data_3UON
# 
_entry.id   3UON 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UON         
RCSB  RCSB069016   
WWPDB D_1000069016 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UON 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Haga, K.'             1  
'Kruse, A.C.'          2  
'Asada, H.'            3  
'Yurugi-Kobayashi, T.' 4  
'Shiroishi, M.'        5  
'Zhang, C.'            6  
'Weis, W.I.'           7  
'Okada, T.'            8  
'Kobilka, B.K.'        9  
'Haga, T.'             10 
'Kobayashi, T.'        11 
# 
_citation.id                        primary 
_citation.title                     'Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            482 
_citation.page_first                547 
_citation.page_last                 551 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22278061 
_citation.pdbx_database_id_DOI      10.1038/nature10753 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Haga, K.'             1  ? 
primary 'Kruse, A.C.'          2  ? 
primary 'Asada, H.'            3  ? 
primary 'Yurugi-Kobayashi, T.' 4  ? 
primary 'Shiroishi, M.'        5  ? 
primary 'Zhang, C.'            6  ? 
primary 'Weis, W.I.'           7  ? 
primary 'Okada, T.'            8  ? 
primary 'Kobilka, B.K.'        9  ? 
primary 'Haga, T.'             10 ? 
primary 'Kobayashi, T.'        11 ? 
# 
_cell.entry_id           3UON 
_cell.length_a           78.17 
_cell.length_b           47.26 
_cell.length_c           88.12 
_cell.angle_alpha        90.0 
_cell.angle_beta         109.7 
_cell.angle_gamma        90.0 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UON 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein' 52694.543 1  3.2.1.17 
'N2D, N3D, N6D, N9D, C54T, C97A' 'UNP RESIDUES 1-217, UNP RESIDUES 2-161, UNP RESIDUES 377-466' ? 
2 non-polymer syn '(3R)-1-azabicyclo[2.2.2]oct-3-yl hydroxy(diphenyl)acetate'              337.412   1  ?        ? ? ? 
3 non-polymer man beta-D-glucopyranose                                                     180.156   1  ?        ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                                           35.453    2  ?        ? ? ? 
5 water       nat water                                                                    18.015    57 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDDSTDSSDNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLY
TLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAIL
FWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRINIFEMLRIDEGLRLKIYKDTEGY
YTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVF
QMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPPPSREKKVTRTILAILLAFIIT
WAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDDSTDSSDNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLY
TLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAIL
FWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRINIFEMLRIDEGLRLKIYKDTEGY
YTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVF
QMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPPPSREKKVTRTILAILLAFIIT
WAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ASP n 
1 4   SER n 
1 5   THR n 
1 6   ASP n 
1 7   SER n 
1 8   SER n 
1 9   ASP n 
1 10  ASN n 
1 11  SER n 
1 12  LEU n 
1 13  ALA n 
1 14  LEU n 
1 15  THR n 
1 16  SER n 
1 17  PRO n 
1 18  TYR n 
1 19  LYS n 
1 20  THR n 
1 21  PHE n 
1 22  GLU n 
1 23  VAL n 
1 24  VAL n 
1 25  PHE n 
1 26  ILE n 
1 27  VAL n 
1 28  LEU n 
1 29  VAL n 
1 30  ALA n 
1 31  GLY n 
1 32  SER n 
1 33  LEU n 
1 34  SER n 
1 35  LEU n 
1 36  VAL n 
1 37  THR n 
1 38  ILE n 
1 39  ILE n 
1 40  GLY n 
1 41  ASN n 
1 42  ILE n 
1 43  LEU n 
1 44  VAL n 
1 45  MET n 
1 46  VAL n 
1 47  SER n 
1 48  ILE n 
1 49  LYS n 
1 50  VAL n 
1 51  ASN n 
1 52  ARG n 
1 53  HIS n 
1 54  LEU n 
1 55  GLN n 
1 56  THR n 
1 57  VAL n 
1 58  ASN n 
1 59  ASN n 
1 60  TYR n 
1 61  PHE n 
1 62  LEU n 
1 63  PHE n 
1 64  SER n 
1 65  LEU n 
1 66  ALA n 
1 67  CYS n 
1 68  ALA n 
1 69  ASP n 
1 70  LEU n 
1 71  ILE n 
1 72  ILE n 
1 73  GLY n 
1 74  VAL n 
1 75  PHE n 
1 76  SER n 
1 77  MET n 
1 78  ASN n 
1 79  LEU n 
1 80  TYR n 
1 81  THR n 
1 82  LEU n 
1 83  TYR n 
1 84  THR n 
1 85  VAL n 
1 86  ILE n 
1 87  GLY n 
1 88  TYR n 
1 89  TRP n 
1 90  PRO n 
1 91  LEU n 
1 92  GLY n 
1 93  PRO n 
1 94  VAL n 
1 95  VAL n 
1 96  CYS n 
1 97  ASP n 
1 98  LEU n 
1 99  TRP n 
1 100 LEU n 
1 101 ALA n 
1 102 LEU n 
1 103 ASP n 
1 104 TYR n 
1 105 VAL n 
1 106 VAL n 
1 107 SER n 
1 108 ASN n 
1 109 ALA n 
1 110 SER n 
1 111 VAL n 
1 112 MET n 
1 113 ASN n 
1 114 LEU n 
1 115 LEU n 
1 116 ILE n 
1 117 ILE n 
1 118 SER n 
1 119 PHE n 
1 120 ASP n 
1 121 ARG n 
1 122 TYR n 
1 123 PHE n 
1 124 CYS n 
1 125 VAL n 
1 126 THR n 
1 127 LYS n 
1 128 PRO n 
1 129 LEU n 
1 130 THR n 
1 131 TYR n 
1 132 PRO n 
1 133 VAL n 
1 134 LYS n 
1 135 ARG n 
1 136 THR n 
1 137 THR n 
1 138 LYS n 
1 139 MET n 
1 140 ALA n 
1 141 GLY n 
1 142 MET n 
1 143 MET n 
1 144 ILE n 
1 145 ALA n 
1 146 ALA n 
1 147 ALA n 
1 148 TRP n 
1 149 VAL n 
1 150 LEU n 
1 151 SER n 
1 152 PHE n 
1 153 ILE n 
1 154 LEU n 
1 155 TRP n 
1 156 ALA n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 LEU n 
1 161 PHE n 
1 162 TRP n 
1 163 GLN n 
1 164 PHE n 
1 165 ILE n 
1 166 VAL n 
1 167 GLY n 
1 168 VAL n 
1 169 ARG n 
1 170 THR n 
1 171 VAL n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 GLU n 
1 176 CYS n 
1 177 TYR n 
1 178 ILE n 
1 179 GLN n 
1 180 PHE n 
1 181 PHE n 
1 182 SER n 
1 183 ASN n 
1 184 ALA n 
1 185 ALA n 
1 186 VAL n 
1 187 THR n 
1 188 PHE n 
1 189 GLY n 
1 190 THR n 
1 191 ALA n 
1 192 ILE n 
1 193 ALA n 
1 194 ALA n 
1 195 PHE n 
1 196 TYR n 
1 197 LEU n 
1 198 PRO n 
1 199 VAL n 
1 200 ILE n 
1 201 ILE n 
1 202 MET n 
1 203 THR n 
1 204 VAL n 
1 205 LEU n 
1 206 TYR n 
1 207 TRP n 
1 208 HIS n 
1 209 ILE n 
1 210 SER n 
1 211 ARG n 
1 212 ALA n 
1 213 SER n 
1 214 LYS n 
1 215 SER n 
1 216 ARG n 
1 217 ILE n 
1 218 ASN n 
1 219 ILE n 
1 220 PHE n 
1 221 GLU n 
1 222 MET n 
1 223 LEU n 
1 224 ARG n 
1 225 ILE n 
1 226 ASP n 
1 227 GLU n 
1 228 GLY n 
1 229 LEU n 
1 230 ARG n 
1 231 LEU n 
1 232 LYS n 
1 233 ILE n 
1 234 TYR n 
1 235 LYS n 
1 236 ASP n 
1 237 THR n 
1 238 GLU n 
1 239 GLY n 
1 240 TYR n 
1 241 TYR n 
1 242 THR n 
1 243 ILE n 
1 244 GLY n 
1 245 ILE n 
1 246 GLY n 
1 247 HIS n 
1 248 LEU n 
1 249 LEU n 
1 250 THR n 
1 251 LYS n 
1 252 SER n 
1 253 PRO n 
1 254 SER n 
1 255 LEU n 
1 256 ASN n 
1 257 ALA n 
1 258 ALA n 
1 259 LYS n 
1 260 SER n 
1 261 GLU n 
1 262 LEU n 
1 263 ASP n 
1 264 LYS n 
1 265 ALA n 
1 266 ILE n 
1 267 GLY n 
1 268 ARG n 
1 269 ASN n 
1 270 THR n 
1 271 ASN n 
1 272 GLY n 
1 273 VAL n 
1 274 ILE n 
1 275 THR n 
1 276 LYS n 
1 277 ASP n 
1 278 GLU n 
1 279 ALA n 
1 280 GLU n 
1 281 LYS n 
1 282 LEU n 
1 283 PHE n 
1 284 ASN n 
1 285 GLN n 
1 286 ASP n 
1 287 VAL n 
1 288 ASP n 
1 289 ALA n 
1 290 ALA n 
1 291 VAL n 
1 292 ARG n 
1 293 GLY n 
1 294 ILE n 
1 295 LEU n 
1 296 ARG n 
1 297 ASN n 
1 298 ALA n 
1 299 LYS n 
1 300 LEU n 
1 301 LYS n 
1 302 PRO n 
1 303 VAL n 
1 304 TYR n 
1 305 ASP n 
1 306 SER n 
1 307 LEU n 
1 308 ASP n 
1 309 ALA n 
1 310 VAL n 
1 311 ARG n 
1 312 ARG n 
1 313 ALA n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 MET n 
1 319 VAL n 
1 320 PHE n 
1 321 GLN n 
1 322 MET n 
1 323 GLY n 
1 324 GLU n 
1 325 THR n 
1 326 GLY n 
1 327 VAL n 
1 328 ALA n 
1 329 GLY n 
1 330 PHE n 
1 331 THR n 
1 332 ASN n 
1 333 SER n 
1 334 LEU n 
1 335 ARG n 
1 336 MET n 
1 337 LEU n 
1 338 GLN n 
1 339 GLN n 
1 340 LYS n 
1 341 ARG n 
1 342 TRP n 
1 343 ASP n 
1 344 GLU n 
1 345 ALA n 
1 346 ALA n 
1 347 VAL n 
1 348 ASN n 
1 349 LEU n 
1 350 ALA n 
1 351 LYS n 
1 352 SER n 
1 353 ARG n 
1 354 TRP n 
1 355 TYR n 
1 356 ASN n 
1 357 GLN n 
1 358 THR n 
1 359 PRO n 
1 360 ASN n 
1 361 ARG n 
1 362 ALA n 
1 363 LYS n 
1 364 ARG n 
1 365 VAL n 
1 366 ILE n 
1 367 THR n 
1 368 THR n 
1 369 PHE n 
1 370 ARG n 
1 371 THR n 
1 372 GLY n 
1 373 THR n 
1 374 TRP n 
1 375 ASP n 
1 376 ALA n 
1 377 TYR n 
1 378 PRO n 
1 379 PRO n 
1 380 PRO n 
1 381 SER n 
1 382 ARG n 
1 383 GLU n 
1 384 LYS n 
1 385 LYS n 
1 386 VAL n 
1 387 THR n 
1 388 ARG n 
1 389 THR n 
1 390 ILE n 
1 391 LEU n 
1 392 ALA n 
1 393 ILE n 
1 394 LEU n 
1 395 LEU n 
1 396 ALA n 
1 397 PHE n 
1 398 ILE n 
1 399 ILE n 
1 400 THR n 
1 401 TRP n 
1 402 ALA n 
1 403 PRO n 
1 404 TYR n 
1 405 ASN n 
1 406 VAL n 
1 407 MET n 
1 408 VAL n 
1 409 LEU n 
1 410 ILE n 
1 411 ASN n 
1 412 THR n 
1 413 PHE n 
1 414 CYS n 
1 415 ALA n 
1 416 PRO n 
1 417 CYS n 
1 418 ILE n 
1 419 PRO n 
1 420 ASN n 
1 421 THR n 
1 422 VAL n 
1 423 TRP n 
1 424 THR n 
1 425 ILE n 
1 426 GLY n 
1 427 TYR n 
1 428 TRP n 
1 429 LEU n 
1 430 CYS n 
1 431 TYR n 
1 432 ILE n 
1 433 ASN n 
1 434 SER n 
1 435 THR n 
1 436 ILE n 
1 437 ASN n 
1 438 PRO n 
1 439 ALA n 
1 440 CYS n 
1 441 TYR n 
1 442 ALA n 
1 443 LEU n 
1 444 CYS n 
1 445 ASN n 
1 446 ALA n 
1 447 THR n 
1 448 PHE n 
1 449 LYS n 
1 450 LYS n 
1 451 THR n 
1 452 PHE n 
1 453 LYS n 
1 454 HIS n 
1 455 LEU n 
1 456 LEU n 
1 457 MET n 
1 458 CYS n 
1 459 HIS n 
1 460 TYR n 
1 461 LYS n 
1 462 ASN n 
1 463 ILE n 
1 464 GLY n 
1 465 ALA n 
1 466 THR n 
1 467 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   217 ? ? 'CHRM2, E' ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 3 sample ? 378 467 ? ? 'CHRM2, E' ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 218 377 ? ? 'CHRM2, E' ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ACM2_HUMAN P08172 1 
;MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLY
TLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAIL
FWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRI
;
1   ? 
2 UNP LYS_BPT4   P00720 1 
;NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRN
AKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY

;
2   ? 
3 UNP ACM2_HUMAN P08172 1 
;PPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLM
CHYKNIGATR
;
377 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UON A 1   ? 217 ? P08172 1   ? 217 ? 1    217  
2 2 3UON A 218 ? 377 ? P00720 2   ? 161 ? 1002 1161 
3 3 3UON A 378 ? 467 ? P08172 377 ? 466 ? 377  466  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UON ASP A 2   ? UNP P08172 ASN 2  'engineered mutation' 2    1 
1 3UON ASP A 3   ? UNP P08172 ASN 3  'engineered mutation' 3    2 
1 3UON ASP A 6   ? UNP P08172 ASN 6  'engineered mutation' 6    3 
1 3UON ASP A 9   ? UNP P08172 ASN 9  'engineered mutation' 9    4 
2 3UON THR A 270 ? UNP P00720 CYS 54 'engineered mutation' 1054 5 
2 3UON ALA A 313 ? UNP P00720 CYS 97 'engineered mutation' 1097 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                             ? 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking' . beta-D-glucopyranose                                        ? 'C6 H12 O6'      180.156 
CL  non-polymer                  . 'CHLORIDE ION'                                              ? 'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                       ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                                               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                     ? 'C5 H9 N O2'     115.130 
QNB non-polymer                  . '(3R)-1-azabicyclo[2.2.2]oct-3-yl hydroxy(diphenyl)acetate' ? 'C21 H23 N O3'   337.412 
SER 'L-peptide linking'          y SERINE                                                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3UON 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   23 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.91 
_exptl_crystal.density_percent_sol   57.70 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;25 to 35% PEG 300, 100 mM ammonium phosphate, 2% 2-Methyl-2,4-pentanediol, 100 mM HEPES, 10:1 monoolein:cholesterol lipid mix diluted 1.5:1 with protein in detergent buffer, Lipidic cubic phase, temperature 293K, pH 7.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 78 ? 1 
2 78 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'MARMOSAIC 300 mm CCD' 2011-02-10 mirrors 
2 CCD 'MARMOSAIC 300 mm CCD' 2011-03-05 mirrors 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si(111) double crystal' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'Si(111) double crystal' 'SINGLE WAVELENGTH' x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 23-ID-D' APS 23-ID-D ? 1.033 
2 SYNCHROTRON 'APS BEAMLINE 23-ID-B' APS 23-ID-B ? 1.033 
# 
_reflns.entry_id                     3UON 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             27.5 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   11726 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.185 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   79.2 
_reflns_shell.Rmerge_I_obs           0.454 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 3UON 
_refine.ls_number_reflns_obs                     11702 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.466 
_refine.ls_d_res_high                            3.000 
_refine.ls_percent_reflns_obs                    94.15 
_refine.ls_R_factor_obs                          0.2274 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2248 
_refine.ls_R_factor_R_free                       0.2764 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_number_reflns_R_free                  593 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            18.2278 
_refine.aniso_B[2][2]                            2.5771 
_refine.aniso_B[3][3]                            -20.8049 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            9.8464 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.357 
_refine.solvent_model_param_bsol                 52.880 
_refine.pdbx_solvent_vdw_probe_radii             0.50 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.16 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Beta2 adrenergic receptor, T4 lysozyme (PDB ENTRY 2RH1)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random. 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.70 
_refine.pdbx_overall_phase_error                 30.11 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3451 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             57 
_refine_hist.number_atoms_total               3547 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        27.466 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.002  ? ? 3577 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.573  ? ? 4880 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 12.894 ? ? 1261 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.041  ? ? 582  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.002  ? ? 592  ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UON 
_struct.title                     'Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist' 
_struct.pdbx_descriptor           'Human M2 muscarinic acetylcholine receptor T4, lysozyme fusion protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UON 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/ANTAGONIST' 
_struct_keywords.text            'G protein-coupled receptor, GPCR, acetylcholine receptor, SIGNALING PROTEIN-ANTAGONIST complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The biological molecule is equivalent to the contents of the asymmetric unit excluding the T4 lysozyme, which is a non-physiological crystallization aid.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 22  ? ASN A 51  ? GLU A 22   ASN A 51   1 ? 30 
HELX_P HELX_P2  2  ARG A 52  ? GLN A 55  ? ARG A 52   GLN A 55   5 ? 4  
HELX_P HELX_P3  3  THR A 56  ? PHE A 75  ? THR A 56   PHE A 75   1 ? 20 
HELX_P HELX_P4  4  PHE A 75  ? ILE A 86  ? PHE A 75   ILE A 86   1 ? 12 
HELX_P HELX_P5  5  GLY A 92  ? LYS A 127 ? GLY A 92   LYS A 127  1 ? 36 
HELX_P HELX_P6  6  TYR A 131 ? ARG A 135 ? TYR A 131  ARG A 135  5 ? 5  
HELX_P HELX_P7  7  THR A 136 ? GLY A 167 ? THR A 136  GLY A 167  1 ? 32 
HELX_P HELX_P8  8  ILE A 178 ? SER A 182 ? ILE A 178  SER A 182  5 ? 5  
HELX_P HELX_P9  9  ASN A 183 ? PHE A 195 ? ASN A 183  PHE A 195  1 ? 13 
HELX_P HELX_P10 10 PHE A 195 ? LYS A 214 ? PHE A 195  LYS A 214  1 ? 20 
HELX_P HELX_P11 11 ASN A 218 ? GLU A 227 ? ASN A 1002 GLU A 1011 1 ? 10 
HELX_P HELX_P12 12 SER A 254 ? GLY A 267 ? SER A 1038 GLY A 1051 1 ? 14 
HELX_P HELX_P13 13 THR A 275 ? ARG A 296 ? THR A 1059 ARG A 1080 1 ? 22 
HELX_P HELX_P14 14 LEU A 300 ? LEU A 307 ? LEU A 1084 LEU A 1091 1 ? 8  
HELX_P HELX_P15 15 ASP A 308 ? ALA A 328 ? ASP A 1092 ALA A 1112 1 ? 21 
HELX_P HELX_P16 16 PHE A 330 ? GLN A 339 ? PHE A 1114 GLN A 1123 1 ? 10 
HELX_P HELX_P17 17 ARG A 341 ? ALA A 350 ? ARG A 1125 ALA A 1134 1 ? 10 
HELX_P HELX_P18 18 SER A 352 ? THR A 358 ? SER A 1136 THR A 1142 1 ? 7  
HELX_P HELX_P19 19 THR A 358 ? GLY A 372 ? THR A 1142 GLY A 1156 1 ? 15 
HELX_P HELX_P20 20 LYS A 384 ? CYS A 414 ? LYS A 383  CYS A 413  1 ? 31 
HELX_P HELX_P21 21 PRO A 419 ? ASN A 433 ? PRO A 418  ASN A 432  1 ? 15 
HELX_P HELX_P22 22 THR A 435 ? ASN A 445 ? THR A 434  ASN A 444  1 ? 11 
HELX_P HELX_P23 23 ASN A 445 ? LEU A 456 ? ASN A 444  LEU A 455  1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 96  SG ? ? ? 1_555 A CYS 176 SG ? ? A CYS 96  A CYS 176 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf2 disulf ? ? A CYS 414 SG ? ? ? 1_555 A CYS 417 SG ? ? A CYS 413 A CYS 416 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 230 ? LYS A 235 ? ARG A 1014 LYS A 1019 
A 2 TYR A 241 ? GLY A 244 ? TYR A 1025 GLY A 1028 
A 3 HIS A 247 ? LEU A 248 ? HIS A 1031 LEU A 1032 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 230 ? N ARG A 1014 O GLY A 244 ? O GLY A 1028 
A 2 3 N ILE A 243 ? N ILE A 1027 O HIS A 247 ? O HIS A 1031 
# 
_database_PDB_matrix.entry_id          3UON 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UON 
_atom_sites.fract_transf_matrix[1][1]   0.012793 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004585 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021159 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012056 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 20  ? 20.300  19.848  -19.190 1.00 117.69 ? 20   THR A N   1 
ATOM   2    C  CA  . THR A 1 20  ? 20.989  20.462  -20.321 1.00 116.97 ? 20   THR A CA  1 
ATOM   3    C  C   . THR A 1 20  ? 22.236  21.226  -19.870 1.00 116.16 ? 20   THR A C   1 
ATOM   4    O  O   . THR A 1 20  ? 23.271  20.621  -19.588 1.00 119.70 ? 20   THR A O   1 
ATOM   5    C  CB  . THR A 1 20  ? 20.054  21.399  -21.111 1.00 115.68 ? 20   THR A CB  1 
ATOM   6    O  OG1 . THR A 1 20  ? 19.541  22.416  -20.241 1.00 119.28 ? 20   THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 20  ? 18.891  20.613  -21.704 1.00 103.76 ? 20   THR A CG2 1 
ATOM   8    N  N   . PHE A 1 21  ? 22.134  22.551  -19.805 1.00 109.27 ? 21   PHE A N   1 
ATOM   9    C  CA  . PHE A 1 21  ? 23.245  23.387  -19.356 1.00 110.11 ? 21   PHE A CA  1 
ATOM   10   C  C   . PHE A 1 21  ? 23.134  23.646  -17.855 1.00 115.15 ? 21   PHE A C   1 
ATOM   11   O  O   . PHE A 1 21  ? 24.091  24.077  -17.208 1.00 104.73 ? 21   PHE A O   1 
ATOM   12   C  CB  . PHE A 1 21  ? 23.254  24.718  -20.115 1.00 95.25  ? 21   PHE A CB  1 
ATOM   13   C  CG  . PHE A 1 21  ? 22.180  25.674  -19.675 1.00 109.27 ? 21   PHE A CG  1 
ATOM   14   C  CD1 . PHE A 1 21  ? 22.463  26.682  -18.766 1.00 112.24 ? 21   PHE A CD1 1 
ATOM   15   C  CD2 . PHE A 1 21  ? 20.887  25.563  -20.163 1.00 112.08 ? 21   PHE A CD2 1 
ATOM   16   C  CE1 . PHE A 1 21  ? 21.479  27.562  -18.355 1.00 108.70 ? 21   PHE A CE1 1 
ATOM   17   C  CE2 . PHE A 1 21  ? 19.898  26.443  -19.754 1.00 112.78 ? 21   PHE A CE2 1 
ATOM   18   C  CZ  . PHE A 1 21  ? 20.196  27.443  -18.849 1.00 107.31 ? 21   PHE A CZ  1 
ATOM   19   N  N   . GLU A 1 22  ? 21.950  23.374  -17.314 1.00 110.34 ? 22   GLU A N   1 
ATOM   20   C  CA  . GLU A 1 22  ? 21.631  23.648  -15.918 1.00 99.90  ? 22   GLU A CA  1 
ATOM   21   C  C   . GLU A 1 22  ? 21.992  22.480  -15.004 1.00 96.72  ? 22   GLU A C   1 
ATOM   22   O  O   . GLU A 1 22  ? 21.597  22.451  -13.838 1.00 87.34  ? 22   GLU A O   1 
ATOM   23   C  CB  . GLU A 1 22  ? 20.137  23.942  -15.796 1.00 105.28 ? 22   GLU A CB  1 
ATOM   24   C  CG  . GLU A 1 22  ? 19.263  22.848  -16.400 1.00 109.92 ? 22   GLU A CG  1 
ATOM   25   C  CD  . GLU A 1 22  ? 17.791  23.214  -16.452 1.00 119.65 ? 22   GLU A CD  1 
ATOM   26   O  OE1 . GLU A 1 22  ? 17.422  24.296  -15.949 1.00 121.77 ? 22   GLU A OE1 1 
ATOM   27   O  OE2 . GLU A 1 22  ? 17.001  22.416  -17.001 1.00 118.02 ? 22   GLU A OE2 1 
ATOM   28   N  N   . VAL A 1 23  ? 22.739  21.519  -15.539 1.00 101.23 ? 23   VAL A N   1 
ATOM   29   C  CA  . VAL A 1 23  ? 23.081  20.300  -14.805 1.00 83.17  ? 23   VAL A CA  1 
ATOM   30   C  C   . VAL A 1 23  ? 23.610  20.563  -13.396 1.00 73.54  ? 23   VAL A C   1 
ATOM   31   O  O   . VAL A 1 23  ? 23.138  19.961  -12.431 1.00 74.11  ? 23   VAL A O   1 
ATOM   32   C  CB  . VAL A 1 23  ? 24.102  19.436  -15.579 1.00 78.55  ? 23   VAL A CB  1 
ATOM   33   C  CG1 . VAL A 1 23  ? 24.637  18.321  -14.692 1.00 62.87  ? 23   VAL A CG1 1 
ATOM   34   C  CG2 . VAL A 1 23  ? 23.469  18.869  -16.842 1.00 82.14  ? 23   VAL A CG2 1 
ATOM   35   N  N   . VAL A 1 24  ? 24.583  21.463  -13.284 1.00 81.04  ? 24   VAL A N   1 
ATOM   36   C  CA  . VAL A 1 24  ? 25.230  21.745  -12.002 1.00 75.91  ? 24   VAL A CA  1 
ATOM   37   C  C   . VAL A 1 24  ? 24.228  22.007  -10.875 1.00 67.17  ? 24   VAL A C   1 
ATOM   38   O  O   . VAL A 1 24  ? 24.462  21.627  -9.730  1.00 65.56  ? 24   VAL A O   1 
ATOM   39   C  CB  . VAL A 1 24  ? 26.212  22.934  -12.101 1.00 76.09  ? 24   VAL A CB  1 
ATOM   40   C  CG1 . VAL A 1 24  ? 25.473  24.217  -12.459 1.00 71.26  ? 24   VAL A CG1 1 
ATOM   41   C  CG2 . VAL A 1 24  ? 26.977  23.098  -10.799 1.00 74.11  ? 24   VAL A CG2 1 
ATOM   42   N  N   . PHE A 1 25  ? 23.112  22.650  -11.206 1.00 63.80  ? 25   PHE A N   1 
ATOM   43   C  CA  . PHE A 1 25  ? 22.075  22.937  -10.219 1.00 63.02  ? 25   PHE A CA  1 
ATOM   44   C  C   . PHE A 1 25  ? 21.470  21.648  -9.674  1.00 65.41  ? 25   PHE A C   1 
ATOM   45   O  O   . PHE A 1 25  ? 21.423  21.438  -8.461  1.00 62.62  ? 25   PHE A O   1 
ATOM   46   C  CB  . PHE A 1 25  ? 20.979  23.817  -10.824 1.00 60.67  ? 25   PHE A CB  1 
ATOM   47   C  CG  . PHE A 1 25  ? 19.866  24.143  -9.868  1.00 67.84  ? 25   PHE A CG  1 
ATOM   48   C  CD1 . PHE A 1 25  ? 19.983  25.204  -8.983  1.00 68.02  ? 25   PHE A CD1 1 
ATOM   49   C  CD2 . PHE A 1 25  ? 18.703  23.391  -9.854  1.00 65.56  ? 25   PHE A CD2 1 
ATOM   50   C  CE1 . PHE A 1 25  ? 18.961  25.508  -8.102  1.00 64.08  ? 25   PHE A CE1 1 
ATOM   51   C  CE2 . PHE A 1 25  ? 17.677  23.689  -8.975  1.00 66.70  ? 25   PHE A CE2 1 
ATOM   52   C  CZ  . PHE A 1 25  ? 17.806  24.749  -8.099  1.00 70.68  ? 25   PHE A CZ  1 
ATOM   53   N  N   . ILE A 1 26  ? 21.007  20.790  -10.578 1.00 68.99  ? 26   ILE A N   1 
ATOM   54   C  CA  . ILE A 1 26  ? 20.418  19.513  -10.192 1.00 59.30  ? 26   ILE A CA  1 
ATOM   55   C  C   . ILE A 1 26  ? 21.379  18.712  -9.320  1.00 51.77  ? 26   ILE A C   1 
ATOM   56   O  O   . ILE A 1 26  ? 20.996  18.197  -8.269  1.00 51.14  ? 26   ILE A O   1 
ATOM   57   C  CB  . ILE A 1 26  ? 20.036  18.666  -11.424 1.00 65.83  ? 26   ILE A CB  1 
ATOM   58   C  CG1 . ILE A 1 26  ? 18.985  19.389  -12.271 1.00 67.63  ? 26   ILE A CG1 1 
ATOM   59   C  CG2 . ILE A 1 26  ? 19.522  17.301  -10.996 1.00 64.88  ? 26   ILE A CG2 1 
ATOM   60   C  CD1 . ILE A 1 26  ? 18.479  18.573  -13.443 1.00 44.70  ? 26   ILE A CD1 1 
ATOM   61   N  N   . VAL A 1 27  ? 22.628  18.616  -9.762  1.00 56.51  ? 27   VAL A N   1 
ATOM   62   C  CA  . VAL A 1 27  ? 23.642  17.850  -9.045  1.00 58.50  ? 27   VAL A CA  1 
ATOM   63   C  C   . VAL A 1 27  ? 23.849  18.376  -7.628  1.00 61.65  ? 27   VAL A C   1 
ATOM   64   O  O   . VAL A 1 27  ? 23.990  17.599  -6.684  1.00 65.94  ? 27   VAL A O   1 
ATOM   65   C  CB  . VAL A 1 27  ? 24.984  17.860  -9.795  1.00 54.10  ? 27   VAL A CB  1 
ATOM   66   C  CG1 . VAL A 1 27  ? 26.061  17.176  -8.966  1.00 51.57  ? 27   VAL A CG1 1 
ATOM   67   C  CG2 . VAL A 1 27  ? 24.835  17.188  -11.151 1.00 43.31  ? 27   VAL A CG2 1 
ATOM   68   N  N   . LEU A 1 28  ? 23.866  19.697  -7.486  1.00 61.71  ? 28   LEU A N   1 
ATOM   69   C  CA  . LEU A 1 28  ? 24.018  20.320  -6.176  1.00 63.75  ? 28   LEU A CA  1 
ATOM   70   C  C   . LEU A 1 28  ? 22.829  19.998  -5.274  1.00 64.34  ? 28   LEU A C   1 
ATOM   71   O  O   . LEU A 1 28  ? 23.004  19.584  -4.126  1.00 69.67  ? 28   LEU A O   1 
ATOM   72   C  CB  . LEU A 1 28  ? 24.179  21.836  -6.317  1.00 75.72  ? 28   LEU A CB  1 
ATOM   73   C  CG  . LEU A 1 28  ? 25.487  22.330  -6.939  1.00 73.66  ? 28   LEU A CG  1 
ATOM   74   C  CD1 . LEU A 1 28  ? 25.424  23.825  -7.220  1.00 71.53  ? 28   LEU A CD1 1 
ATOM   75   C  CD2 . LEU A 1 28  ? 26.667  21.992  -6.039  1.00 72.73  ? 28   LEU A CD2 1 
ATOM   76   N  N   . VAL A 1 29  ? 21.623  20.188  -5.801  1.00 58.82  ? 29   VAL A N   1 
ATOM   77   C  CA  . VAL A 1 29  ? 20.405  19.911  -5.046  1.00 54.52  ? 29   VAL A CA  1 
ATOM   78   C  C   . VAL A 1 29  ? 20.339  18.454  -4.597  1.00 57.50  ? 29   VAL A C   1 
ATOM   79   O  O   . VAL A 1 29  ? 20.265  18.166  -3.400  1.00 58.92  ? 29   VAL A O   1 
ATOM   80   C  CB  . VAL A 1 29  ? 19.143  20.248  -5.861  1.00 48.01  ? 29   VAL A CB  1 
ATOM   81   C  CG1 . VAL A 1 29  ? 17.895  19.776  -5.130  1.00 48.37  ? 29   VAL A CG1 1 
ATOM   82   C  CG2 . VAL A 1 29  ? 19.076  21.743  -6.141  1.00 47.59  ? 29   VAL A CG2 1 
ATOM   83   N  N   . ALA A 1 30  ? 20.365  17.540  -5.562  1.00 52.50  ? 30   ALA A N   1 
ATOM   84   C  CA  . ALA A 1 30  ? 20.303  16.114  -5.268  1.00 54.26  ? 30   ALA A CA  1 
ATOM   85   C  C   . ALA A 1 30  ? 21.475  15.680  -4.392  1.00 59.66  ? 30   ALA A C   1 
ATOM   86   O  O   . ALA A 1 30  ? 21.318  14.847  -3.502  1.00 59.53  ? 30   ALA A O   1 
ATOM   87   C  CB  . ALA A 1 30  ? 20.266  15.304  -6.556  1.00 50.68  ? 30   ALA A CB  1 
ATOM   88   N  N   . GLY A 1 31  ? 22.646  16.255  -4.648  1.00 59.58  ? 31   GLY A N   1 
ATOM   89   C  CA  . GLY A 1 31  ? 23.829  15.970  -3.857  1.00 56.38  ? 31   GLY A CA  1 
ATOM   90   C  C   . GLY A 1 31  ? 23.649  16.392  -2.411  1.00 59.73  ? 31   GLY A C   1 
ATOM   91   O  O   . GLY A 1 31  ? 23.946  15.630  -1.489  1.00 57.02  ? 31   GLY A O   1 
ATOM   92   N  N   . SER A 1 32  ? 23.157  17.612  -2.213  1.00 57.02  ? 32   SER A N   1 
ATOM   93   C  CA  . SER A 1 32  ? 22.907  18.132  -0.872  1.00 61.52  ? 32   SER A CA  1 
ATOM   94   C  C   . SER A 1 32  ? 21.886  17.265  -0.149  1.00 56.18  ? 32   SER A C   1 
ATOM   95   O  O   . SER A 1 32  ? 22.104  16.838  0.986   1.00 55.24  ? 32   SER A O   1 
ATOM   96   C  CB  . SER A 1 32  ? 22.403  19.576  -0.943  1.00 61.41  ? 32   SER A CB  1 
ATOM   97   O  OG  . SER A 1 32  ? 23.332  20.407  -1.614  1.00 65.75  ? 32   SER A OG  1 
ATOM   98   N  N   . LEU A 1 33  ? 20.770  17.009  -0.823  1.00 52.58  ? 33   LEU A N   1 
ATOM   99   C  CA  . LEU A 1 33  ? 19.706  16.187  -0.267  1.00 52.15  ? 33   LEU A CA  1 
ATOM   100  C  C   . LEU A 1 33  ? 20.233  14.828  0.182   1.00 53.23  ? 33   LEU A C   1 
ATOM   101  O  O   . LEU A 1 33  ? 19.904  14.353  1.268   1.00 50.85  ? 33   LEU A O   1 
ATOM   102  C  CB  . LEU A 1 33  ? 18.586  16.008  -1.292  1.00 47.70  ? 33   LEU A CB  1 
ATOM   103  C  CG  . LEU A 1 33  ? 17.384  15.178  -0.844  1.00 47.77  ? 33   LEU A CG  1 
ATOM   104  C  CD1 . LEU A 1 33  ? 16.660  15.862  0.302   1.00 42.25  ? 33   LEU A CD1 1 
ATOM   105  C  CD2 . LEU A 1 33  ? 16.438  14.938  -2.008  1.00 54.82  ? 33   LEU A CD2 1 
ATOM   106  N  N   . SER A 1 34  ? 21.049  14.204  -0.660  1.00 52.77  ? 34   SER A N   1 
ATOM   107  C  CA  . SER A 1 34  ? 21.628  12.908  -0.330  1.00 51.83  ? 34   SER A CA  1 
ATOM   108  C  C   . SER A 1 34  ? 22.575  13.034  0.855   1.00 48.18  ? 34   SER A C   1 
ATOM   109  O  O   . SER A 1 34  ? 22.683  12.125  1.674   1.00 46.91  ? 34   SER A O   1 
ATOM   110  C  CB  . SER A 1 34  ? 22.365  12.320  -1.536  1.00 45.98  ? 34   SER A CB  1 
ATOM   111  O  OG  . SER A 1 34  ? 22.930  11.059  -1.222  1.00 48.73  ? 34   SER A OG  1 
ATOM   112  N  N   . LEU A 1 35  ? 23.261  14.169  0.937   1.00 47.56  ? 35   LEU A N   1 
ATOM   113  C  CA  . LEU A 1 35  ? 24.188  14.426  2.032   1.00 50.27  ? 35   LEU A CA  1 
ATOM   114  C  C   . LEU A 1 35  ? 23.439  14.566  3.355   1.00 55.05  ? 35   LEU A C   1 
ATOM   115  O  O   . LEU A 1 35  ? 23.819  13.972  4.366   1.00 54.05  ? 35   LEU A O   1 
ATOM   116  C  CB  . LEU A 1 35  ? 25.004  15.691  1.755   1.00 54.49  ? 35   LEU A CB  1 
ATOM   117  C  CG  . LEU A 1 35  ? 26.143  15.976  2.734   1.00 59.05  ? 35   LEU A CG  1 
ATOM   118  C  CD1 . LEU A 1 35  ? 27.188  14.869  2.670   1.00 46.99  ? 35   LEU A CD1 1 
ATOM   119  C  CD2 . LEU A 1 35  ? 26.767  17.334  2.448   1.00 47.97  ? 35   LEU A CD2 1 
ATOM   120  N  N   . VAL A 1 36  ? 22.373  15.359  3.342   1.00 51.95  ? 36   VAL A N   1 
ATOM   121  C  CA  . VAL A 1 36  ? 21.546  15.543  4.529   1.00 48.27  ? 36   VAL A CA  1 
ATOM   122  C  C   . VAL A 1 36  ? 21.015  14.202  5.023   1.00 48.98  ? 36   VAL A C   1 
ATOM   123  O  O   . VAL A 1 36  ? 20.990  13.934  6.223   1.00 59.40  ? 36   VAL A O   1 
ATOM   124  C  CB  . VAL A 1 36  ? 20.357  16.482  4.252   1.00 49.87  ? 36   VAL A CB  1 
ATOM   125  C  CG1 . VAL A 1 36  ? 19.418  16.523  5.452   1.00 53.12  ? 36   VAL A CG1 1 
ATOM   126  C  CG2 . VAL A 1 36  ? 20.852  17.879  3.904   1.00 42.62  ? 36   VAL A CG2 1 
ATOM   127  N  N   . THR A 1 37  ? 20.596  13.361  4.085   1.00 45.37  ? 37   THR A N   1 
ATOM   128  C  CA  . THR A 1 37  ? 20.048  12.053  4.416   1.00 43.66  ? 37   THR A CA  1 
ATOM   129  C  C   . THR A 1 37  ? 21.078  11.156  5.094   1.00 49.10  ? 37   THR A C   1 
ATOM   130  O  O   . THR A 1 37  ? 20.802  10.563  6.137   1.00 56.61  ? 37   THR A O   1 
ATOM   131  C  CB  . THR A 1 37  ? 19.502  11.337  3.166   1.00 45.80  ? 37   THR A CB  1 
ATOM   132  O  OG1 . THR A 1 37  ? 18.483  12.142  2.560   1.00 44.07  ? 37   THR A OG1 1 
ATOM   133  C  CG2 . THR A 1 37  ? 18.919  9.983   3.541   1.00 45.15  ? 37   THR A CG2 1 
ATOM   134  N  N   . ILE A 1 38  ? 22.266  11.059  4.503   1.00 46.51  ? 38   ILE A N   1 
ATOM   135  C  CA  . ILE A 1 38  ? 23.296  10.165  5.027   1.00 52.56  ? 38   ILE A CA  1 
ATOM   136  C  C   . ILE A 1 38  ? 23.842  10.616  6.380   1.00 55.35  ? 38   ILE A C   1 
ATOM   137  O  O   . ILE A 1 38  ? 23.972  9.808   7.300   1.00 56.85  ? 38   ILE A O   1 
ATOM   138  C  CB  . ILE A 1 38  ? 24.455  9.957   4.029   1.00 47.22  ? 38   ILE A CB  1 
ATOM   139  C  CG1 . ILE A 1 38  ? 24.991  11.301  3.544   1.00 58.05  ? 38   ILE A CG1 1 
ATOM   140  C  CG2 . ILE A 1 38  ? 23.992  9.122   2.847   1.00 57.90  ? 38   ILE A CG2 1 
ATOM   141  C  CD1 . ILE A 1 38  ? 25.966  11.186  2.384   1.00 57.20  ? 38   ILE A CD1 1 
ATOM   142  N  N   . ILE A 1 39  ? 24.151  11.902  6.507   1.00 53.11  ? 39   ILE A N   1 
ATOM   143  C  CA  . ILE A 1 39  ? 24.663  12.426  7.769   1.00 57.42  ? 39   ILE A CA  1 
ATOM   144  C  C   . ILE A 1 39  ? 23.574  12.441  8.838   1.00 51.24  ? 39   ILE A C   1 
ATOM   145  O  O   . ILE A 1 39  ? 23.866  12.420  10.031  1.00 56.82  ? 39   ILE A O   1 
ATOM   146  C  CB  . ILE A 1 39  ? 25.267  13.843  7.615   1.00 61.76  ? 39   ILE A CB  1 
ATOM   147  C  CG1 . ILE A 1 39  ? 24.167  14.906  7.558   1.00 63.37  ? 39   ILE A CG1 1 
ATOM   148  C  CG2 . ILE A 1 39  ? 26.179  13.912  6.393   1.00 51.25  ? 39   ILE A CG2 1 
ATOM   149  C  CD1 . ILE A 1 39  ? 23.820  15.510  8.908   1.00 48.78  ? 39   ILE A CD1 1 
ATOM   150  N  N   . GLY A 1 40  ? 22.319  12.476  8.402   1.00 47.27  ? 40   GLY A N   1 
ATOM   151  C  CA  . GLY A 1 40  ? 21.192  12.500  9.315   1.00 44.28  ? 40   GLY A CA  1 
ATOM   152  C  C   . GLY A 1 40  ? 20.955  11.164  9.992   1.00 53.23  ? 40   GLY A C   1 
ATOM   153  O  O   . GLY A 1 40  ? 20.783  11.092  11.207  1.00 55.23  ? 40   GLY A O   1 
ATOM   154  N  N   . ASN A 1 41  ? 20.946  10.100  9.195   1.00 51.22  ? 41   ASN A N   1 
ATOM   155  C  CA  . ASN A 1 41  ? 20.729  8.752   9.709   1.00 41.02  ? 41   ASN A CA  1 
ATOM   156  C  C   . ASN A 1 41  ? 21.937  8.209   10.458  1.00 40.24  ? 41   ASN A C   1 
ATOM   157  O  O   . ASN A 1 41  ? 21.794  7.559   11.492  1.00 49.05  ? 41   ASN A O   1 
ATOM   158  C  CB  . ASN A 1 41  ? 20.344  7.797   8.579   1.00 45.62  ? 41   ASN A CB  1 
ATOM   159  C  CG  . ASN A 1 41  ? 18.936  8.030   8.076   1.00 52.30  ? 41   ASN A CG  1 
ATOM   160  O  OD1 . ASN A 1 41  ? 17.971  7.516   8.644   1.00 54.99  ? 41   ASN A OD1 1 
ATOM   161  N  ND2 . ASN A 1 41  ? 18.809  8.806   7.004   1.00 49.27  ? 41   ASN A ND2 1 
ATOM   162  N  N   . ILE A 1 42  ? 23.126  8.469   9.927   1.00 49.42  ? 42   ILE A N   1 
ATOM   163  C  CA  . ILE A 1 42  ? 24.353  8.111   10.624  1.00 57.18  ? 42   ILE A CA  1 
ATOM   164  C  C   . ILE A 1 42  ? 24.381  8.813   11.978  1.00 55.45  ? 42   ILE A C   1 
ATOM   165  O  O   . ILE A 1 42  ? 24.883  8.272   12.963  1.00 51.37  ? 42   ILE A O   1 
ATOM   166  C  CB  . ILE A 1 42  ? 25.607  8.501   9.813   1.00 57.82  ? 42   ILE A CB  1 
ATOM   167  C  CG1 . ILE A 1 42  ? 25.749  7.605   8.581   1.00 55.24  ? 42   ILE A CG1 1 
ATOM   168  C  CG2 . ILE A 1 42  ? 26.855  8.391   10.671  1.00 59.71  ? 42   ILE A CG2 1 
ATOM   169  C  CD1 . ILE A 1 42  ? 27.025  7.841   7.798   1.00 53.41  ? 42   ILE A CD1 1 
ATOM   170  N  N   . LEU A 1 43  ? 23.824  10.019  12.018  1.00 54.08  ? 43   LEU A N   1 
ATOM   171  C  CA  . LEU A 1 43  ? 23.746  10.792  13.251  1.00 49.80  ? 43   LEU A CA  1 
ATOM   172  C  C   . LEU A 1 43  ? 22.810  10.113  14.247  1.00 49.11  ? 43   LEU A C   1 
ATOM   173  O  O   . LEU A 1 43  ? 23.048  10.137  15.453  1.00 55.61  ? 43   LEU A O   1 
ATOM   174  C  CB  . LEU A 1 43  ? 23.267  12.215  12.959  1.00 53.18  ? 43   LEU A CB  1 
ATOM   175  C  CG  . LEU A 1 43  ? 23.978  13.346  13.704  1.00 58.58  ? 43   LEU A CG  1 
ATOM   176  C  CD1 . LEU A 1 43  ? 25.486  13.249  13.513  1.00 53.43  ? 43   LEU A CD1 1 
ATOM   177  C  CD2 . LEU A 1 43  ? 23.459  14.700  13.245  1.00 49.47  ? 43   LEU A CD2 1 
ATOM   178  N  N   . VAL A 1 44  ? 21.749  9.503   13.728  1.00 48.79  ? 44   VAL A N   1 
ATOM   179  C  CA  . VAL A 1 44  ? 20.796  8.769   14.555  1.00 49.08  ? 44   VAL A CA  1 
ATOM   180  C  C   . VAL A 1 44  ? 21.412  7.480   15.083  1.00 52.32  ? 44   VAL A C   1 
ATOM   181  O  O   . VAL A 1 44  ? 21.393  7.220   16.287  1.00 53.11  ? 44   VAL A O   1 
ATOM   182  C  CB  . VAL A 1 44  ? 19.510  8.426   13.775  1.00 45.66  ? 44   VAL A CB  1 
ATOM   183  C  CG1 . VAL A 1 44  ? 18.622  7.505   14.599  1.00 40.31  ? 44   VAL A CG1 1 
ATOM   184  C  CG2 . VAL A 1 44  ? 18.767  9.697   13.386  1.00 51.20  ? 44   VAL A CG2 1 
ATOM   185  N  N   . MET A 1 45  ? 21.956  6.677   14.174  1.00 46.70  ? 45   MET A N   1 
ATOM   186  C  CA  . MET A 1 45  ? 22.610  5.426   14.542  1.00 53.97  ? 45   MET A CA  1 
ATOM   187  C  C   . MET A 1 45  ? 23.674  5.663   15.612  1.00 56.66  ? 45   MET A C   1 
ATOM   188  O  O   . MET A 1 45  ? 23.763  4.922   16.589  1.00 52.15  ? 45   MET A O   1 
ATOM   189  C  CB  . MET A 1 45  ? 23.221  4.751   13.307  1.00 40.32  ? 45   MET A CB  1 
ATOM   190  C  CG  . MET A 1 45  ? 22.188  4.222   12.314  1.00 49.48  ? 45   MET A CG  1 
ATOM   191  S  SD  . MET A 1 45  ? 22.833  3.847   10.665  1.00 51.35  ? 45   MET A SD  1 
ATOM   192  C  CE  . MET A 1 45  ? 23.931  2.479   11.021  1.00 62.89  ? 45   MET A CE  1 
ATOM   193  N  N   . VAL A 1 46  ? 24.474  6.707   15.425  1.00 53.42  ? 46   VAL A N   1 
ATOM   194  C  CA  . VAL A 1 46  ? 25.495  7.067   16.399  1.00 53.17  ? 46   VAL A CA  1 
ATOM   195  C  C   . VAL A 1 46  ? 24.869  7.549   17.703  1.00 59.12  ? 46   VAL A C   1 
ATOM   196  O  O   . VAL A 1 46  ? 25.271  7.120   18.787  1.00 64.15  ? 46   VAL A O   1 
ATOM   197  C  CB  . VAL A 1 46  ? 26.442  8.154   15.857  1.00 48.61  ? 46   VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 46  ? 27.291  8.728   16.983  1.00 50.04  ? 46   VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 46  ? 27.318  7.589   14.756  1.00 51.50  ? 46   VAL A CG2 1 
ATOM   200  N  N   . SER A 1 47  ? 23.882  8.435   17.593  1.00 50.22  ? 47   SER A N   1 
ATOM   201  C  CA  . SER A 1 47  ? 23.191  8.963   18.767  1.00 53.25  ? 47   SER A CA  1 
ATOM   202  C  C   . SER A 1 47  ? 22.675  7.856   19.686  1.00 58.56  ? 47   SER A C   1 
ATOM   203  O  O   . SER A 1 47  ? 22.702  7.990   20.910  1.00 51.01  ? 47   SER A O   1 
ATOM   204  C  CB  . SER A 1 47  ? 22.037  9.878   18.351  1.00 52.13  ? 47   SER A CB  1 
ATOM   205  O  OG  . SER A 1 47  ? 22.515  11.137  17.911  1.00 58.85  ? 47   SER A OG  1 
ATOM   206  N  N   . ILE A 1 48  ? 22.204  6.767   19.087  1.00 63.92  ? 48   ILE A N   1 
ATOM   207  C  CA  . ILE A 1 48  ? 21.681  5.637   19.847  1.00 57.30  ? 48   ILE A CA  1 
ATOM   208  C  C   . ILE A 1 48  ? 22.803  4.790   20.439  1.00 61.34  ? 48   ILE A C   1 
ATOM   209  O  O   . ILE A 1 48  ? 22.738  4.371   21.596  1.00 61.87  ? 48   ILE A O   1 
ATOM   210  C  CB  . ILE A 1 48  ? 20.778  4.745   18.973  1.00 53.88  ? 48   ILE A CB  1 
ATOM   211  C  CG1 . ILE A 1 48  ? 19.451  5.451   18.688  1.00 53.77  ? 48   ILE A CG1 1 
ATOM   212  C  CG2 . ILE A 1 48  ? 20.533  3.409   19.650  1.00 51.22  ? 48   ILE A CG2 1 
ATOM   213  C  CD1 . ILE A 1 48  ? 18.489  4.633   17.859  1.00 47.71  ? 48   ILE A CD1 1 
ATOM   214  N  N   . LYS A 1 49  ? 23.834  4.551   19.636  1.00 62.15  ? 49   LYS A N   1 
ATOM   215  C  CA  . LYS A 1 49  ? 24.975  3.741   20.046  1.00 64.85  ? 49   LYS A CA  1 
ATOM   216  C  C   . LYS A 1 49  ? 25.747  4.389   21.196  1.00 62.47  ? 49   LYS A C   1 
ATOM   217  O  O   . LYS A 1 49  ? 26.210  3.703   22.110  1.00 47.99  ? 49   LYS A O   1 
ATOM   218  C  CB  . LYS A 1 49  ? 25.913  3.526   18.854  1.00 58.61  ? 49   LYS A CB  1 
ATOM   219  C  CG  . LYS A 1 49  ? 26.382  2.090   18.655  1.00 48.36  ? 49   LYS A CG  1 
ATOM   220  C  CD  . LYS A 1 49  ? 25.241  1.200   18.185  1.00 51.99  ? 49   LYS A CD  1 
ATOM   221  C  CE  . LYS A 1 49  ? 25.748  -0.158  17.713  1.00 64.49  ? 49   LYS A CE  1 
ATOM   222  N  NZ  . LYS A 1 49  ? 26.443  -0.918  18.789  1.00 70.18  ? 49   LYS A NZ  1 
ATOM   223  N  N   . VAL A 1 50  ? 25.871  5.714   21.151  1.00 61.97  ? 50   VAL A N   1 
ATOM   224  C  CA  . VAL A 1 50  ? 26.737  6.430   22.089  1.00 68.07  ? 50   VAL A CA  1 
ATOM   225  C  C   . VAL A 1 50  ? 26.014  6.959   23.332  1.00 63.60  ? 50   VAL A C   1 
ATOM   226  O  O   . VAL A 1 50  ? 26.655  7.372   24.301  1.00 65.74  ? 50   VAL A O   1 
ATOM   227  C  CB  . VAL A 1 50  ? 27.478  7.599   21.397  1.00 69.17  ? 50   VAL A CB  1 
ATOM   228  C  CG1 . VAL A 1 50  ? 26.512  8.733   21.081  1.00 63.29  ? 50   VAL A CG1 1 
ATOM   229  C  CG2 . VAL A 1 50  ? 28.621  8.097   22.264  1.00 75.43  ? 50   VAL A CG2 1 
ATOM   230  N  N   . ASN A 1 51  ? 24.686  6.948   23.308  1.00 64.00  ? 51   ASN A N   1 
ATOM   231  C  CA  . ASN A 1 51  ? 23.912  7.437   24.445  1.00 59.71  ? 51   ASN A CA  1 
ATOM   232  C  C   . ASN A 1 51  ? 23.043  6.352   25.073  1.00 62.24  ? 51   ASN A C   1 
ATOM   233  O  O   . ASN A 1 51  ? 22.086  5.878   24.460  1.00 63.25  ? 51   ASN A O   1 
ATOM   234  C  CB  . ASN A 1 51  ? 23.053  8.637   24.039  1.00 55.29  ? 51   ASN A CB  1 
ATOM   235  C  CG  . ASN A 1 51  ? 22.323  9.256   25.214  1.00 58.52  ? 51   ASN A CG  1 
ATOM   236  O  OD1 . ASN A 1 51  ? 22.577  8.913   26.370  1.00 62.92  ? 51   ASN A OD1 1 
ATOM   237  N  ND2 . ASN A 1 51  ? 21.414  10.180  24.925  1.00 55.04  ? 51   ASN A ND2 1 
ATOM   238  N  N   . ARG A 1 52  ? 23.382  5.968   26.301  1.00 70.63  ? 52   ARG A N   1 
ATOM   239  C  CA  . ARG A 1 52  ? 22.653  4.917   27.005  1.00 63.59  ? 52   ARG A CA  1 
ATOM   240  C  C   . ARG A 1 52  ? 21.173  5.260   27.174  1.00 56.34  ? 52   ARG A C   1 
ATOM   241  O  O   . ARG A 1 52  ? 20.317  4.374   27.143  1.00 55.21  ? 52   ARG A O   1 
ATOM   242  C  CB  . ARG A 1 52  ? 23.293  4.636   28.368  1.00 68.16  ? 52   ARG A CB  1 
ATOM   243  C  CG  . ARG A 1 52  ? 22.691  3.446   29.108  1.00 78.51  ? 52   ARG A CG  1 
ATOM   244  C  CD  . ARG A 1 52  ? 23.357  3.222   30.460  1.00 81.66  ? 52   ARG A CD  1 
ATOM   245  N  NE  . ARG A 1 52  ? 23.154  4.346   31.371  1.00 85.38  ? 52   ARG A NE  1 
ATOM   246  C  CZ  . ARG A 1 52  ? 24.048  5.305   31.589  1.00 90.85  ? 52   ARG A CZ  1 
ATOM   247  N  NH1 . ARG A 1 52  ? 25.219  5.279   30.964  1.00 90.53  ? 52   ARG A NH1 1 
ATOM   248  N  NH2 . ARG A 1 52  ? 23.775  6.289   32.435  1.00 92.18  ? 52   ARG A NH2 1 
ATOM   249  N  N   . HIS A 1 53  ? 20.876  6.545   27.345  1.00 53.26  ? 53   HIS A N   1 
ATOM   250  C  CA  . HIS A 1 53  ? 19.495  6.993   27.516  1.00 55.34  ? 53   HIS A CA  1 
ATOM   251  C  C   . HIS A 1 53  ? 18.632  6.702   26.289  1.00 61.62  ? 53   HIS A C   1 
ATOM   252  O  O   . HIS A 1 53  ? 17.418  6.543   26.402  1.00 60.94  ? 53   HIS A O   1 
ATOM   253  C  CB  . HIS A 1 53  ? 19.443  8.486   27.854  1.00 46.87  ? 53   HIS A CB  1 
ATOM   254  C  CG  . HIS A 1 53  ? 19.773  8.796   29.280  1.00 63.04  ? 53   HIS A CG  1 
ATOM   255  N  ND1 . HIS A 1 53  ? 18.820  9.208   30.192  1.00 63.70  ? 53   HIS A ND1 1 
ATOM   256  C  CD2 . HIS A 1 53  ? 20.945  8.757   29.957  1.00 71.02  ? 53   HIS A CD2 1 
ATOM   257  C  CE1 . HIS A 1 53  ? 19.396  9.409   31.365  1.00 65.99  ? 53   HIS A CE1 1 
ATOM   258  N  NE2 . HIS A 1 53  ? 20.683  9.141   31.248  1.00 71.79  ? 53   HIS A NE2 1 
ATOM   259  N  N   . LEU A 1 54  ? 19.263  6.635   25.120  1.00 58.59  ? 54   LEU A N   1 
ATOM   260  C  CA  . LEU A 1 54  ? 18.545  6.426   23.865  1.00 50.85  ? 54   LEU A CA  1 
ATOM   261  C  C   . LEU A 1 54  ? 18.490  4.956   23.464  1.00 52.36  ? 54   LEU A C   1 
ATOM   262  O  O   . LEU A 1 54  ? 18.006  4.617   22.388  1.00 53.83  ? 54   LEU A O   1 
ATOM   263  C  CB  . LEU A 1 54  ? 19.187  7.248   22.745  1.00 53.12  ? 54   LEU A CB  1 
ATOM   264  C  CG  . LEU A 1 54  ? 18.931  8.755   22.752  1.00 46.97  ? 54   LEU A CG  1 
ATOM   265  C  CD1 . LEU A 1 54  ? 19.819  9.449   21.733  1.00 53.49  ? 54   LEU A CD1 1 
ATOM   266  C  CD2 . LEU A 1 54  ? 17.461  9.049   22.486  1.00 39.69  ? 54   LEU A CD2 1 
ATOM   267  N  N   . GLN A 1 55  ? 18.990  4.088   24.334  1.00 55.50  ? 55   GLN A N   1 
ATOM   268  C  CA  . GLN A 1 55  ? 19.079  2.663   24.031  1.00 53.91  ? 55   GLN A CA  1 
ATOM   269  C  C   . GLN A 1 55  ? 17.838  1.900   24.492  1.00 58.73  ? 55   GLN A C   1 
ATOM   270  O  O   . GLN A 1 55  ? 17.801  1.378   25.604  1.00 63.94  ? 55   GLN A O   1 
ATOM   271  C  CB  . GLN A 1 55  ? 20.340  2.067   24.664  1.00 55.74  ? 55   GLN A CB  1 
ATOM   272  C  CG  . GLN A 1 55  ? 21.621  2.741   24.216  1.00 54.71  ? 55   GLN A CG  1 
ATOM   273  C  CD  . GLN A 1 55  ? 22.843  2.221   24.941  1.00 63.55  ? 55   GLN A CD  1 
ATOM   274  O  OE1 . GLN A 1 55  ? 22.743  1.377   25.832  1.00 66.80  ? 55   GLN A OE1 1 
ATOM   275  N  NE2 . GLN A 1 55  ? 24.010  2.727   24.563  1.00 62.57  ? 55   GLN A NE2 1 
ATOM   276  N  N   . THR A 1 56  ? 16.822  1.845   23.634  1.00 61.88  ? 56   THR A N   1 
ATOM   277  C  CA  . THR A 1 56  ? 15.578  1.147   23.949  1.00 51.57  ? 56   THR A CA  1 
ATOM   278  C  C   . THR A 1 56  ? 15.113  0.325   22.747  1.00 55.98  ? 56   THR A C   1 
ATOM   279  O  O   . THR A 1 56  ? 15.494  0.613   21.612  1.00 62.90  ? 56   THR A O   1 
ATOM   280  C  CB  . THR A 1 56  ? 14.469  2.139   24.352  1.00 53.09  ? 56   THR A CB  1 
ATOM   281  O  OG1 . THR A 1 56  ? 14.110  2.948   23.225  1.00 52.80  ? 56   THR A OG1 1 
ATOM   282  C  CG2 . THR A 1 56  ? 14.945  3.040   25.484  1.00 54.83  ? 56   THR A CG2 1 
ATOM   283  N  N   . VAL A 1 57  ? 14.295  -0.696  22.994  1.00 54.54  ? 57   VAL A N   1 
ATOM   284  C  CA  . VAL A 1 57  ? 13.797  -1.543  21.911  1.00 54.94  ? 57   VAL A CA  1 
ATOM   285  C  C   . VAL A 1 57  ? 13.117  -0.714  20.825  1.00 56.07  ? 57   VAL A C   1 
ATOM   286  O  O   . VAL A 1 57  ? 13.240  -1.014  19.639  1.00 64.80  ? 57   VAL A O   1 
ATOM   287  C  CB  . VAL A 1 57  ? 12.817  -2.624  22.411  1.00 49.29  ? 57   VAL A CB  1 
ATOM   288  C  CG1 . VAL A 1 57  ? 13.506  -3.549  23.406  1.00 51.03  ? 57   VAL A CG1 1 
ATOM   289  C  CG2 . VAL A 1 57  ? 11.585  -1.986  23.024  1.00 56.10  ? 57   VAL A CG2 1 
ATOM   290  N  N   . ASN A 1 58  ? 12.403  0.330   21.234  1.00 48.33  ? 58   ASN A N   1 
ATOM   291  C  CA  . ASN A 1 58  ? 11.747  1.218   20.283  1.00 52.77  ? 58   ASN A CA  1 
ATOM   292  C  C   . ASN A 1 58  ? 12.793  1.870   19.395  1.00 54.29  ? 58   ASN A C   1 
ATOM   293  O  O   . ASN A 1 58  ? 12.619  1.977   18.182  1.00 48.20  ? 58   ASN A O   1 
ATOM   294  C  CB  . ASN A 1 58  ? 10.941  2.296   21.012  1.00 56.88  ? 58   ASN A CB  1 
ATOM   295  C  CG  . ASN A 1 58  ? 10.165  1.749   22.193  1.00 62.33  ? 58   ASN A CG  1 
ATOM   296  O  OD1 . ASN A 1 58  ? 9.017   1.327   22.054  1.00 70.04  ? 58   ASN A OD1 1 
ATOM   297  N  ND2 . ASN A 1 58  ? 10.787  1.762   23.368  1.00 59.17  ? 58   ASN A ND2 1 
ATOM   298  N  N   . ASN A 1 59  ? 13.887  2.301   20.016  1.00 50.22  ? 59   ASN A N   1 
ATOM   299  C  CA  . ASN A 1 59  ? 14.987  2.929   19.295  1.00 52.24  ? 59   ASN A CA  1 
ATOM   300  C  C   . ASN A 1 59  ? 15.801  1.931   18.473  1.00 51.23  ? 59   ASN A C   1 
ATOM   301  O  O   . ASN A 1 59  ? 16.530  2.316   17.554  1.00 47.95  ? 59   ASN A O   1 
ATOM   302  C  CB  . ASN A 1 59  ? 15.892  3.708   20.254  1.00 47.31  ? 59   ASN A CB  1 
ATOM   303  C  CG  . ASN A 1 59  ? 15.201  4.922   20.850  1.00 43.77  ? 59   ASN A CG  1 
ATOM   304  O  OD1 . ASN A 1 59  ? 14.165  5.368   20.355  1.00 37.52  ? 59   ASN A OD1 1 
ATOM   305  N  ND2 . ASN A 1 59  ? 15.780  5.469   21.915  1.00 42.23  ? 59   ASN A ND2 1 
ATOM   306  N  N   . TYR A 1 60  ? 15.680  0.650   18.806  1.00 45.39  ? 60   TYR A N   1 
ATOM   307  C  CA  . TYR A 1 60  ? 16.289  -0.390  17.988  1.00 49.12  ? 60   TYR A CA  1 
ATOM   308  C  C   . TYR A 1 60  ? 15.573  -0.449  16.648  1.00 55.12  ? 60   TYR A C   1 
ATOM   309  O  O   . TYR A 1 60  ? 16.195  -0.626  15.600  1.00 51.24  ? 60   TYR A O   1 
ATOM   310  C  CB  . TYR A 1 60  ? 16.223  -1.752  18.677  1.00 52.95  ? 60   TYR A CB  1 
ATOM   311  C  CG  . TYR A 1 60  ? 17.147  -1.890  19.868  1.00 58.98  ? 60   TYR A CG  1 
ATOM   312  C  CD1 . TYR A 1 60  ? 17.331  -3.119  20.486  1.00 61.92  ? 60   TYR A CD1 1 
ATOM   313  C  CD2 . TYR A 1 60  ? 17.830  -0.792  20.378  1.00 66.24  ? 60   TYR A CD2 1 
ATOM   314  C  CE1 . TYR A 1 60  ? 18.170  -3.253  21.576  1.00 69.44  ? 60   TYR A CE1 1 
ATOM   315  C  CE2 . TYR A 1 60  ? 18.670  -0.916  21.470  1.00 63.80  ? 60   TYR A CE2 1 
ATOM   316  C  CZ  . TYR A 1 60  ? 18.837  -2.149  22.065  1.00 70.60  ? 60   TYR A CZ  1 
ATOM   317  O  OH  . TYR A 1 60  ? 19.673  -2.280  23.151  1.00 76.76  ? 60   TYR A OH  1 
ATOM   318  N  N   . PHE A 1 61  ? 14.255  -0.297  16.695  1.00 54.39  ? 61   PHE A N   1 
ATOM   319  C  CA  . PHE A 1 61  ? 13.447  -0.229  15.487  1.00 53.96  ? 61   PHE A CA  1 
ATOM   320  C  C   . PHE A 1 61  ? 13.863  0.978   14.658  1.00 48.02  ? 61   PHE A C   1 
ATOM   321  O  O   . PHE A 1 61  ? 14.058  0.875   13.448  1.00 46.98  ? 61   PHE A O   1 
ATOM   322  C  CB  . PHE A 1 61  ? 11.961  -0.138  15.841  1.00 50.60  ? 61   PHE A CB  1 
ATOM   323  C  CG  . PHE A 1 61  ? 11.409  -1.386  16.472  1.00 62.70  ? 61   PHE A CG  1 
ATOM   324  C  CD1 . PHE A 1 61  ? 11.958  -2.626  16.185  1.00 61.99  ? 61   PHE A CD1 1 
ATOM   325  C  CD2 . PHE A 1 61  ? 10.341  -1.320  17.352  1.00 61.06  ? 61   PHE A CD2 1 
ATOM   326  C  CE1 . PHE A 1 61  ? 11.450  -3.778  16.762  1.00 55.34  ? 61   PHE A CE1 1 
ATOM   327  C  CE2 . PHE A 1 61  ? 9.827   -2.468  17.934  1.00 53.80  ? 61   PHE A CE2 1 
ATOM   328  C  CZ  . PHE A 1 61  ? 10.383  -3.699  17.639  1.00 50.80  ? 61   PHE A CZ  1 
ATOM   329  N  N   . LEU A 1 62  ? 14.001  2.122   15.320  1.00 45.46  ? 62   LEU A N   1 
ATOM   330  C  CA  . LEU A 1 62  ? 14.425  3.346   14.653  1.00 45.76  ? 62   LEU A CA  1 
ATOM   331  C  C   . LEU A 1 62  ? 15.845  3.205   14.118  1.00 45.73  ? 62   LEU A C   1 
ATOM   332  O  O   . LEU A 1 62  ? 16.222  3.852   13.139  1.00 39.75  ? 62   LEU A O   1 
ATOM   333  C  CB  . LEU A 1 62  ? 14.351  4.534   15.612  1.00 44.00  ? 62   LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 62  ? 12.988  4.849   16.225  1.00 32.52  ? 62   LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 62  ? 13.045  6.201   16.911  1.00 39.86  ? 62   LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 62  ? 11.899  4.830   15.170  1.00 25.99  ? 62   LEU A CD2 1 
ATOM   337  N  N   . PHE A 1 63  ? 16.632  2.362   14.779  1.00 46.28  ? 63   PHE A N   1 
ATOM   338  C  CA  . PHE A 1 63  ? 17.991  2.081   14.336  1.00 45.99  ? 63   PHE A CA  1 
ATOM   339  C  C   . PHE A 1 63  ? 17.953  1.334   13.010  1.00 46.52  ? 63   PHE A C   1 
ATOM   340  O  O   . PHE A 1 63  ? 18.690  1.654   12.080  1.00 46.35  ? 63   PHE A O   1 
ATOM   341  C  CB  . PHE A 1 63  ? 18.748  1.264   15.387  1.00 42.04  ? 63   PHE A CB  1 
ATOM   342  C  CG  . PHE A 1 63  ? 20.227  1.161   15.130  1.00 46.42  ? 63   PHE A CG  1 
ATOM   343  C  CD1 . PHE A 1 63  ? 21.112  2.028   15.747  1.00 47.67  ? 63   PHE A CD1 1 
ATOM   344  C  CD2 . PHE A 1 63  ? 20.730  0.194   14.276  1.00 50.38  ? 63   PHE A CD2 1 
ATOM   345  C  CE1 . PHE A 1 63  ? 22.468  1.935   15.518  1.00 49.90  ? 63   PHE A CE1 1 
ATOM   346  C  CE2 . PHE A 1 63  ? 22.087  0.096   14.042  1.00 44.56  ? 63   PHE A CE2 1 
ATOM   347  C  CZ  . PHE A 1 63  ? 22.957  0.968   14.665  1.00 47.57  ? 63   PHE A CZ  1 
ATOM   348  N  N   . SER A 1 64  ? 17.079  0.338   12.930  1.00 46.01  ? 64   SER A N   1 
ATOM   349  C  CA  . SER A 1 64  ? 16.900  -0.420  11.701  1.00 47.26  ? 64   SER A CA  1 
ATOM   350  C  C   . SER A 1 64  ? 16.440  0.501   10.581  1.00 48.69  ? 64   SER A C   1 
ATOM   351  O  O   . SER A 1 64  ? 17.002  0.491   9.488   1.00 48.17  ? 64   SER A O   1 
ATOM   352  C  CB  . SER A 1 64  ? 15.881  -1.542  11.909  1.00 49.17  ? 64   SER A CB  1 
ATOM   353  O  OG  . SER A 1 64  ? 15.618  -2.228  10.696  1.00 57.39  ? 64   SER A OG  1 
ATOM   354  N  N   . LEU A 1 65  ? 15.410  1.291   10.864  1.00 47.42  ? 65   LEU A N   1 
ATOM   355  C  CA  . LEU A 1 65  ? 14.890  2.272   9.918   1.00 43.05  ? 65   LEU A CA  1 
ATOM   356  C  C   . LEU A 1 65  ? 16.000  3.191   9.421   1.00 43.03  ? 65   LEU A C   1 
ATOM   357  O  O   . LEU A 1 65  ? 16.074  3.511   8.237   1.00 43.10  ? 65   LEU A O   1 
ATOM   358  C  CB  . LEU A 1 65  ? 13.797  3.108   10.583  1.00 46.88  ? 65   LEU A CB  1 
ATOM   359  C  CG  . LEU A 1 65  ? 12.404  3.044   9.961   1.00 49.73  ? 65   LEU A CG  1 
ATOM   360  C  CD1 . LEU A 1 65  ? 11.905  1.611   9.915   1.00 40.78  ? 65   LEU A CD1 1 
ATOM   361  C  CD2 . LEU A 1 65  ? 11.449  3.929   10.745  1.00 42.61  ? 65   LEU A CD2 1 
ATOM   362  N  N   . ALA A 1 66  ? 16.861  3.616   10.341  1.00 52.06  ? 66   ALA A N   1 
ATOM   363  C  CA  . ALA A 1 66  ? 17.968  4.512   10.010  1.00 45.08  ? 66   ALA A CA  1 
ATOM   364  C  C   . ALA A 1 66  ? 18.960  3.861   9.050   1.00 44.62  ? 66   ALA A C   1 
ATOM   365  O  O   . ALA A 1 66  ? 19.539  4.527   8.190   1.00 45.91  ? 66   ALA A O   1 
ATOM   366  C  CB  . ALA A 1 66  ? 18.679  4.979   11.278  1.00 40.12  ? 66   ALA A CB  1 
ATOM   367  N  N   . CYS A 1 67  ? 19.151  2.555   9.205   1.00 44.87  ? 67   CYS A N   1 
ATOM   368  C  CA  . CYS A 1 67  ? 20.039  1.800   8.330   1.00 42.90  ? 67   CYS A CA  1 
ATOM   369  C  C   . CYS A 1 67  ? 19.491  1.797   6.915   1.00 44.27  ? 67   CYS A C   1 
ATOM   370  O  O   . CYS A 1 67  ? 20.179  2.184   5.970   1.00 45.66  ? 67   CYS A O   1 
ATOM   371  C  CB  . CYS A 1 67  ? 20.196  0.364   8.828   1.00 36.72  ? 67   CYS A CB  1 
ATOM   372  S  SG  . CYS A 1 67  ? 20.994  0.233   10.439  1.00 56.14  ? 67   CYS A SG  1 
ATOM   373  N  N   . ALA A 1 68  ? 18.246  1.353   6.782   1.00 42.81  ? 68   ALA A N   1 
ATOM   374  C  CA  . ALA A 1 68  ? 17.547  1.350   5.503   1.00 39.69  ? 68   ALA A CA  1 
ATOM   375  C  C   . ALA A 1 68  ? 17.584  2.727   4.853   1.00 41.48  ? 68   ALA A C   1 
ATOM   376  O  O   . ALA A 1 68  ? 17.912  2.857   3.675   1.00 45.09  ? 68   ALA A O   1 
ATOM   377  C  CB  . ALA A 1 68  ? 16.111  0.905   5.700   1.00 37.64  ? 68   ALA A CB  1 
ATOM   378  N  N   . ASP A 1 69  ? 17.254  3.754   5.630   1.00 41.29  ? 69   ASP A N   1 
ATOM   379  C  CA  . ASP A 1 69  ? 17.227  5.121   5.121   1.00 45.11  ? 69   ASP A CA  1 
ATOM   380  C  C   . ASP A 1 69  ? 18.619  5.626   4.746   1.00 50.99  ? 69   ASP A C   1 
ATOM   381  O  O   . ASP A 1 69  ? 18.767  6.460   3.849   1.00 50.51  ? 69   ASP A O   1 
ATOM   382  C  CB  . ASP A 1 69  ? 16.567  6.061   6.133   1.00 48.68  ? 69   ASP A CB  1 
ATOM   383  C  CG  . ASP A 1 69  ? 15.088  5.778   6.312   1.00 59.20  ? 69   ASP A CG  1 
ATOM   384  O  OD1 . ASP A 1 69  ? 14.483  5.183   5.393   1.00 59.23  ? 69   ASP A OD1 1 
ATOM   385  O  OD2 . ASP A 1 69  ? 14.531  6.153   7.366   1.00 57.27  ? 69   ASP A OD2 1 
ATOM   386  N  N   . LEU A 1 70  ? 19.638  5.120   5.434   1.00 49.58  ? 70   LEU A N   1 
ATOM   387  C  CA  . LEU A 1 70  ? 21.014  5.478   5.108   1.00 52.79  ? 70   LEU A CA  1 
ATOM   388  C  C   . LEU A 1 70  ? 21.389  4.961   3.721   1.00 53.10  ? 70   LEU A C   1 
ATOM   389  O  O   . LEU A 1 70  ? 21.940  5.696   2.899   1.00 49.45  ? 70   LEU A O   1 
ATOM   390  C  CB  . LEU A 1 70  ? 21.986  4.932   6.157   1.00 46.25  ? 70   LEU A CB  1 
ATOM   391  C  CG  . LEU A 1 70  ? 23.464  5.253   5.914   1.00 48.09  ? 70   LEU A CG  1 
ATOM   392  C  CD1 . LEU A 1 70  ? 23.682  6.758   5.841   1.00 43.17  ? 70   LEU A CD1 1 
ATOM   393  C  CD2 . LEU A 1 70  ? 24.349  4.631   6.985   1.00 48.51  ? 70   LEU A CD2 1 
ATOM   394  N  N   . ILE A 1 71  ? 21.081  3.691   3.473   1.00 48.36  ? 71   ILE A N   1 
ATOM   395  C  CA  . ILE A 1 71  ? 21.359  3.055   2.191   1.00 45.86  ? 71   ILE A CA  1 
ATOM   396  C  C   . ILE A 1 71  ? 20.649  3.772   1.043   1.00 51.03  ? 71   ILE A C   1 
ATOM   397  O  O   . ILE A 1 71  ? 21.204  3.923   -0.046  1.00 53.91  ? 71   ILE A O   1 
ATOM   398  C  CB  . ILE A 1 71  ? 20.965  1.566   2.208   1.00 42.53  ? 71   ILE A CB  1 
ATOM   399  C  CG1 . ILE A 1 71  ? 21.868  0.795   3.174   1.00 36.13  ? 71   ILE A CG1 1 
ATOM   400  C  CG2 . ILE A 1 71  ? 21.044  0.975   0.810   1.00 32.63  ? 71   ILE A CG2 1 
ATOM   401  C  CD1 . ILE A 1 71  ? 21.623  -0.693  3.176   1.00 36.07  ? 71   ILE A CD1 1 
ATOM   402  N  N   . ILE A 1 72  ? 19.423  4.218   1.299   1.00 50.84  ? 72   ILE A N   1 
ATOM   403  C  CA  . ILE A 1 72  ? 18.661  4.983   0.318   1.00 55.86  ? 72   ILE A CA  1 
ATOM   404  C  C   . ILE A 1 72  ? 19.381  6.284   -0.034  1.00 54.60  ? 72   ILE A C   1 
ATOM   405  O  O   . ILE A 1 72  ? 19.389  6.711   -1.191  1.00 47.59  ? 72   ILE A O   1 
ATOM   406  C  CB  . ILE A 1 72  ? 17.239  5.298   0.834   1.00 46.85  ? 72   ILE A CB  1 
ATOM   407  C  CG1 . ILE A 1 72  ? 16.378  4.032   0.830   1.00 44.59  ? 72   ILE A CG1 1 
ATOM   408  C  CG2 . ILE A 1 72  ? 16.589  6.393   -0.000  1.00 41.36  ? 72   ILE A CG2 1 
ATOM   409  C  CD1 . ILE A 1 72  ? 16.190  3.420   -0.542  1.00 39.65  ? 72   ILE A CD1 1 
ATOM   410  N  N   . GLY A 1 73  ? 19.995  6.902   0.971   1.00 57.08  ? 73   GLY A N   1 
ATOM   411  C  CA  . GLY A 1 73  ? 20.696  8.159   0.783   1.00 50.55  ? 73   GLY A CA  1 
ATOM   412  C  C   . GLY A 1 73  ? 21.997  8.006   0.017   1.00 55.76  ? 73   GLY A C   1 
ATOM   413  O  O   . GLY A 1 73  ? 22.354  8.860   -0.794  1.00 56.00  ? 73   GLY A O   1 
ATOM   414  N  N   . VAL A 1 74  ? 22.708  6.912   0.270   1.00 53.67  ? 74   VAL A N   1 
ATOM   415  C  CA  . VAL A 1 74  ? 23.991  6.671   -0.382  1.00 52.53  ? 74   VAL A CA  1 
ATOM   416  C  C   . VAL A 1 74  ? 23.843  6.074   -1.783  1.00 53.75  ? 74   VAL A C   1 
ATOM   417  O  O   . VAL A 1 74  ? 24.546  6.476   -2.713  1.00 47.57  ? 74   VAL A O   1 
ATOM   418  C  CB  . VAL A 1 74  ? 24.905  5.764   0.475   1.00 46.53  ? 74   VAL A CB  1 
ATOM   419  C  CG1 . VAL A 1 74  ? 24.134  4.571   0.992   1.00 54.58  ? 74   VAL A CG1 1 
ATOM   420  C  CG2 . VAL A 1 74  ? 26.116  5.312   -0.325  1.00 40.43  ? 74   VAL A CG2 1 
ATOM   421  N  N   . PHE A 1 75  ? 22.923  5.125   -1.935  1.00 52.84  ? 75   PHE A N   1 
ATOM   422  C  CA  . PHE A 1 75  ? 22.779  4.403   -3.199  1.00 51.63  ? 75   PHE A CA  1 
ATOM   423  C  C   . PHE A 1 75  ? 21.595  4.855   -4.055  1.00 49.48  ? 75   PHE A C   1 
ATOM   424  O  O   . PHE A 1 75  ? 21.783  5.419   -5.133  1.00 53.65  ? 75   PHE A O   1 
ATOM   425  C  CB  . PHE A 1 75  ? 22.711  2.893   -2.953  1.00 42.33  ? 75   PHE A CB  1 
ATOM   426  C  CG  . PHE A 1 75  ? 23.988  2.308   -2.426  1.00 46.80  ? 75   PHE A CG  1 
ATOM   427  C  CD1 . PHE A 1 75  ? 25.055  2.057   -3.275  1.00 54.89  ? 75   PHE A CD1 1 
ATOM   428  C  CD2 . PHE A 1 75  ? 24.124  2.008   -1.081  1.00 49.87  ? 75   PHE A CD2 1 
ATOM   429  C  CE1 . PHE A 1 75  ? 26.232  1.518   -2.789  1.00 53.21  ? 75   PHE A CE1 1 
ATOM   430  C  CE2 . PHE A 1 75  ? 25.297  1.471   -0.591  1.00 48.25  ? 75   PHE A CE2 1 
ATOM   431  C  CZ  . PHE A 1 75  ? 26.352  1.225   -1.446  1.00 51.61  ? 75   PHE A CZ  1 
ATOM   432  N  N   . SER A 1 76  ? 20.381  4.600   -3.576  1.00 48.57  ? 76   SER A N   1 
ATOM   433  C  CA  . SER A 1 76  ? 19.175  4.864   -4.360  1.00 48.61  ? 76   SER A CA  1 
ATOM   434  C  C   . SER A 1 76  ? 19.106  6.286   -4.915  1.00 50.63  ? 76   SER A C   1 
ATOM   435  O  O   . SER A 1 76  ? 18.976  6.478   -6.124  1.00 52.09  ? 76   SER A O   1 
ATOM   436  C  CB  . SER A 1 76  ? 17.918  4.549   -3.545  1.00 50.35  ? 76   SER A CB  1 
ATOM   437  O  OG  . SER A 1 76  ? 17.806  3.157   -3.300  1.00 55.80  ? 76   SER A OG  1 
ATOM   438  N  N   . MET A 1 77  ? 19.190  7.277   -4.033  1.00 54.12  ? 77   MET A N   1 
ATOM   439  C  CA  . MET A 1 77  ? 19.128  8.676   -4.449  1.00 51.84  ? 77   MET A CA  1 
ATOM   440  C  C   . MET A 1 77  ? 20.168  9.003   -5.516  1.00 50.19  ? 77   MET A C   1 
ATOM   441  O  O   . MET A 1 77  ? 19.827  9.462   -6.607  1.00 51.13  ? 77   MET A O   1 
ATOM   442  C  CB  . MET A 1 77  ? 19.304  9.611   -3.249  1.00 53.11  ? 77   MET A CB  1 
ATOM   443  C  CG  . MET A 1 77  ? 18.039  9.832   -2.434  1.00 52.68  ? 77   MET A CG  1 
ATOM   444  S  SD  . MET A 1 77  ? 18.297  10.965  -1.053  1.00 46.13  ? 77   MET A SD  1 
ATOM   445  C  CE  . MET A 1 77  ? 16.608  11.266  -0.535  1.00 38.96  ? 77   MET A CE  1 
ATOM   446  N  N   . ASN A 1 78  ? 21.435  8.758   -5.194  1.00 51.92  ? 78   ASN A N   1 
ATOM   447  C  CA  . ASN A 1 78  ? 22.540  9.080   -6.095  1.00 47.97  ? 78   ASN A CA  1 
ATOM   448  C  C   . ASN A 1 78  ? 22.431  8.431   -7.475  1.00 42.47  ? 78   ASN A C   1 
ATOM   449  O  O   . ASN A 1 78  ? 22.475  9.120   -8.494  1.00 42.31  ? 78   ASN A O   1 
ATOM   450  C  CB  . ASN A 1 78  ? 23.883  8.727   -5.448  1.00 49.88  ? 78   ASN A CB  1 
ATOM   451  C  CG  . ASN A 1 78  ? 24.202  9.603   -4.248  1.00 51.05  ? 78   ASN A CG  1 
ATOM   452  O  OD1 . ASN A 1 78  ? 23.814  10.771  -4.196  1.00 46.75  ? 78   ASN A OD1 1 
ATOM   453  N  ND2 . ASN A 1 78  ? 24.915  9.040   -3.277  1.00 45.64  ? 78   ASN A ND2 1 
ATOM   454  N  N   . LEU A 1 79  ? 22.296  7.109   -7.506  1.00 41.88  ? 79   LEU A N   1 
ATOM   455  C  CA  . LEU A 1 79  ? 22.202  6.382   -8.770  1.00 38.64  ? 79   LEU A CA  1 
ATOM   456  C  C   . LEU A 1 79  ? 20.974  6.784   -9.580  1.00 41.39  ? 79   LEU A C   1 
ATOM   457  O  O   . LEU A 1 79  ? 21.040  6.888   -10.804 1.00 40.01  ? 79   LEU A O   1 
ATOM   458  C  CB  . LEU A 1 79  ? 22.213  4.869   -8.539  1.00 43.39  ? 79   LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 79  ? 23.580  4.180   -8.592  1.00 44.33  ? 79   LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 79  ? 24.518  4.742   -7.531  1.00 54.33  ? 79   LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 79  ? 23.430  2.673   -8.441  1.00 42.57  ? 79   LEU A CD2 1 
ATOM   462  N  N   . TYR A 1 80  ? 19.854  7.008   -8.899  1.00 48.56  ? 80   TYR A N   1 
ATOM   463  C  CA  . TYR A 1 80  ? 18.637  7.442   -9.578  1.00 48.32  ? 80   TYR A CA  1 
ATOM   464  C  C   . TYR A 1 80  ? 18.830  8.810   -10.224 1.00 46.79  ? 80   TYR A C   1 
ATOM   465  O  O   . TYR A 1 80  ? 18.408  9.036   -11.359 1.00 44.62  ? 80   TYR A O   1 
ATOM   466  C  CB  . TYR A 1 80  ? 17.443  7.477   -8.622  1.00 44.03  ? 80   TYR A CB  1 
ATOM   467  C  CG  . TYR A 1 80  ? 16.173  7.946   -9.295  1.00 46.68  ? 80   TYR A CG  1 
ATOM   468  C  CD1 . TYR A 1 80  ? 15.737  9.259   -9.163  1.00 45.18  ? 80   TYR A CD1 1 
ATOM   469  C  CD2 . TYR A 1 80  ? 15.423  7.083   -10.083 1.00 44.03  ? 80   TYR A CD2 1 
ATOM   470  C  CE1 . TYR A 1 80  ? 14.581  9.694   -9.785  1.00 42.57  ? 80   TYR A CE1 1 
ATOM   471  C  CE2 . TYR A 1 80  ? 14.267  7.508   -10.711 1.00 43.17  ? 80   TYR A CE2 1 
ATOM   472  C  CZ  . TYR A 1 80  ? 13.851  8.814   -10.558 1.00 42.78  ? 80   TYR A CZ  1 
ATOM   473  O  OH  . TYR A 1 80  ? 12.701  9.241   -11.181 1.00 42.55  ? 80   TYR A OH  1 
ATOM   474  N  N   . THR A 1 81  ? 19.462  9.722   -9.492  1.00 48.75  ? 81   THR A N   1 
ATOM   475  C  CA  . THR A 1 81  ? 19.801  11.033  -10.032 1.00 49.21  ? 81   THR A CA  1 
ATOM   476  C  C   . THR A 1 81  ? 20.616  10.878  -11.314 1.00 53.87  ? 81   THR A C   1 
ATOM   477  O  O   . THR A 1 81  ? 20.274  11.445  -12.352 1.00 55.52  ? 81   THR A O   1 
ATOM   478  C  CB  . THR A 1 81  ? 20.596  11.876  -9.018  1.00 45.91  ? 81   THR A CB  1 
ATOM   479  O  OG1 . THR A 1 81  ? 19.728  12.294  -7.959  1.00 52.73  ? 81   THR A OG1 1 
ATOM   480  C  CG2 . THR A 1 81  ? 21.183  13.105  -9.692  1.00 53.23  ? 81   THR A CG2 1 
ATOM   481  N  N   . LEU A 1 82  ? 21.690  10.100  -11.230 1.00 47.40  ? 82   LEU A N   1 
ATOM   482  C  CA  . LEU A 1 82  ? 22.524  9.800   -12.387 1.00 46.23  ? 82   LEU A CA  1 
ATOM   483  C  C   . LEU A 1 82  ? 21.679  9.332   -13.564 1.00 45.77  ? 82   LEU A C   1 
ATOM   484  O  O   . LEU A 1 82  ? 21.843  9.800   -14.690 1.00 45.45  ? 82   LEU A O   1 
ATOM   485  C  CB  . LEU A 1 82  ? 23.547  8.721   -12.031 1.00 42.66  ? 82   LEU A CB  1 
ATOM   486  C  CG  . LEU A 1 82  ? 24.376  8.171   -13.193 1.00 46.35  ? 82   LEU A CG  1 
ATOM   487  C  CD1 . LEU A 1 82  ? 25.117  9.297   -13.901 1.00 40.09  ? 82   LEU A CD1 1 
ATOM   488  C  CD2 . LEU A 1 82  ? 25.344  7.104   -12.703 1.00 38.29  ? 82   LEU A CD2 1 
ATOM   489  N  N   . TYR A 1 83  ? 20.770  8.404   -13.287 1.00 45.45  ? 83   TYR A N   1 
ATOM   490  C  CA  . TYR A 1 83  ? 19.936  7.798   -14.316 1.00 43.06  ? 83   TYR A CA  1 
ATOM   491  C  C   . TYR A 1 83  ? 18.990  8.807   -14.963 1.00 53.58  ? 83   TYR A C   1 
ATOM   492  O  O   . TYR A 1 83  ? 18.692  8.712   -16.154 1.00 53.59  ? 83   TYR A O   1 
ATOM   493  C  CB  . TYR A 1 83  ? 19.150  6.627   -13.721 1.00 42.13  ? 83   TYR A CB  1 
ATOM   494  C  CG  . TYR A 1 83  ? 18.274  5.882   -14.704 1.00 49.98  ? 83   TYR A CG  1 
ATOM   495  C  CD1 . TYR A 1 83  ? 18.823  5.226   -15.799 1.00 54.53  ? 83   TYR A CD1 1 
ATOM   496  C  CD2 . TYR A 1 83  ? 16.899  5.812   -14.521 1.00 57.83  ? 83   TYR A CD2 1 
ATOM   497  C  CE1 . TYR A 1 83  ? 18.025  4.537   -16.695 1.00 51.36  ? 83   TYR A CE1 1 
ATOM   498  C  CE2 . TYR A 1 83  ? 16.093  5.123   -15.411 1.00 58.75  ? 83   TYR A CE2 1 
ATOM   499  C  CZ  . TYR A 1 83  ? 16.662  4.487   -16.496 1.00 53.79  ? 83   TYR A CZ  1 
ATOM   500  O  OH  . TYR A 1 83  ? 15.869  3.801   -17.389 1.00 52.30  ? 83   TYR A OH  1 
ATOM   501  N  N   . THR A 1 84  ? 18.533  9.779   -14.177 1.00 52.58  ? 84   THR A N   1 
ATOM   502  C  CA  . THR A 1 84  ? 17.562  10.763  -14.653 1.00 55.40  ? 84   THR A CA  1 
ATOM   503  C  C   . THR A 1 84  ? 18.207  11.969  -15.340 1.00 56.88  ? 84   THR A C   1 
ATOM   504  O  O   . THR A 1 84  ? 17.667  12.493  -16.314 1.00 59.94  ? 84   THR A O   1 
ATOM   505  C  CB  . THR A 1 84  ? 16.637  11.252  -13.518 1.00 47.90  ? 84   THR A CB  1 
ATOM   506  O  OG1 . THR A 1 84  ? 17.427  11.744  -12.429 1.00 55.92  ? 84   THR A OG1 1 
ATOM   507  C  CG2 . THR A 1 84  ? 15.760  10.117  -13.026 1.00 46.88  ? 84   THR A CG2 1 
ATOM   508  N  N   . VAL A 1 85  ? 19.354  12.410  -14.833 1.00 54.17  ? 85   VAL A N   1 
ATOM   509  C  CA  . VAL A 1 85  ? 20.046  13.551  -15.426 1.00 56.88  ? 85   VAL A CA  1 
ATOM   510  C  C   . VAL A 1 85  ? 20.661  13.189  -16.777 1.00 55.00  ? 85   VAL A C   1 
ATOM   511  O  O   . VAL A 1 85  ? 20.636  13.985  -17.716 1.00 54.18  ? 85   VAL A O   1 
ATOM   512  C  CB  . VAL A 1 85  ? 21.143  14.115  -14.493 1.00 51.15  ? 85   VAL A CB  1 
ATOM   513  C  CG1 . VAL A 1 85  ? 22.130  13.024  -14.101 1.00 50.26  ? 85   VAL A CG1 1 
ATOM   514  C  CG2 . VAL A 1 85  ? 21.868  15.276  -15.163 1.00 44.97  ? 85   VAL A CG2 1 
ATOM   515  N  N   . ILE A 1 86  ? 21.200  11.979  -16.872 1.00 53.00  ? 86   ILE A N   1 
ATOM   516  C  CA  . ILE A 1 86  ? 21.931  11.561  -18.061 1.00 44.21  ? 86   ILE A CA  1 
ATOM   517  C  C   . ILE A 1 86  ? 21.004  11.006  -19.147 1.00 53.79  ? 86   ILE A C   1 
ATOM   518  O  O   . ILE A 1 86  ? 21.417  10.824  -20.293 1.00 58.32  ? 86   ILE A O   1 
ATOM   519  C  CB  . ILE A 1 86  ? 23.022  10.527  -17.706 1.00 40.20  ? 86   ILE A CB  1 
ATOM   520  C  CG1 . ILE A 1 86  ? 24.277  10.751  -18.550 1.00 44.36  ? 86   ILE A CG1 1 
ATOM   521  C  CG2 . ILE A 1 86  ? 22.495  9.114   -17.865 1.00 41.80  ? 86   ILE A CG2 1 
ATOM   522  C  CD1 . ILE A 1 86  ? 25.444  9.872   -18.150 1.00 46.57  ? 86   ILE A CD1 1 
ATOM   523  N  N   . GLY A 1 87  ? 19.753  10.741  -18.780 1.00 58.48  ? 87   GLY A N   1 
ATOM   524  C  CA  . GLY A 1 87  ? 18.754  10.302  -19.741 1.00 55.74  ? 87   GLY A CA  1 
ATOM   525  C  C   . GLY A 1 87  ? 18.690  8.802   -19.973 1.00 57.52  ? 87   GLY A C   1 
ATOM   526  O  O   . GLY A 1 87  ? 17.734  8.302   -20.569 1.00 51.31  ? 87   GLY A O   1 
ATOM   527  N  N   . TYR A 1 88  ? 19.706  8.082   -19.506 1.00 55.53  ? 88   TYR A N   1 
ATOM   528  C  CA  . TYR A 1 88  ? 19.760  6.634   -19.670 1.00 47.81  ? 88   TYR A CA  1 
ATOM   529  C  C   . TYR A 1 88  ? 20.603  5.991   -18.568 1.00 47.06  ? 88   TYR A C   1 
ATOM   530  O  O   . TYR A 1 88  ? 21.038  6.663   -17.635 1.00 43.47  ? 88   TYR A O   1 
ATOM   531  C  CB  . TYR A 1 88  ? 20.319  6.275   -21.050 1.00 46.92  ? 88   TYR A CB  1 
ATOM   532  C  CG  . TYR A 1 88  ? 21.808  6.511   -21.188 1.00 49.26  ? 88   TYR A CG  1 
ATOM   533  C  CD1 . TYR A 1 88  ? 22.320  7.796   -21.331 1.00 41.41  ? 88   TYR A CD1 1 
ATOM   534  C  CD2 . TYR A 1 88  ? 22.702  5.446   -21.175 1.00 43.38  ? 88   TYR A CD2 1 
ATOM   535  C  CE1 . TYR A 1 88  ? 23.681  8.013   -21.454 1.00 46.76  ? 88   TYR A CE1 1 
ATOM   536  C  CE2 . TYR A 1 88  ? 24.062  5.653   -21.298 1.00 40.95  ? 88   TYR A CE2 1 
ATOM   537  C  CZ  . TYR A 1 88  ? 24.546  6.937   -21.437 1.00 49.47  ? 88   TYR A CZ  1 
ATOM   538  O  OH  . TYR A 1 88  ? 25.901  7.145   -21.559 1.00 59.23  ? 88   TYR A OH  1 
ATOM   539  N  N   . TRP A 1 89  ? 20.833  4.687   -18.678 1.00 42.24  ? 89   TRP A N   1 
ATOM   540  C  CA  . TRP A 1 89  ? 21.625  3.968   -17.685 1.00 40.95  ? 89   TRP A CA  1 
ATOM   541  C  C   . TRP A 1 89  ? 22.984  3.567   -18.248 1.00 48.93  ? 89   TRP A C   1 
ATOM   542  O  O   . TRP A 1 89  ? 23.063  2.711   -19.127 1.00 54.57  ? 89   TRP A O   1 
ATOM   543  C  CB  . TRP A 1 89  ? 20.873  2.729   -17.194 1.00 49.39  ? 89   TRP A CB  1 
ATOM   544  C  CG  . TRP A 1 89  ? 21.613  1.961   -16.135 1.00 52.02  ? 89   TRP A CG  1 
ATOM   545  C  CD1 . TRP A 1 89  ? 22.387  0.850   -16.316 1.00 49.92  ? 89   TRP A CD1 1 
ATOM   546  C  CD2 . TRP A 1 89  ? 21.651  2.253   -14.732 1.00 54.18  ? 89   TRP A CD2 1 
ATOM   547  N  NE1 . TRP A 1 89  ? 22.901  0.430   -15.112 1.00 46.42  ? 89   TRP A NE1 1 
ATOM   548  C  CE2 . TRP A 1 89  ? 22.465  1.273   -14.124 1.00 51.62  ? 89   TRP A CE2 1 
ATOM   549  C  CE3 . TRP A 1 89  ? 21.077  3.244   -13.930 1.00 51.55  ? 89   TRP A CE3 1 
ATOM   550  C  CZ2 . TRP A 1 89  ? 22.718  1.257   -12.752 1.00 48.80  ? 89   TRP A CZ2 1 
ATOM   551  C  CZ3 . TRP A 1 89  ? 21.330  3.227   -12.568 1.00 46.33  ? 89   TRP A CZ3 1 
ATOM   552  C  CH2 . TRP A 1 89  ? 22.144  2.241   -11.994 1.00 45.19  ? 89   TRP A CH2 1 
ATOM   553  N  N   . PRO A 1 90  ? 24.060  4.188   -17.740 1.00 50.64  ? 90   PRO A N   1 
ATOM   554  C  CA  . PRO A 1 90  ? 25.415  3.960   -18.253 1.00 46.28  ? 90   PRO A CA  1 
ATOM   555  C  C   . PRO A 1 90  ? 26.183  2.858   -17.525 1.00 47.86  ? 90   PRO A C   1 
ATOM   556  O  O   . PRO A 1 90  ? 27.241  2.452   -18.006 1.00 58.03  ? 90   PRO A O   1 
ATOM   557  C  CB  . PRO A 1 90  ? 26.098  5.299   -17.984 1.00 43.10  ? 90   PRO A CB  1 
ATOM   558  C  CG  . PRO A 1 90  ? 25.456  5.773   -16.716 1.00 39.81  ? 90   PRO A CG  1 
ATOM   559  C  CD  . PRO A 1 90  ? 24.015  5.310   -16.784 1.00 48.40  ? 90   PRO A CD  1 
ATOM   560  N  N   . LEU A 1 91  ? 25.667  2.375   -16.398 1.00 48.01  ? 91   LEU A N   1 
ATOM   561  C  CA  . LEU A 1 91  ? 26.465  1.521   -15.512 1.00 49.27  ? 91   LEU A CA  1 
ATOM   562  C  C   . LEU A 1 91  ? 26.425  0.010   -15.788 1.00 46.00  ? 91   LEU A C   1 
ATOM   563  O  O   . LEU A 1 91  ? 27.236  -0.746  -15.247 1.00 36.45  ? 91   LEU A O   1 
ATOM   564  C  CB  . LEU A 1 91  ? 26.135  1.815   -14.046 1.00 49.37  ? 91   LEU A CB  1 
ATOM   565  C  CG  . LEU A 1 91  ? 26.608  3.182   -13.553 1.00 43.60  ? 91   LEU A CG  1 
ATOM   566  C  CD1 . LEU A 1 91  ? 26.229  3.403   -12.093 1.00 41.88  ? 91   LEU A CD1 1 
ATOM   567  C  CD2 . LEU A 1 91  ? 28.112  3.318   -13.752 1.00 38.11  ? 91   LEU A CD2 1 
ATOM   568  N  N   . GLY A 1 92  ? 25.494  -0.431  -16.628 1.00 51.85  ? 92   GLY A N   1 
ATOM   569  C  CA  . GLY A 1 92  ? 25.430  -1.835  -16.999 1.00 52.08  ? 92   GLY A CA  1 
ATOM   570  C  C   . GLY A 1 92  ? 24.358  -2.622  -16.272 1.00 53.12  ? 92   GLY A C   1 
ATOM   571  O  O   . GLY A 1 92  ? 23.815  -2.159  -15.269 1.00 57.45  ? 92   GLY A O   1 
ATOM   572  N  N   . PRO A 1 93  ? 24.061  -3.834  -16.769 1.00 59.74  ? 93   PRO A N   1 
ATOM   573  C  CA  . PRO A 1 93  ? 22.969  -4.676  -16.266 1.00 56.24  ? 93   PRO A CA  1 
ATOM   574  C  C   . PRO A 1 93  ? 23.180  -5.173  -14.837 1.00 51.60  ? 93   PRO A C   1 
ATOM   575  O  O   . PRO A 1 93  ? 22.261  -5.092  -14.022 1.00 56.07  ? 93   PRO A O   1 
ATOM   576  C  CB  . PRO A 1 93  ? 22.964  -5.859  -17.242 1.00 47.99  ? 93   PRO A CB  1 
ATOM   577  C  CG  . PRO A 1 93  ? 24.351  -5.926  -17.759 1.00 48.91  ? 93   PRO A CG  1 
ATOM   578  C  CD  . PRO A 1 93  ? 24.810  -4.497  -17.852 1.00 60.12  ? 93   PRO A CD  1 
ATOM   579  N  N   . VAL A 1 94  ? 24.372  -5.682  -14.544 1.00 49.61  ? 94   VAL A N   1 
ATOM   580  C  CA  . VAL A 1 94  ? 24.658  -6.260  -13.233 1.00 62.68  ? 94   VAL A CA  1 
ATOM   581  C  C   . VAL A 1 94  ? 24.508  -5.252  -12.089 1.00 59.47  ? 94   VAL A C   1 
ATOM   582  O  O   . VAL A 1 94  ? 23.879  -5.550  -11.073 1.00 48.63  ? 94   VAL A O   1 
ATOM   583  C  CB  . VAL A 1 94  ? 26.062  -6.892  -13.183 1.00 55.02  ? 94   VAL A CB  1 
ATOM   584  C  CG1 . VAL A 1 94  ? 27.106  -5.909  -13.696 1.00 66.82  ? 94   VAL A CG1 1 
ATOM   585  C  CG2 . VAL A 1 94  ? 26.387  -7.347  -11.768 1.00 47.80  ? 94   VAL A CG2 1 
ATOM   586  N  N   . VAL A 1 95  ? 25.086  -4.065  -12.251 1.00 55.62  ? 95   VAL A N   1 
ATOM   587  C  CA  . VAL A 1 95  ? 24.967  -3.029  -11.230 1.00 55.79  ? 95   VAL A CA  1 
ATOM   588  C  C   . VAL A 1 95  ? 23.542  -2.494  -11.203 1.00 56.88  ? 95   VAL A C   1 
ATOM   589  O  O   . VAL A 1 95  ? 23.066  -2.012  -10.175 1.00 57.65  ? 95   VAL A O   1 
ATOM   590  C  CB  . VAL A 1 95  ? 25.940  -1.861  -11.470 1.00 48.18  ? 95   VAL A CB  1 
ATOM   591  C  CG1 . VAL A 1 95  ? 25.593  -1.144  -12.751 1.00 51.84  ? 95   VAL A CG1 1 
ATOM   592  C  CG2 . VAL A 1 95  ? 25.894  -0.894  -10.300 1.00 54.88  ? 95   VAL A CG2 1 
ATOM   593  N  N   . CYS A 1 96  ? 22.862  -2.578  -12.341 1.00 49.18  ? 96   CYS A N   1 
ATOM   594  C  CA  . CYS A 1 96  ? 21.465  -2.178  -12.412 1.00 48.20  ? 96   CYS A CA  1 
ATOM   595  C  C   . CYS A 1 96  ? 20.609  -3.099  -11.549 1.00 55.75  ? 96   CYS A C   1 
ATOM   596  O  O   . CYS A 1 96  ? 19.756  -2.640  -10.788 1.00 45.45  ? 96   CYS A O   1 
ATOM   597  C  CB  . CYS A 1 96  ? 20.970  -2.194  -13.859 1.00 46.55  ? 96   CYS A CB  1 
ATOM   598  S  SG  . CYS A 1 96  ? 19.169  -2.232  -14.027 1.00 52.03  ? 96   CYS A SG  1 
ATOM   599  N  N   . ASP A 1 97  ? 20.848  -4.401  -11.667 1.00 54.62  ? 97   ASP A N   1 
ATOM   600  C  CA  . ASP A 1 97  ? 20.074  -5.387  -10.920 1.00 57.69  ? 97   ASP A CA  1 
ATOM   601  C  C   . ASP A 1 97  ? 20.327  -5.296  -9.415  1.00 54.90  ? 97   ASP A C   1 
ATOM   602  O  O   . ASP A 1 97  ? 19.401  -5.424  -8.613  1.00 57.44  ? 97   ASP A O   1 
ATOM   603  C  CB  . ASP A 1 97  ? 20.361  -6.800  -11.433 1.00 56.86  ? 97   ASP A CB  1 
ATOM   604  C  CG  . ASP A 1 97  ? 19.968  -6.981  -12.888 1.00 51.49  ? 97   ASP A CG  1 
ATOM   605  O  OD1 . ASP A 1 97  ? 20.643  -7.758  -13.597 1.00 52.46  ? 97   ASP A OD1 1 
ATOM   606  O  OD2 . ASP A 1 97  ? 18.984  -6.344  -13.323 1.00 46.80  ? 97   ASP A OD2 1 
ATOM   607  N  N   . LEU A 1 98  ? 21.581  -5.079  -9.035  1.00 49.80  ? 98   LEU A N   1 
ATOM   608  C  CA  . LEU A 1 98  ? 21.921  -4.899  -7.629  1.00 42.98  ? 98   LEU A CA  1 
ATOM   609  C  C   . LEU A 1 98  ? 21.240  -3.653  -7.072  1.00 44.34  ? 98   LEU A C   1 
ATOM   610  O  O   . LEU A 1 98  ? 20.736  -3.655  -5.948  1.00 46.35  ? 98   LEU A O   1 
ATOM   611  C  CB  . LEU A 1 98  ? 23.437  -4.798  -7.444  1.00 42.13  ? 98   LEU A CB  1 
ATOM   612  C  CG  . LEU A 1 98  ? 24.249  -6.061  -7.736  1.00 40.42  ? 98   LEU A CG  1 
ATOM   613  C  CD1 . LEU A 1 98  ? 25.726  -5.813  -7.480  1.00 37.57  ? 98   LEU A CD1 1 
ATOM   614  C  CD2 . LEU A 1 98  ? 23.746  -7.230  -6.903  1.00 26.33  ? 98   LEU A CD2 1 
ATOM   615  N  N   . TRP A 1 99  ? 21.225  -2.591  -7.870  1.00 45.26  ? 99   TRP A N   1 
ATOM   616  C  CA  . TRP A 1 99  ? 20.623  -1.331  -7.451  1.00 46.55  ? 99   TRP A CA  1 
ATOM   617  C  C   . TRP A 1 99  ? 19.131  -1.477  -7.164  1.00 47.49  ? 99   TRP A C   1 
ATOM   618  O  O   . TRP A 1 99  ? 18.639  -0.997  -6.144  1.00 46.74  ? 99   TRP A O   1 
ATOM   619  C  CB  . TRP A 1 99  ? 20.854  -0.243  -8.501  1.00 41.14  ? 99   TRP A CB  1 
ATOM   620  C  CG  . TRP A 1 99  ? 20.230  1.066   -8.136  1.00 47.49  ? 99   TRP A CG  1 
ATOM   621  C  CD1 . TRP A 1 99  ? 20.420  1.769   -6.983  1.00 53.81  ? 99   TRP A CD1 1 
ATOM   622  C  CD2 . TRP A 1 99  ? 19.320  1.835   -8.931  1.00 47.10  ? 99   TRP A CD2 1 
ATOM   623  N  NE1 . TRP A 1 99  ? 19.682  2.927   -7.007  1.00 49.34  ? 99   TRP A NE1 1 
ATOM   624  C  CE2 . TRP A 1 99  ? 18.998  2.993   -8.192  1.00 47.43  ? 99   TRP A CE2 1 
ATOM   625  C  CE3 . TRP A 1 99  ? 18.743  1.659   -10.193 1.00 46.41  ? 99   TRP A CE3 1 
ATOM   626  C  CZ2 . TRP A 1 99  ? 18.127  3.968   -8.674  1.00 44.59  ? 99   TRP A CZ2 1 
ATOM   627  C  CZ3 . TRP A 1 99  ? 17.879  2.629   -10.670 1.00 47.37  ? 99   TRP A CZ3 1 
ATOM   628  C  CH2 . TRP A 1 99  ? 17.579  3.769   -9.911  1.00 49.13  ? 99   TRP A CH2 1 
ATOM   629  N  N   . LEU A 1 100 ? 18.417  -2.140  -8.068  1.00 53.41  ? 100  LEU A N   1 
ATOM   630  C  CA  . LEU A 1 100 ? 16.983  -2.351  -7.903  1.00 50.19  ? 100  LEU A CA  1 
ATOM   631  C  C   . LEU A 1 100 ? 16.703  -3.253  -6.709  1.00 45.88  ? 100  LEU A C   1 
ATOM   632  O  O   . LEU A 1 100 ? 15.869  -2.934  -5.862  1.00 44.10  ? 100  LEU A O   1 
ATOM   633  C  CB  . LEU A 1 100 ? 16.376  -2.956  -9.170  1.00 51.47  ? 100  LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 100 ? 16.515  -2.138  -10.456 1.00 42.58  ? 100  LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 100 ? 15.946  -2.908  -11.633 1.00 46.80  ? 100  LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 100 ? 15.839  -0.782  -10.320 1.00 32.45  ? 100  LEU A CD2 1 
ATOM   637  N  N   . ALA A 1 101 ? 17.400  -4.384  -6.651  1.00 45.48  ? 101  ALA A N   1 
ATOM   638  C  CA  . ALA A 1 101 ? 17.275  -5.299  -5.522  1.00 50.14  ? 101  ALA A CA  1 
ATOM   639  C  C   . ALA A 1 101 ? 17.426  -4.544  -4.207  1.00 50.34  ? 101  ALA A C   1 
ATOM   640  O  O   . ALA A 1 101 ? 16.542  -4.575  -3.351  1.00 46.97  ? 101  ALA A O   1 
ATOM   641  C  CB  . ALA A 1 101 ? 18.317  -6.398  -5.616  1.00 47.85  ? 101  ALA A CB  1 
ATOM   642  N  N   . LEU A 1 102 ? 18.555  -3.861  -4.062  1.00 47.05  ? 102  LEU A N   1 
ATOM   643  C  CA  . LEU A 1 102 ? 18.847  -3.093  -2.861  1.00 41.39  ? 102  LEU A CA  1 
ATOM   644  C  C   . LEU A 1 102 ? 17.696  -2.158  -2.499  1.00 41.22  ? 102  LEU A C   1 
ATOM   645  O  O   . LEU A 1 102 ? 17.229  -2.146  -1.364  1.00 45.14  ? 102  LEU A O   1 
ATOM   646  C  CB  . LEU A 1 102 ? 20.139  -2.297  -3.046  1.00 38.60  ? 102  LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 102 ? 20.667  -1.544  -1.825  1.00 42.73  ? 102  LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 102 ? 20.800  -2.477  -0.636  1.00 41.79  ? 102  LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 102 ? 21.999  -0.890  -2.150  1.00 52.11  ? 102  LEU A CD2 1 
ATOM   650  N  N   . ASP A 1 103 ? 17.239  -1.387  -3.480  1.00 39.79  ? 103  ASP A N   1 
ATOM   651  C  CA  . ASP A 1 103 ? 16.157  -0.428  -3.286  1.00 43.80  ? 103  ASP A CA  1 
ATOM   652  C  C   . ASP A 1 103 ? 14.884  -1.099  -2.772  1.00 46.40  ? 103  ASP A C   1 
ATOM   653  O  O   . ASP A 1 103 ? 14.332  -0.696  -1.749  1.00 43.20  ? 103  ASP A O   1 
ATOM   654  C  CB  . ASP A 1 103 ? 15.872  0.322   -4.591  1.00 50.74  ? 103  ASP A CB  1 
ATOM   655  C  CG  . ASP A 1 103 ? 14.893  1.467   -4.409  1.00 51.75  ? 103  ASP A CG  1 
ATOM   656  O  OD1 . ASP A 1 103 ? 14.277  1.571   -3.326  1.00 56.50  ? 103  ASP A OD1 1 
ATOM   657  O  OD2 . ASP A 1 103 ? 14.733  2.261   -5.360  1.00 52.08  ? 103  ASP A OD2 1 
ATOM   658  N  N   . TYR A 1 104 ? 14.424  -2.123  -3.484  1.00 44.37  ? 104  TYR A N   1 
ATOM   659  C  CA  . TYR A 1 104 ? 13.196  -2.820  -3.110  1.00 47.40  ? 104  TYR A CA  1 
ATOM   660  C  C   . TYR A 1 104 ? 13.342  -3.651  -1.837  1.00 43.46  ? 104  TYR A C   1 
ATOM   661  O  O   . TYR A 1 104 ? 12.394  -3.776  -1.061  1.00 35.74  ? 104  TYR A O   1 
ATOM   662  C  CB  . TYR A 1 104 ? 12.683  -3.682  -4.267  1.00 42.49  ? 104  TYR A CB  1 
ATOM   663  C  CG  . TYR A 1 104 ? 11.954  -2.886  -5.323  1.00 45.41  ? 104  TYR A CG  1 
ATOM   664  C  CD1 . TYR A 1 104 ? 12.637  -1.992  -6.138  1.00 49.78  ? 104  TYR A CD1 1 
ATOM   665  C  CD2 . TYR A 1 104 ? 10.584  -3.021  -5.501  1.00 39.18  ? 104  TYR A CD2 1 
ATOM   666  C  CE1 . TYR A 1 104 ? 11.977  -1.256  -7.104  1.00 40.97  ? 104  TYR A CE1 1 
ATOM   667  C  CE2 . TYR A 1 104 ? 9.914   -2.292  -6.466  1.00 38.79  ? 104  TYR A CE2 1 
ATOM   668  C  CZ  . TYR A 1 104 ? 10.616  -1.411  -7.265  1.00 38.57  ? 104  TYR A CZ  1 
ATOM   669  O  OH  . TYR A 1 104 ? 9.962   -0.679  -8.229  1.00 45.32  ? 104  TYR A OH  1 
ATOM   670  N  N   . VAL A 1 105 ? 14.527  -4.214  -1.618  1.00 42.01  ? 105  VAL A N   1 
ATOM   671  C  CA  . VAL A 1 105 ? 14.760  -5.018  -0.420  1.00 46.24  ? 105  VAL A CA  1 
ATOM   672  C  C   . VAL A 1 105 ? 14.714  -4.168  0.846   1.00 41.23  ? 105  VAL A C   1 
ATOM   673  O  O   . VAL A 1 105 ? 14.107  -4.559  1.843   1.00 41.05  ? 105  VAL A O   1 
ATOM   674  C  CB  . VAL A 1 105 ? 16.098  -5.789  -0.484  1.00 44.79  ? 105  VAL A CB  1 
ATOM   675  C  CG1 . VAL A 1 105 ? 16.501  -6.272  0.901   1.00 45.88  ? 105  VAL A CG1 1 
ATOM   676  C  CG2 . VAL A 1 105 ? 15.986  -6.959  -1.442  1.00 45.32  ? 105  VAL A CG2 1 
ATOM   677  N  N   . VAL A 1 106 ? 15.353  -3.003  0.797   1.00 39.07  ? 106  VAL A N   1 
ATOM   678  C  CA  . VAL A 1 106 ? 15.378  -2.099  1.943   1.00 38.00  ? 106  VAL A CA  1 
ATOM   679  C  C   . VAL A 1 106 ? 14.028  -1.411  2.152   1.00 41.28  ? 106  VAL A C   1 
ATOM   680  O  O   . VAL A 1 106 ? 13.628  -1.136  3.285   1.00 39.64  ? 106  VAL A O   1 
ATOM   681  C  CB  . VAL A 1 106 ? 16.480  -1.035  1.803   1.00 32.33  ? 106  VAL A CB  1 
ATOM   682  C  CG1 . VAL A 1 106 ? 17.838  -1.701  1.632   1.00 32.89  ? 106  VAL A CG1 1 
ATOM   683  C  CG2 . VAL A 1 106 ? 16.185  -0.108  0.636   1.00 31.64  ? 106  VAL A CG2 1 
ATOM   684  N  N   . SER A 1 107 ? 13.332  -1.136  1.053   1.00 41.03  ? 107  SER A N   1 
ATOM   685  C  CA  . SER A 1 107 ? 11.994  -0.560  1.122   1.00 39.36  ? 107  SER A CA  1 
ATOM   686  C  C   . SER A 1 107 ? 11.035  -1.522  1.816   1.00 48.48  ? 107  SER A C   1 
ATOM   687  O  O   . SER A 1 107 ? 10.237  -1.113  2.657   1.00 46.78  ? 107  SER A O   1 
ATOM   688  C  CB  . SER A 1 107 ? 11.480  -0.206  -0.275  1.00 37.30  ? 107  SER A CB  1 
ATOM   689  O  OG  . SER A 1 107 ? 12.191  0.895   -0.816  1.00 41.43  ? 107  SER A OG  1 
ATOM   690  N  N   . ASN A 1 108 ? 11.120  -2.802  1.461   1.00 51.02  ? 108  ASN A N   1 
ATOM   691  C  CA  . ASN A 1 108 ? 10.312  -3.835  2.104   1.00 45.04  ? 108  ASN A CA  1 
ATOM   692  C  C   . ASN A 1 108 ? 10.667  -3.979  3.582   1.00 45.23  ? 108  ASN A C   1 
ATOM   693  O  O   . ASN A 1 108 ? 9.792   -4.154  4.434   1.00 42.93  ? 108  ASN A O   1 
ATOM   694  C  CB  . ASN A 1 108 ? 10.483  -5.176  1.389   1.00 36.56  ? 108  ASN A CB  1 
ATOM   695  C  CG  . ASN A 1 108 ? 9.468   -6.205  1.833   1.00 40.68  ? 108  ASN A CG  1 
ATOM   696  O  OD1 . ASN A 1 108 ? 8.515   -6.496  1.114   1.00 51.97  ? 108  ASN A OD1 1 
ATOM   697  N  ND2 . ASN A 1 108 ? 9.665   -6.762  3.020   1.00 50.48  ? 108  ASN A ND2 1 
ATOM   698  N  N   . ALA A 1 109 ? 11.960  -3.909  3.878   1.00 41.69  ? 109  ALA A N   1 
ATOM   699  C  CA  . ALA A 1 109 ? 12.434  -3.948  5.254   1.00 42.47  ? 109  ALA A CA  1 
ATOM   700  C  C   . ALA A 1 109 ? 11.791  -2.820  6.054   1.00 49.46  ? 109  ALA A C   1 
ATOM   701  O  O   . ALA A 1 109 ? 11.306  -3.021  7.169   1.00 44.14  ? 109  ALA A O   1 
ATOM   702  C  CB  . ALA A 1 109 ? 13.948  -3.829  5.292   1.00 35.91  ? 109  ALA A CB  1 
ATOM   703  N  N   . SER A 1 110 ? 11.784  -1.631  5.461   1.00 49.19  ? 110  SER A N   1 
ATOM   704  C  CA  . SER A 1 110 ? 11.202  -0.454  6.091   1.00 43.49  ? 110  SER A CA  1 
ATOM   705  C  C   . SER A 1 110 ? 9.730   -0.664  6.447   1.00 47.18  ? 110  SER A C   1 
ATOM   706  O  O   . SER A 1 110 ? 9.323   -0.430  7.585   1.00 52.27  ? 110  SER A O   1 
ATOM   707  C  CB  . SER A 1 110 ? 11.359  0.768   5.184   1.00 41.13  ? 110  SER A CB  1 
ATOM   708  O  OG  . SER A 1 110 ? 12.728  1.042   4.935   1.00 44.36  ? 110  SER A OG  1 
ATOM   709  N  N   . VAL A 1 111 ? 8.936   -1.105  5.476   1.00 41.97  ? 111  VAL A N   1 
ATOM   710  C  CA  . VAL A 1 111 ? 7.508   -1.299  5.701   1.00 38.22  ? 111  VAL A CA  1 
ATOM   711  C  C   . VAL A 1 111 ? 7.241   -2.396  6.727   1.00 48.51  ? 111  VAL A C   1 
ATOM   712  O  O   . VAL A 1 111 ? 6.286   -2.307  7.496   1.00 54.59  ? 111  VAL A O   1 
ATOM   713  C  CB  . VAL A 1 111 ? 6.746   -1.603  4.394   1.00 38.24  ? 111  VAL A CB  1 
ATOM   714  C  CG1 . VAL A 1 111 ? 6.925   -0.462  3.406   1.00 41.97  ? 111  VAL A CG1 1 
ATOM   715  C  CG2 . VAL A 1 111 ? 7.210   -2.920  3.795   1.00 43.67  ? 111  VAL A CG2 1 
ATOM   716  N  N   . MET A 1 112 ? 8.088   -3.422  6.750   1.00 48.17  ? 112  MET A N   1 
ATOM   717  C  CA  . MET A 1 112 ? 7.932   -4.492  7.730   1.00 45.79  ? 112  MET A CA  1 
ATOM   718  C  C   . MET A 1 112 ? 8.300   -4.017  9.132   1.00 48.94  ? 112  MET A C   1 
ATOM   719  O  O   . MET A 1 112 ? 7.716   -4.465  10.123  1.00 47.31  ? 112  MET A O   1 
ATOM   720  C  CB  . MET A 1 112 ? 8.748   -5.727  7.344   1.00 46.68  ? 112  MET A CB  1 
ATOM   721  C  CG  . MET A 1 112 ? 8.096   -6.577  6.269   1.00 50.01  ? 112  MET A CG  1 
ATOM   722  S  SD  . MET A 1 112 ? 8.827   -8.221  6.153   1.00 74.30  ? 112  MET A SD  1 
ATOM   723  C  CE  . MET A 1 112 ? 7.895   -8.919  4.791   1.00 72.78  ? 112  MET A CE  1 
ATOM   724  N  N   . ASN A 1 113 ? 9.269   -3.109  9.214   1.00 48.38  ? 113  ASN A N   1 
ATOM   725  C  CA  . ASN A 1 113 ? 9.607   -2.490  10.491  1.00 47.82  ? 113  ASN A CA  1 
ATOM   726  C  C   . ASN A 1 113 ? 8.428   -1.691  11.031  1.00 51.57  ? 113  ASN A C   1 
ATOM   727  O  O   . ASN A 1 113 ? 8.136   -1.721  12.226  1.00 53.69  ? 113  ASN A O   1 
ATOM   728  C  CB  . ASN A 1 113 ? 10.839  -1.597  10.360  1.00 45.77  ? 113  ASN A CB  1 
ATOM   729  C  CG  . ASN A 1 113 ? 12.130  -2.391  10.286  1.00 51.68  ? 113  ASN A CG  1 
ATOM   730  O  OD1 . ASN A 1 113 ? 12.782  -2.634  11.301  1.00 51.90  ? 113  ASN A OD1 1 
ATOM   731  N  ND2 . ASN A 1 113 ? 12.507  -2.797  9.079   1.00 61.49  ? 113  ASN A ND2 1 
ATOM   732  N  N   . LEU A 1 114 ? 7.755   -0.973  10.140  1.00 45.56  ? 114  LEU A N   1 
ATOM   733  C  CA  . LEU A 1 114 ? 6.537   -0.261  10.497  1.00 46.19  ? 114  LEU A CA  1 
ATOM   734  C  C   . LEU A 1 114 ? 5.487   -1.241  11.009  1.00 49.37  ? 114  LEU A C   1 
ATOM   735  O  O   . LEU A 1 114 ? 4.754   -0.945  11.951  1.00 44.12  ? 114  LEU A O   1 
ATOM   736  C  CB  . LEU A 1 114 ? 5.995   0.510   9.293   1.00 50.56  ? 114  LEU A CB  1 
ATOM   737  C  CG  . LEU A 1 114 ? 6.833   1.703   8.832   1.00 48.88  ? 114  LEU A CG  1 
ATOM   738  C  CD1 . LEU A 1 114 ? 6.238   2.326   7.579   1.00 39.00  ? 114  LEU A CD1 1 
ATOM   739  C  CD2 . LEU A 1 114 ? 6.938   2.728   9.950   1.00 40.43  ? 114  LEU A CD2 1 
ATOM   740  N  N   . LEU A 1 115 ? 5.423   -2.411  10.381  1.00 46.81  ? 115  LEU A N   1 
ATOM   741  C  CA  . LEU A 1 115 ? 4.509   -3.463  10.808  1.00 47.04  ? 115  LEU A CA  1 
ATOM   742  C  C   . LEU A 1 115 ? 4.856   -3.944  12.212  1.00 47.12  ? 115  LEU A C   1 
ATOM   743  O  O   . LEU A 1 115 ? 3.985   -4.054  13.075  1.00 48.16  ? 115  LEU A O   1 
ATOM   744  C  CB  . LEU A 1 115 ? 4.555   -4.644  9.837   1.00 46.60  ? 115  LEU A CB  1 
ATOM   745  C  CG  . LEU A 1 115 ? 4.183   -4.339  8.388   1.00 53.16  ? 115  LEU A CG  1 
ATOM   746  C  CD1 . LEU A 1 115 ? 4.159   -5.620  7.570   1.00 58.35  ? 115  LEU A CD1 1 
ATOM   747  C  CD2 . LEU A 1 115 ? 2.843   -3.630  8.325   1.00 50.79  ? 115  LEU A CD2 1 
ATOM   748  N  N   . ILE A 1 116 ? 6.134   -4.235  12.431  1.00 45.18  ? 116  ILE A N   1 
ATOM   749  C  CA  . ILE A 1 116 ? 6.599   -4.709  13.731  1.00 41.31  ? 116  ILE A CA  1 
ATOM   750  C  C   . ILE A 1 116 ? 6.277   -3.703  14.833  1.00 43.05  ? 116  ILE A C   1 
ATOM   751  O  O   . ILE A 1 116 ? 5.791   -4.071  15.904  1.00 44.00  ? 116  ILE A O   1 
ATOM   752  C  CB  . ILE A 1 116 ? 8.111   -5.000  13.719  1.00 47.98  ? 116  ILE A CB  1 
ATOM   753  C  CG1 . ILE A 1 116 ? 8.424   -6.142  12.747  1.00 54.69  ? 116  ILE A CG1 1 
ATOM   754  C  CG2 . ILE A 1 116 ? 8.598   -5.345  15.117  1.00 46.16  ? 116  ILE A CG2 1 
ATOM   755  C  CD1 . ILE A 1 116 ? 9.900   -6.468  12.630  1.00 51.18  ? 116  ILE A CD1 1 
ATOM   756  N  N   . ILE A 1 117 ? 6.551   -2.431  14.562  1.00 44.96  ? 117  ILE A N   1 
ATOM   757  C  CA  . ILE A 1 117 ? 6.216   -1.358  15.489  1.00 37.51  ? 117  ILE A CA  1 
ATOM   758  C  C   . ILE A 1 117 ? 4.722   -1.371  15.797  1.00 38.65  ? 117  ILE A C   1 
ATOM   759  O  O   . ILE A 1 117 ? 4.313   -1.218  16.945  1.00 44.75  ? 117  ILE A O   1 
ATOM   760  C  CB  . ILE A 1 117 ? 6.605   0.018   14.917  1.00 38.64  ? 117  ILE A CB  1 
ATOM   761  C  CG1 . ILE A 1 117 ? 8.123   0.113   14.740  1.00 43.47  ? 117  ILE A CG1 1 
ATOM   762  C  CG2 . ILE A 1 117 ? 6.092   1.135   15.816  1.00 35.13  ? 117  ILE A CG2 1 
ATOM   763  C  CD1 . ILE A 1 117 ? 8.584   1.419   14.131  1.00 41.62  ? 117  ILE A CD1 1 
ATOM   764  N  N   . SER A 1 118 ? 3.914   -1.565  14.760  1.00 42.29  ? 118  SER A N   1 
ATOM   765  C  CA  . SER A 1 118 ? 2.465   -1.619  14.907  1.00 40.32  ? 118  SER A CA  1 
ATOM   766  C  C   . SER A 1 118 ? 2.045   -2.760  15.825  1.00 38.21  ? 118  SER A C   1 
ATOM   767  O  O   . SER A 1 118 ? 1.260   -2.562  16.752  1.00 45.91  ? 118  SER A O   1 
ATOM   768  C  CB  . SER A 1 118 ? 1.798   -1.778  13.540  1.00 45.92  ? 118  SER A CB  1 
ATOM   769  O  OG  . SER A 1 118 ? 2.061   -0.660  12.710  1.00 55.42  ? 118  SER A OG  1 
ATOM   770  N  N   . PHE A 1 119 ? 2.564   -3.954  15.559  1.00 38.65  ? 119  PHE A N   1 
ATOM   771  C  CA  . PHE A 1 119 ? 2.264   -5.117  16.387  1.00 37.89  ? 119  PHE A CA  1 
ATOM   772  C  C   . PHE A 1 119 ? 2.718   -4.902  17.825  1.00 38.37  ? 119  PHE A C   1 
ATOM   773  O  O   . PHE A 1 119 ? 2.044   -5.317  18.767  1.00 39.29  ? 119  PHE A O   1 
ATOM   774  C  CB  . PHE A 1 119 ? 2.907   -6.377  15.804  1.00 40.30  ? 119  PHE A CB  1 
ATOM   775  C  CG  . PHE A 1 119 ? 2.031   -7.107  14.825  1.00 43.57  ? 119  PHE A CG  1 
ATOM   776  C  CD1 . PHE A 1 119 ? 1.672   -6.522  13.621  1.00 41.10  ? 119  PHE A CD1 1 
ATOM   777  C  CD2 . PHE A 1 119 ? 1.572   -8.384  15.107  1.00 43.33  ? 119  PHE A CD2 1 
ATOM   778  C  CE1 . PHE A 1 119 ? 0.867   -7.195  12.720  1.00 38.77  ? 119  PHE A CE1 1 
ATOM   779  C  CE2 . PHE A 1 119 ? 0.767   -9.061  14.208  1.00 40.15  ? 119  PHE A CE2 1 
ATOM   780  C  CZ  . PHE A 1 119 ? 0.414   -8.466  13.014  1.00 35.10  ? 119  PHE A CZ  1 
ATOM   781  N  N   . ASP A 1 120 ? 3.866   -4.253  17.987  1.00 35.65  ? 120  ASP A N   1 
ATOM   782  C  CA  . ASP A 1 120 ? 4.386   -3.950  19.314  1.00 41.89  ? 120  ASP A CA  1 
ATOM   783  C  C   . ASP A 1 120 ? 3.412   -3.072  20.094  1.00 43.27  ? 120  ASP A C   1 
ATOM   784  O  O   . ASP A 1 120 ? 3.087   -3.366  21.244  1.00 46.12  ? 120  ASP A O   1 
ATOM   785  C  CB  . ASP A 1 120 ? 5.755   -3.274  19.222  1.00 52.99  ? 120  ASP A CB  1 
ATOM   786  C  CG  . ASP A 1 120 ? 6.396   -3.076  20.581  1.00 59.78  ? 120  ASP A CG  1 
ATOM   787  O  OD1 . ASP A 1 120 ? 6.320   -4.001  21.421  1.00 50.53  ? 120  ASP A OD1 1 
ATOM   788  O  OD2 . ASP A 1 120 ? 6.969   -1.991  20.809  1.00 66.28  ? 120  ASP A OD2 1 
ATOM   789  N  N   . ARG A 1 121 ? 2.946   -2.000  19.457  1.00 42.05  ? 121  ARG A N   1 
ATOM   790  C  CA  . ARG A 1 121 ? 1.964   -1.107  20.059  1.00 40.03  ? 121  ARG A CA  1 
ATOM   791  C  C   . ARG A 1 121 ? 0.679   -1.840  20.411  1.00 42.08  ? 121  ARG A C   1 
ATOM   792  O  O   . ARG A 1 121 ? 0.115   -1.638  21.485  1.00 51.03  ? 121  ARG A O   1 
ATOM   793  C  CB  . ARG A 1 121 ? 1.653   0.062   19.125  1.00 38.19  ? 121  ARG A CB  1 
ATOM   794  C  CG  . ARG A 1 121 ? 2.752   1.109   19.062  1.00 39.92  ? 121  ARG A CG  1 
ATOM   795  C  CD  . ARG A 1 121 ? 3.176   1.559   20.450  1.00 43.43  ? 121  ARG A CD  1 
ATOM   796  N  NE  . ARG A 1 121 ? 4.275   0.748   20.970  1.00 57.38  ? 121  ARG A NE  1 
ATOM   797  C  CZ  . ARG A 1 121 ? 4.721   0.814   22.219  1.00 56.66  ? 121  ARG A CZ  1 
ATOM   798  N  NH1 . ARG A 1 121 ? 5.727   0.040   22.612  1.00 45.30  ? 121  ARG A NH1 1 
ATOM   799  N  NH2 . ARG A 1 121 ? 4.152   1.650   23.078  1.00 57.54  ? 121  ARG A NH2 1 
ATOM   800  N  N   . TYR A 1 122 ? 0.224   -2.697  19.505  1.00 46.12  ? 122  TYR A N   1 
ATOM   801  C  CA  . TYR A 1 122 ? -1.006  -3.451  19.717  1.00 47.28  ? 122  TYR A CA  1 
ATOM   802  C  C   . TYR A 1 122 ? -0.939  -4.280  20.994  1.00 40.13  ? 122  TYR A C   1 
ATOM   803  O  O   . TYR A 1 122 ? -1.820  -4.191  21.849  1.00 42.34  ? 122  TYR A O   1 
ATOM   804  C  CB  . TYR A 1 122 ? -1.293  -4.357  18.518  1.00 44.96  ? 122  TYR A CB  1 
ATOM   805  C  CG  . TYR A 1 122 ? -2.542  -5.192  18.670  1.00 42.21  ? 122  TYR A CG  1 
ATOM   806  C  CD1 . TYR A 1 122 ? -3.802  -4.624  18.519  1.00 39.92  ? 122  TYR A CD1 1 
ATOM   807  C  CD2 . TYR A 1 122 ? -2.464  -6.549  18.959  1.00 38.31  ? 122  TYR A CD2 1 
ATOM   808  C  CE1 . TYR A 1 122 ? -4.950  -5.385  18.654  1.00 42.07  ? 122  TYR A CE1 1 
ATOM   809  C  CE2 . TYR A 1 122 ? -3.606  -7.317  19.095  1.00 39.75  ? 122  TYR A CE2 1 
ATOM   810  C  CZ  . TYR A 1 122 ? -4.846  -6.732  18.942  1.00 42.76  ? 122  TYR A CZ  1 
ATOM   811  O  OH  . TYR A 1 122 ? -5.983  -7.496  19.080  1.00 51.11  ? 122  TYR A OH  1 
ATOM   812  N  N   . PHE A 1 123 ? 0.113   -5.084  21.113  1.00 36.54  ? 123  PHE A N   1 
ATOM   813  C  CA  . PHE A 1 123 ? 0.294   -5.947  22.273  1.00 41.42  ? 123  PHE A CA  1 
ATOM   814  C  C   . PHE A 1 123 ? 0.495   -5.148  23.560  1.00 44.85  ? 123  PHE A C   1 
ATOM   815  O  O   . PHE A 1 123 ? -0.062  -5.492  24.605  1.00 38.98  ? 123  PHE A O   1 
ATOM   816  C  CB  . PHE A 1 123 ? 1.467   -6.902  22.047  1.00 43.29  ? 123  PHE A CB  1 
ATOM   817  C  CG  . PHE A 1 123 ? 1.207   -7.945  20.998  1.00 41.75  ? 123  PHE A CG  1 
ATOM   818  C  CD1 . PHE A 1 123 ? -0.018  -8.588  20.926  1.00 38.06  ? 123  PHE A CD1 1 
ATOM   819  C  CD2 . PHE A 1 123 ? 2.188   -8.276  20.078  1.00 43.80  ? 123  PHE A CD2 1 
ATOM   820  C  CE1 . PHE A 1 123 ? -0.257  -9.549  19.960  1.00 48.22  ? 123  PHE A CE1 1 
ATOM   821  C  CE2 . PHE A 1 123 ? 1.955   -9.234  19.107  1.00 45.96  ? 123  PHE A CE2 1 
ATOM   822  C  CZ  . PHE A 1 123 ? 0.731   -9.872  19.048  1.00 49.70  ? 123  PHE A CZ  1 
ATOM   823  N  N   . CYS A 1 124 ? 1.294   -4.086  23.480  1.00 47.05  ? 124  CYS A N   1 
ATOM   824  C  CA  . CYS A 1 124 ? 1.518   -3.207  24.626  1.00 46.17  ? 124  CYS A CA  1 
ATOM   825  C  C   . CYS A 1 124 ? 0.200   -2.659  25.150  1.00 40.55  ? 124  CYS A C   1 
ATOM   826  O  O   . CYS A 1 124 ? -0.052  -2.664  26.353  1.00 34.75  ? 124  CYS A O   1 
ATOM   827  C  CB  . CYS A 1 124 ? 2.446   -2.047  24.252  1.00 36.68  ? 124  CYS A CB  1 
ATOM   828  S  SG  . CYS A 1 124 ? 4.206   -2.450  24.287  1.00 44.68  ? 124  CYS A SG  1 
ATOM   829  N  N   . VAL A 1 125 ? -0.638  -2.189  24.233  1.00 39.98  ? 125  VAL A N   1 
ATOM   830  C  CA  . VAL A 1 125 ? -1.930  -1.615  24.587  1.00 42.76  ? 125  VAL A CA  1 
ATOM   831  C  C   . VAL A 1 125 ? -2.944  -2.674  25.017  1.00 38.09  ? 125  VAL A C   1 
ATOM   832  O  O   . VAL A 1 125 ? -3.690  -2.472  25.976  1.00 35.91  ? 125  VAL A O   1 
ATOM   833  C  CB  . VAL A 1 125 ? -2.522  -0.802  23.415  1.00 36.13  ? 125  VAL A CB  1 
ATOM   834  C  CG1 . VAL A 1 125 ? -3.949  -0.376  23.726  1.00 34.29  ? 125  VAL A CG1 1 
ATOM   835  C  CG2 . VAL A 1 125 ? -1.652  0.405   23.116  1.00 35.54  ? 125  VAL A CG2 1 
ATOM   836  N  N   . THR A 1 126 ? -2.968  -3.799  24.307  1.00 39.33  ? 126  THR A N   1 
ATOM   837  C  CA  . THR A 1 126 ? -3.965  -4.837  24.564  1.00 39.48  ? 126  THR A CA  1 
ATOM   838  C  C   . THR A 1 126 ? -3.614  -5.752  25.736  1.00 35.33  ? 126  THR A C   1 
ATOM   839  O  O   . THR A 1 126 ? -4.506  -6.272  26.405  1.00 35.65  ? 126  THR A O   1 
ATOM   840  C  CB  . THR A 1 126 ? -4.239  -5.703  23.312  1.00 38.01  ? 126  THR A CB  1 
ATOM   841  O  OG1 . THR A 1 126 ? -3.005  -6.222  22.803  1.00 44.19  ? 126  THR A OG1 1 
ATOM   842  C  CG2 . THR A 1 126 ? -4.928  -4.884  22.229  1.00 24.96  ? 126  THR A CG2 1 
ATOM   843  N  N   . LYS A 1 127 ? -2.322  -5.951  25.983  1.00 39.77  ? 127  LYS A N   1 
ATOM   844  C  CA  . LYS A 1 127 ? -1.887  -6.857  27.046  1.00 44.72  ? 127  LYS A CA  1 
ATOM   845  C  C   . LYS A 1 127 ? -0.946  -6.170  28.038  1.00 39.25  ? 127  LYS A C   1 
ATOM   846  O  O   . LYS A 1 127 ? 0.221   -6.543  28.152  1.00 40.90  ? 127  LYS A O   1 
ATOM   847  C  CB  . LYS A 1 127 ? -1.211  -8.094  26.446  1.00 40.16  ? 127  LYS A CB  1 
ATOM   848  C  CG  . LYS A 1 127 ? -2.023  -8.798  25.366  1.00 34.19  ? 127  LYS A CG  1 
ATOM   849  C  CD  . LYS A 1 127 ? -3.345  -9.322  25.906  1.00 41.08  ? 127  LYS A CD  1 
ATOM   850  C  CE  . LYS A 1 127 ? -4.216  -9.889  24.792  1.00 44.00  ? 127  LYS A CE  1 
ATOM   851  N  NZ  . LYS A 1 127 ? -5.555  -10.323 25.284  1.00 52.84  ? 127  LYS A NZ  1 
ATOM   852  N  N   . PRO A 1 128 ? -1.462  -5.175  28.778  1.00 36.22  ? 128  PRO A N   1 
ATOM   853  C  CA  . PRO A 1 128 ? -0.650  -4.302  29.636  1.00 38.85  ? 128  PRO A CA  1 
ATOM   854  C  C   . PRO A 1 128 ? 0.135   -5.053  30.707  1.00 45.66  ? 128  PRO A C   1 
ATOM   855  O  O   . PRO A 1 128 ? 1.226   -4.621  31.079  1.00 45.94  ? 128  PRO A O   1 
ATOM   856  C  CB  . PRO A 1 128 ? -1.692  -3.390  30.298  1.00 28.08  ? 128  PRO A CB  1 
ATOM   857  C  CG  . PRO A 1 128 ? -2.886  -3.465  29.420  1.00 32.11  ? 128  PRO A CG  1 
ATOM   858  C  CD  . PRO A 1 128 ? -2.895  -4.852  28.869  1.00 32.01  ? 128  PRO A CD  1 
ATOM   859  N  N   . LEU A 1 129 ? -0.411  -6.163  31.191  1.00 52.97  ? 129  LEU A N   1 
ATOM   860  C  CA  . LEU A 1 129 ? 0.210   -6.905  32.283  1.00 53.82  ? 129  LEU A CA  1 
ATOM   861  C  C   . LEU A 1 129 ? 1.232   -7.926  31.793  1.00 64.48  ? 129  LEU A C   1 
ATOM   862  O  O   . LEU A 1 129 ? 2.371   -7.960  32.267  1.00 60.51  ? 129  LEU A O   1 
ATOM   863  C  CB  . LEU A 1 129 ? -0.861  -7.613  33.110  1.00 50.16  ? 129  LEU A CB  1 
ATOM   864  C  CG  . LEU A 1 129 ? -2.005  -6.738  33.627  1.00 49.51  ? 129  LEU A CG  1 
ATOM   865  C  CD1 . LEU A 1 129 ? -3.089  -7.592  34.270  1.00 41.17  ? 129  LEU A CD1 1 
ATOM   866  C  CD2 . LEU A 1 129 ? -1.491  -5.689  34.605  1.00 39.82  ? 129  LEU A CD2 1 
ATOM   867  N  N   . THR A 1 130 ? 0.818   -8.755  30.841  1.00 65.12  ? 130  THR A N   1 
ATOM   868  C  CA  . THR A 1 130 ? 1.629   -9.884  30.400  1.00 60.38  ? 130  THR A CA  1 
ATOM   869  C  C   . THR A 1 130 ? 2.713   -9.511  29.395  1.00 55.99  ? 130  THR A C   1 
ATOM   870  O  O   . THR A 1 130 ? 3.863   -9.928  29.528  1.00 58.92  ? 130  THR A O   1 
ATOM   871  C  CB  . THR A 1 130 ? 0.750   -10.986 29.781  1.00 61.51  ? 130  THR A CB  1 
ATOM   872  O  OG1 . THR A 1 130 ? -0.074  -10.419 28.754  1.00 56.67  ? 130  THR A OG1 1 
ATOM   873  C  CG2 . THR A 1 130 ? -0.136  -11.616 30.842  1.00 58.57  ? 130  THR A CG2 1 
ATOM   874  N  N   . TYR A 1 131 ? 2.341   -8.724  28.392  1.00 50.70  ? 131  TYR A N   1 
ATOM   875  C  CA  . TYR A 1 131 ? 3.213   -8.487  27.244  1.00 48.83  ? 131  TYR A CA  1 
ATOM   876  C  C   . TYR A 1 131 ? 4.479   -7.666  27.522  1.00 45.91  ? 131  TYR A C   1 
ATOM   877  O  O   . TYR A 1 131 ? 5.584   -8.110  27.213  1.00 43.99  ? 131  TYR A O   1 
ATOM   878  C  CB  . TYR A 1 131 ? 2.419   -7.865  26.094  1.00 41.43  ? 131  TYR A CB  1 
ATOM   879  C  CG  . TYR A 1 131 ? 3.267   -7.508  24.901  1.00 53.27  ? 131  TYR A CG  1 
ATOM   880  C  CD1 . TYR A 1 131 ? 3.772   -8.495  24.063  1.00 48.67  ? 131  TYR A CD1 1 
ATOM   881  C  CD2 . TYR A 1 131 ? 3.563   -6.183  24.608  1.00 49.51  ? 131  TYR A CD2 1 
ATOM   882  C  CE1 . TYR A 1 131 ? 4.547   -8.172  22.967  1.00 43.87  ? 131  TYR A CE1 1 
ATOM   883  C  CE2 . TYR A 1 131 ? 4.335   -5.850  23.515  1.00 45.28  ? 131  TYR A CE2 1 
ATOM   884  C  CZ  . TYR A 1 131 ? 4.826   -6.847  22.698  1.00 47.63  ? 131  TYR A CZ  1 
ATOM   885  O  OH  . TYR A 1 131 ? 5.596   -6.514  21.607  1.00 53.03  ? 131  TYR A OH  1 
ATOM   886  N  N   . PRO A 1 132 ? 4.324   -6.467  28.103  1.00 47.33  ? 132  PRO A N   1 
ATOM   887  C  CA  . PRO A 1 132 ? 5.462   -5.548  28.227  1.00 43.39  ? 132  PRO A CA  1 
ATOM   888  C  C   . PRO A 1 132 ? 6.692   -6.182  28.877  1.00 46.48  ? 132  PRO A C   1 
ATOM   889  O  O   . PRO A 1 132 ? 7.814   -5.765  28.587  1.00 46.89  ? 132  PRO A O   1 
ATOM   890  C  CB  . PRO A 1 132 ? 4.908   -4.429  29.112  1.00 41.39  ? 132  PRO A CB  1 
ATOM   891  C  CG  . PRO A 1 132 ? 3.437   -4.472  28.896  1.00 39.88  ? 132  PRO A CG  1 
ATOM   892  C  CD  . PRO A 1 132 ? 3.109   -5.923  28.734  1.00 47.29  ? 132  PRO A CD  1 
ATOM   893  N  N   . VAL A 1 133 ? 6.483   -7.178  29.733  1.00 50.82  ? 133  VAL A N   1 
ATOM   894  C  CA  . VAL A 1 133 ? 7.584   -7.813  30.450  1.00 52.49  ? 133  VAL A CA  1 
ATOM   895  C  C   . VAL A 1 133 ? 8.488   -8.624  29.521  1.00 49.67  ? 133  VAL A C   1 
ATOM   896  O  O   . VAL A 1 133 ? 9.685   -8.755  29.773  1.00 39.11  ? 133  VAL A O   1 
ATOM   897  C  CB  . VAL A 1 133 ? 7.078   -8.727  31.589  1.00 45.35  ? 133  VAL A CB  1 
ATOM   898  C  CG1 . VAL A 1 133 ? 6.017   -8.011  32.409  1.00 56.18  ? 133  VAL A CG1 1 
ATOM   899  C  CG2 . VAL A 1 133 ? 6.527   -10.027 31.030  1.00 46.58  ? 133  VAL A CG2 1 
ATOM   900  N  N   . LYS A 1 134 ? 7.913   -9.159  28.448  1.00 45.51  ? 134  LYS A N   1 
ATOM   901  C  CA  . LYS A 1 134 ? 8.656   -10.034 27.544  1.00 51.43  ? 134  LYS A CA  1 
ATOM   902  C  C   . LYS A 1 134 ? 9.270   -9.291  26.354  1.00 51.54  ? 134  LYS A C   1 
ATOM   903  O  O   . LYS A 1 134 ? 9.794   -9.907  25.427  1.00 44.07  ? 134  LYS A O   1 
ATOM   904  C  CB  . LYS A 1 134 ? 7.780   -11.207 27.076  1.00 51.05  ? 134  LYS A CB  1 
ATOM   905  C  CG  . LYS A 1 134 ? 6.429   -10.815 26.498  1.00 44.60  ? 134  LYS A CG  1 
ATOM   906  C  CD  . LYS A 1 134 ? 5.601   -12.046 26.154  1.00 40.12  ? 134  LYS A CD  1 
ATOM   907  C  CE  . LYS A 1 134 ? 4.241   -11.663 25.588  1.00 55.39  ? 134  LYS A CE  1 
ATOM   908  N  NZ  . LYS A 1 134 ? 3.434   -12.852 25.192  1.00 60.41  ? 134  LYS A NZ  1 
ATOM   909  N  N   . ARG A 1 135 ? 9.208   -7.963  26.393  1.00 54.21  ? 135  ARG A N   1 
ATOM   910  C  CA  . ARG A 1 135 ? 9.852   -7.132  25.379  1.00 51.10  ? 135  ARG A CA  1 
ATOM   911  C  C   . ARG A 1 135 ? 11.318  -6.906  25.736  1.00 53.73  ? 135  ARG A C   1 
ATOM   912  O  O   . ARG A 1 135 ? 11.636  -6.046  26.556  1.00 57.78  ? 135  ARG A O   1 
ATOM   913  C  CB  . ARG A 1 135 ? 9.138   -5.783  25.241  1.00 41.98  ? 135  ARG A CB  1 
ATOM   914  C  CG  . ARG A 1 135 ? 7.627   -5.873  25.154  1.00 43.59  ? 135  ARG A CG  1 
ATOM   915  C  CD  . ARG A 1 135 ? 7.020   -4.548  24.720  1.00 53.19  ? 135  ARG A CD  1 
ATOM   916  N  NE  . ARG A 1 135 ? 7.805   -3.397  25.161  1.00 59.43  ? 135  ARG A NE  1 
ATOM   917  C  CZ  . ARG A 1 135 ? 8.446   -2.568  24.340  1.00 50.64  ? 135  ARG A CZ  1 
ATOM   918  N  NH1 . ARG A 1 135 ? 8.397   -2.754  23.027  1.00 42.03  ? 135  ARG A NH1 1 
ATOM   919  N  NH2 . ARG A 1 135 ? 9.133   -1.547  24.832  1.00 49.42  ? 135  ARG A NH2 1 
ATOM   920  N  N   . THR A 1 136 ? 12.207  -7.685  25.127  1.00 53.16  ? 136  THR A N   1 
ATOM   921  C  CA  . THR A 1 136 ? 13.633  -7.582  25.421  1.00 62.05  ? 136  THR A CA  1 
ATOM   922  C  C   . THR A 1 136 ? 14.438  -7.169  24.191  1.00 55.08  ? 136  THR A C   1 
ATOM   923  O  O   . THR A 1 136 ? 13.922  -7.172  23.073  1.00 59.71  ? 136  THR A O   1 
ATOM   924  C  CB  . THR A 1 136 ? 14.192  -8.910  25.971  1.00 57.56  ? 136  THR A CB  1 
ATOM   925  O  OG1 . THR A 1 136 ? 14.197  -9.901  24.935  1.00 53.96  ? 136  THR A OG1 1 
ATOM   926  C  CG2 . THR A 1 136 ? 13.345  -9.401  27.133  1.00 48.82  ? 136  THR A CG2 1 
ATOM   927  N  N   . THR A 1 137 ? 15.702  -6.811  24.404  1.00 53.46  ? 137  THR A N   1 
ATOM   928  C  CA  . THR A 1 137 ? 16.591  -6.456  23.303  1.00 54.33  ? 137  THR A CA  1 
ATOM   929  C  C   . THR A 1 137 ? 16.773  -7.640  22.359  1.00 60.69  ? 137  THR A C   1 
ATOM   930  O  O   . THR A 1 137 ? 16.961  -7.462  21.157  1.00 60.80  ? 137  THR A O   1 
ATOM   931  C  CB  . THR A 1 137 ? 17.975  -5.989  23.804  1.00 53.82  ? 137  THR A CB  1 
ATOM   932  O  OG1 . THR A 1 137 ? 18.573  -7.015  24.607  1.00 54.99  ? 137  THR A OG1 1 
ATOM   933  C  CG2 . THR A 1 137 ? 17.848  -4.713  24.627  1.00 53.19  ? 137  THR A CG2 1 
ATOM   934  N  N   . LYS A 1 138 ? 16.707  -8.849  22.909  1.00 60.40  ? 138  LYS A N   1 
ATOM   935  C  CA  . LYS A 1 138 ? 16.878  -10.059 22.112  1.00 60.67  ? 138  LYS A CA  1 
ATOM   936  C  C   . LYS A 1 138 ? 15.720  -10.261 21.139  1.00 59.11  ? 138  LYS A C   1 
ATOM   937  O  O   . LYS A 1 138 ? 15.936  -10.445 19.942  1.00 61.54  ? 138  LYS A O   1 
ATOM   938  C  CB  . LYS A 1 138 ? 17.039  -11.291 23.007  1.00 66.99  ? 138  LYS A CB  1 
ATOM   939  C  CG  . LYS A 1 138 ? 17.320  -12.570 22.231  1.00 83.05  ? 138  LYS A CG  1 
ATOM   940  C  CD  . LYS A 1 138 ? 17.577  -13.746 23.158  1.00 86.39  ? 138  LYS A CD  1 
ATOM   941  C  CE  . LYS A 1 138 ? 17.948  -14.996 22.371  1.00 92.11  ? 138  LYS A CE  1 
ATOM   942  N  NZ  . LYS A 1 138 ? 18.228  -16.154 23.264  1.00 99.83  ? 138  LYS A NZ  1 
ATOM   943  N  N   . MET A 1 139 ? 14.495  -10.233 21.654  1.00 59.87  ? 139  MET A N   1 
ATOM   944  C  CA  . MET A 1 139 ? 13.313  -10.358 20.806  1.00 58.26  ? 139  MET A CA  1 
ATOM   945  C  C   . MET A 1 139 ? 13.341  -9.318  19.694  1.00 56.98  ? 139  MET A C   1 
ATOM   946  O  O   . MET A 1 139 ? 13.008  -9.612  18.545  1.00 57.81  ? 139  MET A O   1 
ATOM   947  C  CB  . MET A 1 139 ? 12.031  -10.216 21.630  1.00 56.65  ? 139  MET A CB  1 
ATOM   948  C  CG  . MET A 1 139 ? 11.590  -11.499 22.314  1.00 81.06  ? 139  MET A CG  1 
ATOM   949  S  SD  . MET A 1 139 ? 11.150  -12.793 21.135  1.00 108.91 ? 139  MET A SD  1 
ATOM   950  C  CE  . MET A 1 139 ? 9.797   -12.011 20.262  1.00 69.00  ? 139  MET A CE  1 
ATOM   951  N  N   . ALA A 1 140 ? 13.747  -8.103  20.045  1.00 55.31  ? 140  ALA A N   1 
ATOM   952  C  CA  . ALA A 1 140 ? 13.845  -7.016  19.080  1.00 56.67  ? 140  ALA A CA  1 
ATOM   953  C  C   . ALA A 1 140 ? 14.793  -7.371  17.935  1.00 60.13  ? 140  ALA A C   1 
ATOM   954  O  O   . ALA A 1 140 ? 14.389  -7.399  16.772  1.00 56.50  ? 140  ALA A O   1 
ATOM   955  C  CB  . ALA A 1 140 ? 14.296  -5.736  19.771  1.00 50.77  ? 140  ALA A CB  1 
ATOM   956  N  N   . GLY A 1 141 ? 16.048  -7.651  18.277  1.00 58.46  ? 141  GLY A N   1 
ATOM   957  C  CA  . GLY A 1 141 ? 17.062  -7.997  17.296  1.00 47.30  ? 141  GLY A CA  1 
ATOM   958  C  C   . GLY A 1 141 ? 16.653  -9.147  16.397  1.00 52.20  ? 141  GLY A C   1 
ATOM   959  O  O   . GLY A 1 141 ? 17.027  -9.193  15.225  1.00 55.69  ? 141  GLY A O   1 
ATOM   960  N  N   . MET A 1 142 ? 15.881  -10.078 16.948  1.00 46.77  ? 142  MET A N   1 
ATOM   961  C  CA  . MET A 1 142 ? 15.407  -11.234 16.192  1.00 52.41  ? 142  MET A CA  1 
ATOM   962  C  C   . MET A 1 142 ? 14.290  -10.860 15.219  1.00 55.45  ? 142  MET A C   1 
ATOM   963  O  O   . MET A 1 142 ? 14.259  -11.339 14.083  1.00 53.03  ? 142  MET A O   1 
ATOM   964  C  CB  . MET A 1 142 ? 14.940  -12.343 17.139  1.00 57.68  ? 142  MET A CB  1 
ATOM   965  C  CG  . MET A 1 142 ? 14.191  -13.478 16.457  1.00 63.36  ? 142  MET A CG  1 
ATOM   966  S  SD  . MET A 1 142 ? 14.091  -14.952 17.494  1.00 88.29  ? 142  MET A SD  1 
ATOM   967  C  CE  . MET A 1 142 ? 13.645  -14.230 19.071  1.00 78.73  ? 142  MET A CE  1 
ATOM   968  N  N   . MET A 1 143 ? 13.374  -10.007 15.670  1.00 48.18  ? 143  MET A N   1 
ATOM   969  C  CA  . MET A 1 143 ? 12.302  -9.521  14.809  1.00 48.78  ? 143  MET A CA  1 
ATOM   970  C  C   . MET A 1 143 ? 12.867  -8.668  13.678  1.00 59.84  ? 143  MET A C   1 
ATOM   971  O  O   . MET A 1 143 ? 12.409  -8.746  12.536  1.00 62.07  ? 143  MET A O   1 
ATOM   972  C  CB  . MET A 1 143 ? 11.276  -8.724  15.616  1.00 50.32  ? 143  MET A CB  1 
ATOM   973  C  CG  . MET A 1 143 ? 10.495  -9.568  16.608  1.00 64.98  ? 143  MET A CG  1 
ATOM   974  S  SD  . MET A 1 143 ? 9.465   -10.808 15.803  1.00 61.42  ? 143  MET A SD  1 
ATOM   975  C  CE  . MET A 1 143 ? 8.100   -9.799  15.231  1.00 70.27  ? 143  MET A CE  1 
ATOM   976  N  N   . ILE A 1 144 ? 13.865  -7.852  14.004  1.00 55.35  ? 144  ILE A N   1 
ATOM   977  C  CA  . ILE A 1 144 ? 14.557  -7.054  13.000  1.00 51.71  ? 144  ILE A CA  1 
ATOM   978  C  C   . ILE A 1 144 ? 15.264  -7.980  12.021  1.00 48.40  ? 144  ILE A C   1 
ATOM   979  O  O   . ILE A 1 144 ? 15.179  -7.802  10.804  1.00 39.26  ? 144  ILE A O   1 
ATOM   980  C  CB  . ILE A 1 144 ? 15.584  -6.100  13.645  1.00 45.61  ? 144  ILE A CB  1 
ATOM   981  C  CG1 . ILE A 1 144 ? 14.890  -5.166  14.641  1.00 51.16  ? 144  ILE A CG1 1 
ATOM   982  C  CG2 . ILE A 1 144 ? 16.316  -5.297  12.580  1.00 45.82  ? 144  ILE A CG2 1 
ATOM   983  C  CD1 . ILE A 1 144 ? 15.843  -4.303  15.451  1.00 41.68  ? 144  ILE A CD1 1 
ATOM   984  N  N   . ALA A 1 145 ? 15.955  -8.978  12.562  1.00 46.04  ? 145  ALA A N   1 
ATOM   985  C  CA  . ALA A 1 145 ? 16.648  -9.963  11.743  1.00 47.88  ? 145  ALA A CA  1 
ATOM   986  C  C   . ALA A 1 145 ? 15.682  -10.622 10.764  1.00 47.68  ? 145  ALA A C   1 
ATOM   987  O  O   . ALA A 1 145 ? 15.959  -10.713 9.568   1.00 49.77  ? 145  ALA A O   1 
ATOM   988  C  CB  . ALA A 1 145 ? 17.311  -11.010 12.623  1.00 39.14  ? 145  ALA A CB  1 
ATOM   989  N  N   . ALA A 1 146 ? 14.543  -11.074 11.276  1.00 47.89  ? 146  ALA A N   1 
ATOM   990  C  CA  . ALA A 1 146 ? 13.534  -11.707 10.436  1.00 47.61  ? 146  ALA A CA  1 
ATOM   991  C  C   . ALA A 1 146 ? 13.065  -10.757 9.340   1.00 50.31  ? 146  ALA A C   1 
ATOM   992  O  O   . ALA A 1 146 ? 12.889  -11.161 8.189   1.00 46.49  ? 146  ALA A O   1 
ATOM   993  C  CB  . ALA A 1 146 ? 12.355  -12.182 11.276  1.00 44.03  ? 146  ALA A CB  1 
ATOM   994  N  N   . ALA A 1 147 ? 12.871  -9.492  9.704   1.00 49.36  ? 147  ALA A N   1 
ATOM   995  C  CA  . ALA A 1 147 ? 12.390  -8.487  8.760   1.00 48.44  ? 147  ALA A CA  1 
ATOM   996  C  C   . ALA A 1 147 ? 13.324  -8.342  7.564   1.00 50.75  ? 147  ALA A C   1 
ATOM   997  O  O   . ALA A 1 147 ? 12.903  -8.478  6.417   1.00 51.32  ? 147  ALA A O   1 
ATOM   998  C  CB  . ALA A 1 147 ? 12.208  -7.149  9.454   1.00 41.36  ? 147  ALA A CB  1 
ATOM   999  N  N   . TRP A 1 148 ? 14.593  -8.064  7.843   1.00 49.44  ? 148  TRP A N   1 
ATOM   1000 C  CA  . TRP A 1 148 ? 15.596  -7.912  6.798   1.00 46.90  ? 148  TRP A CA  1 
ATOM   1001 C  C   . TRP A 1 148 ? 15.743  -9.181  5.966   1.00 51.38  ? 148  TRP A C   1 
ATOM   1002 O  O   . TRP A 1 148 ? 15.619  -9.149  4.742   1.00 52.86  ? 148  TRP A O   1 
ATOM   1003 C  CB  . TRP A 1 148 ? 16.944  -7.527  7.408   1.00 39.00  ? 148  TRP A CB  1 
ATOM   1004 C  CG  . TRP A 1 148 ? 16.995  -6.113  7.887   1.00 45.23  ? 148  TRP A CG  1 
ATOM   1005 C  CD1 . TRP A 1 148 ? 16.710  -5.659  9.143   1.00 50.99  ? 148  TRP A CD1 1 
ATOM   1006 C  CD2 . TRP A 1 148 ? 17.345  -4.958  7.114   1.00 49.01  ? 148  TRP A CD2 1 
ATOM   1007 N  NE1 . TRP A 1 148 ? 16.865  -4.294  9.200   1.00 54.38  ? 148  TRP A NE1 1 
ATOM   1008 C  CE2 . TRP A 1 148 ? 17.255  -3.840  7.967   1.00 45.81  ? 148  TRP A CE2 1 
ATOM   1009 C  CE3 . TRP A 1 148 ? 17.730  -4.763  5.783   1.00 41.40  ? 148  TRP A CE3 1 
ATOM   1010 C  CZ2 . TRP A 1 148 ? 17.536  -2.545  7.533   1.00 42.34  ? 148  TRP A CZ2 1 
ATOM   1011 C  CZ3 . TRP A 1 148 ? 18.008  -3.478  5.353   1.00 38.69  ? 148  TRP A CZ3 1 
ATOM   1012 C  CH2 . TRP A 1 148 ? 17.910  -2.385  6.225   1.00 44.95  ? 148  TRP A CH2 1 
ATOM   1013 N  N   . VAL A 1 149 ? 16.008  -10.295 6.639   1.00 45.73  ? 149  VAL A N   1 
ATOM   1014 C  CA  . VAL A 1 149 ? 16.201  -11.570 5.960   1.00 42.57  ? 149  VAL A CA  1 
ATOM   1015 C  C   . VAL A 1 149 ? 15.001  -11.926 5.089   1.00 43.56  ? 149  VAL A C   1 
ATOM   1016 O  O   . VAL A 1 149 ? 15.157  -12.308 3.928   1.00 50.08  ? 149  VAL A O   1 
ATOM   1017 C  CB  . VAL A 1 149 ? 16.474  -12.712 6.961   1.00 39.57  ? 149  VAL A CB  1 
ATOM   1018 C  CG1 . VAL A 1 149 ? 16.511  -14.051 6.243   1.00 34.33  ? 149  VAL A CG1 1 
ATOM   1019 C  CG2 . VAL A 1 149 ? 17.778  -12.463 7.702   1.00 34.12  ? 149  VAL A CG2 1 
ATOM   1020 N  N   . LEU A 1 150 ? 13.803  -11.791 5.647   1.00 43.27  ? 150  LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 150 ? 12.589  -12.142 4.917   1.00 50.30  ? 150  LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 150 ? 12.401  -11.253 3.690   1.00 46.25  ? 150  LEU A C   1 
ATOM   1023 O  O   . LEU A 1 150 ? 12.127  -11.743 2.596   1.00 48.85  ? 150  LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 150 ? 11.364  -12.067 5.831   1.00 59.14  ? 150  LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 150 ? 10.153  -12.912 5.427   1.00 62.23  ? 150  LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 150 ? 10.557  -14.369 5.229   1.00 42.18  ? 150  LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 150 ? 9.040   -12.790 6.463   1.00 52.57  ? 150  LEU A CD2 1 
ATOM   1028 N  N   . SER A 1 151 ? 12.553  -9.945  3.879   1.00 48.38  ? 151  SER A N   1 
ATOM   1029 C  CA  . SER A 1 151 ? 12.456  -8.991  2.780   1.00 50.77  ? 151  SER A CA  1 
ATOM   1030 C  C   . SER A 1 151 ? 13.402  -9.381  1.649   1.00 51.95  ? 151  SER A C   1 
ATOM   1031 O  O   . SER A 1 151 ? 12.983  -9.552  0.503   1.00 51.24  ? 151  SER A O   1 
ATOM   1032 C  CB  . SER A 1 151 ? 12.787  -7.578  3.270   1.00 53.62  ? 151  SER A CB  1 
ATOM   1033 O  OG  . SER A 1 151 ? 11.923  -7.181  4.322   1.00 58.56  ? 151  SER A OG  1 
ATOM   1034 N  N   . PHE A 1 152 ? 14.681  -9.518  1.985   1.00 50.03  ? 152  PHE A N   1 
ATOM   1035 C  CA  . PHE A 1 152 ? 15.702  -9.930  1.028   1.00 47.40  ? 152  PHE A CA  1 
ATOM   1036 C  C   . PHE A 1 152 ? 15.276  -11.173 0.256   1.00 46.94  ? 152  PHE A C   1 
ATOM   1037 O  O   . PHE A 1 152 ? 15.278  -11.180 -0.975  1.00 50.80  ? 152  PHE A O   1 
ATOM   1038 C  CB  . PHE A 1 152 ? 17.028  -10.188 1.748   1.00 50.02  ? 152  PHE A CB  1 
ATOM   1039 C  CG  . PHE A 1 152 ? 18.080  -10.817 0.882   1.00 47.12  ? 152  PHE A CG  1 
ATOM   1040 C  CD1 . PHE A 1 152 ? 18.936  -10.032 0.129   1.00 52.41  ? 152  PHE A CD1 1 
ATOM   1041 C  CD2 . PHE A 1 152 ? 18.219  -12.194 0.827   1.00 50.22  ? 152  PHE A CD2 1 
ATOM   1042 C  CE1 . PHE A 1 152 ? 19.910  -10.607 -0.667  1.00 51.83  ? 152  PHE A CE1 1 
ATOM   1043 C  CE2 . PHE A 1 152 ? 19.188  -12.776 0.033   1.00 56.47  ? 152  PHE A CE2 1 
ATOM   1044 C  CZ  . PHE A 1 152 ? 20.036  -11.982 -0.716  1.00 46.03  ? 152  PHE A CZ  1 
ATOM   1045 N  N   . ILE A 1 153 ? 14.909  -12.219 0.990   1.00 45.13  ? 153  ILE A N   1 
ATOM   1046 C  CA  . ILE A 1 153 ? 14.494  -13.480 0.382   1.00 49.73  ? 153  ILE A CA  1 
ATOM   1047 C  C   . ILE A 1 153 ? 13.395  -13.283 -0.662  1.00 47.77  ? 153  ILE A C   1 
ATOM   1048 O  O   . ILE A 1 153 ? 13.377  -13.959 -1.692  1.00 43.41  ? 153  ILE A O   1 
ATOM   1049 C  CB  . ILE A 1 153 ? 14.018  -14.490 1.445   1.00 43.95  ? 153  ILE A CB  1 
ATOM   1050 C  CG1 . ILE A 1 153 ? 15.179  -14.882 2.361   1.00 44.29  ? 153  ILE A CG1 1 
ATOM   1051 C  CG2 . ILE A 1 153 ? 13.423  -15.723 0.782   1.00 38.78  ? 153  ILE A CG2 1 
ATOM   1052 C  CD1 . ILE A 1 153 ? 14.786  -15.819 3.478   1.00 42.73  ? 153  ILE A CD1 1 
ATOM   1053 N  N   . LEU A 1 154 ? 12.486  -12.349 -0.399  1.00 46.66  ? 154  LEU A N   1 
ATOM   1054 C  CA  . LEU A 1 154 ? 11.375  -12.090 -1.310  1.00 46.68  ? 154  LEU A CA  1 
ATOM   1055 C  C   . LEU A 1 154 ? 11.824  -11.390 -2.590  1.00 55.00  ? 154  LEU A C   1 
ATOM   1056 O  O   . LEU A 1 154 ? 11.590  -11.885 -3.693  1.00 70.20  ? 154  LEU A O   1 
ATOM   1057 C  CB  . LEU A 1 154 ? 10.288  -11.260 -0.621  1.00 49.11  ? 154  LEU A CB  1 
ATOM   1058 C  CG  . LEU A 1 154 ? 9.437   -11.970 0.434   1.00 45.07  ? 154  LEU A CG  1 
ATOM   1059 C  CD1 . LEU A 1 154 ? 8.374   -11.031 0.986   1.00 50.35  ? 154  LEU A CD1 1 
ATOM   1060 C  CD2 . LEU A 1 154 ? 8.796   -13.220 -0.149  1.00 31.64  ? 154  LEU A CD2 1 
ATOM   1061 N  N   . TRP A 1 155 ? 12.477  -10.244 -2.434  1.00 54.90  ? 155  TRP A N   1 
ATOM   1062 C  CA  . TRP A 1 155 ? 12.828  -9.393  -3.567  1.00 50.35  ? 155  TRP A CA  1 
ATOM   1063 C  C   . TRP A 1 155 ? 14.101  -9.810  -4.308  1.00 52.79  ? 155  TRP A C   1 
ATOM   1064 O  O   . TRP A 1 155 ? 14.075  -10.033 -5.519  1.00 50.27  ? 155  TRP A O   1 
ATOM   1065 C  CB  . TRP A 1 155 ? 12.940  -7.936  -3.116  1.00 45.31  ? 155  TRP A CB  1 
ATOM   1066 C  CG  . TRP A 1 155 ? 11.623  -7.316  -2.752  1.00 48.35  ? 155  TRP A CG  1 
ATOM   1067 C  CD1 . TRP A 1 155 ? 11.173  -7.017  -1.499  1.00 48.08  ? 155  TRP A CD1 1 
ATOM   1068 C  CD2 . TRP A 1 155 ? 10.590  -6.922  -3.659  1.00 56.02  ? 155  TRP A CD2 1 
ATOM   1069 N  NE1 . TRP A 1 155 ? 9.920   -6.455  -1.569  1.00 52.50  ? 155  TRP A NE1 1 
ATOM   1070 C  CE2 . TRP A 1 155 ? 9.536   -6.384  -2.883  1.00 49.33  ? 155  TRP A CE2 1 
ATOM   1071 C  CE3 . TRP A 1 155 ? 10.444  -6.964  -5.049  1.00 52.70  ? 155  TRP A CE3 1 
ATOM   1072 C  CZ2 . TRP A 1 155 ? 8.361   -5.898  -3.453  1.00 50.15  ? 155  TRP A CZ2 1 
ATOM   1073 C  CZ3 . TRP A 1 155 ? 9.277   -6.482  -5.614  1.00 49.02  ? 155  TRP A CZ3 1 
ATOM   1074 C  CH2 . TRP A 1 155 ? 8.251   -5.955  -4.816  1.00 48.72  ? 155  TRP A CH2 1 
ATOM   1075 N  N   . ALA A 1 156 ? 15.210  -9.899  -3.579  1.00 48.60  ? 156  ALA A N   1 
ATOM   1076 C  CA  . ALA A 1 156 ? 16.517  -10.154 -4.185  1.00 51.38  ? 156  ALA A CA  1 
ATOM   1077 C  C   . ALA A 1 156 ? 16.522  -11.255 -5.254  1.00 64.98  ? 156  ALA A C   1 
ATOM   1078 O  O   . ALA A 1 156 ? 16.844  -10.989 -6.414  1.00 57.12  ? 156  ALA A O   1 
ATOM   1079 C  CB  . ALA A 1 156 ? 17.563  -10.438 -3.108  1.00 43.59  ? 156  ALA A CB  1 
ATOM   1080 N  N   . PRO A 1 157 ? 16.170  -12.496 -4.871  1.00 69.32  ? 157  PRO A N   1 
ATOM   1081 C  CA  . PRO A 1 157 ? 16.222  -13.600 -5.838  1.00 65.31  ? 157  PRO A CA  1 
ATOM   1082 C  C   . PRO A 1 157 ? 15.416  -13.303 -7.097  1.00 59.45  ? 157  PRO A C   1 
ATOM   1083 O  O   . PRO A 1 157 ? 15.944  -13.405 -8.205  1.00 52.20  ? 157  PRO A O   1 
ATOM   1084 C  CB  . PRO A 1 157 ? 15.587  -14.764 -5.071  1.00 53.99  ? 157  PRO A CB  1 
ATOM   1085 C  CG  . PRO A 1 157 ? 15.825  -14.437 -3.642  1.00 57.36  ? 157  PRO A CG  1 
ATOM   1086 C  CD  . PRO A 1 157 ? 15.688  -12.947 -3.555  1.00 54.70  ? 157  PRO A CD  1 
ATOM   1087 N  N   . ALA A 1 158 ? 14.151  -12.939 -6.916  1.00 62.77  ? 158  ALA A N   1 
ATOM   1088 C  CA  . ALA A 1 158 ? 13.261  -12.646 -8.034  1.00 56.77  ? 158  ALA A CA  1 
ATOM   1089 C  C   . ALA A 1 158 ? 13.828  -11.569 -8.955  1.00 56.87  ? 158  ALA A C   1 
ATOM   1090 O  O   . ALA A 1 158 ? 13.854  -11.737 -10.171 1.00 61.54  ? 158  ALA A O   1 
ATOM   1091 C  CB  . ALA A 1 158 ? 11.888  -12.235 -7.522  1.00 54.01  ? 158  ALA A CB  1 
ATOM   1092 N  N   . ILE A 1 159 ? 14.290  -10.470 -8.369  1.00 58.20  ? 159  ILE A N   1 
ATOM   1093 C  CA  . ILE A 1 159 ? 14.776  -9.328  -9.139  1.00 52.55  ? 159  ILE A CA  1 
ATOM   1094 C  C   . ILE A 1 159 ? 16.022  -9.641  -9.969  1.00 53.00  ? 159  ILE A C   1 
ATOM   1095 O  O   . ILE A 1 159 ? 16.105  -9.276  -11.142 1.00 56.39  ? 159  ILE A O   1 
ATOM   1096 C  CB  . ILE A 1 159 ? 15.061  -8.121  -8.225  1.00 54.13  ? 159  ILE A CB  1 
ATOM   1097 C  CG1 . ILE A 1 159 ? 13.753  -7.600  -7.624  1.00 53.05  ? 159  ILE A CG1 1 
ATOM   1098 C  CG2 . ILE A 1 159 ? 15.784  -7.024  -8.999  1.00 48.80  ? 159  ILE A CG2 1 
ATOM   1099 C  CD1 . ILE A 1 159 ? 13.929  -6.440  -6.667  1.00 53.55  ? 159  ILE A CD1 1 
ATOM   1100 N  N   . LEU A 1 160 ? 16.985  -10.321 -9.357  1.00 57.88  ? 160  LEU A N   1 
ATOM   1101 C  CA  . LEU A 1 160 ? 18.262  -10.605 -10.009 1.00 55.38  ? 160  LEU A CA  1 
ATOM   1102 C  C   . LEU A 1 160 ? 18.191  -11.778 -10.977 1.00 53.33  ? 160  LEU A C   1 
ATOM   1103 O  O   . LEU A 1 160 ? 18.808  -11.753 -12.042 1.00 63.58  ? 160  LEU A O   1 
ATOM   1104 C  CB  . LEU A 1 160 ? 19.349  -10.886 -8.967  1.00 58.37  ? 160  LEU A CB  1 
ATOM   1105 C  CG  . LEU A 1 160 ? 19.940  -9.695  -8.214  1.00 62.85  ? 160  LEU A CG  1 
ATOM   1106 C  CD1 . LEU A 1 160 ? 18.844  -8.897  -7.540  1.00 65.64  ? 160  LEU A CD1 1 
ATOM   1107 C  CD2 . LEU A 1 160 ? 20.970  -10.165 -7.195  1.00 59.38  ? 160  LEU A CD2 1 
ATOM   1108 N  N   . PHE A 1 161 ? 17.434  -12.803 -10.604 1.00 57.09  ? 161  PHE A N   1 
ATOM   1109 C  CA  . PHE A 1 161 ? 17.465  -14.069 -11.326 1.00 59.05  ? 161  PHE A CA  1 
ATOM   1110 C  C   . PHE A 1 161 ? 16.253  -14.308 -12.227 1.00 57.30  ? 161  PHE A C   1 
ATOM   1111 O  O   . PHE A 1 161 ? 16.166  -15.344 -12.885 1.00 61.15  ? 161  PHE A O   1 
ATOM   1112 C  CB  . PHE A 1 161 ? 17.615  -15.228 -10.338 1.00 62.66  ? 161  PHE A CB  1 
ATOM   1113 C  CG  . PHE A 1 161 ? 18.878  -15.173 -9.525  1.00 63.41  ? 161  PHE A CG  1 
ATOM   1114 C  CD1 . PHE A 1 161 ? 20.083  -14.827 -10.115 1.00 62.50  ? 161  PHE A CD1 1 
ATOM   1115 C  CD2 . PHE A 1 161 ? 18.859  -15.459 -8.169  1.00 70.64  ? 161  PHE A CD2 1 
ATOM   1116 C  CE1 . PHE A 1 161 ? 21.247  -14.774 -9.368  1.00 68.74  ? 161  PHE A CE1 1 
ATOM   1117 C  CE2 . PHE A 1 161 ? 20.018  -15.407 -7.419  1.00 76.72  ? 161  PHE A CE2 1 
ATOM   1118 C  CZ  . PHE A 1 161 ? 21.213  -15.064 -8.019  1.00 75.91  ? 161  PHE A CZ  1 
ATOM   1119 N  N   . TRP A 1 162 ? 15.325  -13.358 -12.263 1.00 46.77  ? 162  TRP A N   1 
ATOM   1120 C  CA  . TRP A 1 162 ? 14.125  -13.516 -13.079 1.00 52.16  ? 162  TRP A CA  1 
ATOM   1121 C  C   . TRP A 1 162 ? 14.485  -13.748 -14.541 1.00 55.24  ? 162  TRP A C   1 
ATOM   1122 O  O   . TRP A 1 162 ? 13.857  -14.558 -15.222 1.00 48.49  ? 162  TRP A O   1 
ATOM   1123 C  CB  . TRP A 1 162 ? 13.210  -12.298 -12.961 1.00 54.45  ? 162  TRP A CB  1 
ATOM   1124 C  CG  . TRP A 1 162 ? 11.948  -12.450 -13.740 1.00 51.74  ? 162  TRP A CG  1 
ATOM   1125 C  CD1 . TRP A 1 162 ? 11.707  -12.000 -15.003 1.00 50.90  ? 162  TRP A CD1 1 
ATOM   1126 C  CD2 . TRP A 1 162 ? 10.753  -13.115 -13.314 1.00 48.75  ? 162  TRP A CD2 1 
ATOM   1127 N  NE1 . TRP A 1 162 ? 10.432  -12.335 -15.390 1.00 44.56  ? 162  TRP A NE1 1 
ATOM   1128 C  CE2 . TRP A 1 162 ? 9.826   -13.021 -14.371 1.00 48.73  ? 162  TRP A CE2 1 
ATOM   1129 C  CE3 . TRP A 1 162 ? 10.376  -13.777 -12.141 1.00 47.56  ? 162  TRP A CE3 1 
ATOM   1130 C  CZ2 . TRP A 1 162 ? 8.545   -13.563 -14.292 1.00 55.60  ? 162  TRP A CZ2 1 
ATOM   1131 C  CZ3 . TRP A 1 162 ? 9.103   -14.315 -12.064 1.00 51.71  ? 162  TRP A CZ3 1 
ATOM   1132 C  CH2 . TRP A 1 162 ? 8.203   -14.205 -13.134 1.00 54.35  ? 162  TRP A CH2 1 
ATOM   1133 N  N   . GLN A 1 163 ? 15.500  -13.031 -15.012 1.00 59.84  ? 163  GLN A N   1 
ATOM   1134 C  CA  . GLN A 1 163 ? 15.958  -13.147 -16.392 1.00 52.64  ? 163  GLN A CA  1 
ATOM   1135 C  C   . GLN A 1 163 ? 16.368  -14.579 -16.709 1.00 61.37  ? 163  GLN A C   1 
ATOM   1136 O  O   . GLN A 1 163 ? 15.993  -15.130 -17.745 1.00 64.90  ? 163  GLN A O   1 
ATOM   1137 C  CB  . GLN A 1 163 ? 17.129  -12.196 -16.648 1.00 49.63  ? 163  GLN A CB  1 
ATOM   1138 C  CG  . GLN A 1 163 ? 18.267  -12.329 -15.647 1.00 49.07  ? 163  GLN A CG  1 
ATOM   1139 C  CD  . GLN A 1 163 ? 19.371  -11.318 -15.883 1.00 58.97  ? 163  GLN A CD  1 
ATOM   1140 O  OE1 . GLN A 1 163 ? 19.604  -10.890 -17.014 1.00 62.78  ? 163  GLN A OE1 1 
ATOM   1141 N  NE2 . GLN A 1 163 ? 20.055  -10.924 -14.813 1.00 49.10  ? 163  GLN A NE2 1 
ATOM   1142 N  N   . PHE A 1 164 ? 17.139  -15.176 -15.806 1.00 62.59  ? 164  PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 164 ? 17.597  -16.549 -15.971 1.00 56.82  ? 164  PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 164 ? 16.435  -17.536 -15.884 1.00 53.47  ? 164  PHE A C   1 
ATOM   1145 O  O   . PHE A 1 164 ? 16.407  -18.540 -16.597 1.00 67.63  ? 164  PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 164 ? 18.665  -16.887 -14.927 1.00 51.92  ? 164  PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 164 ? 19.889  -16.016 -15.006 1.00 53.98  ? 164  PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 164 ? 20.173  -15.099 -14.007 1.00 58.04  ? 164  PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 164 ? 20.755  -16.115 -16.082 1.00 57.91  ? 164  PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 164 ? 21.301  -14.299 -14.079 1.00 57.31  ? 164  PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 164 ? 21.883  -15.318 -16.160 1.00 60.11  ? 164  PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 164 ? 22.155  -14.409 -15.157 1.00 60.26  ? 164  PHE A CZ  1 
ATOM   1153 N  N   . ILE A 1 165 ? 15.478  -17.243 -15.008 1.00 56.11  ? 165  ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 165 ? 14.295  -18.083 -14.853 1.00 63.29  ? 165  ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 165 ? 13.540  -18.199 -16.172 1.00 62.93  ? 165  ILE A C   1 
ATOM   1156 O  O   . ILE A 1 165 ? 13.234  -19.299 -16.630 1.00 62.94  ? 165  ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 165 ? 13.347  -17.526 -13.773 1.00 56.85  ? 165  ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 165 ? 14.042  -17.506 -12.409 1.00 57.29  ? 165  ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 165 ? 12.070  -18.348 -13.714 1.00 40.75  ? 165  ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 165 ? 13.247  -16.809 -11.320 1.00 44.15  ? 165  ILE A CD1 1 
ATOM   1161 N  N   . VAL A 1 166 ? 13.249  -17.053 -16.779 1.00 66.14  ? 166  VAL A N   1 
ATOM   1162 C  CA  . VAL A 1 166 ? 12.534  -17.007 -18.048 1.00 67.19  ? 166  VAL A CA  1 
ATOM   1163 C  C   . VAL A 1 166 ? 13.478  -17.299 -19.212 1.00 67.12  ? 166  VAL A C   1 
ATOM   1164 O  O   . VAL A 1 166 ? 13.044  -17.721 -20.285 1.00 71.23  ? 166  VAL A O   1 
ATOM   1165 C  CB  . VAL A 1 166 ? 11.864  -15.636 -18.262 1.00 65.00  ? 166  VAL A CB  1 
ATOM   1166 C  CG1 . VAL A 1 166 ? 10.939  -15.677 -19.469 1.00 68.30  ? 166  VAL A CG1 1 
ATOM   1167 C  CG2 . VAL A 1 166 ? 11.096  -15.227 -17.016 1.00 57.68  ? 166  VAL A CG2 1 
ATOM   1168 N  N   . GLY A 1 167 ? 14.770  -17.066 -18.994 1.00 67.41  ? 167  GLY A N   1 
ATOM   1169 C  CA  . GLY A 1 167 ? 15.784  -17.384 -19.984 1.00 61.77  ? 167  GLY A CA  1 
ATOM   1170 C  C   . GLY A 1 167 ? 16.197  -16.215 -20.858 1.00 61.73  ? 167  GLY A C   1 
ATOM   1171 O  O   . GLY A 1 167 ? 17.177  -16.301 -21.599 1.00 58.80  ? 167  GLY A O   1 
ATOM   1172 N  N   . VAL A 1 168 ? 15.451  -15.118 -20.772 1.00 66.03  ? 168  VAL A N   1 
ATOM   1173 C  CA  . VAL A 1 168 ? 15.722  -13.938 -21.586 1.00 54.00  ? 168  VAL A CA  1 
ATOM   1174 C  C   . VAL A 1 168 ? 15.670  -12.666 -20.747 1.00 57.16  ? 168  VAL A C   1 
ATOM   1175 O  O   . VAL A 1 168 ? 14.923  -12.590 -19.772 1.00 58.19  ? 168  VAL A O   1 
ATOM   1176 C  CB  . VAL A 1 168 ? 14.715  -13.816 -22.749 1.00 56.08  ? 168  VAL A CB  1 
ATOM   1177 C  CG1 . VAL A 1 168 ? 13.288  -13.849 -22.221 1.00 57.71  ? 168  VAL A CG1 1 
ATOM   1178 C  CG2 . VAL A 1 168 ? 14.966  -12.546 -23.548 1.00 60.89  ? 168  VAL A CG2 1 
ATOM   1179 N  N   . ARG A 1 169 ? 16.470  -11.673 -21.128 1.00 56.82  ? 169  ARG A N   1 
ATOM   1180 C  CA  . ARG A 1 169 ? 16.472  -10.379 -20.451 1.00 52.82  ? 169  ARG A CA  1 
ATOM   1181 C  C   . ARG A 1 169 ? 15.748  -9.332  -21.290 1.00 51.60  ? 169  ARG A C   1 
ATOM   1182 O  O   . ARG A 1 169 ? 16.163  -9.024  -22.406 1.00 57.82  ? 169  ARG A O   1 
ATOM   1183 C  CB  . ARG A 1 169 ? 17.904  -9.923  -20.162 1.00 45.74  ? 169  ARG A CB  1 
ATOM   1184 C  CG  . ARG A 1 169 ? 17.998  -8.620  -19.381 1.00 44.46  ? 169  ARG A CG  1 
ATOM   1185 C  CD  . ARG A 1 169 ? 19.445  -8.273  -19.057 1.00 47.80  ? 169  ARG A CD  1 
ATOM   1186 N  NE  . ARG A 1 169 ? 19.600  -7.791  -17.685 1.00 53.46  ? 169  ARG A NE  1 
ATOM   1187 C  CZ  . ARG A 1 169 ? 19.646  -6.508  -17.339 1.00 51.01  ? 169  ARG A CZ  1 
ATOM   1188 N  NH1 . ARG A 1 169 ? 19.554  -5.562  -18.264 1.00 60.26  ? 169  ARG A NH1 1 
ATOM   1189 N  NH2 . ARG A 1 169 ? 19.790  -6.170  -16.066 1.00 45.99  ? 169  ARG A NH2 1 
ATOM   1190 N  N   . THR A 1 170 ? 14.664  -8.789  -20.747 1.00 57.81  ? 170  THR A N   1 
ATOM   1191 C  CA  . THR A 1 170 ? 13.868  -7.790  -21.452 1.00 57.59  ? 170  THR A CA  1 
ATOM   1192 C  C   . THR A 1 170 ? 14.474  -6.396  -21.307 1.00 56.57  ? 170  THR A C   1 
ATOM   1193 O  O   . THR A 1 170 ? 14.244  -5.517  -22.137 1.00 58.23  ? 170  THR A O   1 
ATOM   1194 C  CB  . THR A 1 170 ? 12.412  -7.770  -20.938 1.00 59.17  ? 170  THR A CB  1 
ATOM   1195 O  OG1 . THR A 1 170 ? 11.834  -9.073  -21.078 1.00 68.48  ? 170  THR A OG1 1 
ATOM   1196 C  CG2 . THR A 1 170 ? 11.579  -6.766  -21.720 1.00 58.91  ? 170  THR A CG2 1 
ATOM   1197 N  N   . VAL A 1 171 ? 15.254  -6.203  -20.249 1.00 57.86  ? 171  VAL A N   1 
ATOM   1198 C  CA  . VAL A 1 171 ? 15.864  -4.907  -19.976 1.00 62.08  ? 171  VAL A CA  1 
ATOM   1199 C  C   . VAL A 1 171 ? 17.043  -4.636  -20.910 1.00 51.81  ? 171  VAL A C   1 
ATOM   1200 O  O   . VAL A 1 171 ? 17.947  -5.462  -21.039 1.00 45.15  ? 171  VAL A O   1 
ATOM   1201 C  CB  . VAL A 1 171 ? 16.338  -4.809  -18.512 1.00 56.70  ? 171  VAL A CB  1 
ATOM   1202 C  CG1 . VAL A 1 171 ? 16.883  -3.420  -18.220 1.00 50.88  ? 171  VAL A CG1 1 
ATOM   1203 C  CG2 . VAL A 1 171 ? 15.199  -5.156  -17.560 1.00 46.39  ? 171  VAL A CG2 1 
ATOM   1204 N  N   . GLU A 1 172 ? 17.028  -3.474  -21.556 1.00 51.40  ? 172  GLU A N   1 
ATOM   1205 C  CA  . GLU A 1 172 ? 18.097  -3.099  -22.478 1.00 58.72  ? 172  GLU A CA  1 
ATOM   1206 C  C   . GLU A 1 172 ? 19.283  -2.464  -21.753 1.00 56.86  ? 172  GLU A C   1 
ATOM   1207 O  O   . GLU A 1 172 ? 19.287  -2.355  -20.527 1.00 65.95  ? 172  GLU A O   1 
ATOM   1208 C  CB  . GLU A 1 172 ? 17.568  -2.175  -23.580 1.00 54.97  ? 172  GLU A CB  1 
ATOM   1209 C  CG  . GLU A 1 172 ? 16.557  -2.841  -24.503 1.00 47.29  ? 172  GLU A CG  1 
ATOM   1210 C  CD  . GLU A 1 172 ? 17.121  -4.068  -25.199 1.00 55.10  ? 172  GLU A CD  1 
ATOM   1211 O  OE1 . GLU A 1 172 ? 18.360  -4.155  -25.345 1.00 60.78  ? 172  GLU A OE1 1 
ATOM   1212 O  OE2 . GLU A 1 172 ? 16.324  -4.947  -25.595 1.00 46.45  ? 172  GLU A OE2 1 
ATOM   1213 N  N   . ASP A 1 173 ? 20.286  -2.048  -22.519 1.00 53.24  ? 173  ASP A N   1 
ATOM   1214 C  CA  . ASP A 1 173 ? 21.557  -1.602  -21.954 1.00 54.25  ? 173  ASP A CA  1 
ATOM   1215 C  C   . ASP A 1 173 ? 21.553  -0.172  -21.417 1.00 48.83  ? 173  ASP A C   1 
ATOM   1216 O  O   . ASP A 1 173 ? 22.416  0.195   -20.620 1.00 52.10  ? 173  ASP A O   1 
ATOM   1217 C  CB  . ASP A 1 173 ? 22.680  -1.767  -22.982 1.00 64.60  ? 173  ASP A CB  1 
ATOM   1218 C  CG  . ASP A 1 173 ? 22.926  -3.218  -23.346 1.00 86.14  ? 173  ASP A CG  1 
ATOM   1219 O  OD1 . ASP A 1 173 ? 22.195  -3.748  -24.211 1.00 82.37  ? 173  ASP A OD1 1 
ATOM   1220 O  OD2 . ASP A 1 173 ? 23.850  -3.829  -22.766 1.00 94.93  ? 173  ASP A OD2 1 
ATOM   1221 N  N   . GLY A 1 174 ? 20.591  0.634   -21.853 1.00 48.07  ? 174  GLY A N   1 
ATOM   1222 C  CA  . GLY A 1 174 ? 20.526  2.021   -21.427 1.00 51.29  ? 174  GLY A CA  1 
ATOM   1223 C  C   . GLY A 1 174 ? 19.429  2.275   -20.411 1.00 56.94  ? 174  GLY A C   1 
ATOM   1224 O  O   . GLY A 1 174 ? 19.248  3.398   -19.943 1.00 55.56  ? 174  GLY A O   1 
ATOM   1225 N  N   . GLU A 1 175 ? 18.696  1.223   -20.064 1.00 50.60  ? 175  GLU A N   1 
ATOM   1226 C  CA  . GLU A 1 175 ? 17.562  1.352   -19.160 1.00 49.51  ? 175  GLU A CA  1 
ATOM   1227 C  C   . GLU A 1 175 ? 17.686  0.411   -17.965 1.00 53.43  ? 175  GLU A C   1 
ATOM   1228 O  O   . GLU A 1 175 ? 18.383  -0.603  -18.026 1.00 45.02  ? 175  GLU A O   1 
ATOM   1229 C  CB  . GLU A 1 175 ? 16.257  1.093   -19.911 1.00 51.92  ? 175  GLU A CB  1 
ATOM   1230 C  CG  . GLU A 1 175 ? 16.253  -0.205  -20.701 1.00 53.59  ? 175  GLU A CG  1 
ATOM   1231 C  CD  . GLU A 1 175 ? 14.997  -0.373  -21.532 1.00 58.26  ? 175  GLU A CD  1 
ATOM   1232 O  OE1 . GLU A 1 175 ? 14.754  -1.497  -22.024 1.00 55.25  ? 175  GLU A OE1 1 
ATOM   1233 O  OE2 . GLU A 1 175 ? 14.256  0.621   -21.694 1.00 51.67  ? 175  GLU A OE2 1 
ATOM   1234 N  N   . CYS A 1 176 ? 17.007  0.760   -16.876 1.00 53.69  ? 176  CYS A N   1 
ATOM   1235 C  CA  . CYS A 1 176 ? 17.080  -0.019  -15.648 1.00 47.88  ? 176  CYS A CA  1 
ATOM   1236 C  C   . CYS A 1 176 ? 15.710  -0.117  -14.987 1.00 43.38  ? 176  CYS A C   1 
ATOM   1237 O  O   . CYS A 1 176 ? 15.169  0.880   -14.513 1.00 50.58  ? 176  CYS A O   1 
ATOM   1238 C  CB  . CYS A 1 176 ? 18.088  0.612   -14.686 1.00 49.69  ? 176  CYS A CB  1 
ATOM   1239 S  SG  . CYS A 1 176 ? 18.553  -0.442  -13.292 1.00 62.81  ? 176  CYS A SG  1 
ATOM   1240 N  N   . TYR A 1 177 ? 15.149  -1.322  -14.965 1.00 35.75  ? 177  TYR A N   1 
ATOM   1241 C  CA  . TYR A 1 177 ? 13.849  -1.548  -14.343 1.00 41.40  ? 177  TYR A CA  1 
ATOM   1242 C  C   . TYR A 1 177 ? 13.615  -3.028  -14.040 1.00 47.91  ? 177  TYR A C   1 
ATOM   1243 O  O   . TYR A 1 177 ? 14.294  -3.899  -14.584 1.00 47.01  ? 177  TYR A O   1 
ATOM   1244 C  CB  . TYR A 1 177 ? 12.724  -0.996  -15.225 1.00 34.59  ? 177  TYR A CB  1 
ATOM   1245 C  CG  . TYR A 1 177 ? 12.616  -1.653  -16.585 1.00 50.03  ? 177  TYR A CG  1 
ATOM   1246 C  CD1 . TYR A 1 177 ? 11.758  -2.727  -16.792 1.00 51.20  ? 177  TYR A CD1 1 
ATOM   1247 C  CD2 . TYR A 1 177 ? 13.367  -1.198  -17.663 1.00 54.07  ? 177  TYR A CD2 1 
ATOM   1248 C  CE1 . TYR A 1 177 ? 11.654  -3.333  -18.034 1.00 52.58  ? 177  TYR A CE1 1 
ATOM   1249 C  CE2 . TYR A 1 177 ? 13.271  -1.798  -18.909 1.00 51.11  ? 177  TYR A CE2 1 
ATOM   1250 C  CZ  . TYR A 1 177 ? 12.412  -2.864  -19.089 1.00 54.90  ? 177  TYR A CZ  1 
ATOM   1251 O  OH  . TYR A 1 177 ? 12.314  -3.460  -20.328 1.00 54.71  ? 177  TYR A OH  1 
ATOM   1252 N  N   . ILE A 1 178 ? 12.657  -3.303  -13.160 1.00 46.90  ? 178  ILE A N   1 
ATOM   1253 C  CA  . ILE A 1 178 ? 12.305  -4.675  -12.809 1.00 48.19  ? 178  ILE A CA  1 
ATOM   1254 C  C   . ILE A 1 178 ? 11.615  -5.365  -13.981 1.00 48.60  ? 178  ILE A C   1 
ATOM   1255 O  O   . ILE A 1 178 ? 10.613  -4.875  -14.502 1.00 47.18  ? 178  ILE A O   1 
ATOM   1256 C  CB  . ILE A 1 178 ? 11.409  -4.727  -11.557 1.00 49.63  ? 178  ILE A CB  1 
ATOM   1257 C  CG1 . ILE A 1 178 ? 12.185  -4.235  -10.333 1.00 47.42  ? 178  ILE A CG1 1 
ATOM   1258 C  CG2 . ILE A 1 178 ? 10.895  -6.134  -11.330 1.00 43.76  ? 178  ILE A CG2 1 
ATOM   1259 C  CD1 . ILE A 1 178 ? 11.399  -4.292  -9.042  1.00 44.93  ? 178  ILE A CD1 1 
ATOM   1260 N  N   . GLN A 1 179 ? 12.159  -6.507  -14.387 1.00 48.18  ? 179  GLN A N   1 
ATOM   1261 C  CA  . GLN A 1 179 ? 11.735  -7.172  -15.618 1.00 49.47  ? 179  GLN A CA  1 
ATOM   1262 C  C   . GLN A 1 179 ? 10.285  -7.658  -15.616 1.00 50.07  ? 179  GLN A C   1 
ATOM   1263 O  O   . GLN A 1 179 ? 9.551   -7.416  -16.574 1.00 49.30  ? 179  GLN A O   1 
ATOM   1264 C  CB  . GLN A 1 179 ? 12.684  -8.321  -15.969 1.00 50.46  ? 179  GLN A CB  1 
ATOM   1265 C  CG  . GLN A 1 179 ? 12.387  -8.975  -17.307 1.00 54.01  ? 179  GLN A CG  1 
ATOM   1266 C  CD  . GLN A 1 179 ? 13.500  -9.896  -17.762 1.00 54.09  ? 179  GLN A CD  1 
ATOM   1267 O  OE1 . GLN A 1 179 ? 13.312  -10.716 -18.661 1.00 65.44  ? 179  GLN A OE1 1 
ATOM   1268 N  NE2 . GLN A 1 179 ? 14.670  -9.760  -17.146 1.00 42.83  ? 179  GLN A NE2 1 
ATOM   1269 N  N   . PHE A 1 180 ? 9.869   -8.344  -14.555 1.00 49.83  ? 180  PHE A N   1 
ATOM   1270 C  CA  . PHE A 1 180 ? 8.495   -8.838  -14.495 1.00 51.81  ? 180  PHE A CA  1 
ATOM   1271 C  C   . PHE A 1 180 ? 7.479   -7.708  -14.343 1.00 52.44  ? 180  PHE A C   1 
ATOM   1272 O  O   . PHE A 1 180 ? 6.281   -7.910  -14.536 1.00 52.52  ? 180  PHE A O   1 
ATOM   1273 C  CB  . PHE A 1 180 ? 8.313   -9.906  -13.407 1.00 47.35  ? 180  PHE A CB  1 
ATOM   1274 C  CG  . PHE A 1 180 ? 8.921   -9.549  -12.078 1.00 56.96  ? 180  PHE A CG  1 
ATOM   1275 C  CD1 . PHE A 1 180 ? 10.239  -9.875  -11.794 1.00 53.59  ? 180  PHE A CD1 1 
ATOM   1276 C  CD2 . PHE A 1 180 ? 8.167   -8.916  -11.100 1.00 57.52  ? 180  PHE A CD2 1 
ATOM   1277 C  CE1 . PHE A 1 180 ? 10.800  -9.561  -10.564 1.00 48.32  ? 180  PHE A CE1 1 
ATOM   1278 C  CE2 . PHE A 1 180 ? 8.722   -8.600  -9.869  1.00 45.44  ? 180  PHE A CE2 1 
ATOM   1279 C  CZ  . PHE A 1 180 ? 10.040  -8.923  -9.602  1.00 45.37  ? 180  PHE A CZ  1 
ATOM   1280 N  N   . PHE A 1 181 ? 7.966   -6.516  -14.012 1.00 51.15  ? 181  PHE A N   1 
ATOM   1281 C  CA  . PHE A 1 181 ? 7.103   -5.345  -13.902 1.00 55.93  ? 181  PHE A CA  1 
ATOM   1282 C  C   . PHE A 1 181 ? 6.730   -4.772  -15.267 1.00 54.82  ? 181  PHE A C   1 
ATOM   1283 O  O   . PHE A 1 181 ? 6.040   -3.755  -15.351 1.00 62.01  ? 181  PHE A O   1 
ATOM   1284 C  CB  . PHE A 1 181 ? 7.762   -4.255  -13.053 1.00 56.86  ? 181  PHE A CB  1 
ATOM   1285 C  CG  . PHE A 1 181 ? 7.602   -4.456  -11.572 1.00 48.46  ? 181  PHE A CG  1 
ATOM   1286 C  CD1 . PHE A 1 181 ? 6.926   -5.558  -11.076 1.00 51.15  ? 181  PHE A CD1 1 
ATOM   1287 C  CD2 . PHE A 1 181 ? 8.115   -3.532  -10.677 1.00 45.21  ? 181  PHE A CD2 1 
ATOM   1288 C  CE1 . PHE A 1 181 ? 6.776   -5.741  -9.713  1.00 46.09  ? 181  PHE A CE1 1 
ATOM   1289 C  CE2 . PHE A 1 181 ? 7.967   -3.707  -9.317  1.00 49.03  ? 181  PHE A CE2 1 
ATOM   1290 C  CZ  . PHE A 1 181 ? 7.296   -4.813  -8.834  1.00 47.26  ? 181  PHE A CZ  1 
ATOM   1291 N  N   . SER A 1 182 ? 7.187   -5.421  -16.334 1.00 60.06  ? 182  SER A N   1 
ATOM   1292 C  CA  . SER A 1 182 ? 6.866   -4.970  -17.685 1.00 59.49  ? 182  SER A CA  1 
ATOM   1293 C  C   . SER A 1 182 ? 5.355   -4.980  -17.894 1.00 61.05  ? 182  SER A C   1 
ATOM   1294 O  O   . SER A 1 182 ? 4.808   -4.130  -18.597 1.00 62.83  ? 182  SER A O   1 
ATOM   1295 C  CB  . SER A 1 182 ? 7.563   -5.839  -18.736 1.00 43.62  ? 182  SER A CB  1 
ATOM   1296 O  OG  . SER A 1 182 ? 7.089   -7.175  -18.695 1.00 60.24  ? 182  SER A OG  1 
ATOM   1297 N  N   . ASN A 1 183 ? 4.686   -5.948  -17.274 1.00 52.58  ? 183  ASN A N   1 
ATOM   1298 C  CA  . ASN A 1 183 ? 3.231   -5.992  -17.283 1.00 52.63  ? 183  ASN A CA  1 
ATOM   1299 C  C   . ASN A 1 183 ? 2.656   -5.174  -16.131 1.00 59.14  ? 183  ASN A C   1 
ATOM   1300 O  O   . ASN A 1 183 ? 2.931   -5.453  -14.963 1.00 55.16  ? 183  ASN A O   1 
ATOM   1301 C  CB  . ASN A 1 183 ? 2.730   -7.434  -17.214 1.00 59.75  ? 183  ASN A CB  1 
ATOM   1302 C  CG  . ASN A 1 183 ? 1.215   -7.531  -17.292 1.00 64.69  ? 183  ASN A CG  1 
ATOM   1303 O  OD1 . ASN A 1 183 ? 0.533   -6.555  -17.615 1.00 60.19  ? 183  ASN A OD1 1 
ATOM   1304 N  ND2 . ASN A 1 183 ? 0.682   -8.714  -17.001 1.00 62.55  ? 183  ASN A ND2 1 
ATOM   1305 N  N   . ALA A 1 184 ? 1.861   -4.164  -16.469 1.00 58.59  ? 184  ALA A N   1 
ATOM   1306 C  CA  . ALA A 1 184 ? 1.303   -3.249  -15.475 1.00 50.02  ? 184  ALA A CA  1 
ATOM   1307 C  C   . ALA A 1 184 ? 0.510   -3.977  -14.393 1.00 56.74  ? 184  ALA A C   1 
ATOM   1308 O  O   . ALA A 1 184 ? 0.628   -3.663  -13.207 1.00 57.48  ? 184  ALA A O   1 
ATOM   1309 C  CB  . ALA A 1 184 ? 0.436   -2.195  -16.150 1.00 45.14  ? 184  ALA A CB  1 
ATOM   1310 N  N   . ALA A 1 185 ? -0.300  -4.947  -14.806 1.00 55.36  ? 185  ALA A N   1 
ATOM   1311 C  CA  . ALA A 1 185 ? -1.130  -5.698  -13.871 1.00 49.35  ? 185  ALA A CA  1 
ATOM   1312 C  C   . ALA A 1 185 ? -0.291  -6.330  -12.766 1.00 49.31  ? 185  ALA A C   1 
ATOM   1313 O  O   . ALA A 1 185 ? -0.655  -6.271  -11.593 1.00 49.45  ? 185  ALA A O   1 
ATOM   1314 C  CB  . ALA A 1 185 ? -1.931  -6.761  -14.605 1.00 51.46  ? 185  ALA A CB  1 
ATOM   1315 N  N   . VAL A 1 186 ? 0.835   -6.927  -13.146 1.00 49.74  ? 186  VAL A N   1 
ATOM   1316 C  CA  . VAL A 1 186 ? 1.724   -7.569  -12.182 1.00 45.23  ? 186  VAL A CA  1 
ATOM   1317 C  C   . VAL A 1 186 ? 2.316   -6.543  -11.220 1.00 43.54  ? 186  VAL A C   1 
ATOM   1318 O  O   . VAL A 1 186 ? 2.466   -6.807  -10.026 1.00 39.96  ? 186  VAL A O   1 
ATOM   1319 C  CB  . VAL A 1 186 ? 2.872   -8.317  -12.885 1.00 40.39  ? 186  VAL A CB  1 
ATOM   1320 C  CG1 . VAL A 1 186 ? 3.657   -9.154  -11.878 1.00 31.35  ? 186  VAL A CG1 1 
ATOM   1321 C  CG2 . VAL A 1 186 ? 2.325   -9.189  -14.003 1.00 45.87  ? 186  VAL A CG2 1 
ATOM   1322 N  N   . THR A 1 187 ? 2.649   -5.370  -11.751 1.00 43.82  ? 187  THR A N   1 
ATOM   1323 C  CA  . THR A 1 187 ? 3.208   -4.290  -10.948 1.00 40.82  ? 187  THR A CA  1 
ATOM   1324 C  C   . THR A 1 187 ? 2.198   -3.794  -9.921  1.00 41.92  ? 187  THR A C   1 
ATOM   1325 O  O   . THR A 1 187 ? 2.537   -3.585  -8.756  1.00 40.76  ? 187  THR A O   1 
ATOM   1326 C  CB  . THR A 1 187 ? 3.651   -3.109  -11.828 1.00 46.75  ? 187  THR A CB  1 
ATOM   1327 O  OG1 . THR A 1 187 ? 4.607   -3.563  -12.794 1.00 53.63  ? 187  THR A OG1 1 
ATOM   1328 C  CG2 . THR A 1 187 ? 4.275   -2.015  -10.979 1.00 41.85  ? 187  THR A CG2 1 
ATOM   1329 N  N   . PHE A 1 188 ? 0.956   -3.605  -10.358 1.00 41.23  ? 188  PHE A N   1 
ATOM   1330 C  CA  . PHE A 1 188 ? -0.112  -3.199  -9.450  1.00 45.82  ? 188  PHE A CA  1 
ATOM   1331 C  C   . PHE A 1 188 ? -0.345  -4.267  -8.384  1.00 47.50  ? 188  PHE A C   1 
ATOM   1332 O  O   . PHE A 1 188 ? -0.424  -3.964  -7.192  1.00 45.69  ? 188  PHE A O   1 
ATOM   1333 C  CB  . PHE A 1 188 ? -1.412  -2.930  -10.212 1.00 45.01  ? 188  PHE A CB  1 
ATOM   1334 C  CG  . PHE A 1 188 ? -2.521  -2.399  -9.346  1.00 53.14  ? 188  PHE A CG  1 
ATOM   1335 C  CD1 . PHE A 1 188 ? -2.236  -1.621  -8.235  1.00 55.74  ? 188  PHE A CD1 1 
ATOM   1336 C  CD2 . PHE A 1 188 ? -3.845  -2.688  -9.633  1.00 56.31  ? 188  PHE A CD2 1 
ATOM   1337 C  CE1 . PHE A 1 188 ? -3.253  -1.132  -7.433  1.00 54.31  ? 188  PHE A CE1 1 
ATOM   1338 C  CE2 . PHE A 1 188 ? -4.865  -2.203  -8.835  1.00 56.17  ? 188  PHE A CE2 1 
ATOM   1339 C  CZ  . PHE A 1 188 ? -4.569  -1.425  -7.734  1.00 51.35  ? 188  PHE A CZ  1 
ATOM   1340 N  N   . GLY A 1 189 ? -0.462  -5.515  -8.824  1.00 38.49  ? 189  GLY A N   1 
ATOM   1341 C  CA  . GLY A 1 189 ? -0.655  -6.626  -7.915  1.00 33.75  ? 189  GLY A CA  1 
ATOM   1342 C  C   . GLY A 1 189 ? 0.406   -6.618  -6.835  1.00 43.71  ? 189  GLY A C   1 
ATOM   1343 O  O   . GLY A 1 189 ? 0.108   -6.784  -5.653  1.00 45.35  ? 189  GLY A O   1 
ATOM   1344 N  N   . THR A 1 190 ? 1.652   -6.412  -7.247  1.00 33.76  ? 190  THR A N   1 
ATOM   1345 C  CA  . THR A 1 190 ? 2.775   -6.393  -6.320  1.00 38.91  ? 190  THR A CA  1 
ATOM   1346 C  C   . THR A 1 190 ? 2.679   -5.210  -5.359  1.00 47.00  ? 190  THR A C   1 
ATOM   1347 O  O   . THR A 1 190 ? 3.014   -5.328  -4.181  1.00 48.01  ? 190  THR A O   1 
ATOM   1348 C  CB  . THR A 1 190 ? 4.115   -6.353  -7.075  1.00 45.73  ? 190  THR A CB  1 
ATOM   1349 O  OG1 . THR A 1 190 ? 4.243   -7.537  -7.873  1.00 49.22  ? 190  THR A OG1 1 
ATOM   1350 C  CG2 . THR A 1 190 ? 5.278   -6.283  -6.101  1.00 46.60  ? 190  THR A CG2 1 
ATOM   1351 N  N   . ALA A 1 191 ? 2.212   -4.073  -5.866  1.00 48.95  ? 191  ALA A N   1 
ATOM   1352 C  CA  . ALA A 1 191 ? 2.003   -2.893  -5.032  1.00 41.43  ? 191  ALA A CA  1 
ATOM   1353 C  C   . ALA A 1 191 ? 1.026   -3.197  -3.903  1.00 43.80  ? 191  ALA A C   1 
ATOM   1354 O  O   . ALA A 1 191 ? 1.272   -2.861  -2.743  1.00 47.49  ? 191  ALA A O   1 
ATOM   1355 C  CB  . ALA A 1 191 ? 1.491   -1.734  -5.871  1.00 44.30  ? 191  ALA A CB  1 
ATOM   1356 N  N   . ILE A 1 192 ? -0.086  -3.834  -4.256  1.00 50.30  ? 192  ILE A N   1 
ATOM   1357 C  CA  . ILE A 1 192 ? -1.112  -4.201  -3.284  1.00 50.57  ? 192  ILE A CA  1 
ATOM   1358 C  C   . ILE A 1 192 ? -0.548  -5.068  -2.165  1.00 47.34  ? 192  ILE A C   1 
ATOM   1359 O  O   . ILE A 1 192 ? -0.724  -4.767  -0.984  1.00 50.99  ? 192  ILE A O   1 
ATOM   1360 C  CB  . ILE A 1 192 ? -2.281  -4.954  -3.953  1.00 42.89  ? 192  ILE A CB  1 
ATOM   1361 C  CG1 . ILE A 1 192 ? -2.943  -4.078  -5.019  1.00 45.16  ? 192  ILE A CG1 1 
ATOM   1362 C  CG2 . ILE A 1 192 ? -3.299  -5.390  -2.913  1.00 45.52  ? 192  ILE A CG2 1 
ATOM   1363 C  CD1 . ILE A 1 192 ? -4.164  -4.712  -5.644  1.00 41.80  ? 192  ILE A CD1 1 
ATOM   1364 N  N   . ALA A 1 193 ? 0.134   -6.144  -2.548  1.00 45.53  ? 193  ALA A N   1 
ATOM   1365 C  CA  . ALA A 1 193 ? 0.685   -7.097  -1.590  1.00 45.56  ? 193  ALA A CA  1 
ATOM   1366 C  C   . ALA A 1 193 ? 1.815   -6.496  -0.755  1.00 50.49  ? 193  ALA A C   1 
ATOM   1367 O  O   . ALA A 1 193 ? 1.930   -6.777  0.435   1.00 49.35  ? 193  ALA A O   1 
ATOM   1368 C  CB  . ALA A 1 193 ? 1.162   -8.351  -2.304  1.00 32.23  ? 193  ALA A CB  1 
ATOM   1369 N  N   . ALA A 1 194 ? 2.645   -5.670  -1.383  1.00 47.35  ? 194  ALA A N   1 
ATOM   1370 C  CA  . ALA A 1 194 ? 3.827   -5.126  -0.720  1.00 48.65  ? 194  ALA A CA  1 
ATOM   1371 C  C   . ALA A 1 194 ? 3.526   -3.849  0.060   1.00 47.35  ? 194  ALA A C   1 
ATOM   1372 O  O   . ALA A 1 194 ? 4.128   -3.596  1.107   1.00 49.38  ? 194  ALA A O   1 
ATOM   1373 C  CB  . ALA A 1 194 ? 4.945   -4.888  -1.726  1.00 48.40  ? 194  ALA A CB  1 
ATOM   1374 N  N   . PHE A 1 195 ? 2.599   -3.044  -0.449  1.00 41.07  ? 195  PHE A N   1 
ATOM   1375 C  CA  . PHE A 1 195 ? 2.343   -1.731  0.136   1.00 38.68  ? 195  PHE A CA  1 
ATOM   1376 C  C   . PHE A 1 195 ? 0.941   -1.569  0.723   1.00 39.82  ? 195  PHE A C   1 
ATOM   1377 O  O   . PHE A 1 195 ? 0.786   -1.207  1.888   1.00 41.70  ? 195  PHE A O   1 
ATOM   1378 C  CB  . PHE A 1 195 ? 2.605   -0.630  -0.895  1.00 36.75  ? 195  PHE A CB  1 
ATOM   1379 C  CG  . PHE A 1 195 ? 2.370   0.758   -0.371  1.00 40.26  ? 195  PHE A CG  1 
ATOM   1380 C  CD1 . PHE A 1 195 ? 3.333   1.394   0.392   1.00 37.09  ? 195  PHE A CD1 1 
ATOM   1381 C  CD2 . PHE A 1 195 ? 1.186   1.426   -0.641  1.00 41.26  ? 195  PHE A CD2 1 
ATOM   1382 C  CE1 . PHE A 1 195 ? 3.121   2.668   0.879   1.00 37.60  ? 195  PHE A CE1 1 
ATOM   1383 C  CE2 . PHE A 1 195 ? 0.968   2.701   -0.157  1.00 39.11  ? 195  PHE A CE2 1 
ATOM   1384 C  CZ  . PHE A 1 195 ? 1.938   3.323   0.604   1.00 38.62  ? 195  PHE A CZ  1 
ATOM   1385 N  N   . TYR A 1 196 ? -0.077  -1.829  -0.089  1.00 40.01  ? 196  TYR A N   1 
ATOM   1386 C  CA  . TYR A 1 196 ? -1.457  -1.583  0.320   1.00 34.79  ? 196  TYR A CA  1 
ATOM   1387 C  C   . TYR A 1 196 ? -1.900  -2.418  1.523   1.00 41.18  ? 196  TYR A C   1 
ATOM   1388 O  O   . TYR A 1 196 ? -2.386  -1.877  2.518   1.00 40.32  ? 196  TYR A O   1 
ATOM   1389 C  CB  . TYR A 1 196 ? -2.414  -1.786  -0.856  1.00 35.31  ? 196  TYR A CB  1 
ATOM   1390 C  CG  . TYR A 1 196 ? -2.385  -0.658  -1.863  1.00 43.53  ? 196  TYR A CG  1 
ATOM   1391 C  CD1 . TYR A 1 196 ? -3.088  0.520   -1.635  1.00 42.07  ? 196  TYR A CD1 1 
ATOM   1392 C  CD2 . TYR A 1 196 ? -1.658  -0.769  -3.043  1.00 48.80  ? 196  TYR A CD2 1 
ATOM   1393 C  CE1 . TYR A 1 196 ? -3.065  1.559   -2.553  1.00 54.17  ? 196  TYR A CE1 1 
ATOM   1394 C  CE2 . TYR A 1 196 ? -1.630  0.264   -3.969  1.00 49.79  ? 196  TYR A CE2 1 
ATOM   1395 C  CZ  . TYR A 1 196 ? -2.335  1.425   -3.718  1.00 51.31  ? 196  TYR A CZ  1 
ATOM   1396 O  OH  . TYR A 1 196 ? -2.311  2.453   -4.633  1.00 44.65  ? 196  TYR A OH  1 
ATOM   1397 N  N   . LEU A 1 197 ? -1.734  -3.733  1.432   1.00 38.96  ? 197  LEU A N   1 
ATOM   1398 C  CA  . LEU A 1 197 ? -2.159  -4.625  2.507   1.00 36.68  ? 197  LEU A CA  1 
ATOM   1399 C  C   . LEU A 1 197 ? -1.516  -4.308  3.861   1.00 41.68  ? 197  LEU A C   1 
ATOM   1400 O  O   . LEU A 1 197 ? -2.219  -4.188  4.865   1.00 43.48  ? 197  LEU A O   1 
ATOM   1401 C  CB  . LEU A 1 197 ? -1.932  -6.090  2.130   1.00 39.29  ? 197  LEU A CB  1 
ATOM   1402 C  CG  . LEU A 1 197 ? -2.921  -6.649  1.108   1.00 47.99  ? 197  LEU A CG  1 
ATOM   1403 C  CD1 . LEU A 1 197 ? -2.738  -8.153  0.953   1.00 50.08  ? 197  LEU A CD1 1 
ATOM   1404 C  CD2 . LEU A 1 197 ? -4.347  -6.319  1.525   1.00 38.50  ? 197  LEU A CD2 1 
ATOM   1405 N  N   . PRO A 1 198 ? -0.180  -4.176  3.899   1.00 40.59  ? 198  PRO A N   1 
ATOM   1406 C  CA  . PRO A 1 198 ? 0.441   -3.824  5.181   1.00 43.64  ? 198  PRO A CA  1 
ATOM   1407 C  C   . PRO A 1 198 ? -0.128  -2.521  5.734   1.00 43.30  ? 198  PRO A C   1 
ATOM   1408 O  O   . PRO A 1 198 ? -0.325  -2.405  6.943   1.00 47.91  ? 198  PRO A O   1 
ATOM   1409 C  CB  . PRO A 1 198 ? 1.926   -3.662  4.827   1.00 35.04  ? 198  PRO A CB  1 
ATOM   1410 C  CG  . PRO A 1 198 ? 1.968   -3.519  3.341   1.00 37.60  ? 198  PRO A CG  1 
ATOM   1411 C  CD  . PRO A 1 198 ? 0.813   -4.312  2.823   1.00 39.47  ? 198  PRO A CD  1 
ATOM   1412 N  N   . VAL A 1 199 ? -0.397  -1.557  4.858   1.00 42.00  ? 199  VAL A N   1 
ATOM   1413 C  CA  . VAL A 1 199 ? -1.011  -0.301  5.276   1.00 48.88  ? 199  VAL A CA  1 
ATOM   1414 C  C   . VAL A 1 199 ? -2.401  -0.544  5.857   1.00 44.78  ? 199  VAL A C   1 
ATOM   1415 O  O   . VAL A 1 199 ? -2.743  -0.019  6.919   1.00 42.59  ? 199  VAL A O   1 
ATOM   1416 C  CB  . VAL A 1 199 ? -1.114  0.700   4.111   1.00 43.58  ? 199  VAL A CB  1 
ATOM   1417 C  CG1 . VAL A 1 199 ? -2.052  1.843   4.473   1.00 42.73  ? 199  VAL A CG1 1 
ATOM   1418 C  CG2 . VAL A 1 199 ? 0.265   1.226   3.740   1.00 35.79  ? 199  VAL A CG2 1 
ATOM   1419 N  N   . ILE A 1 200 ? -3.199  -1.340  5.151   1.00 44.78  ? 200  ILE A N   1 
ATOM   1420 C  CA  . ILE A 1 200 ? -4.528  -1.707  5.630   1.00 44.44  ? 200  ILE A CA  1 
ATOM   1421 C  C   . ILE A 1 200 ? -4.443  -2.324  7.020   1.00 42.36  ? 200  ILE A C   1 
ATOM   1422 O  O   . ILE A 1 200 ? -5.128  -1.890  7.946   1.00 40.90  ? 200  ILE A O   1 
ATOM   1423 C  CB  . ILE A 1 200 ? -5.221  -2.704  4.680   1.00 43.23  ? 200  ILE A CB  1 
ATOM   1424 C  CG1 . ILE A 1 200 ? -5.591  -2.017  3.361   1.00 43.92  ? 200  ILE A CG1 1 
ATOM   1425 C  CG2 . ILE A 1 200 ? -6.454  -3.298  5.342   1.00 21.34  ? 200  ILE A CG2 1 
ATOM   1426 C  CD1 . ILE A 1 200 ? -6.242  -2.938  2.352   1.00 29.35  ? 200  ILE A CD1 1 
ATOM   1427 N  N   . ILE A 1 201 ? -3.592  -3.336  7.161   1.00 39.40  ? 201  ILE A N   1 
ATOM   1428 C  CA  . ILE A 1 201 ? -3.410  -4.005  8.443   1.00 40.30  ? 201  ILE A CA  1 
ATOM   1429 C  C   . ILE A 1 201 ? -2.986  -3.032  9.540   1.00 42.30  ? 201  ILE A C   1 
ATOM   1430 O  O   . ILE A 1 201 ? -3.527  -3.061  10.645  1.00 42.27  ? 201  ILE A O   1 
ATOM   1431 C  CB  . ILE A 1 201 ? -2.391  -5.155  8.352   1.00 37.15  ? 201  ILE A CB  1 
ATOM   1432 C  CG1 . ILE A 1 201 ? -3.021  -6.367  7.664   1.00 32.17  ? 201  ILE A CG1 1 
ATOM   1433 C  CG2 . ILE A 1 201 ? -1.902  -5.542  9.739   1.00 39.01  ? 201  ILE A CG2 1 
ATOM   1434 C  CD1 . ILE A 1 201 ? -2.143  -7.602  7.677   1.00 33.39  ? 201  ILE A CD1 1 
ATOM   1435 N  N   . MET A 1 202 ? -2.017  -2.174  9.237   1.00 42.14  ? 202  MET A N   1 
ATOM   1436 C  CA  . MET A 1 202 ? -1.573  -1.176  10.201  1.00 42.57  ? 202  MET A CA  1 
ATOM   1437 C  C   . MET A 1 202 ? -2.731  -0.271  10.601  1.00 42.73  ? 202  MET A C   1 
ATOM   1438 O  O   . MET A 1 202 ? -2.831  0.154   11.750  1.00 47.64  ? 202  MET A O   1 
ATOM   1439 C  CB  . MET A 1 202 ? -0.418  -0.348  9.639   1.00 40.24  ? 202  MET A CB  1 
ATOM   1440 C  CG  . MET A 1 202 ? 0.883   -1.120  9.516   1.00 43.33  ? 202  MET A CG  1 
ATOM   1441 S  SD  . MET A 1 202 ? 2.265   -0.087  8.999   1.00 53.98  ? 202  MET A SD  1 
ATOM   1442 C  CE  . MET A 1 202 ? 1.666   0.510   7.422   1.00 50.05  ? 202  MET A CE  1 
ATOM   1443 N  N   . THR A 1 203 ? -3.608  0.015   9.645   1.00 39.51  ? 203  THR A N   1 
ATOM   1444 C  CA  . THR A 1 203 ? -4.790  0.827   9.912   1.00 48.03  ? 203  THR A CA  1 
ATOM   1445 C  C   . THR A 1 203 ? -5.720  0.135   10.903  1.00 45.19  ? 203  THR A C   1 
ATOM   1446 O  O   . THR A 1 203 ? -6.138  0.728   11.902  1.00 36.09  ? 203  THR A O   1 
ATOM   1447 C  CB  . THR A 1 203 ? -5.567  1.139   8.614   1.00 43.16  ? 203  THR A CB  1 
ATOM   1448 O  OG1 . THR A 1 203 ? -4.856  2.121   7.849   1.00 42.99  ? 203  THR A OG1 1 
ATOM   1449 C  CG2 . THR A 1 203 ? -6.955  1.674   8.936   1.00 33.44  ? 203  THR A CG2 1 
ATOM   1450 N  N   . VAL A 1 204 ? -6.031  -1.128  10.624  1.00 45.04  ? 204  VAL A N   1 
ATOM   1451 C  CA  . VAL A 1 204 ? -6.966  -1.893  11.442  1.00 40.03  ? 204  VAL A CA  1 
ATOM   1452 C  C   . VAL A 1 204 ? -6.519  -2.033  12.896  1.00 47.69  ? 204  VAL A C   1 
ATOM   1453 O  O   . VAL A 1 204 ? -7.290  -1.757  13.814  1.00 59.39  ? 204  VAL A O   1 
ATOM   1454 C  CB  . VAL A 1 204 ? -7.223  -3.296  10.854  1.00 40.54  ? 204  VAL A CB  1 
ATOM   1455 C  CG1 . VAL A 1 204 ? -8.001  -4.151  11.842  1.00 38.40  ? 204  VAL A CG1 1 
ATOM   1456 C  CG2 . VAL A 1 204 ? -7.969  -3.188  9.530   1.00 29.61  ? 204  VAL A CG2 1 
ATOM   1457 N  N   . LEU A 1 205 ? -5.279  -2.461  13.110  1.00 45.77  ? 205  LEU A N   1 
ATOM   1458 C  CA  . LEU A 1 205 ? -4.798  -2.680  14.472  1.00 47.87  ? 205  LEU A CA  1 
ATOM   1459 C  C   . LEU A 1 205 ? -4.566  -1.365  15.218  1.00 49.24  ? 205  LEU A C   1 
ATOM   1460 O  O   . LEU A 1 205 ? -4.655  -1.317  16.443  1.00 54.98  ? 205  LEU A O   1 
ATOM   1461 C  CB  . LEU A 1 205 ? -3.552  -3.579  14.497  1.00 39.92  ? 205  LEU A CB  1 
ATOM   1462 C  CG  . LEU A 1 205 ? -2.239  -3.105  13.869  1.00 52.04  ? 205  LEU A CG  1 
ATOM   1463 C  CD1 . LEU A 1 205 ? -1.525  -2.122  14.785  1.00 51.92  ? 205  LEU A CD1 1 
ATOM   1464 C  CD2 . LEU A 1 205 ? -1.337  -4.299  13.566  1.00 43.96  ? 205  LEU A CD2 1 
ATOM   1465 N  N   . TYR A 1 206 ? -4.272  -0.300  14.479  1.00 47.74  ? 206  TYR A N   1 
ATOM   1466 C  CA  . TYR A 1 206 ? -4.192  1.024   15.084  1.00 46.20  ? 206  TYR A CA  1 
ATOM   1467 C  C   . TYR A 1 206 ? -5.589  1.538   15.407  1.00 50.16  ? 206  TYR A C   1 
ATOM   1468 O  O   . TYR A 1 206 ? -5.771  2.346   16.319  1.00 55.81  ? 206  TYR A O   1 
ATOM   1469 C  CB  . TYR A 1 206 ? -3.438  2.006   14.185  1.00 37.65  ? 206  TYR A CB  1 
ATOM   1470 C  CG  . TYR A 1 206 ? -1.960  2.061   14.489  1.00 46.16  ? 206  TYR A CG  1 
ATOM   1471 C  CD1 . TYR A 1 206 ? -1.038  1.406   13.684  1.00 47.93  ? 206  TYR A CD1 1 
ATOM   1472 C  CD2 . TYR A 1 206 ? -1.490  2.749   15.598  1.00 51.19  ? 206  TYR A CD2 1 
ATOM   1473 C  CE1 . TYR A 1 206 ? 0.317   1.449   13.968  1.00 50.64  ? 206  TYR A CE1 1 
ATOM   1474 C  CE2 . TYR A 1 206 ? -0.140  2.797   15.892  1.00 55.10  ? 206  TYR A CE2 1 
ATOM   1475 C  CZ  . TYR A 1 206 ? 0.760   2.145   15.075  1.00 55.33  ? 206  TYR A CZ  1 
ATOM   1476 O  OH  . TYR A 1 206 ? 2.104   2.190   15.366  1.00 52.09  ? 206  TYR A OH  1 
ATOM   1477 N  N   . TRP A 1 207 ? -6.573  1.061   14.651  1.00 48.73  ? 207  TRP A N   1 
ATOM   1478 C  CA  . TRP A 1 207 ? -7.967  1.336   14.962  1.00 49.04  ? 207  TRP A CA  1 
ATOM   1479 C  C   . TRP A 1 207 ? -8.292  0.724   16.322  1.00 59.61  ? 207  TRP A C   1 
ATOM   1480 O  O   . TRP A 1 207 ? -8.868  1.380   17.192  1.00 56.27  ? 207  TRP A O   1 
ATOM   1481 C  CB  . TRP A 1 207 ? -8.884  0.767   13.875  1.00 45.62  ? 207  TRP A CB  1 
ATOM   1482 C  CG  . TRP A 1 207 ? -10.346 0.881   14.193  1.00 60.97  ? 207  TRP A CG  1 
ATOM   1483 C  CD1 . TRP A 1 207 ? -11.163 1.937   13.917  1.00 65.29  ? 207  TRP A CD1 1 
ATOM   1484 C  CD2 . TRP A 1 207 ? -11.161 -0.098  14.852  1.00 75.55  ? 207  TRP A CD2 1 
ATOM   1485 N  NE1 . TRP A 1 207 ? -12.438 1.678   14.363  1.00 66.91  ? 207  TRP A NE1 1 
ATOM   1486 C  CE2 . TRP A 1 207 ? -12.464 0.436   14.941  1.00 76.57  ? 207  TRP A CE2 1 
ATOM   1487 C  CE3 . TRP A 1 207 ? -10.920 -1.373  15.376  1.00 73.75  ? 207  TRP A CE3 1 
ATOM   1488 C  CZ2 . TRP A 1 207 ? -13.518 -0.260  15.531  1.00 81.12  ? 207  TRP A CZ2 1 
ATOM   1489 C  CZ3 . TRP A 1 207 ? -11.970 -2.063  15.962  1.00 66.12  ? 207  TRP A CZ3 1 
ATOM   1490 C  CH2 . TRP A 1 207 ? -13.252 -1.505  16.034  1.00 63.60  ? 207  TRP A CH2 1 
ATOM   1491 N  N   . HIS A 1 208 ? -7.903  -0.536  16.501  1.00 58.17  ? 208  HIS A N   1 
ATOM   1492 C  CA  . HIS A 1 208 ? -8.072  -1.221  17.778  1.00 56.93  ? 208  HIS A CA  1 
ATOM   1493 C  C   . HIS A 1 208 ? -7.288  -0.534  18.892  1.00 54.19  ? 208  HIS A C   1 
ATOM   1494 O  O   . HIS A 1 208 ? -7.785  -0.388  20.008  1.00 54.99  ? 208  HIS A O   1 
ATOM   1495 C  CB  . HIS A 1 208 ? -7.644  -2.687  17.672  1.00 51.37  ? 208  HIS A CB  1 
ATOM   1496 C  CG  . HIS A 1 208 ? -8.734  -3.604  17.206  1.00 59.30  ? 208  HIS A CG  1 
ATOM   1497 N  ND1 . HIS A 1 208 ? -9.022  -3.804  15.874  1.00 65.11  ? 208  HIS A ND1 1 
ATOM   1498 C  CD2 . HIS A 1 208 ? -9.604  -4.376  17.901  1.00 58.75  ? 208  HIS A CD2 1 
ATOM   1499 C  CE1 . HIS A 1 208 ? -10.024 -4.662  15.766  1.00 56.49  ? 208  HIS A CE1 1 
ATOM   1500 N  NE2 . HIS A 1 208 ? -10.395 -5.022  16.980  1.00 64.47  ? 208  HIS A NE2 1 
ATOM   1501 N  N   . ILE A 1 209 ? -6.063  -0.118  18.585  1.00 56.03  ? 209  ILE A N   1 
ATOM   1502 C  CA  . ILE A 1 209 ? -5.238  0.604   19.548  1.00 51.45  ? 209  ILE A CA  1 
ATOM   1503 C  C   . ILE A 1 209 ? -5.937  1.890   19.975  1.00 55.55  ? 209  ILE A C   1 
ATOM   1504 O  O   . ILE A 1 209 ? -5.902  2.270   21.146  1.00 52.08  ? 209  ILE A O   1 
ATOM   1505 C  CB  . ILE A 1 209 ? -3.847  0.932   18.968  1.00 50.88  ? 209  ILE A CB  1 
ATOM   1506 C  CG1 . ILE A 1 209 ? -3.021  -0.347  18.816  1.00 50.40  ? 209  ILE A CG1 1 
ATOM   1507 C  CG2 . ILE A 1 209 ? -3.113  1.924   19.857  1.00 43.28  ? 209  ILE A CG2 1 
ATOM   1508 C  CD1 . ILE A 1 209 ? -1.674  -0.133  18.164  1.00 52.77  ? 209  ILE A CD1 1 
ATOM   1509 N  N   . SER A 1 210 ? -6.578  2.553   19.017  1.00 60.49  ? 210  SER A N   1 
ATOM   1510 C  CA  . SER A 1 210 ? -7.346  3.757   19.305  1.00 60.37  ? 210  SER A CA  1 
ATOM   1511 C  C   . SER A 1 210 ? -8.498  3.439   20.251  1.00 61.43  ? 210  SER A C   1 
ATOM   1512 O  O   . SER A 1 210 ? -8.654  4.078   21.291  1.00 64.11  ? 210  SER A O   1 
ATOM   1513 C  CB  . SER A 1 210 ? -7.884  4.374   18.013  1.00 58.93  ? 210  SER A CB  1 
ATOM   1514 O  OG  . SER A 1 210 ? -8.719  5.485   18.289  1.00 61.40  ? 210  SER A OG  1 
ATOM   1515 N  N   . ARG A 1 211 ? -9.300  2.445   19.879  1.00 62.26  ? 211  ARG A N   1 
ATOM   1516 C  CA  . ARG A 1 211 ? -10.437 2.025   20.691  1.00 54.68  ? 211  ARG A CA  1 
ATOM   1517 C  C   . ARG A 1 211 ? -10.027 1.792   22.139  1.00 61.11  ? 211  ARG A C   1 
ATOM   1518 O  O   . ARG A 1 211 ? -10.686 2.264   23.064  1.00 77.18  ? 211  ARG A O   1 
ATOM   1519 C  CB  . ARG A 1 211 ? -11.059 0.746   20.124  1.00 62.86  ? 211  ARG A CB  1 
ATOM   1520 C  CG  . ARG A 1 211 ? -11.527 0.859   18.682  1.00 71.47  ? 211  ARG A CG  1 
ATOM   1521 C  CD  . ARG A 1 211 ? -12.595 1.927   18.530  1.00 74.73  ? 211  ARG A CD  1 
ATOM   1522 N  NE  . ARG A 1 211 ? -13.704 1.726   19.458  1.00 83.43  ? 211  ARG A NE  1 
ATOM   1523 C  CZ  . ARG A 1 211 ? -14.813 2.460   19.468  1.00 92.62  ? 211  ARG A CZ  1 
ATOM   1524 N  NH1 . ARG A 1 211 ? -14.965 3.445   18.592  1.00 87.12  ? 211  ARG A NH1 1 
ATOM   1525 N  NH2 . ARG A 1 211 ? -15.772 2.208   20.351  1.00 90.06  ? 211  ARG A NH2 1 
ATOM   1526 N  N   . ALA A 1 212 ? -8.930  1.066   22.326  1.00 58.25  ? 212  ALA A N   1 
ATOM   1527 C  CA  . ALA A 1 212 ? -8.481  0.675   23.657  1.00 54.30  ? 212  ALA A CA  1 
ATOM   1528 C  C   . ALA A 1 212 ? -7.916  1.840   24.466  1.00 56.47  ? 212  ALA A C   1 
ATOM   1529 O  O   . ALA A 1 212 ? -7.970  1.827   25.694  1.00 65.74  ? 212  ALA A O   1 
ATOM   1530 C  CB  . ALA A 1 212 ? -7.460  -0.447  23.558  1.00 40.75  ? 212  ALA A CB  1 
ATOM   1531 N  N   . SER A 1 213 ? -7.384  2.848   23.781  1.00 57.76  ? 213  SER A N   1 
ATOM   1532 C  CA  . SER A 1 213 ? -6.670  3.932   24.452  1.00 56.50  ? 213  SER A CA  1 
ATOM   1533 C  C   . SER A 1 213 ? -7.441  5.255   24.521  1.00 69.03  ? 213  SER A C   1 
ATOM   1534 O  O   . SER A 1 213 ? -6.885  6.274   24.932  1.00 67.10  ? 213  SER A O   1 
ATOM   1535 C  CB  . SER A 1 213 ? -5.322  4.167   23.769  1.00 52.93  ? 213  SER A CB  1 
ATOM   1536 O  OG  . SER A 1 213 ? -4.535  2.991   23.758  1.00 48.46  ? 213  SER A OG  1 
ATOM   1537 N  N   . LYS A 1 214 ? -8.712  5.239   24.122  1.00 82.43  ? 214  LYS A N   1 
ATOM   1538 C  CA  . LYS A 1 214 ? -9.508  6.468   24.057  1.00 86.24  ? 214  LYS A CA  1 
ATOM   1539 C  C   . LYS A 1 214 ? -9.353  7.329   25.311  1.00 81.43  ? 214  LYS A C   1 
ATOM   1540 O  O   . LYS A 1 214 ? -9.067  8.522   25.221  1.00 88.32  ? 214  LYS A O   1 
ATOM   1541 C  CB  . LYS A 1 214 ? -10.985 6.172   23.764  1.00 75.07  ? 214  LYS A CB  1 
ATOM   1542 C  CG  . LYS A 1 214 ? -11.674 5.243   24.746  1.00 69.07  ? 214  LYS A CG  1 
ATOM   1543 C  CD  . LYS A 1 214 ? -13.130 5.035   24.349  1.00 73.17  ? 214  LYS A CD  1 
ATOM   1544 C  CE  . LYS A 1 214 ? -13.876 4.132   25.317  1.00 96.39  ? 214  LYS A CE  1 
ATOM   1545 N  NZ  . LYS A 1 214 ? -15.306 3.965   24.921  1.00 92.88  ? 214  LYS A NZ  1 
ATOM   1546 N  N   . SER A 1 215 ? -9.542  6.720   26.475  1.00 74.25  ? 215  SER A N   1 
ATOM   1547 C  CA  . SER A 1 215 ? -9.194  7.361   27.737  1.00 80.96  ? 215  SER A CA  1 
ATOM   1548 C  C   . SER A 1 215 ? -7.940  6.673   28.272  1.00 71.59  ? 215  SER A C   1 
ATOM   1549 O  O   . SER A 1 215 ? -8.016  5.704   29.026  1.00 59.65  ? 215  SER A O   1 
ATOM   1550 C  CB  . SER A 1 215 ? -10.344 7.275   28.741  1.00 81.83  ? 215  SER A CB  1 
ATOM   1551 O  OG  . SER A 1 215 ? -10.031 8.006   29.915  1.00 73.79  ? 215  SER A OG  1 
ATOM   1552 N  N   . ARG A 1 216 ? -6.787  7.181   27.849  1.00 70.85  ? 216  ARG A N   1 
ATOM   1553 C  CA  . ARG A 1 216 ? -5.505  6.496   28.015  1.00 69.72  ? 216  ARG A CA  1 
ATOM   1554 C  C   . ARG A 1 216 ? -4.873  6.611   29.401  1.00 66.15  ? 216  ARG A C   1 
ATOM   1555 O  O   . ARG A 1 216 ? -4.177  7.582   29.695  1.00 54.46  ? 216  ARG A O   1 
ATOM   1556 C  CB  . ARG A 1 216 ? -4.510  6.995   26.961  1.00 74.57  ? 216  ARG A CB  1 
ATOM   1557 N  N   . ILE A 1 217 ? -5.125  5.614   30.242  1.00 63.45  ? 217  ILE A N   1 
ATOM   1558 C  CA  . ILE A 1 217 ? -4.383  5.421   31.482  1.00 55.12  ? 217  ILE A CA  1 
ATOM   1559 C  C   . ILE A 1 217 ? -4.107  3.930   31.613  1.00 51.51  ? 217  ILE A C   1 
ATOM   1560 O  O   . ILE A 1 217 ? -4.999  3.112   31.393  1.00 53.48  ? 217  ILE A O   1 
ATOM   1561 C  CB  . ILE A 1 217 ? -5.175  5.881   32.721  1.00 51.14  ? 217  ILE A CB  1 
ATOM   1562 C  CG1 . ILE A 1 217 ? -5.337  7.404   32.741  1.00 46.54  ? 217  ILE A CG1 1 
ATOM   1563 C  CG2 . ILE A 1 217 ? -4.480  5.414   33.989  1.00 51.38  ? 217  ILE A CG2 1 
ATOM   1564 C  CD1 . ILE A 1 217 ? -4.066  8.158   33.068  1.00 47.55  ? 217  ILE A CD1 1 
ATOM   1565 N  N   . ASN A 1 218 ? -2.875  3.570   31.952  1.00 48.43  ? 1002 ASN A N   1 
ATOM   1566 C  CA  . ASN A 1 218 ? -2.557  2.170   32.209  1.00 49.20  ? 1002 ASN A CA  1 
ATOM   1567 C  C   . ASN A 1 218 ? -1.885  1.982   33.566  1.00 47.52  ? 1002 ASN A C   1 
ATOM   1568 O  O   . ASN A 1 218 ? -1.555  2.958   34.242  1.00 45.25  ? 1002 ASN A O   1 
ATOM   1569 C  CB  . ASN A 1 218 ? -1.703  1.585   31.081  1.00 41.81  ? 1002 ASN A CB  1 
ATOM   1570 C  CG  . ASN A 1 218 ? -0.408  2.345   30.873  1.00 45.35  ? 1002 ASN A CG  1 
ATOM   1571 O  OD1 . ASN A 1 218 ? 0.122   2.958   31.799  1.00 54.80  ? 1002 ASN A OD1 1 
ATOM   1572 N  ND2 . ASN A 1 218 ? 0.108   2.306   29.653  1.00 45.00  ? 1002 ASN A ND2 1 
ATOM   1573 N  N   . ILE A 1 219 ? -1.688  0.728   33.962  1.00 45.22  ? 1003 ILE A N   1 
ATOM   1574 C  CA  . ILE A 1 219 ? -1.108  0.428   35.267  1.00 48.37  ? 1003 ILE A CA  1 
ATOM   1575 C  C   . ILE A 1 219 ? 0.173   1.225   35.503  1.00 45.52  ? 1003 ILE A C   1 
ATOM   1576 O  O   . ILE A 1 219 ? 0.467   1.615   36.631  1.00 43.67  ? 1003 ILE A O   1 
ATOM   1577 C  CB  . ILE A 1 219 ? -0.830  -1.087  35.445  1.00 50.01  ? 1003 ILE A CB  1 
ATOM   1578 C  CG1 . ILE A 1 219 ? -0.729  -1.437  36.932  1.00 47.99  ? 1003 ILE A CG1 1 
ATOM   1579 C  CG2 . ILE A 1 219 ? 0.428   -1.500  34.695  1.00 36.56  ? 1003 ILE A CG2 1 
ATOM   1580 C  CD1 . ILE A 1 219 ? -0.677  -2.925  37.208  1.00 42.26  ? 1003 ILE A CD1 1 
ATOM   1581 N  N   . PHE A 1 220 ? 0.919   1.479   34.431  1.00 51.63  ? 1004 PHE A N   1 
ATOM   1582 C  CA  . PHE A 1 220 ? 2.158   2.244   34.523  1.00 55.77  ? 1004 PHE A CA  1 
ATOM   1583 C  C   . PHE A 1 220 ? 1.894   3.701   34.892  1.00 57.28  ? 1004 PHE A C   1 
ATOM   1584 O  O   . PHE A 1 220 ? 2.482   4.229   35.840  1.00 53.83  ? 1004 PHE A O   1 
ATOM   1585 C  CB  . PHE A 1 220 ? 2.943   2.166   33.214  1.00 50.55  ? 1004 PHE A CB  1 
ATOM   1586 C  CG  . PHE A 1 220 ? 4.088   3.137   33.140  1.00 49.86  ? 1004 PHE A CG  1 
ATOM   1587 C  CD1 . PHE A 1 220 ? 5.277   2.881   33.804  1.00 42.77  ? 1004 PHE A CD1 1 
ATOM   1588 C  CD2 . PHE A 1 220 ? 3.974   4.306   32.406  1.00 54.44  ? 1004 PHE A CD2 1 
ATOM   1589 C  CE1 . PHE A 1 220 ? 6.329   3.773   33.737  1.00 48.17  ? 1004 PHE A CE1 1 
ATOM   1590 C  CE2 . PHE A 1 220 ? 5.022   5.203   32.335  1.00 58.71  ? 1004 PHE A CE2 1 
ATOM   1591 C  CZ  . PHE A 1 220 ? 6.203   4.937   33.002  1.00 60.00  ? 1004 PHE A CZ  1 
ATOM   1592 N  N   . GLU A 1 221 ? 1.013   4.349   34.136  1.00 49.50  ? 1005 GLU A N   1 
ATOM   1593 C  CA  . GLU A 1 221 ? 0.642   5.727   34.426  1.00 51.35  ? 1005 GLU A CA  1 
ATOM   1594 C  C   . GLU A 1 221 ? 0.108   5.815   35.848  1.00 50.08  ? 1005 GLU A C   1 
ATOM   1595 O  O   . GLU A 1 221 ? 0.482   6.703   36.612  1.00 50.76  ? 1005 GLU A O   1 
ATOM   1596 C  CB  . GLU A 1 221 ? -0.412  6.225   33.436  1.00 47.65  ? 1005 GLU A CB  1 
ATOM   1597 C  CG  . GLU A 1 221 ? -0.048  6.013   31.974  1.00 58.61  ? 1005 GLU A CG  1 
ATOM   1598 C  CD  . GLU A 1 221 ? 1.226   6.732   31.569  1.00 67.07  ? 1005 GLU A CD  1 
ATOM   1599 O  OE1 . GLU A 1 221 ? 1.711   7.583   32.346  1.00 60.65  ? 1005 GLU A OE1 1 
ATOM   1600 O  OE2 . GLU A 1 221 ? 1.743   6.440   30.468  1.00 68.62  ? 1005 GLU A OE2 1 
ATOM   1601 N  N   . MET A 1 222 ? -0.760  4.870   36.199  1.00 51.05  ? 1006 MET A N   1 
ATOM   1602 C  CA  . MET A 1 222 ? -1.356  4.813   37.529  1.00 47.93  ? 1006 MET A CA  1 
ATOM   1603 C  C   . MET A 1 222 ? -0.307  4.800   38.637  1.00 44.29  ? 1006 MET A C   1 
ATOM   1604 O  O   . MET A 1 222 ? -0.374  5.592   39.577  1.00 36.35  ? 1006 MET A O   1 
ATOM   1605 C  CB  . MET A 1 222 ? -2.258  3.582   37.660  1.00 45.81  ? 1006 MET A CB  1 
ATOM   1606 C  CG  . MET A 1 222 ? -2.506  3.155   39.103  1.00 50.71  ? 1006 MET A CG  1 
ATOM   1607 S  SD  . MET A 1 222 ? -3.488  1.651   39.271  1.00 49.87  ? 1006 MET A SD  1 
ATOM   1608 C  CE  . MET A 1 222 ? -5.136  2.279   38.973  1.00 39.15  ? 1006 MET A CE  1 
ATOM   1609 N  N   . LEU A 1 223 ? 0.660   3.897   38.519  1.00 43.22  ? 1007 LEU A N   1 
ATOM   1610 C  CA  . LEU A 1 223 ? 1.665   3.717   39.560  1.00 45.46  ? 1007 LEU A CA  1 
ATOM   1611 C  C   . LEU A 1 223 ? 2.716   4.826   39.589  1.00 53.54  ? 1007 LEU A C   1 
ATOM   1612 O  O   . LEU A 1 223 ? 3.339   5.068   40.624  1.00 56.21  ? 1007 LEU A O   1 
ATOM   1613 C  CB  . LEU A 1 223 ? 2.325   2.342   39.438  1.00 50.61  ? 1007 LEU A CB  1 
ATOM   1614 C  CG  . LEU A 1 223 ? 1.369   1.186   39.739  1.00 50.66  ? 1007 LEU A CG  1 
ATOM   1615 C  CD1 . LEU A 1 223 ? 2.071   -0.159  39.630  1.00 54.90  ? 1007 LEU A CD1 1 
ATOM   1616 C  CD2 . LEU A 1 223 ? 0.747   1.360   41.116  1.00 39.94  ? 1007 LEU A CD2 1 
ATOM   1617 N  N   . ARG A 1 224 ? 2.916   5.498   38.459  1.00 53.94  ? 1008 ARG A N   1 
ATOM   1618 C  CA  . ARG A 1 224 ? 3.835   6.630   38.421  1.00 46.50  ? 1008 ARG A CA  1 
ATOM   1619 C  C   . ARG A 1 224 ? 3.165   7.861   39.025  1.00 40.73  ? 1008 ARG A C   1 
ATOM   1620 O  O   . ARG A 1 224 ? 3.832   8.814   39.419  1.00 39.01  ? 1008 ARG A O   1 
ATOM   1621 C  CB  . ARG A 1 224 ? 4.297   6.924   36.995  1.00 52.39  ? 1008 ARG A CB  1 
ATOM   1622 C  CG  . ARG A 1 224 ? 3.356   7.810   36.199  1.00 54.58  ? 1008 ARG A CG  1 
ATOM   1623 C  CD  . ARG A 1 224 ? 4.046   8.342   34.955  1.00 66.48  ? 1008 ARG A CD  1 
ATOM   1624 N  NE  . ARG A 1 224 ? 5.236   9.120   35.290  1.00 77.25  ? 1008 ARG A NE  1 
ATOM   1625 C  CZ  . ARG A 1 224 ? 6.076   9.627   34.393  1.00 91.94  ? 1008 ARG A CZ  1 
ATOM   1626 N  NH1 . ARG A 1 224 ? 5.860   9.439   33.097  1.00 85.50  ? 1008 ARG A NH1 1 
ATOM   1627 N  NH2 . ARG A 1 224 ? 7.133   10.323  34.791  1.00 81.93  ? 1008 ARG A NH2 1 
ATOM   1628 N  N   . ILE A 1 225 ? 1.838   7.831   39.087  1.00 44.78  ? 1009 ILE A N   1 
ATOM   1629 C  CA  . ILE A 1 225 ? 1.078   8.886   39.742  1.00 42.65  ? 1009 ILE A CA  1 
ATOM   1630 C  C   . ILE A 1 225 ? 1.074   8.670   41.251  1.00 44.32  ? 1009 ILE A C   1 
ATOM   1631 O  O   . ILE A 1 225 ? 1.319   9.599   42.024  1.00 38.31  ? 1009 ILE A O   1 
ATOM   1632 C  CB  . ILE A 1 225 ? -0.383  8.923   39.258  1.00 38.83  ? 1009 ILE A CB  1 
ATOM   1633 C  CG1 . ILE A 1 225 ? -0.461  9.313   37.785  1.00 34.12  ? 1009 ILE A CG1 1 
ATOM   1634 C  CG2 . ILE A 1 225 ? -1.195  9.899   40.097  1.00 47.45  ? 1009 ILE A CG2 1 
ATOM   1635 C  CD1 . ILE A 1 225 ? -1.879  9.438   37.271  1.00 37.20  ? 1009 ILE A CD1 1 
ATOM   1636 N  N   . ASP A 1 226 ? 0.800   7.434   41.658  1.00 41.17  ? 1010 ASP A N   1 
ATOM   1637 C  CA  . ASP A 1 226 ? 0.671   7.086   43.070  1.00 43.34  ? 1010 ASP A CA  1 
ATOM   1638 C  C   . ASP A 1 226 ? 2.015   7.019   43.790  1.00 45.49  ? 1010 ASP A C   1 
ATOM   1639 O  O   . ASP A 1 226 ? 2.176   7.594   44.868  1.00 42.82  ? 1010 ASP A O   1 
ATOM   1640 C  CB  . ASP A 1 226 ? -0.080  5.760   43.229  1.00 39.44  ? 1010 ASP A CB  1 
ATOM   1641 C  CG  . ASP A 1 226 ? -1.538  5.859   42.816  1.00 39.52  ? 1010 ASP A CG  1 
ATOM   1642 O  OD1 . ASP A 1 226 ? -2.059  4.874   42.255  1.00 40.04  ? 1010 ASP A OD1 1 
ATOM   1643 O  OD2 . ASP A 1 226 ? -2.162  6.917   43.053  1.00 37.33  ? 1010 ASP A OD2 1 
ATOM   1644 N  N   . GLU A 1 227 ? 2.975   6.321   43.192  1.00 45.70  ? 1011 GLU A N   1 
ATOM   1645 C  CA  . GLU A 1 227 ? 4.291   6.163   43.803  1.00 53.42  ? 1011 GLU A CA  1 
ATOM   1646 C  C   . GLU A 1 227 ? 5.335   7.070   43.157  1.00 47.94  ? 1011 GLU A C   1 
ATOM   1647 O  O   . GLU A 1 227 ? 6.487   7.113   43.591  1.00 44.91  ? 1011 GLU A O   1 
ATOM   1648 C  CB  . GLU A 1 227 ? 4.745   4.703   43.740  1.00 48.69  ? 1011 GLU A CB  1 
ATOM   1649 C  CG  . GLU A 1 227 ? 3.893   3.762   44.571  1.00 58.12  ? 1011 GLU A CG  1 
ATOM   1650 C  CD  . GLU A 1 227 ? 4.394   2.333   44.536  1.00 71.08  ? 1011 GLU A CD  1 
ATOM   1651 O  OE1 . GLU A 1 227 ? 4.061   1.563   45.463  1.00 63.08  ? 1011 GLU A OE1 1 
ATOM   1652 O  OE2 . GLU A 1 227 ? 5.116   1.980   43.579  1.00 91.98  ? 1011 GLU A OE2 1 
ATOM   1653 N  N   . GLY A 1 228 ? 4.927   7.798   42.124  1.00 43.81  ? 1012 GLY A N   1 
ATOM   1654 C  CA  . GLY A 1 228 ? 5.843   8.672   41.418  1.00 50.60  ? 1012 GLY A CA  1 
ATOM   1655 C  C   . GLY A 1 228 ? 6.900   7.897   40.653  1.00 57.04  ? 1012 GLY A C   1 
ATOM   1656 O  O   . GLY A 1 228 ? 6.924   6.665   40.667  1.00 45.63  ? 1012 GLY A O   1 
ATOM   1657 N  N   . LEU A 1 229 ? 7.776   8.629   39.975  1.00 55.99  ? 1013 LEU A N   1 
ATOM   1658 C  CA  . LEU A 1 229 ? 8.878   8.024   39.242  1.00 58.18  ? 1013 LEU A CA  1 
ATOM   1659 C  C   . LEU A 1 229 ? 10.178  8.771   39.513  1.00 62.11  ? 1013 LEU A C   1 
ATOM   1660 O  O   . LEU A 1 229 ? 10.365  9.899   39.057  1.00 65.10  ? 1013 LEU A O   1 
ATOM   1661 C  CB  . LEU A 1 229 ? 8.577   7.998   37.742  1.00 61.25  ? 1013 LEU A CB  1 
ATOM   1662 C  CG  . LEU A 1 229 ? 9.590   7.271   36.852  1.00 53.13  ? 1013 LEU A CG  1 
ATOM   1663 C  CD1 . LEU A 1 229 ? 8.905   6.690   35.630  1.00 58.62  ? 1013 LEU A CD1 1 
ATOM   1664 C  CD2 . LEU A 1 229 ? 10.736  8.191   36.448  1.00 59.24  ? 1013 LEU A CD2 1 
ATOM   1665 N  N   . ARG A 1 230 ? 11.069  8.136   40.266  1.00 57.82  ? 1014 ARG A N   1 
ATOM   1666 C  CA  . ARG A 1 230 ? 12.366  8.720   40.582  1.00 66.31  ? 1014 ARG A CA  1 
ATOM   1667 C  C   . ARG A 1 230 ? 13.491  7.884   39.984  1.00 60.36  ? 1014 ARG A C   1 
ATOM   1668 O  O   . ARG A 1 230 ? 13.488  6.660   40.095  1.00 54.19  ? 1014 ARG A O   1 
ATOM   1669 C  CB  . ARG A 1 230 ? 12.549  8.843   42.097  1.00 70.72  ? 1014 ARG A CB  1 
ATOM   1670 C  CG  . ARG A 1 230 ? 11.692  9.920   42.750  1.00 65.77  ? 1014 ARG A CG  1 
ATOM   1671 C  CD  . ARG A 1 230 ? 12.030  10.059  44.228  1.00 91.39  ? 1014 ARG A CD  1 
ATOM   1672 N  NE  . ARG A 1 230 ? 11.263  11.116  44.884  1.00 105.88 ? 1014 ARG A NE  1 
ATOM   1673 C  CZ  . ARG A 1 230 ? 11.713  12.350  45.088  1.00 105.45 ? 1014 ARG A CZ  1 
ATOM   1674 N  NH1 . ARG A 1 230 ? 12.932  12.690  44.689  1.00 91.06  ? 1014 ARG A NH1 1 
ATOM   1675 N  NH2 . ARG A 1 230 ? 10.945  13.247  45.694  1.00 108.50 ? 1014 ARG A NH2 1 
ATOM   1676 N  N   . LEU A 1 231 ? 14.451  8.547   39.349  1.00 70.34  ? 1015 LEU A N   1 
ATOM   1677 C  CA  . LEU A 1 231 ? 15.576  7.851   38.729  1.00 72.75  ? 1015 LEU A CA  1 
ATOM   1678 C  C   . LEU A 1 231 ? 16.775  7.786   39.672  1.00 76.88  ? 1015 LEU A C   1 
ATOM   1679 O  O   . LEU A 1 231 ? 17.812  7.213   39.337  1.00 70.19  ? 1015 LEU A O   1 
ATOM   1680 C  CB  . LEU A 1 231 ? 15.970  8.523   37.412  1.00 60.35  ? 1015 LEU A CB  1 
ATOM   1681 C  CG  . LEU A 1 231 ? 14.851  8.669   36.377  1.00 54.51  ? 1015 LEU A CG  1 
ATOM   1682 C  CD1 . LEU A 1 231 ? 15.393  9.235   35.075  1.00 59.22  ? 1015 LEU A CD1 1 
ATOM   1683 C  CD2 . LEU A 1 231 ? 14.165  7.338   36.133  1.00 52.02  ? 1015 LEU A CD2 1 
ATOM   1684 N  N   . LYS A 1 232 ? 16.622  8.379   40.851  1.00 75.83  ? 1016 LYS A N   1 
ATOM   1685 C  CA  . LYS A 1 232 ? 17.668  8.368   41.866  1.00 72.10  ? 1016 LYS A CA  1 
ATOM   1686 C  C   . LYS A 1 232 ? 17.149  7.732   43.152  1.00 78.55  ? 1016 LYS A C   1 
ATOM   1687 O  O   . LYS A 1 232 ? 15.982  7.898   43.506  1.00 72.79  ? 1016 LYS A O   1 
ATOM   1688 C  CB  . LYS A 1 232 ? 18.165  9.790   42.140  1.00 60.85  ? 1016 LYS A CB  1 
ATOM   1689 N  N   . ILE A 1 233 ? 18.020  7.002   43.843  1.00 80.70  ? 1017 ILE A N   1 
ATOM   1690 C  CA  . ILE A 1 233 ? 17.646  6.324   45.081  1.00 75.82  ? 1017 ILE A CA  1 
ATOM   1691 C  C   . ILE A 1 233 ? 17.040  7.288   46.096  1.00 75.68  ? 1017 ILE A C   1 
ATOM   1692 O  O   . ILE A 1 233 ? 17.679  8.257   46.508  1.00 69.16  ? 1017 ILE A O   1 
ATOM   1693 C  CB  . ILE A 1 233 ? 18.848  5.606   45.726  1.00 69.60  ? 1017 ILE A CB  1 
ATOM   1694 C  CG1 . ILE A 1 233 ? 19.362  4.497   44.806  1.00 74.29  ? 1017 ILE A CG1 1 
ATOM   1695 C  CG2 . ILE A 1 233 ? 18.461  5.041   47.084  1.00 66.33  ? 1017 ILE A CG2 1 
ATOM   1696 C  CD1 . ILE A 1 233 ? 20.502  3.689   45.386  1.00 64.48  ? 1017 ILE A CD1 1 
ATOM   1697 N  N   . TYR A 1 234 ? 15.801  7.020   46.492  1.00 71.09  ? 1018 TYR A N   1 
ATOM   1698 C  CA  . TYR A 1 234 ? 15.121  7.849   47.478  1.00 71.81  ? 1018 TYR A CA  1 
ATOM   1699 C  C   . TYR A 1 234 ? 14.622  7.006   48.646  1.00 76.84  ? 1018 TYR A C   1 
ATOM   1700 O  O   . TYR A 1 234 ? 13.995  5.965   48.451  1.00 82.99  ? 1018 TYR A O   1 
ATOM   1701 C  CB  . TYR A 1 234 ? 13.961  8.616   46.834  1.00 75.55  ? 1018 TYR A CB  1 
ATOM   1702 C  CG  . TYR A 1 234 ? 12.859  7.731   46.294  1.00 85.11  ? 1018 TYR A CG  1 
ATOM   1703 C  CD1 . TYR A 1 234 ? 11.640  7.628   46.952  1.00 82.29  ? 1018 TYR A CD1 1 
ATOM   1704 C  CD2 . TYR A 1 234 ? 13.038  6.998   45.126  1.00 80.38  ? 1018 TYR A CD2 1 
ATOM   1705 C  CE1 . TYR A 1 234 ? 10.628  6.821   46.464  1.00 76.26  ? 1018 TYR A CE1 1 
ATOM   1706 C  CE2 . TYR A 1 234 ? 12.032  6.189   44.628  1.00 77.14  ? 1018 TYR A CE2 1 
ATOM   1707 C  CZ  . TYR A 1 234 ? 10.830  6.104   45.302  1.00 87.38  ? 1018 TYR A CZ  1 
ATOM   1708 O  OH  . TYR A 1 234 ? 9.828   5.299   44.810  1.00 82.87  ? 1018 TYR A OH  1 
ATOM   1709 N  N   . LYS A 1 235 ? 14.916  7.458   49.860  1.00 78.52  ? 1019 LYS A N   1 
ATOM   1710 C  CA  . LYS A 1 235 ? 14.492  6.753   51.061  1.00 87.82  ? 1019 LYS A CA  1 
ATOM   1711 C  C   . LYS A 1 235 ? 12.974  6.793   51.193  1.00 91.70  ? 1019 LYS A C   1 
ATOM   1712 O  O   . LYS A 1 235 ? 12.364  7.861   51.127  1.00 83.24  ? 1019 LYS A O   1 
ATOM   1713 C  CB  . LYS A 1 235 ? 15.148  7.369   52.298  1.00 84.78  ? 1019 LYS A CB  1 
ATOM   1714 N  N   . ASP A 1 236 ? 12.368  5.625   51.375  1.00 94.66  ? 1020 ASP A N   1 
ATOM   1715 C  CA  . ASP A 1 236 ? 10.921  5.537   51.528  1.00 93.35  ? 1020 ASP A CA  1 
ATOM   1716 C  C   . ASP A 1 236 ? 10.489  6.040   52.901  1.00 101.45 ? 1020 ASP A C   1 
ATOM   1717 O  O   . ASP A 1 236 ? 11.301  6.129   53.823  1.00 99.17  ? 1020 ASP A O   1 
ATOM   1718 C  CB  . ASP A 1 236 ? 10.448  4.097   51.318  1.00 97.23  ? 1020 ASP A CB  1 
ATOM   1719 C  CG  . ASP A 1 236 ? 8.959   3.933   51.552  1.00 102.95 ? 1020 ASP A CG  1 
ATOM   1720 O  OD1 . ASP A 1 236 ? 8.196   4.853   51.189  1.00 100.90 ? 1020 ASP A OD1 1 
ATOM   1721 O  OD2 . ASP A 1 236 ? 8.551   2.889   52.103  1.00 106.16 ? 1020 ASP A OD2 1 
ATOM   1722 N  N   . THR A 1 237 ? 9.208   6.371   53.031  1.00 102.42 ? 1021 THR A N   1 
ATOM   1723 C  CA  . THR A 1 237 ? 8.663   6.834   54.301  1.00 103.96 ? 1021 THR A CA  1 
ATOM   1724 C  C   . THR A 1 237 ? 8.943   5.821   55.408  1.00 105.88 ? 1021 THR A C   1 
ATOM   1725 O  O   . THR A 1 237 ? 9.138   6.189   56.566  1.00 103.08 ? 1021 THR A O   1 
ATOM   1726 C  CB  . THR A 1 237 ? 7.146   7.078   54.212  1.00 99.59  ? 1021 THR A CB  1 
ATOM   1727 O  OG1 . THR A 1 237 ? 6.477   5.846   53.916  1.00 95.29  ? 1021 THR A OG1 1 
ATOM   1728 C  CG2 . THR A 1 237 ? 6.829   8.094   53.125  1.00 79.92  ? 1021 THR A CG2 1 
ATOM   1729 N  N   . GLU A 1 238 ? 8.954   4.544   55.039  1.00 109.31 ? 1022 GLU A N   1 
ATOM   1730 C  CA  . GLU A 1 238 ? 9.277   3.474   55.974  1.00 104.64 ? 1022 GLU A CA  1 
ATOM   1731 C  C   . GLU A 1 238 ? 10.752  3.527   56.360  1.00 108.70 ? 1022 GLU A C   1 
ATOM   1732 O  O   . GLU A 1 238 ? 11.138  3.059   57.431  1.00 102.26 ? 1022 GLU A O   1 
ATOM   1733 C  CB  . GLU A 1 238 ? 8.932   2.111   55.368  1.00 99.37  ? 1022 GLU A CB  1 
ATOM   1734 N  N   . GLY A 1 239 ? 11.571  4.095   55.479  1.00 107.15 ? 1023 GLY A N   1 
ATOM   1735 C  CA  . GLY A 1 239 ? 12.985  4.272   55.757  1.00 98.39  ? 1023 GLY A CA  1 
ATOM   1736 C  C   . GLY A 1 239 ? 13.891  3.377   54.933  1.00 98.63  ? 1023 GLY A C   1 
ATOM   1737 O  O   . GLY A 1 239 ? 15.115  3.446   55.048  1.00 99.72  ? 1023 GLY A O   1 
ATOM   1738 N  N   . TYR A 1 240 ? 13.292  2.533   54.099  1.00 99.25  ? 1024 TYR A N   1 
ATOM   1739 C  CA  . TYR A 1 240 ? 14.059  1.605   53.273  1.00 104.15 ? 1024 TYR A CA  1 
ATOM   1740 C  C   . TYR A 1 240 ? 14.503  2.242   51.956  1.00 102.76 ? 1024 TYR A C   1 
ATOM   1741 O  O   . TYR A 1 240 ? 14.065  3.336   51.601  1.00 91.99  ? 1024 TYR A O   1 
ATOM   1742 C  CB  . TYR A 1 240 ? 13.253  0.333   52.997  1.00 92.30  ? 1024 TYR A CB  1 
ATOM   1743 N  N   . TYR A 1 241 ? 15.380  1.545   51.239  1.00 104.49 ? 1025 TYR A N   1 
ATOM   1744 C  CA  . TYR A 1 241 ? 15.878  2.009   49.947  1.00 99.41  ? 1025 TYR A CA  1 
ATOM   1745 C  C   . TYR A 1 241 ? 14.902  1.673   48.818  1.00 92.06  ? 1025 TYR A C   1 
ATOM   1746 O  O   . TYR A 1 241 ? 14.348  0.574   48.773  1.00 83.41  ? 1025 TYR A O   1 
ATOM   1747 C  CB  . TYR A 1 241 ? 17.252  1.397   49.656  1.00 85.18  ? 1025 TYR A CB  1 
ATOM   1748 N  N   . THR A 1 242 ? 14.702  2.622   47.907  1.00 89.47  ? 1026 THR A N   1 
ATOM   1749 C  CA  . THR A 1 242 ? 13.757  2.450   46.803  1.00 88.08  ? 1026 THR A CA  1 
ATOM   1750 C  C   . THR A 1 242 ? 14.258  3.115   45.518  1.00 78.07  ? 1026 THR A C   1 
ATOM   1751 O  O   . THR A 1 242 ? 15.067  4.041   45.567  1.00 79.23  ? 1026 THR A O   1 
ATOM   1752 C  CB  . THR A 1 242 ? 12.364  3.007   47.170  1.00 82.67  ? 1026 THR A CB  1 
ATOM   1753 O  OG1 . THR A 1 242 ? 11.895  2.374   48.368  1.00 88.01  ? 1026 THR A OG1 1 
ATOM   1754 C  CG2 . THR A 1 242 ? 11.367  2.757   46.048  1.00 73.94  ? 1026 THR A CG2 1 
ATOM   1755 N  N   . ILE A 1 243 ? 13.781  2.634   44.371  1.00 75.04  ? 1027 ILE A N   1 
ATOM   1756 C  CA  . ILE A 1 243 ? 14.182  3.180   43.074  1.00 65.71  ? 1027 ILE A CA  1 
ATOM   1757 C  C   . ILE A 1 243 ? 13.030  3.125   42.066  1.00 60.00  ? 1027 ILE A C   1 
ATOM   1758 O  O   . ILE A 1 243 ? 12.077  2.370   42.246  1.00 64.44  ? 1027 ILE A O   1 
ATOM   1759 C  CB  . ILE A 1 243 ? 15.403  2.425   42.503  1.00 67.03  ? 1027 ILE A CB  1 
ATOM   1760 C  CG1 . ILE A 1 243 ? 16.084  3.248   41.407  1.00 60.34  ? 1027 ILE A CG1 1 
ATOM   1761 C  CG2 . ILE A 1 243 ? 14.994  1.046   41.994  1.00 53.86  ? 1027 ILE A CG2 1 
ATOM   1762 C  CD1 . ILE A 1 243 ? 16.584  4.596   41.877  1.00 54.95  ? 1027 ILE A CD1 1 
ATOM   1763 N  N   . GLY A 1 244 ? 13.121  3.934   41.013  1.00 60.93  ? 1028 GLY A N   1 
ATOM   1764 C  CA  . GLY A 1 244 ? 12.122  3.945   39.957  1.00 57.12  ? 1028 GLY A CA  1 
ATOM   1765 C  C   . GLY A 1 244 ? 10.716  4.212   40.455  1.00 57.04  ? 1028 GLY A C   1 
ATOM   1766 O  O   . GLY A 1 244 ? 10.457  5.220   41.104  1.00 64.46  ? 1028 GLY A O   1 
ATOM   1767 N  N   . ILE A 1 245 ? 9.799   3.305   40.137  1.00 55.37  ? 1029 ILE A N   1 
ATOM   1768 C  CA  . ILE A 1 245 ? 8.427   3.403   40.620  1.00 64.34  ? 1029 ILE A CA  1 
ATOM   1769 C  C   . ILE A 1 245 ? 8.220   2.494   41.831  1.00 66.84  ? 1029 ILE A C   1 
ATOM   1770 O  O   . ILE A 1 245 ? 7.842   1.332   41.691  1.00 64.65  ? 1029 ILE A O   1 
ATOM   1771 C  CB  . ILE A 1 245 ? 7.397   3.058   39.520  1.00 62.00  ? 1029 ILE A CB  1 
ATOM   1772 C  CG1 . ILE A 1 245 ? 7.545   4.009   38.331  1.00 56.09  ? 1029 ILE A CG1 1 
ATOM   1773 C  CG2 . ILE A 1 245 ? 5.985   3.122   40.082  1.00 65.11  ? 1029 ILE A CG2 1 
ATOM   1774 C  CD1 . ILE A 1 245 ? 6.425   3.910   37.334  1.00 43.09  ? 1029 ILE A CD1 1 
ATOM   1775 N  N   . GLY A 1 246 ? 8.486   3.033   43.017  1.00 63.67  ? 1030 GLY A N   1 
ATOM   1776 C  CA  . GLY A 1 246 ? 8.330   2.291   44.254  1.00 68.86  ? 1030 GLY A CA  1 
ATOM   1777 C  C   . GLY A 1 246 ? 8.854   0.866   44.193  1.00 67.65  ? 1030 GLY A C   1 
ATOM   1778 O  O   . GLY A 1 246 ? 8.119   -0.089  44.453  1.00 74.44  ? 1030 GLY A O   1 
ATOM   1779 N  N   . HIS A 1 247 ? 10.128  0.720   43.842  1.00 63.18  ? 1031 HIS A N   1 
ATOM   1780 C  CA  . HIS A 1 247 ? 10.781  -0.589  43.845  1.00 66.79  ? 1031 HIS A CA  1 
ATOM   1781 C  C   . HIS A 1 247 ? 11.685  -0.741  45.066  1.00 69.19  ? 1031 HIS A C   1 
ATOM   1782 O  O   . HIS A 1 247 ? 12.697  -0.055  45.186  1.00 65.99  ? 1031 HIS A O   1 
ATOM   1783 C  CB  . HIS A 1 247 ? 11.596  -0.801  42.566  1.00 57.50  ? 1031 HIS A CB  1 
ATOM   1784 C  CG  . HIS A 1 247 ? 12.297  -2.127  42.506  1.00 61.36  ? 1031 HIS A CG  1 
ATOM   1785 N  ND1 . HIS A 1 247 ? 11.647  -3.301  42.212  1.00 61.73  ? 1031 HIS A ND1 1 
ATOM   1786 C  CD2 . HIS A 1 247 ? 13.602  -2.451  42.698  1.00 59.17  ? 1031 HIS A CD2 1 
ATOM   1787 C  CE1 . HIS A 1 247 ? 12.518  -4.301  42.227  1.00 58.52  ? 1031 HIS A CE1 1 
ATOM   1788 N  NE2 . HIS A 1 247 ? 13.703  -3.813  42.518  1.00 54.04  ? 1031 HIS A NE2 1 
ATOM   1789 N  N   . LEU A 1 248 ? 11.315  -1.649  45.965  1.00 68.50  ? 1032 LEU A N   1 
ATOM   1790 C  CA  . LEU A 1 248 ? 12.050  -1.853  47.214  1.00 75.28  ? 1032 LEU A CA  1 
ATOM   1791 C  C   . LEU A 1 248 ? 13.417  -2.502  46.989  1.00 74.37  ? 1032 LEU A C   1 
ATOM   1792 O  O   . LEU A 1 248 ? 13.524  -3.504  46.284  1.00 63.27  ? 1032 LEU A O   1 
ATOM   1793 C  CB  . LEU A 1 248 ? 11.227  -2.713  48.177  1.00 85.69  ? 1032 LEU A CB  1 
ATOM   1794 C  CG  . LEU A 1 248 ? 11.730  -2.775  49.620  1.00 88.22  ? 1032 LEU A CG  1 
ATOM   1795 C  CD1 . LEU A 1 248 ? 11.792  -1.373  50.200  1.00 81.46  ? 1032 LEU A CD1 1 
ATOM   1796 C  CD2 . LEU A 1 248 ? 10.844  -3.676  50.469  1.00 63.76  ? 1032 LEU A CD2 1 
ATOM   1797 N  N   . LEU A 1 249 ? 14.458  -1.945  47.603  1.00 79.17  ? 1033 LEU A N   1 
ATOM   1798 C  CA  . LEU A 1 249 ? 15.816  -2.458  47.412  1.00 85.80  ? 1033 LEU A CA  1 
ATOM   1799 C  C   . LEU A 1 249 ? 16.382  -3.194  48.630  1.00 100.95 ? 1033 LEU A C   1 
ATOM   1800 O  O   . LEU A 1 249 ? 16.594  -4.407  48.584  1.00 101.53 ? 1033 LEU A O   1 
ATOM   1801 C  CB  . LEU A 1 249 ? 16.762  -1.328  46.994  1.00 86.07  ? 1033 LEU A CB  1 
ATOM   1802 C  CG  . LEU A 1 249 ? 16.455  -0.686  45.638  1.00 74.37  ? 1033 LEU A CG  1 
ATOM   1803 C  CD1 . LEU A 1 249 ? 17.359  0.509   45.386  1.00 66.56  ? 1033 LEU A CD1 1 
ATOM   1804 C  CD2 . LEU A 1 249 ? 16.585  -1.710  44.519  1.00 69.61  ? 1033 LEU A CD2 1 
ATOM   1805 N  N   . THR A 1 250 ? 16.635  -2.460  49.711  1.00 106.46 ? 1034 THR A N   1 
ATOM   1806 C  CA  . THR A 1 250 ? 17.212  -3.054  50.916  1.00 105.16 ? 1034 THR A CA  1 
ATOM   1807 C  C   . THR A 1 250 ? 16.842  -2.266  52.167  1.00 112.41 ? 1034 THR A C   1 
ATOM   1808 O  O   . THR A 1 250 ? 16.246  -1.194  52.086  1.00 106.15 ? 1034 THR A O   1 
ATOM   1809 C  CB  . THR A 1 250 ? 18.751  -3.142  50.828  1.00 102.99 ? 1034 THR A CB  1 
ATOM   1810 O  OG1 . THR A 1 250 ? 19.247  -3.974  51.885  1.00 111.04 ? 1034 THR A OG1 1 
ATOM   1811 C  CG2 . THR A 1 250 ? 19.373  -1.757  50.940  1.00 104.68 ? 1034 THR A CG2 1 
ATOM   1812 N  N   . LYS A 1 251 ? 17.217  -2.800  53.325  1.00 118.20 ? 1035 LYS A N   1 
ATOM   1813 C  CA  . LYS A 1 251 ? 16.869  -2.196  54.605  1.00 116.45 ? 1035 LYS A CA  1 
ATOM   1814 C  C   . LYS A 1 251 ? 18.078  -1.525  55.250  1.00 116.18 ? 1035 LYS A C   1 
ATOM   1815 O  O   . LYS A 1 251 ? 17.954  -0.853  56.273  1.00 108.71 ? 1035 LYS A O   1 
ATOM   1816 C  CB  . LYS A 1 251 ? 16.323  -3.265  55.555  1.00 112.53 ? 1035 LYS A CB  1 
ATOM   1817 C  CG  . LYS A 1 251 ? 15.408  -4.283  54.899  1.00 103.08 ? 1035 LYS A CG  1 
ATOM   1818 C  CD  . LYS A 1 251 ? 14.109  -3.656  54.425  1.00 89.55  ? 1035 LYS A CD  1 
ATOM   1819 C  CE  . LYS A 1 251 ? 13.176  -4.718  53.873  1.00 79.17  ? 1035 LYS A CE  1 
ATOM   1820 N  NZ  . LYS A 1 251 ? 13.870  -5.576  52.873  1.00 90.55  ? 1035 LYS A NZ  1 
ATOM   1821 N  N   . SER A 1 252 ? 19.248  -1.714  54.649  1.00 119.26 ? 1036 SER A N   1 
ATOM   1822 C  CA  . SER A 1 252 ? 20.502  -1.250  55.237  1.00 122.64 ? 1036 SER A CA  1 
ATOM   1823 C  C   . SER A 1 252 ? 20.639  0.270   55.263  1.00 123.91 ? 1036 SER A C   1 
ATOM   1824 O  O   . SER A 1 252 ? 20.126  0.962   54.384  1.00 125.62 ? 1036 SER A O   1 
ATOM   1825 C  CB  . SER A 1 252 ? 21.691  -1.866  54.493  1.00 118.90 ? 1036 SER A CB  1 
ATOM   1826 O  OG  . SER A 1 252 ? 22.925  -1.342  54.953  1.00 114.22 ? 1036 SER A OG  1 
ATOM   1827 N  N   . PRO A 1 253 ? 21.346  0.789   56.281  1.00 128.00 ? 1037 PRO A N   1 
ATOM   1828 C  CA  . PRO A 1 253 ? 21.681  2.213   56.383  1.00 133.91 ? 1037 PRO A CA  1 
ATOM   1829 C  C   . PRO A 1 253 ? 22.822  2.574   55.436  1.00 127.11 ? 1037 PRO A C   1 
ATOM   1830 O  O   . PRO A 1 253 ? 23.077  3.754   55.191  1.00 119.04 ? 1037 PRO A O   1 
ATOM   1831 C  CB  . PRO A 1 253 ? 22.138  2.357   57.835  1.00 138.05 ? 1037 PRO A CB  1 
ATOM   1832 C  CG  . PRO A 1 253 ? 22.676  1.015   58.189  1.00 132.08 ? 1037 PRO A CG  1 
ATOM   1833 C  CD  . PRO A 1 253 ? 21.809  0.027   57.455  1.00 134.41 ? 1037 PRO A CD  1 
ATOM   1834 N  N   . SER A 1 254 ? 23.500  1.556   54.914  1.00 126.72 ? 1038 SER A N   1 
ATOM   1835 C  CA  . SER A 1 254 ? 24.585  1.754   53.961  1.00 123.18 ? 1038 SER A CA  1 
ATOM   1836 C  C   . SER A 1 254 ? 24.047  1.785   52.534  1.00 118.26 ? 1038 SER A C   1 
ATOM   1837 O  O   . SER A 1 254 ? 23.456  0.814   52.061  1.00 108.86 ? 1038 SER A O   1 
ATOM   1838 C  CB  . SER A 1 254 ? 25.639  0.653   54.107  1.00 107.23 ? 1038 SER A CB  1 
ATOM   1839 O  OG  . SER A 1 254 ? 25.073  -0.629  53.896  1.00 104.37 ? 1038 SER A OG  1 
ATOM   1840 N  N   . LEU A 1 255 ? 24.252  2.909   51.855  1.00 113.26 ? 1039 LEU A N   1 
ATOM   1841 C  CA  . LEU A 1 255 ? 23.789  3.068   50.483  1.00 99.10  ? 1039 LEU A CA  1 
ATOM   1842 C  C   . LEU A 1 255 ? 24.311  1.947   49.589  1.00 108.43 ? 1039 LEU A C   1 
ATOM   1843 O  O   . LEU A 1 255 ? 23.566  1.387   48.785  1.00 112.18 ? 1039 LEU A O   1 
ATOM   1844 C  CB  . LEU A 1 255 ? 24.208  4.431   49.926  1.00 84.07  ? 1039 LEU A CB  1 
ATOM   1845 C  CG  . LEU A 1 255 ? 23.344  5.640   50.298  1.00 81.52  ? 1039 LEU A CG  1 
ATOM   1846 C  CD1 . LEU A 1 255 ? 23.186  5.775   51.807  1.00 81.82  ? 1039 LEU A CD1 1 
ATOM   1847 C  CD2 . LEU A 1 255 ? 23.923  6.915   49.697  1.00 80.96  ? 1039 LEU A CD2 1 
ATOM   1848 N  N   . ASN A 1 256 ? 25.590  1.619   49.740  1.00 107.97 ? 1040 ASN A N   1 
ATOM   1849 C  CA  . ASN A 1 256 ? 26.212  0.568   48.938  1.00 110.78 ? 1040 ASN A CA  1 
ATOM   1850 C  C   . ASN A 1 256 ? 25.491  -0.773  49.043  1.00 107.99 ? 1040 ASN A C   1 
ATOM   1851 O  O   . ASN A 1 256 ? 25.547  -1.589  48.122  1.00 106.25 ? 1040 ASN A O   1 
ATOM   1852 C  CB  . ASN A 1 256 ? 27.690  0.405   49.302  1.00 108.94 ? 1040 ASN A CB  1 
ATOM   1853 C  CG  . ASN A 1 256 ? 28.545  1.550   48.796  1.00 117.28 ? 1040 ASN A CG  1 
ATOM   1854 O  OD1 . ASN A 1 256 ? 28.157  2.273   47.877  1.00 114.20 ? 1040 ASN A OD1 1 
ATOM   1855 N  ND2 . ASN A 1 256 ? 29.721  1.717   49.390  1.00 121.08 ? 1040 ASN A ND2 1 
ATOM   1856 N  N   . ALA A 1 257 ? 24.821  -1.002  50.168  1.00 102.40 ? 1041 ALA A N   1 
ATOM   1857 C  CA  . ALA A 1 257 ? 24.037  -2.217  50.341  1.00 104.55 ? 1041 ALA A CA  1 
ATOM   1858 C  C   . ALA A 1 257 ? 22.870  -2.221  49.360  1.00 102.86 ? 1041 ALA A C   1 
ATOM   1859 O  O   . ALA A 1 257 ? 22.465  -3.272  48.863  1.00 96.82  ? 1041 ALA A O   1 
ATOM   1860 C  CB  . ALA A 1 257 ? 23.537  -2.329  51.767  1.00 106.15 ? 1041 ALA A CB  1 
ATOM   1861 N  N   . ALA A 1 258 ? 22.334  -1.036  49.085  1.00 100.39 ? 1042 ALA A N   1 
ATOM   1862 C  CA  . ALA A 1 258 ? 21.271  -0.890  48.101  1.00 94.02  ? 1042 ALA A CA  1 
ATOM   1863 C  C   . ALA A 1 258 ? 21.850  -0.959  46.694  1.00 91.69  ? 1042 ALA A C   1 
ATOM   1864 O  O   . ALA A 1 258 ? 21.349  -1.692  45.840  1.00 85.87  ? 1042 ALA A O   1 
ATOM   1865 C  CB  . ALA A 1 258 ? 20.527  0.419   48.311  1.00 88.76  ? 1042 ALA A CB  1 
ATOM   1866 N  N   . LYS A 1 259 ? 22.914  -0.195  46.464  1.00 94.04  ? 1043 LYS A N   1 
ATOM   1867 C  CA  . LYS A 1 259 ? 23.593  -0.179  45.173  1.00 95.21  ? 1043 LYS A CA  1 
ATOM   1868 C  C   . LYS A 1 259 ? 23.900  -1.597  44.695  1.00 96.07  ? 1043 LYS A C   1 
ATOM   1869 O  O   . LYS A 1 259 ? 23.969  -1.856  43.495  1.00 95.67  ? 1043 LYS A O   1 
ATOM   1870 C  CB  . LYS A 1 259 ? 24.885  0.641   45.252  1.00 98.91  ? 1043 LYS A CB  1 
ATOM   1871 C  CG  . LYS A 1 259 ? 24.699  2.056   45.789  1.00 95.35  ? 1043 LYS A CG  1 
ATOM   1872 C  CD  . LYS A 1 259 ? 25.979  2.873   45.677  1.00 95.38  ? 1043 LYS A CD  1 
ATOM   1873 C  CE  . LYS A 1 259 ? 25.861  4.195   46.423  1.00 86.58  ? 1043 LYS A CE  1 
ATOM   1874 N  NZ  . LYS A 1 259 ? 24.678  4.988   45.989  1.00 72.60  ? 1043 LYS A NZ  1 
ATOM   1875 N  N   . SER A 1 260 ? 24.082  -2.511  45.643  1.00 98.11  ? 1044 SER A N   1 
ATOM   1876 C  CA  . SER A 1 260 ? 24.346  -3.908  45.324  1.00 92.15  ? 1044 SER A CA  1 
ATOM   1877 C  C   . SER A 1 260 ? 23.127  -4.541  44.668  1.00 92.11  ? 1044 SER A C   1 
ATOM   1878 O  O   . SER A 1 260 ? 23.212  -5.075  43.562  1.00 104.21 ? 1044 SER A O   1 
ATOM   1879 C  CB  . SER A 1 260 ? 24.726  -4.685  46.587  1.00 92.14  ? 1044 SER A CB  1 
ATOM   1880 O  OG  . SER A 1 260 ? 24.970  -6.051  46.294  1.00 83.92  ? 1044 SER A OG  1 
ATOM   1881 N  N   . GLU A 1 261 ? 21.992  -4.474  45.356  1.00 88.73  ? 1045 GLU A N   1 
ATOM   1882 C  CA  . GLU A 1 261 ? 20.748  -5.026  44.836  1.00 94.58  ? 1045 GLU A CA  1 
ATOM   1883 C  C   . GLU A 1 261 ? 20.334  -4.351  43.527  1.00 93.44  ? 1045 GLU A C   1 
ATOM   1884 O  O   . GLU A 1 261 ? 19.834  -5.008  42.613  1.00 88.34  ? 1045 GLU A O   1 
ATOM   1885 C  CB  . GLU A 1 261 ? 19.632  -4.909  45.878  1.00 97.52  ? 1045 GLU A CB  1 
ATOM   1886 C  CG  . GLU A 1 261 ? 19.015  -6.240  46.273  1.00 96.58  ? 1045 GLU A CG  1 
ATOM   1887 C  CD  . GLU A 1 261 ? 18.364  -6.950  45.102  1.00 103.32 ? 1045 GLU A CD  1 
ATOM   1888 O  OE1 . GLU A 1 261 ? 18.197  -8.186  45.172  1.00 98.62  ? 1045 GLU A OE1 1 
ATOM   1889 O  OE2 . GLU A 1 261 ? 18.016  -6.273  44.111  1.00 96.79  ? 1045 GLU A OE2 1 
ATOM   1890 N  N   . LEU A 1 262 ? 20.552  -3.041  43.439  1.00 90.03  ? 1046 LEU A N   1 
ATOM   1891 C  CA  . LEU A 1 262 ? 20.199  -2.283  42.241  1.00 81.80  ? 1046 LEU A CA  1 
ATOM   1892 C  C   . LEU A 1 262 ? 21.022  -2.729  41.034  1.00 86.02  ? 1046 LEU A C   1 
ATOM   1893 O  O   . LEU A 1 262 ? 20.470  -3.031  39.974  1.00 86.21  ? 1046 LEU A O   1 
ATOM   1894 C  CB  . LEU A 1 262 ? 20.377  -0.780  42.474  1.00 78.45  ? 1046 LEU A CB  1 
ATOM   1895 C  CG  . LEU A 1 262 ? 19.880  0.135   41.350  1.00 70.66  ? 1046 LEU A CG  1 
ATOM   1896 C  CD1 . LEU A 1 262 ? 18.373  0.011   41.185  1.00 61.52  ? 1046 LEU A CD1 1 
ATOM   1897 C  CD2 . LEU A 1 262 ? 20.272  1.581   41.608  1.00 72.62  ? 1046 LEU A CD2 1 
ATOM   1898 N  N   . ASP A 1 263 ? 22.341  -2.766  41.203  1.00 87.08  ? 1047 ASP A N   1 
ATOM   1899 C  CA  . ASP A 1 263 ? 23.241  -3.191  40.133  1.00 89.42  ? 1047 ASP A CA  1 
ATOM   1900 C  C   . ASP A 1 263 ? 23.014  -4.655  39.761  1.00 90.65  ? 1047 ASP A C   1 
ATOM   1901 O  O   . ASP A 1 263 ? 23.449  -5.109  38.704  1.00 88.60  ? 1047 ASP A O   1 
ATOM   1902 C  CB  . ASP A 1 263 ? 24.707  -2.964  40.522  1.00 90.81  ? 1047 ASP A CB  1 
ATOM   1903 C  CG  . ASP A 1 263 ? 25.086  -1.491  40.549  1.00 97.58  ? 1047 ASP A CG  1 
ATOM   1904 O  OD1 . ASP A 1 263 ? 24.434  -0.687  39.848  1.00 91.99  ? 1047 ASP A OD1 1 
ATOM   1905 O  OD2 . ASP A 1 263 ? 26.045  -1.138  41.268  1.00 104.69 ? 1047 ASP A OD2 1 
ATOM   1906 N  N   . LYS A 1 264 ? 22.333  -5.388  40.638  1.00 87.59  ? 1048 LYS A N   1 
ATOM   1907 C  CA  . LYS A 1 264 ? 21.967  -6.774  40.361  1.00 87.62  ? 1048 LYS A CA  1 
ATOM   1908 C  C   . LYS A 1 264 ? 20.730  -6.829  39.470  1.00 82.72  ? 1048 LYS A C   1 
ATOM   1909 O  O   . LYS A 1 264 ? 20.602  -7.713  38.623  1.00 79.86  ? 1048 LYS A O   1 
ATOM   1910 C  CB  . LYS A 1 264 ? 21.725  -7.554  41.662  1.00 83.99  ? 1048 LYS A CB  1 
ATOM   1911 C  CG  . LYS A 1 264 ? 22.986  -8.144  42.292  1.00 86.94  ? 1048 LYS A CG  1 
ATOM   1912 C  CD  . LYS A 1 264 ? 22.670  -9.024  43.503  1.00 82.92  ? 1048 LYS A CD  1 
ATOM   1913 C  CE  . LYS A 1 264 ? 22.237  -8.198  44.707  1.00 84.45  ? 1048 LYS A CE  1 
ATOM   1914 N  NZ  . LYS A 1 264 ? 21.998  -9.036  45.917  1.00 82.70  ? 1048 LYS A NZ  1 
ATOM   1915 N  N   . ALA A 1 265 ? 19.822  -5.878  39.666  1.00 82.39  ? 1049 ALA A N   1 
ATOM   1916 C  CA  . ALA A 1 265 ? 18.607  -5.799  38.864  1.00 77.02  ? 1049 ALA A CA  1 
ATOM   1917 C  C   . ALA A 1 265 ? 18.895  -5.183  37.501  1.00 85.74  ? 1049 ALA A C   1 
ATOM   1918 O  O   . ALA A 1 265 ? 18.286  -5.556  36.498  1.00 88.98  ? 1049 ALA A O   1 
ATOM   1919 C  CB  . ALA A 1 265 ? 17.540  -4.997  39.594  1.00 75.58  ? 1049 ALA A CB  1 
ATOM   1920 N  N   . ILE A 1 266 ? 19.827  -4.237  37.472  1.00 84.07  ? 1050 ILE A N   1 
ATOM   1921 C  CA  . ILE A 1 266 ? 20.202  -3.577  36.226  1.00 87.64  ? 1050 ILE A CA  1 
ATOM   1922 C  C   . ILE A 1 266 ? 21.225  -4.403  35.449  1.00 87.31  ? 1050 ILE A C   1 
ATOM   1923 O  O   . ILE A 1 266 ? 21.209  -4.428  34.219  1.00 92.31  ? 1050 ILE A O   1 
ATOM   1924 C  CB  . ILE A 1 266 ? 20.767  -2.165  36.479  1.00 85.46  ? 1050 ILE A CB  1 
ATOM   1925 C  CG1 . ILE A 1 266 ? 19.774  -1.328  37.288  1.00 84.44  ? 1050 ILE A CG1 1 
ATOM   1926 C  CG2 . ILE A 1 266 ? 21.096  -1.476  35.163  1.00 74.63  ? 1050 ILE A CG2 1 
ATOM   1927 C  CD1 . ILE A 1 266 ? 18.454  -1.093  36.583  1.00 73.64  ? 1050 ILE A CD1 1 
ATOM   1928 N  N   . GLY A 1 267 ? 22.107  -5.085  36.173  1.00 94.41  ? 1051 GLY A N   1 
ATOM   1929 C  CA  . GLY A 1 267 ? 23.151  -5.878  35.550  1.00 103.50 ? 1051 GLY A CA  1 
ATOM   1930 C  C   . GLY A 1 267 ? 24.337  -5.013  35.175  1.00 107.17 ? 1051 GLY A C   1 
ATOM   1931 O  O   . GLY A 1 267 ? 25.268  -5.461  34.506  1.00 116.68 ? 1051 GLY A O   1 
ATOM   1932 N  N   . ARG A 1 268 ? 24.295  -3.762  35.617  1.00 96.28  ? 1052 ARG A N   1 
ATOM   1933 C  CA  . ARG A 1 268 ? 25.335  -2.791  35.314  1.00 89.26  ? 1052 ARG A CA  1 
ATOM   1934 C  C   . ARG A 1 268 ? 25.619  -1.927  36.535  1.00 90.71  ? 1052 ARG A C   1 
ATOM   1935 O  O   . ARG A 1 268 ? 24.744  -1.701  37.365  1.00 94.46  ? 1052 ARG A O   1 
ATOM   1936 C  CB  . ARG A 1 268 ? 24.907  -1.906  34.142  1.00 82.89  ? 1052 ARG A CB  1 
ATOM   1937 C  CG  . ARG A 1 268 ? 25.799  -0.702  33.903  1.00 88.26  ? 1052 ARG A CG  1 
ATOM   1938 C  CD  . ARG A 1 268 ? 25.170  0.249   32.904  1.00 85.87  ? 1052 ARG A CD  1 
ATOM   1939 N  NE  . ARG A 1 268 ? 23.848  0.695   33.335  1.00 75.82  ? 1052 ARG A NE  1 
ATOM   1940 C  CZ  . ARG A 1 268 ? 23.624  1.798   34.043  1.00 83.02  ? 1052 ARG A CZ  1 
ATOM   1941 N  NH1 . ARG A 1 268 ? 24.637  2.573   34.405  1.00 88.29  ? 1052 ARG A NH1 1 
ATOM   1942 N  NH2 . ARG A 1 268 ? 22.387  2.126   34.389  1.00 85.50  ? 1052 ARG A NH2 1 
ATOM   1943 N  N   . ASN A 1 269 ? 26.854  -1.452  36.643  1.00 90.08  ? 1053 ASN A N   1 
ATOM   1944 C  CA  . ASN A 1 269 ? 27.225  -0.537  37.716  1.00 97.72  ? 1053 ASN A CA  1 
ATOM   1945 C  C   . ASN A 1 269 ? 26.607  0.840   37.498  1.00 94.03  ? 1053 ASN A C   1 
ATOM   1946 O  O   . ASN A 1 269 ? 27.103  1.635   36.700  1.00 90.77  ? 1053 ASN A O   1 
ATOM   1947 C  CB  . ASN A 1 269 ? 28.747  -0.431  37.843  1.00 103.08 ? 1053 ASN A CB  1 
ATOM   1948 C  CG  . ASN A 1 269 ? 29.376  -1.703  38.376  1.00 113.16 ? 1053 ASN A CG  1 
ATOM   1949 O  OD1 . ASN A 1 269 ? 28.762  -2.432  39.160  1.00 109.46 ? 1053 ASN A OD1 1 
ATOM   1950 N  ND2 . ASN A 1 269 ? 30.611  -1.970  37.966  1.00 111.29 ? 1053 ASN A ND2 1 
ATOM   1951 N  N   . THR A 1 270 ? 25.521  1.113   38.215  1.00 97.73  ? 1054 THR A N   1 
ATOM   1952 C  CA  . THR A 1 270 ? 24.761  2.349   38.046  1.00 93.52  ? 1054 THR A CA  1 
ATOM   1953 C  C   . THR A 1 270 ? 25.330  3.508   38.857  1.00 96.85  ? 1054 THR A C   1 
ATOM   1954 O  O   . THR A 1 270 ? 25.064  4.672   38.562  1.00 92.09  ? 1054 THR A O   1 
ATOM   1955 C  CB  . THR A 1 270 ? 23.297  2.159   38.471  1.00 87.59  ? 1054 THR A CB  1 
ATOM   1956 O  OG1 . THR A 1 270 ? 23.242  1.834   39.865  1.00 90.73  ? 1054 THR A OG1 1 
ATOM   1957 C  CG2 . THR A 1 270 ? 22.645  1.048   37.676  1.00 82.45  ? 1054 THR A CG2 1 
ATOM   1958 N  N   . ASN A 1 271 ? 26.096  3.178   39.892  1.00 99.82  ? 1055 ASN A N   1 
ATOM   1959 C  CA  . ASN A 1 271 ? 26.597  4.175   40.832  1.00 94.53  ? 1055 ASN A CA  1 
ATOM   1960 C  C   . ASN A 1 271 ? 25.472  4.741   41.691  1.00 89.50  ? 1055 ASN A C   1 
ATOM   1961 O  O   . ASN A 1 271 ? 25.707  5.579   42.561  1.00 89.63  ? 1055 ASN A O   1 
ATOM   1962 C  CB  . ASN A 1 271 ? 27.308  5.312   40.097  1.00 99.10  ? 1055 ASN A CB  1 
ATOM   1963 C  CG  . ASN A 1 271 ? 28.538  4.841   39.347  1.00 105.95 ? 1055 ASN A CG  1 
ATOM   1964 O  OD1 . ASN A 1 271 ? 28.807  3.641   39.266  1.00 105.72 ? 1055 ASN A OD1 1 
ATOM   1965 N  ND2 . ASN A 1 271 ? 29.289  5.784   38.788  1.00 107.59 ? 1055 ASN A ND2 1 
ATOM   1966 N  N   . GLY A 1 272 ? 24.248  4.281   41.439  1.00 85.85  ? 1056 GLY A N   1 
ATOM   1967 C  CA  . GLY A 1 272 ? 23.089  4.731   42.190  1.00 82.77  ? 1056 GLY A CA  1 
ATOM   1968 C  C   . GLY A 1 272 ? 22.020  5.372   41.325  1.00 83.23  ? 1056 GLY A C   1 
ATOM   1969 O  O   . GLY A 1 272 ? 20.907  5.627   41.787  1.00 75.38  ? 1056 GLY A O   1 
ATOM   1970 N  N   . VAL A 1 273 ? 22.356  5.629   40.064  1.00 83.33  ? 1057 VAL A N   1 
ATOM   1971 C  CA  . VAL A 1 273 ? 21.442  6.309   39.154  1.00 72.52  ? 1057 VAL A CA  1 
ATOM   1972 C  C   . VAL A 1 273 ? 21.137  5.472   37.915  1.00 70.76  ? 1057 VAL A C   1 
ATOM   1973 O  O   . VAL A 1 273 ? 22.045  4.954   37.265  1.00 72.79  ? 1057 VAL A O   1 
ATOM   1974 C  CB  . VAL A 1 273 ? 22.011  7.667   38.711  1.00 64.26  ? 1057 VAL A CB  1 
ATOM   1975 C  CG1 . VAL A 1 273 ? 20.961  8.459   37.947  1.00 59.89  ? 1057 VAL A CG1 1 
ATOM   1976 C  CG2 . VAL A 1 273 ? 22.492  8.446   39.920  1.00 68.30  ? 1057 VAL A CG2 1 
ATOM   1977 N  N   . ILE A 1 274 ? 19.853  5.345   37.595  1.00 64.78  ? 1058 ILE A N   1 
ATOM   1978 C  CA  . ILE A 1 274 ? 19.427  4.619   36.403  1.00 62.94  ? 1058 ILE A CA  1 
ATOM   1979 C  C   . ILE A 1 274 ? 18.676  5.539   35.449  1.00 60.27  ? 1058 ILE A C   1 
ATOM   1980 O  O   . ILE A 1 274 ? 18.438  6.707   35.759  1.00 57.64  ? 1058 ILE A O   1 
ATOM   1981 C  CB  . ILE A 1 274 ? 18.535  3.412   36.752  1.00 57.50  ? 1058 ILE A CB  1 
ATOM   1982 C  CG1 . ILE A 1 274 ? 17.207  3.882   37.350  1.00 55.50  ? 1058 ILE A CG1 1 
ATOM   1983 C  CG2 . ILE A 1 274 ? 19.264  2.470   37.700  1.00 57.80  ? 1058 ILE A CG2 1 
ATOM   1984 C  CD1 . ILE A 1 274 ? 16.214  2.761   37.588  1.00 40.86  ? 1058 ILE A CD1 1 
ATOM   1985 N  N   . THR A 1 275 ? 18.306  5.008   34.288  1.00 62.44  ? 1059 THR A N   1 
ATOM   1986 C  CA  . THR A 1 275 ? 17.630  5.801   33.268  1.00 64.69  ? 1059 THR A CA  1 
ATOM   1987 C  C   . THR A 1 275 ? 16.116  5.652   33.347  1.00 55.88  ? 1059 THR A C   1 
ATOM   1988 O  O   . THR A 1 275 ? 15.596  4.831   34.104  1.00 49.10  ? 1059 THR A O   1 
ATOM   1989 C  CB  . THR A 1 275 ? 18.107  5.431   31.846  1.00 57.44  ? 1059 THR A CB  1 
ATOM   1990 O  OG1 . THR A 1 275 ? 17.747  4.075   31.553  1.00 61.92  ? 1059 THR A OG1 1 
ATOM   1991 C  CG2 . THR A 1 275 ? 19.615  5.589   31.734  1.00 59.07  ? 1059 THR A CG2 1 
ATOM   1992 N  N   . LYS A 1 276 ? 15.417  6.458   32.555  1.00 57.47  ? 1060 LYS A N   1 
ATOM   1993 C  CA  . LYS A 1 276 ? 13.962  6.448   32.523  1.00 54.31  ? 1060 LYS A CA  1 
ATOM   1994 C  C   . LYS A 1 276 ? 13.447  5.145   31.917  1.00 54.76  ? 1060 LYS A C   1 
ATOM   1995 O  O   . LYS A 1 276 ? 12.294  4.765   32.123  1.00 58.23  ? 1060 LYS A O   1 
ATOM   1996 C  CB  . LYS A 1 276 ? 13.456  7.648   31.719  1.00 52.36  ? 1060 LYS A CB  1 
ATOM   1997 C  CG  . LYS A 1 276 ? 12.014  8.040   31.990  1.00 52.60  ? 1060 LYS A CG  1 
ATOM   1998 C  CD  . LYS A 1 276 ? 11.703  9.403   31.390  1.00 51.66  ? 1060 LYS A CD  1 
ATOM   1999 C  CE  . LYS A 1 276 ? 10.283  9.840   31.698  1.00 58.64  ? 1060 LYS A CE  1 
ATOM   2000 N  NZ  . LYS A 1 276 ? 10.005  11.212  31.193  1.00 65.83  ? 1060 LYS A NZ  1 
ATOM   2001 N  N   . ASP A 1 277 ? 14.315  4.457   31.181  1.00 55.83  ? 1061 ASP A N   1 
ATOM   2002 C  CA  . ASP A 1 277 ? 13.944  3.211   30.523  1.00 54.04  ? 1061 ASP A CA  1 
ATOM   2003 C  C   . ASP A 1 277 ? 14.187  1.999   31.418  1.00 50.63  ? 1061 ASP A C   1 
ATOM   2004 O  O   . ASP A 1 277 ? 13.364  1.088   31.468  1.00 46.76  ? 1061 ASP A O   1 
ATOM   2005 C  CB  . ASP A 1 277 ? 14.696  3.059   29.198  1.00 54.95  ? 1061 ASP A CB  1 
ATOM   2006 C  CG  . ASP A 1 277 ? 14.432  1.723   28.526  1.00 59.28  ? 1061 ASP A CG  1 
ATOM   2007 O  OD1 . ASP A 1 277 ? 13.351  1.558   27.914  1.00 51.93  ? 1061 ASP A OD1 1 
ATOM   2008 O  OD2 . ASP A 1 277 ? 15.317  0.842   28.599  1.00 61.79  ? 1061 ASP A OD2 1 
ATOM   2009 N  N   . GLU A 1 278 ? 15.315  1.985   32.122  1.00 51.13  ? 1062 GLU A N   1 
ATOM   2010 C  CA  . GLU A 1 278 ? 15.608  0.899   33.052  1.00 50.59  ? 1062 GLU A CA  1 
ATOM   2011 C  C   . GLU A 1 278 ? 14.576  0.884   34.174  1.00 55.75  ? 1062 GLU A C   1 
ATOM   2012 O  O   . GLU A 1 278 ? 14.300  -0.160  34.770  1.00 59.17  ? 1062 GLU A O   1 
ATOM   2013 C  CB  . GLU A 1 278 ? 17.019  1.038   33.625  1.00 52.98  ? 1062 GLU A CB  1 
ATOM   2014 C  CG  . GLU A 1 278 ? 18.109  1.062   32.568  1.00 63.73  ? 1062 GLU A CG  1 
ATOM   2015 C  CD  . GLU A 1 278 ? 19.488  1.277   33.158  1.00 70.70  ? 1062 GLU A CD  1 
ATOM   2016 O  OE1 . GLU A 1 278 ? 20.483  1.165   32.409  1.00 73.38  ? 1062 GLU A OE1 1 
ATOM   2017 O  OE2 . GLU A 1 278 ? 19.575  1.561   34.371  1.00 73.01  ? 1062 GLU A OE2 1 
ATOM   2018 N  N   . ALA A 1 279 ? 14.010  2.054   34.456  1.00 49.54  ? 1063 ALA A N   1 
ATOM   2019 C  CA  . ALA A 1 279 ? 12.957  2.177   35.455  1.00 42.04  ? 1063 ALA A CA  1 
ATOM   2020 C  C   . ALA A 1 279 ? 11.727  1.386   35.028  1.00 43.65  ? 1063 ALA A C   1 
ATOM   2021 O  O   . ALA A 1 279 ? 11.142  0.649   35.823  1.00 47.53  ? 1063 ALA A O   1 
ATOM   2022 C  CB  . ALA A 1 279 ? 12.599  3.637   35.664  1.00 40.74  ? 1063 ALA A CB  1 
ATOM   2023 N  N   . GLU A 1 280 ? 11.349  1.542   33.764  1.00 49.94  ? 1064 GLU A N   1 
ATOM   2024 C  CA  . GLU A 1 280 ? 10.161  0.893   33.222  1.00 47.72  ? 1064 GLU A CA  1 
ATOM   2025 C  C   . GLU A 1 280 ? 10.380  -0.600  32.990  1.00 47.56  ? 1064 GLU A C   1 
ATOM   2026 O  O   . GLU A 1 280 ? 9.429   -1.384  33.007  1.00 48.18  ? 1064 GLU A O   1 
ATOM   2027 C  CB  . GLU A 1 280 ? 9.738   1.569   31.918  1.00 48.98  ? 1064 GLU A CB  1 
ATOM   2028 C  CG  . GLU A 1 280 ? 8.393   1.111   31.390  1.00 60.93  ? 1064 GLU A CG  1 
ATOM   2029 C  CD  . GLU A 1 280 ? 8.035   1.769   30.070  1.00 67.81  ? 1064 GLU A CD  1 
ATOM   2030 O  OE1 . GLU A 1 280 ? 8.945   1.964   29.233  1.00 62.85  ? 1064 GLU A OE1 1 
ATOM   2031 O  OE2 . GLU A 1 280 ? 6.844   2.094   29.873  1.00 70.65  ? 1064 GLU A OE2 1 
ATOM   2032 N  N   . LYS A 1 281 ? 11.634  -0.986  32.771  1.00 49.92  ? 1065 LYS A N   1 
ATOM   2033 C  CA  . LYS A 1 281 ? 11.982  -2.392  32.601  1.00 52.83  ? 1065 LYS A CA  1 
ATOM   2034 C  C   . LYS A 1 281 ? 11.873  -3.098  33.951  1.00 50.04  ? 1065 LYS A C   1 
ATOM   2035 O  O   . LYS A 1 281 ? 11.375  -4.220  34.042  1.00 47.83  ? 1065 LYS A O   1 
ATOM   2036 C  CB  . LYS A 1 281 ? 13.396  -2.525  32.027  1.00 59.09  ? 1065 LYS A CB  1 
ATOM   2037 C  CG  . LYS A 1 281 ? 13.742  -3.913  31.504  1.00 70.16  ? 1065 LYS A CG  1 
ATOM   2038 C  CD  . LYS A 1 281 ? 15.107  -3.921  30.828  1.00 71.56  ? 1065 LYS A CD  1 
ATOM   2039 C  CE  . LYS A 1 281 ? 15.452  -5.299  30.281  1.00 68.29  ? 1065 LYS A CE  1 
ATOM   2040 N  NZ  . LYS A 1 281 ? 14.520  -5.723  29.196  1.00 66.64  ? 1065 LYS A NZ  1 
ATOM   2041 N  N   . LEU A 1 282 ? 12.332  -2.417  34.998  1.00 51.19  ? 1066 LEU A N   1 
ATOM   2042 C  CA  . LEU A 1 282 ? 12.206  -2.904  36.365  1.00 54.25  ? 1066 LEU A CA  1 
ATOM   2043 C  C   . LEU A 1 282 ? 10.737  -2.941  36.777  1.00 51.02  ? 1066 LEU A C   1 
ATOM   2044 O  O   . LEU A 1 282 ? 10.285  -3.884  37.430  1.00 48.93  ? 1066 LEU A O   1 
ATOM   2045 C  CB  . LEU A 1 282 ? 12.982  -1.994  37.319  1.00 51.51  ? 1066 LEU A CB  1 
ATOM   2046 C  CG  . LEU A 1 282 ? 14.007  -2.659  38.240  1.00 56.82  ? 1066 LEU A CG  1 
ATOM   2047 C  CD1 . LEU A 1 282 ? 14.629  -1.632  39.170  1.00 57.17  ? 1066 LEU A CD1 1 
ATOM   2048 C  CD2 . LEU A 1 282 ? 13.367  -3.786  39.034  1.00 51.32  ? 1066 LEU A CD2 1 
ATOM   2049 N  N   . PHE A 1 283 ? 9.999   -1.904  36.392  1.00 48.36  ? 1067 PHE A N   1 
ATOM   2050 C  CA  . PHE A 1 283 ? 8.576   -1.797  36.706  1.00 50.14  ? 1067 PHE A CA  1 
ATOM   2051 C  C   . PHE A 1 283 ? 7.794   -3.011  36.214  1.00 47.66  ? 1067 PHE A C   1 
ATOM   2052 O  O   . PHE A 1 283 ? 7.053   -3.637  36.974  1.00 46.60  ? 1067 PHE A O   1 
ATOM   2053 C  CB  . PHE A 1 283 ? 7.993   -0.516  36.098  1.00 46.69  ? 1067 PHE A CB  1 
ATOM   2054 C  CG  . PHE A 1 283 ? 6.503   -0.391  36.249  1.00 48.31  ? 1067 PHE A CG  1 
ATOM   2055 C  CD1 . PHE A 1 283 ? 5.946   -0.028  37.464  1.00 55.18  ? 1067 PHE A CD1 1 
ATOM   2056 C  CD2 . PHE A 1 283 ? 5.660   -0.624  35.173  1.00 45.96  ? 1067 PHE A CD2 1 
ATOM   2057 C  CE1 . PHE A 1 283 ? 4.577   0.092   37.606  1.00 52.87  ? 1067 PHE A CE1 1 
ATOM   2058 C  CE2 . PHE A 1 283 ? 4.291   -0.504  35.308  1.00 46.38  ? 1067 PHE A CE2 1 
ATOM   2059 C  CZ  . PHE A 1 283 ? 3.749   -0.146  36.526  1.00 57.85  ? 1067 PHE A CZ  1 
ATOM   2060 N  N   . ASN A 1 284 ? 7.962   -3.331  34.935  1.00 48.52  ? 1068 ASN A N   1 
ATOM   2061 C  CA  . ASN A 1 284 ? 7.297   -4.480  34.330  1.00 44.72  ? 1068 ASN A CA  1 
ATOM   2062 C  C   . ASN A 1 284 ? 7.682   -5.780  35.016  1.00 43.13  ? 1068 ASN A C   1 
ATOM   2063 O  O   . ASN A 1 284 ? 6.856   -6.676  35.175  1.00 41.53  ? 1068 ASN A O   1 
ATOM   2064 C  CB  . ASN A 1 284 ? 7.625   -4.562  32.840  1.00 48.82  ? 1068 ASN A CB  1 
ATOM   2065 C  CG  . ASN A 1 284 ? 7.042   -3.405  32.053  1.00 52.86  ? 1068 ASN A CG  1 
ATOM   2066 O  OD1 . ASN A 1 284 ? 6.357   -2.544  32.607  1.00 55.53  ? 1068 ASN A OD1 1 
ATOM   2067 N  ND2 . ASN A 1 284 ? 7.320   -3.372  30.757  1.00 61.51  ? 1068 ASN A ND2 1 
ATOM   2068 N  N   . GLN A 1 285 ? 8.944   -5.875  35.418  1.00 47.98  ? 1069 GLN A N   1 
ATOM   2069 C  CA  . GLN A 1 285 ? 9.427   -7.029  36.164  1.00 52.61  ? 1069 GLN A CA  1 
ATOM   2070 C  C   . GLN A 1 285 ? 8.662   -7.178  37.472  1.00 47.95  ? 1069 GLN A C   1 
ATOM   2071 O  O   . GLN A 1 285 ? 8.288   -8.283  37.860  1.00 44.94  ? 1069 GLN A O   1 
ATOM   2072 C  CB  . GLN A 1 285 ? 10.924  -6.897  36.451  1.00 55.24  ? 1069 GLN A CB  1 
ATOM   2073 C  CG  . GLN A 1 285 ? 11.810  -7.026  35.226  1.00 50.37  ? 1069 GLN A CG  1 
ATOM   2074 C  CD  . GLN A 1 285 ? 13.289  -6.964  35.566  1.00 66.48  ? 1069 GLN A CD  1 
ATOM   2075 O  OE1 . GLN A 1 285 ? 13.663  -6.722  36.714  1.00 70.30  ? 1069 GLN A OE1 1 
ATOM   2076 N  NE2 . GLN A 1 285 ? 14.137  -7.186  34.567  1.00 73.32  ? 1069 GLN A NE2 1 
ATOM   2077 N  N   . ASP A 1 286 ? 8.437   -6.058  38.152  1.00 53.83  ? 1070 ASP A N   1 
ATOM   2078 C  CA  . ASP A 1 286 ? 7.692   -6.061  39.406  1.00 53.29  ? 1070 ASP A CA  1 
ATOM   2079 C  C   . ASP A 1 286 ? 6.239   -6.464  39.171  1.00 45.83  ? 1070 ASP A C   1 
ATOM   2080 O  O   . ASP A 1 286 ? 5.681   -7.276  39.913  1.00 49.86  ? 1070 ASP A O   1 
ATOM   2081 C  CB  . ASP A 1 286 ? 7.760   -4.685  40.075  1.00 56.74  ? 1070 ASP A CB  1 
ATOM   2082 C  CG  . ASP A 1 286 ? 9.184   -4.241  40.350  1.00 66.78  ? 1070 ASP A CG  1 
ATOM   2083 O  OD1 . ASP A 1 286 ? 10.027  -5.110  40.665  1.00 62.77  ? 1070 ASP A OD1 1 
ATOM   2084 O  OD2 . ASP A 1 286 ? 9.461   -3.025  40.249  1.00 69.46  ? 1070 ASP A OD2 1 
ATOM   2085 N  N   . VAL A 1 287 ? 5.634   -5.895  38.132  1.00 45.44  ? 1071 VAL A N   1 
ATOM   2086 C  CA  . VAL A 1 287 ? 4.249   -6.199  37.784  1.00 38.37  ? 1071 VAL A CA  1 
ATOM   2087 C  C   . VAL A 1 287 ? 4.058   -7.688  37.526  1.00 40.02  ? 1071 VAL A C   1 
ATOM   2088 O  O   . VAL A 1 287 ? 3.177   -8.321  38.109  1.00 44.07  ? 1071 VAL A O   1 
ATOM   2089 C  CB  . VAL A 1 287 ? 3.788   -5.415  36.537  1.00 35.69  ? 1071 VAL A CB  1 
ATOM   2090 C  CG1 . VAL A 1 287 ? 2.350   -5.773  36.177  1.00 21.91  ? 1071 VAL A CG1 1 
ATOM   2091 C  CG2 . VAL A 1 287 ? 3.931   -3.917  36.769  1.00 38.16  ? 1071 VAL A CG2 1 
ATOM   2092 N  N   . ASP A 1 288 ? 4.887   -8.243  36.649  1.00 37.64  ? 1072 ASP A N   1 
ATOM   2093 C  CA  . ASP A 1 288 ? 4.819   -9.663  36.327  1.00 43.66  ? 1072 ASP A CA  1 
ATOM   2094 C  C   . ASP A 1 288 ? 4.972   -10.493 37.591  1.00 44.11  ? 1072 ASP A C   1 
ATOM   2095 O  O   . ASP A 1 288 ? 4.156   -11.368 37.875  1.00 41.43  ? 1072 ASP A O   1 
ATOM   2096 C  CB  . ASP A 1 288 ? 5.907   -10.036 35.320  1.00 47.49  ? 1072 ASP A CB  1 
ATOM   2097 C  CG  . ASP A 1 288 ? 5.846   -11.494 34.909  1.00 54.94  ? 1072 ASP A CG  1 
ATOM   2098 O  OD1 . ASP A 1 288 ? 5.075   -11.819 33.982  1.00 65.83  ? 1072 ASP A OD1 1 
ATOM   2099 O  OD2 . ASP A 1 288 ? 6.573   -12.314 35.508  1.00 57.42  ? 1072 ASP A OD2 1 
ATOM   2100 N  N   . ALA A 1 289 ? 6.027   -10.204 38.347  1.00 47.02  ? 1073 ALA A N   1 
ATOM   2101 C  CA  . ALA A 1 289 ? 6.285   -10.881 39.611  1.00 43.69  ? 1073 ALA A CA  1 
ATOM   2102 C  C   . ALA A 1 289 ? 5.102   -10.716 40.560  1.00 45.67  ? 1073 ALA A C   1 
ATOM   2103 O  O   . ALA A 1 289 ? 4.693   -11.665 41.229  1.00 54.63  ? 1073 ALA A O   1 
ATOM   2104 C  CB  . ALA A 1 289 ? 7.559   -10.347 40.244  1.00 38.81  ? 1073 ALA A CB  1 
ATOM   2105 N  N   . ALA A 1 290 ? 4.554   -9.507  40.609  1.00 38.18  ? 1074 ALA A N   1 
ATOM   2106 C  CA  . ALA A 1 290 ? 3.391   -9.227  41.442  1.00 35.35  ? 1074 ALA A CA  1 
ATOM   2107 C  C   . ALA A 1 290 ? 2.255   -10.202 41.150  1.00 40.61  ? 1074 ALA A C   1 
ATOM   2108 O  O   . ALA A 1 290 ? 1.780   -10.906 42.042  1.00 41.21  ? 1074 ALA A O   1 
ATOM   2109 C  CB  . ALA A 1 290 ? 2.922   -7.795  41.237  1.00 36.89  ? 1074 ALA A CB  1 
ATOM   2110 N  N   . VAL A 1 291 ? 1.828   -10.234 39.892  1.00 42.05  ? 1075 VAL A N   1 
ATOM   2111 C  CA  . VAL A 1 291 ? 0.747   -11.114 39.463  1.00 43.69  ? 1075 VAL A CA  1 
ATOM   2112 C  C   . VAL A 1 291 ? 1.033   -12.573 39.800  1.00 43.26  ? 1075 VAL A C   1 
ATOM   2113 O  O   . VAL A 1 291 ? 0.162   -13.291 40.291  1.00 43.50  ? 1075 VAL A O   1 
ATOM   2114 C  CB  . VAL A 1 291 ? 0.492   -10.992 37.946  1.00 40.59  ? 1075 VAL A CB  1 
ATOM   2115 C  CG1 . VAL A 1 291 ? -0.502  -12.050 37.490  1.00 45.42  ? 1075 VAL A CG1 1 
ATOM   2116 C  CG2 . VAL A 1 291 ? -0.003  -9.598  37.604  1.00 37.01  ? 1075 VAL A CG2 1 
ATOM   2117 N  N   . ARG A 1 292 ? 2.261   -13.004 39.529  1.00 45.13  ? 1076 ARG A N   1 
ATOM   2118 C  CA  . ARG A 1 292 ? 2.671   -14.381 39.780  1.00 50.08  ? 1076 ARG A CA  1 
ATOM   2119 C  C   . ARG A 1 292 ? 2.437   -14.761 41.235  1.00 53.41  ? 1076 ARG A C   1 
ATOM   2120 O  O   . ARG A 1 292 ? 1.842   -15.797 41.530  1.00 48.11  ? 1076 ARG A O   1 
ATOM   2121 C  CB  . ARG A 1 292 ? 4.145   -14.577 39.412  1.00 53.09  ? 1076 ARG A CB  1 
ATOM   2122 C  CG  . ARG A 1 292 ? 4.468   -14.252 37.962  1.00 58.77  ? 1076 ARG A CG  1 
ATOM   2123 C  CD  . ARG A 1 292 ? 5.946   -14.451 37.650  1.00 60.91  ? 1076 ARG A CD  1 
ATOM   2124 N  NE  . ARG A 1 292 ? 6.292   -15.859 37.474  1.00 76.32  ? 1076 ARG A NE  1 
ATOM   2125 C  CZ  . ARG A 1 292 ? 6.232   -16.503 36.312  1.00 85.91  ? 1076 ARG A CZ  1 
ATOM   2126 N  NH1 . ARG A 1 292 ? 5.836   -15.865 35.217  1.00 79.09  ? 1076 ARG A NH1 1 
ATOM   2127 N  NH2 . ARG A 1 292 ? 6.567   -17.785 36.243  1.00 83.39  ? 1076 ARG A NH2 1 
ATOM   2128 N  N   . GLY A 1 293 ? 2.909   -13.909 42.139  1.00 56.45  ? 1077 GLY A N   1 
ATOM   2129 C  CA  . GLY A 1 293 ? 2.762   -14.137 43.564  1.00 54.17  ? 1077 GLY A CA  1 
ATOM   2130 C  C   . GLY A 1 293 ? 1.313   -14.138 44.008  1.00 50.24  ? 1077 GLY A C   1 
ATOM   2131 O  O   . GLY A 1 293 ? 0.914   -14.947 44.844  1.00 46.15  ? 1077 GLY A O   1 
ATOM   2132 N  N   . ILE A 1 294 ? 0.525   -13.224 43.448  1.00 49.37  ? 1078 ILE A N   1 
ATOM   2133 C  CA  . ILE A 1 294 ? -0.899  -13.148 43.758  1.00 44.32  ? 1078 ILE A CA  1 
ATOM   2134 C  C   . ILE A 1 294 ? -1.595  -14.458 43.410  1.00 48.17  ? 1078 ILE A C   1 
ATOM   2135 O  O   . ILE A 1 294 ? -2.446  -14.942 44.158  1.00 45.57  ? 1078 ILE A O   1 
ATOM   2136 C  CB  . ILE A 1 294 ? -1.588  -11.996 42.999  1.00 35.49  ? 1078 ILE A CB  1 
ATOM   2137 C  CG1 . ILE A 1 294 ? -1.060  -10.648 43.488  1.00 34.24  ? 1078 ILE A CG1 1 
ATOM   2138 C  CG2 . ILE A 1 294 ? -3.099  -12.072 43.167  1.00 29.70  ? 1078 ILE A CG2 1 
ATOM   2139 C  CD1 . ILE A 1 294 ? -1.759  -9.462  42.861  1.00 42.95  ? 1078 ILE A CD1 1 
ATOM   2140 N  N   . LEU A 1 295 ? -1.221  -15.030 42.271  1.00 47.54  ? 1079 LEU A N   1 
ATOM   2141 C  CA  . LEU A 1 295 ? -1.806  -16.285 41.816  1.00 48.12  ? 1079 LEU A CA  1 
ATOM   2142 C  C   . LEU A 1 295 ? -1.350  -17.460 42.675  1.00 49.99  ? 1079 LEU A C   1 
ATOM   2143 O  O   . LEU A 1 295 ? -2.090  -18.425 42.862  1.00 52.07  ? 1079 LEU A O   1 
ATOM   2144 C  CB  . LEU A 1 295 ? -1.466  -16.533 40.345  1.00 50.93  ? 1079 LEU A CB  1 
ATOM   2145 C  CG  . LEU A 1 295 ? -2.067  -15.529 39.360  1.00 41.91  ? 1079 LEU A CG  1 
ATOM   2146 C  CD1 . LEU A 1 295 ? -1.656  -15.861 37.936  1.00 39.69  ? 1079 LEU A CD1 1 
ATOM   2147 C  CD2 . LEU A 1 295 ? -3.580  -15.502 39.493  1.00 38.70  ? 1079 LEU A CD2 1 
ATOM   2148 N  N   . ARG A 1 296 ? -0.128  -17.374 43.195  1.00 51.86  ? 1080 ARG A N   1 
ATOM   2149 C  CA  . ARG A 1 296 ? 0.398   -18.399 44.091  1.00 50.06  ? 1080 ARG A CA  1 
ATOM   2150 C  C   . ARG A 1 296 ? -0.069  -18.147 45.520  1.00 49.68  ? 1080 ARG A C   1 
ATOM   2151 O  O   . ARG A 1 296 ? 0.236   -18.921 46.427  1.00 55.92  ? 1080 ARG A O   1 
ATOM   2152 C  CB  . ARG A 1 296 ? 1.929   -18.436 44.044  1.00 54.83  ? 1080 ARG A CB  1 
ATOM   2153 C  CG  . ARG A 1 296 ? 2.519   -18.820 42.695  1.00 59.28  ? 1080 ARG A CG  1 
ATOM   2154 C  CD  . ARG A 1 296 ? 4.042   -18.859 42.759  1.00 72.44  ? 1080 ARG A CD  1 
ATOM   2155 N  NE  . ARG A 1 296 ? 4.589   -17.642 43.355  1.00 89.96  ? 1080 ARG A NE  1 
ATOM   2156 C  CZ  . ARG A 1 296 ? 5.885   -17.416 43.550  1.00 91.92  ? 1080 ARG A CZ  1 
ATOM   2157 N  NH1 . ARG A 1 296 ? 6.782   -18.326 43.194  1.00 86.67  ? 1080 ARG A NH1 1 
ATOM   2158 N  NH2 . ARG A 1 296 ? 6.284   -16.278 44.103  1.00 79.70  ? 1080 ARG A NH2 1 
ATOM   2159 N  N   . ASN A 1 297 ? -0.799  -17.053 45.712  1.00 50.36  ? 1081 ASN A N   1 
ATOM   2160 C  CA  . ASN A 1 297 ? -1.348  -16.705 47.016  1.00 44.86  ? 1081 ASN A CA  1 
ATOM   2161 C  C   . ASN A 1 297 ? -2.804  -17.145 47.133  1.00 45.23  ? 1081 ASN A C   1 
ATOM   2162 O  O   . ASN A 1 297 ? -3.639  -16.790 46.299  1.00 44.79  ? 1081 ASN A O   1 
ATOM   2163 C  CB  . ASN A 1 297 ? -1.232  -15.201 47.254  1.00 47.21  ? 1081 ASN A CB  1 
ATOM   2164 C  CG  . ASN A 1 297 ? -1.580  -14.808 48.675  1.00 44.19  ? 1081 ASN A CG  1 
ATOM   2165 O  OD1 . ASN A 1 297 ? -2.752  -14.695 49.031  1.00 47.57  ? 1081 ASN A OD1 1 
ATOM   2166 N  ND2 . ASN A 1 297 ? -0.558  -14.591 49.494  1.00 49.73  ? 1081 ASN A ND2 1 
ATOM   2167 N  N   . ALA A 1 298 ? -3.104  -17.911 48.176  1.00 43.87  ? 1082 ALA A N   1 
ATOM   2168 C  CA  . ALA A 1 298 ? -4.428  -18.509 48.337  1.00 40.80  ? 1082 ALA A CA  1 
ATOM   2169 C  C   . ALA A 1 298 ? -5.538  -17.497 48.640  1.00 42.42  ? 1082 ALA A C   1 
ATOM   2170 O  O   . ALA A 1 298 ? -6.675  -17.662 48.198  1.00 38.02  ? 1082 ALA A O   1 
ATOM   2171 C  CB  . ALA A 1 298 ? -4.388  -19.589 49.404  1.00 37.53  ? 1082 ALA A CB  1 
ATOM   2172 N  N   . LYS A 1 299 ? -5.209  -16.456 49.398  1.00 41.93  ? 1083 LYS A N   1 
ATOM   2173 C  CA  . LYS A 1 299 ? -6.188  -15.430 49.744  1.00 44.96  ? 1083 LYS A CA  1 
ATOM   2174 C  C   . LYS A 1 299 ? -6.483  -14.499 48.572  1.00 47.34  ? 1083 LYS A C   1 
ATOM   2175 O  O   . LYS A 1 299 ? -7.613  -14.044 48.399  1.00 44.32  ? 1083 LYS A O   1 
ATOM   2176 C  CB  . LYS A 1 299 ? -5.708  -14.601 50.939  1.00 48.26  ? 1083 LYS A CB  1 
ATOM   2177 C  CG  . LYS A 1 299 ? -6.218  -15.075 52.291  1.00 48.20  ? 1083 LYS A CG  1 
ATOM   2178 C  CD  . LYS A 1 299 ? -5.373  -16.203 52.855  1.00 58.14  ? 1083 LYS A CD  1 
ATOM   2179 C  CE  . LYS A 1 299 ? -5.779  -16.521 54.286  1.00 64.47  ? 1083 LYS A CE  1 
ATOM   2180 N  NZ  . LYS A 1 299 ? -4.869  -17.513 54.925  1.00 78.46  ? 1083 LYS A NZ  1 
ATOM   2181 N  N   . LEU A 1 300 ? -5.460  -14.226 47.768  1.00 48.08  ? 1084 LEU A N   1 
ATOM   2182 C  CA  . LEU A 1 300 ? -5.552  -13.211 46.723  1.00 43.65  ? 1084 LEU A CA  1 
ATOM   2183 C  C   . LEU A 1 300 ? -6.015  -13.756 45.368  1.00 44.26  ? 1084 LEU A C   1 
ATOM   2184 O  O   . LEU A 1 300 ? -6.671  -13.050 44.604  1.00 45.20  ? 1084 LEU A O   1 
ATOM   2185 C  CB  . LEU A 1 300 ? -4.205  -12.501 46.564  1.00 37.36  ? 1084 LEU A CB  1 
ATOM   2186 C  CG  . LEU A 1 300 ? -3.585  -11.902 47.828  1.00 40.74  ? 1084 LEU A CG  1 
ATOM   2187 C  CD1 . LEU A 1 300 ? -2.216  -11.310 47.526  1.00 37.47  ? 1084 LEU A CD1 1 
ATOM   2188 C  CD2 . LEU A 1 300 ? -4.504  -10.855 48.449  1.00 42.26  ? 1084 LEU A CD2 1 
ATOM   2189 N  N   . LYS A 1 301 ? -5.672  -15.007 45.073  1.00 44.07  ? 1085 LYS A N   1 
ATOM   2190 C  CA  . LYS A 1 301 ? -5.966  -15.590 43.763  1.00 41.81  ? 1085 LYS A CA  1 
ATOM   2191 C  C   . LYS A 1 301 ? -7.435  -15.503 43.334  1.00 46.34  ? 1085 LYS A C   1 
ATOM   2192 O  O   . LYS A 1 301 ? -7.725  -15.071 42.216  1.00 46.75  ? 1085 LYS A O   1 
ATOM   2193 C  CB  . LYS A 1 301 ? -5.486  -17.042 43.679  1.00 43.17  ? 1085 LYS A CB  1 
ATOM   2194 C  CG  . LYS A 1 301 ? -5.888  -17.736 42.387  1.00 44.86  ? 1085 LYS A CG  1 
ATOM   2195 C  CD  . LYS A 1 301 ? -5.409  -19.175 42.345  1.00 56.77  ? 1085 LYS A CD  1 
ATOM   2196 C  CE  . LYS A 1 301 ? -5.802  -19.849 41.035  1.00 61.16  ? 1085 LYS A CE  1 
ATOM   2197 N  NZ  . LYS A 1 301 ? -7.279  -19.899 40.841  1.00 56.72  ? 1085 LYS A NZ  1 
ATOM   2198 N  N   . PRO A 1 302 ? -8.365  -15.923 44.211  1.00 46.66  ? 1086 PRO A N   1 
ATOM   2199 C  CA  . PRO A 1 302 ? -9.781  -15.932 43.821  1.00 41.11  ? 1086 PRO A CA  1 
ATOM   2200 C  C   . PRO A 1 302 ? -10.281 -14.569 43.360  1.00 44.46  ? 1086 PRO A C   1 
ATOM   2201 O  O   . PRO A 1 302 ? -10.915 -14.493 42.312  1.00 49.17  ? 1086 PRO A O   1 
ATOM   2202 C  CB  . PRO A 1 302 ? -10.502 -16.349 45.108  1.00 31.94  ? 1086 PRO A CB  1 
ATOM   2203 C  CG  . PRO A 1 302 ? -9.478  -17.113 45.879  1.00 38.68  ? 1086 PRO A CG  1 
ATOM   2204 C  CD  . PRO A 1 302 ? -8.173  -16.429 45.582  1.00 42.34  ? 1086 PRO A CD  1 
ATOM   2205 N  N   . VAL A 1 303 ? -10.009 -13.518 44.129  1.00 44.28  ? 1087 VAL A N   1 
ATOM   2206 C  CA  . VAL A 1 303 ? -10.487 -12.182 43.781  1.00 44.73  ? 1087 VAL A CA  1 
ATOM   2207 C  C   . VAL A 1 303 ? -9.813  -11.660 42.513  1.00 36.57  ? 1087 VAL A C   1 
ATOM   2208 O  O   . VAL A 1 303 ? -10.436 -10.965 41.714  1.00 39.07  ? 1087 VAL A O   1 
ATOM   2209 C  CB  . VAL A 1 303 ? -10.306 -11.166 44.938  1.00 44.89  ? 1087 VAL A CB  1 
ATOM   2210 C  CG1 . VAL A 1 303 ? -8.834  -10.888 45.197  1.00 42.08  ? 1087 VAL A CG1 1 
ATOM   2211 C  CG2 . VAL A 1 303 ? -11.047 -9.874  44.624  1.00 37.07  ? 1087 VAL A CG2 1 
ATOM   2212 N  N   . TYR A 1 304 ? -8.544  -12.004 42.324  1.00 35.44  ? 1088 TYR A N   1 
ATOM   2213 C  CA  . TYR A 1 304 ? -7.831  -11.579 41.127  1.00 36.73  ? 1088 TYR A CA  1 
ATOM   2214 C  C   . TYR A 1 304 ? -8.444  -12.219 39.889  1.00 38.09  ? 1088 TYR A C   1 
ATOM   2215 O  O   . TYR A 1 304 ? -8.567  -11.577 38.843  1.00 38.86  ? 1088 TYR A O   1 
ATOM   2216 C  CB  . TYR A 1 304 ? -6.345  -11.926 41.213  1.00 37.47  ? 1088 TYR A CB  1 
ATOM   2217 C  CG  . TYR A 1 304 ? -5.554  -11.421 40.029  1.00 48.94  ? 1088 TYR A CG  1 
ATOM   2218 C  CD1 . TYR A 1 304 ? -5.217  -10.078 39.923  1.00 48.14  ? 1088 TYR A CD1 1 
ATOM   2219 C  CD2 . TYR A 1 304 ? -5.154  -12.281 39.012  1.00 41.32  ? 1088 TYR A CD2 1 
ATOM   2220 C  CE1 . TYR A 1 304 ? -4.500  -9.602  38.839  1.00 42.28  ? 1088 TYR A CE1 1 
ATOM   2221 C  CE2 . TYR A 1 304 ? -4.436  -11.814 37.923  1.00 37.07  ? 1088 TYR A CE2 1 
ATOM   2222 C  CZ  . TYR A 1 304 ? -4.112  -10.474 37.844  1.00 41.59  ? 1088 TYR A CZ  1 
ATOM   2223 O  OH  . TYR A 1 304 ? -3.397  -10.005 36.766  1.00 50.05  ? 1088 TYR A OH  1 
ATOM   2224 N  N   . ASP A 1 305 ? -8.831  -13.486 40.017  1.00 38.38  ? 1089 ASP A N   1 
ATOM   2225 C  CA  . ASP A 1 305 ? -9.449  -14.213 38.911  1.00 42.22  ? 1089 ASP A CA  1 
ATOM   2226 C  C   . ASP A 1 305 ? -10.771 -13.578 38.481  1.00 42.59  ? 1089 ASP A C   1 
ATOM   2227 O  O   . ASP A 1 305 ? -11.109 -13.559 37.297  1.00 38.76  ? 1089 ASP A O   1 
ATOM   2228 C  CB  . ASP A 1 305 ? -9.670  -15.682 39.286  1.00 45.12  ? 1089 ASP A CB  1 
ATOM   2229 C  CG  . ASP A 1 305 ? -8.376  -16.480 39.318  1.00 54.29  ? 1089 ASP A CG  1 
ATOM   2230 O  OD1 . ASP A 1 305 ? -7.455  -16.162 38.533  1.00 54.53  ? 1089 ASP A OD1 1 
ATOM   2231 O  OD2 . ASP A 1 305 ? -8.284  -17.432 40.125  1.00 53.66  ? 1089 ASP A OD2 1 
ATOM   2232 N  N   . SER A 1 306 ? -11.510 -13.055 39.453  1.00 39.36  ? 1090 SER A N   1 
ATOM   2233 C  CA  . SER A 1 306 ? -12.844 -12.519 39.204  1.00 39.45  ? 1090 SER A CA  1 
ATOM   2234 C  C   . SER A 1 306 ? -12.814 -11.100 38.650  1.00 42.90  ? 1090 SER A C   1 
ATOM   2235 O  O   . SER A 1 306 ? -13.717 -10.694 37.918  1.00 47.43  ? 1090 SER A O   1 
ATOM   2236 C  CB  . SER A 1 306 ? -13.681 -12.550 40.487  1.00 40.83  ? 1090 SER A CB  1 
ATOM   2237 O  OG  . SER A 1 306 ? -13.179 -11.632 41.444  1.00 37.74  ? 1090 SER A OG  1 
ATOM   2238 N  N   . LEU A 1 307 ? -11.781 -10.346 39.008  1.00 41.01  ? 1091 LEU A N   1 
ATOM   2239 C  CA  . LEU A 1 307 ? -11.692 -8.948  38.607  1.00 38.44  ? 1091 LEU A CA  1 
ATOM   2240 C  C   . LEU A 1 307 ? -11.342 -8.775  37.133  1.00 49.91  ? 1091 LEU A C   1 
ATOM   2241 O  O   . LEU A 1 307 ? -10.816 -9.685  36.491  1.00 45.02  ? 1091 LEU A O   1 
ATOM   2242 C  CB  . LEU A 1 307 ? -10.679 -8.201  39.477  1.00 35.36  ? 1091 LEU A CB  1 
ATOM   2243 C  CG  . LEU A 1 307 ? -11.055 -8.034  40.948  1.00 34.80  ? 1091 LEU A CG  1 
ATOM   2244 C  CD1 . LEU A 1 307 ? -10.065 -7.117  41.652  1.00 31.64  ? 1091 LEU A CD1 1 
ATOM   2245 C  CD2 . LEU A 1 307 ? -12.475 -7.504  41.071  1.00 33.16  ? 1091 LEU A CD2 1 
ATOM   2246 N  N   . ASP A 1 308 ? -11.640 -7.590  36.611  1.00 50.69  ? 1092 ASP A N   1 
ATOM   2247 C  CA  . ASP A 1 308 ? -11.308 -7.236  35.239  1.00 37.70  ? 1092 ASP A CA  1 
ATOM   2248 C  C   . ASP A 1 308 ? -9.967  -6.511  35.195  1.00 41.58  ? 1092 ASP A C   1 
ATOM   2249 O  O   . ASP A 1 308 ? -9.373  -6.225  36.235  1.00 40.85  ? 1092 ASP A O   1 
ATOM   2250 C  CB  . ASP A 1 308 ? -12.404 -6.360  34.631  1.00 38.91  ? 1092 ASP A CB  1 
ATOM   2251 C  CG  . ASP A 1 308 ? -12.772 -5.186  35.520  1.00 47.50  ? 1092 ASP A CG  1 
ATOM   2252 O  OD1 . ASP A 1 308 ? -12.123 -4.122  35.399  1.00 43.26  ? 1092 ASP A OD1 1 
ATOM   2253 O  OD2 . ASP A 1 308 ? -13.710 -5.328  36.338  1.00 38.99  ? 1092 ASP A OD2 1 
ATOM   2254 N  N   . ALA A 1 309 ? -9.498  -6.217  33.985  1.00 40.23  ? 1093 ALA A N   1 
ATOM   2255 C  CA  . ALA A 1 309 ? -8.184  -5.605  33.788  1.00 32.79  ? 1093 ALA A CA  1 
ATOM   2256 C  C   . ALA A 1 309 ? -7.947  -4.369  34.657  1.00 42.03  ? 1093 ALA A C   1 
ATOM   2257 O  O   . ALA A 1 309 ? -6.919  -4.268  35.330  1.00 41.80  ? 1093 ALA A O   1 
ATOM   2258 C  CB  . ALA A 1 309 ? -7.969  -5.271  32.321  1.00 38.34  ? 1093 ALA A CB  1 
ATOM   2259 N  N   . VAL A 1 310 ? -8.894  -3.433  34.645  1.00 36.04  ? 1094 VAL A N   1 
ATOM   2260 C  CA  . VAL A 1 310 ? -8.746  -2.194  35.407  1.00 35.88  ? 1094 VAL A CA  1 
ATOM   2261 C  C   . VAL A 1 310 ? -8.696  -2.460  36.908  1.00 37.69  ? 1094 VAL A C   1 
ATOM   2262 O  O   . VAL A 1 310 ? -7.808  -1.973  37.604  1.00 36.39  ? 1094 VAL A O   1 
ATOM   2263 C  CB  . VAL A 1 310 ? -9.881  -1.195  35.115  1.00 42.57  ? 1094 VAL A CB  1 
ATOM   2264 C  CG1 . VAL A 1 310 ? -9.643  0.109   35.866  1.00 41.99  ? 1094 VAL A CG1 1 
ATOM   2265 C  CG2 . VAL A 1 310 ? -9.991  -0.944  33.621  1.00 33.82  ? 1094 VAL A CG2 1 
ATOM   2266 N  N   . ARG A 1 311 ? -9.652  -3.240  37.400  1.00 37.89  ? 1095 ARG A N   1 
ATOM   2267 C  CA  . ARG A 1 311 ? -9.710  -3.571  38.819  1.00 35.24  ? 1095 ARG A CA  1 
ATOM   2268 C  C   . ARG A 1 311 ? -8.551  -4.470  39.240  1.00 37.52  ? 1095 ARG A C   1 
ATOM   2269 O  O   . ARG A 1 311 ? -8.132  -4.449  40.398  1.00 36.07  ? 1095 ARG A O   1 
ATOM   2270 C  CB  . ARG A 1 311 ? -11.051 -4.216  39.171  1.00 26.68  ? 1095 ARG A CB  1 
ATOM   2271 C  CG  . ARG A 1 311 ? -12.234 -3.283  38.984  1.00 32.97  ? 1095 ARG A CG  1 
ATOM   2272 C  CD  . ARG A 1 311 ? -13.451 -3.778  39.738  1.00 35.40  ? 1095 ARG A CD  1 
ATOM   2273 N  NE  . ARG A 1 311 ? -14.555 -2.824  39.678  1.00 33.28  ? 1095 ARG A NE  1 
ATOM   2274 C  CZ  . ARG A 1 311 ? -15.510 -2.847  38.755  1.00 34.17  ? 1095 ARG A CZ  1 
ATOM   2275 N  NH1 . ARG A 1 311 ? -15.495 -3.778  37.810  1.00 41.90  ? 1095 ARG A NH1 1 
ATOM   2276 N  NH2 . ARG A 1 311 ? -16.481 -1.942  38.775  1.00 30.66  ? 1095 ARG A NH2 1 
ATOM   2277 N  N   . ARG A 1 312 ? -8.036  -5.256  38.300  1.00 36.12  ? 1096 ARG A N   1 
ATOM   2278 C  CA  . ARG A 1 312 ? -6.864  -6.083  38.566  1.00 36.00  ? 1096 ARG A CA  1 
ATOM   2279 C  C   . ARG A 1 312 ? -5.646  -5.196  38.795  1.00 34.32  ? 1096 ARG A C   1 
ATOM   2280 O  O   . ARG A 1 312 ? -4.781  -5.505  39.618  1.00 33.61  ? 1096 ARG A O   1 
ATOM   2281 C  CB  . ARG A 1 312 ? -6.605  -7.055  37.412  1.00 32.77  ? 1096 ARG A CB  1 
ATOM   2282 C  CG  . ARG A 1 312 ? -7.597  -8.199  37.338  1.00 31.27  ? 1096 ARG A CG  1 
ATOM   2283 C  CD  . ARG A 1 312 ? -7.235  -9.180  36.241  1.00 32.53  ? 1096 ARG A CD  1 
ATOM   2284 N  NE  . ARG A 1 312 ? -8.151  -10.316 36.214  1.00 37.40  ? 1096 ARG A NE  1 
ATOM   2285 C  CZ  . ARG A 1 312 ? -7.934  -11.434 35.528  1.00 40.59  ? 1096 ARG A CZ  1 
ATOM   2286 N  NH1 . ARG A 1 312 ? -6.825  -11.571 34.814  1.00 40.53  ? 1096 ARG A NH1 1 
ATOM   2287 N  NH2 . ARG A 1 312 ? -8.824  -12.419 35.562  1.00 38.84  ? 1096 ARG A NH2 1 
ATOM   2288 N  N   . ALA A 1 313 ? -5.591  -4.091  38.057  1.00 33.26  ? 1097 ALA A N   1 
ATOM   2289 C  CA  . ALA A 1 313 ? -4.516  -3.115  38.204  1.00 34.04  ? 1097 ALA A CA  1 
ATOM   2290 C  C   . ALA A 1 313 ? -4.578  -2.450  39.575  1.00 32.66  ? 1097 ALA A C   1 
ATOM   2291 O  O   . ALA A 1 313 ? -3.559  -2.292  40.252  1.00 29.91  ? 1097 ALA A O   1 
ATOM   2292 C  CB  . ALA A 1 313 ? -4.593  -2.070  37.097  1.00 24.81  ? 1097 ALA A CB  1 
ATOM   2293 N  N   . ALA A 1 314 ? -5.785  -2.068  39.979  1.00 29.64  ? 1098 ALA A N   1 
ATOM   2294 C  CA  . ALA A 1 314 ? -6.000  -1.469  41.288  1.00 33.96  ? 1098 ALA A CA  1 
ATOM   2295 C  C   . ALA A 1 314 ? -5.442  -2.365  42.384  1.00 39.11  ? 1098 ALA A C   1 
ATOM   2296 O  O   . ALA A 1 314 ? -4.755  -1.896  43.288  1.00 30.83  ? 1098 ALA A O   1 
ATOM   2297 C  CB  . ALA A 1 314 ? -7.479  -1.211  41.515  1.00 30.63  ? 1098 ALA A CB  1 
ATOM   2298 N  N   . LEU A 1 315 ? -5.734  -3.658  42.287  1.00 43.27  ? 1099 LEU A N   1 
ATOM   2299 C  CA  . LEU A 1 315 ? -5.259  -4.634  43.261  1.00 37.92  ? 1099 LEU A CA  1 
ATOM   2300 C  C   . LEU A 1 315 ? -3.736  -4.668  43.276  1.00 38.04  ? 1099 LEU A C   1 
ATOM   2301 O  O   . LEU A 1 315 ? -3.109  -4.574  44.332  1.00 39.83  ? 1099 LEU A O   1 
ATOM   2302 C  CB  . LEU A 1 315 ? -5.809  -6.025  42.937  1.00 38.42  ? 1099 LEU A CB  1 
ATOM   2303 C  CG  . LEU A 1 315 ? -5.441  -7.129  43.932  1.00 47.02  ? 1099 LEU A CG  1 
ATOM   2304 C  CD1 . LEU A 1 315 ? -6.110  -6.887  45.282  1.00 40.02  ? 1099 LEU A CD1 1 
ATOM   2305 C  CD2 . LEU A 1 315 ? -5.810  -8.497  43.381  1.00 42.52  ? 1099 LEU A CD2 1 
ATOM   2306 N  N   . ILE A 1 316 ? -3.148  -4.806  42.092  1.00 34.32  ? 1100 ILE A N   1 
ATOM   2307 C  CA  . ILE A 1 316 ? -1.696  -4.784  41.946  1.00 38.17  ? 1100 ILE A CA  1 
ATOM   2308 C  C   . ILE A 1 316 ? -1.103  -3.549  42.618  1.00 45.54  ? 1100 ILE A C   1 
ATOM   2309 O  O   . ILE A 1 316 ? -0.051  -3.618  43.258  1.00 45.63  ? 1100 ILE A O   1 
ATOM   2310 C  CB  . ILE A 1 316 ? -1.282  -4.814  40.461  1.00 39.25  ? 1100 ILE A CB  1 
ATOM   2311 C  CG1 . ILE A 1 316 ? -1.776  -6.104  39.804  1.00 33.96  ? 1100 ILE A CG1 1 
ATOM   2312 C  CG2 . ILE A 1 316 ? 0.232   -4.682  40.316  1.00 36.93  ? 1100 ILE A CG2 1 
ATOM   2313 C  CD1 . ILE A 1 316 ? -1.456  -6.204  38.333  1.00 32.34  ? 1100 ILE A CD1 1 
ATOM   2314 N  N   . ASN A 1 317 ? -1.786  -2.419  42.468  1.00 39.02  ? 1101 ASN A N   1 
ATOM   2315 C  CA  . ASN A 1 317 ? -1.366  -1.183  43.114  1.00 36.36  ? 1101 ASN A CA  1 
ATOM   2316 C  C   . ASN A 1 317 ? -1.243  -1.360  44.625  1.00 41.43  ? 1101 ASN A C   1 
ATOM   2317 O  O   . ASN A 1 317 ? -0.271  -0.918  45.234  1.00 34.91  ? 1101 ASN A O   1 
ATOM   2318 C  CB  . ASN A 1 317 ? -2.346  -0.054  42.792  1.00 38.25  ? 1101 ASN A CB  1 
ATOM   2319 C  CG  . ASN A 1 317 ? -1.844  1.306   43.245  1.00 44.60  ? 1101 ASN A CG  1 
ATOM   2320 O  OD1 . ASN A 1 317 ? -1.228  1.438   44.306  1.00 45.82  ? 1101 ASN A OD1 1 
ATOM   2321 N  ND2 . ASN A 1 317 ? -2.105  2.328   42.438  1.00 35.69  ? 1101 ASN A ND2 1 
ATOM   2322 N  N   . MET A 1 318 ? -2.235  -2.018  45.219  1.00 46.87  ? 1102 MET A N   1 
ATOM   2323 C  CA  . MET A 1 318 ? -2.251  -2.262  46.658  1.00 44.34  ? 1102 MET A CA  1 
ATOM   2324 C  C   . MET A 1 318 ? -1.100  -3.167  47.077  1.00 44.01  ? 1102 MET A C   1 
ATOM   2325 O  O   . MET A 1 318 ? -0.417  -2.900  48.064  1.00 42.79  ? 1102 MET A O   1 
ATOM   2326 C  CB  . MET A 1 318 ? -3.588  -2.874  47.091  1.00 43.30  ? 1102 MET A CB  1 
ATOM   2327 C  CG  . MET A 1 318 ? -4.786  -1.963  46.893  1.00 51.50  ? 1102 MET A CG  1 
ATOM   2328 S  SD  . MET A 1 318 ? -6.327  -2.677  47.503  1.00 51.25  ? 1102 MET A SD  1 
ATOM   2329 C  CE  . MET A 1 318 ? -5.982  -2.792  49.257  1.00 40.37  ? 1102 MET A CE  1 
ATOM   2330 N  N   . VAL A 1 319 ? -0.897  -4.244  46.327  1.00 37.81  ? 1103 VAL A N   1 
ATOM   2331 C  CA  . VAL A 1 319 ? 0.210   -5.152  46.593  1.00 40.60  ? 1103 VAL A CA  1 
ATOM   2332 C  C   . VAL A 1 319 ? 1.536   -4.401  46.504  1.00 46.73  ? 1103 VAL A C   1 
ATOM   2333 O  O   . VAL A 1 319 ? 2.463   -4.650  47.278  1.00 45.44  ? 1103 VAL A O   1 
ATOM   2334 C  CB  . VAL A 1 319 ? 0.211   -6.334  45.610  1.00 34.58  ? 1103 VAL A CB  1 
ATOM   2335 C  CG1 . VAL A 1 319 ? 1.467   -7.177  45.779  1.00 31.01  ? 1103 VAL A CG1 1 
ATOM   2336 C  CG2 . VAL A 1 319 ? -1.037  -7.177  45.801  1.00 35.49  ? 1103 VAL A CG2 1 
ATOM   2337 N  N   . PHE A 1 320 ? 1.618   -3.476  45.554  1.00 48.17  ? 1104 PHE A N   1 
ATOM   2338 C  CA  . PHE A 1 320 ? 2.798   -2.634  45.419  1.00 47.65  ? 1104 PHE A CA  1 
ATOM   2339 C  C   . PHE A 1 320 ? 3.079   -1.872  46.712  1.00 48.95  ? 1104 PHE A C   1 
ATOM   2340 O  O   . PHE A 1 320 ? 4.189   -1.904  47.236  1.00 49.70  ? 1104 PHE A O   1 
ATOM   2341 C  CB  . PHE A 1 320 ? 2.623   -1.651  44.258  1.00 49.29  ? 1104 PHE A CB  1 
ATOM   2342 C  CG  . PHE A 1 320 ? 3.485   -1.958  43.065  1.00 56.35  ? 1104 PHE A CG  1 
ATOM   2343 C  CD1 . PHE A 1 320 ? 3.101   -2.919  42.145  1.00 52.53  ? 1104 PHE A CD1 1 
ATOM   2344 C  CD2 . PHE A 1 320 ? 4.677   -1.280  42.863  1.00 58.04  ? 1104 PHE A CD2 1 
ATOM   2345 C  CE1 . PHE A 1 320 ? 3.889   -3.203  41.050  1.00 47.24  ? 1104 PHE A CE1 1 
ATOM   2346 C  CE2 . PHE A 1 320 ? 5.469   -1.558  41.769  1.00 60.40  ? 1104 PHE A CE2 1 
ATOM   2347 C  CZ  . PHE A 1 320 ? 5.075   -2.521  40.861  1.00 59.97  ? 1104 PHE A CZ  1 
ATOM   2348 N  N   . GLN A 1 321 ? 2.056   -1.199  47.228  1.00 48.53  ? 1105 GLN A N   1 
ATOM   2349 C  CA  . GLN A 1 321 ? 2.212   -0.333  48.393  1.00 49.21  ? 1105 GLN A CA  1 
ATOM   2350 C  C   . GLN A 1 321 ? 2.433   -1.089  49.700  1.00 51.65  ? 1105 GLN A C   1 
ATOM   2351 O  O   . GLN A 1 321 ? 3.429   -0.868  50.390  1.00 50.16  ? 1105 GLN A O   1 
ATOM   2352 C  CB  . GLN A 1 321 ? 1.011   0.606   48.534  1.00 34.69  ? 1105 GLN A CB  1 
ATOM   2353 C  CG  . GLN A 1 321 ? 1.117   1.541   49.722  1.00 36.86  ? 1105 GLN A CG  1 
ATOM   2354 C  CD  . GLN A 1 321 ? 0.059   2.623   49.705  1.00 40.59  ? 1105 GLN A CD  1 
ATOM   2355 O  OE1 . GLN A 1 321 ? -0.910  2.548   48.949  1.00 43.11  ? 1105 GLN A OE1 1 
ATOM   2356 N  NE2 . GLN A 1 321 ? 0.240   3.640   50.539  1.00 42.85  ? 1105 GLN A NE2 1 
ATOM   2357 N  N   . MET A 1 322 ? 1.504   -1.976  50.040  1.00 48.97  ? 1106 MET A N   1 
ATOM   2358 C  CA  . MET A 1 322 ? 1.526   -2.632  51.343  1.00 50.47  ? 1106 MET A CA  1 
ATOM   2359 C  C   . MET A 1 322 ? 2.005   -4.080  51.278  1.00 57.47  ? 1106 MET A C   1 
ATOM   2360 O  O   . MET A 1 322 ? 2.110   -4.752  52.306  1.00 63.24  ? 1106 MET A O   1 
ATOM   2361 C  CB  . MET A 1 322 ? 0.139   -2.570  51.983  1.00 55.96  ? 1106 MET A CB  1 
ATOM   2362 C  CG  . MET A 1 322 ? -0.938  -3.301  51.203  1.00 56.45  ? 1106 MET A CG  1 
ATOM   2363 S  SD  . MET A 1 322 ? -2.588  -2.713  51.628  1.00 63.33  ? 1106 MET A SD  1 
ATOM   2364 C  CE  . MET A 1 322 ? -2.447  -0.990  51.165  1.00 40.71  ? 1106 MET A CE  1 
ATOM   2365 N  N   . GLY A 1 323 ? 2.298   -4.560  50.073  1.00 47.28  ? 1107 GLY A N   1 
ATOM   2366 C  CA  . GLY A 1 323 ? 2.732   -5.933  49.897  1.00 44.48  ? 1107 GLY A CA  1 
ATOM   2367 C  C   . GLY A 1 323 ? 1.556   -6.888  49.900  1.00 45.23  ? 1107 GLY A C   1 
ATOM   2368 O  O   . GLY A 1 323 ? 0.466   -6.538  50.349  1.00 43.76  ? 1107 GLY A O   1 
ATOM   2369 N  N   . GLU A 1 324 ? 1.774   -8.100  49.401  1.00 41.43  ? 1108 GLU A N   1 
ATOM   2370 C  CA  . GLU A 1 324 ? 0.689   -9.067  49.285  1.00 45.46  ? 1108 GLU A CA  1 
ATOM   2371 C  C   . GLU A 1 324 ? 0.210   -9.567  50.645  1.00 51.04  ? 1108 GLU A C   1 
ATOM   2372 O  O   . GLU A 1 324 ? -0.961  -9.913  50.806  1.00 52.83  ? 1108 GLU A O   1 
ATOM   2373 C  CB  . GLU A 1 324 ? 1.083   -10.236 48.377  1.00 48.46  ? 1108 GLU A CB  1 
ATOM   2374 C  CG  . GLU A 1 324 ? 2.393   -10.914 48.735  1.00 65.75  ? 1108 GLU A CG  1 
ATOM   2375 C  CD  . GLU A 1 324 ? 2.719   -12.069 47.801  1.00 70.57  ? 1108 GLU A CD  1 
ATOM   2376 O  OE1 . GLU A 1 324 ? 1.796   -12.839 47.459  1.00 62.48  ? 1108 GLU A OE1 1 
ATOM   2377 O  OE2 . GLU A 1 324 ? 3.896   -12.199 47.397  1.00 65.49  ? 1108 GLU A OE2 1 
ATOM   2378 N  N   . THR A 1 325 ? 1.109   -9.596  51.623  1.00 54.61  ? 1109 THR A N   1 
ATOM   2379 C  CA  . THR A 1 325 ? 0.736   -10.019 52.969  1.00 58.02  ? 1109 THR A CA  1 
ATOM   2380 C  C   . THR A 1 325 ? -0.202  -8.990  53.590  1.00 56.09  ? 1109 THR A C   1 
ATOM   2381 O  O   . THR A 1 325 ? -1.106  -9.337  54.349  1.00 58.93  ? 1109 THR A O   1 
ATOM   2382 C  CB  . THR A 1 325 ? 1.965   -10.205 53.881  1.00 62.85  ? 1109 THR A CB  1 
ATOM   2383 O  OG1 . THR A 1 325 ? 2.481   -8.924  54.264  1.00 82.27  ? 1109 THR A OG1 1 
ATOM   2384 C  CG2 . THR A 1 325 ? 3.052   -11.002 53.166  1.00 58.58  ? 1109 THR A CG2 1 
ATOM   2385 N  N   . GLY A 1 326 ? 0.020   -7.722  53.258  1.00 49.59  ? 1110 GLY A N   1 
ATOM   2386 C  CA  . GLY A 1 326 ? -0.819  -6.644  53.750  1.00 55.78  ? 1110 GLY A CA  1 
ATOM   2387 C  C   . GLY A 1 326 ? -2.191  -6.667  53.103  1.00 57.47  ? 1110 GLY A C   1 
ATOM   2388 O  O   . GLY A 1 326 ? -3.214  -6.640  53.788  1.00 56.09  ? 1110 GLY A O   1 
ATOM   2389 N  N   . VAL A 1 327 ? -2.206  -6.716  51.773  1.00 56.80  ? 1111 VAL A N   1 
ATOM   2390 C  CA  . VAL A 1 327 ? -3.445  -6.781  51.007  1.00 48.03  ? 1111 VAL A CA  1 
ATOM   2391 C  C   . VAL A 1 327 ? -4.299  -7.958  51.459  1.00 45.35  ? 1111 VAL A C   1 
ATOM   2392 O  O   . VAL A 1 327 ? -5.529  -7.881  51.470  1.00 44.72  ? 1111 VAL A O   1 
ATOM   2393 C  CB  . VAL A 1 327 ? -3.157  -6.926  49.502  1.00 39.94  ? 1111 VAL A CB  1 
ATOM   2394 C  CG1 . VAL A 1 327 ? -4.454  -7.095  48.722  1.00 35.58  ? 1111 VAL A CG1 1 
ATOM   2395 C  CG2 . VAL A 1 327 ? -2.372  -5.728  49.002  1.00 41.40  ? 1111 VAL A CG2 1 
ATOM   2396 N  N   . ALA A 1 328 ? -3.636  -9.048  51.833  1.00 47.82  ? 1112 ALA A N   1 
ATOM   2397 C  CA  . ALA A 1 328 ? -4.327  -10.250 52.282  1.00 49.93  ? 1112 ALA A CA  1 
ATOM   2398 C  C   . ALA A 1 328 ? -5.155  -9.982  53.536  1.00 53.36  ? 1112 ALA A C   1 
ATOM   2399 O  O   . ALA A 1 328 ? -6.111  -10.702 53.823  1.00 49.65  ? 1112 ALA A O   1 
ATOM   2400 C  CB  . ALA A 1 328 ? -3.332  -11.375 52.527  1.00 49.18  ? 1112 ALA A CB  1 
ATOM   2401 N  N   . GLY A 1 329 ? -4.783  -8.943  54.278  1.00 48.04  ? 1113 GLY A N   1 
ATOM   2402 C  CA  . GLY A 1 329 ? -5.499  -8.571  55.482  1.00 40.91  ? 1113 GLY A CA  1 
ATOM   2403 C  C   . GLY A 1 329 ? -6.869  -7.988  55.183  1.00 48.10  ? 1113 GLY A C   1 
ATOM   2404 O  O   . GLY A 1 329 ? -7.680  -7.802  56.097  1.00 47.34  ? 1113 GLY A O   1 
ATOM   2405 N  N   . PHE A 1 330 ? -7.127  -7.699  53.909  1.00 52.45  ? 1114 PHE A N   1 
ATOM   2406 C  CA  . PHE A 1 330 ? -8.397  -7.105  53.496  1.00 48.28  ? 1114 PHE A CA  1 
ATOM   2407 C  C   . PHE A 1 330 ? -9.390  -8.170  53.031  1.00 47.81  ? 1114 PHE A C   1 
ATOM   2408 O  O   . PHE A 1 330 ? -10.259 -7.899  52.201  1.00 46.57  ? 1114 PHE A O   1 
ATOM   2409 C  CB  . PHE A 1 330 ? -8.177  -6.100  52.363  1.00 47.81  ? 1114 PHE A CB  1 
ATOM   2410 C  CG  . PHE A 1 330 ? -7.478  -4.837  52.788  1.00 46.66  ? 1114 PHE A CG  1 
ATOM   2411 C  CD1 . PHE A 1 330 ? -8.208  -3.704  53.114  1.00 47.83  ? 1114 PHE A CD1 1 
ATOM   2412 C  CD2 . PHE A 1 330 ? -6.095  -4.780  52.859  1.00 45.34  ? 1114 PHE A CD2 1 
ATOM   2413 C  CE1 . PHE A 1 330 ? -7.569  -2.536  53.507  1.00 48.98  ? 1114 PHE A CE1 1 
ATOM   2414 C  CE2 . PHE A 1 330 ? -5.454  -3.620  53.251  1.00 54.38  ? 1114 PHE A CE2 1 
ATOM   2415 C  CZ  . PHE A 1 330 ? -6.190  -2.495  53.575  1.00 45.36  ? 1114 PHE A CZ  1 
ATOM   2416 N  N   . THR A 1 331 ? -9.272  -9.371  53.587  1.00 51.41  ? 1115 THR A N   1 
ATOM   2417 C  CA  . THR A 1 331 ? -10.140 -10.492 53.226  1.00 54.53  ? 1115 THR A CA  1 
ATOM   2418 C  C   . THR A 1 331 ? -11.615 -10.104 53.132  1.00 51.74  ? 1115 THR A C   1 
ATOM   2419 O  O   . THR A 1 331 ? -12.310 -10.488 52.189  1.00 50.30  ? 1115 THR A O   1 
ATOM   2420 C  CB  . THR A 1 331 ? -9.993  -11.660 54.219  1.00 57.34  ? 1115 THR A CB  1 
ATOM   2421 O  OG1 . THR A 1 331 ? -8.626  -12.094 54.245  1.00 83.04  ? 1115 THR A OG1 1 
ATOM   2422 C  CG2 . THR A 1 331 ? -10.891 -12.821 53.801  1.00 67.45  ? 1115 THR A CG2 1 
ATOM   2423 N  N   . ASN A 1 332 ? -12.085 -9.343  54.115  1.00 48.19  ? 1116 ASN A N   1 
ATOM   2424 C  CA  . ASN A 1 332 ? -13.478 -8.911  54.150  1.00 48.21  ? 1116 ASN A CA  1 
ATOM   2425 C  C   . ASN A 1 332 ? -13.873 -8.079  52.937  1.00 43.76  ? 1116 ASN A C   1 
ATOM   2426 O  O   . ASN A 1 332 ? -14.875 -8.362  52.288  1.00 38.37  ? 1116 ASN A O   1 
ATOM   2427 C  CB  . ASN A 1 332 ? -13.778 -8.133  55.432  1.00 55.98  ? 1116 ASN A CB  1 
ATOM   2428 C  CG  . ASN A 1 332 ? -13.739 -9.006  56.670  1.00 56.69  ? 1116 ASN A CG  1 
ATOM   2429 O  OD1 . ASN A 1 332 ? -13.958 -10.218 56.604  1.00 56.64  ? 1116 ASN A OD1 1 
ATOM   2430 N  ND2 . ASN A 1 332 ? -13.466 -8.389  57.814  1.00 54.23  ? 1116 ASN A ND2 1 
ATOM   2431 N  N   . SER A 1 333 ? -13.085 -7.050  52.644  1.00 50.15  ? 1117 SER A N   1 
ATOM   2432 C  CA  . SER A 1 333 ? -13.339 -6.192  51.493  1.00 44.24  ? 1117 SER A CA  1 
ATOM   2433 C  C   . SER A 1 333 ? -13.118 -6.958  50.194  1.00 40.96  ? 1117 SER A C   1 
ATOM   2434 O  O   . SER A 1 333 ? -13.873 -6.800  49.234  1.00 39.90  ? 1117 SER A O   1 
ATOM   2435 C  CB  . SER A 1 333 ? -12.445 -4.950  51.539  1.00 39.97  ? 1117 SER A CB  1 
ATOM   2436 O  OG  . SER A 1 333 ? -12.820 -4.087  52.598  1.00 38.92  ? 1117 SER A OG  1 
ATOM   2437 N  N   . LEU A 1 334 ? -12.082 -7.791  50.169  1.00 39.83  ? 1118 LEU A N   1 
ATOM   2438 C  CA  . LEU A 1 334 ? -11.808 -8.626  49.004  1.00 37.19  ? 1118 LEU A CA  1 
ATOM   2439 C  C   . LEU A 1 334 ? -13.019 -9.488  48.653  1.00 38.65  ? 1118 LEU A C   1 
ATOM   2440 O  O   . LEU A 1 334 ? -13.392 -9.608  47.486  1.00 45.53  ? 1118 LEU A O   1 
ATOM   2441 C  CB  . LEU A 1 334 ? -10.573 -9.504  49.236  1.00 40.89  ? 1118 LEU A CB  1 
ATOM   2442 C  CG  . LEU A 1 334 ? -9.247  -8.769  49.448  1.00 41.17  ? 1118 LEU A CG  1 
ATOM   2443 C  CD1 . LEU A 1 334 ? -8.089  -9.755  49.485  1.00 39.87  ? 1118 LEU A CD1 1 
ATOM   2444 C  CD2 . LEU A 1 334 ? -9.032  -7.725  48.365  1.00 37.26  ? 1118 LEU A CD2 1 
ATOM   2445 N  N   . ARG A 1 335 ? -13.636 -10.080 49.671  1.00 41.17  ? 1119 ARG A N   1 
ATOM   2446 C  CA  . ARG A 1 335 ? -14.825 -10.899 49.464  1.00 45.58  ? 1119 ARG A CA  1 
ATOM   2447 C  C   . ARG A 1 335 ? -15.982 -10.063 48.915  1.00 44.69  ? 1119 ARG A C   1 
ATOM   2448 O  O   . ARG A 1 335 ? -16.830 -10.564 48.179  1.00 39.66  ? 1119 ARG A O   1 
ATOM   2449 C  CB  . ARG A 1 335 ? -15.233 -11.606 50.764  1.00 44.56  ? 1119 ARG A CB  1 
ATOM   2450 C  CG  . ARG A 1 335 ? -16.374 -12.601 50.594  1.00 47.18  ? 1119 ARG A CG  1 
ATOM   2451 C  CD  . ARG A 1 335 ? -16.483 -13.562 51.773  1.00 60.40  ? 1119 ARG A CD  1 
ATOM   2452 N  NE  . ARG A 1 335 ? -17.020 -12.926 52.973  1.00 74.79  ? 1119 ARG A NE  1 
ATOM   2453 C  CZ  . ARG A 1 335 ? -16.309 -12.663 54.065  1.00 78.00  ? 1119 ARG A CZ  1 
ATOM   2454 N  NH1 . ARG A 1 335 ? -15.023 -12.988 54.113  1.00 67.11  ? 1119 ARG A NH1 1 
ATOM   2455 N  NH2 . ARG A 1 335 ? -16.883 -12.081 55.111  1.00 75.14  ? 1119 ARG A NH2 1 
ATOM   2456 N  N   . MET A 1 336 ? -16.001 -8.782  49.268  1.00 49.20  ? 1120 MET A N   1 
ATOM   2457 C  CA  . MET A 1 336 ? -17.037 -7.869  48.799  1.00 45.24  ? 1120 MET A CA  1 
ATOM   2458 C  C   . MET A 1 336 ? -16.821 -7.533  47.327  1.00 48.45  ? 1120 MET A C   1 
ATOM   2459 O  O   . MET A 1 336 ? -17.775 -7.264  46.591  1.00 46.32  ? 1120 MET A O   1 
ATOM   2460 C  CB  . MET A 1 336 ? -17.041 -6.592  49.639  1.00 42.54  ? 1120 MET A CB  1 
ATOM   2461 C  CG  . MET A 1 336 ? -17.125 -6.836  51.135  1.00 43.91  ? 1120 MET A CG  1 
ATOM   2462 S  SD  . MET A 1 336 ? -17.597 -5.360  52.055  1.00 47.07  ? 1120 MET A SD  1 
ATOM   2463 C  CE  . MET A 1 336 ? -19.267 -5.131  51.453  1.00 43.40  ? 1120 MET A CE  1 
ATOM   2464 N  N   . LEU A 1 337 ? -15.559 -7.537  46.908  1.00 48.65  ? 1121 LEU A N   1 
ATOM   2465 C  CA  . LEU A 1 337 ? -15.216 -7.339  45.504  1.00 40.89  ? 1121 LEU A CA  1 
ATOM   2466 C  C   . LEU A 1 337 ? -15.657 -8.536  44.666  1.00 41.70  ? 1121 LEU A C   1 
ATOM   2467 O  O   . LEU A 1 337 ? -16.255 -8.377  43.601  1.00 43.03  ? 1121 LEU A O   1 
ATOM   2468 C  CB  . LEU A 1 337 ? -13.713 -7.107  45.345  1.00 36.09  ? 1121 LEU A CB  1 
ATOM   2469 C  CG  . LEU A 1 337 ? -13.193 -5.761  45.854  1.00 41.36  ? 1121 LEU A CG  1 
ATOM   2470 C  CD1 . LEU A 1 337 ? -11.672 -5.746  45.903  1.00 37.39  ? 1121 LEU A CD1 1 
ATOM   2471 C  CD2 . LEU A 1 337 ? -13.722 -4.628  44.983  1.00 39.24  ? 1121 LEU A CD2 1 
ATOM   2472 N  N   . GLN A 1 338 ? -15.364 -9.736  45.159  1.00 43.74  ? 1122 GLN A N   1 
ATOM   2473 C  CA  . GLN A 1 338 ? -15.737 -10.963 44.461  1.00 44.69  ? 1122 GLN A CA  1 
ATOM   2474 C  C   . GLN A 1 338 ? -17.253 -11.070 44.302  1.00 40.77  ? 1122 GLN A C   1 
ATOM   2475 O  O   . GLN A 1 338 ? -17.746 -11.678 43.352  1.00 35.64  ? 1122 GLN A O   1 
ATOM   2476 C  CB  . GLN A 1 338 ? -15.183 -12.191 45.190  1.00 41.16  ? 1122 GLN A CB  1 
ATOM   2477 C  CG  . GLN A 1 338 ? -13.682 -12.137 45.444  1.00 43.38  ? 1122 GLN A CG  1 
ATOM   2478 C  CD  . GLN A 1 338 ? -13.140 -13.419 46.057  1.00 54.69  ? 1122 GLN A CD  1 
ATOM   2479 O  OE1 . GLN A 1 338 ? -13.406 -14.518 45.567  1.00 57.21  ? 1122 GLN A OE1 1 
ATOM   2480 N  NE2 . GLN A 1 338 ? -12.373 -13.283 47.137  1.00 49.68  ? 1122 GLN A NE2 1 
ATOM   2481 N  N   . GLN A 1 339 ? -17.983 -10.473 45.239  1.00 44.44  ? 1123 GLN A N   1 
ATOM   2482 C  CA  . GLN A 1 339 ? -19.441 -10.442 45.184  1.00 43.83  ? 1123 GLN A CA  1 
ATOM   2483 C  C   . GLN A 1 339 ? -19.940 -9.340  44.252  1.00 44.14  ? 1123 GLN A C   1 
ATOM   2484 O  O   . GLN A 1 339 ? -21.145 -9.195  44.040  1.00 40.69  ? 1123 GLN A O   1 
ATOM   2485 C  CB  . GLN A 1 339 ? -20.025 -10.256 46.586  1.00 43.93  ? 1123 GLN A CB  1 
ATOM   2486 C  CG  . GLN A 1 339 ? -19.766 -11.426 47.524  1.00 53.03  ? 1123 GLN A CG  1 
ATOM   2487 C  CD  . GLN A 1 339 ? -20.030 -11.078 48.978  1.00 55.95  ? 1123 GLN A CD  1 
ATOM   2488 O  OE1 . GLN A 1 339 ? -20.073 -9.904  49.351  1.00 50.85  ? 1123 GLN A OE1 1 
ATOM   2489 N  NE2 . GLN A 1 339 ? -20.206 -12.101 49.809  1.00 52.85  ? 1123 GLN A NE2 1 
ATOM   2490 N  N   . LYS A 1 340 ? -19.005 -8.561  43.712  1.00 42.52  ? 1124 LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 340 ? -19.319 -7.531  42.725  1.00 38.05  ? 1124 LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 340 ? -20.135 -6.381  43.317  1.00 42.36  ? 1124 LYS A C   1 
ATOM   2493 O  O   . LYS A 1 340 ? -20.835 -5.666  42.604  1.00 49.03  ? 1124 LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 340 ? -20.032 -8.152  41.522  1.00 37.06  ? 1124 LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 340 ? -19.212 -9.230  40.812  1.00 37.39  ? 1124 LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 340 ? -18.191 -8.616  39.864  1.00 42.39  ? 1124 LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 340 ? -17.031 -9.560  39.570  1.00 44.47  ? 1124 LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 340 ? -16.093 -9.666  40.730  1.00 32.94  ? 1124 LYS A NZ  1 
ATOM   2499 N  N   . ARG A 1 341 ? -20.033 -6.217  44.633  1.00 43.86  ? 1125 ARG A N   1 
ATOM   2500 C  CA  . ARG A 1 341 ? -20.697 -5.134  45.350  1.00 42.43  ? 1125 ARG A CA  1 
ATOM   2501 C  C   . ARG A 1 341 ? -19.710 -3.991  45.541  1.00 43.60  ? 1125 ARG A C   1 
ATOM   2502 O  O   . ARG A 1 341 ? -19.046 -3.900  46.571  1.00 41.60  ? 1125 ARG A O   1 
ATOM   2503 C  CB  . ARG A 1 341 ? -21.197 -5.633  46.708  1.00 42.78  ? 1125 ARG A CB  1 
ATOM   2504 C  CG  . ARG A 1 341 ? -21.864 -6.999  46.650  1.00 41.25  ? 1125 ARG A CG  1 
ATOM   2505 C  CD  . ARG A 1 341 ? -21.951 -7.641  48.026  1.00 57.66  ? 1125 ARG A CD  1 
ATOM   2506 N  NE  . ARG A 1 341 ? -23.124 -7.205  48.782  1.00 71.25  ? 1125 ARG A NE  1 
ATOM   2507 C  CZ  . ARG A 1 341 ? -23.237 -7.296  50.104  1.00 64.71  ? 1125 ARG A CZ  1 
ATOM   2508 N  NH1 . ARG A 1 341 ? -22.240 -7.790  50.827  1.00 57.78  ? 1125 ARG A NH1 1 
ATOM   2509 N  NH2 . ARG A 1 341 ? -24.341 -6.880  50.708  1.00 67.45  ? 1125 ARG A NH2 1 
ATOM   2510 N  N   . TRP A 1 342 ? -19.616 -3.123  44.539  1.00 44.56  ? 1126 TRP A N   1 
ATOM   2511 C  CA  . TRP A 1 342 ? -18.544 -2.132  44.475  1.00 44.41  ? 1126 TRP A CA  1 
ATOM   2512 C  C   . TRP A 1 342 ? -18.628 -1.028  45.527  1.00 41.64  ? 1126 TRP A C   1 
ATOM   2513 O  O   . TRP A 1 342 ? -17.632 -0.713  46.183  1.00 42.45  ? 1126 TRP A O   1 
ATOM   2514 C  CB  . TRP A 1 342 ? -18.482 -1.512  43.079  1.00 49.08  ? 1126 TRP A CB  1 
ATOM   2515 C  CG  . TRP A 1 342 ? -18.611 -2.525  41.988  1.00 37.35  ? 1126 TRP A CG  1 
ATOM   2516 C  CD1 . TRP A 1 342 ? -19.622 -2.625  41.076  1.00 39.03  ? 1126 TRP A CD1 1 
ATOM   2517 C  CD2 . TRP A 1 342 ? -17.709 -3.602  41.710  1.00 36.52  ? 1126 TRP A CD2 1 
ATOM   2518 N  NE1 . TRP A 1 342 ? -19.399 -3.691  40.237  1.00 42.21  ? 1126 TRP A NE1 1 
ATOM   2519 C  CE2 . TRP A 1 342 ? -18.231 -4.309  40.604  1.00 39.56  ? 1126 TRP A CE2 1 
ATOM   2520 C  CE3 . TRP A 1 342 ? -16.508 -4.036  42.281  1.00 34.70  ? 1126 TRP A CE3 1 
ATOM   2521 C  CZ2 . TRP A 1 342 ? -17.593 -5.423  40.060  1.00 31.12  ? 1126 TRP A CZ2 1 
ATOM   2522 C  CZ3 . TRP A 1 342 ? -15.876 -5.142  41.740  1.00 33.40  ? 1126 TRP A CZ3 1 
ATOM   2523 C  CH2 . TRP A 1 342 ? -16.419 -5.823  40.641  1.00 32.78  ? 1126 TRP A CH2 1 
ATOM   2524 N  N   . ASP A 1 343 ? -19.809 -0.436  45.676  1.00 46.71  ? 1127 ASP A N   1 
ATOM   2525 C  CA  . ASP A 1 343 ? -19.987 0.685   46.598  1.00 55.19  ? 1127 ASP A CA  1 
ATOM   2526 C  C   . ASP A 1 343 ? -19.729 0.284   48.048  1.00 54.64  ? 1127 ASP A C   1 
ATOM   2527 O  O   . ASP A 1 343 ? -19.154 1.049   48.823  1.00 52.59  ? 1127 ASP A O   1 
ATOM   2528 C  CB  . ASP A 1 343 ? -21.388 1.286   46.464  1.00 50.78  ? 1127 ASP A CB  1 
ATOM   2529 C  CG  . ASP A 1 343 ? -21.672 1.793   45.063  1.00 58.90  ? 1127 ASP A CG  1 
ATOM   2530 O  OD1 . ASP A 1 343 ? -20.705 2.041   44.312  1.00 57.05  ? 1127 ASP A OD1 1 
ATOM   2531 O  OD2 . ASP A 1 343 ? -22.861 1.947   44.714  1.00 65.03  ? 1127 ASP A OD2 1 
ATOM   2532 N  N   . GLU A 1 344 ? -20.166 -0.917  48.410  1.00 49.52  ? 1128 GLU A N   1 
ATOM   2533 C  CA  . GLU A 1 344 ? -19.977 -1.420  49.763  1.00 47.06  ? 1128 GLU A CA  1 
ATOM   2534 C  C   . GLU A 1 344 ? -18.520 -1.811  49.985  1.00 47.19  ? 1128 GLU A C   1 
ATOM   2535 O  O   . GLU A 1 344 ? -17.975 -1.630  51.074  1.00 45.51  ? 1128 GLU A O   1 
ATOM   2536 C  CB  . GLU A 1 344 ? -20.896 -2.613  50.017  1.00 45.99  ? 1128 GLU A CB  1 
ATOM   2537 C  CG  . GLU A 1 344 ? -22.351 -2.344  49.687  1.00 58.66  ? 1128 GLU A CG  1 
ATOM   2538 C  CD  . GLU A 1 344 ? -23.235 -3.545  49.949  1.00 66.16  ? 1128 GLU A CD  1 
ATOM   2539 O  OE1 . GLU A 1 344 ? -22.740 -4.529  50.536  1.00 63.19  ? 1128 GLU A OE1 1 
ATOM   2540 O  OE2 . GLU A 1 344 ? -24.424 -3.505  49.567  1.00 77.18  ? 1128 GLU A OE2 1 
ATOM   2541 N  N   . ALA A 1 345 ? -17.895 -2.352  48.944  1.00 45.66  ? 1129 ALA A N   1 
ATOM   2542 C  CA  . ALA A 1 345 ? -16.475 -2.677  48.991  1.00 44.74  ? 1129 ALA A CA  1 
ATOM   2543 C  C   . ALA A 1 345 ? -15.667 -1.412  49.272  1.00 41.24  ? 1129 ALA A C   1 
ATOM   2544 O  O   . ALA A 1 345 ? -14.694 -1.430  50.030  1.00 34.12  ? 1129 ALA A O   1 
ATOM   2545 C  CB  . ALA A 1 345 ? -16.034 -3.319  47.683  1.00 35.78  ? 1129 ALA A CB  1 
ATOM   2546 N  N   . ALA A 1 346 ? -16.088 -0.311  48.656  1.00 42.92  ? 1130 ALA A N   1 
ATOM   2547 C  CA  . ALA A 1 346 ? -15.436 0.979   48.842  1.00 43.17  ? 1130 ALA A CA  1 
ATOM   2548 C  C   . ALA A 1 346 ? -15.604 1.474   50.275  1.00 41.54  ? 1130 ALA A C   1 
ATOM   2549 O  O   . ALA A 1 346 ? -14.627 1.797   50.950  1.00 36.07  ? 1130 ALA A O   1 
ATOM   2550 C  CB  . ALA A 1 346 ? -15.991 1.995   47.858  1.00 38.60  ? 1130 ALA A CB  1 
ATOM   2551 N  N   . VAL A 1 347 ? -16.850 1.532   50.733  1.00 42.98  ? 1131 VAL A N   1 
ATOM   2552 C  CA  . VAL A 1 347 ? -17.150 1.927   52.102  1.00 44.43  ? 1131 VAL A CA  1 
ATOM   2553 C  C   . VAL A 1 347 ? -16.308 1.125   53.087  1.00 44.68  ? 1131 VAL A C   1 
ATOM   2554 O  O   . VAL A 1 347 ? -15.748 1.675   54.038  1.00 42.07  ? 1131 VAL A O   1 
ATOM   2555 C  CB  . VAL A 1 347 ? -18.641 1.717   52.433  1.00 41.94  ? 1131 VAL A CB  1 
ATOM   2556 C  CG1 . VAL A 1 347 ? -18.887 1.924   53.920  1.00 38.02  ? 1131 VAL A CG1 1 
ATOM   2557 C  CG2 . VAL A 1 347 ? -19.507 2.648   51.597  1.00 46.13  ? 1131 VAL A CG2 1 
ATOM   2558 N  N   . ASN A 1 348 ? -16.215 -0.178  52.844  1.00 37.21  ? 1132 ASN A N   1 
ATOM   2559 C  CA  . ASN A 1 348 ? -15.489 -1.074  53.733  1.00 34.89  ? 1132 ASN A CA  1 
ATOM   2560 C  C   . ASN A 1 348 ? -13.983 -0.821  53.703  1.00 39.58  ? 1132 ASN A C   1 
ATOM   2561 O  O   . ASN A 1 348 ? -13.303 -0.940  54.723  1.00 40.38  ? 1132 ASN A O   1 
ATOM   2562 C  CB  . ASN A 1 348 ? -15.799 -2.529  53.380  1.00 38.88  ? 1132 ASN A CB  1 
ATOM   2563 C  CG  . ASN A 1 348 ? -15.470 -3.486  54.507  1.00 40.28  ? 1132 ASN A CG  1 
ATOM   2564 O  OD1 . ASN A 1 348 ? -14.621 -4.367  54.363  1.00 41.48  ? 1132 ASN A OD1 1 
ATOM   2565 N  ND2 . ASN A 1 348 ? -16.139 -3.313  55.642  1.00 33.49  ? 1132 ASN A ND2 1 
ATOM   2566 N  N   . LEU A 1 349 ? -13.470 -0.467  52.528  1.00 47.78  ? 1133 LEU A N   1 
ATOM   2567 C  CA  . LEU A 1 349 ? -12.043 -0.202  52.357  1.00 38.05  ? 1133 LEU A CA  1 
ATOM   2568 C  C   . LEU A 1 349 ? -11.603 1.079   53.057  1.00 41.66  ? 1133 LEU A C   1 
ATOM   2569 O  O   . LEU A 1 349 ? -10.465 1.185   53.517  1.00 36.64  ? 1133 LEU A O   1 
ATOM   2570 C  CB  . LEU A 1 349 ? -11.686 -0.131  50.873  1.00 35.37  ? 1133 LEU A CB  1 
ATOM   2571 C  CG  . LEU A 1 349 ? -11.567 -1.468  50.142  1.00 38.41  ? 1133 LEU A CG  1 
ATOM   2572 C  CD1 . LEU A 1 349 ? -11.442 -1.249  48.642  1.00 35.84  ? 1133 LEU A CD1 1 
ATOM   2573 C  CD2 . LEU A 1 349 ? -10.382 -2.255  50.681  1.00 48.99  ? 1133 LEU A CD2 1 
ATOM   2574 N  N   . ALA A 1 350 ? -12.509 2.048   53.136  1.00 45.89  ? 1134 ALA A N   1 
ATOM   2575 C  CA  . ALA A 1 350 ? -12.206 3.339   53.744  1.00 48.23  ? 1134 ALA A CA  1 
ATOM   2576 C  C   . ALA A 1 350 ? -12.097 3.247   55.268  1.00 51.05  ? 1134 ALA A C   1 
ATOM   2577 O  O   . ALA A 1 350 ? -11.609 4.171   55.920  1.00 50.80  ? 1134 ALA A O   1 
ATOM   2578 C  CB  . ALA A 1 350 ? -13.251 4.372   53.342  1.00 44.99  ? 1134 ALA A CB  1 
ATOM   2579 N  N   . LYS A 1 351 ? -12.549 2.129   55.827  1.00 46.75  ? 1135 LYS A N   1 
ATOM   2580 C  CA  . LYS A 1 351 ? -12.488 1.912   57.271  1.00 47.52  ? 1135 LYS A CA  1 
ATOM   2581 C  C   . LYS A 1 351 ? -11.087 1.497   57.725  1.00 48.21  ? 1135 LYS A C   1 
ATOM   2582 O  O   . LYS A 1 351 ? -10.805 1.445   58.922  1.00 49.44  ? 1135 LYS A O   1 
ATOM   2583 C  CB  . LYS A 1 351 ? -13.511 0.856   57.703  1.00 39.08  ? 1135 LYS A CB  1 
ATOM   2584 C  CG  . LYS A 1 351 ? -14.962 1.236   57.449  1.00 38.88  ? 1135 LYS A CG  1 
ATOM   2585 C  CD  . LYS A 1 351 ? -15.915 0.162   57.962  1.00 46.43  ? 1135 LYS A CD  1 
ATOM   2586 C  CE  . LYS A 1 351 ? -17.334 0.378   57.453  1.00 44.58  ? 1135 LYS A CE  1 
ATOM   2587 N  NZ  . LYS A 1 351 ? -17.879 1.711   57.836  1.00 42.39  ? 1135 LYS A NZ  1 
ATOM   2588 N  N   . SER A 1 352 ? -10.216 1.196   56.768  1.00 55.91  ? 1136 SER A N   1 
ATOM   2589 C  CA  . SER A 1 352 ? -8.843  0.809   57.078  1.00 54.74  ? 1136 SER A CA  1 
ATOM   2590 C  C   . SER A 1 352 ? -7.994  2.033   57.417  1.00 55.89  ? 1136 SER A C   1 
ATOM   2591 O  O   . SER A 1 352 ? -8.333  3.156   57.044  1.00 50.60  ? 1136 SER A O   1 
ATOM   2592 C  CB  . SER A 1 352 ? -8.221  0.050   55.903  1.00 54.37  ? 1136 SER A CB  1 
ATOM   2593 O  OG  . SER A 1 352 ? -8.099  0.884   54.763  1.00 48.18  ? 1136 SER A OG  1 
ATOM   2594 N  N   . ARG A 1 353 ? -6.892  1.812   58.129  1.00 54.30  ? 1137 ARG A N   1 
ATOM   2595 C  CA  . ARG A 1 353 ? -5.974  2.899   58.454  1.00 47.76  ? 1137 ARG A CA  1 
ATOM   2596 C  C   . ARG A 1 353 ? -5.138  3.260   57.233  1.00 58.54  ? 1137 ARG A C   1 
ATOM   2597 O  O   . ARG A 1 353 ? -4.617  4.372   57.131  1.00 55.89  ? 1137 ARG A O   1 
ATOM   2598 C  CB  . ARG A 1 353 ? -5.080  2.528   59.639  1.00 52.02  ? 1137 ARG A CB  1 
ATOM   2599 C  CG  . ARG A 1 353 ? -4.566  1.099   59.619  1.00 56.10  ? 1137 ARG A CG  1 
ATOM   2600 C  CD  . ARG A 1 353 ? -3.734  0.813   60.857  1.00 58.81  ? 1137 ARG A CD  1 
ATOM   2601 N  NE  . ARG A 1 353 ? -3.544  -0.617  61.080  1.00 75.88  ? 1137 ARG A NE  1 
ATOM   2602 C  CZ  . ARG A 1 353 ? -2.912  -1.130  62.132  1.00 80.92  ? 1137 ARG A CZ  1 
ATOM   2603 N  NH1 . ARG A 1 353 ? -2.406  -0.329  63.062  1.00 67.67  ? 1137 ARG A NH1 1 
ATOM   2604 N  NH2 . ARG A 1 353 ? -2.786  -2.446  62.256  1.00 84.73  ? 1137 ARG A NH2 1 
ATOM   2605 N  N   . TRP A 1 354 ? -5.019  2.309   56.311  1.00 59.83  ? 1138 TRP A N   1 
ATOM   2606 C  CA  . TRP A 1 354 ? -4.378  2.549   55.023  1.00 61.50  ? 1138 TRP A CA  1 
ATOM   2607 C  C   . TRP A 1 354 ? -5.001  3.765   54.346  1.00 55.46  ? 1138 TRP A C   1 
ATOM   2608 O  O   . TRP A 1 354 ? -4.300  4.605   53.781  1.00 47.69  ? 1138 TRP A O   1 
ATOM   2609 C  CB  . TRP A 1 354 ? -4.517  1.314   54.126  1.00 64.76  ? 1138 TRP A CB  1 
ATOM   2610 C  CG  . TRP A 1 354 ? -4.289  1.582   52.661  1.00 60.72  ? 1138 TRP A CG  1 
ATOM   2611 C  CD1 . TRP A 1 354 ? -3.144  2.047   52.081  1.00 51.95  ? 1138 TRP A CD1 1 
ATOM   2612 C  CD2 . TRP A 1 354 ? -5.229  1.383   51.595  1.00 55.77  ? 1138 TRP A CD2 1 
ATOM   2613 N  NE1 . TRP A 1 354 ? -3.314  2.158   50.721  1.00 54.55  ? 1138 TRP A NE1 1 
ATOM   2614 C  CE2 . TRP A 1 354 ? -4.582  1.756   50.395  1.00 54.11  ? 1138 TRP A CE2 1 
ATOM   2615 C  CE3 . TRP A 1 354 ? -6.551  0.931   51.532  1.00 51.13  ? 1138 TRP A CE3 1 
ATOM   2616 C  CZ2 . TRP A 1 354 ? -5.214  1.689   49.155  1.00 50.70  ? 1138 TRP A CZ2 1 
ATOM   2617 C  CZ3 . TRP A 1 354 ? -7.176  0.864   50.300  1.00 40.90  ? 1138 TRP A CZ3 1 
ATOM   2618 C  CH2 . TRP A 1 354 ? -6.506  1.242   49.128  1.00 51.58  ? 1138 TRP A CH2 1 
ATOM   2619 N  N   . TYR A 1 355 ? -6.325  3.850   54.415  1.00 51.01  ? 1139 TYR A N   1 
ATOM   2620 C  CA  . TYR A 1 355 ? -7.057  4.973   53.845  1.00 47.86  ? 1139 TYR A CA  1 
ATOM   2621 C  C   . TYR A 1 355 ? -6.700  6.281   54.543  1.00 50.65  ? 1139 TYR A C   1 
ATOM   2622 O  O   . TYR A 1 355 ? -6.661  7.340   53.916  1.00 52.42  ? 1139 TYR A O   1 
ATOM   2623 C  CB  . TYR A 1 355 ? -8.564  4.728   53.946  1.00 49.58  ? 1139 TYR A CB  1 
ATOM   2624 C  CG  . TYR A 1 355 ? -9.403  5.910   53.515  1.00 56.46  ? 1139 TYR A CG  1 
ATOM   2625 C  CD1 . TYR A 1 355 ? -9.856  6.024   52.207  1.00 50.22  ? 1139 TYR A CD1 1 
ATOM   2626 C  CD2 . TYR A 1 355 ? -9.742  6.913   54.416  1.00 53.49  ? 1139 TYR A CD2 1 
ATOM   2627 C  CE1 . TYR A 1 355 ? -10.624 7.103   51.806  1.00 48.31  ? 1139 TYR A CE1 1 
ATOM   2628 C  CE2 . TYR A 1 355 ? -10.509 7.998   54.025  1.00 63.28  ? 1139 TYR A CE2 1 
ATOM   2629 C  CZ  . TYR A 1 355 ? -10.948 8.087   52.718  1.00 66.15  ? 1139 TYR A CZ  1 
ATOM   2630 O  OH  . TYR A 1 355 ? -11.713 9.163   52.323  1.00 64.63  ? 1139 TYR A OH  1 
ATOM   2631 N  N   . ASN A 1 356 ? -6.441  6.199   55.844  1.00 52.80  ? 1140 ASN A N   1 
ATOM   2632 C  CA  . ASN A 1 356 ? -6.167  7.385   56.649  1.00 51.61  ? 1140 ASN A CA  1 
ATOM   2633 C  C   . ASN A 1 356 ? -4.719  7.860   56.565  1.00 53.07  ? 1140 ASN A C   1 
ATOM   2634 O  O   . ASN A 1 356 ? -4.433  9.040   56.771  1.00 56.11  ? 1140 ASN A O   1 
ATOM   2635 C  CB  . ASN A 1 356 ? -6.548  7.137   58.110  1.00 49.31  ? 1140 ASN A CB  1 
ATOM   2636 C  CG  . ASN A 1 356 ? -8.013  6.779   58.280  1.00 48.46  ? 1140 ASN A CG  1 
ATOM   2637 O  OD1 . ASN A 1 356 ? -8.855  7.647   58.519  1.00 43.73  ? 1140 ASN A OD1 1 
ATOM   2638 N  ND2 . ASN A 1 356 ? -8.326  5.493   58.152  1.00 45.95  ? 1140 ASN A ND2 1 
ATOM   2639 N  N   . GLN A 1 357 ? -3.809  6.941   56.256  1.00 58.55  ? 1141 GLN A N   1 
ATOM   2640 C  CA  . GLN A 1 357 ? -2.386  7.265   56.202  1.00 64.05  ? 1141 GLN A CA  1 
ATOM   2641 C  C   . GLN A 1 357 ? -1.928  7.665   54.794  1.00 65.00  ? 1141 GLN A C   1 
ATOM   2642 O  O   . GLN A 1 357 ? -0.904  8.333   54.634  1.00 63.95  ? 1141 GLN A O   1 
ATOM   2643 C  CB  . GLN A 1 357 ? -1.554  6.100   56.748  1.00 58.42  ? 1141 GLN A CB  1 
ATOM   2644 C  CG  . GLN A 1 357 ? -1.835  5.797   58.215  1.00 65.65  ? 1141 GLN A CG  1 
ATOM   2645 C  CD  . GLN A 1 357 ? -1.026  4.629   58.748  1.00 69.15  ? 1141 GLN A CD  1 
ATOM   2646 O  OE1 . GLN A 1 357 ? -0.310  3.961   58.002  1.00 71.62  ? 1141 GLN A OE1 1 
ATOM   2647 N  NE2 . GLN A 1 357 ? -1.138  4.378   60.049  1.00 71.27  ? 1141 GLN A NE2 1 
ATOM   2648 N  N   . THR A 1 358 ? -2.690  7.255   53.782  1.00 58.98  ? 1142 THR A N   1 
ATOM   2649 C  CA  . THR A 1 358 ? -2.428  7.656   52.400  1.00 58.66  ? 1142 THR A CA  1 
ATOM   2650 C  C   . THR A 1 358 ? -3.734  7.961   51.671  1.00 54.18  ? 1142 THR A C   1 
ATOM   2651 O  O   . THR A 1 358 ? -4.078  7.288   50.697  1.00 47.02  ? 1142 THR A O   1 
ATOM   2652 C  CB  . THR A 1 358 ? -1.659  6.572   51.619  1.00 59.02  ? 1142 THR A CB  1 
ATOM   2653 O  OG1 . THR A 1 358 ? -2.416  5.354   51.613  1.00 65.37  ? 1142 THR A OG1 1 
ATOM   2654 C  CG2 . THR A 1 358 ? -0.299  6.318   52.250  1.00 52.15  ? 1142 THR A CG2 1 
ATOM   2655 N  N   . PRO A 1 359 ? -4.459  8.987   52.143  1.00 50.38  ? 1143 PRO A N   1 
ATOM   2656 C  CA  . PRO A 1 359 ? -5.791  9.372   51.662  1.00 53.15  ? 1143 PRO A CA  1 
ATOM   2657 C  C   . PRO A 1 359 ? -5.892  9.436   50.142  1.00 51.55  ? 1143 PRO A C   1 
ATOM   2658 O  O   . PRO A 1 359 ? -6.650  8.676   49.541  1.00 42.37  ? 1143 PRO A O   1 
ATOM   2659 C  CB  . PRO A 1 359 ? -5.976  10.774  52.252  1.00 47.11  ? 1143 PRO A CB  1 
ATOM   2660 C  CG  . PRO A 1 359 ? -5.162  10.762  53.487  1.00 54.37  ? 1143 PRO A CG  1 
ATOM   2661 C  CD  . PRO A 1 359 ? -3.964  9.911   53.178  1.00 52.23  ? 1143 PRO A CD  1 
ATOM   2662 N  N   . ASN A 1 360 ? -5.136  10.347  49.539  1.00 47.66  ? 1144 ASN A N   1 
ATOM   2663 C  CA  . ASN A 1 360 ? -5.197  10.586  48.100  1.00 41.63  ? 1144 ASN A CA  1 
ATOM   2664 C  C   . ASN A 1 360 ? -5.063  9.332   47.235  1.00 48.21  ? 1144 ASN A C   1 
ATOM   2665 O  O   . ASN A 1 360 ? -5.939  9.035   46.424  1.00 43.34  ? 1144 ASN A O   1 
ATOM   2666 C  CB  . ASN A 1 360 ? -4.151  11.624  47.690  1.00 46.66  ? 1144 ASN A CB  1 
ATOM   2667 C  CG  . ASN A 1 360 ? -4.460  13.005  48.231  1.00 50.14  ? 1144 ASN A CG  1 
ATOM   2668 O  OD1 . ASN A 1 360 ? -5.625  13.368  48.416  1.00 41.31  ? 1144 ASN A OD1 1 
ATOM   2669 N  ND2 . ASN A 1 360 ? -3.415  13.787  48.483  1.00 47.23  ? 1144 ASN A ND2 1 
ATOM   2670 N  N   . ARG A 1 361 ? -3.960  8.608   47.401  1.00 46.54  ? 1145 ARG A N   1 
ATOM   2671 C  CA  . ARG A 1 361 ? -3.719  7.399   46.620  1.00 37.32  ? 1145 ARG A CA  1 
ATOM   2672 C  C   . ARG A 1 361 ? -4.807  6.363   46.876  1.00 42.84  ? 1145 ARG A C   1 
ATOM   2673 O  O   . ARG A 1 361 ? -5.319  5.744   45.943  1.00 40.62  ? 1145 ARG A O   1 
ATOM   2674 C  CB  . ARG A 1 361 ? -2.343  6.814   46.941  1.00 33.32  ? 1145 ARG A CB  1 
ATOM   2675 C  CG  . ARG A 1 361 ? -2.029  5.514   46.216  1.00 29.26  ? 1145 ARG A CG  1 
ATOM   2676 C  CD  . ARG A 1 361 ? -0.648  5.013   46.607  1.00 29.90  ? 1145 ARG A CD  1 
ATOM   2677 N  NE  . ARG A 1 361 ? -0.289  3.768   45.935  1.00 38.26  ? 1145 ARG A NE  1 
ATOM   2678 C  CZ  . ARG A 1 361 ? 0.856   3.121   46.136  1.00 44.89  ? 1145 ARG A CZ  1 
ATOM   2679 N  NH1 . ARG A 1 361 ? 1.747   3.605   46.990  1.00 40.96  ? 1145 ARG A NH1 1 
ATOM   2680 N  NH2 . ARG A 1 361 ? 1.109   1.992   45.487  1.00 46.29  ? 1145 ARG A NH2 1 
ATOM   2681 N  N   . ALA A 1 362 ? -5.156  6.181   48.146  1.00 50.92  ? 1146 ALA A N   1 
ATOM   2682 C  CA  . ALA A 1 362 ? -6.191  5.227   48.528  1.00 43.85  ? 1146 ALA A CA  1 
ATOM   2683 C  C   . ALA A 1 362 ? -7.516  5.543   47.841  1.00 40.03  ? 1146 ALA A C   1 
ATOM   2684 O  O   . ALA A 1 362 ? -8.177  4.652   47.301  1.00 41.01  ? 1146 ALA A O   1 
ATOM   2685 C  CB  . ALA A 1 362 ? -6.364  5.211   50.043  1.00 44.64  ? 1146 ALA A CB  1 
ATOM   2686 N  N   . LYS A 1 363 ? -7.894  6.818   47.858  1.00 40.70  ? 1147 LYS A N   1 
ATOM   2687 C  CA  . LYS A 1 363 ? -9.153  7.256   47.260  1.00 43.63  ? 1147 LYS A CA  1 
ATOM   2688 C  C   . LYS A 1 363 ? -9.253  6.867   45.786  1.00 41.23  ? 1147 LYS A C   1 
ATOM   2689 O  O   . LYS A 1 363 ? -10.292 6.390   45.329  1.00 31.76  ? 1147 LYS A O   1 
ATOM   2690 C  CB  . LYS A 1 363 ? -9.332  8.768   47.425  1.00 37.89  ? 1147 LYS A CB  1 
ATOM   2691 C  CG  . LYS A 1 363 ? -9.520  9.212   48.869  1.00 39.36  ? 1147 LYS A CG  1 
ATOM   2692 C  CD  . LYS A 1 363 ? -9.487  10.729  49.009  1.00 53.96  ? 1147 LYS A CD  1 
ATOM   2693 C  CE  . LYS A 1 363 ? -9.579  11.139  50.476  1.00 58.17  ? 1147 LYS A CE  1 
ATOM   2694 N  NZ  . LYS A 1 363 ? -9.438  12.611  50.679  1.00 54.15  ? 1147 LYS A NZ  1 
ATOM   2695 N  N   . ARG A 1 364 ? -8.165  7.070   45.050  1.00 41.22  ? 1148 ARG A N   1 
ATOM   2696 C  CA  . ARG A 1 364 ? -8.126  6.743   43.628  1.00 44.94  ? 1148 ARG A CA  1 
ATOM   2697 C  C   . ARG A 1 364 ? -8.249  5.240   43.392  1.00 42.44  ? 1148 ARG A C   1 
ATOM   2698 O  O   . ARG A 1 364 ? -9.023  4.797   42.540  1.00 31.31  ? 1148 ARG A O   1 
ATOM   2699 C  CB  . ARG A 1 364 ? -6.840  7.270   42.980  1.00 40.50  ? 1148 ARG A CB  1 
ATOM   2700 C  CG  . ARG A 1 364 ? -6.806  8.775   42.766  1.00 35.37  ? 1148 ARG A CG  1 
ATOM   2701 C  CD  . ARG A 1 364 ? -5.577  9.188   41.962  1.00 40.81  ? 1148 ARG A CD  1 
ATOM   2702 N  NE  . ARG A 1 364 ? -4.323  8.883   42.650  1.00 35.79  ? 1148 ARG A NE  1 
ATOM   2703 C  CZ  . ARG A 1 364 ? -3.702  9.717   43.479  1.00 34.33  ? 1148 ARG A CZ  1 
ATOM   2704 N  NH1 . ARG A 1 364 ? -4.220  10.912  43.729  1.00 35.21  ? 1148 ARG A NH1 1 
ATOM   2705 N  NH2 . ARG A 1 364 ? -2.566  9.359   44.061  1.00 36.68  ? 1148 ARG A NH2 1 
ATOM   2706 N  N   . VAL A 1 365 ? -7.478  4.460   44.144  1.00 39.18  ? 1149 VAL A N   1 
ATOM   2707 C  CA  . VAL A 1 365 ? -7.505  3.008   44.001  1.00 38.83  ? 1149 VAL A CA  1 
ATOM   2708 C  C   . VAL A 1 365 ? -8.880  2.451   44.357  1.00 43.28  ? 1149 VAL A C   1 
ATOM   2709 O  O   . VAL A 1 365 ? -9.429  1.623   43.629  1.00 37.22  ? 1149 VAL A O   1 
ATOM   2710 C  CB  . VAL A 1 365 ? -6.426  2.316   44.861  1.00 37.57  ? 1149 VAL A CB  1 
ATOM   2711 C  CG1 . VAL A 1 365 ? -6.581  0.805   44.786  1.00 37.57  ? 1149 VAL A CG1 1 
ATOM   2712 C  CG2 . VAL A 1 365 ? -5.036  2.732   44.407  1.00 32.41  ? 1149 VAL A CG2 1 
ATOM   2713 N  N   . ILE A 1 366 ? -9.433  2.908   45.478  1.00 41.20  ? 1150 ILE A N   1 
ATOM   2714 C  CA  . ILE A 1 366 ? -10.771 2.494   45.890  1.00 37.65  ? 1150 ILE A CA  1 
ATOM   2715 C  C   . ILE A 1 366 ? -11.790 2.883   44.823  1.00 40.55  ? 1150 ILE A C   1 
ATOM   2716 O  O   . ILE A 1 366 ? -12.631 2.077   44.424  1.00 36.11  ? 1150 ILE A O   1 
ATOM   2717 C  CB  . ILE A 1 366 ? -11.178 3.122   47.241  1.00 37.95  ? 1150 ILE A CB  1 
ATOM   2718 C  CG1 . ILE A 1 366 ? -10.317 2.558   48.373  1.00 40.67  ? 1150 ILE A CG1 1 
ATOM   2719 C  CG2 . ILE A 1 366 ? -12.648 2.861   47.532  1.00 26.27  ? 1150 ILE A CG2 1 
ATOM   2720 C  CD1 . ILE A 1 366 ? -10.651 3.128   49.734  1.00 29.56  ? 1150 ILE A CD1 1 
ATOM   2721 N  N   . THR A 1 367 ? -11.701 4.126   44.365  1.00 41.50  ? 1151 THR A N   1 
ATOM   2722 C  CA  . THR A 1 367 ? -12.560 4.618   43.294  1.00 44.56  ? 1151 THR A CA  1 
ATOM   2723 C  C   . THR A 1 367 ? -12.442 3.758   42.038  1.00 42.78  ? 1151 THR A C   1 
ATOM   2724 O  O   . THR A 1 367 ? -13.433 3.505   41.352  1.00 35.45  ? 1151 THR A O   1 
ATOM   2725 C  CB  . THR A 1 367 ? -12.223 6.075   42.939  1.00 46.31  ? 1151 THR A CB  1 
ATOM   2726 O  OG1 . THR A 1 367 ? -12.481 6.913   44.073  1.00 42.57  ? 1151 THR A OG1 1 
ATOM   2727 C  CG2 . THR A 1 367 ? -13.060 6.549   41.759  1.00 50.11  ? 1151 THR A CG2 1 
ATOM   2728 N  N   . THR A 1 368 ? -11.224 3.313   41.739  1.00 40.14  ? 1152 THR A N   1 
ATOM   2729 C  CA  . THR A 1 368 ? -10.994 2.427   40.602  1.00 43.58  ? 1152 THR A CA  1 
ATOM   2730 C  C   . THR A 1 368 ? -11.751 1.115   40.788  1.00 40.13  ? 1152 THR A C   1 
ATOM   2731 O  O   . THR A 1 368 ? -12.345 0.590   39.847  1.00 34.81  ? 1152 THR A O   1 
ATOM   2732 C  CB  . THR A 1 368 ? -9.492  2.133   40.401  1.00 48.01  ? 1152 THR A CB  1 
ATOM   2733 O  OG1 . THR A 1 368 ? -8.794  3.356   40.128  1.00 40.47  ? 1152 THR A OG1 1 
ATOM   2734 C  CG2 . THR A 1 368 ? -9.284  1.164   39.245  1.00 37.16  ? 1152 THR A CG2 1 
ATOM   2735 N  N   . PHE A 1 369 ? -11.726 0.594   42.013  1.00 44.87  ? 1153 PHE A N   1 
ATOM   2736 C  CA  . PHE A 1 369 ? -12.492 -0.597  42.367  1.00 38.80  ? 1153 PHE A CA  1 
ATOM   2737 C  C   . PHE A 1 369 ? -13.986 -0.321  42.217  1.00 33.68  ? 1153 PHE A C   1 
ATOM   2738 O  O   . PHE A 1 369 ? -14.752 -1.175  41.769  1.00 30.55  ? 1153 PHE A O   1 
ATOM   2739 C  CB  . PHE A 1 369 ? -12.190 -1.018  43.811  1.00 34.79  ? 1153 PHE A CB  1 
ATOM   2740 C  CG  . PHE A 1 369 ? -10.917 -1.806  43.970  1.00 39.66  ? 1153 PHE A CG  1 
ATOM   2741 C  CD1 . PHE A 1 369 ? -10.559 -2.767  43.038  1.00 40.98  ? 1153 PHE A CD1 1 
ATOM   2742 C  CD2 . PHE A 1 369 ? -10.083 -1.590  45.058  1.00 27.29  ? 1153 PHE A CD2 1 
ATOM   2743 C  CE1 . PHE A 1 369 ? -9.394  -3.496  43.184  1.00 38.14  ? 1153 PHE A CE1 1 
ATOM   2744 C  CE2 . PHE A 1 369 ? -8.915  -2.313  45.211  1.00 25.90  ? 1153 PHE A CE2 1 
ATOM   2745 C  CZ  . PHE A 1 369 ? -8.569  -3.269  44.273  1.00 38.63  ? 1153 PHE A CZ  1 
ATOM   2746 N  N   . ARG A 1 370 ? -14.385 0.888   42.596  1.00 35.01  ? 1154 ARG A N   1 
ATOM   2747 C  CA  . ARG A 1 370 ? -15.782 1.297   42.571  1.00 38.88  ? 1154 ARG A CA  1 
ATOM   2748 C  C   . ARG A 1 370 ? -16.347 1.337   41.147  1.00 42.52  ? 1154 ARG A C   1 
ATOM   2749 O  O   . ARG A 1 370 ? -17.376 0.723   40.857  1.00 33.89  ? 1154 ARG A O   1 
ATOM   2750 C  CB  . ARG A 1 370 ? -15.914 2.671   43.236  1.00 40.85  ? 1154 ARG A CB  1 
ATOM   2751 C  CG  . ARG A 1 370 ? -17.317 3.048   43.680  1.00 45.96  ? 1154 ARG A CG  1 
ATOM   2752 C  CD  . ARG A 1 370 ? -17.301 4.381   44.420  1.00 54.33  ? 1154 ARG A CD  1 
ATOM   2753 N  NE  . ARG A 1 370 ? -18.634 4.804   44.841  1.00 59.27  ? 1154 ARG A NE  1 
ATOM   2754 C  CZ  . ARG A 1 370 ? -19.141 4.594   46.053  1.00 60.54  ? 1154 ARG A CZ  1 
ATOM   2755 N  NH1 . ARG A 1 370 ? -18.425 3.963   46.974  1.00 64.33  ? 1154 ARG A NH1 1 
ATOM   2756 N  NH2 . ARG A 1 370 ? -20.364 5.017   46.346  1.00 53.18  ? 1154 ARG A NH2 1 
ATOM   2757 N  N   . THR A 1 371 ? -15.657 2.051   40.261  1.00 43.69  ? 1155 THR A N   1 
ATOM   2758 C  CA  . THR A 1 371 ? -16.165 2.317   38.917  1.00 34.43  ? 1155 THR A CA  1 
ATOM   2759 C  C   . THR A 1 371 ? -15.736 1.268   37.892  1.00 38.58  ? 1155 THR A C   1 
ATOM   2760 O  O   . THR A 1 371 ? -16.491 0.941   36.975  1.00 38.47  ? 1155 THR A O   1 
ATOM   2761 C  CB  . THR A 1 371 ? -15.713 3.699   38.416  1.00 32.36  ? 1155 THR A CB  1 
ATOM   2762 O  OG1 . THR A 1 371 ? -14.302 3.681   38.167  1.00 40.73  ? 1155 THR A OG1 1 
ATOM   2763 C  CG2 . THR A 1 371 ? -16.023 4.768   39.450  1.00 40.63  ? 1155 THR A CG2 1 
ATOM   2764 N  N   . GLY A 1 372 ? -14.522 0.748   38.045  1.00 42.02  ? 1156 GLY A N   1 
ATOM   2765 C  CA  . GLY A 1 372 ? -13.986 -0.213  37.098  1.00 42.82  ? 1156 GLY A CA  1 
ATOM   2766 C  C   . GLY A 1 372 ? -13.399 0.479   35.883  1.00 45.25  ? 1156 GLY A C   1 
ATOM   2767 O  O   . GLY A 1 372 ? -13.195 -0.141  34.837  1.00 36.27  ? 1156 GLY A O   1 
ATOM   2768 N  N   . THR A 1 373 ? -13.133 1.775   36.028  1.00 44.32  ? 1157 THR A N   1 
ATOM   2769 C  CA  . THR A 1 373 ? -12.565 2.577   34.952  1.00 39.08  ? 1157 THR A CA  1 
ATOM   2770 C  C   . THR A 1 373 ? -11.350 3.348   35.459  1.00 40.83  ? 1157 THR A C   1 
ATOM   2771 O  O   . THR A 1 373 ? -10.999 3.256   36.637  1.00 46.82  ? 1157 THR A O   1 
ATOM   2772 C  CB  . THR A 1 373 ? -13.602 3.562   34.372  1.00 39.04  ? 1157 THR A CB  1 
ATOM   2773 O  OG1 . THR A 1 373 ? -13.832 4.629   35.299  1.00 43.97  ? 1157 THR A OG1 1 
ATOM   2774 C  CG2 . THR A 1 373 ? -14.918 2.851   34.097  1.00 33.81  ? 1157 THR A CG2 1 
ATOM   2775 N  N   . TRP A 1 374 ? -10.713 4.103   34.570  1.00 39.39  ? 1158 TRP A N   1 
ATOM   2776 C  CA  . TRP A 1 374 ? -9.515  4.863   34.921  1.00 45.91  ? 1158 TRP A CA  1 
ATOM   2777 C  C   . TRP A 1 374 ? -9.849  6.307   35.290  1.00 42.79  ? 1158 TRP A C   1 
ATOM   2778 O  O   . TRP A 1 374 ? -8.954  7.134   35.474  1.00 36.02  ? 1158 TRP A O   1 
ATOM   2779 C  CB  . TRP A 1 374 ? -8.521  4.857   33.757  1.00 47.99  ? 1158 TRP A CB  1 
ATOM   2780 C  CG  . TRP A 1 374 ? -8.039  3.491   33.368  1.00 47.89  ? 1158 TRP A CG  1 
ATOM   2781 C  CD1 . TRP A 1 374 ? -8.433  2.761   32.283  1.00 36.99  ? 1158 TRP A CD1 1 
ATOM   2782 C  CD2 . TRP A 1 374 ? -7.072  2.693   34.062  1.00 51.61  ? 1158 TRP A CD2 1 
ATOM   2783 N  NE1 . TRP A 1 374 ? -7.770  1.557   32.258  1.00 32.72  ? 1158 TRP A NE1 1 
ATOM   2784 C  CE2 . TRP A 1 374 ? -6.929  1.489   33.338  1.00 39.70  ? 1158 TRP A CE2 1 
ATOM   2785 C  CE3 . TRP A 1 374 ? -6.314  2.875   35.224  1.00 47.00  ? 1158 TRP A CE3 1 
ATOM   2786 C  CZ2 . TRP A 1 374 ? -6.059  0.476   33.740  1.00 36.50  ? 1158 TRP A CZ2 1 
ATOM   2787 C  CZ3 . TRP A 1 374 ? -5.451  1.869   35.619  1.00 47.36  ? 1158 TRP A CZ3 1 
ATOM   2788 C  CH2 . TRP A 1 374 ? -5.330  0.685   34.878  1.00 43.01  ? 1158 TRP A CH2 1 
ATOM   2789 N  N   . ASP A 1 375 ? -11.141 6.599   35.406  1.00 47.04  ? 1159 ASP A N   1 
ATOM   2790 C  CA  . ASP A 1 375 ? -11.624 7.971   35.562  1.00 48.53  ? 1159 ASP A CA  1 
ATOM   2791 C  C   . ASP A 1 375 ? -11.156 8.692   36.828  1.00 49.41  ? 1159 ASP A C   1 
ATOM   2792 O  O   . ASP A 1 375 ? -11.424 9.881   37.002  1.00 49.83  ? 1159 ASP A O   1 
ATOM   2793 C  CB  . ASP A 1 375 ? -13.152 8.006   35.479  1.00 41.11  ? 1159 ASP A CB  1 
ATOM   2794 C  CG  . ASP A 1 375 ? -13.663 7.742   34.078  1.00 49.64  ? 1159 ASP A CG  1 
ATOM   2795 O  OD1 . ASP A 1 375 ? -14.861 7.987   33.825  1.00 61.77  ? 1159 ASP A OD1 1 
ATOM   2796 O  OD2 . ASP A 1 375 ? -12.863 7.297   33.227  1.00 48.38  ? 1159 ASP A OD2 1 
ATOM   2797 N  N   . ALA A 1 376 ? -10.463 7.981   37.709  1.00 50.71  ? 1160 ALA A N   1 
ATOM   2798 C  CA  . ALA A 1 376 ? -9.966  8.589   38.938  1.00 42.49  ? 1160 ALA A CA  1 
ATOM   2799 C  C   . ALA A 1 376 ? -8.550  9.112   38.737  1.00 45.87  ? 1160 ALA A C   1 
ATOM   2800 O  O   . ALA A 1 376 ? -7.955  9.692   39.648  1.00 42.85  ? 1160 ALA A O   1 
ATOM   2801 C  CB  . ALA A 1 376 ? -10.005 7.586   40.080  1.00 48.43  ? 1160 ALA A CB  1 
ATOM   2802 N  N   . TYR A 1 377 ? -8.017  8.904   37.537  1.00 45.62  ? 1161 TYR A N   1 
ATOM   2803 C  CA  . TYR A 1 377 ? -6.638  9.270   37.237  1.00 48.36  ? 1161 TYR A CA  1 
ATOM   2804 C  C   . TYR A 1 377 ? -6.534  10.264  36.081  1.00 53.80  ? 1161 TYR A C   1 
ATOM   2805 O  O   . TYR A 1 377 ? -7.144  10.072  35.028  1.00 51.66  ? 1161 TYR A O   1 
ATOM   2806 C  CB  . TYR A 1 377 ? -5.806  8.016   36.951  1.00 39.15  ? 1161 TYR A CB  1 
ATOM   2807 C  CG  . TYR A 1 377 ? -5.558  7.167   38.179  1.00 41.42  ? 1161 TYR A CG  1 
ATOM   2808 C  CD1 . TYR A 1 377 ? -4.372  7.278   38.894  1.00 44.15  ? 1161 TYR A CD1 1 
ATOM   2809 C  CD2 . TYR A 1 377 ? -6.513  6.266   38.632  1.00 37.25  ? 1161 TYR A CD2 1 
ATOM   2810 C  CE1 . TYR A 1 377 ? -4.139  6.508   40.018  1.00 35.77  ? 1161 TYR A CE1 1 
ATOM   2811 C  CE2 . TYR A 1 377 ? -6.290  5.493   39.758  1.00 39.31  ? 1161 TYR A CE2 1 
ATOM   2812 C  CZ  . TYR A 1 377 ? -5.101  5.618   40.446  1.00 36.68  ? 1161 TYR A CZ  1 
ATOM   2813 O  OH  . TYR A 1 377 ? -4.872  4.853   41.567  1.00 34.99  ? 1161 TYR A OH  1 
ATOM   2814 N  N   . PRO A 1 378 ? -5.752  11.334  36.283  1.00 52.26  ? 377  PRO A N   1 
ATOM   2815 C  CA  . PRO A 1 378 ? -5.501  12.371  35.278  1.00 49.99  ? 377  PRO A CA  1 
ATOM   2816 C  C   . PRO A 1 378 ? -4.419  11.955  34.280  1.00 56.81  ? 377  PRO A C   1 
ATOM   2817 O  O   . PRO A 1 378 ? -3.343  11.508  34.686  1.00 56.20  ? 377  PRO A O   1 
ATOM   2818 C  CB  . PRO A 1 378 ? -5.015  13.550  36.121  1.00 48.29  ? 377  PRO A CB  1 
ATOM   2819 C  CG  . PRO A 1 378 ? -4.337  12.910  37.280  1.00 45.66  ? 377  PRO A CG  1 
ATOM   2820 C  CD  . PRO A 1 378 ? -5.093  11.637  37.566  1.00 53.40  ? 377  PRO A CD  1 
ATOM   2821 N  N   . PRO A 1 379 ? -4.709  12.092  32.977  1.00 55.60  ? 378  PRO A N   1 
ATOM   2822 C  CA  . PRO A 1 379 ? -3.752  11.794  31.906  1.00 50.62  ? 378  PRO A CA  1 
ATOM   2823 C  C   . PRO A 1 379 ? -2.511  12.681  31.989  1.00 62.95  ? 378  PRO A C   1 
ATOM   2824 O  O   . PRO A 1 379 ? -2.587  13.794  32.511  1.00 65.00  ? 378  PRO A O   1 
ATOM   2825 C  CB  . PRO A 1 379 ? -4.545  12.111  30.635  1.00 54.16  ? 378  PRO A CB  1 
ATOM   2826 C  CG  . PRO A 1 379 ? -5.975  11.968  31.035  1.00 45.42  ? 378  PRO A CG  1 
ATOM   2827 C  CD  . PRO A 1 379 ? -6.031  12.461  32.446  1.00 52.10  ? 378  PRO A CD  1 
ATOM   2828 N  N   . PRO A 1 380 ? -1.376  12.189  31.471  1.00 64.97  ? 379  PRO A N   1 
ATOM   2829 C  CA  . PRO A 1 380 ? -0.069  12.859  31.518  1.00 67.28  ? 379  PRO A CA  1 
ATOM   2830 C  C   . PRO A 1 380 ? -0.041  14.241  30.862  1.00 75.49  ? 379  PRO A C   1 
ATOM   2831 O  O   . PRO A 1 380 ? 0.878   15.015  31.129  1.00 77.11  ? 379  PRO A O   1 
ATOM   2832 C  CB  . PRO A 1 380 ? 0.842   11.892  30.753  1.00 67.07  ? 379  PRO A CB  1 
ATOM   2833 C  CG  . PRO A 1 380 ? 0.186   10.563  30.909  1.00 54.54  ? 379  PRO A CG  1 
ATOM   2834 C  CD  . PRO A 1 380 ? -1.283  10.848  30.870  1.00 50.28  ? 379  PRO A CD  1 
ATOM   2835 N  N   . SER A 1 381 ? -1.022  14.537  30.015  1.00 77.74  ? 380  SER A N   1 
ATOM   2836 C  CA  . SER A 1 381 ? -1.107  15.834  29.341  1.00 84.06  ? 380  SER A CA  1 
ATOM   2837 C  C   . SER A 1 381 ? -0.032  16.014  28.268  1.00 84.19  ? 380  SER A C   1 
ATOM   2838 O  O   . SER A 1 381 ? -0.160  16.864  27.388  1.00 87.72  ? 380  SER A O   1 
ATOM   2839 C  CB  . SER A 1 381 ? -1.060  16.986  30.352  1.00 88.87  ? 380  SER A CB  1 
ATOM   2840 O  OG  . SER A 1 381 ? -2.152  16.918  31.257  1.00 81.99  ? 380  SER A OG  1 
ATOM   2841 N  N   . ARG A 1 382 ? 1.028   15.216  28.350  1.00 90.84  ? 381  ARG A N   1 
ATOM   2842 C  CA  . ARG A 1 382 ? 2.030   15.156  27.290  1.00 85.51  ? 381  ARG A CA  1 
ATOM   2843 C  C   . ARG A 1 382 ? 2.205   13.706  26.857  1.00 86.42  ? 381  ARG A C   1 
ATOM   2844 O  O   . ARG A 1 382 ? 2.617   12.857  27.650  1.00 81.79  ? 381  ARG A O   1 
ATOM   2845 C  CB  . ARG A 1 382 ? 3.370   15.727  27.755  1.00 88.96  ? 381  ARG A CB  1 
ATOM   2846 C  CG  . ARG A 1 382 ? 4.316   16.066  26.610  1.00 87.23  ? 381  ARG A CG  1 
ATOM   2847 C  CD  . ARG A 1 382 ? 5.778   15.932  27.016  1.00 90.28  ? 381  ARG A CD  1 
ATOM   2848 N  NE  . ARG A 1 382 ? 6.195   14.534  27.113  1.00 84.60  ? 381  ARG A NE  1 
ATOM   2849 C  CZ  . ARG A 1 382 ? 7.452   14.137  27.288  1.00 72.41  ? 381  ARG A CZ  1 
ATOM   2850 N  NH1 . ARG A 1 382 ? 8.427   15.031  27.383  1.00 70.54  ? 381  ARG A NH1 1 
ATOM   2851 N  NH2 . ARG A 1 382 ? 7.737   12.843  27.364  1.00 59.57  ? 381  ARG A NH2 1 
ATOM   2852 N  N   . GLU A 1 383 ? 1.883   13.426  25.598  1.00 79.50  ? 382  GLU A N   1 
ATOM   2853 C  CA  . GLU A 1 383 ? 1.920   12.062  25.076  1.00 70.83  ? 382  GLU A CA  1 
ATOM   2854 C  C   . GLU A 1 383 ? 3.323   11.465  25.110  1.00 61.41  ? 382  GLU A C   1 
ATOM   2855 O  O   . GLU A 1 383 ? 4.319   12.191  25.116  1.00 60.61  ? 382  GLU A O   1 
ATOM   2856 C  CB  . GLU A 1 383 ? 1.366   12.023  23.650  1.00 72.79  ? 382  GLU A CB  1 
ATOM   2857 C  CG  . GLU A 1 383 ? -0.041  12.578  23.524  1.00 82.31  ? 382  GLU A CG  1 
ATOM   2858 C  CD  . GLU A 1 383 ? -0.536  12.590  22.092  1.00 97.46  ? 382  GLU A CD  1 
ATOM   2859 O  OE1 . GLU A 1 383 ? -1.542  13.277  21.816  1.00 102.47 ? 382  GLU A OE1 1 
ATOM   2860 O  OE2 . GLU A 1 383 ? 0.082   11.911  21.244  1.00 104.61 ? 382  GLU A OE2 1 
ATOM   2861 N  N   . LYS A 1 384 ? 3.390   10.137  25.135  1.00 53.16  ? 383  LYS A N   1 
ATOM   2862 C  CA  . LYS A 1 384 ? 4.664   9.426   25.150  1.00 59.98  ? 383  LYS A CA  1 
ATOM   2863 C  C   . LYS A 1 384 ? 5.539   9.807   23.960  1.00 63.06  ? 383  LYS A C   1 
ATOM   2864 O  O   . LYS A 1 384 ? 5.032   10.138  22.887  1.00 62.42  ? 383  LYS A O   1 
ATOM   2865 C  CB  . LYS A 1 384 ? 4.435   7.914   25.142  1.00 60.15  ? 383  LYS A CB  1 
ATOM   2866 C  CG  . LYS A 1 384 ? 3.927   7.341   26.447  1.00 64.07  ? 383  LYS A CG  1 
ATOM   2867 C  CD  . LYS A 1 384 ? 3.884   5.823   26.371  1.00 72.17  ? 383  LYS A CD  1 
ATOM   2868 C  CE  . LYS A 1 384 ? 3.730   5.196   27.746  1.00 78.25  ? 383  LYS A CE  1 
ATOM   2869 N  NZ  . LYS A 1 384 ? 3.834   3.712   27.680  1.00 71.54  ? 383  LYS A NZ  1 
ATOM   2870 N  N   . LYS A 1 385 ? 6.853   9.749   24.152  1.00 56.48  ? 384  LYS A N   1 
ATOM   2871 C  CA  . LYS A 1 385 ? 7.790   9.991   23.062  1.00 53.75  ? 384  LYS A CA  1 
ATOM   2872 C  C   . LYS A 1 385 ? 7.631   8.924   21.984  1.00 56.71  ? 384  LYS A C   1 
ATOM   2873 O  O   . LYS A 1 385 ? 7.748   9.209   20.792  1.00 59.61  ? 384  LYS A O   1 
ATOM   2874 C  CB  . LYS A 1 385 ? 9.234   10.006  23.572  1.00 50.25  ? 384  LYS A CB  1 
ATOM   2875 C  CG  . LYS A 1 385 ? 9.570   11.166  24.492  1.00 58.43  ? 384  LYS A CG  1 
ATOM   2876 C  CD  . LYS A 1 385 ? 11.063  11.208  24.795  1.00 52.65  ? 384  LYS A CD  1 
ATOM   2877 C  CE  . LYS A 1 385 ? 11.415  12.369  25.713  1.00 53.59  ? 384  LYS A CE  1 
ATOM   2878 N  NZ  . LYS A 1 385 ? 10.992  13.679  25.143  1.00 56.46  ? 384  LYS A NZ  1 
ATOM   2879 N  N   . VAL A 1 386 ? 7.358   7.696   22.415  1.00 56.49  ? 385  VAL A N   1 
ATOM   2880 C  CA  . VAL A 1 386 ? 7.209   6.574   21.496  1.00 50.90  ? 385  VAL A CA  1 
ATOM   2881 C  C   . VAL A 1 386 ? 5.982   6.725   20.595  1.00 53.05  ? 385  VAL A C   1 
ATOM   2882 O  O   . VAL A 1 386 ? 6.075   6.553   19.380  1.00 57.85  ? 385  VAL A O   1 
ATOM   2883 C  CB  . VAL A 1 386 ? 7.143   5.231   22.249  1.00 45.53  ? 385  VAL A CB  1 
ATOM   2884 C  CG1 . VAL A 1 386 ? 6.065   5.271   23.320  1.00 51.88  ? 385  VAL A CG1 1 
ATOM   2885 C  CG2 . VAL A 1 386 ? 6.901   4.088   21.277  1.00 49.10  ? 385  VAL A CG2 1 
ATOM   2886 N  N   . THR A 1 387 ? 4.837   7.048   21.189  1.00 52.33  ? 386  THR A N   1 
ATOM   2887 C  CA  . THR A 1 387 ? 3.609   7.228   20.419  1.00 53.15  ? 386  THR A CA  1 
ATOM   2888 C  C   . THR A 1 387 ? 3.715   8.479   19.562  1.00 53.38  ? 386  THR A C   1 
ATOM   2889 O  O   . THR A 1 387 ? 3.251   8.513   18.423  1.00 51.90  ? 386  THR A O   1 
ATOM   2890 C  CB  . THR A 1 387 ? 2.378   7.364   21.331  1.00 46.03  ? 386  THR A CB  1 
ATOM   2891 O  OG1 . THR A 1 387 ? 2.448   8.600   22.052  1.00 56.30  ? 386  THR A OG1 1 
ATOM   2892 C  CG2 . THR A 1 387 ? 2.310   6.207   22.314  1.00 38.46  ? 386  THR A CG2 1 
ATOM   2893 N  N   . ARG A 1 388 ? 4.335   9.509   20.125  1.00 50.77  ? 387  ARG A N   1 
ATOM   2894 C  CA  . ARG A 1 388 ? 4.514   10.778  19.436  1.00 50.58  ? 387  ARG A CA  1 
ATOM   2895 C  C   . ARG A 1 388 ? 5.361   10.586  18.181  1.00 57.87  ? 387  ARG A C   1 
ATOM   2896 O  O   . ARG A 1 388 ? 5.039   11.108  17.114  1.00 54.91  ? 387  ARG A O   1 
ATOM   2897 C  CB  . ARG A 1 388 ? 5.177   11.783  20.377  1.00 49.71  ? 387  ARG A CB  1 
ATOM   2898 C  CG  . ARG A 1 388 ? 4.701   13.211  20.213  1.00 60.32  ? 387  ARG A CG  1 
ATOM   2899 C  CD  . ARG A 1 388 ? 4.948   13.986  21.493  1.00 66.02  ? 387  ARG A CD  1 
ATOM   2900 N  NE  . ARG A 1 388 ? 6.269   13.695  22.040  1.00 62.15  ? 387  ARG A NE  1 
ATOM   2901 C  CZ  . ARG A 1 388 ? 6.715   14.154  23.203  1.00 66.61  ? 387  ARG A CZ  1 
ATOM   2902 N  NH1 . ARG A 1 388 ? 5.944   14.931  23.951  1.00 74.63  ? 387  ARG A NH1 1 
ATOM   2903 N  NH2 . ARG A 1 388 ? 7.933   13.835  23.618  1.00 61.09  ? 387  ARG A NH2 1 
ATOM   2904 N  N   . THR A 1 389 ? 6.445   9.830   18.321  1.00 52.70  ? 388  THR A N   1 
ATOM   2905 C  CA  . THR A 1 389 ? 7.328   9.527   17.201  1.00 44.10  ? 388  THR A CA  1 
ATOM   2906 C  C   . THR A 1 389 ? 6.636   8.641   16.171  1.00 50.75  ? 388  THR A C   1 
ATOM   2907 O  O   . THR A 1 389 ? 6.622   8.946   14.977  1.00 54.34  ? 388  THR A O   1 
ATOM   2908 C  CB  . THR A 1 389 ? 8.611   8.822   17.676  1.00 43.08  ? 388  THR A CB  1 
ATOM   2909 O  OG1 . THR A 1 389 ? 9.388   9.726   18.470  1.00 51.61  ? 388  THR A OG1 1 
ATOM   2910 C  CG2 . THR A 1 389 ? 9.439   8.364   16.487  1.00 49.30  ? 388  THR A CG2 1 
ATOM   2911 N  N   . ILE A 1 390 ? 6.061   7.543   16.646  1.00 48.54  ? 389  ILE A N   1 
ATOM   2912 C  CA  . ILE A 1 390 ? 5.380   6.591   15.778  1.00 48.82  ? 389  ILE A CA  1 
ATOM   2913 C  C   . ILE A 1 390 ? 4.382   7.262   14.839  1.00 45.23  ? 389  ILE A C   1 
ATOM   2914 O  O   . ILE A 1 390 ? 4.342   6.963   13.647  1.00 46.93  ? 389  ILE A O   1 
ATOM   2915 C  CB  . ILE A 1 390 ? 4.665   5.504   16.603  1.00 48.89  ? 389  ILE A CB  1 
ATOM   2916 C  CG1 . ILE A 1 390 ? 5.692   4.534   17.190  1.00 50.73  ? 389  ILE A CG1 1 
ATOM   2917 C  CG2 . ILE A 1 390 ? 3.652   4.761   15.750  1.00 44.75  ? 389  ILE A CG2 1 
ATOM   2918 C  CD1 . ILE A 1 390 ? 5.104   3.530   18.152  1.00 57.41  ? 389  ILE A CD1 1 
ATOM   2919 N  N   . LEU A 1 391 ? 3.583   8.176   15.378  1.00 41.76  ? 390  LEU A N   1 
ATOM   2920 C  CA  . LEU A 1 391 ? 2.574   8.864   14.580  1.00 48.79  ? 390  LEU A CA  1 
ATOM   2921 C  C   . LEU A 1 391 ? 3.208   9.613   13.410  1.00 49.21  ? 390  LEU A C   1 
ATOM   2922 O  O   . LEU A 1 391 ? 2.771   9.482   12.265  1.00 44.77  ? 390  LEU A O   1 
ATOM   2923 C  CB  . LEU A 1 391 ? 1.761   9.830   15.446  1.00 46.64  ? 390  LEU A CB  1 
ATOM   2924 C  CG  . LEU A 1 391 ? 0.626   10.567  14.726  1.00 44.58  ? 390  LEU A CG  1 
ATOM   2925 C  CD1 . LEU A 1 391 ? -0.357  9.574   14.109  1.00 26.05  ? 390  LEU A CD1 1 
ATOM   2926 C  CD2 . LEU A 1 391 ? -0.087  11.536  15.664  1.00 28.97  ? 390  LEU A CD2 1 
ATOM   2927 N  N   . ALA A 1 392 ? 4.240   10.396  13.707  1.00 47.56  ? 391  ALA A N   1 
ATOM   2928 C  CA  . ALA A 1 392 ? 4.935   11.174  12.688  1.00 42.84  ? 391  ALA A CA  1 
ATOM   2929 C  C   . ALA A 1 392 ? 5.526   10.263  11.617  1.00 52.53  ? 391  ALA A C   1 
ATOM   2930 O  O   . ALA A 1 392 ? 5.450   10.558  10.421  1.00 47.67  ? 391  ALA A O   1 
ATOM   2931 C  CB  . ALA A 1 392 ? 6.024   12.024  13.321  1.00 37.78  ? 391  ALA A CB  1 
ATOM   2932 N  N   . ILE A 1 393 ? 6.117   9.156   12.056  1.00 49.67  ? 392  ILE A N   1 
ATOM   2933 C  CA  . ILE A 1 393 ? 6.697   8.183   11.141  1.00 42.99  ? 392  ILE A CA  1 
ATOM   2934 C  C   . ILE A 1 393 ? 5.657   7.687   10.145  1.00 41.94  ? 392  ILE A C   1 
ATOM   2935 O  O   . ILE A 1 393 ? 5.905   7.654   8.941   1.00 48.65  ? 392  ILE A O   1 
ATOM   2936 C  CB  . ILE A 1 393 ? 7.287   6.978   11.896  1.00 45.09  ? 392  ILE A CB  1 
ATOM   2937 C  CG1 . ILE A 1 393 ? 8.459   7.423   12.772  1.00 43.64  ? 392  ILE A CG1 1 
ATOM   2938 C  CG2 . ILE A 1 393 ? 7.739   5.910   10.915  1.00 47.09  ? 392  ILE A CG2 1 
ATOM   2939 C  CD1 . ILE A 1 393 ? 9.586   8.063   11.994  1.00 53.13  ? 392  ILE A CD1 1 
ATOM   2940 N  N   . LEU A 1 394 ? 4.492   7.306   10.657  1.00 41.62  ? 393  LEU A N   1 
ATOM   2941 C  CA  . LEU A 1 394 ? 3.409   6.814   9.814   1.00 41.66  ? 393  LEU A CA  1 
ATOM   2942 C  C   . LEU A 1 394 ? 2.931   7.879   8.834   1.00 44.99  ? 393  LEU A C   1 
ATOM   2943 O  O   . LEU A 1 394 ? 2.871   7.639   7.628   1.00 47.49  ? 393  LEU A O   1 
ATOM   2944 C  CB  . LEU A 1 394 ? 2.246   6.311   10.669  1.00 39.43  ? 393  LEU A CB  1 
ATOM   2945 C  CG  . LEU A 1 394 ? 2.511   4.997   11.406  1.00 48.12  ? 393  LEU A CG  1 
ATOM   2946 C  CD1 . LEU A 1 394 ? 1.312   4.598   12.256  1.00 48.94  ? 393  LEU A CD1 1 
ATOM   2947 C  CD2 . LEU A 1 394 ? 2.864   3.894   10.415  1.00 38.91  ? 393  LEU A CD2 1 
ATOM   2948 N  N   . LEU A 1 395 ? 2.590   9.053   9.356   1.00 44.69  ? 394  LEU A N   1 
ATOM   2949 C  CA  . LEU A 1 395 ? 2.181   10.170  8.511   1.00 40.71  ? 394  LEU A CA  1 
ATOM   2950 C  C   . LEU A 1 395 ? 3.163   10.362  7.362   1.00 48.53  ? 394  LEU A C   1 
ATOM   2951 O  O   . LEU A 1 395 ? 2.780   10.330  6.191   1.00 44.21  ? 394  LEU A O   1 
ATOM   2952 C  CB  . LEU A 1 395 ? 2.066   11.457  9.331   1.00 41.14  ? 394  LEU A CB  1 
ATOM   2953 C  CG  . LEU A 1 395 ? 0.749   11.649  10.086  1.00 56.59  ? 394  LEU A CG  1 
ATOM   2954 C  CD1 . LEU A 1 395 ? 0.893   12.692  11.190  1.00 50.79  ? 394  LEU A CD1 1 
ATOM   2955 C  CD2 . LEU A 1 395 ? -0.361  12.027  9.114   1.00 48.01  ? 394  LEU A CD2 1 
ATOM   2956 N  N   . ALA A 1 396 ? 4.433   10.551  7.705   1.00 46.98  ? 395  ALA A N   1 
ATOM   2957 C  CA  . ALA A 1 396 ? 5.477   10.741  6.707   1.00 42.58  ? 395  ALA A CA  1 
ATOM   2958 C  C   . ALA A 1 396 ? 5.491   9.597   5.698   1.00 49.02  ? 395  ALA A C   1 
ATOM   2959 O  O   . ALA A 1 396 ? 5.532   9.825   4.489   1.00 50.31  ? 395  ALA A O   1 
ATOM   2960 C  CB  . ALA A 1 396 ? 6.834   10.877  7.380   1.00 43.51  ? 395  ALA A CB  1 
ATOM   2961 N  N   . PHE A 1 397 ? 5.447   8.366   6.201   1.00 47.08  ? 396  PHE A N   1 
ATOM   2962 C  CA  . PHE A 1 397 ? 5.463   7.190   5.338   1.00 44.88  ? 396  PHE A CA  1 
ATOM   2963 C  C   . PHE A 1 397 ? 4.319   7.194   4.330   1.00 49.46  ? 396  PHE A C   1 
ATOM   2964 O  O   . PHE A 1 397 ? 4.542   7.064   3.126   1.00 44.19  ? 396  PHE A O   1 
ATOM   2965 C  CB  . PHE A 1 397 ? 5.420   5.904   6.166   1.00 40.59  ? 396  PHE A CB  1 
ATOM   2966 C  CG  . PHE A 1 397 ? 5.162   4.671   5.351   1.00 45.22  ? 396  PHE A CG  1 
ATOM   2967 C  CD1 . PHE A 1 397 ? 3.928   4.043   5.390   1.00 39.16  ? 396  PHE A CD1 1 
ATOM   2968 C  CD2 . PHE A 1 397 ? 6.151   4.150   4.533   1.00 48.41  ? 396  PHE A CD2 1 
ATOM   2969 C  CE1 . PHE A 1 397 ? 3.690   2.910   4.636   1.00 47.54  ? 396  PHE A CE1 1 
ATOM   2970 C  CE2 . PHE A 1 397 ? 5.919   3.019   3.776   1.00 44.82  ? 396  PHE A CE2 1 
ATOM   2971 C  CZ  . PHE A 1 397 ? 4.688   2.398   3.828   1.00 47.86  ? 396  PHE A CZ  1 
ATOM   2972 N  N   . ILE A 1 398 ? 3.096   7.343   4.827   1.00 52.14  ? 397  ILE A N   1 
ATOM   2973 C  CA  . ILE A 1 398 ? 1.914   7.289   3.970   1.00 49.88  ? 397  ILE A CA  1 
ATOM   2974 C  C   . ILE A 1 398 ? 1.835   8.462   2.989   1.00 49.23  ? 397  ILE A C   1 
ATOM   2975 O  O   . ILE A 1 398 ? 1.536   8.272   1.812   1.00 46.96  ? 397  ILE A O   1 
ATOM   2976 C  CB  . ILE A 1 398 ? 0.607   7.203   4.792   1.00 45.79  ? 397  ILE A CB  1 
ATOM   2977 C  CG1 . ILE A 1 398 ? -0.598  7.043   3.862   1.00 50.73  ? 397  ILE A CG1 1 
ATOM   2978 C  CG2 . ILE A 1 398 ? 0.446   8.424   5.680   1.00 46.17  ? 397  ILE A CG2 1 
ATOM   2979 C  CD1 . ILE A 1 398 ? -1.924  7.007   4.588   1.00 62.58  ? 397  ILE A CD1 1 
ATOM   2980 N  N   . ILE A 1 399 ? 2.119   9.669   3.469   1.00 52.65  ? 398  ILE A N   1 
ATOM   2981 C  CA  . ILE A 1 399 ? 2.033   10.860  2.626   1.00 49.87  ? 398  ILE A CA  1 
ATOM   2982 C  C   . ILE A 1 399 ? 3.057   10.853  1.491   1.00 51.73  ? 398  ILE A C   1 
ATOM   2983 O  O   . ILE A 1 399 ? 2.809   11.404  0.419   1.00 54.10  ? 398  ILE A O   1 
ATOM   2984 C  CB  . ILE A 1 399 ? 2.212   12.155  3.439   1.00 53.02  ? 398  ILE A CB  1 
ATOM   2985 C  CG1 . ILE A 1 399 ? 2.022   13.376  2.537   1.00 54.77  ? 398  ILE A CG1 1 
ATOM   2986 C  CG2 . ILE A 1 399 ? 3.580   12.195  4.088   1.00 60.84  ? 398  ILE A CG2 1 
ATOM   2987 C  CD1 . ILE A 1 399 ? 2.357   14.688  3.203   1.00 59.22  ? 398  ILE A CD1 1 
ATOM   2988 N  N   . THR A 1 400 ? 4.203   10.223  1.725   1.00 48.72  ? 399  THR A N   1 
ATOM   2989 C  CA  . THR A 1 400 ? 5.285   10.208  0.740   1.00 49.45  ? 399  THR A CA  1 
ATOM   2990 C  C   . THR A 1 400 ? 5.209   9.022   -0.220  1.00 44.12  ? 399  THR A C   1 
ATOM   2991 O  O   . THR A 1 400 ? 5.668   9.110   -1.358  1.00 45.39  ? 399  THR A O   1 
ATOM   2992 C  CB  . THR A 1 400 ? 6.666   10.188  1.420   1.00 49.07  ? 399  THR A CB  1 
ATOM   2993 O  OG1 . THR A 1 400 ? 6.749   9.057   2.296   1.00 51.47  ? 399  THR A OG1 1 
ATOM   2994 C  CG2 . THR A 1 400 ? 6.888   11.464  2.214   1.00 39.49  ? 399  THR A CG2 1 
ATOM   2995 N  N   . TRP A 1 401 ? 4.638   7.915   0.244   1.00 40.27  ? 400  TRP A N   1 
ATOM   2996 C  CA  . TRP A 1 401 ? 4.552   6.699   -0.557  1.00 36.64  ? 400  TRP A CA  1 
ATOM   2997 C  C   . TRP A 1 401 ? 3.237   6.584   -1.330  1.00 37.77  ? 400  TRP A C   1 
ATOM   2998 O  O   . TRP A 1 401 ? 3.189   5.941   -2.375  1.00 41.38  ? 400  TRP A O   1 
ATOM   2999 C  CB  . TRP A 1 401 ? 4.742   5.465   0.327   1.00 39.93  ? 400  TRP A CB  1 
ATOM   3000 C  CG  . TRP A 1 401 ? 6.150   5.253   0.810   1.00 40.81  ? 400  TRP A CG  1 
ATOM   3001 C  CD1 . TRP A 1 401 ? 6.948   6.159   1.447   1.00 45.46  ? 400  TRP A CD1 1 
ATOM   3002 C  CD2 . TRP A 1 401 ? 6.909   4.044   0.714   1.00 44.58  ? 400  TRP A CD2 1 
ATOM   3003 N  NE1 . TRP A 1 401 ? 8.165   5.590   1.744   1.00 44.14  ? 400  TRP A NE1 1 
ATOM   3004 C  CE2 . TRP A 1 401 ? 8.167   4.292   1.307   1.00 44.50  ? 400  TRP A CE2 1 
ATOM   3005 C  CE3 . TRP A 1 401 ? 6.654   2.777   0.183   1.00 40.08  ? 400  TRP A CE3 1 
ATOM   3006 C  CZ2 . TRP A 1 401 ? 9.162   3.320   1.378   1.00 46.78  ? 400  TRP A CZ2 1 
ATOM   3007 C  CZ3 . TRP A 1 401 ? 7.642   1.814   0.254   1.00 39.01  ? 400  TRP A CZ3 1 
ATOM   3008 C  CH2 . TRP A 1 401 ? 8.882   2.090   0.847   1.00 46.24  ? 400  TRP A CH2 1 
ATOM   3009 N  N   . ALA A 1 402 ? 2.173   7.194   -0.815  1.00 34.20  ? 401  ALA A N   1 
ATOM   3010 C  CA  . ALA A 1 402 ? 0.868   7.123   -1.472  1.00 32.85  ? 401  ALA A CA  1 
ATOM   3011 C  C   . ALA A 1 402 ? 0.891   7.673   -2.898  1.00 41.16  ? 401  ALA A C   1 
ATOM   3012 O  O   . ALA A 1 402 ? 0.374   7.031   -3.817  1.00 38.36  ? 401  ALA A O   1 
ATOM   3013 C  CB  . ALA A 1 402 ? -0.199  7.830   -0.641  1.00 36.34  ? 401  ALA A CB  1 
ATOM   3014 N  N   . PRO A 1 403 ? 1.486   8.865   -3.089  1.00 47.32  ? 402  PRO A N   1 
ATOM   3015 C  CA  . PRO A 1 403 ? 1.569   9.450   -4.432  1.00 47.03  ? 402  PRO A CA  1 
ATOM   3016 C  C   . PRO A 1 403 ? 2.065   8.442   -5.463  1.00 42.66  ? 402  PRO A C   1 
ATOM   3017 O  O   . PRO A 1 403 ? 1.409   8.223   -6.481  1.00 38.74  ? 402  PRO A O   1 
ATOM   3018 C  CB  . PRO A 1 403 ? 2.602   10.567  -4.258  1.00 40.09  ? 402  PRO A CB  1 
ATOM   3019 C  CG  . PRO A 1 403 ? 2.461   10.980  -2.834  1.00 40.83  ? 402  PRO A CG  1 
ATOM   3020 C  CD  . PRO A 1 403 ? 2.134   9.720   -2.076  1.00 43.79  ? 402  PRO A CD  1 
ATOM   3021 N  N   . TYR A 1 404 ? 3.215   7.835   -5.192  1.00 45.31  ? 403  TYR A N   1 
ATOM   3022 C  CA  . TYR A 1 404 ? 3.801   6.870   -6.111  1.00 42.00  ? 403  TYR A CA  1 
ATOM   3023 C  C   . TYR A 1 404 ? 2.888   5.672   -6.357  1.00 40.20  ? 403  TYR A C   1 
ATOM   3024 O  O   . TYR A 1 404 ? 2.662   5.274   -7.495  1.00 43.37  ? 403  TYR A O   1 
ATOM   3025 C  CB  . TYR A 1 404 ? 5.155   6.386   -5.596  1.00 37.95  ? 403  TYR A CB  1 
ATOM   3026 C  CG  . TYR A 1 404 ? 5.837   5.445   -6.555  1.00 40.56  ? 403  TYR A CG  1 
ATOM   3027 C  CD1 . TYR A 1 404 ? 6.777   5.910   -7.465  1.00 44.64  ? 403  TYR A CD1 1 
ATOM   3028 C  CD2 . TYR A 1 404 ? 5.525   4.092   -6.566  1.00 44.18  ? 403  TYR A CD2 1 
ATOM   3029 C  CE1 . TYR A 1 404 ? 7.396   5.052   -8.350  1.00 49.21  ? 403  TYR A CE1 1 
ATOM   3030 C  CE2 . TYR A 1 404 ? 6.139   3.226   -7.448  1.00 50.17  ? 403  TYR A CE2 1 
ATOM   3031 C  CZ  . TYR A 1 404 ? 7.075   3.711   -8.338  1.00 49.34  ? 403  TYR A CZ  1 
ATOM   3032 O  OH  . TYR A 1 404 ? 7.691   2.853   -9.220  1.00 42.01  ? 403  TYR A OH  1 
ATOM   3033 N  N   . ASN A 1 405 ? 2.366   5.099   -5.280  1.00 42.44  ? 404  ASN A N   1 
ATOM   3034 C  CA  . ASN A 1 405 ? 1.542   3.901   -5.378  1.00 41.05  ? 404  ASN A CA  1 
ATOM   3035 C  C   . ASN A 1 405 ? 0.180   4.146   -6.023  1.00 44.08  ? 404  ASN A C   1 
ATOM   3036 O  O   . ASN A 1 405 ? -0.322  3.293   -6.755  1.00 46.41  ? 404  ASN A O   1 
ATOM   3037 C  CB  . ASN A 1 405 ? 1.381   3.237   -4.008  1.00 45.25  ? 404  ASN A CB  1 
ATOM   3038 C  CG  . ASN A 1 405 ? 2.655   2.574   -3.531  1.00 41.40  ? 404  ASN A CG  1 
ATOM   3039 O  OD1 . ASN A 1 405 ? 2.870   1.382   -3.760  1.00 36.85  ? 404  ASN A OD1 1 
ATOM   3040 N  ND2 . ASN A 1 405 ? 3.511   3.342   -2.864  1.00 37.04  ? 404  ASN A ND2 1 
ATOM   3041 N  N   . VAL A 1 406 ? -0.423  5.300   -5.756  1.00 46.41  ? 405  VAL A N   1 
ATOM   3042 C  CA  . VAL A 1 406 ? -1.664  5.646   -6.440  1.00 53.93  ? 405  VAL A CA  1 
ATOM   3043 C  C   . VAL A 1 406 ? -1.346  5.964   -7.899  1.00 50.59  ? 405  VAL A C   1 
ATOM   3044 O  O   . VAL A 1 406 ? -2.217  5.914   -8.770  1.00 54.36  ? 405  VAL A O   1 
ATOM   3045 C  CB  . VAL A 1 406 ? -2.398  6.832   -5.779  1.00 43.19  ? 405  VAL A CB  1 
ATOM   3046 C  CG1 . VAL A 1 406 ? -1.594  8.111   -5.920  1.00 41.90  ? 405  VAL A CG1 1 
ATOM   3047 C  CG2 . VAL A 1 406 ? -3.786  7.006   -6.390  1.00 35.63  ? 405  VAL A CG2 1 
ATOM   3048 N  N   . MET A 1 407 ? -0.082  6.284   -8.155  1.00 41.20  ? 406  MET A N   1 
ATOM   3049 C  CA  . MET A 1 407 ? 0.396   6.511   -9.513  1.00 43.15  ? 406  MET A CA  1 
ATOM   3050 C  C   . MET A 1 407 ? 0.393   5.187   -10.264 1.00 49.06  ? 406  MET A C   1 
ATOM   3051 O  O   . MET A 1 407 ? 0.028   5.122   -11.437 1.00 48.47  ? 406  MET A O   1 
ATOM   3052 C  CB  . MET A 1 407 ? 1.809   7.095   -9.486  1.00 38.64  ? 406  MET A CB  1 
ATOM   3053 C  CG  . MET A 1 407 ? 1.976   8.391   -10.263 1.00 34.72  ? 406  MET A CG  1 
ATOM   3054 S  SD  . MET A 1 407 ? 3.231   9.447   -9.519  1.00 47.21  ? 406  MET A SD  1 
ATOM   3055 C  CE  . MET A 1 407 ? 4.608   8.314   -9.378  1.00 43.43  ? 406  MET A CE  1 
ATOM   3056 N  N   . VAL A 1 408 ? 0.800   4.130   -9.568  1.00 42.65  ? 407  VAL A N   1 
ATOM   3057 C  CA  . VAL A 1 408 ? 0.785   2.787   -10.127 1.00 40.89  ? 407  VAL A CA  1 
ATOM   3058 C  C   . VAL A 1 408 ? -0.650  2.368   -10.433 1.00 45.37  ? 407  VAL A C   1 
ATOM   3059 O  O   . VAL A 1 408 ? -0.951  1.907   -11.531 1.00 49.66  ? 407  VAL A O   1 
ATOM   3060 C  CB  . VAL A 1 408 ? 1.423   1.775   -9.160  1.00 34.58  ? 407  VAL A CB  1 
ATOM   3061 C  CG1 . VAL A 1 408 ? 1.201   0.351   -9.650  1.00 37.47  ? 407  VAL A CG1 1 
ATOM   3062 C  CG2 . VAL A 1 408 ? 2.906   2.071   -8.987  1.00 33.30  ? 407  VAL A CG2 1 
ATOM   3063 N  N   . LEU A 1 409 ? -1.530  2.533   -9.451  1.00 51.01  ? 408  LEU A N   1 
ATOM   3064 C  CA  . LEU A 1 409 ? -2.949  2.233   -9.618  1.00 53.97  ? 408  LEU A CA  1 
ATOM   3065 C  C   . LEU A 1 409 ? -3.501  2.868   -10.892 1.00 52.91  ? 408  LEU A C   1 
ATOM   3066 O  O   . LEU A 1 409 ? -4.025  2.179   -11.767 1.00 50.98  ? 408  LEU A O   1 
ATOM   3067 C  CB  . LEU A 1 409 ? -3.736  2.721   -8.398  1.00 51.19  ? 408  LEU A CB  1 
ATOM   3068 C  CG  . LEU A 1 409 ? -5.256  2.802   -8.551  1.00 55.21  ? 408  LEU A CG  1 
ATOM   3069 C  CD1 . LEU A 1 409 ? -5.829  1.482   -9.053  1.00 56.04  ? 408  LEU A CD1 1 
ATOM   3070 C  CD2 . LEU A 1 409 ? -5.898  3.209   -7.234  1.00 60.61  ? 408  LEU A CD2 1 
ATOM   3071 N  N   . ILE A 1 410 ? -3.376  4.188   -10.989 1.00 50.30  ? 409  ILE A N   1 
ATOM   3072 C  CA  . ILE A 1 410 ? -3.859  4.920   -12.155 1.00 54.20  ? 409  ILE A CA  1 
ATOM   3073 C  C   . ILE A 1 410 ? -3.213  4.414   -13.444 1.00 54.73  ? 409  ILE A C   1 
ATOM   3074 O  O   . ILE A 1 410 ? -3.865  4.323   -14.487 1.00 49.46  ? 409  ILE A O   1 
ATOM   3075 C  CB  . ILE A 1 410 ? -3.608  6.434   -12.012 1.00 50.52  ? 409  ILE A CB  1 
ATOM   3076 C  CG1 . ILE A 1 410 ? -4.428  6.994   -10.848 1.00 53.24  ? 409  ILE A CG1 1 
ATOM   3077 C  CG2 . ILE A 1 410 ? -3.946  7.160   -13.308 1.00 42.56  ? 409  ILE A CG2 1 
ATOM   3078 C  CD1 . ILE A 1 410 ? -4.287  8.489   -10.659 1.00 52.05  ? 409  ILE A CD1 1 
ATOM   3079 N  N   . ASN A 1 411 ? -1.931  4.076   -13.358 1.00 52.78  ? 410  ASN A N   1 
ATOM   3080 C  CA  . ASN A 1 411 ? -1.190  3.571   -14.508 1.00 50.85  ? 410  ASN A CA  1 
ATOM   3081 C  C   . ASN A 1 411 ? -1.764  2.273   -15.063 1.00 52.23  ? 410  ASN A C   1 
ATOM   3082 O  O   . ASN A 1 411 ? -1.481  1.893   -16.198 1.00 47.83  ? 410  ASN A O   1 
ATOM   3083 C  CB  . ASN A 1 411 ? 0.280   3.359   -14.144 1.00 52.67  ? 410  ASN A CB  1 
ATOM   3084 C  CG  . ASN A 1 411 ? 1.081   2.765   -15.285 1.00 48.44  ? 410  ASN A CG  1 
ATOM   3085 O  OD1 . ASN A 1 411 ? 1.585   3.486   -16.146 1.00 57.87  ? 410  ASN A OD1 1 
ATOM   3086 N  ND2 . ASN A 1 411 ? 1.202   1.443   -15.298 1.00 45.87  ? 410  ASN A ND2 1 
ATOM   3087 N  N   . THR A 1 412 ? -2.573  1.594   -14.256 1.00 55.60  ? 411  THR A N   1 
ATOM   3088 C  CA  . THR A 1 412 ? -3.100  0.292   -14.635 1.00 49.25  ? 411  THR A CA  1 
ATOM   3089 C  C   . THR A 1 412 ? -4.080  0.403   -15.801 1.00 48.32  ? 411  THR A C   1 
ATOM   3090 O  O   . THR A 1 412 ? -4.058  -0.423  -16.716 1.00 44.86  ? 411  THR A O   1 
ATOM   3091 C  CB  . THR A 1 412 ? -3.755  -0.433  -13.436 1.00 48.28  ? 411  THR A CB  1 
ATOM   3092 O  OG1 . THR A 1 412 ? -3.669  -1.850  -13.626 1.00 48.07  ? 411  THR A OG1 1 
ATOM   3093 C  CG2 . THR A 1 412 ? -5.217  -0.020  -13.271 1.00 48.13  ? 411  THR A CG2 1 
ATOM   3094 N  N   . PHE A 1 413 ? -4.925  1.429   -15.778 1.00 52.33  ? 412  PHE A N   1 
ATOM   3095 C  CA  . PHE A 1 413 ? -5.916  1.603   -16.832 1.00 54.75  ? 412  PHE A CA  1 
ATOM   3096 C  C   . PHE A 1 413 ? -5.508  2.677   -17.836 1.00 62.23  ? 412  PHE A C   1 
ATOM   3097 O  O   . PHE A 1 413 ? -5.993  2.695   -18.968 1.00 67.97  ? 412  PHE A O   1 
ATOM   3098 C  CB  . PHE A 1 413 ? -7.306  1.902   -16.249 1.00 58.09  ? 412  PHE A CB  1 
ATOM   3099 C  CG  . PHE A 1 413 ? -7.334  3.049   -15.270 1.00 59.54  ? 412  PHE A CG  1 
ATOM   3100 C  CD1 . PHE A 1 413 ? -7.240  4.361   -15.710 1.00 61.98  ? 412  PHE A CD1 1 
ATOM   3101 C  CD2 . PHE A 1 413 ? -7.489  2.814   -13.910 1.00 54.96  ? 412  PHE A CD2 1 
ATOM   3102 C  CE1 . PHE A 1 413 ? -7.279  5.415   -14.812 1.00 62.43  ? 412  PHE A CE1 1 
ATOM   3103 C  CE2 . PHE A 1 413 ? -7.530  3.864   -13.008 1.00 51.95  ? 412  PHE A CE2 1 
ATOM   3104 C  CZ  . PHE A 1 413 ? -7.425  5.165   -13.460 1.00 59.61  ? 412  PHE A CZ  1 
ATOM   3105 N  N   . CYS A 1 414 ? -4.612  3.567   -17.423 1.00 58.47  ? 413  CYS A N   1 
ATOM   3106 C  CA  . CYS A 1 414 ? -4.184  4.660   -18.287 1.00 56.94  ? 413  CYS A CA  1 
ATOM   3107 C  C   . CYS A 1 414 ? -2.725  5.035   -18.056 1.00 57.56  ? 413  CYS A C   1 
ATOM   3108 O  O   . CYS A 1 414 ? -2.396  5.739   -17.102 1.00 55.85  ? 413  CYS A O   1 
ATOM   3109 C  CB  . CYS A 1 414 ? -5.084  5.881   -18.090 1.00 53.40  ? 413  CYS A CB  1 
ATOM   3110 S  SG  . CYS A 1 414 ? -4.602  7.314   -19.076 1.00 83.02  ? 413  CYS A SG  1 
ATOM   3111 N  N   . ALA A 1 415 ? -1.856  4.562   -18.941 1.00 59.31  ? 414  ALA A N   1 
ATOM   3112 C  CA  . ALA A 1 415 ? -0.424  4.833   -18.840 1.00 53.80  ? 414  ALA A CA  1 
ATOM   3113 C  C   . ALA A 1 415 ? -0.047  6.257   -19.264 1.00 64.78  ? 414  ALA A C   1 
ATOM   3114 O  O   . ALA A 1 415 ? 0.732   6.921   -18.578 1.00 61.50  ? 414  ALA A O   1 
ATOM   3115 C  CB  . ALA A 1 415 ? 0.371   3.809   -19.643 1.00 46.85  ? 414  ALA A CB  1 
ATOM   3116 N  N   . PRO A 1 416 ? -0.599  6.736   -20.395 1.00 66.51  ? 415  PRO A N   1 
ATOM   3117 C  CA  . PRO A 1 416 ? -0.272  8.088   -20.866 1.00 59.95  ? 415  PRO A CA  1 
ATOM   3118 C  C   . PRO A 1 416 ? -0.668  9.187   -19.880 1.00 63.33  ? 415  PRO A C   1 
ATOM   3119 O  O   . PRO A 1 416 ? -0.096  10.275  -19.928 1.00 63.66  ? 415  PRO A O   1 
ATOM   3120 C  CB  . PRO A 1 416 ? -1.096  8.219   -22.153 1.00 53.72  ? 415  PRO A CB  1 
ATOM   3121 C  CG  . PRO A 1 416 ? -1.287  6.820   -22.618 1.00 55.44  ? 415  PRO A CG  1 
ATOM   3122 C  CD  . PRO A 1 416 ? -1.444  6.015   -21.365 1.00 58.85  ? 415  PRO A CD  1 
ATOM   3123 N  N   . CYS A 1 417 ? -1.631  8.911   -19.005 1.00 64.64  ? 416  CYS A N   1 
ATOM   3124 C  CA  . CYS A 1 417 ? -2.083  9.904   -18.029 1.00 59.34  ? 416  CYS A CA  1 
ATOM   3125 C  C   . CYS A 1 417 ? -0.943  10.387  -17.138 1.00 54.45  ? 416  CYS A C   1 
ATOM   3126 O  O   . CYS A 1 417 ? -0.889  11.559  -16.768 1.00 45.61  ? 416  CYS A O   1 
ATOM   3127 C  CB  . CYS A 1 417 ? -3.220  9.347   -17.164 1.00 56.83  ? 416  CYS A CB  1 
ATOM   3128 S  SG  . CYS A 1 417 ? -4.774  9.053   -18.041 1.00 77.62  ? 416  CYS A SG  1 
ATOM   3129 N  N   . ILE A 1 418 ? -0.037  9.474   -16.798 1.00 58.77  ? 417  ILE A N   1 
ATOM   3130 C  CA  . ILE A 1 418 ? 1.090   9.787   -15.927 1.00 53.17  ? 417  ILE A CA  1 
ATOM   3131 C  C   . ILE A 1 418 ? 2.359   10.061  -16.732 1.00 56.22  ? 417  ILE A C   1 
ATOM   3132 O  O   . ILE A 1 418 ? 2.975   9.134   -17.263 1.00 57.37  ? 417  ILE A O   1 
ATOM   3133 C  CB  . ILE A 1 418 ? 1.370   8.636   -14.932 1.00 51.60  ? 417  ILE A CB  1 
ATOM   3134 C  CG1 . ILE A 1 418 ? 0.066   8.109   -14.324 1.00 50.76  ? 417  ILE A CG1 1 
ATOM   3135 C  CG2 . ILE A 1 418 ? 2.342   9.086   -13.849 1.00 41.66  ? 417  ILE A CG2 1 
ATOM   3136 C  CD1 . ILE A 1 418 ? -0.670  9.124   -13.479 1.00 53.52  ? 417  ILE A CD1 1 
ATOM   3137 N  N   . PRO A 1 419 ? 2.746   11.342  -16.838 1.00 54.22  ? 418  PRO A N   1 
ATOM   3138 C  CA  . PRO A 1 419 ? 3.984   11.727  -17.524 1.00 53.14  ? 418  PRO A CA  1 
ATOM   3139 C  C   . PRO A 1 419 ? 5.212   11.235  -16.761 1.00 57.71  ? 418  PRO A C   1 
ATOM   3140 O  O   . PRO A 1 419 ? 5.086   10.763  -15.629 1.00 57.06  ? 418  PRO A O   1 
ATOM   3141 C  CB  . PRO A 1 419 ? 3.939   13.260  -17.502 1.00 48.28  ? 418  PRO A CB  1 
ATOM   3142 C  CG  . PRO A 1 419 ? 2.510   13.612  -17.232 1.00 48.31  ? 418  PRO A CG  1 
ATOM   3143 C  CD  . PRO A 1 419 ? 1.990   12.512  -16.364 1.00 53.32  ? 418  PRO A CD  1 
ATOM   3144 N  N   . ASN A 1 420 ? 6.385   11.349  -17.375 1.00 59.74  ? 419  ASN A N   1 
ATOM   3145 C  CA  . ASN A 1 420 ? 7.622   10.933  -16.730 1.00 61.10  ? 419  ASN A CA  1 
ATOM   3146 C  C   . ASN A 1 420 ? 7.978   11.846  -15.557 1.00 55.89  ? 419  ASN A C   1 
ATOM   3147 O  O   . ASN A 1 420 ? 8.372   11.372  -14.491 1.00 58.10  ? 419  ASN A O   1 
ATOM   3148 C  CB  . ASN A 1 420 ? 8.766   10.888  -17.748 1.00 60.71  ? 419  ASN A CB  1 
ATOM   3149 C  CG  . ASN A 1 420 ? 9.977   10.120  -17.240 1.00 74.26  ? 419  ASN A CG  1 
ATOM   3150 O  OD1 . ASN A 1 420 ? 10.355  10.226  -16.072 1.00 77.90  ? 419  ASN A OD1 1 
ATOM   3151 N  ND2 . ASN A 1 420 ? 10.594  9.342   -18.122 1.00 82.70  ? 419  ASN A ND2 1 
ATOM   3152 N  N   . THR A 1 421 ? 7.828   13.153  -15.755 1.00 52.20  ? 420  THR A N   1 
ATOM   3153 C  CA  . THR A 1 421 ? 8.116   14.128  -14.704 1.00 59.57  ? 420  THR A CA  1 
ATOM   3154 C  C   . THR A 1 421 ? 7.336   13.817  -13.429 1.00 61.66  ? 420  THR A C   1 
ATOM   3155 O  O   . THR A 1 421 ? 7.801   14.084  -12.321 1.00 54.56  ? 420  THR A O   1 
ATOM   3156 C  CB  . THR A 1 421 ? 7.795   15.568  -15.154 1.00 51.64  ? 420  THR A CB  1 
ATOM   3157 O  OG1 . THR A 1 421 ? 8.654   15.932  -16.242 1.00 51.21  ? 420  THR A OG1 1 
ATOM   3158 C  CG2 . THR A 1 421 ? 8.005   16.546  -14.005 1.00 51.23  ? 420  THR A CG2 1 
ATOM   3159 N  N   . VAL A 1 422 ? 6.144   13.253  -13.595 1.00 57.75  ? 421  VAL A N   1 
ATOM   3160 C  CA  . VAL A 1 422 ? 5.325   12.867  -12.454 1.00 54.34  ? 421  VAL A CA  1 
ATOM   3161 C  C   . VAL A 1 422 ? 5.943   11.680  -11.721 1.00 53.67  ? 421  VAL A C   1 
ATOM   3162 O  O   . VAL A 1 422 ? 6.075   11.697  -10.497 1.00 54.43  ? 421  VAL A O   1 
ATOM   3163 C  CB  . VAL A 1 422 ? 3.889   12.521  -12.879 1.00 53.40  ? 421  VAL A CB  1 
ATOM   3164 C  CG1 . VAL A 1 422 ? 3.088   12.036  -11.682 1.00 55.56  ? 421  VAL A CG1 1 
ATOM   3165 C  CG2 . VAL A 1 422 ? 3.225   13.731  -13.513 1.00 50.29  ? 421  VAL A CG2 1 
ATOM   3166 N  N   . TRP A 1 423 ? 6.319   10.652  -12.475 1.00 48.98  ? 422  TRP A N   1 
ATOM   3167 C  CA  . TRP A 1 423 ? 6.990   9.491   -11.901 1.00 47.85  ? 422  TRP A CA  1 
ATOM   3168 C  C   . TRP A 1 423 ? 8.223   9.911   -11.111 1.00 47.34  ? 422  TRP A C   1 
ATOM   3169 O  O   . TRP A 1 423 ? 8.484   9.393   -10.025 1.00 48.39  ? 422  TRP A O   1 
ATOM   3170 C  CB  . TRP A 1 423 ? 7.392   8.499   -12.995 1.00 57.86  ? 422  TRP A CB  1 
ATOM   3171 C  CG  . TRP A 1 423 ? 6.248   7.726   -13.561 1.00 55.60  ? 422  TRP A CG  1 
ATOM   3172 C  CD1 . TRP A 1 423 ? 5.674   7.892   -14.787 1.00 53.49  ? 422  TRP A CD1 1 
ATOM   3173 C  CD2 . TRP A 1 423 ? 5.532   6.661   -12.922 1.00 57.96  ? 422  TRP A CD2 1 
ATOM   3174 N  NE1 . TRP A 1 423 ? 4.646   6.995   -14.953 1.00 55.61  ? 422  TRP A NE1 1 
ATOM   3175 C  CE2 . TRP A 1 423 ? 4.539   6.228   -13.823 1.00 56.98  ? 422  TRP A CE2 1 
ATOM   3176 C  CE3 . TRP A 1 423 ? 5.636   6.031   -11.675 1.00 47.28  ? 422  TRP A CE3 1 
ATOM   3177 C  CZ2 . TRP A 1 423 ? 3.655   5.194   -13.518 1.00 55.77  ? 422  TRP A CZ2 1 
ATOM   3178 C  CZ3 . TRP A 1 423 ? 4.757   5.006   -11.373 1.00 39.66  ? 422  TRP A CZ3 1 
ATOM   3179 C  CH2 . TRP A 1 423 ? 3.779   4.597   -12.291 1.00 48.30  ? 422  TRP A CH2 1 
ATOM   3180 N  N   . THR A 1 424 ? 8.980   10.851  -11.664 1.00 50.86  ? 423  THR A N   1 
ATOM   3181 C  CA  . THR A 1 424 ? 10.190  11.338  -11.014 1.00 50.60  ? 423  THR A CA  1 
ATOM   3182 C  C   . THR A 1 424 ? 9.863   11.950  -9.660  1.00 53.75  ? 423  THR A C   1 
ATOM   3183 O  O   . THR A 1 424 ? 10.562  11.715  -8.673  1.00 50.35  ? 423  THR A O   1 
ATOM   3184 C  CB  . THR A 1 424 ? 10.915  12.384  -11.876 1.00 43.72  ? 423  THR A CB  1 
ATOM   3185 O  OG1 . THR A 1 424 ? 11.265  11.802  -13.138 1.00 56.16  ? 423  THR A OG1 1 
ATOM   3186 C  CG2 . THR A 1 424 ? 12.176  12.866  -11.178 1.00 39.98  ? 423  THR A CG2 1 
ATOM   3187 N  N   . ILE A 1 425 ? 8.795   12.739  -9.623  1.00 54.51  ? 424  ILE A N   1 
ATOM   3188 C  CA  . ILE A 1 425 ? 8.340   13.356  -8.385  1.00 45.58  ? 424  ILE A CA  1 
ATOM   3189 C  C   . ILE A 1 425 ? 7.960   12.284  -7.378  1.00 46.27  ? 424  ILE A C   1 
ATOM   3190 O  O   . ILE A 1 425 ? 8.358   12.337  -6.216  1.00 47.78  ? 424  ILE A O   1 
ATOM   3191 C  CB  . ILE A 1 425 ? 7.129   14.271  -8.625  1.00 46.05  ? 424  ILE A CB  1 
ATOM   3192 C  CG1 . ILE A 1 425 ? 7.495   15.390  -9.600  1.00 47.70  ? 424  ILE A CG1 1 
ATOM   3193 C  CG2 . ILE A 1 425 ? 6.633   14.853  -7.309  1.00 48.61  ? 424  ILE A CG2 1 
ATOM   3194 C  CD1 . ILE A 1 425 ? 6.365   16.356  -9.862  1.00 48.66  ? 424  ILE A CD1 1 
ATOM   3195 N  N   . GLY A 1 426 ? 7.184   11.309  -7.840  1.00 44.13  ? 425  GLY A N   1 
ATOM   3196 C  CA  . GLY A 1 426 ? 6.803   10.179  -7.017  1.00 42.07  ? 425  GLY A CA  1 
ATOM   3197 C  C   . GLY A 1 426 ? 8.011   9.502   -6.399  1.00 47.45  ? 425  GLY A C   1 
ATOM   3198 O  O   . GLY A 1 426 ? 8.016   9.195   -5.210  1.00 47.82  ? 425  GLY A O   1 
ATOM   3199 N  N   . TYR A 1 427 ? 9.041   9.276   -7.210  1.00 46.82  ? 426  TYR A N   1 
ATOM   3200 C  CA  . TYR A 1 427 ? 10.269  8.633   -6.746  1.00 49.17  ? 426  TYR A CA  1 
ATOM   3201 C  C   . TYR A 1 427 ? 10.963  9.435   -5.654  1.00 48.38  ? 426  TYR A C   1 
ATOM   3202 O  O   . TYR A 1 427 ? 11.388  8.883   -4.638  1.00 55.91  ? 426  TYR A O   1 
ATOM   3203 C  CB  . TYR A 1 427 ? 11.237  8.412   -7.911  1.00 42.69  ? 426  TYR A CB  1 
ATOM   3204 C  CG  . TYR A 1 427 ? 11.239  7.000   -8.444  1.00 49.28  ? 426  TYR A CG  1 
ATOM   3205 C  CD1 . TYR A 1 427 ? 12.126  6.053   -7.950  1.00 47.19  ? 426  TYR A CD1 1 
ATOM   3206 C  CD2 . TYR A 1 427 ? 10.350  6.611   -9.437  1.00 55.98  ? 426  TYR A CD2 1 
ATOM   3207 C  CE1 . TYR A 1 427 ? 12.133  4.756   -8.433  1.00 51.56  ? 426  TYR A CE1 1 
ATOM   3208 C  CE2 . TYR A 1 427 ? 10.348  5.314   -9.930  1.00 60.39  ? 426  TYR A CE2 1 
ATOM   3209 C  CZ  . TYR A 1 427 ? 11.242  4.391   -9.423  1.00 66.20  ? 426  TYR A CZ  1 
ATOM   3210 O  OH  . TYR A 1 427 ? 11.243  3.102   -9.910  1.00 74.47  ? 426  TYR A OH  1 
ATOM   3211 N  N   . TRP A 1 428 ? 11.080  10.740  -5.867  1.00 46.34  ? 427  TRP A N   1 
ATOM   3212 C  CA  . TRP A 1 428 ? 11.781  11.598  -4.919  1.00 46.52  ? 427  TRP A CA  1 
ATOM   3213 C  C   . TRP A 1 428 ? 11.028  11.769  -3.603  1.00 49.69  ? 427  TRP A C   1 
ATOM   3214 O  O   . TRP A 1 428 ? 11.634  11.972  -2.549  1.00 51.19  ? 427  TRP A O   1 
ATOM   3215 C  CB  . TRP A 1 428 ? 12.114  12.950  -5.550  1.00 51.44  ? 427  TRP A CB  1 
ATOM   3216 C  CG  . TRP A 1 428 ? 13.295  12.869  -6.455  1.00 56.46  ? 427  TRP A CG  1 
ATOM   3217 C  CD1 . TRP A 1 428 ? 13.291  12.920  -7.816  1.00 51.96  ? 427  TRP A CD1 1 
ATOM   3218 C  CD2 . TRP A 1 428 ? 14.653  12.690  -6.055  1.00 61.05  ? 427  TRP A CD2 1 
ATOM   3219 N  NE1 . TRP A 1 428 ? 14.573  12.797  -8.296  1.00 50.53  ? 427  TRP A NE1 1 
ATOM   3220 C  CE2 . TRP A 1 428 ? 15.431  12.654  -7.239  1.00 53.83  ? 427  TRP A CE2 1 
ATOM   3221 C  CE3 . TRP A 1 428 ? 15.302  12.564  -4.825  1.00 50.00  ? 427  TRP A CE3 1 
ATOM   3222 C  CZ2 . TRP A 1 428 ? 16.811  12.498  -7.218  1.00 45.56  ? 427  TRP A CZ2 1 
ATOM   3223 C  CZ3 . TRP A 1 428 ? 16.671  12.408  -4.805  1.00 53.70  ? 427  TRP A CZ3 1 
ATOM   3224 C  CH2 . TRP A 1 428 ? 17.413  12.376  -5.995  1.00 54.11  ? 427  TRP A CH2 1 
ATOM   3225 N  N   . LEU A 1 429 ? 9.706   11.671  -3.662  1.00 44.62  ? 428  LEU A N   1 
ATOM   3226 C  CA  . LEU A 1 429 ? 8.909   11.699  -2.447  1.00 40.14  ? 428  LEU A CA  1 
ATOM   3227 C  C   . LEU A 1 429 ? 9.241   10.485  -1.589  1.00 47.30  ? 428  LEU A C   1 
ATOM   3228 O  O   . LEU A 1 429 ? 9.591   10.620  -0.418  1.00 53.25  ? 428  LEU A O   1 
ATOM   3229 C  CB  . LEU A 1 429 ? 7.419   11.732  -2.773  1.00 41.38  ? 428  LEU A CB  1 
ATOM   3230 C  CG  . LEU A 1 429 ? 6.891   13.050  -3.340  1.00 47.11  ? 428  LEU A CG  1 
ATOM   3231 C  CD1 . LEU A 1 429 ? 5.384   12.972  -3.547  1.00 42.87  ? 428  LEU A CD1 1 
ATOM   3232 C  CD2 . LEU A 1 429 ? 7.254   14.217  -2.428  1.00 45.02  ? 428  LEU A CD2 1 
ATOM   3233 N  N   . CYS A 1 430 ? 9.134   9.301   -2.181  1.00 40.56  ? 429  CYS A N   1 
ATOM   3234 C  CA  . CYS A 1 430 ? 9.489   8.064   -1.496  1.00 43.44  ? 429  CYS A CA  1 
ATOM   3235 C  C   . CYS A 1 430 ? 10.903  8.141   -0.935  1.00 50.50  ? 429  CYS A C   1 
ATOM   3236 O  O   . CYS A 1 430 ? 11.185  7.624   0.146   1.00 56.23  ? 429  CYS A O   1 
ATOM   3237 C  CB  . CYS A 1 430 ? 9.369   6.869   -2.445  1.00 41.21  ? 429  CYS A CB  1 
ATOM   3238 S  SG  . CYS A 1 430 ? 7.686   6.517   -2.987  1.00 61.87  ? 429  CYS A SG  1 
ATOM   3239 N  N   . TYR A 1 431 ? 11.791  8.792   -1.677  1.00 50.22  ? 430  TYR A N   1 
ATOM   3240 C  CA  . TYR A 1 431 ? 13.186  8.894   -1.266  1.00 49.79  ? 430  TYR A CA  1 
ATOM   3241 C  C   . TYR A 1 431 ? 13.369  9.825   -0.068  1.00 48.27  ? 430  TYR A C   1 
ATOM   3242 O  O   . TYR A 1 431 ? 13.932  9.427   0.954   1.00 45.27  ? 430  TYR A O   1 
ATOM   3243 C  CB  . TYR A 1 431 ? 14.070  9.340   -2.437  1.00 45.34  ? 430  TYR A CB  1 
ATOM   3244 C  CG  . TYR A 1 431 ? 14.358  8.248   -3.445  1.00 48.21  ? 430  TYR A CG  1 
ATOM   3245 C  CD1 . TYR A 1 431 ? 14.211  6.909   -3.106  1.00 51.17  ? 430  TYR A CD1 1 
ATOM   3246 C  CD2 . TYR A 1 431 ? 14.779  8.555   -4.734  1.00 50.77  ? 430  TYR A CD2 1 
ATOM   3247 C  CE1 . TYR A 1 431 ? 14.474  5.905   -4.023  1.00 53.95  ? 430  TYR A CE1 1 
ATOM   3248 C  CE2 . TYR A 1 431 ? 15.043  7.557   -5.658  1.00 45.20  ? 430  TYR A CE2 1 
ATOM   3249 C  CZ  . TYR A 1 431 ? 14.890  6.235   -5.297  1.00 49.90  ? 430  TYR A CZ  1 
ATOM   3250 O  OH  . TYR A 1 431 ? 15.150  5.240   -6.212  1.00 43.37  ? 430  TYR A OH  1 
ATOM   3251 N  N   . ILE A 1 432 ? 12.884  11.057  -0.195  1.00 49.01  ? 431  ILE A N   1 
ATOM   3252 C  CA  . ILE A 1 432 ? 13.058  12.059  0.855   1.00 52.64  ? 431  ILE A CA  1 
ATOM   3253 C  C   . ILE A 1 432 ? 12.434  11.640  2.185   1.00 51.92  ? 431  ILE A C   1 
ATOM   3254 O  O   . ILE A 1 432 ? 12.796  12.166  3.236   1.00 48.15  ? 431  ILE A O   1 
ATOM   3255 C  CB  . ILE A 1 432 ? 12.489  13.438  0.444   1.00 50.99  ? 431  ILE A CB  1 
ATOM   3256 C  CG1 . ILE A 1 432 ? 10.966  13.375  0.320   1.00 55.19  ? 431  ILE A CG1 1 
ATOM   3257 C  CG2 . ILE A 1 432 ? 13.132  13.925  -0.850  1.00 46.55  ? 431  ILE A CG2 1 
ATOM   3258 C  CD1 . ILE A 1 432 ? 10.298  14.728  0.293   1.00 53.74  ? 431  ILE A CD1 1 
ATOM   3259 N  N   . ASN A 1 433 ? 11.494  10.700  2.139   1.00 47.93  ? 432  ASN A N   1 
ATOM   3260 C  CA  . ASN A 1 433 ? 10.891  10.173  3.360   1.00 47.50  ? 432  ASN A CA  1 
ATOM   3261 C  C   . ASN A 1 433 ? 11.959  9.575   4.262   1.00 48.66  ? 432  ASN A C   1 
ATOM   3262 O  O   . ASN A 1 433 ? 11.791  9.490   5.480   1.00 57.07  ? 432  ASN A O   1 
ATOM   3263 C  CB  . ASN A 1 433 ? 9.826   9.122   3.038   1.00 54.03  ? 432  ASN A CB  1 
ATOM   3264 C  CG  . ASN A 1 433 ? 9.242   8.483   4.286   1.00 49.80  ? 432  ASN A CG  1 
ATOM   3265 O  OD1 . ASN A 1 433 ? 9.515   7.320   4.589   1.00 51.59  ? 432  ASN A OD1 1 
ATOM   3266 N  ND2 . ASN A 1 433 ? 8.443   9.246   5.022   1.00 41.01  ? 432  ASN A ND2 1 
ATOM   3267 N  N   . SER A 1 434 ? 13.062  9.164   3.646   1.00 40.21  ? 433  SER A N   1 
ATOM   3268 C  CA  . SER A 1 434 ? 14.205  8.651   4.380   1.00 43.66  ? 433  SER A CA  1 
ATOM   3269 C  C   . SER A 1 434 ? 15.013  9.813   4.943   1.00 46.93  ? 433  SER A C   1 
ATOM   3270 O  O   . SER A 1 434 ? 15.868  9.628   5.808   1.00 47.83  ? 433  SER A O   1 
ATOM   3271 C  CB  . SER A 1 434 ? 15.072  7.778   3.471   1.00 50.50  ? 433  SER A CB  1 
ATOM   3272 O  OG  . SER A 1 434 ? 14.353  6.640   3.028   1.00 52.52  ? 433  SER A OG  1 
ATOM   3273 N  N   . THR A 1 435 ? 14.725  11.016  4.456   1.00 50.90  ? 434  THR A N   1 
ATOM   3274 C  CA  . THR A 1 435 ? 15.438  12.211  4.895   1.00 51.92  ? 434  THR A CA  1 
ATOM   3275 C  C   . THR A 1 435 ? 14.763  12.862  6.100   1.00 51.88  ? 434  THR A C   1 
ATOM   3276 O  O   . THR A 1 435 ? 15.436  13.342  7.013   1.00 52.32  ? 434  THR A O   1 
ATOM   3277 C  CB  . THR A 1 435 ? 15.543  13.258  3.766   1.00 44.47  ? 434  THR A CB  1 
ATOM   3278 O  OG1 . THR A 1 435 ? 16.029  12.636  2.570   1.00 49.16  ? 434  THR A OG1 1 
ATOM   3279 C  CG2 . THR A 1 435 ? 16.482  14.388  4.166   1.00 41.95  ? 434  THR A CG2 1 
ATOM   3280 N  N   . ILE A 1 436 ? 13.433  12.875  6.098   1.00 49.81  ? 435  ILE A N   1 
ATOM   3281 C  CA  . ILE A 1 436 ? 12.674  13.545  7.150   1.00 53.71  ? 435  ILE A CA  1 
ATOM   3282 C  C   . ILE A 1 436 ? 12.468  12.681  8.394   1.00 57.05  ? 435  ILE A C   1 
ATOM   3283 O  O   . ILE A 1 436 ? 11.886  13.135  9.379   1.00 59.14  ? 435  ILE A O   1 
ATOM   3284 C  CB  . ILE A 1 436 ? 11.302  14.032  6.640   1.00 51.07  ? 435  ILE A CB  1 
ATOM   3285 C  CG1 . ILE A 1 436 ? 10.487  12.859  6.090   1.00 53.83  ? 435  ILE A CG1 1 
ATOM   3286 C  CG2 . ILE A 1 436 ? 11.476  15.113  5.581   1.00 44.09  ? 435  ILE A CG2 1 
ATOM   3287 C  CD1 . ILE A 1 436 ? 9.155   13.267  5.500   1.00 57.25  ? 435  ILE A CD1 1 
ATOM   3288 N  N   . ASN A 1 437 ? 12.946  11.441  8.351   1.00 53.08  ? 436  ASN A N   1 
ATOM   3289 C  CA  . ASN A 1 437 ? 12.847  10.559  9.513   1.00 56.03  ? 436  ASN A CA  1 
ATOM   3290 C  C   . ASN A 1 437 ? 13.662  11.049  10.711  1.00 59.49  ? 436  ASN A C   1 
ATOM   3291 O  O   . ASN A 1 437 ? 13.118  11.204  11.806  1.00 59.81  ? 436  ASN A O   1 
ATOM   3292 C  CB  . ASN A 1 437 ? 13.217  9.115   9.158   1.00 50.00  ? 436  ASN A CB  1 
ATOM   3293 C  CG  . ASN A 1 437 ? 12.063  8.353   8.539   1.00 58.76  ? 436  ASN A CG  1 
ATOM   3294 O  OD1 . ASN A 1 437 ? 11.017  8.927   8.230   1.00 60.09  ? 436  ASN A OD1 1 
ATOM   3295 N  ND2 . ASN A 1 437 ? 12.249  7.051   8.349   1.00 61.04  ? 436  ASN A ND2 1 
ATOM   3296 N  N   . PRO A 1 438 ? 14.969  11.294  10.510  1.00 60.42  ? 437  PRO A N   1 
ATOM   3297 C  CA  . PRO A 1 438 ? 15.784  11.834  11.605  1.00 57.59  ? 437  PRO A CA  1 
ATOM   3298 C  C   . PRO A 1 438 ? 15.243  13.172  12.096  1.00 54.51  ? 437  PRO A C   1 
ATOM   3299 O  O   . PRO A 1 438 ? 15.386  13.492  13.275  1.00 56.81  ? 437  PRO A O   1 
ATOM   3300 C  CB  . PRO A 1 438 ? 17.155  12.035  10.956  1.00 56.76  ? 437  PRO A CB  1 
ATOM   3301 C  CG  . PRO A 1 438 ? 17.178  11.070  9.819   1.00 58.25  ? 437  PRO A CG  1 
ATOM   3302 C  CD  . PRO A 1 438 ? 15.771  11.040  9.300   1.00 52.21  ? 437  PRO A CD  1 
ATOM   3303 N  N   . ALA A 1 439 ? 14.639  13.942  11.197  1.00 51.98  ? 438  ALA A N   1 
ATOM   3304 C  CA  . ALA A 1 439 ? 14.017  15.206  11.571  1.00 53.99  ? 438  ALA A CA  1 
ATOM   3305 C  C   . ALA A 1 439 ? 12.919  14.963  12.601  1.00 57.63  ? 438  ALA A C   1 
ATOM   3306 O  O   . ALA A 1 439 ? 12.823  15.672  13.602  1.00 60.24  ? 438  ALA A O   1 
ATOM   3307 C  CB  . ALA A 1 439 ? 13.452  15.899  10.344  1.00 43.77  ? 438  ALA A CB  1 
ATOM   3308 N  N   . CYS A 1 440 ? 12.099  13.947  12.345  1.00 63.89  ? 439  CYS A N   1 
ATOM   3309 C  CA  . CYS A 1 440 ? 11.003  13.575  13.236  1.00 60.74  ? 439  CYS A CA  1 
ATOM   3310 C  C   . CYS A 1 440 ? 11.500  13.126  14.606  1.00 62.63  ? 439  CYS A C   1 
ATOM   3311 O  O   . CYS A 1 440 ? 10.907  13.467  15.632  1.00 65.09  ? 439  CYS A O   1 
ATOM   3312 C  CB  . CYS A 1 440 ? 10.159  12.461  12.611  1.00 63.89  ? 439  CYS A CB  1 
ATOM   3313 S  SG  . CYS A 1 440 ? 9.267   12.934  11.110  1.00 84.41  ? 439  CYS A SG  1 
ATOM   3314 N  N   . TYR A 1 441 ? 12.580  12.350  14.619  1.00 57.96  ? 440  TYR A N   1 
ATOM   3315 C  CA  . TYR A 1 441 ? 13.142  11.855  15.871  1.00 55.61  ? 440  TYR A CA  1 
ATOM   3316 C  C   . TYR A 1 441 ? 13.549  13.030  16.749  1.00 60.61  ? 440  TYR A C   1 
ATOM   3317 O  O   . TYR A 1 441 ? 13.343  13.016  17.962  1.00 54.81  ? 440  TYR A O   1 
ATOM   3318 C  CB  . TYR A 1 441 ? 14.355  10.958  15.615  1.00 46.21  ? 440  TYR A CB  1 
ATOM   3319 C  CG  . TYR A 1 441 ? 14.099  9.804   14.666  1.00 57.67  ? 440  TYR A CG  1 
ATOM   3320 C  CD1 . TYR A 1 441 ? 12.806  9.420   14.331  1.00 58.01  ? 440  TYR A CD1 1 
ATOM   3321 C  CD2 . TYR A 1 441 ? 15.156  9.098   14.106  1.00 52.20  ? 440  TYR A CD2 1 
ATOM   3322 C  CE1 . TYR A 1 441 ? 12.574  8.366   13.463  1.00 46.16  ? 440  TYR A CE1 1 
ATOM   3323 C  CE2 . TYR A 1 441 ? 14.933  8.043   13.239  1.00 51.94  ? 440  TYR A CE2 1 
ATOM   3324 C  CZ  . TYR A 1 441 ? 13.640  7.681   12.920  1.00 52.61  ? 440  TYR A CZ  1 
ATOM   3325 O  OH  . TYR A 1 441 ? 13.412  6.632   12.055  1.00 55.61  ? 440  TYR A OH  1 
ATOM   3326 N  N   . ALA A 1 442 ? 14.120  14.048  16.115  1.00 62.21  ? 441  ALA A N   1 
ATOM   3327 C  CA  . ALA A 1 442 ? 14.620  15.225  16.813  1.00 52.13  ? 441  ALA A CA  1 
ATOM   3328 C  C   . ALA A 1 442 ? 13.488  16.120  17.307  1.00 57.67  ? 441  ALA A C   1 
ATOM   3329 O  O   . ALA A 1 442 ? 13.601  16.751  18.356  1.00 68.11  ? 441  ALA A O   1 
ATOM   3330 C  CB  . ALA A 1 442 ? 15.560  16.009  15.911  1.00 45.15  ? 441  ALA A CB  1 
ATOM   3331 N  N   . LEU A 1 443 ? 12.397  16.171  16.548  1.00 55.65  ? 442  LEU A N   1 
ATOM   3332 C  CA  . LEU A 1 443 ? 11.264  17.025  16.893  1.00 59.36  ? 442  LEU A CA  1 
ATOM   3333 C  C   . LEU A 1 443 ? 10.327  16.361  17.897  1.00 71.63  ? 442  LEU A C   1 
ATOM   3334 O  O   . LEU A 1 443 ? 9.782   17.021  18.784  1.00 75.50  ? 442  LEU A O   1 
ATOM   3335 C  CB  . LEU A 1 443 ? 10.481  17.418  15.640  1.00 56.64  ? 442  LEU A CB  1 
ATOM   3336 C  CG  . LEU A 1 443 ? 11.219  18.304  14.639  1.00 58.65  ? 442  LEU A CG  1 
ATOM   3337 C  CD1 . LEU A 1 443 ? 10.357  18.546  13.410  1.00 60.21  ? 442  LEU A CD1 1 
ATOM   3338 C  CD2 . LEU A 1 443 ? 11.626  19.618  15.284  1.00 48.38  ? 442  LEU A CD2 1 
ATOM   3339 N  N   . CYS A 1 444 ? 10.142  15.053  17.752  1.00 68.82  ? 443  CYS A N   1 
ATOM   3340 C  CA  . CYS A 1 444 ? 9.230   14.311  18.615  1.00 64.86  ? 443  CYS A CA  1 
ATOM   3341 C  C   . CYS A 1 444 ? 9.944   13.726  19.830  1.00 67.44  ? 443  CYS A C   1 
ATOM   3342 O  O   . CYS A 1 444 ? 9.311   13.174  20.731  1.00 60.97  ? 443  CYS A O   1 
ATOM   3343 C  CB  . CYS A 1 444 ? 8.522   13.210  17.823  1.00 57.17  ? 443  CYS A CB  1 
ATOM   3344 S  SG  . CYS A 1 444 ? 7.496   13.837  16.475  1.00 74.89  ? 443  CYS A SG  1 
ATOM   3345 N  N   . ASN A 1 445 ? 11.267  13.856  19.848  1.00 68.72  ? 444  ASN A N   1 
ATOM   3346 C  CA  . ASN A 1 445 ? 12.070  13.386  20.969  1.00 62.05  ? 444  ASN A CA  1 
ATOM   3347 C  C   . ASN A 1 445 ? 13.218  14.344  21.270  1.00 61.45  ? 444  ASN A C   1 
ATOM   3348 O  O   . ASN A 1 445 ? 14.132  14.508  20.461  1.00 64.70  ? 444  ASN A O   1 
ATOM   3349 C  CB  . ASN A 1 445 ? 12.604  11.980  20.695  1.00 61.29  ? 444  ASN A CB  1 
ATOM   3350 C  CG  . ASN A 1 445 ? 13.282  11.368  21.904  1.00 62.96  ? 444  ASN A CG  1 
ATOM   3351 O  OD1 . ASN A 1 445 ? 14.039  12.035  22.610  1.00 61.02  ? 444  ASN A OD1 1 
ATOM   3352 N  ND2 . ASN A 1 445 ? 13.009  10.090  22.153  1.00 63.32  ? 444  ASN A ND2 1 
ATOM   3353 N  N   . ALA A 1 446 ? 13.162  14.975  22.438  1.00 56.53  ? 445  ALA A N   1 
ATOM   3354 C  CA  . ALA A 1 446 ? 14.147  15.984  22.812  1.00 54.69  ? 445  ALA A CA  1 
ATOM   3355 C  C   . ALA A 1 446 ? 15.534  15.393  23.055  1.00 58.54  ? 445  ALA A C   1 
ATOM   3356 O  O   . ALA A 1 446 ? 16.542  16.089  22.924  1.00 56.92  ? 445  ALA A O   1 
ATOM   3357 C  CB  . ALA A 1 446 ? 13.676  16.755  24.035  1.00 45.05  ? 445  ALA A CB  1 
ATOM   3358 N  N   . THR A 1 447 ? 15.585  14.113  23.410  1.00 59.64  ? 446  THR A N   1 
ATOM   3359 C  CA  . THR A 1 447 ? 16.859  13.463  23.700  1.00 58.11  ? 446  THR A CA  1 
ATOM   3360 C  C   . THR A 1 447 ? 17.678  13.253  22.428  1.00 51.32  ? 446  THR A C   1 
ATOM   3361 O  O   . THR A 1 447 ? 18.894  13.448  22.425  1.00 46.85  ? 446  THR A O   1 
ATOM   3362 C  CB  . THR A 1 447 ? 16.667  12.118  24.428  1.00 56.21  ? 446  THR A CB  1 
ATOM   3363 O  OG1 . THR A 1 447 ? 15.828  12.307  25.574  1.00 55.06  ? 446  THR A OG1 1 
ATOM   3364 C  CG2 . THR A 1 447 ? 18.010  11.561  24.877  1.00 59.61  ? 446  THR A CG2 1 
ATOM   3365 N  N   . PHE A 1 448 ? 17.005  12.856  21.351  1.00 54.52  ? 447  PHE A N   1 
ATOM   3366 C  CA  . PHE A 1 448 ? 17.657  12.692  20.054  1.00 54.74  ? 447  PHE A CA  1 
ATOM   3367 C  C   . PHE A 1 448 ? 18.219  14.019  19.555  1.00 51.98  ? 447  PHE A C   1 
ATOM   3368 O  O   . PHE A 1 448 ? 19.377  14.095  19.142  1.00 49.14  ? 447  PHE A O   1 
ATOM   3369 C  CB  . PHE A 1 448 ? 16.680  12.115  19.026  1.00 54.49  ? 447  PHE A CB  1 
ATOM   3370 C  CG  . PHE A 1 448 ? 16.774  10.623  18.868  1.00 52.02  ? 447  PHE A CG  1 
ATOM   3371 C  CD1 . PHE A 1 448 ? 18.008  9.995   18.806  1.00 46.73  ? 447  PHE A CD1 1 
ATOM   3372 C  CD2 . PHE A 1 448 ? 15.628  9.848   18.784  1.00 47.93  ? 447  PHE A CD2 1 
ATOM   3373 C  CE1 . PHE A 1 448 ? 18.095  8.623   18.661  1.00 42.05  ? 447  PHE A CE1 1 
ATOM   3374 C  CE2 . PHE A 1 448 ? 15.710  8.477   18.639  1.00 38.25  ? 447  PHE A CE2 1 
ATOM   3375 C  CZ  . PHE A 1 448 ? 16.944  7.864   18.579  1.00 35.91  ? 447  PHE A CZ  1 
ATOM   3376 N  N   . LYS A 1 449 ? 17.394  15.061  19.595  1.00 50.84  ? 448  LYS A N   1 
ATOM   3377 C  CA  . LYS A 1 449 ? 17.828  16.395  19.192  1.00 56.94  ? 448  LYS A CA  1 
ATOM   3378 C  C   . LYS A 1 449 ? 19.056  16.824  19.989  1.00 61.10  ? 448  LYS A C   1 
ATOM   3379 O  O   . LYS A 1 449 ? 20.077  17.204  19.416  1.00 63.05  ? 448  LYS A O   1 
ATOM   3380 C  CB  . LYS A 1 449 ? 16.696  17.411  19.367  1.00 53.23  ? 448  LYS A CB  1 
ATOM   3381 C  CG  . LYS A 1 449 ? 17.137  18.861  19.210  1.00 47.27  ? 448  LYS A CG  1 
ATOM   3382 C  CD  . LYS A 1 449 ? 15.969  19.823  19.381  1.00 53.57  ? 448  LYS A CD  1 
ATOM   3383 C  CE  . LYS A 1 449 ? 15.449  20.318  18.039  1.00 63.76  ? 448  LYS A CE  1 
ATOM   3384 N  NZ  . LYS A 1 449 ? 16.412  21.240  17.367  1.00 55.58  ? 448  LYS A NZ  1 
ATOM   3385 N  N   . LYS A 1 450 ? 18.947  16.761  21.313  1.00 61.20  ? 449  LYS A N   1 
ATOM   3386 C  CA  . LYS A 1 450 ? 20.065  17.063  22.201  1.00 52.55  ? 449  LYS A CA  1 
ATOM   3387 C  C   . LYS A 1 450 ? 21.319  16.305  21.786  1.00 55.17  ? 449  LYS A C   1 
ATOM   3388 O  O   . LYS A 1 450 ? 22.383  16.897  21.597  1.00 61.69  ? 449  LYS A O   1 
ATOM   3389 C  CB  . LYS A 1 450 ? 19.705  16.708  23.645  1.00 61.14  ? 449  LYS A CB  1 
ATOM   3390 C  CG  . LYS A 1 450 ? 20.906  16.390  24.530  1.00 70.63  ? 449  LYS A CG  1 
ATOM   3391 C  CD  . LYS A 1 450 ? 20.473  15.650  25.790  1.00 67.96  ? 449  LYS A CD  1 
ATOM   3392 C  CE  . LYS A 1 450 ? 21.665  15.046  26.517  1.00 79.00  ? 449  LYS A CE  1 
ATOM   3393 N  NZ  . LYS A 1 450 ? 21.242  14.117  27.605  1.00 81.64  ? 449  LYS A NZ  1 
ATOM   3394 N  N   . THR A 1 451 ? 21.184  14.991  21.650  1.00 56.10  ? 450  THR A N   1 
ATOM   3395 C  CA  . THR A 1 451 ? 22.309  14.138  21.295  1.00 60.30  ? 450  THR A CA  1 
ATOM   3396 C  C   . THR A 1 451 ? 22.951  14.589  19.987  1.00 62.28  ? 450  THR A C   1 
ATOM   3397 O  O   . THR A 1 451 ? 24.174  14.699  19.897  1.00 67.03  ? 450  THR A O   1 
ATOM   3398 C  CB  . THR A 1 451 ? 21.887  12.660  21.191  1.00 56.59  ? 450  THR A CB  1 
ATOM   3399 O  OG1 . THR A 1 451 ? 21.138  12.293  22.358  1.00 52.70  ? 450  THR A OG1 1 
ATOM   3400 C  CG2 . THR A 1 451 ? 23.110  11.765  21.069  1.00 53.38  ? 450  THR A CG2 1 
ATOM   3401 N  N   . PHE A 1 452 ? 22.125  14.854  18.979  1.00 59.36  ? 451  PHE A N   1 
ATOM   3402 C  CA  . PHE A 1 452 ? 22.620  15.370  17.707  1.00 61.75  ? 451  PHE A CA  1 
ATOM   3403 C  C   . PHE A 1 452 ? 23.444  16.630  17.944  1.00 65.62  ? 451  PHE A C   1 
ATOM   3404 O  O   . PHE A 1 452 ? 24.593  16.727  17.513  1.00 65.63  ? 451  PHE A O   1 
ATOM   3405 C  CB  . PHE A 1 452 ? 21.458  15.688  16.761  1.00 62.04  ? 451  PHE A CB  1 
ATOM   3406 C  CG  . PHE A 1 452 ? 20.650  14.486  16.357  1.00 61.30  ? 451  PHE A CG  1 
ATOM   3407 C  CD1 . PHE A 1 452 ? 21.208  13.218  16.370  1.00 60.26  ? 451  PHE A CD1 1 
ATOM   3408 C  CD2 . PHE A 1 452 ? 19.329  14.628  15.959  1.00 50.38  ? 451  PHE A CD2 1 
ATOM   3409 C  CE1 . PHE A 1 452 ? 20.462  12.113  15.996  1.00 55.77  ? 451  PHE A CE1 1 
ATOM   3410 C  CE2 . PHE A 1 452 ? 18.579  13.527  15.586  1.00 44.88  ? 451  PHE A CE2 1 
ATOM   3411 C  CZ  . PHE A 1 452 ? 19.145  12.269  15.605  1.00 48.62  ? 451  PHE A CZ  1 
ATOM   3412 N  N   . LYS A 1 453 ? 22.838  17.589  18.638  1.00 67.69  ? 452  LYS A N   1 
ATOM   3413 C  CA  . LYS A 1 453 ? 23.482  18.857  18.963  1.00 72.20  ? 452  LYS A CA  1 
ATOM   3414 C  C   . LYS A 1 453 ? 24.881  18.661  19.539  1.00 77.91  ? 452  LYS A C   1 
ATOM   3415 O  O   . LYS A 1 453 ? 25.830  19.331  19.130  1.00 84.37  ? 452  LYS A O   1 
ATOM   3416 C  CB  . LYS A 1 453 ? 22.616  19.644  19.949  1.00 75.24  ? 452  LYS A CB  1 
ATOM   3417 C  CG  . LYS A 1 453 ? 23.270  20.896  20.504  1.00 83.63  ? 452  LYS A CG  1 
ATOM   3418 C  CD  . LYS A 1 453 ? 22.389  21.543  21.563  1.00 94.57  ? 452  LYS A CD  1 
ATOM   3419 C  CE  . LYS A 1 453 ? 23.055  22.765  22.173  1.00 107.37 ? 452  LYS A CE  1 
ATOM   3420 N  NZ  . LYS A 1 453 ? 22.207  23.383  23.231  1.00 94.22  ? 452  LYS A NZ  1 
ATOM   3421 N  N   . HIS A 1 454 ? 25.003  17.741  20.492  1.00 72.83  ? 453  HIS A N   1 
ATOM   3422 C  CA  . HIS A 1 454 ? 26.287  17.464  21.126  1.00 79.10  ? 453  HIS A CA  1 
ATOM   3423 C  C   . HIS A 1 454 ? 27.202  16.631  20.228  1.00 80.12  ? 453  HIS A C   1 
ATOM   3424 O  O   . HIS A 1 454 ? 28.425  16.654  20.383  1.00 81.25  ? 453  HIS A O   1 
ATOM   3425 C  CB  . HIS A 1 454 ? 26.084  16.762  22.473  1.00 74.62  ? 453  HIS A CB  1 
ATOM   3426 C  CG  . HIS A 1 454 ? 25.372  17.598  23.492  1.00 81.35  ? 453  HIS A CG  1 
ATOM   3427 N  ND1 . HIS A 1 454 ? 24.003  17.759  23.496  1.00 85.35  ? 453  HIS A ND1 1 
ATOM   3428 C  CD2 . HIS A 1 454 ? 25.839  18.320  24.537  1.00 80.79  ? 453  HIS A CD2 1 
ATOM   3429 C  CE1 . HIS A 1 454 ? 23.657  18.544  24.502  1.00 83.37  ? 453  HIS A CE1 1 
ATOM   3430 N  NE2 . HIS A 1 454 ? 24.753  18.898  25.149  1.00 81.37  ? 453  HIS A NE2 1 
ATOM   3431 N  N   . LEU A 1 455 ? 26.608  15.899  19.289  1.00 70.86  ? 454  LEU A N   1 
ATOM   3432 C  CA  . LEU A 1 455 ? 27.379  15.055  18.381  1.00 70.19  ? 454  LEU A CA  1 
ATOM   3433 C  C   . LEU A 1 455 ? 28.082  15.866  17.298  1.00 78.16  ? 454  LEU A C   1 
ATOM   3434 O  O   . LEU A 1 455 ? 29.133  15.466  16.795  1.00 76.81  ? 454  LEU A O   1 
ATOM   3435 C  CB  . LEU A 1 455 ? 26.494  13.982  17.746  1.00 67.39  ? 454  LEU A CB  1 
ATOM   3436 C  CG  . LEU A 1 455 ? 26.370  12.675  18.528  1.00 65.47  ? 454  LEU A CG  1 
ATOM   3437 C  CD1 . LEU A 1 455 ? 25.426  11.720  17.821  1.00 63.55  ? 454  LEU A CD1 1 
ATOM   3438 C  CD2 . LEU A 1 455 ? 27.737  12.032  18.720  1.00 48.52  ? 454  LEU A CD2 1 
ATOM   3439 N  N   . LEU A 1 456 ? 27.499  17.004  16.938  1.00 81.41  ? 455  LEU A N   1 
ATOM   3440 C  CA  . LEU A 1 456 ? 28.103  17.882  15.945  1.00 75.65  ? 455  LEU A CA  1 
ATOM   3441 C  C   . LEU A 1 456 ? 29.386  18.490  16.499  1.00 83.88  ? 455  LEU A C   1 
ATOM   3442 O  O   . LEU A 1 456 ? 30.266  18.907  15.745  1.00 89.87  ? 455  LEU A O   1 
ATOM   3443 C  CB  . LEU A 1 456 ? 27.126  18.980  15.527  1.00 77.10  ? 455  LEU A CB  1 
ATOM   3444 C  CG  . LEU A 1 456 ? 25.790  18.497  14.959  1.00 77.64  ? 455  LEU A CG  1 
ATOM   3445 C  CD1 . LEU A 1 456 ? 24.943  19.676  14.507  1.00 86.42  ? 455  LEU A CD1 1 
ATOM   3446 C  CD2 . LEU A 1 456 ? 26.008  17.516  13.815  1.00 57.49  ? 455  LEU A CD2 1 
ATOM   3447 N  N   . MET A 1 457 ? 29.481  18.530  17.825  1.00 91.31  ? 456  MET A N   1 
ATOM   3448 C  CA  . MET A 1 457 ? 30.672  19.024  18.505  1.00 88.77  ? 456  MET A CA  1 
ATOM   3449 C  C   . MET A 1 457 ? 31.393  17.886  19.222  1.00 83.33  ? 456  MET A C   1 
ATOM   3450 O  O   . MET A 1 457 ? 32.354  17.320  18.700  1.00 84.41  ? 456  MET A O   1 
ATOM   3451 C  CB  . MET A 1 457 ? 30.300  20.119  19.506  1.00 64.28  ? 456  MET A CB  1 
HETATM 3452 C  C1  . QNB B 2 .   ? 6.159   -0.164  -3.375  1.00 46.84  ? 1162 QNB A C1  1 
HETATM 3453 C  C2  . QNB B 2 .   ? 6.982   -1.060  -2.494  1.00 45.55  ? 1162 QNB A C2  1 
HETATM 3454 C  C3  . QNB B 2 .   ? 8.054   -1.773  -3.017  1.00 45.78  ? 1162 QNB A C3  1 
HETATM 3455 C  C4  . QNB B 2 .   ? 8.803   -2.606  -2.190  1.00 51.41  ? 1162 QNB A C4  1 
HETATM 3456 C  C5  . QNB B 2 .   ? 8.475   -2.735  -0.844  1.00 40.65  ? 1162 QNB A C5  1 
HETATM 3457 C  C6  . QNB B 2 .   ? 7.398   -2.028  -0.324  1.00 40.35  ? 1162 QNB A C6  1 
HETATM 3458 C  C7  . QNB B 2 .   ? 6.650   -1.195  -1.150  1.00 41.80  ? 1162 QNB A C7  1 
HETATM 3459 C  C8  . QNB B 2 .   ? 5.926   -0.813  -4.710  1.00 47.65  ? 1162 QNB A C8  1 
HETATM 3460 C  C9  . QNB B 2 .   ? 5.485   -2.132  -4.769  1.00 51.51  ? 1162 QNB A C9  1 
HETATM 3461 C  C10 . QNB B 2 .   ? 5.259   -2.739  -5.999  1.00 51.65  ? 1162 QNB A C10 1 
HETATM 3462 C  C11 . QNB B 2 .   ? 5.463   -2.026  -7.176  1.00 46.41  ? 1162 QNB A C11 1 
HETATM 3463 C  C12 . QNB B 2 .   ? 5.894   -0.706  -7.122  1.00 38.49  ? 1162 QNB A C12 1 
HETATM 3464 C  C13 . QNB B 2 .   ? 6.120   -0.102  -5.891  1.00 45.16  ? 1162 QNB A C13 1 
HETATM 3465 C  C14 . QNB B 2 .   ? 6.828   1.186   -3.514  1.00 47.20  ? 1162 QNB A C14 1 
HETATM 3466 O  O15 . QNB B 2 .   ? 4.887   0.028   -2.746  1.00 47.98  ? 1162 QNB A O15 1 
HETATM 3467 O  O16 . QNB B 2 .   ? 6.466   2.128   -2.827  1.00 48.46  ? 1162 QNB A O16 1 
HETATM 3468 O  O17 . QNB B 2 .   ? 7.905   1.402   -4.468  1.00 47.27  ? 1162 QNB A O17 1 
HETATM 3469 C  C18 . QNB B 2 .   ? 8.723   2.519   -4.128  1.00 45.49  ? 1162 QNB A C18 1 
HETATM 3470 C  C19 . QNB B 2 .   ? 9.793   2.093   -3.129  1.00 44.99  ? 1162 QNB A C19 1 
HETATM 3471 N  N20 . QNB B 2 .   ? 11.120  2.428   -3.684  1.00 49.90  ? 1162 QNB A N20 1 
HETATM 3472 C  C21 . QNB B 2 .   ? 11.412  1.702   -4.938  1.00 39.27  ? 1162 QNB A C21 1 
HETATM 3473 C  C22 . QNB B 2 .   ? 10.291  1.938   -5.939  1.00 43.85  ? 1162 QNB A C22 1 
HETATM 3474 C  C23 . QNB B 2 .   ? 9.401   3.034   -5.387  1.00 45.38  ? 1162 QNB A C23 1 
HETATM 3475 C  C24 . QNB B 2 .   ? 10.291  4.229   -5.073  1.00 45.07  ? 1162 QNB A C24 1 
HETATM 3476 C  C25 . QNB B 2 .   ? 11.192  3.886   -3.891  1.00 52.69  ? 1162 QNB A C25 1 
HETATM 3477 C  C2  . BGC C 3 .   ? 9.339   -5.223  43.914  1.00 76.15  ? 1163 BGC A C2  1 
HETATM 3478 C  C3  . BGC C 3 .   ? 8.346   -4.268  44.557  1.00 74.09  ? 1163 BGC A C3  1 
HETATM 3479 C  C4  . BGC C 3 .   ? 6.980   -4.475  43.931  1.00 70.16  ? 1163 BGC A C4  1 
HETATM 3480 C  C5  . BGC C 3 .   ? 6.544   -5.923  44.102  1.00 80.14  ? 1163 BGC A C5  1 
HETATM 3481 C  C6  . BGC C 3 .   ? 5.205   -6.153  43.413  1.00 66.71  ? 1163 BGC A C6  1 
HETATM 3482 C  C1  . BGC C 3 .   ? 8.854   -6.671  43.976  1.00 81.32  ? 1163 BGC A C1  1 
HETATM 3483 O  O1  . BGC C 3 .   ? 9.697   -7.491  43.154  1.00 87.10  ? 1163 BGC A O1  1 
HETATM 3484 O  O2  . BGC C 3 .   ? 10.598  -5.119  44.590  1.00 74.64  ? 1163 BGC A O2  1 
HETATM 3485 O  O3  . BGC C 3 .   ? 8.766   -2.917  44.342  1.00 75.38  ? 1163 BGC A O3  1 
HETATM 3486 O  O4  . BGC C 3 .   ? 6.032   -3.608  44.564  1.00 64.90  ? 1163 BGC A O4  1 
HETATM 3487 O  O5  . BGC C 3 .   ? 7.498   -6.827  43.539  1.00 77.48  ? 1163 BGC A O5  1 
HETATM 3488 O  O6  . BGC C 3 .   ? 4.807   -7.512  43.633  1.00 70.99  ? 1163 BGC A O6  1 
HETATM 3489 CL CL  . CL  D 4 .   ? 8.595   9.954   27.821  1.00 51.38  ? 1164 CL  A CL  1 
HETATM 3490 CL CL  . CL  E 4 .   ? 16.997  -7.124  27.636  1.00 50.14  ? 1165 CL  A CL  1 
HETATM 3491 O  O   . HOH F 5 .   ? -7.794  -13.466 32.465  1.00 19.11  ? 1166 HOH A O   1 
HETATM 3492 O  O   . HOH F 5 .   ? -20.190 1.216   41.498  1.00 29.73  ? 1167 HOH A O   1 
HETATM 3493 O  O   . HOH F 5 .   ? 19.193  12.870  29.048  1.00 47.81  ? 1168 HOH A O   1 
HETATM 3494 O  O   . HOH F 5 .   ? -7.517  -15.951 35.600  1.00 29.98  ? 1169 HOH A O   1 
HETATM 3495 O  O   . HOH F 5 .   ? -10.831 5.809   58.387  1.00 46.98  ? 1170 HOH A O   1 
HETATM 3496 O  O   . HOH F 5 .   ? -8.126  -19.818 47.146  1.00 41.25  ? 1171 HOH A O   1 
HETATM 3497 O  O   . HOH F 5 .   ? 11.000  -2.809  27.069  1.00 41.73  ? 1172 HOH A O   1 
HETATM 3498 O  O   . HOH F 5 .   ? 9.233   -10.704 36.721  1.00 43.88  ? 1173 HOH A O   1 
HETATM 3499 O  O   . HOH F 5 .   ? 4.215   1.757   29.884  1.00 43.40  ? 1174 HOH A O   1 
HETATM 3500 O  O   . HOH F 5 .   ? -10.503 -8.074  55.931  1.00 39.22  ? 1175 HOH A O   1 
HETATM 3501 O  O   . HOH F 5 .   ? 11.215  -7.101  40.568  1.00 60.65  ? 1176 HOH A O   1 
HETATM 3502 O  O   . HOH F 5 .   ? 6.753   -12.826 42.775  1.00 42.19  ? 1177 HOH A O   1 
HETATM 3503 O  O   . HOH F 5 .   ? 14.129  10.491  50.367  1.00 58.19  ? 1178 HOH A O   1 
HETATM 3504 O  O   . HOH F 5 .   ? 6.039   7.649   28.873  1.00 44.55  ? 1179 HOH A O   1 
HETATM 3505 O  O   . HOH F 5 .   ? 8.152   9.380   45.194  1.00 54.72  ? 1180 HOH A O   1 
HETATM 3506 O  O   . HOH F 5 .   ? 24.856  -0.914  26.696  1.00 32.08  ? 1181 HOH A O   1 
HETATM 3507 O  O   . HOH F 5 .   ? 26.371  -1.366  56.686  1.00 67.87  ? 1182 HOH A O   1 
HETATM 3508 O  O   . HOH F 5 .   ? 7.306   7.866   49.537  1.00 65.96  ? 1183 HOH A O   1 
HETATM 3509 O  O   . HOH F 5 .   ? -11.246 -13.705 49.978  1.00 55.61  ? 1184 HOH A O   1 
HETATM 3510 O  O   . HOH F 5 .   ? -16.049 4.168   56.238  1.00 52.32  ? 1185 HOH A O   1 
HETATM 3511 O  O   . HOH F 5 .   ? 7.946   -1.814  28.186  1.00 39.74  ? 1186 HOH A O   1 
HETATM 3512 O  O   . HOH F 5 .   ? 23.208  12.239  28.654  1.00 51.89  ? 1187 HOH A O   1 
HETATM 3513 O  O   . HOH F 5 .   ? 3.218   -0.878  31.885  1.00 37.26  ? 1188 HOH A O   1 
HETATM 3514 O  O   . HOH F 5 .   ? -1.680  -4.441  -18.390 1.00 35.62  ? 1189 HOH A O   1 
HETATM 3515 O  O   . HOH F 5 .   ? 26.818  -7.417  -20.383 1.00 41.45  ? 1190 HOH A O   1 
HETATM 3516 O  O   . HOH F 5 .   ? -0.767  18.940  34.009  1.00 43.29  ? 1191 HOH A O   1 
HETATM 3517 O  O   . HOH F 5 .   ? 27.313  12.777  28.657  1.00 49.94  ? 1192 HOH A O   1 
HETATM 3518 O  O   . HOH F 5 .   ? -24.456 -0.136  41.650  1.00 60.47  ? 1193 HOH A O   1 
HETATM 3519 O  O   . HOH F 5 .   ? 13.434  6.316   -14.542 1.00 50.43  ? 1194 HOH A O   1 
HETATM 3520 O  O   . HOH F 5 .   ? -2.131  16.011  45.954  1.00 35.95  ? 1195 HOH A O   1 
HETATM 3521 O  O   . HOH F 5 .   ? 17.597  12.707  48.574  1.00 36.61  ? 1196 HOH A O   1 
HETATM 3522 O  O   . HOH F 5 .   ? 21.722  12.281  -5.345  1.00 30.75  ? 1197 HOH A O   1 
HETATM 3523 O  O   . HOH F 5 .   ? 12.611  3.363   -0.860  1.00 46.68  ? 1198 HOH A O   1 
HETATM 3524 O  O   . HOH F 5 .   ? 9.452   5.176   6.694   1.00 40.29  ? 1199 HOH A O   1 
HETATM 3525 O  O   . HOH F 5 .   ? 17.424  -7.862  33.178  1.00 58.71  ? 1200 HOH A O   1 
HETATM 3526 O  O   . HOH F 5 .   ? -1.240  3.824   54.607  1.00 58.25  ? 1201 HOH A O   1 
HETATM 3527 O  O   . HOH F 5 .   ? -1.401  10.427  49.964  1.00 38.70  ? 1202 HOH A O   1 
HETATM 3528 O  O   . HOH F 5 .   ? -11.015 -2.443  54.862  1.00 41.11  ? 1203 HOH A O   1 
HETATM 3529 O  O   . HOH F 5 .   ? 13.812  1.591   -7.753  1.00 51.29  ? 1204 HOH A O   1 
HETATM 3530 O  O   . HOH F 5 .   ? 2.591   6.101   -16.257 1.00 46.01  ? 1205 HOH A O   1 
HETATM 3531 O  O   . HOH F 5 .   ? 12.130  2.445   -17.482 1.00 25.33  ? 1206 HOH A O   1 
HETATM 3532 O  O   . HOH F 5 .   ? 9.645   6.323   -14.792 1.00 46.68  ? 1207 HOH A O   1 
HETATM 3533 O  O   . HOH F 5 .   ? 7.872   3.449   -13.608 1.00 32.41  ? 1208 HOH A O   1 
HETATM 3534 O  O   . HOH F 5 .   ? 10.178  -0.644  -12.343 1.00 35.25  ? 1209 HOH A O   1 
HETATM 3535 O  O   . HOH F 5 .   ? 0.054   -1.707  63.830  1.00 48.44  ? 1210 HOH A O   1 
HETATM 3536 O  O   . HOH F 5 .   ? -1.591  12.251  45.290  1.00 29.61  ? 1211 HOH A O   1 
HETATM 3537 O  O   . HOH F 5 .   ? -1.358  14.136  42.328  1.00 38.79  ? 1212 HOH A O   1 
HETATM 3538 O  O   . HOH F 5 .   ? 2.367   15.510  33.561  1.00 46.33  ? 1213 HOH A O   1 
HETATM 3539 O  O   . HOH F 5 .   ? 5.543   11.442  38.813  1.00 33.73  ? 1214 HOH A O   1 
HETATM 3540 O  O   . HOH F 5 .   ? 8.601   2.804   26.283  1.00 36.95  ? 1215 HOH A O   1 
HETATM 3541 O  O   . HOH F 5 .   ? -15.135 7.333   56.254  1.00 29.93  ? 1216 HOH A O   1 
HETATM 3542 O  O   . HOH F 5 .   ? 11.663  14.783  -15.368 1.00 32.16  ? 1217 HOH A O   1 
HETATM 3543 O  O   . HOH F 5 .   ? 8.691   7.832   7.664   1.00 40.07  ? 1218 HOH A O   1 
HETATM 3544 O  O   . HOH F 5 .   ? 24.604  0.693   -18.552 1.00 45.39  ? 1219 HOH A O   1 
HETATM 3545 O  O   . HOH F 5 .   ? 5.798   0.702   -13.833 1.00 28.70  ? 1220 HOH A O   1 
HETATM 3546 O  O   . HOH F 5 .   ? 12.338  6.025   1.324   1.00 42.23  ? 1221 HOH A O   1 
HETATM 3547 O  O   . HOH F 5 .   ? 8.166   1.292   19.231  1.00 40.13  ? 1222 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1    ?    ?   ?   A . n 
A 1 2   ASP 2   2    ?    ?   ?   A . n 
A 1 3   ASP 3   3    ?    ?   ?   A . n 
A 1 4   SER 4   4    ?    ?   ?   A . n 
A 1 5   THR 5   5    ?    ?   ?   A . n 
A 1 6   ASP 6   6    ?    ?   ?   A . n 
A 1 7   SER 7   7    ?    ?   ?   A . n 
A 1 8   SER 8   8    ?    ?   ?   A . n 
A 1 9   ASP 9   9    ?    ?   ?   A . n 
A 1 10  ASN 10  10   ?    ?   ?   A . n 
A 1 11  SER 11  11   ?    ?   ?   A . n 
A 1 12  LEU 12  12   ?    ?   ?   A . n 
A 1 13  ALA 13  13   ?    ?   ?   A . n 
A 1 14  LEU 14  14   ?    ?   ?   A . n 
A 1 15  THR 15  15   ?    ?   ?   A . n 
A 1 16  SER 16  16   ?    ?   ?   A . n 
A 1 17  PRO 17  17   ?    ?   ?   A . n 
A 1 18  TYR 18  18   ?    ?   ?   A . n 
A 1 19  LYS 19  19   ?    ?   ?   A . n 
A 1 20  THR 20  20   20   THR THR A . n 
A 1 21  PHE 21  21   21   PHE PHE A . n 
A 1 22  GLU 22  22   22   GLU GLU A . n 
A 1 23  VAL 23  23   23   VAL VAL A . n 
A 1 24  VAL 24  24   24   VAL VAL A . n 
A 1 25  PHE 25  25   25   PHE PHE A . n 
A 1 26  ILE 26  26   26   ILE ILE A . n 
A 1 27  VAL 27  27   27   VAL VAL A . n 
A 1 28  LEU 28  28   28   LEU LEU A . n 
A 1 29  VAL 29  29   29   VAL VAL A . n 
A 1 30  ALA 30  30   30   ALA ALA A . n 
A 1 31  GLY 31  31   31   GLY GLY A . n 
A 1 32  SER 32  32   32   SER SER A . n 
A 1 33  LEU 33  33   33   LEU LEU A . n 
A 1 34  SER 34  34   34   SER SER A . n 
A 1 35  LEU 35  35   35   LEU LEU A . n 
A 1 36  VAL 36  36   36   VAL VAL A . n 
A 1 37  THR 37  37   37   THR THR A . n 
A 1 38  ILE 38  38   38   ILE ILE A . n 
A 1 39  ILE 39  39   39   ILE ILE A . n 
A 1 40  GLY 40  40   40   GLY GLY A . n 
A 1 41  ASN 41  41   41   ASN ASN A . n 
A 1 42  ILE 42  42   42   ILE ILE A . n 
A 1 43  LEU 43  43   43   LEU LEU A . n 
A 1 44  VAL 44  44   44   VAL VAL A . n 
A 1 45  MET 45  45   45   MET MET A . n 
A 1 46  VAL 46  46   46   VAL VAL A . n 
A 1 47  SER 47  47   47   SER SER A . n 
A 1 48  ILE 48  48   48   ILE ILE A . n 
A 1 49  LYS 49  49   49   LYS LYS A . n 
A 1 50  VAL 50  50   50   VAL VAL A . n 
A 1 51  ASN 51  51   51   ASN ASN A . n 
A 1 52  ARG 52  52   52   ARG ARG A . n 
A 1 53  HIS 53  53   53   HIS HIS A . n 
A 1 54  LEU 54  54   54   LEU LEU A . n 
A 1 55  GLN 55  55   55   GLN GLN A . n 
A 1 56  THR 56  56   56   THR THR A . n 
A 1 57  VAL 57  57   57   VAL VAL A . n 
A 1 58  ASN 58  58   58   ASN ASN A . n 
A 1 59  ASN 59  59   59   ASN ASN A . n 
A 1 60  TYR 60  60   60   TYR TYR A . n 
A 1 61  PHE 61  61   61   PHE PHE A . n 
A 1 62  LEU 62  62   62   LEU LEU A . n 
A 1 63  PHE 63  63   63   PHE PHE A . n 
A 1 64  SER 64  64   64   SER SER A . n 
A 1 65  LEU 65  65   65   LEU LEU A . n 
A 1 66  ALA 66  66   66   ALA ALA A . n 
A 1 67  CYS 67  67   67   CYS CYS A . n 
A 1 68  ALA 68  68   68   ALA ALA A . n 
A 1 69  ASP 69  69   69   ASP ASP A . n 
A 1 70  LEU 70  70   70   LEU LEU A . n 
A 1 71  ILE 71  71   71   ILE ILE A . n 
A 1 72  ILE 72  72   72   ILE ILE A . n 
A 1 73  GLY 73  73   73   GLY GLY A . n 
A 1 74  VAL 74  74   74   VAL VAL A . n 
A 1 75  PHE 75  75   75   PHE PHE A . n 
A 1 76  SER 76  76   76   SER SER A . n 
A 1 77  MET 77  77   77   MET MET A . n 
A 1 78  ASN 78  78   78   ASN ASN A . n 
A 1 79  LEU 79  79   79   LEU LEU A . n 
A 1 80  TYR 80  80   80   TYR TYR A . n 
A 1 81  THR 81  81   81   THR THR A . n 
A 1 82  LEU 82  82   82   LEU LEU A . n 
A 1 83  TYR 83  83   83   TYR TYR A . n 
A 1 84  THR 84  84   84   THR THR A . n 
A 1 85  VAL 85  85   85   VAL VAL A . n 
A 1 86  ILE 86  86   86   ILE ILE A . n 
A 1 87  GLY 87  87   87   GLY GLY A . n 
A 1 88  TYR 88  88   88   TYR TYR A . n 
A 1 89  TRP 89  89   89   TRP TRP A . n 
A 1 90  PRO 90  90   90   PRO PRO A . n 
A 1 91  LEU 91  91   91   LEU LEU A . n 
A 1 92  GLY 92  92   92   GLY GLY A . n 
A 1 93  PRO 93  93   93   PRO PRO A . n 
A 1 94  VAL 94  94   94   VAL VAL A . n 
A 1 95  VAL 95  95   95   VAL VAL A . n 
A 1 96  CYS 96  96   96   CYS CYS A . n 
A 1 97  ASP 97  97   97   ASP ASP A . n 
A 1 98  LEU 98  98   98   LEU LEU A . n 
A 1 99  TRP 99  99   99   TRP TRP A . n 
A 1 100 LEU 100 100  100  LEU LEU A . n 
A 1 101 ALA 101 101  101  ALA ALA A . n 
A 1 102 LEU 102 102  102  LEU LEU A . n 
A 1 103 ASP 103 103  103  ASP ASP A . n 
A 1 104 TYR 104 104  104  TYR TYR A . n 
A 1 105 VAL 105 105  105  VAL VAL A . n 
A 1 106 VAL 106 106  106  VAL VAL A . n 
A 1 107 SER 107 107  107  SER SER A . n 
A 1 108 ASN 108 108  108  ASN ASN A . n 
A 1 109 ALA 109 109  109  ALA ALA A . n 
A 1 110 SER 110 110  110  SER SER A . n 
A 1 111 VAL 111 111  111  VAL VAL A . n 
A 1 112 MET 112 112  112  MET MET A . n 
A 1 113 ASN 113 113  113  ASN ASN A . n 
A 1 114 LEU 114 114  114  LEU LEU A . n 
A 1 115 LEU 115 115  115  LEU LEU A . n 
A 1 116 ILE 116 116  116  ILE ILE A . n 
A 1 117 ILE 117 117  117  ILE ILE A . n 
A 1 118 SER 118 118  118  SER SER A . n 
A 1 119 PHE 119 119  119  PHE PHE A . n 
A 1 120 ASP 120 120  120  ASP ASP A . n 
A 1 121 ARG 121 121  121  ARG ARG A . n 
A 1 122 TYR 122 122  122  TYR TYR A . n 
A 1 123 PHE 123 123  123  PHE PHE A . n 
A 1 124 CYS 124 124  124  CYS CYS A . n 
A 1 125 VAL 125 125  125  VAL VAL A . n 
A 1 126 THR 126 126  126  THR THR A . n 
A 1 127 LYS 127 127  127  LYS LYS A . n 
A 1 128 PRO 128 128  128  PRO PRO A . n 
A 1 129 LEU 129 129  129  LEU LEU A . n 
A 1 130 THR 130 130  130  THR THR A . n 
A 1 131 TYR 131 131  131  TYR TYR A . n 
A 1 132 PRO 132 132  132  PRO PRO A . n 
A 1 133 VAL 133 133  133  VAL VAL A . n 
A 1 134 LYS 134 134  134  LYS LYS A . n 
A 1 135 ARG 135 135  135  ARG ARG A . n 
A 1 136 THR 136 136  136  THR THR A . n 
A 1 137 THR 137 137  137  THR THR A . n 
A 1 138 LYS 138 138  138  LYS LYS A . n 
A 1 139 MET 139 139  139  MET MET A . n 
A 1 140 ALA 140 140  140  ALA ALA A . n 
A 1 141 GLY 141 141  141  GLY GLY A . n 
A 1 142 MET 142 142  142  MET MET A . n 
A 1 143 MET 143 143  143  MET MET A . n 
A 1 144 ILE 144 144  144  ILE ILE A . n 
A 1 145 ALA 145 145  145  ALA ALA A . n 
A 1 146 ALA 146 146  146  ALA ALA A . n 
A 1 147 ALA 147 147  147  ALA ALA A . n 
A 1 148 TRP 148 148  148  TRP TRP A . n 
A 1 149 VAL 149 149  149  VAL VAL A . n 
A 1 150 LEU 150 150  150  LEU LEU A . n 
A 1 151 SER 151 151  151  SER SER A . n 
A 1 152 PHE 152 152  152  PHE PHE A . n 
A 1 153 ILE 153 153  153  ILE ILE A . n 
A 1 154 LEU 154 154  154  LEU LEU A . n 
A 1 155 TRP 155 155  155  TRP TRP A . n 
A 1 156 ALA 156 156  156  ALA ALA A . n 
A 1 157 PRO 157 157  157  PRO PRO A . n 
A 1 158 ALA 158 158  158  ALA ALA A . n 
A 1 159 ILE 159 159  159  ILE ILE A . n 
A 1 160 LEU 160 160  160  LEU LEU A . n 
A 1 161 PHE 161 161  161  PHE PHE A . n 
A 1 162 TRP 162 162  162  TRP TRP A . n 
A 1 163 GLN 163 163  163  GLN GLN A . n 
A 1 164 PHE 164 164  164  PHE PHE A . n 
A 1 165 ILE 165 165  165  ILE ILE A . n 
A 1 166 VAL 166 166  166  VAL VAL A . n 
A 1 167 GLY 167 167  167  GLY GLY A . n 
A 1 168 VAL 168 168  168  VAL VAL A . n 
A 1 169 ARG 169 169  169  ARG ARG A . n 
A 1 170 THR 170 170  170  THR THR A . n 
A 1 171 VAL 171 171  171  VAL VAL A . n 
A 1 172 GLU 172 172  172  GLU GLU A . n 
A 1 173 ASP 173 173  173  ASP ASP A . n 
A 1 174 GLY 174 174  174  GLY GLY A . n 
A 1 175 GLU 175 175  175  GLU GLU A . n 
A 1 176 CYS 176 176  176  CYS CYS A . n 
A 1 177 TYR 177 177  177  TYR TYR A . n 
A 1 178 ILE 178 178  178  ILE ILE A . n 
A 1 179 GLN 179 179  179  GLN GLN A . n 
A 1 180 PHE 180 180  180  PHE PHE A . n 
A 1 181 PHE 181 181  181  PHE PHE A . n 
A 1 182 SER 182 182  182  SER SER A . n 
A 1 183 ASN 183 183  183  ASN ASN A . n 
A 1 184 ALA 184 184  184  ALA ALA A . n 
A 1 185 ALA 185 185  185  ALA ALA A . n 
A 1 186 VAL 186 186  186  VAL VAL A . n 
A 1 187 THR 187 187  187  THR THR A . n 
A 1 188 PHE 188 188  188  PHE PHE A . n 
A 1 189 GLY 189 189  189  GLY GLY A . n 
A 1 190 THR 190 190  190  THR THR A . n 
A 1 191 ALA 191 191  191  ALA ALA A . n 
A 1 192 ILE 192 192  192  ILE ILE A . n 
A 1 193 ALA 193 193  193  ALA ALA A . n 
A 1 194 ALA 194 194  194  ALA ALA A . n 
A 1 195 PHE 195 195  195  PHE PHE A . n 
A 1 196 TYR 196 196  196  TYR TYR A . n 
A 1 197 LEU 197 197  197  LEU LEU A . n 
A 1 198 PRO 198 198  198  PRO PRO A . n 
A 1 199 VAL 199 199  199  VAL VAL A . n 
A 1 200 ILE 200 200  200  ILE ILE A . n 
A 1 201 ILE 201 201  201  ILE ILE A . n 
A 1 202 MET 202 202  202  MET MET A . n 
A 1 203 THR 203 203  203  THR THR A . n 
A 1 204 VAL 204 204  204  VAL VAL A . n 
A 1 205 LEU 205 205  205  LEU LEU A . n 
A 1 206 TYR 206 206  206  TYR TYR A . n 
A 1 207 TRP 207 207  207  TRP TRP A . n 
A 1 208 HIS 208 208  208  HIS HIS A . n 
A 1 209 ILE 209 209  209  ILE ILE A . n 
A 1 210 SER 210 210  210  SER SER A . n 
A 1 211 ARG 211 211  211  ARG ARG A . n 
A 1 212 ALA 212 212  212  ALA ALA A . n 
A 1 213 SER 213 213  213  SER SER A . n 
A 1 214 LYS 214 214  214  LYS LYS A . n 
A 1 215 SER 215 215  215  SER SER A . n 
A 1 216 ARG 216 216  216  ARG ARG A . n 
A 1 217 ILE 217 217  217  ILE ILE A . n 
A 1 218 ASN 218 1002 1002 ASN ASN A . n 
A 1 219 ILE 219 1003 1003 ILE ILE A . n 
A 1 220 PHE 220 1004 1004 PHE PHE A . n 
A 1 221 GLU 221 1005 1005 GLU GLU A . n 
A 1 222 MET 222 1006 1006 MET MET A . n 
A 1 223 LEU 223 1007 1007 LEU LEU A . n 
A 1 224 ARG 224 1008 1008 ARG ARG A . n 
A 1 225 ILE 225 1009 1009 ILE ILE A . n 
A 1 226 ASP 226 1010 1010 ASP ASP A . n 
A 1 227 GLU 227 1011 1011 GLU GLU A . n 
A 1 228 GLY 228 1012 1012 GLY GLY A . n 
A 1 229 LEU 229 1013 1013 LEU LEU A . n 
A 1 230 ARG 230 1014 1014 ARG ARG A . n 
A 1 231 LEU 231 1015 1015 LEU LEU A . n 
A 1 232 LYS 232 1016 1016 LYS LYS A . n 
A 1 233 ILE 233 1017 1017 ILE ILE A . n 
A 1 234 TYR 234 1018 1018 TYR TYR A . n 
A 1 235 LYS 235 1019 1019 LYS LYS A . n 
A 1 236 ASP 236 1020 1020 ASP ASP A . n 
A 1 237 THR 237 1021 1021 THR THR A . n 
A 1 238 GLU 238 1022 1022 GLU GLU A . n 
A 1 239 GLY 239 1023 1023 GLY GLY A . n 
A 1 240 TYR 240 1024 1024 TYR TYR A . n 
A 1 241 TYR 241 1025 1025 TYR TYR A . n 
A 1 242 THR 242 1026 1026 THR THR A . n 
A 1 243 ILE 243 1027 1027 ILE ILE A . n 
A 1 244 GLY 244 1028 1028 GLY GLY A . n 
A 1 245 ILE 245 1029 1029 ILE ILE A . n 
A 1 246 GLY 246 1030 1030 GLY GLY A . n 
A 1 247 HIS 247 1031 1031 HIS HIS A . n 
A 1 248 LEU 248 1032 1032 LEU LEU A . n 
A 1 249 LEU 249 1033 1033 LEU LEU A . n 
A 1 250 THR 250 1034 1034 THR THR A . n 
A 1 251 LYS 251 1035 1035 LYS LYS A . n 
A 1 252 SER 252 1036 1036 SER SER A . n 
A 1 253 PRO 253 1037 1037 PRO PRO A . n 
A 1 254 SER 254 1038 1038 SER SER A . n 
A 1 255 LEU 255 1039 1039 LEU LEU A . n 
A 1 256 ASN 256 1040 1040 ASN ASN A . n 
A 1 257 ALA 257 1041 1041 ALA ALA A . n 
A 1 258 ALA 258 1042 1042 ALA ALA A . n 
A 1 259 LYS 259 1043 1043 LYS LYS A . n 
A 1 260 SER 260 1044 1044 SER SER A . n 
A 1 261 GLU 261 1045 1045 GLU GLU A . n 
A 1 262 LEU 262 1046 1046 LEU LEU A . n 
A 1 263 ASP 263 1047 1047 ASP ASP A . n 
A 1 264 LYS 264 1048 1048 LYS LYS A . n 
A 1 265 ALA 265 1049 1049 ALA ALA A . n 
A 1 266 ILE 266 1050 1050 ILE ILE A . n 
A 1 267 GLY 267 1051 1051 GLY GLY A . n 
A 1 268 ARG 268 1052 1052 ARG ARG A . n 
A 1 269 ASN 269 1053 1053 ASN ASN A . n 
A 1 270 THR 270 1054 1054 THR THR A . n 
A 1 271 ASN 271 1055 1055 ASN ASN A . n 
A 1 272 GLY 272 1056 1056 GLY GLY A . n 
A 1 273 VAL 273 1057 1057 VAL VAL A . n 
A 1 274 ILE 274 1058 1058 ILE ILE A . n 
A 1 275 THR 275 1059 1059 THR THR A . n 
A 1 276 LYS 276 1060 1060 LYS LYS A . n 
A 1 277 ASP 277 1061 1061 ASP ASP A . n 
A 1 278 GLU 278 1062 1062 GLU GLU A . n 
A 1 279 ALA 279 1063 1063 ALA ALA A . n 
A 1 280 GLU 280 1064 1064 GLU GLU A . n 
A 1 281 LYS 281 1065 1065 LYS LYS A . n 
A 1 282 LEU 282 1066 1066 LEU LEU A . n 
A 1 283 PHE 283 1067 1067 PHE PHE A . n 
A 1 284 ASN 284 1068 1068 ASN ASN A . n 
A 1 285 GLN 285 1069 1069 GLN GLN A . n 
A 1 286 ASP 286 1070 1070 ASP ASP A . n 
A 1 287 VAL 287 1071 1071 VAL VAL A . n 
A 1 288 ASP 288 1072 1072 ASP ASP A . n 
A 1 289 ALA 289 1073 1073 ALA ALA A . n 
A 1 290 ALA 290 1074 1074 ALA ALA A . n 
A 1 291 VAL 291 1075 1075 VAL VAL A . n 
A 1 292 ARG 292 1076 1076 ARG ARG A . n 
A 1 293 GLY 293 1077 1077 GLY GLY A . n 
A 1 294 ILE 294 1078 1078 ILE ILE A . n 
A 1 295 LEU 295 1079 1079 LEU LEU A . n 
A 1 296 ARG 296 1080 1080 ARG ARG A . n 
A 1 297 ASN 297 1081 1081 ASN ASN A . n 
A 1 298 ALA 298 1082 1082 ALA ALA A . n 
A 1 299 LYS 299 1083 1083 LYS LYS A . n 
A 1 300 LEU 300 1084 1084 LEU LEU A . n 
A 1 301 LYS 301 1085 1085 LYS LYS A . n 
A 1 302 PRO 302 1086 1086 PRO PRO A . n 
A 1 303 VAL 303 1087 1087 VAL VAL A . n 
A 1 304 TYR 304 1088 1088 TYR TYR A . n 
A 1 305 ASP 305 1089 1089 ASP ASP A . n 
A 1 306 SER 306 1090 1090 SER SER A . n 
A 1 307 LEU 307 1091 1091 LEU LEU A . n 
A 1 308 ASP 308 1092 1092 ASP ASP A . n 
A 1 309 ALA 309 1093 1093 ALA ALA A . n 
A 1 310 VAL 310 1094 1094 VAL VAL A . n 
A 1 311 ARG 311 1095 1095 ARG ARG A . n 
A 1 312 ARG 312 1096 1096 ARG ARG A . n 
A 1 313 ALA 313 1097 1097 ALA ALA A . n 
A 1 314 ALA 314 1098 1098 ALA ALA A . n 
A 1 315 LEU 315 1099 1099 LEU LEU A . n 
A 1 316 ILE 316 1100 1100 ILE ILE A . n 
A 1 317 ASN 317 1101 1101 ASN ASN A . n 
A 1 318 MET 318 1102 1102 MET MET A . n 
A 1 319 VAL 319 1103 1103 VAL VAL A . n 
A 1 320 PHE 320 1104 1104 PHE PHE A . n 
A 1 321 GLN 321 1105 1105 GLN GLN A . n 
A 1 322 MET 322 1106 1106 MET MET A . n 
A 1 323 GLY 323 1107 1107 GLY GLY A . n 
A 1 324 GLU 324 1108 1108 GLU GLU A . n 
A 1 325 THR 325 1109 1109 THR THR A . n 
A 1 326 GLY 326 1110 1110 GLY GLY A . n 
A 1 327 VAL 327 1111 1111 VAL VAL A . n 
A 1 328 ALA 328 1112 1112 ALA ALA A . n 
A 1 329 GLY 329 1113 1113 GLY GLY A . n 
A 1 330 PHE 330 1114 1114 PHE PHE A . n 
A 1 331 THR 331 1115 1115 THR THR A . n 
A 1 332 ASN 332 1116 1116 ASN ASN A . n 
A 1 333 SER 333 1117 1117 SER SER A . n 
A 1 334 LEU 334 1118 1118 LEU LEU A . n 
A 1 335 ARG 335 1119 1119 ARG ARG A . n 
A 1 336 MET 336 1120 1120 MET MET A . n 
A 1 337 LEU 337 1121 1121 LEU LEU A . n 
A 1 338 GLN 338 1122 1122 GLN GLN A . n 
A 1 339 GLN 339 1123 1123 GLN GLN A . n 
A 1 340 LYS 340 1124 1124 LYS LYS A . n 
A 1 341 ARG 341 1125 1125 ARG ARG A . n 
A 1 342 TRP 342 1126 1126 TRP TRP A . n 
A 1 343 ASP 343 1127 1127 ASP ASP A . n 
A 1 344 GLU 344 1128 1128 GLU GLU A . n 
A 1 345 ALA 345 1129 1129 ALA ALA A . n 
A 1 346 ALA 346 1130 1130 ALA ALA A . n 
A 1 347 VAL 347 1131 1131 VAL VAL A . n 
A 1 348 ASN 348 1132 1132 ASN ASN A . n 
A 1 349 LEU 349 1133 1133 LEU LEU A . n 
A 1 350 ALA 350 1134 1134 ALA ALA A . n 
A 1 351 LYS 351 1135 1135 LYS LYS A . n 
A 1 352 SER 352 1136 1136 SER SER A . n 
A 1 353 ARG 353 1137 1137 ARG ARG A . n 
A 1 354 TRP 354 1138 1138 TRP TRP A . n 
A 1 355 TYR 355 1139 1139 TYR TYR A . n 
A 1 356 ASN 356 1140 1140 ASN ASN A . n 
A 1 357 GLN 357 1141 1141 GLN GLN A . n 
A 1 358 THR 358 1142 1142 THR THR A . n 
A 1 359 PRO 359 1143 1143 PRO PRO A . n 
A 1 360 ASN 360 1144 1144 ASN ASN A . n 
A 1 361 ARG 361 1145 1145 ARG ARG A . n 
A 1 362 ALA 362 1146 1146 ALA ALA A . n 
A 1 363 LYS 363 1147 1147 LYS LYS A . n 
A 1 364 ARG 364 1148 1148 ARG ARG A . n 
A 1 365 VAL 365 1149 1149 VAL VAL A . n 
A 1 366 ILE 366 1150 1150 ILE ILE A . n 
A 1 367 THR 367 1151 1151 THR THR A . n 
A 1 368 THR 368 1152 1152 THR THR A . n 
A 1 369 PHE 369 1153 1153 PHE PHE A . n 
A 1 370 ARG 370 1154 1154 ARG ARG A . n 
A 1 371 THR 371 1155 1155 THR THR A . n 
A 1 372 GLY 372 1156 1156 GLY GLY A . n 
A 1 373 THR 373 1157 1157 THR THR A . n 
A 1 374 TRP 374 1158 1158 TRP TRP A . n 
A 1 375 ASP 375 1159 1159 ASP ASP A . n 
A 1 376 ALA 376 1160 1160 ALA ALA A . n 
A 1 377 TYR 377 1161 1161 TYR TYR A . n 
A 1 378 PRO 378 377  377  PRO PRO A . n 
A 1 379 PRO 379 378  378  PRO PRO A . n 
A 1 380 PRO 380 379  379  PRO PRO A . n 
A 1 381 SER 381 380  380  SER SER A . n 
A 1 382 ARG 382 381  381  ARG ARG A . n 
A 1 383 GLU 383 382  382  GLU GLU A . n 
A 1 384 LYS 384 383  383  LYS LYS A . n 
A 1 385 LYS 385 384  384  LYS LYS A . n 
A 1 386 VAL 386 385  385  VAL VAL A . n 
A 1 387 THR 387 386  386  THR THR A . n 
A 1 388 ARG 388 387  387  ARG ARG A . n 
A 1 389 THR 389 388  388  THR THR A . n 
A 1 390 ILE 390 389  389  ILE ILE A . n 
A 1 391 LEU 391 390  390  LEU LEU A . n 
A 1 392 ALA 392 391  391  ALA ALA A . n 
A 1 393 ILE 393 392  392  ILE ILE A . n 
A 1 394 LEU 394 393  393  LEU LEU A . n 
A 1 395 LEU 395 394  394  LEU LEU A . n 
A 1 396 ALA 396 395  395  ALA ALA A . n 
A 1 397 PHE 397 396  396  PHE PHE A . n 
A 1 398 ILE 398 397  397  ILE ILE A . n 
A 1 399 ILE 399 398  398  ILE ILE A . n 
A 1 400 THR 400 399  399  THR THR A . n 
A 1 401 TRP 401 400  400  TRP TRP A . n 
A 1 402 ALA 402 401  401  ALA ALA A . n 
A 1 403 PRO 403 402  402  PRO PRO A . n 
A 1 404 TYR 404 403  403  TYR TYR A . n 
A 1 405 ASN 405 404  404  ASN ASN A . n 
A 1 406 VAL 406 405  405  VAL VAL A . n 
A 1 407 MET 407 406  406  MET MET A . n 
A 1 408 VAL 408 407  407  VAL VAL A . n 
A 1 409 LEU 409 408  408  LEU LEU A . n 
A 1 410 ILE 410 409  409  ILE ILE A . n 
A 1 411 ASN 411 410  410  ASN ASN A . n 
A 1 412 THR 412 411  411  THR THR A . n 
A 1 413 PHE 413 412  412  PHE PHE A . n 
A 1 414 CYS 414 413  413  CYS CYS A . n 
A 1 415 ALA 415 414  414  ALA ALA A . n 
A 1 416 PRO 416 415  415  PRO PRO A . n 
A 1 417 CYS 417 416  416  CYS CYS A . n 
A 1 418 ILE 418 417  417  ILE ILE A . n 
A 1 419 PRO 419 418  418  PRO PRO A . n 
A 1 420 ASN 420 419  419  ASN ASN A . n 
A 1 421 THR 421 420  420  THR THR A . n 
A 1 422 VAL 422 421  421  VAL VAL A . n 
A 1 423 TRP 423 422  422  TRP TRP A . n 
A 1 424 THR 424 423  423  THR THR A . n 
A 1 425 ILE 425 424  424  ILE ILE A . n 
A 1 426 GLY 426 425  425  GLY GLY A . n 
A 1 427 TYR 427 426  426  TYR TYR A . n 
A 1 428 TRP 428 427  427  TRP TRP A . n 
A 1 429 LEU 429 428  428  LEU LEU A . n 
A 1 430 CYS 430 429  429  CYS CYS A . n 
A 1 431 TYR 431 430  430  TYR TYR A . n 
A 1 432 ILE 432 431  431  ILE ILE A . n 
A 1 433 ASN 433 432  432  ASN ASN A . n 
A 1 434 SER 434 433  433  SER SER A . n 
A 1 435 THR 435 434  434  THR THR A . n 
A 1 436 ILE 436 435  435  ILE ILE A . n 
A 1 437 ASN 437 436  436  ASN ASN A . n 
A 1 438 PRO 438 437  437  PRO PRO A . n 
A 1 439 ALA 439 438  438  ALA ALA A . n 
A 1 440 CYS 440 439  439  CYS CYS A . n 
A 1 441 TYR 441 440  440  TYR TYR A . n 
A 1 442 ALA 442 441  441  ALA ALA A . n 
A 1 443 LEU 443 442  442  LEU LEU A . n 
A 1 444 CYS 444 443  443  CYS CYS A . n 
A 1 445 ASN 445 444  444  ASN ASN A . n 
A 1 446 ALA 446 445  445  ALA ALA A . n 
A 1 447 THR 447 446  446  THR THR A . n 
A 1 448 PHE 448 447  447  PHE PHE A . n 
A 1 449 LYS 449 448  448  LYS LYS A . n 
A 1 450 LYS 450 449  449  LYS LYS A . n 
A 1 451 THR 451 450  450  THR THR A . n 
A 1 452 PHE 452 451  451  PHE PHE A . n 
A 1 453 LYS 453 452  452  LYS LYS A . n 
A 1 454 HIS 454 453  453  HIS HIS A . n 
A 1 455 LEU 455 454  454  LEU LEU A . n 
A 1 456 LEU 456 455  455  LEU LEU A . n 
A 1 457 MET 457 456  456  MET MET A . n 
A 1 458 CYS 458 457  ?    ?   ?   A . n 
A 1 459 HIS 459 458  ?    ?   ?   A . n 
A 1 460 TYR 460 459  ?    ?   ?   A . n 
A 1 461 LYS 461 460  ?    ?   ?   A . n 
A 1 462 ASN 462 461  ?    ?   ?   A . n 
A 1 463 ILE 463 462  ?    ?   ?   A . n 
A 1 464 GLY 464 463  ?    ?   ?   A . n 
A 1 465 ALA 465 464  ?    ?   ?   A . n 
A 1 466 THR 466 465  ?    ?   ?   A . n 
A 1 467 ARG 467 466  ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 QNB 1  1162 1  QNB QNB A . 
C 3 BGC 1  1163 2  BGC BGC A . 
D 4 CL  1  1164 3  CL  CL  A . 
E 4 CL  1  1165 4  CL  CL  A . 
F 5 HOH 1  1166 1  HOH HOH A . 
F 5 HOH 2  1167 2  HOH HOH A . 
F 5 HOH 3  1168 3  HOH HOH A . 
F 5 HOH 4  1169 4  HOH HOH A . 
F 5 HOH 5  1170 5  HOH HOH A . 
F 5 HOH 6  1171 6  HOH HOH A . 
F 5 HOH 7  1172 7  HOH HOH A . 
F 5 HOH 8  1173 8  HOH HOH A . 
F 5 HOH 9  1174 9  HOH HOH A . 
F 5 HOH 10 1175 10 HOH HOH A . 
F 5 HOH 11 1176 11 HOH HOH A . 
F 5 HOH 12 1177 12 HOH HOH A . 
F 5 HOH 13 1178 13 HOH HOH A . 
F 5 HOH 14 1179 14 HOH HOH A . 
F 5 HOH 15 1180 15 HOH HOH A . 
F 5 HOH 16 1181 16 HOH HOH A . 
F 5 HOH 17 1182 17 HOH HOH A . 
F 5 HOH 18 1183 18 HOH HOH A . 
F 5 HOH 19 1184 19 HOH HOH A . 
F 5 HOH 20 1185 20 HOH HOH A . 
F 5 HOH 21 1186 21 HOH HOH A . 
F 5 HOH 22 1187 22 HOH HOH A . 
F 5 HOH 23 1188 23 HOH HOH A . 
F 5 HOH 24 1189 24 HOH HOH A . 
F 5 HOH 25 1190 25 HOH HOH A . 
F 5 HOH 26 1191 26 HOH HOH A . 
F 5 HOH 27 1192 27 HOH HOH A . 
F 5 HOH 28 1193 28 HOH HOH A . 
F 5 HOH 29 1194 29 HOH HOH A . 
F 5 HOH 30 1195 30 HOH HOH A . 
F 5 HOH 31 1196 31 HOH HOH A . 
F 5 HOH 32 1197 32 HOH HOH A . 
F 5 HOH 33 1198 33 HOH HOH A . 
F 5 HOH 34 1199 34 HOH HOH A . 
F 5 HOH 35 1200 35 HOH HOH A . 
F 5 HOH 36 1201 36 HOH HOH A . 
F 5 HOH 37 1202 37 HOH HOH A . 
F 5 HOH 38 1203 38 HOH HOH A . 
F 5 HOH 39 1204 39 HOH HOH A . 
F 5 HOH 40 1205 40 HOH HOH A . 
F 5 HOH 41 1206 41 HOH HOH A . 
F 5 HOH 42 1207 42 HOH HOH A . 
F 5 HOH 43 1208 43 HOH HOH A . 
F 5 HOH 44 1209 44 HOH HOH A . 
F 5 HOH 45 1210 45 HOH HOH A . 
F 5 HOH 46 1211 46 HOH HOH A . 
F 5 HOH 47 1212 47 HOH HOH A . 
F 5 HOH 48 1213 48 HOH HOH A . 
F 5 HOH 49 1214 49 HOH HOH A . 
F 5 HOH 50 1215 50 HOH HOH A . 
F 5 HOH 51 1216 51 HOH HOH A . 
F 5 HOH 52 1217 52 HOH HOH A . 
F 5 HOH 53 1218 53 HOH HOH A . 
F 5 HOH 54 1219 54 HOH HOH A . 
F 5 HOH 55 1220 55 HOH HOH A . 
F 5 HOH 56 1221 56 HOH HOH A . 
F 5 HOH 57 1222 57 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-02-01 
2 'Structure model' 1 1 2012-03-28 
3 'Structure model' 1 2 2017-08-09 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
4 4 'Structure model' 'Data collection'        
5 4 'Structure model' 'Database references'    
6 4 'Structure model' 'Derived calculations'   
7 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen            
2 3 'Structure model' software                  
3 4 'Structure model' chem_comp                 
4 4 'Structure model' entity                    
5 4 'Structure model' pdbx_chem_comp_identifier 
6 4 'Structure model' pdbx_entity_nonpoly       
7 4 'Structure model' struct_ref_seq_dif        
8 4 'Structure model' struct_site               
9 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'             
2 4 'Structure model' '_chem_comp.type'             
3 4 'Structure model' '_entity.pdbx_description'    
4 4 'Structure model' '_pdbx_entity_nonpoly.name'   
5 4 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHASER   phasing           .                            ? 2 
PHENIX   refinement        '(phenix.refine: 1.7.1_743)' ? 3 
HKL-2000 'data reduction'  .                            ? 4 
HKL-2000 'data scaling'    .                            ? 5 
# 
_pdbx_entry_details.entry_id                 3UON 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;THE STRUCTURE IS AN INTERNAL FUSION PROTEIN WITH LYSOZYME.               
AN OFFSET 1000 HAS BEEN ADDED TO ORIGINAL SEQUENCE DATABASE RESIDUE NUMBERS (2-161) OF THE LYSOZYME PART IN COORDINATES TO DISTINGUISH THE LYSOZYME PART IN THE CHAIN. THEREFORE LYSOZYME PART HAVE NUMBERS A1002-A1161.
;
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 75   ? ? -102.90 -67.42 
2 1 LEU A 1033 ? ? -108.18 -67.90 
3 1 ASN A 1055 ? ? 69.92   -1.55  
4 1 SER A 380  ? ? 71.19   -19.28 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 216  ? CG  ? A ARG 216 CG  
2  1 Y 1 A ARG 216  ? CD  ? A ARG 216 CD  
3  1 Y 1 A ARG 216  ? NE  ? A ARG 216 NE  
4  1 Y 1 A ARG 216  ? CZ  ? A ARG 216 CZ  
5  1 Y 1 A ARG 216  ? NH1 ? A ARG 216 NH1 
6  1 Y 1 A ARG 216  ? NH2 ? A ARG 216 NH2 
7  1 Y 1 A LYS 1016 ? CG  ? A LYS 232 CG  
8  1 Y 1 A LYS 1016 ? CD  ? A LYS 232 CD  
9  1 Y 1 A LYS 1016 ? CE  ? A LYS 232 CE  
10 1 Y 1 A LYS 1016 ? NZ  ? A LYS 232 NZ  
11 1 Y 1 A LYS 1019 ? CG  ? A LYS 235 CG  
12 1 Y 1 A LYS 1019 ? CD  ? A LYS 235 CD  
13 1 Y 1 A LYS 1019 ? CE  ? A LYS 235 CE  
14 1 Y 1 A LYS 1019 ? NZ  ? A LYS 235 NZ  
15 1 Y 1 A GLU 1022 ? CG  ? A GLU 238 CG  
16 1 Y 1 A GLU 1022 ? CD  ? A GLU 238 CD  
17 1 Y 1 A GLU 1022 ? OE1 ? A GLU 238 OE1 
18 1 Y 1 A GLU 1022 ? OE2 ? A GLU 238 OE2 
19 1 Y 1 A TYR 1024 ? CG  ? A TYR 240 CG  
20 1 Y 1 A TYR 1024 ? CD1 ? A TYR 240 CD1 
21 1 Y 1 A TYR 1024 ? CD2 ? A TYR 240 CD2 
22 1 Y 1 A TYR 1024 ? CE1 ? A TYR 240 CE1 
23 1 Y 1 A TYR 1024 ? CE2 ? A TYR 240 CE2 
24 1 Y 1 A TYR 1024 ? CZ  ? A TYR 240 CZ  
25 1 Y 1 A TYR 1024 ? OH  ? A TYR 240 OH  
26 1 Y 1 A TYR 1025 ? CG  ? A TYR 241 CG  
27 1 Y 1 A TYR 1025 ? CD1 ? A TYR 241 CD1 
28 1 Y 1 A TYR 1025 ? CD2 ? A TYR 241 CD2 
29 1 Y 1 A TYR 1025 ? CE1 ? A TYR 241 CE1 
30 1 Y 1 A TYR 1025 ? CE2 ? A TYR 241 CE2 
31 1 Y 1 A TYR 1025 ? CZ  ? A TYR 241 CZ  
32 1 Y 1 A TYR 1025 ? OH  ? A TYR 241 OH  
33 1 Y 1 A MET 456  ? CG  ? A MET 457 CG  
34 1 Y 1 A MET 456  ? SD  ? A MET 457 SD  
35 1 Y 1 A MET 456  ? CE  ? A MET 457 CE  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A SER 4   ? A SER 4   
5  1 Y 1 A THR 5   ? A THR 5   
6  1 Y 1 A ASP 6   ? A ASP 6   
7  1 Y 1 A SER 7   ? A SER 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A ASP 9   ? A ASP 9   
10 1 Y 1 A ASN 10  ? A ASN 10  
11 1 Y 1 A SER 11  ? A SER 11  
12 1 Y 1 A LEU 12  ? A LEU 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A LEU 14  ? A LEU 14  
15 1 Y 1 A THR 15  ? A THR 15  
16 1 Y 1 A SER 16  ? A SER 16  
17 1 Y 1 A PRO 17  ? A PRO 17  
18 1 Y 1 A TYR 18  ? A TYR 18  
19 1 Y 1 A LYS 19  ? A LYS 19  
20 1 Y 1 A CYS 457 ? A CYS 458 
21 1 Y 1 A HIS 458 ? A HIS 459 
22 1 Y 1 A TYR 459 ? A TYR 460 
23 1 Y 1 A LYS 460 ? A LYS 461 
24 1 Y 1 A ASN 461 ? A ASN 462 
25 1 Y 1 A ILE 462 ? A ILE 463 
26 1 Y 1 A GLY 463 ? A GLY 464 
27 1 Y 1 A ALA 464 ? A ALA 465 
28 1 Y 1 A THR 465 ? A THR 466 
29 1 Y 1 A ARG 466 ? A ARG 467 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpb            
BGC 'COMMON NAME'                         GMML     1.0 b-D-glucopyranose 
BGC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Glcp          
BGC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc               
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(3R)-1-azabicyclo[2.2.2]oct-3-yl hydroxy(diphenyl)acetate' QNB 
3 beta-D-glucopyranose                                        BGC 
4 'CHLORIDE ION'                                              CL  
5 water                                                       HOH 
#