 -6.783  -6.647  1.00 33.52  ? 465 ARG C HH21 1 
ATOM   7804  H HH22 . ARG B 1 128 ? -19.211 -5.689  -6.268  1.00 33.52  ? 465 ARG C HH22 1 
ATOM   7805  N N    . LYS B 1 129 ? -10.318 -7.433  -5.198  1.00 24.26  ? 466 LYS C N    1 
ATOM   7806  C CA   . LYS B 1 129 ? -9.368  -7.053  -6.232  1.00 34.81  ? 466 LYS C CA   1 
ATOM   7807  C C    . LYS B 1 129 ? -9.310  -8.137  -7.306  1.00 34.76  ? 466 LYS C C    1 
ATOM   7808  O O    . LYS B 1 129 ? -9.673  -9.283  -7.059  1.00 31.02  ? 466 LYS C O    1 
ATOM   7809  C CB   . LYS B 1 129 ? -7.986  -6.804  -5.625  1.00 31.23  ? 466 LYS C CB   1 
ATOM   7810  C CG   . LYS B 1 129 ? -7.930  -5.546  -4.756  1.00 32.96  ? 466 LYS C CG   1 
ATOM   7811  C CD   . LYS B 1 129 ? -6.589  -5.407  -4.036  1.00 43.03  ? 466 LYS C CD   1 
ATOM   7812  C CE   . LYS B 1 129 ? -5.512  -4.864  -4.955  1.00 51.26  ? 466 LYS C CE   1 
ATOM   7813  N NZ   . LYS B 1 129 ? -4.174  -4.838  -4.293  1.00 53.15  ? 466 LYS C NZ   1 
ATOM   7814  H H    . LYS B 1 129 ? -9.962  -7.667  -4.451  1.00 29.11  ? 466 LYS C H    1 
ATOM   7815  H HA   . LYS B 1 129 ? -9.669  -6.222  -6.654  1.00 41.78  ? 466 LYS C HA   1 
ATOM   7816  H HB2  . LYS B 1 129 ? -7.744  -7.562  -5.070  1.00 37.48  ? 466 LYS C HB2  1 
ATOM   7817  H HB3  . LYS B 1 129 ? -7.341  -6.700  -6.343  1.00 37.48  ? 466 LYS C HB3  1 
ATOM   7818  H HG2  . LYS B 1 129 ? -8.054  -4.765  -5.318  1.00 39.55  ? 466 LYS C HG2  1 
ATOM   7819  H HG3  . LYS B 1 129 ? -8.630  -5.591  -4.086  1.00 39.55  ? 466 LYS C HG3  1 
ATOM   7820  H HD2  . LYS B 1 129 ? -6.689  -4.794  -3.291  1.00 51.63  ? 466 LYS C HD2  1 
ATOM   7821  H HD3  . LYS B 1 129 ? -6.305  -6.278  -3.717  1.00 51.63  ? 466 LYS C HD3  1 
ATOM   7822  H HE2  . LYS B 1 129 ? -5.450  -5.429  -5.741  1.00 61.52  ? 466 LYS C HE2  1 
ATOM   7823  H HE3  . LYS B 1 129 ? -5.740  -3.957  -5.213  1.00 61.52  ? 466 LYS C HE3  1 
ATOM   7824  H HZ1  . LYS B 1 129 ? -3.563  -4.515  -4.854  1.00 63.79  ? 466 LYS C HZ1  1 
ATOM   7825  H HZ2  . LYS B 1 129 ? -4.203  -4.320  -3.569  1.00 63.79  ? 466 LYS C HZ2  1 
ATOM   7826  H HZ3  . LYS B 1 129 ? -3.938  -5.661  -4.051  1.00 63.79  ? 466 LYS C HZ3  1 
ATOM   7827  N N    . ARG B 1 130 ? -8.862  -7.774  -8.503  1.00 28.60  ? 467 ARG C N    1 
ATOM   7828  C CA   . ARG B 1 130 ? -8.666  -8.758  -9.563  1.00 27.08  ? 467 ARG C CA   1 
ATOM   7829  C C    . ARG B 1 130 ? -7.548  -9.751  -9.230  1.00 32.78  ? 467 ARG C C    1 
ATOM   7830  O O    . ARG B 1 130 ? -6.576  -9.423  -8.553  1.00 38.34  ? 467 ARG C O    1 
ATOM   7831  C CB   . ARG B 1 130 ? -8.327  -8.061  -10.883 1.00 35.55  ? 467 ARG C CB   1 
ATOM   7832  C CG   . ARG B 1 130 ? -9.051  -8.659  -12.079 1.00 46.14  ? 467 ARG C CG   1 
ATOM   7833  C CD   . ARG B 1 130 ? -8.747  -7.930  -13.393 1.00 40.60  ? 467 ARG C CD   1 
ATOM   7834  N NE   . ARG B 1 130 ? -8.792  -8.866  -14.509 1.00 55.10  ? 467 ARG C NE   1 
ATOM   7835  C CZ   . ARG B 1 130 ? -7.788  -9.671  -14.846 1.00 79.77  ? 467 ARG C CZ   1 
ATOM   7836  N NH1  . ARG B 1 130 ? -6.653  -9.653  -14.156 1.00 73.75  ? 467 ARG C NH1  1 
ATOM   7837  N NH2  . ARG B 1 130 ? -7.914  -10.496 -15.877 1.00 96.38  ? 467 ARG C NH2  1 
ATOM   7838  H H    . ARG B 1 130 ? -8.665  -6.967  -8.728  1.00 34.32  ? 467 ARG C H    1 
ATOM   7839  H HA   . ARG B 1 130 ? -9.496  -9.263  -9.690  1.00 32.50  ? 467 ARG C HA   1 
ATOM   7840  H HB2  . ARG B 1 130 ? -8.578  -7.126  -10.819 1.00 42.65  ? 467 ARG C HB2  1 
ATOM   7841  H HB3  . ARG B 1 130 ? -7.373  -8.136  -11.043 1.00 42.65  ? 467 ARG C HB3  1 
ATOM   7842  H HG2  . ARG B 1 130 ? -8.780  -9.585  -12.180 1.00 55.37  ? 467 ARG C HG2  1 
ATOM   7843  H HG3  . ARG B 1 130 ? -10.008 -8.610  -11.924 1.00 55.37  ? 467 ARG C HG3  1 
ATOM   7844  H HD2  . ARG B 1 130 ? -9.412  -7.240  -13.543 1.00 48.72  ? 467 ARG C HD2  1 
ATOM   7845  H HD3  . ARG B 1 130 ? -7.858  -7.543  -13.351 1.00 48.72  ? 467 ARG C HD3  1 
ATOM   7846  H HE   . ARG B 1 130 ? -9.535  -8.951  -14.933 1.00 66.12  ? 467 ARG C HE   1 
ATOM   7847  H HH11 . ARG B 1 130 ? -6.566  -9.121  -13.486 1.00 88.50  ? 467 ARG C HH11 1 
ATOM   7848  H HH12 . ARG B 1 130 ? -6.007  -10.175 -14.378 1.00 88.50  ? 467 ARG C HH12 1 
ATOM   7849  H HH21 . ARG B 1 130 ? -8.645  -10.511 -16.328 1.00 115.66 ? 467 ARG C HH21 1 
ATOM   7850  H HH22 . ARG B 1 130 ? -7.263  -11.015 -16.095 1.00 115.66 ? 467 ARG C HH22 1 
ATOM   7851  N N    . ASN B 1 131 ? -7.699  -10.969 -9.718  1.00 34.55  ? 468 ASN C N    1 
ATOM   7852  C CA   . ASN B 1 131 ? -6.623  -11.941 -9.683  1.00 42.82  ? 468 ASN C CA   1 
ATOM   7853  C C    . ASN B 1 131 ? -5.930  -11.923 -11.039 1.00 45.10  ? 468 ASN C C    1 
ATOM   7854  O O    . ASN B 1 131 ? -6.469  -12.437 -12.016 1.00 34.62  ? 468 ASN C O    1 
ATOM   7855  C CB   . ASN B 1 131 ? -7.174  -13.331 -9.387  1.00 29.32  ? 468 ASN C CB   1 
ATOM   7856  C CG   . ASN B 1 131 ? -6.084  -14.376 -9.289  1.00 39.84  ? 468 ASN C CG   1 
ATOM   7857  O OD1  . ASN B 1 131 ? -4.929  -14.106 -9.596  1.00 37.13  ? 468 ASN C OD1  1 
ATOM   7858  N ND2  . ASN B 1 131 ? -6.448  -15.576 -8.864  1.00 28.32  ? 468 ASN C ND2  1 
ATOM   7859  H H    . ASN B 1 131 ? -8.423  -11.261 -10.079 1.00 41.46  ? 468 ASN C H    1 
ATOM   7860  H HA   . ASN B 1 131 ? -5.974  -11.699 -8.989  1.00 51.38  ? 468 ASN C HA   1 
ATOM   7861  H HB2  . ASN B 1 131 ? -7.649  -13.311 -8.541  1.00 35.19  ? 468 ASN C HB2  1 
ATOM   7862  H HB3  . ASN B 1 131 ? -7.777  -13.591 -10.101 1.00 35.19  ? 468 ASN C HB3  1 
ATOM   7863  H HD21 . ASN B 1 131 ? -7.270  -15.728 -8.661  1.00 33.98  ? 468 ASN C HD21 1 
ATOM   7864  H HD22 . ASN B 1 131 ? -5.864  -16.202 -8.792  1.00 33.98  ? 468 ASN C HD22 1 
ATOM   7865  N N    . ASP B 1 132 ? -4.747  -11.314 -11.098 1.00 41.61  ? 469 ASP C N    1 
ATOM   7866  C CA   . ASP B 1 132 ? -4.018  -11.166 -12.356 1.00 49.84  ? 469 ASP C CA   1 
ATOM   7867  C C    . ASP B 1 132 ? -3.619  -12.510 -12.943 1.00 50.16  ? 469 ASP C C    1 
ATOM   7868  O O    . ASP B 1 132 ? -3.315  -12.603 -14.127 1.00 41.64  ? 469 ASP C O    1 
ATOM   7869  C CB   . ASP B 1 132 ? -2.766  -10.307 -12.157 1.00 53.66  ? 469 ASP C CB   1 
ATOM   7870  C CG   . ASP B 1 132 ? -3.097  -8.858  -11.865 1.00 56.96  ? 469 ASP C CG   1 
ATOM   7871  O OD1  . ASP B 1 132 ? -4.160  -8.391  -12.326 1.00 53.79  ? 469 ASP C OD1  1 
ATOM   7872  O OD2  . ASP B 1 132 ? -2.296  -8.189  -11.175 1.00 58.54  ? 469 ASP C OD2  1 
ATOM   7873  H H    . ASP B 1 132 ? -4.343  -10.975 -10.418 1.00 49.93  ? 469 ASP C H    1 
ATOM   7874  H HA   . ASP B 1 132 ? -4.595  -10.713 -13.006 1.00 59.81  ? 469 ASP C HA   1 
ATOM   7875  H HB2  . ASP B 1 132 ? -2.258  -10.657 -11.409 1.00 64.39  ? 469 ASP C HB2  1 
ATOM   7876  H HB3  . ASP B 1 132 ? -2.231  -10.336 -12.966 1.00 64.39  ? 469 ASP C HB3  1 
ATOM   7877  N N    . TYR B 1 133 ? -3.610  -13.547 -12.110 1.00 42.19  ? 470 TYR C N    1 
ATOM   7878  C CA   . TYR B 1 133 ? -3.221  -14.885 -12.549 1.00 45.66  ? 470 TYR C CA   1 
ATOM   7879  C C    . TYR B 1 133 ? -4.368  -15.645 -13.214 1.00 56.31  ? 470 TYR C C    1 
ATOM   7880  O O    . TYR B 1 133 ? -4.140  -16.555 -14.011 1.00 65.70  ? 470 TYR C O    1 
ATOM   7881  C CB   . TYR B 1 133 ? -2.658  -15.678 -11.360 1.00 38.72  ? 470 TYR C CB   1 
ATOM   7882  C CG   . TYR B 1 133 ? -1.323  -15.134 -10.914 1.00 36.37  ? 470 TYR C CG   1 
ATOM   7883  C CD1  . TYR B 1 133 ? -1.248  -14.089 -10.004 1.00 32.56  ? 470 TYR C CD1  1 
ATOM   7884  C CD2  . TYR B 1 133 ? -0.138  -15.636 -11.437 1.00 49.49  ? 470 TYR C CD2  1 
ATOM   7885  C CE1  . TYR B 1 133 ? -0.026  -13.563 -9.618  1.00 47.59  ? 470 TYR C CE1  1 
ATOM   7886  C CE2  . TYR B 1 133 ? 1.088   -15.122 -11.053 1.00 57.17  ? 470 TYR C CE2  1 
ATOM   7887  C CZ   . TYR B 1 133 ? 1.138   -14.089 -10.144 1.00 56.66  ? 470 TYR C CZ   1 
ATOM   7888  O OH   . TYR B 1 133 ? 2.355   -13.575 -9.762  1.00 67.23  ? 470 TYR C OH   1 
ATOM   7889  H H    . TYR B 1 133 ? -3.826  -13.501 -11.279 1.00 50.62  ? 470 TYR C H    1 
ATOM   7890  H HA   . TYR B 1 133 ? -2.504  -14.798 -13.211 1.00 54.79  ? 470 TYR C HA   1 
ATOM   7891  H HB2  . TYR B 1 133 ? -3.275  -15.617 -10.614 1.00 46.46  ? 470 TYR C HB2  1 
ATOM   7892  H HB3  . TYR B 1 133 ? -2.536  -16.604 -11.621 1.00 46.46  ? 470 TYR C HB3  1 
ATOM   7893  H HD1  . TYR B 1 133 ? -2.031  -13.732 -9.652  1.00 39.07  ? 470 TYR C HD1  1 
ATOM   7894  H HD2  . TYR B 1 133 ? -0.169  -16.331 -12.054 1.00 59.39  ? 470 TYR C HD2  1 
ATOM   7895  H HE1  . TYR B 1 133 ? 0.010   -12.868 -9.002  1.00 57.11  ? 470 TYR C HE1  1 
ATOM   7896  H HE2  . TYR B 1 133 ? 1.874   -15.472 -11.407 1.00 68.60  ? 470 TYR C HE2  1 
ATOM   7897  H HH   . TYR B 1 133 ? 2.753   -13.283 -10.416 1.00 80.67  ? 470 TYR C HH   1 
ATOM   7898  N N    . ASP B 1 134 ? -5.599  -15.266 -12.887 1.00 45.46  ? 471 ASP C N    1 
ATOM   7899  C CA   . ASP B 1 134 ? -6.774  -15.904 -13.463 1.00 42.56  ? 471 ASP C CA   1 
ATOM   7900  C C    . ASP B 1 134 ? -7.179  -15.161 -14.729 1.00 53.42  ? 471 ASP C C    1 
ATOM   7901  O O    . ASP B 1 134 ? -7.721  -14.063 -14.652 1.00 33.27  ? 471 ASP C O    1 
ATOM   7902  C CB   . ASP B 1 134 ? -7.924  -15.908 -12.449 1.00 42.56  ? 471 ASP C CB   1 
ATOM   7903  C CG   . ASP B 1 134 ? -9.231  -16.401 -13.043 1.00 46.61  ? 471 ASP C CG   1 
ATOM   7904  O OD1  . ASP B 1 134 ? -9.233  -16.824 -14.212 1.00 43.70  ? 471 ASP C OD1  1 
ATOM   7905  O OD2  . ASP B 1 134 ? -10.261 -16.368 -12.339 1.00 50.53  ? 471 ASP C OD2  1 
ATOM   7906  H H    . ASP B 1 134 ? -5.781  -14.636 -12.330 1.00 54.55  ? 471 ASP C H    1 
ATOM   7907  H HA   . ASP B 1 134 ? -6.562  -16.832 -13.700 1.00 51.07  ? 471 ASP C HA   1 
ATOM   7908  H HB2  . ASP B 1 134 ? -7.692  -16.492 -11.710 1.00 51.08  ? 471 ASP C HB2  1 
ATOM   7909  H HB3  . ASP B 1 134 ? -8.064  -15.004 -12.126 1.00 51.08  ? 471 ASP C HB3  1 
ATOM   7910  N N    . ASP B 1 135 ? -6.912  -15.762 -15.886 1.00 45.25  ? 472 ASP C N    1 
ATOM   7911  C CA   . ASP B 1 135 ? -7.184  -15.124 -17.173 1.00 54.60  ? 472 ASP C CA   1 
ATOM   7912  C C    . ASP B 1 135 ? -8.448  -15.666 -17.854 1.00 54.91  ? 472 ASP C C    1 
ATOM   7913  O O    . ASP B 1 135 ? -8.797  -15.231 -18.952 1.00 55.10  ? 472 ASP C O    1 
ATOM   7914  C CB   . ASP B 1 135 ? -5.980  -15.298 -18.112 1.00 54.00  ? 472 ASP C CB   1 
ATOM   7915  C CG   . ASP B 1 135 ? -5.815  -16.729 -18.595 1.00 53.39  ? 472 ASP C CG   1 
ATOM   7916  O OD1  . ASP B 1 135 ? -6.516  -17.617 -18.065 1.00 43.89  ? 472 ASP C OD1  1 
ATOM   7917  O OD2  . ASP B 1 135 ? -4.977  -16.974 -19.492 1.00 53.17  ? 472 ASP C OD2  1 
ATOM   7918  H H    . ASP B 1 135 ? -6.569  -16.548 -15.953 1.00 54.30  ? 472 ASP C H    1 
ATOM   7919  H HA   . ASP B 1 135 ? -7.313  -14.164 -17.028 1.00 65.52  ? 472 ASP C HA   1 
ATOM   7920  H HB2  . ASP B 1 135 ? -6.101  -14.731 -18.890 1.00 64.80  ? 472 ASP C HB2  1 
ATOM   7921  H HB3  . ASP B 1 135 ? -5.172  -15.046 -17.639 1.00 64.80  ? 472 ASP C HB3  1 
ATOM   7922  N N    . THR B 1 136 ? -9.132  -16.609 -17.211 1.00 58.66  ? 473 THR C N    1 
ATOM   7923  C CA   . THR B 1 136 ? -10.298 -17.245 -17.823 1.00 61.09  ? 473 THR C CA   1 
ATOM   7924  C C    . THR B 1 136 ? -11.453 -16.260 -18.005 1.00 60.18  ? 473 THR C C    1 
ATOM   7925  O O    . THR B 1 136 ? -11.598 -15.305 -17.242 1.00 55.74  ? 473 THR C O    1 
ATOM   7926  C CB   . THR B 1 136 ? -10.785 -18.465 -17.005 1.00 55.93  ? 473 THR C CB   1 
ATOM   7927  O OG1  . THR B 1 136 ? -11.379 -18.035 -15.771 1.00 51.45  ? 473 THR C OG1  1 
ATOM   7928  C CG2  . THR B 1 136 ? -9.624  -19.415 -16.713 1.00 56.46  ? 473 THR C CG2  1 
ATOM   7929  H H    . THR B 1 136 ? -8.945  -16.897 -16.422 1.00 70.39  ? 473 THR C H    1 
ATOM   7930  H HA   . THR B 1 136 ? -10.044 -17.569 -18.712 1.00 73.31  ? 473 THR C HA   1 
ATOM   7931  H HB   . THR B 1 136 ? -11.447 -18.950 -17.522 1.00 67.12  ? 473 THR C HB   1 
ATOM   7932  H HG1  . THR B 1 136 ? -10.829 -17.621 -15.324 1.00 61.74  ? 473 THR C HG1  1 
ATOM   7933  H HG21 . THR B 1 136 ? -9.936  -20.168 -16.205 1.00 67.76  ? 473 THR C HG21 1 
ATOM   7934  H HG22 . THR B 1 136 ? -9.243  -19.730 -17.536 1.00 67.76  ? 473 THR C HG22 1 
ATOM   7935  H HG23 . THR B 1 136 ? -8.946  -18.959 -16.209 1.00 67.76  ? 473 THR C HG23 1 
ATOM   7936  N N    . ILE B 1 137 ? -12.272 -16.491 -19.026 1.00 63.77  ? 474 ILE C N    1 
ATOM   7937  C CA   . ILE B 1 137 ? -13.437 -15.645 -19.273 1.00 69.49  ? 474 ILE C CA   1 
ATOM   7938  C C    . ILE B 1 137 ? -14.712 -16.477 -19.291 1.00 70.53  ? 474 ILE C C    1 
ATOM   7939  O O    . ILE B 1 137 ? -15.379 -16.577 -20.326 1.00 70.38  ? 474 ILE C O    1 
ATOM   7940  C CB   . ILE B 1 137 ? -13.321 -14.886 -20.610 1.00 64.51  ? 474 ILE C CB   1 
ATOM   7941  C CG1  . ILE B 1 137 ? -12.950 -15.845 -21.744 1.00 68.97  ? 474 ILE C CG1  1 
ATOM   7942  C CG2  . ILE B 1 137 ? -12.287 -13.783 -20.499 1.00 75.01  ? 474 ILE C CG2  1 
ATOM   7943  C CD1  . ILE B 1 137 ? -13.166 -15.258 -23.133 1.00 68.31  ? 474 ILE C CD1  1 
ATOM   7944  H H    . ILE B 1 137 ? -12.175 -17.132 -19.592 1.00 76.52  ? 474 ILE C H    1 
ATOM   7945  H HA   . ILE B 1 137 ? -13.513 -14.985 -18.553 1.00 83.39  ? 474 ILE C HA   1 
ATOM   7946  H HB   . ILE B 1 137 ? -14.181 -14.485 -20.813 1.00 77.41  ? 474 ILE C HB   1 
ATOM   7947  H HG12 . ILE B 1 137 ? -12.012 -16.079 -21.663 1.00 82.76  ? 474 ILE C HG12 1 
ATOM   7948  H HG13 . ILE B 1 137 ? -13.496 -16.644 -21.671 1.00 82.76  ? 474 ILE C HG13 1 
ATOM   7949  H HG21 . ILE B 1 137 ? -12.230 -13.323 -21.340 1.00 90.02  ? 474 ILE C HG21 1 
ATOM   7950  H HG22 . ILE B 1 137 ? -12.556 -13.172 -19.809 1.00 90.02  ? 474 ILE C HG22 1 
ATOM   7951  H HG23 . ILE B 1 137 ? -11.437 -14.172 -20.280 1.00 90.02  ? 474 ILE C HG23 1 
ATOM   7952  H HD11 . ILE B 1 137 ? -12.915 -15.911 -23.791 1.00 81.98  ? 474 ILE C HD11 1 
ATOM   7953  H HD12 . ILE B 1 137 ? -14.094 -15.031 -23.235 1.00 81.98  ? 474 ILE C HD12 1 
ATOM   7954  H HD13 . ILE B 1 137 ? -12.624 -14.471 -23.227 1.00 81.98  ? 474 ILE C HD13 1 
ATOM   7955  N N    . PRO B 1 138 ? -15.064 -17.065 -18.138 1.00 63.84  ? 475 PRO C N    1 
ATOM   7956  C CA   . PRO B 1 138 ? -16.192 -17.997 -18.070 1.00 61.76  ? 475 PRO C CA   1 
ATOM   7957  C C    . PRO B 1 138 ? -17.515 -17.287 -18.302 1.00 60.47  ? 475 PRO C C    1 
ATOM   7958  O O    . PRO B 1 138 ? -17.652 -16.116 -17.939 1.00 53.64  ? 475 PRO C O    1 
ATOM   7959  C CB   . PRO B 1 138 ? -16.131 -18.532 -16.631 1.00 71.00  ? 475 PRO C CB   1 
ATOM   7960  C CG   . PRO B 1 138 ? -14.843 -18.013 -16.047 1.00 74.44  ? 475 PRO C CG   1 
ATOM   7961  C CD   . PRO B 1 138 ? -14.514 -16.778 -16.806 1.00 64.83  ? 475 PRO C CD   1 
ATOM   7962  H HA   . PRO B 1 138 ? -16.083 -18.733 -18.708 1.00 74.11  ? 475 PRO C HA   1 
ATOM   7963  H HB2  . PRO B 1 138 ? -16.891 -18.198 -16.129 1.00 85.20  ? 475 PRO C HB2  1 
ATOM   7964  H HB3  . PRO B 1 138 ? -16.131 -19.501 -16.645 1.00 85.20  ? 475 PRO C HB3  1 
ATOM   7965  H HG2  . PRO B 1 138 ? -14.972 -17.810 -15.107 1.00 89.33  ? 475 PRO C HG2  1 
ATOM   7966  H HG3  . PRO B 1 138 ? -14.146 -18.677 -16.159 1.00 89.33  ? 475 PRO C HG3  1 
ATOM   7967  H HD2  . PRO B 1 138 ? -14.956 -16.008 -16.414 1.00 77.80  ? 475 PRO C HD2  1 
ATOM   7968  H HD3  . PRO B 1 138 ? -13.553 -16.654 -16.854 1.00 77.80  ? 475 PRO C HD3  1 
ATOM   7969  N N    . ILE B 1 139 ? -18.468 -17.981 -18.914 1.00 64.65  ? 476 ILE C N    1 
ATOM   7970  C CA   . ILE B 1 139 ? -19.817 -17.451 -19.054 1.00 73.49  ? 476 ILE C CA   1 
ATOM   7971  C C    . ILE B 1 139 ? -20.786 -18.382 -18.346 1.00 73.25  ? 476 ILE C C    1 
ATOM   7972  O O    . ILE B 1 139 ? -21.159 -19.435 -18.869 1.00 70.18  ? 476 ILE C O    1 
ATOM   7973  C CB   . ILE B 1 139 ? -20.242 -17.291 -20.530 1.00 72.62  ? 476 ILE C CB   1 
ATOM   7974  C CG1  . ILE B 1 139 ? -19.222 -16.441 -21.290 1.00 74.45  ? 476 ILE C CG1  1 
ATOM   7975  C CG2  . ILE B 1 139 ? -21.631 -16.656 -20.615 1.00 63.03  ? 476 ILE C CG2  1 
ATOM   7976  C CD1  . ILE B 1 139 ? -19.430 -16.432 -22.794 1.00 77.60  ? 476 ILE C CD1  1 
ATOM   7977  H H    . ILE B 1 139 ? -18.358 -18.761 -19.258 1.00 77.58  ? 476 ILE C H    1 
ATOM   7978  H HA   . ILE B 1 139 ? -19.865 -16.572 -18.623 1.00 88.19  ? 476 ILE C HA   1 
ATOM   7979  H HB   . ILE B 1 139 ? -20.278 -18.170 -20.938 1.00 87.14  ? 476 ILE C HB   1 
ATOM   7980  H HG12 . ILE B 1 139 ? -19.283 -15.525 -20.977 1.00 89.34  ? 476 ILE C HG12 1 
ATOM   7981  H HG13 . ILE B 1 139 ? -18.333 -16.789 -21.116 1.00 89.34  ? 476 ILE C HG13 1 
ATOM   7982  H HG21 . ILE B 1 139 ? -21.876 -16.565 -21.538 1.00 75.63  ? 476 ILE C HG21 1 
ATOM   7983  H HG22 . ILE B 1 139 ? -22.261 -17.221 -20.162 1.00 75.63  ? 476 ILE C HG22 1 
ATOM   7984  H HG23 . ILE B 1 139 ? -21.605 -15.792 -20.195 1.00 75.63  ? 476 ILE C HG23 1 
ATOM   7985  H HD11 . ILE B 1 139 ? -18.757 -15.881 -23.199 1.00 93.12  ? 476 ILE C HD11 1 
ATOM   7986  H HD12 . ILE B 1 139 ? -19.361 -17.331 -23.124 1.00 93.12  ? 476 ILE C HD12 1 
ATOM   7987  H HD13 . ILE B 1 139 ? -20.302 -16.078 -22.986 1.00 93.12  ? 476 ILE C HD13 1 
ATOM   7988  N N    . LEU B 1 140 ? -21.170 -17.995 -17.137 1.00 76.33  ? 477 LEU C N    1 
ATOM   7989  C CA   . LEU B 1 140 ? -22.210 -18.699 -16.418 1.00 76.81  ? 477 LEU C CA   1 
ATOM   7990  C C    . LEU B 1 140 ? -23.508 -18.454 -17.172 1.00 70.19  ? 477 LEU C C    1 
ATOM   7991  O O    . LEU B 1 140 ? -23.662 -17.423 -17.838 1.00 58.02  ? 477 LEU C O    1 
ATOM   7992  C CB   . LEU B 1 140 ? -22.330 -18.172 -14.986 1.00 81.34  ? 477 LEU C CB   1 
ATOM   7993  C CG   . LEU B 1 140 ? -21.168 -18.440 -14.021 1.00 82.56  ? 477 LEU C CG   1 
ATOM   7994  C CD1  . LEU B 1 140 ? -19.854 -17.875 -14.543 1.00 84.76  ? 477 LEU C CD1  1 
ATOM   7995  C CD2  . LEU B 1 140 ? -21.482 -17.861 -12.650 1.00 76.61  ? 477 LEU C CD2  1 
ATOM   7996  H H    . LEU B 1 140 ? -20.839 -17.325 -16.712 1.00 91.59  ? 477 LEU C H    1 
ATOM   7997  H HA   . LEU B 1 140 ? -22.022 -19.661 -16.398 1.00 92.17  ? 477 LEU C HA   1 
ATOM   7998  H HB2  . LEU B 1 140 ? -22.442 -17.209 -15.031 1.00 97.61  ? 477 LEU C HB2  1 
ATOM   7999  H HB3  . LEU B 1 140 ? -23.123 -18.565 -14.588 1.00 97.61  ? 477 LEU C HB3  1 
ATOM   8000  H HG   . LEU B 1 140 ? -21.060 -19.399 -13.921 1.00 99.07  ? 477 LEU C HG   1 
ATOM   8001  H HD11 . LEU B 1 140 ? -19.158 -18.066 -13.910 1.00 101.72 ? 477 LEU C HD11 1 
ATOM   8002  H HD12 . LEU B 1 140 ? -19.651 -18.286 -15.387 1.00 101.72 ? 477 LEU C HD12 1 
ATOM   8003  H HD13 . LEU B 1 140 ? -19.945 -16.926 -14.655 1.00 101.72 ? 477 LEU C HD13 1 
ATOM   8004  H HD21 . LEU B 1 140 ? -20.745 -18.038 -12.060 1.00 91.93  ? 477 LEU C HD21 1 
ATOM   8005  H HD22 . LEU B 1 140 ? -21.614 -16.914 -12.734 1.00 91.93  ? 477 LEU C HD22 1 
ATOM   8006  H HD23 . LEU B 1 140 ? -22.279 -18.275 -12.312 1.00 91.93  ? 477 LEU C HD23 1 
ATOM   8007  N N    . ASP B 1 141 ? -24.435 -19.400 -17.089 1.00 67.49  ? 478 ASP C N    1 
ATOM   8008  C CA   . ASP B 1 141 ? -25.766 -19.162 -17.620 1.00 69.07  ? 478 ASP C CA   1 
ATOM   8009  C C    . ASP B 1 141 ? -26.344 -17.950 -16.906 1.00 50.41  ? 478 ASP C C    1 
ATOM   8010  O O    . ASP B 1 141 ? -26.034 -17.698 -15.739 1.00 43.67  ? 478 ASP C O    1 
ATOM   8011  C CB   . ASP B 1 141 ? -26.669 -20.376 -17.413 1.00 79.62  ? 478 ASP C CB   1 
ATOM   8012  C CG   . ASP B 1 141 ? -26.354 -21.506 -18.370 1.00 89.11  ? 478 ASP C CG   1 
ATOM   8013  O OD1  . ASP B 1 141 ? -25.505 -22.356 -18.029 1.00 92.30  ? 478 ASP C OD1  1 
ATOM   8014  O OD2  . ASP B 1 141 ? -26.958 -21.542 -19.463 1.00 89.30  ? 478 ASP C OD2  1 
ATOM   8015  H H    . ASP B 1 141 ? -24.321 -20.175 -16.735 1.00 80.99  ? 478 ASP C H    1 
ATOM   8016  H HA   . ASP B 1 141 ? -25.711 -18.968 -18.579 1.00 82.89  ? 478 ASP C HA   1 
ATOM   8017  H HB2  . ASP B 1 141 ? -26.553 -20.707 -16.509 1.00 95.55  ? 478 ASP C HB2  1 
ATOM   8018  H HB3  . ASP B 1 141 ? -27.592 -20.111 -17.554 1.00 95.55  ? 478 ASP C HB3  1 
ATOM   8019  N N    . ALA B 1 142 ? -27.164 -17.189 -17.617 1.00 46.91  ? 479 ALA C N    1 
ATOM   8020  C CA   . ALA B 1 142 ? -27.872 -16.077 -17.009 1.00 49.47  ? 479 ALA C CA   1 
ATOM   8021  C C    . ALA B 1 142 ? -28.718 -16.609 -15.860 1.00 43.33  ? 479 ALA C C    1 
ATOM   8022  O O    . ALA B 1 142 ? -29.447 -17.590 -16.008 1.00 45.23  ? 479 ALA C O    1 
ATOM   8023  C CB   . ALA B 1 142 ? -28.748 -15.376 -18.036 1.00 53.32  ? 479 ALA C CB   1 
ATOM   8024  H H    . ALA B 1 142 ? -27.326 -17.296 -18.454 1.00 56.30  ? 479 ALA C H    1 
ATOM   8025  H HA   . ALA B 1 142 ? -27.228 -15.431 -16.652 1.00 59.37  ? 479 ALA C HA   1 
ATOM   8026  H HB1  . ALA B 1 142 ? -29.205 -14.647 -17.611 1.00 63.99  ? 479 ALA C HB1  1 
ATOM   8027  H HB2  . ALA B 1 142 ? -28.193 -15.046 -18.746 1.00 63.99  ? 479 ALA C HB2  1 
ATOM   8028  H HB3  . ALA B 1 142 ? -29.385 -16.005 -18.384 1.00 63.99  ? 479 ALA C HB3  1 
ATOM   8029  N N    . LEU B 1 143 ? -28.608 -15.964 -14.708 1.00 33.41  ? 480 LEU C N    1 
ATOM   8030  C CA   . LEU B 1 143 ? -29.400 -16.351 -13.549 1.00 41.68  ? 480 LEU C CA   1 
ATOM   8031  C C    . LEU B 1 143 ? -30.881 -16.067 -13.796 1.00 45.58  ? 480 LEU C C    1 
ATOM   8032  O O    . LEU B 1 143 ? -31.238 -15.127 -14.523 1.00 31.88  ? 480 LEU C O    1 
ATOM   8033  C CB   . LEU B 1 143 ? -28.923 -15.592 -12.311 1.00 43.35  ? 480 LEU C CB   1 
ATOM   8034  C CG   . LEU B 1 143 ? -27.418 -15.640 -12.035 1.00 49.30  ? 480 LEU C CG   1 
ATOM   8035  C CD1  . LEU B 1 143 ? -27.003 -14.494 -11.115 1.00 47.79  ? 480 LEU C CD1  1 
ATOM   8036  C CD2  . LEU B 1 143 ? -27.012 -16.991 -11.450 1.00 52.79  ? 480 LEU C CD2  1 
ATOM   8037  H H    . LEU B 1 143 ? -28.082 -15.298 -14.571 1.00 40.10  ? 480 LEU C H    1 
ATOM   8038  H HA   . LEU B 1 143 ? -29.291 -17.311 -13.385 1.00 50.02  ? 480 LEU C HA   1 
ATOM   8039  H HB2  . LEU B 1 143 ? -29.169 -14.659 -12.411 1.00 52.03  ? 480 LEU C HB2  1 
ATOM   8040  H HB3  . LEU B 1 143 ? -29.371 -15.961 -11.534 1.00 52.03  ? 480 LEU C HB3  1 
ATOM   8041  H HG   . LEU B 1 143 ? -26.945 -15.529 -12.874 1.00 59.16  ? 480 LEU C HG   1 
ATOM   8042  H HD11 . LEU B 1 143 ? -26.058 -14.546 -10.958 1.00 57.35  ? 480 LEU C HD11 1 
ATOM   8043  H HD12 . LEU B 1 143 ? -27.219 -13.660 -11.539 1.00 57.35  ? 480 LEU C HD12 1 
ATOM   8044  H HD13 . LEU B 1 143 ? -27.478 -14.572 -10.285 1.00 57.35  ? 480 LEU C HD13 1 
ATOM   8045  H HD21 . LEU B 1 143 ? -26.066 -16.990 -11.288 1.00 63.35  ? 480 LEU C HD21 1 
ATOM   8046  H HD22 . LEU B 1 143 ? -27.485 -17.129 -10.626 1.00 63.35  ? 480 LEU C HD22 1 
ATOM   8047  H HD23 . LEU B 1 143 ? -27.237 -17.683 -12.076 1.00 63.35  ? 480 LEU C HD23 1 
ATOM   8048  N N    . LYS B 1 144 ? -31.746 -16.883 -13.197 1.00 29.68  ? 481 LYS C N    1 
ATOM   8049  C CA   . LYS B 1 144 ? -33.180 -16.637 -13.270 1.00 39.38  ? 481 LYS C CA   1 
ATOM   8050  C C    . LYS B 1 144 ? -33.498 -15.350 -12.524 1.00 43.19  ? 481 LYS C C    1 
ATOM   8051  O O    . LYS B 1 144 ? -32.781 -14.967 -11.595 1.00 35.77  ? 481 LYS C O    1 
ATOM   8052  C CB   . LYS B 1 144 ? -33.975 -17.795 -12.661 1.00 59.68  ? 481 LYS C CB   1 
ATOM   8053  C CG   . LYS B 1 144 ? -33.882 -19.100 -13.435 1.00 78.62  ? 481 LYS C CG   1 
ATOM   8054  C CD   . LYS B 1 144 ? -34.906 -20.113 -12.938 1.00 93.73  ? 481 LYS C CD   1 
ATOM   8055  C CE   . LYS B 1 144 ? -34.979 -21.330 -13.854 1.00 107.30 ? 481 LYS C CE   1 
ATOM   8056  N NZ   . LYS B 1 144 ? -35.959 -22.345 -13.374 1.00 115.62 ? 481 LYS C NZ   1 
ATOM   8057  H H    . LYS B 1 144 ? -31.527 -17.581 -12.744 1.00 35.62  ? 481 LYS C H    1 
ATOM   8058  H HA   . LYS B 1 144 ? -33.449 -16.532 -14.207 1.00 47.25  ? 481 LYS C HA   1 
ATOM   8059  H HB2  . LYS B 1 144 ? -33.643 -17.960 -11.764 1.00 71.61  ? 481 LYS C HB2  1 
ATOM   8060  H HB3  . LYS B 1 144 ? -34.910 -17.542 -12.621 1.00 71.61  ? 481 LYS C HB3  1 
ATOM   8061  H HG2  . LYS B 1 144 ? -34.054 -18.928 -14.374 1.00 94.34  ? 481 LYS C HG2  1 
ATOM   8062  H HG3  . LYS B 1 144 ? -32.997 -19.479 -13.318 1.00 94.34  ? 481 LYS C HG3  1 
ATOM   8063  H HD2  . LYS B 1 144 ? -34.654 -20.415 -12.051 1.00 112.48 ? 481 LYS C HD2  1 
ATOM   8064  H HD3  . LYS B 1 144 ? -35.782 -19.698 -12.915 1.00 112.48 ? 481 LYS C HD3  1 
ATOM   8065  H HE2  . LYS B 1 144 ? -35.251 -21.044 -14.740 1.00 128.76 ? 481 LYS C HE2  1 
ATOM   8066  H HE3  . LYS B 1 144 ? -34.105 -21.749 -13.893 1.00 128.76 ? 481 LYS C HE3  1 
ATOM   8067  H HZ1  . LYS B 1 144 ? -35.974 -23.039 -13.931 1.00 138.74 ? 481 LYS C HZ1  1 
ATOM   8068  H HZ2  . LYS B 1 144 ? -35.728 -22.630 -12.563 1.00 138.74 ? 481 LYS C HZ2  1 
ATOM   8069  H HZ3  . LYS B 1 144 ? -36.772 -21.987 -13.335 1.00 138.74 ? 481 LYS C HZ3  1 
ATOM   8070  N N    . VAL B 1 145 ? -34.576 -14.688 -12.929 1.00 33.46  ? 482 VAL C N    1 
ATOM   8071  C CA   . VAL B 1 145 ? -35.009 -13.471 -12.260 1.00 42.47  ? 482 VAL C CA   1 
ATOM   8072  C C    . VAL B 1 145 ? -35.928 -13.846 -11.095 1.00 40.78  ? 482 VAL C C    1 
ATOM   8073  O O    . VAL B 1 145 ? -37.137 -13.970 -11.258 1.00 35.07  ? 482 VAL C O    1 
ATOM   8074  C CB   . VAL B 1 145 ? -35.741 -12.518 -13.232 1.00 42.65  ? 482 VAL C CB   1 
ATOM   8075  C CG1  . VAL B 1 145 ? -36.183 -11.253 -12.512 1.00 41.22  ? 482 VAL C CG1  1 
ATOM   8076  C CG2  . VAL B 1 145 ? -34.847 -12.171 -14.435 1.00 29.56  ? 482 VAL C CG2  1 
ATOM   8077  H H    . VAL B 1 145 ? -35.074 -14.923 -13.590 1.00 40.15  ? 482 VAL C H    1 
ATOM   8078  H HA   . VAL B 1 145 ? -34.228 -13.003 -11.898 1.00 50.96  ? 482 VAL C HA   1 
ATOM   8079  H HB   . VAL B 1 145 ? -36.543 -12.966 -13.573 1.00 51.18  ? 482 VAL C HB   1 
ATOM   8080  H HG11 . VAL B 1 145 ? -36.633 -10.679 -13.136 1.00 49.47  ? 482 VAL C HG11 1 
ATOM   8081  H HG12 . VAL B 1 145 ? -36.778 -11.492 -11.798 1.00 49.47  ? 482 VAL C HG12 1 
ATOM   8082  H HG13 . VAL B 1 145 ? -35.408 -10.809 -12.158 1.00 49.47  ? 482 VAL C HG13 1 
ATOM   8083  H HG21 . VAL B 1 145 ? -35.327 -11.579 -15.020 1.00 35.47  ? 482 VAL C HG21 1 
ATOM   8084  H HG22 . VAL B 1 145 ? -34.049 -11.742 -14.117 1.00 35.47  ? 482 VAL C HG22 1 
ATOM   8085  H HG23 . VAL B 1 145 ? -34.622 -12.980 -14.900 1.00 35.47  ? 482 VAL C HG23 1 
ATOM   8086  N N    . THR B 1 146 ? -35.351 -14.030 -9.913  1.00 38.39  ? 483 THR C N    1 
ATOM   8087  C CA   . THR B 1 146 ? -36.143 -14.477 -8.778  1.00 37.56  ? 483 THR C CA   1 
ATOM   8088  C C    . THR B 1 146 ? -36.421 -13.349 -7.796  1.00 28.28  ? 483 THR C C    1 
ATOM   8089  O O    . THR B 1 146 ? -37.176 -13.526 -6.849  1.00 29.49  ? 483 THR C O    1 
ATOM   8090  C CB   . THR B 1 146 ? -35.475 -15.653 -8.059  1.00 29.57  ? 483 THR C CB   1 
ATOM   8091  O OG1  . THR B 1 146 ? -34.110 -15.325 -7.773  1.00 28.59  ? 483 THR C OG1  1 
ATOM   8092  C CG2  . THR B 1 146 ? -35.527 -16.900 -8.941  1.00 42.02  ? 483 THR C CG2  1 
ATOM   8093  H H    . THR B 1 146 ? -34.517 -13.905 -9.745  1.00 46.07  ? 483 THR C H    1 
ATOM   8094  H HA   . THR B 1 146 ? -37.008 -14.793 -9.112  1.00 45.07  ? 483 THR C HA   1 
ATOM   8095  H HB   . THR B 1 146 ? -35.945 -15.839 -7.231  1.00 35.48  ? 483 THR C HB   1 
ATOM   8096  H HG1  . THR B 1 146 ? -34.076 -14.661 -7.293  1.00 34.30  ? 483 THR C HG1  1 
ATOM   8097  H HG21 . THR B 1 146 ? -35.109 -17.638 -8.491  1.00 50.42  ? 483 THR C HG21 1 
ATOM   8098  H HG22 . THR B 1 146 ? -36.440 -17.128 -9.132  1.00 50.42  ? 483 THR C HG22 1 
ATOM   8099  H HG23 . THR B 1 146 ? -35.067 -16.737 -9.767  1.00 50.42  ? 483 THR C HG23 1 
ATOM   8100  N N    . ALA B 1 147 ? -35.813 -12.194 -8.025  1.00 29.75  ? 484 ALA C N    1 
ATOM   8101  C CA   . ALA B 1 147 ? -36.181 -10.994 -7.291  1.00 26.48  ? 484 ALA C CA   1 
ATOM   8102  C C    . ALA B 1 147 ? -36.149 -11.228 -5.780  1.00 24.55  ? 484 ALA C C    1 
ATOM   8103  O O    . ALA B 1 147 ? -37.040 -10.783 -5.063  1.00 24.71  ? 484 ALA C O    1 
ATOM   8104  C CB   . ALA B 1 147 ? -37.588 -10.546 -7.722  1.00 30.07  ? 484 ALA C CB   1 
ATOM   8105  H H    . ALA B 1 147 ? -35.184 -12.079 -8.600  1.00 35.69  ? 484 ALA C H    1 
ATOM   8106  H HA   . ALA B 1 147 ? -35.549 -10.276 -7.505  1.00 31.77  ? 484 ALA C HA   1 
ATOM   8107  H HB1  . ALA B 1 147 ? -37.826 -9.754  -7.234  1.00 36.08  ? 484 ALA C HB1  1 
ATOM   8108  H HB2  . ALA B 1 147 ? -37.582 -10.362 -8.664  1.00 36.08  ? 484 ALA C HB2  1 
ATOM   8109  H HB3  . ALA B 1 147 ? -38.212 -11.249 -7.529  1.00 36.08  ? 484 ALA C HB3  1 
ATOM   8110  N N    . ASN B 1 148 ? -35.119 -11.925 -5.305  1.00 24.54  ? 485 ASN C N    1 
ATOM   8111  C CA   . ASN B 1 148 ? -35.038 -12.329 -3.899  1.00 22.98  ? 485 ASN C CA   1 
ATOM   8112  C C    . ASN B 1 148 ? -33.591 -12.550 -3.480  1.00 18.98  ? 485 ASN C C    1 
ATOM   8113  O O    . ASN B 1 148 ? -33.296 -13.369 -2.614  1.00 30.43  ? 485 ASN C O    1 
ATOM   8114  C CB   . ASN B 1 148 ? -35.862 -13.586 -3.683  1.00 24.21  ? 485 ASN C CB   1 
ATOM   8115  C CG   . ASN B 1 148 ? -35.305 -14.779 -4.420  1.00 30.83  ? 485 ASN C CG   1 
ATOM   8116  O OD1  . ASN B 1 148 ? -34.362 -14.660 -5.199  1.00 26.12  ? 485 ASN C OD1  1 
ATOM   8117  N ND2  . ASN B 1 148 ? -35.890 -15.947 -4.176  1.00 26.32  ? 485 ASN C ND2  1 
ATOM   8118  H H    . ASN B 1 148 ? -34.447 -12.179 -5.779  1.00 29.45  ? 485 ASN C H    1 
ATOM   8119  H HA   . ASN B 1 148 ? -35.412 -11.618 -3.339  1.00 27.57  ? 485 ASN C HA   1 
ATOM   8120  H HB2  . ASN B 1 148 ? -35.875 -13.797 -2.736  1.00 29.05  ? 485 ASN C HB2  1 
ATOM   8121  H HB3  . ASN B 1 148 ? -36.765 -13.431 -4.001  1.00 29.05  ? 485 ASN C HB3  1 
ATOM   8122  H HD21 . ASN B 1 148 ? -36.549 -15.992 -3.625  1.00 31.58  ? 485 ASN C HD21 1 
ATOM   8123  H HD22 . ASN B 1 148 ? -35.611 -16.659 -4.571  1.00 31.58  ? 485 ASN C HD22 1 
ATOM   8124  N N    . ILE B 1 149 ? -32.691 -11.799 -4.112  1.00 23.10  ? 486 ILE C N    1 
ATOM   8125  C CA   . ILE B 1 149 ? -31.261 -11.924 -3.879  1.00 23.09  ? 486 ILE C CA   1 
ATOM   8126  C C    . ILE B 1 149 ? -30.697 -10.649 -3.274  1.00 26.81  ? 486 ILE C C    1 
ATOM   8127  O O    . ILE B 1 149 ? -30.945 -9.561  -3.780  1.00 21.97  ? 486 ILE C O    1 
ATOM   8128  C CB   . ILE B 1 149 ? -30.525 -12.186 -5.209  1.00 24.11  ? 486 ILE C CB   1 
ATOM   8129  C CG1  . ILE B 1 149 ? -30.997 -13.511 -5.825  1.00 28.55  ? 486 ILE C CG1  1 
ATOM   8130  C CG2  . ILE B 1 149 ? -29.021 -12.218 -4.989  1.00 20.36  ? 486 ILE C CG2  1 
ATOM   8131  C CD1  . ILE B 1 149 ? -30.607 -13.677 -7.293  1.00 28.66  ? 486 ILE C CD1  1 
ATOM   8132  H H    . ILE B 1 149 ? -32.892 -11.198 -4.693  1.00 27.72  ? 486 ILE C H    1 
ATOM   8133  H HA   . ILE B 1 149 ? -31.087 -12.670 -3.267  1.00 27.70  ? 486 ILE C HA   1 
ATOM   8134  H HB   . ILE B 1 149 ? -30.733 -11.466 -5.825  1.00 28.93  ? 486 ILE C HB   1 
ATOM   8135  H HG12 . ILE B 1 149 ? -30.603 -14.245 -5.328  1.00 34.26  ? 486 ILE C HG12 1 
ATOM   8136  H HG13 . ILE B 1 149 ? -31.964 -13.555 -5.768  1.00 34.26  ? 486 ILE C HG13 1 
ATOM   8137  H HG21 . ILE B 1 149 ? -28.587 -12.382 -5.830  1.00 24.44  ? 486 ILE C HG21 1 
ATOM   8138  H HG22 . ILE B 1 149 ? -28.740 -11.371 -4.634  1.00 24.44  ? 486 ILE C HG22 1 
ATOM   8139  H HG23 . ILE B 1 149 ? -28.811 -12.920 -4.369  1.00 24.44  ? 486 ILE C HG23 1 
ATOM   8140  H HD11 . ILE B 1 149 ? -30.933 -14.523 -7.608  1.00 34.40  ? 486 ILE C HD11 1 
ATOM   8141  H HD12 . ILE B 1 149 ? -30.998 -12.964 -7.802  1.00 34.40  ? 486 ILE C HD12 1 
ATOM   8142  H HD13 . ILE B 1 149 ? -29.650 -13.647 -7.367  1.00 34.40  ? 486 ILE C HD13 1 
ATOM   8143  N N    . VAL B 1 150 ? -29.925 -10.773 -2.199  1.00 19.51  ? 487 VAL C N    1 
ATOM   8144  C CA   . VAL B 1 150 ? -29.290 -9.611  -1.591  1.00 19.40  ? 487 VAL C CA   1 
ATOM   8145  C C    . VAL B 1 150 ? -27.844 -9.966  -1.261  1.00 26.44  ? 487 VAL C C    1 
ATOM   8146  O O    . VAL B 1 150 ? -27.586 -10.966 -0.580  1.00 20.53  ? 487 VAL C O    1 
ATOM   8147  C CB   . VAL B 1 150 ? -30.006 -9.210  -0.267  1.00 20.70  ? 487 VAL C CB   1 
ATOM   8148  C CG1  . VAL B 1 150 ? -29.274 -8.071  0.423   1.00 18.93  ? 487 VAL C CG1  1 
ATOM   8149  C CG2  . VAL B 1 150 ? -31.478 -8.863  -0.525  1.00 17.03  ? 487 VAL C CG2  1 
ATOM   8150  H H    . VAL B 1 150 ? -29.754 -11.518 -1.804  1.00 23.41  ? 487 VAL C H    1 
ATOM   8151  H HA   . VAL B 1 150 ? -29.304 -8.852  -2.210  1.00 23.28  ? 487 VAL C HA   1 
ATOM   8152  H HB   . VAL B 1 150 ? -29.989 -9.980  0.339   1.00 24.85  ? 487 VAL C HB   1 
ATOM   8153  H HG11 . VAL B 1 150 ? -29.738 -7.847  1.233   1.00 22.71  ? 487 VAL C HG11 1 
ATOM   8154  H HG12 . VAL B 1 150 ? -28.379 -8.352  0.625   1.00 22.71  ? 487 VAL C HG12 1 
ATOM   8155  H HG13 . VAL B 1 150 ? -29.254 -7.311  -0.164  1.00 22.71  ? 487 VAL C HG13 1 
ATOM   8156  H HG21 . VAL B 1 150 ? -31.892 -8.621  0.307   1.00 20.43  ? 487 VAL C HG21 1 
ATOM   8157  H HG22 . VAL B 1 150 ? -31.522 -8.127  -1.139  1.00 20.43  ? 487 VAL C HG22 1 
ATOM   8158  H HG23 . VAL B 1 150 ? -31.919 -9.629  -0.899  1.00 20.43  ? 487 VAL C HG23 1 
ATOM   8159  N N    . PHE B 1 151 ? -26.917 -9.169  -1.778  1.00 19.58  ? 488 PHE C N    1 
ATOM   8160  C CA   . PHE B 1 151 ? -25.515 -9.233  -1.411  1.00 22.20  ? 488 PHE C CA   1 
ATOM   8161  C C    . PHE B 1 151 ? -25.170 -8.055  -0.528  1.00 26.31  ? 488 PHE C C    1 
ATOM   8162  O O    . PHE B 1 151 ? -25.542 -6.919  -0.836  1.00 23.31  ? 488 PHE C O    1 
ATOM   8163  C CB   . PHE B 1 151 ? -24.635 -9.131  -2.662  1.00 14.59  ? 488 PHE C CB   1 
ATOM   8164  C CG   . PHE B 1 151 ? -24.501 -10.414 -3.429  1.00 26.48  ? 488 PHE C CG   1 
ATOM   8165  C CD1  . PHE B 1 151 ? -23.251 -10.990 -3.620  1.00 22.89  ? 488 PHE C CD1  1 
ATOM   8166  C CD2  . PHE B 1 151 ? -25.611 -11.029 -3.986  1.00 35.12  ? 488 PHE C CD2  1 
ATOM   8167  C CE1  . PHE B 1 151 ? -23.113 -12.170 -4.339  1.00 24.18  ? 488 PHE C CE1  1 
ATOM   8168  C CE2  . PHE B 1 151 ? -25.478 -12.215 -4.710  1.00 43.65  ? 488 PHE C CE2  1 
ATOM   8169  C CZ   . PHE B 1 151 ? -24.230 -12.782 -4.888  1.00 31.16  ? 488 PHE C CZ   1 
ATOM   8170  H H    . PHE B 1 151 ? -27.086 -8.564  -2.365  1.00 23.49  ? 488 PHE C H    1 
ATOM   8171  H HA   . PHE B 1 151 ? -25.319 -10.068 -0.937  1.00 26.64  ? 488 PHE C HA   1 
ATOM   8172  H HB2  . PHE B 1 151 ? -25.019 -8.469  -3.258  1.00 17.51  ? 488 PHE C HB2  1 
ATOM   8173  H HB3  . PHE B 1 151 ? -23.745 -8.853  -2.394  1.00 17.51  ? 488 PHE C HB3  1 
ATOM   8174  H HD1  . PHE B 1 151 ? -22.498 -10.584 -3.255  1.00 27.47  ? 488 PHE C HD1  1 
ATOM   8175  H HD2  . PHE B 1 151 ? -26.453 -10.651 -3.871  1.00 42.15  ? 488 PHE C HD2  1 
ATOM   8176  H HE1  . PHE B 1 151 ? -22.271 -12.548 -4.455  1.00 29.02  ? 488 PHE C HE1  1 
ATOM   8177  H HE2  . PHE B 1 151 ? -26.230 -12.622 -5.075  1.00 52.38  ? 488 PHE C HE2  1 
ATOM   8178  H HZ   . PHE B 1 151 ? -24.141 -13.574 -5.369  1.00 37.39  ? 488 PHE C HZ   1 
ATOM   8179  N N    . GLY B 1 152 ? -24.463 -8.315  0.563   1.00 18.70  ? 489 GLY C N    1 
ATOM   8180  C CA   . GLY B 1 152 ? -23.731 -7.277  1.255   1.00 20.00  ? 489 GLY C CA   1 
ATOM   8181  C C    . GLY B 1 152 ? -22.247 -7.587  1.168   1.00 23.21  ? 489 GLY C C    1 
ATOM   8182  O O    . GLY B 1 152 ? -21.767 -8.529  1.808   1.00 20.74  ? 489 GLY C O    1 
ATOM   8183  H H    . GLY B 1 152 ? -24.393 -9.093  0.922   1.00 22.44  ? 489 GLY C H    1 
ATOM   8184  H HA2  . GLY B 1 152 ? -23.901 -6.416  0.844   1.00 24.00  ? 489 GLY C HA2  1 
ATOM   8185  H HA3  . GLY B 1 152 ? -23.996 -7.245  2.187   1.00 24.00  ? 489 GLY C HA3  1 
ATOM   8186  N N    . TYR B 1 153 ? -21.527 -6.823  0.356   1.00 23.66  ? 490 TYR C N    1 
ATOM   8187  C CA   . TYR B 1 153 ? -20.083 -6.933  0.254   1.00 18.81  ? 490 TYR C CA   1 
ATOM   8188  C C    . TYR B 1 153 ? -19.423 -6.017  1.273   1.00 18.29  ? 490 TYR C C    1 
ATOM   8189  O O    . TYR B 1 153 ? -19.775 -4.843  1.378   1.00 21.39  ? 490 TYR C O    1 
ATOM   8190  C CB   . TYR B 1 153 ? -19.602 -6.497  -1.134  1.00 23.98  ? 490 TYR C CB   1 
ATOM   8191  C CG   . TYR B 1 153 ? -20.150 -7.238  -2.337  1.00 24.45  ? 490 TYR C CG   1 
ATOM   8192  C CD1  . TYR B 1 153 ? -19.469 -8.323  -2.895  1.00 22.98  ? 490 TYR C CD1  1 
ATOM   8193  C CD2  . TYR B 1 153 ? -21.312 -6.805  -2.966  1.00 27.88  ? 490 TYR C CD2  1 
ATOM   8194  C CE1  . TYR B 1 153 ? -19.959 -8.965  -4.041  1.00 25.88  ? 490 TYR C CE1  1 
ATOM   8195  C CE2  . TYR B 1 153 ? -21.805 -7.435  -4.096  1.00 25.82  ? 490 TYR C CE2  1 
ATOM   8196  C CZ   . TYR B 1 153 ? -21.130 -8.509  -4.629  1.00 26.15  ? 490 TYR C CZ   1 
ATOM   8197  O OH   . TYR B 1 153 ? -21.650 -9.113  -5.748  1.00 27.26  ? 490 TYR C OH   1 
ATOM   8198  H H    . TYR B 1 153 ? -21.863 -6.220  -0.157  1.00 28.39  ? 490 TYR C H    1 
ATOM   8199  H HA   . TYR B 1 153 ? -19.800 -7.857  0.418   1.00 22.57  ? 490 TYR C HA   1 
ATOM   8200  H HB2  . TYR B 1 153 ? -19.832 -5.561  -1.249  1.00 28.78  ? 490 TYR C HB2  1 
ATOM   8201  H HB3  . TYR B 1 153 ? -18.637 -6.591  -1.159  1.00 28.78  ? 490 TYR C HB3  1 
ATOM   8202  H HD1  . TYR B 1 153 ? -18.680 -8.621  -2.503  1.00 27.58  ? 490 TYR C HD1  1 
ATOM   8203  H HD2  . TYR B 1 153 ? -21.770 -6.074  -2.618  1.00 33.45  ? 490 TYR C HD2  1 
ATOM   8204  H HE1  . TYR B 1 153 ? -19.506 -9.694  -4.400  1.00 31.06  ? 490 TYR C HE1  1 
ATOM   8205  H HE2  . TYR B 1 153 ? -22.590 -7.134  -4.494  1.00 30.99  ? 490 TYR C HE2  1 
ATOM   8206  H HH   . TYR B 1 153 ? -21.819 -9.900  -5.590  1.00 32.71  ? 490 TYR C HH   1 
ATOM   8207  N N    . ALA B 1 154 ? -18.461 -6.546  2.033   1.00 20.92  ? 491 ALA C N    1 
ATOM   8208  C CA   . ALA B 1 154 ? -17.714 -5.735  2.980   1.00 16.36  ? 491 ALA C CA   1 
ATOM   8209  C C    . ALA B 1 154 ? -17.013 -4.561  2.309   1.00 24.27  ? 491 ALA C C    1 
ATOM   8210  O O    . ALA B 1 154 ? -16.754 -3.550  2.953   1.00 25.83  ? 491 ALA C O    1 
ATOM   8211  C CB   . ALA B 1 154 ? -16.655 -6.601  3.721   1.00 20.42  ? 491 ALA C CB   1 
ATOM   8212  H H    . ALA B 1 154 ? -18.225 -7.373  2.015   1.00 25.10  ? 491 ALA C H    1 
ATOM   8213  H HA   . ALA B 1 154 ? -18.333 -5.376  3.650   1.00 19.64  ? 491 ALA C HA   1 
ATOM   8214  H HB1  . ALA B 1 154 ? -16.175 -6.046  4.340   1.00 24.50  ? 491 ALA C HB1  1 
ATOM   8215  H HB2  . ALA B 1 154 ? -17.104 -7.307  4.193   1.00 24.50  ? 491 ALA C HB2  1 
ATOM   8216  H HB3  . ALA B 1 154 ? -16.049 -6.973  3.076   1.00 24.50  ? 491 ALA C HB3  1 
ATOM   8217  N N    . THR B 1 155 ? -16.668 -4.706  1.033   1.00 24.68  ? 492 THR C N    1 
ATOM   8218  C CA   . THR B 1 155 ? -15.972 -3.636  0.327   1.00 26.50  ? 492 THR C CA   1 
ATOM   8219  C C    . THR B 1 155 ? -16.432 -3.548  -1.125  1.00 27.06  ? 492 THR C C    1 
ATOM   8220  O O    . THR B 1 155 ? -17.222 -4.369  -1.577  1.00 26.36  ? 492 THR C O    1 
ATOM   8221  C CB   . THR B 1 155 ? -14.428 -3.781  0.403   1.00 26.19  ? 492 THR C CB   1 
ATOM   8222  O OG1  . THR B 1 155 ? -13.822 -2.509  0.148   1.00 35.40  ? 492 THR C OG1  1 
ATOM   8223  C CG2  . THR B 1 155 ? -13.890 -4.810  -0.606  1.00 21.18  ? 492 THR C CG2  1 
ATOM   8224  H H    . THR B 1 155 ? -16.823 -5.407  0.558   1.00 29.62  ? 492 THR C H    1 
ATOM   8225  H HA   . THR B 1 155 ? -16.204 -2.786  0.756   1.00 31.80  ? 492 THR C HA   1 
ATOM   8226  H HB   . THR B 1 155 ? -14.181 -4.077  1.293   1.00 31.43  ? 492 THR C HB   1 
ATOM   8227  H HG1  . THR B 1 155 ? -13.005 -2.575  0.186   1.00 42.49  ? 492 THR C HG1  1 
ATOM   8228  H HG21 . THR B 1 155 ? -12.935 -4.874  -0.532  1.00 25.41  ? 492 THR C HG21 1 
ATOM   8229  H HG22 . THR B 1 155 ? -14.275 -5.672  -0.432  1.00 25.41  ? 492 THR C HG22 1 
ATOM   8230  H HG23 . THR B 1 155 ? -14.116 -4.542  -1.500  1.00 25.41  ? 492 THR C HG23 1 
ATOM   8231  N N    . CYS B 1 156 ? -15.953 -2.535  -1.843  1.00 21.48  ? 493 CYS C N    1 
ATOM   8232  C CA   . CYS B 1 156 ? -16.351 -2.328  -3.229  1.00 21.49  ? 493 CYS C CA   1 
ATOM   8233  C C    . CYS B 1 156 ? -15.490 -3.113  -4.216  1.00 28.83  ? 493 CYS C C    1 
ATOM   8234  O O    . CYS B 1 156 ? -14.392 -3.565  -3.887  1.00 27.35  ? 493 CYS C O    1 
ATOM   8235  C CB   . CYS B 1 156 ? -16.296 -0.828  -3.573  1.00 24.05  ? 493 CYS C CB   1 
ATOM   8236  S SG   . CYS B 1 156 ? -17.591 0.103   -2.728  1.00 29.37  ? 493 CYS C SG   1 
ATOM   8237  H H    . CYS B 1 156 ? -15.394 -1.952  -1.548  1.00 25.78  ? 493 CYS C H    1 
ATOM   8238  H HA   . CYS B 1 156 ? -17.278 -2.626  -3.339  1.00 25.78  ? 493 CYS C HA   1 
ATOM   8239  H HB2  . CYS B 1 156 ? -15.437 -0.469  -3.299  1.00 28.86  ? 493 CYS C HB2  1 
ATOM   8240  H HB3  . CYS B 1 156 ? -16.416 -0.715  -4.529  1.00 28.86  ? 493 CYS C HB3  1 
ATOM   8241  H HG   . CYS B 1 156 ? -17.451 -0.023  -1.542  1.00 35.24  ? 493 CYS C HG   1 
ATOM   8242  N N    . GLN B 1 157 ? -16.000 -3.286  -5.429  1.00 23.76  ? 494 GLN C N    1 
ATOM   8243  C CA   . GLN B 1 157 ? -15.262 -4.008  -6.456  1.00 29.59  ? 494 GLN C CA   1 
ATOM   8244  C C    . GLN B 1 157 ? -13.910 -3.348  -6.651  1.00 33.02  ? 494 GLN C C    1 
ATOM   8245  O O    . GLN B 1 157 ? -13.816 -2.127  -6.683  1.00 32.75  ? 494 GLN C O    1 
ATOM   8246  C CB   . GLN B 1 157 ? -16.048 -4.028  -7.766  1.00 32.74  ? 494 GLN C CB   1 
ATOM   8247  C CG   . GLN B 1 157 ? -15.378 -4.854  -8.852  1.00 44.04  ? 494 GLN C CG   1 
ATOM   8248  C CD   . GLN B 1 157 ? -16.247 -5.007  -10.081 1.00 53.23  ? 494 GLN C CD   1 
ATOM   8249  O OE1  . GLN B 1 157 ? -16.407 -4.069  -10.857 1.00 45.54  ? 494 GLN C OE1  1 
ATOM   8250  N NE2  . GLN B 1 157 ? -16.812 -6.194  -10.265 1.00 55.53  ? 494 GLN C NE2  1 
ATOM   8251  H H    . GLN B 1 157 ? -16.769 -2.996  -5.682  1.00 28.51  ? 494 GLN C H    1 
ATOM   8252  H HA   . GLN B 1 157 ? -15.117 -4.932  -6.166  1.00 35.51  ? 494 GLN C HA   1 
ATOM   8253  H HB2  . GLN B 1 157 ? -16.925 -4.408  -7.600  1.00 39.28  ? 494 GLN C HB2  1 
ATOM   8254  H HB3  . GLN B 1 157 ? -16.137 -3.120  -8.094  1.00 39.28  ? 494 GLN C HB3  1 
ATOM   8255  H HG2  . GLN B 1 157 ? -14.554 -4.418  -9.119  1.00 52.85  ? 494 GLN C HG2  1 
ATOM   8256  H HG3  . GLN B 1 157 ? -15.190 -5.740  -8.506  1.00 52.85  ? 494 GLN C HG3  1 
ATOM   8257  H HE21 . GLN B 1 157 ? -16.676 -6.827  -9.699  1.00 66.63  ? 494 GLN C HE21 1 
ATOM   8258  H HE22 . GLN B 1 157 ? -17.315 -6.330  -10.950 1.00 66.63  ? 494 GLN C HE22 1 
ATOM   8259  N N    . GLY B 1 158 ? -12.855 -4.152  -6.745  1.00 21.73  ? 495 GLY C N    1 
ATOM   8260  C CA   . GLY B 1 158 ? -11.513 -3.620  -6.936  1.00 25.46  ? 495 GLY C CA   1 
ATOM   8261  C C    . GLY B 1 158 ? -10.854 -3.057  -5.683  1.00 31.53  ? 495 GLY C C    1 
ATOM   8262  O O    . GLY B 1 158 ? -9.765  -2.494  -5.761  1.00 36.60  ? 495 GLY C O    1 
ATOM   8263  H H    . GLY B 1 158 ? -12.891 -5.010  -6.701  1.00 26.07  ? 495 GLY C H    1 
ATOM   8264  H HA2  . GLY B 1 158 ? -10.943 -4.324  -7.282  1.00 30.55  ? 495 GLY C HA2  1 
ATOM   8265  H HA3  . GLY B 1 158 ? -11.548 -2.911  -7.598  1.00 30.55  ? 495 GLY C HA3  1 
ATOM   8266  N N    . ALA B 1 159 ? -11.495 -3.217  -4.527  1.00 32.30  ? 496 ALA C N    1 
ATOM   8267  C CA   . ALA B 1 159 ? -10.997 -2.642  -3.276  1.00 29.00  ? 496 ALA C CA   1 
ATOM   8268  C C    . ALA B 1 159 ? -10.745 -3.746  -2.235  1.00 27.32  ? 496 ALA C C    1 
ATOM   8269  O O    . ALA B 1 159 ? -11.032 -4.918  -2.481  1.00 26.85  ? 496 ALA C O    1 
ATOM   8270  C CB   . ALA B 1 159 ? -12.004 -1.618  -2.729  1.00 27.59  ? 496 ALA C CB   1 
ATOM   8271  H H    . ALA B 1 159 ? -12.228 -3.659  -4.440  1.00 38.76  ? 496 ALA C H    1 
ATOM   8272  H HA   . ALA B 1 159 ? -10.150 -2.180  -3.447  1.00 34.80  ? 496 ALA C HA   1 
ATOM   8273  H HB1  . ALA B 1 159 ? -11.662 -1.251  -1.910  1.00 33.11  ? 496 ALA C HB1  1 
ATOM   8274  H HB2  . ALA B 1 159 ? -12.122 -0.919  -3.377  1.00 33.11  ? 496 ALA C HB2  1 
ATOM   8275  H HB3  . ALA B 1 159 ? -12.841 -2.059  -2.567  1.00 33.11  ? 496 ALA C HB3  1 
ATOM   8276  N N    . GLU B 1 160 ? -10.233 -3.367  -1.070  1.00 33.36  ? 497 GLU C N    1 
ATOM   8277  C CA   . GLU B 1 160 ? -9.928  -4.341  -0.022  1.00 36.87  ? 497 GLU C CA   1 
ATOM   8278  C C    . GLU B 1 160 ? -10.893 -4.254  1.156   1.00 38.37  ? 497 GLU C C    1 
ATOM   8279  O O    . GLU B 1 160 ? -11.446 -3.191  1.447   1.00 35.33  ? 497 GLU C O    1 
ATOM   8280  C CB   . GLU B 1 160 ? -8.502  -4.134  0.483   1.00 40.28  ? 497 GLU C CB   1 
ATOM   8281  C CG   . GLU B 1 160 ? -7.441  -4.339  -0.580  1.00 36.40  ? 497 GLU C CG   1 
ATOM   8282  C CD   . GLU B 1 160 ? -6.045  -4.150  -0.037  1.00 36.96  ? 497 GLU C CD   1 
ATOM   8283  O OE1  . GLU B 1 160 ? -5.794  -3.093  0.571   1.00 36.52  ? 497 GLU C OE1  1 
ATOM   8284  O OE2  . GLU B 1 160 ? -5.202  -5.054  -0.212  1.00 43.76  ? 497 GLU C OE2  1 
ATOM   8285  H H    . GLU B 1 160 ? -10.052 -2.553  -0.859  1.00 40.04  ? 497 GLU C H    1 
ATOM   8286  H HA   . GLU B 1 160 ? -9.990  -5.244  -0.398  1.00 44.25  ? 497 GLU C HA   1 
ATOM   8287  H HB2  . GLU B 1 160 ? -8.416  -3.227  0.817   1.00 48.33  ? 497 GLU C HB2  1 
ATOM   8288  H HB3  . GLU B 1 160 ? -8.329  -4.766  1.200   1.00 48.33  ? 497 GLU C HB3  1 
ATOM   8289  H HG2  . GLU B 1 160 ? -7.509  -5.242  -0.928  1.00 43.68  ? 497 GLU C HG2  1 
ATOM   8290  H HG3  . GLU B 1 160 ? -7.577  -3.696  -1.293  1.00 43.68  ? 497 GLU C HG3  1 
ATOM   8291  N N    . ALA B 1 161 ? -11.085 -5.388  1.828   1.00 27.48  ? 498 ALA C N    1 
ATOM   8292  C CA   . ALA B 1 161 ? -11.820 -5.434  3.081   1.00 25.17  ? 498 ALA C CA   1 
ATOM   8293  C C    . ALA B 1 161 ? -10.801 -5.636  4.180   1.00 31.25  ? 498 ALA C C    1 
ATOM   8294  O O    . ALA B 1 161 ? -9.801  -6.340  3.984   1.00 35.81  ? 498 ALA C O    1 
ATOM   8295  C CB   . ALA B 1 161 ? -12.828 -6.583  3.071   1.00 22.71  ? 498 ALA C CB   1 
ATOM   8296  H H    . ALA B 1 161 ? -10.791 -6.154  1.571   1.00 32.97  ? 498 ALA C H    1 
ATOM   8297  H HA   . ALA B 1 161 ? -12.294 -4.589  3.229   1.00 30.20  ? 498 ALA C HA   1 
ATOM   8298  H HB1  . ALA B 1 161 ? -13.300 -6.592  3.907   1.00 27.25  ? 498 ALA C HB1  1 
ATOM   8299  H HB2  . ALA B 1 161 ? -13.446 -6.450  2.348   1.00 27.25  ? 498 ALA C HB2  1 
ATOM   8300  H HB3  . ALA B 1 161 ? -12.357 -7.411  2.952   1.00 27.25  ? 498 ALA C HB3  1 
ATOM   8301  N N    . PHE B 1 162 ? -11.051 -5.056  5.347   1.00 28.58  ? 499 PHE C N    1 
ATOM   8302  C CA   . PHE B 1 162 ? -10.034 -5.057  6.398   1.00 24.53  ? 499 PHE C CA   1 
ATOM   8303  C C    . PHE B 1 162 ? -10.459 -5.660  7.725   1.00 31.54  ? 499 PHE C C    1 
ATOM   8304  O O    . PHE B 1 162 ? -11.643 -5.792  8.035   1.00 31.17  ? 499 PHE C O    1 
ATOM   8305  C CB   . PHE B 1 162 ? -9.555  -3.631  6.657   1.00 31.78  ? 499 PHE C CB   1 
ATOM   8306  C CG   . PHE B 1 162 ? -8.820  -3.023  5.496   1.00 42.92  ? 499 PHE C CG   1 
ATOM   8307  C CD1  . PHE B 1 162 ? -9.477  -2.191  4.604   1.00 43.42  ? 499 PHE C CD1  1 
ATOM   8308  C CD2  . PHE B 1 162 ? -7.475  -3.295  5.290   1.00 38.87  ? 499 PHE C CD2  1 
ATOM   8309  C CE1  . PHE B 1 162 ? -8.807  -1.636  3.532   1.00 42.07  ? 499 PHE C CE1  1 
ATOM   8310  C CE2  . PHE B 1 162 ? -6.802  -2.744  4.219   1.00 41.84  ? 499 PHE C CE2  1 
ATOM   8311  C CZ   . PHE B 1 162 ? -7.473  -1.909  3.337   1.00 47.22  ? 499 PHE C CZ   1 
ATOM   8312  H H    . PHE B 1 162 ? -11.786 -4.661  5.557   1.00 34.30  ? 499 PHE C H    1 
ATOM   8313  H HA   . PHE B 1 162 ? -9.263  -5.571  6.078   1.00 29.43  ? 499 PHE C HA   1 
ATOM   8314  H HB2  . PHE B 1 162 ? -10.324 -3.072  6.847   1.00 38.13  ? 499 PHE C HB2  1 
ATOM   8315  H HB3  . PHE B 1 162 ? -8.954  -3.636  7.419   1.00 38.13  ? 499 PHE C HB3  1 
ATOM   8316  H HD1  . PHE B 1 162 ? -10.379 -2.003  4.730   1.00 52.11  ? 499 PHE C HD1  1 
ATOM   8317  H HD2  . PHE B 1 162 ? -7.023  -3.854  5.880   1.00 46.65  ? 499 PHE C HD2  1 
ATOM   8318  H HE1  . PHE B 1 162 ? -9.258  -1.077  2.941   1.00 50.48  ? 499 PHE C HE1  1 
ATOM   8319  H HE2  . PHE B 1 162 ? -5.899  -2.929  4.090   1.00 50.21  ? 499 PHE C HE2  1 
ATOM   8320  H HZ   . PHE B 1 162 ? -7.021  -1.534  2.615   1.00 56.67  ? 499 PHE C HZ   1 
ATOM   8321  N N    . GLU B 1 163 ? -9.444  -6.040  8.491   1.00 27.57  ? 500 GLU C N    1 
ATOM   8322  C CA   . GLU B 1 163 ? -9.577  -6.284  9.907   1.00 28.52  ? 500 GLU C CA   1 
ATOM   8323  C C    . GLU B 1 163 ? -8.447  -5.488  10.531  1.00 32.78  ? 500 GLU C C    1 
ATOM   8324  O O    . GLU B 1 163 ? -7.561  -5.007  9.823   1.00 36.90  ? 500 GLU C O    1 
ATOM   8325  C CB   . GLU B 1 163 ? -9.445  -7.774  10.226  1.00 26.84  ? 500 GLU C CB   1 
ATOM   8326  C CG   . GLU B 1 163 ? -8.178  -8.428  9.698   1.00 33.16  ? 500 GLU C CG   1 
ATOM   8327  C CD   . GLU B 1 163 ? -8.167  -9.937  9.936   1.00 39.60  ? 500 GLU C CD   1 
ATOM   8328  O OE1  . GLU B 1 163 ? -9.064  -10.636 9.418   1.00 28.10  ? 500 GLU C OE1  1 
ATOM   8329  O OE2  . GLU B 1 163 ? -7.264  -10.424 10.648  1.00 37.87  ? 500 GLU C OE2  1 
ATOM   8330  H H    . GLU B 1 163 ? -8.646  -6.166  8.197   1.00 33.08  ? 500 GLU C H    1 
ATOM   8331  H HA   . GLU B 1 163 ? -10.438 -5.951  10.237  1.00 34.23  ? 500 GLU C HA   1 
ATOM   8332  H HB2  . GLU B 1 163 ? -9.453  -7.887  11.190  1.00 32.21  ? 500 GLU C HB2  1 
ATOM   8333  H HB3  . GLU B 1 163 ? -10.200 -8.242  9.837   1.00 32.21  ? 500 GLU C HB3  1 
ATOM   8334  H HG2  . GLU B 1 163 ? -8.115  -8.273  8.742   1.00 39.79  ? 500 GLU C HG2  1 
ATOM   8335  H HG3  . GLU B 1 163 ? -7.410  -8.045  10.150  1.00 39.79  ? 500 GLU C HG3  1 
ATOM   8336  N N    . ILE B 1 164 ? -8.481  -5.330  11.845  1.00 28.04  ? 501 ILE C N    1 
ATOM   8337  C CA   . ILE B 1 164 ? -7.473  -4.539  12.542  1.00 44.41  ? 501 ILE C CA   1 
ATOM   8338  C C    . ILE B 1 164 ? -6.281  -5.393  12.980  1.00 51.78  ? 501 ILE C C    1 
ATOM   8339  O O    . ILE B 1 164 ? -6.454  -6.466  13.556  1.00 52.23  ? 501 ILE C O    1 
ATOM   8340  C CB   . ILE B 1 164 ? -8.080  -3.838  13.768  1.00 58.58  ? 501 ILE C CB   1 
ATOM   8341  C CG1  . ILE B 1 164 ? -9.437  -3.231  13.405  1.00 54.09  ? 501 ILE C CG1  1 
ATOM   8342  C CG2  . ILE B 1 164 ? -7.135  -2.762  14.288  1.00 70.38  ? 501 ILE C CG2  1 
ATOM   8343  C CD1  . ILE B 1 164 ? -10.127 -2.533  14.555  1.00 60.36  ? 501 ILE C CD1  1 
ATOM   8344  H H    . ILE B 1 164 ? -9.079  -5.672  12.360  1.00 33.65  ? 501 ILE C H    1 
ATOM   8345  H HA   . ILE B 1 164 ? -7.139  -3.846  11.934  1.00 53.29  ? 501 ILE C HA   1 
ATOM   8346  H HB   . ILE B 1 164 ? -8.213  -4.497  14.467  1.00 70.29  ? 501 ILE C HB   1 
ATOM   8347  H HG12 . ILE B 1 164 ? -9.308  -2.579  12.698  1.00 64.90  ? 501 ILE C HG12 1 
ATOM   8348  H HG13 . ILE B 1 164 ? -10.023 -3.939  13.095  1.00 64.90  ? 501 ILE C HG13 1 
ATOM   8349  H HG21 . ILE B 1 164 ? -7.533  -2.339  15.052  1.00 84.46  ? 501 ILE C HG21 1 
ATOM   8350  H HG22 . ILE B 1 164 ? -6.303  -3.171  14.536  1.00 84.46  ? 501 ILE C HG22 1 
ATOM   8351  H HG23 . ILE B 1 164 ? -6.988  -2.115  13.594  1.00 84.46  ? 501 ILE C HG23 1 
ATOM   8352  H HD11 . ILE B 1 164 ? -10.966 -2.181  14.249  1.00 72.43  ? 501 ILE C HD11 1 
ATOM   8353  H HD12 . ILE B 1 164 ? -10.275 -3.166  15.261  1.00 72.43  ? 501 ILE C HD12 1 
ATOM   8354  H HD13 . ILE B 1 164 ? -9.567  -1.818  14.867  1.00 72.43  ? 501 ILE C HD13 1 
ATOM   8355  N N    . GLN B 1 165 ? -5.070  -4.919  12.691  1.00 45.22  ? 502 GLN C N    1 
ATOM   8356  C CA   . GLN B 1 165 ? -3.857  -5.610  13.133  1.00 57.72  ? 502 GLN C CA   1 
ATOM   8357  C C    . GLN B 1 165 ? -3.753  -5.604  14.653  1.00 61.76  ? 502 GLN C C    1 
ATOM   8358  O O    . GLN B 1 165 ? -4.223  -4.671  15.310  1.00 58.96  ? 502 GLN C O    1 
ATOM   8359  C CB   . GLN B 1 165 ? -2.610  -4.952  12.544  1.00 58.34  ? 502 GLN C CB   1 
ATOM   8360  C CG   . GLN B 1 165 ? -2.324  -5.329  11.108  1.00 57.72  ? 502 GLN C CG   1 
ATOM   8361  C CD   . GLN B 1 165 ? -0.964  -4.849  10.658  1.00 64.76  ? 502 GLN C CD   1 
ATOM   8362  O OE1  . GLN B 1 165 ? 0.054   -5.468  10.963  1.00 61.36  ? 502 GLN C OE1  1 
ATOM   8363  N NE2  . GLN B 1 165 ? -0.935  -3.730  9.943   1.00 68.52  ? 502 GLN C NE2  1 
ATOM   8364  H H    . GLN B 1 165 ? -4.923  -4.200  12.242  1.00 54.26  ? 502 GLN C H    1 
ATOM   8365  H HA   . GLN B 1 165 ? -3.886  -6.541  12.830  1.00 69.26  ? 502 GLN C HA   1 
ATOM   8366  H HB2  . GLN B 1 165 ? -2.721  -3.989  12.580  1.00 70.00  ? 502 GLN C HB2  1 
ATOM   8367  H HB3  . GLN B 1 165 ? -1.841  -5.212  13.075  1.00 70.00  ? 502 GLN C HB3  1 
ATOM   8368  H HG2  . GLN B 1 165 ? -2.348  -6.295  11.021  1.00 69.26  ? 502 GLN C HG2  1 
ATOM   8369  H HG3  . GLN B 1 165 ? -2.993  -4.924  10.533  1.00 69.26  ? 502 GLN C HG3  1 
ATOM   8370  H HE21 . GLN B 1 165 ? -1.668  -3.319  9.759   1.00 82.22  ? 502 GLN C HE21 1 
ATOM   8371  H HE22 . GLN B 1 165 ? -0.185  -3.416  9.665   1.00 82.22  ? 502 GLN C HE22 1 
ATOM   8372  N N    . HIS B 1 166 ? -3.130  -6.644  15.202  1.00 65.59  ? 503 HIS C N    1 
ATOM   8373  C CA   . HIS B 1 166 ? -2.940  -6.760  16.644  1.00 73.32  ? 503 HIS C CA   1 
ATOM   8374  C C    . HIS B 1 166 ? -4.164  -6.253  17.397  1.00 78.03  ? 503 HIS C C    1 
ATOM   8375  O O    . HIS B 1 166 ? -4.083  -5.262  18.125  1.00 80.88  ? 503 HIS C O    1 
ATOM   8376  C CB   . HIS B 1 166 ? -1.716  -5.954  17.083  1.00 83.89  ? 503 HIS C CB   1 
ATOM   8377  C CG   . HIS B 1 166 ? -0.507  -6.174  16.230  1.00 91.68  ? 503 HIS C CG   1 
ATOM   8378  N ND1  . HIS B 1 166 ? -0.059  -5.239  15.320  1.00 93.22  ? 503 HIS C ND1  1 
ATOM   8379  C CD2  . HIS B 1 166 ? 0.352   -7.217  16.148  1.00 95.50  ? 503 HIS C CD2  1 
ATOM   8380  C CE1  . HIS B 1 166 ? 1.021   -5.698  14.716  1.00 97.42  ? 503 HIS C CE1  1 
ATOM   8381  N NE2  . HIS B 1 166 ? 1.292   -6.897  15.199  1.00 98.52  ? 503 HIS C NE2  1 
ATOM   8382  H H    . HIS B 1 166 ? -2.805  -7.303  14.754  1.00 78.71  ? 503 HIS C H    1 
ATOM   8383  H HA   . HIS B 1 166 ? -2.796  -7.700  16.881  1.00 87.99  ? 503 HIS C HA   1 
ATOM   8384  H HB2  . HIS B 1 166 ? -1.935  -5.009  17.048  1.00 100.67 ? 503 HIS C HB2  1 
ATOM   8385  H HB3  . HIS B 1 166 ? -1.487  -6.204  17.992  1.00 100.67 ? 503 HIS C HB3  1 
ATOM   8386  H HD2  . HIS B 1 166 ? 0.312   -8.004  16.642  1.00 114.60 ? 503 HIS C HD2  1 
ATOM   8387  H HE1  . HIS B 1 166 ? 1.507   -5.253  14.060  1.00 116.90 ? 503 HIS C HE1  1 
ATOM   8388  N N    . SER B 1 167 ? -5.297  -6.925  17.224  1.00 84.76  ? 504 SER C N    1 
ATOM   8389  C CA   . SER B 1 167 ? -6.544  -6.453  17.817  1.00 88.34  ? 504 SER C CA   1 
ATOM   8390  C C    . SER B 1 167 ? -7.209  -7.500  18.702  1.00 78.10  ? 504 SER C C    1 
ATOM   8391  O O    . SER B 1 167 ? -8.415  -7.445  18.925  1.00 66.21  ? 504 SER C O    1 
ATOM   8392  C CB   . SER B 1 167 ? -7.521  -6.023  16.719  1.00 88.24  ? 504 SER C CB   1 
ATOM   8393  O OG   . SER B 1 167 ? -7.971  -7.139  15.969  1.00 84.48  ? 504 SER C OG   1 
ATOM   8394  H H    . SER B 1 167 ? -5.372  -7.652  16.770  1.00 101.71 ? 504 SER C H    1 
ATOM   8395  H HA   . SER B 1 167 ? -6.352  -5.669  18.372  1.00 106.01 ? 504 SER C HA   1 
ATOM   8396  H HB2  . SER B 1 167 ? -8.285  -5.590  17.130  1.00 105.89 ? 504 SER C HB2  1 
ATOM   8397  H HB3  . SER B 1 167 ? -7.071  -5.404  16.123  1.00 105.89 ? 504 SER C HB3  1 
ATOM   8398  H HG   . SER B 1 167 ? -8.493  -6.893  15.386  1.00 101.38 ? 504 SER C HG   1 
ATOM   8399  N N    . GLY B 1 168 ? -6.428  -8.447  19.211  1.00 73.33  ? 505 GLY C N    1 
ATOM   8400  C CA   . GLY B 1 168 ? -6.972  -9.498  20.053  1.00 64.02  ? 505 GLY C CA   1 
ATOM   8401  C C    . GLY B 1 168 ? -8.264  -10.074 19.499  1.00 55.72  ? 505 GLY C C    1 
ATOM   8402  O O    . GLY B 1 168 ? -8.283  -10.625 18.397  1.00 47.46  ? 505 GLY C O    1 
ATOM   8403  H H    . GLY B 1 168 ? -5.580  -8.502  19.082  1.00 88.00  ? 505 GLY C H    1 
ATOM   8404  H HA2  . GLY B 1 168 ? -6.325  -10.216 20.133  1.00 76.83  ? 505 GLY C HA2  1 
ATOM   8405  H HA3  . GLY B 1 168 ? -7.149  -9.143  20.939  1.00 76.83  ? 505 GLY C HA3  1 
ATOM   8406  N N    . LEU B 1 169 ? -9.350  -9.936  20.259  1.00 46.40  ? 506 LEU C N    1 
ATOM   8407  C CA   . LEU B 1 169 ? -10.632 -10.521 19.879  1.00 47.42  ? 506 LEU C CA   1 
ATOM   8408  C C    . LEU B 1 169 ? -11.562 -9.506  19.222  1.00 48.50  ? 506 LEU C C    1 
ATOM   8409  O O    . LEU B 1 169 ? -12.782 -9.598  19.356  1.00 48.48  ? 506 LEU C O    1 
ATOM   8410  C CB   . LEU B 1 169 ? -11.327 -11.119 21.103  1.00 58.18  ? 506 LEU C CB   1 
ATOM   8411  C CG   . LEU B 1 169 ? -10.830 -12.490 21.563  1.00 69.49  ? 506 LEU C CG   1 
ATOM   8412  C CD1  . LEU B 1 169 ? -9.361  -12.438 21.946  1.00 75.75  ? 506 LEU C CD1  1 
ATOM   8413  C CD2  . LEU B 1 169 ? -11.676 -12.987 22.728  1.00 67.39  ? 506 LEU C CD2  1 
ATOM   8414  H H    . LEU B 1 169 ? -9.369  -9.505  21.003  1.00 55.68  ? 506 LEU C H    1 
ATOM   8415  H HA   . LEU B 1 169 ? -10.473 -11.245 19.238  1.00 56.90  ? 506 LEU C HA   1 
ATOM   8416  H HB2  . LEU B 1 169 ? -11.212 -10.506 21.847  1.00 69.82  ? 506 LEU C HB2  1 
ATOM   8417  H HB3  . LEU B 1 169 ? -12.272 -11.207 20.903  1.00 69.82  ? 506 LEU C HB3  1 
ATOM   8418  H HG   . LEU B 1 169 ? -10.927 -13.121 20.833  1.00 83.39  ? 506 LEU C HG   1 
ATOM   8419  H HD11 . LEU B 1 169 ? -9.081  -13.311 22.229  1.00 90.90  ? 506 LEU C HD11 1 
ATOM   8420  H HD12 . LEU B 1 169 ? -8.849  -12.161 21.182  1.00 90.90  ? 506 LEU C HD12 1 
ATOM   8421  H HD13 . LEU B 1 169 ? -9.247  -11.808 22.662  1.00 90.90  ? 506 LEU C HD13 1 
ATOM   8422  H HD21 . LEU B 1 169 ? -11.351 -13.848 23.004  1.00 80.87  ? 506 LEU C HD21 1 
ATOM   8423  H HD22 . LEU B 1 169 ? -11.607 -12.362 23.453  1.00 80.87  ? 506 LEU C HD22 1 
ATOM   8424  H HD23 . LEU B 1 169 ? -12.590 -13.058 22.442  1.00 80.87  ? 506 LEU C HD23 1 
ATOM   8425  N N    . ALA B 1 170 ? -10.991 -8.547  18.504  1.00 50.08  ? 507 ALA C N    1 
ATOM   8426  C CA   . ALA B 1 170 ? -11.786 -7.528  17.831  1.00 45.97  ? 507 ALA C CA   1 
ATOM   8427  C C    . ALA B 1 170 ? -12.253 -8.054  16.476  1.00 41.68  ? 507 ALA C C    1 
ATOM   8428  O O    . ALA B 1 170 ? -11.555 -8.844  15.844  1.00 33.87  ? 507 ALA C O    1 
ATOM   8429  C CB   . ALA B 1 170 ? -10.971 -6.258  17.656  1.00 46.37  ? 507 ALA C CB   1 
ATOM   8430  H H    . ALA B 1 170 ? -10.142 -8.464  18.391  1.00 60.10  ? 507 ALA C H    1 
ATOM   8431  H HA   . ALA B 1 170 ? -12.575 -7.318  18.372  1.00 55.17  ? 507 ALA C HA   1 
ATOM   8432  H HB1  . ALA B 1 170 ? -11.510 -5.599  17.212  1.00 55.64  ? 507 ALA C HB1  1 
ATOM   8433  H HB2  . ALA B 1 170 ? -10.706 -5.935  18.521  1.00 55.64  ? 507 ALA C HB2  1 
ATOM   8434  H HB3  . ALA B 1 170 ? -10.194 -6.456  17.128  1.00 55.64  ? 507 ALA C HB3  1 
ATOM   8435  N N    . ASN B 1 171 ? -13.430 -7.614  16.035  1.00 36.87  ? 508 ASN C N    1 
ATOM   8436  C CA   . ASN B 1 171 ? -13.972 -8.030  14.747  1.00 30.81  ? 508 ASN C CA   1 
ATOM   8437  C C    . ASN B 1 171 ? -13.251 -7.365  13.574  1.00 32.25  ? 508 ASN C C    1 
ATOM   8438  O O    . ASN B 1 171 ? -12.592 -6.334  13.740  1.00 35.35  ? 508 ASN C O    1 
ATOM   8439  C CB   . ASN B 1 171 ? -15.459 -7.667  14.664  1.00 42.32  ? 508 ASN C CB   1 
ATOM   8440  C CG   . ASN B 1 171 ? -16.288 -8.340  15.740  1.00 46.26  ? 508 ASN C CG   1 
ATOM   8441  O OD1  . ASN B 1 171 ? -16.582 -9.531  15.657  1.00 39.78  ? 508 ASN C OD1  1 
ATOM   8442  N ND2  . ASN B 1 171 ? -16.685 -7.574  16.748  1.00 42.26  ? 508 ASN C ND2  1 
ATOM   8443  H H    . ASN B 1 171 ? -13.937 -7.071  16.468  1.00 44.25  ? 508 ASN C H    1 
ATOM   8444  H HA   . ASN B 1 171 ? -13.884 -9.002  14.654  1.00 36.97  ? 508 ASN C HA   1 
ATOM   8445  H HB2  . ASN B 1 171 ? -15.556 -6.708  14.767  1.00 50.78  ? 508 ASN C HB2  1 
ATOM   8446  H HB3  . ASN B 1 171 ? -15.805 -7.945  13.801  1.00 50.78  ? 508 ASN C HB3  1 
ATOM   8447  H HD21 . ASN B 1 171 ? -16.469 -6.742  16.767  1.00 50.71  ? 508 ASN C HD21 1 
ATOM   8448  H HD22 . ASN B 1 171 ? -17.157 -7.910  17.383  1.00 50.71  ? 508 ASN C HD22 1 
ATOM   8449  N N    . GLY B 1 172 ? -13.382 -7.956  12.389  1.00 27.17  ? 509 GLY C N    1 
ATOM   8450  C CA   . GLY B 1 172 ? -13.065 -7.260  11.158  1.00 34.91  ? 509 GLY C CA   1 
ATOM   8451  C C    . GLY B 1 172 ? -13.990 -6.054  11.057  1.00 29.69  ? 509 GLY C C    1 
ATOM   8452  O O    . GLY B 1 172 ? -14.932 -5.933  11.848  1.00 22.81  ? 509 GLY C O    1 
ATOM   8453  H H    . GLY B 1 172 ? -13.655 -8.764  12.276  1.00 32.60  ? 509 GLY C H    1 
ATOM   8454  H HA2  . GLY B 1 172 ? -12.143 -6.959  11.168  1.00 41.89  ? 509 GLY C HA2  1 
ATOM   8455  H HA3  . GLY B 1 172 ? -13.207 -7.841  10.395  1.00 41.89  ? 509 GLY C HA3  1 
ATOM   8456  N N    . ILE B 1 173 ? -13.736 -5.169  10.094  1.00 24.21  ? 510 ILE C N    1 
ATOM   8457  C CA   . ILE B 1 173 ? -14.495 -3.913  9.988   1.00 25.31  ? 510 ILE C CA   1 
ATOM   8458  C C    . ILE B 1 173 ? -15.974 -4.141  9.698   1.00 29.25  ? 510 ILE C C    1 
ATOM   8459  O O    . ILE B 1 173 ? -16.837 -3.535  10.328  1.00 32.91  ? 510 ILE C O    1 
ATOM   8460  C CB   . ILE B 1 173 ? -13.922 -2.986  8.897   1.00 33.53  ? 510 ILE C CB   1 
ATOM   8461  C CG1  . ILE B 1 173 ? -12.486 -2.588  9.239   1.00 32.13  ? 510 ILE C CG1  1 
ATOM   8462  C CG2  . ILE B 1 173 ? -14.791 -1.735  8.753   1.00 26.82  ? 510 ILE C CG2  1 
ATOM   8463  C CD1  . ILE B 1 173 ? -12.355 -1.923  10.592  1.00 41.03  ? 510 ILE C CD1  1 
ATOM   8464  H H    . ILE B 1 173 ? -13.132 -5.267  9.490   1.00 29.05  ? 510 ILE C H    1 
ATOM   8465  H HA   . ILE B 1 173 ? -14.431 -3.438  10.843  1.00 30.37  ? 510 ILE C HA   1 
ATOM   8466  H HB   . ILE B 1 173 ? -13.920 -3.463  8.052   1.00 40.23  ? 510 ILE C HB   1 
ATOM   8467  H HG12 . ILE B 1 173 ? -11.932 -3.384  9.244   1.00 38.55  ? 510 ILE C HG12 1 
ATOM   8468  H HG13 . ILE B 1 173 ? -12.164 -1.966  8.569   1.00 38.55  ? 510 ILE C HG13 1 
ATOM   8469  H HG21 . ILE B 1 173 ? -14.418 -1.172  8.071   1.00 32.18  ? 510 ILE C HG21 1 
ATOM   8470  H HG22 . ILE B 1 173 ? -15.681 -2.000  8.510   1.00 32.18  ? 510 ILE C HG22 1 
ATOM   8471  H HG23 . ILE B 1 173 ? -14.806 -1.268  9.592   1.00 32.18  ? 510 ILE C HG23 1 
ATOM   8472  H HD11 . ILE B 1 173 ? -11.434 -1.700  10.742  1.00 49.24  ? 510 ILE C HD11 1 
ATOM   8473  H HD12 . ILE B 1 173 ? -12.891 -1.126  10.600  1.00 49.24  ? 510 ILE C HD12 1 
ATOM   8474  H HD13 . ILE B 1 173 ? -12.661 -2.531  11.269  1.00 49.24  ? 510 ILE C HD13 1 
ATOM   8475  N N    . PHE B 1 174 ? -16.259 -5.006  8.736   1.00 26.19  ? 511 PHE C N    1 
ATOM   8476  C CA   . PHE B 1 174 ? -17.627 -5.309  8.349   1.00 24.54  ? 511 PHE C CA   1 
ATOM   8477  C C    . PHE B 1 174 ? -18.444 -5.786  9.548   1.00 22.44  ? 511 PHE C C    1 
ATOM   8478  O O    . PHE B 1 174 ? -19.441 -5.158  9.913   1.00 22.58  ? 511 PHE C O    1 
ATOM   8479  C CB   . PHE B 1 174 ? -17.630 -6.358  7.242   1.00 27.30  ? 511 PHE C CB   1 
ATOM   8480  C CG   . PHE B 1 174 ? -18.996 -6.706  6.718   1.00 32.34  ? 511 PHE C CG   1 
ATOM   8481  C CD1  . PHE B 1 174 ? -19.938 -5.728  6.461   1.00 27.73  ? 511 PHE C CD1  1 
ATOM   8482  C CD2  . PHE B 1 174 ? -19.322 -8.024  6.436   1.00 32.79  ? 511 PHE C CD2  1 
ATOM   8483  C CE1  . PHE B 1 174 ? -21.189 -6.061  5.954   1.00 28.79  ? 511 PHE C CE1  1 
ATOM   8484  C CE2  . PHE B 1 174 ? -20.573 -8.359  5.922   1.00 35.80  ? 511 PHE C CE2  1 
ATOM   8485  C CZ   . PHE B 1 174 ? -21.503 -7.374  5.682   1.00 29.09  ? 511 PHE C CZ   1 
ATOM   8486  H H    . PHE B 1 174 ? -15.667 -5.437  8.284   1.00 31.43  ? 511 PHE C H    1 
ATOM   8487  H HA   . PHE B 1 174 ? -18.048 -4.497  7.999   1.00 29.44  ? 511 PHE C HA   1 
ATOM   8488  H HB2  . PHE B 1 174 ? -17.105 -6.025  6.497   1.00 32.75  ? 511 PHE C HB2  1 
ATOM   8489  H HB3  . PHE B 1 174 ? -17.230 -7.173  7.585   1.00 32.75  ? 511 PHE C HB3  1 
ATOM   8490  H HD1  . PHE B 1 174 ? -19.735 -4.838  6.638   1.00 33.27  ? 511 PHE C HD1  1 
ATOM   8491  H HD2  . PHE B 1 174 ? -18.696 -8.694  6.592   1.00 39.35  ? 511 PHE C HD2  1 
ATOM   8492  H HE1  . PHE B 1 174 ? -21.815 -5.393  5.794   1.00 34.55  ? 511 PHE C HE1  1 
ATOM   8493  H HE2  . PHE B 1 174 ? -20.780 -9.248  5.746   1.00 42.96  ? 511 PHE C HE2  1 
ATOM   8494  H HZ   . PHE B 1 174 ? -22.342 -7.594  5.347   1.00 34.90  ? 511 PHE C HZ   1 
ATOM   8495  N N    . MET B 1 175 ? -18.019 -6.883  10.176  1.00 31.25  ? 512 MET C N    1 
ATOM   8496  C CA   . MET B 1 175 ? -18.763 -7.432  11.307  1.00 31.33  ? 512 MET C CA   1 
ATOM   8497  C C    . MET B 1 175 ? -18.833 -6.445  12.469  1.00 31.30  ? 512 MET C C    1 
ATOM   8498  O O    . MET B 1 175 ? -19.789 -6.460  13.253  1.00 28.61  ? 512 MET C O    1 
ATOM   8499  C CB   . MET B 1 175 ? -18.141 -8.750  11.787  1.00 25.10  ? 512 MET C CB   1 
ATOM   8500  C CG   . MET B 1 175 ? -19.024 -9.497  12.773  1.00 30.63  ? 512 MET C CG   1 
ATOM   8501  S SD   . MET B 1 175 ? -20.612 -9.931  12.032  1.00 26.35  ? 512 MET C SD   1 
ATOM   8502  C CE   . MET B 1 175 ? -20.061 -10.899 10.636  1.00 35.94  ? 512 MET C CE   1 
ATOM   8503  H H    . MET B 1 175 ? -17.310 -7.323  9.969   1.00 37.50  ? 512 MET C H    1 
ATOM   8504  H HA   . MET B 1 175 ? -19.676 -7.629  11.011  1.00 37.60  ? 512 MET C HA   1 
ATOM   8505  H HB2  . MET B 1 175 ? -17.992 -9.327  11.022  1.00 30.12  ? 512 MET C HB2  1 
ATOM   8506  H HB3  . MET B 1 175 ? -17.297 -8.559  12.227  1.00 30.12  ? 512 MET C HB3  1 
ATOM   8507  H HG2  . MET B 1 175 ? -18.580 -10.316 13.044  1.00 36.76  ? 512 MET C HG2  1 
ATOM   8508  H HG3  . MET B 1 175 ? -19.191 -8.933  13.544  1.00 36.76  ? 512 MET C HG3  1 
ATOM   8509  H HE1  . MET B 1 175 ? -20.827 -11.201 10.143  1.00 43.12  ? 512 MET C HE1  1 
ATOM   8510  H HE2  . MET B 1 175 ? -19.506 -10.352 10.076  1.00 43.12  ? 512 MET C HE2  1 
ATOM   8511  H HE3  . MET B 1 175 ? -19.560 -11.653 10.957  1.00 43.12  ? 512 MET C HE3  1 
ATOM   8512  N N    . LYS B 1 176 ? -17.819 -5.599  12.599  1.00 25.60  ? 513 LYS C N    1 
ATOM   8513  C CA   . LYS B 1 176 ? -17.806 -4.630  13.688  1.00 35.23  ? 513 LYS C CA   1 
ATOM   8514  C C    . LYS B 1 176 ? -19.093 -3.814  13.631  1.00 29.97  ? 513 LYS C C    1 
ATOM   8515  O O    . LYS B 1 176 ? -19.696 -3.523  14.655  1.00 32.65  ? 513 LYS C O    1 
ATOM   8516  C CB   . LYS B 1 176 ? -16.584 -3.711  13.598  1.00 33.65  ? 513 LYS C CB   1 
ATOM   8517  C CG   . LYS B 1 176 ? -16.599 -2.538  14.580  1.00 51.57  ? 513 LYS C CG   1 
ATOM   8518  C CD   . LYS B 1 176 ? -15.392 -1.625  14.372  1.00 54.32  ? 513 LYS C CD   1 
ATOM   8519  C CE   . LYS B 1 176 ? -15.482 -0.353  15.208  1.00 64.93  ? 513 LYS C CE   1 
ATOM   8520  N NZ   . LYS B 1 176 ? -15.533 -0.628  16.673  1.00 73.22  ? 513 LYS C NZ   1 
ATOM   8521  H H    . LYS B 1 176 ? -17.135 -5.564  12.079  1.00 30.72  ? 513 LYS C H    1 
ATOM   8522  H HA   . LYS B 1 176 ? -17.776 -5.103  14.546  1.00 42.27  ? 513 LYS C HA   1 
ATOM   8523  H HB2  . LYS B 1 176 ? -15.788 -4.235  13.777  1.00 40.37  ? 513 LYS C HB2  1 
ATOM   8524  H HB3  . LYS B 1 176 ? -16.539 -3.344  12.701  1.00 40.37  ? 513 LYS C HB3  1 
ATOM   8525  H HG2  . LYS B 1 176 ? -17.404 -2.015  14.443  1.00 61.88  ? 513 LYS C HG2  1 
ATOM   8526  H HG3  . LYS B 1 176 ? -16.570 -2.880  15.488  1.00 61.88  ? 513 LYS C HG3  1 
ATOM   8527  H HD2  . LYS B 1 176 ? -14.586 -2.100  14.629  1.00 65.19  ? 513 LYS C HD2  1 
ATOM   8528  H HD3  . LYS B 1 176 ? -15.345 -1.369  13.437  1.00 65.19  ? 513 LYS C HD3  1 
ATOM   8529  H HE2  . LYS B 1 176 ? -14.701 0.196   15.034  1.00 77.92  ? 513 LYS C HE2  1 
ATOM   8530  H HE3  . LYS B 1 176 ? -16.288 0.129   14.965  1.00 77.92  ? 513 LYS C HE3  1 
ATOM   8531  H HZ1  . LYS B 1 176 ? -15.585 0.137   17.124  1.00 87.86  ? 513 LYS C HZ1  1 
ATOM   8532  H HZ2  . LYS B 1 176 ? -16.246 -1.126  16.863  1.00 87.86  ? 513 LYS C HZ2  1 
ATOM   8533  H HZ3  . LYS B 1 176 ? -14.800 -1.065  16.926  1.00 87.86  ? 513 LYS C HZ3  1 
ATOM   8534  N N    . PHE B 1 177 ? -19.537 -3.489  12.426  1.00 29.62  ? 514 PHE C N    1 
ATOM   8535  C CA   . PHE B 1 177 ? -20.731 -2.667  12.284  1.00 33.31  ? 514 PHE C CA   1 
ATOM   8536  C C    . PHE B 1 177 ? -21.962 -3.536  12.038  1.00 34.38  ? 514 PHE C C    1 
ATOM   8537  O O    . PHE B 1 177 ? -23.043 -3.217  12.509  1.00 28.15  ? 514 PHE C O    1 
ATOM   8538  C CB   . PHE B 1 177 ? -20.537 -1.624  11.185  1.00 30.93  ? 514 PHE C CB   1 
ATOM   8539  C CG   . PHE B 1 177 ? -19.433 -0.639  11.480  1.00 29.22  ? 514 PHE C CG   1 
ATOM   8540  C CD1  . PHE B 1 177 ? -19.625 0.385   12.395  1.00 30.08  ? 514 PHE C CD1  1 
ATOM   8541  C CD2  . PHE B 1 177 ? -18.204 -0.744  10.844  1.00 27.91  ? 514 PHE C CD2  1 
ATOM   8542  C CE1  . PHE B 1 177 ? -18.611 1.288   12.671  1.00 34.71  ? 514 PHE C CE1  1 
ATOM   8543  C CE2  . PHE B 1 177 ? -17.185 0.158   11.111  1.00 35.00  ? 514 PHE C CE2  1 
ATOM   8544  C CZ   . PHE B 1 177 ? -17.387 1.175   12.025  1.00 33.86  ? 514 PHE C CZ   1 
ATOM   8545  H H    . PHE B 1 177 ? -19.172 -3.726  11.684  1.00 35.54  ? 514 PHE C H    1 
ATOM   8546  H HA   . PHE B 1 177 ? -20.877 -2.185  13.124  1.00 39.97  ? 514 PHE C HA   1 
ATOM   8547  H HB2  . PHE B 1 177 ? -20.317 -2.078  10.357  1.00 37.12  ? 514 PHE C HB2  1 
ATOM   8548  H HB3  . PHE B 1 177 ? -21.361 -1.124  11.078  1.00 37.12  ? 514 PHE C HB3  1 
ATOM   8549  H HD1  . PHE B 1 177 ? -20.443 0.465   12.831  1.00 36.10  ? 514 PHE C HD1  1 
ATOM   8550  H HD2  . PHE B 1 177 ? -18.063 -1.426  10.228  1.00 33.49  ? 514 PHE C HD2  1 
ATOM   8551  H HE1  . PHE B 1 177 ? -18.751 1.972   13.285  1.00 41.65  ? 514 PHE C HE1  1 
ATOM   8552  H HE2  . PHE B 1 177 ? -16.366 0.078   10.677  1.00 42.00  ? 514 PHE C HE2  1 
ATOM   8553  H HZ   . PHE B 1 177 ? -16.706 1.781   12.208  1.00 40.63  ? 514 PHE C HZ   1 
ATOM   8554  N N    . LEU B 1 178 ? -21.795 -4.664  11.353  1.00 28.48  ? 515 LEU C N    1 
ATOM   8555  C CA   . LEU B 1 178 ? -22.934 -5.540  11.079  1.00 25.54  ? 515 LEU C CA   1 
ATOM   8556  C C    . LEU B 1 178 ? -23.568 -6.066  12.365  1.00 27.61  ? 515 LEU C C    1 
ATOM   8557  O O    . LEU B 1 178 ? -24.789 -6.149  12.464  1.00 28.48  ? 515 LEU C O    1 
ATOM   8558  C CB   . LEU B 1 178 ? -22.533 -6.710  10.166  1.00 23.24  ? 515 LEU C CB   1 
ATOM   8559  C CG   . LEU B 1 178 ? -23.659 -7.694  9.823   1.00 28.30  ? 515 LEU C CG   1 
ATOM   8560  C CD1  . LEU B 1 178 ? -24.748 -7.015  8.994   1.00 28.34  ? 515 LEU C CD1  1 
ATOM   8561  C CD2  . LEU B 1 178 ? -23.127 -8.907  9.078   1.00 25.48  ? 515 LEU C CD2  1 
ATOM   8562  H H    . LEU B 1 178 ? -21.044 -4.943  11.040  1.00 34.17  ? 515 LEU C H    1 
ATOM   8563  H HA   . LEU B 1 178 ? -23.617 -5.020  10.607  1.00 30.65  ? 515 LEU C HA   1 
ATOM   8564  H HB2  . LEU B 1 178 ? -22.199 -6.346  9.330   1.00 27.89  ? 515 LEU C HB2  1 
ATOM   8565  H HB3  . LEU B 1 178 ? -21.829 -7.214  10.603  1.00 27.89  ? 515 LEU C HB3  1 
ATOM   8566  H HG   . LEU B 1 178 ? -24.064 -8.006  10.648  1.00 33.95  ? 515 LEU C HG   1 
ATOM   8567  H HD11 . LEU B 1 178 ? -25.436 -7.655  8.797   1.00 34.01  ? 515 LEU C HD11 1 
ATOM   8568  H HD12 . LEU B 1 178 ? -25.115 -6.285  9.498   1.00 34.01  ? 515 LEU C HD12 1 
ATOM   8569  H HD13 . LEU B 1 178 ? -24.361 -6.688  8.178   1.00 34.01  ? 515 LEU C HD13 1 
ATOM   8570  H HD21 . LEU B 1 178 ? -23.857 -9.498  8.882   1.00 30.58  ? 515 LEU C HD21 1 
ATOM   8571  H HD22 . LEU B 1 178 ? -22.713 -8.615  8.263   1.00 30.58  ? 515 LEU C HD22 1 
ATOM   8572  H HD23 . LEU B 1 178 ? -22.482 -9.355  9.631   1.00 30.58  ? 515 LEU C HD23 1 
ATOM   8573  N N    . LYS B 1 179 ? -22.741 -6.395  13.357  1.00 25.29  ? 516 LYS C N    1 
ATOM   8574  C CA   . LYS B 1 179 ? -23.214 -7.088  14.548  1.00 31.91  ? 516 LYS C CA   1 
ATOM   8575  C C    . LYS B 1 179 ? -24.193 -6.217  15.330  1.00 34.63  ? 516 LYS C C    1 
ATOM   8576  O O    . LYS B 1 179 ? -25.099 -6.734  15.973  1.00 37.25  ? 516 LYS C O    1 
ATOM   8577  C CB   . LYS B 1 179 ? -22.032 -7.501  15.447  1.00 28.25  ? 516 LYS C CB   1 
ATOM   8578  C CG   . LYS B 1 179 ? -21.239 -6.328  15.995  1.00 41.71  ? 516 LYS C CG   1 
ATOM   8579  C CD   . LYS B 1 179 ? -19.976 -6.757  16.739  1.00 56.08  ? 516 LYS C CD   1 
ATOM   8580  C CE   . LYS B 1 179 ? -20.301 -7.397  18.077  1.00 66.10  ? 516 LYS C CE   1 
ATOM   8581  N NZ   . LYS B 1 179 ? -19.102 -7.516  18.957  1.00 67.90  ? 516 LYS C NZ   1 
ATOM   8582  H H    . LYS B 1 179 ? -21.898 -6.225  13.362  1.00 30.35  ? 516 LYS C H    1 
ATOM   8583  H HA   . LYS B 1 179 ? -23.685 -7.903  14.276  1.00 38.29  ? 516 LYS C HA   1 
ATOM   8584  H HB2  . LYS B 1 179 ? -22.375 -8.005  16.202  1.00 33.90  ? 516 LYS C HB2  1 
ATOM   8585  H HB3  . LYS B 1 179 ? -21.425 -8.053  14.931  1.00 33.90  ? 516 LYS C HB3  1 
ATOM   8586  H HG2  . LYS B 1 179 ? -20.973 -5.756  15.258  1.00 50.05  ? 516 LYS C HG2  1 
ATOM   8587  H HG3  . LYS B 1 179 ? -21.798 -5.832  16.614  1.00 50.05  ? 516 LYS C HG3  1 
ATOM   8588  H HD2  . LYS B 1 179 ? -19.494 -7.405  16.202  1.00 67.29  ? 516 LYS C HD2  1 
ATOM   8589  H HD3  . LYS B 1 179 ? -19.422 -5.978  16.902  1.00 67.29  ? 516 LYS C HD3  1 
ATOM   8590  H HE2  . LYS B 1 179 ? -20.959 -6.854  18.537  1.00 79.31  ? 516 LYS C HE2  1 
ATOM   8591  H HE3  . LYS B 1 179 ? -20.652 -8.289  17.925  1.00 79.31  ? 516 LYS C HE3  1 
ATOM   8592  H HZ1  . LYS B 1 179 ? -19.329 -7.895  19.730  1.00 81.48  ? 516 LYS C HZ1  1 
ATOM   8593  H HZ2  . LYS B 1 179 ? -18.483 -8.017  18.561  1.00 81.48  ? 516 LYS C HZ2  1 
ATOM   8594  H HZ3  . LYS B 1 179 ? -18.762 -6.710  19.118  1.00 81.48  ? 516 LYS C HZ3  1 
ATOM   8595  N N    . ASP B 1 180 ? -24.009 -4.900  15.262  1.00 28.03  ? 517 ASP C N    1 
ATOM   8596  C CA   . ASP B 1 180 ? -24.850 -3.957  15.994  1.00 38.87  ? 517 ASP C CA   1 
ATOM   8597  C C    . ASP B 1 180 ? -26.188 -3.665  15.303  1.00 38.23  ? 517 ASP C C    1 
ATOM   8598  O O    . ASP B 1 180 ? -27.026 -2.977  15.867  1.00 33.08  ? 517 ASP C O    1 
ATOM   8599  C CB   . ASP B 1 180 ? -24.110 -2.633  16.221  1.00 43.41  ? 517 ASP C CB   1 
ATOM   8600  C CG   . ASP B 1 180 ? -23.046 -2.726  17.303  1.00 51.62  ? 517 ASP C CG   1 
ATOM   8601  O OD1  . ASP B 1 180 ? -23.055 -3.708  18.081  1.00 34.55  ? 517 ASP C OD1  1 
ATOM   8602  O OD2  . ASP B 1 180 ? -22.204 -1.804  17.377  1.00 51.46  ? 517 ASP C OD2  1 
ATOM   8603  H H    . ASP B 1 180 ? -23.395 -4.523  14.792  1.00 33.63  ? 517 ASP C H    1 
ATOM   8604  H HA   . ASP B 1 180 ? -25.050 -4.338  16.875  1.00 46.64  ? 517 ASP C HA   1 
ATOM   8605  H HB2  . ASP B 1 180 ? -23.675 -2.369  15.395  1.00 52.09  ? 517 ASP C HB2  1 
ATOM   8606  H HB3  . ASP B 1 180 ? -24.750 -1.955  16.489  1.00 52.09  ? 517 ASP C HB3  1 
ATOM   8607  N N    . ARG B 1 181 ? -26.388 -4.177  14.092  1.00 34.93  ? 518 ARG C N    1 
ATOM   8608  C CA   . ARG B 1 181 ? -27.635 -3.938  13.360  1.00 30.87  ? 518 ARG C CA   1 
ATOM   8609  C C    . ARG B 1 181 ? -28.383 -5.233  13.055  1.00 29.42  ? 518 ARG C C    1 
ATOM   8610  O O    . ARG B 1 181 ? -29.559 -5.207  12.694  1.00 26.75  ? 518 ARG C O    1 
ATOM   8611  C CB   . ARG B 1 181 ? -27.340 -3.241  12.030  1.00 30.41  ? 518 ARG C CB   1 
ATOM   8612  C CG   . ARG B 1 181 ? -26.731 -1.858  12.146  1.00 45.02  ? 518 ARG C CG   1 
ATOM   8613  C CD   . ARG B 1 181 ? -27.780 -0.806  12.440  1.00 39.69  ? 518 ARG C CD   1 
ATOM   8614  N NE   . ARG B 1 181 ? -27.207 0.536   12.415  1.00 39.46  ? 518 ARG C NE   1 
ATOM   8615  C CZ   . ARG B 1 181 ? -27.882 1.645   12.688  1.00 37.11  ? 518 ARG C CZ   1 
ATOM   8616  N NH1  . ARG B 1 181 ? -29.163 1.577   13.011  1.00 45.26  ? 518 ARG C NH1  1 
ATOM   8617  N NH2  . ARG B 1 181 ? -27.273 2.823   12.644  1.00 32.36  ? 518 ARG C NH2  1 
ATOM   8618  H H    . ARG B 1 181 ? -25.820 -4.666  13.671  1.00 41.91  ? 518 ARG C H    1 
ATOM   8619  H HA   . ARG B 1 181 ? -28.220 -3.359  13.892  1.00 37.05  ? 518 ARG C HA   1 
ATOM   8620  H HB2  . ARG B 1 181 ? -26.721 -3.791  11.525  1.00 36.49  ? 518 ARG C HB2  1 
ATOM   8621  H HB3  . ARG B 1 181 ? -28.172 -3.153  11.538  1.00 36.49  ? 518 ARG C HB3  1 
ATOM   8622  H HG2  . ARG B 1 181 ? -26.085 -1.854  12.870  1.00 54.03  ? 518 ARG C HG2  1 
ATOM   8623  H HG3  . ARG B 1 181 ? -26.298 -1.629  11.309  1.00 54.03  ? 518 ARG C HG3  1 
ATOM   8624  H HD2  . ARG B 1 181 ? -28.477 -0.852  11.767  1.00 47.63  ? 518 ARG C HD2  1 
ATOM   8625  H HD3  . ARG B 1 181 ? -28.152 -0.961  13.322  1.00 47.63  ? 518 ARG C HD3  1 
ATOM   8626  H HE   . ARG B 1 181 ? -26.376 0.613   12.209  1.00 47.35  ? 518 ARG C HE   1 
ATOM   8627  H HH11 . ARG B 1 181 ? -29.559 0.814   13.042  1.00 54.31  ? 518 ARG C HH11 1 
ATOM   8628  H HH12 . ARG B 1 181 ? -29.601 2.295   13.189  1.00 54.31  ? 518 ARG C HH12 1 
ATOM   8629  H HH21 . ARG B 1 181 ? -26.440 2.869   12.434  1.00 38.83  ? 518 ARG C HH21 1 
ATOM   8630  H HH22 . ARG B 1 181 ? -27.713 3.541   12.821  1.00 38.83  ? 518 ARG C HH22 1 
ATOM   8631  N N    . LEU B 1 182 ? -27.702 -6.364  13.196  1.00 26.67  ? 519 LEU C N    1 
ATOM   8632  C CA   . LEU B 1 182 ? -28.182 -7.606  12.599  1.00 30.78  ? 519 LEU C CA   1 
ATOM   8633  C C    . LEU B 1 182 ? -29.542 -8.045  13.115  1.00 25.15  ? 519 LEU C C    1 
ATOM   8634  O O    . LEU B 1 182 ? -30.316 -8.651  12.376  1.00 26.66  ? 519 LEU C O    1 
ATOM   8635  C CB   . LEU B 1 182 ? -27.174 -8.742  12.805  1.00 33.61  ? 519 LEU C CB   1 
ATOM   8636  C CG   . LEU B 1 182 ? -27.495 -9.951  11.919  1.00 39.52  ? 519 LEU C CG   1 
ATOM   8637  C CD1  . LEU B 1 182 ? -27.270 -9.602  10.450  1.00 34.61  ? 519 LEU C CD1  1 
ATOM   8638  C CD2  . LEU B 1 182 ? -26.670 -11.170 12.309  1.00 37.97  ? 519 LEU C CD2  1 
ATOM   8639  H H    . LEU B 1 182 ? -26.962 -6.440  13.629  1.00 32.01  ? 519 LEU C H    1 
ATOM   8640  H HA   . LEU B 1 182 ? -28.270 -7.466  11.633  1.00 36.94  ? 519 LEU C HA   1 
ATOM   8641  H HB2  . LEU B 1 182 ? -26.286 -8.427  12.577  1.00 40.33  ? 519 LEU C HB2  1 
ATOM   8642  H HB3  . LEU B 1 182 ? -27.201 -9.029  13.731  1.00 40.33  ? 519 LEU C HB3  1 
ATOM   8643  H HG   . LEU B 1 182 ? -28.432 -10.179 12.030  1.00 47.43  ? 519 LEU C HG   1 
ATOM   8644  H HD11 . LEU B 1 182 ? -27.476 -10.370 9.912   1.00 41.53  ? 519 LEU C HD11 1 
ATOM   8645  H HD12 . LEU B 1 182 ? -27.845 -8.871  10.211  1.00 41.53  ? 519 LEU C HD12 1 
ATOM   8646  H HD13 . LEU B 1 182 ? -26.352 -9.352  10.326  1.00 41.53  ? 519 LEU C HD13 1 
ATOM   8647  H HD21 . LEU B 1 182 ? -26.901 -11.901 11.732  1.00 45.57  ? 519 LEU C HD21 1 
ATOM   8648  H HD22 . LEU B 1 182 ? -25.738 -10.959 12.214  1.00 45.57  ? 519 LEU C HD22 1 
ATOM   8649  H HD23 . LEU B 1 182 ? -26.863 -11.399 13.221  1.00 45.57  ? 519 LEU C HD23 1 
ATOM   8650  N N    . LEU B 1 183 ? -29.835 -7.735  14.374  1.00 27.09  ? 520 LEU C N    1 
ATOM   8651  C CA   . LEU B 1 183 ? -31.070 -8.192  15.009  1.00 26.37  ? 520 LEU C CA   1 
ATOM   8652  C C    . LEU B 1 183 ? -32.269 -7.282  14.733  1.00 30.39  ? 520 LEU C C    1 
ATOM   8653  O O    . LEU B 1 183 ? -33.386 -7.572  15.161  1.00 31.45  ? 520 LEU C O    1 
ATOM   8654  C CB   . LEU B 1 183 ? -30.874 -8.298  16.527  1.00 32.44  ? 520 LEU C CB   1 
ATOM   8655  C CG   . LEU B 1 183 ? -29.742 -9.230  16.957  1.00 38.57  ? 520 LEU C CG   1 
ATOM   8656  C CD1  . LEU B 1 183 ? -29.688 -9.372  18.490  1.00 41.08  ? 520 LEU C CD1  1 
ATOM   8657  C CD2  . LEU B 1 183 ? -29.935 -10.565 16.292  1.00 27.58  ? 520 LEU C CD2  1 
ATOM   8658  H H    . LEU B 1 183 ? -29.333 -7.259  14.886  1.00 32.51  ? 520 LEU C H    1 
ATOM   8659  H HA   . LEU B 1 183 ? -31.288 -9.085  14.670  1.00 31.64  ? 520 LEU C HA   1 
ATOM   8660  H HB2  . LEU B 1 183 ? -30.677 -7.415  16.876  1.00 38.93  ? 520 LEU C HB2  1 
ATOM   8661  H HB3  . LEU B 1 183 ? -31.695 -8.630  16.923  1.00 38.93  ? 520 LEU C HB3  1 
ATOM   8662  H HG   . LEU B 1 183 ? -28.895 -8.863  16.658  1.00 46.29  ? 520 LEU C HG   1 
ATOM   8663  H HD11 . LEU B 1 183 ? -28.968 -9.962  18.724  1.00 49.29  ? 520 LEU C HD11 1 
ATOM   8664  H HD12 . LEU B 1 183 ? -29.542 -8.506  18.879  1.00 49.29  ? 520 LEU C HD12 1 
ATOM   8665  H HD13 . LEU B 1 183 ? -30.522 -9.733  18.800  1.00 49.29  ? 520 LEU C HD13 1 
ATOM   8666  H HD21 . LEU B 1 183 ? -29.225 -11.153 16.561  1.00 33.10  ? 520 LEU C HD21 1 
ATOM   8667  H HD22 . LEU B 1 183 ? -30.782 -10.929 16.562  1.00 33.10  ? 520 LEU C HD22 1 
ATOM   8668  H HD23 . LEU B 1 183 ? -29.919 -10.445 15.340  1.00 33.10  ? 520 LEU C HD23 1 
ATOM   8669  N N    . GLU B 1 184 ? -32.054 -6.183  14.023  1.00 34.25  ? 521 GLU C N    1 
ATOM   8670  C CA   . GLU B 1 184 ? -33.160 -5.263  13.765  1.00 40.04  ? 521 GLU C CA   1 
ATOM   8671  C C    . GLU B 1 184 ? -34.239 -5.925  12.907  1.00 35.86  ? 521 GLU C C    1 
ATOM   8672  O O    . GLU B 1 184 ? -33.942 -6.587  11.910  1.00 34.44  ? 521 GLU C O    1 
ATOM   8673  C CB   . GLU B 1 184 ? -32.672 -3.994  13.080  1.00 40.56  ? 521 GLU C CB   1 
ATOM   8674  C CG   . GLU B 1 184 ? -31.769 -3.113  13.924  1.00 34.74  ? 521 GLU C CG   1 
ATOM   8675  C CD   . GLU B 1 184 ? -31.413 -1.823  13.193  1.00 38.83  ? 521 GLU C CD   1 
ATOM   8676  O OE1  . GLU B 1 184 ? -31.982 -1.582  12.104  1.00 38.15  ? 521 GLU C OE1  1 
ATOM   8677  O OE2  . GLU B 1 184 ? -30.571 -1.053  13.693  1.00 35.12  ? 521 GLU C OE2  1 
ATOM   8678  H H    . GLU B 1 184 ? -31.299 -5.948  13.685  1.00 41.10  ? 521 GLU C H    1 
ATOM   8679  H HA   . GLU B 1 184 ? -33.568 -5.009  14.619  1.00 48.05  ? 521 GLU C HA   1 
ATOM   8680  H HB2  . GLU B 1 184 ? -32.177 -4.244  12.285  1.00 48.67  ? 521 GLU C HB2  1 
ATOM   8681  H HB3  . GLU B 1 184 ? -33.444 -3.464  12.828  1.00 48.67  ? 521 GLU C HB3  1 
ATOM   8682  H HG2  . GLU B 1 184 ? -32.225 -2.881  14.747  1.00 41.69  ? 521 GLU C HG2  1 
ATOM   8683  H HG3  . GLU B 1 184 ? -30.946 -3.590  14.118  1.00 41.69  ? 521 GLU C HG3  1 
ATOM   8684  N N    . ASP B 1 185 ? -35.494 -5.741  13.304  1.00 26.58  ? 522 ASP C N    1 
ATOM   8685  C CA   . ASP B 1 185 ? -36.620 -6.217  12.508  1.00 33.58  ? 522 ASP C CA   1 
ATOM   8686  C C    . ASP B 1 185 ? -36.925 -5.267  11.343  1.00 27.33  ? 522 ASP C C    1 
ATOM   8687  O O    . ASP B 1 185 ? -37.967 -4.599  11.332  1.00 29.25  ? 522 ASP C O    1 
ATOM   8688  C CB   . ASP B 1 185 ? -37.860 -6.406  13.386  1.00 39.28  ? 522 ASP C CB   1 
ATOM   8689  C CG   . ASP B 1 185 ? -38.998 -7.076  12.647  1.00 39.40  ? 522 ASP C CG   1 
ATOM   8690  O OD1  . ASP B 1 185 ? -38.740 -7.714  11.607  1.00 33.84  ? 522 ASP C OD1  1 
ATOM   8691  O OD2  . ASP B 1 185 ? -40.151 -6.967  13.100  1.00 40.79  ? 522 ASP C OD2  1 
ATOM   8692  H H    . ASP B 1 185 ? -35.720 -5.344  14.032  1.00 31.90  ? 522 ASP C H    1 
ATOM   8693  H HA   . ASP B 1 185 ? -36.389 -7.090  12.127  1.00 40.30  ? 522 ASP C HA   1 
ATOM   8694  H HB2  . ASP B 1 185 ? -37.627 -6.961  14.147  1.00 47.13  ? 522 ASP C HB2  1 
ATOM   8695  H HB3  . ASP B 1 185 ? -38.168 -5.538  13.690  1.00 47.13  ? 522 ASP C HB3  1 
ATOM   8696  N N    . LYS B 1 186 ? -36.010 -5.232  10.367  1.00 20.27  ? 523 LYS C N    1 
ATOM   8697  C CA   . LYS B 1 186 ? -36.181 -4.487  9.124   1.00 24.88  ? 523 LYS C CA   1 
ATOM   8698  C C    . LYS B 1 186 ? -35.800 -5.338  7.912   1.00 29.30  ? 523 LYS C C    1 
ATOM   8699  O O    . LYS B 1 186 ? -35.056 -6.326  8.036   1.00 27.68  ? 523 LYS C O    1 
ATOM   8700  C CB   . LYS B 1 186 ? -35.307 -3.222  9.140   1.00 28.97  ? 523 LYS C CB   1 
ATOM   8701  C CG   . LYS B 1 186 ? -35.763 -2.170  10.133  1.00 39.00  ? 523 LYS C CG   1 
ATOM   8702  C CD   . LYS B 1 186 ? -34.726 -1.074  10.314  1.00 46.87  ? 523 LYS C CD   1 
ATOM   8703  C CE   . LYS B 1 186 ? -35.263 0.034   11.205  1.00 50.88  ? 523 LYS C CE   1 
ATOM   8704  N NZ   . LYS B 1 186 ? -34.199 0.717   11.986  1.00 48.12  ? 523 LYS C NZ   1 
ATOM   8705  H H    . LYS B 1 186 ? -35.259 -5.649  10.408  1.00 24.33  ? 523 LYS C H    1 
ATOM   8706  H HA   . LYS B 1 186 ? -37.119 -4.216  9.031   1.00 29.85  ? 523 LYS C HA   1 
ATOM   8707  H HB2  . LYS B 1 186 ? -34.399 -3.474  9.371   1.00 34.77  ? 523 LYS C HB2  1 
ATOM   8708  H HB3  . LYS B 1 186 ? -35.322 -2.822  8.257   1.00 34.77  ? 523 LYS C HB3  1 
ATOM   8709  H HG2  . LYS B 1 186 ? -36.582 -1.762  9.811   1.00 46.80  ? 523 LYS C HG2  1 
ATOM   8710  H HG3  . LYS B 1 186 ? -35.914 -2.589  10.994  1.00 46.80  ? 523 LYS C HG3  1 
ATOM   8711  H HD2  . LYS B 1 186 ? -33.933 -1.446  10.731  1.00 56.24  ? 523 LYS C HD2  1 
ATOM   8712  H HD3  . LYS B 1 186 ? -34.506 -0.692  9.450   1.00 56.24  ? 523 LYS C HD3  1 
ATOM   8713  H HE2  . LYS B 1 186 ? -35.702 0.699   10.652  1.00 61.06  ? 523 LYS C HE2  1 
ATOM   8714  H HE3  . LYS B 1 186 ? -35.897 -0.346  11.833  1.00 61.06  ? 523 LYS C HE3  1 
ATOM   8715  H HZ1  . LYS B 1 186 ? -34.556 1.356   12.492  1.00 57.74  ? 523 LYS C HZ1  1 
ATOM   8716  H HZ2  . LYS B 1 186 ? -33.783 0.131   12.511  1.00 57.74  ? 523 LYS C HZ2  1 
ATOM   8717  H HZ3  . LYS B 1 186 ? -33.605 1.083   11.434  1.00 57.74  ? 523 LYS C HZ3  1 
ATOM   8718  N N    . LYS B 1 187 ? -36.296 -4.949  6.739   1.00 31.91  ? 524 LYS C N    1 
ATOM   8719  C CA   . LYS B 1 187 ? -35.885 -5.585  5.485   1.00 30.26  ? 524 LYS C CA   1 
ATOM   8720  C C    . LYS B 1 187 ? -34.362 -5.600  5.426   1.00 27.51  ? 524 LYS C C    1 
ATOM   8721  O O    . LYS B 1 187 ? -33.706 -4.623  5.801   1.00 23.06  ? 524 LYS C O    1 
ATOM   8722  C CB   . LYS B 1 187 ? -36.452 -4.823  4.286   1.00 27.28  ? 524 LYS C CB   1 
ATOM   8723  C CG   . LYS B 1 187 ? -36.185 -5.492  2.921   1.00 26.01  ? 524 LYS C CG   1 
ATOM   8724  C CD   . LYS B 1 187 ? -36.773 -4.662  1.760   1.00 27.59  ? 524 LYS C CD   1 
ATOM   8725  C CE   . LYS B 1 187 ? -36.396 -5.283  0.413   1.00 24.84  ? 524 LYS C CE   1 
ATOM   8726  N NZ   . LYS B 1 187 ? -37.159 -4.682  -0.729  1.00 27.61  ? 524 LYS C NZ   1 
ATOM   8727  H H    . LYS B 1 187 ? -36.873 -4.318  6.641   1.00 38.29  ? 524 LYS C H    1 
ATOM   8728  H HA   . LYS B 1 187 ? -36.212 -6.508  5.457   1.00 36.31  ? 524 LYS C HA   1 
ATOM   8729  H HB2  . LYS B 1 187 ? -37.413 -4.747  4.393   1.00 32.73  ? 524 LYS C HB2  1 
ATOM   8730  H HB3  . LYS B 1 187 ? -36.055 -3.939  4.263   1.00 32.73  ? 524 LYS C HB3  1 
ATOM   8731  H HG2  . LYS B 1 187 ? -35.227 -5.570  2.785   1.00 31.22  ? 524 LYS C HG2  1 
ATOM   8732  H HG3  . LYS B 1 187 ? -36.598 -6.369  2.908   1.00 31.22  ? 524 LYS C HG3  1 
ATOM   8733  H HD2  . LYS B 1 187 ? -37.740 -4.647  1.832   1.00 33.10  ? 524 LYS C HD2  1 
ATOM   8734  H HD3  . LYS B 1 187 ? -36.416 -3.761  1.794   1.00 33.10  ? 524 LYS C HD3  1 
ATOM   8735  H HE2  . LYS B 1 187 ? -35.451 -5.139  0.252   1.00 29.81  ? 524 LYS C HE2  1 
ATOM   8736  H HE3  . LYS B 1 187 ? -36.589 -6.233  0.437   1.00 29.81  ? 524 LYS C HE3  1 
ATOM   8737  H HZ1  . LYS B 1 187 ? -36.915 -5.066  -1.493  1.00 33.13  ? 524 LYS C HZ1  1 
ATOM   8738  H HZ2  . LYS B 1 187 ? -38.032 -4.805  -0.609  1.00 33.13  ? 524 LYS C HZ2  1 
ATOM   8739  H HZ3  . LYS B 1 187 ? -36.994 -3.808  -0.778  1.00 33.13  ? 524 LYS C HZ3  1 
ATOM   8740  N N    . ILE B 1 188 ? -33.800 -6.713  4.962   1.00 24.38  ? 525 ILE C N    1 
ATOM   8741  C CA   . ILE B 1 188 ? -32.346 -6.900  4.958   1.00 24.81  ? 525 ILE C CA   1 
ATOM   8742  C C    . ILE B 1 188 ? -31.601 -5.817  4.160   1.00 20.71  ? 525 ILE C C    1 
ATOM   8743  O O    . ILE B 1 188 ? -30.500 -5.413  4.515   1.00 20.57  ? 525 ILE C O    1 
ATOM   8744  C CB   . ILE B 1 188 ? -31.974 -8.334  4.467   1.00 23.21  ? 525 ILE C CB   1 
ATOM   8745  C CG1  . ILE B 1 188 ? -30.462 -8.567  4.548   1.00 29.01  ? 525 ILE C CG1  1 
ATOM   8746  C CG2  . ILE B 1 188 ? -32.488 -8.583  3.049   1.00 23.03  ? 525 ILE C CG2  1 
ATOM   8747  C CD1  . ILE B 1 188 ? -29.848 -8.239  5.898   1.00 21.75  ? 525 ILE C CD1  1 
ATOM   8748  H H    . ILE B 1 188 ? -34.239 -7.380  4.643   1.00 29.25  ? 525 ILE C H    1 
ATOM   8749  H HA   . ILE B 1 188 ? -32.034 -6.830  5.885   1.00 29.78  ? 525 ILE C HA   1 
ATOM   8750  H HB   . ILE B 1 188 ? -32.406 -8.972  5.056   1.00 27.85  ? 525 ILE C HB   1 
ATOM   8751  H HG12 . ILE B 1 188 ? -30.282 -9.502  4.362   1.00 34.81  ? 525 ILE C HG12 1 
ATOM   8752  H HG13 . ILE B 1 188 ? -30.027 -8.011  3.883   1.00 34.81  ? 525 ILE C HG13 1 
ATOM   8753  H HG21 . ILE B 1 188 ? -32.243 -9.471  2.779   1.00 27.64  ? 525 ILE C HG21 1 
ATOM   8754  H HG22 . ILE B 1 188 ? -33.444 -8.490  3.043   1.00 27.64  ? 525 ILE C HG22 1 
ATOM   8755  H HG23 . ILE B 1 188 ? -32.093 -7.939  2.456   1.00 27.64  ? 525 ILE C HG23 1 
ATOM   8756  H HD11 . ILE B 1 188 ? -28.904 -8.412  5.861   1.00 26.09  ? 525 ILE C HD11 1 
ATOM   8757  H HD12 . ILE B 1 188 ? -30.004 -7.312  6.095   1.00 26.09  ? 525 ILE C HD12 1 
ATOM   8758  H HD13 . ILE B 1 188 ? -30.257 -8.790  6.569   1.00 26.09  ? 525 ILE C HD13 1 
ATOM   8759  N N    . THR B 1 189 ? -32.205 -5.310  3.094   1.00 19.69  ? 526 THR C N    1 
ATOM   8760  C CA   . THR B 1 189 ? -31.581 -4.219  2.369   1.00 18.70  ? 526 THR C CA   1 
ATOM   8761  C C    . THR B 1 189 ? -31.473 -2.944  3.210   1.00 20.39  ? 526 THR C C    1 
ATOM   8762  O O    . THR B 1 189 ? -30.446 -2.267  3.182   1.00 22.92  ? 526 THR C O    1 
ATOM   8763  C CB   . THR B 1 189 ? -32.351 -3.898  1.104   1.00 25.09  ? 526 THR C CB   1 
ATOM   8764  O OG1  . THR B 1 189 ? -33.735 -3.723  1.429   1.00 23.48  ? 526 THR C OG1  1 
ATOM   8765  C CG2  . THR B 1 189 ? -32.209 -5.041  0.120   1.00 22.79  ? 526 THR C CG2  1 
ATOM   8766  H H    . THR B 1 189 ? -32.960 -5.574  2.777   1.00 23.63  ? 526 THR C H    1 
ATOM   8767  H HA   . THR B 1 189 ? -30.675 -4.487  2.110   1.00 22.43  ? 526 THR C HA   1 
ATOM   8768  H HB   . THR B 1 189 ? -32.002 -3.089  0.700   1.00 30.11  ? 526 THR C HB   1 
ATOM   8769  H HG1  . THR B 1 189 ? -34.163 -3.549  0.751   1.00 28.18  ? 526 THR C HG1  1 
ATOM   8770  H HG21 . THR B 1 189 ? -32.695 -4.843  -0.684  1.00 27.35  ? 526 THR C HG21 1 
ATOM   8771  H HG22 . THR B 1 189 ? -31.284 -5.171  -0.099  1.00 27.35  ? 526 THR C HG22 1 
ATOM   8772  H HG23 . THR B 1 189 ? -32.556 -5.849  0.504   1.00 27.35  ? 526 THR C HG23 1 
ATOM   8773  N N    . VAL B 1 190 ? -32.528 -2.611  3.949   1.00 20.02  ? 527 VAL C N    1 
ATOM   8774  C CA   . VAL B 1 190 ? -32.520 -1.385  4.752   1.00 22.08  ? 527 VAL C CA   1 
ATOM   8775  C C    . VAL B 1 190 ? -31.444 -1.503  5.824   1.00 29.90  ? 527 VAL C C    1 
ATOM   8776  O O    . VAL B 1 190 ? -30.665 -0.578  6.066   1.00 26.18  ? 527 VAL C O    1 
ATOM   8777  C CB   . VAL B 1 190 ? -33.877 -1.141  5.427   1.00 32.64  ? 527 VAL C CB   1 
ATOM   8778  C CG1  . VAL B 1 190 ? -33.798 0.071   6.338   1.00 45.26  ? 527 VAL C CG1  1 
ATOM   8779  C CG2  . VAL B 1 190 ? -34.963 -0.960  4.381   1.00 30.30  ? 527 VAL C CG2  1 
ATOM   8780  H H    . VAL B 1 190 ? -33.253 -3.070  4.005   1.00 24.02  ? 527 VAL C H    1 
ATOM   8781  H HA   . VAL B 1 190 ? -32.311 -0.617  4.180   1.00 26.49  ? 527 VAL C HA   1 
ATOM   8782  H HB   . VAL B 1 190 ? -34.108 -1.920  5.975   1.00 39.16  ? 527 VAL C HB   1 
ATOM   8783  H HG11 . VAL B 1 190 ? -34.654 0.207   6.750   1.00 54.31  ? 527 VAL C HG11 1 
ATOM   8784  H HG12 . VAL B 1 190 ? -33.132 -0.087  7.010   1.00 54.31  ? 527 VAL C HG12 1 
ATOM   8785  H HG13 . VAL B 1 190 ? -33.560 0.839   5.814   1.00 54.31  ? 527 VAL C HG13 1 
ATOM   8786  H HG21 . VAL B 1 190 ? -35.801 -0.809  4.825   1.00 36.35  ? 527 VAL C HG21 1 
ATOM   8787  H HG22 . VAL B 1 190 ? -34.744 -0.205  3.830   1.00 36.35  ? 527 VAL C HG22 1 
ATOM   8788  H HG23 . VAL B 1 190 ? -35.015 -1.754  3.844   1.00 36.35  ? 527 VAL C HG23 1 
ATOM   8789  N N    . LEU B 1 191 ? -31.407 -2.669  6.450   1.00 26.78  ? 528 LEU C N    1 
ATOM   8790  C CA   . LEU B 1 191 ? -30.435 -2.958  7.489   1.00 31.86  ? 528 LEU C CA   1 
ATOM   8791  C C    . LEU B 1 191 ? -29.002 -2.773  6.975   1.00 23.64  ? 528 LEU C C    1 
ATOM   8792  O O    . LEU B 1 191 ? -28.201 -2.075  7.589   1.00 25.74  ? 528 LEU C O    1 
ATOM   8793  C CB   . LEU B 1 191 ? -30.667 -4.380  7.979   1.00 29.70  ? 528 LEU C CB   1 
ATOM   8794  C CG   . LEU B 1 191 ? -29.971 -4.843  9.247   1.00 31.75  ? 528 LEU C CG   1 
ATOM   8795  C CD1  . LEU B 1 191 ? -30.753 -6.015  9.777   1.00 28.44  ? 528 LEU C CD1  1 
ATOM   8796  C CD2  . LEU B 1 191 ? -28.536 -5.221  8.941   1.00 32.35  ? 528 LEU C CD2  1 
ATOM   8797  H H    . LEU B 1 191 ? -31.944 -3.321  6.287   1.00 32.14  ? 528 LEU C H    1 
ATOM   8798  H HA   . LEU B 1 191 ? -30.573 -2.346  8.242   1.00 38.23  ? 528 LEU C HA   1 
ATOM   8799  H HB2  . LEU B 1 191 ? -31.619 -4.488  8.129   1.00 35.64  ? 528 LEU C HB2  1 
ATOM   8800  H HB3  . LEU B 1 191 ? -30.390 -4.984  7.273   1.00 35.64  ? 528 LEU C HB3  1 
ATOM   8801  H HG   . LEU B 1 191 ? -29.978 -4.133  9.908   1.00 38.10  ? 528 LEU C HG   1 
ATOM   8802  H HD11 . LEU B 1 191 ? -30.335 -6.331  10.581  1.00 34.13  ? 528 LEU C HD11 1 
ATOM   8803  H HD12 . LEU B 1 191 ? -31.651 -5.732  9.963   1.00 34.13  ? 528 LEU C HD12 1 
ATOM   8804  H HD13 . LEU B 1 191 ? -30.759 -6.710  9.115   1.00 34.13  ? 528 LEU C HD13 1 
ATOM   8805  H HD21 . LEU B 1 191 ? -28.110 -5.511  9.751   1.00 38.82  ? 528 LEU C HD21 1 
ATOM   8806  H HD22 . LEU B 1 191 ? -28.531 -5.931  8.296   1.00 38.82  ? 528 LEU C HD22 1 
ATOM   8807  H HD23 . LEU B 1 191 ? -28.080 -4.453  8.587   1.00 38.82  ? 528 LEU C HD23 1 
ATOM   8808  N N    . LEU B 1 192 ? -28.678 -3.369  5.836   1.00 20.16  ? 529 LEU C N    1 
ATOM   8809  C CA   . LEU B 1 192 ? -27.333 -3.207  5.281   1.00 23.60  ? 529 LEU C CA   1 
ATOM   8810  C C    . LEU B 1 192 ? -27.088 -1.751  4.891   1.00 24.71  ? 529 LEU C C    1 
ATOM   8811  O O    . LEU B 1 192 ? -25.966 -1.259  4.942   1.00 26.54  ? 529 LEU C O    1 
ATOM   8812  C CB   . LEU B 1 192 ? -27.129 -4.114  4.065   1.00 23.16  ? 529 LEU C CB   1 
ATOM   8813  C CG   . LEU B 1 192 ? -27.117 -5.617  4.348   1.00 26.52  ? 529 LEU C CG   1 
ATOM   8814  C CD1  . LEU B 1 192 ? -27.086 -6.426  3.045   1.00 20.51  ? 529 LEU C CD1  1 
ATOM   8815  C CD2  . LEU B 1 192 ? -25.933 -5.988  5.235   1.00 21.41  ? 529 LEU C CD2  1 
ATOM   8816  H H    . LEU B 1 192 ? -29.204 -3.864  5.370   1.00 24.19  ? 529 LEU C H    1 
ATOM   8817  H HA   . LEU B 1 192 ? -26.673 -3.456  5.961   1.00 28.32  ? 529 LEU C HA   1 
ATOM   8818  H HB2  . LEU B 1 192 ? -27.846 -3.944  3.434   1.00 27.79  ? 529 LEU C HB2  1 
ATOM   8819  H HB3  . LEU B 1 192 ? -26.279 -3.889  3.655   1.00 27.79  ? 529 LEU C HB3  1 
ATOM   8820  H HG   . LEU B 1 192 ? -27.929 -5.853  4.824   1.00 31.83  ? 529 LEU C HG   1 
ATOM   8821  H HD11 . LEU B 1 192 ? -27.079 -7.362  3.259   1.00 24.61  ? 529 LEU C HD11 1 
ATOM   8822  H HD12 . LEU B 1 192 ? -27.867 -6.214  2.528   1.00 24.61  ? 529 LEU C HD12 1 
ATOM   8823  H HD13 . LEU B 1 192 ? -26.294 -6.196  2.553   1.00 24.61  ? 529 LEU C HD13 1 
ATOM   8824  H HD21 . LEU B 1 192 ? -25.948 -6.934  5.397   1.00 25.69  ? 529 LEU C HD21 1 
ATOM   8825  H HD22 . LEU B 1 192 ? -25.119 -5.745  4.787   1.00 25.69  ? 529 LEU C HD22 1 
ATOM   8826  H HD23 . LEU B 1 192 ? -26.004 -5.512  6.066   1.00 25.69  ? 529 LEU C HD23 1 
ATOM   8827  N N    . ASP B 1 193 ? -28.142 -1.059  4.490   1.00 19.20  ? 530 ASP C N    1 
ATOM   8828  C CA   . ASP B 1 193 ? -28.002 0.348   4.142   1.00 22.91  ? 530 ASP C CA   1 
ATOM   8829  C C    . ASP B 1 193 ? -27.543 1.099   5.397   1.00 30.96  ? 530 ASP C C    1 
ATOM   8830  O O    . ASP B 1 193 ? -26.684 1.972   5.328   1.00 23.93  ? 530 ASP C O    1 
ATOM   8831  C CB   . ASP B 1 193 ? -29.337 0.888   3.617   1.00 23.60  ? 530 ASP C CB   1 
ATOM   8832  C CG   . ASP B 1 193 ? -29.170 2.078   2.688   1.00 29.43  ? 530 ASP C CG   1 
ATOM   8833  O OD1  . ASP B 1 193 ? -28.031 2.392   2.283   1.00 31.16  ? 530 ASP C OD1  1 
ATOM   8834  O OD2  . ASP B 1 193 ? -30.196 2.686   2.340   1.00 35.00  ? 530 ASP C OD2  1 
ATOM   8835  H H    . ASP B 1 193 ? -28.939 -1.373  4.410   1.00 23.04  ? 530 ASP C H    1 
ATOM   8836  H HA   . ASP B 1 193 ? -27.322 0.452   3.444   1.00 27.49  ? 530 ASP C HA   1 
ATOM   8837  H HB2  . ASP B 1 193 ? -29.790 0.185   3.124   1.00 28.32  ? 530 ASP C HB2  1 
ATOM   8838  H HB3  . ASP B 1 193 ? -29.881 1.169   4.369   1.00 28.32  ? 530 ASP C HB3  1 
ATOM   8839  N N    . GLU B 1 194 ? -28.104 0.742   6.549   1.00 21.19  ? 531 GLU C N    1 
ATOM   8840  C CA   . GLU B 1 194 ? -27.712 1.375   7.812   1.00 35.03  ? 531 GLU C CA   1 
ATOM   8841  C C    . GLU B 1 194 ? -26.268 1.023   8.154   1.00 29.40  ? 531 GLU C C    1 
ATOM   8842  O O    . GLU B 1 194 ? -25.494 1.880   8.566   1.00 28.46  ? 531 GLU C O    1 
ATOM   8843  C CB   . GLU B 1 194 ? -28.641 0.945   8.952   1.00 34.56  ? 531 GLU C CB   1 
ATOM   8844  C CG   . GLU B 1 194 ? -30.077 1.448   8.814   1.00 27.95  ? 531 GLU C CG   1 
ATOM   8845  C CD   . GLU B 1 194 ? -31.004 0.817   9.840   1.00 44.47  ? 531 GLU C CD   1 
ATOM   8846  O OE1  . GLU B 1 194 ? -30.614 -0.212  10.441  1.00 37.54  ? 531 GLU C OE1  1 
ATOM   8847  O OE2  . GLU B 1 194 ? -32.116 1.347   10.043  1.00 33.05  ? 531 GLU C OE2  1 
ATOM   8848  H H    . GLU B 1 194 ? -28.711 0.139   6.630   1.00 25.43  ? 531 GLU C H    1 
ATOM   8849  H HA   . GLU B 1 194 ? -27.776 2.348   7.717   1.00 42.04  ? 531 GLU C HA   1 
ATOM   8850  H HB2  . GLU B 1 194 ? -28.669 -0.024  8.982   1.00 41.47  ? 531 GLU C HB2  1 
ATOM   8851  H HB3  . GLU B 1 194 ? -28.287 1.288   9.787   1.00 41.47  ? 531 GLU C HB3  1 
ATOM   8852  H HG2  . GLU B 1 194 ? -30.092 2.409   8.944   1.00 33.54  ? 531 GLU C HG2  1 
ATOM   8853  H HG3  . GLU B 1 194 ? -30.409 1.225   7.930   1.00 33.54  ? 531 GLU C HG3  1 
ATOM   8854  N N    . VAL B 1 195 ? -25.902 -0.241  7.978   1.00 25.53  ? 532 VAL C N    1 
ATOM   8855  C CA   . VAL B 1 195 ? -24.523 -0.647  8.192   1.00 27.59  ? 532 VAL C CA   1 
ATOM   8856  C C    . VAL B 1 195 ? -23.585 0.154   7.294   1.00 22.89  ? 532 VAL C C    1 
ATOM   8857  O O    . VAL B 1 195 ? -22.520 0.577   7.726   1.00 26.06  ? 532 VAL C O    1 
ATOM   8858  C CB   . VAL B 1 195 ? -24.311 -2.145  7.908   1.00 33.37  ? 532 VAL C CB   1 
ATOM   8859  C CG1  . VAL B 1 195 ? -22.830 -2.476  7.970   1.00 20.41  ? 532 VAL C CG1  1 
ATOM   8860  C CG2  . VAL B 1 195 ? -25.099 -3.000  8.901   1.00 30.64  ? 532 VAL C CG2  1 
ATOM   8861  H H    . VAL B 1 195 ? -26.429 -0.877  7.737   1.00 30.64  ? 532 VAL C H    1 
ATOM   8862  H HA   . VAL B 1 195 ? -24.277 -0.474  9.125   1.00 33.11  ? 532 VAL C HA   1 
ATOM   8863  H HB   . VAL B 1 195 ? -24.633 -2.350  7.005   1.00 40.04  ? 532 VAL C HB   1 
ATOM   8864  H HG11 . VAL B 1 195 ? -22.712 -3.411  7.791   1.00 24.49  ? 532 VAL C HG11 1 
ATOM   8865  H HG12 . VAL B 1 195 ? -22.366 -1.955  7.311   1.00 24.49  ? 532 VAL C HG12 1 
ATOM   8866  H HG13 . VAL B 1 195 ? -22.500 -2.265  8.846   1.00 24.49  ? 532 VAL C HG13 1 
ATOM   8867  H HG21 . VAL B 1 195 ? -24.949 -3.927  8.702   1.00 36.77  ? 532 VAL C HG21 1 
ATOM   8868  H HG22 . VAL B 1 195 ? -24.796 -2.803  9.791   1.00 36.77  ? 532 VAL C HG22 1 
ATOM   8869  H HG23 . VAL B 1 195 ? -26.032 -2.793  8.819   1.00 36.77  ? 532 VAL C HG23 1 
ATOM   8870  N N    . ALA B 1 196 ? -23.976 0.360   6.038   1.00 25.64  ? 533 ALA C N    1 
ATOM   8871  C CA   . ALA B 1 196 ? -23.148 1.129   5.110   1.00 22.04  ? 533 ALA C CA   1 
ATOM   8872  C C    . ALA B 1 196 ? -22.856 2.503   5.701   1.00 19.49  ? 533 ALA C C    1 
ATOM   8873  O O    . ALA B 1 196 ? -21.727 2.981   5.647   1.00 25.25  ? 533 ALA C O    1 
ATOM   8874  C CB   . ALA B 1 196 ? -23.839 1.265   3.733   1.00 23.43  ? 533 ALA C CB   1 
ATOM   8875  H H    . ALA B 1 196 ? -24.710 0.067   5.700   1.00 30.77  ? 533 ALA C H    1 
ATOM   8876  H HA   . ALA B 1 196 ? -22.295 0.665   4.979   1.00 26.45  ? 533 ALA C HA   1 
ATOM   8877  H HB1  . ALA B 1 196 ? -23.272 1.773   3.149   1.00 28.11  ? 533 ALA C HB1  1 
ATOM   8878  H HB2  . ALA B 1 196 ? -23.983 0.388   3.369   1.00 28.11  ? 533 ALA C HB2  1 
ATOM   8879  H HB3  . ALA B 1 196 ? -24.679 1.715   3.849   1.00 28.11  ? 533 ALA C HB3  1 
ATOM   8880  N N    . GLU B 1 197 ? -23.875 3.131   6.276   1.00 23.26  ? 534 GLU C N    1 
ATOM   8881  C CA   . GLU B 1 197 ? -23.728 4.474   6.834   1.00 29.66  ? 534 GLU C CA   1 
ATOM   8882  C C    . GLU B 1 197 ? -22.821 4.473   8.066   1.00 36.95  ? 534 GLU C C    1 
ATOM   8883  O O    . GLU B 1 197 ? -21.974 5.346   8.218   1.00 29.52  ? 534 GLU C O    1 
ATOM   8884  C CB   . GLU B 1 197 ? -25.098 5.047   7.175   1.00 25.51  ? 534 GLU C CB   1 
ATOM   8885  C CG   . GLU B 1 197 ? -25.900 5.354   5.906   1.00 33.92  ? 534 GLU C CG   1 
ATOM   8886  C CD   . GLU B 1 197 ? -27.310 5.859   6.159   1.00 41.90  ? 534 GLU C CD   1 
ATOM   8887  O OE1  . GLU B 1 197 ? -27.737 6.000   7.330   1.00 33.58  ? 534 GLU C OE1  1 
ATOM   8888  O OE2  . GLU B 1 197 ? -27.999 6.113   5.154   1.00 36.65  ? 534 GLU C OE2  1 
ATOM   8889  H H    . GLU B 1 197 ? -24.666 2.801   6.357   1.00 27.92  ? 534 GLU C H    1 
ATOM   8890  H HA   . GLU B 1 197 ? -23.318 5.055   6.159   1.00 35.59  ? 534 GLU C HA   1 
ATOM   8891  H HB2  . GLU B 1 197 ? -25.594 4.400   7.701   1.00 30.61  ? 534 GLU C HB2  1 
ATOM   8892  H HB3  . GLU B 1 197 ? -24.987 5.872   7.673   1.00 30.61  ? 534 GLU C HB3  1 
ATOM   8893  H HG2  . GLU B 1 197 ? -25.430 6.034   5.399   1.00 40.71  ? 534 GLU C HG2  1 
ATOM   8894  H HG3  . GLU B 1 197 ? -25.968 4.543   5.379   1.00 40.71  ? 534 GLU C HG3  1 
ATOM   8895  N N    . ASP B 1 198 ? -22.989 3.478   8.930   1.00 30.13  ? 535 ASP C N    1 
ATOM   8896  C CA   . ASP B 1 198 ? -22.146 3.360   10.118  1.00 34.30  ? 535 ASP C CA   1 
ATOM   8897  C C    . ASP B 1 198 ? -20.680 3.244   9.718   1.00 30.18  ? 535 ASP C C    1 
ATOM   8898  O O    . ASP B 1 198 ? -19.808 3.867   10.314  1.00 25.51  ? 535 ASP C O    1 
ATOM   8899  C CB   . ASP B 1 198 ? -22.537 2.123   10.925  1.00 32.43  ? 535 ASP C CB   1 
ATOM   8900  C CG   . ASP B 1 198 ? -23.927 2.223   11.517  1.00 41.90  ? 535 ASP C CG   1 
ATOM   8901  O OD1  . ASP B 1 198 ? -24.434 3.353   11.682  1.00 41.62  ? 535 ASP C OD1  1 
ATOM   8902  O OD2  . ASP B 1 198 ? -24.511 1.166   11.823  1.00 41.00  ? 535 ASP C OD2  1 
ATOM   8903  H H    . ASP B 1 198 ? -23.581 2.859   8.853   1.00 36.15  ? 535 ASP C H    1 
ATOM   8904  H HA   . ASP B 1 198 ? -22.257 4.153   10.683  1.00 41.16  ? 535 ASP C HA   1 
ATOM   8905  H HB2  . ASP B 1 198 ? -22.513 1.347   10.344  1.00 38.91  ? 535 ASP C HB2  1 
ATOM   8906  H HB3  . ASP B 1 198 ? -21.908 2.010   11.655  1.00 38.91  ? 535 ASP C HB3  1 
ATOM   8907  N N    . MET B 1 199 ? -20.419 2.439   8.696   1.00 26.16  ? 536 MET C N    1 
ATOM   8908  C CA   . MET B 1 199 ? -19.059 2.165   8.262   1.00 32.40  ? 536 MET C CA   1 
ATOM   8909  C C    . MET B 1 199 ? -18.430 3.390   7.613   1.00 36.10  ? 536 MET C C    1 
ATOM   8910  O O    . MET B 1 199 ? -17.205 3.527   7.599   1.00 34.17  ? 536 MET C O    1 
ATOM   8911  C CB   . MET B 1 199 ? -19.047 0.983   7.292   1.00 36.42  ? 536 MET C CB   1 
ATOM   8912  C CG   . MET B 1 199 ? -17.664 0.435   6.982   1.00 44.49  ? 536 MET C CG   1 
ATOM   8913  S SD   . MET B 1 199 ? -17.736 -0.837  5.701   1.00 48.26  ? 536 MET C SD   1 
ATOM   8914  C CE   . MET B 1 199 ? -19.092 -1.836  6.339   1.00 23.46  ? 536 MET C CE   1 
ATOM   8915  H H    . MET B 1 199 ? -21.021 2.035   8.233   1.00 31.39  ? 536 MET C H    1 
ATOM   8916  H HA   . MET B 1 199 ? -18.524 1.914   9.044   1.00 38.88  ? 536 MET C HA   1 
ATOM   8917  H HB2  . MET B 1 199 ? -19.570 0.262   7.676   1.00 43.71  ? 536 MET C HB2  1 
ATOM   8918  H HB3  . MET B 1 199 ? -19.446 1.265   6.455   1.00 43.71  ? 536 MET C HB3  1 
ATOM   8919  H HG2  . MET B 1 199 ? -17.097 1.155   6.665   1.00 53.39  ? 536 MET C HG2  1 
ATOM   8920  H HG3  . MET B 1 199 ? -17.288 0.039   7.784   1.00 53.39  ? 536 MET C HG3  1 
ATOM   8921  H HE1  . MET B 1 199 ? -19.246 -2.571  5.741   1.00 28.16  ? 536 MET C HE1  1 
ATOM   8922  H HE2  . MET B 1 199 ? -18.855 -2.165  7.209   1.00 28.16  ? 536 MET C HE2  1 
ATOM   8923  H HE3  . MET B 1 199 ? -19.880 -1.290  6.398   1.00 28.16  ? 536 MET C HE3  1 
ATOM   8924  N N    . GLY B 1 200 ? -19.268 4.283   7.087   1.00 33.02  ? 537 GLY C N    1 
ATOM   8925  C CA   . GLY B 1 200 ? -18.788 5.521   6.499   1.00 32.74  ? 537 GLY C CA   1 
ATOM   8926  C C    . GLY B 1 200 ? -18.214 6.449   7.550   1.00 38.05  ? 537 GLY C C    1 
ATOM   8927  O O    . GLY B 1 200 ? -17.533 7.423   7.225   1.00 43.89  ? 537 GLY C O    1 
ATOM   8928  H H    . GLY B 1 200 ? -20.123 4.190   7.060   1.00 39.62  ? 537 GLY C H    1 
ATOM   8929  H HA2  . GLY B 1 200 ? -18.097 5.326   5.846   1.00 39.29  ? 537 GLY C HA2  1 
ATOM   8930  H HA3  . GLY B 1 200 ? -19.519 5.975   6.051   1.00 39.29  ? 537 GLY C HA3  1 
ATOM   8931  N N    . LYS B 1 201 ? -18.489 6.144   8.814   1.00 32.79  ? 538 LYS C N    1 
ATOM   8932  C CA   . LYS B 1 201 ? -18.010 6.957   9.930   1.00 40.77  ? 538 LYS C CA   1 
ATOM   8933  C C    . LYS B 1 201 ? -16.711 6.410   10.507  1.00 42.80  ? 538 LYS C C    1 
ATOM   8934  O O    . LYS B 1 201 ? -16.138 6.992   11.423  1.00 47.99  ? 538 LYS C O    1 
ATOM   8935  C CB   . LYS B 1 201 ? -19.060 7.004   11.041  1.00 54.55  ? 538 LYS C CB   1 
ATOM   8936  C CG   . LYS B 1 201 ? -20.364 7.691   10.658  1.00 60.46  ? 538 LYS C CG   1 
ATOM   8937  C CD   . LYS B 1 201 ? -21.429 7.425   11.712  1.00 69.54  ? 538 LYS C CD   1 
ATOM   8938  C CE   . LYS B 1 201 ? -22.754 8.076   11.359  1.00 75.72  ? 538 LYS C CE   1 
ATOM   8939  N NZ   . LYS B 1 201 ? -23.818 7.737   12.346  1.00 75.17  ? 538 LYS C NZ   1 
ATOM   8940  H H    . LYS B 1 201 ? -18.957 5.464   9.056   1.00 39.35  ? 538 LYS C H    1 
ATOM   8941  H HA   . LYS B 1 201 ? -17.848 7.872   9.619   1.00 48.92  ? 538 LYS C HA   1 
ATOM   8942  H HB2  . LYS B 1 201 ? -19.274 6.095   11.303  1.00 65.46  ? 538 LYS C HB2  1 
ATOM   8943  H HB3  . LYS B 1 201 ? -18.688 7.483   11.798  1.00 65.46  ? 538 LYS C HB3  1 
ATOM   8944  H HG2  . LYS B 1 201 ? -20.221 8.649   10.600  1.00 72.55  ? 538 LYS C HG2  1 
ATOM   8945  H HG3  . LYS B 1 201 ? -20.677 7.342   9.809   1.00 72.55  ? 538 LYS C HG3  1 
ATOM   8946  H HD2  . LYS B 1 201 ? -21.572 6.468   11.785  1.00 83.45  ? 538 LYS C HD2  1 
ATOM   8947  H HD3  . LYS B 1 201 ? -21.133 7.784   12.562  1.00 83.45  ? 538 LYS C HD3  1 
ATOM   8948  H HE2  . LYS B 1 201 ? -22.644 9.039   11.351  1.00 90.86  ? 538 LYS C HE2  1 
ATOM   8949  H HE3  . LYS B 1 201 ? -23.040 7.764   10.486  1.00 90.86  ? 538 LYS C HE3  1 
ATOM   8950  H HZ1  . LYS B 1 201 ? -24.582 8.130   12.116  1.00 90.21  ? 538 LYS C HZ1  1 
ATOM   8951  H HZ2  . LYS B 1 201 ? -23.941 6.856   12.369  1.00 90.21  ? 538 LYS C HZ2  1 
ATOM   8952  H HZ3  . LYS B 1 201 ? -23.581 8.017   13.157  1.00 90.21  ? 538 LYS C HZ3  1 
ATOM   8953  N N    . CYS B 1 202 ? -16.251 5.286   9.973   1.00 42.55  ? 539 CYS C N    1 
ATOM   8954  C CA   . CYS B 1 202 ? -15.052 4.648   10.494  1.00 49.30  ? 539 CYS C CA   1 
ATOM   8955  C C    . CYS B 1 202 ? -13.806 5.267   9.878   1.00 50.75  ? 539 CYS C C    1 
ATOM   8956  O O    . CYS B 1 202 ? -13.523 5.080   8.689   1.00 41.64  ? 539 CYS C O    1 
ATOM   8957  C CB   . CYS B 1 202 ? -15.077 3.146   10.223  1.00 43.88  ? 539 CYS C CB   1 
ATOM   8958  S SG   . CYS B 1 202 ? -13.578 2.308   10.779  1.00 41.77  ? 539 CYS C SG   1 
ATOM   8959  H H    . CYS B 1 202 ? -16.613 4.875   9.311   1.00 51.06  ? 539 CYS C H    1 
ATOM   8960  H HA   . CYS B 1 202 ? -15.012 4.782   11.464  1.00 59.16  ? 539 CYS C HA   1 
ATOM   8961  H HB2  . CYS B 1 202 ? -15.830 2.753   10.692  1.00 52.66  ? 539 CYS C HB2  1 
ATOM   8962  H HB3  . CYS B 1 202 ? -15.167 2.998   9.269   1.00 52.66  ? 539 CYS C HB3  1 
ATOM   8963  H HG   . CYS B 1 202 ? -13.671 1.138   10.533  1.00 50.13  ? 539 CYS C HG   1 
ATOM   8964  N N    . HIS B 1 203 ? -13.062 5.997   10.702  1.00 49.77  ? 540 HIS C N    1 
ATOM   8965  C CA   . HIS B 1 203 ? -11.891 6.737   10.243  1.00 56.63  ? 540 HIS C CA   1 
ATOM   8966  C C    . HIS B 1 203 ? -10.763 5.822   9.781   1.00 50.37  ? 540 HIS C C    1 
ATOM   8967  O O    . HIS B 1 203 ? -9.891  6.236   9.017   1.00 55.08  ? 540 HIS C O    1 
ATOM   8968  C CB   . HIS B 1 203 ? -11.390 7.666   11.350  1.00 68.48  ? 540 HIS C CB   1 
ATOM   8969  C CG   . HIS B 1 203 ? -12.290 8.834   11.605  1.00 77.97  ? 540 HIS C CG   1 
ATOM   8970  N ND1  . HIS B 1 203 ? -12.321 9.941   10.785  1.00 75.62  ? 540 HIS C ND1  1 
ATOM   8971  C CD2  . HIS B 1 203 ? -13.197 9.065   12.583  1.00 83.51  ? 540 HIS C CD2  1 
ATOM   8972  C CE1  . HIS B 1 203 ? -13.206 10.805  11.247  1.00 80.35  ? 540 HIS C CE1  1 
ATOM   8973  N NE2  . HIS B 1 203 ? -13.752 10.298  12.338  1.00 83.26  ? 540 HIS C NE2  1 
ATOM   8974  H H    . HIS B 1 203 ? -13.217 6.082   11.544  1.00 59.73  ? 540 HIS C H    1 
ATOM   8975  H HA   . HIS B 1 203 ? -12.152 7.295   9.480   1.00 67.96  ? 540 HIS C HA   1 
ATOM   8976  H HB2  . HIS B 1 203 ? -11.318 7.161   12.174  1.00 82.18  ? 540 HIS C HB2  1 
ATOM   8977  H HB3  . HIS B 1 203 ? -10.519 8.012   11.098  1.00 82.18  ? 540 HIS C HB3  1 
ATOM   8978  H HD2  . HIS B 1 203 ? -13.405 8.497   13.289  1.00 100.21 ? 540 HIS C HD2  1 
ATOM   8979  H HE1  . HIS B 1 203 ? -13.410 11.630  10.870  1.00 96.41  ? 540 HIS C HE1  1 
ATOM   8980  N N    . LEU B 1 204 ? -10.782 4.578   10.236  1.00 48.45  ? 541 LEU C N    1 
ATOM   8981  C CA   . LEU B 1 204 ? -9.722  3.641   9.897   1.00 56.48  ? 541 LEU C CA   1 
ATOM   8982  C C    . LEU B 1 204 ? -9.786  3.296   8.408   1.00 58.84  ? 541 LEU C C    1 
ATOM   8983  O O    . LEU B 1 204 ? -8.755  3.200   7.737   1.00 60.33  ? 541 LEU C O    1 
ATOM   8984  C CB   . LEU B 1 204 ? -9.852  2.374   10.747  1.00 55.46  ? 541 LEU C CB   1 
ATOM   8985  C CG   . LEU B 1 204 ? -8.559  1.638   11.100  1.00 63.80  ? 541 LEU C CG   1 
ATOM   8986  C CD1  . LEU B 1 204 ? -7.564  2.577   11.769  1.00 65.40  ? 541 LEU C CD1  1 
ATOM   8987  C CD2  . LEU B 1 204 ? -8.852  0.439   12.000  1.00 62.34  ? 541 LEU C CD2  1 
ATOM   8988  H H    . LEU B 1 204 ? -11.396 4.251   10.741  1.00 58.14  ? 541 LEU C H    1 
ATOM   8989  H HA   . LEU B 1 204 ? -8.851  4.052   10.083  1.00 67.78  ? 541 LEU C HA   1 
ATOM   8990  H HB2  . LEU B 1 204 ? -10.281 2.614   11.583  1.00 66.55  ? 541 LEU C HB2  1 
ATOM   8991  H HB3  . LEU B 1 204 ? -10.416 1.746   10.268  1.00 66.55  ? 541 LEU C HB3  1 
ATOM   8992  H HG   . LEU B 1 204 ? -8.153  1.306   10.284  1.00 76.56  ? 541 LEU C HG   1 
ATOM   8993  H HD11 . LEU B 1 204 ? -6.765  2.088   11.978  1.00 78.48  ? 541 LEU C HD11 1 
ATOM   8994  H HD12 . LEU B 1 204 ? -7.360  3.296   11.166  1.00 78.48  ? 541 LEU C HD12 1 
ATOM   8995  H HD13 . LEU B 1 204 ? -7.955  2.925   12.574  1.00 78.48  ? 541 LEU C HD13 1 
ATOM   8996  H HD21 . LEU B 1 204 ? -8.027  -0.006  12.207  1.00 74.80  ? 541 LEU C HD21 1 
ATOM   8997  H HD22 . LEU B 1 204 ? -9.269  0.749   12.807  1.00 74.80  ? 541 LEU C HD22 1 
ATOM   8998  H HD23 . LEU B 1 204 ? -9.440  -0.162  11.537  1.00 74.80  ? 541 LEU C HD23 1 
ATOM   8999  N N    . THR B 1 205 ? -11.005 3.139   7.895   1.00 37.98  ? 542 THR C N    1 
ATOM   9000  C CA   . THR B 1 205 ? -11.214 2.636   6.544   1.00 49.37  ? 542 THR C CA   1 
ATOM   9001  C C    . THR B 1 205 ? -11.670 3.695   5.542   1.00 51.35  ? 542 THR C C    1 
ATOM   9002  O O    . THR B 1 205 ? -11.932 3.376   4.389   1.00 48.03  ? 542 THR C O    1 
ATOM   9003  C CB   . THR B 1 205 ? -12.274 1.523   6.540   1.00 54.13  ? 542 THR C CB   1 
ATOM   9004  O OG1  . THR B 1 205 ? -13.496 2.024   7.100   1.00 58.55  ? 542 THR C OG1  1 
ATOM   9005  C CG2  . THR B 1 205 ? -11.795 0.328   7.346   1.00 54.80  ? 542 THR C CG2  1 
ATOM   9006  H H    . THR B 1 205 ? -11.733 3.318   8.316   1.00 45.58  ? 542 THR C H    1 
ATOM   9007  H HA   . THR B 1 205 ? -10.373 2.254   6.216   1.00 59.24  ? 542 THR C HA   1 
ATOM   9008  H HB   . THR B 1 205 ? -12.433 1.233   5.628   1.00 64.95  ? 542 THR C HB   1 
ATOM   9009  H HG1  . THR B 1 205 ? -13.370 2.273   7.871   1.00 70.26  ? 542 THR C HG1  1 
ATOM   9010  H HG21 . THR B 1 205 ? -12.462 -0.362  7.338   1.00 65.76  ? 542 THR C HG21 1 
ATOM   9011  H HG22 . THR B 1 205 ? -10.983 -0.018  6.967   1.00 65.76  ? 542 THR C HG22 1 
ATOM   9012  H HG23 . THR B 1 205 ? -11.628 0.591   8.254   1.00 65.76  ? 542 THR C HG23 1 
ATOM   9013  N N    . LYS B 1 206 ? -11.779 4.947   5.968   1.00 45.08  ? 543 LYS C N    1 
ATOM   9014  C CA   . LYS B 1 206 ? -12.205 6.000   5.050   1.00 46.21  ? 543 LYS C CA   1 
ATOM   9015  C C    . LYS B 1 206 ? -11.333 5.988   3.793   1.00 36.08  ? 543 LYS C C    1 
ATOM   9016  O O    . LYS B 1 206 ? -10.107 6.030   3.879   1.00 49.79  ? 543 LYS C O    1 
ATOM   9017  C CB   . LYS B 1 206 ? -12.151 7.372   5.723   1.00 54.06  ? 543 LYS C CB   1 
ATOM   9018  C CG   . LYS B 1 206 ? -13.299 7.644   6.685   1.00 59.76  ? 543 LYS C CG   1 
ATOM   9019  C CD   . LYS B 1 206 ? -13.361 9.124   7.051   1.00 74.30  ? 543 LYS C CD   1 
ATOM   9020  C CE   . LYS B 1 206 ? -14.128 9.358   8.341   1.00 77.19  ? 543 LYS C CE   1 
ATOM   9021  N NZ   . LYS B 1 206 ? -15.485 8.765   8.297   1.00 77.80  ? 543 LYS C NZ   1 
ATOM   9022  H H    . LYS B 1 206 ? -11.615 5.212   6.770   1.00 54.10  ? 543 LYS C H    1 
ATOM   9023  H HA   . LYS B 1 206 ? -13.131 5.831   4.778   1.00 55.45  ? 543 LYS C HA   1 
ATOM   9024  H HB2  . LYS B 1 206 ? -11.324 7.440   6.224   1.00 64.88  ? 543 LYS C HB2  1 
ATOM   9025  H HB3  . LYS B 1 206 ? -12.174 8.056   5.036   1.00 64.88  ? 543 LYS C HB3  1 
ATOM   9026  H HG2  . LYS B 1 206 ? -14.138 7.397   6.265   1.00 71.71  ? 543 LYS C HG2  1 
ATOM   9027  H HG3  . LYS B 1 206 ? -13.165 7.133   7.499   1.00 71.71  ? 543 LYS C HG3  1 
ATOM   9028  H HD2  . LYS B 1 206 ? -12.459 9.461   7.169   1.00 89.16  ? 543 LYS C HD2  1 
ATOM   9029  H HD3  . LYS B 1 206 ? -13.808 9.609   6.340   1.00 89.16  ? 543 LYS C HD3  1 
ATOM   9030  H HE2  . LYS B 1 206 ? -13.644 8.952   9.077   1.00 92.63  ? 543 LYS C HE2  1 
ATOM   9031  H HE3  . LYS B 1 206 ? -14.220 10.313  8.487   1.00 92.63  ? 543 LYS C HE3  1 
ATOM   9032  H HZ1  . LYS B 1 206 ? -15.908 8.918   9.065   1.00 93.36  ? 543 LYS C HZ1  1 
ATOM   9033  H HZ2  . LYS B 1 206 ? -15.953 9.125   7.632   1.00 93.36  ? 543 LYS C HZ2  1 
ATOM   9034  H HZ3  . LYS B 1 206 ? -15.428 7.886   8.169   1.00 93.36  ? 543 LYS C HZ3  1 
ATOM   9035  N N    . GLY B 1 207 ? -11.977 5.892   2.632   1.00 40.56  ? 544 GLY C N    1 
ATOM   9036  C CA   . GLY B 1 207 ? -11.282 5.913   1.357   1.00 42.72  ? 544 GLY C CA   1 
ATOM   9037  C C    . GLY B 1 207 ? -10.583 4.610   1.001   1.00 53.14  ? 544 GLY C C    1 
ATOM   9038  O O    . GLY B 1 207 ? -9.786  4.569   0.063   1.00 53.92  ? 544 GLY C O    1 
ATOM   9039  H H    . GLY B 1 207 ? -12.831 5.812   2.560   1.00 48.67  ? 544 GLY C H    1 
ATOM   9040  H HA2  . GLY B 1 207 ? -11.917 6.116   0.653   1.00 51.27  ? 544 GLY C HA2  1 
ATOM   9041  H HA3  . GLY B 1 207 ? -10.614 6.617   1.373   1.00 51.27  ? 544 GLY C HA3  1 
ATOM   9042  N N    . LYS B 1 208 ? -10.881 3.543   1.739   1.00 34.85  ? 545 LYS C N    1 
ATOM   9043  C CA   . LYS B 1 208 ? -10.305 2.233   1.445   1.00 45.31  ? 545 LYS C CA   1 
ATOM   9044  C C    . LYS B 1 208 ? -11.362 1.139   1.427   1.00 37.62  ? 545 LYS C C    1 
ATOM   9045  O O    . LYS B 1 208 ? -11.267 0.187   0.654   1.00 36.45  ? 545 LYS C O    1 
ATOM   9046  C CB   . LYS B 1 208 ? -9.230  1.887   2.480   1.00 48.85  ? 545 LYS C CB   1 
ATOM   9047  C CG   . LYS B 1 208 ? -8.048  2.839   2.464   1.00 66.40  ? 545 LYS C CG   1 
ATOM   9048  C CD   . LYS B 1 208 ? -7.422  2.993   3.842   1.00 76.96  ? 545 LYS C CD   1 
ATOM   9049  C CE   . LYS B 1 208 ? -6.946  1.664   4.399   1.00 73.73  ? 545 LYS C CE   1 
ATOM   9050  N NZ   . LYS B 1 208 ? -6.153  1.854   5.649   1.00 75.26  ? 545 LYS C NZ   1 
ATOM   9051  H H    . LYS B 1 208 ? -11.413 3.550   2.414   1.00 41.82  ? 545 LYS C H    1 
ATOM   9052  H HA   . LYS B 1 208 ? -9.880  2.261   0.562   1.00 54.38  ? 545 LYS C HA   1 
ATOM   9053  H HB2  . LYS B 1 208 ? -9.626  1.917   3.365   1.00 58.62  ? 545 LYS C HB2  1 
ATOM   9054  H HB3  . LYS B 1 208 ? -8.896  0.994   2.298   1.00 58.62  ? 545 LYS C HB3  1 
ATOM   9055  H HG2  . LYS B 1 208 ? -7.370  2.496   1.861   1.00 79.68  ? 545 LYS C HG2  1 
ATOM   9056  H HG3  . LYS B 1 208 ? -8.347  3.714   2.169   1.00 79.68  ? 545 LYS C HG3  1 
ATOM   9057  H HD2  . LYS B 1 208 ? -6.658  3.587   3.780   1.00 92.35  ? 545 LYS C HD2  1 
ATOM   9058  H HD3  . LYS B 1 208 ? -8.081  3.359   4.452   1.00 92.35  ? 545 LYS C HD3  1 
ATOM   9059  H HE2  . LYS B 1 208 ? -7.715  1.110   4.607   1.00 88.48  ? 545 LYS C HE2  1 
ATOM   9060  H HE3  . LYS B 1 208 ? -6.382  1.225   3.744   1.00 88.48  ? 545 LYS C HE3  1 
ATOM   9061  H HZ1  . LYS B 1 208 ? -5.883  1.065   5.960   1.00 90.31  ? 545 LYS C HZ1  1 
ATOM   9062  H HZ2  . LYS B 1 208 ? -5.439  2.359   5.482   1.00 90.31  ? 545 LYS C HZ2  1 
ATOM   9063  H HZ3  . LYS B 1 208 ? -6.652  2.254   6.268   1.00 90.31  ? 545 LYS C HZ3  1 
ATOM   9064  N N    . GLN B 1 209 ? -12.358 1.265   2.295   1.00 32.18  ? 546 GLN C N    1 
ATOM   9065  C CA   . GLN B 1 209 ? -13.410 0.268   2.392   1.00 36.10  ? 546 GLN C CA   1 
ATOM   9066  C C    . GLN B 1 209 ? -14.781 0.926   2.555   1.00 36.36  ? 546 GLN C C    1 
ATOM   9067  O O    . GLN B 1 209 ? -14.983 1.789   3.405   1.00 36.32  ? 546 GLN C O    1 
ATOM   9068  C CB   . GLN B 1 209 ? -13.145 -0.680  3.570   1.00 26.33  ? 546 GLN C CB   1 
ATOM   9069  C CG   . GLN B 1 209 ? -14.189 -1.777  3.698   1.00 22.38  ? 546 GLN C CG   1 
ATOM   9070  C CD   . GLN B 1 209 ? -13.889 -2.781  4.809   1.00 28.69  ? 546 GLN C CD   1 
ATOM   9071  O OE1  . GLN B 1 209 ? -12.804 -2.788  5.385   1.00 27.56  ? 546 GLN C OE1  1 
ATOM   9072  N NE2  . GLN B 1 209 ? -14.858 -3.628  5.108   1.00 27.69  ? 546 GLN C NE2  1 
ATOM   9073  H H    . GLN B 1 209 ? -12.446 1.923   2.842   1.00 38.62  ? 546 GLN C H    1 
ATOM   9074  H HA   . GLN B 1 209 ? -13.424 -0.265  1.569   1.00 43.32  ? 546 GLN C HA   1 
ATOM   9075  H HB2  . GLN B 1 209 ? -12.281 -1.103  3.445   1.00 31.60  ? 546 GLN C HB2  1 
ATOM   9076  H HB3  . GLN B 1 209 ? -13.147 -0.168  4.393   1.00 31.60  ? 546 GLN C HB3  1 
ATOM   9077  H HG2  . GLN B 1 209 ? -15.048 -1.371  3.890   1.00 26.85  ? 546 GLN C HG2  1 
ATOM   9078  H HG3  . GLN B 1 209 ? -14.235 -2.266  2.861   1.00 26.85  ? 546 GLN C HG3  1 
ATOM   9079  H HE21 . GLN B 1 209 ? -15.606 -3.593  4.685   1.00 33.23  ? 546 GLN C HE21 1 
ATOM   9080  H HE22 . GLN B 1 209 ? -14.741 -4.214  5.726   1.00 33.23  ? 546 GLN C HE22 1 
ATOM   9081  N N    . ALA B 1 210 ? -15.719 0.506   1.724   1.00 27.54  ? 547 ALA C N    1 
ATOM   9082  C CA   . ALA B 1 210 ? -17.100 0.905   1.860   1.00 26.19  ? 547 ALA C CA   1 
ATOM   9083  C C    . ALA B 1 210 ? -17.955 -0.286  1.489   1.00 26.49  ? 547 ALA C C    1 
ATOM   9084  O O    . ALA B 1 210 ? -17.644 -1.010  0.549   1.00 28.16  ? 547 ALA C O    1 
ATOM   9085  C CB   . ALA B 1 210 ? -17.412 2.084   0.951   1.00 25.55  ? 547 ALA C CB   1 
ATOM   9086  H H    . ALA B 1 210 ? -15.574 -0.022  1.060   1.00 33.05  ? 547 ALA C H    1 
ATOM   9087  H HA   . ALA B 1 210 ? -17.287 1.157   2.788   1.00 31.43  ? 547 ALA C HA   1 
ATOM   9088  H HB1  . ALA B 1 210 ? -18.333 2.328   1.062   1.00 30.66  ? 547 ALA C HB1  1 
ATOM   9089  H HB2  . ALA B 1 210 ? -16.846 2.821   1.191   1.00 30.66  ? 547 ALA C HB2  1 
ATOM   9090  H HB3  . ALA B 1 210 ? -17.247 1.828   0.041   1.00 30.66  ? 547 ALA C HB3  1 
ATOM   9091  N N    . LEU B 1 211 ? -19.026 -0.490  2.241   1.00 20.34  ? 548 LEU C N    1 
ATOM   9092  C CA   . LEU B 1 211 ? -19.951 -1.575  1.974   1.00 18.30  ? 548 LEU C CA   1 
ATOM   9093  C C    . LEU B 1 211 ? -20.575 -1.367  0.594   1.00 23.46  ? 548 LEU C C    1 
ATOM   9094  O O    . LEU B 1 211 ? -20.806 -0.235  0.183   1.00 24.88  ? 548 LEU C O    1 
ATOM   9095  C CB   . LEU B 1 211 ? -21.032 -1.582  3.061   1.00 22.69  ? 548 LEU C CB   1 
ATOM   9096  C CG   . LEU B 1 211 ? -21.944 -2.796  3.227   1.00 38.26  ? 548 LEU C CG   1 
ATOM   9097  C CD1  . LEU B 1 211 ? -22.491 -2.851  4.643   1.00 44.11  ? 548 LEU C CD1  1 
ATOM   9098  C CD2  . LEU B 1 211 ? -23.082 -2.763  2.231   1.00 49.71  ? 548 LEU C CD2  1 
ATOM   9099  H H    . LEU B 1 211 ? -19.240 -0.007  2.920   1.00 24.41  ? 548 LEU C H    1 
ATOM   9100  H HA   . LEU B 1 211 ? -19.477 -2.433  1.987   1.00 21.96  ? 548 LEU C HA   1 
ATOM   9101  H HB2  . LEU B 1 211 ? -20.588 -1.454  3.913   1.00 27.23  ? 548 LEU C HB2  1 
ATOM   9102  H HB3  . LEU B 1 211 ? -21.613 -0.823  2.896   1.00 27.23  ? 548 LEU C HB3  1 
ATOM   9103  H HG   . LEU B 1 211 ? -21.430 -3.604  3.070   1.00 45.92  ? 548 LEU C HG   1 
ATOM   9104  H HD11 . LEU B 1 211 ? -23.060 -3.620  4.729   1.00 52.93  ? 548 LEU C HD11 1 
ATOM   9105  H HD12 . LEU B 1 211 ? -21.757 -2.918  5.259   1.00 52.93  ? 548 LEU C HD12 1 
ATOM   9106  H HD13 . LEU B 1 211 ? -22.992 -2.051  4.816   1.00 52.93  ? 548 LEU C HD13 1 
ATOM   9107  H HD21 . LEU B 1 211 ? -23.634 -3.537  2.362   1.00 59.65  ? 548 LEU C HD21 1 
ATOM   9108  H HD22 . LEU B 1 211 ? -23.597 -1.965  2.373   1.00 59.65  ? 548 LEU C HD22 1 
ATOM   9109  H HD23 . LEU B 1 211 ? -22.719 -2.765  1.342   1.00 59.65  ? 548 LEU C HD23 1 
ATOM   9110  N N    . GLU B 1 212 ? -20.790 -2.447  -0.140  1.00 22.26  ? 549 GLU C N    1 
ATOM   9111  C CA   . GLU B 1 212 ? -21.626 -2.377  -1.327  1.00 29.26  ? 549 GLU C CA   1 
ATOM   9112  C C    . GLU B 1 212 ? -22.809 -3.315  -1.154  1.00 21.58  ? 549 GLU C C    1 
ATOM   9113  O O    . GLU B 1 212 ? -22.646 -4.484  -0.802  1.00 20.04  ? 549 GLU C O    1 
ATOM   9114  C CB   . GLU B 1 212 ? -20.869 -2.724  -2.617  1.00 19.25  ? 549 GLU C CB   1 
ATOM   9115  C CG   . GLU B 1 212 ? -21.841 -2.787  -3.831  1.00 24.14  ? 549 GLU C CG   1 
ATOM   9116  C CD   . GLU B 1 212 ? -21.182 -3.100  -5.173  1.00 29.17  ? 549 GLU C CD   1 
ATOM   9117  O OE1  . GLU B 1 212 ? -20.029 -3.549  -5.194  1.00 30.39  ? 549 GLU C OE1  1 
ATOM   9118  O OE2  . GLU B 1 212 ? -21.828 -2.884  -6.225  1.00 34.36  ? 549 GLU C OE2  1 
ATOM   9119  H H    . GLU B 1 212 ? -20.467 -3.227  0.024   1.00 26.71  ? 549 GLU C H    1 
ATOM   9120  H HA   . GLU B 1 212 ? -21.974 -1.465  -1.418  1.00 35.11  ? 549 GLU C HA   1 
ATOM   9121  H HB2  . GLU B 1 212 ? -20.203 -2.040  -2.793  1.00 23.10  ? 549 GLU C HB2  1 
ATOM   9122  H HB3  . GLU B 1 212 ? -20.445 -3.591  -2.519  1.00 23.10  ? 549 GLU C HB3  1 
ATOM   9123  H HG2  . GLU B 1 212 ? -22.501 -3.477  -3.661  1.00 28.97  ? 549 GLU C HG2  1 
ATOM   9124  H HG3  . GLU B 1 212 ? -22.284 -1.928  -3.916  1.00 28.97  ? 549 GLU C HG3  1 
ATOM   9125  N N    . ILE B 1 213 ? -24.006 -2.796  -1.403  1.00 17.56  ? 550 ILE C N    1 
ATOM   9126  C CA   . ILE B 1 213 ? -25.211 -3.612  -1.428  1.00 17.20  ? 550 ILE C CA   1 
ATOM   9127  C C    . ILE B 1 213 ? -25.644 -3.824  -2.872  1.00 21.62  ? 550 ILE C C    1 
ATOM   9128  O O    . ILE B 1 213 ? -25.694 -2.867  -3.641  1.00 21.14  ? 550 ILE C O    1 
ATOM   9129  C CB   . ILE B 1 213 ? -26.367 -2.881  -0.718  1.00 25.50  ? 550 ILE C CB   1 
ATOM   9130  C CG1  . ILE B 1 213 ? -25.952 -2.501  0.711   1.00 29.42  ? 550 ILE C CG1  1 
ATOM   9131  C CG2  . ILE B 1 213 ? -27.642 -3.721  -0.767  1.00 26.24  ? 550 ILE C CG2  1 
ATOM   9132  C CD1  . ILE B 1 213 ? -26.884 -1.497  1.381   1.00 26.15  ? 550 ILE C CD1  1 
ATOM   9133  H H    . ILE B 1 213 ? -24.146 -1.962  -1.562  1.00 21.07  ? 550 ILE C H    1 
ATOM   9134  H HA   . ILE B 1 213 ? -25.054 -4.479  -0.998  1.00 20.64  ? 550 ILE C HA   1 
ATOM   9135  H HB   . ILE B 1 213 ? -26.538 -2.058  -1.203  1.00 30.60  ? 550 ILE C HB   1 
ATOM   9136  H HG12 . ILE B 1 213 ? -25.941 -3.304  1.256   1.00 35.31  ? 550 ILE C HG12 1 
ATOM   9137  H HG13 . ILE B 1 213 ? -25.065 -2.110  0.685   1.00 35.31  ? 550 ILE C HG13 1 
ATOM   9138  H HG21 . ILE B 1 213 ? -28.346 -3.246  -0.320  1.00 31.49  ? 550 ILE C HG21 1 
ATOM   9139  H HG22 . ILE B 1 213 ? -27.881 -3.874  -1.684  1.00 31.49  ? 550 ILE C HG22 1 
ATOM   9140  H HG23 . ILE B 1 213 ? -27.481 -4.559  -0.326  1.00 31.49  ? 550 ILE C HG23 1 
ATOM   9141  H HD11 . ILE B 1 213 ? -26.560 -1.312  2.265   1.00 31.38  ? 550 ILE C HD11 1 
ATOM   9142  H HD12 . ILE B 1 213 ? -26.899 -0.690  0.861   1.00 31.38  ? 550 ILE C HD12 1 
ATOM   9143  H HD13 . ILE B 1 213 ? -27.767 -1.873  1.427   1.00 31.38  ? 550 ILE C HD13 1 
ATOM   9144  N N    . ARG B 1 214 ? -25.959 -5.063  -3.239  1.00 23.51  ? 551 ARG C N    1 
ATOM   9145  C CA   . ARG B 1 214 ? -26.664 -5.335  -4.486  1.00 22.03  ? 551 ARG C CA   1 
ATOM   9146  C C    . ARG B 1 214 ? -27.906 -6.145  -4.199  1.00 23.55  ? 551 ARG C C    1 
ATOM   9147  O O    . ARG B 1 214 ? -27.846 -7.171  -3.524  1.00 25.15  ? 551 ARG C O    1 
ATOM   9148  C CB   . ARG B 1 214 ? -25.799 -6.085  -5.492  1.00 21.22  ? 551 ARG C CB   1 
ATOM   9149  C CG   . ARG B 1 214 ? -24.467 -5.477  -5.717  1.00 19.79  ? 551 ARG C CG   1 
ATOM   9150  C CD   . ARG B 1 214 ? -23.728 -6.230  -6.804  1.00 28.96  ? 551 ARG C CD   1 
ATOM   9151  N NE   . ARG B 1 214 ? -22.526 -5.518  -7.224  1.00 32.44  ? 551 ARG C NE   1 
ATOM   9152  C CZ   . ARG B 1 214 ? -21.652 -5.978  -8.116  1.00 34.49  ? 551 ARG C CZ   1 
ATOM   9153  N NH1  . ARG B 1 214 ? -21.841 -7.165  -8.684  1.00 32.44  ? 551 ARG C NH1  1 
ATOM   9154  N NH2  . ARG B 1 214 ? -20.587 -5.254  -8.435  1.00 37.01  ? 551 ARG C NH2  1 
ATOM   9155  H H    . ARG B 1 214 ? -25.775 -5.767  -2.780  1.00 28.21  ? 551 ARG C H    1 
ATOM   9156  H HA   . ARG B 1 214 ? -26.939 -4.486  -4.892  1.00 26.43  ? 551 ARG C HA   1 
ATOM   9157  H HB2  . ARG B 1 214 ? -25.660 -6.990  -5.170  1.00 25.47  ? 551 ARG C HB2  1 
ATOM   9158  H HB3  . ARG B 1 214 ? -26.261 -6.108  -6.344  1.00 25.47  ? 551 ARG C HB3  1 
ATOM   9159  H HG2  . ARG B 1 214 ? -24.575 -4.555  -5.998  1.00 23.75  ? 551 ARG C HG2  1 
ATOM   9160  H HG3  . ARG B 1 214 ? -23.946 -5.525  -4.900  1.00 23.75  ? 551 ARG C HG3  1 
ATOM   9161  H HD2  . ARG B 1 214 ? -23.464 -7.101  -6.468  1.00 34.75  ? 551 ARG C HD2  1 
ATOM   9162  H HD3  . ARG B 1 214 ? -24.307 -6.330  -7.576  1.00 34.75  ? 551 ARG C HD3  1 
ATOM   9163  H HE   . ARG B 1 214 ? -22.371 -4.749  -6.872  1.00 38.92  ? 551 ARG C HE   1 
ATOM   9164  H HH11 . ARG B 1 214 ? -22.531 -7.635  -8.478  1.00 38.93  ? 551 ARG C HH11 1 
ATOM   9165  H HH12 . ARG B 1 214 ? -21.274 -7.461  -9.259  1.00 38.93  ? 551 ARG C HH12 1 
ATOM   9166  H HH21 . ARG B 1 214 ? -20.463 -4.487  -8.067  1.00 44.41  ? 551 ARG C HH21 1 
ATOM   9167  H HH22 . ARG B 1 214 ? -20.021 -5.552  -9.010  1.00 44.41  ? 551 ARG C HH22 1 
ATOM   9168  N N    . SER B 1 215 ? -29.041 -5.699  -4.729  1.00 19.24  ? 552 SER C N    1 
ATOM   9169  C CA   . SER B 1 215 ? -30.312 -6.322  -4.389  1.00 17.42  ? 552 SER C CA   1 
ATOM   9170  C C    . SER B 1 215 ? -31.285 -6.289  -5.556  1.00 17.27  ? 552 SER C C    1 
ATOM   9171  O O    . SER B 1 215 ? -31.443 -5.269  -6.215  1.00 22.88  ? 552 SER C O    1 
ATOM   9172  C CB   . SER B 1 215 ? -30.951 -5.602  -3.201  1.00 15.53  ? 552 SER C CB   1 
ATOM   9173  O OG   . SER B 1 215 ? -32.261 -6.117  -2.951  1.00 19.13  ? 552 SER C OG   1 
ATOM   9174  H H    . SER B 1 215 ? -29.101 -5.043  -5.282  1.00 23.09  ? 552 SER C H    1 
ATOM   9175  H HA   . SER B 1 215 ? -30.159 -7.257  -4.139  1.00 20.91  ? 552 SER C HA   1 
ATOM   9176  H HB2  . SER B 1 215 ? -30.401 -5.738  -2.414  1.00 18.64  ? 552 SER C HB2  1 
ATOM   9177  H HB3  . SER B 1 215 ? -31.016 -4.655  -3.402  1.00 18.64  ? 552 SER C HB3  1 
ATOM   9178  H HG   . SER B 1 215 ? -32.599 -5.728  -2.314  1.00 22.96  ? 552 SER C HG   1 
ATOM   9179  N N    . SER B 1 216 ? -31.934 -7.423  -5.776  1.00 19.63  ? 553 SER C N    1 
ATOM   9180  C CA   . SER B 1 216 ? -33.095 -7.520  -6.631  1.00 23.06  ? 553 SER C CA   1 
ATOM   9181  C C    . SER B 1 216 ? -34.302 -7.939  -5.787  1.00 20.96  ? 553 SER C C    1 
ATOM   9182  O O    . SER B 1 216 ? -35.346 -8.284  -6.331  1.00 28.98  ? 553 SER C O    1 
ATOM   9183  C CB   . SER B 1 216 ? -32.847 -8.552  -7.739  1.00 20.26  ? 553 SER C CB   1 
ATOM   9184  O OG   . SER B 1 216 ? -32.579 -9.836  -7.175  1.00 21.49  ? 553 SER C OG   1 
ATOM   9185  H H    . SER B 1 216 ? -31.707 -8.175  -5.426  1.00 23.56  ? 553 SER C H    1 
ATOM   9186  H HA   . SER B 1 216 ? -33.281 -6.650  -7.043  1.00 27.67  ? 553 SER C HA   1 
ATOM   9187  H HB2  . SER B 1 216 ? -33.637 -8.611  -8.299  1.00 24.31  ? 553 SER C HB2  1 
ATOM   9188  H HB3  . SER B 1 216 ? -32.084 -8.272  -8.268  1.00 24.31  ? 553 SER C HB3  1 
ATOM   9189  H HG   . SER B 1 216 ? -32.448 -10.383 -7.772  1.00 25.79  ? 553 SER C HG   1 
ATOM   9190  N N    . LEU B 1 217 ? -34.161 -7.915  -4.458  1.00 19.29  ? 554 LEU C N    1 
ATOM   9191  C CA   . LEU B 1 217 ? -35.224 -8.394  -3.574  1.00 19.07  ? 554 LEU C CA   1 
ATOM   9192  C C    . LEU B 1 217 ? -36.442 -7.476  -3.634  1.00 25.47  ? 554 LEU C C    1 
ATOM   9193  O O    . LEU B 1 217 ? -36.364 -6.324  -3.211  1.00 24.59  ? 554 LEU C O    1 
ATOM   9194  C CB   . LEU B 1 217 ? -34.726 -8.475  -2.127  1.00 22.32  ? 554 LEU C CB   1 
ATOM   9195  C CG   . LEU B 1 217 ? -35.796 -8.729  -1.061  1.00 25.93  ? 554 LEU C CG   1 
ATOM   9196  C CD1  . LEU B 1 217 ? -36.388 -10.167 -1.109  1.00 22.56  ? 554 LEU C CD1  1 
ATOM   9197  C CD2  . LEU B 1 217 ? -35.196 -8.458  0.307   1.00 30.33  ? 554 LEU C CD2  1 
ATOM   9198  H H    . LEU B 1 217 ? -33.462 -7.627  -4.048  1.00 23.15  ? 554 LEU C H    1 
ATOM   9199  H HA   . LEU B 1 217 ? -35.499 -9.291  -3.855  1.00 22.88  ? 554 LEU C HA   1 
ATOM   9200  H HB2  . LEU B 1 217 ? -34.082 -9.197  -2.067  1.00 26.78  ? 554 LEU C HB2  1 
ATOM   9201  H HB3  . LEU B 1 217 ? -34.292 -7.636  -1.906  1.00 26.78  ? 554 LEU C HB3  1 
ATOM   9202  H HG   . LEU B 1 217 ? -36.525 -8.103  -1.194  1.00 31.12  ? 554 LEU C HG   1 
ATOM   9203  H HD11 . LEU B 1 217 ? -37.048 -10.256 -0.418  1.00 27.07  ? 554 LEU C HD11 1 
ATOM   9204  H HD12 . LEU B 1 217 ? -36.792 -10.309 -1.968  1.00 27.07  ? 554 LEU C HD12 1 
ATOM   9205  H HD13 . LEU B 1 217 ? -35.680 -10.801 -0.971  1.00 27.07  ? 554 LEU C HD13 1 
ATOM   9206  H HD21 . LEU B 1 217 ? -35.864 -8.616  0.978   1.00 36.39  ? 554 LEU C HD21 1 
ATOM   9207  H HD22 . LEU B 1 217 ? -34.450 -9.047  0.442   1.00 36.39  ? 554 LEU C HD22 1 
ATOM   9208  H HD23 . LEU B 1 217 ? -34.904 -7.544  0.344   1.00 36.39  ? 554 LEU C HD23 1 
ATOM   9209  N N    . SER B 1 218 ? -37.565 -8.000  -4.126  1.00 27.70  ? 555 SER C N    1 
ATOM   9210  C CA   . SER B 1 218 ? -38.744 -7.181  -4.410  1.00 33.06  ? 555 SER C CA   1 
ATOM   9211  C C    . SER B 1 218 ? -39.878 -7.363  -3.397  1.00 36.96  ? 555 SER C C    1 
ATOM   9212  O O    . SER B 1 218 ? -40.982 -6.863  -3.614  1.00 40.28  ? 555 SER C O    1 
ATOM   9213  C CB   . SER B 1 218 ? -39.278 -7.507  -5.808  1.00 21.74  ? 555 SER C CB   1 
ATOM   9214  O OG   . SER B 1 218 ? -39.761 -8.839  -5.839  1.00 29.11  ? 555 SER C OG   1 
ATOM   9215  H H    . SER B 1 218 ? -37.670 -8.835  -4.304  1.00 33.25  ? 555 SER C H    1 
ATOM   9216  H HA   . SER B 1 218 ? -38.482 -6.237  -4.400  1.00 39.67  ? 555 SER C HA   1 
ATOM   9217  H HB2  . SER B 1 218 ? -40.003 -6.900  -6.022  1.00 26.09  ? 555 SER C HB2  1 
ATOM   9218  H HB3  . SER B 1 218 ? -38.560 -7.413  -6.453  1.00 26.09  ? 555 SER C HB3  1 
ATOM   9219  H HG   . SER B 1 218 ? -40.047 -9.015  -6.587  1.00 34.93  ? 555 SER C HG   1 
ATOM   9220  N N    . GLU B 1 219 ? -39.620 -8.097  -2.316  1.00 23.71  ? 556 GLU C N    1 
ATOM   9221  C CA   . GLU B 1 219 ? -40.576 -8.215  -1.213  1.00 24.34  ? 556 GLU C CA   1 
ATOM   9222  C C    . GLU B 1 219 ? -39.893 -7.814  0.086   1.00 23.52  ? 556 GLU C C    1 
ATOM   9223  O O    . GLU B 1 219 ? -38.668 -7.896  0.196   1.00 26.75  ? 556 GLU C O    1 
ATOM   9224  C CB   . GLU B 1 219 ? -41.086 -9.655  -1.081  1.00 32.80  ? 556 GLU C CB   1 
ATOM   9225  C CG   . GLU B 1 219 ? -41.843 -10.188 -2.280  1.00 43.52  ? 556 GLU C CG   1 
ATOM   9226  C CD   . GLU B 1 219 ? -43.257 -9.642  -2.368  1.00 59.25  ? 556 GLU C CD   1 
ATOM   9227  O OE1  . GLU B 1 219 ? -43.816 -9.251  -1.322  1.00 65.73  ? 556 GLU C OE1  1 
ATOM   9228  O OE2  . GLU B 1 219 ? -43.813 -9.606  -3.487  1.00 69.53  ? 556 GLU C OE2  1 
ATOM   9229  H H    . GLU B 1 219 ? -38.893 -8.540  -2.196  1.00 28.45  ? 556 GLU C H    1 
ATOM   9230  H HA   . GLU B 1 219 ? -41.340 -7.620  -1.367  1.00 29.21  ? 556 GLU C HA   1 
ATOM   9231  H HB2  . GLU B 1 219 ? -40.324 -10.238 -0.934  1.00 39.36  ? 556 GLU C HB2  1 
ATOM   9232  H HB3  . GLU B 1 219 ? -41.681 -9.702  -0.316  1.00 39.36  ? 556 GLU C HB3  1 
ATOM   9233  H HG2  . GLU B 1 219 ? -41.372 -9.935  -3.090  1.00 52.22  ? 556 GLU C HG2  1 
ATOM   9234  H HG3  . GLU B 1 219 ? -41.898 -11.155 -2.216  1.00 52.22  ? 556 GLU C HG3  1 
ATOM   9235  N N    . LYS B 1 220 ? -40.678 -7.422  1.086   1.00 26.91  ? 557 LYS C N    1 
ATOM   9236  C CA   . LYS B 1 220 ? -40.117 -6.963  2.352   1.00 28.11  ? 557 LYS C CA   1 
ATOM   9237  C C    . LYS B 1 220 ? -39.676 -8.126  3.225   1.00 33.17  ? 557 LYS C C    1 
ATOM   9238  O O    . LYS B 1 220 ? -40.287 -8.387  4.253   1.00 35.25  ? 557 LYS C O    1 
ATOM   9239  C CB   . LYS B 1 220 ? -41.137 -6.124  3.132   1.00 30.73  ? 557 LYS C CB   1 
ATOM   9240  C CG   . LYS B 1 220 ? -41.632 -4.888  2.382   1.00 37.44  ? 557 LYS C CG   1 
ATOM   9241  C CD   . LYS B 1 220 ? -42.375 -3.938  3.304   1.00 48.68  ? 557 LYS C CD   1 
ATOM   9242  C CE   . LYS B 1 220 ? -42.617 -2.587  2.632   1.00 51.07  ? 557 LYS C CE   1 
ATOM   9243  N NZ   . LYS B 1 220 ? -43.481 -2.708  1.431   1.00 54.83  ? 557 LYS C NZ   1 
ATOM   9244  H H    . LYS B 1 220 ? -41.537 -7.412  1.057   1.00 32.29  ? 557 LYS C H    1 
ATOM   9245  H HA   . LYS B 1 220 ? -39.334 -6.402  2.172   1.00 33.73  ? 557 LYS C HA   1 
ATOM   9246  H HB2  . LYS B 1 220 ? -41.909 -6.677  3.331   1.00 36.87  ? 557 LYS C HB2  1 
ATOM   9247  H HB3  . LYS B 1 220 ? -40.728 -5.824  3.958   1.00 36.87  ? 557 LYS C HB3  1 
ATOM   9248  H HG2  . LYS B 1 220 ? -40.872 -4.416  2.007   1.00 44.93  ? 557 LYS C HG2  1 
ATOM   9249  H HG3  . LYS B 1 220 ? -42.238 -5.163  1.676   1.00 44.93  ? 557 LYS C HG3  1 
ATOM   9250  H HD2  . LYS B 1 220 ? -43.236 -4.322  3.534   1.00 58.41  ? 557 LYS C HD2  1 
ATOM   9251  H HD3  . LYS B 1 220 ? -41.848 -3.790  4.105   1.00 58.41  ? 557 LYS C HD3  1 
ATOM   9252  H HE2  . LYS B 1 220 ? -43.055 -1.993  3.261   1.00 61.29  ? 557 LYS C HE2  1 
ATOM   9253  H HE3  . LYS B 1 220 ? -41.766 -2.213  2.356   1.00 61.29  ? 557 LYS C HE3  1 
ATOM   9254  H HZ1  . LYS B 1 220 ? -43.603 -1.907  1.063   1.00 65.80  ? 557 LYS C HZ1  1 
ATOM   9255  H HZ2  . LYS B 1 220 ? -43.098 -3.246  0.834   1.00 65.80  ? 557 LYS C HZ2  1 
ATOM   9256  H HZ3  . LYS B 1 220 ? -44.272 -3.046  1.659   1.00 65.80  ? 557 LYS C HZ3  1 
ATOM   9257  N N    . ARG B 1 221 ? -38.616 -8.823  2.822   1.00 28.67  ? 558 ARG C N    1 
ATOM   9258  C CA   . ARG B 1 221 ? -38.135 -9.961  3.599   1.00 28.23  ? 558 ARG C CA   1 
ATOM   9259  C C    . ARG B 1 221 ? -36.992 -9.537  4.516   1.00 26.21  ? 558 ARG C C    1 
ATOM   9260  O O    . ARG B 1 221 ? -36.189 -8.672  4.170   1.00 28.05  ? 558 ARG C O    1 
ATOM   9261  C CB   . ARG B 1 221 ? -37.718 -11.112 2.683   1.00 27.75  ? 558 ARG C CB   1 
ATOM   9262  C CG   . ARG B 1 221 ? -38.900 -11.731 1.927   1.00 37.46  ? 558 ARG C CG   1 
ATOM   9263  C CD   . ARG B 1 221 ? -38.453 -12.819 0.957   1.00 36.36  ? 558 ARG C CD   1 
ATOM   9264  N NE   . ARG B 1 221 ? -39.551 -13.305 0.124   1.00 34.58  ? 558 ARG C NE   1 
ATOM   9265  C CZ   . ARG B 1 221 ? -40.552 -14.066 0.561   1.00 36.72  ? 558 ARG C CZ   1 
ATOM   9266  N NH1  . ARG B 1 221 ? -40.617 -14.431 1.837   1.00 36.09  ? 558 ARG C NH1  1 
ATOM   9267  N NH2  . ARG B 1 221 ? -41.496 -14.460 -0.280  1.00 42.56  ? 558 ARG C NH2  1 
ATOM   9268  H H    . ARG B 1 221 ? -38.163 -8.660  2.110   1.00 34.41  ? 558 ARG C H    1 
ATOM   9269  H HA   . ARG B 1 221 ? -38.866 -10.284 4.166   1.00 33.88  ? 558 ARG C HA   1 
ATOM   9270  H HB2  . ARG B 1 221 ? -37.084 -10.780 2.028   1.00 33.30  ? 558 ARG C HB2  1 
ATOM   9271  H HB3  . ARG B 1 221 ? -37.308 -11.809 3.218   1.00 33.30  ? 558 ARG C HB3  1 
ATOM   9272  H HG2  . ARG B 1 221 ? -39.513 -12.128 2.565   1.00 44.95  ? 558 ARG C HG2  1 
ATOM   9273  H HG3  . ARG B 1 221 ? -39.350 -11.038 1.418   1.00 44.95  ? 558 ARG C HG3  1 
ATOM   9274  H HD2  . ARG B 1 221 ? -37.767 -12.461 0.372   1.00 43.64  ? 558 ARG C HD2  1 
ATOM   9275  H HD3  . ARG B 1 221 ? -38.102 -13.569 1.461   1.00 43.64  ? 558 ARG C HD3  1 
ATOM   9276  H HE   . ARG B 1 221 ? -39.551 -13.083 -0.707  1.00 41.49  ? 558 ARG C HE   1 
ATOM   9277  H HH11 . ARG B 1 221 ? -40.006 -14.180 2.388   1.00 43.31  ? 558 ARG C HH11 1 
ATOM   9278  H HH12 . ARG B 1 221 ? -41.268 -14.921 2.111   1.00 43.31  ? 558 ARG C HH12 1 
ATOM   9279  H HH21 . ARG B 1 221 ? -41.461 -14.224 -1.106  1.00 51.07  ? 558 ARG C HH21 1 
ATOM   9280  H HH22 . ARG B 1 221 ? -42.146 -14.947 0.001   1.00 51.07  ? 558 ARG C HH22 1 
ATOM   9281  N N    . ALA B 1 222 ? -36.961 -10.148 5.695   1.00 27.44  ? 559 ALA C N    1 
ATOM   9282  C CA   . ALA B 1 222 ? -36.017 -9.815  6.755   1.00 25.50  ? 559 ALA C CA   1 
ATOM   9283  C C    . ALA B 1 222 ? -35.537 -11.104 7.408   1.00 28.17  ? 559 ALA C C    1 
ATOM   9284  O O    . ALA B 1 222 ? -36.254 -12.110 7.413   1.00 28.79  ? 559 ALA C O    1 
ATOM   9285  C CB   . ALA B 1 222 ? -36.703 -8.937  7.822   1.00 23.35  ? 559 ALA C CB   1 
ATOM   9286  H H    . ALA B 1 222 ? -37.498 -10.783 5.912   1.00 32.93  ? 559 ALA C H    1 
ATOM   9287  H HA   . ALA B 1 222 ? -35.248 -9.333  6.386   1.00 30.60  ? 559 ALA C HA   1 
ATOM   9288  H HB1  . ALA B 1 222 ? -36.068 -8.728  8.510   1.00 28.02  ? 559 ALA C HB1  1 
ATOM   9289  H HB2  . ALA B 1 222 ? -37.015 -8.129  7.408   1.00 28.02  ? 559 ALA C HB2  1 
ATOM   9290  H HB3  . ALA B 1 222 ? -37.444 -9.421  8.195   1.00 28.02  ? 559 ALA C HB3  1 
ATOM   9291  N N    . LEU B 1 223 ? -34.345 -11.051 7.989   1.00 22.31  ? 560 LEU C N    1 
ATOM   9292  C CA   . LEU B 1 223 ? -33.783 -12.178 8.731   1.00 24.72  ? 560 LEU C CA   1 
ATOM   9293  C C    . LEU B 1 223 ? -34.624 -12.563 9.963   1.00 25.21  ? 560 LEU C C    1 
ATOM   9294  O O    . LEU B 1 223 ? -34.461 -13.653 10.519  1.00 26.18  ? 560 LEU C O    1 
ATOM   9295  C CB   . LEU B 1 223 ? -32.355 -11.842 9.171   1.00 24.05  ? 560 LEU C CB   1 
ATOM   9296  C CG   . LEU B 1 223 ? -31.390 -11.387 8.065   1.00 25.27  ? 560 LEU C CG   1 
ATOM   9297  C CD1  . LEU B 1 223 ? -29.979 -11.227 8.625   1.00 22.16  ? 560 LEU C CD1  1 
ATOM   9298  C CD2  . LEU B 1 223 ? -31.403 -12.368 6.897   1.00 22.98  ? 560 LEU C CD2  1 
ATOM   9299  H H    . LEU B 1 223 ? -33.831 -10.361 7.969   1.00 26.77  ? 560 LEU C H    1 
ATOM   9300  H HA   . LEU B 1 223 ? -33.740 -12.958 8.140   1.00 29.66  ? 560 LEU C HA   1 
ATOM   9301  H HB2  . LEU B 1 223 ? -32.399 -11.127 9.826   1.00 28.86  ? 560 LEU C HB2  1 
ATOM   9302  H HB3  . LEU B 1 223 ? -31.970 -12.631 9.583   1.00 28.86  ? 560 LEU C HB3  1 
ATOM   9303  H HG   . LEU B 1 223 ? -31.678 -10.523 7.732   1.00 30.33  ? 560 LEU C HG   1 
ATOM   9304  H HD11 . LEU B 1 223 ? -29.393 -10.944 7.919   1.00 26.59  ? 560 LEU C HD11 1 
ATOM   9305  H HD12 . LEU B 1 223 ? -29.993 -10.569 9.324   1.00 26.59  ? 560 LEU C HD12 1 
ATOM   9306  H HD13 . LEU B 1 223 ? -29.685 -12.071 8.976   1.00 26.59  ? 560 LEU C HD13 1 
ATOM   9307  H HD21 . LEU B 1 223 ? -30.792 -12.059 6.223   1.00 27.57  ? 560 LEU C HD21 1 
ATOM   9308  H HD22 . LEU B 1 223 ? -31.132 -13.233 7.212   1.00 27.57  ? 560 LEU C HD22 1 
ATOM   9309  H HD23 . LEU B 1 223 ? -32.292 -12.414 6.537   1.00 27.57  ? 560 LEU C HD23 1 
ATOM   9310  N N    . THR B 1 224 ? -35.514 -11.664 10.373  1.00 25.35  ? 561 THR C N    1 
ATOM   9311  C CA   . THR B 1 224 ? -36.388 -11.862 11.524  1.00 30.49  ? 561 THR C CA   1 
ATOM   9312  C C    . THR B 1 224 ? -37.710 -12.541 11.158  1.00 38.33  ? 561 THR C C    1 
ATOM   9313  O O    . THR B 1 224 ? -38.524 -12.833 12.035  1.00 38.62  ? 561 THR C O    1 
ATOM   9314  C CB   . THR B 1 224 ? -36.751 -10.505 12.170  1.00 30.77  ? 561 THR C CB   1 
ATOM   9315  O OG1  . THR B 1 224 ? -37.126 -9.589  11.133  1.00 31.61  ? 561 THR C OG1  1 
ATOM   9316  C CG2  . THR B 1 224 ? -35.573 -9.917  12.923  1.00 31.31  ? 561 THR C CG2  1 
ATOM   9317  H H    . THR B 1 224 ? -35.633 -10.905 9.986   1.00 30.42  ? 561 THR C H    1 
ATOM   9318  H HA   . THR B 1 224 ? -35.929 -12.412 12.193  1.00 36.58  ? 561 THR C HA   1 
ATOM   9319  H HB   . THR B 1 224 ? -37.490 -10.622 12.787  1.00 36.92  ? 561 THR C HB   1 
ATOM   9320  H HG1  . THR B 1 224 ? -37.322 -8.862  11.458  1.00 37.94  ? 561 THR C HG1  1 
ATOM   9321  H HG21 . THR B 1 224 ? -35.821 -9.076  13.315  1.00 37.58  ? 561 THR C HG21 1 
ATOM   9322  H HG22 . THR B 1 224 ? -35.297 -10.516 13.620  1.00 37.58  ? 561 THR C HG22 1 
ATOM   9323  H HG23 . THR B 1 224 ? -34.837 -9.776  12.323  1.00 37.58  ? 561 THR C HG23 1 
ATOM   9324  N N    . ASP B 1 225 ? -37.931 -12.791 9.873   1.00 29.60  ? 562 ASP C N    1 
ATOM   9325  C CA   . ASP B 1 225 ? -39.200 -13.352 9.420   1.00 36.61  ? 562 ASP C CA   1 
ATOM   9326  C C    . ASP B 1 225 ? -39.473 -14.685 10.107  1.00 40.19  ? 562 ASP C C    1 
ATOM   9327  O O    . ASP B 1 225 ? -38.558 -15.495 10.272  1.00 31.23  ? 562 ASP C O    1 
ATOM   9328  C CB   . ASP B 1 225 ? -39.190 -13.541 7.904   1.00 29.12  ? 562 ASP C CB   1 
ATOM   9329  C CG   . ASP B 1 225 ? -39.314 -12.236 7.153   1.00 31.57  ? 562 ASP C CG   1 
ATOM   9330  O OD1  . ASP B 1 225 ? -39.696 -11.221 7.772   1.00 29.42  ? 562 ASP C OD1  1 
ATOM   9331  O OD2  . ASP B 1 225 ? -39.043 -12.229 5.935   1.00 28.34  ? 562 ASP C OD2  1 
ATOM   9332  H H    . ASP B 1 225 ? -37.364 -12.644 9.243   1.00 35.52  ? 562 ASP C H    1 
ATOM   9333  H HA   . ASP B 1 225 ? -39.926 -12.735 9.647   1.00 43.93  ? 562 ASP C HA   1 
ATOM   9334  H HB2  . ASP B 1 225 ? -38.354 -13.959 7.643   1.00 34.94  ? 562 ASP C HB2  1 
ATOM   9335  H HB3  . ASP B 1 225 ? -39.937 -14.105 7.650   1.00 34.94  ? 562 ASP C HB3  1 
ATOM   9336  N N    . PRO B 1 226 ? -40.735 -14.927 10.504  1.00 34.29  ? 563 PRO C N    1 
ATOM   9337  C CA   . PRO B 1 226 ? -41.006 -16.163 11.230  1.00 37.82  ? 563 PRO C CA   1 
ATOM   9338  C C    . PRO B 1 226 ? -41.026 -17.367 10.305  1.00 44.03  ? 563 PRO C C    1 
ATOM   9339  O O    . PRO B 1 226 ? -41.361 -17.253 9.121   1.00 33.57  ? 563 PRO C O    1 
ATOM   9340  C CB   . PRO B 1 226 ? -42.405 -15.927 11.835  1.00 42.50  ? 563 PRO C CB   1 
ATOM   9341  C CG   . PRO B 1 226 ? -42.893 -14.604 11.287  1.00 40.20  ? 563 PRO C CG   1 
ATOM   9342  C CD   . PRO B 1 226 ? -41.983 -14.225 10.168  1.00 31.07  ? 563 PRO C CD   1 
ATOM   9343  H HA   . PRO B 1 226 ? -40.351 -16.300 11.946  1.00 45.38  ? 563 PRO C HA   1 
ATOM   9344  H HB2  . PRO B 1 226 ? -42.998 -16.646 11.566  1.00 51.00  ? 563 PRO C HB2  1 
ATOM   9345  H HB3  . PRO B 1 226 ? -42.336 -15.889 12.802  1.00 51.00  ? 563 PRO C HB3  1 
ATOM   9346  H HG2  . PRO B 1 226 ? -43.801 -14.707 10.962  1.00 48.24  ? 563 PRO C HG2  1 
ATOM   9347  H HG3  . PRO B 1 226 ? -42.860 -13.935 11.988  1.00 48.24  ? 563 PRO C HG3  1 
ATOM   9348  H HD2  . PRO B 1 226 ? -42.334 -14.543 9.322   1.00 37.29  ? 563 PRO C HD2  1 
ATOM   9349  H HD3  . PRO B 1 226 ? -41.840 -13.265 10.157  1.00 37.29  ? 563 PRO C HD3  1 
ATOM   9350  N N    . ILE B 1 227 ? -40.655 -18.514 10.859  1.00 44.02  ? 564 ILE C N    1 
ATOM   9351  C CA   . ILE B 1 227 ? -40.687 -19.771 10.138  1.00 46.46  ? 564 ILE C CA   1 
ATOM   9352  C C    . ILE B 1 227 ? -42.082 -20.365 10.265  1.00 51.75  ? 564 ILE C C    1 
ATOM   9353  O O    . ILE B 1 227 ? -42.552 -20.608 11.376  1.00 43.85  ? 564 ILE C O    1 
ATOM   9354  C CB   . ILE B 1 227 ? -39.647 -20.744 10.723  1.00 46.90  ? 564 ILE C CB   1 
ATOM   9355  C CG1  . ILE B 1 227 ? -38.240 -20.282 10.337  1.00 44.90  ? 564 ILE C CG1  1 
ATOM   9356  C CG2  . ILE B 1 227 ? -39.914 -22.171 10.253  1.00 36.80  ? 564 ILE C CG2  1 
ATOM   9357  C CD1  . ILE B 1 227 ? -37.128 -20.853 11.209  1.00 40.60  ? 564 ILE C CD1  1 
ATOM   9358  H H    . ILE B 1 227 ? -40.375 -18.588 11.669  1.00 52.82  ? 564 ILE C H    1 
ATOM   9359  H HA   . ILE B 1 227 ? -40.488 -19.621 9.190   1.00 55.75  ? 564 ILE C HA   1 
ATOM   9360  H HB   . ILE B 1 227 ? -39.720 -20.723 11.690  1.00 56.28  ? 564 ILE C HB   1 
ATOM   9361  H HG12 . ILE B 1 227 ? -38.064 -20.551 9.422   1.00 53.88  ? 564 ILE C HG12 1 
ATOM   9362  H HG13 . ILE B 1 227 ? -38.201 -19.315 10.406  1.00 53.88  ? 564 ILE C HG13 1 
ATOM   9363  H HG21 . ILE B 1 227 ? -39.251 -22.754 10.633  1.00 44.16  ? 564 ILE C HG21 1 
ATOM   9364  H HG22 . ILE B 1 227 ? -40.789 -22.437 10.543  1.00 44.16  ? 564 ILE C HG22 1 
ATOM   9365  H HG23 . ILE B 1 227 ? -39.864 -22.199 9.295   1.00 44.16  ? 564 ILE C HG23 1 
ATOM   9366  H HD11 . ILE B 1 227 ? -36.285 -20.514 10.901  1.00 48.72  ? 564 ILE C HD11 1 
ATOM   9367  H HD12 . ILE B 1 227 ? -37.277 -20.584 12.119  1.00 48.72  ? 564 ILE C HD12 1 
ATOM   9368  H HD13 . ILE B 1 227 ? -37.141 -21.810 11.144  1.00 48.72  ? 564 ILE C HD13 1 
ATOM   9369  N N    . GLN B 1 228 ? -42.754 -20.584 9.139   1.00 39.38  ? 565 GLN C N    1 
ATOM   9370  C CA   . GLN B 1 228 ? -44.073 -21.206 9.169   1.00 51.60  ? 565 GLN C CA   1 
ATOM   9371  C C    . GLN B 1 228 ? -44.236 -22.186 8.016   1.00 56.71  ? 565 GLN C C    1 
ATOM   9372  O O    . GLN B 1 228 ? -43.894 -21.871 6.879   1.00 55.15  ? 565 GLN C O    1 
ATOM   9373  C CB   . GLN B 1 228 ? -45.170 -20.137 9.114   1.00 46.39  ? 565 GLN C CB   1 
ATOM   9374  H H    . GLN B 1 228 ? -42.471 -20.384 8.351   1.00 47.26  ? 565 GLN C H    1 
ATOM   9375  H HA   . GLN B 1 228 ? -44.174 -21.703 10.008  1.00 61.92  ? 565 GLN C HA   1 
ATOM   9376  N N    . ASN B 1 240 ? -32.246 -32.637 7.766   1.00 93.97  ? 577 ASN C N    1 
ATOM   9377  C CA   . ASN B 1 240 ? -32.873 -31.796 8.778   1.00 95.84  ? 577 ASN C CA   1 
ATOM   9378  C C    . ASN B 1 240 ? -32.404 -32.149 10.186  1.00 92.34  ? 577 ASN C C    1 
ATOM   9379  O O    . ASN B 1 240 ? -31.839 -31.312 10.891  1.00 89.08  ? 577 ASN C O    1 
ATOM   9380  C CB   . ASN B 1 240 ? -34.395 -31.915 8.697   1.00 104.31 ? 577 ASN C CB   1 
ATOM   9381  H HA   . ASN B 1 240 ? -32.634 -30.861 8.607   1.00 115.01 ? 577 ASN C HA   1 
ATOM   9382  N N    . LEU B 1 241 ? -32.642 -33.391 10.593  1.00 92.40  ? 578 LEU C N    1 
ATOM   9383  C CA   . LEU B 1 241 ? -32.253 -33.841 11.926  1.00 90.85  ? 578 LEU C CA   1 
ATOM   9384  C C    . LEU B 1 241 ? -30.739 -33.823 12.108  1.00 82.91  ? 578 LEU C C    1 
ATOM   9385  O O    . LEU B 1 241 ? -30.240 -33.473 13.179  1.00 79.94  ? 578 LEU C O    1 
ATOM   9386  C CB   . LEU B 1 241 ? -32.791 -35.248 12.193  1.00 94.56  ? 578 LEU C CB   1 
ATOM   9387  C CG   . LEU B 1 241 ? -34.273 -35.325 12.561  1.00 100.49 ? 578 LEU C CG   1 
ATOM   9388  C CD1  . LEU B 1 241 ? -34.759 -36.766 12.535  1.00 107.13 ? 578 LEU C CD1  1 
ATOM   9389  C CD2  . LEU B 1 241 ? -34.520 -34.694 13.924  1.00 94.26  ? 578 LEU C CD2  1 
ATOM   9390  H H    . LEU B 1 241 ? -33.027 -33.995 10.116  1.00 110.88 ? 578 LEU C H    1 
ATOM   9391  H HA   . LEU B 1 241 ? -32.644 -33.238 12.592  1.00 109.02 ? 578 LEU C HA   1 
ATOM   9392  H HB2  . LEU B 1 241 ? -32.661 -35.783 11.394  1.00 113.48 ? 578 LEU C HB2  1 
ATOM   9393  H HB3  . LEU B 1 241 ? -32.288 -35.635 12.926  1.00 113.48 ? 578 LEU C HB3  1 
ATOM   9394  H HG   . LEU B 1 241 ? -34.786 -34.826 11.905  1.00 120.59 ? 578 LEU C HG   1 
ATOM   9395  H HD11 . LEU B 1 241 ? -35.690 -36.785 12.770  1.00 128.56 ? 578 LEU C HD11 1 
ATOM   9396  H HD12 . LEU B 1 241 ? -34.636 -37.121 11.652  1.00 128.56 ? 578 LEU C HD12 1 
ATOM   9397  H HD13 . LEU B 1 241 ? -34.251 -37.278 13.169  1.00 128.56 ? 578 LEU C HD13 1 
ATOM   9398  H HD21 . LEU B 1 241 ? -35.456 -34.755 14.132  1.00 113.11 ? 578 LEU C HD21 1 
ATOM   9399  H HD22 . LEU B 1 241 ? -34.007 -35.166 14.584  1.00 113.11 ? 578 LEU C HD22 1 
ATOM   9400  H HD23 . LEU B 1 241 ? -34.250 -33.773 13.896  1.00 113.11 ? 578 LEU C HD23 1 
ATOM   9401  N N    . GLN B 1 242 ? -30.013 -34.204 11.060  1.00 77.94  ? 579 GLN C N    1 
ATOM   9402  C CA   . GLN B 1 242 ? -28.555 -34.258 11.110  1.00 74.19  ? 579 GLN C CA   1 
ATOM   9403  C C    . GLN B 1 242 ? -27.931 -32.865 11.198  1.00 73.08  ? 579 GLN C C    1 
ATOM   9404  O O    . GLN B 1 242 ? -26.949 -32.659 11.910  1.00 65.59  ? 579 GLN C O    1 
ATOM   9405  C CB   . GLN B 1 242 ? -28.009 -34.990 9.883   1.00 75.52  ? 579 GLN C CB   1 
ATOM   9406  C CG   . GLN B 1 242 ? -28.264 -36.487 9.889   1.00 82.01  ? 579 GLN C CG   1 
ATOM   9407  C CD   . GLN B 1 242 ? -27.562 -37.199 8.747   1.00 86.17  ? 579 GLN C CD   1 
ATOM   9408  O OE1  . GLN B 1 242 ? -27.590 -36.741 7.603   1.00 84.99  ? 579 GLN C OE1  1 
ATOM   9409  N NE2  . GLN B 1 242 ? -26.918 -38.322 9.056   1.00 83.91  ? 579 GLN C NE2  1 
ATOM   9410  H H    . GLN B 1 242 ? -30.345 -34.439 10.302  1.00 93.52  ? 579 GLN C H    1 
ATOM   9411  H HA   . GLN B 1 242 ? -28.283 -34.760 11.906  1.00 89.03  ? 579 GLN C HA   1 
ATOM   9412  H HB2  . GLN B 1 242 ? -28.427 -34.622 9.089   1.00 90.63  ? 579 GLN C HB2  1 
ATOM   9413  H HB3  . GLN B 1 242 ? -27.049 -34.854 9.841   1.00 90.63  ? 579 GLN C HB3  1 
ATOM   9414  H HG2  . GLN B 1 242 ? -27.938 -36.861 10.723  1.00 98.41  ? 579 GLN C HG2  1 
ATOM   9415  H HG3  . GLN B 1 242 ? -29.217 -36.647 9.802   1.00 98.41  ? 579 GLN C HG3  1 
ATOM   9416  H HE21 . GLN B 1 242 ? -26.916 -38.607 9.867   1.00 100.69 ? 579 GLN C HE21 1 
ATOM   9417  H HE22 . GLN B 1 242 ? -26.504 -38.762 8.444   1.00 100.69 ? 579 GLN C HE22 1 
ATOM   9418  N N    . TRP B 1 243 ? -28.503 -31.914 10.467  1.00 84.14  ? 580 TRP C N    1 
ATOM   9419  C CA   . TRP B 1 243 ? -28.004 -30.543 10.463  1.00 84.31  ? 580 TRP C CA   1 
ATOM   9420  C C    . TRP B 1 243 ? -28.114 -29.927 11.858  1.00 84.91  ? 580 TRP C C    1 
ATOM   9421  O O    . TRP B 1 243 ? -27.449 -28.938 12.165  1.00 88.83  ? 580 TRP C O    1 
ATOM   9422  C CB   . TRP B 1 243 ? -28.784 -29.716 9.438   1.00 81.59  ? 580 TRP C CB   1 
ATOM   9423  C CG   . TRP B 1 243 ? -28.321 -28.293 9.261   1.00 72.96  ? 580 TRP C CG   1 
ATOM   9424  C CD1  . TRP B 1 243 ? -28.680 -27.216 10.018  1.00 74.42  ? 580 TRP C CD1  1 
ATOM   9425  C CD2  . TRP B 1 243 ? -27.444 -27.790 8.241   1.00 67.94  ? 580 TRP C CD2  1 
ATOM   9426  N NE1  . TRP B 1 243 ? -28.078 -26.077 9.540   1.00 74.02  ? 580 TRP C NE1  1 
ATOM   9427  C CE2  . TRP B 1 243 ? -27.315 -26.400 8.450   1.00 65.50  ? 580 TRP C CE2  1 
ATOM   9428  C CE3  . TRP B 1 243 ? -26.757 -28.379 7.173   1.00 61.12  ? 580 TRP C CE3  1 
ATOM   9429  C CZ2  . TRP B 1 243 ? -26.520 -25.593 7.639   1.00 63.12  ? 580 TRP C CZ2  1 
ATOM   9430  C CZ3  . TRP B 1 243 ? -25.967 -27.575 6.368   1.00 61.17  ? 580 TRP C CZ3  1 
ATOM   9431  C CH2  . TRP B 1 243 ? -25.857 -26.196 6.605   1.00 68.11  ? 580 TRP C CH2  1 
ATOM   9432  H H    . TRP B 1 243 ? -29.187 -32.038 9.961   1.00 100.97 ? 580 TRP C H    1 
ATOM   9433  H HA   . TRP B 1 243 ? -27.059 -30.543 10.202  1.00 101.17 ? 580 TRP C HA   1 
ATOM   9434  H HB2  . TRP B 1 243 ? -28.715 -30.154 8.575   1.00 97.91  ? 580 TRP C HB2  1 
ATOM   9435  H HB3  . TRP B 1 243 ? -29.714 -29.687 9.712   1.00 97.91  ? 580 TRP C HB3  1 
ATOM   9436  H HD1  . TRP B 1 243 ? -29.253 -27.248 10.750  1.00 89.30  ? 580 TRP C HD1  1 
ATOM   9437  H HE1  . TRP B 1 243 ? -28.164 -25.289 9.874   1.00 88.82  ? 580 TRP C HE1  1 
ATOM   9438  H HE3  . TRP B 1 243 ? -26.825 -29.292 7.010   1.00 73.35  ? 580 TRP C HE3  1 
ATOM   9439  H HZ2  . TRP B 1 243 ? -26.443 -24.679 7.795   1.00 75.74  ? 580 TRP C HZ2  1 
ATOM   9440  H HZ3  . TRP B 1 243 ? -25.505 -27.955 5.656   1.00 73.40  ? 580 TRP C HZ3  1 
ATOM   9441  H HH2  . TRP B 1 243 ? -25.320 -25.681 6.047   1.00 81.73  ? 580 TRP C HH2  1 
ATOM   9442  N N    . ALA B 1 244 ? -28.953 -30.524 12.702  1.00 75.20  ? 581 ALA C N    1 
ATOM   9443  C CA   . ALA B 1 244 ? -29.097 -30.085 14.085  1.00 68.95  ? 581 ALA C CA   1 
ATOM   9444  C C    . ALA B 1 244 ? -28.138 -30.856 14.982  1.00 77.09  ? 581 ALA C C    1 
ATOM   9445  O O    . ALA B 1 244 ? -27.551 -30.303 15.914  1.00 74.99  ? 581 ALA C O    1 
ATOM   9446  C CB   . ALA B 1 244 ? -30.524 -30.289 14.552  1.00 68.79  ? 581 ALA C CB   1 
ATOM   9447  H H    . ALA B 1 244 ? -29.454 -31.191 12.494  1.00 90.24  ? 581 ALA C H    1 
ATOM   9448  H HA   . ALA B 1 244 ? -28.883 -29.131 14.149  1.00 82.74  ? 581 ALA C HA   1 
ATOM   9449  H HB1  . ALA B 1 244 ? -30.600 -29.996 15.463  1.00 82.55  ? 581 ALA C HB1  1 
ATOM   9450  H HB2  . ALA B 1 244 ? -31.112 -29.776 13.993  1.00 82.55  ? 581 ALA C HB2  1 
ATOM   9451  H HB3  . ALA B 1 244 ? -30.743 -31.222 14.489  1.00 82.55  ? 581 ALA C HB3  1 
ATOM   9452  N N    . LYS B 1 245 ? -27.986 -32.143 14.695  1.00 85.35  ? 582 LYS C N    1 
ATOM   9453  C CA   . LYS B 1 245 ? -27.097 -32.994 15.469  1.00 83.74  ? 582 LYS C CA   1 
ATOM   9454  C C    . LYS B 1 245 ? -25.638 -32.682 15.176  1.00 77.52  ? 582 LYS C C    1 
ATOM   9455  O O    . LYS B 1 245 ? -24.743 -33.209 15.830  1.00 83.00  ? 582 LYS C O    1 
ATOM   9456  C CB   . LYS B 1 245 ? -27.394 -34.465 15.188  1.00 88.23  ? 582 LYS C CB   1 
ATOM   9457  C CG   . LYS B 1 245 ? -28.431 -35.049 16.123  1.00 90.40  ? 582 LYS C CG   1 
ATOM   9458  C CD   . LYS B 1 245 ? -28.919 -36.403 15.657  1.00 93.12  ? 582 LYS C CD   1 
ATOM   9459  C CE   . LYS B 1 245 ? -29.605 -37.150 16.787  1.00 93.44  ? 582 LYS C CE   1 
ATOM   9460  N NZ   . LYS B 1 245 ? -30.384 -36.244 17.676  1.00 91.61  ? 582 LYS C NZ   1 
ATOM   9461  H H    . LYS B 1 245 ? -28.389 -32.549 14.053  1.00 102.42 ? 582 LYS C H    1 
ATOM   9462  H HA   . LYS B 1 245 ? -27.254 -32.833 16.423  1.00 100.48 ? 582 LYS C HA   1 
ATOM   9463  H HB2  . LYS B 1 245 ? -27.726 -34.552 14.281  1.00 105.87 ? 582 LYS C HB2  1 
ATOM   9464  H HB3  . LYS B 1 245 ? -26.576 -34.977 15.291  1.00 105.87 ? 582 LYS C HB3  1 
ATOM   9465  H HG2  . LYS B 1 245 ? -28.041 -35.156 17.005  1.00 108.48 ? 582 LYS C HG2  1 
ATOM   9466  H HG3  . LYS B 1 245 ? -29.194 -34.452 16.166  1.00 108.48 ? 582 LYS C HG3  1 
ATOM   9467  H HD2  . LYS B 1 245 ? -29.558 -36.285 14.937  1.00 111.74 ? 582 LYS C HD2  1 
ATOM   9468  H HD3  . LYS B 1 245 ? -28.164 -36.931 15.355  1.00 111.74 ? 582 LYS C HD3  1 
ATOM   9469  H HE2  . LYS B 1 245 ? -30.216 -37.803 16.411  1.00 112.12 ? 582 LYS C HE2  1 
ATOM   9470  H HE3  . LYS B 1 245 ? -28.933 -37.596 17.326  1.00 112.12 ? 582 LYS C HE3  1 
ATOM   9471  H HZ1  . LYS B 1 245 ? -30.771 -36.714 18.325  1.00 109.93 ? 582 LYS C HZ1  1 
ATOM   9472  H HZ2  . LYS B 1 245 ? -29.844 -35.638 18.040  1.00 109.93 ? 582 LYS C HZ2  1 
ATOM   9473  H HZ3  . LYS B 1 245 ? -31.014 -35.826 17.206  1.00 109.93 ? 582 LYS C HZ3  1 
ATOM   9474  N N    . ALA B 1 246 ? -25.400 -31.816 14.197  1.00 68.16  ? 583 ALA C N    1 
ATOM   9475  C CA   . ALA B 1 246 ? -24.050 -31.365 13.892  1.00 66.44  ? 583 ALA C CA   1 
ATOM   9476  C C    . ALA B 1 246 ? -23.647 -30.254 14.858  1.00 65.85  ? 583 ALA C C    1 
ATOM   9477  O O    . ALA B 1 246 ? -22.589 -29.643 14.713  1.00 58.70  ? 583 ALA C O    1 
ATOM   9478  C CB   . ALA B 1 246 ? -23.967 -30.877 12.456  1.00 67.60  ? 583 ALA C CB   1 
ATOM   9479  H H    . ALA B 1 246 ? -26.007 -31.474 13.693  1.00 81.79  ? 583 ALA C H    1 
ATOM   9480  H HA   . ALA B 1 246 ? -23.424 -32.112 14.002  1.00 79.73  ? 583 ALA C HA   1 
ATOM   9481  H HB1  . ALA B 1 246 ? -23.070 -30.585 12.277  1.00 81.12  ? 583 ALA C HB1  1 
ATOM   9482  H HB2  . ALA B 1 246 ? -24.201 -31.598 11.867  1.00 81.12  ? 583 ALA C HB2  1 
ATOM   9483  H HB3  . ALA B 1 246 ? -24.579 -30.146 12.339  1.00 81.12  ? 583 ALA C HB3  1 
ATOM   9484  N N    . HIS B 1 247 ? -24.503 -30.001 15.844  1.00 70.93  ? 584 HIS C N    1 
ATOM   9485  C CA   . HIS B 1 247 ? -24.270 -28.945 16.820  1.00 77.19  ? 584 HIS C CA   1 
ATOM   9486  C C    . HIS B 1 247 ? -24.294 -29.497 18.242  1.00 66.24  ? 584 HIS C C    1 
ATOM   9487  O O    . HIS B 1 247 ? -23.977 -28.791 19.197  1.00 61.91  ? 584 HIS C O    1 
ATOM   9488  C CB   . HIS B 1 247 ? -25.329 -27.851 16.664  1.00 91.27  ? 584 HIS C CB   1 
ATOM   9489  C CG   . HIS B 1 247 ? -25.285 -26.803 17.733  1.00 102.38 ? 584 HIS C CG   1 
ATOM   9490  N ND1  . HIS B 1 247 ? -24.105 -26.289 18.225  1.00 104.57 ? 584 HIS C ND1  1 
ATOM   9491  C CD2  . HIS B 1 247 ? -26.279 -26.167 18.398  1.00 108.45 ? 584 HIS C CD2  1 
ATOM   9492  C CE1  . HIS B 1 247 ? -24.372 -25.386 19.151  1.00 107.14 ? 584 HIS C CE1  1 
ATOM   9493  N NE2  . HIS B 1 247 ? -25.684 -25.292 19.275  1.00 110.28 ? 584 HIS C NE2  1 
ATOM   9494  H H    . HIS B 1 247 ? -25.236 -30.434 15.969  1.00 85.12  ? 584 HIS C H    1 
ATOM   9495  H HA   . HIS B 1 247 ? -23.390 -28.546 16.660  1.00 92.63  ? 584 HIS C HA   1 
ATOM   9496  H HB2  . HIS B 1 247 ? -25.196 -27.408 15.811  1.00 109.52 ? 584 HIS C HB2  1 
ATOM   9497  H HB3  . HIS B 1 247 ? -26.207 -28.261 16.687  1.00 109.52 ? 584 HIS C HB3  1 
ATOM   9498  H HD2  . HIS B 1 247 ? -27.192 -26.300 18.285  1.00 130.14 ? 584 HIS C HD2  1 
ATOM   9499  H HE1  . HIS B 1 247 ? -23.744 -24.898 19.633  1.00 128.57 ? 584 HIS C HE1  1 
ATOM   9500  N N    . GLU B 1 248 ? -24.658 -30.767 18.378  1.00 64.51  ? 585 GLU C N    1 
ATOM   9501  C CA   . GLU B 1 248 ? -24.769 -31.387 19.690  1.00 66.00  ? 585 GLU C CA   1 
ATOM   9502  C C    . GLU B 1 248 ? -23.479 -32.108 20.075  1.00 57.72  ? 585 GLU C C    1 
ATOM   9503  O O    . GLU B 1 248 ? -23.079 -33.082 19.438  1.00 41.86  ? 585 GLU C O    1 
ATOM   9504  C CB   . GLU B 1 248 ? -25.953 -32.352 19.711  1.00 78.81  ? 585 GLU C CB   1 
ATOM   9505  C CG   . GLU B 1 248 ? -27.272 -31.680 19.363  1.00 91.62  ? 585 GLU C CG   1 
ATOM   9506  C CD   . GLU B 1 248 ? -28.431 -32.652 19.299  1.00 101.44 ? 585 GLU C CD   1 
ATOM   9507  O OE1  . GLU B 1 248 ? -28.196 -33.870 19.438  1.00 98.77  ? 585 GLU C OE1  1 
ATOM   9508  O OE2  . GLU B 1 248 ? -29.578 -32.197 19.105  1.00 110.16 ? 585 GLU C OE2  1 
ATOM   9509  H H    . GLU B 1 248 ? -24.848 -31.292 17.723  1.00 77.41  ? 585 GLU C H    1 
ATOM   9510  H HA   . GLU B 1 248 ? -24.936 -30.690 20.358  1.00 79.20  ? 585 GLU C HA   1 
ATOM   9511  H HB2  . GLU B 1 248 ? -25.797 -33.057 19.064  1.00 94.58  ? 585 GLU C HB2  1 
ATOM   9512  H HB3  . GLU B 1 248 ? -26.036 -32.731 20.600  1.00 94.58  ? 585 GLU C HB3  1 
ATOM   9513  H HG2  . GLU B 1 248 ? -27.476 -31.016 20.041  1.00 109.95 ? 585 GLU C HG2  1 
ATOM   9514  H HG3  . GLU B 1 248 ? -27.190 -31.254 18.496  1.00 109.95 ? 585 GLU C HG3  1 
ATOM   9515  N N    . LEU B 1 249 ? -22.833 -31.614 21.126  1.00 54.91  ? 586 LEU C N    1 
ATOM   9516  C CA   . LEU B 1 249 ? -21.570 -32.169 21.593  1.00 43.02  ? 586 LEU C CA   1 
ATOM   9517  C C    . LEU B 1 249 ? -21.711 -33.599 22.122  1.00 47.67  ? 586 LEU C C    1 
ATOM   9518  O O    . LEU B 1 249 ? -22.803 -34.040 22.474  1.00 44.99  ? 586 LEU C O    1 
ATOM   9519  C CB   . LEU B 1 249 ? -21.005 -31.271 22.696  1.00 47.10  ? 586 LEU C CB   1 
ATOM   9520  C CG   . LEU B 1 249 ? -20.479 -29.918 22.224  1.00 40.32  ? 586 LEU C CG   1 
ATOM   9521  C CD1  . LEU B 1 249 ? -20.484 -28.909 23.359  1.00 44.50  ? 586 LEU C CD1  1 
ATOM   9522  C CD2  . LEU B 1 249 ? -19.092 -30.068 21.644  1.00 27.64  ? 586 LEU C CD2  1 
ATOM   9523  H H    . LEU B 1 249 ? -23.111 -30.948 21.593  1.00 65.89  ? 586 LEU C H    1 
ATOM   9524  H HA   . LEU B 1 249 ? -20.931 -32.180 20.851  1.00 51.63  ? 586 LEU C HA   1 
ATOM   9525  H HB2  . LEU B 1 249 ? -21.706 -31.102 23.345  1.00 56.53  ? 586 LEU C HB2  1 
ATOM   9526  H HB3  . LEU B 1 249 ? -20.270 -31.736 23.126  1.00 56.53  ? 586 LEU C HB3  1 
ATOM   9527  H HG   . LEU B 1 249 ? -21.060 -29.582 21.524  1.00 48.39  ? 586 LEU C HG   1 
ATOM   9528  H HD11 . LEU B 1 249 ? -20.149 -28.070 23.033  1.00 53.40  ? 586 LEU C HD11 1 
ATOM   9529  H HD12 . LEU B 1 249 ? -21.383 -28.801 23.677  1.00 53.40  ? 586 LEU C HD12 1 
ATOM   9530  H HD13 . LEU B 1 249 ? -19.922 -29.233 24.067  1.00 53.40  ? 586 LEU C HD13 1 
ATOM   9531  H HD21 . LEU B 1 249 ? -18.780 -29.208 21.354  1.00 33.16  ? 586 LEU C HD21 1 
ATOM   9532  H HD22 . LEU B 1 249 ? -18.507 -30.418 22.320  1.00 33.16  ? 586 LEU C HD22 1 
ATOM   9533  H HD23 . LEU B 1 249 ? -19.129 -30.672 20.899  1.00 33.16  ? 586 LEU C HD23 1 
ATOM   9534  N N    . PRO B 1 250 ? -20.595 -34.335 22.179  1.00 46.48  ? 587 PRO C N    1 
ATOM   9535  C CA   . PRO B 1 250 ? -20.640 -35.626 22.871  1.00 44.43  ? 587 PRO C CA   1 
ATOM   9536  C C    . PRO B 1 250 ? -21.071 -35.418 24.316  1.00 38.37  ? 587 PRO C C    1 
ATOM   9537  O O    . PRO B 1 250 ? -20.822 -34.344 24.866  1.00 38.58  ? 587 PRO C O    1 
ATOM   9538  C CB   . PRO B 1 250 ? -19.189 -36.117 22.805  1.00 43.07  ? 587 PRO C CB   1 
ATOM   9539  C CG   . PRO B 1 250 ? -18.585 -35.384 21.649  1.00 45.16  ? 587 PRO C CG   1 
ATOM   9540  C CD   . PRO B 1 250 ? -19.261 -34.042 21.630  1.00 47.89  ? 587 PRO C CD   1 
ATOM   9541  H HA   . PRO B 1 250 ? -21.238 -36.257 22.418  1.00 53.31  ? 587 PRO C HA   1 
ATOM   9542  H HB2  . PRO B 1 250 ? -18.731 -35.894 23.631  1.00 51.68  ? 587 PRO C HB2  1 
ATOM   9543  H HB3  . PRO B 1 250 ? -19.174 -37.074 22.651  1.00 51.68  ? 587 PRO C HB3  1 
ATOM   9544  H HG2  . PRO B 1 250 ? -17.631 -35.284 21.790  1.00 54.19  ? 587 PRO C HG2  1 
ATOM   9545  H HG3  . PRO B 1 250 ? -18.762 -35.868 20.828  1.00 54.19  ? 587 PRO C HG3  1 
ATOM   9546  H HD2  . PRO B 1 250 ? -18.789 -33.415 22.200  1.00 57.47  ? 587 PRO C HD2  1 
ATOM   9547  H HD3  . PRO B 1 250 ? -19.334 -33.712 20.720  1.00 57.47  ? 587 PRO C HD3  1 
ATOM   9548  N N    . GLU B 1 251 ? -21.714 -36.415 24.916  1.00 42.44  ? 588 GLU C N    1 
ATOM   9549  C CA   . GLU B 1 251 ? -22.107 -36.328 26.321  1.00 40.10  ? 588 GLU C CA   1 
ATOM   9550  C C    . GLU B 1 251 ? -20.874 -36.346 27.215  1.00 38.56  ? 588 GLU C C    1 
ATOM   9551  O O    . GLU B 1 251 ? -19.896 -37.015 26.906  1.00 34.53  ? 588 GLU C O    1 
ATOM   9552  C CB   . GLU B 1 251 ? -23.009 -37.506 26.697  1.00 48.32  ? 588 GLU C CB   1 
ATOM   9553  C CG   . GLU B 1 251 ? -24.321 -37.574 25.935  1.00 60.15  ? 588 GLU C CG   1 
ATOM   9554  C CD   . GLU B 1 251 ? -25.265 -36.442 26.285  1.00 66.97  ? 588 GLU C CD   1 
ATOM   9555  O OE1  . GLU B 1 251 ? -24.978 -35.705 27.250  1.00 72.01  ? 588 GLU C OE1  1 
ATOM   9556  O OE2  . GLU B 1 251 ? -26.294 -36.288 25.591  1.00 74.45  ? 588 GLU C OE2  1 
ATOM   9557  H H    . GLU B 1 251 ? -21.935 -37.152 24.534  1.00 50.93  ? 588 GLU C H    1 
ATOM   9558  H HA   . GLU B 1 251 ? -22.596 -35.493 26.476  1.00 48.12  ? 588 GLU C HA   1 
ATOM   9559  H HB2  . GLU B 1 251 ? -22.528 -38.330 26.527  1.00 57.98  ? 588 GLU C HB2  1 
ATOM   9560  H HB3  . GLU B 1 251 ? -23.222 -37.442 27.642  1.00 57.98  ? 588 GLU C HB3  1 
ATOM   9561  H HG2  . GLU B 1 251 ? -24.137 -37.528 24.984  1.00 72.18  ? 588 GLU C HG2  1 
ATOM   9562  H HG3  . GLU B 1 251 ? -24.766 -38.411 26.146  1.00 72.18  ? 588 GLU C HG3  1 
ATOM   9563  N N    . SER B 1 252 ? -20.921 -35.606 28.319  1.00 41.06  ? 589 SER C N    1 
ATOM   9564  C CA   . SER B 1 252 ? -19.921 -35.742 29.371  1.00 45.38  ? 589 SER C CA   1 
ATOM   9565  C C    . SER B 1 252 ? -19.839 -37.203 29.795  1.00 45.63  ? 589 SER C C    1 
ATOM   9566  O O    . SER B 1 252 ? -20.848 -37.903 29.821  1.00 46.97  ? 589 SER C O    1 
ATOM   9567  C CB   . SER B 1 252 ? -20.307 -34.893 30.585  1.00 51.44  ? 589 SER C CB   1 
ATOM   9568  O OG   . SER B 1 252 ? -20.367 -33.516 30.261  1.00 56.72  ? 589 SER C OG   1 
ATOM   9569  H H    . SER B 1 252 ? -21.525 -35.016 28.482  1.00 49.27  ? 589 SER C H    1 
ATOM   9570  H HA   . SER B 1 252 ? -19.044 -35.453 29.043  1.00 54.46  ? 589 SER C HA   1 
ATOM   9571  H HB2  . SER B 1 252 ? -21.178 -35.178 30.903  1.00 61.73  ? 589 SER C HB2  1 
ATOM   9572  H HB3  . SER B 1 252 ? -19.644 -35.022 31.281  1.00 61.73  ? 589 SER C HB3  1 
ATOM   9573  H HG   . SER B 1 252 ? -20.574 -33.081 30.924  1.00 68.06  ? 589 SER C HG   1 
ATOM   9574  N N    . MET B 1 253 ? -18.641 -37.668 30.131  1.00 31.74  ? 590 MET C N    1 
ATOM   9575  C CA   . MET B 1 253 ? -18.485 -39.008 30.671  1.00 46.82  ? 590 MET C CA   1 
ATOM   9576  C C    . MET B 1 253 ? -17.541 -38.994 31.867  1.00 51.79  ? 590 MET C C    1 
ATOM   9577  O O    . MET B 1 253 ? -16.572 -38.244 31.895  1.00 42.72  ? 590 MET C O    1 
ATOM   9578  C CB   . MET B 1 253 ? -17.969 -39.957 29.592  1.00 53.65  ? 590 MET C CB   1 
ATOM   9579  C CG   . MET B 1 253 ? -16.730 -39.466 28.882  1.00 62.07  ? 590 MET C CG   1 
ATOM   9580  S SD   . MET B 1 253 ? -16.743 -39.932 27.142  1.00 103.89 ? 590 MET C SD   1 
ATOM   9581  C CE   . MET B 1 253 ? -17.198 -41.651 27.285  1.00 41.87  ? 590 MET C CE   1 
ATOM   9582  H H    . MET B 1 253 ? -17.906 -37.228 30.055  1.00 38.09  ? 590 MET C H    1 
ATOM   9583  H HA   . MET B 1 253 ? -19.362 -39.335 30.964  1.00 56.18  ? 590 MET C HA   1 
ATOM   9584  H HB2  . MET B 1 253 ? -17.756 -40.810 30.002  1.00 64.38  ? 590 MET C HB2  1 
ATOM   9585  H HB3  . MET B 1 253 ? -18.663 -40.078 28.925  1.00 64.38  ? 590 MET C HB3  1 
ATOM   9586  H HG2  . MET B 1 253 ? -16.691 -38.498 28.938  1.00 74.48  ? 590 MET C HG2  1 
ATOM   9587  H HG3  . MET B 1 253 ? -15.946 -39.859 29.297  1.00 74.48  ? 590 MET C HG3  1 
ATOM   9588  H HE1  . MET B 1 253 ? -17.243 -42.037 26.407  1.00 50.25  ? 590 MET C HE1  1 
ATOM   9589  H HE2  . MET B 1 253 ? -16.534 -42.107 27.809  1.00 50.25  ? 590 MET C HE2  1 
ATOM   9590  H HE3  . MET B 1 253 ? -18.054 -41.713 27.715  1.00 50.25  ? 590 MET C HE3  1 
ATOM   9591  N N    . CYS B 1 254 ? -17.845 -39.817 32.863  1.00 61.95  ? 591 CYS C N    1 
ATOM   9592  C CA   . CYS B 1 254 ? -17.002 -39.934 34.042  1.00 60.05  ? 591 CYS C CA   1 
ATOM   9593  C C    . CYS B 1 254 ? -16.337 -41.297 34.028  1.00 62.81  ? 591 CYS C C    1 
ATOM   9594  O O    . CYS B 1 254 ? -16.929 -42.288 34.450  1.00 74.00  ? 591 CYS C O    1 
ATOM   9595  C CB   . CYS B 1 254 ? -17.832 -39.759 35.316  1.00 53.34  ? 591 CYS C CB   1 
ATOM   9596  S SG   . CYS B 1 254 ? -16.916 -40.012 36.863  1.00 57.42  ? 591 CYS C SG   1 
ATOM   9597  H H    . CYS B 1 254 ? -18.540 -40.324 32.878  1.00 74.34  ? 591 CYS C H    1 
ATOM   9598  H HA   . CYS B 1 254 ? -16.306 -39.243 34.022  1.00 72.06  ? 591 CYS C HA   1 
ATOM   9599  H HB2  . CYS B 1 254 ? -18.189 -38.857 35.331  1.00 64.00  ? 591 CYS C HB2  1 
ATOM   9600  H HB3  . CYS B 1 254 ? -18.562 -40.397 35.299  1.00 64.00  ? 591 CYS C HB3  1 
ATOM   9601  H HG   . CYS B 1 254 ? -17.661 -39.851 37.790  1.00 68.90  ? 591 CYS C HG   1 
ATOM   9602  N N    . LEU B 1 255 ? -15.109 -41.340 33.522  1.00 48.40  ? 592 LEU C N    1 
ATOM   9603  C CA   . LEU B 1 255 ? -14.354 -42.579 33.436  1.00 40.16  ? 592 LEU C CA   1 
ATOM   9604  C C    . LEU B 1 255 ? -13.852 -43.006 34.814  1.00 46.90  ? 592 LEU C C    1 
ATOM   9605  O O    . LEU B 1 255 ? -13.194 -42.231 35.508  1.00 36.73  ? 592 LEU C O    1 
ATOM   9606  C CB   . LEU B 1 255 ? -13.157 -42.414 32.504  1.00 43.47  ? 592 LEU C CB   1 
ATOM   9607  C CG   . LEU B 1 255 ? -13.433 -41.915 31.083  1.00 50.95  ? 592 LEU C CG   1 
ATOM   9608  C CD1  . LEU B 1 255 ? -12.115 -41.775 30.335  1.00 50.47  ? 592 LEU C CD1  1 
ATOM   9609  C CD2  . LEU B 1 255 ? -14.384 -42.849 30.340  1.00 47.39  ? 592 LEU C CD2  1 
ATOM   9610  H H    . LEU B 1 255 ? -14.688 -40.655 33.217  1.00 58.09  ? 592 LEU C H    1 
ATOM   9611  H HA   . LEU B 1 255 ? -14.929 -43.289 33.082  1.00 48.19  ? 592 LEU C HA   1 
ATOM   9612  H HB2  . LEU B 1 255 ? -12.544 -41.783 32.912  1.00 52.16  ? 592 LEU C HB2  1 
ATOM   9613  H HB3  . LEU B 1 255 ? -12.720 -43.276 32.422  1.00 52.16  ? 592 LEU C HB3  1 
ATOM   9614  H HG   . LEU B 1 255 ? -13.847 -41.039 31.129  1.00 61.15  ? 592 LEU C HG   1 
ATOM   9615  H HD11 . LEU B 1 255 ? -12.293 -41.462 29.445  1.00 60.56  ? 592 LEU C HD11 1 
ATOM   9616  H HD12 . LEU B 1 255 ? -11.558 -41.145 30.798  1.00 60.56  ? 592 LEU C HD12 1 
ATOM   9617  H HD13 . LEU B 1 255 ? -11.683 -42.631 30.301  1.00 60.56  ? 592 LEU C HD13 1 
ATOM   9618  H HD21 . LEU B 1 255 ? -14.533 -42.505 29.456  1.00 56.87  ? 592 LEU C HD21 1 
ATOM   9619  H HD22 . LEU B 1 255 ? -13.988 -43.722 30.290  1.00 56.87  ? 592 LEU C HD22 1 
ATOM   9620  H HD23 . LEU B 1 255 ? -15.215 -42.893 30.819  1.00 56.87  ? 592 LEU C HD23 1 
ATOM   9621  N N    . LYS B 1 256 ? -14.167 -44.236 35.204  1.00 55.09  ? 593 LYS C N    1 
ATOM   9622  C CA   . LYS B 1 256 ? -13.602 -44.824 36.412  1.00 59.89  ? 593 LYS C CA   1 
ATOM   9623  C C    . LYS B 1 256 ? -12.526 -45.820 36.021  1.00 53.64  ? 593 LYS C C    1 
ATOM   9624  O O    . LYS B 1 256 ? -12.803 -46.795 35.327  1.00 61.02  ? 593 LYS C O    1 
ATOM   9625  C CB   . LYS B 1 256 ? -14.673 -45.541 37.231  1.00 70.04  ? 593 LYS C CB   1 
ATOM   9626  C CG   . LYS B 1 256 ? -14.105 -46.261 38.458  1.00 84.41  ? 593 LYS C CG   1 
ATOM   9627  C CD   . LYS B 1 256 ? -15.039 -47.338 38.989  1.00 90.06  ? 593 LYS C CD   1 
ATOM   9628  C CE   . LYS B 1 256 ? -14.397 -48.100 40.140  1.00 94.95  ? 593 LYS C CE   1 
ATOM   9629  N NZ   . LYS B 1 256 ? -15.299 -49.134 40.719  1.00 97.62  ? 593 LYS C NZ   1 
ATOM   9630  H H    . LYS B 1 256 ? -14.710 -44.753 34.783  1.00 66.11  ? 593 LYS C H    1 
ATOM   9631  H HA   . LYS B 1 256 ? -13.198 -44.123 36.965  1.00 71.87  ? 593 LYS C HA   1 
ATOM   9632  H HB2  . LYS B 1 256 ? -15.322 -44.890 37.541  1.00 84.05  ? 593 LYS C HB2  1 
ATOM   9633  H HB3  . LYS B 1 256 ? -15.108 -46.203 36.671  1.00 84.05  ? 593 LYS C HB3  1 
ATOM   9634  H HG2  . LYS B 1 256 ? -13.266 -46.684 38.216  1.00 101.29 ? 593 LYS C HG2  1 
ATOM   9635  H HG3  . LYS B 1 256 ? -13.960 -45.614 39.166  1.00 101.29 ? 593 LYS C HG3  1 
ATOM   9636  H HD2  . LYS B 1 256 ? -15.855 -46.925 39.313  1.00 108.07 ? 593 LYS C HD2  1 
ATOM   9637  H HD3  . LYS B 1 256 ? -15.240 -47.968 38.279  1.00 108.07 ? 593 LYS C HD3  1 
ATOM   9638  H HE2  . LYS B 1 256 ? -13.598 -48.546 39.817  1.00 113.94 ? 593 LYS C HE2  1 
ATOM   9639  H HE3  . LYS B 1 256 ? -14.166 -47.474 40.844  1.00 113.94 ? 593 LYS C HE3  1 
ATOM   9640  H HZ1  . LYS B 1 256 ? -14.889 -49.556 41.387  1.00 117.14 ? 593 LYS C HZ1  1 
ATOM   9641  H HZ2  . LYS B 1 256 ? -16.040 -48.751 41.031  1.00 117.14 ? 593 LYS C HZ2  1 
ATOM   9642  H HZ3  . LYS B 1 256 ? -15.522 -49.728 40.095  1.00 117.14 ? 593 LYS C HZ3  1 
ATOM   9643  N N    . PHE B 1 257 ? -11.298 -45.567 36.464  1.00 44.22  ? 594 PHE C N    1 
ATOM   9644  C CA   . PHE B 1 257 ? -10.186 -46.478 36.226  1.00 38.92  ? 594 PHE C CA   1 
ATOM   9645  C C    . PHE B 1 257 ? -10.135 -47.577 37.291  1.00 54.82  ? 594 PHE C C    1 
ATOM   9646  O O    . PHE B 1 257 ? -10.793 -47.485 38.326  1.00 56.38  ? 594 PHE C O    1 
ATOM   9647  C CB   . PHE B 1 257 ? -8.868  -45.709 36.221  1.00 32.04  ? 594 PHE C CB   1 
ATOM   9648  C CG   . PHE B 1 257 ? -8.608  -44.970 34.942  1.00 42.46  ? 594 PHE C CG   1 
ATOM   9649  C CD1  . PHE B 1 257 ? -9.446  -43.951 34.533  1.00 43.25  ? 594 PHE C CD1  1 
ATOM   9650  C CD2  . PHE B 1 257 ? -7.522  -45.296 34.152  1.00 52.34  ? 594 PHE C CD2  1 
ATOM   9651  C CE1  . PHE B 1 257 ? -9.206  -43.276 33.349  1.00 47.93  ? 594 PHE C CE1  1 
ATOM   9652  C CE2  . PHE B 1 257 ? -7.273  -44.618 32.973  1.00 57.48  ? 594 PHE C CE2  1 
ATOM   9653  C CZ   . PHE B 1 257 ? -8.115  -43.611 32.574  1.00 48.90  ? 594 PHE C CZ   1 
ATOM   9654  H H    . PHE B 1 257 ? -11.082 -44.865 36.910  1.00 53.06  ? 594 PHE C H    1 
ATOM   9655  H HA   . PHE B 1 257 ? -10.298 -46.903 35.350  1.00 46.70  ? 594 PHE C HA   1 
ATOM   9656  H HB2  . PHE B 1 257 ? -8.881  -45.061 36.942  1.00 38.45  ? 594 PHE C HB2  1 
ATOM   9657  H HB3  . PHE B 1 257 ? -8.140  -46.336 36.356  1.00 38.45  ? 594 PHE C HB3  1 
ATOM   9658  H HD1  . PHE B 1 257 ? -10.183 -43.723 35.052  1.00 51.90  ? 594 PHE C HD1  1 
ATOM   9659  H HD2  . PHE B 1 257 ? -6.949  -45.978 34.419  1.00 62.81  ? 594 PHE C HD2  1 
ATOM   9660  H HE1  . PHE B 1 257 ? -9.774  -42.591 33.081  1.00 57.51  ? 594 PHE C HE1  1 
ATOM   9661  H HE2  . PHE B 1 257 ? -6.540  -44.847 32.449  1.00 68.98  ? 594 PHE C HE2  1 
ATOM   9662  H HZ   . PHE B 1 257 ? -7.952  -43.155 31.780  1.00 58.68  ? 594 PHE C HZ   1 
ATOM   9663  N N    . ASP B 1 258 ? -9.333  -48.606 37.032  1.00 50.13  ? 595 ASP C N    1 
ATOM   9664  C CA   . ASP B 1 258 ? -9.272  -49.776 37.900  1.00 57.75  ? 595 ASP C CA   1 
ATOM   9665  C C    . ASP B 1 258 ? -8.654  -49.464 39.259  1.00 55.78  ? 595 ASP C C    1 
ATOM   9666  O O    . ASP B 1 258 ? -8.914  -50.163 40.235  1.00 52.96  ? 595 ASP C O    1 
ATOM   9667  C CB   . ASP B 1 258 ? -8.469  -50.893 37.230  1.00 61.75  ? 595 ASP C CB   1 
ATOM   9668  C CG   . ASP B 1 258 ? -9.192  -51.501 36.051  1.00 64.19  ? 595 ASP C CG   1 
ATOM   9669  O OD1  . ASP B 1 258 ? -8.513  -52.006 35.132  1.00 80.74  ? 595 ASP C OD1  1 
ATOM   9670  O OD2  . ASP B 1 258 ? -10.441 -51.475 36.046  1.00 46.46  ? 595 ASP C OD2  1 
ATOM   9671  H H    . ASP B 1 258 ? -8.809  -48.651 36.352  1.00 60.16  ? 595 ASP C H    1 
ATOM   9672  H HA   . ASP B 1 258 ? -10.182 -50.107 38.052  1.00 69.30  ? 595 ASP C HA   1 
ATOM   9673  H HB2  . ASP B 1 258 ? -7.627  -50.531 36.912  1.00 74.10  ? 595 ASP C HB2  1 
ATOM   9674  H HB3  . ASP B 1 258 ? -8.305  -51.597 37.877  1.00 74.10  ? 595 ASP C HB3  1 
ATOM   9675  N N    . CYS B 1 259 ? -7.828  -48.425 39.319  1.00 50.64  ? 596 CYS C N    1 
ATOM   9676  C CA   . CYS B 1 259 ? -7.167  -48.048 40.563  1.00 57.55  ? 596 CYS C CA   1 
ATOM   9677  C C    . CYS B 1 259 ? -8.123  -47.243 41.435  1.00 62.96  ? 596 CYS C C    1 
ATOM   9678  O O    . CYS B 1 259 ? -7.848  -46.995 42.606  1.00 51.07  ? 596 CYS C O    1 
ATOM   9679  C CB   . CYS B 1 259 ? -5.907  -47.226 40.278  1.00 48.37  ? 596 CYS C CB   1 
ATOM   9680  S SG   . CYS B 1 259 ? -6.240  -45.614 39.527  1.00 46.78  ? 596 CYS C SG   1 
ATOM   9681  H H    . CYS B 1 259 ? -7.634  -47.920 38.650  1.00 60.77  ? 596 CYS C H    1 
ATOM   9682  H HA   . CYS B 1 259 ? -6.906  -48.856 41.052  1.00 69.05  ? 596 CYS C HA   1 
ATOM   9683  H HB2  . CYS B 1 259 ? -5.439  -47.073 41.114  1.00 58.04  ? 596 CYS C HB2  1 
ATOM   9684  H HB3  . CYS B 1 259 ? -5.340  -47.725 39.670  1.00 58.04  ? 596 CYS C HB3  1 
ATOM   9685  H HG   . CYS B 1 259 ? -5.198  -45.047 39.343  1.00 56.14  ? 596 CYS C HG   1 
ATOM   9686  N N    . GLY B 1 260 ? -9.245  -46.826 40.853  1.00 60.76  ? 597 GLY C N    1 
ATOM   9687  C CA   . GLY B 1 260 ? -10.264 -46.108 41.595  1.00 55.39  ? 597 GLY C CA   1 
ATOM   9688  C C    . GLY B 1 260 ? -10.296 -44.619 41.303  1.00 47.85  ? 597 GLY C C    1 
ATOM   9689  O O    . GLY B 1 260 ? -11.186 -43.912 41.770  1.00 53.64  ? 597 GLY C O    1 
ATOM   9690  H H    . GLY B 1 260 ? -9.437  -46.950 40.024  1.00 72.91  ? 597 GLY C H    1 
ATOM   9691  H HA2  . GLY B 1 260 ? -11.135 -46.478 41.380  1.00 66.46  ? 597 GLY C HA2  1 
ATOM   9692  H HA3  . GLY B 1 260 ? -10.110 -46.227 42.545  1.00 66.46  ? 597 GLY C HA3  1 
ATOM   9693  N N    . VAL B 1 261 ? -9.327  -44.125 40.542  1.00 46.77  ? 598 VAL C N    1 
ATOM   9694  C CA   . VAL B 1 261 ? -9.379  -42.734 40.114  1.00 37.48  ? 598 VAL C CA   1 
ATOM   9695  C C    . VAL B 1 261 ? -10.556 -42.560 39.162  1.00 39.25  ? 598 VAL C C    1 
ATOM   9696  O O    . VAL B 1 261 ? -10.793 -43.408 38.310  1.00 42.49  ? 598 VAL C O    1 
ATOM   9697  C CB   . VAL B 1 261 ? -8.094  -42.301 39.397  1.00 29.65  ? 598 VAL C CB   1 
ATOM   9698  C CG1  . VAL B 1 261 ? -8.335  -40.979 38.649  1.00 32.42  ? 598 VAL C CG1  1 
ATOM   9699  C CG2  . VAL B 1 261 ? -6.931  -42.180 40.398  1.00 34.70  ? 598 VAL C CG2  1 
ATOM   9700  H H    . VAL B 1 261 ? -8.642  -44.564 40.265  1.00 56.13  ? 598 VAL C H    1 
ATOM   9701  H HA   . VAL B 1 261 ? -9.516  -42.154 40.892  1.00 44.97  ? 598 VAL C HA   1 
ATOM   9702  H HB   . VAL B 1 261 ? -7.854  -42.982 38.735  1.00 35.58  ? 598 VAL C HB   1 
ATOM   9703  H HG11 . VAL B 1 261 ? -7.524  -40.720 38.206  1.00 38.91  ? 598 VAL C HG11 1 
ATOM   9704  H HG12 . VAL B 1 261 ? -9.034  -41.108 38.004  1.00 38.91  ? 598 VAL C HG12 1 
ATOM   9705  H HG13 . VAL B 1 261 ? -8.593  -40.305 39.282  1.00 38.91  ? 598 VAL C HG13 1 
ATOM   9706  H HG21 . VAL B 1 261 ? -6.140  -41.908 39.926  1.00 41.64  ? 598 VAL C HG21 1 
ATOM   9707  H HG22 . VAL B 1 261 ? -7.158  -41.525 41.062  1.00 41.64  ? 598 VAL C HG22 1 
ATOM   9708  H HG23 . VAL B 1 261 ? -6.787  -43.033 40.814  1.00 41.64  ? 598 VAL C HG23 1 
ATOM   9709  N N    . GLN B 1 262 ? -11.298 -41.468 39.322  1.00 40.22  ? 599 GLN C N    1 
ATOM   9710  C CA   . GLN B 1 262 ? -12.360 -41.123 38.392  1.00 46.28  ? 599 GLN C CA   1 
ATOM   9711  C C    . GLN B 1 262 ? -11.996 -39.832 37.673  1.00 45.76  ? 599 GLN C C    1 
ATOM   9712  O O    . GLN B 1 262 ? -11.667 -38.828 38.303  1.00 45.52  ? 599 GLN C O    1 
ATOM   9713  C CB   . GLN B 1 262 ? -13.703 -40.980 39.114  1.00 59.34  ? 599 GLN C CB   1 
ATOM   9714  C CG   . GLN B 1 262 ? -14.253 -42.297 39.648  1.00 73.54  ? 599 GLN C CG   1 
ATOM   9715  C CD   . GLN B 1 262 ? -15.697 -42.196 40.118  1.00 82.96  ? 599 GLN C CD   1 
ATOM   9716  O OE1  . GLN B 1 262 ? -16.248 -41.103 40.249  1.00 82.06  ? 599 GLN C OE1  1 
ATOM   9717  N NE2  . GLN B 1 262 ? -16.318 -43.345 40.368  1.00 85.95  ? 599 GLN C NE2  1 
ATOM   9718  H H    . GLN B 1 262 ? -11.203 -40.908 39.967  1.00 48.27  ? 599 GLN C H    1 
ATOM   9719  H HA   . GLN B 1 262 ? -12.446 -41.833 37.722  1.00 55.53  ? 599 GLN C HA   1 
ATOM   9720  H HB2  . GLN B 1 262 ? -13.591 -40.377 39.866  1.00 71.20  ? 599 GLN C HB2  1 
ATOM   9721  H HB3  . GLN B 1 262 ? -14.354 -40.615 38.494  1.00 71.20  ? 599 GLN C HB3  1 
ATOM   9722  H HG2  . GLN B 1 262 ? -14.214 -42.963 38.944  1.00 88.25  ? 599 GLN C HG2  1 
ATOM   9723  H HG3  . GLN B 1 262 ? -13.713 -42.581 40.403  1.00 88.25  ? 599 GLN C HG3  1 
ATOM   9724  H HE21 . GLN B 1 262 ? -15.902 -44.090 40.262  1.00 103.13 ? 599 GLN C HE21 1 
ATOM   9725  H HE22 . GLN B 1 262 ? -17.135 -43.342 40.636  1.00 103.13 ? 599 GLN C HE22 1 
ATOM   9726  N N    . ILE B 1 263 ? -12.053 -39.873 36.348  1.00 36.96  ? 600 ILE C N    1 
ATOM   9727  C CA   . ILE B 1 263 ? -11.693 -38.738 35.516  1.00 33.94  ? 600 ILE C CA   1 
ATOM   9728  C C    . ILE B 1 263 ? -12.916 -38.295 34.730  1.00 42.90  ? 600 ILE C C    1 
ATOM   9729  O O    . ILE B 1 263 ? -13.518 -39.081 34.006  1.00 43.99  ? 600 ILE C O    1 
ATOM   9730  C CB   . ILE B 1 263 ? -10.575 -39.123 34.546  1.00 36.08  ? 600 ILE C CB   1 
ATOM   9731  C CG1  . ILE B 1 263 ? -9.326  -39.538 35.337  1.00 34.59  ? 600 ILE C CG1  1 
ATOM   9732  C CG2  . ILE B 1 263 ? -10.279 -37.969 33.569  1.00 37.77  ? 600 ILE C CG2  1 
ATOM   9733  C CD1  . ILE B 1 263 ? -8.544  -40.624 34.676  1.00 49.14  ? 600 ILE C CD1  1 
ATOM   9734  H H    . ILE B 1 263 ? -12.302 -40.563 35.899  1.00 44.35  ? 600 ILE C H    1 
ATOM   9735  H HA   . ILE B 1 263 ? -11.387 -37.995 36.077  1.00 40.73  ? 600 ILE C HA   1 
ATOM   9736  H HB   . ILE B 1 263 ? -10.873 -39.888 34.028  1.00 43.30  ? 600 ILE C HB   1 
ATOM   9737  H HG12 . ILE B 1 263 ? -8.744  -38.767 35.433  1.00 41.51  ? 600 ILE C HG12 1 
ATOM   9738  H HG13 . ILE B 1 263 ? -9.599  -39.857 36.211  1.00 41.51  ? 600 ILE C HG13 1 
ATOM   9739  H HG21 . ILE B 1 263 ? -9.575  -38.237 32.973  1.00 45.32  ? 600 ILE C HG21 1 
ATOM   9740  H HG22 . ILE B 1 263 ? -11.074 -37.771 33.070  1.00 45.32  ? 600 ILE C HG22 1 
ATOM   9741  H HG23 . ILE B 1 263 ? -10.006 -37.198 34.072  1.00 45.32  ? 600 ILE C HG23 1 
ATOM   9742  H HD11 . ILE B 1 263 ? -7.781  -40.834 35.219  1.00 58.97  ? 600 ILE C HD11 1 
ATOM   9743  H HD12 . ILE B 1 263 ? -9.104  -41.398 34.582  1.00 58.97  ? 600 ILE C HD12 1 
ATOM   9744  H HD13 . ILE B 1 263 ? -8.258  -40.320 33.811  1.00 58.97  ? 600 ILE C HD13 1 
ATOM   9745  N N    . GLN B 1 264 ? -13.297 -37.040 34.902  1.00 36.87  ? 601 GLN C N    1 
ATOM   9746  C CA   . GLN B 1 264 ? -14.420 -36.494 34.176  1.00 41.10  ? 601 GLN C CA   1 
ATOM   9747  C C    . GLN B 1 264 ? -13.931 -35.909 32.857  1.00 42.73  ? 601 GLN C C    1 
ATOM   9748  O O    . GLN B 1 264 ? -12.935 -35.183 32.807  1.00 33.68  ? 601 GLN C O    1 
ATOM   9749  C CB   . GLN B 1 264 ? -15.142 -35.431 34.998  1.00 47.12  ? 601 GLN C CB   1 
ATOM   9750  C CG   . GLN B 1 264 ? -16.274 -34.758 34.234  1.00 56.75  ? 601 GLN C CG   1 
ATOM   9751  C CD   . GLN B 1 264 ? -17.424 -34.345 35.129  1.00 68.60  ? 601 GLN C CD   1 
ATOM   9752  O OE1  . GLN B 1 264 ? -17.361 -34.484 36.351  1.00 75.62  ? 601 GLN C OE1  1 
ATOM   9753  N NE2  . GLN B 1 264 ? -18.490 -33.840 34.520  1.00 75.31  ? 601 GLN C NE2  1 
ATOM   9754  H H    . GLN B 1 264 ? -12.917 -36.483 35.437  1.00 44.24  ? 601 GLN C H    1 
ATOM   9755  H HA   . GLN B 1 264 ? -15.056 -37.212 33.976  1.00 49.32  ? 601 GLN C HA   1 
ATOM   9756  H HB2  . GLN B 1 264 ? -15.520 -35.846 35.789  1.00 56.54  ? 601 GLN C HB2  1 
ATOM   9757  H HB3  . GLN B 1 264 ? -14.506 -34.745 35.256  1.00 56.54  ? 601 GLN C HB3  1 
ATOM   9758  H HG2  . GLN B 1 264 ? -15.932 -33.961 33.799  1.00 68.10  ? 601 GLN C HG2  1 
ATOM   9759  H HG3  . GLN B 1 264 ? -16.618 -35.376 33.571  1.00 68.10  ? 601 GLN C HG3  1 
ATOM   9760  H HE21 . GLN B 1 264 ? -18.500 -33.764 33.663  1.00 90.37  ? 601 GLN C HE21 1 
ATOM   9761  H HE22 . GLN B 1 264 ? -19.171 -33.590 34.982  1.00 90.37  ? 601 GLN C HE22 1 
ATOM   9762  N N    . LEU B 1 265 ? -14.653 -36.240 31.797  1.00 36.24  ? 602 LEU C N    1 
ATOM   9763  C CA   . LEU B 1 265 ? -14.316 -35.824 30.441  1.00 33.98  ? 602 LEU C CA   1 
ATOM   9764  C C    . LEU B 1 265 ? -15.491 -34.984 29.957  1.00 36.54  ? 602 LEU C C    1 
ATOM   9765  O O    . LEU B 1 265 ? -16.634 -35.442 29.976  1.00 33.44  ? 602 LEU C O    1 
ATOM   9766  C CB   . LEU B 1 265 ? -14.130 -37.068 29.571  1.00 45.14  ? 602 LEU C CB   1 
ATOM   9767  C CG   . LEU B 1 265 ? -13.474 -37.004 28.194  1.00 59.40  ? 602 LEU C CG   1 
ATOM   9768  C CD1  . LEU B 1 265 ? -12.056 -36.467 28.260  1.00 68.43  ? 602 LEU C CD1  1 
ATOM   9769  C CD2  . LEU B 1 265 ? -13.481 -38.401 27.600  1.00 56.36  ? 602 LEU C CD2  1 
ATOM   9770  H H    . LEU B 1 265 ? -15.366 -36.719 31.838  1.00 43.49  ? 602 LEU C H    1 
ATOM   9771  H HA   . LEU B 1 265 ? -13.497 -35.286 30.435  1.00 40.78  ? 602 LEU C HA   1 
ATOM   9772  H HB2  . LEU B 1 265 ? -13.605 -37.698 30.088  1.00 54.17  ? 602 LEU C HB2  1 
ATOM   9773  H HB3  . LEU B 1 265 ? -15.011 -37.448 29.429  1.00 54.17  ? 602 LEU C HB3  1 
ATOM   9774  H HG   . LEU B 1 265 ? -13.995 -36.424 27.617  1.00 71.28  ? 602 LEU C HG   1 
ATOM   9775  H HD11 . LEU B 1 265 ? -11.688 -36.447 27.374  1.00 82.11  ? 602 LEU C HD11 1 
ATOM   9776  H HD12 . LEU B 1 265 ? -12.075 -35.581 28.628  1.00 82.11  ? 602 LEU C HD12 1 
ATOM   9777  H HD13 . LEU B 1 265 ? -11.530 -37.043 28.820  1.00 82.11  ? 602 LEU C HD13 1 
ATOM   9778  H HD21 . LEU B 1 265 ? -13.071 -38.373 26.733  1.00 67.63  ? 602 LEU C HD21 1 
ATOM   9779  H HD22 . LEU B 1 265 ? -12.988 -38.988 28.178  1.00 67.63  ? 602 LEU C HD22 1 
ATOM   9780  H HD23 . LEU B 1 265 ? -14.389 -38.703 27.523  1.00 67.63  ? 602 LEU C HD23 1 
ATOM   9781  N N    . GLY B 1 266 ? -15.220 -33.742 29.569  1.00 25.38  ? 603 GLY C N    1 
ATOM   9782  C CA   . GLY B 1 266 ? -16.262 -32.860 29.081  1.00 34.66  ? 603 GLY C CA   1 
ATOM   9783  C C    . GLY B 1 266 ? -15.918 -32.330 27.701  1.00 33.62  ? 603 GLY C C    1 
ATOM   9784  O O    . GLY B 1 266 ? -14.802 -32.518 27.214  1.00 31.08  ? 603 GLY C O    1 
ATOM   9785  H H    . GLY B 1 266 ? -14.436 -33.389 29.580  1.00 30.46  ? 603 GLY C H    1 
ATOM   9786  H HA2  . GLY B 1 266 ? -17.102 -33.341 29.031  1.00 41.60  ? 603 GLY C HA2  1 
ATOM   9787  H HA3  . GLY B 1 266 ? -16.366 -32.109 29.686  1.00 41.60  ? 603 GLY C HA3  1 
ATOM   9788  N N    . PHE B 1 267 ? -16.882 -31.668 27.072  1.00 32.47  ? 604 PHE C N    1 
ATOM   9789  C CA   . PHE B 1 267 ? -16.701 -31.157 25.722  1.00 36.51  ? 604 PHE C CA   1 
ATOM   9790  C C    . PHE B 1 267 ? -17.387 -29.800 25.588  1.00 44.19  ? 604 PHE C C    1 
ATOM   9791  O O    . PHE B 1 267 ? -18.447 -29.585 26.167  1.00 42.54  ? 604 PHE C O    1 
ATOM   9792  C CB   . PHE B 1 267 ? -17.301 -32.129 24.713  1.00 33.39  ? 604 PHE C CB   1 
ATOM   9793  C CG   . PHE B 1 267 ? -16.850 -33.545 24.892  1.00 31.24  ? 604 PHE C CG   1 
ATOM   9794  C CD1  . PHE B 1 267 ? -17.384 -34.334 25.894  1.00 41.34  ? 604 PHE C CD1  1 
ATOM   9795  C CD2  . PHE B 1 267 ? -15.891 -34.093 24.051  1.00 32.53  ? 604 PHE C CD2  1 
ATOM   9796  C CE1  . PHE B 1 267 ? -16.969 -35.647 26.060  1.00 41.52  ? 604 PHE C CE1  1 
ATOM   9797  C CE2  . PHE B 1 267 ? -15.470 -35.398 24.207  1.00 38.27  ? 604 PHE C CE2  1 
ATOM   9798  C CZ   . PHE B 1 267 ? -16.009 -36.180 25.214  1.00 39.66  ? 604 PHE C CZ   1 
ATOM   9799  H H    . PHE B 1 267 ? -17.656 -31.502 27.409  1.00 38.96  ? 604 PHE C H    1 
ATOM   9800  H HA   . PHE B 1 267 ? -15.746 -31.050 25.531  1.00 43.81  ? 604 PHE C HA   1 
ATOM   9801  H HB2  . PHE B 1 267 ? -18.267 -32.113 24.801  1.00 40.07  ? 604 PHE C HB2  1 
ATOM   9802  H HB3  . PHE B 1 267 ? -17.047 -31.849 23.820  1.00 40.07  ? 604 PHE C HB3  1 
ATOM   9803  H HD1  . PHE B 1 267 ? -18.028 -33.979 26.464  1.00 49.60  ? 604 PHE C HD1  1 
ATOM   9804  H HD2  . PHE B 1 267 ? -15.525 -33.571 23.373  1.00 39.04  ? 604 PHE C HD2  1 
ATOM   9805  H HE1  . PHE B 1 267 ? -17.334 -36.168 26.738  1.00 49.83  ? 604 PHE C HE1  1 
ATOM   9806  H HE2  . PHE B 1 267 ? -14.826 -35.751 23.637  1.00 45.93  ? 604 PHE C HE2  1 
ATOM   9807  H HZ   . PHE B 1 267 ? -15.729 -37.060 25.322  1.00 47.59  ? 604 PHE C HZ   1 
ATOM   9808  N N    . ALA B 1 268 ? -16.779 -28.892 24.828  1.00 34.00  ? 605 ALA C N    1 
ATOM   9809  C CA   . ALA B 1 268 ? -17.379 -27.589 24.543  1.00 33.46  ? 605 ALA C CA   1 
ATOM   9810  C C    . ALA B 1 268 ? -17.277 -27.329 23.045  1.00 41.69  ? 605 ALA C C    1 
ATOM   9811  O O    . ALA B 1 268 ? -16.270 -27.662 22.424  1.00 32.96  ? 605 ALA C O    1 
ATOM   9812  C CB   . ALA B 1 268 ? -16.676 -26.492 25.318  1.00 38.17  ? 605 ALA C CB   1 
ATOM   9813  H H    . ALA B 1 268 ? -16.010 -29.008 24.461  1.00 40.80  ? 605 ALA C H    1 
ATOM   9814  H HA   . ALA B 1 268 ? -18.325 -27.598 24.797  1.00 40.15  ? 605 ALA C HA   1 
ATOM   9815  H HB1  . ALA B 1 268 ? -17.089 -25.651 25.112  1.00 45.80  ? 605 ALA C HB1  1 
ATOM   9816  H HB2  . ALA B 1 268 ? -16.754 -26.675 26.257  1.00 45.80  ? 605 ALA C HB2  1 
ATOM   9817  H HB3  . ALA B 1 268 ? -15.751 -26.474 25.063  1.00 45.80  ? 605 ALA C HB3  1 
ATOM   9818  N N    . ALA B 1 269 ? -18.313 -26.730 22.464  1.00 41.57  ? 606 ALA C N    1 
ATOM   9819  C CA   . ALA B 1 269 ? -18.342 -26.482 21.027  1.00 34.17  ? 606 ALA C CA   1 
ATOM   9820  C C    . ALA B 1 269 ? -17.963 -25.040 20.724  1.00 44.65  ? 606 ALA C C    1 
ATOM   9821  O O    . ALA B 1 269 ? -18.501 -24.114 21.327  1.00 43.60  ? 606 ALA C O    1 
ATOM   9822  C CB   . ALA B 1 269 ? -19.722 -26.799 20.463  1.00 38.64  ? 606 ALA C CB   1 
ATOM   9823  H H    . ALA B 1 269 ? -19.014 -26.457 22.882  1.00 49.89  ? 606 ALA C H    1 
ATOM   9824  H HA   . ALA B 1 269 ? -17.691 -27.068 20.587  1.00 41.01  ? 606 ALA C HA   1 
ATOM   9825  H HB1  . ALA B 1 269 ? -19.719 -26.630 19.518  1.00 46.37  ? 606 ALA C HB1  1 
ATOM   9826  H HB2  . ALA B 1 269 ? -19.923 -27.723 20.630  1.00 46.37  ? 606 ALA C HB2  1 
ATOM   9827  H HB3  . ALA B 1 269 ? -20.372 -26.240 20.895  1.00 46.37  ? 606 ALA C HB3  1 
ATOM   9828  N N    . GLU B 1 270 ? -17.038 -24.856 19.786  1.00 33.53  ? 607 GLU C N    1 
ATOM   9829  C CA   . GLU B 1 270 ? -16.564 -23.527 19.417  1.00 32.56  ? 607 GLU C CA   1 
ATOM   9830  C C    . GLU B 1 270 ? -17.062 -23.162 18.010  1.00 25.00  ? 607 GLU C C    1 
ATOM   9831  O O    . GLU B 1 270 ? -17.558 -22.057 17.787  1.00 32.80  ? 607 GLU C O    1 
ATOM   9832  C CB   . GLU B 1 270 ? -15.043 -23.492 19.490  1.00 37.81  ? 607 GLU C CB   1 
ATOM   9833  C CG   . GLU B 1 270 ? -14.425 -22.118 19.375  1.00 35.22  ? 607 GLU C CG   1 
ATOM   9834  C CD   . GLU B 1 270 ? -12.926 -22.161 19.610  1.00 39.46  ? 607 GLU C CD   1 
ATOM   9835  O OE1  . GLU B 1 270 ? -12.475 -23.067 20.344  1.00 40.81  ? 607 GLU C OE1  1 
ATOM   9836  O OE2  . GLU B 1 270 ? -12.193 -21.313 19.055  1.00 31.75  ? 607 GLU C OE2  1 
ATOM   9837  H H    . GLU B 1 270 ? -16.667 -25.493 19.344  1.00 40.23  ? 607 GLU C H    1 
ATOM   9838  H HA   . GLU B 1 270 ? -16.919 -22.868 20.050  1.00 39.08  ? 607 GLU C HA   1 
ATOM   9839  H HB2  . GLU B 1 270 ? -14.767 -23.866 20.341  1.00 45.37  ? 607 GLU C HB2  1 
ATOM   9840  H HB3  . GLU B 1 270 ? -14.688 -24.033 18.768  1.00 45.37  ? 607 GLU C HB3  1 
ATOM   9841  H HG2  . GLU B 1 270 ? -14.583 -21.770 18.484  1.00 42.26  ? 607 GLU C HG2  1 
ATOM   9842  H HG3  . GLU B 1 270 ? -14.821 -21.533 20.040  1.00 42.26  ? 607 GLU C HG3  1 
ATOM   9843  N N    . PHE B 1 271 ? -16.903 -24.103 17.076  1.00 23.94  ? 608 PHE C N    1 
ATOM   9844  C CA   . PHE B 1 271 ? -17.522 -24.041 15.751  1.00 29.39  ? 608 PHE C CA   1 
ATOM   9845  C C    . PHE B 1 271 ? -17.994 -25.449 15.390  1.00 21.26  ? 608 PHE C C    1 
ATOM   9846  O O    . PHE B 1 271 ? -17.706 -26.395 16.111  1.00 25.23  ? 608 PHE C O    1 
ATOM   9847  C CB   . PHE B 1 271 ? -16.533 -23.527 14.702  1.00 31.08  ? 608 PHE C CB   1 
ATOM   9848  C CG   . PHE B 1 271 ? -15.978 -22.173 15.013  1.00 25.17  ? 608 PHE C CG   1 
ATOM   9849  C CD1  . PHE B 1 271 ? -16.578 -21.030 14.514  1.00 27.83  ? 608 PHE C CD1  1 
ATOM   9850  C CD2  . PHE B 1 271 ? -14.868 -22.041 15.826  1.00 32.65  ? 608 PHE C CD2  1 
ATOM   9851  C CE1  . PHE B 1 271 ? -16.072 -19.781 14.810  1.00 31.80  ? 608 PHE C CE1  1 
ATOM   9852  C CE2  . PHE B 1 271 ? -14.359 -20.791 16.128  1.00 42.58  ? 608 PHE C CE2  1 
ATOM   9853  C CZ   . PHE B 1 271 ? -14.966 -19.662 15.622  1.00 41.85  ? 608 PHE C CZ   1 
ATOM   9854  H H    . PHE B 1 271 ? -16.425 -24.809 17.192  1.00 28.73  ? 608 PHE C H    1 
ATOM   9855  H HA   . PHE B 1 271 ? -18.298 -23.443 15.774  1.00 35.27  ? 608 PHE C HA   1 
ATOM   9856  H HB2  . PHE B 1 271 ? -15.789 -24.147 14.643  1.00 37.30  ? 608 PHE C HB2  1 
ATOM   9857  H HB3  . PHE B 1 271 ? -16.985 -23.473 13.845  1.00 37.30  ? 608 PHE C HB3  1 
ATOM   9858  H HD1  . PHE B 1 271 ? -17.328 -21.105 13.969  1.00 33.40  ? 608 PHE C HD1  1 
ATOM   9859  H HD2  . PHE B 1 271 ? -14.458 -22.801 16.173  1.00 39.18  ? 608 PHE C HD2  1 
ATOM   9860  H HE1  . PHE B 1 271 ? -16.482 -19.020 14.467  1.00 38.16  ? 608 PHE C HE1  1 
ATOM   9861  H HE2  . PHE B 1 271 ? -13.610 -20.712 16.673  1.00 51.10  ? 608 PHE C HE2  1 
ATOM   9862  H HZ   . PHE B 1 271 ? -14.622 -18.821 15.820  1.00 50.22  ? 608 PHE C HZ   1 
ATOM   9863  N N    . SER B 1 272 ? -18.735 -25.593 14.294  1.00 24.38  ? 609 SER C N    1 
ATOM   9864  C CA   . SER B 1 272 ? -19.199 -26.912 13.904  1.00 27.16  ? 609 SER C CA   1 
ATOM   9865  C C    . SER B 1 272 ? -18.035 -27.870 13.656  1.00 32.08  ? 609 SER C C    1 
ATOM   9866  O O    . SER B 1 272 ? -18.206 -29.079 13.738  1.00 33.84  ? 609 SER C O    1 
ATOM   9867  C CB   . SER B 1 272 ? -20.084 -26.837 12.670  1.00 26.02  ? 609 SER C CB   1 
ATOM   9868  O OG   . SER B 1 272 ? -21.147 -25.916 12.873  1.00 36.43  ? 609 SER C OG   1 
ATOM   9869  H H    . SER B 1 272 ? -18.976 -24.955 13.771  1.00 29.26  ? 609 SER C H    1 
ATOM   9870  H HA   . SER B 1 272 ? -19.738 -27.283 14.634  1.00 32.59  ? 609 SER C HA   1 
ATOM   9871  H HB2  . SER B 1 272 ? -19.550 -26.542 11.916  1.00 31.22  ? 609 SER C HB2  1 
ATOM   9872  H HB3  . SER B 1 272 ? -20.455 -27.715 12.493  1.00 31.22  ? 609 SER C HB3  1 
ATOM   9873  H HG   . SER B 1 272 ? -21.619 -25.882 12.203  1.00 43.72  ? 609 SER C HG   1 
ATOM   9874  N N    . ASN B 1 273 ? -16.853 -27.342 13.358  1.00 28.26  ? 610 ASN C N    1 
ATOM   9875  C CA   . ASN B 1 273 ? -15.690 -28.208 13.192  1.00 23.07  ? 610 ASN C CA   1 
ATOM   9876  C C    . ASN B 1 273 ? -14.592 -27.979 14.221  1.00 29.48  ? 610 ASN C C    1 
ATOM   9877  O O    . ASN B 1 273 ? -13.438 -28.341 13.986  1.00 28.30  ? 610 ASN C O    1 
ATOM   9878  C CB   . ASN B 1 273 ? -15.123 -28.120 11.766  1.00 21.54  ? 610 ASN C CB   1 
ATOM   9879  C CG   . ASN B 1 273 ? -14.534 -26.751 11.430  1.00 26.78  ? 610 ASN C CG   1 
ATOM   9880  O OD1  . ASN B 1 273 ? -14.932 -25.729 11.978  1.00 26.00  ? 610 ASN C OD1  1 
ATOM   9881  N ND2  . ASN B 1 273 ? -13.596 -26.735 10.486  1.00 27.86  ? 610 ASN C ND2  1 
ATOM   9882  H H    . ASN B 1 273 ? -16.698 -26.503 13.249  1.00 33.91  ? 610 ASN C H    1 
ATOM   9883  H HA   . ASN B 1 273 ? -15.994 -29.132 13.313  1.00 27.68  ? 610 ASN C HA   1 
ATOM   9884  H HB2  . ASN B 1 273 ? -14.418 -28.779 11.667  1.00 25.85  ? 610 ASN C HB2  1 
ATOM   9885  H HB3  . ASN B 1 273 ? -15.835 -28.301 11.133  1.00 25.85  ? 610 ASN C HB3  1 
ATOM   9886  H HD21 . ASN B 1 273 ? -13.356 -27.467 10.106  1.00 33.43  ? 610 ASN C HD21 1 
ATOM   9887  H HD22 . ASN B 1 273 ? -13.230 -25.991 10.257  1.00 33.43  ? 610 ASN C HD22 1 
ATOM   9888  N N    . VAL B 1 274 ? -14.949 -27.419 15.376  1.00 24.00  ? 611 VAL C N    1 
ATOM   9889  C CA   . VAL B 1 274 ? -13.961 -27.178 16.424  1.00 20.79  ? 611 VAL C CA   1 
ATOM   9890  C C    . VAL B 1 274 ? -14.537 -27.462 17.818  1.00 25.48  ? 611 VAL C C    1 
ATOM   9891  O O    . VAL B 1 274 ? -15.552 -26.911 18.213  1.00 30.25  ? 611 VAL C O    1 
ATOM   9892  C CB   . VAL B 1 274 ? -13.402 -25.744 16.366  1.00 27.11  ? 611 VAL C CB   1 
ATOM   9893  C CG1  . VAL B 1 274 ? -12.298 -25.565 17.395  1.00 28.83  ? 611 VAL C CG1  1 
ATOM   9894  C CG2  . VAL B 1 274 ? -12.875 -25.433 14.955  1.00 29.50  ? 611 VAL C CG2  1 
ATOM   9895  H H    . VAL B 1 274 ? -15.749 -27.173 15.575  1.00 28.80  ? 611 VAL C H    1 
ATOM   9896  H HA   . VAL B 1 274 ? -13.209 -27.791 16.287  1.00 24.95  ? 611 VAL C HA   1 
ATOM   9897  H HB   . VAL B 1 274 ? -14.120 -25.109 16.572  1.00 32.53  ? 611 VAL C HB   1 
ATOM   9898  H HG11 . VAL B 1 274 ? -11.965 -24.666 17.342  1.00 34.60  ? 611 VAL C HG11 1 
ATOM   9899  H HG12 . VAL B 1 274 ? -12.657 -25.730 18.270  1.00 34.60  ? 611 VAL C HG12 1 
ATOM   9900  H HG13 . VAL B 1 274 ? -11.593 -26.188 17.207  1.00 34.60  ? 611 VAL C HG13 1 
ATOM   9901  H HG21 . VAL B 1 274 ? -12.532 -24.537 14.940  1.00 35.39  ? 611 VAL C HG21 1 
ATOM   9902  H HG22 . VAL B 1 274 ? -12.176 -26.055 14.739  1.00 35.39  ? 611 VAL C HG22 1 
ATOM   9903  H HG23 . VAL B 1 274 ? -13.596 -25.519 14.327  1.00 35.39  ? 611 VAL C HG23 1 
ATOM   9904  N N    . MET B 1 275 ? -13.871 -28.340 18.551  1.00 25.92  ? 612 MET C N    1 
ATOM   9905  C CA   . MET B 1 275 ? -14.377 -28.811 19.834  1.00 25.51  ? 612 MET C CA   1 
ATOM   9906  C C    . MET B 1 275 ? -13.240 -28.770 20.840  1.00 32.14  ? 612 MET C C    1 
ATOM   9907  O O    . MET B 1 275 ? -12.092 -29.047 20.494  1.00 27.64  ? 612 MET C O    1 
ATOM   9908  C CB   . MET B 1 275 ? -14.888 -30.250 19.685  1.00 31.32  ? 612 MET C CB   1 
ATOM   9909  C CG   . MET B 1 275 ? -15.521 -30.825 20.924  1.00 34.41  ? 612 MET C CG   1 
ATOM   9910  S SD   . MET B 1 275 ? -16.326 -32.409 20.619  1.00 35.56  ? 612 MET C SD   1 
ATOM   9911  C CE   . MET B 1 275 ? -14.901 -33.449 20.219  1.00 26.95  ? 612 MET C CE   1 
ATOM   9912  H H    . MET B 1 275 ? -13.115 -28.684 18.327  1.00 31.10  ? 612 MET C H    1 
ATOM   9913  H HA   . MET B 1 275 ? -15.113 -28.239 20.136  1.00 30.61  ? 612 MET C HA   1 
ATOM   9914  H HB2  . MET B 1 275 ? -15.553 -30.271 18.979  1.00 37.58  ? 612 MET C HB2  1 
ATOM   9915  H HB3  . MET B 1 275 ? -14.140 -30.821 19.445  1.00 37.58  ? 612 MET C HB3  1 
ATOM   9916  H HG2  . MET B 1 275 ? -14.835 -30.962 21.596  1.00 41.29  ? 612 MET C HG2  1 
ATOM   9917  H HG3  . MET B 1 275 ? -16.191 -30.206 21.254  1.00 41.29  ? 612 MET C HG3  1 
ATOM   9918  H HE1  . MET B 1 275 ? -15.207 -34.340 20.032  1.00 32.34  ? 612 MET C HE1  1 
ATOM   9919  H HE2  . MET B 1 275 ? -14.456 -33.087 19.449  1.00 32.34  ? 612 MET C HE2  1 
ATOM   9920  H HE3  . MET B 1 275 ? -14.301 -33.459 20.969  1.00 32.34  ? 612 MET C HE3  1 
ATOM   9921  N N    . ILE B 1 276 ? -13.567 -28.409 22.076  1.00 27.73  ? 613 ILE C N    1 
ATOM   9922  C CA   . ILE B 1 276 ? -12.616 -28.391 23.169  1.00 29.16  ? 613 ILE C CA   1 
ATOM   9923  C C    . ILE B 1 276 ? -12.954 -29.554 24.065  1.00 32.04  ? 613 ILE C C    1 
ATOM   9924  O O    . ILE B 1 276 ? -14.099 -29.701 24.469  1.00 35.22  ? 613 ILE C O    1 
ATOM   9925  C CB   . ILE B 1 276 ? -12.753 -27.127 24.035  1.00 37.01  ? 613 ILE C CB   1 
ATOM   9926  C CG1  . ILE B 1 276 ? -12.723 -25.868 23.165  1.00 45.26  ? 613 ILE C CG1  1 
ATOM   9927  C CG2  . ILE B 1 276 ? -11.658 -27.101 25.087  1.00 37.42  ? 613 ILE C CG2  1 
ATOM   9928  C CD1  . ILE B 1 276 ? -11.447 -25.695 22.389  1.00 44.12  ? 613 ILE C CD1  1 
ATOM   9929  H H    . ILE B 1 276 ? -14.358 -28.164 22.308  1.00 33.28  ? 613 ILE C H    1 
ATOM   9930  H HA   . ILE B 1 276 ? -11.697 -28.477 22.840  1.00 34.99  ? 613 ILE C HA   1 
ATOM   9931  H HB   . ILE B 1 276 ? -13.609 -27.162 24.489  1.00 44.42  ? 613 ILE C HB   1 
ATOM   9932  H HG12 . ILE B 1 276 ? -13.453 -25.911 22.528  1.00 54.31  ? 613 ILE C HG12 1 
ATOM   9933  H HG13 . ILE B 1 276 ? -12.830 -25.091 23.736  1.00 54.31  ? 613 ILE C HG13 1 
ATOM   9934  H HG21 . ILE B 1 276 ? -11.756 -26.308 25.619  1.00 44.91  ? 613 ILE C HG21 1 
ATOM   9935  H HG22 . ILE B 1 276 ? -11.740 -27.881 25.642  1.00 44.91  ? 613 ILE C HG22 1 
ATOM   9936  H HG23 . ILE B 1 276 ? -10.804 -27.099 24.649  1.00 44.91  ? 613 ILE C HG23 1 
ATOM   9937  H HD11 . ILE B 1 276 ? -11.504 -24.889 21.871  1.00 52.94  ? 613 ILE C HD11 1 
ATOM   9938  H HD12 . ILE B 1 276 ? -10.713 -25.638 23.005  1.00 52.94  ? 613 ILE C HD12 1 
ATOM   9939  H HD13 . ILE B 1 276 ? -11.330 -26.450 21.808  1.00 52.94  ? 613 ILE C HD13 1 
ATOM   9940  N N    . ILE B 1 277 ? -11.963 -30.394 24.342  1.00 28.02  ? 614 ILE C N    1 
ATOM   9941  C CA   . ILE B 1 277 ? -12.110 -31.477 25.296  1.00 25.84  ? 614 ILE C CA   1 
ATOM   9942  C C    . ILE B 1 277 ? -11.372 -31.047 26.550  1.00 36.20  ? 614 ILE C C    1 
ATOM   9943  O O    . ILE B 1 277 ? -10.289 -30.462 26.461  1.00 28.29  ? 614 ILE C O    1 
ATOM   9944  C CB   . ILE B 1 277 ? -11.483 -32.776 24.759  1.00 22.77  ? 614 ILE C CB   1 
ATOM   9945  C CG1  . ILE B 1 277 ? -12.114 -33.144 23.414  1.00 28.10  ? 614 ILE C CG1  1 
ATOM   9946  C CG2  . ILE B 1 277 ? -11.661 -33.930 25.775  1.00 32.29  ? 614 ILE C CG2  1 
ATOM   9947  C CD1  . ILE B 1 277 ? -11.476 -34.369 22.758  1.00 37.91  ? 614 ILE C CD1  1 
ATOM   9948  H H    . ILE B 1 277 ? -11.183 -30.353 23.983  1.00 33.62  ? 614 ILE C H    1 
ATOM   9949  H HA   . ILE B 1 277 ? -13.056 -31.628 25.505  1.00 31.00  ? 614 ILE C HA   1 
ATOM   9950  H HB   . ILE B 1 277 ? -10.534 -32.628 24.624  1.00 27.33  ? 614 ILE C HB   1 
ATOM   9951  H HG12 . ILE B 1 277 ? -13.055 -33.336 23.550  1.00 33.72  ? 614 ILE C HG12 1 
ATOM   9952  H HG13 . ILE B 1 277 ? -12.015 -32.395 22.805  1.00 33.72  ? 614 ILE C HG13 1 
ATOM   9953  H HG21 . ILE B 1 277 ? -11.262 -34.726 25.416  1.00 38.75  ? 614 ILE C HG21 1 
ATOM   9954  H HG22 . ILE B 1 277 ? -11.230 -33.690 26.598  1.00 38.75  ? 614 ILE C HG22 1 
ATOM   9955  H HG23 . ILE B 1 277 ? -12.598 -34.073 25.925  1.00 38.75  ? 614 ILE C HG23 1 
ATOM   9956  H HD11 . ILE B 1 277 ? -11.917 -34.541 21.924  1.00 45.49  ? 614 ILE C HD11 1 
ATOM   9957  H HD12 . ILE B 1 277 ? -10.545 -34.192 22.606  1.00 45.49  ? 614 ILE C HD12 1 
ATOM   9958  H HD13 . ILE B 1 277 ? -11.575 -35.123 23.344  1.00 45.49  ? 614 ILE C HD13 1 
ATOM   9959  N N    . TYR B 1 278 ? -11.946 -31.329 27.716  1.00 36.46  ? 615 TYR C N    1 
ATOM   9960  C CA   . TYR B 1 278 ? -11.265 -31.021 28.963  1.00 33.97  ? 615 TYR C CA   1 
ATOM   9961  C C    . TYR B 1 278 ? -11.437 -32.153 29.984  1.00 34.39  ? 615 TYR C C    1 
ATOM   9962  O O    . TYR B 1 278 ? -12.472 -32.816 30.030  1.00 32.23  ? 615 TYR C O    1 
ATOM   9963  C CB   . TYR B 1 278 ? -11.727 -29.666 29.516  1.00 28.07  ? 615 TYR C CB   1 
ATOM   9964  C CG   . TYR B 1 278 ? -13.225 -29.505 29.639  1.00 31.38  ? 615 TYR C CG   1 
ATOM   9965  C CD1  . TYR B 1 278 ? -13.869 -29.726 30.850  1.00 43.30  ? 615 TYR C CD1  1 
ATOM   9966  C CD2  . TYR B 1 278 ? -13.991 -29.119 28.550  1.00 40.05  ? 615 TYR C CD2  1 
ATOM   9967  C CE1  . TYR B 1 278 ? -15.235 -29.576 30.968  1.00 46.96  ? 615 TYR C CE1  1 
ATOM   9968  C CE2  . TYR B 1 278 ? -15.358 -28.966 28.660  1.00 45.64  ? 615 TYR C CE2  1 
ATOM   9969  C CZ   . TYR B 1 278 ? -15.976 -29.197 29.868  1.00 50.40  ? 615 TYR C CZ   1 
ATOM   9970  O OH   . TYR B 1 278 ? -17.340 -29.041 29.979  1.00 55.10  ? 615 TYR C OH   1 
ATOM   9971  H H    . TYR B 1 278 ? -12.719 -31.694 27.810  1.00 43.75  ? 615 TYR C H    1 
ATOM   9972  H HA   . TYR B 1 278 ? -10.306 -30.945 28.776  1.00 40.76  ? 615 TYR C HA   1 
ATOM   9973  H HB2  . TYR B 1 278 ? -11.346 -29.547 30.400  1.00 33.68  ? 615 TYR C HB2  1 
ATOM   9974  H HB3  . TYR B 1 278 ? -11.404 -28.966 28.926  1.00 33.68  ? 615 TYR C HB3  1 
ATOM   9975  H HD1  . TYR B 1 278 ? -13.372 -29.984 31.592  1.00 51.96  ? 615 TYR C HD1  1 
ATOM   9976  H HD2  . TYR B 1 278 ? -13.577 -28.964 27.732  1.00 48.06  ? 615 TYR C HD2  1 
ATOM   9977  H HE1  . TYR B 1 278 ? -15.654 -29.730 31.784  1.00 56.36  ? 615 TYR C HE1  1 
ATOM   9978  H HE2  . TYR B 1 278 ? -15.860 -28.709 27.920  1.00 54.77  ? 615 TYR C HE2  1 
ATOM   9979  H HH   . TYR B 1 278 ? -17.723 -29.554 29.467  1.00 66.12  ? 615 TYR C HH   1 
ATOM   9980  N N    . THR B 1 279 ? -10.396 -32.394 30.770  1.00 33.08  ? 616 THR C N    1 
ATOM   9981  C CA   . THR B 1 279 ? -10.412 -33.481 31.739  1.00 34.71  ? 616 THR C CA   1 
ATOM   9982  C C    . THR B 1 279 ? -10.080 -32.933 33.111  1.00 41.15  ? 616 THR C C    1 
ATOM   9983  O O    . THR B 1 279 ? -9.355  -31.947 33.238  1.00 41.77  ? 616 THR C O    1 
ATOM   9984  C CB   . THR B 1 279 ? -9.352  -34.546 31.430  1.00 34.15  ? 616 THR C CB   1 
ATOM   9985  O OG1  . THR B 1 279 ? -8.087  -33.899 31.251  1.00 31.25  ? 616 THR C OG1  1 
ATOM   9986  C CG2  . THR B 1 279 ? -9.703  -35.337 30.186  1.00 41.43  ? 616 THR C CG2  1 
ATOM   9987  H H    . THR B 1 279 ? -9.665  -31.941 30.761  1.00 39.70  ? 616 THR C H    1 
ATOM   9988  H HA   . THR B 1 279 ? -11.297 -33.902 31.764  1.00 41.66  ? 616 THR C HA   1 
ATOM   9989  H HB   . THR B 1 279 ? -9.292  -35.163 32.175  1.00 40.98  ? 616 THR C HB   1 
ATOM   9990  H HG1  . THR B 1 279 ? -8.130  -33.366 30.629  1.00 37.50  ? 616 THR C HG1  1 
ATOM   9991  H HG21 . THR B 1 279 ? -9.026  -35.995 30.014  1.00 49.72  ? 616 THR C HG21 1 
ATOM   9992  H HG22 . THR B 1 279 ? -10.546 -35.780 30.307  1.00 49.72  ? 616 THR C HG22 1 
ATOM   9993  H HG23 . THR B 1 279 ? -9.766  -34.748 29.430  1.00 49.72  ? 616 THR C HG23 1 
ATOM   9994  N N    . SER B 1 280 ? -10.599 -33.589 34.137  1.00 45.55  ? 617 SER C N    1 
ATOM   9995  C CA   . SER B 1 280 ? -10.255 -33.248 35.505  1.00 46.20  ? 617 SER C CA   1 
ATOM   9996  C C    . SER B 1 280 ? -10.444 -34.476 36.373  1.00 39.52  ? 617 SER C C    1 
ATOM   9997  O O    . SER B 1 280 ? -11.208 -35.381 36.028  1.00 37.43  ? 617 SER C O    1 
ATOM   9998  C CB   . SER B 1 280 ? -11.130 -32.099 36.003  1.00 44.21  ? 617 SER C CB   1 
ATOM   9999  O OG   . SER B 1 280 ? -12.498 -32.465 35.996  1.00 36.15  ? 617 SER C OG   1 
ATOM   10000 H H    . SER B 1 280 ? -11.156 -34.241 34.066  1.00 54.66  ? 617 SER C H    1 
ATOM   10001 H HA   . SER B 1 280 ? -9.315  -32.972 35.551  1.00 55.44  ? 617 SER C HA   1 
ATOM   10002 H HB2  . SER B 1 280 ? -10.868 -31.873 36.910  1.00 53.06  ? 617 SER C HB2  1 
ATOM   10003 H HB3  . SER B 1 280 ? -11.005 -31.332 35.422  1.00 53.06  ? 617 SER C HB3  1 
ATOM   10004 H HG   . SER B 1 280 ? -12.957 -31.841 36.265  1.00 43.38  ? 617 SER C HG   1 
ATOM   10005 N N    . ILE B 1 281 ? -9.737  -34.513 37.498  1.00 38.86  ? 618 ILE C N    1 
ATOM   10006 C CA   . ILE B 1 281 ? -9.902  -35.586 38.464  1.00 33.17  ? 618 ILE C CA   1 
ATOM   10007 C C    . ILE B 1 281 ? -11.095 -35.259 39.341  1.00 42.31  ? 618 ILE C C    1 
ATOM   10008 O O    . ILE B 1 281 ? -11.117 -34.210 39.987  1.00 54.84  ? 618 ILE C O    1 
ATOM   10009 C CB   . ILE B 1 281 ? -8.665  -35.708 39.386  1.00 28.38  ? 618 ILE C CB   1 
ATOM   10010 C CG1  . ILE B 1 281 ? -7.390  -35.845 38.552  1.00 45.00  ? 618 ILE C CG1  1 
ATOM   10011 C CG2  . ILE B 1 281 ? -8.821  -36.895 40.329  1.00 40.64  ? 618 ILE C CG2  1 
ATOM   10012 C CD1  . ILE B 1 281 ? -7.330  -37.115 37.738  1.00 54.72  ? 618 ILE C CD1  1 
ATOM   10013 H H    . ILE B 1 281 ? -9.153  -33.923 37.725  1.00 46.64  ? 618 ILE C H    1 
ATOM   10014 H HA   . ILE B 1 281 ? -10.056 -36.439 38.007  1.00 39.81  ? 618 ILE C HA   1 
ATOM   10015 H HB   . ILE B 1 281 ? -8.598  -34.900 39.918  1.00 34.06  ? 618 ILE C HB   1 
ATOM   10016 H HG12 . ILE B 1 281 ? -7.336  -35.096 37.938  1.00 54.01  ? 618 ILE C HG12 1 
ATOM   10017 H HG13 . ILE B 1 281 ? -6.625  -35.838 39.148  1.00 54.01  ? 618 ILE C HG13 1 
ATOM   10018 H HG21 . ILE B 1 281 ? -8.044  -36.952 40.890  1.00 48.77  ? 618 ILE C HG21 1 
ATOM   10019 H HG22 . ILE B 1 281 ? -9.605  -36.766 40.867  1.00 48.77  ? 618 ILE C HG22 1 
ATOM   10020 H HG23 . ILE B 1 281 ? -8.908  -37.698 39.808  1.00 48.77  ? 618 ILE C HG23 1 
ATOM   10021 H HD11 . ILE B 1 281 ? -6.507  -37.131 37.244  1.00 65.67  ? 618 ILE C HD11 1 
ATOM   10022 H HD12 . ILE B 1 281 ? -7.371  -37.868 38.332  1.00 65.67  ? 618 ILE C HD12 1 
ATOM   10023 H HD13 . ILE B 1 281 ? -8.076  -37.134 37.133  1.00 65.67  ? 618 ILE C HD13 1 
ATOM   10024 N N    . VAL B 1 282 ? -12.090 -36.139 39.366  1.00 39.06  ? 619 VAL C N    1 
ATOM   10025 C CA   . VAL B 1 282 ? -13.231 -35.936 40.252  1.00 53.34  ? 619 VAL C CA   1 
ATOM   10026 C C    . VAL B 1 282 ? -13.157 -36.792 41.523  1.00 59.50  ? 619 VAL C C    1 
ATOM   10027 O O    . VAL B 1 282 ? -13.759 -36.433 42.534  1.00 60.42  ? 619 VAL C O    1 
ATOM   10028 C CB   . VAL B 1 282 ? -14.576 -36.179 39.534  1.00 49.01  ? 619 VAL C CB   1 
ATOM   10029 C CG1  . VAL B 1 282 ? -14.749 -35.183 38.404  1.00 50.55  ? 619 VAL C CG1  1 
ATOM   10030 C CG2  . VAL B 1 282 ? -14.673 -37.605 39.026  1.00 51.14  ? 619 VAL C CG2  1 
ATOM   10031 H H    . VAL B 1 282 ? -12.129 -36.852 38.886  1.00 46.87  ? 619 VAL C H    1 
ATOM   10032 H HA   . VAL B 1 282 ? -13.226 -34.999 40.538  1.00 64.01  ? 619 VAL C HA   1 
ATOM   10033 H HB   . VAL B 1 282 ? -15.305 -36.037 40.173  1.00 58.82  ? 619 VAL C HB   1 
ATOM   10034 H HG11 . VAL B 1 282 ? -15.589 -35.348 37.969  1.00 60.66  ? 619 VAL C HG11 1 
ATOM   10035 H HG12 . VAL B 1 282 ? -14.736 -34.294 38.766  1.00 60.66  ? 619 VAL C HG12 1 
ATOM   10036 H HG13 . VAL B 1 282 ? -14.029 -35.293 37.779  1.00 60.66  ? 619 VAL C HG13 1 
ATOM   10037 H HG21 . VAL B 1 282 ? -15.519 -37.722 38.586  1.00 61.36  ? 619 VAL C HG21 1 
ATOM   10038 H HG22 . VAL B 1 282 ? -13.957 -37.766 38.408  1.00 61.36  ? 619 VAL C HG22 1 
ATOM   10039 H HG23 . VAL B 1 282 ? -14.605 -38.207 39.771  1.00 61.36  ? 619 VAL C HG23 1 
ATOM   10040 N N    . TYR B 1 283 ? -12.433 -37.911 41.480  1.00 50.85  ? 620 TYR C N    1 
ATOM   10041 C CA   . TYR B 1 283 ? -12.223 -38.723 42.689  1.00 51.41  ? 620 TYR C CA   1 
ATOM   10042 C C    . TYR B 1 283 ? -10.874 -39.439 42.689  1.00 47.27  ? 620 TYR C C    1 
ATOM   10043 O O    . TYR B 1 283 ? -10.480 -40.051 41.696  1.00 44.80  ? 620 TYR C O    1 
ATOM   10044 C CB   . TYR B 1 283 ? -13.345 -39.756 42.868  1.00 53.50  ? 620 TYR C CB   1 
ATOM   10045 C CG   . TYR B 1 283 ? -13.084 -40.753 43.987  1.00 60.77  ? 620 TYR C CG   1 
ATOM   10046 C CD1  . TYR B 1 283 ? -12.691 -42.057 43.705  1.00 57.66  ? 620 TYR C CD1  1 
ATOM   10047 C CD2  . TYR B 1 283 ? -13.222 -40.388 45.322  1.00 68.27  ? 620 TYR C CD2  1 
ATOM   10048 C CE1  . TYR B 1 283 ? -12.448 -42.971 44.720  1.00 68.31  ? 620 TYR C CE1  1 
ATOM   10049 C CE2  . TYR B 1 283 ? -12.979 -41.299 46.348  1.00 67.12  ? 620 TYR C CE2  1 
ATOM   10050 C CZ   . TYR B 1 283 ? -12.591 -42.588 46.038  1.00 69.90  ? 620 TYR C CZ   1 
ATOM   10051 O OH   . TYR B 1 283 ? -12.345 -43.501 47.042  1.00 71.67  ? 620 TYR C OH   1 
ATOM   10052 H H    . TYR B 1 283 ? -12.055 -38.222 40.773  1.00 61.02  ? 620 TYR C H    1 
ATOM   10053 H HA   . TYR B 1 283 ? -12.242 -38.129 43.468  1.00 61.69  ? 620 TYR C HA   1 
ATOM   10054 H HB2  . TYR B 1 283 ? -14.170 -39.289 43.072  1.00 64.20  ? 620 TYR C HB2  1 
ATOM   10055 H HB3  . TYR B 1 283 ? -13.445 -40.255 42.042  1.00 64.20  ? 620 TYR C HB3  1 
ATOM   10056 H HD1  . TYR B 1 283 ? -12.592 -42.322 42.819  1.00 69.19  ? 620 TYR C HD1  1 
ATOM   10057 H HD2  . TYR B 1 283 ? -13.482 -39.521 45.533  1.00 81.92  ? 620 TYR C HD2  1 
ATOM   10058 H HE1  . TYR B 1 283 ? -12.186 -43.840 44.513  1.00 81.97  ? 620 TYR C HE1  1 
ATOM   10059 H HE2  . TYR B 1 283 ? -13.076 -41.040 47.236  1.00 80.54  ? 620 TYR C HE2  1 
ATOM   10060 H HH   . TYR B 1 283 ? -13.020 -43.608 47.495  1.00 86.00  ? 620 TYR C HH   1 
ATOM   10061 N N    . LYS B 1 284 ? -10.171 -39.362 43.814  1.00 47.64  ? 621 LYS C N    1 
ATOM   10062 C CA   . LYS B 1 284 ? -8.903  -40.061 43.974  1.00 45.13  ? 621 LYS C CA   1 
ATOM   10063 C C    . LYS B 1 284 ? -8.896  -40.840 45.286  1.00 51.53  ? 621 LYS C C    1 
ATOM   10064 O O    . LYS B 1 284 ? -9.069  -40.256 46.355  1.00 64.21  ? 621 LYS C O    1 
ATOM   10065 C CB   . LYS B 1 284 ? -7.739  -39.075 43.972  1.00 43.46  ? 621 LYS C CB   1 
ATOM   10066 C CG   . LYS B 1 284 ? -6.403  -39.714 44.340  1.00 55.61  ? 621 LYS C CG   1 
ATOM   10067 C CD   . LYS B 1 284 ? -5.246  -38.750 44.125  1.00 65.01  ? 621 LYS C CD   1 
ATOM   10068 C CE   . LYS B 1 284 ? -5.430  -37.467 44.919  1.00 73.49  ? 621 LYS C CE   1 
ATOM   10069 N NZ   . LYS B 1 284 ? -4.352  -36.478 44.641  1.00 80.06  ? 621 LYS C NZ   1 
ATOM   10070 H H    . LYS B 1 284 ? -10.410 -38.909 44.505  1.00 57.17  ? 621 LYS C H    1 
ATOM   10071 H HA   . LYS B 1 284 ? -8.780  -40.692 43.234  1.00 54.16  ? 621 LYS C HA   1 
ATOM   10072 H HB2  . LYS B 1 284 ? -7.651  -38.694 43.084  1.00 52.16  ? 621 LYS C HB2  1 
ATOM   10073 H HB3  . LYS B 1 284 ? -7.921  -38.373 44.615  1.00 52.16  ? 621 LYS C HB3  1 
ATOM   10074 H HG2  . LYS B 1 284 ? -6.417  -39.968 45.276  1.00 66.73  ? 621 LYS C HG2  1 
ATOM   10075 H HG3  . LYS B 1 284 ? -6.256  -40.494 43.783  1.00 66.73  ? 621 LYS C HG3  1 
ATOM   10076 H HD2  . LYS B 1 284 ? -4.422  -39.170 44.415  1.00 78.01  ? 621 LYS C HD2  1 
ATOM   10077 H HD3  . LYS B 1 284 ? -5.193  -38.519 43.185  1.00 78.01  ? 621 LYS C HD3  1 
ATOM   10078 H HE2  . LYS B 1 284 ? -6.279  -37.064 44.681  1.00 88.19  ? 621 LYS C HE2  1 
ATOM   10079 H HE3  . LYS B 1 284 ? -5.413  -37.674 45.867  1.00 88.19  ? 621 LYS C HE3  1 
ATOM   10080 H HZ1  . LYS B 1 284 ? -4.487  -35.739 45.119  1.00 96.08  ? 621 LYS C HZ1  1 
ATOM   10081 H HZ2  . LYS B 1 284 ? -3.561  -36.822 44.857  1.00 96.08  ? 621 LYS C HZ2  1 
ATOM   10082 H HZ3  . LYS B 1 284 ? -4.350  -36.267 43.776  1.00 96.08  ? 621 LYS C HZ3  1 
ATOM   10083 N N    . PRO B 1 285 ? -8.704  -42.165 45.209  1.00 48.74  ? 622 PRO C N    1 
ATOM   10084 C CA   . PRO B 1 285 ? -8.553  -42.986 46.417  1.00 51.25  ? 622 PRO C CA   1 
ATOM   10085 C C    . PRO B 1 285 ? -7.488  -42.398 47.341  1.00 52.44  ? 622 PRO C C    1 
ATOM   10086 O O    . PRO B 1 285 ? -6.536  -41.798 46.844  1.00 47.34  ? 622 PRO C O    1 
ATOM   10087 C CB   . PRO B 1 285 ? -8.086  -44.334 45.864  1.00 53.28  ? 622 PRO C CB   1 
ATOM   10088 C CG   . PRO B 1 285 ? -8.613  -44.385 44.477  1.00 54.00  ? 622 PRO C CG   1 
ATOM   10089 C CD   . PRO B 1 285 ? -8.641  -42.968 43.975  1.00 50.35  ? 622 PRO C CD   1 
ATOM   10090 H HA   . PRO B 1 285 ? -9.404  -43.086 46.892  1.00 61.50  ? 622 PRO C HA   1 
ATOM   10091 H HB2  . PRO B 1 285 ? -7.117  -44.370 45.865  1.00 63.93  ? 622 PRO C HB2  1 
ATOM   10092 H HB3  . PRO B 1 285 ? -8.458  -45.053 46.399  1.00 63.93  ? 622 PRO C HB3  1 
ATOM   10093 H HG2  . PRO B 1 285 ? -8.025  -44.927 43.929  1.00 64.80  ? 622 PRO C HG2  1 
ATOM   10094 H HG3  . PRO B 1 285 ? -9.508  -44.758 44.486  1.00 64.80  ? 622 PRO C HG3  1 
ATOM   10095 H HD2  . PRO B 1 285 ? -7.829  -42.768 43.483  1.00 60.43  ? 622 PRO C HD2  1 
ATOM   10096 H HD3  . PRO B 1 285 ? -9.431  -42.817 43.432  1.00 60.43  ? 622 PRO C HD3  1 
ATOM   10097 N N    . PRO B 1 286 ? -7.637  -42.556 48.669  1.00 52.07  ? 623 PRO C N    1 
ATOM   10098 C CA   . PRO B 1 286 ? -6.610  -41.973 49.539  1.00 51.00  ? 623 PRO C CA   1 
ATOM   10099 C C    . PRO B 1 286 ? -5.253  -42.666 49.381  1.00 53.29  ? 623 PRO C C    1 
ATOM   10100 O O    . PRO B 1 286 ? -4.212  -42.035 49.571  1.00 48.01  ? 623 PRO C O    1 
ATOM   10101 C CB   . PRO B 1 286 ? -7.182  -42.184 50.949  1.00 56.57  ? 623 PRO C CB   1 
ATOM   10102 C CG   . PRO B 1 286 ? -8.652  -42.351 50.744  1.00 54.86  ? 623 PRO C CG   1 
ATOM   10103 C CD   . PRO B 1 286 ? -8.787  -43.059 49.436  1.00 55.06  ? 623 PRO C CD   1 
ATOM   10104 H HA   . PRO B 1 286 ? -6.513  -41.013 49.363  1.00 61.20  ? 623 PRO C HA   1 
ATOM   10105 H HB2  . PRO B 1 286 ? -6.796  -42.982 51.343  1.00 67.89  ? 623 PRO C HB2  1 
ATOM   10106 H HB3  . PRO B 1 286 ? -6.997  -41.405 51.498  1.00 67.89  ? 623 PRO C HB3  1 
ATOM   10107 H HG2  . PRO B 1 286 ? -9.023  -42.886 51.463  1.00 65.83  ? 623 PRO C HG2  1 
ATOM   10108 H HG3  . PRO B 1 286 ? -9.078  -41.481 50.708  1.00 65.83  ? 623 PRO C HG3  1 
ATOM   10109 H HD2  . PRO B 1 286 ? -8.718  -44.019 49.561  1.00 66.08  ? 623 PRO C HD2  1 
ATOM   10110 H HD3  . PRO B 1 286 ? -9.619  -42.814 49.002  1.00 66.08  ? 623 PRO C HD3  1 
ATOM   10111 N N    . GLU B 1 287 ? -5.273  -43.946 49.021  1.00 51.14  ? 624 GLU C N    1 
ATOM   10112 C CA   . GLU B 1 287 ? -4.042  -44.696 48.791  1.00 59.34  ? 624 GLU C CA   1 
ATOM   10113 C C    . GLU B 1 287 ? -3.152  -44.004 47.766  1.00 57.22  ? 624 GLU C C    1 
ATOM   10114 O O    . GLU B 1 287 ? -1.938  -43.963 47.926  1.00 56.54  ? 624 GLU C O    1 
ATOM   10115 C CB   . GLU B 1 287 ? -4.357  -46.112 48.308  1.00 68.33  ? 624 GLU C CB   1 
ATOM   10116 C CG   . GLU B 1 287 ? -4.921  -47.025 49.383  1.00 79.38  ? 624 GLU C CG   1 
ATOM   10117 C CD   . GLU B 1 287 ? -6.429  -46.932 49.502  1.00 76.68  ? 624 GLU C CD   1 
ATOM   10118 O OE1  . GLU B 1 287 ? -7.058  -46.267 48.650  1.00 58.60  ? 624 GLU C OE1  1 
ATOM   10119 O OE2  . GLU B 1 287 ? -6.982  -47.537 50.447  1.00 81.14  ? 624 GLU C OE2  1 
ATOM   10120 H H    . GLU B 1 287 ? -5.990  -44.405 48.903  1.00 61.37  ? 624 GLU C H    1 
ATOM   10121 H HA   . GLU B 1 287 ? -3.544  -44.764 49.632  1.00 71.21  ? 624 GLU C HA   1 
ATOM   10122 H HB2  . GLU B 1 287 ? -5.010  -46.059 47.592  1.00 82.00  ? 624 GLU C HB2  1 
ATOM   10123 H HB3  . GLU B 1 287 ? -3.540  -46.517 47.976  1.00 82.00  ? 624 GLU C HB3  1 
ATOM   10124 H HG2  . GLU B 1 287 ? -4.693  -47.943 49.169  1.00 95.26  ? 624 GLU C HG2  1 
ATOM   10125 H HG3  . GLU B 1 287 ? -4.538  -46.778 50.239  1.00 95.26  ? 624 GLU C HG3  1 
ATOM   10126 N N    . ILE B 1 288 ? -3.769  -43.473 46.712  1.00 51.48  ? 625 ILE C N    1 
ATOM   10127 C CA   . ILE B 1 288 ? -3.057  -42.801 45.625  1.00 50.77  ? 625 ILE C CA   1 
ATOM   10128 C C    . ILE B 1 288 ? -2.732  -41.365 46.015  1.00 48.35  ? 625 ILE C C    1 
ATOM   10129 O O    . ILE B 1 288 ? -3.633  -40.545 46.160  1.00 51.35  ? 625 ILE C O    1 
ATOM   10130 C CB   . ILE B 1 288 ? -3.920  -42.785 44.349  1.00 48.14  ? 625 ILE C CB   1 
ATOM   10131 C CG1  . ILE B 1 288 ? -4.329  -44.216 43.979  1.00 45.76  ? 625 ILE C CG1  1 
ATOM   10132 C CG2  . ILE B 1 288 ? -3.184  -42.085 43.197  1.00 42.72  ? 625 ILE C CG2  1 
ATOM   10133 C CD1  . ILE B 1 288 ? -5.181  -44.299 42.729  1.00 53.14  ? 625 ILE C CD1  1 
ATOM   10134 H H    . ILE B 1 288 ? -4.622  -43.489 46.601  1.00 61.78  ? 625 ILE C H    1 
ATOM   10135 H HA   . ILE B 1 288 ? -2.220  -43.274 45.435  1.00 60.92  ? 625 ILE C HA   1 
ATOM   10136 H HB   . ILE B 1 288 ? -4.727  -42.282 44.539  1.00 57.77  ? 625 ILE C HB   1 
ATOM   10137 H HG12 . ILE B 1 288 ? -3.528  -44.742 43.828  1.00 54.91  ? 625 ILE C HG12 1 
ATOM   10138 H HG13 . ILE B 1 288 ? -4.839  -44.595 44.711  1.00 54.91  ? 625 ILE C HG13 1 
ATOM   10139 H HG21 . ILE B 1 288 ? -3.745  -42.091 42.419  1.00 51.26  ? 625 ILE C HG21 1 
ATOM   10140 H HG22 . ILE B 1 288 ? -2.990  -41.181 43.455  1.00 51.26  ? 625 ILE C HG22 1 
ATOM   10141 H HG23 . ILE B 1 288 ? -2.367  -42.557 43.016  1.00 51.26  ? 625 ILE C HG23 1 
ATOM   10142 H HD11 . ILE B 1 288 ? -5.397  -45.219 42.560  1.00 63.76  ? 625 ILE C HD11 1 
ATOM   10143 H HD12 . ILE B 1 288 ? -5.985  -43.793 42.865  1.00 63.76  ? 625 ILE C HD12 1 
ATOM   10144 H HD13 . ILE B 1 288 ? -4.686  -43.938 41.990  1.00 63.76  ? 625 ILE C HD13 1 
ATOM   10145 N N    . ILE B 1 289 ? -1.447  -41.057 46.180  1.00 46.85  ? 626 ILE C N    1 
ATOM   10146 C CA   . ILE B 1 289 ? -1.034  -39.747 46.684  1.00 51.27  ? 626 ILE C CA   1 
ATOM   10147 C C    . ILE B 1 289 ? -1.097  -38.667 45.614  1.00 56.59  ? 626 ILE C C    1 
ATOM   10148 O O    . ILE B 1 289 ? -1.426  -37.516 45.904  1.00 57.42  ? 626 ILE C O    1 
ATOM   10149 C CB   . ILE B 1 289 ? 0.393   -39.782 47.253  1.00 57.84  ? 626 ILE C CB   1 
ATOM   10150 C CG1  . ILE B 1 289 ? 1.392   -40.167 46.163  1.00 63.23  ? 626 ILE C CG1  1 
ATOM   10151 C CG2  . ILE B 1 289 ? 0.468   -40.761 48.403  1.00 63.92  ? 626 ILE C CG2  1 
ATOM   10152 C CD1  . ILE B 1 289 ? 2.776   -40.453 46.691  1.00 75.20  ? 626 ILE C CD1  1 
ATOM   10153 H H    . ILE B 1 289 ? -0.793  -41.589 46.008  1.00 56.22  ? 626 ILE C H    1 
ATOM   10154 H HA   . ILE B 1 289 ? -1.638  -39.485 47.410  1.00 61.52  ? 626 ILE C HA   1 
ATOM   10155 H HB   . ILE B 1 289 ? 0.618   -38.898 47.582  1.00 69.40  ? 626 ILE C HB   1 
ATOM   10156 H HG12 . ILE B 1 289 ? 1.075   -40.966 45.714  1.00 75.87  ? 626 ILE C HG12 1 
ATOM   10157 H HG13 . ILE B 1 289 ? 1.461   -39.437 45.528  1.00 75.87  ? 626 ILE C HG13 1 
ATOM   10158 H HG21 . ILE B 1 289 ? 1.364   -40.771 48.746  1.00 76.71  ? 626 ILE C HG21 1 
ATOM   10159 H HG22 . ILE B 1 289 ? -0.143  -40.483 49.090  1.00 76.71  ? 626 ILE C HG22 1 
ATOM   10160 H HG23 . ILE B 1 289 ? 0.228   -41.635 48.086  1.00 76.71  ? 626 ILE C HG23 1 
ATOM   10161 H HD11 . ILE B 1 289 ? 3.348   -40.686 45.956  1.00 90.24  ? 626 ILE C HD11 1 
ATOM   10162 H HD12 . ILE B 1 289 ? 3.111   -39.667 47.130  1.00 90.24  ? 626 ILE C HD12 1 
ATOM   10163 H HD13 . ILE B 1 289 ? 2.728   -41.181 47.314  1.00 90.24  ? 626 ILE C HD13 1 
ATOM   10164 N N    . MET B 1 290 ? -0.766  -39.038 44.383  1.00 55.73  ? 627 MET C N    1 
ATOM   10165 C CA   . MET B 1 290 ? -0.792  -38.094 43.274  1.00 57.22  ? 627 MET C CA   1 
ATOM   10166 C C    . MET B 1 290 ? -1.157  -38.794 41.972  1.00 52.78  ? 627 MET C C    1 
ATOM   10167 O O    . MET B 1 290 ? -0.842  -39.969 41.779  1.00 48.00  ? 627 MET C O    1 
ATOM   10168 C CB   . MET B 1 290 ? 0.569   -37.415 43.132  1.00 56.97  ? 627 MET C CB   1 
ATOM   10169 C CG   . MET B 1 290 ? 0.607   -36.348 42.058  1.00 65.49  ? 627 MET C CG   1 
ATOM   10170 S SD   . MET B 1 290 ? 1.867   -35.096 42.357  1.00 84.75  ? 627 MET C SD   1 
ATOM   10171 C CE   . MET B 1 290 ? 1.213   -34.312 43.829  1.00 102.03 ? 627 MET C CE   1 
ATOM   10172 H H    . MET B 1 290 ? -0.522  -39.832 44.163  1.00 66.87  ? 627 MET C H    1 
ATOM   10173 H HA   . MET B 1 290 ? -1.459  -37.401 43.461  1.00 68.67  ? 627 MET C HA   1 
ATOM   10174 H HB2  . MET B 1 290 ? 0.799   -36.994 43.976  1.00 68.37  ? 627 MET C HB2  1 
ATOM   10175 H HB3  . MET B 1 290 ? 1.233   -38.086 42.908  1.00 68.37  ? 627 MET C HB3  1 
ATOM   10176 H HG2  . MET B 1 290 ? 0.798   -36.767 41.204  1.00 78.59  ? 627 MET C HG2  1 
ATOM   10177 H HG3  . MET B 1 290 ? -0.255  -35.903 42.024  1.00 78.59  ? 627 MET C HG3  1 
ATOM   10178 H HE1  . MET B 1 290 ? 1.808   -33.609 44.098  1.00 122.44 ? 627 MET C HE1  1 
ATOM   10179 H HE2  . MET B 1 290 ? 0.346   -33.951 43.631  1.00 122.44 ? 627 MET C HE2  1 
ATOM   10180 H HE3  . MET B 1 290 ? 1.144   -34.968 44.527  1.00 122.44 ? 627 MET C HE3  1 
ATOM   10181 N N    . CYS B 1 291 ? -1.830  -38.070 41.083  1.00 51.21  ? 628 CYS C N    1 
ATOM   10182 C CA   . CYS B 1 291 ? -2.177  -38.611 39.776  1.00 50.75  ? 628 CYS C CA   1 
ATOM   10183 C C    . CYS B 1 291 ? -2.501  -37.503 38.777  1.00 46.02  ? 628 CYS C C    1 
ATOM   10184 O O    . CYS B 1 291 ? -2.989  -36.435 39.148  1.00 42.01  ? 628 CYS C O    1 
ATOM   10185 C CB   . CYS B 1 291 ? -3.354  -39.586 39.888  1.00 50.85  ? 628 CYS C CB   1 
ATOM   10186 S SG   . CYS B 1 291 ? -4.970  -38.819 40.157  1.00 52.18  ? 628 CYS C SG   1 
ATOM   10187 H H    . CYS B 1 291 ? -2.096  -37.262 41.213  1.00 61.45  ? 628 CYS C H    1 
ATOM   10188 H HA   . CYS B 1 291 ? -1.408  -39.110 39.429  1.00 60.90  ? 628 CYS C HA   1 
ATOM   10189 H HB2  . CYS B 1 291 ? -3.408  -40.099 39.067  1.00 61.02  ? 628 CYS C HB2  1 
ATOM   10190 H HB3  . CYS B 1 291 ? -3.188  -40.184 40.633  1.00 61.02  ? 628 CYS C HB3  1 
ATOM   10191 H HG   . CYS B 1 291 ? -5.213  -38.088 39.237  1.00 62.61  ? 628 CYS C HG   1 
ATOM   10192 N N    . ASP B 1 292 ? -2.216  -37.768 37.507  1.00 46.72  ? 629 ASP C N    1 
ATOM   10193 C CA   . ASP B 1 292 ? -2.517  -36.832 36.431  1.00 49.57  ? 629 ASP C CA   1 
ATOM   10194 C C    . ASP B 1 292 ? -3.155  -37.587 35.275  1.00 40.05  ? 629 ASP C C    1 
ATOM   10195 O O    . ASP B 1 292 ? -2.797  -38.724 34.994  1.00 37.43  ? 629 ASP C O    1 
ATOM   10196 C CB   . ASP B 1 292 ? -1.244  -36.131 35.945  1.00 66.17  ? 629 ASP C CB   1 
ATOM   10197 C CG   . ASP B 1 292 ? -0.520  -35.403 37.058  1.00 81.96  ? 629 ASP C CG   1 
ATOM   10198 O OD1  . ASP B 1 292 ? 0.316   -36.037 37.737  1.00 88.60  ? 629 ASP C OD1  1 
ATOM   10199 O OD2  . ASP B 1 292 ? -0.784  -34.198 37.255  1.00 83.69  ? 629 ASP C OD2  1 
ATOM   10200 H H    . ASP B 1 292 ? -1.841  -38.495 37.239  1.00 56.07  ? 629 ASP C H    1 
ATOM   10201 H HA   . ASP B 1 292 ? -3.148  -36.154 36.750  1.00 59.48  ? 629 ASP C HA   1 
ATOM   10202 H HB2  . ASP B 1 292 ? -0.640  -36.793 35.576  1.00 79.41  ? 629 ASP C HB2  1 
ATOM   10203 H HB3  . ASP B 1 292 ? -1.481  -35.481 35.265  1.00 79.41  ? 629 ASP C HB3  1 
ATOM   10204 N N    . ALA B 1 293 ? -4.106  -36.953 34.605  1.00 40.59  ? 630 ALA C N    1 
ATOM   10205 C CA   . ALA B 1 293 ? -4.735  -37.568 33.449  1.00 42.15  ? 630 ALA C CA   1 
ATOM   10206 C C    . ALA B 1 293 ? -4.495  -36.669 32.254  1.00 37.92  ? 630 ALA C C    1 
ATOM   10207 O O    . ALA B 1 293 ? -4.452  -35.447 32.381  1.00 34.11  ? 630 ALA C O    1 
ATOM   10208 C CB   . ALA B 1 293 ? -6.214  -37.764 33.686  1.00 48.34  ? 630 ALA C CB   1 
ATOM   10209 H H    . ALA B 1 293 ? -4.404  -36.169 34.798  1.00 48.71  ? 630 ALA C H    1 
ATOM   10210 H HA   . ALA B 1 293 ? -4.326  -38.441 33.274  1.00 50.58  ? 630 ALA C HA   1 
ATOM   10211 H HB1  . ALA B 1 293 ? -6.604  -38.171 32.909  1.00 58.01  ? 630 ALA C HB1  1 
ATOM   10212 H HB2  . ALA B 1 293 ? -6.335  -38.333 34.450  1.00 58.01  ? 630 ALA C HB2  1 
ATOM   10213 H HB3  . ALA B 1 293 ? -6.620  -36.909 33.848  1.00 58.01  ? 630 ALA C HB3  1 
ATOM   10214 N N    . TYR B 1 294 ? -4.322  -37.270 31.089  1.00 31.60  ? 631 TYR C N    1 
ATOM   10215 C CA   . TYR B 1 294 ? -4.151  -36.484 29.872  1.00 37.49  ? 631 TYR C CA   1 
ATOM   10216 C C    . TYR B 1 294 ? -4.625  -37.283 28.667  1.00 38.63  ? 631 TYR C C    1 
ATOM   10217 O O    . TYR B 1 294 ? -4.715  -38.502 28.735  1.00 36.11  ? 631 TYR C O    1 
ATOM   10218 C CB   . TYR B 1 294 ? -2.687  -36.074 29.717  1.00 34.63  ? 631 TYR C CB   1 
ATOM   10219 C CG   . TYR B 1 294 ? -1.732  -37.240 29.695  1.00 48.38  ? 631 TYR C CG   1 
ATOM   10220 C CD1  . TYR B 1 294 ? -1.233  -37.772 30.876  1.00 54.63  ? 631 TYR C CD1  1 
ATOM   10221 C CD2  . TYR B 1 294 ? -1.327  -37.809 28.498  1.00 56.70  ? 631 TYR C CD2  1 
ATOM   10222 C CE1  . TYR B 1 294 ? -0.359  -38.841 30.865  1.00 67.66  ? 631 TYR C CE1  1 
ATOM   10223 C CE2  . TYR B 1 294 ? -0.453  -38.877 28.477  1.00 68.65  ? 631 TYR C CE2  1 
ATOM   10224 C CZ   . TYR B 1 294 ? 0.027   -39.388 29.663  1.00 74.03  ? 631 TYR C CZ   1 
ATOM   10225 O OH   . TYR B 1 294 ? 0.899   -40.451 29.648  1.00 83.78  ? 631 TYR C OH   1 
ATOM   10226 H H    . TYR B 1 294 ? -4.299  -38.122 30.972  1.00 37.91  ? 631 TYR C H    1 
ATOM   10227 H HA   . TYR B 1 294 ? -4.693  -35.670 29.934  1.00 44.99  ? 631 TYR C HA   1 
ATOM   10228 H HB2  . TYR B 1 294 ? -2.584  -35.590 28.882  1.00 41.56  ? 631 TYR C HB2  1 
ATOM   10229 H HB3  . TYR B 1 294 ? -2.441  -35.502 30.461  1.00 41.56  ? 631 TYR C HB3  1 
ATOM   10230 H HD1  . TYR B 1 294 ? -1.493  -37.403 31.689  1.00 65.56  ? 631 TYR C HD1  1 
ATOM   10231 H HD2  . TYR B 1 294 ? -1.650  -37.467 27.696  1.00 68.04  ? 631 TYR C HD2  1 
ATOM   10232 H HE1  . TYR B 1 294 ? -0.032  -39.187 31.664  1.00 81.19  ? 631 TYR C HE1  1 
ATOM   10233 H HE2  . TYR B 1 294 ? -0.190  -39.250 27.666  1.00 82.38  ? 631 TYR C HE2  1 
ATOM   10234 H HH   . TYR B 1 294 ? 1.578   -40.251 29.233  1.00 100.53 ? 631 TYR C HH   1 
ATOM   10235 N N    . VAL B 1 295 ? -4.935  -36.601 27.567  1.00 34.95  ? 632 VAL C N    1 
ATOM   10236 C CA   . VAL B 1 295 ? -5.462  -37.275 26.383  1.00 40.35  ? 632 VAL C CA   1 
ATOM   10237 C C    . VAL B 1 295 ? -4.388  -37.415 25.312  1.00 46.95  ? 632 VAL C C    1 
ATOM   10238 O O    . VAL B 1 295 ? -3.536  -36.549 25.167  1.00 33.51  ? 632 VAL C O    1 
ATOM   10239 C CB   . VAL B 1 295 ? -6.668  -36.529 25.789  1.00 38.55  ? 632 VAL C CB   1 
ATOM   10240 C CG1  . VAL B 1 295 ? -7.883  -36.703 26.670  1.00 33.37  ? 632 VAL C CG1  1 
ATOM   10241 C CG2  . VAL B 1 295 ? -6.351  -35.048 25.597  1.00 36.46  ? 632 VAL C CG2  1 
ATOM   10242 H H    . VAL B 1 295 ? -4.849  -35.750 27.481  1.00 41.95  ? 632 VAL C H    1 
ATOM   10243 H HA   . VAL B 1 295 ? -5.758  -38.175 26.635  1.00 48.41  ? 632 VAL C HA   1 
ATOM   10244 H HB   . VAL B 1 295 ? -6.876  -36.910 24.911  1.00 46.26  ? 632 VAL C HB   1 
ATOM   10245 H HG11 . VAL B 1 295 ? -8.621  -36.231 26.281  1.00 40.04  ? 632 VAL C HG11 1 
ATOM   10246 H HG12 . VAL B 1 295 ? -8.089  -37.639 26.735  1.00 40.04  ? 632 VAL C HG12 1 
ATOM   10247 H HG13 . VAL B 1 295 ? -7.689  -36.349 27.542  1.00 40.04  ? 632 VAL C HG13 1 
ATOM   10248 H HG21 . VAL B 1 295 ? -7.120  -34.609 25.226  1.00 43.76  ? 632 VAL C HG21 1 
ATOM   10249 H HG22 . VAL B 1 295 ? -6.132  -34.662 26.449  1.00 43.76  ? 632 VAL C HG22 1 
ATOM   10250 H HG23 . VAL B 1 295 ? -5.605  -34.964 24.999  1.00 43.76  ? 632 VAL C HG23 1 
ATOM   10251 N N    . THR B 1 296 ? -4.438  -38.509 24.560  1.00 41.71  ? 633 THR C N    1 
ATOM   10252 C CA   . THR B 1 296 ? -3.420  -38.789 23.558  1.00 50.42  ? 633 THR C CA   1 
ATOM   10253 C C    . THR B 1 296 ? -3.982  -39.707 22.474  1.00 42.69  ? 633 THR C C    1 
ATOM   10254 O O    . THR B 1 296 ? -5.128  -40.134 22.555  1.00 30.48  ? 633 THR C O    1 
ATOM   10255 C CB   . THR B 1 296 ? -2.186  -39.443 24.213  1.00 61.82  ? 633 THR C CB   1 
ATOM   10256 O OG1  . THR B 1 296 ? -1.130  -39.557 23.253  1.00 66.59  ? 633 THR C OG1  1 
ATOM   10257 C CG2  . THR B 1 296 ? -2.536  -40.817 24.767  1.00 55.15  ? 633 THR C CG2  1 
ATOM   10258 H H    . THR B 1 296 ? -5.054  -39.107 24.612  1.00 50.05  ? 633 THR C H    1 
ATOM   10259 H HA   . THR B 1 296 ? -3.138  -37.949 23.137  1.00 60.50  ? 633 THR C HA   1 
ATOM   10260 H HB   . THR B 1 296 ? -1.887  -38.889 24.950  1.00 74.19  ? 633 THR C HB   1 
ATOM   10261 H HG1  . THR B 1 296 ? -0.473  -39.905 23.599  1.00 79.90  ? 633 THR C HG1  1 
ATOM   10262 H HG21 . THR B 1 296 ? -1.762  -41.214 25.171  1.00 66.18  ? 633 THR C HG21 1 
ATOM   10263 H HG22 . THR B 1 296 ? -3.227  -40.737 25.428  1.00 66.18  ? 633 THR C HG22 1 
ATOM   10264 H HG23 . THR B 1 296 ? -2.846  -41.387 24.059  1.00 66.18  ? 633 THR C HG23 1 
ATOM   10265 N N    . ASP B 1 297 ? -3.171  -40.002 21.461  1.00 46.85  ? 634 ASP C N    1 
ATOM   10266 C CA   . ASP B 1 297 ? -3.545  -40.952 20.413  1.00 48.60  ? 634 ASP C CA   1 
ATOM   10267 C C    . ASP B 1 297 ? -4.815  -40.546 19.663  1.00 45.42  ? 634 ASP C C    1 
ATOM   10268 O O    . ASP B 1 297 ? -5.729  -41.351 19.490  1.00 45.24  ? 634 ASP C O    1 
ATOM   10269 C CB   . ASP B 1 297 ? -3.714  -42.360 20.988  1.00 61.81  ? 634 ASP C CB   1 
ATOM   10270 C CG   . ASP B 1 297 ? -2.397  -43.108 21.104  1.00 77.10  ? 634 ASP C CG   1 
ATOM   10271 O OD1  . ASP B 1 297 ? -1.369  -42.473 21.422  1.00 79.43  ? 634 ASP C OD1  1 
ATOM   10272 O OD2  . ASP B 1 297 ? -2.389  -44.335 20.869  1.00 84.22  ? 634 ASP C OD2  1 
ATOM   10273 H H    . ASP B 1 297 ? -2.388  -39.661 21.356  1.00 56.22  ? 634 ASP C H    1 
ATOM   10274 H HA   . ASP B 1 297 ? -2.817  -40.989 19.757  1.00 58.32  ? 634 ASP C HA   1 
ATOM   10275 H HB2  . ASP B 1 297 ? -4.102  -42.295 21.875  1.00 74.17  ? 634 ASP C HB2  1 
ATOM   10276 H HB3  . ASP B 1 297 ? -4.299  -42.871 20.406  1.00 74.17  ? 634 ASP C HB3  1 
ATOM   10277 N N    . PHE B 1 298 ? -4.863  -39.298 19.216  1.00 44.27  ? 635 PHE C N    1 
ATOM   10278 C CA   . PHE B 1 298 ? -5.966  -38.833 18.385  1.00 55.60  ? 635 PHE C CA   1 
ATOM   10279 C C    . PHE B 1 298 ? -5.747  -39.255 16.935  1.00 61.50  ? 635 PHE C C    1 
ATOM   10280 O O    . PHE B 1 298 ? -4.601  -39.404 16.495  1.00 49.01  ? 635 PHE C O    1 
ATOM   10281 C CB   . PHE B 1 298 ? -6.083  -37.312 18.452  1.00 40.74  ? 635 PHE C CB   1 
ATOM   10282 C CG   . PHE B 1 298 ? -6.627  -36.802 19.753  1.00 40.48  ? 635 PHE C CG   1 
ATOM   10283 C CD1  . PHE B 1 298 ? -5.773  -36.334 20.742  1.00 42.85  ? 635 PHE C CD1  1 
ATOM   10284 C CD2  . PHE B 1 298 ? -7.994  -36.788 19.988  1.00 38.37  ? 635 PHE C CD2  1 
ATOM   10285 C CE1  . PHE B 1 298 ? -6.270  -35.863 21.943  1.00 35.04  ? 635 PHE C CE1  1 
ATOM   10286 C CE2  . PHE B 1 298 ? -8.504  -36.321 21.197  1.00 37.04  ? 635 PHE C CE2  1 
ATOM   10287 C CZ   . PHE B 1 298 ? -7.644  -35.855 22.170  1.00 32.29  ? 635 PHE C CZ   1 
ATOM   10288 H H    . PHE B 1 298 ? -4.268  -38.699 19.381  1.00 53.12  ? 635 PHE C H    1 
ATOM   10289 H HA   . PHE B 1 298 ? -6.806  -39.225 18.702  1.00 66.72  ? 635 PHE C HA   1 
ATOM   10290 H HB2  . PHE B 1 298 ? -5.202  -36.926 18.327  1.00 48.89  ? 635 PHE C HB2  1 
ATOM   10291 H HB3  . PHE B 1 298 ? -6.676  -37.014 17.745  1.00 48.89  ? 635 PHE C HB3  1 
ATOM   10292 H HD1  . PHE B 1 298 ? -4.854  -36.337 20.594  1.00 51.42  ? 635 PHE C HD1  1 
ATOM   10293 H HD2  . PHE B 1 298 ? -8.576  -37.101 19.334  1.00 46.05  ? 635 PHE C HD2  1 
ATOM   10294 H HE1  . PHE B 1 298 ? -5.688  -35.552 22.598  1.00 42.05  ? 635 PHE C HE1  1 
ATOM   10295 H HE2  . PHE B 1 298 ? -9.422  -36.315 21.345  1.00 44.45  ? 635 PHE C HE2  1 
ATOM   10296 H HZ   . PHE B 1 298 ? -7.981  -35.539 22.977  1.00 38.75  ? 635 PHE C HZ   1 
ATOM   10297 N N    . PRO B 1 299 ? -6.846  -39.443 16.185  1.00 50.10  ? 636 PRO C N    1 
ATOM   10298 C CA   . PRO B 1 299 ? -6.734  -39.757 14.756  1.00 50.73  ? 636 PRO C CA   1 
ATOM   10299 C C    . PRO B 1 299 ? -5.709  -38.855 14.079  1.00 42.59  ? 636 PRO C C    1 
ATOM   10300 O O    . PRO B 1 299 ? -5.665  -37.664 14.368  1.00 42.41  ? 636 PRO C O    1 
ATOM   10301 C CB   . PRO B 1 299 ? -8.141  -39.477 14.230  1.00 50.23  ? 636 PRO C CB   1 
ATOM   10302 C CG   . PRO B 1 299 ? -9.031  -39.751 15.406  1.00 44.84  ? 636 PRO C CG   1 
ATOM   10303 C CD   . PRO B 1 299 ? -8.249  -39.349 16.626  1.00 38.72  ? 636 PRO C CD   1 
ATOM   10304 H HA   . PRO B 1 299 ? -6.503  -40.699 14.617  1.00 60.88  ? 636 PRO C HA   1 
ATOM   10305 H HB2  . PRO B 1 299 ? -8.211  -38.551 13.951  1.00 60.27  ? 636 PRO C HB2  1 
ATOM   10306 H HB3  . PRO B 1 299 ? -8.344  -40.078 13.496  1.00 60.27  ? 636 PRO C HB3  1 
ATOM   10307 H HG2  . PRO B 1 299 ? -9.839  -39.220 15.330  1.00 53.80  ? 636 PRO C HG2  1 
ATOM   10308 H HG3  . PRO B 1 299 ? -9.247  -40.696 15.436  1.00 53.80  ? 636 PRO C HG3  1 
ATOM   10309 H HD2  . PRO B 1 299 ? -8.463  -38.437 16.879  1.00 46.46  ? 636 PRO C HD2  1 
ATOM   10310 H HD3  . PRO B 1 299 ? -8.417  -39.968 17.354  1.00 46.46  ? 636 PRO C HD3  1 
ATOM   10311 N N    . LEU B 1 300 ? -4.876  -39.426 13.213  1.00 48.20  ? 637 LEU C N    1 
ATOM   10312 C CA   . LEU B 1 300 ? -3.820  -38.663 12.555  1.00 48.37  ? 637 LEU C CA   1 
ATOM   10313 C C    . LEU B 1 300 ? -4.382  -37.517 11.711  1.00 40.55  ? 637 LEU C C    1 
ATOM   10314 O O    . LEU B 1 300 ? -3.776  -36.454 11.616  1.00 43.48  ? 637 LEU C O    1 
ATOM   10315 C CB   . LEU B 1 300 ? -2.967  -39.579 11.677  1.00 59.95  ? 637 LEU C CB   1 
ATOM   10316 C CG   . LEU B 1 300 ? -1.490  -39.649 12.067  1.00 68.42  ? 637 LEU C CG   1 
ATOM   10317 C CD1  . LEU B 1 300 ? -1.335  -40.041 13.533  1.00 62.71  ? 637 LEU C CD1  1 
ATOM   10318 C CD2  . LEU B 1 300 ? -0.745  -40.627 11.166  1.00 68.65  ? 637 LEU C CD2  1 
ATOM   10319 H H    . LEU B 1 300 ? -4.901  -40.256 12.989  1.00 57.84  ? 637 LEU C H    1 
ATOM   10320 H HA   . LEU B 1 300 ? -3.237  -38.274 13.239  1.00 58.05  ? 637 LEU C HA   1 
ATOM   10321 H HB2  . LEU B 1 300 ? -3.327  -40.478 11.728  1.00 71.94  ? 637 LEU C HB2  1 
ATOM   10322 H HB3  . LEU B 1 300 ? -3.013  -39.261 10.762  1.00 71.94  ? 637 LEU C HB3  1 
ATOM   10323 H HG   . LEU B 1 300 ? -1.091  -38.773 11.949  1.00 82.11  ? 637 LEU C HG   1 
ATOM   10324 H HD11 . LEU B 1 300 ? -0.401  -40.077 13.749  1.00 75.25  ? 637 LEU C HD11 1 
ATOM   10325 H HD12 . LEU B 1 300 ? -1.773  -39.384 14.079  1.00 75.25  ? 637 LEU C HD12 1 
ATOM   10326 H HD13 . LEU B 1 300 ? -1.738  -40.902 13.670  1.00 75.25  ? 637 LEU C HD13 1 
ATOM   10327 H HD21 . LEU B 1 300 ? 0.177   -40.654 11.429  1.00 82.39  ? 637 LEU C HD21 1 
ATOM   10328 H HD22 . LEU B 1 300 ? -1.139  -41.498 11.258  1.00 82.39  ? 637 LEU C HD22 1 
ATOM   10329 H HD23 . LEU B 1 300 ? -0.818  -40.330 10.256  1.00 82.39  ? 637 LEU C HD23 1 
ATOM   10330 N N    . ASP B 1 301 ? -5.546  -37.736 11.113  1.00 37.65  ? 638 ASP C N    1 
ATOM   10331 C CA   . ASP B 1 301 ? -6.157  -36.742 10.234  1.00 45.29  ? 638 ASP C CA   1 
ATOM   10332 C C    . ASP B 1 301 ? -6.393  -35.387 10.907  1.00 49.10  ? 638 ASP C C    1 
ATOM   10333 O O    . ASP B 1 301 ? -6.502  -34.370 10.227  1.00 46.44  ? 638 ASP C O    1 
ATOM   10334 C CB   . ASP B 1 301 ? -7.480  -37.274 9.687   1.00 49.08  ? 638 ASP C CB   1 
ATOM   10335 C CG   . ASP B 1 301 ? -7.282  -38.353 8.649   1.00 58.83  ? 638 ASP C CG   1 
ATOM   10336 O OD1  . ASP B 1 301 ? -8.073  -39.318 8.623   1.00 59.62  ? 638 ASP C OD1  1 
ATOM   10337 O OD2  . ASP B 1 301 ? -6.329  -38.230 7.854   1.00 62.49  ? 638 ASP C OD2  1 
ATOM   10338 H H    . ASP B 1 301 ? -6.008  -38.457 11.199  1.00 45.18  ? 638 ASP C H    1 
ATOM   10339 H HA   . ASP B 1 301 ? -5.560  -36.592 9.471   1.00 54.35  ? 638 ASP C HA   1 
ATOM   10340 H HB2  . ASP B 1 301 ? -7.996  -37.650 10.417  1.00 58.90  ? 638 ASP C HB2  1 
ATOM   10341 H HB3  . ASP B 1 301 ? -7.969  -36.545 9.275   1.00 58.90  ? 638 ASP C HB3  1 
ATOM   10342 N N    . LEU B 1 302 ? -6.474  -35.370 12.234  1.00 49.46  ? 639 LEU C N    1 
ATOM   10343 C CA   . LEU B 1 302 ? -6.750  -34.132 12.956  1.00 46.09  ? 639 LEU C CA   1 
ATOM   10344 C C    . LEU B 1 302 ? -5.507  -33.268 13.134  1.00 53.88  ? 639 LEU C C    1 
ATOM   10345 O O    . LEU B 1 302 ? -5.613  -32.073 13.389  1.00 52.47  ? 639 LEU C O    1 
ATOM   10346 C CB   . LEU B 1 302 ? -7.354  -34.427 14.334  1.00 35.88  ? 639 LEU C CB   1 
ATOM   10347 C CG   . LEU B 1 302 ? -8.776  -34.981 14.378  1.00 36.83  ? 639 LEU C CG   1 
ATOM   10348 C CD1  . LEU B 1 302 ? -9.199  -35.134 15.827  1.00 31.81  ? 639 LEU C CD1  1 
ATOM   10349 C CD2  . LEU B 1 302 ? -9.761  -34.071 13.632  1.00 29.45  ? 639 LEU C CD2  1 
ATOM   10350 H H    . LEU B 1 302 ? -6.374  -36.060 12.738  1.00 59.36  ? 639 LEU C H    1 
ATOM   10351 H HA   . LEU B 1 302 ? -7.406  -33.611 12.448  1.00 55.31  ? 639 LEU C HA   1 
ATOM   10352 H HB2  . LEU B 1 302 ? -6.784  -35.074 14.779  1.00 43.05  ? 639 LEU C HB2  1 
ATOM   10353 H HB3  . LEU B 1 302 ? -7.356  -33.602 14.844  1.00 43.05  ? 639 LEU C HB3  1 
ATOM   10354 H HG   . LEU B 1 302 ? -8.792  -35.857 13.961  1.00 44.19  ? 639 LEU C HG   1 
ATOM   10355 H HD11 . LEU B 1 302 ? -10.093 -35.482 15.856  1.00 38.17  ? 639 LEU C HD11 1 
ATOM   10356 H HD12 . LEU B 1 302 ? -8.597  -35.739 16.266  1.00 38.17  ? 639 LEU C HD12 1 
ATOM   10357 H HD13 . LEU B 1 302 ? -9.168  -34.274 16.253  1.00 38.17  ? 639 LEU C HD13 1 
ATOM   10358 H HD21 . LEU B 1 302 ? -10.640 -34.454 13.683  1.00 35.34  ? 639 LEU C HD21 1 
ATOM   10359 H HD22 . LEU B 1 302 ? -9.757  -33.203 14.043  1.00 35.34  ? 639 LEU C HD22 1 
ATOM   10360 H HD23 . LEU B 1 302 ? -9.487  -34.001 12.714  1.00 35.34  ? 639 LEU C HD23 1 
ATOM   10361 N N    . ASP B 1 303 ? -4.331  -33.875 13.034  1.00 65.45  ? 640 ASP C N    1 
ATOM   10362 C CA   . ASP B 1 303 ? -3.081  -33.132 13.154  1.00 71.67  ? 640 ASP C CA   1 
ATOM   10363 C C    . ASP B 1 303 ? -2.984  -32.355 14.469  1.00 74.62  ? 640 ASP C C    1 
ATOM   10364 O O    . ASP B 1 303 ? -2.675  -31.167 14.468  1.00 72.43  ? 640 ASP C O    1 
ATOM   10365 C CB   . ASP B 1 303 ? -2.929  -32.168 11.975  1.00 75.31  ? 640 ASP C CB   1 
ATOM   10366 H H    . ASP B 1 303 ? -4.229  -34.717 12.895  1.00 78.54  ? 640 ASP C H    1 
ATOM   10367 H HA   . ASP B 1 303 ? -2.334  -33.765 13.124  1.00 86.00  ? 640 ASP C HA   1 
ATOM   10368 N N    . ILE B 1 304 ? -3.245  -33.022 15.589  1.00 89.54  ? 641 ILE C N    1 
ATOM   10369 C CA   . ILE B 1 304 ? -3.057  -32.398 16.897  1.00 95.31  ? 641 ILE C CA   1 
ATOM   10370 C C    . ILE B 1 304 ? -1.595  -32.490 17.319  1.00 100.70 ? 641 ILE C C    1 
ATOM   10371 O O    . ILE B 1 304 ? -0.969  -33.542 17.193  1.00 106.21 ? 641 ILE C O    1 
ATOM   10372 C CB   . ILE B 1 304 ? -3.937  -33.052 17.987  1.00 92.09  ? 641 ILE C CB   1 
ATOM   10373 C CG1  . ILE B 1 304 ? -5.380  -32.563 17.879  1.00 85.28  ? 641 ILE C CG1  1 
ATOM   10374 C CG2  . ILE B 1 304 ? -3.406  -32.732 19.380  1.00 94.22  ? 641 ILE C CG2  1 
ATOM   10375 C CD1  . ILE B 1 304 ? -6.281  -33.517 17.154  1.00 84.79  ? 641 ILE C CD1  1 
ATOM   10376 H H    . ILE B 1 304 ? -3.530  -33.833 15.621  1.00 107.45 ? 641 ILE C H    1 
ATOM   10377 H HA   . ILE B 1 304 ? -3.299  -31.450 16.838  1.00 114.37 ? 641 ILE C HA   1 
ATOM   10378 H HB   . ILE B 1 304 ? -3.923  -34.014 17.862  1.00 110.51 ? 641 ILE C HB   1 
ATOM   10379 H HG12 . ILE B 1 304 ? -5.736  -32.437 18.772  1.00 102.33 ? 641 ILE C HG12 1 
ATOM   10380 H HG13 . ILE B 1 304 ? -5.390  -31.721 17.398  1.00 102.33 ? 641 ILE C HG13 1 
ATOM   10381 H HG21 . ILE B 1 304 ? -3.971  -33.151 20.033  1.00 113.07 ? 641 ILE C HG21 1 
ATOM   10382 H HG22 . ILE B 1 304 ? -2.510  -33.069 19.457  1.00 113.07 ? 641 ILE C HG22 1 
ATOM   10383 H HG23 . ILE B 1 304 ? -3.410  -31.780 19.504  1.00 113.07 ? 641 ILE C HG23 1 
ATOM   10384 H HD11 . ILE B 1 304 ? -7.167  -33.148 17.124  1.00 101.74 ? 641 ILE C HD11 1 
ATOM   10385 H HD12 . ILE B 1 304 ? -5.949  -33.645 16.263  1.00 101.74 ? 641 ILE C HD12 1 
ATOM   10386 H HD13 . ILE B 1 304 ? -6.291  -34.355 17.624  1.00 101.74 ? 641 ILE C HD13 1 
ATOM   10387 N N    . ASP B 1 305 ? -1.055  -31.383 17.817  1.00 91.08  ? 642 ASP C N    1 
ATOM   10388 C CA   . ASP B 1 305 ? 0.298   -31.372 18.354  1.00 90.44  ? 642 ASP C CA   1 
ATOM   10389 C C    . ASP B 1 305 ? 0.222   -31.484 19.870  1.00 83.90  ? 642 ASP C C    1 
ATOM   10390 O O    . ASP B 1 305 ? -0.558  -30.775 20.504  1.00 85.31  ? 642 ASP C O    1 
ATOM   10391 C CB   . ASP B 1 305 ? 1.018   -30.086 17.950  1.00 98.36  ? 642 ASP C CB   1 
ATOM   10392 C CG   . ASP B 1 305 ? 2.471   -30.071 18.378  1.00 104.35 ? 642 ASP C CG   1 
ATOM   10393 O OD1  . ASP B 1 305 ? 2.826   -29.240 19.238  1.00 104.76 ? 642 ASP C OD1  1 
ATOM   10394 O OD2  . ASP B 1 305 ? 3.254   -30.893 17.857  1.00 107.11 ? 642 ASP C OD2  1 
ATOM   10395 H H    . ASP B 1 305 ? -1.454  -30.622 17.854  1.00 109.30 ? 642 ASP C H    1 
ATOM   10396 H HA   . ASP B 1 305 ? 0.800   -32.138 18.005  1.00 108.52 ? 642 ASP C HA   1 
ATOM   10397 H HB2  . ASP B 1 305 ? 0.989   -29.997 16.984  1.00 118.03 ? 642 ASP C HB2  1 
ATOM   10398 H HB3  . ASP B 1 305 ? 0.575   -29.331 18.367  1.00 118.03 ? 642 ASP C HB3  1 
ATOM   10399 N N    . PRO B 1 306 ? 1.034   -32.374 20.461  1.00 74.12  ? 643 PRO C N    1 
ATOM   10400 C CA   . PRO B 1 306 ? 0.915   -32.618 21.902  1.00 69.19  ? 643 PRO C CA   1 
ATOM   10401 C C    . PRO B 1 306 ? 1.439   -31.454 22.733  1.00 74.26  ? 643 PRO C C    1 
ATOM   10402 O O    . PRO B 1 306 ? 1.037   -31.295 23.886  1.00 66.29  ? 643 PRO C O    1 
ATOM   10403 C CB   . PRO B 1 306 ? 1.755   -33.882 22.121  1.00 71.12  ? 643 PRO C CB   1 
ATOM   10404 C CG   . PRO B 1 306 ? 2.666   -33.990 20.931  1.00 71.91  ? 643 PRO C CG   1 
ATOM   10405 C CD   . PRO B 1 306 ? 2.248   -32.984 19.894  1.00 73.23  ? 643 PRO C CD   1 
ATOM   10406 H HA   . PRO B 1 306 ? -0.017  -32.799 22.143  1.00 83.03  ? 643 PRO C HA   1 
ATOM   10407 H HB2  . PRO B 1 306 ? 2.271   -33.791 22.938  1.00 85.34  ? 643 PRO C HB2  1 
ATOM   10408 H HB3  . PRO B 1 306 ? 1.170   -34.655 22.173  1.00 85.34  ? 643 PRO C HB3  1 
ATOM   10409 H HG2  . PRO B 1 306 ? 3.576   -33.813 21.215  1.00 86.29  ? 643 PRO C HG2  1 
ATOM   10410 H HG3  . PRO B 1 306 ? 2.602   -34.886 20.566  1.00 86.29  ? 643 PRO C HG3  1 
ATOM   10411 H HD2  . PRO B 1 306 ? 2.939   -32.313 19.779  1.00 87.87  ? 643 PRO C HD2  1 
ATOM   10412 H HD3  . PRO B 1 306 ? 2.042   -33.429 19.057  1.00 87.87  ? 643 PRO C HD3  1 
ATOM   10413 N N    . LYS B 1 307 ? 2.316   -30.642 22.150  1.00 103.61 ? 644 LYS C N    1 
ATOM   10414 C CA   . LYS B 1 307 ? 2.816   -29.457 22.834  1.00 107.85 ? 644 LYS C CA   1 
ATOM   10415 C C    . LYS B 1 307 ? 1.721   -28.408 22.940  1.00 101.56 ? 644 LYS C C    1 
ATOM   10416 O O    . LYS B 1 307 ? 1.879   -27.413 23.638  1.00 106.17 ? 644 LYS C O    1 
ATOM   10417 C CB   . LYS B 1 307 ? 4.023   -28.870 22.101  1.00 109.44 ? 644 LYS C CB   1 
ATOM   10418 C CG   . LYS B 1 307 ? 5.251   -29.758 22.117  1.00 113.91 ? 644 LYS C CG   1 
ATOM   10419 C CD   . LYS B 1 307 ? 5.760   -29.970 23.534  1.00 116.99 ? 644 LYS C CD   1 
ATOM   10420 C CE   . LYS B 1 307 ? 7.022   -30.814 23.549  1.00 120.56 ? 644 LYS C CE   1 
ATOM   10421 N NZ   . LYS B 1 307 ? 8.117   -30.194 22.750  1.00 122.89 ? 644 LYS C NZ   1 
ATOM   10422 H H    . LYS B 1 307 ? 2.636   -30.757 21.360  1.00 124.34 ? 644 LYS C H    1 
ATOM   10423 H HA   . LYS B 1 307 ? 3.097   -29.701 23.741  1.00 129.42 ? 644 LYS C HA   1 
ATOM   10424 H HB2  . LYS B 1 307 ? 3.780   -28.719 21.174  1.00 131.33 ? 644 LYS C HB2  1 
ATOM   10425 H HB3  . LYS B 1 307 ? 4.262   -28.028 22.518  1.00 131.33 ? 644 LYS C HB3  1 
ATOM   10426 H HG2  . LYS B 1 307 ? 5.027   -30.623 21.741  1.00 136.69 ? 644 LYS C HG2  1 
ATOM   10427 H HG3  . LYS B 1 307 ? 5.957   -29.339 21.600  1.00 136.69 ? 644 LYS C HG3  1 
ATOM   10428 H HD2  . LYS B 1 307 ? 5.963   -29.110 23.934  1.00 140.39 ? 644 LYS C HD2  1 
ATOM   10429 H HD3  . LYS B 1 307 ? 5.081   -30.430 24.053  1.00 140.39 ? 644 LYS C HD3  1 
ATOM   10430 H HE2  . LYS B 1 307 ? 7.332   -30.908 24.464  1.00 144.67 ? 644 LYS C HE2  1 
ATOM   10431 H HE3  . LYS B 1 307 ? 6.828   -31.686 23.171  1.00 144.67 ? 644 LYS C HE3  1 
ATOM   10432 H HZ1  . LYS B 1 307 ? 8.843   -30.710 22.777  1.00 147.47 ? 644 LYS C HZ1  1 
ATOM   10433 H HZ2  . LYS B 1 307 ? 7.860   -30.101 21.903  1.00 147.47 ? 644 LYS C HZ2  1 
ATOM   10434 H HZ3  . LYS B 1 307 ? 8.319   -29.393 23.080  1.00 147.47 ? 644 LYS C HZ3  1 
ATOM   10435 N N    . ASP B 1 308 ? 0.614   -28.636 22.239  1.00 80.16  ? 645 ASP C N    1 
ATOM   10436 C CA   . ASP B 1 308 ? -0.517  -27.713 22.258  1.00 72.04  ? 645 ASP C CA   1 
ATOM   10437 C C    . ASP B 1 308 ? -1.695  -28.311 23.019  1.00 68.49  ? 645 ASP C C    1 
ATOM   10438 O O    . ASP B 1 308 ? -2.611  -27.598 23.429  1.00 70.66  ? 645 ASP C O    1 
ATOM   10439 C CB   . ASP B 1 308 ? -0.946  -27.374 20.831  1.00 65.19  ? 645 ASP C CB   1 
ATOM   10440 C CG   . ASP B 1 308 ? 0.210   -26.904 19.978  1.00 76.71  ? 645 ASP C CG   1 
ATOM   10441 O OD1  . ASP B 1 308 ? 0.187   -27.151 18.753  1.00 78.46  ? 645 ASP C OD1  1 
ATOM   10442 O OD2  . ASP B 1 308 ? 1.147   -26.295 20.536  1.00 77.84  ? 645 ASP C OD2  1 
ATOM   10443 H H    . ASP B 1 308 ? 0.493   -29.325 21.739  1.00 96.19  ? 645 ASP C H    1 
ATOM   10444 H HA   . ASP B 1 308 ? -0.251  -26.883 22.705  1.00 86.44  ? 645 ASP C HA   1 
ATOM   10445 H HB2  . ASP B 1 308 ? -1.324  -28.166 20.417  1.00 78.23  ? 645 ASP C HB2  1 
ATOM   10446 H HB3  . ASP B 1 308 ? -1.608  -26.665 20.859  1.00 78.23  ? 645 ASP C HB3  1 
ATOM   10447 N N    . ALA B 1 309 ? -1.664  -29.625 23.208  1.00 62.41  ? 646 ALA C N    1 
ATOM   10448 C CA   . ALA B 1 309 ? -2.747  -30.319 23.887  1.00 53.04  ? 646 ALA C CA   1 
ATOM   10449 C C    . ALA B 1 309 ? -2.522  -30.312 25.394  1.00 54.10  ? 646 ALA C C    1 
ATOM   10450 O O    . ALA B 1 309 ? -1.425  -30.008 25.863  1.00 62.71  ? 646 ALA C O    1 
ATOM   10451 C CB   . ALA B 1 309 ? -2.851  -31.738 23.374  1.00 53.63  ? 646 ALA C CB   1 
ATOM   10452 H H    . ALA B 1 309 ? -1.023  -30.139 22.951  1.00 74.89  ? 646 ALA C H    1 
ATOM   10453 H HA   . ALA B 1 309 ? -3.593  -29.861 23.700  1.00 63.65  ? 646 ALA C HA   1 
ATOM   10454 H HB1  . ALA B 1 309 ? -3.569  -32.183 23.830  1.00 64.35  ? 646 ALA C HB1  1 
ATOM   10455 H HB2  . ALA B 1 309 ? -3.026  -31.717 22.430  1.00 64.35  ? 646 ALA C HB2  1 
ATOM   10456 H HB3  . ALA B 1 309 ? -2.023  -32.193 23.544  1.00 64.35  ? 646 ALA C HB3  1 
ATOM   10457 N N    . ASN B 1 310 ? -3.571  -30.631 26.147  1.00 44.73  ? 647 ASN C N    1 
ATOM   10458 C CA   . ASN B 1 310 ? -3.447  -30.846 27.584  1.00 52.60  ? 647 ASN C CA   1 
ATOM   10459 C C    . ASN B 1 310 ? -2.912  -29.622 28.316  1.00 55.01  ? 647 ASN C C    1 
ATOM   10460 O O    . ASN B 1 310 ? -2.039  -29.735 29.173  1.00 50.43  ? 647 ASN C O    1 
ATOM   10461 C CB   . ASN B 1 310 ? -2.556  -32.067 27.846  1.00 54.89  ? 647 ASN C CB   1 
ATOM   10462 C CG   . ASN B 1 310 ? -3.229  -33.366 27.440  1.00 42.40  ? 647 ASN C CG   1 
ATOM   10463 O OD1  . ASN B 1 310 ? -4.313  -33.675 27.915  1.00 33.89  ? 647 ASN C OD1  1 
ATOM   10464 N ND2  . ASN B 1 310 ? -2.616  -34.101 26.521  1.00 37.01  ? 647 ASN C ND2  1 
ATOM   10465 H H    . ASN B 1 310 ? -4.371  -30.728 25.847  1.00 53.68  ? 647 ASN C H    1 
ATOM   10466 H HA   . ASN B 1 310 ? -4.335  -31.044 27.947  1.00 63.11  ? 647 ASN C HA   1 
ATOM   10467 H HB2  . ASN B 1 310 ? -1.737  -31.978 27.334  1.00 65.87  ? 647 ASN C HB2  1 
ATOM   10468 H HB3  . ASN B 1 310 ? -2.354  -32.115 28.793  1.00 65.87  ? 647 ASN C HB3  1 
ATOM   10469 H HD21 . ASN B 1 310 ? -1.872  -33.834 26.183  1.00 44.41  ? 647 ASN C HD21 1 
ATOM   10470 H HD22 . ASN B 1 310 ? -2.964  -34.844 26.263  1.00 44.41  ? 647 ASN C HD22 1 
ATOM   10471 N N    . LYS B 1 311 ? -3.460  -28.456 27.984  1.00 47.25  ? 648 LYS C N    1 
ATOM   10472 C CA   . LYS B 1 311 ? -3.012  -27.192 28.557  1.00 44.43  ? 648 LYS C CA   1 
ATOM   10473 C C    . LYS B 1 311 ? -3.783  -26.803 29.812  1.00 42.63  ? 648 LYS C C    1 
ATOM   10474 O O    . LYS B 1 311 ? -4.948  -27.152 29.975  1.00 38.93  ? 648 LYS C O    1 
ATOM   10475 C CB   . LYS B 1 311 ? -3.128  -26.085 27.507  1.00 48.50  ? 648 LYS C CB   1 
ATOM   10476 C CG   . LYS B 1 311 ? -1.987  -26.095 26.513  1.00 53.73  ? 648 LYS C CG   1 
ATOM   10477 C CD   . LYS B 1 311 ? -0.685  -25.732 27.207  1.00 67.51  ? 648 LYS C CD   1 
ATOM   10478 C CE   . LYS B 1 311 ? 0.515   -26.306 26.490  1.00 73.20  ? 648 LYS C CE   1 
ATOM   10479 N NZ   . LYS B 1 311 ? 0.744   -25.606 25.213  1.00 72.56  ? 648 LYS C NZ   1 
ATOM   10480 H H    . LYS B 1 311 ? -4.103  -28.371 27.419  1.00 56.70  ? 648 LYS C H    1 
ATOM   10481 H HA   . LYS B 1 311 ? -2.067  -27.275 28.801  1.00 53.31  ? 648 LYS C HA   1 
ATOM   10482 H HB2  . LYS B 1 311 ? -3.955  -26.202 27.015  1.00 58.19  ? 648 LYS C HB2  1 
ATOM   10483 H HB3  . LYS B 1 311 ? -3.127  -25.224 27.955  1.00 58.19  ? 648 LYS C HB3  1 
ATOM   10484 H HG2  . LYS B 1 311 ? -1.896  -26.982 26.132  1.00 64.48  ? 648 LYS C HG2  1 
ATOM   10485 H HG3  . LYS B 1 311 ? -2.158  -25.441 25.817  1.00 64.48  ? 648 LYS C HG3  1 
ATOM   10486 H HD2  . LYS B 1 311 ? -0.593  -24.767 27.227  1.00 81.02  ? 648 LYS C HD2  1 
ATOM   10487 H HD3  . LYS B 1 311 ? -0.696  -26.086 28.110  1.00 81.02  ? 648 LYS C HD3  1 
ATOM   10488 H HE2  . LYS B 1 311 ? 1.303   -26.198 27.045  1.00 87.84  ? 648 LYS C HE2  1 
ATOM   10489 H HE3  . LYS B 1 311 ? 0.359   -27.245 26.302  1.00 87.84  ? 648 LYS C HE3  1 
ATOM   10490 H HZ1  . LYS B 1 311 ? 1.453   -25.952 24.800  1.00 87.07  ? 648 LYS C HZ1  1 
ATOM   10491 H HZ2  . LYS B 1 311 ? 0.032   -25.693 24.686  1.00 87.07  ? 648 LYS C HZ2  1 
ATOM   10492 H HZ3  . LYS B 1 311 ? 0.891   -24.741 25.362  1.00 87.07  ? 648 LYS C HZ3  1 
ATOM   10493 N N    . GLY B 1 312 ? -3.121  -26.072 30.702  1.00 40.32  ? 649 GLY C N    1 
ATOM   10494 C CA   . GLY B 1 312 ? -3.751  -25.620 31.928  1.00 38.71  ? 649 GLY C CA   1 
ATOM   10495 C C    . GLY B 1 312 ? -4.816  -24.572 31.691  1.00 47.82  ? 649 GLY C C    1 
ATOM   10496 O O    . GLY B 1 312 ? -5.647  -24.316 32.562  1.00 45.67  ? 649 GLY C O    1 
ATOM   10497 H H    . GLY B 1 312 ? -2.302  -25.825 30.615  1.00 48.38  ? 649 GLY C H    1 
ATOM   10498 H HA2  . GLY B 1 312 ? -4.161  -26.376 32.377  1.00 46.45  ? 649 GLY C HA2  1 
ATOM   10499 H HA3  . GLY B 1 312 ? -3.077  -25.244 32.516  1.00 46.45  ? 649 GLY C HA3  1 
ATOM   10500 N N    . THR B 1 313 ? -4.797  -23.967 30.507  1.00 51.31  ? 650 THR C N    1 
ATOM   10501 C CA   . THR B 1 313 ? -5.775  -22.945 30.158  1.00 53.78  ? 650 THR C CA   1 
ATOM   10502 C C    . THR B 1 313 ? -6.296  -23.152 28.737  1.00 44.07  ? 650 THR C C    1 
ATOM   10503 O O    . THR B 1 313 ? -5.556  -23.594 27.856  1.00 36.11  ? 650 THR C O    1 
ATOM   10504 C CB   . THR B 1 313 ? -5.167  -21.531 30.254  1.00 62.09  ? 650 THR C CB   1 
ATOM   10505 O OG1  . THR B 1 313 ? -4.336  -21.433 31.419  1.00 66.92  ? 650 THR C OG1  1 
ATOM   10506 C CG2  . THR B 1 313 ? -6.263  -20.493 30.338  1.00 67.78  ? 650 THR C CG2  1 
ATOM   10507 H H    . THR B 1 313 ? -4.225  -24.132 29.886  1.00 61.57  ? 650 THR C H    1 
ATOM   10508 H HA   . THR B 1 313 ? -6.534  -22.998 30.776  1.00 64.53  ? 650 THR C HA   1 
ATOM   10509 H HB   . THR B 1 313 ? -4.636  -21.353 29.462  1.00 74.51  ? 650 THR C HB   1 
ATOM   10510 H HG1  . THR B 1 313 ? -3.728  -21.982 31.377  1.00 80.30  ? 650 THR C HG1  1 
ATOM   10511 H HG21 . THR B 1 313 ? -5.879  -19.616 30.398  1.00 81.34  ? 650 THR C HG21 1 
ATOM   10512 H HG22 . THR B 1 313 ? -6.818  -20.539 29.556  1.00 81.34  ? 650 THR C HG22 1 
ATOM   10513 H HG23 . THR B 1 313 ? -6.804  -20.650 31.115  1.00 81.34  ? 650 THR C HG23 1 
ATOM   10514 N N    . PRO B 1 314 ? -7.580  -22.843 28.510  1.00 41.82  ? 651 PRO C N    1 
ATOM   10515 C CA   . PRO B 1 314 ? -8.103  -22.945 27.148  1.00 53.30  ? 651 PRO C CA   1 
ATOM   10516 C C    . PRO B 1 314 ? -7.389  -21.967 26.221  1.00 54.68  ? 651 PRO C C    1 
ATOM   10517 O O    . PRO B 1 314 ? -7.104  -22.327 25.084  1.00 43.16  ? 651 PRO C O    1 
ATOM   10518 C CB   . PRO B 1 314 ? -9.581  -22.572 27.305  1.00 52.99  ? 651 PRO C CB   1 
ATOM   10519 C CG   . PRO B 1 314 ? -9.889  -22.810 28.749  1.00 53.17  ? 651 PRO C CG   1 
ATOM   10520 C CD   . PRO B 1 314 ? -8.630  -22.485 29.478  1.00 48.65  ? 651 PRO C CD   1 
ATOM   10521 H HA   . PRO B 1 314 ? -8.020  -23.859 26.805  1.00 63.96  ? 651 PRO C HA   1 
ATOM   10522 H HB2  . PRO B 1 314 ? -9.710  -21.639 27.075  1.00 63.59  ? 651 PRO C HB2  1 
ATOM   10523 H HB3  . PRO B 1 314 ? -10.124 -23.144 26.740  1.00 63.59  ? 651 PRO C HB3  1 
ATOM   10524 H HG2  . PRO B 1 314 ? -10.608 -22.223 29.030  1.00 63.80  ? 651 PRO C HG2  1 
ATOM   10525 H HG3  . PRO B 1 314 ? -10.132 -23.739 28.882  1.00 63.80  ? 651 PRO C HG3  1 
ATOM   10526 H HD2  . PRO B 1 314 ? -8.592  -21.538 29.684  1.00 58.38  ? 651 PRO C HD2  1 
ATOM   10527 H HD3  . PRO B 1 314 ? -8.552  -23.028 30.278  1.00 58.38  ? 651 PRO C HD3  1 
ATOM   10528 N N    . GLU B 1 315 ? -7.087  -20.765 26.709  1.00 44.45  ? 652 GLU C N    1 
ATOM   10529 C CA   . GLU B 1 315 ? -6.450  -19.750 25.872  1.00 49.38  ? 652 GLU C CA   1 
ATOM   10530 C C    . GLU B 1 315 ? -5.159  -20.303 25.284  1.00 44.96  ? 652 GLU C C    1 
ATOM   10531 O O    . GLU B 1 315 ? -4.790  -19.980 24.155  1.00 43.61  ? 652 GLU C O    1 
ATOM   10532 C CB   . GLU B 1 315 ? -6.139  -18.460 26.650  1.00 65.07  ? 652 GLU C CB   1 
ATOM   10533 C CG   . GLU B 1 315 ? -6.943  -18.226 27.924  1.00 75.53  ? 652 GLU C CG   1 
ATOM   10534 C CD   . GLU B 1 315 ? -8.425  -18.059 27.674  1.00 80.71  ? 652 GLU C CD   1 
ATOM   10535 O OE1  . GLU B 1 315 ? -9.183  -17.947 28.662  1.00 82.41  ? 652 GLU C OE1  1 
ATOM   10536 O OE2  . GLU B 1 315 ? -8.833  -18.035 26.496  1.00 84.68  ? 652 GLU C OE2  1 
ATOM   10537 H H    . GLU B 1 315 ? -7.239  -20.513 27.517  1.00 53.34  ? 652 GLU C H    1 
ATOM   10538 H HA   . GLU B 1 315 ? -7.050  -19.523 25.131  1.00 59.26  ? 652 GLU C HA   1 
ATOM   10539 H HB2  . GLU B 1 315 ? -5.202  -18.474 26.900  1.00 78.08  ? 652 GLU C HB2  1 
ATOM   10540 H HB3  . GLU B 1 315 ? -6.303  -17.705 26.064  1.00 78.08  ? 652 GLU C HB3  1 
ATOM   10541 H HG2  . GLU B 1 315 ? -6.824  -18.986 28.514  1.00 90.63  ? 652 GLU C HG2  1 
ATOM   10542 H HG3  . GLU B 1 315 ? -6.620  -17.419 28.355  1.00 90.63  ? 652 GLU C HG3  1 
ATOM   10543 N N    . GLU B 1 316 ? -4.468  -21.144 26.045  1.00 43.71  ? 653 GLU C N    1 
ATOM   10544 C CA   . GLU B 1 316 ? -3.189  -21.680 25.588  1.00 44.19  ? 653 GLU C CA   1 
ATOM   10545 C C    . GLU B 1 316 ? -3.325  -22.617 24.386  1.00 45.33  ? 653 GLU C C    1 
ATOM   10546 O O    . GLU B 1 316 ? -2.345  -22.887 23.691  1.00 42.98  ? 653 GLU C O    1 
ATOM   10547 C CB   . GLU B 1 316 ? -2.483  -22.399 26.731  1.00 52.46  ? 653 GLU C CB   1 
ATOM   10548 C CG   . GLU B 1 316 ? -2.171  -21.498 27.901  1.00 52.23  ? 653 GLU C CG   1 
ATOM   10549 C CD   . GLU B 1 316 ? -1.414  -22.217 28.984  1.00 55.05  ? 653 GLU C CD   1 
ATOM   10550 O OE1  . GLU B 1 316 ? -1.975  -22.385 30.086  1.00 48.23  ? 653 GLU C OE1  1 
ATOM   10551 O OE2  . GLU B 1 316 ? -0.259  -22.615 28.728  1.00 58.61  ? 653 GLU C OE2  1 
ATOM   10552 H H    . GLU B 1 316 ? -4.714  -21.419 26.822  1.00 52.46  ? 653 GLU C H    1 
ATOM   10553 H HA   . GLU B 1 316 ? -2.619  -20.931 25.314  1.00 53.03  ? 653 GLU C HA   1 
ATOM   10554 H HB2  . GLU B 1 316 ? -3.053  -23.116 27.051  1.00 62.95  ? 653 GLU C HB2  1 
ATOM   10555 H HB3  . GLU B 1 316 ? -1.646  -22.764 26.404  1.00 62.95  ? 653 GLU C HB3  1 
ATOM   10556 H HG2  . GLU B 1 316 ? -1.628  -20.756 27.594  1.00 62.68  ? 653 GLU C HG2  1 
ATOM   10557 H HG3  . GLU B 1 316 ? -3.002  -21.170 28.280  1.00 62.68  ? 653 GLU C HG3  1 
ATOM   10558 N N    . THR B 1 317 ? -4.537  -23.104 24.136  1.00 49.96  ? 654 THR C N    1 
ATOM   10559 C CA   . THR B 1 317 ? -4.779  -24.028 23.029  1.00 51.87  ? 654 THR C CA   1 
ATOM   10560 C C    . THR B 1 317 ? -5.270  -23.302 21.777  1.00 50.02  ? 654 THR C C    1 
ATOM   10561 O O    . THR B 1 317 ? -5.638  -23.939 20.788  1.00 45.09  ? 654 THR C O    1 
ATOM   10562 C CB   . THR B 1 317 ? -5.840  -25.082 23.397  1.00 38.03  ? 654 THR C CB   1 
ATOM   10563 O OG1  . THR B 1 317 ? -7.148  -24.504 23.290  1.00 37.41  ? 654 THR C OG1  1 
ATOM   10564 C CG2  . THR B 1 317 ? -5.622  -25.610 24.820  1.00 38.54  ? 654 THR C CG2  1 
ATOM   10565 H H    . THR B 1 317 ? -5.239  -22.915 24.595  1.00 59.96  ? 654 THR C H    1 
ATOM   10566 H HA   . THR B 1 317 ? -3.946  -24.494 22.809  1.00 62.24  ? 654 THR C HA   1 
ATOM   10567 H HB   . THR B 1 317 ? -5.772  -25.830 22.783  1.00 45.63  ? 654 THR C HB   1 
ATOM   10568 H HG1  . THR B 1 317 ? -7.215  -23.865 23.800  1.00 44.89  ? 654 THR C HG1  1 
ATOM   10569 H HG21 . THR B 1 317 ? -6.291  -26.265 25.032  1.00 46.24  ? 654 THR C HG21 1 
ATOM   10570 H HG22 . THR B 1 317 ? -4.755  -26.016 24.889  1.00 46.24  ? 654 THR C HG22 1 
ATOM   10571 H HG23 . THR B 1 317 ? -5.680  -24.889 25.450  1.00 46.24  ? 654 THR C HG23 1 
ATOM   10572 N N    . GLY B 1 318 ? -5.280  -21.975 21.820  1.00 48.65  ? 655 GLY C N    1 
ATOM   10573 C CA   . GLY B 1 318 ? -5.791  -21.190 20.712  1.00 50.17  ? 655 GLY C CA   1 
ATOM   10574 C C    . GLY B 1 318 ? -7.297  -21.002 20.778  1.00 51.41  ? 655 GLY C C    1 
ATOM   10575 O O    . GLY B 1 318 ? -7.890  -20.373 19.898  1.00 47.17  ? 655 GLY C O    1 
ATOM   10576 H H    . GLY B 1 318 ? -4.995  -21.506 22.482  1.00 58.38  ? 655 GLY C H    1 
ATOM   10577 H HA2  . GLY B 1 318 ? -5.371  -20.316 20.715  1.00 60.20  ? 655 GLY C HA2  1 
ATOM   10578 H HA3  . GLY B 1 318 ? -5.573  -21.632 19.876  1.00 60.20  ? 655 GLY C HA3  1 
ATOM   10579 N N    . SER B 1 319 ? -7.922  -21.547 21.818  1.00 43.12  ? 656 SER C N    1 
ATOM   10580 C CA   . SER B 1 319 ? -9.349  -21.337 22.046  1.00 43.99  ? 656 SER C CA   1 
ATOM   10581 C C    . SER B 1 319 ? -9.527  -20.108 22.905  1.00 56.25  ? 656 SER C C    1 
ATOM   10582 O O    . SER B 1 319 ? -9.303  -20.155 24.120  1.00 62.32  ? 656 SER C O    1 
ATOM   10583 C CB   . SER B 1 319 ? -9.983  -22.519 22.783  1.00 49.29  ? 656 SER C CB   1 
ATOM   10584 O OG   . SER B 1 319 ? -9.474  -23.751 22.306  1.00 52.16  ? 656 SER C OG   1 
ATOM   10585 H H    . SER B 1 319 ? -7.541  -22.045 22.408  1.00 51.74  ? 656 SER C H    1 
ATOM   10586 H HA   . SER B 1 319 ? -9.812  -21.203 21.193  1.00 52.78  ? 656 SER C HA   1 
ATOM   10587 H HB2  . SER B 1 319 ? -9.785  -22.443 23.729  1.00 59.15  ? 656 SER C HB2  1 
ATOM   10588 H HB3  . SER B 1 319 ? -10.942 -22.500 22.643  1.00 59.15  ? 656 SER C HB3  1 
ATOM   10589 H HG   . SER B 1 319 ? -8.924  -23.617 21.712  1.00 62.59  ? 656 SER C HG   1 
ATOM   10590 N N    . TYR B 1 320 ? -9.939  -19.010 22.291  1.00 40.37  ? 657 TYR C N    1 
ATOM   10591 C CA   . TYR B 1 320 ? -10.140 -17.783 23.046  1.00 50.63  ? 657 TYR C CA   1 
ATOM   10592 C C    . TYR B 1 320 ? -11.612 -17.544 23.386  1.00 51.88  ? 657 TYR C C    1 
ATOM   10593 O O    . TYR B 1 320 ? -11.949 -16.547 24.020  1.00 56.18  ? 657 TYR C O    1 
ATOM   10594 C CB   . TYR B 1 320 ? -9.537  -16.601 22.285  1.00 52.90  ? 657 TYR C CB   1 
ATOM   10595 C CG   . TYR B 1 320 ? -8.049  -16.763 22.082  1.00 62.41  ? 657 TYR C CG   1 
ATOM   10596 C CD1  . TYR B 1 320 ? -7.535  -17.192 20.865  1.00 67.09  ? 657 TYR C CD1  1 
ATOM   10597 C CD2  . TYR B 1 320 ? -7.158  -16.520 23.121  1.00 68.64  ? 657 TYR C CD2  1 
ATOM   10598 C CE1  . TYR B 1 320 ? -6.171  -17.355 20.683  1.00 65.94  ? 657 TYR C CE1  1 
ATOM   10599 C CE2  . TYR B 1 320 ? -5.796  -16.679 22.948  1.00 66.85  ? 657 TYR C CE2  1 
ATOM   10600 C CZ   . TYR B 1 320 ? -5.309  -17.096 21.729  1.00 64.88  ? 657 TYR C CZ   1 
ATOM   10601 O OH   . TYR B 1 320 ? -3.954  -17.257 21.556  1.00 67.01  ? 657 TYR C OH   1 
ATOM   10602 H H    . TYR B 1 320 ? -10.107 -18.948 21.450  1.00 48.44  ? 657 TYR C H    1 
ATOM   10603 H HA   . TYR B 1 320 ? -9.655  -17.861 23.894  1.00 60.75  ? 657 TYR C HA   1 
ATOM   10604 H HB2  . TYR B 1 320 ? -9.956  -16.536 21.413  1.00 63.49  ? 657 TYR C HB2  1 
ATOM   10605 H HB3  . TYR B 1 320 ? -9.687  -15.787 22.790  1.00 63.49  ? 657 TYR C HB3  1 
ATOM   10606 H HD1  . TYR B 1 320 ? -8.115  -17.366 20.159  1.00 80.50  ? 657 TYR C HD1  1 
ATOM   10607 H HD2  . TYR B 1 320 ? -7.484  -16.237 23.945  1.00 82.37  ? 657 TYR C HD2  1 
ATOM   10608 H HE1  . TYR B 1 320 ? -5.839  -17.637 19.862  1.00 79.12  ? 657 TYR C HE1  1 
ATOM   10609 H HE2  . TYR B 1 320 ? -5.212  -16.506 23.650  1.00 80.22  ? 657 TYR C HE2  1 
ATOM   10610 H HH   . TYR B 1 320 ? -3.669  -17.815 22.084  1.00 80.42  ? 657 TYR C HH   1 
ATOM   10611 N N    . LEU B 1 321 ? -12.478 -18.476 22.996  1.00 51.86  ? 658 LEU C N    1 
ATOM   10612 C CA   . LEU B 1 321 ? -13.909 -18.328 23.232  1.00 58.85  ? 658 LEU C CA   1 
ATOM   10613 C C    . LEU B 1 321 ? -14.499 -19.486 24.047  1.00 64.64  ? 658 LEU C C    1 
ATOM   10614 O O    . LEU B 1 321 ? -15.679 -19.808 23.913  1.00 68.24  ? 658 LEU C O    1 
ATOM   10615 C CB   . LEU B 1 321 ? -14.640 -18.216 21.893  1.00 62.29  ? 658 LEU C CB   1 
ATOM   10616 C CG   . LEU B 1 321 ? -14.093 -17.155 20.936  1.00 65.42  ? 658 LEU C CG   1 
ATOM   10617 C CD1  . LEU B 1 321 ? -14.465 -17.492 19.507  1.00 63.17  ? 658 LEU C CD1  1 
ATOM   10618 C CD2  . LEU B 1 321 ? -14.593 -15.769 21.314  1.00 74.35  ? 658 LEU C CD2  1 
ATOM   10619 H H    . LEU B 1 321 ? -12.261 -19.204 22.593  1.00 62.23  ? 658 LEU C H    1 
ATOM   10620 H HA   . LEU B 1 321 ? -14.065 -17.499 23.731  1.00 70.61  ? 658 LEU C HA   1 
ATOM   10621 H HB2  . LEU B 1 321 ? -14.585 -19.072 21.440  1.00 74.75  ? 658 LEU C HB2  1 
ATOM   10622 H HB3  . LEU B 1 321 ? -15.569 -18.000 22.067  1.00 74.75  ? 658 LEU C HB3  1 
ATOM   10623 H HG   . LEU B 1 321 ? -13.125 -17.148 20.996  1.00 78.51  ? 658 LEU C HG   1 
ATOM   10624 H HD11 . LEU B 1 321 ? -14.112 -16.815 18.925  1.00 75.81  ? 658 LEU C HD11 1 
ATOM   10625 H HD12 . LEU B 1 321 ? -14.090 -18.347 19.281  1.00 75.81  ? 658 LEU C HD12 1 
ATOM   10626 H HD13 . LEU B 1 321 ? -15.421 -17.523 19.433  1.00 75.81  ? 658 LEU C HD13 1 
ATOM   10627 H HD21 . LEU B 1 321 ? -14.233 -15.128 20.696  1.00 89.22  ? 658 LEU C HD21 1 
ATOM   10628 H HD22 . LEU B 1 321 ? -15.552 -15.762 21.272  1.00 89.22  ? 658 LEU C HD22 1 
ATOM   10629 H HD23 . LEU B 1 321 ? -14.302 -15.565 22.205  1.00 89.22  ? 658 LEU C HD23 1 
ATOM   10630 N N    . VAL B 1 322 ? -13.686 -20.104 24.896  1.00 67.16  ? 659 VAL C N    1 
ATOM   10631 C CA   . VAL B 1 322 ? -14.154 -21.221 25.712  1.00 78.36  ? 659 VAL C CA   1 
ATOM   10632 C C    . VAL B 1 322 ? -14.760 -20.741 27.027  1.00 82.56  ? 659 VAL C C    1 
ATOM   10633 O O    . VAL B 1 322 ? -15.941 -20.964 27.294  1.00 84.73  ? 659 VAL C O    1 
ATOM   10634 C CB   . VAL B 1 322 ? -13.008 -22.201 26.038  1.00 86.43  ? 659 VAL C CB   1 
ATOM   10635 C CG1  . VAL B 1 322 ? -13.505 -23.335 26.935  1.00 83.59  ? 659 VAL C CG1  1 
ATOM   10636 C CG2  . VAL B 1 322 ? -12.406 -22.748 24.757  1.00 87.00  ? 659 VAL C CG2  1 
ATOM   10637 H H    . VAL B 1 322 ? -12.861 -19.897 25.020  1.00 80.59  ? 659 VAL C H    1 
ATOM   10638 H HA   . VAL B 1 322 ? -14.844 -21.712 25.218  1.00 94.03  ? 659 VAL C HA   1 
ATOM   10639 H HB   . VAL B 1 322 ? -12.305 -21.719 26.521  1.00 103.72 ? 659 VAL C HB   1 
ATOM   10640 H HG11 . VAL B 1 322 ? -12.774 -23.928 27.122  1.00 100.30 ? 659 VAL C HG11 1 
ATOM   10641 H HG12 . VAL B 1 322 ? -13.841 -22.961 27.753  1.00 100.30 ? 659 VAL C HG12 1 
ATOM   10642 H HG13 . VAL B 1 322 ? -14.205 -23.809 26.480  1.00 100.30 ? 659 VAL C HG13 1 
ATOM   10643 H HG21 . VAL B 1 322 ? -11.696 -23.355 24.980  1.00 104.40 ? 659 VAL C HG21 1 
ATOM   10644 H HG22 . VAL B 1 322 ? -13.088 -23.209 24.264  1.00 104.40 ? 659 VAL C HG22 1 
ATOM   10645 H HG23 . VAL B 1 322 ? -12.062 -22.018 24.237  1.00 104.40 ? 659 VAL C HG23 1 
ATOM   10646 N N    . SER B 1 323 ? -13.937 -20.088 27.842  1.00 78.09  ? 660 SER C N    1 
ATOM   10647 C CA   . SER B 1 323 ? -14.335 -19.658 29.178  1.00 73.12  ? 660 SER C CA   1 
ATOM   10648 C C    . SER B 1 323 ? -15.792 -19.201 29.215  1.00 77.00  ? 660 SER C C    1 
ATOM   10649 O O    . SER B 1 323 ? -16.689 -19.971 29.565  1.00 76.01  ? 660 SER C O    1 
ATOM   10650 C CB   . SER B 1 323 ? -13.428 -18.523 29.651  1.00 77.64  ? 660 SER C CB   1 
ATOM   10651 O OG   . SER B 1 323 ? -12.082 -18.751 29.267  1.00 73.06  ? 660 SER C OG   1 
ATOM   10652 H H    . SER B 1 323 ? -13.128 -19.878 27.639  1.00 93.71  ? 660 SER C H    1 
ATOM   10653 H HA   . SER B 1 323 ? -14.235 -20.409 29.800  1.00 87.74  ? 660 SER C HA   1 
ATOM   10654 H HB2  . SER B 1 323 ? -13.731 -17.691 29.255  1.00 93.17  ? 660 SER C HB2  1 
ATOM   10655 H HB3  . SER B 1 323 ? -13.474 -18.465 30.618  1.00 93.17  ? 660 SER C HB3  1 
ATOM   10656 H HG   . SER B 1 323 ? -11.608 -18.134 29.528  1.00 87.67  ? 660 SER C HG   1 
ATOM   10657 N N    . HIS B 1 329 ? -10.964 -25.985 36.346  1.00 47.80  ? 666 HIS C N    1 
ATOM   10658 C CA   . HIS B 1 329 ? -9.626  -26.401 36.781  1.00 64.36  ? 666 HIS C CA   1 
ATOM   10659 C C    . HIS B 1 329 ? -9.194  -27.698 36.091  1.00 63.74  ? 666 HIS C C    1 
ATOM   10660 O O    . HIS B 1 329 ? -8.885  -28.693 36.748  1.00 58.25  ? 666 HIS C O    1 
ATOM   10661 C CB   . HIS B 1 329 ? -9.585  -26.587 38.300  1.00 69.68  ? 666 HIS C CB   1 
ATOM   10662 C CG   . HIS B 1 329 ? -9.449  -25.307 39.063  1.00 82.92  ? 666 HIS C CG   1 
ATOM   10663 N ND1  . HIS B 1 329 ? -10.460 -24.797 39.850  1.00 87.81  ? 666 HIS C ND1  1 
ATOM   10664 C CD2  . HIS B 1 329 ? -8.421  -24.432 39.159  1.00 86.39  ? 666 HIS C CD2  1 
ATOM   10665 C CE1  . HIS B 1 329 ? -10.059 -23.664 40.398  1.00 89.99  ? 666 HIS C CE1  1 
ATOM   10666 N NE2  . HIS B 1 329 ? -8.825  -23.420 39.995  1.00 90.20  ? 666 HIS C NE2  1 
ATOM   10667 H HA   . HIS B 1 329 ? -8.982  -25.702 36.543  1.00 77.23  ? 666 HIS C HA   1 
ATOM   10668 H HB2  . HIS B 1 329 ? -10.407 -27.016 38.584  1.00 83.61  ? 666 HIS C HB2  1 
ATOM   10669 H HB3  . HIS B 1 329 ? -8.827  -27.149 38.525  1.00 83.61  ? 666 HIS C HB3  1 
ATOM   10670 H HD2  . HIS B 1 329 ? -7.595  -24.503 38.738  1.00 103.67 ? 666 HIS C HD2  1 
ATOM   10671 H HE1  . HIS B 1 329 ? -10.561 -23.130 40.971  1.00 107.98 ? 666 HIS C HE1  1 
ATOM   10672 N N    . CYS B 1 330 ? -9.153  -27.671 34.762  1.00 62.63  ? 667 CYS C N    1 
ATOM   10673 C CA   . CYS B 1 330 ? -8.960  -28.883 33.980  1.00 48.78  ? 667 CYS C CA   1 
ATOM   10674 C C    . CYS B 1 330 ? -7.736  -28.792 33.085  1.00 45.88  ? 667 CYS C C    1 
ATOM   10675 O O    . CYS B 1 330 ? -6.976  -27.825 33.141  1.00 45.08  ? 667 CYS C O    1 
ATOM   10676 C CB   . CYS B 1 330 ? -10.192 -29.110 33.103  1.00 42.14  ? 667 CYS C CB   1 
ATOM   10677 S SG   . CYS B 1 330 ? -11.752 -28.789 33.948  1.00 49.65  ? 667 CYS C SG   1 
ATOM   10678 H H    . CYS B 1 330 ? -9.235  -26.958 34.289  1.00 75.16  ? 667 CYS C H    1 
ATOM   10679 H HA   . CYS B 1 330 ? -8.855  -29.650 34.580  1.00 58.53  ? 667 CYS C HA   1 
ATOM   10680 H HB2  . CYS B 1 330 ? -10.144 -28.519 32.336  1.00 50.56  ? 667 CYS C HB2  1 
ATOM   10681 H HB3  . CYS B 1 330 ? -10.200 -30.034 32.808  1.00 50.56  ? 667 CYS C HB3  1 
ATOM   10682 H HG   . CYS B 1 330 ? -12.657 -28.992 33.188  1.00 59.58  ? 667 CYS C HG   1 
ATOM   10683 N N    . LEU B 1 331 ? -7.552  -29.816 32.259  1.00 31.19  ? 668 LEU C N    1 
ATOM   10684 C CA   . LEU B 1 331 ? -6.616  -29.748 31.148  1.00 39.91  ? 668 LEU C CA   1 
ATOM   10685 C C    . LEU B 1 331 ? -7.443  -29.667 29.867  1.00 32.62  ? 668 LEU C C    1 
ATOM   10686 O O    . LEU B 1 331 ? -8.432  -30.379 29.725  1.00 32.56  ? 668 LEU C O    1 
ATOM   10687 C CB   . LEU B 1 331 ? -5.699  -30.965 31.132  1.00 41.52  ? 668 LEU C CB   1 
ATOM   10688 C CG   . LEU B 1 331 ? -4.737  -31.034 32.323  1.00 45.92  ? 668 LEU C CG   1 
ATOM   10689 C CD1  . LEU B 1 331 ? -3.855  -32.270 32.245  1.00 49.73  ? 668 LEU C CD1  1 
ATOM   10690 C CD2  . LEU B 1 331 ? -3.888  -29.775 32.402  1.00 47.07  ? 668 LEU C CD2  1 
ATOM   10691 H H    . LEU B 1 331 ? -7.964  -30.568 32.322  1.00 37.43  ? 668 LEU C H    1 
ATOM   10692 H HA   . LEU B 1 331 ? -6.067  -28.939 31.224  1.00 47.90  ? 668 LEU C HA   1 
ATOM   10693 H HB2  . LEU B 1 331 ? -6.244  -31.767 31.145  1.00 49.82  ? 668 LEU C HB2  1 
ATOM   10694 H HB3  . LEU B 1 331 ? -5.165  -30.944 30.322  1.00 49.82  ? 668 LEU C HB3  1 
ATOM   10695 H HG   . LEU B 1 331 ? -5.257  -31.092 33.141  1.00 55.11  ? 668 LEU C HG   1 
ATOM   10696 H HD11 . LEU B 1 331 ? -3.267  -32.281 33.004  1.00 59.68  ? 668 LEU C HD11 1 
ATOM   10697 H HD12 . LEU B 1 331 ? -4.412  -33.052 32.250  1.00 59.68  ? 668 LEU C HD12 1 
ATOM   10698 H HD13 . LEU B 1 331 ? -3.342  -32.237 31.434  1.00 59.68  ? 668 LEU C HD13 1 
ATOM   10699 H HD21 . LEU B 1 331 ? -3.296  -29.844 33.155  1.00 56.49  ? 668 LEU C HD21 1 
ATOM   10700 H HD22 . LEU B 1 331 ? -3.379  -29.691 31.592  1.00 56.49  ? 668 LEU C HD22 1 
ATOM   10701 H HD23 . LEU B 1 331 ? -4.465  -29.015 32.507  1.00 56.49  ? 668 LEU C HD23 1 
ATOM   10702 N N    . TYR B 1 332 ? -7.023  -28.814 28.940  1.00 30.15  ? 669 TYR C N    1 
ATOM   10703 C CA   . TYR B 1 332 ? -7.836  -28.478 27.769  1.00 29.06  ? 669 TYR C CA   1 
ATOM   10704 C C    . TYR B 1 332 ? -7.104  -28.851 26.482  1.00 28.58  ? 669 TYR C C    1 
ATOM   10705 O O    . TYR B 1 332 ? -5.886  -28.708 26.383  1.00 33.56  ? 669 TYR C O    1 
ATOM   10706 C CB   . TYR B 1 332 ? -8.159  -26.980 27.781  1.00 38.88  ? 669 TYR C CB   1 
ATOM   10707 C CG   . TYR B 1 332 ? -8.850  -26.534 29.048  1.00 42.07  ? 669 TYR C CG   1 
ATOM   10708 C CD1  . TYR B 1 332 ? -10.228 -26.617 29.172  1.00 38.95  ? 669 TYR C CD1  1 
ATOM   10709 C CD2  . TYR B 1 332 ? -8.123  -26.049 30.132  1.00 45.22  ? 669 TYR C CD2  1 
ATOM   10710 C CE1  . TYR B 1 332 ? -10.869 -26.221 30.328  1.00 47.44  ? 669 TYR C CE1  1 
ATOM   10711 C CE2  . TYR B 1 332 ? -8.756  -25.655 31.296  1.00 44.70  ? 669 TYR C CE2  1 
ATOM   10712 C CZ   . TYR B 1 332 ? -10.129 -25.741 31.388  1.00 50.80  ? 669 TYR C CZ   1 
ATOM   10713 O OH   . TYR B 1 332 ? -10.773 -25.348 32.541  1.00 57.62  ? 669 TYR C OH   1 
ATOM   10714 H H    . TYR B 1 332 ? -6.264  -28.410 28.964  1.00 36.18  ? 669 TYR C H    1 
ATOM   10715 H HA   . TYR B 1 332 ? -8.678  -28.978 27.802  1.00 34.87  ? 669 TYR C HA   1 
ATOM   10716 H HB2  . TYR B 1 332 ? -7.333  -26.478 27.699  1.00 46.65  ? 669 TYR C HB2  1 
ATOM   10717 H HB3  . TYR B 1 332 ? -8.744  -26.778 27.034  1.00 46.65  ? 669 TYR C HB3  1 
ATOM   10718 H HD1  . TYR B 1 332 ? -10.731 -26.940 28.459  1.00 46.74  ? 669 TYR C HD1  1 
ATOM   10719 H HD2  . TYR B 1 332 ? -7.196  -25.991 30.072  1.00 54.26  ? 669 TYR C HD2  1 
ATOM   10720 H HE1  . TYR B 1 332 ? -11.795 -26.280 30.393  1.00 56.92  ? 669 TYR C HE1  1 
ATOM   10721 H HE2  . TYR B 1 332 ? -8.259  -25.329 32.011  1.00 53.64  ? 669 TYR C HE2  1 
ATOM   10722 H HH   . TYR B 1 332 ? -10.621 -24.557 32.692  1.00 69.15  ? 669 TYR C HH   1 
ATOM   10723 N N    . THR B 1 333 ? -7.854  -29.336 25.498  1.00 30.66  ? 670 THR C N    1 
ATOM   10724 C CA   . THR B 1 333 ? -7.286  -29.727 24.216  1.00 29.73  ? 670 THR C CA   1 
ATOM   10725 C C    . THR B 1 333 ? -8.231  -29.280 23.106  1.00 29.28  ? 670 THR C C    1 
ATOM   10726 O O    . THR B 1 333 ? -9.420  -29.583 23.144  1.00 30.04  ? 670 THR C O    1 
ATOM   10727 C CB   . THR B 1 333 ? -7.105  -31.247 24.116  1.00 34.97  ? 670 THR C CB   1 
ATOM   10728 O OG1  . THR B 1 333 ? -6.159  -31.692 25.099  1.00 34.84  ? 670 THR C OG1  1 
ATOM   10729 C CG2  . THR B 1 333 ? -6.609  -31.630 22.729  1.00 43.13  ? 670 THR C CG2  1 
ATOM   10730 H H    . THR B 1 333 ? -8.705  -29.449 25.550  1.00 36.80  ? 670 THR C H    1 
ATOM   10731 H HA   . THR B 1 333 ? -6.417  -29.293 24.088  1.00 35.67  ? 670 THR C HA   1 
ATOM   10732 H HB   . THR B 1 333 ? -7.957  -31.684 24.268  1.00 41.97  ? 670 THR C HB   1 
ATOM   10733 H HG1  . THR B 1 333 ? -6.061  -32.504 25.047  1.00 41.81  ? 670 THR C HG1  1 
ATOM   10734 H HG21 . THR B 1 333 ? -6.498  -32.582 22.672  1.00 51.76  ? 670 THR C HG21 1 
ATOM   10735 H HG22 . THR B 1 333 ? -7.244  -31.350 22.066  1.00 51.76  ? 670 THR C HG22 1 
ATOM   10736 H HG23 . THR B 1 333 ? -5.766  -31.206 22.554  1.00 51.76  ? 670 THR C HG23 1 
ATOM   10737 N N    . ARG B 1 334 ? -7.699  -28.568 22.122  1.00 28.54  ? 671 ARG C N    1 
ATOM   10738 C CA   . ARG B 1 334 ? -8.533  -28.023 21.058  1.00 30.20  ? 671 ARG C CA   1 
ATOM   10739 C C    . ARG B 1 334 ? -8.437  -28.901 19.825  1.00 32.37  ? 671 ARG C C    1 
ATOM   10740 O O    . ARG B 1 334 ? -7.357  -29.121 19.279  1.00 31.88  ? 671 ARG C O    1 
ATOM   10741 C CB   . ARG B 1 334 ? -8.117  -26.591 20.743  1.00 30.66  ? 671 ARG C CB   1 
ATOM   10742 C CG   . ARG B 1 334 ? -8.970  -25.902 19.659  1.00 27.39  ? 671 ARG C CG   1 
ATOM   10743 C CD   . ARG B 1 334 ? -8.564  -24.457 19.551  1.00 35.13  ? 671 ARG C CD   1 
ATOM   10744 N NE   . ARG B 1 334 ? -9.502  -23.646 18.770  1.00 36.49  ? 671 ARG C NE   1 
ATOM   10745 C CZ   . ARG B 1 334 ? -9.228  -23.175 17.563  1.00 41.49  ? 671 ARG C CZ   1 
ATOM   10746 N NH1  . ARG B 1 334 ? -8.051  -23.443 17.011  1.00 39.16  ? 671 ARG C NH1  1 
ATOM   10747 N NH2  . ARG B 1 334 ? -10.119 -22.435 16.908  1.00 47.89  ? 671 ARG C NH2  1 
ATOM   10748 H H    . ARG B 1 334 ? -6.861  -28.386 22.045  1.00 34.25  ? 671 ARG C H    1 
ATOM   10749 H HA   . ARG B 1 334 ? -9.467  -28.012 21.355  1.00 36.24  ? 671 ARG C HA   1 
ATOM   10750 H HB2  . ARG B 1 334 ? -8.188  -26.062 21.553  1.00 36.80  ? 671 ARG C HB2  1 
ATOM   10751 H HB3  . ARG B 1 334 ? -7.198  -26.596 20.435  1.00 36.80  ? 671 ARG C HB3  1 
ATOM   10752 H HG2  . ARG B 1 334 ? -8.820  -26.332 18.803  1.00 32.87  ? 671 ARG C HG2  1 
ATOM   10753 H HG3  . ARG B 1 334 ? -9.908  -25.945 19.905  1.00 32.87  ? 671 ARG C HG3  1 
ATOM   10754 H HD2  . ARG B 1 334 ? -8.514  -24.078 20.443  1.00 42.16  ? 671 ARG C HD2  1 
ATOM   10755 H HD3  . ARG B 1 334 ? -7.696  -24.406 19.122  1.00 42.16  ? 671 ARG C HD3  1 
ATOM   10756 H HE   . ARG B 1 334 ? -10.208 -23.354 19.165  1.00 43.79  ? 671 ARG C HE   1 
ATOM   10757 H HH11 . ARG B 1 334 ? -7.475  -23.918 17.437  1.00 47.00  ? 671 ARG C HH11 1 
ATOM   10758 H HH12 . ARG B 1 334 ? -7.865  -23.141 16.228  1.00 47.00  ? 671 ARG C HH12 1 
ATOM   10759 H HH21 . ARG B 1 334 ? -10.882 -22.263 17.265  1.00 57.47  ? 671 ARG C HH21 1 
ATOM   10760 H HH22 . ARG B 1 334 ? -9.936  -22.135 16.123  1.00 57.47  ? 671 ARG C HH22 1 
ATOM   10761 N N    . LEU B 1 335 ? -9.583  -29.424 19.417  1.00 24.36  ? 672 LEU C N    1 
ATOM   10762 C CA   . LEU B 1 335 ? -9.694  -30.229 18.221  1.00 24.63  ? 672 LEU C CA   1 
ATOM   10763 C C    . LEU B 1 335 ? -10.317 -29.382 17.119  1.00 24.19  ? 672 LEU C C    1 
ATOM   10764 O O    . LEU B 1 335 ? -11.531 -29.236 17.040  1.00 26.80  ? 672 LEU C O    1 
ATOM   10765 C CB   . LEU B 1 335 ? -10.574 -31.453 18.463  1.00 32.48  ? 672 LEU C CB   1 
ATOM   10766 C CG   . LEU B 1 335 ? -10.298 -32.277 19.719  1.00 39.46  ? 672 LEU C CG   1 
ATOM   10767 C CD1  . LEU B 1 335 ? -10.889 -33.662 19.530  1.00 47.38  ? 672 LEU C CD1  1 
ATOM   10768 C CD2  . LEU B 1 335 ? -8.815  -32.355 19.997  1.00 41.34  ? 672 LEU C CD2  1 
ATOM   10769 H H    . LEU B 1 335 ? -10.330 -29.321 19.831  1.00 29.24  ? 672 LEU C H    1 
ATOM   10770 H HA   . LEU B 1 335 ? -8.805  -30.526 17.933  1.00 29.56  ? 672 LEU C HA   1 
ATOM   10771 H HB2  . LEU B 1 335 ? -11.495 -31.154 18.516  1.00 38.98  ? 672 LEU C HB2  1 
ATOM   10772 H HB3  . LEU B 1 335 ? -10.475 -32.049 17.704  1.00 38.98  ? 672 LEU C HB3  1 
ATOM   10773 H HG   . LEU B 1 335 ? -10.731 -31.860 20.480  1.00 47.36  ? 672 LEU C HG   1 
ATOM   10774 H HD11 . LEU B 1 335 ? -10.719 -34.184 20.317  1.00 56.86  ? 672 LEU C HD11 1 
ATOM   10775 H HD12 . LEU B 1 335 ? -11.836 -33.580 19.389  1.00 56.86  ? 672 LEU C HD12 1 
ATOM   10776 H HD13 . LEU B 1 335 ? -10.479 -34.075 18.766  1.00 56.86  ? 672 LEU C HD13 1 
ATOM   10777 H HD21 . LEU B 1 335 ? -8.674  -32.878 20.790  1.00 49.61  ? 672 LEU C HD21 1 
ATOM   10778 H HD22 . LEU B 1 335 ? -8.379  -32.769 19.249  1.00 49.61  ? 672 LEU C HD22 1 
ATOM   10779 H HD23 . LEU B 1 335 ? -8.475  -31.467 20.125  1.00 49.61  ? 672 LEU C HD23 1 
ATOM   10780 N N    . SER B 1 336 ? -9.477  -28.805 16.286  1.00 28.78  ? 673 SER C N    1 
ATOM   10781 C CA   . SER B 1 336 ? -9.969  -28.096 15.119  1.00 31.12  ? 673 SER C CA   1 
ATOM   10782 C C    . SER B 1 336 ? -9.911  -29.116 13.983  1.00 45.35  ? 673 SER C C    1 
ATOM   10783 O O    . SER B 1 336 ? -9.346  -30.196 14.155  1.00 55.92  ? 673 SER C O    1 
ATOM   10784 C CB   . SER B 1 336 ? -9.096  -26.885 14.832  1.00 34.92  ? 673 SER C CB   1 
ATOM   10785 O OG   . SER B 1 336 ? -7.726  -27.205 14.998  1.00 36.00  ? 673 SER C OG   1 
ATOM   10786 H H    . SER B 1 336 ? -8.621  -28.806 16.370  1.00 34.53  ? 673 SER C H    1 
ATOM   10787 H HA   . SER B 1 336 ? -10.896 -27.809 15.256  1.00 37.34  ? 673 SER C HA   1 
ATOM   10788 H HB2  . SER B 1 336 ? -9.245  -26.597 13.918  1.00 41.90  ? 673 SER C HB2  1 
ATOM   10789 H HB3  . SER B 1 336 ? -9.331  -26.173 15.448  1.00 41.90  ? 673 SER C HB3  1 
ATOM   10790 H HG   . SER B 1 336 ? -7.263  -26.547 14.842  1.00 43.20  ? 673 SER C HG   1 
ATOM   10791 N N    . SER B 1 337 ? -10.517 -28.800 12.846  1.00 46.43  ? 674 SER C N    1 
ATOM   10792 C CA   . SER B 1 337 ? -10.453 -29.695 11.693  1.00 37.84  ? 674 SER C CA   1 
ATOM   10793 C C    . SER B 1 337 ? -11.261 -30.988 11.871  1.00 29.33  ? 674 SER C C    1 
ATOM   10794 O O    . SER B 1 337 ? -10.867 -32.044 11.369  1.00 29.14  ? 674 SER C O    1 
ATOM   10795 C CB   . SER B 1 337 ? -8.994  -30.042 11.394  1.00 41.11  ? 674 SER C CB   1 
ATOM   10796 O OG   . SER B 1 337 ? -8.229  -28.867 11.204  1.00 47.10  ? 674 SER C OG   1 
ATOM   10797 H H    . SER B 1 337 ? -10.968 -28.080 12.714  1.00 55.72  ? 674 SER C H    1 
ATOM   10798 H HA   . SER B 1 337 ? -10.814 -29.225 10.912  1.00 45.40  ? 674 SER C HA   1 
ATOM   10799 H HB2  . SER B 1 337 ? -8.628  -30.541 12.141  1.00 49.33  ? 674 SER C HB2  1 
ATOM   10800 H HB3  . SER B 1 337 ? -8.956  -30.578 10.587  1.00 49.33  ? 674 SER C HB3  1 
ATOM   10801 H HG   . SER B 1 337 ? -8.706  -28.205 11.289  1.00 56.52  ? 674 SER C HG   1 
ATOM   10802 N N    . LEU B 1 338 ? -12.399 -30.915 12.555  1.00 21.79  ? 675 LEU C N    1 
ATOM   10803 C CA   . LEU B 1 338 ? -13.221 -32.114 12.742  1.00 25.46  ? 675 LEU C CA   1 
ATOM   10804 C C    . LEU B 1 338 ? -13.768 -32.643 11.424  1.00 30.43  ? 675 LEU C C    1 
ATOM   10805 O O    . LEU B 1 338 ? -14.112 -33.825 11.309  1.00 34.08  ? 675 LEU C O    1 
ATOM   10806 C CB   . LEU B 1 338 ? -14.387 -31.852 13.681  1.00 24.76  ? 675 LEU C CB   1 
ATOM   10807 C CG   . LEU B 1 338 ? -14.055 -31.671 15.158  1.00 29.27  ? 675 LEU C CG   1 
ATOM   10808 C CD1  . LEU B 1 338 ? -15.341 -31.450 15.911  1.00 23.48  ? 675 LEU C CD1  1 
ATOM   10809 C CD2  . LEU B 1 338 ? -13.287 -32.882 15.715  1.00 35.62  ? 675 LEU C CD2  1 
ATOM   10810 H H    . LEU B 1 338 ? -12.715 -30.201 12.915  1.00 26.15  ? 675 LEU C H    1 
ATOM   10811 H HA   . LEU B 1 338 ? -12.667 -32.817 13.141  1.00 30.55  ? 675 LEU C HA   1 
ATOM   10812 H HB2  . LEU B 1 338 ? -14.835 -31.043 13.387  1.00 29.71  ? 675 LEU C HB2  1 
ATOM   10813 H HB3  . LEU B 1 338 ? -15.002 -32.599 13.615  1.00 29.71  ? 675 LEU C HB3  1 
ATOM   10814 H HG   . LEU B 1 338 ? -13.500 -30.883 15.267  1.00 35.12  ? 675 LEU C HG   1 
ATOM   10815 H HD11 . LEU B 1 338 ? -15.141 -31.335 16.843  1.00 28.18  ? 675 LEU C HD11 1 
ATOM   10816 H HD12 . LEU B 1 338 ? -15.772 -30.663 15.568  1.00 28.18  ? 675 LEU C HD12 1 
ATOM   10817 H HD13 . LEU B 1 338 ? -15.910 -32.214 15.789  1.00 28.18  ? 675 LEU C HD13 1 
ATOM   10818 H HD21 . LEU B 1 338 ? -13.097 -32.731 16.644  1.00 42.75  ? 675 LEU C HD21 1 
ATOM   10819 H HD22 . LEU B 1 338 ? -13.828 -33.668 15.615  1.00 42.75  ? 675 LEU C HD22 1 
ATOM   10820 H HD23 . LEU B 1 338 ? -12.467 -32.984 15.225  1.00 42.75  ? 675 LEU C HD23 1 
ATOM   10821 N N    . GLN B 1 339 ? -13.856 -31.760 10.436  1.00 27.65  ? 676 GLN C N    1 
ATOM   10822 C CA   . GLN B 1 339 ? -14.364 -32.124 9.122   1.00 26.22  ? 676 GLN C CA   1 
ATOM   10823 C C    . GLN B 1 339 ? -13.424 -33.098 8.393   1.00 32.79  ? 676 GLN C C    1 
ATOM   10824 O O    . GLN B 1 339 ? -13.797 -33.700 7.383   1.00 35.04  ? 676 GLN C O    1 
ATOM   10825 C CB   . GLN B 1 339 ? -14.633 -30.857 8.275   1.00 32.49  ? 676 GLN C CB   1 
ATOM   10826 C CG   . GLN B 1 339 ? -13.411 -30.183 7.620   1.00 31.03  ? 676 GLN C CG   1 
ATOM   10827 C CD   . GLN B 1 339 ? -12.510 -29.428 8.589   1.00 27.54  ? 676 GLN C CD   1 
ATOM   10828 O OE1  . GLN B 1 339 ? -12.725 -29.412 9.805   1.00 28.81  ? 676 GLN C OE1  1 
ATOM   10829 N NE2  . GLN B 1 339 ? -11.481 -28.798 8.043   1.00 27.70  ? 676 GLN C NE2  1 
ATOM   10830 H H    . GLN B 1 339 ? -13.624 -30.935 10.504  1.00 33.18  ? 676 GLN C H    1 
ATOM   10831 H HA   . GLN B 1 339 ? -15.222 -32.582 9.241   1.00 31.46  ? 676 GLN C HA   1 
ATOM   10832 H HB2  . GLN B 1 339 ? -15.244 -31.096 7.561   1.00 38.98  ? 676 GLN C HB2  1 
ATOM   10833 H HB3  . GLN B 1 339 ? -15.053 -30.195 8.847   1.00 38.98  ? 676 GLN C HB3  1 
ATOM   10834 H HG2  . GLN B 1 339 ? -12.873 -30.866 7.190   1.00 37.24  ? 676 GLN C HG2  1 
ATOM   10835 H HG3  . GLN B 1 339 ? -13.725 -29.549 6.957   1.00 37.24  ? 676 GLN C HG3  1 
ATOM   10836 H HE21 . GLN B 1 339 ? -11.358 -28.833 7.193   1.00 33.24  ? 676 GLN C HE21 1 
ATOM   10837 H HE22 . GLN B 1 339 ? -10.936 -28.355 8.539   1.00 33.24  ? 676 GLN C HE22 1 
ATOM   10838 N N    . LYS B 1 340 ? -12.213 -33.261 8.906   1.00 23.84  ? 677 LYS C N    1 
ATOM   10839 C CA   . LYS B 1 340 ? -11.253 -34.190 8.300   1.00 35.43  ? 677 LYS C CA   1 
ATOM   10840 C C    . LYS B 1 340 ? -11.437 -35.608 8.828   1.00 40.35  ? 677 LYS C C    1 
ATOM   10841 O O    . LYS B 1 340 ? -10.745 -36.541 8.406   1.00 34.68  ? 677 LYS C O    1 
ATOM   10842 C CB   . LYS B 1 340 ? -9.821  -33.694 8.532   1.00 38.95  ? 677 LYS C CB   1 
ATOM   10843 C CG   . LYS B 1 340 ? -9.592  -32.284 7.955   1.00 40.32  ? 677 LYS C CG   1 
ATOM   10844 C CD   . LYS B 1 340 ? -8.158  -31.785 8.105   1.00 39.34  ? 677 LYS C CD   1 
ATOM   10845 C CE   . LYS B 1 340 ? -8.054  -30.281 7.780   1.00 33.44  ? 677 LYS C CE   1 
ATOM   10846 N NZ   . LYS B 1 340 ? -8.186  -30.027 6.316   1.00 31.63  ? 677 LYS C NZ   1 
ATOM   10847 H H    . LYS B 1 340 ? -11.918 -32.851 9.602   1.00 28.61  ? 677 LYS C H    1 
ATOM   10848 H HA   . LYS B 1 340 ? -11.406 -34.211 7.332   1.00 42.52  ? 677 LYS C HA   1 
ATOM   10849 H HB2  . LYS B 1 340 ? -9.646  -33.662 9.486   1.00 46.74  ? 677 LYS C HB2  1 
ATOM   10850 H HB3  . LYS B 1 340 ? -9.200  -34.302 8.100   1.00 46.74  ? 677 LYS C HB3  1 
ATOM   10851 H HG2  . LYS B 1 340 ? -9.805  -32.295 7.009   1.00 48.39  ? 677 LYS C HG2  1 
ATOM   10852 H HG3  . LYS B 1 340 ? -10.174 -31.660 8.416   1.00 48.39  ? 677 LYS C HG3  1 
ATOM   10853 H HD2  . LYS B 1 340 ? -7.865  -31.920 9.020   1.00 47.21  ? 677 LYS C HD2  1 
ATOM   10854 H HD3  . LYS B 1 340 ? -7.584  -32.270 7.493   1.00 47.21  ? 677 LYS C HD3  1 
ATOM   10855 H HE2  . LYS B 1 340 ? -8.765  -29.805 8.237   1.00 40.13  ? 677 LYS C HE2  1 
ATOM   10856 H HE3  . LYS B 1 340 ? -7.189  -29.951 8.068   1.00 40.13  ? 677 LYS C HE3  1 
ATOM   10857 H HZ1  . LYS B 1 340 ? -8.123  -29.154 6.152   1.00 37.96  ? 677 LYS C HZ1  1 
ATOM   10858 H HZ2  . LYS B 1 340 ? -7.541  -30.452 5.874   1.00 37.96  ? 677 LYS C HZ2  1 
ATOM   10859 H HZ3  . LYS B 1 340 ? -8.976  -30.319 6.027   1.00 37.96  ? 677 LYS C HZ3  1 
ATOM   10860 N N    . LEU B 1 341 ? -12.388 -35.770 9.742   1.00 34.36  ? 678 LEU C N    1 
ATOM   10861 C CA   . LEU B 1 341 ? -12.605 -37.049 10.420  1.00 40.46  ? 678 LEU C CA   1 
ATOM   10862 C C    . LEU B 1 341 ? -13.420 -38.012 9.552   1.00 46.32  ? 678 LEU C C    1 
ATOM   10863 O O    . LEU B 1 341 ? -14.539 -37.699 9.159   1.00 48.49  ? 678 LEU C O    1 
ATOM   10864 C CB   . LEU B 1 341 ? -13.333 -36.801 11.738  1.00 33.43  ? 678 LEU C CB   1 
ATOM   10865 C CG   . LEU B 1 341 ? -13.439 -37.977 12.704  1.00 52.69  ? 678 LEU C CG   1 
ATOM   10866 C CD1  . LEU B 1 341 ? -12.056 -38.451 13.143  1.00 41.19  ? 678 LEU C CD1  1 
ATOM   10867 C CD2  . LEU B 1 341 ? -14.283 -37.563 13.904  1.00 57.43  ? 678 LEU C CD2  1 
ATOM   10868 H H    . LEU B 1 341 ? -12.927 -35.148 9.992   1.00 41.24  ? 678 LEU C H    1 
ATOM   10869 H HA   . LEU B 1 341 ? -11.740 -37.466 10.617  1.00 48.56  ? 678 LEU C HA   1 
ATOM   10870 H HB2  . LEU B 1 341 ? -12.874 -36.087 12.206  1.00 40.12  ? 678 LEU C HB2  1 
ATOM   10871 H HB3  . LEU B 1 341 ? -14.238 -36.518 11.533  1.00 40.12  ? 678 LEU C HB3  1 
ATOM   10872 H HG   . LEU B 1 341 ? -13.885 -38.715 12.260  1.00 63.23  ? 678 LEU C HG   1 
ATOM   10873 H HD11 . LEU B 1 341 ? -12.156 -39.190 13.748  1.00 49.43  ? 678 LEU C HD11 1 
ATOM   10874 H HD12 . LEU B 1 341 ? -11.560 -38.727 12.368  1.00 49.43  ? 678 LEU C HD12 1 
ATOM   10875 H HD13 . LEU B 1 341 ? -11.602 -37.727 13.581  1.00 49.43  ? 678 LEU C HD13 1 
ATOM   10876 H HD21 . LEU B 1 341 ? -14.347 -38.305 14.511  1.00 68.92  ? 678 LEU C HD21 1 
ATOM   10877 H HD22 . LEU B 1 341 ? -13.861 -36.819 14.340  1.00 68.92  ? 678 LEU C HD22 1 
ATOM   10878 H HD23 . LEU B 1 341 ? -15.157 -37.312 13.599  1.00 68.92  ? 678 LEU C HD23 1 
ATOM   10879 N N    . LYS B 1 342 ? -12.856 -39.186 9.276   1.00 46.35  ? 679 LYS C N    1 
ATOM   10880 C CA   . LYS B 1 342 ? -13.485 -40.166 8.388   1.00 60.79  ? 679 LYS C CA   1 
ATOM   10881 C C    . LYS B 1 342 ? -14.180 -41.291 9.153   1.00 63.37  ? 679 LYS C C    1 
ATOM   10882 O O    . LYS B 1 342 ? -14.966 -42.046 8.578   1.00 63.01  ? 679 LYS C O    1 
ATOM   10883 C CB   . LYS B 1 342 ? -12.442 -40.772 7.443   1.00 67.95  ? 679 LYS C CB   1 
ATOM   10884 C CG   . LYS B 1 342 ? -12.110 -39.906 6.231   1.00 80.73  ? 679 LYS C CG   1 
ATOM   10885 C CD   . LYS B 1 342 ? -11.208 -40.642 5.246   1.00 86.28  ? 679 LYS C CD   1 
ATOM   10886 C CE   . LYS B 1 342 ? -9.811  -40.860 5.810   1.00 90.67  ? 679 LYS C CE   1 
ATOM   10887 N NZ   . LYS B 1 342 ? -9.055  -39.588 5.960   1.00 91.37  ? 679 LYS C NZ   1 
ATOM   10888 H H    . LYS B 1 342 ? -12.100 -39.443 9.594   1.00 55.62  ? 679 LYS C H    1 
ATOM   10889 H HA   . LYS B 1 342 ? -14.160 -39.711 7.842   1.00 72.95  ? 679 LYS C HA   1 
ATOM   10890 H HB2  . LYS B 1 342 ? -11.620 -40.915 7.937   1.00 81.54  ? 679 LYS C HB2  1 
ATOM   10891 H HB3  . LYS B 1 342 ? -12.777 -41.622 7.115   1.00 81.54  ? 679 LYS C HB3  1 
ATOM   10892 H HG2  . LYS B 1 342 ? -12.932 -39.670 5.772   1.00 96.88  ? 679 LYS C HG2  1 
ATOM   10893 H HG3  . LYS B 1 342 ? -11.649 -39.106 6.527   1.00 96.88  ? 679 LYS C HG3  1 
ATOM   10894 H HD2  . LYS B 1 342 ? -11.593 -41.510 5.048   1.00 103.54 ? 679 LYS C HD2  1 
ATOM   10895 H HD3  . LYS B 1 342 ? -11.128 -40.118 4.434   1.00 103.54 ? 679 LYS C HD3  1 
ATOM   10896 H HE2  . LYS B 1 342 ? -9.883  -41.273 6.685   1.00 108.81 ? 679 LYS C HE2  1 
ATOM   10897 H HE3  . LYS B 1 342 ? -9.313  -41.438 5.210   1.00 108.81 ? 679 LYS C HE3  1 
ATOM   10898 H HZ1  . LYS B 1 342 ? -8.968  -39.191 5.168   1.00 109.65 ? 679 LYS C HZ1  1 
ATOM   10899 H HZ2  . LYS B 1 342 ? -9.487  -39.041 6.512   1.00 109.65 ? 679 LYS C HZ2  1 
ATOM   10900 H HZ3  . LYS B 1 342 ? -8.245  -39.753 6.291   1.00 109.65 ? 679 LYS C HZ3  1 
ATOM   10901 N N    . GLU B 1 343 ? -13.881 -41.405 10.444  1.00 54.15  ? 680 GLU C N    1 
ATOM   10902 C CA   . GLU B 1 343 ? -14.440 -42.466 11.274  1.00 49.51  ? 680 GLU C CA   1 
ATOM   10903 C C    . GLU B 1 343 ? -14.842 -41.893 12.628  1.00 42.80  ? 680 GLU C C    1 
ATOM   10904 O O    . GLU B 1 343 ? -14.939 -40.676 12.783  1.00 44.28  ? 680 GLU C O    1 
ATOM   10905 C CB   . GLU B 1 343 ? -13.413 -43.579 11.460  1.00 50.07  ? 680 GLU C CB   1 
ATOM   10906 H H    . GLU B 1 343 ? -13.351 -40.876 10.866  1.00 64.98  ? 680 GLU C H    1 
ATOM   10907 H HA   . GLU B 1 343 ? -15.235 -42.840 10.841  1.00 59.41  ? 680 GLU C HA   1 
ATOM   10908 N N    . HIS B 1 344 ? -15.078 -42.762 13.604  1.00 37.95  ? 681 HIS C N    1 
ATOM   10909 C CA   . HIS B 1 344 ? -15.433 -42.301 14.942  1.00 44.51  ? 681 HIS C CA   1 
ATOM   10910 C C    . HIS B 1 344 ? -14.229 -41.637 15.600  1.00 46.52  ? 681 HIS C C    1 
ATOM   10911 O O    . HIS B 1 344 ? -13.090 -42.088 15.438  1.00 42.44  ? 681 HIS C O    1 
ATOM   10912 C CB   . HIS B 1 344 ? -15.910 -43.462 15.812  1.00 42.27  ? 681 HIS C CB   1 
ATOM   10913 C CG   . HIS B 1 344 ? -17.227 -44.036 15.397  1.00 49.89  ? 681 HIS C CG   1 
ATOM   10914 N ND1  . HIS B 1 344 ? -18.128 -43.349 14.6