data_3URZ
# 
_entry.id   3URZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3URZ         
RCSB  RCSB069135   
WWPDB D_1000069135 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          416729 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        3URZ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-22 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Joint Center for Structural Genomics (JCSG)' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of a hypothetical protein (BACOVA_03105) from Bacteroides ovatus ATCC 8483 at 2.19 A resolution' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Joint Center for Structural Genomics (JCSG)' 
_citation_author.ordinal       1 
# 
_cell.entry_id           3URZ 
_cell.length_a           30.703 
_cell.length_b           41.597 
_cell.length_c           236.878 
_cell.angle_alpha        90.000 
_cell.angle_beta         92.520 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3URZ 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Uncharacterized protein' 24495.137 2  ? ? 'UNP residues 21-227' ? 
2 non-polymer syn 'ZINC ION'                65.409    4  ? ? ?                     ? 
3 non-polymer syn 'TETRAETHYLENE GLYCOL'    194.226   1  ? ? ?                     ? 
4 non-polymer syn 1,2-ETHANEDIOL            62.068    1  ? ? ?                     ? 
5 water       nat water                     18.015    55 ? ? ?                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GQSVDE(MSE)LQKVSAAIEAGQNGQAVSYFRQTIALNIDRTE(MSE)YYWTNVDKNSEISSKLATELALAYKKNRNYDK
AYLFYKELLQKAPNNVD(CSX)LEACAE(MSE)QVCRGQEKDALR(MSE)YEKILQLEADNLAANIFLGNYYYLTAEQEK
KKLETDYKKLSSPTK(MSE)QYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVNR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKEL
LQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYAR
YRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVNR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         416729 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLN n 
1 3   SER n 
1 4   VAL n 
1 5   ASP n 
1 6   GLU n 
1 7   MSE n 
1 8   LEU n 
1 9   GLN n 
1 10  LYS n 
1 11  VAL n 
1 12  SER n 
1 13  ALA n 
1 14  ALA n 
1 15  ILE n 
1 16  GLU n 
1 17  ALA n 
1 18  GLY n 
1 19  GLN n 
1 20  ASN n 
1 21  GLY n 
1 22  GLN n 
1 23  ALA n 
1 24  VAL n 
1 25  SER n 
1 26  TYR n 
1 27  PHE n 
1 28  ARG n 
1 29  GLN n 
1 30  THR n 
1 31  ILE n 
1 32  ALA n 
1 33  LEU n 
1 34  ASN n 
1 35  ILE n 
1 36  ASP n 
1 37  ARG n 
1 38  THR n 
1 39  GLU n 
1 40  MSE n 
1 41  TYR n 
1 42  TYR n 
1 43  TRP n 
1 44  THR n 
1 45  ASN n 
1 46  VAL n 
1 47  ASP n 
1 48  LYS n 
1 49  ASN n 
1 50  SER n 
1 51  GLU n 
1 52  ILE n 
1 53  SER n 
1 54  SER n 
1 55  LYS n 
1 56  LEU n 
1 57  ALA n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  ALA n 
1 62  LEU n 
1 63  ALA n 
1 64  TYR n 
1 65  LYS n 
1 66  LYS n 
1 67  ASN n 
1 68  ARG n 
1 69  ASN n 
1 70  TYR n 
1 71  ASP n 
1 72  LYS n 
1 73  ALA n 
1 74  TYR n 
1 75  LEU n 
1 76  PHE n 
1 77  TYR n 
1 78  LYS n 
1 79  GLU n 
1 80  LEU n 
1 81  LEU n 
1 82  GLN n 
1 83  LYS n 
1 84  ALA n 
1 85  PRO n 
1 86  ASN n 
1 87  ASN n 
1 88  VAL n 
1 89  ASP n 
1 90  CSX n 
1 91  LEU n 
1 92  GLU n 
1 93  ALA n 
1 94  CYS n 
1 95  ALA n 
1 96  GLU n 
1 97  MSE n 
1 98  GLN n 
1 99  VAL n 
1 100 CYS n 
1 101 ARG n 
1 102 GLY n 
1 103 GLN n 
1 104 GLU n 
1 105 LYS n 
1 106 ASP n 
1 107 ALA n 
1 108 LEU n 
1 109 ARG n 
1 110 MSE n 
1 111 TYR n 
1 112 GLU n 
1 113 LYS n 
1 114 ILE n 
1 115 LEU n 
1 116 GLN n 
1 117 LEU n 
1 118 GLU n 
1 119 ALA n 
1 120 ASP n 
1 121 ASN n 
1 122 LEU n 
1 123 ALA n 
1 124 ALA n 
1 125 ASN n 
1 126 ILE n 
1 127 PHE n 
1 128 LEU n 
1 129 GLY n 
1 130 ASN n 
1 131 TYR n 
1 132 TYR n 
1 133 TYR n 
1 134 LEU n 
1 135 THR n 
1 136 ALA n 
1 137 GLU n 
1 138 GLN n 
1 139 GLU n 
1 140 LYS n 
1 141 LYS n 
1 142 LYS n 
1 143 LEU n 
1 144 GLU n 
1 145 THR n 
1 146 ASP n 
1 147 TYR n 
1 148 LYS n 
1 149 LYS n 
1 150 LEU n 
1 151 SER n 
1 152 SER n 
1 153 PRO n 
1 154 THR n 
1 155 LYS n 
1 156 MSE n 
1 157 GLN n 
1 158 TYR n 
1 159 ALA n 
1 160 ARG n 
1 161 TYR n 
1 162 ARG n 
1 163 ASP n 
1 164 GLY n 
1 165 LEU n 
1 166 SER n 
1 167 LYS n 
1 168 LEU n 
1 169 PHE n 
1 170 THR n 
1 171 THR n 
1 172 ARG n 
1 173 TYR n 
1 174 GLU n 
1 175 LYS n 
1 176 ALA n 
1 177 ARG n 
1 178 ASN n 
1 179 SER n 
1 180 LEU n 
1 181 GLN n 
1 182 LYS n 
1 183 VAL n 
1 184 ILE n 
1 185 LEU n 
1 186 ARG n 
1 187 PHE n 
1 188 PRO n 
1 189 SER n 
1 190 THR n 
1 191 GLU n 
1 192 ALA n 
1 193 GLN n 
1 194 LYS n 
1 195 THR n 
1 196 LEU n 
1 197 ASP n 
1 198 LYS n 
1 199 ILE n 
1 200 LEU n 
1 201 ARG n 
1 202 ILE n 
1 203 GLU n 
1 204 LYS n 
1 205 GLU n 
1 206 VAL n 
1 207 ASN n 
1 208 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BACOVA_03105 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacteroides ovatus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     411476 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 8483 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               HK100 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       SpeedET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A7LZ30_BACOV 
_struct_ref.pdbx_db_accession          A7LZ30 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELL
QKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYARY
RDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVNR
;
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3URZ A 2 ? 208 ? A7LZ30 21 ? 227 ? 21 227 
2 1 3URZ B 2 ? 208 ? A7LZ30 21 ? 227 ? 21 227 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3URZ GLY A 1 ? UNP A7LZ30 ? ? 'leader sequence' 0 1 
2 3URZ GLY B 1 ? UNP A7LZ30 ? ? 'leader sequence' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                 'C4 H7 N O4'     133.103 
CSX 'L-peptide linking' n 'S-OXY CYSTEINE'       ?                 'C3 H7 N O3 S'   137.158 
CYS 'L-peptide linking' y CYSTEINE               ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL         'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE              ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER                  ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE       ?                 'C5 H11 N O2 Se' 196.106 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL' ?                 'C8 H18 O5'      194.226 
PHE 'L-peptide linking' y PHENYLALANINE          ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'             ?                 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          3URZ 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.08 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.12 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.93 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'0.20 M zinc acetate, 16.40 % polyethylene glycol 8000, 0.1M MES pH 5.93, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.details                
'Flat mirror (vertical focusing); single crystal Si(111) bent monochromator (ho rizontal focusing)' 
_diffrn_detector.pdbx_collection_date   2010-11-22 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111) bent' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.91837 1.0 
2 0.98021 1.0 
3 0.97963 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength_list        0.91837,0.98021,0.97963 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.entry_id                     3URZ 
_reflns.d_resolution_high            2.19 
_reflns.d_resolution_low             29.581 
_reflns.number_obs                   29857 
_reflns.pdbx_Rmerge_I_obs            0.035 
_reflns.pdbx_netI_over_sigmaI        10.960 
_reflns.percent_possible_obs         93.300 
_reflns.B_iso_Wilson_estimate        56.560 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.210 2.290  10767 ? 5529 0.451 2.1  ? ? ? ? ? 94.200 1  1 
2.290 2.380  10973 ? 5661 0.396 2.5  ? ? ? ? ? 96.200 2  1 
2.380 2.490  11013 ? 5683 0.283 3.4  ? ? ? ? ? 95.400 3  1 
2.490 2.620  11068 ? 5639 0.215 4.4  ? ? ? ? ? 95.900 4  1 
2.620 2.780  11039 ? 5587 0.157 5.8  ? ? ? ? ? 95.400 5  1 
2.780 3.000  11123 ? 5717 0.102 8.3  ? ? ? ? ? 95.100 6  1 
3.000 3.300  10435 ? 5415 0.064 12.0 ? ? ? ? ? 92.700 7  1 
3.300 3.770  10465 ? 5304 0.035 18.9 ? ? ? ? ? 89.400 8  1 
3.770 4.740  10221 ? 5232 0.025 26.0 ? ? ? ? ? 88.700 9  1 
4.740 29.581 10560 ? 5413 0.022 28.2 ? ? ? ? ? 89.800 10 1 
# 
_refine.entry_id                                 3URZ 
_refine.ls_d_res_high                            2.1900 
_refine.ls_d_res_low                             29.581 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    95.5700 
_refine.ls_number_reflns_obs                     29857 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. 3. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. 4. WATERS WERE EXCLUDED FROM AUTOMATIC TLS ASSIGNMENT. 5. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 6. PRESENCE OF ZINC IN CRYSTALLIZATION CONDITION AND ANOMALOUS DIFFERENCE FOURIERS SUPPORT THE MODELING OF ZINC (ZN) IONS. 7. PEG FRAGMENT (PG4) AND 1,2-ETHANEDIOL (EDO) MOLECULES FROM THE CRYSTALLIZATION/CRYOPROTECTION SOLUTION ARE MODELED.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2184 
_refine.ls_R_factor_R_work                       0.2173 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2397 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1508 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               101.8585 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.0700 
_refine.aniso_B[2][2]                            -1.1200 
_refine.aniso_B[3][3]                            1.3100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            1.3200 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9560 
_refine.correlation_coeff_Fo_to_Fc_free          0.9460 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.2350 
_refine.pdbx_overall_ESU_R_Free                  0.1870 
_refine.overall_SU_ML                            0.1580 
_refine.overall_SU_B                             11.7780 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                244.130 
_refine.B_iso_min                                41.570 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3278 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               3351 
_refine_hist.d_res_high                       2.1900 
_refine_hist.d_res_low                        29.581 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3371 0.011  0.020  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         2335 0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    4537 1.415  1.975  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      5703 1.197  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 414  2.514  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 164  23.789 24.817 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 643  9.205  15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 22   11.443 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         504  0.090  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   3712 0.004  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     670  0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_bond_it              3371 4.144  7.559  ? ? 'X-RAY DIFFRACTION' 
r_bond_other           2335 0.963  7.920  ? ? 'X-RAY DIFFRACTION' 
r_angle_it             4532 5.851  13.905 ? ? 'X-RAY DIFFRACTION' 
r_angle_others         5703 3.749  14.795 ? ? 'X-RAY DIFFRACTION' 
r_torsion_it           1243 9.769  30.927 ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 1193 0.280 0.500  1 ? ? ? 
'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  A 1447 0.510 5.000  2 ? ? ? 
'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 1193 4.540 2.000  3 ? ? ? 
'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     A 1447 6.740 10.000 4 ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.1910 
_refine_ls_shell.d_res_low                        2.2480 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               76.3500 
_refine_ls_shell.number_reflns_R_work             1572 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2530 
_refine_ls_shell.R_factor_R_free                  0.2990 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             81 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1653 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 5 A 22 A 226 ? . . . . . . . . 
1 2 1 5 B 22 B 226 ? . . . . . . . . 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.title                     
'Crystal structure of a putative protein binding protein (BACOVA_03105) from Bacteroides ovatus ATCC 8483 at 2.19 A resolution' 
_struct.entry_id                  3URZ 
_struct.pdbx_model_type_details   ? 
_struct.pdbx_model_details        ? 
_struct.pdbx_descriptor           'Uncharacterized protein' 
_struct.pdbx_CASP_flag            ? 
# 
_struct_keywords.text            
;TETRATRICOPEPTIDE REPEATS (TPR) CONTAINING PROTEIN, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, PROTEIN BINDING
;
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.entry_id        3URZ 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'ANALYTICAL SIZE EXCLUSION CHROMATOGRAPHY SUPPORTS THE ASSIGNMENT OF A MONOMER AS A SIGNIFICANT OLIGOMERIZATION STATE IN SOLUTION.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3   ? ALA A 17  ? SER A 22  ALA A 36  1 ? 15 
HELX_P HELX_P2  2  GLN A 19  ? ASN A 34  ? GLN A 38  ASN A 53  1 ? 16 
HELX_P HELX_P3  3  ASN A 34  ? VAL A 46  ? ASN A 53  VAL A 65  1 ? 13 
HELX_P HELX_P4  4  SER A 50  ? ASN A 67  ? SER A 69  ASN A 86  1 ? 18 
HELX_P HELX_P5  5  ASN A 69  ? ALA A 84  ? ASN A 88  ALA A 103 1 ? 16 
HELX_P HELX_P6  6  ASN A 87  ? GLY A 102 ? ASN A 106 GLY A 121 1 ? 16 
HELX_P HELX_P7  7  GLN A 103 ? GLU A 118 ? GLN A 122 GLU A 137 1 ? 16 
HELX_P HELX_P8  8  ASN A 121 ? LYS A 148 ? ASN A 140 LYS A 167 1 ? 28 
HELX_P HELX_P9  9  THR A 154 ? ARG A 172 ? THR A 173 ARG A 191 1 ? 19 
HELX_P HELX_P10 10 ARG A 172 ? ILE A 184 ? ARG A 191 ILE A 203 1 ? 13 
HELX_P HELX_P11 11 SER A 189 ? ASN A 207 ? SER A 208 ASN A 226 1 ? 19 
HELX_P HELX_P12 12 SER B 3   ? ALA B 17  ? SER B 22  ALA B 36  1 ? 15 
HELX_P HELX_P13 13 GLN B 19  ? ASN B 34  ? GLN B 38  ASN B 53  1 ? 16 
HELX_P HELX_P14 14 ASN B 34  ? VAL B 46  ? ASN B 53  VAL B 65  1 ? 13 
HELX_P HELX_P15 15 GLU B 51  ? ARG B 68  ? GLU B 70  ARG B 87  1 ? 18 
HELX_P HELX_P16 16 ASN B 69  ? ALA B 84  ? ASN B 88  ALA B 103 1 ? 16 
HELX_P HELX_P17 17 ASN B 87  ? ARG B 101 ? ASN B 106 ARG B 120 1 ? 15 
HELX_P HELX_P18 18 GLN B 103 ? GLU B 118 ? GLN B 122 GLU B 137 1 ? 16 
HELX_P HELX_P19 19 ASN B 121 ? LYS B 149 ? ASN B 140 LYS B 168 1 ? 29 
HELX_P HELX_P20 20 THR B 154 ? ARG B 172 ? THR B 173 ARG B 191 1 ? 19 
HELX_P HELX_P21 21 ARG B 172 ? PHE B 187 ? ARG B 191 PHE B 206 1 ? 16 
HELX_P HELX_P22 22 SER B 189 ? ASN B 207 ? SER B 208 ASN B 226 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A GLU 6   C   ? ? ? 1_555 A MSE 7   N  ? ? A GLU 25  A MSE 26  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale2  covale ? ? A MSE 7   C   ? ? ? 1_555 A LEU 8   N  ? ? A MSE 26  A LEU 27  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale3  covale ? ? A GLU 39  C   ? ? ? 1_555 A MSE 40  N  ? ? A GLU 58  A MSE 59  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale4  covale ? ? A MSE 40  C   ? ? ? 1_555 A TYR 41  N  ? ? A MSE 59  A TYR 60  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale5  covale ? ? A ASP 89  C   ? ? ? 1_555 A CSX 90  N  ? ? A ASP 108 A CSX 109 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale6  covale ? ? A CSX 90  C   ? ? ? 1_555 A LEU 91  N  ? ? A CSX 109 A LEU 110 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale7  covale ? ? A GLU 96  C   ? ? ? 1_555 A MSE 97  N  ? ? A GLU 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale8  covale ? ? A MSE 97  C   ? ? ? 1_555 A GLN 98  N  ? ? A MSE 116 A GLN 117 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale9  covale ? ? A ARG 109 C   ? ? ? 1_555 A MSE 110 N  ? ? A ARG 128 A MSE 129 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale10 covale ? ? A MSE 110 C   ? ? ? 1_555 A TYR 111 N  ? ? A MSE 129 A TYR 130 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale11 covale ? ? A LYS 155 C   ? ? ? 1_555 A MSE 156 N  ? ? A LYS 174 A MSE 175 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale12 covale ? ? A MSE 156 C   ? ? ? 1_555 A GLN 157 N  ? ? A MSE 175 A GLN 176 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale13 covale ? ? B GLU 6   C   ? ? ? 1_555 B MSE 7   N  ? ? B GLU 25  B MSE 26  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale14 covale ? ? B MSE 7   C   ? ? ? 1_555 B LEU 8   N  ? ? B MSE 26  B LEU 27  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale15 covale ? ? B GLU 39  C   ? ? ? 1_555 B MSE 40  N  ? ? B GLU 58  B MSE 59  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale16 covale ? ? B MSE 40  C   ? ? ? 1_555 B TYR 41  N  ? ? B MSE 59  B TYR 60  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale17 covale ? ? B ASP 89  C   ? ? ? 1_555 B CSX 90  N  ? ? B ASP 108 B CSX 109 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale18 covale ? ? B CSX 90  C   ? ? ? 1_555 B LEU 91  N  ? ? B CSX 109 B LEU 110 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19 covale ? ? B GLU 96  C   ? ? ? 1_555 B MSE 97  N  ? ? B GLU 115 B MSE 116 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale20 covale ? ? B MSE 97  C   ? ? ? 1_555 B GLN 98  N  ? ? B MSE 116 B GLN 117 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale21 covale ? ? B ARG 109 C   ? ? ? 1_555 B MSE 110 N  ? ? B ARG 128 B MSE 129 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale22 covale ? ? B MSE 110 C   ? ? ? 1_555 B TYR 111 N  ? ? B MSE 129 B TYR 130 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale23 covale ? ? B LYS 155 C   ? ? ? 1_555 B MSE 156 N  ? ? B LYS 174 B MSE 175 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale24 covale ? ? B MSE 156 C   ? ? ? 1_555 B GLN 157 N  ? ? B MSE 175 B GLN 176 1_555 ? ? ? ? ? ? ? 1.343 ? 
metalc1  metalc ? ? A GLU 96  OE2 ? ? ? 1_555 C ZN  .   ZN ? ? A GLU 115 A ZN  250 1_555 ? ? ? ? ? ? ? 1.973 ? 
metalc2  metalc ? ? D ZN  .   ZN  ? ? ? 1_555 I HOH .   O  ? ? A ZN  260 A HOH 303 1_555 ? ? ? ? ? ? ? 1.982 ? 
metalc3  metalc ? ? B GLU 92  OE2 ? ? ? 1_555 E ZN  .   ZN ? ? B GLU 111 B ZN  250 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc4  metalc ? ? B GLU 118 OE2 ? ? ? 1_555 F ZN  .   ZN ? ? B GLU 137 B ZN  260 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc5  metalc ? ? F ZN  .   ZN  ? ? ? 1_555 H EDO .   O2 ? ? B ZN  260 B EDO 301 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc6  metalc ? ? A GLU 118 OE2 ? ? ? 1_555 D ZN  .   ZN ? ? A GLU 137 A ZN  260 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc7  metalc ? ? E ZN  .   ZN  ? ? ? 1_555 J HOH .   O  ? ? B ZN  250 B HOH 304 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc8  metalc ? ? B ASP 120 OD1 ? ? ? 1_555 F ZN  .   ZN ? ? B ASP 139 B ZN  260 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc9  metalc ? ? B GLU 96  OE2 ? ? ? 1_555 E ZN  .   ZN ? ? B GLU 115 B ZN  250 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc10 metalc ? ? A GLU 92  OE2 ? ? ? 1_555 C ZN  .   ZN ? ? A GLU 111 A ZN  250 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc11 metalc ? ? A ASP 120 OD1 ? ? ? 1_555 D ZN  .   ZN ? ? A ASP 139 A ZN  260 1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc12 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 I HOH .   O  ? ? A ZN  250 A HOH 302 1_555 ? ? ? ? ? ? ? 2.572 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 152 A . ? SER 171 A PRO 153 A ? PRO 172 A 1 0.05  
2 SER 152 B . ? SER 171 B PRO 153 B ? PRO 172 B 1 -1.82 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 250'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 260'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN B 250'  
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN B 260'  
AC5 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PG4 B 300' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 GLU A 92  ? GLU A 111 . ? 1_555 ? 
2  AC1 3 GLU A 96  ? GLU A 115 . ? 1_555 ? 
3  AC1 3 HOH I .   ? HOH A 302 . ? 1_555 ? 
4  AC2 3 GLU A 118 ? GLU A 137 . ? 1_555 ? 
5  AC2 3 ASP A 120 ? ASP A 139 . ? 1_555 ? 
6  AC2 3 HOH I .   ? HOH A 303 . ? 1_555 ? 
7  AC3 3 GLU B 92  ? GLU B 111 . ? 1_555 ? 
8  AC3 3 GLU B 96  ? GLU B 115 . ? 1_555 ? 
9  AC3 3 HOH J .   ? HOH B 304 . ? 1_555 ? 
10 AC4 3 GLU B 118 ? GLU B 137 . ? 1_555 ? 
11 AC4 3 ASP B 120 ? ASP B 139 . ? 1_555 ? 
12 AC4 3 EDO H .   ? EDO B 301 . ? 1_555 ? 
13 AC5 9 ILE B 35  ? ILE B 54  . ? 1_555 ? 
14 AC5 9 ASP B 36  ? ASP B 55  . ? 1_555 ? 
15 AC5 9 ASN B 67  ? ASN B 86  . ? 1_555 ? 
16 AC5 9 ASN B 69  ? ASN B 88  . ? 1_555 ? 
17 AC5 9 LYS B 83  ? LYS B 102 . ? 1_455 ? 
18 AC5 9 ALA B 84  ? ALA B 103 . ? 1_455 ? 
19 AC5 9 PRO B 85  ? PRO B 104 . ? 1_455 ? 
20 AC5 9 ASN B 86  ? ASN B 105 . ? 1_455 ? 
21 AC5 9 HOH J .   ? HOH B 356 . ? 1_555 ? 
22 AC6 5 ARG B 68  ? ARG B 87  . ? 1_655 ? 
23 AC6 5 GLU B 118 ? GLU B 137 . ? 1_555 ? 
24 AC6 5 ASP B 120 ? ASP B 139 . ? 1_555 ? 
25 AC6 5 ZN  F .   ? ZN  B 260 . ? 1_555 ? 
26 AC6 5 HOH J .   ? HOH B 316 . ? 1_655 ? 
# 
_atom_sites.entry_id                    3URZ 
_atom_sites.fract_transf_matrix[1][1]   0.032570 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001435 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024040 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004226 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 3   ? -6.086  20.156 102.311 1.00 122.77 ? 22  SER A N   1 
ATOM   2    C  CA  . SER A 1 3   ? -5.950  21.220 103.347 1.00 120.53 ? 22  SER A CA  1 
ATOM   3    C  C   . SER A 1 3   ? -7.160  21.235 104.276 1.00 117.60 ? 22  SER A C   1 
ATOM   4    O  O   . SER A 1 3   ? -8.262  20.853 103.874 1.00 116.77 ? 22  SER A O   1 
ATOM   5    C  CB  . SER A 1 3   ? -5.797  22.590 102.678 1.00 122.00 ? 22  SER A CB  1 
ATOM   6    O  OG  . SER A 1 3   ? -5.665  23.636 103.631 1.00 117.56 ? 22  SER A OG  1 
ATOM   7    N  N   . VAL A 1 4   ? -6.943  21.688 105.511 1.00 118.03 ? 23  VAL A N   1 
ATOM   8    C  CA  . VAL A 1 4   ? -8.015  21.779 106.518 1.00 114.62 ? 23  VAL A CA  1 
ATOM   9    C  C   . VAL A 1 4   ? -9.038  22.877 106.194 1.00 112.78 ? 23  VAL A C   1 
ATOM   10   O  O   . VAL A 1 4   ? -10.221 22.693 106.454 1.00 108.96 ? 23  VAL A O   1 
ATOM   11   C  CB  . VAL A 1 4   ? -7.478  21.966 107.960 1.00 115.46 ? 23  VAL A CB  1 
ATOM   12   C  CG1 . VAL A 1 4   ? -6.622  20.773 108.355 1.00 120.18 ? 23  VAL A CG1 1 
ATOM   13   C  CG2 . VAL A 1 4   ? -6.697  23.266 108.115 1.00 116.66 ? 23  VAL A CG2 1 
ATOM   14   N  N   . ASP A 1 5   ? -8.588  24.000 105.623 1.00 116.34 ? 24  ASP A N   1 
ATOM   15   C  CA  . ASP A 1 5   ? -9.488  25.121 105.260 1.00 113.75 ? 24  ASP A CA  1 
ATOM   16   C  C   . ASP A 1 5   ? -10.543 24.747 104.201 1.00 111.39 ? 24  ASP A C   1 
ATOM   17   O  O   . ASP A 1 5   ? -11.640 25.306 104.206 1.00 108.67 ? 24  ASP A O   1 
ATOM   18   C  CB  . ASP A 1 5   ? -8.692  26.367 104.826 1.00 117.17 ? 24  ASP A CB  1 
ATOM   19   C  CG  . ASP A 1 5   ? -7.871  26.989 105.971 1.00 122.48 ? 24  ASP A CG  1 
ATOM   20   O  OD1 . ASP A 1 5   ? -7.719  26.378 107.056 1.00 123.31 ? 24  ASP A OD1 1 
ATOM   21   O  OD2 . ASP A 1 5   ? -7.360  28.109 105.778 1.00 129.19 ? 24  ASP A OD2 1 
ATOM   22   N  N   . GLU A 1 6   ? -10.205 23.800 103.322 1.00 111.50 ? 25  GLU A N   1 
ATOM   23   C  CA  . GLU A 1 6   ? -11.118 23.294 102.284 1.00 109.92 ? 25  GLU A CA  1 
ATOM   24   C  C   . GLU A 1 6   ? -12.118 22.318 102.908 1.00 106.01 ? 25  GLU A C   1 
ATOM   25   O  O   . GLU A 1 6   ? -13.299 22.333 102.555 1.00 101.54 ? 25  GLU A O   1 
ATOM   26   C  CB  . GLU A 1 6   ? -10.340 22.601 101.159 1.00 113.86 ? 25  GLU A CB  1 
ATOM   27   C  CG  . GLU A 1 6   ? -9.316  23.494 100.462 1.00 118.34 ? 25  GLU A CG  1 
ATOM   28   C  CD  . GLU A 1 6   ? -9.918  24.706 99.759  1.00 118.13 ? 25  GLU A CD  1 
ATOM   29   O  OE1 . GLU A 1 6   ? -11.101 24.675 99.339  1.00 114.93 ? 25  GLU A OE1 1 
ATOM   30   O  OE2 . GLU A 1 6   ? -9.182  25.699 99.606  1.00 122.48 ? 25  GLU A OE2 1 
HETATM 31   N  N   . MSE A 1 7   ? -11.622 21.462 103.810 1.00 107.50 ? 26  MSE A N   1 
HETATM 32   C  CA  . MSE A 1 7   ? -12.439 20.499 104.568 1.00 105.47 ? 26  MSE A CA  1 
HETATM 33   C  C   . MSE A 1 7   ? -13.541 21.212 105.357 1.00 97.45  ? 26  MSE A C   1 
HETATM 34   O  O   . MSE A 1 7   ? -14.676 20.736 105.383 1.00 94.52  ? 26  MSE A O   1 
HETATM 35   C  CB  . MSE A 1 7   ? -11.564 19.707 105.544 1.00 117.65 ? 26  MSE A CB  1 
HETATM 36   C  CG  . MSE A 1 7   ? -10.602 18.713 104.922 1.00 130.65 ? 26  MSE A CG  1 
HETATM 37   SE SE  . MSE A 1 7   ? -11.448 16.992 104.636 0.75 154.28 ? 26  MSE A SE  1 
HETATM 38   C  CE  . MSE A 1 7   ? -11.664 16.516 106.483 1.00 118.17 ? 26  MSE A CE  1 
ATOM   39   N  N   . LEU A 1 8   ? -13.193 22.341 105.986 1.00 94.85  ? 27  LEU A N   1 
ATOM   40   C  CA  . LEU A 1 8   ? -14.145 23.146 106.778 1.00 91.68  ? 27  LEU A CA  1 
ATOM   41   C  C   . LEU A 1 8   ? -15.287 23.767 105.961 1.00 90.55  ? 27  LEU A C   1 
ATOM   42   O  O   . LEU A 1 8   ? -16.366 23.988 106.516 1.00 89.39  ? 27  LEU A O   1 
ATOM   43   C  CB  . LEU A 1 8   ? -13.422 24.211 107.623 1.00 92.94  ? 27  LEU A CB  1 
ATOM   44   C  CG  . LEU A 1 8   ? -12.516 23.680 108.745 1.00 93.69  ? 27  LEU A CG  1 
ATOM   45   C  CD1 . LEU A 1 8   ? -11.711 24.810 109.375 1.00 93.93  ? 27  LEU A CD1 1 
ATOM   46   C  CD2 . LEU A 1 8   ? -13.316 22.929 109.799 1.00 92.05  ? 27  LEU A CD2 1 
ATOM   47   N  N   . GLN A 1 9   ? -15.055 24.058 104.675 1.00 90.01  ? 28  GLN A N   1 
ATOM   48   C  CA  . GLN A 1 9   ? -16.125 24.562 103.790 1.00 89.87  ? 28  GLN A CA  1 
ATOM   49   C  C   . GLN A 1 9   ? -17.171 23.470 103.546 1.00 88.01  ? 28  GLN A C   1 
ATOM   50   O  O   . GLN A 1 9   ? -18.363 23.778 103.459 1.00 86.89  ? 28  GLN A O   1 
ATOM   51   C  CB  . GLN A 1 9   ? -15.600 25.084 102.446 1.00 91.01  ? 28  GLN A CB  1 
ATOM   52   C  CG  . GLN A 1 9   ? -14.723 26.323 102.574 1.00 92.17  ? 28  GLN A CG  1 
ATOM   53   C  CD  . GLN A 1 9   ? -14.417 26.997 101.247 1.00 93.56  ? 28  GLN A CD  1 
ATOM   54   O  OE1 . GLN A 1 9   ? -15.258 27.055 100.354 1.00 95.22  ? 28  GLN A OE1 1 
ATOM   55   N  NE2 . GLN A 1 9   ? -13.221 27.560 101.135 1.00 95.07  ? 28  GLN A NE2 1 
ATOM   56   N  N   . LYS A 1 10  ? -16.721 22.211 103.429 1.00 88.10  ? 29  LYS A N   1 
ATOM   57   C  CA  . LYS A 1 10  ? -17.628 21.062 103.248 1.00 88.17  ? 29  LYS A CA  1 
ATOM   58   C  C   . LYS A 1 10  ? -18.516 20.906 104.475 1.00 85.92  ? 29  LYS A C   1 
ATOM   59   O  O   . LYS A 1 10  ? -19.707 20.632 104.328 1.00 85.56  ? 29  LYS A O   1 
ATOM   60   C  CB  . LYS A 1 10  ? -16.875 19.762 102.949 1.00 90.30  ? 29  LYS A CB  1 
ATOM   61   N  N   . VAL A 1 11  ? -17.934 21.103 105.669 1.00 86.67  ? 30  VAL A N   1 
ATOM   62   C  CA  . VAL A 1 11  ? -18.671 21.070 106.942 1.00 84.07  ? 30  VAL A CA  1 
ATOM   63   C  C   . VAL A 1 11  ? -19.743 22.170 106.886 1.00 84.14  ? 30  VAL A C   1 
ATOM   64   O  O   . VAL A 1 11  ? -20.914 21.883 107.120 1.00 85.32  ? 30  VAL A O   1 
ATOM   65   C  CB  . VAL A 1 11  ? -17.746 21.256 108.185 1.00 83.64  ? 30  VAL A CB  1 
ATOM   66   C  CG1 . VAL A 1 11  ? -18.549 21.334 109.479 1.00 81.15  ? 30  VAL A CG1 1 
ATOM   67   C  CG2 . VAL A 1 11  ? -16.719 20.133 108.273 1.00 83.46  ? 30  VAL A CG2 1 
ATOM   68   N  N   . SER A 1 12  ? -19.341 23.396 106.533 1.00 85.02  ? 31  SER A N   1 
ATOM   69   C  CA  . SER A 1 12  ? -20.272 24.539 106.393 1.00 88.43  ? 31  SER A CA  1 
ATOM   70   C  C   . SER A 1 12  ? -21.382 24.279 105.363 1.00 91.68  ? 31  SER A C   1 
ATOM   71   O  O   . SER A 1 12  ? -22.535 24.640 105.608 1.00 94.77  ? 31  SER A O   1 
ATOM   72   C  CB  . SER A 1 12  ? -19.535 25.837 106.020 1.00 89.99  ? 31  SER A CB  1 
ATOM   73   O  OG  . SER A 1 12  ? -18.665 26.261 107.053 1.00 91.89  ? 31  SER A OG  1 
ATOM   74   N  N   . ALA A 1 13  ? -21.028 23.662 104.228 1.00 91.87  ? 32  ALA A N   1 
ATOM   75   C  CA  . ALA A 1 13  ? -22.005 23.323 103.176 1.00 93.48  ? 32  ALA A CA  1 
ATOM   76   C  C   . ALA A 1 13  ? -22.979 22.226 103.639 1.00 92.21  ? 32  ALA A C   1 
ATOM   77   O  O   . ALA A 1 13  ? -24.189 22.344 103.420 1.00 96.83  ? 32  ALA A O   1 
ATOM   78   C  CB  . ALA A 1 13  ? -21.310 22.913 101.875 1.00 93.62  ? 32  ALA A CB  1 
ATOM   79   N  N   . ALA A 1 14  ? -22.455 21.176 104.274 1.00 89.10  ? 33  ALA A N   1 
ATOM   80   C  CA  . ALA A 1 14  ? -23.285 20.066 104.785 1.00 90.92  ? 33  ALA A CA  1 
ATOM   81   C  C   . ALA A 1 14  ? -24.297 20.520 105.854 1.00 95.14  ? 33  ALA A C   1 
ATOM   82   O  O   . ALA A 1 14  ? -25.411 19.987 105.907 1.00 100.13 ? 33  ALA A O   1 
ATOM   83   C  CB  . ALA A 1 14  ? -22.413 18.931 105.314 1.00 88.35  ? 33  ALA A CB  1 
ATOM   84   N  N   . ILE A 1 15  ? -23.904 21.498 106.685 1.00 95.01  ? 34  ILE A N   1 
ATOM   85   C  CA  . ILE A 1 15  ? -24.774 22.082 107.728 1.00 94.95  ? 34  ILE A CA  1 
ATOM   86   C  C   . ILE A 1 15  ? -25.956 22.840 107.101 1.00 97.84  ? 34  ILE A C   1 
ATOM   87   O  O   . ILE A 1 15  ? -27.099 22.667 107.530 1.00 100.48 ? 34  ILE A O   1 
ATOM   88   C  CB  . ILE A 1 15  ? -23.982 23.005 108.698 1.00 92.70  ? 34  ILE A CB  1 
ATOM   89   C  CG1 . ILE A 1 15  ? -23.035 22.173 109.570 1.00 89.94  ? 34  ILE A CG1 1 
ATOM   90   C  CG2 . ILE A 1 15  ? -24.912 23.758 109.642 1.00 92.25  ? 34  ILE A CG2 1 
ATOM   91   C  CD1 . ILE A 1 15  ? -22.040 22.999 110.355 1.00 87.54  ? 34  ILE A CD1 1 
ATOM   92   N  N   . GLU A 1 16  ? -25.671 23.660 106.089 1.00 98.90  ? 35  GLU A N   1 
ATOM   93   C  CA  . GLU A 1 16  ? -26.708 24.441 105.386 1.00 100.54 ? 35  GLU A CA  1 
ATOM   94   C  C   . GLU A 1 16  ? -27.629 23.595 104.491 1.00 102.28 ? 35  GLU A C   1 
ATOM   95   O  O   . GLU A 1 16  ? -28.758 24.009 104.214 1.00 102.30 ? 35  GLU A O   1 
ATOM   96   C  CB  . GLU A 1 16  ? -26.075 25.575 104.582 1.00 102.67 ? 35  GLU A CB  1 
ATOM   97   C  CG  . GLU A 1 16  ? -25.374 26.593 105.466 1.00 103.38 ? 35  GLU A CG  1 
ATOM   98   C  CD  . GLU A 1 16  ? -24.663 27.683 104.701 1.00 105.51 ? 35  GLU A CD  1 
ATOM   99   O  OE1 . GLU A 1 16  ? -24.740 27.746 103.451 1.00 100.78 ? 35  GLU A OE1 1 
ATOM   100  O  OE2 . GLU A 1 16  ? -24.012 28.506 105.375 1.00 108.06 ? 35  GLU A OE2 1 
ATOM   101  N  N   . ALA A 1 17  ? -27.144 22.433 104.039 1.00 101.69 ? 36  ALA A N   1 
ATOM   102  C  CA  . ALA A 1 17  ? -27.935 21.498 103.216 1.00 104.66 ? 36  ALA A CA  1 
ATOM   103  C  C   . ALA A 1 17  ? -28.797 20.538 104.061 1.00 106.92 ? 36  ALA A C   1 
ATOM   104  O  O   . ALA A 1 17  ? -29.519 19.718 103.490 1.00 106.67 ? 36  ALA A O   1 
ATOM   105  C  CB  . ALA A 1 17  ? -27.017 20.697 102.301 1.00 100.60 ? 36  ALA A CB  1 
ATOM   106  N  N   . GLY A 1 18  ? -28.720 20.633 105.397 1.00 105.35 ? 37  GLY A N   1 
ATOM   107  C  CA  . GLY A 1 18  ? -29.473 19.769 106.309 1.00 109.03 ? 37  GLY A CA  1 
ATOM   108  C  C   . GLY A 1 18  ? -28.896 18.372 106.521 1.00 111.13 ? 37  GLY A C   1 
ATOM   109  O  O   . GLY A 1 18  ? -29.526 17.545 107.190 1.00 114.73 ? 37  GLY A O   1 
ATOM   110  N  N   . GLN A 1 19  ? -27.694 18.123 105.993 1.00 108.61 ? 38  GLN A N   1 
ATOM   111  C  CA  . GLN A 1 19  ? -27.019 16.829 106.081 1.00 109.28 ? 38  GLN A CA  1 
ATOM   112  C  C   . GLN A 1 19  ? -26.008 16.887 107.228 1.00 105.64 ? 38  GLN A C   1 
ATOM   113  O  O   . GLN A 1 19  ? -24.787 16.892 107.021 1.00 102.27 ? 38  GLN A O   1 
ATOM   114  C  CB  . GLN A 1 19  ? -26.369 16.488 104.734 1.00 116.50 ? 38  GLN A CB  1 
ATOM   115  C  CG  . GLN A 1 19  ? -27.385 16.369 103.595 1.00 122.96 ? 38  GLN A CG  1 
ATOM   116  C  CD  . GLN A 1 19  ? -26.769 16.147 102.225 1.00 131.63 ? 38  GLN A CD  1 
ATOM   117  O  OE1 . GLN A 1 19  ? -25.587 16.410 101.999 1.00 135.35 ? 38  GLN A OE1 1 
ATOM   118  N  NE2 . GLN A 1 19  ? -27.590 15.689 101.286 1.00 137.09 ? 38  GLN A NE2 1 
ATOM   119  N  N   . ASN A 1 20  ? -26.551 16.937 108.446 1.00 102.82 ? 39  ASN A N   1 
ATOM   120  C  CA  . ASN A 1 20  ? -25.752 16.993 109.682 1.00 99.95  ? 39  ASN A CA  1 
ATOM   121  C  C   . ASN A 1 20  ? -24.815 15.797 109.864 1.00 96.88  ? 39  ASN A C   1 
ATOM   122  O  O   . ASN A 1 20  ? -23.716 15.963 110.403 1.00 96.16  ? 39  ASN A O   1 
ATOM   123  C  CB  . ASN A 1 20  ? -26.652 17.147 110.920 1.00 101.22 ? 39  ASN A CB  1 
ATOM   124  C  CG  . ASN A 1 20  ? -27.374 18.488 110.970 1.00 103.83 ? 39  ASN A CG  1 
ATOM   125  O  OD1 . ASN A 1 20  ? -27.414 19.240 109.993 1.00 101.05 ? 39  ASN A OD1 1 
ATOM   126  N  ND2 . ASN A 1 20  ? -27.956 18.790 112.127 1.00 106.07 ? 39  ASN A ND2 1 
ATOM   127  N  N   . GLY A 1 21  ? -25.251 14.619 109.398 1.00 97.23  ? 40  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 21  ? -24.481 13.375 109.471 1.00 98.28  ? 40  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 21  ? -23.102 13.487 108.848 1.00 98.24  ? 40  GLY A C   1 
ATOM   130  O  O   . GLY A 1 21  ? -22.099 13.218 109.520 1.00 98.68  ? 40  GLY A O   1 
ATOM   131  N  N   . GLN A 1 22  ? -23.052 13.908 107.583 1.00 96.53  ? 41  GLN A N   1 
ATOM   132  C  CA  . GLN A 1 22  ? -21.766 14.087 106.880 1.00 100.34 ? 41  GLN A CA  1 
ATOM   133  C  C   . GLN A 1 22  ? -20.994 15.338 107.360 1.00 98.39  ? 41  GLN A C   1 
ATOM   134  O  O   . GLN A 1 22  ? -19.775 15.391 107.201 1.00 96.80  ? 41  GLN A O   1 
ATOM   135  C  CB  . GLN A 1 22  ? -21.916 14.043 105.345 1.00 104.89 ? 41  GLN A CB  1 
ATOM   136  C  CG  . GLN A 1 22  ? -22.687 15.180 104.688 1.00 106.27 ? 41  GLN A CG  1 
ATOM   137  C  CD  . GLN A 1 22  ? -22.737 15.053 103.170 1.00 113.64 ? 41  GLN A CD  1 
ATOM   138  O  OE1 . GLN A 1 22  ? -22.633 13.956 102.614 1.00 120.67 ? 41  GLN A OE1 1 
ATOM   139  N  NE2 . GLN A 1 22  ? -22.908 16.183 102.490 1.00 110.15 ? 41  GLN A NE2 1 
ATOM   140  N  N   . ALA A 1 23  ? -21.695 16.327 107.933 1.00 99.08  ? 42  ALA A N   1 
ATOM   141  C  CA  . ALA A 1 23  ? -21.057 17.535 108.508 1.00 96.33  ? 42  ALA A CA  1 
ATOM   142  C  C   . ALA A 1 23  ? -20.157 17.141 109.684 1.00 95.95  ? 42  ALA A C   1 
ATOM   143  O  O   . ALA A 1 23  ? -19.020 17.604 109.777 1.00 95.81  ? 42  ALA A O   1 
ATOM   144  C  CB  . ALA A 1 23  ? -22.100 18.547 108.963 1.00 91.85  ? 42  ALA A CB  1 
ATOM   145  N  N   . VAL A 1 24  ? -20.676 16.275 110.559 1.00 98.07  ? 43  VAL A N   1 
ATOM   146  C  CA  . VAL A 1 24  ? -19.928 15.759 111.724 1.00 97.13  ? 43  VAL A CA  1 
ATOM   147  C  C   . VAL A 1 24  ? -18.788 14.827 111.269 1.00 98.43  ? 43  VAL A C   1 
ATOM   148  O  O   . VAL A 1 24  ? -17.730 14.803 111.906 1.00 95.01  ? 43  VAL A O   1 
ATOM   149  C  CB  . VAL A 1 24  ? -20.855 15.021 112.733 1.00 96.93  ? 43  VAL A CB  1 
ATOM   150  C  CG1 . VAL A 1 24  ? -20.076 14.491 113.931 1.00 99.67  ? 43  VAL A CG1 1 
ATOM   151  C  CG2 . VAL A 1 24  ? -21.958 15.944 113.227 1.00 94.66  ? 43  VAL A CG2 1 
ATOM   152  N  N   . SER A 1 25  ? -19.003 14.080 110.176 1.00 97.68  ? 44  SER A N   1 
ATOM   153  C  CA  . SER A 1 25  ? -17.991 13.157 109.629 1.00 101.94 ? 44  SER A CA  1 
ATOM   154  C  C   . SER A 1 25  ? -16.766 13.896 109.090 1.00 100.82 ? 44  SER A C   1 
ATOM   155  O  O   . SER A 1 25  ? -15.638 13.466 109.341 1.00 103.79 ? 44  SER A O   1 
ATOM   156  C  CB  . SER A 1 25  ? -18.586 12.252 108.548 1.00 109.09 ? 44  SER A CB  1 
ATOM   157  O  OG  . SER A 1 25  ? -19.619 11.451 109.091 1.00 118.07 ? 44  SER A OG  1 
ATOM   158  N  N   . TYR A 1 26  ? -16.991 14.979 108.339 1.00 99.09  ? 45  TYR A N   1 
ATOM   159  C  CA  . TYR A 1 26  ? -15.888 15.820 107.830 1.00 98.69  ? 45  TYR A CA  1 
ATOM   160  C  C   . TYR A 1 26  ? -15.226 16.614 108.973 1.00 96.12  ? 45  TYR A C   1 
ATOM   161  O  O   . TYR A 1 26  ? -14.022 16.885 108.915 1.00 96.74  ? 45  TYR A O   1 
ATOM   162  C  CB  . TYR A 1 26  ? -16.320 16.758 106.687 1.00 100.18 ? 45  TYR A CB  1 
ATOM   163  C  CG  . TYR A 1 26  ? -16.544 16.068 105.347 1.00 101.63 ? 45  TYR A CG  1 
ATOM   164  C  CD1 . TYR A 1 26  ? -15.465 15.519 104.632 1.00 104.96 ? 45  TYR A CD1 1 
ATOM   165  C  CD2 . TYR A 1 26  ? -17.817 16.014 104.754 1.00 102.41 ? 45  TYR A CD2 1 
ATOM   166  C  CE1 . TYR A 1 26  ? -15.653 14.895 103.394 1.00 104.99 ? 45  TYR A CE1 1 
ATOM   167  C  CE2 . TYR A 1 26  ? -18.015 15.397 103.512 1.00 105.25 ? 45  TYR A CE2 1 
ATOM   168  C  CZ  . TYR A 1 26  ? -16.933 14.838 102.838 1.00 105.49 ? 45  TYR A CZ  1 
ATOM   169  O  OH  . TYR A 1 26  ? -17.122 14.234 101.616 1.00 115.52 ? 45  TYR A OH  1 
ATOM   170  N  N   . PHE A 1 27  ? -16.010 16.979 109.995 1.00 93.03  ? 46  PHE A N   1 
ATOM   171  C  CA  . PHE A 1 27  ? -15.495 17.695 111.173 1.00 92.10  ? 46  PHE A CA  1 
ATOM   172  C  C   . PHE A 1 27  ? -14.510 16.794 111.931 1.00 93.47  ? 46  PHE A C   1 
ATOM   173  O  O   . PHE A 1 27  ? -13.442 17.265 112.317 1.00 90.70  ? 46  PHE A O   1 
ATOM   174  C  CB  . PHE A 1 27  ? -16.635 18.169 112.080 1.00 87.69  ? 46  PHE A CB  1 
ATOM   175  C  CG  . PHE A 1 27  ? -16.206 19.130 113.149 1.00 87.59  ? 46  PHE A CG  1 
ATOM   176  C  CD1 . PHE A 1 27  ? -16.107 20.496 112.876 1.00 87.54  ? 46  PHE A CD1 1 
ATOM   177  C  CD2 . PHE A 1 27  ? -15.929 18.685 114.443 1.00 87.70  ? 46  PHE A CD2 1 
ATOM   178  C  CE1 . PHE A 1 27  ? -15.722 21.397 113.867 1.00 89.46  ? 46  PHE A CE1 1 
ATOM   179  C  CE2 . PHE A 1 27  ? -15.546 19.582 115.443 1.00 87.56  ? 46  PHE A CE2 1 
ATOM   180  C  CZ  . PHE A 1 27  ? -15.444 20.940 115.157 1.00 88.91  ? 46  PHE A CZ  1 
ATOM   181  N  N   . ARG A 1 28  ? -14.858 15.512 112.124 1.00 96.98  ? 47  ARG A N   1 
ATOM   182  C  CA  . ARG A 1 28  ? -13.946 14.534 112.774 1.00 99.52  ? 47  ARG A CA  1 
ATOM   183  C  C   . ARG A 1 28  ? -12.624 14.353 112.013 1.00 101.89 ? 47  ARG A C   1 
ATOM   184  O  O   . ARG A 1 28  ? -11.573 14.191 112.638 1.00 105.34 ? 47  ARG A O   1 
ATOM   185  C  CB  . ARG A 1 28  ? -14.594 13.152 113.014 1.00 102.59 ? 47  ARG A CB  1 
ATOM   186  C  CG  . ARG A 1 28  ? -15.376 13.014 114.316 1.00 104.00 ? 47  ARG A CG  1 
ATOM   187  C  CD  . ARG A 1 28  ? -15.786 11.563 114.551 1.00 107.68 ? 47  ARG A CD  1 
ATOM   188  N  NE  . ARG A 1 28  ? -16.866 11.146 113.652 1.00 112.79 ? 47  ARG A NE  1 
ATOM   189  C  CZ  . ARG A 1 28  ? -18.171 11.045 113.952 1.00 116.37 ? 47  ARG A CZ  1 
ATOM   190  N  NH1 . ARG A 1 28  ? -18.656 11.278 115.179 1.00 113.44 ? 47  ARG A NH1 1 
ATOM   191  N  NH2 . ARG A 1 28  ? -19.022 10.662 112.997 1.00 120.31 ? 47  ARG A NH2 1 
ATOM   192  N  N   . GLN A 1 29  ? -12.687 14.368 110.681 1.00 105.44 ? 48  GLN A N   1 
ATOM   193  C  CA  . GLN A 1 29  ? -11.485 14.253 109.840 1.00 109.26 ? 48  GLN A CA  1 
ATOM   194  C  C   . GLN A 1 29  ? -10.579 15.508 109.938 1.00 107.90 ? 48  GLN A C   1 
ATOM   195  O  O   . GLN A 1 29  ? -9.353  15.372 109.889 1.00 107.25 ? 48  GLN A O   1 
ATOM   196  C  CB  . GLN A 1 29  ? -11.854 13.917 108.389 1.00 114.49 ? 48  GLN A CB  1 
ATOM   197  C  CG  . GLN A 1 29  ? -12.458 12.532 108.186 1.00 117.17 ? 48  GLN A CG  1 
ATOM   198  C  CD  . GLN A 1 29  ? -12.913 12.275 106.752 1.00 121.50 ? 48  GLN A CD  1 
ATOM   199  O  OE1 . GLN A 1 29  ? -12.611 13.040 105.832 1.00 117.48 ? 48  GLN A OE1 1 
ATOM   200  N  NE2 . GLN A 1 29  ? -13.647 11.186 106.560 1.00 127.25 ? 48  GLN A NE2 1 
ATOM   201  N  N   . THR A 1 30  ? -11.171 16.703 110.092 1.00 107.19 ? 49  THR A N   1 
ATOM   202  C  CA  . THR A 1 30  ? -10.394 17.963 110.258 1.00 106.83 ? 49  THR A CA  1 
ATOM   203  C  C   . THR A 1 30  ? -9.635  18.012 111.600 1.00 104.12 ? 49  THR A C   1 
ATOM   204  O  O   . THR A 1 30  ? -8.577  18.642 111.691 1.00 105.17 ? 49  THR A O   1 
ATOM   205  C  CB  . THR A 1 30  ? -11.254 19.250 110.146 1.00 105.47 ? 49  THR A CB  1 
ATOM   206  O  OG1 . THR A 1 30  ? -12.235 19.293 111.189 1.00 101.90 ? 49  THR A OG1 1 
ATOM   207  C  CG2 . THR A 1 30  ? -11.947 19.332 108.813 1.00 103.83 ? 49  THR A CG2 1 
ATOM   208  N  N   . ILE A 1 31  ? -10.197 17.375 112.633 1.00 101.81 ? 50  ILE A N   1 
ATOM   209  C  CA  . ILE A 1 31  ? -9.560  17.279 113.964 1.00 101.49 ? 50  ILE A CA  1 
ATOM   210  C  C   . ILE A 1 31  ? -8.263  16.457 113.862 1.00 105.16 ? 50  ILE A C   1 
ATOM   211  O  O   . ILE A 1 31  ? -7.261  16.791 114.510 1.00 107.81 ? 50  ILE A O   1 
ATOM   212  C  CB  . ILE A 1 31  ? -10.518 16.673 115.024 1.00 98.13  ? 50  ILE A CB  1 
ATOM   213  C  CG1 . ILE A 1 31  ? -11.678 17.637 115.299 1.00 96.38  ? 50  ILE A CG1 1 
ATOM   214  C  CG2 . ILE A 1 31  ? -9.795  16.413 116.343 1.00 98.76  ? 50  ILE A CG2 1 
ATOM   215  C  CD1 . ILE A 1 31  ? -12.709 17.118 116.284 1.00 94.72  ? 50  ILE A CD1 1 
ATOM   216  N  N   . ALA A 1 32  ? -8.300  15.394 113.052 1.00 103.47 ? 51  ALA A N   1 
ATOM   217  C  CA  . ALA A 1 32  ? -7.134  14.537 112.807 1.00 107.99 ? 51  ALA A CA  1 
ATOM   218  C  C   . ALA A 1 32  ? -6.033  15.310 112.080 1.00 112.80 ? 51  ALA A C   1 
ATOM   219  O  O   . ALA A 1 32  ? -4.863  15.217 112.458 1.00 119.07 ? 51  ALA A O   1 
ATOM   220  C  CB  . ALA A 1 32  ? -7.527  13.304 112.003 1.00 105.62 ? 51  ALA A CB  1 
ATOM   221  N  N   . LEU A 1 33  ? -6.420  16.075 111.054 1.00 113.32 ? 52  LEU A N   1 
ATOM   222  C  CA  . LEU A 1 33  ? -5.482  16.886 110.268 1.00 115.82 ? 52  LEU A CA  1 
ATOM   223  C  C   . LEU A 1 33  ? -4.933  18.081 111.062 1.00 115.87 ? 52  LEU A C   1 
ATOM   224  O  O   . LEU A 1 33  ? -3.715  18.274 111.114 1.00 121.18 ? 52  LEU A O   1 
ATOM   225  C  CB  . LEU A 1 33  ? -6.134  17.376 108.964 1.00 115.63 ? 52  LEU A CB  1 
ATOM   226  C  CG  . LEU A 1 33  ? -6.581  16.318 107.942 1.00 116.47 ? 52  LEU A CG  1 
ATOM   227  C  CD1 . LEU A 1 33  ? -7.378  16.966 106.820 1.00 114.47 ? 52  LEU A CD1 1 
ATOM   228  C  CD2 . LEU A 1 33  ? -5.408  15.529 107.374 1.00 118.27 ? 52  LEU A CD2 1 
ATOM   229  N  N   . ASN A 1 34  ? -5.823  18.870 111.671 1.00 109.13 ? 53  ASN A N   1 
ATOM   230  C  CA  . ASN A 1 34  ? -5.422  20.056 112.450 1.00 107.81 ? 53  ASN A CA  1 
ATOM   231  C  C   . ASN A 1 34  ? -6.501  20.444 113.475 1.00 105.69 ? 53  ASN A C   1 
ATOM   232  O  O   . ASN A 1 34  ? -7.502  21.073 113.124 1.00 103.16 ? 53  ASN A O   1 
ATOM   233  C  CB  . ASN A 1 34  ? -5.097  21.225 111.495 1.00 108.77 ? 53  ASN A CB  1 
ATOM   234  C  CG  . ASN A 1 34  ? -4.471  22.439 112.191 1.00 110.53 ? 53  ASN A CG  1 
ATOM   235  O  OD1 . ASN A 1 34  ? -4.252  22.464 113.406 1.00 109.39 ? 53  ASN A OD1 1 
ATOM   236  N  ND2 . ASN A 1 34  ? -4.166  23.461 111.396 1.00 110.99 ? 53  ASN A ND2 1 
ATOM   237  N  N   . ILE A 1 35  ? -6.272  20.061 114.735 1.00 106.75 ? 54  ILE A N   1 
ATOM   238  C  CA  . ILE A 1 35  ? -7.196  20.350 115.845 1.00 103.86 ? 54  ILE A CA  1 
ATOM   239  C  C   . ILE A 1 35  ? -7.242  21.842 116.226 1.00 104.62 ? 54  ILE A C   1 
ATOM   240  O  O   . ILE A 1 35  ? -8.303  22.330 116.620 1.00 104.33 ? 54  ILE A O   1 
ATOM   241  C  CB  . ILE A 1 35  ? -6.899  19.461 117.088 1.00 100.36 ? 54  ILE A CB  1 
ATOM   242  C  CG1 . ILE A 1 35  ? -8.053  19.525 118.108 1.00 99.02  ? 54  ILE A CG1 1 
ATOM   243  C  CG2 . ILE A 1 35  ? -5.552  19.815 117.714 1.00 104.41 ? 54  ILE A CG2 1 
ATOM   244  C  CD1 . ILE A 1 35  ? -7.892  18.593 119.293 1.00 97.22  ? 54  ILE A CD1 1 
ATOM   245  N  N   . ASP A 1 36  ? -6.114  22.551 116.107 1.00 108.97 ? 55  ASP A N   1 
ATOM   246  C  CA  . ASP A 1 36  ? -6.038  23.991 116.440 1.00 111.97 ? 55  ASP A CA  1 
ATOM   247  C  C   . ASP A 1 36  ? -6.907  24.855 115.508 1.00 108.35 ? 55  ASP A C   1 
ATOM   248  O  O   . ASP A 1 36  ? -7.625  25.742 115.981 1.00 102.05 ? 55  ASP A O   1 
ATOM   249  C  CB  . ASP A 1 36  ? -4.575  24.485 116.417 1.00 118.93 ? 55  ASP A CB  1 
ATOM   250  C  CG  . ASP A 1 36  ? -4.417  25.942 116.884 1.00 124.40 ? 55  ASP A CG  1 
ATOM   251  O  OD1 . ASP A 1 36  ? -5.192  26.408 117.751 1.00 123.45 ? 55  ASP A OD1 1 
ATOM   252  O  OD2 . ASP A 1 36  ? -3.482  26.616 116.396 1.00 131.07 ? 55  ASP A OD2 1 
ATOM   253  N  N   . ARG A 1 37  ? -6.826  24.591 114.201 1.00 109.04 ? 56  ARG A N   1 
ATOM   254  C  CA  . ARG A 1 37  ? -7.615  25.316 113.185 1.00 110.26 ? 56  ARG A CA  1 
ATOM   255  C  C   . ARG A 1 37  ? -9.112  24.960 113.254 1.00 105.42 ? 56  ARG A C   1 
ATOM   256  O  O   . ARG A 1 37  ? -9.961  25.824 113.011 1.00 103.15 ? 56  ARG A O   1 
ATOM   257  C  CB  . ARG A 1 37  ? -7.057  25.054 111.773 1.00 114.36 ? 56  ARG A CB  1 
ATOM   258  C  CG  . ARG A 1 37  ? -7.741  25.790 110.625 1.00 118.42 ? 56  ARG A CG  1 
ATOM   259  C  CD  . ARG A 1 37  ? -7.649  27.307 110.730 1.00 121.65 ? 56  ARG A CD  1 
ATOM   260  N  NE  . ARG A 1 37  ? -8.359  27.959 109.624 1.00 123.92 ? 56  ARG A NE  1 
ATOM   261  C  CZ  . ARG A 1 37  ? -9.671  28.234 109.573 1.00 121.49 ? 56  ARG A CZ  1 
ATOM   262  N  NH1 . ARG A 1 37  ? -10.509 27.919 110.569 1.00 119.91 ? 56  ARG A NH1 1 
ATOM   263  N  NH2 . ARG A 1 37  ? -10.165 28.834 108.488 1.00 125.59 ? 56  ARG A NH2 1 
ATOM   264  N  N   . THR A 1 38  ? -9.416  23.691 113.544 1.00 101.83 ? 57  THR A N   1 
ATOM   265  C  CA  . THR A 1 38  ? -10.799 23.204 113.700 1.00 97.69  ? 57  THR A CA  1 
ATOM   266  C  C   . THR A 1 38  ? -11.466 23.873 114.911 1.00 96.86  ? 57  THR A C   1 
ATOM   267  O  O   . THR A 1 38  ? -12.645 24.235 114.845 1.00 93.01  ? 57  THR A O   1 
ATOM   268  C  CB  . THR A 1 38  ? -10.843 21.664 113.857 1.00 98.34  ? 57  THR A CB  1 
ATOM   269  O  OG1 . THR A 1 38  ? -10.254 21.048 112.703 1.00 101.71 ? 57  THR A OG1 1 
ATOM   270  C  CG2 . THR A 1 38  ? -12.274 21.158 114.020 1.00 96.27  ? 57  THR A CG2 1 
ATOM   271  N  N   . GLU A 1 39  ? -10.706 24.011 116.006 1.00 95.91  ? 58  GLU A N   1 
ATOM   272  C  CA  . GLU A 1 39  ? -11.170 24.681 117.234 1.00 98.77  ? 58  GLU A CA  1 
ATOM   273  C  C   . GLU A 1 39  ? -11.577 26.129 116.911 1.00 98.88  ? 58  GLU A C   1 
ATOM   274  O  O   . GLU A 1 39  ? -12.630 26.599 117.344 1.00 96.81  ? 58  GLU A O   1 
ATOM   275  C  CB  . GLU A 1 39  ? -10.070 24.705 118.321 1.00 97.96  ? 58  GLU A CB  1 
ATOM   276  C  CG  . GLU A 1 39  ? -10.592 25.139 119.682 1.00 101.72 ? 58  GLU A CG  1 
ATOM   277  C  CD  . GLU A 1 39  ? -9.541  25.455 120.737 1.00 100.90 ? 58  GLU A CD  1 
ATOM   278  O  OE1 . GLU A 1 39  ? -8.406  24.944 120.681 1.00 103.29 ? 58  GLU A OE1 1 
ATOM   279  O  OE2 . GLU A 1 39  ? -9.878  26.220 121.659 1.00 103.15 ? 58  GLU A OE2 1 
HETATM 280  N  N   . MSE A 1 40  ? -10.723 26.813 116.149 1.00 100.55 ? 59  MSE A N   1 
HETATM 281  C  CA  . MSE A 1 40  ? -10.951 28.201 115.738 1.00 104.95 ? 59  MSE A CA  1 
HETATM 282  C  C   . MSE A 1 40  ? -12.234 28.337 114.902 1.00 102.20 ? 59  MSE A C   1 
HETATM 283  O  O   . MSE A 1 40  ? -12.992 29.292 115.102 1.00 100.78 ? 59  MSE A O   1 
HETATM 284  C  CB  . MSE A 1 40  ? -9.729  28.720 114.985 1.00 115.69 ? 59  MSE A CB  1 
HETATM 285  C  CG  . MSE A 1 40  ? -9.723  30.199 114.730 1.00 128.54 ? 59  MSE A CG  1 
HETATM 286  SE SE  . MSE A 1 40  ? -7.973  30.737 114.095 0.75 153.37 ? 59  MSE A SE  1 
HETATM 287  C  CE  . MSE A 1 40  ? -6.893  30.383 115.693 1.00 148.79 ? 59  MSE A CE  1 
ATOM   288  N  N   . TYR A 1 41  ? -12.465 27.377 113.993 1.00 97.78  ? 60  TYR A N   1 
ATOM   289  C  CA  . TYR A 1 41  ? -13.688 27.315 113.159 1.00 94.72  ? 60  TYR A CA  1 
ATOM   290  C  C   . TYR A 1 41  ? -14.959 27.227 114.026 1.00 92.59  ? 60  TYR A C   1 
ATOM   291  O  O   . TYR A 1 41  ? -15.958 27.876 113.715 1.00 90.72  ? 60  TYR A O   1 
ATOM   292  C  CB  . TYR A 1 41  ? -13.629 26.135 112.161 1.00 93.80  ? 60  TYR A CB  1 
ATOM   293  C  CG  . TYR A 1 41  ? -14.922 25.862 111.402 1.00 94.98  ? 60  TYR A CG  1 
ATOM   294  C  CD1 . TYR A 1 41  ? -15.252 26.576 110.237 1.00 92.18  ? 60  TYR A CD1 1 
ATOM   295  C  CD2 . TYR A 1 41  ? -15.824 24.885 111.853 1.00 93.84  ? 60  TYR A CD2 1 
ATOM   296  C  CE1 . TYR A 1 41  ? -16.445 26.331 109.558 1.00 93.16  ? 60  TYR A CE1 1 
ATOM   297  C  CE2 . TYR A 1 41  ? -17.018 24.634 111.178 1.00 91.73  ? 60  TYR A CE2 1 
ATOM   298  C  CZ  . TYR A 1 41  ? -17.325 25.354 110.033 1.00 93.02  ? 60  TYR A CZ  1 
ATOM   299  O  OH  . TYR A 1 41  ? -18.502 25.084 109.374 1.00 94.78  ? 60  TYR A OH  1 
ATOM   300  N  N   . TYR A 1 42  ? -14.911 26.422 115.094 1.00 90.28  ? 61  TYR A N   1 
ATOM   301  C  CA  . TYR A 1 42  ? -16.045 26.276 116.022 1.00 88.14  ? 61  TYR A CA  1 
ATOM   302  C  C   . TYR A 1 42  ? -16.410 27.617 116.670 1.00 89.50  ? 61  TYR A C   1 
ATOM   303  O  O   . TYR A 1 42  ? -17.581 27.991 116.675 1.00 88.93  ? 61  TYR A O   1 
ATOM   304  C  CB  . TYR A 1 42  ? -15.770 25.199 117.099 1.00 87.40  ? 61  TYR A CB  1 
ATOM   305  C  CG  . TYR A 1 42  ? -16.828 25.111 118.184 1.00 86.68  ? 61  TYR A CG  1 
ATOM   306  C  CD1 . TYR A 1 42  ? -17.961 24.309 118.028 1.00 87.19  ? 61  TYR A CD1 1 
ATOM   307  C  CD2 . TYR A 1 42  ? -16.706 25.852 119.363 1.00 88.13  ? 61  TYR A CD2 1 
ATOM   308  C  CE1 . TYR A 1 42  ? -18.939 24.241 119.020 1.00 87.49  ? 61  TYR A CE1 1 
ATOM   309  C  CE2 . TYR A 1 42  ? -17.674 25.790 120.363 1.00 91.65  ? 61  TYR A CE2 1 
ATOM   310  C  CZ  . TYR A 1 42  ? -18.792 24.984 120.188 1.00 92.06  ? 61  TYR A CZ  1 
ATOM   311  O  OH  . TYR A 1 42  ? -19.749 24.927 121.178 1.00 96.76  ? 61  TYR A OH  1 
ATOM   312  N  N   . TRP A 1 43  ? -15.407 28.326 117.195 1.00 91.64  ? 62  TRP A N   1 
ATOM   313  C  CA  . TRP A 1 43  ? -15.627 29.623 117.858 1.00 92.76  ? 62  TRP A CA  1 
ATOM   314  C  C   . TRP A 1 43  ? -16.051 30.742 116.946 1.00 95.73  ? 62  TRP A C   1 
ATOM   315  O  O   . TRP A 1 43  ? -16.916 31.537 117.319 1.00 97.63  ? 62  TRP A O   1 
ATOM   316  C  CB  . TRP A 1 43  ? -14.394 30.072 118.648 1.00 93.58  ? 62  TRP A CB  1 
ATOM   317  C  CG  . TRP A 1 43  ? -14.035 29.148 119.785 1.00 93.65  ? 62  TRP A CG  1 
ATOM   318  C  CD1 . TRP A 1 43  ? -12.873 28.396 119.938 1.00 94.07  ? 62  TRP A CD1 1 
ATOM   319  C  CD2 . TRP A 1 43  ? -14.864 28.805 120.947 1.00 92.20  ? 62  TRP A CD2 1 
ATOM   320  N  NE1 . TRP A 1 43  ? -12.909 27.660 121.096 1.00 95.38  ? 62  TRP A NE1 1 
ATOM   321  C  CE2 . TRP A 1 43  ? -14.073 27.852 121.746 1.00 93.43  ? 62  TRP A CE2 1 
ATOM   322  C  CE3 . TRP A 1 43  ? -16.132 29.184 121.401 1.00 91.90  ? 62  TRP A CE3 1 
ATOM   323  C  CZ2 . TRP A 1 43  ? -14.552 27.314 122.937 1.00 91.78  ? 62  TRP A CZ2 1 
ATOM   324  C  CZ3 . TRP A 1 43  ? -16.606 28.630 122.605 1.00 92.70  ? 62  TRP A CZ3 1 
ATOM   325  C  CH2 . TRP A 1 43  ? -15.831 27.718 123.353 1.00 92.58  ? 62  TRP A CH2 1 
ATOM   326  N  N   . THR A 1 44  ? -15.463 30.810 115.750 1.00 97.80  ? 63  THR A N   1 
ATOM   327  C  CA  . THR A 1 44  ? -15.753 31.886 114.787 1.00 101.22 ? 63  THR A CA  1 
ATOM   328  C  C   . THR A 1 44  ? -16.987 31.685 113.898 1.00 103.42 ? 63  THR A C   1 
ATOM   329  O  O   . THR A 1 44  ? -17.814 32.593 113.794 1.00 108.75 ? 63  THR A O   1 
ATOM   330  C  CB  . THR A 1 44  ? -14.537 32.152 113.871 1.00 101.54 ? 63  THR A CB  1 
ATOM   331  O  OG1 . THR A 1 44  ? -14.155 30.934 113.223 1.00 104.22 ? 63  THR A OG1 1 
ATOM   332  C  CG2 . THR A 1 44  ? -13.360 32.673 114.672 1.00 102.93 ? 63  THR A CG2 1 
ATOM   333  N  N   . ASN A 1 45  ? -17.114 30.504 113.285 1.00 102.77 ? 64  ASN A N   1 
ATOM   334  C  CA  . ASN A 1 45  ? -18.194 30.209 112.311 1.00 101.77 ? 64  ASN A CA  1 
ATOM   335  C  C   . ASN A 1 45  ? -19.449 29.435 112.748 1.00 100.61 ? 64  ASN A C   1 
ATOM   336  O  O   . ASN A 1 45  ? -20.521 29.668 112.180 1.00 98.47  ? 64  ASN A O   1 
ATOM   337  C  CB  . ASN A 1 45  ? -17.590 29.485 111.092 1.00 104.26 ? 64  ASN A CB  1 
ATOM   338  C  CG  . ASN A 1 45  ? -16.534 30.315 110.373 1.00 109.63 ? 64  ASN A CG  1 
ATOM   339  O  OD1 . ASN A 1 45  ? -15.740 31.015 111.002 1.00 112.53 ? 64  ASN A OD1 1 
ATOM   340  N  ND2 . ASN A 1 45  ? -16.503 30.215 109.046 1.00 112.94 ? 64  ASN A ND2 1 
ATOM   341  N  N   . VAL A 1 46  ? -19.332 28.524 113.719 1.00 98.63  ? 65  VAL A N   1 
ATOM   342  C  CA  . VAL A 1 46  ? -20.481 27.692 114.147 1.00 95.76  ? 65  VAL A CA  1 
ATOM   343  C  C   . VAL A 1 46  ? -21.536 28.470 114.953 1.00 96.89  ? 65  VAL A C   1 
ATOM   344  O  O   . VAL A 1 46  ? -21.196 29.258 115.836 1.00 98.26  ? 65  VAL A O   1 
ATOM   345  C  CB  . VAL A 1 46  ? -20.016 26.423 114.919 1.00 93.62  ? 65  VAL A CB  1 
ATOM   346  C  CG1 . VAL A 1 46  ? -21.191 25.618 115.474 1.00 90.34  ? 65  VAL A CG1 1 
ATOM   347  C  CG2 . VAL A 1 46  ? -19.159 25.551 114.012 1.00 90.46  ? 65  VAL A CG2 1 
ATOM   348  N  N   . ASP A 1 47  ? -22.812 28.242 114.617 1.00 97.65  ? 66  ASP A N   1 
ATOM   349  C  CA  . ASP A 1 47  ? -23.958 28.848 115.308 1.00 97.79  ? 66  ASP A CA  1 
ATOM   350  C  C   . ASP A 1 47  ? -24.118 28.030 116.592 1.00 98.23  ? 66  ASP A C   1 
ATOM   351  O  O   . ASP A 1 47  ? -24.444 26.845 116.522 1.00 94.83  ? 66  ASP A O   1 
ATOM   352  C  CB  . ASP A 1 47  ? -25.228 28.767 114.430 1.00 96.31  ? 66  ASP A CB  1 
ATOM   353  C  CG  . ASP A 1 47  ? -26.475 29.393 115.082 1.00 97.89  ? 66  ASP A CG  1 
ATOM   354  O  OD1 . ASP A 1 47  ? -26.407 29.927 116.210 1.00 97.82  ? 66  ASP A OD1 1 
ATOM   355  O  OD2 . ASP A 1 47  ? -27.549 29.355 114.440 1.00 97.84  ? 66  ASP A OD2 1 
ATOM   356  N  N   . LYS A 1 48  ? -23.903 28.670 117.744 1.00 100.32 ? 67  LYS A N   1 
ATOM   357  C  CA  . LYS A 1 48  ? -23.994 27.993 119.056 1.00 103.24 ? 67  LYS A CA  1 
ATOM   358  C  C   . LYS A 1 48  ? -25.429 27.611 119.483 1.00 106.28 ? 67  LYS A C   1 
ATOM   359  O  O   . LYS A 1 48  ? -25.595 26.750 120.354 1.00 102.84 ? 67  LYS A O   1 
ATOM   360  C  CB  . LYS A 1 48  ? -23.303 28.812 120.170 1.00 104.50 ? 67  LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 48  ? -21.867 29.260 119.882 1.00 103.52 ? 67  LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 48  ? -20.926 28.132 119.469 1.00 102.07 ? 67  LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 48  ? -19.518 28.648 119.210 1.00 104.97 ? 67  LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 48  ? -19.446 29.633 118.092 1.00 108.18 ? 67  LYS A NZ  1 
ATOM   365  N  N   . ASN A 1 49  ? -26.443 28.241 118.875 1.00 111.30 ? 68  ASN A N   1 
ATOM   366  C  CA  . ASN A 1 49  ? -27.865 27.951 119.153 1.00 114.22 ? 68  ASN A CA  1 
ATOM   367  C  C   . ASN A 1 49  ? -28.466 26.764 118.357 1.00 110.45 ? 68  ASN A C   1 
ATOM   368  O  O   . ASN A 1 49  ? -29.647 26.445 118.544 1.00 114.37 ? 68  ASN A O   1 
ATOM   369  C  CB  . ASN A 1 49  ? -28.722 29.220 118.934 1.00 118.70 ? 68  ASN A CB  1 
ATOM   370  C  CG  . ASN A 1 49  ? -28.365 30.357 119.888 1.00 121.50 ? 68  ASN A CG  1 
ATOM   371  O  OD1 . ASN A 1 49  ? -27.666 30.169 120.883 1.00 122.34 ? 68  ASN A OD1 1 
ATOM   372  N  ND2 . ASN A 1 49  ? -28.872 31.547 119.593 1.00 128.13 ? 68  ASN A ND2 1 
ATOM   373  N  N   . SER A 1 50  ? -27.674 26.112 117.498 1.00 103.94 ? 69  SER A N   1 
ATOM   374  C  CA  . SER A 1 50  ? -28.148 24.969 116.690 1.00 103.03 ? 69  SER A CA  1 
ATOM   375  C  C   . SER A 1 50  ? -27.893 23.638 117.396 1.00 98.60  ? 69  SER A C   1 
ATOM   376  O  O   . SER A 1 50  ? -27.099 23.569 118.334 1.00 99.78  ? 69  SER A O   1 
ATOM   377  C  CB  . SER A 1 50  ? -27.472 24.954 115.310 1.00 99.13  ? 69  SER A CB  1 
ATOM   378  O  OG  . SER A 1 50  ? -26.069 24.773 115.418 1.00 97.22  ? 69  SER A OG  1 
ATOM   379  N  N   . GLU A 1 51  ? -28.576 22.592 116.930 1.00 97.69  ? 70  GLU A N   1 
ATOM   380  C  CA  . GLU A 1 51  ? -28.415 21.235 117.477 1.00 95.46  ? 70  GLU A CA  1 
ATOM   381  C  C   . GLU A 1 51  ? -27.033 20.660 117.126 1.00 93.37  ? 70  GLU A C   1 
ATOM   382  O  O   . GLU A 1 51  ? -26.426 19.967 117.949 1.00 90.15  ? 70  GLU A O   1 
ATOM   383  C  CB  . GLU A 1 51  ? -29.525 20.297 116.984 1.00 94.49  ? 70  GLU A CB  1 
ATOM   384  N  N   . ILE A 1 52  ? -26.551 20.960 115.913 1.00 91.78  ? 71  ILE A N   1 
ATOM   385  C  CA  . ILE A 1 52  ? -25.229 20.511 115.428 1.00 92.81  ? 71  ILE A CA  1 
ATOM   386  C  C   . ILE A 1 52  ? -24.066 21.033 116.296 1.00 93.64  ? 71  ILE A C   1 
ATOM   387  O  O   . ILE A 1 52  ? -23.053 20.351 116.422 1.00 92.93  ? 71  ILE A O   1 
ATOM   388  C  CB  . ILE A 1 52  ? -25.015 20.870 113.922 1.00 96.12  ? 71  ILE A CB  1 
ATOM   389  C  CG1 . ILE A 1 52  ? -23.799 20.157 113.308 1.00 98.19  ? 71  ILE A CG1 1 
ATOM   390  C  CG2 . ILE A 1 52  ? -24.903 22.373 113.707 1.00 95.78  ? 71  ILE A CG2 1 
ATOM   391  C  CD1 . ILE A 1 52  ? -23.903 18.649 113.282 1.00 99.28  ? 71  ILE A CD1 1 
ATOM   392  N  N   . SER A 1 53  ? -24.221 22.226 116.883 1.00 95.20  ? 72  SER A N   1 
ATOM   393  C  CA  . SER A 1 53  ? -23.217 22.838 117.787 1.00 96.43  ? 72  SER A CA  1 
ATOM   394  C  C   . SER A 1 53  ? -22.704 21.877 118.864 1.00 90.18  ? 72  SER A C   1 
ATOM   395  O  O   . SER A 1 53  ? -21.497 21.751 119.064 1.00 84.69  ? 72  SER A O   1 
ATOM   396  C  CB  . SER A 1 53  ? -23.813 24.054 118.501 1.00 99.31  ? 72  SER A CB  1 
ATOM   397  O  OG  . SER A 1 53  ? -22.852 24.689 119.320 1.00 109.46 ? 72  SER A OG  1 
ATOM   398  N  N   . SER A 1 54  ? -23.639 21.211 119.539 1.00 90.97  ? 73  SER A N   1 
ATOM   399  C  CA  . SER A 1 54  ? -23.315 20.241 120.596 1.00 93.02  ? 73  SER A CA  1 
ATOM   400  C  C   . SER A 1 54  ? -22.551 19.023 120.077 1.00 90.53  ? 73  SER A C   1 
ATOM   401  O  O   . SER A 1 54  ? -21.687 18.501 120.784 1.00 93.10  ? 73  SER A O   1 
ATOM   402  C  CB  . SER A 1 54  ? -24.578 19.799 121.337 1.00 95.91  ? 73  SER A CB  1 
ATOM   403  O  OG  . SER A 1 54  ? -25.186 20.909 121.972 1.00 98.99  ? 73  SER A OG  1 
ATOM   404  N  N   . LYS A 1 55  ? -22.863 18.582 118.855 1.00 93.57  ? 74  LYS A N   1 
ATOM   405  C  CA  . LYS A 1 55  ? -22.165 17.448 118.230 1.00 92.64  ? 74  LYS A CA  1 
ATOM   406  C  C   . LYS A 1 55  ? -20.710 17.834 117.981 1.00 89.71  ? 74  LYS A C   1 
ATOM   407  O  O   . LYS A 1 55  ? -19.815 17.086 118.347 1.00 87.16  ? 74  LYS A O   1 
ATOM   408  C  CB  . LYS A 1 55  ? -22.797 17.028 116.895 1.00 94.96  ? 74  LYS A CB  1 
ATOM   409  C  CG  . LYS A 1 55  ? -24.237 16.544 116.956 1.00 101.40 ? 74  LYS A CG  1 
ATOM   410  C  CD  . LYS A 1 55  ? -24.364 15.188 117.622 1.00 107.53 ? 74  LYS A CD  1 
ATOM   411  C  CE  . LYS A 1 55  ? -25.803 14.699 117.565 1.00 113.87 ? 74  LYS A CE  1 
ATOM   412  N  NZ  . LYS A 1 55  ? -25.961 13.357 118.187 1.00 118.24 ? 74  LYS A NZ  1 
ATOM   413  N  N   . LEU A 1 56  ? -20.493 19.015 117.391 1.00 89.69  ? 75  LEU A N   1 
ATOM   414  C  CA  . LEU A 1 56  ? -19.137 19.513 117.079 1.00 86.04  ? 75  LEU A CA  1 
ATOM   415  C  C   . LEU A 1 56  ? -18.289 19.756 118.348 1.00 82.53  ? 75  LEU A C   1 
ATOM   416  O  O   . LEU A 1 56  ? -17.095 19.445 118.358 1.00 80.17  ? 75  LEU A O   1 
ATOM   417  C  CB  . LEU A 1 56  ? -19.188 20.779 116.199 1.00 83.41  ? 75  LEU A CB  1 
ATOM   418  C  CG  . LEU A 1 56  ? -19.938 20.727 114.848 1.00 85.34  ? 75  LEU A CG  1 
ATOM   419  C  CD1 . LEU A 1 56  ? -19.815 22.057 114.114 1.00 82.31  ? 75  LEU A CD1 1 
ATOM   420  C  CD2 . LEU A 1 56  ? -19.458 19.597 113.949 1.00 81.50  ? 75  LEU A CD2 1 
ATOM   421  N  N   . ALA A 1 57  ? -18.909 20.295 119.398 1.00 82.24  ? 76  ALA A N   1 
ATOM   422  C  CA  . ALA A 1 57  ? -18.228 20.547 120.690 1.00 83.40  ? 76  ALA A CA  1 
ATOM   423  C  C   . ALA A 1 57  ? -17.777 19.245 121.381 1.00 86.64  ? 76  ALA A C   1 
ATOM   424  O  O   . ALA A 1 57  ? -16.691 19.201 121.979 1.00 86.79  ? 76  ALA A O   1 
ATOM   425  C  CB  . ALA A 1 57  ? -19.122 21.354 121.624 1.00 80.30  ? 76  ALA A CB  1 
ATOM   426  N  N   . THR A 1 58  ? -18.617 18.207 121.298 1.00 89.40  ? 77  THR A N   1 
ATOM   427  C  CA  . THR A 1 58  ? -18.329 16.885 121.880 1.00 92.39  ? 77  THR A CA  1 
ATOM   428  C  C   . THR A 1 58  ? -17.111 16.231 121.210 1.00 93.54  ? 77  THR A C   1 
ATOM   429  O  O   . THR A 1 58  ? -16.303 15.608 121.897 1.00 93.78  ? 77  THR A O   1 
ATOM   430  C  CB  . THR A 1 58  ? -19.551 15.935 121.782 1.00 95.55  ? 77  THR A CB  1 
ATOM   431  O  OG1 . THR A 1 58  ? -20.681 16.538 122.425 1.00 96.65  ? 77  THR A OG1 1 
ATOM   432  C  CG2 . THR A 1 58  ? -19.268 14.582 122.439 1.00 92.33  ? 77  THR A CG2 1 
ATOM   433  N  N   . GLU A 1 59  ? -16.982 16.387 119.889 1.00 91.82  ? 78  GLU A N   1 
ATOM   434  C  CA  . GLU A 1 59  ? -15.842 15.822 119.138 1.00 93.91  ? 78  GLU A CA  1 
ATOM   435  C  C   . GLU A 1 59  ? -14.510 16.464 119.546 1.00 89.84  ? 78  GLU A C   1 
ATOM   436  O  O   . GLU A 1 59  ? -13.502 15.763 119.660 1.00 92.87  ? 78  GLU A O   1 
ATOM   437  C  CB  . GLU A 1 59  ? -16.035 15.940 117.617 1.00 97.30  ? 78  GLU A CB  1 
ATOM   438  C  CG  . GLU A 1 59  ? -17.272 15.242 117.048 1.00 103.41 ? 78  GLU A CG  1 
ATOM   439  C  CD  . GLU A 1 59  ? -17.323 13.734 117.258 1.00 106.83 ? 78  GLU A CD  1 
ATOM   440  O  OE1 . GLU A 1 59  ? -16.285 13.098 117.541 1.00 110.55 ? 78  GLU A OE1 1 
ATOM   441  O  OE2 . GLU A 1 59  ? -18.427 13.164 117.109 1.00 103.29 ? 78  GLU A OE2 1 
ATOM   442  N  N   . LEU A 1 60  ? -14.505 17.785 119.746 1.00 84.88  ? 79  LEU A N   1 
ATOM   443  C  CA  . LEU A 1 60  ? -13.303 18.498 120.214 1.00 85.81  ? 79  LEU A CA  1 
ATOM   444  C  C   . LEU A 1 60  ? -12.950 18.088 121.659 1.00 84.58  ? 79  LEU A C   1 
ATOM   445  O  O   . LEU A 1 60  ? -11.775 17.864 121.954 1.00 83.48  ? 79  LEU A O   1 
ATOM   446  C  CB  . LEU A 1 60  ? -13.455 20.025 120.079 1.00 85.97  ? 79  LEU A CB  1 
ATOM   447  C  CG  . LEU A 1 60  ? -13.434 20.546 118.632 1.00 85.16  ? 79  LEU A CG  1 
ATOM   448  C  CD1 . LEU A 1 60  ? -13.940 21.976 118.535 1.00 85.79  ? 79  LEU A CD1 1 
ATOM   449  C  CD2 . LEU A 1 60  ? -12.041 20.428 118.026 1.00 83.69  ? 79  LEU A CD2 1 
ATOM   450  N  N   . ALA A 1 61  ? -13.962 17.952 122.526 1.00 84.07  ? 80  ALA A N   1 
ATOM   451  C  CA  . ALA A 1 61  ? -13.759 17.527 123.930 1.00 86.77  ? 80  ALA A CA  1 
ATOM   452  C  C   . ALA A 1 61  ? -13.108 16.141 124.002 1.00 89.59  ? 80  ALA A C   1 
ATOM   453  O  O   . ALA A 1 61  ? -12.130 15.955 124.725 1.00 89.33  ? 80  ALA A O   1 
ATOM   454  C  CB  . ALA A 1 61  ? -15.071 17.531 124.706 1.00 85.69  ? 80  ALA A CB  1 
ATOM   455  N  N   . LEU A 1 62  ? -13.649 15.192 123.233 1.00 91.97  ? 81  LEU A N   1 
ATOM   456  C  CA  . LEU A 1 62  ? -13.110 13.822 123.148 1.00 92.72  ? 81  LEU A CA  1 
ATOM   457  C  C   . LEU A 1 62  ? -11.684 13.803 122.586 1.00 95.68  ? 81  LEU A C   1 
ATOM   458  O  O   . LEU A 1 62  ? -10.841 13.053 123.086 1.00 102.12 ? 81  LEU A O   1 
ATOM   459  C  CB  . LEU A 1 62  ? -14.006 12.929 122.275 1.00 94.83  ? 81  LEU A CB  1 
ATOM   460  C  CG  . LEU A 1 62  ? -15.389 12.569 122.825 1.00 94.67  ? 81  LEU A CG  1 
ATOM   461  C  CD1 . LEU A 1 62  ? -16.291 12.036 121.715 1.00 93.12  ? 81  LEU A CD1 1 
ATOM   462  C  CD2 . LEU A 1 62  ? -15.280 11.582 123.984 1.00 94.91  ? 81  LEU A CD2 1 
ATOM   463  N  N   . ALA A 1 63  ? -11.431 14.632 121.567 1.00 91.12  ? 82  ALA A N   1 
ATOM   464  C  CA  . ALA A 1 63  ? -10.112 14.733 120.922 1.00 93.05  ? 82  ALA A CA  1 
ATOM   465  C  C   . ALA A 1 63  ? -9.030  15.238 121.883 1.00 93.61  ? 82  ALA A C   1 
ATOM   466  O  O   . ALA A 1 63  ? -7.962  14.631 121.955 1.00 97.91  ? 82  ALA A O   1 
ATOM   467  C  CB  . ALA A 1 63  ? -10.175 15.600 119.662 1.00 90.66  ? 82  ALA A CB  1 
ATOM   468  N  N   . TYR A 1 64  ? -9.300  16.323 122.614 1.00 93.51  ? 83  TYR A N   1 
ATOM   469  C  CA  . TYR A 1 64  ? -8.330  16.848 123.615 1.00 95.92  ? 83  TYR A CA  1 
ATOM   470  C  C   . TYR A 1 64  ? -8.105  15.894 124.804 1.00 95.79  ? 83  TYR A C   1 
ATOM   471  O  O   . TYR A 1 64  ? -6.994  15.837 125.335 1.00 95.35  ? 83  TYR A O   1 
ATOM   472  C  CB  . TYR A 1 64  ? -8.697  18.253 124.122 1.00 94.69  ? 83  TYR A CB  1 
ATOM   473  C  CG  . TYR A 1 64  ? -8.471  19.347 123.103 1.00 96.02  ? 83  TYR A CG  1 
ATOM   474  C  CD1 . TYR A 1 64  ? -7.172  19.703 122.717 1.00 97.68  ? 83  TYR A CD1 1 
ATOM   475  C  CD2 . TYR A 1 64  ? -9.544  20.065 122.552 1.00 95.61  ? 83  TYR A CD2 1 
ATOM   476  C  CE1 . TYR A 1 64  ? -6.949  20.712 121.785 1.00 101.39 ? 83  TYR A CE1 1 
ATOM   477  C  CE2 . TYR A 1 64  ? -9.331  21.084 121.628 1.00 96.93  ? 83  TYR A CE2 1 
ATOM   478  C  CZ  . TYR A 1 64  ? -8.035  21.403 121.246 1.00 99.86  ? 83  TYR A CZ  1 
ATOM   479  O  OH  . TYR A 1 64  ? -7.820  22.398 120.332 1.00 102.33 ? 83  TYR A OH  1 
ATOM   480  N  N   . LYS A 1 65  ? -9.156  15.170 125.208 1.00 95.91  ? 84  LYS A N   1 
ATOM   481  C  CA  . LYS A 1 65  ? -9.085  14.169 126.289 1.00 97.01  ? 84  LYS A CA  1 
ATOM   482  C  C   . LYS A 1 65  ? -8.124  13.027 125.920 1.00 101.83 ? 84  LYS A C   1 
ATOM   483  O  O   . LYS A 1 65  ? -7.379  12.555 126.778 1.00 104.85 ? 84  LYS A O   1 
ATOM   484  C  CB  . LYS A 1 65  ? -10.482 13.620 126.643 1.00 94.90  ? 84  LYS A CB  1 
ATOM   485  C  CG  . LYS A 1 65  ? -10.501 12.576 127.762 1.00 96.06  ? 84  LYS A CG  1 
ATOM   486  C  CD  . LYS A 1 65  ? -11.903 12.293 128.299 1.00 95.89  ? 84  LYS A CD  1 
ATOM   487  C  CE  . LYS A 1 65  ? -12.859 11.684 127.283 1.00 95.07  ? 84  LYS A CE  1 
ATOM   488  N  NZ  . LYS A 1 65  ? -12.404 10.371 126.745 1.00 97.95  ? 84  LYS A NZ  1 
ATOM   489  N  N   . LYS A 1 66  ? -8.158  12.587 124.659 1.00 106.35 ? 85  LYS A N   1 
ATOM   490  C  CA  . LYS A 1 66  ? -7.244  11.541 124.173 1.00 110.37 ? 85  LYS A CA  1 
ATOM   491  C  C   . LYS A 1 66  ? -5.811  12.077 124.013 1.00 113.38 ? 85  LYS A C   1 
ATOM   492  O  O   . LYS A 1 66  ? -4.864  11.325 124.220 1.00 116.63 ? 85  LYS A O   1 
ATOM   493  C  CB  . LYS A 1 66  ? -7.760  10.886 122.888 1.00 112.63 ? 85  LYS A CB  1 
ATOM   494  C  CG  . LYS A 1 66  ? -9.049  10.102 123.111 1.00 114.48 ? 85  LYS A CG  1 
ATOM   495  C  CD  . LYS A 1 66  ? -9.622  9.479  121.842 1.00 117.87 ? 85  LYS A CD  1 
ATOM   496  C  CE  . LYS A 1 66  ? -8.772  8.328  121.323 1.00 121.99 ? 85  LYS A CE  1 
ATOM   497  N  NZ  . LYS A 1 66  ? -9.384  7.658  120.141 1.00 126.48 ? 85  LYS A NZ  1 
ATOM   498  N  N   . ASN A 1 67  ? -5.659  13.368 123.689 1.00 113.08 ? 86  ASN A N   1 
ATOM   499  C  CA  . ASN A 1 67  ? -4.332  14.016 123.549 1.00 117.05 ? 86  ASN A CA  1 
ATOM   500  C  C   . ASN A 1 67  ? -3.664  14.438 124.878 1.00 116.13 ? 86  ASN A C   1 
ATOM   501  O  O   . ASN A 1 67  ? -2.551  14.972 124.855 1.00 118.23 ? 86  ASN A O   1 
ATOM   502  C  CB  . ASN A 1 67  ? -4.430  15.256 122.633 1.00 119.87 ? 86  ASN A CB  1 
ATOM   503  C  CG  . ASN A 1 67  ? -4.869  14.926 121.211 1.00 122.58 ? 86  ASN A CG  1 
ATOM   504  O  OD1 . ASN A 1 67  ? -4.852  13.771 120.772 1.00 124.57 ? 86  ASN A OD1 1 
ATOM   505  N  ND2 . ASN A 1 67  ? -5.256  15.960 120.475 1.00 125.24 ? 86  ASN A ND2 1 
ATOM   506  N  N   . ARG A 1 68  ? -4.337  14.208 126.014 1.00 113.14 ? 87  ARG A N   1 
ATOM   507  C  CA  . ARG A 1 68  ? -3.850  14.563 127.361 1.00 111.96 ? 87  ARG A CA  1 
ATOM   508  C  C   . ARG A 1 68  ? -3.786  16.078 127.641 1.00 109.85 ? 87  ARG A C   1 
ATOM   509  O  O   . ARG A 1 68  ? -3.092  16.499 128.572 1.00 113.85 ? 87  ARG A O   1 
ATOM   510  C  CB  . ARG A 1 68  ? -2.508  13.871 127.679 1.00 115.77 ? 87  ARG A CB  1 
ATOM   511  N  N   . ASN A 1 69  ? -4.522  16.878 126.859 1.00 105.78 ? 88  ASN A N   1 
ATOM   512  C  CA  . ASN A 1 69  ? -4.603  18.334 127.025 1.00 104.79 ? 88  ASN A CA  1 
ATOM   513  C  C   . ASN A 1 69  ? -5.885  18.524 127.827 1.00 100.75 ? 88  ASN A C   1 
ATOM   514  O  O   . ASN A 1 69  ? -6.948  18.819 127.277 1.00 97.99  ? 88  ASN A O   1 
ATOM   515  C  CB  . ASN A 1 69  ? -4.631  19.046 125.659 1.00 104.02 ? 88  ASN A CB  1 
ATOM   516  C  CG  . ASN A 1 69  ? -4.669  20.573 125.764 1.00 104.09 ? 88  ASN A CG  1 
ATOM   517  O  OD1 . ASN A 1 69  ? -4.797  21.156 126.842 1.00 100.96 ? 88  ASN A OD1 1 
ATOM   518  N  ND2 . ASN A 1 69  ? -4.559  21.227 124.614 1.00 109.40 ? 88  ASN A ND2 1 
ATOM   519  N  N   . TYR A 1 70  ? -5.760  18.353 129.140 1.00 103.16 ? 89  TYR A N   1 
ATOM   520  C  CA  . TYR A 1 70  ? -6.910  18.433 130.053 1.00 101.93 ? 89  TYR A CA  1 
ATOM   521  C  C   . TYR A 1 70  ? -7.516  19.840 130.219 1.00 100.68 ? 89  TYR A C   1 
ATOM   522  O  O   . TYR A 1 70  ? -8.685  19.948 130.600 1.00 99.53  ? 89  TYR A O   1 
ATOM   523  C  CB  . TYR A 1 70  ? -6.587  17.794 131.407 1.00 104.07 ? 89  TYR A CB  1 
ATOM   524  C  CG  . TYR A 1 70  ? -6.088  16.359 131.305 1.00 107.66 ? 89  TYR A CG  1 
ATOM   525  C  CD1 . TYR A 1 70  ? -6.935  15.332 130.862 1.00 105.07 ? 89  TYR A CD1 1 
ATOM   526  C  CD2 . TYR A 1 70  ? -4.771  16.018 131.673 1.00 111.38 ? 89  TYR A CD2 1 
ATOM   527  C  CE1 . TYR A 1 70  ? -6.485  14.014 130.767 1.00 107.87 ? 89  TYR A CE1 1 
ATOM   528  C  CE2 . TYR A 1 70  ? -4.314  14.699 131.588 1.00 111.35 ? 89  TYR A CE2 1 
ATOM   529  C  CZ  . TYR A 1 70  ? -5.172  13.700 131.137 1.00 110.41 ? 89  TYR A CZ  1 
ATOM   530  O  OH  . TYR A 1 70  ? -4.729  12.401 131.049 1.00 110.91 ? 89  TYR A OH  1 
ATOM   531  N  N   . ASP A 1 71  ? -6.743  20.896 129.933 1.00 101.86 ? 90  ASP A N   1 
ATOM   532  C  CA  . ASP A 1 71  ? -7.242  22.288 129.991 1.00 102.33 ? 90  ASP A CA  1 
ATOM   533  C  C   . ASP A 1 71  ? -8.278  22.517 128.870 1.00 98.18  ? 90  ASP A C   1 
ATOM   534  O  O   . ASP A 1 71  ? -9.373  23.024 129.126 1.00 95.19  ? 90  ASP A O   1 
ATOM   535  C  CB  . ASP A 1 71  ? -6.106  23.316 129.840 1.00 105.34 ? 90  ASP A CB  1 
ATOM   536  C  CG  . ASP A 1 71  ? -5.076  23.262 130.968 1.00 112.19 ? 90  ASP A CG  1 
ATOM   537  O  OD1 . ASP A 1 71  ? -5.384  22.820 132.101 1.00 109.14 ? 90  ASP A OD1 1 
ATOM   538  O  OD2 . ASP A 1 71  ? -3.939  23.707 130.711 1.00 120.13 ? 90  ASP A OD2 1 
ATOM   539  N  N   . LYS A 1 72  ? -7.923  22.141 127.642 1.00 97.41  ? 91  LYS A N   1 
ATOM   540  C  CA  . LYS A 1 72  ? -8.837  22.279 126.485 1.00 98.68  ? 91  LYS A CA  1 
ATOM   541  C  C   . LYS A 1 72  ? -10.054 21.349 126.580 1.00 95.05  ? 91  LYS A C   1 
ATOM   542  O  O   . LYS A 1 72  ? -11.152 21.755 126.213 1.00 93.38  ? 91  LYS A O   1 
ATOM   543  C  CB  . LYS A 1 72  ? -8.107  22.076 125.151 1.00 100.17 ? 91  LYS A CB  1 
ATOM   544  C  CG  . LYS A 1 72  ? -7.159  23.199 124.753 1.00 106.01 ? 91  LYS A CG  1 
ATOM   545  C  CD  . LYS A 1 72  ? -7.906  24.455 124.317 1.00 108.46 ? 91  LYS A CD  1 
ATOM   546  C  CE  . LYS A 1 72  ? -6.955  25.529 123.814 1.00 112.64 ? 91  LYS A CE  1 
ATOM   547  N  NZ  . LYS A 1 72  ? -7.684  26.743 123.354 1.00 114.28 ? 91  LYS A NZ  1 
ATOM   548  N  N   . ALA A 1 73  ? -9.856  20.121 127.077 1.00 93.49  ? 92  ALA A N   1 
ATOM   549  C  CA  . ALA A 1 73  ? -10.952 19.142 127.256 1.00 91.53  ? 92  ALA A CA  1 
ATOM   550  C  C   . ALA A 1 73  ? -12.032 19.685 128.192 1.00 91.33  ? 92  ALA A C   1 
ATOM   551  O  O   . ALA A 1 73  ? -13.223 19.528 127.926 1.00 91.04  ? 92  ALA A O   1 
ATOM   552  C  CB  . ALA A 1 73  ? -10.420 17.818 127.785 1.00 92.47  ? 92  ALA A CB  1 
ATOM   553  N  N   . TYR A 1 74  ? -11.592 20.331 129.274 1.00 96.63  ? 93  TYR A N   1 
ATOM   554  C  CA  . TYR A 1 74  ? -12.487 20.957 130.253 1.00 94.75  ? 93  TYR A CA  1 
ATOM   555  C  C   . TYR A 1 74  ? -13.274 22.112 129.628 1.00 91.24  ? 93  TYR A C   1 
ATOM   556  O  O   . TYR A 1 74  ? -14.477 22.215 129.864 1.00 90.30  ? 93  TYR A O   1 
ATOM   557  C  CB  . TYR A 1 74  ? -11.707 21.438 131.488 1.00 96.62  ? 93  TYR A CB  1 
ATOM   558  C  CG  . TYR A 1 74  ? -12.553 22.192 132.492 1.00 99.61  ? 93  TYR A CG  1 
ATOM   559  C  CD1 . TYR A 1 74  ? -13.480 21.519 133.297 1.00 99.61  ? 93  TYR A CD1 1 
ATOM   560  C  CD2 . TYR A 1 74  ? -12.431 23.580 132.643 1.00 102.67 ? 93  TYR A CD2 1 
ATOM   561  C  CE1 . TYR A 1 74  ? -14.270 22.204 134.213 1.00 101.24 ? 93  TYR A CE1 1 
ATOM   562  C  CE2 . TYR A 1 74  ? -13.213 24.274 133.566 1.00 105.36 ? 93  TYR A CE2 1 
ATOM   563  C  CZ  . TYR A 1 74  ? -14.131 23.582 134.347 1.00 105.89 ? 93  TYR A CZ  1 
ATOM   564  O  OH  . TYR A 1 74  ? -14.903 24.249 135.270 1.00 113.02 ? 93  TYR A OH  1 
ATOM   565  N  N   . LEU A 1 75  ? -12.591 22.955 128.843 1.00 92.30  ? 94  LEU A N   1 
ATOM   566  C  CA  . LEU A 1 75  ? -13.206 24.119 128.158 1.00 94.49  ? 94  LEU A CA  1 
ATOM   567  C  C   . LEU A 1 75  ? -14.416 23.707 127.323 1.00 92.87  ? 94  LEU A C   1 
ATOM   568  O  O   . LEU A 1 75  ? -15.473 24.337 127.409 1.00 94.71  ? 94  LEU A O   1 
ATOM   569  C  CB  . LEU A 1 75  ? -12.187 24.844 127.255 1.00 95.60  ? 94  LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 75  ? -12.588 26.165 126.582 1.00 97.58  ? 94  LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 75  ? -12.886 27.244 127.613 1.00 100.11 ? 94  LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 75  ? -11.485 26.635 125.647 1.00 100.17 ? 94  LEU A CD2 1 
ATOM   573  N  N   . PHE A 1 76  ? -14.255 22.635 126.542 1.00 92.18  ? 95  PHE A N   1 
ATOM   574  C  CA  . PHE A 1 76  ? -15.336 22.121 125.698 1.00 91.98  ? 95  PHE A CA  1 
ATOM   575  C  C   . PHE A 1 76  ? -16.415 21.369 126.448 1.00 92.75  ? 95  PHE A C   1 
ATOM   576  O  O   . PHE A 1 76  ? -17.589 21.516 126.094 1.00 99.42  ? 95  PHE A O   1 
ATOM   577  C  CB  . PHE A 1 76  ? -14.803 21.388 124.467 1.00 92.86  ? 95  PHE A CB  1 
ATOM   578  C  CG  . PHE A 1 76  ? -14.248 22.331 123.460 1.00 94.52  ? 95  PHE A CG  1 
ATOM   579  C  CD1 . PHE A 1 76  ? -15.128 23.079 122.684 1.00 94.28  ? 95  PHE A CD1 1 
ATOM   580  C  CD2 . PHE A 1 76  ? -12.875 22.551 123.330 1.00 97.69  ? 95  PHE A CD2 1 
ATOM   581  C  CE1 . PHE A 1 76  ? -14.664 24.002 121.768 1.00 96.67  ? 95  PHE A CE1 1 
ATOM   582  C  CE2 . PHE A 1 76  ? -12.399 23.475 122.395 1.00 101.85 ? 95  PHE A CE2 1 
ATOM   583  C  CZ  . PHE A 1 76  ? -13.305 24.203 121.618 1.00 98.33  ? 95  PHE A CZ  1 
ATOM   584  N  N   . TYR A 1 77  ? -16.052 20.575 127.462 1.00 91.36  ? 96  TYR A N   1 
ATOM   585  C  CA  . TYR A 1 77  ? -17.080 19.914 128.286 1.00 89.41  ? 96  TYR A CA  1 
ATOM   586  C  C   . TYR A 1 77  ? -17.883 20.979 129.054 1.00 90.67  ? 96  TYR A C   1 
ATOM   587  O  O   . TYR A 1 77  ? -19.087 20.804 129.251 1.00 90.28  ? 96  TYR A O   1 
ATOM   588  C  CB  . TYR A 1 77  ? -16.532 18.801 129.202 1.00 90.39  ? 96  TYR A CB  1 
ATOM   589  C  CG  . TYR A 1 77  ? -16.216 17.493 128.481 1.00 91.56  ? 96  TYR A CG  1 
ATOM   590  C  CD1 . TYR A 1 77  ? -17.228 16.786 127.801 1.00 87.51  ? 96  TYR A CD1 1 
ATOM   591  C  CD2 . TYR A 1 77  ? -14.936 16.909 128.536 1.00 92.17  ? 96  TYR A CD2 1 
ATOM   592  C  CE1 . TYR A 1 77  ? -16.966 15.581 127.160 1.00 88.11  ? 96  TYR A CE1 1 
ATOM   593  C  CE2 . TYR A 1 77  ? -14.668 15.693 127.894 1.00 89.59  ? 96  TYR A CE2 1 
ATOM   594  C  CZ  . TYR A 1 77  ? -15.687 15.035 127.209 1.00 89.61  ? 96  TYR A CZ  1 
ATOM   595  O  OH  . TYR A 1 77  ? -15.452 13.842 126.560 1.00 94.95  ? 96  TYR A OH  1 
ATOM   596  N  N   . LYS A 1 78  ? -17.218 22.076 129.448 1.00 94.25  ? 97  LYS A N   1 
ATOM   597  C  CA  . LYS A 1 78  ? -17.867 23.221 130.113 1.00 98.27  ? 97  LYS A CA  1 
ATOM   598  C  C   . LYS A 1 78  ? -18.813 23.938 129.127 1.00 98.88  ? 97  LYS A C   1 
ATOM   599  O  O   . LYS A 1 78  ? -19.876 24.394 129.543 1.00 100.85 ? 97  LYS A O   1 
ATOM   600  C  CB  . LYS A 1 78  ? -16.826 24.202 130.692 1.00 101.27 ? 97  LYS A CB  1 
ATOM   601  C  CG  . LYS A 1 78  ? -17.397 25.350 131.520 1.00 104.96 ? 97  LYS A CG  1 
ATOM   602  C  CD  . LYS A 1 78  ? -16.305 26.295 131.999 1.00 109.09 ? 97  LYS A CD  1 
ATOM   603  C  CE  . LYS A 1 78  ? -16.893 27.482 132.749 1.00 111.27 ? 97  LYS A CE  1 
ATOM   604  N  NZ  . LYS A 1 78  ? -15.850 28.459 133.161 1.00 112.38 ? 97  LYS A NZ  1 
ATOM   605  N  N   . GLU A 1 79  ? -18.416 24.041 127.848 1.00 101.01 ? 98  GLU A N   1 
ATOM   606  C  CA  . GLU A 1 79  ? -19.255 24.641 126.780 1.00 102.22 ? 98  GLU A CA  1 
ATOM   607  C  C   . GLU A 1 79  ? -20.544 23.826 126.551 1.00 102.40 ? 98  GLU A C   1 
ATOM   608  O  O   . GLU A 1 79  ? -21.589 24.395 126.224 1.00 106.35 ? 98  GLU A O   1 
ATOM   609  C  CB  . GLU A 1 79  ? -18.480 24.771 125.461 1.00 102.01 ? 98  GLU A CB  1 
ATOM   610  N  N   . LEU A 1 80  ? -20.445 22.499 126.691 1.00 99.81  ? 99  LEU A N   1 
ATOM   611  C  CA  . LEU A 1 80  ? -21.602 21.586 126.608 1.00 97.13  ? 99  LEU A CA  1 
ATOM   612  C  C   . LEU A 1 80  ? -22.482 21.730 127.859 1.00 100.16 ? 99  LEU A C   1 
ATOM   613  O  O   . LEU A 1 80  ? -23.711 21.742 127.756 1.00 103.21 ? 99  LEU A O   1 
ATOM   614  C  CB  . LEU A 1 80  ? -21.154 20.119 126.476 1.00 91.12  ? 99  LEU A CB  1 
ATOM   615  C  CG  . LEU A 1 80  ? -20.454 19.696 125.181 1.00 89.08  ? 99  LEU A CG  1 
ATOM   616  C  CD1 . LEU A 1 80  ? -19.843 18.308 125.304 1.00 85.57  ? 99  LEU A CD1 1 
ATOM   617  C  CD2 . LEU A 1 80  ? -21.434 19.749 124.022 1.00 88.25  ? 99  LEU A CD2 1 
ATOM   618  N  N   . LEU A 1 81  ? -21.838 21.842 129.025 1.00 99.25  ? 100 LEU A N   1 
ATOM   619  C  CA  . LEU A 1 81  ? -22.525 21.979 130.322 1.00 104.69 ? 100 LEU A CA  1 
ATOM   620  C  C   . LEU A 1 81  ? -23.384 23.254 130.452 1.00 108.29 ? 100 LEU A C   1 
ATOM   621  O  O   . LEU A 1 81  ? -24.348 23.250 131.214 1.00 107.89 ? 100 LEU A O   1 
ATOM   622  C  CB  . LEU A 1 81  ? -21.513 21.885 131.483 1.00 101.60 ? 100 LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 81  ? -22.031 21.721 132.913 1.00 103.17 ? 100 LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 81  ? -22.837 20.439 133.064 1.00 101.15 ? 100 LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 81  ? -20.864 21.723 133.891 1.00 102.67 ? 100 LEU A CD2 1 
ATOM   626  N  N   . GLN A 1 82  ? -23.029 24.328 129.736 1.00 112.27 ? 101 GLN A N   1 
ATOM   627  C  CA  . GLN A 1 82  ? -23.823 25.577 129.734 1.00 117.18 ? 101 GLN A CA  1 
ATOM   628  C  C   . GLN A 1 82  ? -25.210 25.386 129.098 1.00 118.52 ? 101 GLN A C   1 
ATOM   629  O  O   . GLN A 1 82  ? -26.175 26.015 129.534 1.00 122.80 ? 101 GLN A O   1 
ATOM   630  C  CB  . GLN A 1 82  ? -23.088 26.728 129.028 1.00 123.23 ? 101 GLN A CB  1 
ATOM   631  C  CG  . GLN A 1 82  ? -21.898 27.285 129.801 1.00 128.75 ? 101 GLN A CG  1 
ATOM   632  C  CD  . GLN A 1 82  ? -21.197 28.443 129.095 1.00 133.33 ? 101 GLN A CD  1 
ATOM   633  O  OE1 . GLN A 1 82  ? -21.377 28.674 127.896 1.00 130.43 ? 101 GLN A OE1 1 
ATOM   634  N  NE2 . GLN A 1 82  ? -20.377 29.172 129.844 1.00 139.68 ? 101 GLN A NE2 1 
ATOM   635  N  N   . LYS A 1 83  ? -25.293 24.534 128.072 1.00 118.88 ? 102 LYS A N   1 
ATOM   636  C  CA  . LYS A 1 83  ? -26.564 24.231 127.388 1.00 118.27 ? 102 LYS A CA  1 
ATOM   637  C  C   . LYS A 1 83  ? -27.532 23.374 128.229 1.00 115.52 ? 102 LYS A C   1 
ATOM   638  O  O   . LYS A 1 83  ? -28.742 23.441 128.011 1.00 117.74 ? 102 LYS A O   1 
ATOM   639  C  CB  . LYS A 1 83  ? -26.312 23.550 126.036 1.00 119.68 ? 102 LYS A CB  1 
ATOM   640  C  CG  . LYS A 1 83  ? -25.544 24.408 125.042 1.00 124.57 ? 102 LYS A CG  1 
ATOM   641  C  CD  . LYS A 1 83  ? -25.342 23.681 123.723 1.00 126.91 ? 102 LYS A CD  1 
ATOM   642  C  CE  . LYS A 1 83  ? -24.624 24.549 122.699 1.00 130.31 ? 102 LYS A CE  1 
ATOM   643  N  NZ  . LYS A 1 83  ? -23.235 24.901 123.100 1.00 131.97 ? 102 LYS A NZ  1 
ATOM   644  N  N   . ALA A 1 84  ? -27.001 22.563 129.152 1.00 110.26 ? 103 ALA A N   1 
ATOM   645  C  CA  . ALA A 1 84  ? -27.808 21.702 130.042 1.00 109.79 ? 103 ALA A CA  1 
ATOM   646  C  C   . ALA A 1 84  ? -27.102 21.511 131.412 1.00 106.72 ? 103 ALA A C   1 
ATOM   647  O  O   . ALA A 1 84  ? -26.538 20.440 131.664 1.00 101.61 ? 103 ALA A O   1 
ATOM   648  C  CB  . ALA A 1 84  ? -28.079 20.361 129.363 1.00 105.49 ? 103 ALA A CB  1 
ATOM   649  N  N   . PRO A 1 85  ? -27.125 22.552 132.292 1.00 110.67 ? 104 PRO A N   1 
ATOM   650  C  CA  . PRO A 1 85  ? -26.465 22.531 133.625 1.00 111.55 ? 104 PRO A CA  1 
ATOM   651  C  C   . PRO A 1 85  ? -26.751 21.357 134.578 1.00 113.34 ? 104 PRO A C   1 
ATOM   652  O  O   . PRO A 1 85  ? -25.846 20.952 135.318 1.00 114.74 ? 104 PRO A O   1 
ATOM   653  C  CB  . PRO A 1 85  ? -26.945 23.838 134.272 1.00 113.49 ? 104 PRO A CB  1 
ATOM   654  C  CG  . PRO A 1 85  ? -27.227 24.744 133.140 1.00 111.54 ? 104 PRO A CG  1 
ATOM   655  C  CD  . PRO A 1 85  ? -27.714 23.882 132.016 1.00 111.81 ? 104 PRO A CD  1 
ATOM   656  N  N   . ASN A 1 86  ? -27.979 20.831 134.557 1.00 115.64 ? 105 ASN A N   1 
ATOM   657  C  CA  . ASN A 1 86  ? -28.402 19.709 135.429 1.00 113.36 ? 105 ASN A CA  1 
ATOM   658  C  C   . ASN A 1 86  ? -28.273 18.297 134.817 1.00 107.93 ? 105 ASN A C   1 
ATOM   659  O  O   . ASN A 1 86  ? -28.722 17.320 135.428 1.00 106.95 ? 105 ASN A O   1 
ATOM   660  C  CB  . ASN A 1 86  ? -29.848 19.950 135.907 1.00 117.23 ? 105 ASN A CB  1 
ATOM   661  C  CG  . ASN A 1 86  ? -30.010 21.258 136.675 1.00 118.68 ? 105 ASN A CG  1 
ATOM   662  O  OD1 . ASN A 1 86  ? -29.054 21.801 137.234 1.00 117.82 ? 105 ASN A OD1 1 
ATOM   663  N  ND2 . ASN A 1 86  ? -31.238 21.758 136.719 1.00 121.97 ? 105 ASN A ND2 1 
ATOM   664  N  N   . ASN A 1 87  ? -27.644 18.186 133.641 1.00 101.49 ? 106 ASN A N   1 
ATOM   665  C  CA  . ASN A 1 87  ? -27.454 16.898 132.966 1.00 100.15 ? 106 ASN A CA  1 
ATOM   666  C  C   . ASN A 1 87  ? -26.274 16.177 133.623 1.00 98.42  ? 106 ASN A C   1 
ATOM   667  O  O   . ASN A 1 87  ? -25.129 16.612 133.477 1.00 98.57  ? 106 ASN A O   1 
ATOM   668  C  CB  . ASN A 1 87  ? -27.227 17.109 131.461 1.00 97.93  ? 106 ASN A CB  1 
ATOM   669  C  CG  . ASN A 1 87  ? -27.242 15.812 130.662 1.00 96.57  ? 106 ASN A CG  1 
ATOM   670  O  OD1 . ASN A 1 87  ? -26.679 14.798 131.064 1.00 98.06  ? 106 ASN A OD1 1 
ATOM   671  N  ND2 . ASN A 1 87  ? -27.867 15.858 129.499 1.00 100.46 ? 106 ASN A ND2 1 
ATOM   672  N  N   . VAL A 1 88  ? -26.567 15.082 134.336 1.00 97.60  ? 107 VAL A N   1 
ATOM   673  C  CA  . VAL A 1 88  ? -25.545 14.276 135.049 1.00 95.02  ? 107 VAL A CA  1 
ATOM   674  C  C   . VAL A 1 88  ? -24.370 13.807 134.178 1.00 93.08  ? 107 VAL A C   1 
ATOM   675  O  O   . VAL A 1 88  ? -23.231 13.780 134.657 1.00 92.56  ? 107 VAL A O   1 
ATOM   676  C  CB  . VAL A 1 88  ? -26.148 13.047 135.783 1.00 94.09  ? 107 VAL A CB  1 
ATOM   677  C  CG1 . VAL A 1 88  ? -27.056 13.499 136.921 1.00 94.32  ? 107 VAL A CG1 1 
ATOM   678  C  CG2 . VAL A 1 88  ? -26.880 12.122 134.815 1.00 92.29  ? 107 VAL A CG2 1 
ATOM   679  N  N   . ASP A 1 89  ? -24.650 13.459 132.919 1.00 90.38  ? 108 ASP A N   1 
ATOM   680  C  CA  . ASP A 1 89  ? -23.611 13.012 131.968 1.00 92.28  ? 108 ASP A CA  1 
ATOM   681  C  C   . ASP A 1 89  ? -22.667 14.159 131.574 1.00 90.05  ? 108 ASP A C   1 
ATOM   682  O  O   . ASP A 1 89  ? -21.468 13.934 131.396 1.00 88.73  ? 108 ASP A O   1 
ATOM   683  C  CB  . ASP A 1 89  ? -24.229 12.349 130.723 1.00 93.11  ? 108 ASP A CB  1 
ATOM   684  C  CG  . ASP A 1 89  ? -25.021 11.068 131.054 1.00 96.54  ? 108 ASP A CG  1 
ATOM   685  O  OD1 . ASP A 1 89  ? -25.172 10.727 132.246 1.00 99.77  ? 108 ASP A OD1 1 
ATOM   686  O  OD2 . ASP A 1 89  ? -25.506 10.400 130.116 1.00 97.27  ? 108 ASP A OD2 1 
HETATM 687  N  N   . CSX A 1 90  ? -23.211 15.371 131.446 1.00 90.22  ? 109 CSX A N   1 
HETATM 688  C  CA  . CSX A 1 90  ? -22.411 16.573 131.142 1.00 92.12  ? 109 CSX A CA  1 
HETATM 689  C  CB  . CSX A 1 90  ? -23.299 17.725 130.672 1.00 97.85  ? 109 CSX A CB  1 
HETATM 690  S  SG  . CSX A 1 90  ? -24.187 17.261 129.277 1.00 108.95 ? 109 CSX A SG  1 
HETATM 691  C  C   . CSX A 1 90  ? -21.579 16.951 132.362 1.00 90.82  ? 109 CSX A C   1 
HETATM 692  O  O   . CSX A 1 90  ? -20.411 17.325 132.222 1.00 90.63  ? 109 CSX A O   1 
HETATM 693  O  OD  . CSX A 1 90  ? -23.237 17.083 128.145 1.00 103.72 ? 109 CSX A OD  1 
ATOM   694  N  N   . LEU A 1 91  ? -22.162 16.869 133.562 1.00 89.66  ? 110 LEU A N   1 
ATOM   695  C  CA  . LEU A 1 91  ? -21.417 17.146 134.807 1.00 89.60  ? 110 LEU A CA  1 
ATOM   696  C  C   . LEU A 1 91  ? -20.270 16.132 134.984 1.00 88.27  ? 110 LEU A C   1 
ATOM   697  O  O   . LEU A 1 91  ? -19.142 16.539 135.275 1.00 87.80  ? 110 LEU A O   1 
ATOM   698  C  CB  . LEU A 1 91  ? -22.338 17.154 136.036 1.00 91.90  ? 110 LEU A CB  1 
ATOM   699  C  CG  . LEU A 1 91  ? -23.336 18.314 136.183 1.00 93.90  ? 110 LEU A CG  1 
ATOM   700  C  CD1 . LEU A 1 91  ? -24.323 18.038 137.306 1.00 95.05  ? 110 LEU A CD1 1 
ATOM   701  C  CD2 . LEU A 1 91  ? -22.622 19.636 136.428 1.00 93.11  ? 110 LEU A CD2 1 
ATOM   702  N  N   . GLU A 1 92  ? -20.568 14.841 134.766 1.00 87.65  ? 111 GLU A N   1 
ATOM   703  C  CA  . GLU A 1 92  ? -19.588 13.727 134.859 1.00 89.90  ? 111 GLU A CA  1 
ATOM   704  C  C   . GLU A 1 92  ? -18.333 13.982 134.025 1.00 88.45  ? 111 GLU A C   1 
ATOM   705  O  O   . GLU A 1 92  ? -17.219 13.795 134.511 1.00 87.78  ? 111 GLU A O   1 
ATOM   706  C  CB  . GLU A 1 92  ? -20.235 12.396 134.405 1.00 94.33  ? 111 GLU A CB  1 
ATOM   707  C  CG  . GLU A 1 92  ? -19.315 11.160 134.321 1.00 98.31  ? 111 GLU A CG  1 
ATOM   708  C  CD  . GLU A 1 92  ? -20.004 9.908  133.773 1.00 105.33 ? 111 GLU A CD  1 
ATOM   709  O  OE1 . GLU A 1 92  ? -21.239 9.770  133.930 1.00 114.18 ? 111 GLU A OE1 1 
ATOM   710  O  OE2 . GLU A 1 92  ? -19.299 9.038  133.194 1.00 99.97  ? 111 GLU A OE2 1 
ATOM   711  N  N   . ALA A 1 93  ? -18.539 14.396 132.772 1.00 88.47  ? 112 ALA A N   1 
ATOM   712  C  CA  . ALA A 1 93  ? -17.449 14.668 131.827 1.00 86.75  ? 112 ALA A CA  1 
ATOM   713  C  C   . ALA A 1 93  ? -16.518 15.791 132.296 1.00 84.43  ? 112 ALA A C   1 
ATOM   714  O  O   . ALA A 1 93  ? -15.303 15.657 132.191 1.00 82.74  ? 112 ALA A O   1 
ATOM   715  C  CB  . ALA A 1 93  ? -18.001 14.956 130.430 1.00 84.24  ? 112 ALA A CB  1 
ATOM   716  N  N   . CYS A 1 94  ? -17.085 16.882 132.810 1.00 87.93  ? 113 CYS A N   1 
ATOM   717  C  CA  . CYS A 1 94  ? -16.284 17.997 133.345 1.00 93.82  ? 113 CYS A CA  1 
ATOM   718  C  C   . CYS A 1 94  ? -15.494 17.578 134.591 1.00 91.63  ? 113 CYS A C   1 
ATOM   719  O  O   . CYS A 1 94  ? -14.309 17.903 134.707 1.00 93.09  ? 113 CYS A O   1 
ATOM   720  C  CB  . CYS A 1 94  ? -17.167 19.187 133.720 1.00 100.28 ? 113 CYS A CB  1 
ATOM   721  S  SG  . CYS A 1 94  ? -18.080 19.900 132.346 1.00 111.68 ? 113 CYS A SG  1 
ATOM   722  N  N   . ALA A 1 95  ? -16.161 16.859 135.500 1.00 91.48  ? 114 ALA A N   1 
ATOM   723  C  CA  . ALA A 1 95  ? -15.560 16.382 136.768 1.00 92.45  ? 114 ALA A CA  1 
ATOM   724  C  C   . ALA A 1 95  ? -14.298 15.540 136.559 1.00 93.80  ? 114 ALA A C   1 
ATOM   725  O  O   . ALA A 1 95  ? -13.316 15.729 137.273 1.00 97.64  ? 114 ALA A O   1 
ATOM   726  C  CB  . ALA A 1 95  ? -16.578 15.601 137.590 1.00 89.60  ? 114 ALA A CB  1 
ATOM   727  N  N   . GLU A 1 96  ? -14.334 14.633 135.577 1.00 92.15  ? 115 GLU A N   1 
ATOM   728  C  CA  . GLU A 1 96  ? -13.176 13.783 135.247 1.00 93.38  ? 115 GLU A CA  1 
ATOM   729  C  C   . GLU A 1 96  ? -11.970 14.600 134.787 1.00 95.41  ? 115 GLU A C   1 
ATOM   730  O  O   . GLU A 1 96  ? -10.839 14.267 135.141 1.00 94.10  ? 115 GLU A O   1 
ATOM   731  C  CB  . GLU A 1 96  ? -13.521 12.758 134.164 1.00 95.73  ? 115 GLU A CB  1 
ATOM   732  C  CG  . GLU A 1 96  ? -14.489 11.679 134.606 1.00 95.06  ? 115 GLU A CG  1 
ATOM   733  C  CD  . GLU A 1 96  ? -14.928 10.772 133.474 1.00 97.60  ? 115 GLU A CD  1 
ATOM   734  O  OE1 . GLU A 1 96  ? -14.385 10.827 132.346 1.00 95.75  ? 115 GLU A OE1 1 
ATOM   735  O  OE2 . GLU A 1 96  ? -15.853 9.978  133.707 1.00 104.07 ? 115 GLU A OE2 1 
HETATM 736  N  N   . MSE A 1 97  ? -12.216 15.642 133.987 1.00 98.07  ? 116 MSE A N   1 
HETATM 737  C  CA  . MSE A 1 97  ? -11.143 16.521 133.500 1.00 98.90  ? 116 MSE A CA  1 
HETATM 738  C  C   . MSE A 1 97  ? -10.546 17.366 134.628 1.00 99.44  ? 116 MSE A C   1 
HETATM 739  O  O   . MSE A 1 97  ? -9.341  17.603 134.621 1.00 102.74 ? 116 MSE A O   1 
HETATM 740  C  CB  . MSE A 1 97  ? -11.603 17.387 132.323 1.00 97.99  ? 116 MSE A CB  1 
HETATM 741  C  CG  . MSE A 1 97  ? -12.060 16.608 131.087 1.00 97.07  ? 116 MSE A CG  1 
HETATM 742  SE SE  . MSE A 1 97  ? -10.795 15.328 130.283 0.75 98.81  ? 116 MSE A SE  1 
HETATM 743  C  CE  . MSE A 1 97  ? -10.887 13.827 131.534 1.00 104.68 ? 116 MSE A CE  1 
ATOM   744  N  N   . GLN A 1 98  ? -11.364 17.804 135.590 1.00 100.68 ? 117 GLN A N   1 
ATOM   745  C  CA  . GLN A 1 98  ? -10.852 18.556 136.758 1.00 105.51 ? 117 GLN A CA  1 
ATOM   746  C  C   . GLN A 1 98  ? -9.919  17.704 137.642 1.00 105.54 ? 117 GLN A C   1 
ATOM   747  O  O   . GLN A 1 98  ? -8.967  18.235 138.217 1.00 106.34 ? 117 GLN A O   1 
ATOM   748  C  CB  . GLN A 1 98  ? -11.993 19.137 137.608 1.00 108.41 ? 117 GLN A CB  1 
ATOM   749  C  CG  . GLN A 1 98  ? -12.847 20.212 136.946 1.00 110.40 ? 117 GLN A CG  1 
ATOM   750  C  CD  . GLN A 1 98  ? -12.136 21.549 136.752 1.00 114.10 ? 117 GLN A CD  1 
ATOM   751  O  OE1 . GLN A 1 98  ? -11.011 21.623 136.258 1.00 112.92 ? 117 GLN A OE1 1 
ATOM   752  N  NE2 . GLN A 1 98  ? -12.826 22.624 137.100 1.00 117.77 ? 117 GLN A NE2 1 
ATOM   753  N  N   . VAL A 1 99  ? -10.196 16.399 137.734 1.00 104.11 ? 118 VAL A N   1 
ATOM   754  C  CA  . VAL A 1 99  ? -9.359  15.453 138.494 1.00 104.27 ? 118 VAL A CA  1 
ATOM   755  C  C   . VAL A 1 99  ? -8.001  15.278 137.793 1.00 106.02 ? 118 VAL A C   1 
ATOM   756  O  O   . VAL A 1 99  ? -6.963  15.247 138.463 1.00 105.12 ? 118 VAL A O   1 
ATOM   757  C  CB  . VAL A 1 99  ? -10.048 14.075 138.673 1.00 101.54 ? 118 VAL A CB  1 
ATOM   758  C  CG1 . VAL A 1 99  ? -9.141  13.093 139.405 1.00 99.79  ? 118 VAL A CG1 1 
ATOM   759  C  CG2 . VAL A 1 99  ? -11.362 14.228 139.425 1.00 98.85  ? 118 VAL A CG2 1 
ATOM   760  N  N   . CYS A 1 100 ? -8.021  15.162 136.459 1.00 104.98 ? 119 CYS A N   1 
ATOM   761  C  CA  . CYS A 1 100 ? -6.793  15.023 135.654 1.00 108.46 ? 119 CYS A CA  1 
ATOM   762  C  C   . CYS A 1 100 ? -5.935  16.296 135.687 1.00 111.00 ? 119 CYS A C   1 
ATOM   763  O  O   . CYS A 1 100 ? -4.709  16.197 135.747 1.00 118.26 ? 119 CYS A O   1 
ATOM   764  C  CB  . CYS A 1 100 ? -7.098  14.616 134.205 1.00 109.16 ? 119 CYS A CB  1 
ATOM   765  S  SG  . CYS A 1 100 ? -7.785  12.954 134.011 1.00 111.49 ? 119 CYS A SG  1 
ATOM   766  N  N   . ARG A 1 101 ? -6.575  17.469 135.643 1.00 109.86 ? 120 ARG A N   1 
ATOM   767  C  CA  . ARG A 1 101 ? -5.863  18.764 135.720 1.00 113.86 ? 120 ARG A CA  1 
ATOM   768  C  C   . ARG A 1 101 ? -5.205  19.041 137.083 1.00 115.74 ? 120 ARG A C   1 
ATOM   769  O  O   . ARG A 1 101 ? -4.238  19.805 137.149 1.00 115.91 ? 120 ARG A O   1 
ATOM   770  C  CB  . ARG A 1 101 ? -6.798  19.944 135.421 1.00 114.69 ? 120 ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 101 ? -7.259  20.093 133.980 1.00 119.82 ? 120 ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 101 ? -8.248  21.247 133.876 1.00 123.31 ? 120 ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 101 ? -7.621  22.531 134.214 1.00 129.15 ? 120 ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 101 ? -8.259  23.678 134.478 1.00 129.75 ? 120 ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 101 ? -9.596  23.761 134.488 1.00 127.76 ? 120 ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 101 ? -7.541  24.766 134.768 1.00 135.24 ? 120 ARG A NH2 1 
ATOM   777  N  N   . GLY A 1 102 ? -5.741  18.443 138.150 1.00 115.12 ? 121 GLY A N   1 
ATOM   778  C  CA  . GLY A 1 102 ? -5.256  18.639 139.521 1.00 116.05 ? 121 GLY A CA  1 
ATOM   779  C  C   . GLY A 1 102 ? -6.235  19.399 140.408 1.00 117.05 ? 121 GLY A C   1 
ATOM   780  O  O   . GLY A 1 102 ? -5.982  19.534 141.608 1.00 122.84 ? 121 GLY A O   1 
ATOM   781  N  N   . GLN A 1 103 ? -7.344  19.892 139.839 1.00 115.69 ? 122 GLN A N   1 
ATOM   782  C  CA  . GLN A 1 103 ? -8.387  20.617 140.582 1.00 117.82 ? 122 GLN A CA  1 
ATOM   783  C  C   . GLN A 1 103 ? -9.222  19.573 141.339 1.00 121.38 ? 122 GLN A C   1 
ATOM   784  O  O   . GLN A 1 103 ? -10.338 19.230 140.937 1.00 122.25 ? 122 GLN A O   1 
ATOM   785  C  CB  . GLN A 1 103 ? -9.264  21.454 139.630 1.00 118.16 ? 122 GLN A CB  1 
ATOM   786  C  CG  . GLN A 1 103 ? -8.523  22.530 138.837 1.00 118.02 ? 122 GLN A CG  1 
ATOM   787  C  CD  . GLN A 1 103 ? -7.944  23.643 139.691 1.00 117.21 ? 122 GLN A CD  1 
ATOM   788  O  OE1 . GLN A 1 103 ? -8.343  23.843 140.834 1.00 121.90 ? 122 GLN A OE1 1 
ATOM   789  N  NE2 . GLN A 1 103 ? -7.009  24.389 139.125 1.00 118.19 ? 122 GLN A NE2 1 
ATOM   790  N  N   . GLU A 1 104 ? -8.653  19.088 142.442 1.00 125.96 ? 123 GLU A N   1 
ATOM   791  C  CA  . GLU A 1 104 ? -9.243  18.046 143.291 1.00 127.72 ? 123 GLU A CA  1 
ATOM   792  C  C   . GLU A 1 104 ? -10.515 18.514 143.995 1.00 124.80 ? 123 GLU A C   1 
ATOM   793  O  O   . GLU A 1 104 ? -11.520 17.799 143.993 1.00 119.90 ? 123 GLU A O   1 
ATOM   794  C  CB  . GLU A 1 104 ? -8.199  17.591 144.332 1.00 135.73 ? 123 GLU A CB  1 
ATOM   795  C  CG  . GLU A 1 104 ? -8.580  16.412 145.229 1.00 141.37 ? 123 GLU A CG  1 
ATOM   796  C  CD  . GLU A 1 104 ? -7.495  16.038 146.239 1.00 148.22 ? 123 GLU A CD  1 
ATOM   797  O  OE1 . GLU A 1 104 ? -6.412  16.669 146.266 1.00 150.46 ? 123 GLU A OE1 1 
ATOM   798  O  OE2 . GLU A 1 104 ? -7.731  15.097 147.026 1.00 153.47 ? 123 GLU A OE2 1 
ATOM   799  N  N   . LYS A 1 105 ? -10.461 19.713 144.578 1.00 124.83 ? 124 LYS A N   1 
ATOM   800  C  CA  . LYS A 1 105 ? -11.591 20.276 145.327 1.00 124.65 ? 124 LYS A CA  1 
ATOM   801  C  C   . LYS A 1 105 ? -12.783 20.621 144.426 1.00 120.87 ? 124 LYS A C   1 
ATOM   802  O  O   . LYS A 1 105 ? -13.921 20.287 144.766 1.00 119.38 ? 124 LYS A O   1 
ATOM   803  C  CB  . LYS A 1 105 ? -11.138 21.487 146.152 1.00 132.29 ? 124 LYS A CB  1 
ATOM   804  C  CG  . LYS A 1 105 ? -12.125 21.921 147.224 1.00 138.30 ? 124 LYS A CG  1 
ATOM   805  C  CD  . LYS A 1 105 ? -11.477 22.877 148.217 1.00 145.09 ? 124 LYS A CD  1 
ATOM   806  C  CE  . LYS A 1 105 ? -12.397 23.197 149.385 1.00 151.00 ? 124 LYS A CE  1 
ATOM   807  N  NZ  . LYS A 1 105 ? -13.647 23.879 148.954 1.00 155.59 ? 124 LYS A NZ  1 
ATOM   808  N  N   . ASP A 1 106 ? -12.516 21.254 143.281 1.00 117.37 ? 125 ASP A N   1 
ATOM   809  C  CA  . ASP A 1 106 ? -13.574 21.621 142.317 1.00 115.95 ? 125 ASP A CA  1 
ATOM   810  C  C   . ASP A 1 106 ? -14.184 20.364 141.648 1.00 111.77 ? 125 ASP A C   1 
ATOM   811  O  O   . ASP A 1 106 ? -15.374 20.349 141.321 1.00 105.21 ? 125 ASP A O   1 
ATOM   812  C  CB  . ASP A 1 106 ? -13.042 22.608 141.264 1.00 120.03 ? 125 ASP A CB  1 
ATOM   813  C  CG  . ASP A 1 106 ? -14.147 23.241 140.407 1.00 122.44 ? 125 ASP A CG  1 
ATOM   814  O  OD1 . ASP A 1 106 ? -15.328 23.292 140.817 1.00 121.70 ? 125 ASP A OD1 1 
ATOM   815  O  OD2 . ASP A 1 106 ? -13.817 23.731 139.311 1.00 130.17 ? 125 ASP A OD2 1 
ATOM   816  N  N   . ALA A 1 107 ? -13.363 19.330 141.435 1.00 107.38 ? 126 ALA A N   1 
ATOM   817  C  CA  . ALA A 1 107 ? -13.835 18.047 140.898 1.00 105.74 ? 126 ALA A CA  1 
ATOM   818  C  C   . ALA A 1 107 ? -14.721 17.335 141.929 1.00 103.55 ? 126 ALA A C   1 
ATOM   819  O  O   . ALA A 1 107 ? -15.724 16.725 141.564 1.00 101.01 ? 126 ALA A O   1 
ATOM   820  C  CB  . ALA A 1 107 ? -12.670 17.153 140.501 1.00 107.46 ? 126 ALA A CB  1 
ATOM   821  N  N   . LEU A 1 108 ? -14.347 17.421 143.210 1.00 111.01 ? 127 LEU A N   1 
ATOM   822  C  CA  . LEU A 1 108 ? -15.125 16.819 144.308 1.00 109.92 ? 127 LEU A CA  1 
ATOM   823  C  C   . LEU A 1 108 ? -16.531 17.450 144.382 1.00 109.10 ? 127 LEU A C   1 
ATOM   824  O  O   . LEU A 1 108 ? -17.505 16.742 144.642 1.00 113.21 ? 127 LEU A O   1 
ATOM   825  C  CB  . LEU A 1 108 ? -14.399 16.964 145.662 1.00 111.43 ? 127 LEU A CB  1 
ATOM   826  C  CG  . LEU A 1 108 ? -14.924 16.123 146.833 1.00 114.71 ? 127 LEU A CG  1 
ATOM   827  C  CD1 . LEU A 1 108 ? -14.619 14.650 146.590 1.00 115.43 ? 127 LEU A CD1 1 
ATOM   828  C  CD2 . LEU A 1 108 ? -14.317 16.563 148.162 1.00 115.97 ? 127 LEU A CD2 1 
ATOM   829  N  N   . ARG A 1 109 ? -16.621 18.765 144.139 1.00 107.09 ? 128 ARG A N   1 
ATOM   830  C  CA  . ARG A 1 109 ? -17.896 19.507 144.137 1.00 106.60 ? 128 ARG A CA  1 
ATOM   831  C  C   . ARG A 1 109 ? -18.841 18.993 143.049 1.00 105.90 ? 128 ARG A C   1 
ATOM   832  O  O   . ARG A 1 109 ? -20.011 18.713 143.332 1.00 105.92 ? 128 ARG A O   1 
ATOM   833  C  CB  . ARG A 1 109 ? -17.653 21.011 143.914 1.00 107.50 ? 128 ARG A CB  1 
ATOM   834  C  CG  . ARG A 1 109 ? -18.901 21.899 143.919 1.00 111.92 ? 128 ARG A CG  1 
ATOM   835  C  CD  . ARG A 1 109 ? -18.581 23.345 143.567 1.00 118.41 ? 128 ARG A CD  1 
ATOM   836  N  NE  . ARG A 1 109 ? -18.003 23.482 142.225 1.00 119.03 ? 128 ARG A NE  1 
ATOM   837  C  CZ  . ARG A 1 109 ? -18.677 23.492 141.066 1.00 122.50 ? 128 ARG A CZ  1 
ATOM   838  N  NH1 . ARG A 1 109 ? -20.009 23.345 141.014 1.00 127.08 ? 128 ARG A NH1 1 
ATOM   839  N  NH2 . ARG A 1 109 ? -18.000 23.629 139.923 1.00 122.12 ? 128 ARG A NH2 1 
HETATM 840  N  N   . MSE A 1 110 ? -18.329 18.879 141.821 1.00 101.09 ? 129 MSE A N   1 
HETATM 841  C  CA  . MSE A 1 110 ? -19.146 18.420 140.678 1.00 104.06 ? 129 MSE A CA  1 
HETATM 842  C  C   . MSE A 1 110 ? -19.706 17.006 140.867 1.00 103.33 ? 129 MSE A C   1 
HETATM 843  O  O   . MSE A 1 110 ? -20.866 16.771 140.530 1.00 109.05 ? 129 MSE A O   1 
HETATM 844  C  CB  . MSE A 1 110 ? -18.412 18.556 139.337 1.00 100.23 ? 129 MSE A CB  1 
HETATM 845  C  CG  . MSE A 1 110 ? -18.000 19.988 139.015 1.00 101.84 ? 129 MSE A CG  1 
HETATM 846  SE SE  . MSE A 1 110 ? -17.474 20.242 137.174 0.75 107.41 ? 129 MSE A SE  1 
HETATM 847  C  CE  . MSE A 1 110 ? -19.260 20.108 136.408 1.00 100.13 ? 129 MSE A CE  1 
ATOM   848  N  N   . TYR A 1 111 ? -18.901 16.089 141.416 1.00 102.73 ? 130 TYR A N   1 
ATOM   849  C  CA  . TYR A 1 111 ? -19.371 14.719 141.702 1.00 102.17 ? 130 TYR A CA  1 
ATOM   850  C  C   . TYR A 1 111 ? -20.443 14.700 142.794 1.00 104.47 ? 130 TYR A C   1 
ATOM   851  O  O   . TYR A 1 111 ? -21.384 13.910 142.704 1.00 106.49 ? 130 TYR A O   1 
ATOM   852  C  CB  . TYR A 1 111 ? -18.235 13.748 142.074 1.00 101.19 ? 130 TYR A CB  1 
ATOM   853  C  CG  . TYR A 1 111 ? -17.414 13.237 140.906 1.00 97.94  ? 130 TYR A CG  1 
ATOM   854  C  CD1 . TYR A 1 111 ? -17.991 12.389 139.945 1.00 97.84  ? 130 TYR A CD1 1 
ATOM   855  C  CD2 . TYR A 1 111 ? -16.047 13.525 140.792 1.00 96.54  ? 130 TYR A CD2 1 
ATOM   856  C  CE1 . TYR A 1 111 ? -17.248 11.889 138.882 1.00 94.64  ? 130 TYR A CE1 1 
ATOM   857  C  CE2 . TYR A 1 111 ? -15.291 13.022 139.735 1.00 96.42  ? 130 TYR A CE2 1 
ATOM   858  C  CZ  . TYR A 1 111 ? -15.893 12.204 138.781 1.00 95.26  ? 130 TYR A CZ  1 
ATOM   859  O  OH  . TYR A 1 111 ? -15.154 11.708 137.730 1.00 96.95  ? 130 TYR A OH  1 
ATOM   860  N  N   . GLU A 1 112 ? -20.297 15.555 143.813 1.00 106.05 ? 131 GLU A N   1 
ATOM   861  C  CA  . GLU A 1 112 ? -21.290 15.651 144.896 1.00 109.41 ? 131 GLU A CA  1 
ATOM   862  C  C   . GLU A 1 112 ? -22.598 16.255 144.340 1.00 106.63 ? 131 GLU A C   1 
ATOM   863  O  O   . GLU A 1 112 ? -23.685 15.846 144.755 1.00 105.56 ? 131 GLU A O   1 
ATOM   864  C  CB  . GLU A 1 112 ? -20.746 16.447 146.097 1.00 116.32 ? 131 GLU A CB  1 
ATOM   865  C  CG  . GLU A 1 112 ? -21.519 16.222 147.389 1.00 124.61 ? 131 GLU A CG  1 
ATOM   866  C  CD  . GLU A 1 112 ? -20.884 16.888 148.609 1.00 138.78 ? 131 GLU A CD  1 
ATOM   867  O  OE1 . GLU A 1 112 ? -19.991 17.751 148.453 1.00 146.90 ? 131 GLU A OE1 1 
ATOM   868  O  OE2 . GLU A 1 112 ? -21.283 16.548 149.746 1.00 145.41 ? 131 GLU A OE2 1 
ATOM   869  N  N   . LYS A 1 113 ? -22.482 17.199 143.393 1.00 105.32 ? 132 LYS A N   1 
ATOM   870  C  CA  . LYS A 1 113 ? -23.646 17.809 142.717 1.00 107.61 ? 132 LYS A CA  1 
ATOM   871  C  C   . LYS A 1 113 ? -24.412 16.761 141.878 1.00 107.32 ? 132 LYS A C   1 
ATOM   872  O  O   . LYS A 1 113 ? -25.639 16.851 141.767 1.00 109.27 ? 132 LYS A O   1 
ATOM   873  C  CB  . LYS A 1 113 ? -23.228 19.003 141.840 1.00 110.26 ? 132 LYS A CB  1 
ATOM   874  C  CG  . LYS A 1 113 ? -24.383 19.766 141.193 1.00 115.38 ? 132 LYS A CG  1 
ATOM   875  C  CD  . LYS A 1 113 ? -23.891 20.925 140.345 1.00 116.90 ? 132 LYS A CD  1 
ATOM   876  C  CE  . LYS A 1 113 ? -25.057 21.690 139.744 1.00 122.75 ? 132 LYS A CE  1 
ATOM   877  N  NZ  . LYS A 1 113 ? -24.595 22.784 138.846 1.00 128.62 ? 132 LYS A NZ  1 
ATOM   878  N  N   . ILE A 1 114 ? -23.688 15.807 141.273 1.00 103.36 ? 133 ILE A N   1 
ATOM   879  C  CA  . ILE A 1 114 ? -24.302 14.700 140.509 1.00 102.05 ? 133 ILE A CA  1 
ATOM   880  C  C   . ILE A 1 114 ? -25.178 13.850 141.438 1.00 105.69 ? 133 ILE A C   1 
ATOM   881  O  O   . ILE A 1 114 ? -26.313 13.524 141.079 1.00 110.70 ? 133 ILE A O   1 
ATOM   882  C  CB  . ILE A 1 114 ? -23.247 13.809 139.797 1.00 98.05  ? 133 ILE A CB  1 
ATOM   883  C  CG1 . ILE A 1 114 ? -22.668 14.545 138.586 1.00 97.34  ? 133 ILE A CG1 1 
ATOM   884  C  CG2 . ILE A 1 114 ? -23.861 12.499 139.322 1.00 96.24  ? 133 ILE A CG2 1 
ATOM   885  C  CD1 . ILE A 1 114 ? -21.543 13.813 137.880 1.00 94.39  ? 133 ILE A CD1 1 
ATOM   886  N  N   . LEU A 1 115 ? -24.643 13.508 142.615 1.00 105.15 ? 134 LEU A N   1 
ATOM   887  C  CA  . LEU A 1 115 ? -25.379 12.732 143.639 1.00 110.30 ? 134 LEU A CA  1 
ATOM   888  C  C   . LEU A 1 115 ? -26.663 13.421 144.130 1.00 116.68 ? 134 LEU A C   1 
ATOM   889  O  O   . LEU A 1 115 ? -27.623 12.737 144.484 1.00 123.92 ? 134 LEU A O   1 
ATOM   890  C  CB  . LEU A 1 115 ? -24.488 12.378 144.838 1.00 106.17 ? 134 LEU A CB  1 
ATOM   891  C  CG  . LEU A 1 115 ? -23.295 11.454 144.584 1.00 104.02 ? 134 LEU A CG  1 
ATOM   892  C  CD1 . LEU A 1 115 ? -22.551 11.225 145.887 1.00 103.87 ? 134 LEU A CD1 1 
ATOM   893  C  CD2 . LEU A 1 115 ? -23.722 10.118 143.992 1.00 103.79 ? 134 LEU A CD2 1 
ATOM   894  N  N   . GLN A 1 116 ? -26.662 14.758 144.154 1.00 119.95 ? 135 GLN A N   1 
ATOM   895  C  CA  . GLN A 1 116 ? -27.834 15.562 144.543 1.00 122.77 ? 135 GLN A CA  1 
ATOM   896  C  C   . GLN A 1 116 ? -28.932 15.438 143.466 1.00 121.45 ? 135 GLN A C   1 
ATOM   897  O  O   . GLN A 1 116 ? -30.110 15.288 143.794 1.00 124.83 ? 135 GLN A O   1 
ATOM   898  C  CB  . GLN A 1 116 ? -27.430 17.026 144.750 1.00 124.98 ? 135 GLN A CB  1 
ATOM   899  C  CG  . GLN A 1 116 ? -28.493 17.912 145.380 1.00 133.00 ? 135 GLN A CG  1 
ATOM   900  C  CD  . GLN A 1 116 ? -27.993 19.319 145.672 1.00 136.04 ? 135 GLN A CD  1 
ATOM   901  O  OE1 . GLN A 1 116 ? -26.962 19.757 145.150 1.00 132.21 ? 135 GLN A OE1 1 
ATOM   902  N  NE2 . GLN A 1 116 ? -28.733 20.040 146.508 1.00 143.04 ? 135 GLN A NE2 1 
ATOM   903  N  N   . LEU A 1 117 ? -28.532 15.508 142.193 1.00 118.67 ? 136 LEU A N   1 
ATOM   904  C  CA  . LEU A 1 117 ? -29.454 15.346 141.054 1.00 116.58 ? 136 LEU A CA  1 
ATOM   905  C  C   . LEU A 1 117 ? -29.916 13.885 140.864 1.00 115.09 ? 136 LEU A C   1 
ATOM   906  O  O   . LEU A 1 117 ? -31.028 13.659 140.385 1.00 120.07 ? 136 LEU A O   1 
ATOM   907  C  CB  . LEU A 1 117 ? -28.826 15.877 139.756 1.00 114.70 ? 136 LEU A CB  1 
ATOM   908  C  CG  . LEU A 1 117 ? -28.560 17.385 139.662 1.00 115.74 ? 136 LEU A CG  1 
ATOM   909  C  CD1 . LEU A 1 117 ? -27.705 17.718 138.448 1.00 111.20 ? 136 LEU A CD1 1 
ATOM   910  C  CD2 . LEU A 1 117 ? -29.863 18.170 139.616 1.00 119.30 ? 136 LEU A CD2 1 
ATOM   911  N  N   . GLU A 1 118 ? -29.059 12.917 141.208 1.00 111.50 ? 137 GLU A N   1 
ATOM   912  C  CA  . GLU A 1 118 ? -29.372 11.473 141.111 1.00 110.67 ? 137 GLU A CA  1 
ATOM   913  C  C   . GLU A 1 118 ? -28.602 10.688 142.190 1.00 111.01 ? 137 GLU A C   1 
ATOM   914  O  O   . GLU A 1 118 ? -27.388 10.510 142.074 1.00 108.25 ? 137 GLU A O   1 
ATOM   915  C  CB  . GLU A 1 118 ? -29.034 10.939 139.708 1.00 107.04 ? 137 GLU A CB  1 
ATOM   916  C  CG  . GLU A 1 118 ? -29.361 9.457  139.493 1.00 107.69 ? 137 GLU A CG  1 
ATOM   917  C  CD  . GLU A 1 118 ? -29.110 8.967  138.075 1.00 105.63 ? 137 GLU A CD  1 
ATOM   918  O  OE1 . GLU A 1 118 ? -28.462 9.673  137.273 1.00 100.90 ? 137 GLU A OE1 1 
ATOM   919  O  OE2 . GLU A 1 118 ? -29.554 7.844  137.769 1.00 105.44 ? 137 GLU A OE2 1 
ATOM   920  N  N   . ALA A 1 119 ? -29.319 10.210 143.210 1.00 113.76 ? 138 ALA A N   1 
ATOM   921  C  CA  . ALA A 1 119 ? -28.733 9.465  144.339 1.00 115.34 ? 138 ALA A CA  1 
ATOM   922  C  C   . ALA A 1 119 ? -27.876 8.254  143.952 1.00 115.73 ? 138 ALA A C   1 
ATOM   923  O  O   . ALA A 1 119 ? -26.708 8.165  144.348 1.00 113.46 ? 138 ALA A O   1 
ATOM   924  C  CB  . ALA A 1 119 ? -29.832 9.022  145.300 1.00 119.35 ? 138 ALA A CB  1 
ATOM   925  N  N   . ASP A 1 120 ? -28.452 7.364  143.143 1.00 117.07 ? 139 ASP A N   1 
ATOM   926  C  CA  . ASP A 1 120 ? -27.791 6.109  142.712 1.00 116.18 ? 139 ASP A CA  1 
ATOM   927  C  C   . ASP A 1 120 ? -26.965 6.183  141.399 1.00 108.87 ? 139 ASP A C   1 
ATOM   928  O  O   . ASP A 1 120 ? -26.730 5.138  140.771 1.00 105.44 ? 139 ASP A O   1 
ATOM   929  C  CB  . ASP A 1 120 ? -28.839 4.974  142.613 1.00 121.99 ? 139 ASP A CB  1 
ATOM   930  C  CG  . ASP A 1 120 ? -29.820 5.171  141.459 1.00 120.98 ? 139 ASP A CG  1 
ATOM   931  O  OD1 . ASP A 1 120 ? -30.214 6.330  141.206 1.00 118.04 ? 139 ASP A OD1 1 
ATOM   932  O  OD2 . ASP A 1 120 ? -30.189 4.173  140.805 1.00 123.90 ? 139 ASP A OD2 1 
ATOM   933  N  N   . ASN A 1 121 ? -26.517 7.385  141.000 1.00 106.03 ? 140 ASN A N   1 
ATOM   934  C  CA  . ASN A 1 121 ? -25.703 7.583  139.776 1.00 101.59 ? 140 ASN A CA  1 
ATOM   935  C  C   . ASN A 1 121 ? -24.488 6.666  139.874 1.00 101.87 ? 140 ASN A C   1 
ATOM   936  O  O   . ASN A 1 121 ? -23.785 6.691  140.891 1.00 99.14  ? 140 ASN A O   1 
ATOM   937  C  CB  . ASN A 1 121 ? -25.224 9.037  139.637 1.00 97.63  ? 140 ASN A CB  1 
ATOM   938  C  CG  . ASN A 1 121 ? -24.568 9.315  138.294 1.00 94.63  ? 140 ASN A CG  1 
ATOM   939  O  OD1 . ASN A 1 121 ? -23.359 9.542  138.210 1.00 92.47  ? 140 ASN A OD1 1 
ATOM   940  N  ND2 . ASN A 1 121 ? -25.360 9.262  137.232 1.00 90.14  ? 140 ASN A ND2 1 
ATOM   941  N  N   . LEU A 1 122 ? -24.261 5.852  138.844 1.00 99.25  ? 141 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 122 ? -23.169 4.870  138.872 1.00 99.83  ? 141 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 122 ? -21.779 5.516  138.835 1.00 98.23  ? 141 LEU A C   1 
ATOM   944  O  O   . LEU A 1 122 ? -20.923 5.172  139.652 1.00 97.48  ? 141 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 122 ? -23.329 3.850  137.743 1.00 101.23 ? 141 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 122 ? -22.479 2.581  137.804 1.00 103.50 ? 141 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 122 ? -22.838 1.736  139.020 1.00 107.03 ? 141 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 122 ? -22.686 1.779  136.535 1.00 104.00 ? 141 LEU A CD2 1 
ATOM   949  N  N   . ALA A 1 123 ? -21.588 6.476  137.931 1.00 95.24  ? 142 ALA A N   1 
ATOM   950  C  CA  . ALA A 1 123 ? -20.303 7.181  137.763 1.00 95.41  ? 142 ALA A CA  1 
ATOM   951  C  C   . ALA A 1 123 ? -19.793 7.896  139.022 1.00 97.25  ? 142 ALA A C   1 
ATOM   952  O  O   . ALA A 1 123 ? -18.650 7.679  139.428 1.00 96.58  ? 142 ALA A O   1 
ATOM   953  C  CB  . ALA A 1 123 ? -20.392 8.173  136.611 1.00 95.19  ? 142 ALA A CB  1 
ATOM   954  N  N   . ALA A 1 124 ? -20.648 8.722  139.631 1.00 97.69  ? 143 ALA A N   1 
ATOM   955  C  CA  . ALA A 1 124 ? -20.297 9.497  140.839 1.00 96.31  ? 143 ALA A CA  1 
ATOM   956  C  C   . ALA A 1 124 ? -19.990 8.612  142.053 1.00 100.01 ? 143 ALA A C   1 
ATOM   957  O  O   . ALA A 1 124 ? -19.027 8.872  142.783 1.00 98.26  ? 143 ALA A O   1 
ATOM   958  C  CB  . ALA A 1 124 ? -21.391 10.505 141.176 1.00 94.16  ? 143 ALA A CB  1 
ATOM   959  N  N   . ASN A 1 125 ? -20.808 7.576  142.252 1.00 103.08 ? 144 ASN A N   1 
ATOM   960  C  CA  . ASN A 1 125 ? -20.621 6.607  143.347 1.00 106.66 ? 144 ASN A CA  1 
ATOM   961  C  C   . ASN A 1 125 ? -19.337 5.754  143.211 1.00 106.36 ? 144 ASN A C   1 
ATOM   962  O  O   . ASN A 1 125 ? -18.779 5.326  144.225 1.00 105.92 ? 144 ASN A O   1 
ATOM   963  C  CB  . ASN A 1 125 ? -21.873 5.729  143.518 1.00 109.56 ? 144 ASN A CB  1 
ATOM   964  C  CG  . ASN A 1 125 ? -23.061 6.494  144.100 1.00 111.46 ? 144 ASN A CG  1 
ATOM   965  O  OD1 . ASN A 1 125 ? -22.937 7.184  145.118 1.00 109.40 ? 144 ASN A OD1 1 
ATOM   966  N  ND2 . ASN A 1 125 ? -24.232 6.325  143.490 1.00 109.79 ? 144 ASN A ND2 1 
ATOM   967  N  N   . ILE A 1 126 ? -18.879 5.503  141.980 1.00 103.71 ? 145 ILE A N   1 
ATOM   968  C  CA  . ILE A 1 126 ? -17.621 4.768  141.747 1.00 105.13 ? 145 ILE A CA  1 
ATOM   969  C  C   . ILE A 1 126 ? -16.432 5.636  142.180 1.00 106.85 ? 145 ILE A C   1 
ATOM   970  O  O   . ILE A 1 126 ? -15.588 5.172  142.954 1.00 107.66 ? 145 ILE A O   1 
ATOM   971  C  CB  . ILE A 1 126 ? -17.436 4.334  140.274 1.00 102.49 ? 145 ILE A CB  1 
ATOM   972  C  CG1 . ILE A 1 126 ? -18.398 3.196  139.921 1.00 103.89 ? 145 ILE A CG1 1 
ATOM   973  C  CG2 . ILE A 1 126 ? -16.019 3.823  140.026 1.00 102.90 ? 145 ILE A CG2 1 
ATOM   974  C  CD1 . ILE A 1 126 ? -18.495 2.921  138.430 1.00 98.98  ? 145 ILE A CD1 1 
ATOM   975  N  N   . PHE A 1 127 ? -16.383 6.882  141.690 1.00 104.70 ? 146 PHE A N   1 
ATOM   976  C  CA  . PHE A 1 127 ? -15.287 7.815  142.015 1.00 104.86 ? 146 PHE A CA  1 
ATOM   977  C  C   . PHE A 1 127 ? -15.171 8.109  143.503 1.00 106.66 ? 146 PHE A C   1 
ATOM   978  O  O   . PHE A 1 127 ? -14.086 7.973  144.065 1.00 109.57 ? 146 PHE A O   1 
ATOM   979  C  CB  . PHE A 1 127 ? -15.416 9.156  141.272 1.00 102.12 ? 146 PHE A CB  1 
ATOM   980  C  CG  . PHE A 1 127 ? -14.299 10.128 141.584 1.00 102.02 ? 146 PHE A CG  1 
ATOM   981  C  CD1 . PHE A 1 127 ? -13.076 10.047 140.908 1.00 102.18 ? 146 PHE A CD1 1 
ATOM   982  C  CD2 . PHE A 1 127 ? -14.457 11.118 142.568 1.00 104.37 ? 146 PHE A CD2 1 
ATOM   983  C  CE1 . PHE A 1 127 ? -12.038 10.933 141.197 1.00 104.08 ? 146 PHE A CE1 1 
ATOM   984  C  CE2 . PHE A 1 127 ? -13.419 12.003 142.868 1.00 104.09 ? 146 PHE A CE2 1 
ATOM   985  C  CZ  . PHE A 1 127 ? -12.208 11.912 142.179 1.00 104.76 ? 146 PHE A CZ  1 
ATOM   986  N  N   . LEU A 1 128 ? -16.281 8.544  144.105 1.00 106.87 ? 147 LEU A N   1 
ATOM   987  C  CA  . LEU A 1 128 ? -16.325 8.902  145.531 1.00 108.32 ? 147 LEU A CA  1 
ATOM   988  C  C   . LEU A 1 128 ? -16.048 7.716  146.453 1.00 109.45 ? 147 LEU A C   1 
ATOM   989  O  O   . LEU A 1 128 ? -15.335 7.878  147.441 1.00 111.79 ? 147 LEU A O   1 
ATOM   990  C  CB  . LEU A 1 128 ? -17.640 9.614  145.895 1.00 108.53 ? 147 LEU A CB  1 
ATOM   991  C  CG  . LEU A 1 128 ? -17.845 10.984 145.219 1.00 105.63 ? 147 LEU A CG  1 
ATOM   992  C  CD1 . LEU A 1 128 ? -19.270 11.486 145.391 1.00 104.55 ? 147 LEU A CD1 1 
ATOM   993  C  CD2 . LEU A 1 128 ? -16.855 12.025 145.725 1.00 104.37 ? 147 LEU A CD2 1 
ATOM   994  N  N   . GLY A 1 129 ? -16.581 6.537  146.110 1.00 108.72 ? 148 GLY A N   1 
ATOM   995  C  CA  . GLY A 1 129 ? -16.352 5.293  146.871 1.00 112.32 ? 148 GLY A CA  1 
ATOM   996  C  C   . GLY A 1 129 ? -14.868 4.952  146.984 1.00 113.46 ? 148 GLY A C   1 
ATOM   997  O  O   . GLY A 1 129 ? -14.398 4.555  148.051 1.00 114.84 ? 148 GLY A O   1 
ATOM   998  N  N   . ASN A 1 130 ? -14.147 5.123  145.875 1.00 112.75 ? 149 ASN A N   1 
ATOM   999  C  CA  . ASN A 1 130 ? -12.695 4.907  145.811 1.00 112.89 ? 149 ASN A CA  1 
ATOM   1000 C  C   . ASN A 1 130 ? -11.918 6.079  146.420 1.00 110.30 ? 149 ASN A C   1 
ATOM   1001 O  O   . ASN A 1 130 ? -10.859 5.860  147.005 1.00 114.81 ? 149 ASN A O   1 
ATOM   1002 C  CB  . ASN A 1 130 ? -12.231 4.687  144.357 1.00 112.36 ? 149 ASN A CB  1 
ATOM   1003 C  CG  . ASN A 1 130 ? -12.830 3.440  143.721 1.00 113.77 ? 149 ASN A CG  1 
ATOM   1004 O  OD1 . ASN A 1 130 ? -13.187 2.474  144.401 1.00 117.27 ? 149 ASN A OD1 1 
ATOM   1005 N  ND2 . ASN A 1 130 ? -12.916 3.448  142.400 1.00 116.35 ? 149 ASN A ND2 1 
ATOM   1006 N  N   . TYR A 1 131 ? -12.436 7.306  146.271 1.00 105.96 ? 150 TYR A N   1 
ATOM   1007 C  CA  . TYR A 1 131 ? -11.803 8.529  146.810 1.00 108.66 ? 150 TYR A CA  1 
ATOM   1008 C  C   . TYR A 1 131 ? -11.710 8.498  148.333 1.00 112.77 ? 150 TYR A C   1 
ATOM   1009 O  O   . TYR A 1 131 ? -10.628 8.715  148.894 1.00 113.21 ? 150 TYR A O   1 
ATOM   1010 C  CB  . TYR A 1 131 ? -12.574 9.786  146.376 1.00 109.31 ? 150 TYR A CB  1 
ATOM   1011 C  CG  . TYR A 1 131 ? -12.026 11.089 146.922 1.00 114.04 ? 150 TYR A CG  1 
ATOM   1012 C  CD1 . TYR A 1 131 ? -10.929 11.714 146.324 1.00 117.54 ? 150 TYR A CD1 1 
ATOM   1013 C  CD2 . TYR A 1 131 ? -12.612 11.709 148.039 1.00 121.43 ? 150 TYR A CD2 1 
ATOM   1014 C  CE1 . TYR A 1 131 ? -10.420 12.913 146.822 1.00 122.23 ? 150 TYR A CE1 1 
ATOM   1015 C  CE2 . TYR A 1 131 ? -12.111 12.906 148.547 1.00 126.14 ? 150 TYR A CE2 1 
ATOM   1016 C  CZ  . TYR A 1 131 ? -11.017 13.508 147.934 1.00 128.06 ? 150 TYR A CZ  1 
ATOM   1017 O  OH  . TYR A 1 131 ? -10.517 14.691 148.427 1.00 136.60 ? 150 TYR A OH  1 
ATOM   1018 N  N   . TYR A 1 132 ? -12.851 8.252  148.982 1.00 112.87 ? 151 TYR A N   1 
ATOM   1019 C  CA  . TYR A 1 132 ? -12.916 8.180  150.445 1.00 115.80 ? 151 TYR A CA  1 
ATOM   1020 C  C   . TYR A 1 132 ? -12.127 6.988  151.002 1.00 116.98 ? 151 TYR A C   1 
ATOM   1021 O  O   . TYR A 1 132 ? -11.458 7.135  152.018 1.00 122.81 ? 151 TYR A O   1 
ATOM   1022 C  CB  . TYR A 1 132 ? -14.362 8.222  150.970 1.00 117.54 ? 151 TYR A CB  1 
ATOM   1023 C  CG  . TYR A 1 132 ? -15.046 9.566  150.756 1.00 119.66 ? 151 TYR A CG  1 
ATOM   1024 C  CD1 . TYR A 1 132 ? -14.599 10.715 151.430 1.00 124.97 ? 151 TYR A CD1 1 
ATOM   1025 C  CD2 . TYR A 1 132 ? -16.166 9.694  149.918 1.00 120.91 ? 151 TYR A CD2 1 
ATOM   1026 C  CE1 . TYR A 1 132 ? -15.217 11.952 151.248 1.00 127.84 ? 151 TYR A CE1 1 
ATOM   1027 C  CE2 . TYR A 1 132 ? -16.796 10.928 149.732 1.00 122.33 ? 151 TYR A CE2 1 
ATOM   1028 C  CZ  . TYR A 1 132 ? -16.319 12.054 150.397 1.00 128.18 ? 151 TYR A CZ  1 
ATOM   1029 O  OH  . TYR A 1 132 ? -16.933 13.272 150.221 1.00 131.25 ? 151 TYR A OH  1 
ATOM   1030 N  N   . TYR A 1 133 ? -12.175 5.837  150.323 1.00 116.89 ? 152 TYR A N   1 
ATOM   1031 C  CA  . TYR A 1 133 ? -11.424 4.639  150.748 1.00 119.37 ? 152 TYR A CA  1 
ATOM   1032 C  C   . TYR A 1 133 ? -9.902  4.852  150.680 1.00 119.19 ? 152 TYR A C   1 
ATOM   1033 O  O   . TYR A 1 133 ? -9.199  4.500  151.625 1.00 121.93 ? 152 TYR A O   1 
ATOM   1034 C  CB  . TYR A 1 133 ? -11.832 3.391  149.939 1.00 121.65 ? 152 TYR A CB  1 
ATOM   1035 C  CG  . TYR A 1 133 ? -11.016 2.150  150.271 1.00 124.58 ? 152 TYR A CG  1 
ATOM   1036 C  CD1 . TYR A 1 133 ? -11.227 1.447  151.468 1.00 127.62 ? 152 TYR A CD1 1 
ATOM   1037 C  CD2 . TYR A 1 133 ? -10.030 1.674  149.389 1.00 125.04 ? 152 TYR A CD2 1 
ATOM   1038 C  CE1 . TYR A 1 133 ? -10.474 0.312  151.783 1.00 130.21 ? 152 TYR A CE1 1 
ATOM   1039 C  CE2 . TYR A 1 133 ? -9.276  0.539  149.691 1.00 128.10 ? 152 TYR A CE2 1 
ATOM   1040 C  CZ  . TYR A 1 133 ? -9.498  -0.139 150.889 1.00 131.10 ? 152 TYR A CZ  1 
ATOM   1041 O  OH  . TYR A 1 133 ? -8.756  -1.257 151.193 1.00 132.86 ? 152 TYR A OH  1 
ATOM   1042 N  N   . LEU A 1 134 ? -9.415  5.420  149.573 1.00 117.49 ? 153 LEU A N   1 
ATOM   1043 C  CA  . LEU A 1 134 ? -7.974  5.691  149.392 1.00 119.18 ? 153 LEU A CA  1 
ATOM   1044 C  C   . LEU A 1 134 ? -7.458  6.805  150.314 1.00 119.80 ? 153 LEU A C   1 
ATOM   1045 O  O   . LEU A 1 134 ? -6.343  6.691  150.837 1.00 120.05 ? 153 LEU A O   1 
ATOM   1046 C  CB  . LEU A 1 134 ? -7.627  5.993  147.925 1.00 118.21 ? 153 LEU A CB  1 
ATOM   1047 C  CG  . LEU A 1 134 ? -7.762  4.836  146.919 1.00 120.44 ? 153 LEU A CG  1 
ATOM   1048 C  CD1 . LEU A 1 134 ? -7.617  5.338  145.488 1.00 115.89 ? 153 LEU A CD1 1 
ATOM   1049 C  CD2 . LEU A 1 134 ? -6.762  3.718  147.197 1.00 124.08 ? 153 LEU A CD2 1 
ATOM   1050 N  N   . THR A 1 135 ? -8.250  7.867  150.502 1.00 117.60 ? 154 THR A N   1 
ATOM   1051 C  CA  . THR A 1 135 ? -7.872  8.976  151.399 1.00 120.08 ? 154 THR A CA  1 
ATOM   1052 C  C   . THR A 1 135 ? -7.916  8.562  152.887 1.00 125.23 ? 154 THR A C   1 
ATOM   1053 O  O   . THR A 1 135 ? -7.134  9.078  153.687 1.00 125.89 ? 154 THR A O   1 
ATOM   1054 C  CB  . THR A 1 135 ? -8.711  10.245 151.166 1.00 118.07 ? 154 THR A CB  1 
ATOM   1055 O  OG1 . THR A 1 135 ? -10.098 9.918  151.239 1.00 118.85 ? 154 THR A OG1 1 
ATOM   1056 C  CG2 . THR A 1 135 ? -8.416  10.840 149.801 1.00 117.87 ? 154 THR A CG2 1 
ATOM   1057 N  N   . ALA A 1 136 ? -8.832  7.656  153.248 1.00 126.56 ? 155 ALA A N   1 
ATOM   1058 C  CA  . ALA A 1 136 ? -8.918  7.120  154.621 1.00 130.70 ? 155 ALA A CA  1 
ATOM   1059 C  C   . ALA A 1 136 ? -7.784  6.124  154.896 1.00 132.39 ? 155 ALA A C   1 
ATOM   1060 O  O   . ALA A 1 136 ? -7.375  5.973  156.049 1.00 131.67 ? 155 ALA A O   1 
ATOM   1061 C  CB  . ALA A 1 136 ? -10.266 6.454  154.877 1.00 130.44 ? 155 ALA A CB  1 
ATOM   1062 N  N   . GLU A 1 137 ? -7.287  5.455  153.845 1.00 131.81 ? 156 GLU A N   1 
ATOM   1063 C  CA  . GLU A 1 137 ? -6.194  4.475  153.963 1.00 136.62 ? 156 GLU A CA  1 
ATOM   1064 C  C   . GLU A 1 137 ? -4.879  5.180  154.353 1.00 137.80 ? 156 GLU A C   1 
ATOM   1065 O  O   . GLU A 1 137 ? -4.168  4.701  155.245 1.00 136.60 ? 156 GLU A O   1 
ATOM   1066 C  CB  . GLU A 1 137 ? -6.025  3.669  152.657 1.00 137.03 ? 156 GLU A CB  1 
ATOM   1067 C  CG  . GLU A 1 137 ? -5.207  2.381  152.772 1.00 143.55 ? 156 GLU A CG  1 
ATOM   1068 C  CD  . GLU A 1 137 ? -5.870  1.280  153.606 1.00 148.16 ? 156 GLU A CD  1 
ATOM   1069 O  OE1 . GLU A 1 137 ? -7.114  1.265  153.758 1.00 148.91 ? 156 GLU A OE1 1 
ATOM   1070 O  OE2 . GLU A 1 137 ? -5.137  0.397  154.099 1.00 151.46 ? 156 GLU A OE2 1 
ATOM   1071 N  N   . GLN A 1 138 ? -4.570  6.300  153.682 1.00 134.71 ? 157 GLN A N   1 
ATOM   1072 C  CA  . GLN A 1 138 ? -3.363  7.109  153.991 1.00 137.98 ? 157 GLN A CA  1 
ATOM   1073 C  C   . GLN A 1 138 ? -3.425  7.761  155.392 1.00 139.93 ? 157 GLN A C   1 
ATOM   1074 O  O   . GLN A 1 138 ? -2.391  7.875  156.061 1.00 139.35 ? 157 GLN A O   1 
ATOM   1075 C  CB  . GLN A 1 138 ? -3.039  8.149  152.897 1.00 137.14 ? 157 GLN A CB  1 
ATOM   1076 C  CG  . GLN A 1 138 ? -4.108  9.203  152.603 1.00 137.51 ? 157 GLN A CG  1 
ATOM   1077 C  CD  . GLN A 1 138 ? -3.729  10.155 151.470 1.00 137.28 ? 157 GLN A CD  1 
ATOM   1078 O  OE1 . GLN A 1 138 ? -2.550  10.357 151.172 1.00 142.03 ? 157 GLN A OE1 1 
ATOM   1079 N  NE2 . GLN A 1 138 ? -4.737  10.755 150.840 1.00 131.22 ? 157 GLN A NE2 1 
ATOM   1080 N  N   . GLU A 1 139 ? -4.622  8.186  155.815 1.00 138.00 ? 158 GLU A N   1 
ATOM   1081 C  CA  . GLU A 1 139 ? -4.839  8.757  157.165 1.00 139.98 ? 158 GLU A CA  1 
ATOM   1082 C  C   . GLU A 1 139 ? -4.660  7.686  158.262 1.00 140.70 ? 158 GLU A C   1 
ATOM   1083 O  O   . GLU A 1 139 ? -4.185  7.995  159.361 1.00 137.76 ? 158 GLU A O   1 
ATOM   1084 C  CB  . GLU A 1 139 ? -6.227  9.407  157.283 1.00 140.93 ? 158 GLU A CB  1 
ATOM   1085 C  CG  . GLU A 1 139 ? -6.421  10.666 156.439 1.00 142.38 ? 158 GLU A CG  1 
ATOM   1086 C  CD  . GLU A 1 139 ? -5.690  11.903 156.951 1.00 147.33 ? 158 GLU A CD  1 
ATOM   1087 O  OE1 . GLU A 1 139 ? -4.981  11.852 157.980 1.00 151.05 ? 158 GLU A OE1 1 
ATOM   1088 O  OE2 . GLU A 1 139 ? -5.836  12.959 156.304 1.00 152.46 ? 158 GLU A OE2 1 
ATOM   1089 N  N   . LYS A 1 140 ? -5.062  6.448  157.954 1.00 139.73 ? 159 LYS A N   1 
ATOM   1090 C  CA  . LYS A 1 140 ? -4.909  5.293  158.849 1.00 142.66 ? 159 LYS A CA  1 
ATOM   1091 C  C   . LYS A 1 140 ? -3.422  4.923  159.028 1.00 148.56 ? 159 LYS A C   1 
ATOM   1092 O  O   . LYS A 1 140 ? -3.028  4.497  160.114 1.00 153.74 ? 159 LYS A O   1 
ATOM   1093 C  CB  . LYS A 1 140 ? -5.717  4.097  158.317 1.00 141.34 ? 159 LYS A CB  1 
ATOM   1094 C  CG  . LYS A 1 140 ? -5.706  2.834  159.168 1.00 145.25 ? 159 LYS A CG  1 
ATOM   1095 C  CD  . LYS A 1 140 ? -6.624  1.787  158.553 1.00 145.21 ? 159 LYS A CD  1 
ATOM   1096 C  CE  . LYS A 1 140 ? -6.635  0.487  159.339 1.00 148.91 ? 159 LYS A CE  1 
ATOM   1097 N  NZ  . LYS A 1 140 ? -5.306  -0.182 159.340 1.00 153.78 ? 159 LYS A NZ  1 
ATOM   1098 N  N   . LYS A 1 141 ? -2.619  5.075  157.967 1.00 150.42 ? 160 LYS A N   1 
ATOM   1099 C  CA  . LYS A 1 141 ? -1.166  4.803  158.014 1.00 154.45 ? 160 LYS A CA  1 
ATOM   1100 C  C   . LYS A 1 141 ? -0.438  5.875  158.843 1.00 154.43 ? 160 LYS A C   1 
ATOM   1101 O  O   . LYS A 1 141 ? 0.477   5.540  159.597 1.00 157.80 ? 160 LYS A O   1 
ATOM   1102 C  CB  . LYS A 1 141 ? -0.567  4.721  156.599 1.00 156.45 ? 160 LYS A CB  1 
ATOM   1103 C  CG  . LYS A 1 141 ? 0.901   4.305  156.549 1.00 162.28 ? 160 LYS A CG  1 
ATOM   1104 C  CD  . LYS A 1 141 ? 1.411   4.214  155.122 1.00 164.92 ? 160 LYS A CD  1 
ATOM   1105 C  CE  . LYS A 1 141 ? 2.885   3.839  155.095 1.00 169.77 ? 160 LYS A CE  1 
ATOM   1106 N  NZ  . LYS A 1 141 ? 3.421   3.768  153.708 1.00 170.58 ? 160 LYS A NZ  1 
ATOM   1107 N  N   . LYS A 1 142 ? -0.826  7.146  158.667 1.00 151.55 ? 161 LYS A N   1 
ATOM   1108 C  CA  . LYS A 1 142 ? -0.267  8.292  159.424 1.00 152.94 ? 161 LYS A CA  1 
ATOM   1109 C  C   . LYS A 1 142 ? -0.539  8.129  160.929 1.00 157.88 ? 161 LYS A C   1 
ATOM   1110 O  O   . LYS A 1 142 ? 0.331   8.421  161.757 1.00 161.12 ? 161 LYS A O   1 
ATOM   1111 C  CB  . LYS A 1 142 ? -0.867  9.621  158.925 1.00 148.87 ? 161 LYS A CB  1 
ATOM   1112 C  CG  . LYS A 1 142 ? -0.339  10.885 159.601 1.00 150.05 ? 161 LYS A CG  1 
ATOM   1113 C  CD  . LYS A 1 142 ? -1.032  12.132 159.070 1.00 145.36 ? 161 LYS A CD  1 
ATOM   1114 C  CE  . LYS A 1 142 ? -0.521  13.397 159.746 1.00 147.24 ? 161 LYS A CE  1 
ATOM   1115 N  NZ  . LYS A 1 142 ? -0.728  13.391 161.220 1.00 149.05 ? 161 LYS A NZ  1 
ATOM   1116 N  N   . LEU A 1 143 ? -1.755  7.684  161.255 1.00 156.70 ? 162 LEU A N   1 
ATOM   1117 C  CA  . LEU A 1 143 ? -2.197  7.435  162.636 1.00 158.97 ? 162 LEU A CA  1 
ATOM   1118 C  C   . LEU A 1 143 ? -1.386  6.319  163.328 1.00 165.59 ? 162 LEU A C   1 
ATOM   1119 O  O   . LEU A 1 143 ? -1.049  6.438  164.515 1.00 168.63 ? 162 LEU A O   1 
ATOM   1120 C  CB  . LEU A 1 143 ? -3.697  7.105  162.639 1.00 155.35 ? 162 LEU A CB  1 
ATOM   1121 C  CG  . LEU A 1 143 ? -4.435  6.829  163.947 1.00 160.66 ? 162 LEU A CG  1 
ATOM   1122 C  CD1 . LEU A 1 143 ? -4.263  7.957  164.952 1.00 165.16 ? 162 LEU A CD1 1 
ATOM   1123 C  CD2 . LEU A 1 143 ? -5.905  6.606  163.637 1.00 156.31 ? 162 LEU A CD2 1 
ATOM   1124 N  N   . GLU A 1 144 ? -1.081  5.253  162.581 1.00 166.94 ? 163 GLU A N   1 
ATOM   1125 C  CA  . GLU A 1 144 ? -0.282  4.113  163.084 1.00 172.79 ? 163 GLU A CA  1 
ATOM   1126 C  C   . GLU A 1 144 ? 1.220   4.419  163.179 1.00 174.06 ? 163 GLU A C   1 
ATOM   1127 O  O   . GLU A 1 144 ? 1.886   3.910  164.081 1.00 178.56 ? 163 GLU A O   1 
ATOM   1128 C  CB  . GLU A 1 144 ? -0.509  2.865  162.221 1.00 176.36 ? 163 GLU A CB  1 
ATOM   1129 C  CG  . GLU A 1 144 ? -1.918  2.294  162.325 1.00 177.57 ? 163 GLU A CG  1 
ATOM   1130 C  CD  . GLU A 1 144 ? -2.219  1.213  161.295 1.00 179.14 ? 163 GLU A CD  1 
ATOM   1131 O  OE1 . GLU A 1 144 ? -1.278  0.646  160.696 1.00 183.64 ? 163 GLU A OE1 1 
ATOM   1132 O  OE2 . GLU A 1 144 ? -3.416  0.918  161.086 1.00 174.80 ? 163 GLU A OE2 1 
ATOM   1133 N  N   . THR A 1 145 ? 1.745   5.221  162.244 1.00 171.55 ? 164 THR A N   1 
ATOM   1134 C  CA  . THR A 1 145 ? 3.170   5.623  162.231 1.00 172.63 ? 164 THR A CA  1 
ATOM   1135 C  C   . THR A 1 145 ? 3.538   6.494  163.451 1.00 172.55 ? 164 THR A C   1 
ATOM   1136 O  O   . THR A 1 145 ? 4.648   6.376  163.978 1.00 176.32 ? 164 THR A O   1 
ATOM   1137 C  CB  . THR A 1 145 ? 3.547   6.379  160.927 1.00 170.16 ? 164 THR A CB  1 
ATOM   1138 O  OG1 . THR A 1 145 ? 3.148   5.612  159.783 1.00 166.42 ? 164 THR A OG1 1 
ATOM   1139 C  CG2 . THR A 1 145 ? 5.054   6.651  160.848 1.00 173.29 ? 164 THR A CG2 1 
ATOM   1140 N  N   . ASP A 1 146 ? 2.609   7.355  163.881 1.00 169.37 ? 165 ASP A N   1 
ATOM   1141 C  CA  . ASP A 1 146 ? 2.803   8.236  165.048 1.00 172.62 ? 165 ASP A CA  1 
ATOM   1142 C  C   . ASP A 1 146 ? 2.847   7.453  166.369 1.00 175.46 ? 165 ASP A C   1 
ATOM   1143 O  O   . ASP A 1 146 ? 3.721   7.704  167.203 1.00 178.72 ? 165 ASP A O   1 
ATOM   1144 C  CB  . ASP A 1 146 ? 1.700   9.313  165.138 1.00 169.76 ? 165 ASP A CB  1 
ATOM   1145 C  CG  . ASP A 1 146 ? 1.726   10.313 163.978 1.00 168.33 ? 165 ASP A CG  1 
ATOM   1146 O  OD1 . ASP A 1 146 ? 2.502   10.141 163.011 1.00 169.32 ? 165 ASP A OD1 1 
ATOM   1147 O  OD2 . ASP A 1 146 ? 0.944   11.285 164.038 1.00 166.63 ? 165 ASP A OD2 1 
ATOM   1148 N  N   . TYR A 1 147 ? 1.906   6.519  166.542 1.00 174.17 ? 166 TYR A N   1 
ATOM   1149 C  CA  . TYR A 1 147 ? 1.803   5.696  167.758 1.00 177.93 ? 166 TYR A CA  1 
ATOM   1150 C  C   . TYR A 1 147 ? 2.912   4.649  167.861 1.00 184.90 ? 166 TYR A C   1 
ATOM   1151 O  O   . TYR A 1 147 ? 3.616   4.589  168.878 1.00 187.09 ? 166 TYR A O   1 
ATOM   1152 C  CB  . TYR A 1 147 ? 0.439   5.001  167.837 1.00 173.46 ? 166 TYR A CB  1 
ATOM   1153 N  N   . LYS A 1 148 ? 3.062   3.835  166.813 1.00 185.08 ? 167 LYS A N   1 
ATOM   1154 C  CA  . LYS A 1 148 ? 4.080   2.771  166.783 1.00 191.19 ? 167 LYS A CA  1 
ATOM   1155 C  C   . LYS A 1 148 ? 5.453   3.316  166.398 1.00 192.43 ? 167 LYS A C   1 
ATOM   1156 O  O   . LYS A 1 148 ? 6.375   3.332  167.218 1.00 191.57 ? 167 LYS A O   1 
ATOM   1157 C  CB  . LYS A 1 148 ? 3.666   1.638  165.839 1.00 191.68 ? 167 LYS A CB  1 
ATOM   1158 C  CG  . LYS A 1 148 ? 2.359   0.968  166.250 1.00 191.67 ? 167 LYS A CG  1 
ATOM   1159 C  CD  . LYS A 1 148 ? 2.030   -0.322 165.499 1.00 191.01 ? 167 LYS A CD  1 
ATOM   1160 C  CE  . LYS A 1 148 ? 1.713   -0.138 164.021 1.00 186.62 ? 167 LYS A CE  1 
ATOM   1161 N  NZ  . LYS A 1 148 ? 2.877   0.213  163.162 1.00 188.51 ? 167 LYS A NZ  1 
ATOM   1162 N  N   . SER A 1 152 ? 6.729   3.217  177.922 1.00 217.89 ? 171 SER A N   1 
ATOM   1163 C  CA  . SER A 1 152 ? 6.255   3.714  176.638 1.00 211.04 ? 171 SER A CA  1 
ATOM   1164 C  C   . SER A 1 152 ? 5.832   2.554  175.722 1.00 209.68 ? 171 SER A C   1 
ATOM   1165 O  O   . SER A 1 152 ? 6.527   1.534  175.682 1.00 211.57 ? 171 SER A O   1 
ATOM   1166 C  CB  . SER A 1 152 ? 7.356   4.527  175.968 1.00 210.98 ? 171 SER A CB  1 
ATOM   1167 O  OG  . SER A 1 152 ? 6.979   4.981  174.685 1.00 204.87 ? 171 SER A OG  1 
ATOM   1168 N  N   . PRO A 1 153 ? 4.715   2.706  174.965 1.00 207.20 ? 172 PRO A N   1 
ATOM   1169 C  CA  . PRO A 1 153 ? 3.792   3.853  174.866 1.00 204.34 ? 172 PRO A CA  1 
ATOM   1170 C  C   . PRO A 1 153 ? 2.827   3.987  176.060 1.00 206.43 ? 172 PRO A C   1 
ATOM   1171 O  O   . PRO A 1 153 ? 2.548   2.996  176.747 1.00 209.53 ? 172 PRO A O   1 
ATOM   1172 C  CB  . PRO A 1 153 ? 3.032   3.574  173.566 1.00 200.72 ? 172 PRO A CB  1 
ATOM   1173 C  CG  . PRO A 1 153 ? 3.011   2.092  173.469 1.00 201.52 ? 172 PRO A CG  1 
ATOM   1174 C  CD  . PRO A 1 153 ? 4.308   1.614  174.058 1.00 204.33 ? 172 PRO A CD  1 
ATOM   1175 N  N   . THR A 1 154 ? 2.335   5.208  176.288 1.00 204.10 ? 173 THR A N   1 
ATOM   1176 C  CA  . THR A 1 154 ? 1.410   5.506  177.393 1.00 205.55 ? 173 THR A CA  1 
ATOM   1177 C  C   . THR A 1 154 ? -0.013  5.160  176.953 1.00 200.07 ? 173 THR A C   1 
ATOM   1178 O  O   . THR A 1 154 ? -0.367  5.358  175.789 1.00 198.35 ? 173 THR A O   1 
ATOM   1179 C  CB  . THR A 1 154 ? 1.489   6.991  177.830 1.00 207.27 ? 173 THR A CB  1 
ATOM   1180 O  OG1 . THR A 1 154 ? 2.830   7.306  178.219 1.00 210.38 ? 173 THR A OG1 1 
ATOM   1181 C  CG2 . THR A 1 154 ? 0.567   7.279  179.016 1.00 208.98 ? 173 THR A CG2 1 
ATOM   1182 N  N   . LYS A 1 155 ? -0.817  4.645  177.886 1.00 200.56 ? 174 LYS A N   1 
ATOM   1183 C  CA  . LYS A 1 155 ? -2.226  4.272  177.612 1.00 197.89 ? 174 LYS A CA  1 
ATOM   1184 C  C   . LYS A 1 155 ? -3.160  5.452  177.236 1.00 196.02 ? 174 LYS A C   1 
ATOM   1185 O  O   . LYS A 1 155 ? -4.226  5.223  176.657 1.00 188.87 ? 174 LYS A O   1 
ATOM   1186 C  CB  . LYS A 1 155 ? -2.814  3.408  178.744 1.00 198.44 ? 174 LYS A CB  1 
ATOM   1187 C  CG  . LYS A 1 155 ? -2.897  4.055  180.120 1.00 203.28 ? 174 LYS A CG  1 
ATOM   1188 C  CD  . LYS A 1 155 ? -3.237  3.024  181.184 1.00 205.64 ? 174 LYS A CD  1 
ATOM   1189 C  CE  . LYS A 1 155 ? -3.211  3.637  182.573 1.00 209.62 ? 174 LYS A CE  1 
ATOM   1190 N  NZ  . LYS A 1 155 ? -3.454  2.635  183.648 1.00 212.81 ? 174 LYS A NZ  1 
HETATM 1191 N  N   . MSE A 1 156 ? -2.765  6.685  177.577 1.00 201.13 ? 175 MSE A N   1 
HETATM 1192 C  CA  . MSE A 1 156 ? -3.497  7.915  177.198 1.00 203.03 ? 175 MSE A CA  1 
HETATM 1193 C  C   . MSE A 1 156 ? -3.333  8.163  175.686 1.00 200.62 ? 175 MSE A C   1 
HETATM 1194 O  O   . MSE A 1 156 ? -4.301  8.505  174.991 1.00 192.75 ? 175 MSE A O   1 
HETATM 1195 C  CB  . MSE A 1 156 ? -2.982  9.119  178.011 1.00 212.71 ? 175 MSE A CB  1 
HETATM 1196 C  CG  . MSE A 1 156 ? -3.561  10.502 177.663 1.00 216.95 ? 175 MSE A CG  1 
HETATM 1197 SE SE  . MSE A 1 156 ? -5.507  10.618 177.622 0.75 228.79 ? 175 MSE A SE  1 
HETATM 1198 C  CE  . MSE A 1 156 ? -5.690  12.549 177.434 1.00 227.49 ? 175 MSE A CE  1 
ATOM   1199 N  N   . GLN A 1 157 ? -2.098  7.998  175.201 1.00 200.95 ? 176 GLN A N   1 
ATOM   1200 C  CA  . GLN A 1 157 ? -1.758  8.143  173.776 1.00 194.75 ? 176 GLN A CA  1 
ATOM   1201 C  C   . GLN A 1 157 ? -2.383  7.001  172.957 1.00 188.58 ? 176 GLN A C   1 
ATOM   1202 O  O   . GLN A 1 157 ? -2.770  7.216  171.803 1.00 186.45 ? 176 GLN A O   1 
ATOM   1203 C  CB  . GLN A 1 157 ? -0.235  8.177  173.576 1.00 199.40 ? 176 GLN A CB  1 
ATOM   1204 C  CG  . GLN A 1 157 ? 0.460   9.360  174.254 1.00 203.66 ? 176 GLN A CG  1 
ATOM   1205 C  CD  . GLN A 1 157 ? 1.982   9.317  174.181 1.00 207.71 ? 176 GLN A CD  1 
ATOM   1206 O  OE1 . GLN A 1 157 ? 2.577   8.397  173.617 1.00 211.19 ? 176 GLN A OE1 1 
ATOM   1207 N  NE2 . GLN A 1 157 ? 2.619   10.323 174.767 1.00 210.60 ? 176 GLN A NE2 1 
ATOM   1208 N  N   . TYR A 1 158 ? -2.465  5.802  173.552 1.00 186.63 ? 177 TYR A N   1 
ATOM   1209 C  CA  . TYR A 1 158 ? -3.103  4.631  172.919 1.00 182.15 ? 177 TYR A CA  1 
ATOM   1210 C  C   . TYR A 1 158 ? -4.630  4.840  172.790 1.00 176.79 ? 177 TYR A C   1 
ATOM   1211 O  O   . TYR A 1 158 ? -5.239  4.340  171.835 1.00 172.84 ? 177 TYR A O   1 
ATOM   1212 C  CB  . TYR A 1 158 ? -2.767  3.328  173.672 1.00 185.01 ? 177 TYR A CB  1 
ATOM   1213 C  CG  . TYR A 1 158 ? -3.332  2.082  173.019 1.00 183.53 ? 177 TYR A CG  1 
ATOM   1214 C  CD1 . TYR A 1 158 ? -2.734  1.539  171.872 1.00 183.78 ? 177 TYR A CD1 1 
ATOM   1215 C  CD2 . TYR A 1 158 ? -4.469  1.444  173.537 1.00 183.12 ? 177 TYR A CD2 1 
ATOM   1216 C  CE1 . TYR A 1 158 ? -3.256  0.401  171.255 1.00 182.93 ? 177 TYR A CE1 1 
ATOM   1217 C  CE2 . TYR A 1 158 ? -4.995  0.301  172.932 1.00 183.11 ? 177 TYR A CE2 1 
ATOM   1218 C  CZ  . TYR A 1 158 ? -4.388  -0.219 171.791 1.00 183.02 ? 177 TYR A CZ  1 
ATOM   1219 O  OH  . TYR A 1 158 ? -4.905  -1.344 171.187 1.00 180.40 ? 177 TYR A OH  1 
ATOM   1220 N  N   . ALA A 1 159 ? -5.232  5.560  173.748 1.00 174.76 ? 178 ALA A N   1 
ATOM   1221 C  CA  . ALA A 1 159 ? -6.666  5.908  173.709 1.00 171.76 ? 178 ALA A CA  1 
ATOM   1222 C  C   . ALA A 1 159 ? -6.920  6.864  172.539 1.00 168.28 ? 178 ALA A C   1 
ATOM   1223 O  O   . ALA A 1 159 ? -7.855  6.653  171.763 1.00 163.43 ? 178 ALA A O   1 
ATOM   1224 C  CB  . ALA A 1 159 ? -7.116  6.546  175.013 1.00 175.69 ? 178 ALA A CB  1 
ATOM   1225 N  N   . ARG A 1 160 ? -6.075  7.897  172.424 1.00 168.50 ? 179 ARG A N   1 
ATOM   1226 C  CA  . ARG A 1 160 ? -6.133  8.877  171.322 1.00 167.54 ? 179 ARG A CA  1 
ATOM   1227 C  C   . ARG A 1 160 ? -5.902  8.218  169.944 1.00 163.29 ? 179 ARG A C   1 
ATOM   1228 O  O   . ARG A 1 160 ? -6.466  8.671  168.949 1.00 159.71 ? 179 ARG A O   1 
ATOM   1229 C  CB  . ARG A 1 160 ? -5.122  10.010 171.541 1.00 169.75 ? 179 ARG A CB  1 
ATOM   1230 N  N   . TYR A 1 161 ? -5.073  7.165  169.910 1.00 166.73 ? 180 TYR A N   1 
ATOM   1231 C  CA  . TYR A 1 161 ? -4.782  6.372  168.693 1.00 165.74 ? 180 TYR A CA  1 
ATOM   1232 C  C   . TYR A 1 161 ? -6.027  5.619  168.197 1.00 165.80 ? 180 TYR A C   1 
ATOM   1233 O  O   . TYR A 1 161 ? -6.414  5.774  167.029 1.00 160.20 ? 180 TYR A O   1 
ATOM   1234 C  CB  . TYR A 1 161 ? -3.581  5.414  168.918 1.00 169.27 ? 180 TYR A CB  1 
ATOM   1235 C  CG  . TYR A 1 161 ? -3.484  4.235  167.960 1.00 168.28 ? 180 TYR A CG  1 
ATOM   1236 C  CD1 . TYR A 1 161 ? -3.102  4.412  166.619 1.00 168.08 ? 180 TYR A CD1 1 
ATOM   1237 C  CD2 . TYR A 1 161 ? -3.763  2.927  168.400 1.00 169.24 ? 180 TYR A CD2 1 
ATOM   1238 C  CE1 . TYR A 1 161 ? -3.019  3.325  165.742 1.00 166.63 ? 180 TYR A CE1 1 
ATOM   1239 C  CE2 . TYR A 1 161 ? -3.676  1.837  167.535 1.00 170.83 ? 180 TYR A CE2 1 
ATOM   1240 C  CZ  . TYR A 1 161 ? -3.307  2.036  166.208 1.00 168.93 ? 180 TYR A CZ  1 
ATOM   1241 O  OH  . TYR A 1 161 ? -3.226  0.956  165.359 1.00 170.00 ? 180 TYR A OH  1 
ATOM   1242 N  N   . ARG A 1 162 ? -6.629  4.807  169.073 1.00 169.26 ? 181 ARG A N   1 
ATOM   1243 C  CA  . ARG A 1 162 ? -7.852  4.043  168.729 1.00 169.39 ? 181 ARG A CA  1 
ATOM   1244 C  C   . ARG A 1 162 ? -9.079  4.942  168.441 1.00 162.35 ? 181 ARG A C   1 
ATOM   1245 O  O   . ARG A 1 162 ? -9.947  4.550  167.654 1.00 156.13 ? 181 ARG A O   1 
ATOM   1246 C  CB  . ARG A 1 162 ? -8.186  2.964  169.782 1.00 176.13 ? 181 ARG A CB  1 
ATOM   1247 C  CG  . ARG A 1 162 ? -7.324  1.703  169.795 1.00 183.04 ? 181 ARG A CG  1 
ATOM   1248 C  CD  . ARG A 1 162 ? -7.499  0.891  168.512 1.00 188.54 ? 181 ARG A CD  1 
ATOM   1249 N  NE  . ARG A 1 162 ? -7.022  -0.494 168.618 1.00 195.17 ? 181 ARG A NE  1 
ATOM   1250 C  CZ  . ARG A 1 162 ? -7.744  -1.555 169.011 1.00 200.45 ? 181 ARG A CZ  1 
ATOM   1251 N  NH1 . ARG A 1 162 ? -9.033  -1.455 169.375 1.00 200.10 ? 181 ARG A NH1 1 
ATOM   1252 N  NH2 . ARG A 1 162 ? -7.161  -2.757 169.047 1.00 206.74 ? 181 ARG A NH2 1 
ATOM   1253 N  N   . ASP A 1 163 ? -9.160  6.106  169.101 1.00 160.36 ? 182 ASP A N   1 
ATOM   1254 C  CA  . ASP A 1 163 ? -10.233 7.100  168.846 1.00 156.78 ? 182 ASP A CA  1 
ATOM   1255 C  C   . ASP A 1 163 ? -10.110 7.710  167.449 1.00 149.72 ? 182 ASP A C   1 
ATOM   1256 O  O   . ASP A 1 163 ? -11.128 8.030  166.836 1.00 146.27 ? 182 ASP A O   1 
ATOM   1257 C  CB  . ASP A 1 163 ? -10.271 8.221  169.908 1.00 160.59 ? 182 ASP A CB  1 
ATOM   1258 C  CG  . ASP A 1 163 ? -11.024 7.820  171.164 1.00 165.71 ? 182 ASP A CG  1 
ATOM   1259 O  OD1 . ASP A 1 163 ? -12.189 7.388  171.042 1.00 165.96 ? 182 ASP A OD1 1 
ATOM   1260 O  OD2 . ASP A 1 163 ? -10.488 8.001  172.274 1.00 172.79 ? 182 ASP A OD2 1 
ATOM   1261 N  N   . GLY A 1 164 ? -8.872  7.900  166.980 1.00 147.96 ? 183 GLY A N   1 
ATOM   1262 C  CA  . GLY A 1 164 ? -8.597  8.397  165.625 1.00 145.46 ? 183 GLY A CA  1 
ATOM   1263 C  C   . GLY A 1 164 ? -9.082  7.395  164.584 1.00 142.21 ? 183 GLY A C   1 
ATOM   1264 O  O   . GLY A 1 164 ? -9.647  7.794  163.559 1.00 140.90 ? 183 GLY A O   1 
ATOM   1265 N  N   . LEU A 1 165 ? -8.851  6.100  164.852 1.00 143.55 ? 184 LEU A N   1 
ATOM   1266 C  CA  . LEU A 1 165 ? -9.315  5.000  163.987 1.00 144.02 ? 184 LEU A CA  1 
ATOM   1267 C  C   . LEU A 1 165 ? -10.847 4.951  163.921 1.00 143.22 ? 184 LEU A C   1 
ATOM   1268 O  O   . LEU A 1 165 ? -11.403 4.680  162.868 1.00 136.03 ? 184 LEU A O   1 
ATOM   1269 C  CB  . LEU A 1 165 ? -8.787  3.630  164.459 1.00 145.66 ? 184 LEU A CB  1 
ATOM   1270 C  CG  . LEU A 1 165 ? -7.285  3.336  164.433 1.00 147.57 ? 184 LEU A CG  1 
ATOM   1271 C  CD1 . LEU A 1 165 ? -7.029  1.951  165.002 1.00 152.62 ? 184 LEU A CD1 1 
ATOM   1272 C  CD2 . LEU A 1 165 ? -6.722  3.426  163.024 1.00 148.42 ? 184 LEU A CD2 1 
ATOM   1273 N  N   . SER A 1 166 ? -11.510 5.209  165.050 1.00 147.89 ? 185 SER A N   1 
ATOM   1274 C  CA  . SER A 1 166 ? -12.979 5.222  165.125 1.00 149.12 ? 185 SER A CA  1 
ATOM   1275 C  C   . SER A 1 166 ? -13.588 6.442  164.401 1.00 147.35 ? 185 SER A C   1 
ATOM   1276 O  O   . SER A 1 166 ? -14.534 6.289  163.620 1.00 147.98 ? 185 SER A O   1 
ATOM   1277 C  CB  . SER A 1 166 ? -13.434 5.188  166.592 1.00 151.54 ? 185 SER A CB  1 
ATOM   1278 O  OG  . SER A 1 166 ? -14.843 5.125  166.704 1.00 152.16 ? 185 SER A OG  1 
ATOM   1279 N  N   . LYS A 1 167 ? -13.026 7.629  164.655 1.00 147.34 ? 186 LYS A N   1 
ATOM   1280 C  CA  . LYS A 1 167 ? -13.501 8.904  164.068 1.00 144.21 ? 186 LYS A CA  1 
ATOM   1281 C  C   . LYS A 1 167 ? -13.327 8.926  162.549 1.00 141.64 ? 186 LYS A C   1 
ATOM   1282 O  O   . LYS A 1 167 ? -14.233 9.345  161.814 1.00 137.19 ? 186 LYS A O   1 
ATOM   1283 C  CB  . LYS A 1 167 ? -12.741 10.095 164.675 1.00 148.01 ? 186 LYS A CB  1 
ATOM   1284 C  CG  . LYS A 1 167 ? -13.409 11.456 164.533 1.00 149.50 ? 186 LYS A CG  1 
ATOM   1285 C  CD  . LYS A 1 167 ? -14.642 11.561 165.425 1.00 156.77 ? 186 LYS A CD  1 
ATOM   1286 C  CE  . LYS A 1 167 ? -15.169 12.982 165.515 1.00 158.14 ? 186 LYS A CE  1 
ATOM   1287 N  NZ  . LYS A 1 167 ? -15.529 13.537 164.184 1.00 150.96 ? 186 LYS A NZ  1 
ATOM   1288 N  N   . LEU A 1 168 ? -12.154 8.482  162.097 1.00 139.96 ? 187 LEU A N   1 
ATOM   1289 C  CA  . LEU A 1 168 ? -11.837 8.397  160.667 1.00 134.09 ? 187 LEU A CA  1 
ATOM   1290 C  C   . LEU A 1 168 ? -12.730 7.360  159.966 1.00 132.07 ? 187 LEU A C   1 
ATOM   1291 O  O   . LEU A 1 168 ? -13.068 7.556  158.799 1.00 131.62 ? 187 LEU A O   1 
ATOM   1292 C  CB  . LEU A 1 168 ? -10.341 8.084  160.461 1.00 134.70 ? 187 LEU A CB  1 
ATOM   1293 C  CG  . LEU A 1 168 ? -9.668  8.076  159.075 1.00 134.08 ? 187 LEU A CG  1 
ATOM   1294 C  CD1 . LEU A 1 168 ? -10.003 6.849  158.238 1.00 134.18 ? 187 LEU A CD1 1 
ATOM   1295 C  CD2 . LEU A 1 168 ? -9.964  9.363  158.309 1.00 129.59 ? 187 LEU A CD2 1 
ATOM   1296 N  N   . PHE A 1 169 ? -13.116 6.287  160.670 1.00 132.81 ? 188 PHE A N   1 
ATOM   1297 C  CA  . PHE A 1 169 ? -13.981 5.244  160.099 1.00 134.04 ? 188 PHE A CA  1 
ATOM   1298 C  C   . PHE A 1 169 ? -15.404 5.754  159.833 1.00 134.21 ? 188 PHE A C   1 
ATOM   1299 O  O   . PHE A 1 169 ? -15.898 5.650  158.704 1.00 130.45 ? 188 PHE A O   1 
ATOM   1300 C  CB  . PHE A 1 169 ? -14.025 3.975  160.970 1.00 136.83 ? 188 PHE A CB  1 
ATOM   1301 C  CG  . PHE A 1 169 ? -14.798 2.845  160.342 1.00 140.45 ? 188 PHE A CG  1 
ATOM   1302 C  CD1 . PHE A 1 169 ? -14.181 1.995  159.417 1.00 140.48 ? 188 PHE A CD1 1 
ATOM   1303 C  CD2 . PHE A 1 169 ? -16.150 2.638  160.647 1.00 144.14 ? 188 PHE A CD2 1 
ATOM   1304 C  CE1 . PHE A 1 169 ? -14.894 0.959  158.812 1.00 141.78 ? 188 PHE A CE1 1 
ATOM   1305 C  CE2 . PHE A 1 169 ? -16.867 1.604  160.043 1.00 146.27 ? 188 PHE A CE2 1 
ATOM   1306 C  CZ  . PHE A 1 169 ? -16.238 0.763  159.123 1.00 144.22 ? 188 PHE A CZ  1 
ATOM   1307 N  N   . THR A 1 170 ? -16.053 6.289  160.867 1.00 135.83 ? 189 THR A N   1 
ATOM   1308 C  CA  . THR A 1 170 ? -17.431 6.805  160.742 1.00 135.99 ? 189 THR A CA  1 
ATOM   1309 C  C   . THR A 1 170 ? -17.569 8.031  159.813 1.00 136.95 ? 189 THR A C   1 
ATOM   1310 O  O   . THR A 1 170 ? -18.607 8.201  159.163 1.00 136.45 ? 189 THR A O   1 
ATOM   1311 C  CB  . THR A 1 170 ? -18.039 7.133  162.118 1.00 138.76 ? 189 THR A CB  1 
ATOM   1312 O  OG1 . THR A 1 170 ? -17.185 8.053  162.804 1.00 140.18 ? 189 THR A OG1 1 
ATOM   1313 C  CG2 . THR A 1 170 ? -18.189 5.865  162.956 1.00 138.79 ? 189 THR A CG2 1 
ATOM   1314 N  N   . THR A 1 171 ? -16.518 8.852  159.738 1.00 137.59 ? 190 THR A N   1 
ATOM   1315 C  CA  . THR A 1 171 ? -16.504 10.061 158.906 1.00 133.84 ? 190 THR A CA  1 
ATOM   1316 C  C   . THR A 1 171 ? -16.155 9.771  157.447 1.00 134.85 ? 190 THR A C   1 
ATOM   1317 O  O   . THR A 1 171 ? -16.869 10.215 156.540 1.00 131.83 ? 190 THR A O   1 
ATOM   1318 C  CB  . THR A 1 171 ? -15.475 11.092 159.438 1.00 136.01 ? 190 THR A CB  1 
ATOM   1319 O  OG1 . THR A 1 171 ? -15.716 11.346 160.827 1.00 142.07 ? 190 THR A OG1 1 
ATOM   1320 C  CG2 . THR A 1 171 ? -15.548 12.409 158.668 1.00 134.83 ? 190 THR A CG2 1 
ATOM   1321 N  N   . ARG A 1 172 ? -15.073 9.014  157.236 1.00 133.89 ? 191 ARG A N   1 
ATOM   1322 C  CA  . ARG A 1 172 ? -14.540 8.735  155.896 1.00 126.94 ? 191 ARG A CA  1 
ATOM   1323 C  C   . ARG A 1 172 ? -14.865 7.350  155.306 1.00 125.66 ? 191 ARG A C   1 
ATOM   1324 O  O   . ARG A 1 172 ? -15.414 7.296  154.199 1.00 123.67 ? 191 ARG A O   1 
ATOM   1325 C  CB  . ARG A 1 172 ? -13.038 9.026  155.907 1.00 128.13 ? 191 ARG A CB  1 
ATOM   1326 C  CG  . ARG A 1 172 ? -12.413 9.199  154.541 1.00 130.75 ? 191 ARG A CG  1 
ATOM   1327 C  CD  . ARG A 1 172 ? -11.052 9.876  154.628 1.00 133.29 ? 191 ARG A CD  1 
ATOM   1328 N  NE  . ARG A 1 172 ? -11.169 11.311 154.928 1.00 133.10 ? 191 ARG A NE  1 
ATOM   1329 C  CZ  . ARG A 1 172 ? -11.330 12.300 154.035 1.00 128.86 ? 191 ARG A CZ  1 
ATOM   1330 N  NH1 . ARG A 1 172 ? -11.416 12.069 152.716 1.00 130.68 ? 191 ARG A NH1 1 
ATOM   1331 N  NH2 . ARG A 1 172 ? -11.419 13.560 154.470 1.00 128.13 ? 191 ARG A NH2 1 
ATOM   1332 N  N   . TYR A 1 173 ? -14.531 6.252  156.000 1.00 125.79 ? 192 TYR A N   1 
ATOM   1333 C  CA  . TYR A 1 173 ? -14.844 4.878  155.503 1.00 127.17 ? 192 TYR A CA  1 
ATOM   1334 C  C   . TYR A 1 173 ? -16.349 4.639  155.259 1.00 126.01 ? 192 TYR A C   1 
ATOM   1335 O  O   . TYR A 1 173 ? -16.711 3.980  154.264 1.00 122.76 ? 192 TYR A O   1 
ATOM   1336 C  CB  . TYR A 1 173 ? -14.288 3.756  156.407 1.00 133.88 ? 192 TYR A CB  1 
ATOM   1337 C  CG  . TYR A 1 173 ? -12.815 3.408  156.242 1.00 141.05 ? 192 TYR A CG  1 
ATOM   1338 C  CD1 . TYR A 1 173 ? -12.421 2.384  155.371 1.00 146.36 ? 192 TYR A CD1 1 
ATOM   1339 C  CD2 . TYR A 1 173 ? -11.814 4.054  156.986 1.00 148.32 ? 192 TYR A CD2 1 
ATOM   1340 C  CE1 . TYR A 1 173 ? -11.080 2.029  155.220 1.00 149.96 ? 192 TYR A CE1 1 
ATOM   1341 C  CE2 . TYR A 1 173 ? -10.467 3.705  156.843 1.00 150.80 ? 192 TYR A CE2 1 
ATOM   1342 C  CZ  . TYR A 1 173 ? -10.103 2.694  155.960 1.00 150.30 ? 192 TYR A CZ  1 
ATOM   1343 O  OH  . TYR A 1 173 ? -8.778  2.348  155.817 1.00 150.84 ? 192 TYR A OH  1 
ATOM   1344 N  N   . GLU A 1 174 ? -17.198 5.172  156.150 1.00 122.79 ? 193 GLU A N   1 
ATOM   1345 C  CA  . GLU A 1 174 ? -18.676 5.064  156.038 1.00 122.52 ? 193 GLU A CA  1 
ATOM   1346 C  C   . GLU A 1 174 ? -19.216 5.622  154.709 1.00 119.25 ? 193 GLU A C   1 
ATOM   1347 O  O   . GLU A 1 174 ? -20.110 5.027  154.103 1.00 114.90 ? 193 GLU A O   1 
ATOM   1348 C  CB  . GLU A 1 174 ? -19.376 5.774  157.200 1.00 123.45 ? 193 GLU A CB  1 
ATOM   1349 N  N   . LYS A 1 175 ? -18.668 6.762  154.281 1.00 118.72 ? 194 LYS A N   1 
ATOM   1350 C  CA  . LYS A 1 175 ? -19.036 7.393  153.003 1.00 120.36 ? 194 LYS A CA  1 
ATOM   1351 C  C   . LYS A 1 175 ? -18.527 6.556  151.818 1.00 118.04 ? 194 LYS A C   1 
ATOM   1352 O  O   . LYS A 1 175 ? -19.170 6.532  150.765 1.00 126.10 ? 194 LYS A O   1 
ATOM   1353 C  CB  . LYS A 1 175 ? -18.527 8.837  152.925 1.00 121.59 ? 194 LYS A CB  1 
ATOM   1354 C  CG  . LYS A 1 175 ? -19.153 9.739  153.979 1.00 128.90 ? 194 LYS A CG  1 
ATOM   1355 C  CD  . LYS A 1 175 ? -18.590 11.148 153.959 1.00 132.55 ? 194 LYS A CD  1 
ATOM   1356 C  CE  . LYS A 1 175 ? -19.229 11.987 155.055 1.00 136.85 ? 194 LYS A CE  1 
ATOM   1357 N  NZ  . LYS A 1 175 ? -18.648 13.354 155.133 1.00 141.34 ? 194 LYS A NZ  1 
ATOM   1358 N  N   . ALA A 1 176 ? -17.383 5.880  151.999 1.00 116.45 ? 195 ALA A N   1 
ATOM   1359 C  CA  . ALA A 1 176 ? -16.802 4.990  150.984 1.00 113.43 ? 195 ALA A CA  1 
ATOM   1360 C  C   . ALA A 1 176 ? -17.693 3.766  150.758 1.00 116.36 ? 195 ALA A C   1 
ATOM   1361 O  O   . ALA A 1 176 ? -17.994 3.427  149.605 1.00 119.23 ? 195 ALA A O   1 
ATOM   1362 C  CB  . ALA A 1 176 ? -15.395 4.553  151.367 1.00 111.97 ? 195 ALA A CB  1 
ATOM   1363 N  N   . ARG A 1 177 ? -18.124 3.131  151.849 1.00 118.95 ? 196 ARG A N   1 
ATOM   1364 C  CA  . ARG A 1 177 ? -19.004 1.951  151.783 1.00 122.14 ? 196 ARG A CA  1 
ATOM   1365 C  C   . ARG A 1 177 ? -20.414 2.296  151.269 1.00 122.70 ? 196 ARG A C   1 
ATOM   1366 O  O   . ARG A 1 177 ? -21.011 1.479  150.568 1.00 125.64 ? 196 ARG A O   1 
ATOM   1367 C  CB  . ARG A 1 177 ? -19.072 1.216  153.135 1.00 124.49 ? 196 ARG A CB  1 
ATOM   1368 C  CG  . ARG A 1 177 ? -19.868 -0.089 153.104 1.00 127.01 ? 196 ARG A CG  1 
ATOM   1369 C  CD  . ARG A 1 177 ? -19.702 -0.922 154.371 1.00 130.84 ? 196 ARG A CD  1 
ATOM   1370 N  NE  . ARG A 1 177 ? -20.133 -0.225 155.580 1.00 129.82 ? 196 ARG A NE  1 
ATOM   1371 C  CZ  . ARG A 1 177 ? -20.110 -0.739 156.814 1.00 136.08 ? 196 ARG A CZ  1 
ATOM   1372 N  NH1 . ARG A 1 177 ? -19.685 -1.988 157.049 1.00 140.35 ? 196 ARG A NH1 1 
ATOM   1373 N  NH2 . ARG A 1 177 ? -20.526 0.008  157.837 1.00 135.07 ? 196 ARG A NH2 1 
ATOM   1374 N  N   . ASN A 1 178 ? -20.938 3.476  151.620 1.00 121.98 ? 197 ASN A N   1 
ATOM   1375 C  CA  . ASN A 1 178 ? -22.267 3.926  151.147 1.00 123.92 ? 197 ASN A CA  1 
ATOM   1376 C  C   . ASN A 1 178 ? -22.317 4.052  149.611 1.00 122.25 ? 197 ASN A C   1 
ATOM   1377 O  O   . ASN A 1 178 ? -23.318 3.682  148.986 1.00 120.70 ? 197 ASN A O   1 
ATOM   1378 C  CB  . ASN A 1 178 ? -22.657 5.270  151.789 1.00 126.83 ? 197 ASN A CB  1 
ATOM   1379 C  CG  . ASN A 1 178 ? -24.054 5.747  151.388 1.00 131.61 ? 197 ASN A CG  1 
ATOM   1380 O  OD1 . ASN A 1 178 ? -24.972 4.948  151.182 1.00 137.64 ? 197 ASN A OD1 1 
ATOM   1381 N  ND2 . ASN A 1 178 ? -24.222 7.061  151.297 1.00 134.39 ? 197 ASN A ND2 1 
ATOM   1382 N  N   . SER A 1 179 ? -21.239 4.579  149.028 1.00 117.99 ? 198 SER A N   1 
ATOM   1383 C  CA  . SER A 1 179 ? -21.127 4.731  147.579 1.00 117.73 ? 198 SER A CA  1 
ATOM   1384 C  C   . SER A 1 179 ? -20.871 3.386  146.889 1.00 117.78 ? 198 SER A C   1 
ATOM   1385 O  O   . SER A 1 179 ? -21.469 3.113  145.844 1.00 117.50 ? 198 SER A O   1 
ATOM   1386 C  CB  . SER A 1 179 ? -20.029 5.731  147.215 1.00 116.57 ? 198 SER A CB  1 
ATOM   1387 O  OG  . SER A 1 179 ? -20.296 7.007  147.761 1.00 121.04 ? 198 SER A OG  1 
ATOM   1388 N  N   . LEU A 1 180 ? -19.993 2.560  147.468 1.00 116.99 ? 199 LEU A N   1 
ATOM   1389 C  CA  . LEU A 1 180 ? -19.670 1.229  146.908 1.00 118.54 ? 199 LEU A CA  1 
ATOM   1390 C  C   . LEU A 1 180 ? -20.851 0.237  146.918 1.00 121.47 ? 199 LEU A C   1 
ATOM   1391 O  O   . LEU A 1 180 ? -20.909 -0.639 146.052 1.00 117.12 ? 199 LEU A O   1 
ATOM   1392 C  CB  . LEU A 1 180 ? -18.419 0.628  147.577 1.00 118.70 ? 199 LEU A CB  1 
ATOM   1393 C  CG  . LEU A 1 180 ? -17.100 1.354  147.258 1.00 117.17 ? 199 LEU A CG  1 
ATOM   1394 C  CD1 . LEU A 1 180 ? -15.984 0.944  148.206 1.00 121.28 ? 199 LEU A CD1 1 
ATOM   1395 C  CD2 . LEU A 1 180 ? -16.673 1.141  145.812 1.00 115.85 ? 199 LEU A CD2 1 
ATOM   1396 N  N   . GLN A 1 181 ? -21.763 0.362  147.890 1.00 126.60 ? 200 GLN A N   1 
ATOM   1397 C  CA  . GLN A 1 181 ? -22.974 -0.495 147.950 1.00 129.21 ? 200 GLN A CA  1 
ATOM   1398 C  C   . GLN A 1 181 ? -23.969 -0.157 146.825 1.00 127.20 ? 200 GLN A C   1 
ATOM   1399 O  O   . GLN A 1 181 ? -24.615 -1.063 146.292 1.00 130.57 ? 200 GLN A O   1 
ATOM   1400 C  CB  . GLN A 1 181 ? -23.651 -0.450 149.326 1.00 130.20 ? 200 GLN A CB  1 
ATOM   1401 C  CG  . GLN A 1 181 ? -22.904 -1.245 150.393 1.00 132.22 ? 200 GLN A CG  1 
ATOM   1402 C  CD  . GLN A 1 181 ? -23.513 -1.135 151.784 1.00 134.49 ? 200 GLN A CD  1 
ATOM   1403 O  OE1 . GLN A 1 181 ? -24.449 -0.367 152.019 1.00 134.00 ? 200 GLN A OE1 1 
ATOM   1404 N  NE2 . GLN A 1 181 ? -22.972 -1.906 152.721 1.00 134.05 ? 200 GLN A NE2 1 
ATOM   1405 N  N   . LYS A 1 182 ? -24.100 1.131  146.487 1.00 123.09 ? 201 LYS A N   1 
ATOM   1406 C  CA  . LYS A 1 182 ? -24.966 1.574  145.372 1.00 124.09 ? 201 LYS A CA  1 
ATOM   1407 C  C   . LYS A 1 182 ? -24.400 1.159  143.997 1.00 119.21 ? 201 LYS A C   1 
ATOM   1408 O  O   . LYS A 1 182 ? -25.168 1.017  143.042 1.00 121.15 ? 201 LYS A O   1 
ATOM   1409 C  CB  . LYS A 1 182 ? -25.213 3.089  145.408 1.00 125.17 ? 201 LYS A CB  1 
ATOM   1410 C  CG  . LYS A 1 182 ? -25.993 3.555  146.626 1.00 131.08 ? 201 LYS A CG  1 
ATOM   1411 C  CD  . LYS A 1 182 ? -26.230 5.056  146.604 1.00 133.19 ? 201 LYS A CD  1 
ATOM   1412 C  CE  . LYS A 1 182 ? -26.957 5.514  147.860 1.00 141.30 ? 201 LYS A CE  1 
ATOM   1413 N  NZ  . LYS A 1 182 ? -27.203 6.983  147.857 1.00 146.11 ? 201 LYS A NZ  1 
ATOM   1414 N  N   . VAL A 1 183 ? -23.073 0.980  143.912 1.00 115.96 ? 202 VAL A N   1 
ATOM   1415 C  CA  . VAL A 1 183 ? -22.383 0.539  142.690 1.00 118.23 ? 202 VAL A CA  1 
ATOM   1416 C  C   . VAL A 1 183 ? -22.786 -0.903 142.353 1.00 123.89 ? 202 VAL A C   1 
ATOM   1417 O  O   . VAL A 1 183 ? -23.169 -1.188 141.210 1.00 127.47 ? 202 VAL A O   1 
ATOM   1418 C  CB  . VAL A 1 183 ? -20.841 0.660  142.808 1.00 116.72 ? 202 VAL A CB  1 
ATOM   1419 C  CG1 . VAL A 1 183 ? -20.135 0.077  141.585 1.00 117.89 ? 202 VAL A CG1 1 
ATOM   1420 C  CG2 . VAL A 1 183 ? -20.439 2.115  142.994 1.00 113.17 ? 202 VAL A CG2 1 
ATOM   1421 N  N   . ILE A 1 184 ? -22.726 -1.785 143.356 1.00 128.20 ? 203 ILE A N   1 
ATOM   1422 C  CA  . ILE A 1 184 ? -23.128 -3.204 143.209 1.00 133.80 ? 203 ILE A CA  1 
ATOM   1423 C  C   . ILE A 1 184 ? -24.611 -3.455 143.584 1.00 137.12 ? 203 ILE A C   1 
ATOM   1424 O  O   . ILE A 1 184 ? -24.965 -4.559 144.015 1.00 144.18 ? 203 ILE A O   1 
ATOM   1425 C  CB  . ILE A 1 184 ? -22.156 -4.180 143.944 1.00 136.73 ? 203 ILE A CB  1 
ATOM   1426 C  CG1 . ILE A 1 184 ? -22.153 -4.001 145.472 1.00 136.92 ? 203 ILE A CG1 1 
ATOM   1427 C  CG2 . ILE A 1 184 ? -20.746 -4.009 143.403 1.00 137.72 ? 203 ILE A CG2 1 
ATOM   1428 C  CD1 . ILE A 1 184 ? -21.306 -5.030 146.183 1.00 140.07 ? 203 ILE A CD1 1 
ATOM   1429 N  N   . LEU A 1 185 ? -25.470 -2.445 143.392 1.00 134.78 ? 204 LEU A N   1 
ATOM   1430 C  CA  . LEU A 1 185 ? -26.911 -2.532 143.687 1.00 141.32 ? 204 LEU A CA  1 
ATOM   1431 C  C   . LEU A 1 185 ? -27.583 -3.459 142.677 1.00 151.36 ? 204 LEU A C   1 
ATOM   1432 O  O   . LEU A 1 185 ? -28.355 -4.345 143.055 1.00 159.86 ? 204 LEU A O   1 
ATOM   1433 C  CB  . LEU A 1 185 ? -27.559 -1.137 143.637 1.00 136.04 ? 204 LEU A CB  1 
ATOM   1434 C  CG  . LEU A 1 185 ? -29.049 -0.974 143.965 1.00 138.50 ? 204 LEU A CG  1 
ATOM   1435 C  CD1 . LEU A 1 185 ? -29.374 -1.445 145.379 1.00 136.01 ? 204 LEU A CD1 1 
ATOM   1436 C  CD2 . LEU A 1 185 ? -29.452 0.481  143.777 1.00 134.86 ? 204 LEU A CD2 1 
ATOM   1437 N  N   . ARG A 1 186 ? -27.286 -3.218 141.399 1.00 156.37 ? 205 ARG A N   1 
ATOM   1438 C  CA  . ARG A 1 186 ? -27.790 -4.018 140.267 1.00 161.75 ? 205 ARG A CA  1 
ATOM   1439 C  C   . ARG A 1 186 ? -26.736 -4.456 139.214 1.00 164.21 ? 205 ARG A C   1 
ATOM   1440 O  O   . ARG A 1 186 ? -27.078 -5.231 138.316 1.00 166.38 ? 205 ARG A O   1 
ATOM   1441 C  CB  . ARG A 1 186 ? -29.035 -3.346 139.646 1.00 165.23 ? 205 ARG A CB  1 
ATOM   1442 C  CG  . ARG A 1 186 ? -28.977 -1.826 139.500 1.00 164.02 ? 205 ARG A CG  1 
ATOM   1443 C  CD  . ARG A 1 186 ? -30.320 -1.263 139.070 1.00 163.22 ? 205 ARG A CD  1 
ATOM   1444 N  NE  . ARG A 1 186 ? -30.430 0.165  139.376 1.00 159.03 ? 205 ARG A NE  1 
ATOM   1445 C  CZ  . ARG A 1 186 ? -31.539 0.900  139.248 1.00 157.01 ? 205 ARG A CZ  1 
ATOM   1446 N  NH1 . ARG A 1 186 ? -32.686 0.376  138.788 1.00 158.63 ? 205 ARG A NH1 1 
ATOM   1447 N  NH2 . ARG A 1 186 ? -31.504 2.191  139.580 1.00 151.55 ? 205 ARG A NH2 1 
ATOM   1448 N  N   . PHE A 1 187 ? -25.482 -3.986 139.335 1.00 167.23 ? 206 PHE A N   1 
ATOM   1449 C  CA  . PHE A 1 187 ? -24.374 -4.362 138.433 1.00 172.10 ? 206 PHE A CA  1 
ATOM   1450 C  C   . PHE A 1 187 ? -23.198 -4.843 139.288 1.00 163.70 ? 206 PHE A C   1 
ATOM   1451 O  O   . PHE A 1 187 ? -22.493 -4.009 139.867 1.00 160.68 ? 206 PHE A O   1 
ATOM   1452 C  CB  . PHE A 1 187 ? -23.928 -3.194 137.552 1.00 178.88 ? 206 PHE A CB  1 
ATOM   1453 C  CG  . PHE A 1 187 ? -25.041 -2.572 136.780 1.00 185.30 ? 206 PHE A CG  1 
ATOM   1454 C  CD1 . PHE A 1 187 ? -25.738 -3.315 135.828 1.00 186.05 ? 206 PHE A CD1 1 
ATOM   1455 C  CD2 . PHE A 1 187 ? -25.387 -1.233 136.983 1.00 192.39 ? 206 PHE A CD2 1 
ATOM   1456 C  CE1 . PHE A 1 187 ? -26.779 -2.744 135.110 1.00 188.95 ? 206 PHE A CE1 1 
ATOM   1457 C  CE2 . PHE A 1 187 ? -26.420 -0.655 136.263 1.00 188.32 ? 206 PHE A CE2 1 
ATOM   1458 C  CZ  . PHE A 1 187 ? -27.118 -1.411 135.327 1.00 188.08 ? 206 PHE A CZ  1 
ATOM   1459 N  N   . PRO A 1 188 ? -22.971 -6.179 139.364 1.00 160.97 ? 207 PRO A N   1 
ATOM   1460 C  CA  . PRO A 1 188 ? -21.877 -6.678 140.207 1.00 158.60 ? 207 PRO A CA  1 
ATOM   1461 C  C   . PRO A 1 188 ? -20.485 -6.290 139.694 1.00 156.54 ? 207 PRO A C   1 
ATOM   1462 O  O   . PRO A 1 188 ? -20.304 -6.069 138.488 1.00 149.42 ? 207 PRO A O   1 
ATOM   1463 C  CB  . PRO A 1 188 ? -22.077 -8.196 140.179 1.00 162.58 ? 207 PRO A CB  1 
ATOM   1464 C  CG  . PRO A 1 188 ? -22.723 -8.465 138.871 1.00 163.67 ? 207 PRO A CG  1 
ATOM   1465 C  CD  . PRO A 1 188 ? -23.555 -7.261 138.545 1.00 161.78 ? 207 PRO A CD  1 
ATOM   1466 N  N   . SER A 1 189 ? -19.535 -6.186 140.622 1.00 154.60 ? 208 SER A N   1 
ATOM   1467 C  CA  . SER A 1 189 ? -18.155 -5.815 140.311 1.00 155.93 ? 208 SER A CA  1 
ATOM   1468 C  C   . SER A 1 189 ? -17.170 -6.458 141.297 1.00 157.35 ? 208 SER A C   1 
ATOM   1469 O  O   . SER A 1 189 ? -17.403 -6.439 142.510 1.00 154.65 ? 208 SER A O   1 
ATOM   1470 C  CB  . SER A 1 189 ? -18.019 -4.288 140.343 1.00 151.36 ? 208 SER A CB  1 
ATOM   1471 O  OG  . SER A 1 189 ? -16.703 -3.869 140.024 1.00 154.46 ? 208 SER A OG  1 
ATOM   1472 N  N   . THR A 1 190 ? -16.096 -7.044 140.760 1.00 162.18 ? 209 THR A N   1 
ATOM   1473 C  CA  . THR A 1 190 ? -15.029 -7.658 141.566 1.00 166.43 ? 209 THR A CA  1 
ATOM   1474 C  C   . THR A 1 190 ? -14.225 -6.548 142.256 1.00 165.83 ? 209 THR A C   1 
ATOM   1475 O  O   . THR A 1 190 ? -13.798 -6.720 143.396 1.00 165.39 ? 209 THR A O   1 
ATOM   1476 C  CB  . THR A 1 190 ? -14.082 -8.531 140.710 1.00 168.47 ? 209 THR A CB  1 
ATOM   1477 O  OG1 . THR A 1 190 ? -14.846 -9.510 139.997 1.00 174.34 ? 209 THR A OG1 1 
ATOM   1478 C  CG2 . THR A 1 190 ? -13.040 -9.241 141.575 1.00 168.22 ? 209 THR A CG2 1 
ATOM   1479 N  N   . GLU A 1 191 ? -14.025 -5.428 141.549 1.00 165.31 ? 210 GLU A N   1 
ATOM   1480 C  CA  . GLU A 1 191 ? -13.310 -4.251 142.069 1.00 169.08 ? 210 GLU A CA  1 
ATOM   1481 C  C   . GLU A 1 191 ? -14.069 -3.606 143.248 1.00 167.56 ? 210 GLU A C   1 
ATOM   1482 O  O   . GLU A 1 191 ? -13.438 -3.105 144.185 1.00 164.10 ? 210 GLU A O   1 
ATOM   1483 C  CB  . GLU A 1 191 ? -13.092 -3.215 140.946 1.00 172.93 ? 210 GLU A CB  1 
ATOM   1484 C  CG  . GLU A 1 191 ? -12.148 -2.053 141.267 1.00 178.74 ? 210 GLU A CG  1 
ATOM   1485 C  CD  . GLU A 1 191 ? -10.693 -2.463 141.483 1.00 189.83 ? 210 GLU A CD  1 
ATOM   1486 O  OE1 . GLU A 1 191 ? -10.299 -3.599 141.135 1.00 198.34 ? 210 GLU A OE1 1 
ATOM   1487 O  OE2 . GLU A 1 191 ? -9.923  -1.622 141.993 1.00 197.09 ? 210 GLU A OE2 1 
ATOM   1488 N  N   . ALA A 1 192 ? -15.406 -3.614 143.186 1.00 161.93 ? 211 ALA A N   1 
ATOM   1489 C  CA  . ALA A 1 192 ? -16.254 -3.062 144.256 1.00 152.42 ? 211 ALA A CA  1 
ATOM   1490 C  C   . ALA A 1 192 ? -16.306 -4.006 145.457 1.00 153.82 ? 211 ALA A C   1 
ATOM   1491 O  O   . ALA A 1 192 ? -16.076 -3.566 146.584 1.00 149.43 ? 211 ALA A O   1 
ATOM   1492 C  CB  . ALA A 1 192 ? -17.659 -2.777 143.751 1.00 149.19 ? 211 ALA A CB  1 
ATOM   1493 N  N   . GLN A 1 193 ? -16.611 -5.287 145.210 1.00 154.74 ? 212 GLN A N   1 
ATOM   1494 C  CA  . GLN A 1 193 ? -16.687 -6.314 146.285 1.00 158.23 ? 212 GLN A CA  1 
ATOM   1495 C  C   . GLN A 1 193 ? -15.376 -6.597 147.035 1.00 157.94 ? 212 GLN A C   1 
ATOM   1496 O  O   . GLN A 1 193 ? -15.426 -6.904 148.230 1.00 153.77 ? 212 GLN A O   1 
ATOM   1497 C  CB  . GLN A 1 193 ? -17.323 -7.642 145.801 1.00 159.13 ? 212 GLN A CB  1 
ATOM   1498 C  CG  . GLN A 1 193 ? -18.850 -7.695 145.869 1.00 157.15 ? 212 GLN A CG  1 
ATOM   1499 C  CD  . GLN A 1 193 ? -19.412 -7.807 147.293 1.00 158.60 ? 212 GLN A CD  1 
ATOM   1500 O  OE1 . GLN A 1 193 ? -18.680 -7.769 148.286 1.00 155.11 ? 212 GLN A OE1 1 
ATOM   1501 N  NE2 . GLN A 1 193 ? -20.726 -7.953 147.390 1.00 161.49 ? 212 GLN A NE2 1 
ATOM   1502 N  N   . LYS A 1 194 ? -14.231 -6.506 146.346 1.00 160.38 ? 213 LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 194 ? -12.915 -6.714 146.991 1.00 162.99 ? 213 LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 194 ? -12.608 -5.568 147.975 1.00 157.36 ? 213 LYS A C   1 
ATOM   1505 O  O   . LYS A 1 194 ? -11.929 -5.791 148.973 1.00 155.98 ? 213 LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 194 ? -11.781 -6.960 145.964 1.00 168.61 ? 213 LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 194 ? -11.315 -5.794 145.084 1.00 168.20 ? 213 LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 194 ? -10.250 -4.858 145.667 1.00 168.75 ? 213 LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 194 ? -8.900  -5.530 145.915 1.00 172.68 ? 213 LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 194 ? -8.298  -6.106 144.681 1.00 176.22 ? 213 LYS A NZ  1 
ATOM   1511 N  N   . THR A 1 195 ? -13.108 -4.360 147.688 1.00 148.65 ? 214 THR A N   1 
ATOM   1512 C  CA  . THR A 1 195 ? -12.945 -3.201 148.578 1.00 143.02 ? 214 THR A CA  1 
ATOM   1513 C  C   . THR A 1 195 ? -13.891 -3.299 149.788 1.00 143.57 ? 214 THR A C   1 
ATOM   1514 O  O   . THR A 1 195 ? -13.487 -2.939 150.892 1.00 140.09 ? 214 THR A O   1 
ATOM   1515 C  CB  . THR A 1 195 ? -13.150 -1.866 147.831 1.00 135.11 ? 214 THR A CB  1 
ATOM   1516 O  OG1 . THR A 1 195 ? -12.218 -1.791 146.747 1.00 130.73 ? 214 THR A OG1 1 
ATOM   1517 C  CG2 . THR A 1 195 ? -12.934 -0.663 148.763 1.00 130.75 ? 214 THR A CG2 1 
ATOM   1518 N  N   . LEU A 1 196 ? -15.127 -3.775 149.583 1.00 145.92 ? 215 LEU A N   1 
ATOM   1519 C  CA  . LEU A 1 196 ? -16.111 -3.931 150.682 1.00 149.56 ? 215 LEU A CA  1 
ATOM   1520 C  C   . LEU A 1 196 ? -15.661 -4.904 151.784 1.00 158.33 ? 215 LEU A C   1 
ATOM   1521 O  O   . LEU A 1 196 ? -15.933 -4.648 152.966 1.00 162.76 ? 215 LEU A O   1 
ATOM   1522 C  CB  . LEU A 1 196 ? -17.504 -4.333 150.162 1.00 149.28 ? 215 LEU A CB  1 
ATOM   1523 C  CG  . LEU A 1 196 ? -18.293 -3.314 149.331 1.00 146.16 ? 215 LEU A CG  1 
ATOM   1524 C  CD1 . LEU A 1 196 ? -19.594 -3.934 148.845 1.00 146.26 ? 215 LEU A CD1 1 
ATOM   1525 C  CD2 . LEU A 1 196 ? -18.578 -2.041 150.112 1.00 140.62 ? 215 LEU A CD2 1 
ATOM   1526 N  N   . ASP A 1 197 ? -14.999 -6.005 151.406 1.00 162.23 ? 216 ASP A N   1 
ATOM   1527 C  CA  . ASP A 1 197 ? -14.472 -6.977 152.398 1.00 166.81 ? 216 ASP A CA  1 
ATOM   1528 C  C   . ASP A 1 197 ? -13.264 -6.403 153.185 1.00 166.13 ? 216 ASP A C   1 
ATOM   1529 O  O   . ASP A 1 197 ? -13.074 -6.751 154.354 1.00 167.73 ? 216 ASP A O   1 
ATOM   1530 C  CB  . ASP A 1 197 ? -14.222 -8.389 151.803 1.00 170.63 ? 216 ASP A CB  1 
ATOM   1531 C  CG  . ASP A 1 197 ? -13.133 -8.433 150.726 1.00 170.10 ? 216 ASP A CG  1 
ATOM   1532 O  OD1 . ASP A 1 197 ? -12.023 -7.901 150.929 1.00 173.53 ? 216 ASP A OD1 1 
ATOM   1533 O  OD2 . ASP A 1 197 ? -13.372 -9.087 149.689 1.00 166.75 ? 216 ASP A OD2 1 
ATOM   1534 N  N   . LYS A 1 198 ? -12.464 -5.541 152.536 1.00 162.71 ? 217 LYS A N   1 
ATOM   1535 C  CA  . LYS A 1 198 ? -11.332 -4.843 153.190 1.00 161.38 ? 217 LYS A CA  1 
ATOM   1536 C  C   . LYS A 1 198 ? -11.852 -3.804 154.197 1.00 159.58 ? 217 LYS A C   1 
ATOM   1537 O  O   . LYS A 1 198 ? -11.248 -3.635 155.258 1.00 163.01 ? 217 LYS A O   1 
ATOM   1538 C  CB  . LYS A 1 198 ? -10.371 -4.194 152.181 1.00 159.28 ? 217 LYS A CB  1 
ATOM   1539 C  CG  . LYS A 1 198 ? -9.525  -5.195 151.402 1.00 162.63 ? 217 LYS A CG  1 
ATOM   1540 C  CD  . LYS A 1 198 ? -8.519  -4.536 150.460 1.00 161.60 ? 217 LYS A CD  1 
ATOM   1541 C  CE  . LYS A 1 198 ? -9.161  -3.829 149.273 1.00 156.77 ? 217 LYS A CE  1 
ATOM   1542 N  NZ  . LYS A 1 198 ? -8.149  -3.183 148.394 1.00 154.70 ? 217 LYS A NZ  1 
ATOM   1543 N  N   . ILE A 1 199 ? -12.946 -3.107 153.855 1.00 151.07 ? 218 ILE A N   1 
ATOM   1544 C  CA  . ILE A 1 199 ? -13.603 -2.151 154.776 1.00 149.23 ? 218 ILE A CA  1 
ATOM   1545 C  C   . ILE A 1 199 ? -14.193 -2.934 155.968 1.00 152.17 ? 218 ILE A C   1 
ATOM   1546 O  O   . ILE A 1 199 ? -14.113 -2.470 157.109 1.00 154.07 ? 218 ILE A O   1 
ATOM   1547 C  CB  . ILE A 1 199 ? -14.707 -1.307 154.089 1.00 143.48 ? 218 ILE A CB  1 
ATOM   1548 C  CG1 . ILE A 1 199 ? -14.102 -0.385 153.023 1.00 141.52 ? 218 ILE A CG1 1 
ATOM   1549 C  CG2 . ILE A 1 199 ? -15.449 -0.442 155.104 1.00 141.35 ? 218 ILE A CG2 1 
ATOM   1550 C  CD1 . ILE A 1 199 ? -15.122 0.430  152.255 1.00 136.24 ? 218 ILE A CD1 1 
ATOM   1551 N  N   . LEU A 1 200 ? -14.782 -4.103 155.684 1.00 154.11 ? 219 LEU A N   1 
ATOM   1552 C  CA  . LEU A 1 200 ? -15.338 -5.006 156.712 1.00 159.07 ? 219 LEU A CA  1 
ATOM   1553 C  C   . LEU A 1 200 ? -14.231 -5.567 157.629 1.00 161.18 ? 219 LEU A C   1 
ATOM   1554 O  O   . LEU A 1 200 ? -14.481 -5.805 158.810 1.00 163.02 ? 219 LEU A O   1 
ATOM   1555 C  CB  . LEU A 1 200 ? -16.124 -6.159 156.059 1.00 160.63 ? 219 LEU A CB  1 
ATOM   1556 C  CG  . LEU A 1 200 ? -16.851 -7.184 156.942 1.00 164.58 ? 219 LEU A CG  1 
ATOM   1557 C  CD1 . LEU A 1 200 ? -17.894 -6.514 157.824 1.00 163.58 ? 219 LEU A CD1 1 
ATOM   1558 C  CD2 . LEU A 1 200 ? -17.499 -8.254 156.077 1.00 165.12 ? 219 LEU A CD2 1 
ATOM   1559 N  N   . ARG A 1 201 ? -13.033 -5.786 157.069 1.00 163.08 ? 220 ARG A N   1 
ATOM   1560 C  CA  . ARG A 1 201 ? -11.855 -6.276 157.813 1.00 167.50 ? 220 ARG A CA  1 
ATOM   1561 C  C   . ARG A 1 201 ? -11.365 -5.189 158.782 1.00 165.48 ? 220 ARG A C   1 
ATOM   1562 O  O   . ARG A 1 201 ? -11.115 -5.474 159.954 1.00 167.55 ? 220 ARG A O   1 
ATOM   1563 C  CB  . ARG A 1 201 ? -10.716 -6.649 156.850 1.00 170.00 ? 220 ARG A CB  1 
ATOM   1564 C  CG  . ARG A 1 201 ? -9.528  -7.383 157.472 1.00 176.26 ? 220 ARG A CG  1 
ATOM   1565 C  CD  . ARG A 1 201 ? -8.338  -7.417 156.520 1.00 178.11 ? 220 ARG A CD  1 
ATOM   1566 N  NE  . ARG A 1 201 ? -8.654  -8.006 155.215 1.00 179.98 ? 220 ARG A NE  1 
ATOM   1567 C  CZ  . ARG A 1 201 ? -7.824  -8.061 154.166 1.00 184.61 ? 220 ARG A CZ  1 
ATOM   1568 N  NH1 . ARG A 1 201 ? -6.580  -7.567 154.226 1.00 186.42 ? 220 ARG A NH1 1 
ATOM   1569 N  NH2 . ARG A 1 201 ? -8.244  -8.620 153.027 1.00 185.29 ? 220 ARG A NH2 1 
ATOM   1570 N  N   . ILE A 1 202 ? -11.221 -3.961 158.273 1.00 158.63 ? 221 ILE A N   1 
ATOM   1571 C  CA  . ILE A 1 202 ? -10.785 -2.790 159.066 1.00 157.26 ? 221 ILE A CA  1 
ATOM   1572 C  C   . ILE A 1 202 ? -11.805 -2.413 160.167 1.00 159.21 ? 221 ILE A C   1 
ATOM   1573 O  O   . ILE A 1 202 ? -11.410 -1.918 161.230 1.00 159.76 ? 221 ILE A O   1 
ATOM   1574 C  CB  . ILE A 1 202 ? -10.472 -1.571 158.145 1.00 153.43 ? 221 ILE A CB  1 
ATOM   1575 C  CG1 . ILE A 1 202 ? -9.253  -1.864 157.255 1.00 154.57 ? 221 ILE A CG1 1 
ATOM   1576 C  CG2 . ILE A 1 202 ? -10.165 -0.306 158.943 1.00 149.45 ? 221 ILE A CG2 1 
ATOM   1577 C  CD1 . ILE A 1 202 ? -9.002  -0.815 156.191 1.00 150.86 ? 221 ILE A CD1 1 
ATOM   1578 N  N   . GLU A 1 203 ? -13.094 -2.672 159.916 1.00 158.76 ? 222 GLU A N   1 
ATOM   1579 C  CA  . GLU A 1 203 ? -14.186 -2.375 160.864 1.00 158.95 ? 222 GLU A CA  1 
ATOM   1580 C  C   . GLU A 1 203 ? -14.099 -3.205 162.156 1.00 166.49 ? 222 GLU A C   1 
ATOM   1581 O  O   . GLU A 1 203 ? -14.196 -2.642 163.255 1.00 164.16 ? 222 GLU A O   1 
ATOM   1582 C  CB  . GLU A 1 203 ? -15.552 -2.595 160.189 1.00 157.82 ? 222 GLU A CB  1 
ATOM   1583 C  CG  . GLU A 1 203 ? -16.776 -2.140 160.985 1.00 157.19 ? 222 GLU A CG  1 
ATOM   1584 C  CD  . GLU A 1 203 ? -18.088 -2.297 160.220 1.00 156.60 ? 222 GLU A CD  1 
ATOM   1585 O  OE1 . GLU A 1 203 ? -18.174 -3.133 159.289 1.00 153.51 ? 222 GLU A OE1 1 
ATOM   1586 O  OE2 . GLU A 1 203 ? -19.057 -1.586 160.560 1.00 156.58 ? 222 GLU A OE2 1 
ATOM   1587 N  N   . LYS A 1 204 ? -13.915 -4.524 162.020 1.00 171.18 ? 223 LYS A N   1 
ATOM   1588 C  CA  . LYS A 1 204 ? -13.827 -5.428 163.193 1.00 175.16 ? 223 LYS A CA  1 
ATOM   1589 C  C   . LYS A 1 204 ? -12.548 -5.260 164.047 1.00 177.27 ? 223 LYS A C   1 
ATOM   1590 O  O   . LYS A 1 204 ? -12.557 -5.612 165.228 1.00 177.07 ? 223 LYS A O   1 
ATOM   1591 C  CB  . LYS A 1 204 ? -14.119 -6.905 162.816 1.00 178.21 ? 223 LYS A CB  1 
ATOM   1592 C  CG  . LYS A 1 204 ? -13.159 -7.669 161.899 1.00 178.99 ? 223 LYS A CG  1 
ATOM   1593 C  CD  . LYS A 1 204 ? -11.892 -8.162 162.591 1.00 182.79 ? 223 LYS A CD  1 
ATOM   1594 C  CE  . LYS A 1 204 ? -11.152 -9.185 161.743 1.00 183.10 ? 223 LYS A CE  1 
ATOM   1595 N  NZ  . LYS A 1 204 ? -10.730 -8.639 160.424 1.00 177.37 ? 223 LYS A NZ  1 
ATOM   1596 N  N   . GLU A 1 205 ? -11.471 -4.734 163.451 1.00 176.65 ? 224 GLU A N   1 
ATOM   1597 C  CA  . GLU A 1 205 ? -10.210 -4.460 164.172 1.00 180.06 ? 224 GLU A CA  1 
ATOM   1598 C  C   . GLU A 1 205 ? -10.353 -3.209 165.050 1.00 177.63 ? 224 GLU A C   1 
ATOM   1599 O  O   . GLU A 1 205 ? -9.944  -3.213 166.213 1.00 180.51 ? 224 GLU A O   1 
ATOM   1600 C  CB  . GLU A 1 205 ? -9.032  -4.272 163.203 1.00 181.04 ? 224 GLU A CB  1 
ATOM   1601 C  CG  . GLU A 1 205 ? -8.658  -5.519 162.410 1.00 187.72 ? 224 GLU A CG  1 
ATOM   1602 C  CD  . GLU A 1 205 ? -7.577  -5.280 161.361 1.00 192.37 ? 224 GLU A CD  1 
ATOM   1603 O  OE1 . GLU A 1 205 ? -6.895  -4.230 161.396 1.00 195.46 ? 224 GLU A OE1 1 
ATOM   1604 O  OE2 . GLU A 1 205 ? -7.402  -6.160 160.492 1.00 196.11 ? 224 GLU A OE2 1 
ATOM   1605 N  N   . VAL A 1 206 ? -10.932 -2.151 164.478 1.00 171.61 ? 225 VAL A N   1 
ATOM   1606 C  CA  . VAL A 1 206 ? -11.151 -0.871 165.182 1.00 168.87 ? 225 VAL A CA  1 
ATOM   1607 C  C   . VAL A 1 206 ? -12.292 -0.947 166.231 1.00 167.13 ? 225 VAL A C   1 
ATOM   1608 O  O   . VAL A 1 206 ? -12.313 -0.136 167.162 1.00 163.29 ? 225 VAL A O   1 
ATOM   1609 C  CB  . VAL A 1 206 ? -11.421 0.286  164.171 1.00 164.82 ? 225 VAL A CB  1 
ATOM   1610 C  CG1 . VAL A 1 206 ? -11.574 1.633  164.871 1.00 163.98 ? 225 VAL A CG1 1 
ATOM   1611 C  CG2 . VAL A 1 206 ? -10.294 0.389  163.150 1.00 163.67 ? 225 VAL A CG2 1 
ATOM   1612 N  N   . ASN A 1 207 ? -13.212 -1.913 166.074 1.00 166.51 ? 226 ASN A N   1 
ATOM   1613 C  CA  . ASN A 1 207 ? -14.386 -2.130 166.953 1.00 166.05 ? 226 ASN A CA  1 
ATOM   1614 C  C   . ASN A 1 207 ? -15.418 -1.015 166.792 1.00 162.76 ? 226 ASN A C   1 
ATOM   1615 O  O   . ASN A 1 207 ? -15.912 -0.769 165.686 1.00 152.03 ? 226 ASN A O   1 
ATOM   1616 C  CB  . ASN A 1 207 ? -14.020 -2.306 168.443 1.00 169.39 ? 226 ASN A CB  1 
ATOM   1617 C  CG  . ASN A 1 207 ? -13.019 -3.426 168.690 1.00 170.09 ? 226 ASN A CG  1 
ATOM   1618 O  OD1 . ASN A 1 207 ? -12.976 -4.421 167.969 1.00 168.08 ? 226 ASN A OD1 1 
ATOM   1619 N  ND2 . ASN A 1 207 ? -12.228 -3.276 169.744 1.00 173.03 ? 226 ASN A ND2 1 
ATOM   1620 N  N   . GLN B 1 2   ? -26.983 20.671 249.085 1.00 108.72 ? 21  GLN B N   1 
ATOM   1621 C  CA  . GLN B 1 2   ? -28.039 20.436 248.053 1.00 109.17 ? 21  GLN B CA  1 
ATOM   1622 C  C   . GLN B 1 2   ? -27.978 21.540 246.987 1.00 93.72  ? 21  GLN B C   1 
ATOM   1623 O  O   . GLN B 1 2   ? -27.982 21.244 245.794 1.00 92.69  ? 21  GLN B O   1 
ATOM   1624 C  CB  . GLN B 1 2   ? -29.432 20.363 248.712 1.00 108.84 ? 21  GLN B CB  1 
ATOM   1625 C  CG  . GLN B 1 2   ? -30.569 19.968 247.769 1.00 103.36 ? 21  GLN B CG  1 
ATOM   1626 C  CD  . GLN B 1 2   ? -31.931 19.860 248.444 1.00 111.71 ? 21  GLN B CD  1 
ATOM   1627 O  OE1 . GLN B 1 2   ? -32.065 19.969 249.670 1.00 104.13 ? 21  GLN B OE1 1 
ATOM   1628 N  NE2 . GLN B 1 2   ? -32.959 19.637 247.632 1.00 110.67 ? 21  GLN B NE2 1 
ATOM   1629 N  N   . SER B 1 3   ? -27.942 22.798 247.434 1.00 86.04  ? 22  SER B N   1 
ATOM   1630 C  CA  . SER B 1 3   ? -27.855 23.972 246.552 1.00 74.34  ? 22  SER B CA  1 
ATOM   1631 C  C   . SER B 1 3   ? -26.462 24.072 245.934 1.00 74.54  ? 22  SER B C   1 
ATOM   1632 O  O   . SER B 1 3   ? -25.484 23.671 246.558 1.00 66.15  ? 22  SER B O   1 
ATOM   1633 C  CB  . SER B 1 3   ? -28.128 25.259 247.348 1.00 79.56  ? 22  SER B CB  1 
ATOM   1634 O  OG  . SER B 1 3   ? -27.972 26.435 246.571 1.00 92.09  ? 22  SER B OG  1 
ATOM   1635 N  N   . VAL B 1 4   ? -26.385 24.615 244.719 1.00 67.44  ? 23  VAL B N   1 
ATOM   1636 C  CA  . VAL B 1 4   ? -25.105 24.810 244.029 1.00 70.18  ? 23  VAL B CA  1 
ATOM   1637 C  C   . VAL B 1 4   ? -24.227 25.849 244.739 1.00 60.14  ? 23  VAL B C   1 
ATOM   1638 O  O   . VAL B 1 4   ? -23.022 25.687 244.779 1.00 59.02  ? 23  VAL B O   1 
ATOM   1639 C  CB  . VAL B 1 4   ? -25.268 25.186 242.545 1.00 67.07  ? 23  VAL B CB  1 
ATOM   1640 C  CG1 . VAL B 1 4   ? -25.920 24.037 241.800 1.00 81.75  ? 23  VAL B CG1 1 
ATOM   1641 C  CG2 . VAL B 1 4   ? -26.079 26.461 242.394 1.00 68.28  ? 23  VAL B CG2 1 
ATOM   1642 N  N   . ASP B 1 5   ? -24.832 26.904 245.276 1.00 60.29  ? 24  ASP B N   1 
ATOM   1643 C  CA  . ASP B 1 5   ? -24.109 27.932 246.034 1.00 58.70  ? 24  ASP B CA  1 
ATOM   1644 C  C   . ASP B 1 5   ? -23.406 27.273 247.246 1.00 60.09  ? 24  ASP B C   1 
ATOM   1645 O  O   . ASP B 1 5   ? -22.226 27.492 247.455 1.00 58.51  ? 24  ASP B O   1 
ATOM   1646 C  CB  . ASP B 1 5   ? -25.062 29.038 246.494 1.00 59.69  ? 24  ASP B CB  1 
ATOM   1647 N  N   . GLU B 1 6   ? -24.131 26.427 247.982 1.00 58.32  ? 25  GLU B N   1 
ATOM   1648 C  CA  . GLU B 1 6   ? -23.587 25.690 249.139 1.00 58.53  ? 25  GLU B CA  1 
ATOM   1649 C  C   . GLU B 1 6   ? -22.458 24.729 248.745 1.00 59.40  ? 25  GLU B C   1 
ATOM   1650 O  O   . GLU B 1 6   ? -21.435 24.644 249.420 1.00 56.34  ? 25  GLU B O   1 
ATOM   1651 C  CB  . GLU B 1 6   ? -24.690 24.885 249.829 1.00 63.76  ? 25  GLU B CB  1 
ATOM   1652 C  CG  . GLU B 1 6   ? -25.833 25.718 250.408 1.00 69.72  ? 25  GLU B CG  1 
ATOM   1653 C  CD  . GLU B 1 6   ? -25.455 26.584 251.595 1.00 73.75  ? 25  GLU B CD  1 
ATOM   1654 O  OE1 . GLU B 1 6   ? -24.338 26.474 252.148 1.00 73.67  ? 25  GLU B OE1 1 
ATOM   1655 O  OE2 . GLU B 1 6   ? -26.316 27.381 252.017 1.00 78.44  ? 25  GLU B OE2 1 
HETATM 1656 N  N   . MSE B 1 7   ? -22.642 24.032 247.627 1.00 58.18  ? 26  MSE B N   1 
HETATM 1657 C  CA  . MSE B 1 7   ? -21.651 23.090 247.128 1.00 56.51  ? 26  MSE B CA  1 
HETATM 1658 C  C   . MSE B 1 7   ? -20.367 23.774 246.675 1.00 52.03  ? 26  MSE B C   1 
HETATM 1659 O  O   . MSE B 1 7   ? -19.286 23.221 246.856 1.00 50.19  ? 26  MSE B O   1 
HETATM 1660 C  CB  . MSE B 1 7   ? -22.230 22.289 245.972 1.00 63.16  ? 26  MSE B CB  1 
HETATM 1661 C  CG  . MSE B 1 7   ? -23.321 21.312 246.348 1.00 70.40  ? 26  MSE B CG  1 
HETATM 1662 SE SE  . MSE B 1 7   ? -22.579 19.782 247.255 0.75 86.40  ? 26  MSE B SE  1 
HETATM 1663 C  CE  . MSE B 1 7   ? -21.367 19.097 245.911 1.00 64.58  ? 26  MSE B CE  1 
ATOM   1664 N  N   . LEU B 1 8   ? -20.500 24.951 246.057 1.00 49.80  ? 27  LEU B N   1 
ATOM   1665 C  CA  . LEU B 1 8   ? -19.353 25.734 245.598 1.00 50.28  ? 27  LEU B CA  1 
ATOM   1666 C  C   . LEU B 1 8   ? -18.515 26.250 246.788 1.00 48.81  ? 27  LEU B C   1 
ATOM   1667 O  O   . LEU B 1 8   ? -17.299 26.375 246.672 1.00 48.93  ? 27  LEU B O   1 
ATOM   1668 C  CB  . LEU B 1 8   ? -19.779 26.847 244.638 1.00 47.78  ? 27  LEU B CB  1 
ATOM   1669 C  CG  . LEU B 1 8   ? -20.287 26.347 243.277 1.00 50.61  ? 27  LEU B CG  1 
ATOM   1670 C  CD1 . LEU B 1 8   ? -20.846 27.525 242.500 1.00 51.42  ? 27  LEU B CD1 1 
ATOM   1671 C  CD2 . LEU B 1 8   ? -19.218 25.608 242.461 1.00 46.90  ? 27  LEU B CD2 1 
ATOM   1672 N  N   . GLN B 1 9   ? -19.150 26.528 247.920 1.00 49.83  ? 28  GLN B N   1 
ATOM   1673 C  CA  . GLN B 1 9   ? -18.392 26.897 249.141 1.00 53.15  ? 28  GLN B CA  1 
ATOM   1674 C  C   . GLN B 1 9   ? -17.470 25.758 249.612 1.00 55.10  ? 28  GLN B C   1 
ATOM   1675 O  O   . GLN B 1 9   ? -16.395 26.033 250.128 1.00 53.80  ? 28  GLN B O   1 
ATOM   1676 C  CB  . GLN B 1 9   ? -19.288 27.300 250.277 1.00 52.98  ? 28  GLN B CB  1 
ATOM   1677 C  CG  . GLN B 1 9   ? -20.078 28.566 250.032 1.00 54.01  ? 28  GLN B CG  1 
ATOM   1678 C  CD  . GLN B 1 9   ? -20.857 29.000 251.260 1.00 61.16  ? 28  GLN B CD  1 
ATOM   1679 O  OE1 . GLN B 1 9   ? -20.489 28.678 252.392 1.00 60.39  ? 28  GLN B OE1 1 
ATOM   1680 N  NE2 . GLN B 1 9   ? -21.919 29.770 251.046 1.00 62.75  ? 28  GLN B NE2 1 
ATOM   1681 N  N   . LYS B 1 10  ? -17.869 24.500 249.388 1.00 53.98  ? 29  LYS B N   1 
ATOM   1682 C  CA  . LYS B 1 10  ? -17.049 23.333 249.768 1.00 54.23  ? 29  LYS B CA  1 
ATOM   1683 C  C   . LYS B 1 10  ? -15.834 23.226 248.860 1.00 51.94  ? 29  LYS B C   1 
ATOM   1684 O  O   . LYS B 1 10  ? -14.754 22.836 249.313 1.00 50.73  ? 29  LYS B O   1 
ATOM   1685 C  CB  . LYS B 1 10  ? -17.839 22.023 249.714 1.00 60.95  ? 29  LYS B CB  1 
ATOM   1686 C  CG  . LYS B 1 10  ? -19.117 21.989 250.536 1.00 63.69  ? 29  LYS B CG  1 
ATOM   1687 C  CD  . LYS B 1 10  ? -19.828 20.659 250.339 1.00 70.26  ? 29  LYS B CD  1 
ATOM   1688 C  CE  . LYS B 1 10  ? -21.215 20.653 250.957 1.00 77.24  ? 29  LYS B CE  1 
ATOM   1689 N  NZ  . LYS B 1 10  ? -21.813 19.290 250.881 1.00 85.22  ? 29  LYS B NZ  1 
ATOM   1690 N  N   . VAL B 1 11  ? -16.027 23.553 247.575 1.00 51.13  ? 30  VAL B N   1 
ATOM   1691 C  CA  . VAL B 1 11  ? -14.956 23.583 246.594 1.00 47.68  ? 30  VAL B CA  1 
ATOM   1692 C  C   . VAL B 1 11  ? -13.905 24.606 247.079 1.00 48.92  ? 30  VAL B C   1 
ATOM   1693 O  O   . VAL B 1 11  ? -12.736 24.267 247.197 1.00 47.71  ? 30  VAL B O   1 
ATOM   1694 C  CB  . VAL B 1 11  ? -15.462 23.921 245.160 1.00 48.11  ? 30  VAL B CB  1 
ATOM   1695 C  CG1 . VAL B 1 11  ? -14.313 23.987 244.182 1.00 44.30  ? 30  VAL B CG1 1 
ATOM   1696 C  CG2 . VAL B 1 11  ? -16.487 22.899 244.676 1.00 46.49  ? 30  VAL B CG2 1 
ATOM   1697 N  N   . SER B 1 12  ? -14.340 25.823 247.402 1.00 46.62  ? 31  SER B N   1 
ATOM   1698 C  CA  . SER B 1 12  ? -13.443 26.877 247.899 1.00 50.69  ? 31  SER B CA  1 
ATOM   1699 C  C   . SER B 1 12  ? -12.735 26.495 249.203 1.00 51.94  ? 31  SER B C   1 
ATOM   1700 O  O   . SER B 1 12  ? -11.513 26.659 249.303 1.00 49.84  ? 31  SER B O   1 
ATOM   1701 C  CB  . SER B 1 12  ? -14.195 28.192 248.072 1.00 51.73  ? 31  SER B CB  1 
ATOM   1702 O  OG  . SER B 1 12  ? -14.764 28.562 246.813 1.00 54.98  ? 31  SER B OG  1 
ATOM   1703 N  N   . ALA B 1 13  ? -13.488 25.969 250.176 1.00 51.33  ? 32  ALA B N   1 
ATOM   1704 C  CA  . ALA B 1 13  ? -12.915 25.512 251.467 1.00 50.18  ? 32  ALA B CA  1 
ATOM   1705 C  C   . ALA B 1 13  ? -11.857 24.418 251.273 1.00 52.04  ? 32  ALA B C   1 
ATOM   1706 O  O   . ALA B 1 13  ? -10.794 24.494 251.871 1.00 53.98  ? 32  ALA B O   1 
ATOM   1707 C  CB  . ALA B 1 13  ? -13.997 25.013 252.418 1.00 52.93  ? 32  ALA B CB  1 
ATOM   1708 N  N   . ALA B 1 14  ? -12.142 23.446 250.398 1.00 54.45  ? 33  ALA B N   1 
ATOM   1709 C  CA  . ALA B 1 14  ? -11.214 22.347 250.087 1.00 56.86  ? 33  ALA B CA  1 
ATOM   1710 C  C   . ALA B 1 14  ? -9.930  22.877 249.438 1.00 57.08  ? 33  ALA B C   1 
ATOM   1711 O  O   . ALA B 1 14  ? -8.833  22.441 249.801 1.00 59.18  ? 33  ALA B O   1 
ATOM   1712 C  CB  . ALA B 1 14  ? -11.876 21.298 249.200 1.00 49.22  ? 33  ALA B CB  1 
ATOM   1713 N  N   . ILE B 1 15  ? -10.082 23.832 248.513 1.00 56.18  ? 34  ILE B N   1 
ATOM   1714 C  CA  . ILE B 1 15  ? -8.943  24.477 247.858 1.00 56.76  ? 34  ILE B CA  1 
ATOM   1715 C  C   . ILE B 1 15  ? -8.050  25.223 248.859 1.00 55.01  ? 34  ILE B C   1 
ATOM   1716 O  O   . ILE B 1 15  ? -6.846  25.039 248.838 1.00 55.94  ? 34  ILE B O   1 
ATOM   1717 C  CB  . ILE B 1 15  ? -9.366  25.412 246.711 1.00 55.98  ? 34  ILE B CB  1 
ATOM   1718 C  CG1 . ILE B 1 15  ? -9.915  24.585 245.551 1.00 55.87  ? 34  ILE B CG1 1 
ATOM   1719 C  CG2 . ILE B 1 15  ? -8.165  26.220 246.213 1.00 52.36  ? 34  ILE B CG2 1 
ATOM   1720 C  CD1 . ILE B 1 15  ? -10.593 25.406 244.475 1.00 55.67  ? 34  ILE B CD1 1 
ATOM   1721 N  N   . GLU B 1 16  ? -8.631  26.023 249.750 1.00 58.31  ? 35  GLU B N   1 
ATOM   1722 C  CA  . GLU B 1 16  ? -7.822  26.756 250.739 1.00 64.65  ? 35  GLU B CA  1 
ATOM   1723 C  C   . GLU B 1 16  ? -7.130  25.887 251.779 1.00 67.18  ? 35  GLU B C   1 
ATOM   1724 O  O   . GLU B 1 16  ? -6.133  26.318 252.360 1.00 69.99  ? 35  GLU B O   1 
ATOM   1725 C  CB  . GLU B 1 16  ? -8.631  27.844 251.430 1.00 66.64  ? 35  GLU B CB  1 
ATOM   1726 C  CG  . GLU B 1 16  ? -9.098  28.896 250.439 1.00 68.15  ? 35  GLU B CG  1 
ATOM   1727 C  CD  . GLU B 1 16  ? -9.869  30.019 251.084 1.00 72.36  ? 35  GLU B CD  1 
ATOM   1728 O  OE1 . GLU B 1 16  ? -10.000 30.071 252.331 1.00 66.46  ? 35  GLU B OE1 1 
ATOM   1729 O  OE2 . GLU B 1 16  ? -10.353 30.881 250.326 1.00 73.31  ? 35  GLU B OE2 1 
ATOM   1730 N  N   . ALA B 1 17  ? -7.670  24.691 252.029 1.00 64.89  ? 36  ALA B N   1 
ATOM   1731 C  CA  . ALA B 1 17  ? -7.071  23.734 252.975 1.00 63.19  ? 36  ALA B CA  1 
ATOM   1732 C  C   . ALA B 1 17  ? -6.060  22.806 252.266 1.00 67.36  ? 36  ALA B C   1 
ATOM   1733 O  O   . ALA B 1 17  ? -5.465  21.967 252.922 1.00 71.04  ? 36  ALA B O   1 
ATOM   1734 C  CB  . ALA B 1 17  ? -8.156  22.903 253.641 1.00 57.40  ? 36  ALA B CB  1 
ATOM   1735 N  N   . GLY B 1 18  ? -5.859  22.959 250.949 1.00 61.18  ? 37  GLY B N   1 
ATOM   1736 C  CA  . GLY B 1 18  ? -4.953  22.108 250.197 1.00 65.15  ? 37  GLY B CA  1 
ATOM   1737 C  C   . GLY B 1 18  ? -5.479  20.689 249.998 1.00 70.15  ? 37  GLY B C   1 
ATOM   1738 O  O   . GLY B 1 18  ? -4.675  19.761 249.893 1.00 71.40  ? 37  GLY B O   1 
ATOM   1739 N  N   . GLN B 1 19  ? -6.813  20.528 249.941 1.00 62.53  ? 38  GLN B N   1 
ATOM   1740 C  CA  . GLN B 1 19  ? -7.484  19.230 249.765 1.00 61.08  ? 38  GLN B CA  1 
ATOM   1741 C  C   . GLN B 1 19  ? -8.055  19.234 248.357 1.00 60.96  ? 38  GLN B C   1 
ATOM   1742 O  O   . GLN B 1 19  ? -9.273  19.293 248.130 1.00 65.49  ? 38  GLN B O   1 
ATOM   1743 C  CB  . GLN B 1 19  ? -8.554  19.028 250.842 1.00 63.50  ? 38  GLN B CB  1 
ATOM   1744 C  CG  . GLN B 1 19  ? -8.028  18.979 252.275 1.00 65.48  ? 38  GLN B CG  1 
ATOM   1745 C  CD  . GLN B 1 19  ? -7.196  17.740 252.607 1.00 73.73  ? 38  GLN B CD  1 
ATOM   1746 O  OE1 . GLN B 1 19  ? -7.158  16.762 251.859 1.00 76.69  ? 38  GLN B OE1 1 
ATOM   1747 N  NE2 . GLN B 1 19  ? -6.547  17.771 253.763 1.00 85.57  ? 38  GLN B NE2 1 
ATOM   1748 N  N   . ASN B 1 20  ? -7.130  19.181 247.411 1.00 58.17  ? 39  ASN B N   1 
ATOM   1749 C  CA  . ASN B 1 20  ? -7.433  19.259 245.974 1.00 59.91  ? 39  ASN B CA  1 
ATOM   1750 C  C   . ASN B 1 20  ? -8.295  18.140 245.418 1.00 57.18  ? 39  ASN B C   1 
ATOM   1751 O  O   . ASN B 1 20  ? -9.119  18.389 244.533 1.00 56.67  ? 39  ASN B O   1 
ATOM   1752 C  CB  . ASN B 1 20  ? -6.137  19.380 245.159 1.00 62.37  ? 39  ASN B CB  1 
ATOM   1753 C  CG  . ASN B 1 20  ? -5.360  20.658 245.457 1.00 66.36  ? 39  ASN B CG  1 
ATOM   1754 O  OD1 . ASN B 1 20  ? -5.901  21.642 245.967 1.00 64.30  ? 39  ASN B OD1 1 
ATOM   1755 N  ND2 . ASN B 1 20  ? -4.078  20.646 245.127 1.00 81.11  ? 39  ASN B ND2 1 
ATOM   1756 N  N   . GLY B 1 21  ? -8.104  16.929 245.942 1.00 62.20  ? 40  GLY B N   1 
ATOM   1757 C  CA  . GLY B 1 21  ? -8.865  15.750 245.547 1.00 58.70  ? 40  GLY B CA  1 
ATOM   1758 C  C   . GLY B 1 21  ? -10.339 15.917 245.860 1.00 58.18  ? 40  GLY B C   1 
ATOM   1759 O  O   . GLY B 1 21  ? -11.178 15.722 244.979 1.00 60.01  ? 40  GLY B O   1 
ATOM   1760 N  N   . GLN B 1 22  ? -10.658 16.327 247.088 1.00 57.20  ? 41  GLN B N   1 
ATOM   1761 C  CA  . GLN B 1 22  ? -12.066 16.530 247.457 1.00 64.02  ? 41  GLN B CA  1 
ATOM   1762 C  C   . GLN B 1 22  ? -12.662 17.773 246.774 1.00 60.38  ? 41  GLN B C   1 
ATOM   1763 O  O   . GLN B 1 22  ? -13.855 17.789 246.491 1.00 60.85  ? 41  GLN B O   1 
ATOM   1764 C  CB  . GLN B 1 22  ? -12.306 16.484 248.967 1.00 68.69  ? 41  GLN B CB  1 
ATOM   1765 C  CG  . GLN B 1 22  ? -11.794 17.639 249.776 1.00 76.67  ? 41  GLN B CG  1 
ATOM   1766 C  CD  . GLN B 1 22  ? -11.997 17.435 251.274 1.00 86.01  ? 41  GLN B CD  1 
ATOM   1767 O  OE1 . GLN B 1 22  ? -11.751 16.353 251.819 1.00 100.86 ? 41  GLN B OE1 1 
ATOM   1768 N  NE2 . GLN B 1 22  ? -12.417 18.486 251.949 1.00 80.61  ? 41  GLN B NE2 1 
ATOM   1769 N  N   . ALA B 1 23  ? -11.836 18.782 246.488 1.00 60.71  ? 42  ALA B N   1 
ATOM   1770 C  CA  . ALA B 1 23  ? -12.282 19.981 245.765 1.00 57.52  ? 42  ALA B CA  1 
ATOM   1771 C  C   . ALA B 1 23  ? -12.772 19.603 244.351 1.00 53.78  ? 42  ALA B C   1 
ATOM   1772 O  O   . ALA B 1 23  ? -13.821 20.071 243.913 1.00 53.64  ? 42  ALA B O   1 
ATOM   1773 C  CB  . ALA B 1 23  ? -11.167 21.021 245.701 1.00 54.00  ? 42  ALA B CB  1 
ATOM   1774 N  N   . VAL B 1 24  ? -12.039 18.720 243.674 1.00 52.85  ? 43  VAL B N   1 
ATOM   1775 C  CA  . VAL B 1 24  ? -12.414 18.244 242.321 1.00 52.86  ? 43  VAL B CA  1 
ATOM   1776 C  C   . VAL B 1 24  ? -13.722 17.412 242.344 1.00 57.56  ? 43  VAL B C   1 
ATOM   1777 O  O   . VAL B 1 24  ? -14.570 17.597 241.468 1.00 46.41  ? 43  VAL B O   1 
ATOM   1778 C  CB  . VAL B 1 24  ? -11.266 17.475 241.641 1.00 55.84  ? 43  VAL B CB  1 
ATOM   1779 C  CG1 . VAL B 1 24  ? -11.683 16.936 240.284 1.00 59.35  ? 43  VAL B CG1 1 
ATOM   1780 C  CG2 . VAL B 1 24  ? -10.045 18.376 241.491 1.00 50.36  ? 43  VAL B CG2 1 
ATOM   1781 N  N   . SER B 1 25  ? -13.892 16.553 243.360 1.00 54.33  ? 44  SER B N   1 
ATOM   1782 C  CA  . SER B 1 25  ? -15.105 15.729 243.519 1.00 57.63  ? 44  SER B CA  1 
ATOM   1783 C  C   . SER B 1 25  ? -16.328 16.603 243.696 1.00 53.69  ? 44  SER B C   1 
ATOM   1784 O  O   . SER B 1 25  ? -17.331 16.369 243.049 1.00 60.81  ? 44  SER B O   1 
ATOM   1785 C  CB  . SER B 1 25  ? -15.022 14.799 244.739 1.00 60.12  ? 44  SER B CB  1 
ATOM   1786 O  OG  . SER B 1 25  ? -13.960 13.899 244.593 1.00 73.34  ? 44  SER B OG  1 
ATOM   1787 N  N   . TYR B 1 26  ? -16.249 17.575 244.610 1.00 52.16  ? 45  TYR B N   1 
ATOM   1788 C  CA  . TYR B 1 26  ? -17.342 18.530 244.824 1.00 50.75  ? 45  TYR B CA  1 
ATOM   1789 C  C   . TYR B 1 26  ? -17.672 19.334 243.543 1.00 47.23  ? 45  TYR B C   1 
ATOM   1790 O  O   . TYR B 1 26  ? -18.831 19.621 243.262 1.00 50.45  ? 45  TYR B O   1 
ATOM   1791 C  CB  . TYR B 1 26  ? -17.037 19.505 245.972 1.00 54.92  ? 45  TYR B CB  1 
ATOM   1792 C  CG  . TYR B 1 26  ? -17.075 18.899 247.361 1.00 58.99  ? 45  TYR B CG  1 
ATOM   1793 C  CD1 . TYR B 1 26  ? -18.228 18.239 247.824 1.00 67.63  ? 45  TYR B CD1 1 
ATOM   1794 C  CD2 . TYR B 1 26  ? -16.023 19.094 248.269 1.00 63.82  ? 45  TYR B CD2 1 
ATOM   1795 C  CE1 . TYR B 1 26  ? -18.296 17.711 249.112 1.00 67.84  ? 45  TYR B CE1 1 
ATOM   1796 C  CE2 . TYR B 1 26  ? -16.081 18.569 249.564 1.00 65.94  ? 45  TYR B CE2 1 
ATOM   1797 C  CZ  . TYR B 1 26  ? -17.219 17.881 249.979 1.00 70.88  ? 45  TYR B CZ  1 
ATOM   1798 O  OH  . TYR B 1 26  ? -17.293 17.362 251.251 1.00 79.88  ? 45  TYR B OH  1 
ATOM   1799 N  N   . PHE B 1 27  ? -16.647 19.701 242.798 1.00 42.86  ? 46  PHE B N   1 
ATOM   1800 C  CA  . PHE B 1 27  ? -16.825 20.432 241.552 1.00 48.15  ? 46  PHE B CA  1 
ATOM   1801 C  C   . PHE B 1 27  ? -17.581 19.582 240.510 1.00 52.04  ? 46  PHE B C   1 
ATOM   1802 O  O   . PHE B 1 27  ? -18.433 20.125 239.800 1.00 59.49  ? 46  PHE B O   1 
ATOM   1803 C  CB  . PHE B 1 27  ? -15.490 20.921 241.046 1.00 45.87  ? 46  PHE B CB  1 
ATOM   1804 C  CG  . PHE B 1 27  ? -15.590 21.942 239.959 1.00 45.36  ? 46  PHE B CG  1 
ATOM   1805 C  CD1 . PHE B 1 27  ? -15.812 23.279 240.271 1.00 47.67  ? 46  PHE B CD1 1 
ATOM   1806 C  CD2 . PHE B 1 27  ? -15.435 21.571 238.624 1.00 42.21  ? 46  PHE B CD2 1 
ATOM   1807 C  CE1 . PHE B 1 27  ? -15.870 24.241 239.264 1.00 50.39  ? 46  PHE B CE1 1 
ATOM   1808 C  CE2 . PHE B 1 27  ? -15.476 22.523 237.621 1.00 45.40  ? 46  PHE B CE2 1 
ATOM   1809 C  CZ  . PHE B 1 27  ? -15.695 23.862 237.940 1.00 49.48  ? 46  PHE B CZ  1 
ATOM   1810 N  N   . ARG B 1 28  ? -17.292 18.273 240.424 1.00 59.19  ? 47  ARG B N   1 
ATOM   1811 C  CA  . ARG B 1 28  ? -18.046 17.365 239.515 1.00 56.25  ? 47  ARG B CA  1 
ATOM   1812 C  C   . ARG B 1 28  ? -19.521 17.289 239.858 1.00 52.15  ? 47  ARG B C   1 
ATOM   1813 O  O   . ARG B 1 28  ? -20.372 17.283 238.980 1.00 52.87  ? 47  ARG B O   1 
ATOM   1814 C  CB  . ARG B 1 28  ? -17.535 15.919 239.516 1.00 60.56  ? 47  ARG B CB  1 
ATOM   1815 C  CG  . ARG B 1 28  ? -16.433 15.640 238.541 1.00 68.15  ? 47  ARG B CG  1 
ATOM   1816 C  CD  . ARG B 1 28  ? -16.273 14.147 238.282 1.00 66.65  ? 47  ARG B CD  1 
ATOM   1817 N  NE  . ARG B 1 28  ? -15.901 13.428 239.492 1.00 68.97  ? 47  ARG B NE  1 
ATOM   1818 C  CZ  . ARG B 1 28  ? -14.665 13.320 239.982 1.00 66.09  ? 47  ARG B CZ  1 
ATOM   1819 N  NH1 . ARG B 1 28  ? -13.611 13.905 239.395 1.00 78.05  ? 47  ARG B NH1 1 
ATOM   1820 N  NH2 . ARG B 1 28  ? -14.475 12.624 241.099 1.00 83.07  ? 47  ARG B NH2 1 
ATOM   1821 N  N   . GLN B 1 29  ? -19.799 17.207 241.144 1.00 53.97  ? 48  GLN B N   1 
ATOM   1822 C  CA  . GLN B 1 29  ? -21.167 17.129 241.645 1.00 58.32  ? 48  GLN B CA  1 
ATOM   1823 C  C   . GLN B 1 29  ? -21.959 18.404 241.369 1.00 52.08  ? 48  GLN B C   1 
ATOM   1824 O  O   . GLN B 1 29  ? -23.149 18.326 241.115 1.00 60.72  ? 48  GLN B O   1 
ATOM   1825 C  CB  . GLN B 1 29  ? -21.166 16.805 243.137 1.00 61.14  ? 48  GLN B CB  1 
ATOM   1826 C  CG  . GLN B 1 29  ? -20.579 15.438 243.478 1.00 64.77  ? 48  GLN B CG  1 
ATOM   1827 C  CD  . GLN B 1 29  ? -20.438 15.208 244.983 1.00 74.50  ? 48  GLN B CD  1 
ATOM   1828 O  OE1 . GLN B 1 29  ? -21.017 15.929 245.797 1.00 79.86  ? 48  GLN B OE1 1 
ATOM   1829 N  NE2 . GLN B 1 29  ? -19.667 14.194 245.353 1.00 73.43  ? 48  GLN B NE2 1 
ATOM   1830 N  N   . THR B 1 30  ? -21.298 19.561 241.418 1.00 51.91  ? 49  THR B N   1 
ATOM   1831 C  CA  . THR B 1 30  ? -21.956 20.857 241.137 1.00 58.12  ? 49  THR B CA  1 
ATOM   1832 C  C   . THR B 1 30  ? -22.260 20.995 239.623 1.00 55.78  ? 49  THR B C   1 
ATOM   1833 O  O   . THR B 1 30  ? -23.274 21.611 239.252 1.00 53.59  ? 49  THR B O   1 
ATOM   1834 C  CB  . THR B 1 30  ? -21.163 22.073 241.669 1.00 59.21  ? 49  THR B CB  1 
ATOM   1835 O  OG1 . THR B 1 30  ? -19.948 22.237 240.940 1.00 82.45  ? 49  THR B OG1 1 
ATOM   1836 C  CG2 . THR B 1 30  ? -20.828 21.869 243.093 1.00 55.78  ? 49  THR B CG2 1 
ATOM   1837 N  N   . ILE B 1 31  ? -21.396 20.439 238.762 1.00 52.99  ? 50  ILE B N   1 
ATOM   1838 C  CA  . ILE B 1 31  ? -21.656 20.438 237.297 1.00 51.56  ? 50  ILE B CA  1 
ATOM   1839 C  C   . ILE B 1 31  ? -22.988 19.710 237.001 1.00 54.33  ? 50  ILE B C   1 
ATOM   1840 O  O   . ILE B 1 31  ? -23.805 20.220 236.238 1.00 53.26  ? 50  ILE B O   1 
ATOM   1841 C  CB  . ILE B 1 31  ? -20.518 19.791 236.490 1.00 49.79  ? 50  ILE B CB  1 
ATOM   1842 C  CG1 . ILE B 1 31  ? -19.291 20.693 236.493 1.00 49.60  ? 50  ILE B CG1 1 
ATOM   1843 C  CG2 . ILE B 1 31  ? -20.942 19.546 235.039 1.00 54.35  ? 50  ILE B CG2 1 
ATOM   1844 C  CD1 . ILE B 1 31  ? -18.051 20.031 235.915 1.00 46.35  ? 50  ILE B CD1 1 
ATOM   1845 N  N   . ALA B 1 32  ? -23.204 18.558 237.642 1.00 55.89  ? 51  ALA B N   1 
ATOM   1846 C  CA  . ALA B 1 32  ? -24.440 17.767 237.489 1.00 57.62  ? 51  ALA B CA  1 
ATOM   1847 C  C   . ALA B 1 32  ? -25.702 18.541 237.920 1.00 63.13  ? 51  ALA B C   1 
ATOM   1848 O  O   . ALA B 1 32  ? -26.764 18.353 237.327 1.00 69.34  ? 51  ALA B O   1 
ATOM   1849 C  CB  . ALA B 1 32  ? -24.340 16.462 238.274 1.00 56.95  ? 51  ALA B CB  1 
ATOM   1850 N  N   . LEU B 1 33  ? -25.579 19.382 238.956 1.00 60.17  ? 52  LEU B N   1 
ATOM   1851 C  CA  . LEU B 1 33  ? -26.682 20.220 239.433 1.00 57.75  ? 52  LEU B CA  1 
ATOM   1852 C  C   . LEU B 1 33  ? -26.937 21.423 238.492 1.00 58.41  ? 52  LEU B C   1 
ATOM   1853 O  O   . LEU B 1 33  ? -28.075 21.647 238.084 1.00 60.56  ? 52  LEU B O   1 
ATOM   1854 C  CB  . LEU B 1 33  ? -26.427 20.719 240.864 1.00 61.90  ? 52  LEU B CB  1 
ATOM   1855 C  CG  . LEU B 1 33  ? -26.343 19.685 241.998 1.00 67.56  ? 52  LEU B CG  1 
ATOM   1856 C  CD1 . LEU B 1 33  ? -25.855 20.335 243.285 1.00 69.63  ? 52  LEU B CD1 1 
ATOM   1857 C  CD2 . LEU B 1 33  ? -27.686 18.988 242.233 1.00 70.58  ? 52  LEU B CD2 1 
ATOM   1858 N  N   . ASN B 1 34  ? -25.891 22.182 238.150 1.00 55.80  ? 53  ASN B N   1 
ATOM   1859 C  CA  . ASN B 1 34  ? -26.030 23.390 237.292 1.00 52.72  ? 53  ASN B CA  1 
ATOM   1860 C  C   . ASN B 1 34  ? -24.691 23.777 236.677 1.00 54.73  ? 53  ASN B C   1 
ATOM   1861 O  O   . ASN B 1 34  ? -23.883 24.463 237.307 1.00 55.94  ? 53  ASN B O   1 
ATOM   1862 C  CB  . ASN B 1 34  ? -26.612 24.559 238.118 1.00 57.44  ? 53  ASN B CB  1 
ATOM   1863 C  CG  . ASN B 1 34  ? -26.967 25.794 237.281 1.00 55.09  ? 53  ASN B CG  1 
ATOM   1864 O  OD1 . ASN B 1 34  ? -26.447 26.027 236.203 1.00 53.50  ? 53  ASN B OD1 1 
ATOM   1865 N  ND2 . ASN B 1 34  ? -27.856 26.605 237.818 1.00 63.27  ? 53  ASN B ND2 1 
ATOM   1866 N  N   . ILE B 1 35  ? -24.496 23.365 235.427 1.00 54.32  ? 54  ILE B N   1 
ATOM   1867 C  CA  . ILE B 1 35  ? -23.253 23.600 234.705 1.00 51.82  ? 54  ILE B CA  1 
ATOM   1868 C  C   . ILE B 1 35  ? -22.941 25.073 234.439 1.00 50.97  ? 54  ILE B C   1 
ATOM   1869 O  O   . ILE B 1 35  ? -21.767 25.445 234.509 1.00 49.02  ? 54  ILE B O   1 
ATOM   1870 C  CB  . ILE B 1 35  ? -23.188 22.761 233.393 1.00 47.63  ? 54  ILE B CB  1 
ATOM   1871 C  CG1 . ILE B 1 35  ? -21.754 22.695 232.861 1.00 44.29  ? 54  ILE B CG1 1 
ATOM   1872 C  CG2 . ILE B 1 35  ? -24.178 23.274 232.370 1.00 48.78  ? 54  ILE B CG2 1 
ATOM   1873 C  CD1 . ILE B 1 35  ? -21.560 21.655 231.787 1.00 46.24  ? 54  ILE B CD1 1 
ATOM   1874 N  N   . ASP B 1 36  ? -23.963 25.885 234.147 1.00 54.22  ? 55  ASP B N   1 
ATOM   1875 C  CA  A ASP B 1 36  ? -23.790 27.333 233.885 0.50 59.49  ? 55  ASP B CA  1 
ATOM   1876 C  CA  B ASP B 1 36  ? -23.756 27.322 233.886 0.50 57.06  ? 55  ASP B CA  1 
ATOM   1877 C  C   . ASP B 1 36  ? -23.282 28.079 235.134 1.00 55.13  ? 55  ASP B C   1 
ATOM   1878 O  O   . ASP B 1 36  ? -22.439 28.971 235.027 1.00 54.77  ? 55  ASP B O   1 
ATOM   1879 C  CB  A ASP B 1 36  ? -25.107 27.968 233.400 0.50 68.15  ? 55  ASP B CB  1 
ATOM   1880 C  CB  B ASP B 1 36  ? -25.009 27.958 233.285 0.50 61.59  ? 55  ASP B CB  1 
ATOM   1881 C  CG  A ASP B 1 36  ? -24.937 29.419 232.942 0.50 80.98  ? 55  ASP B CG  1 
ATOM   1882 C  CG  B ASP B 1 36  ? -25.299 27.440 231.895 0.50 66.66  ? 55  ASP B CG  1 
ATOM   1883 O  OD1 A ASP B 1 36  ? -23.839 29.778 232.456 0.50 91.56  ? 55  ASP B OD1 1 
ATOM   1884 O  OD1 B ASP B 1 36  ? -24.339 27.131 231.153 0.50 69.36  ? 55  ASP B OD1 1 
ATOM   1885 O  OD2 A ASP B 1 36  ? -25.910 30.197 233.051 0.50 92.17  ? 55  ASP B OD2 1 
ATOM   1886 O  OD2 B ASP B 1 36  ? -26.486 27.346 231.538 0.50 78.92  ? 55  ASP B OD2 1 
ATOM   1887 N  N   . ARG B 1 37  ? -23.814 27.720 236.304 1.00 57.77  ? 56  ARG B N   1 
ATOM   1888 C  CA  A ARG B 1 37  ? -23.388 28.334 237.578 0.50 56.67  ? 56  ARG B CA  1 
ATOM   1889 C  CA  B ARG B 1 37  ? -23.401 28.328 237.585 0.50 58.28  ? 56  ARG B CA  1 
ATOM   1890 C  C   . ARG B 1 37  ? -21.946 27.917 237.862 1.00 54.88  ? 56  ARG B C   1 
ATOM   1891 O  O   . ARG B 1 37  ? -21.119 28.746 238.226 1.00 55.09  ? 56  ARG B O   1 
ATOM   1892 C  CB  A ARG B 1 37  ? -24.298 27.922 238.736 0.50 58.74  ? 56  ARG B CB  1 
ATOM   1893 C  CB  B ARG B 1 37  ? -24.298 27.839 238.724 0.50 63.00  ? 56  ARG B CB  1 
ATOM   1894 C  CG  A ARG B 1 37  ? -23.956 28.557 240.083 0.50 64.57  ? 56  ARG B CG  1 
ATOM   1895 C  CG  B ARG B 1 37  ? -24.171 28.566 240.058 0.50 73.00  ? 56  ARG B CG  1 
ATOM   1896 C  CD  A ARG B 1 37  ? -23.977 30.079 240.031 0.50 64.13  ? 56  ARG B CD  1 
ATOM   1897 C  CD  B ARG B 1 37  ? -24.814 29.946 240.043 0.50 75.89  ? 56  ARG B CD  1 
ATOM   1898 N  NE  A ARG B 1 37  ? -23.495 30.652 241.284 0.50 64.99  ? 56  ARG B NE  1 
ATOM   1899 N  NE  B ARG B 1 37  ? -25.031 30.441 241.404 0.50 78.19  ? 56  ARG B NE  1 
ATOM   1900 C  CZ  A ARG B 1 37  ? -22.233 31.010 241.495 0.50 64.81  ? 56  ARG B CZ  1 
ATOM   1901 C  CZ  B ARG B 1 37  ? -26.134 30.206 242.111 0.50 79.56  ? 56  ARG B CZ  1 
ATOM   1902 N  NH1 A ARG B 1 37  ? -21.341 30.876 240.525 0.50 57.90  ? 56  ARG B NH1 1 
ATOM   1903 N  NH1 B ARG B 1 37  ? -26.255 30.685 243.340 0.50 86.59  ? 56  ARG B NH1 1 
ATOM   1904 N  NH2 A ARG B 1 37  ? -21.866 31.519 242.665 0.50 67.68  ? 56  ARG B NH2 1 
ATOM   1905 N  NH2 B ARG B 1 37  ? -27.120 29.487 241.588 0.50 77.15  ? 56  ARG B NH2 1 
ATOM   1906 N  N   . THR B 1 38  ? -21.655 26.628 237.668 1.00 52.40  ? 57  THR B N   1 
ATOM   1907 C  CA  . THR B 1 38  ? -20.319 26.062 237.872 1.00 51.29  ? 57  THR B CA  1 
ATOM   1908 C  C   . THR B 1 38  ? -19.302 26.743 236.984 1.00 50.97  ? 57  THR B C   1 
ATOM   1909 O  O   . THR B 1 38  ? -18.224 27.096 237.469 1.00 49.71  ? 57  THR B O   1 
ATOM   1910 C  CB  . THR B 1 38  ? -20.295 24.541 237.636 1.00 52.66  ? 57  THR B CB  1 
ATOM   1911 O  OG1 . THR B 1 38  ? -21.249 23.925 238.502 1.00 57.52  ? 57  THR B OG1 1 
ATOM   1912 C  CG2 . THR B 1 38  ? -18.936 23.969 237.964 1.00 54.35  ? 57  THR B CG2 1 
ATOM   1913 N  N   . GLU B 1 39  ? -19.649 26.926 235.700 1.00 51.02  ? 58  GLU B N   1 
ATOM   1914 C  CA  . GLU B 1 39  ? -18.793 27.637 234.731 1.00 50.04  ? 58  GLU B CA  1 
ATOM   1915 C  C   . GLU B 1 39  ? -18.494 29.065 235.208 1.00 50.02  ? 58  GLU B C   1 
ATOM   1916 O  O   . GLU B 1 39  ? -17.359 29.513 235.152 1.00 54.96  ? 58  GLU B O   1 
ATOM   1917 C  CB  . GLU B 1 39  ? -19.421 27.669 233.325 1.00 47.97  ? 58  GLU B CB  1 
ATOM   1918 C  CG  . GLU B 1 39  ? -18.646 28.564 232.382 1.00 53.41  ? 58  GLU B CG  1 
ATOM   1919 C  CD  . GLU B 1 39  ? -19.088 28.589 230.936 1.00 58.43  ? 58  GLU B CD  1 
ATOM   1920 O  OE1 . GLU B 1 39  ? -20.103 27.981 230.556 1.00 65.89  ? 58  GLU B OE1 1 
ATOM   1921 O  OE2 . GLU B 1 39  ? -18.397 29.294 230.174 1.00 57.08  ? 58  GLU B OE2 1 
HETATM 1922 N  N   . MSE B 1 40  ? -19.531 29.771 235.634 1.00 51.42  ? 59  MSE B N   1 
HETATM 1923 C  CA  . MSE B 1 40  ? -19.405 31.141 236.181 1.00 61.52  ? 59  MSE B CA  1 
HETATM 1924 C  C   . MSE B 1 40  ? -18.415 31.173 237.367 1.00 54.45  ? 59  MSE B C   1 
HETATM 1925 O  O   . MSE B 1 40  ? -17.593 32.080 237.456 1.00 53.07  ? 59  MSE B O   1 
HETATM 1926 C  CB  . MSE B 1 40  ? -20.779 31.651 236.617 1.00 61.95  ? 59  MSE B CB  1 
HETATM 1927 C  CG  . MSE B 1 40  ? -20.925 33.141 236.795 1.00 81.12  ? 59  MSE B CG  1 
HETATM 1928 SE SE  . MSE B 1 40  ? -22.793 33.548 237.314 0.75 110.25 ? 59  MSE B SE  1 
HETATM 1929 C  CE  . MSE B 1 40  ? -23.788 32.499 235.965 1.00 72.25  ? 59  MSE B CE  1 
ATOM   1930 N  N   . TYR B 1 41  ? -18.483 30.163 238.241 1.00 52.25  ? 60  TYR B N   1 
ATOM   1931 C  CA  . TYR B 1 41  ? -17.559 30.037 239.384 1.00 52.67  ? 60  TYR B CA  1 
ATOM   1932 C  C   . TYR B 1 41  ? -16.109 29.907 238.910 1.00 49.53  ? 60  TYR B C   1 
ATOM   1933 O  O   . TYR B 1 41  ? -15.210 30.524 239.488 1.00 49.70  ? 60  TYR B O   1 
ATOM   1934 C  CB  . TYR B 1 41  ? -17.939 28.847 240.283 1.00 54.22  ? 60  TYR B CB  1 
ATOM   1935 C  CG  . TYR B 1 41  ? -16.932 28.530 241.374 1.00 54.21  ? 60  TYR B CG  1 
ATOM   1936 C  CD1 . TYR B 1 41  ? -17.042 29.097 242.645 1.00 50.59  ? 60  TYR B CD1 1 
ATOM   1937 C  CD2 . TYR B 1 41  ? -15.875 27.642 241.132 1.00 53.22  ? 60  TYR B CD2 1 
ATOM   1938 C  CE1 . TYR B 1 41  ? -16.105 28.811 243.645 1.00 56.44  ? 60  TYR B CE1 1 
ATOM   1939 C  CE2 . TYR B 1 41  ? -14.939 27.338 242.119 1.00 54.14  ? 60  TYR B CE2 1 
ATOM   1940 C  CZ  . TYR B 1 41  ? -15.049 27.925 243.374 1.00 56.11  ? 60  TYR B CZ  1 
ATOM   1941 O  OH  . TYR B 1 41  ? -14.127 27.607 244.345 1.00 54.23  ? 60  TYR B OH  1 
ATOM   1942 N  N   . TYR B 1 42  ? -15.890 29.081 237.882 1.00 47.00  ? 61  TYR B N   1 
ATOM   1943 C  CA  . TYR B 1 42  ? -14.570 28.896 237.318 1.00 47.34  ? 61  TYR B CA  1 
ATOM   1944 C  C   . TYR B 1 42  ? -13.979 30.237 236.853 1.00 51.25  ? 61  TYR B C   1 
ATOM   1945 O  O   . TYR B 1 42  ? -12.821 30.514 237.137 1.00 51.40  ? 61  TYR B O   1 
ATOM   1946 C  CB  . TYR B 1 42  ? -14.593 27.867 236.166 1.00 47.55  ? 61  TYR B CB  1 
ATOM   1947 C  CG  . TYR B 1 42  ? -13.288 27.764 235.457 1.00 48.35  ? 61  TYR B CG  1 
ATOM   1948 C  CD1 . TYR B 1 42  ? -12.271 26.950 235.949 1.00 54.74  ? 61  TYR B CD1 1 
ATOM   1949 C  CD2 . TYR B 1 42  ? -13.038 28.518 234.300 1.00 48.05  ? 61  TYR B CD2 1 
ATOM   1950 C  CE1 . TYR B 1 42  ? -11.033 26.867 235.302 1.00 52.46  ? 61  TYR B CE1 1 
ATOM   1951 C  CE2 . TYR B 1 42  ? -11.813 28.449 233.657 1.00 46.90  ? 61  TYR B CE2 1 
ATOM   1952 C  CZ  . TYR B 1 42  ? -10.812 27.620 234.160 1.00 53.74  ? 61  TYR B CZ  1 
ATOM   1953 O  OH  . TYR B 1 42  ? -9.599  27.536 233.525 1.00 58.34  ? 61  TYR B OH  1 
ATOM   1954 N  N   . TRP B 1 43  ? -14.789 31.044 236.155 1.00 52.62  ? 62  TRP B N   1 
ATOM   1955 C  CA  . TRP B 1 43  ? -14.345 32.326 235.626 1.00 54.54  ? 62  TRP B CA  1 
ATOM   1956 C  C   . TRP B 1 43  ? -14.094 33.390 236.647 1.00 59.17  ? 62  TRP B C   1 
ATOM   1957 O  O   . TRP B 1 43  ? -13.103 34.098 236.554 1.00 62.42  ? 62  TRP B O   1 
ATOM   1958 C  CB  . TRP B 1 43  ? -15.317 32.866 234.569 1.00 57.46  ? 62  TRP B CB  1 
ATOM   1959 C  CG  . TRP B 1 43  ? -15.374 32.037 233.309 1.00 56.83  ? 62  TRP B CG  1 
ATOM   1960 C  CD1 . TRP B 1 43  ? -16.474 31.380 232.773 1.00 57.49  ? 62  TRP B CD1 1 
ATOM   1961 C  CD2 . TRP B 1 43  ? -14.261 31.706 232.413 1.00 55.64  ? 62  TRP B CD2 1 
ATOM   1962 N  NE1 . TRP B 1 43  ? -16.132 30.716 231.625 1.00 63.16  ? 62  TRP B NE1 1 
ATOM   1963 C  CE2 . TRP B 1 43  ? -14.827 30.860 231.357 1.00 56.20  ? 62  TRP B CE2 1 
ATOM   1964 C  CE3 . TRP B 1 43  ? -12.902 32.022 232.368 1.00 61.45  ? 62  TRP B CE3 1 
ATOM   1965 C  CZ2 . TRP B 1 43  ? -14.057 30.374 230.311 1.00 59.25  ? 62  TRP B CZ2 1 
ATOM   1966 C  CZ3 . TRP B 1 43  ? -12.129 31.515 231.306 1.00 63.17  ? 62  TRP B CZ3 1 
ATOM   1967 C  CH2 . TRP B 1 43  ? -12.697 30.708 230.307 1.00 60.24  ? 62  TRP B CH2 1 
ATOM   1968 N  N   . THR B 1 44  ? -14.973 33.497 237.631 1.00 56.90  ? 63  THR B N   1 
ATOM   1969 C  CA  . THR B 1 44  ? -14.887 34.535 238.654 1.00 58.99  ? 63  THR B CA  1 
ATOM   1970 C  C   . THR B 1 44  ? -14.072 34.192 239.920 1.00 60.54  ? 63  THR B C   1 
ATOM   1971 O  O   . THR B 1 44  ? -13.459 35.089 240.482 1.00 61.89  ? 63  THR B O   1 
ATOM   1972 C  CB  . THR B 1 44  ? -16.306 34.946 239.091 1.00 59.24  ? 63  THR B CB  1 
ATOM   1973 O  OG1 . THR B 1 44  ? -16.975 33.810 239.640 1.00 68.06  ? 63  THR B OG1 1 
ATOM   1974 C  CG2 . THR B 1 44  ? -17.105 35.444 237.913 1.00 62.31  ? 63  THR B CG2 1 
ATOM   1975 N  N   . ASN B 1 45  ? -14.059 32.924 240.351 1.00 57.67  ? 64  ASN B N   1 
ATOM   1976 C  CA  . ASN B 1 45  ? -13.383 32.502 241.614 1.00 57.59  ? 64  ASN B CA  1 
ATOM   1977 C  C   . ASN B 1 45  ? -12.153 31.602 241.544 1.00 57.74  ? 64  ASN B C   1 
ATOM   1978 O  O   . ASN B 1 45  ? -11.482 31.456 242.545 1.00 58.63  ? 64  ASN B O   1 
ATOM   1979 C  CB  . ASN B 1 45  ? -14.387 31.776 242.530 1.00 62.64  ? 64  ASN B CB  1 
ATOM   1980 C  CG  . ASN B 1 45  ? -15.546 32.656 242.956 1.00 72.12  ? 64  ASN B CG  1 
ATOM   1981 O  OD1 . ASN B 1 45  ? -16.193 33.300 242.132 1.00 80.04  ? 64  ASN B OD1 1 
ATOM   1982 N  ND2 . ASN B 1 45  ? -15.835 32.660 244.250 1.00 76.64  ? 64  ASN B ND2 1 
ATOM   1983 N  N   . VAL B 1 46  ? -11.862 30.957 240.419 1.00 56.41  ? 65  VAL B N   1 
ATOM   1984 C  CA  . VAL B 1 46  ? -10.698 30.069 240.381 1.00 51.91  ? 65  VAL B CA  1 
ATOM   1985 C  C   . VAL B 1 46  ? -9.447  30.799 239.909 1.00 57.83  ? 65  VAL B C   1 
ATOM   1986 O  O   . VAL B 1 46  ? -9.470  31.490 238.872 1.00 57.52  ? 65  VAL B O   1 
ATOM   1987 C  CB  . VAL B 1 46  ? -10.953 28.813 239.545 1.00 53.22  ? 65  VAL B CB  1 
ATOM   1988 C  CG1 . VAL B 1 46  ? -9.683  27.978 239.451 1.00 48.13  ? 65  VAL B CG1 1 
ATOM   1989 C  CG2 . VAL B 1 46  ? -12.095 28.017 240.165 1.00 48.72  ? 65  VAL B CG2 1 
ATOM   1990 N  N   . ASP B 1 47  ? -8.371  30.646 240.695 1.00 58.25  ? 66  ASP B N   1 
ATOM   1991 C  CA  . ASP B 1 47  ? -7.052  31.194 240.386 1.00 60.32  ? 66  ASP B CA  1 
ATOM   1992 C  C   . ASP B 1 47  ? -6.547  30.370 239.201 1.00 58.88  ? 66  ASP B C   1 
ATOM   1993 O  O   . ASP B 1 47  ? -6.313  29.168 239.337 1.00 54.44  ? 66  ASP B O   1 
ATOM   1994 C  CB  . ASP B 1 47  ? -6.113  31.057 241.600 1.00 68.45  ? 66  ASP B CB  1 
ATOM   1995 C  CG  . ASP B 1 47  ? -4.681  31.523 241.325 1.00 80.08  ? 66  ASP B CG  1 
ATOM   1996 O  OD1 . ASP B 1 47  ? -4.404  32.173 240.290 1.00 82.38  ? 66  ASP B OD1 1 
ATOM   1997 O  OD2 . ASP B 1 47  ? -3.810  31.243 242.181 1.00 86.66  ? 66  ASP B OD2 1 
ATOM   1998 N  N   . LYS B 1 48  ? -6.397  31.018 238.046 1.00 59.20  ? 67  LYS B N   1 
ATOM   1999 C  CA  . LYS B 1 48  ? -5.955  30.326 236.811 1.00 64.23  ? 67  LYS B CA  1 
ATOM   2000 C  C   . LYS B 1 48  ? -4.479  29.869 236.840 1.00 59.55  ? 67  LYS B C   1 
ATOM   2001 O  O   . LYS B 1 48  ? -4.098  28.992 236.070 1.00 60.12  ? 67  LYS B O   1 
ATOM   2002 C  CB  . LYS B 1 48  ? -6.279  31.156 235.552 1.00 60.78  ? 67  LYS B CB  1 
ATOM   2003 C  CG  . LYS B 1 48  ? -7.738  31.628 235.442 1.00 56.85  ? 67  LYS B CG  1 
ATOM   2004 C  CD  . LYS B 1 48  ? -8.768  30.512 235.587 1.00 54.24  ? 67  LYS B CD  1 
ATOM   2005 C  CE  . LYS B 1 48  ? -10.182 31.029 235.397 1.00 53.09  ? 67  LYS B CE  1 
ATOM   2006 N  NZ  . LYS B 1 48  ? -10.562 32.191 236.263 1.00 55.26  ? 67  LYS B NZ  1 
ATOM   2007 N  N   . ASN B 1 49  ? -3.669  30.459 237.722 1.00 65.26  ? 68  ASN B N   1 
ATOM   2008 C  CA  . ASN B 1 49  ? -2.264  30.044 237.909 1.00 69.98  ? 68  ASN B CA  1 
ATOM   2009 C  C   . ASN B 1 49  ? -2.067  28.891 238.925 1.00 72.99  ? 68  ASN B C   1 
ATOM   2010 O  O   . ASN B 1 49  ? -0.928  28.455 239.122 1.00 72.37  ? 68  ASN B O   1 
ATOM   2011 C  CB  . ASN B 1 49  ? -1.400  31.255 238.293 1.00 70.75  ? 68  ASN B CB  1 
ATOM   2012 C  CG  . ASN B 1 49  ? -1.317  32.293 237.185 1.00 71.68  ? 68  ASN B CG  1 
ATOM   2013 O  OD1 . ASN B 1 49  ? -1.295  31.961 236.003 1.00 79.10  ? 68  ASN B OD1 1 
ATOM   2014 N  ND2 . ASN B 1 49  ? -1.233  33.556 237.567 1.00 74.77  ? 68  ASN B ND2 1 
ATOM   2015 N  N   . SER B 1 50  ? -3.149  28.393 239.549 1.00 67.85  ? 69  SER B N   1 
ATOM   2016 C  CA  . SER B 1 50  ? -3.062  27.298 240.538 1.00 65.82  ? 69  SER B CA  1 
ATOM   2017 C  C   . SER B 1 50  ? -3.079  25.935 239.842 1.00 62.22  ? 69  SER B C   1 
ATOM   2018 O  O   . SER B 1 50  ? -3.540  25.818 238.710 1.00 60.83  ? 69  SER B O   1 
ATOM   2019 C  CB  . SER B 1 50  ? -4.194  27.393 241.572 1.00 65.51  ? 69  SER B CB  1 
ATOM   2020 O  OG  . SER B 1 50  ? -5.467  27.150 240.992 1.00 58.52  ? 69  SER B OG  1 
ATOM   2021 N  N   . GLU B 1 51  ? -2.602  24.898 240.530 1.00 65.24  ? 70  GLU B N   1 
ATOM   2022 C  CA  . GLU B 1 51  ? -2.559  23.538 239.938 1.00 68.03  ? 70  GLU B CA  1 
ATOM   2023 C  C   . GLU B 1 51  ? -3.977  22.965 239.763 1.00 63.14  ? 70  GLU B C   1 
ATOM   2024 O  O   . GLU B 1 51  ? -4.245  22.260 238.789 1.00 68.48  ? 70  GLU B O   1 
ATOM   2025 C  CB  . GLU B 1 51  ? -1.682  22.573 240.754 1.00 80.41  ? 70  GLU B CB  1 
ATOM   2026 C  CG  . GLU B 1 51  ? -0.315  23.110 241.207 1.00 97.05  ? 70  GLU B CG  1 
ATOM   2027 C  CD  . GLU B 1 51  ? 0.549   23.733 240.109 1.00 97.07  ? 70  GLU B CD  1 
ATOM   2028 O  OE1 . GLU B 1 51  ? 0.435   23.346 238.928 1.00 92.42  ? 70  GLU B OE1 1 
ATOM   2029 O  OE2 . GLU B 1 51  ? 1.375   24.615 240.446 1.00 100.74 ? 70  GLU B OE2 1 
ATOM   2030 N  N   . ILE B 1 52  ? -4.882  23.295 240.685 1.00 58.00  ? 71  ILE B N   1 
ATOM   2031 C  CA  . ILE B 1 52  ? -6.290  22.841 240.622 1.00 56.67  ? 71  ILE B CA  1 
ATOM   2032 C  C   . ILE B 1 52  ? -7.030  23.315 239.340 1.00 52.37  ? 71  ILE B C   1 
ATOM   2033 O  O   . ILE B 1 52  ? -7.820  22.567 238.788 1.00 56.72  ? 71  ILE B O   1 
ATOM   2034 C  CB  . ILE B 1 52  ? -7.057  23.277 241.894 1.00 54.79  ? 71  ILE B CB  1 
ATOM   2035 C  CG1 . ILE B 1 52  ? -8.375  22.512 242.101 1.00 63.90  ? 71  ILE B CG1 1 
ATOM   2036 C  CG2 . ILE B 1 52  ? -7.290  24.783 241.917 1.00 54.44  ? 71  ILE B CG2 1 
ATOM   2037 C  CD1 . ILE B 1 52  ? -8.210  21.052 242.423 1.00 72.76  ? 71  ILE B CD1 1 
ATOM   2038 N  N   . SER B 1 53  ? -6.757  24.546 238.897 1.00 52.76  ? 72  SER B N   1 
ATOM   2039 C  CA  . SER B 1 53  ? -7.361  25.192 237.704 1.00 58.87  ? 72  SER B CA  1 
ATOM   2040 C  C   . SER B 1 53  ? -7.605  24.269 236.510 1.00 56.58  ? 72  SER B C   1 
ATOM   2041 O  O   . SER B 1 53  ? -8.711  24.226 235.936 1.00 48.94  ? 72  SER B O   1 
ATOM   2042 C  CB  . SER B 1 53  ? -6.441  26.330 237.228 1.00 65.01  ? 72  SER B CB  1 
ATOM   2043 O  OG  . SER B 1 53  ? -6.985  27.021 236.129 1.00 90.81  ? 72  SER B OG  1 
ATOM   2044 N  N   . SER B 1 54  ? -6.563  23.528 236.164 1.00 52.26  ? 73  SER B N   1 
ATOM   2045 C  CA  . SER B 1 54  ? -6.598  22.595 235.028 1.00 56.91  ? 73  SER B CA  1 
ATOM   2046 C  C   . SER B 1 54  ? -7.538  21.440 235.250 1.00 54.17  ? 73  SER B C   1 
ATOM   2047 O  O   . SER B 1 54  ? -8.188  20.994 234.308 1.00 50.71  ? 73  SER B O   1 
ATOM   2048 C  CB  . SER B 1 54  ? -5.203  22.041 234.749 1.00 58.78  ? 73  SER B CB  1 
ATOM   2049 O  OG  . SER B 1 54  ? -4.313  23.103 234.526 1.00 75.65  ? 73  SER B OG  1 
ATOM   2050 N  N   . LYS B 1 55  ? -7.579  20.914 236.475 1.00 48.33  ? 74  LYS B N   1 
ATOM   2051 C  CA  . LYS B 1 55  ? -8.486  19.804 236.774 1.00 51.69  ? 74  LYS B CA  1 
ATOM   2052 C  C   . LYS B 1 55  ? -9.954  20.265 236.667 1.00 47.35  ? 74  LYS B C   1 
ATOM   2053 O  O   . LYS B 1 55  ? -10.781 19.539 236.140 1.00 48.40  ? 74  LYS B O   1 
ATOM   2054 C  CB  . LYS B 1 55  ? -8.183  19.194 238.143 1.00 61.55  ? 74  LYS B CB  1 
ATOM   2055 C  CG  . LYS B 1 55  ? -6.814  18.525 238.192 1.00 78.08  ? 74  LYS B CG  1 
ATOM   2056 C  CD  . LYS B 1 55  ? -6.522  17.886 239.544 1.00 102.81 ? 74  LYS B CD  1 
ATOM   2057 C  CE  . LYS B 1 55  ? -5.195  17.136 239.557 1.00 105.54 ? 74  LYS B CE  1 
ATOM   2058 N  NZ  . LYS B 1 55  ? -5.190  15.984 238.610 1.00 106.59 ? 74  LYS B NZ  1 
ATOM   2059 N  N   . LEU B 1 56  ? -10.247 21.483 237.121 1.00 46.20  ? 75  LEU B N   1 
ATOM   2060 C  CA  . LEU B 1 56  ? -11.607 22.034 237.051 1.00 50.64  ? 75  LEU B CA  1 
ATOM   2061 C  C   . LEU B 1 56  ? -12.025 22.338 235.592 1.00 46.98  ? 75  LEU B C   1 
ATOM   2062 O  O   . LEU B 1 56  ? -13.158 22.068 235.200 1.00 48.76  ? 75  LEU B O   1 
ATOM   2063 C  CB  . LEU B 1 56  ? -11.730 23.279 237.915 1.00 46.39  ? 75  LEU B CB  1 
ATOM   2064 C  CG  . LEU B 1 56  ? -11.348 23.111 239.391 1.00 48.02  ? 75  LEU B CG  1 
ATOM   2065 C  CD1 . LEU B 1 56  ? -11.674 24.406 240.113 1.00 44.62  ? 75  LEU B CD1 1 
ATOM   2066 C  CD2 . LEU B 1 56  ? -12.048 21.928 240.077 1.00 46.70  ? 75  LEU B CD2 1 
ATOM   2067 N  N   . ALA B 1 57  ? -11.104 22.880 234.803 1.00 45.80  ? 76  ALA B N   1 
ATOM   2068 C  CA  . ALA B 1 57  ? -11.366 23.157 233.393 1.00 47.65  ? 76  ALA B CA  1 
ATOM   2069 C  C   . ALA B 1 57  ? -11.691 21.858 232.638 1.00 47.96  ? 76  ALA B C   1 
ATOM   2070 O  O   . ALA B 1 57  ? -12.582 21.855 231.820 1.00 47.00  ? 76  ALA B O   1 
ATOM   2071 C  CB  . ALA B 1 57  ? -10.191 23.866 232.754 1.00 45.32  ? 76  ALA B CB  1 
ATOM   2072 N  N   . THR B 1 58  ? -11.000 20.764 232.972 1.00 51.27  ? 77  THR B N   1 
ATOM   2073 C  CA  . THR B 1 58  ? -11.208 19.449 232.340 1.00 50.63  ? 77  THR B CA  1 
ATOM   2074 C  C   . THR B 1 58  ? -12.575 18.879 232.670 1.00 49.70  ? 77  THR B C   1 
ATOM   2075 O  O   . THR B 1 58  ? -13.198 18.261 231.816 1.00 48.42  ? 77  THR B O   1 
ATOM   2076 C  CB  . THR B 1 58  ? -10.132 18.420 232.776 1.00 54.84  ? 77  THR B CB  1 
ATOM   2077 O  OG1 . THR B 1 58  ? -8.833  18.987 232.615 1.00 55.97  ? 77  THR B OG1 1 
ATOM   2078 C  CG2 . THR B 1 58  ? -10.218 17.149 231.953 1.00 44.18  ? 77  THR B CG2 1 
ATOM   2079 N  N   . GLU B 1 59  ? -13.027 19.062 233.913 1.00 48.88  ? 78  GLU B N   1 
ATOM   2080 C  CA  . GLU B 1 59  ? -14.349 18.596 234.313 1.00 51.63  ? 78  GLU B CA  1 
ATOM   2081 C  C   . GLU B 1 59  ? -15.448 19.345 233.509 1.00 49.51  ? 78  GLU B C   1 
ATOM   2082 O  O   . GLU B 1 59  ? -16.408 18.730 233.103 1.00 49.09  ? 78  GLU B O   1 
ATOM   2083 C  CB  . GLU B 1 59  ? -14.576 18.741 235.828 1.00 53.83  ? 78  GLU B CB  1 
ATOM   2084 C  CG  . GLU B 1 59  ? -13.646 17.920 236.731 1.00 63.28  ? 78  GLU B CG  1 
ATOM   2085 C  CD  . GLU B 1 59  ? -13.780 16.403 236.602 1.00 68.47  ? 78  GLU B CD  1 
ATOM   2086 O  OE1 . GLU B 1 59  ? -14.742 15.923 235.980 1.00 74.61  ? 78  GLU B OE1 1 
ATOM   2087 O  OE2 . GLU B 1 59  ? -12.920 15.672 237.152 1.00 71.82  ? 78  GLU B OE2 1 
ATOM   2088 N  N   . LEU B 1 60  ? -15.286 20.650 233.277 1.00 44.81  ? 79  LEU B N   1 
ATOM   2089 C  CA  . LEU B 1 60  ? -16.257 21.434 232.508 1.00 44.56  ? 79  LEU B CA  1 
ATOM   2090 C  C   . LEU B 1 60  ? -16.245 21.020 231.034 1.00 44.91  ? 79  LEU B C   1 
ATOM   2091 O  O   . LEU B 1 60  ? -17.306 20.826 230.444 1.00 41.84  ? 79  LEU B O   1 
ATOM   2092 C  CB  . LEU B 1 60  ? -16.036 22.951 232.657 1.00 45.71  ? 79  LEU B CB  1 
ATOM   2093 C  CG  . LEU B 1 60  ? -16.524 23.567 233.974 1.00 45.49  ? 79  LEU B CG  1 
ATOM   2094 C  CD1 . LEU B 1 60  ? -15.916 24.940 234.195 1.00 51.07  ? 79  LEU B CD1 1 
ATOM   2095 C  CD2 . LEU B 1 60  ? -18.059 23.612 234.027 1.00 43.53  ? 79  LEU B CD2 1 
ATOM   2096 N  N   . ALA B 1 61  ? -15.055 20.844 230.470 1.00 41.57  ? 80  ALA B N   1 
ATOM   2097 C  CA  . ALA B 1 61  ? -14.918 20.427 229.066 1.00 48.64  ? 80  ALA B CA  1 
ATOM   2098 C  C   . ALA B 1 61  ? -15.623 19.090 228.810 1.00 46.95  ? 80  ALA B C   1 
ATOM   2099 O  O   . ALA B 1 61  ? -16.373 18.945 227.846 1.00 50.41  ? 80  ALA B O   1 
ATOM   2100 C  CB  . ALA B 1 61  ? -13.443 20.333 228.670 1.00 47.52  ? 80  ALA B CB  1 
ATOM   2101 N  N   . LEU B 1 62  ? -15.423 18.150 229.721 1.00 50.00  ? 81  LEU B N   1 
ATOM   2102 C  CA  . LEU B 1 62  ? -16.003 16.827 229.615 1.00 50.01  ? 81  LEU B CA  1 
ATOM   2103 C  C   . LEU B 1 62  ? -17.532 16.866 229.711 1.00 49.12  ? 81  LEU B C   1 
ATOM   2104 O  O   . LEU B 1 62  ? -18.208 16.219 228.921 1.00 48.12  ? 81  LEU B O   1 
ATOM   2105 C  CB  . LEU B 1 62  ? -15.396 15.926 230.687 1.00 55.69  ? 81  LEU B CB  1 
ATOM   2106 C  CG  . LEU B 1 62  ? -15.600 14.420 230.681 1.00 69.46  ? 81  LEU B CG  1 
ATOM   2107 C  CD1 . LEU B 1 62  ? -14.998 13.779 229.438 1.00 66.18  ? 81  LEU B CD1 1 
ATOM   2108 C  CD2 . LEU B 1 62  ? -14.931 13.863 231.934 1.00 78.98  ? 81  LEU B CD2 1 
ATOM   2109 N  N   . ALA B 1 63  ? -18.065 17.668 230.633 1.00 49.35  ? 82  ALA B N   1 
ATOM   2110 C  CA  . ALA B 1 63  ? -19.518 17.784 230.838 1.00 47.39  ? 82  ALA B CA  1 
ATOM   2111 C  C   . ALA B 1 63  ? -20.222 18.469 229.662 1.00 45.77  ? 82  ALA B C   1 
ATOM   2112 O  O   . ALA B 1 63  ? -21.323 18.059 229.281 1.00 50.71  ? 82  ALA B O   1 
ATOM   2113 C  CB  . ALA B 1 63  ? -19.826 18.494 232.155 1.00 44.77  ? 82  ALA B CB  1 
ATOM   2114 N  N   . TYR B 1 64  ? -19.606 19.507 229.103 1.00 43.58  ? 83  TYR B N   1 
ATOM   2115 C  CA  . TYR B 1 64  ? -20.165 20.187 227.927 1.00 46.34  ? 83  TYR B CA  1 
ATOM   2116 C  C   . TYR B 1 64  ? -20.184 19.272 226.693 1.00 47.48  ? 83  TYR B C   1 
ATOM   2117 O  O   . TYR B 1 64  ? -21.130 19.345 225.905 1.00 49.85  ? 83  TYR B O   1 
ATOM   2118 C  CB  . TYR B 1 64  ? -19.474 21.531 227.625 1.00 47.09  ? 83  TYR B CB  1 
ATOM   2119 C  CG  . TYR B 1 64  ? -19.922 22.674 228.529 1.00 46.53  ? 83  TYR B CG  1 
ATOM   2120 C  CD1 . TYR B 1 64  ? -21.257 23.076 228.543 1.00 48.94  ? 83  TYR B CD1 1 
ATOM   2121 C  CD2 . TYR B 1 64  ? -19.012 23.391 229.316 1.00 47.83  ? 83  TYR B CD2 1 
ATOM   2122 C  CE1 . TYR B 1 64  ? -21.687 24.133 229.324 1.00 51.14  ? 83  TYR B CE1 1 
ATOM   2123 C  CE2 . TYR B 1 64  ? -19.435 24.458 230.109 1.00 53.12  ? 83  TYR B CE2 1 
ATOM   2124 C  CZ  . TYR B 1 64  ? -20.778 24.822 230.098 1.00 54.53  ? 83  TYR B CZ  1 
ATOM   2125 O  OH  . TYR B 1 64  ? -21.247 25.847 230.865 1.00 59.53  ? 83  TYR B OH  1 
ATOM   2126 N  N   . LYS B 1 65  ? -19.163 18.421 226.555 1.00 45.84  ? 84  LYS B N   1 
ATOM   2127 C  CA  . LYS B 1 65  ? -19.082 17.420 225.488 1.00 48.73  ? 84  LYS B CA  1 
ATOM   2128 C  C   . LYS B 1 65  ? -20.248 16.427 225.612 1.00 50.34  ? 84  LYS B C   1 
ATOM   2129 O  O   . LYS B 1 65  ? -20.889 16.154 224.601 1.00 51.24  ? 84  LYS B O   1 
ATOM   2130 C  CB  . LYS B 1 65  ? -17.734 16.673 225.479 1.00 52.45  ? 84  LYS B CB  1 
ATOM   2131 C  CG  . LYS B 1 65  ? -17.657 15.477 224.527 1.00 59.27  ? 84  LYS B CG  1 
ATOM   2132 C  CD  . LYS B 1 65  ? -16.244 14.907 224.387 1.00 69.30  ? 84  LYS B CD  1 
ATOM   2133 C  CE  . LYS B 1 65  ? -15.782 14.150 225.612 1.00 72.43  ? 84  LYS B CE  1 
ATOM   2134 N  NZ  . LYS B 1 65  ? -14.403 13.608 225.447 1.00 83.45  ? 84  LYS B NZ  1 
ATOM   2135 N  N   . LYS B 1 66  ? -20.521 15.903 226.819 1.00 51.18  ? 85  LYS B N   1 
ATOM   2136 C  CA  . LYS B 1 66  ? -21.662 14.988 227.005 1.00 54.97  ? 85  LYS B CA  1 
ATOM   2137 C  C   . LYS B 1 66  ? -23.007 15.646 226.677 1.00 55.28  ? 85  LYS B C   1 
ATOM   2138 O  O   . LYS B 1 66  ? -23.924 14.970 226.210 1.00 55.29  ? 85  LYS B O   1 
ATOM   2139 C  CB  . LYS B 1 66  ? -21.808 14.429 228.425 1.00 67.31  ? 85  LYS B CB  1 
ATOM   2140 C  CG  . LYS B 1 66  ? -20.990 13.216 228.825 1.00 79.72  ? 85  LYS B CG  1 
ATOM   2141 C  CD  . LYS B 1 66  ? -19.803 13.512 229.720 1.00 87.64  ? 85  LYS B CD  1 
ATOM   2142 C  CE  . LYS B 1 66  ? -19.511 12.294 230.577 1.00 81.54  ? 85  LYS B CE  1 
ATOM   2143 N  NZ  . LYS B 1 66  ? -18.560 12.640 231.652 1.00 83.11  ? 85  LYS B NZ  1 
ATOM   2144 N  N   . ASN B 1 67  ? -23.132 16.936 227.001 1.00 54.25  ? 86  ASN B N   1 
ATOM   2145 C  CA  . ASN B 1 67  ? -24.342 17.731 226.714 1.00 51.02  ? 86  ASN B CA  1 
ATOM   2146 C  C   . ASN B 1 67  ? -24.498 18.068 225.215 1.00 47.57  ? 86  ASN B C   1 
ATOM   2147 O  O   . ASN B 1 67  ? -25.537 18.504 224.796 1.00 48.98  ? 86  ASN B O   1 
ATOM   2148 C  CB  . ASN B 1 67  ? -24.319 19.066 227.499 1.00 51.39  ? 86  ASN B CB  1 
ATOM   2149 C  CG  . ASN B 1 67  ? -24.440 18.889 229.006 1.00 56.42  ? 86  ASN B CG  1 
ATOM   2150 O  OD1 . ASN B 1 67  ? -24.653 17.797 229.514 1.00 62.07  ? 86  ASN B OD1 1 
ATOM   2151 N  ND2 . ASN B 1 67  ? -24.310 19.990 229.724 1.00 59.00  ? 86  ASN B ND2 1 
ATOM   2152 N  N   . ARG B 1 68  ? -23.457 17.848 224.431 1.00 48.60  ? 87  ARG B N   1 
ATOM   2153 C  CA  . ARG B 1 68  ? -23.399 18.166 223.022 1.00 49.86  ? 87  ARG B CA  1 
ATOM   2154 C  C   . ARG B 1 68  ? -23.389 19.684 222.806 1.00 52.25  ? 87  ARG B C   1 
ATOM   2155 O  O   . ARG B 1 68  ? -23.902 20.165 221.793 1.00 52.16  ? 87  ARG B O   1 
ATOM   2156 C  CB  . ARG B 1 68  ? -24.462 17.419 222.188 1.00 56.79  ? 87  ARG B CB  1 
ATOM   2157 C  CG  . ARG B 1 68  ? -24.383 15.919 222.374 1.00 55.99  ? 87  ARG B CG  1 
ATOM   2158 C  CD  . ARG B 1 68  ? -25.247 15.206 221.377 1.00 59.71  ? 87  ARG B CD  1 
ATOM   2159 N  NE  . ARG B 1 68  ? -25.103 13.756 221.459 1.00 61.29  ? 87  ARG B NE  1 
ATOM   2160 C  CZ  . ARG B 1 68  ? -25.762 12.948 222.293 1.00 64.38  ? 87  ARG B CZ  1 
ATOM   2161 N  NH1 . ARG B 1 68  ? -26.626 13.411 223.210 1.00 65.48  ? 87  ARG B NH1 1 
ATOM   2162 N  NH2 . ARG B 1 68  ? -25.521 11.642 222.233 1.00 67.86  ? 87  ARG B NH2 1 
ATOM   2163 N  N   . ASN B 1 69  ? -22.801 20.413 223.769 1.00 50.22  ? 88  ASN B N   1 
ATOM   2164 C  CA  . ASN B 1 69  ? -22.596 21.851 223.679 1.00 53.05  ? 88  ASN B CA  1 
ATOM   2165 C  C   . ASN B 1 69  ? -21.143 21.883 223.240 1.00 52.17  ? 88  ASN B C   1 
ATOM   2166 O  O   . ASN B 1 69  ? -20.232 22.060 224.048 1.00 49.54  ? 88  ASN B O   1 
ATOM   2167 C  CB  . ASN B 1 69  ? -22.801 22.577 225.024 1.00 51.45  ? 88  ASN B CB  1 
ATOM   2168 C  CG  . ASN B 1 69  ? -22.810 24.097 224.870 1.00 55.10  ? 88  ASN B CG  1 
ATOM   2169 O  OD1 . ASN B 1 69  ? -22.384 24.650 223.846 1.00 50.41  ? 88  ASN B OD1 1 
ATOM   2170 N  ND2 . ASN B 1 69  ? -23.308 24.775 225.879 1.00 53.03  ? 88  ASN B ND2 1 
ATOM   2171 N  N   . TYR B 1 70  ? -20.942 21.667 221.947 1.00 49.97  ? 89  TYR B N   1 
ATOM   2172 C  CA  . TYR B 1 70  ? -19.609 21.581 221.387 1.00 52.26  ? 89  TYR B CA  1 
ATOM   2173 C  C   . TYR B 1 70  ? -18.866 22.921 221.433 1.00 50.09  ? 89  TYR B C   1 
ATOM   2174 O  O   . TYR B 1 70  ? -17.656 22.912 221.591 1.00 47.23  ? 89  TYR B O   1 
ATOM   2175 C  CB  . TYR B 1 70  ? -19.620 20.949 219.986 1.00 52.77  ? 89  TYR B CB  1 
ATOM   2176 C  CG  . TYR B 1 70  ? -20.321 19.592 219.945 1.00 54.13  ? 89  TYR B CG  1 
ATOM   2177 C  CD1 . TYR B 1 70  ? -19.844 18.518 220.697 1.00 51.91  ? 89  TYR B CD1 1 
ATOM   2178 C  CD2 . TYR B 1 70  ? -21.452 19.376 219.131 1.00 56.46  ? 89  TYR B CD2 1 
ATOM   2179 C  CE1 . TYR B 1 70  ? -20.478 17.276 220.678 1.00 52.77  ? 89  TYR B CE1 1 
ATOM   2180 C  CE2 . TYR B 1 70  ? -22.084 18.130 219.100 1.00 58.45  ? 89  TYR B CE2 1 
ATOM   2181 C  CZ  . TYR B 1 70  ? -21.594 17.088 219.883 1.00 58.96  ? 89  TYR B CZ  1 
ATOM   2182 O  OH  . TYR B 1 70  ? -22.196 15.856 219.873 1.00 64.63  ? 89  TYR B OH  1 
ATOM   2183 N  N   . ASP B 1 71  ? -19.588 24.042 221.313 1.00 51.96  ? 90  ASP B N   1 
ATOM   2184 C  CA  . ASP B 1 71  ? -19.001 25.395 221.422 1.00 52.15  ? 90  ASP B CA  1 
ATOM   2185 C  C   . ASP B 1 71  ? -18.318 25.585 222.786 1.00 49.86  ? 90  ASP B C   1 
ATOM   2186 O  O   . ASP B 1 71  ? -17.179 26.001 222.848 1.00 54.42  ? 90  ASP B O   1 
ATOM   2187 C  CB  . ASP B 1 71  ? -20.057 26.500 221.181 1.00 55.87  ? 90  ASP B CB  1 
ATOM   2188 C  CG  . ASP B 1 71  ? -20.561 26.553 219.735 1.00 62.94  ? 90  ASP B CG  1 
ATOM   2189 O  OD1 . ASP B 1 71  ? -19.912 25.981 218.843 1.00 68.80  ? 90  ASP B OD1 1 
ATOM   2190 O  OD2 . ASP B 1 71  ? -21.629 27.166 219.475 1.00 72.47  ? 90  ASP B OD2 1 
ATOM   2191 N  N   . LYS B 1 72  ? -19.008 25.230 223.861 1.00 52.88  ? 91  LYS B N   1 
ATOM   2192 C  CA  . LYS B 1 72  ? -18.451 25.309 225.212 1.00 49.13  ? 91  LYS B CA  1 
ATOM   2193 C  C   . LYS B 1 72  ? -17.376 24.252 225.484 1.00 52.23  ? 91  LYS B C   1 
ATOM   2194 O  O   . LYS B 1 72  ? -16.406 24.542 226.187 1.00 45.59  ? 91  LYS B O   1 
ATOM   2195 C  CB  . LYS B 1 72  ? -19.551 25.209 226.248 1.00 51.90  ? 91  LYS B CB  1 
ATOM   2196 C  CG  . LYS B 1 72  ? -20.472 26.427 226.309 1.00 55.01  ? 91  LYS B CG  1 
ATOM   2197 C  CD  . LYS B 1 72  ? -19.769 27.590 227.002 1.00 63.34  ? 91  LYS B CD  1 
ATOM   2198 C  CE  . LYS B 1 72  ? -20.707 28.735 227.318 1.00 66.67  ? 91  LYS B CE  1 
ATOM   2199 N  NZ  . LYS B 1 72  ? -19.912 29.826 227.939 1.00 71.65  ? 91  LYS B NZ  1 
ATOM   2200 N  N   . ALA B 1 73  ? -17.532 23.039 224.940 1.00 48.09  ? 92  ALA B N   1 
ATOM   2201 C  CA  . ALA B 1 73  ? -16.523 21.963 225.125 1.00 50.87  ? 92  ALA B CA  1 
ATOM   2202 C  C   . ALA B 1 73  ? -15.191 22.440 224.543 1.00 48.18  ? 92  ALA B C   1 
ATOM   2203 O  O   . ALA B 1 73  ? -14.137 22.328 225.179 1.00 48.97  ? 92  ALA B O   1 
ATOM   2204 C  CB  . ALA B 1 73  ? -16.960 20.663 224.451 1.00 44.79  ? 92  ALA B CB  1 
ATOM   2205 N  N   . TYR B 1 74  ? -15.286 23.003 223.341 1.00 51.27  ? 93  TYR B N   1 
ATOM   2206 C  CA  . TYR B 1 74  ? -14.164 23.572 222.632 1.00 50.94  ? 93  TYR B CA  1 
ATOM   2207 C  C   . TYR B 1 74  ? -13.507 24.672 223.455 1.00 53.37  ? 93  TYR B C   1 
ATOM   2208 O  O   . TYR B 1 74  ? -12.282 24.651 223.642 1.00 52.07  ? 93  TYR B O   1 
ATOM   2209 C  CB  . TYR B 1 74  ? -14.609 24.070 221.244 1.00 50.71  ? 93  TYR B CB  1 
ATOM   2210 C  CG  . TYR B 1 74  ? -13.552 24.839 220.512 1.00 53.22  ? 93  TYR B CG  1 
ATOM   2211 C  CD1 . TYR B 1 74  ? -12.407 24.200 220.025 1.00 60.32  ? 93  TYR B CD1 1 
ATOM   2212 C  CD2 . TYR B 1 74  ? -13.687 26.216 220.286 1.00 62.19  ? 93  TYR B CD2 1 
ATOM   2213 C  CE1 . TYR B 1 74  ? -11.422 24.917 219.341 1.00 62.14  ? 93  TYR B CE1 1 
ATOM   2214 C  CE2 . TYR B 1 74  ? -12.704 26.940 219.607 1.00 61.48  ? 93  TYR B CE2 1 
ATOM   2215 C  CZ  . TYR B 1 74  ? -11.571 26.282 219.144 1.00 64.29  ? 93  TYR B CZ  1 
ATOM   2216 O  OH  . TYR B 1 74  ? -10.592 26.974 218.478 1.00 81.81  ? 93  TYR B OH  1 
ATOM   2217 N  N   . LEU B 1 75  ? -14.317 25.596 223.981 1.00 57.50  ? 94  LEU B N   1 
ATOM   2218 C  CA  . LEU B 1 75  ? -13.814 26.715 224.810 1.00 53.20  ? 94  LEU B CA  1 
ATOM   2219 C  C   . LEU B 1 75  ? -12.935 26.215 225.959 1.00 52.51  ? 94  LEU B C   1 
ATOM   2220 O  O   . LEU B 1 75  ? -11.823 26.710 226.153 1.00 52.81  ? 94  LEU B O   1 
ATOM   2221 C  CB  . LEU B 1 75  ? -14.975 27.551 225.353 1.00 58.02  ? 94  LEU B CB  1 
ATOM   2222 C  CG  . LEU B 1 75  ? -14.701 28.813 226.178 1.00 60.04  ? 94  LEU B CG  1 
ATOM   2223 C  CD1 . LEU B 1 75  ? -14.003 29.847 225.310 1.00 60.86  ? 94  LEU B CD1 1 
ATOM   2224 C  CD2 . LEU B 1 75  ? -16.018 29.368 226.714 1.00 59.58  ? 94  LEU B CD2 1 
ATOM   2225 N  N   . PHE B 1 76  ? -13.406 25.200 226.677 1.00 57.20  ? 95  PHE B N   1 
ATOM   2226 C  CA  . PHE B 1 76  ? -12.641 24.641 227.803 1.00 52.54  ? 95  PHE B CA  1 
ATOM   2227 C  C   . PHE B 1 76  ? -11.443 23.798 227.436 1.00 59.72  ? 95  PHE B C   1 
ATOM   2228 O  O   . PHE B 1 76  ? -10.447 23.839 228.167 1.00 55.51  ? 95  PHE B O   1 
ATOM   2229 C  CB  . PHE B 1 76  ? -13.535 23.995 228.841 1.00 49.22  ? 95  PHE B CB  1 
ATOM   2230 C  CG  . PHE B 1 76  ? -14.223 25.009 229.670 1.00 52.32  ? 95  PHE B CG  1 
ATOM   2231 C  CD1 . PHE B 1 76  ? -13.547 25.575 230.741 1.00 55.02  ? 95  PHE B CD1 1 
ATOM   2232 C  CD2 . PHE B 1 76  ? -15.488 25.484 229.339 1.00 53.14  ? 95  PHE B CD2 1 
ATOM   2233 C  CE1 . PHE B 1 76  ? -14.129 26.566 231.495 1.00 53.44  ? 95  PHE B CE1 1 
ATOM   2234 C  CE2 . PHE B 1 76  ? -16.088 26.469 230.111 1.00 50.05  ? 95  PHE B CE2 1 
ATOM   2235 C  CZ  . PHE B 1 76  ? -15.399 27.011 231.185 1.00 54.67  ? 95  PHE B CZ  1 
ATOM   2236 N  N   . TYR B 1 77  ? -11.519 23.045 226.333 1.00 58.75  ? 96  TYR B N   1 
ATOM   2237 C  CA  . TYR B 1 77  ? -10.347 22.295 225.885 1.00 54.60  ? 96  TYR B CA  1 
ATOM   2238 C  C   . TYR B 1 77  ? -9.273  23.274 225.375 1.00 55.73  ? 96  TYR B C   1 
ATOM   2239 O  O   . TYR B 1 77  ? -8.085  23.004 225.529 1.00 53.90  ? 96  TYR B O   1 
ATOM   2240 C  CB  . TYR B 1 77  ? -10.680 21.195 224.867 1.00 52.58  ? 96  TYR B CB  1 
ATOM   2241 C  CG  . TYR B 1 77  ? -11.342 19.968 225.468 1.00 48.62  ? 96  TYR B CG  1 
ATOM   2242 C  CD1 . TYR B 1 77  ? -10.682 19.198 226.433 1.00 47.32  ? 96  TYR B CD1 1 
ATOM   2243 C  CD2 . TYR B 1 77  ? -12.583 19.507 224.996 1.00 52.70  ? 96  TYR B CD2 1 
ATOM   2244 C  CE1 . TYR B 1 77  ? -11.264 18.045 226.960 1.00 46.63  ? 96  TYR B CE1 1 
ATOM   2245 C  CE2 . TYR B 1 77  ? -13.169 18.343 225.505 1.00 47.61  ? 96  TYR B CE2 1 
ATOM   2246 C  CZ  . TYR B 1 77  ? -12.518 17.628 226.493 1.00 49.82  ? 96  TYR B CZ  1 
ATOM   2247 O  OH  . TYR B 1 77  ? -13.112 16.501 227.008 1.00 54.14  ? 96  TYR B OH  1 
ATOM   2248 N  N   . LYS B 1 78  ? -9.696  24.404 224.800 1.00 53.79  ? 97  LYS B N   1 
ATOM   2249 C  CA  . LYS B 1 78  ? -8.780  25.457 224.344 1.00 58.86  ? 97  LYS B CA  1 
ATOM   2250 C  C   . LYS B 1 78  ? -8.066  26.110 225.564 1.00 61.22  ? 97  LYS B C   1 
ATOM   2251 O  O   . LYS B 1 78  ? -6.869  26.376 225.488 1.00 63.38  ? 97  LYS B O   1 
ATOM   2252 C  CB  . LYS B 1 78  ? -9.513  26.470 223.454 1.00 57.81  ? 97  LYS B CB  1 
ATOM   2253 C  CG  . LYS B 1 78  ? -8.636  27.461 222.718 1.00 69.48  ? 97  LYS B CG  1 
ATOM   2254 C  CD  . LYS B 1 78  ? -9.458  28.322 221.762 1.00 74.54  ? 97  LYS B CD  1 
ATOM   2255 N  N   . GLU B 1 79  ? -8.783  26.339 226.675 1.00 65.51  ? 98  GLU B N   1 
ATOM   2256 C  CA  . GLU B 1 79  ? -8.172  26.855 227.931 1.00 66.61  ? 98  GLU B CA  1 
ATOM   2257 C  C   . GLU B 1 79  ? -7.073  25.910 228.454 1.00 64.98  ? 98  GLU B C   1 
ATOM   2258 O  O   . GLU B 1 79  ? -6.057  26.363 228.946 1.00 65.77  ? 98  GLU B O   1 
ATOM   2259 C  CB  . GLU B 1 79  ? -9.217  27.075 229.037 1.00 67.68  ? 98  GLU B CB  1 
ATOM   2260 C  CG  . GLU B 1 79  ? -10.131 28.267 228.791 1.00 87.25  ? 98  GLU B CG  1 
ATOM   2261 N  N   . LEU B 1 80  ? -7.297  24.601 228.361 1.00 60.03  ? 99  LEU B N   1 
ATOM   2262 C  CA  . LEU B 1 80  ? -6.298  23.596 228.777 1.00 54.25  ? 99  LEU B CA  1 
ATOM   2263 C  C   . LEU B 1 80  ? -5.096  23.611 227.843 1.00 54.64  ? 99  LEU B C   1 
ATOM   2264 O  O   . LEU B 1 80  ? -3.949  23.565 228.300 1.00 58.22  ? 99  LEU B O   1 
ATOM   2265 C  CB  . LEU B 1 80  ? -6.925  22.205 228.799 1.00 58.62  ? 99  LEU B CB  1 
ATOM   2266 C  CG  . LEU B 1 80  ? -7.927  22.009 229.933 1.00 62.67  ? 99  LEU B CG  1 
ATOM   2267 C  CD1 . LEU B 1 80  ? -8.862  20.851 229.616 1.00 55.07  ? 99  LEU B CD1 1 
ATOM   2268 C  CD2 . LEU B 1 80  ? -7.173  21.823 231.267 1.00 48.45  ? 99  LEU B CD2 1 
ATOM   2269 N  N   . LEU B 1 81  ? -5.387  23.704 226.540 1.00 52.84  ? 100 LEU B N   1 
ATOM   2270 C  CA  . LEU B 1 81  ? -4.390  23.759 225.507 1.00 53.86  ? 100 LEU B CA  1 
ATOM   2271 C  C   . LEU B 1 81  ? -3.459  24.966 225.630 1.00 61.05  ? 100 LEU B C   1 
ATOM   2272 O  O   . LEU B 1 81  ? -2.291  24.810 225.316 1.00 60.52  ? 100 LEU B O   1 
ATOM   2273 C  CB  . LEU B 1 81  ? -5.030  23.735 224.111 1.00 54.68  ? 100 LEU B CB  1 
ATOM   2274 C  CG  . LEU B 1 81  ? -4.122  23.625 222.882 1.00 57.83  ? 100 LEU B CG  1 
ATOM   2275 C  CD1 . LEU B 1 81  ? -3.431  22.261 222.864 1.00 54.82  ? 100 LEU B CD1 1 
ATOM   2276 C  CD2 . LEU B 1 81  ? -4.928  23.840 221.607 1.00 53.47  ? 100 LEU B CD2 1 
ATOM   2277 N  N   . GLN B 1 82  ? -3.930  26.134 226.099 1.00 67.58  ? 101 GLN B N   1 
ATOM   2278 C  CA  A GLN B 1 82  ? -3.047  27.314 226.230 0.50 67.55  ? 101 GLN B CA  1 
ATOM   2279 C  CA  B GLN B 1 82  ? -3.060  27.336 226.244 0.50 67.84  ? 101 GLN B CA  1 
ATOM   2280 C  C   . GLN B 1 82  ? -1.934  27.081 227.265 1.00 62.88  ? 101 GLN B C   1 
ATOM   2281 O  O   . GLN B 1 82  ? -0.829  27.578 227.101 1.00 69.11  ? 101 GLN B O   1 
ATOM   2282 C  CB  A GLN B 1 82  ? -3.854  28.596 226.501 0.50 74.53  ? 101 GLN B CB  1 
ATOM   2283 C  CB  B GLN B 1 82  ? -3.866  28.613 226.619 0.50 74.97  ? 101 GLN B CB  1 
ATOM   2284 C  CG  A GLN B 1 82  ? -4.665  29.043 225.288 0.50 76.69  ? 101 GLN B CG  1 
ATOM   2285 C  CG  B GLN B 1 82  ? -4.178  28.805 228.106 0.50 77.79  ? 101 GLN B CG  1 
ATOM   2286 C  CD  A GLN B 1 82  ? -5.597  30.216 225.561 0.50 82.01  ? 101 GLN B CD  1 
ATOM   2287 C  CD  B GLN B 1 82  ? -5.306  29.780 228.394 0.50 76.41  ? 101 GLN B CD  1 
ATOM   2288 O  OE1 A GLN B 1 82  ? -5.871  30.569 226.712 0.50 76.79  ? 101 GLN B OE1 1 
ATOM   2289 O  OE1 B GLN B 1 82  ? -5.647  30.638 227.575 0.50 73.37  ? 101 GLN B OE1 1 
ATOM   2290 N  NE2 A GLN B 1 82  ? -6.104  30.816 224.491 0.50 75.23  ? 101 GLN B NE2 1 
ATOM   2291 N  NE2 B GLN B 1 82  ? -5.889  29.652 229.583 0.50 67.44  ? 101 GLN B NE2 1 
ATOM   2292 N  N   . LYS B 1 83  ? -2.232  26.302 228.308 1.00 60.82  ? 102 LYS B N   1 
ATOM   2293 C  CA  . LYS B 1 83  ? -1.275  25.944 229.371 1.00 71.44  ? 102 LYS B CA  1 
ATOM   2294 C  C   . LYS B 1 83  ? -0.204  24.939 228.897 1.00 69.58  ? 102 LYS B C   1 
ATOM   2295 O  O   . LYS B 1 83  ? 0.917   24.960 229.403 1.00 69.94  ? 102 LYS B O   1 
ATOM   2296 C  CB  . LYS B 1 83  ? -2.020  25.384 230.603 1.00 78.43  ? 102 LYS B CB  1 
ATOM   2297 C  CG  . LYS B 1 83  ? -2.976  26.381 231.262 1.00 89.52  ? 102 LYS B CG  1 
ATOM   2298 C  CD  . LYS B 1 83  ? -3.996  25.707 232.176 1.00 99.55  ? 102 LYS B CD  1 
ATOM   2299 C  CE  . LYS B 1 83  ? -5.030  26.704 232.702 1.00 107.03 ? 102 LYS B CE  1 
ATOM   2300 N  NZ  . LYS B 1 83  ? -6.220  26.063 233.341 1.00 97.98  ? 102 LYS B NZ  1 
ATOM   2301 N  N   . ALA B 1 84  ? -0.560  24.072 227.940 1.00 71.99  ? 103 ALA B N   1 
ATOM   2302 C  CA  . ALA B 1 84  ? 0.345   23.059 227.358 1.00 62.33  ? 103 ALA B CA  1 
ATOM   2303 C  C   . ALA B 1 84  ? 0.076   22.954 225.832 1.00 56.93  ? 103 ALA B C   1 
ATOM   2304 O  O   . ALA B 1 84  ? -0.540  21.989 225.378 1.00 58.17  ? 103 ALA B O   1 
ATOM   2305 C  CB  . ALA B 1 84  ? 0.110   21.719 228.048 1.00 55.78  ? 103 ALA B CB  1 
ATOM   2306 N  N   . PRO B 1 85  ? 0.526   23.949 225.037 1.00 54.17  ? 104 PRO B N   1 
ATOM   2307 C  CA  . PRO B 1 85  ? 0.197   23.983 223.591 1.00 53.16  ? 104 PRO B CA  1 
ATOM   2308 C  C   . PRO B 1 85  ? 0.682   22.847 222.690 1.00 58.16  ? 104 PRO B C   1 
ATOM   2309 O  O   . PRO B 1 85  ? 0.099   22.648 221.612 1.00 59.95  ? 104 PRO B O   1 
ATOM   2310 C  CB  . PRO B 1 85  ? 0.752   25.343 223.123 1.00 58.40  ? 104 PRO B CB  1 
ATOM   2311 C  CG  . PRO B 1 85  ? 1.697   25.776 224.176 1.00 57.36  ? 104 PRO B CG  1 
ATOM   2312 C  CD  . PRO B 1 85  ? 1.248   25.160 225.457 1.00 56.85  ? 104 PRO B CD  1 
ATOM   2313 N  N   . ASN B 1 86  ? 1.717   22.128 223.126 1.00 56.06  ? 105 ASN B N   1 
ATOM   2314 C  CA  . ASN B 1 86  ? 2.308   21.015 222.395 1.00 56.27  ? 105 ASN B CA  1 
ATOM   2315 C  C   . ASN B 1 86  ? 1.923   19.655 222.993 1.00 50.89  ? 105 ASN B C   1 
ATOM   2316 O  O   . ASN B 1 86  ? 2.497   18.639 222.626 1.00 57.12  ? 105 ASN B O   1 
ATOM   2317 C  CB  . ASN B 1 86  ? 3.822   21.178 222.369 1.00 62.18  ? 105 ASN B CB  1 
ATOM   2318 C  CG  . ASN B 1 86  ? 4.257   22.490 221.748 1.00 63.11  ? 105 ASN B CG  1 
ATOM   2319 O  OD1 . ASN B 1 86  ? 4.183   22.672 220.531 1.00 65.86  ? 105 ASN B OD1 1 
ATOM   2320 N  ND2 . ASN B 1 86  ? 4.785   23.386 222.578 1.00 61.97  ? 105 ASN B ND2 1 
ATOM   2321 N  N   . ASN B 1 87  ? 0.931   19.625 223.874 1.00 49.13  ? 106 ASN B N   1 
ATOM   2322 C  CA  . ASN B 1 87  ? 0.479   18.383 224.490 1.00 53.20  ? 106 ASN B CA  1 
ATOM   2323 C  C   . ASN B 1 87  ? -0.482  17.739 223.485 1.00 50.69  ? 106 ASN B C   1 
ATOM   2324 O  O   . ASN B 1 87  ? -1.561  18.270 223.228 1.00 49.04  ? 106 ASN B O   1 
ATOM   2325 C  CB  . ASN B 1 87  ? -0.152  18.662 225.847 1.00 51.25  ? 106 ASN B CB  1 
ATOM   2326 C  CG  . ASN B 1 87  ? -0.585  17.406 226.568 1.00 53.46  ? 106 ASN B CG  1 
ATOM   2327 O  OD1 . ASN B 1 87  ? -1.223  16.531 225.998 1.00 60.92  ? 106 ASN B OD1 1 
ATOM   2328 N  ND2 . ASN B 1 87  ? -0.297  17.345 227.854 1.00 57.84  ? 106 ASN B ND2 1 
ATOM   2329 N  N   . VAL B 1 88  ? -0.068  16.607 222.918 1.00 49.94  ? 107 VAL B N   1 
ATOM   2330 C  CA  . VAL B 1 88  ? -0.866  15.888 221.890 1.00 50.83  ? 107 VAL B CA  1 
ATOM   2331 C  C   . VAL B 1 88  ? -2.263  15.456 222.366 1.00 48.37  ? 107 VAL B C   1 
ATOM   2332 O  O   . VAL B 1 88  ? -3.196  15.442 221.558 1.00 51.76  ? 107 VAL B O   1 
ATOM   2333 C  CB  . VAL B 1 88  ? -0.093  14.690 221.266 1.00 51.64  ? 107 VAL B CB  1 
ATOM   2334 C  CG1 . VAL B 1 88  ? 1.182   15.185 220.610 1.00 51.04  ? 107 VAL B CG1 1 
ATOM   2335 C  CG2 . VAL B 1 88  ? 0.238   13.604 222.301 1.00 49.35  ? 107 VAL B CG2 1 
ATOM   2336 N  N   . ASP B 1 89  ? -2.408  15.146 223.665 1.00 48.07  ? 108 ASP B N   1 
ATOM   2337 C  CA  . ASP B 1 89  ? -3.706  14.754 224.251 1.00 50.95  ? 108 ASP B CA  1 
ATOM   2338 C  C   . ASP B 1 89  ? -4.667  15.951 224.301 1.00 53.75  ? 108 ASP B C   1 
ATOM   2339 O  O   . ASP B 1 89  ? -5.857  15.794 224.036 1.00 52.83  ? 108 ASP B O   1 
ATOM   2340 C  CB  . ASP B 1 89  ? -3.557  14.149 225.667 1.00 55.58  ? 108 ASP B CB  1 
ATOM   2341 C  CG  . ASP B 1 89  ? -2.654  12.906 225.707 1.00 67.57  ? 108 ASP B CG  1 
ATOM   2342 O  OD1 . ASP B 1 89  ? -2.416  12.245 224.659 1.00 65.58  ? 108 ASP B OD1 1 
ATOM   2343 O  OD2 . ASP B 1 89  ? -2.183  12.579 226.819 1.00 81.70  ? 108 ASP B OD2 1 
HETATM 2344 N  N   . CSX B 1 90  ? -4.148  17.128 224.660 1.00 51.39  ? 109 CSX B N   1 
HETATM 2345 C  CA  . CSX B 1 90  ? -4.939  18.379 224.670 1.00 52.62  ? 109 CSX B CA  1 
HETATM 2346 C  CB  . CSX B 1 90  ? -4.160  19.502 225.369 1.00 56.33  ? 109 CSX B CB  1 
HETATM 2347 S  SG  . CSX B 1 90  ? -3.780  19.082 226.996 1.00 70.96  ? 109 CSX B SG  1 
HETATM 2348 C  C   . CSX B 1 90  ? -5.315  18.790 223.245 1.00 49.68  ? 109 CSX B C   1 
HETATM 2349 O  O   . CSX B 1 90  ? -6.419  19.269 222.994 1.00 54.75  ? 109 CSX B O   1 
HETATM 2350 O  OD  . CSX B 1 90  ? -5.086  18.923 227.699 1.00 84.78  ? 109 CSX B OD  1 
ATOM   2351 N  N   . LEU B 1 91  ? -4.393  18.629 222.302 1.00 46.98  ? 110 LEU B N   1 
ATOM   2352 C  CA  . LEU B 1 91  ? -4.675  18.929 220.877 1.00 48.77  ? 110 LEU B CA  1 
ATOM   2353 C  C   . LEU B 1 91  ? -5.807  18.015 220.317 1.00 49.62  ? 110 LEU B C   1 
ATOM   2354 O  O   . LEU B 1 91  ? -6.742  18.497 219.682 1.00 50.19  ? 110 LEU B O   1 
ATOM   2355 C  CB  . LEU B 1 91  ? -3.410  18.823 220.043 1.00 48.98  ? 110 LEU B CB  1 
ATOM   2356 C  CG  . LEU B 1 91  ? -2.367  19.954 220.146 1.00 54.15  ? 110 LEU B CG  1 
ATOM   2357 C  CD1 . LEU B 1 91  ? -1.013  19.498 219.602 1.00 51.39  ? 110 LEU B CD1 1 
ATOM   2358 C  CD2 . LEU B 1 91  ? -2.853  21.195 219.388 1.00 55.80  ? 110 LEU B CD2 1 
ATOM   2359 N  N   . GLU B 1 92  ? -5.728  16.723 220.635 1.00 50.72  ? 111 GLU B N   1 
ATOM   2360 C  CA  . GLU B 1 92  ? -6.702  15.702 220.234 1.00 49.40  ? 111 GLU B CA  1 
ATOM   2361 C  C   . GLU B 1 92  ? -8.110  16.047 220.737 1.00 48.32  ? 111 GLU B C   1 
ATOM   2362 O  O   . GLU B 1 92  ? -9.057  15.974 219.966 1.00 44.82  ? 111 GLU B O   1 
ATOM   2363 C  CB  . GLU B 1 92  ? -6.265  14.345 220.783 1.00 49.04  ? 111 GLU B CB  1 
ATOM   2364 C  CG  . GLU B 1 92  ? -7.190  13.142 220.566 1.00 51.25  ? 111 GLU B CG  1 
ATOM   2365 C  CD  . GLU B 1 92  ? -6.850  11.967 221.488 1.00 57.19  ? 111 GLU B CD  1 
ATOM   2366 O  OE1 . GLU B 1 92  ? -5.667  11.844 221.931 1.00 55.44  ? 111 GLU B OE1 1 
ATOM   2367 O  OE2 . GLU B 1 92  ? -7.786  11.160 221.779 1.00 50.33  ? 111 GLU B OE2 1 
ATOM   2368 N  N   . ALA B 1 93  ? -8.236  16.376 222.026 1.00 48.15  ? 112 ALA B N   1 
ATOM   2369 C  CA  . ALA B 1 93  ? -9.531  16.762 222.623 1.00 48.20  ? 112 ALA B CA  1 
ATOM   2370 C  C   . ALA B 1 93  ? -10.140 17.980 221.915 1.00 49.27  ? 112 ALA B C   1 
ATOM   2371 O  O   . ALA B 1 93  ? -11.338 18.002 221.642 1.00 48.02  ? 112 ALA B O   1 
ATOM   2372 C  CB  . ALA B 1 93  ? -9.397  17.024 224.128 1.00 45.21  ? 112 ALA B CB  1 
ATOM   2373 N  N   . CYS B 1 94  ? -9.302  18.960 221.579 1.00 54.45  ? 113 CYS B N   1 
ATOM   2374 C  CA  A CYS B 1 94  ? -9.756  20.174 220.862 0.50 50.56  ? 113 CYS B CA  1 
ATOM   2375 C  CA  B CYS B 1 94  ? -9.748  20.176 220.901 0.50 52.62  ? 113 CYS B CA  1 
ATOM   2376 C  C   . CYS B 1 94  ? -10.196 19.863 219.443 1.00 55.86  ? 113 CYS B C   1 
ATOM   2377 O  O   . CYS B 1 94  ? -11.263 20.321 219.002 1.00 56.57  ? 113 CYS B O   1 
ATOM   2378 C  CB  A CYS B 1 94  ? -8.673  21.251 220.801 0.50 50.42  ? 113 CYS B CB  1 
ATOM   2379 C  CB  B CYS B 1 94  ? -8.617  21.212 220.970 0.50 55.12  ? 113 CYS B CB  1 
ATOM   2380 S  SG  A CYS B 1 94  ? -8.333  22.023 222.379 0.50 50.90  ? 113 CYS B SG  1 
ATOM   2381 S  SG  B CYS B 1 94  ? -9.070  22.930 220.715 0.50 64.18  ? 113 CYS B SG  1 
ATOM   2382 N  N   . ALA B 1 95  ? -9.388  19.079 218.719 1.00 51.89  ? 114 ALA B N   1 
ATOM   2383 C  CA  . ALA B 1 95  ? -9.690  18.693 217.329 1.00 52.57  ? 114 ALA B CA  1 
ATOM   2384 C  C   . ALA B 1 95  ? -11.042 17.956 217.202 1.00 53.98  ? 114 ALA B C   1 
ATOM   2385 O  O   . ALA B 1 95  ? -11.811 18.235 216.287 1.00 50.70  ? 114 ALA B O   1 
ATOM   2386 C  CB  . ALA B 1 95  ? -8.574  17.850 216.737 1.00 56.71  ? 114 ALA B CB  1 
ATOM   2387 N  N   . GLU B 1 96  ? -11.327 17.059 218.140 1.00 51.47  ? 115 GLU B N   1 
ATOM   2388 C  CA  . GLU B 1 96  ? -12.602 16.304 218.183 1.00 55.23  ? 115 GLU B CA  1 
ATOM   2389 C  C   . GLU B 1 96  ? -13.822 17.226 218.301 1.00 55.64  ? 115 GLU B C   1 
ATOM   2390 O  O   . GLU B 1 96  ? -14.827 17.000 217.629 1.00 54.47  ? 115 GLU B O   1 
ATOM   2391 C  CB  . GLU B 1 96  ? -12.595 15.289 219.334 1.00 56.60  ? 115 GLU B CB  1 
ATOM   2392 C  CG  . GLU B 1 96  ? -11.668 14.128 219.051 1.00 61.59  ? 115 GLU B CG  1 
ATOM   2393 C  CD  . GLU B 1 96  ? -11.431 13.216 220.232 1.00 62.19  ? 115 GLU B CD  1 
ATOM   2394 O  OE1 . GLU B 1 96  ? -12.090 13.328 221.287 1.00 64.92  ? 115 GLU B OE1 1 
ATOM   2395 O  OE2 . GLU B 1 96  ? -10.535 12.366 220.103 1.00 59.20  ? 115 GLU B OE2 1 
HETATM 2396 N  N   . MSE B 1 97  ? -13.720 18.247 219.163 1.00 48.25  ? 116 MSE B N   1 
HETATM 2397 C  CA  . MSE B 1 97  ? -14.779 19.229 219.326 1.00 47.56  ? 116 MSE B CA  1 
HETATM 2398 C  C   . MSE B 1 97  ? -14.992 20.032 218.041 1.00 52.49  ? 116 MSE B C   1 
HETATM 2399 O  O   . MSE B 1 97  ? -16.134 20.329 217.701 1.00 54.51  ? 116 MSE B O   1 
HETATM 2400 C  CB  . MSE B 1 97  ? -14.543 20.121 220.539 1.00 44.84  ? 116 MSE B CB  1 
HETATM 2401 C  CG  . MSE B 1 97  ? -14.572 19.355 221.884 1.00 48.32  ? 116 MSE B CG  1 
HETATM 2402 SE SE  . MSE B 1 97  ? -16.188 18.281 222.133 0.75 51.30  ? 116 MSE B SE  1 
HETATM 2403 C  CE  . MSE B 1 97  ? -15.802 16.590 221.129 1.00 54.96  ? 116 MSE B CE  1 
ATOM   2404 N  N   . GLN B 1 98  ? -13.919 20.317 217.309 1.00 52.81  ? 117 GLN B N   1 
ATOM   2405 C  CA  . GLN B 1 98  ? -14.020 21.019 216.035 1.00 56.10  ? 117 GLN B CA  1 
ATOM   2406 C  C   . GLN B 1 98  ? -14.759 20.205 214.966 1.00 57.01  ? 117 GLN B C   1 
ATOM   2407 O  O   . GLN B 1 98  ? -15.476 20.787 214.148 1.00 57.72  ? 117 GLN B O   1 
ATOM   2408 C  CB  . GLN B 1 98  ? -12.639 21.494 215.535 1.00 57.90  ? 117 GLN B CB  1 
ATOM   2409 C  CG  . GLN B 1 98  ? -11.993 22.613 216.343 1.00 56.57  ? 117 GLN B CG  1 
ATOM   2410 C  CD  . GLN B 1 98  ? -12.725 23.946 216.202 1.00 61.94  ? 117 GLN B CD  1 
ATOM   2411 O  OE1 . GLN B 1 98  ? -13.904 24.060 216.527 1.00 60.81  ? 117 GLN B OE1 1 
ATOM   2412 N  NE2 . GLN B 1 98  ? -12.017 24.968 215.741 1.00 63.35  ? 117 GLN B NE2 1 
ATOM   2413 N  N   . VAL B 1 99  ? -14.593 18.879 214.984 1.00 59.18  ? 118 VAL B N   1 
ATOM   2414 C  CA  . VAL B 1 99  ? -15.309 17.980 214.060 1.00 61.66  ? 118 VAL B CA  1 
ATOM   2415 C  C   . VAL B 1 99  ? -16.810 18.037 214.399 1.00 58.79  ? 118 VAL B C   1 
ATOM   2416 O  O   . VAL B 1 99  ? -17.647 18.214 213.514 1.00 59.71  ? 118 VAL B O   1 
ATOM   2417 C  CB  . VAL B 1 99  ? -14.774 16.527 214.133 1.00 65.50  ? 118 VAL B CB  1 
ATOM   2418 C  CG1 . VAL B 1 99  ? -15.638 15.559 213.322 1.00 58.34  ? 118 VAL B CG1 1 
ATOM   2419 C  CG2 . VAL B 1 99  ? -13.328 16.482 213.654 1.00 61.40  ? 118 VAL B CG2 1 
ATOM   2420 N  N   . CYS B 1 100 ? -17.132 17.933 215.685 1.00 57.55  ? 119 CYS B N   1 
ATOM   2421 C  CA  . CYS B 1 100 ? -18.523 18.019 216.148 1.00 57.98  ? 119 CYS B CA  1 
ATOM   2422 C  C   . CYS B 1 100 ? -19.191 19.381 215.849 1.00 60.05  ? 119 CYS B C   1 
ATOM   2423 O  O   . CYS B 1 100 ? -20.392 19.417 215.639 1.00 64.83  ? 119 CYS B O   1 
ATOM   2424 C  CB  . CYS B 1 100 ? -18.597 17.682 217.627 1.00 62.75  ? 119 CYS B CB  1 
ATOM   2425 S  SG  . CYS B 1 100 ? -17.942 16.048 217.979 1.00 65.96  ? 119 CYS B SG  1 
ATOM   2426 N  N   . ARG B 1 101 ? -18.415 20.475 215.798 1.00 63.89  ? 120 ARG B N   1 
ATOM   2427 C  CA  . ARG B 1 101 ? -18.930 21.831 215.461 1.00 63.13  ? 120 ARG B CA  1 
ATOM   2428 C  C   . ARG B 1 101 ? -19.018 22.104 213.953 1.00 67.95  ? 120 ARG B C   1 
ATOM   2429 O  O   . ARG B 1 101 ? -19.443 23.196 213.539 1.00 69.63  ? 120 ARG B O   1 
ATOM   2430 C  CB  . ARG B 1 101 ? -18.051 22.932 216.101 1.00 62.30  ? 120 ARG B CB  1 
ATOM   2431 C  CG  . ARG B 1 101 ? -18.065 22.933 217.608 1.00 60.48  ? 120 ARG B CG  1 
ATOM   2432 C  CD  . ARG B 1 101 ? -17.096 23.926 218.241 1.00 68.17  ? 120 ARG B CD  1 
ATOM   2433 N  NE  . ARG B 1 101 ? -17.480 25.327 218.013 1.00 70.72  ? 120 ARG B NE  1 
ATOM   2434 C  CZ  . ARG B 1 101 ? -16.755 26.306 217.457 1.00 74.96  ? 120 ARG B CZ  1 
ATOM   2435 N  NH1 . ARG B 1 101 ? -15.479 26.151 217.098 1.00 79.82  ? 120 ARG B NH1 1 
ATOM   2436 N  NH2 . ARG B 1 101 ? -17.309 27.514 217.333 1.00 77.13  ? 120 ARG B NH2 1 
ATOM   2437 N  N   . GLY B 1 102 ? -18.634 21.133 213.124 1.00 70.43  ? 121 GLY B N   1 
ATOM   2438 C  CA  . GLY B 1 102 ? -18.624 21.321 211.681 1.00 67.96  ? 121 GLY B CA  1 
ATOM   2439 C  C   . GLY B 1 102 ? -17.458 22.185 211.214 1.00 71.04  ? 121 GLY B C   1 
ATOM   2440 O  O   . GLY B 1 102 ? -17.498 22.693 210.099 1.00 77.73  ? 121 GLY B O   1 
ATOM   2441 N  N   . GLN B 1 103 ? -16.423 22.344 212.052 1.00 64.65  ? 122 GLN B N   1 
ATOM   2442 C  CA  . GLN B 1 103 ? -15.226 23.121 211.728 1.00 68.92  ? 122 GLN B CA  1 
ATOM   2443 C  C   . GLN B 1 103 ? -14.178 22.083 211.293 1.00 71.23  ? 122 GLN B C   1 
ATOM   2444 O  O   . GLN B 1 103 ? -13.171 21.848 211.985 1.00 68.31  ? 122 GLN B O   1 
ATOM   2445 C  CB  . GLN B 1 103 ? -14.771 23.961 212.936 1.00 69.68  ? 122 GLN B CB  1 
ATOM   2446 C  CG  . GLN B 1 103 ? -15.781 25.020 213.386 1.00 71.98  ? 122 GLN B CG  1 
ATOM   2447 C  CD  . GLN B 1 103 ? -16.028 26.111 212.353 1.00 77.50  ? 122 GLN B CD  1 
ATOM   2448 O  OE1 . GLN B 1 103 ? -15.110 26.544 211.660 1.00 85.75  ? 122 GLN B OE1 1 
ATOM   2449 N  NE2 . GLN B 1 103 ? -17.273 26.577 212.263 1.00 77.81  ? 122 GLN B NE2 1 
ATOM   2450 N  N   . GLU B 1 104 ? -14.455 21.465 210.139 1.00 66.19  ? 123 GLU B N   1 
ATOM   2451 C  CA  . GLU B 1 104 ? -13.626 20.404 209.555 1.00 71.94  ? 123 GLU B CA  1 
ATOM   2452 C  C   . GLU B 1 104 ? -12.256 20.899 209.149 1.00 73.27  ? 123 GLU B C   1 
ATOM   2453 O  O   . GLU B 1 104 ? -11.278 20.202 209.376 1.00 79.59  ? 123 GLU B O   1 
ATOM   2454 C  CB  . GLU B 1 104 ? -14.307 19.755 208.334 1.00 67.05  ? 123 GLU B CB  1 
ATOM   2455 N  N   . LYS B 1 105 ? -12.194 22.099 208.567 1.00 76.88  ? 124 LYS B N   1 
ATOM   2456 C  CA  . LYS B 1 105 ? -10.923 22.695 208.126 1.00 81.59  ? 124 LYS B CA  1 
ATOM   2457 C  C   . LYS B 1 105 ? -10.004 22.844 209.348 1.00 71.04  ? 124 LYS B C   1 
ATOM   2458 O  O   . LYS B 1 105 ? -8.903  22.309 209.353 1.00 72.40  ? 124 LYS B O   1 
ATOM   2459 C  CB  . LYS B 1 105 ? -11.138 24.062 207.451 1.00 87.94  ? 124 LYS B CB  1 
ATOM   2460 C  CG  . LYS B 1 105 ? -10.000 24.546 206.559 1.00 107.57 ? 124 LYS B CG  1 
ATOM   2461 C  CD  . LYS B 1 105 ? -10.012 23.838 205.204 1.00 123.14 ? 124 LYS B CD  1 
ATOM   2462 C  CE  . LYS B 1 105 ? -8.931  24.347 204.257 1.00 129.22 ? 124 LYS B CE  1 
ATOM   2463 N  NZ  . LYS B 1 105 ? -9.097  25.784 203.905 1.00 139.55 ? 124 LYS B NZ  1 
ATOM   2464 N  N   . ASP B 1 106 ? -10.485 23.517 210.392 1.00 68.56  ? 125 ASP B N   1 
ATOM   2465 C  CA  . ASP B 1 106 ? -9.686  23.715 211.615 1.00 66.59  ? 125 ASP B CA  1 
ATOM   2466 C  C   . ASP B 1 106 ? -9.385  22.390 212.344 1.00 65.74  ? 125 ASP B C   1 
ATOM   2467 O  O   . ASP B 1 106 ? -8.297  22.237 212.879 1.00 59.73  ? 125 ASP B O   1 
ATOM   2468 C  CB  . ASP B 1 106 ? -10.324 24.712 212.589 1.00 64.15  ? 125 ASP B CB  1 
ATOM   2469 C  CG  . ASP B 1 106 ? -9.346  25.164 213.677 1.00 71.28  ? 125 ASP B CG  1 
ATOM   2470 O  OD1 . ASP B 1 106 ? -8.310  25.780 213.339 1.00 77.64  ? 125 ASP B OD1 1 
ATOM   2471 O  OD2 . ASP B 1 106 ? -9.601  24.912 214.872 1.00 68.94  ? 125 ASP B OD2 1 
ATOM   2472 N  N   . ALA B 1 107 ? -10.320 21.438 212.344 1.00 61.09  ? 126 ALA B N   1 
ATOM   2473 C  CA  . ALA B 1 107 ? -10.087 20.135 212.993 1.00 62.35  ? 126 ALA B CA  1 
ATOM   2474 C  C   . ALA B 1 107 ? -8.942  19.379 212.318 1.00 64.51  ? 126 ALA B C   1 
ATOM   2475 O  O   . ALA B 1 107 ? -8.095  18.792 213.001 1.00 55.84  ? 126 ALA B O   1 
ATOM   2476 C  CB  . ALA B 1 107 ? -11.341 19.273 212.976 1.00 62.53  ? 126 ALA B CB  1 
ATOM   2477 N  N   . LEU B 1 108 ? -8.923  19.422 210.988 1.00 60.42  ? 127 LEU B N   1 
ATOM   2478 C  CA  . LEU B 1 108 ? -7.902  18.750 210.189 1.00 65.05  ? 127 LEU B CA  1 
ATOM   2479 C  C   . LEU B 1 108 ? -6.509  19.367 210.467 1.00 66.28  ? 127 LEU B C   1 
ATOM   2480 O  O   . LEU B 1 108 ? -5.531  18.637 210.561 1.00 63.56  ? 127 LEU B O   1 
ATOM   2481 C  CB  . LEU B 1 108 ? -8.262  18.802 208.689 1.00 68.47  ? 127 LEU B CB  1 
ATOM   2482 C  CG  . LEU B 1 108 ? -7.662  17.709 207.809 1.00 78.54  ? 127 LEU B CG  1 
ATOM   2483 C  CD1 . LEU B 1 108 ? -8.348  16.382 208.135 1.00 73.80  ? 127 LEU B CD1 1 
ATOM   2484 C  CD2 . LEU B 1 108 ? -7.826  18.037 206.328 1.00 79.39  ? 127 LEU B CD2 1 
ATOM   2485 N  N   . ARG B 1 109 ? -6.438  20.695 210.608 1.00 67.33  ? 128 ARG B N   1 
ATOM   2486 C  CA  . ARG B 1 109 ? -5.190  21.416 210.958 1.00 72.38  ? 128 ARG B CA  1 
ATOM   2487 C  C   . ARG B 1 109 ? -4.617  20.899 212.293 1.00 70.13  ? 128 ARG B C   1 
ATOM   2488 O  O   . ARG B 1 109 ? -3.423  20.651 212.418 1.00 74.01  ? 128 ARG B O   1 
ATOM   2489 C  CB  . ARG B 1 109 ? -5.456  22.930 211.102 1.00 71.83  ? 128 ARG B CB  1 
ATOM   2490 C  CG  . ARG B 1 109 ? -4.246  23.797 211.462 1.00 79.56  ? 128 ARG B CG  1 
ATOM   2491 C  CD  . ARG B 1 109 ? -4.634  25.219 211.844 1.00 82.70  ? 128 ARG B CD  1 
ATOM   2492 N  NE  . ARG B 1 109 ? -5.481  25.256 213.039 1.00 78.65  ? 128 ARG B NE  1 
ATOM   2493 C  CZ  . ARG B 1 109 ? -5.067  25.167 214.312 1.00 86.81  ? 128 ARG B CZ  1 
ATOM   2494 N  NH1 . ARG B 1 109 ? -3.774  25.010 214.641 1.00 80.05  ? 128 ARG B NH1 1 
ATOM   2495 N  NH2 . ARG B 1 109 ? -5.974  25.219 215.288 1.00 91.98  ? 128 ARG B NH2 1 
HETATM 2496 N  N   . MSE B 1 110 ? -5.490  20.742 213.278 1.00 62.22  ? 129 MSE B N   1 
HETATM 2497 C  CA  . MSE B 1 110 ? -5.095  20.277 214.601 1.00 61.74  ? 129 MSE B CA  1 
HETATM 2498 C  C   . MSE B 1 110 ? -4.566  18.845 214.586 1.00 60.22  ? 129 MSE B C   1 
HETATM 2499 O  O   . MSE B 1 110 ? -3.536  18.575 215.212 1.00 53.65  ? 129 MSE B O   1 
HETATM 2500 C  CB  . MSE B 1 110 ? -6.223  20.447 215.591 1.00 58.33  ? 129 MSE B CB  1 
HETATM 2501 C  CG  . MSE B 1 110 ? -6.655  21.895 215.701 1.00 69.01  ? 129 MSE B CG  1 
HETATM 2502 SE SE  . MSE B 1 110 ? -7.748  22.227 217.212 0.75 69.32  ? 129 MSE B SE  1 
HETATM 2503 C  CE  . MSE B 1 110 ? -6.293  22.171 218.442 1.00 52.93  ? 129 MSE B CE  1 
ATOM   2504 N  N   . TYR B 1 111 ? -5.236  17.956 213.844 1.00 57.43  ? 130 TYR B N   1 
ATOM   2505 C  CA  . TYR B 1 111 ? -4.784  16.564 213.716 1.00 55.81  ? 130 TYR B CA  1 
ATOM   2506 C  C   . TYR B 1 111 ? -3.434  16.469 213.013 1.00 57.42  ? 130 TYR B C   1 
ATOM   2507 O  O   . TYR B 1 111 ? -2.619  15.629 213.388 1.00 57.39  ? 130 TYR B O   1 
ATOM   2508 C  CB  . TYR B 1 111 ? -5.802  15.672 213.009 1.00 51.66  ? 130 TYR B CB  1 
ATOM   2509 C  CG  . TYR B 1 111 ? -6.962  15.243 213.857 1.00 50.58  ? 130 TYR B CG  1 
ATOM   2510 C  CD1 . TYR B 1 111 ? -6.761  14.382 214.932 1.00 52.94  ? 130 TYR B CD1 1 
ATOM   2511 C  CD2 . TYR B 1 111 ? -8.271  15.624 213.551 1.00 51.40  ? 130 TYR B CD2 1 
ATOM   2512 C  CE1 . TYR B 1 111 ? -7.814  13.945 215.713 1.00 52.23  ? 130 TYR B CE1 1 
ATOM   2513 C  CE2 . TYR B 1 111 ? -9.336  15.193 214.323 1.00 52.17  ? 130 TYR B CE2 1 
ATOM   2514 C  CZ  . TYR B 1 111 ? -9.096  14.358 215.410 1.00 51.12  ? 130 TYR B CZ  1 
ATOM   2515 O  OH  . TYR B 1 111 ? -10.128 13.906 216.177 1.00 54.21  ? 130 TYR B OH  1 
ATOM   2516 N  N   . GLU B 1 112 ? -3.217  17.317 212.004 1.00 58.57  ? 131 GLU B N   1 
ATOM   2517 C  CA  . GLU B 1 112 ? -1.942  17.371 211.290 1.00 62.13  ? 131 GLU B CA  1 
ATOM   2518 C  C   . GLU B 1 112 ? -0.838  17.946 212.181 1.00 58.53  ? 131 GLU B C   1 
ATOM   2519 O  O   . GLU B 1 112 ? 0.296   17.525 212.053 1.00 64.28  ? 131 GLU B O   1 
ATOM   2520 C  CB  . GLU B 1 112 ? -2.067  18.091 209.928 1.00 70.65  ? 131 GLU B CB  1 
ATOM   2521 C  CG  . GLU B 1 112 ? -2.855  17.253 208.917 1.00 78.82  ? 131 GLU B CG  1 
ATOM   2522 C  CD  . GLU B 1 112 ? -3.053  17.900 207.553 1.00 104.21 ? 131 GLU B CD  1 
ATOM   2523 O  OE1 . GLU B 1 112 ? -2.489  18.987 207.283 1.00 134.16 ? 131 GLU B OE1 1 
ATOM   2524 O  OE2 . GLU B 1 112 ? -3.785  17.302 206.731 1.00 112.68 ? 131 GLU B OE2 1 
ATOM   2525 N  N   . LYS B 1 113 ? -1.156  18.885 213.080 1.00 58.07  ? 132 LYS B N   1 
ATOM   2526 C  CA  . LYS B 1 113 ? -0.165  19.412 214.044 1.00 61.22  ? 132 LYS B CA  1 
ATOM   2527 C  C   . LYS B 1 113 ? 0.258   18.280 215.013 1.00 60.62  ? 132 LYS B C   1 
ATOM   2528 O  O   . LYS B 1 113 ? 1.441   18.161 215.347 1.00 56.30  ? 132 LYS B O   1 
ATOM   2529 C  CB  . LYS B 1 113 ? -0.697  20.616 214.841 1.00 63.96  ? 132 LYS B CB  1 
ATOM   2530 C  CG  . LYS B 1 113 ? 0.337   21.217 215.790 1.00 69.84  ? 132 LYS B CG  1 
ATOM   2531 C  CD  . LYS B 1 113 ? -0.148  22.434 216.553 1.00 80.00  ? 132 LYS B CD  1 
ATOM   2532 C  CE  . LYS B 1 113 ? 0.971   22.950 217.455 1.00 92.58  ? 132 LYS B CE  1 
ATOM   2533 N  NZ  . LYS B 1 113 ? 0.553   24.063 218.351 1.00 95.63  ? 132 LYS B NZ  1 
ATOM   2534 N  N   . ILE B 1 114 ? -0.708  17.472 215.460 1.00 55.31  ? 133 ILE B N   1 
ATOM   2535 C  CA  . ILE B 1 114 ? -0.416  16.319 216.322 1.00 53.45  ? 133 ILE B CA  1 
ATOM   2536 C  C   . ILE B 1 114 ? 0.608   15.405 215.653 1.00 54.85  ? 133 ILE B C   1 
ATOM   2537 O  O   . ILE B 1 114 ? 1.585   15.029 216.305 1.00 52.60  ? 133 ILE B O   1 
ATOM   2538 C  CB  . ILE B 1 114 ? -1.673  15.509 216.671 1.00 51.89  ? 133 ILE B CB  1 
ATOM   2539 C  CG1 . ILE B 1 114 ? -2.555  16.292 217.633 1.00 52.64  ? 133 ILE B CG1 1 
ATOM   2540 C  CG2 . ILE B 1 114 ? -1.306  14.179 217.307 1.00 53.03  ? 133 ILE B CG2 1 
ATOM   2541 C  CD1 . ILE B 1 114 ? -3.895  15.634 217.909 1.00 48.46  ? 133 ILE B CD1 1 
ATOM   2542 N  N   . LEU B 1 115 ? 0.412   15.102 214.352 1.00 56.76  ? 134 LEU B N   1 
ATOM   2543 C  CA  . LEU B 1 115 ? 1.349   14.247 213.607 1.00 58.73  ? 134 LEU B CA  1 
ATOM   2544 C  C   . LEU B 1 115 ? 2.751   14.858 213.468 1.00 63.24  ? 134 LEU B C   1 
ATOM   2545 O  O   . LEU B 1 115 ? 3.742   14.128 213.476 1.00 63.45  ? 134 LEU B O   1 
ATOM   2546 C  CB  . LEU B 1 115 ? 0.793   13.818 212.241 1.00 65.87  ? 134 LEU B CB  1 
ATOM   2547 C  CG  . LEU B 1 115 ? -0.445  12.908 212.295 1.00 67.25  ? 134 LEU B CG  1 
ATOM   2548 C  CD1 . LEU B 1 115 ? -0.787  12.480 210.885 1.00 64.01  ? 134 LEU B CD1 1 
ATOM   2549 C  CD2 . LEU B 1 115 ? -0.238  11.663 213.144 1.00 64.59  ? 134 LEU B CD2 1 
ATOM   2550 N  N   . GLN B 1 116 ? 2.824   16.184 213.380 1.00 61.49  ? 135 GLN B N   1 
ATOM   2551 C  CA  . GLN B 1 116 ? 4.097   16.907 213.325 1.00 68.70  ? 135 GLN B CA  1 
ATOM   2552 C  C   . GLN B 1 116 ? 4.860   16.713 214.661 1.00 63.26  ? 135 GLN B C   1 
ATOM   2553 O  O   . GLN B 1 116 ? 6.054   16.445 214.660 1.00 64.67  ? 135 GLN B O   1 
ATOM   2554 C  CB  . GLN B 1 116 ? 3.835   18.390 213.023 1.00 79.37  ? 135 GLN B CB  1 
ATOM   2555 C  CG  . GLN B 1 116 ? 5.047   19.256 212.717 1.00 94.23  ? 135 GLN B CG  1 
ATOM   2556 C  CD  . GLN B 1 116 ? 4.664   20.657 212.228 1.00 105.00 ? 135 GLN B CD  1 
ATOM   2557 O  OE1 . GLN B 1 116 ? 3.510   21.097 212.357 1.00 94.88  ? 135 GLN B OE1 1 
ATOM   2558 N  NE2 . GLN B 1 116 ? 5.638   21.365 211.659 1.00 102.56 ? 135 GLN B NE2 1 
ATOM   2559 N  N   . LEU B 1 117 ? 4.154   16.810 215.788 1.00 61.90  ? 136 LEU B N   1 
ATOM   2560 C  CA  . LEU B 1 117 ? 4.762   16.599 217.112 1.00 62.29  ? 136 LEU B CA  1 
ATOM   2561 C  C   . LEU B 1 117 ? 5.127   15.128 217.373 1.00 66.00  ? 136 LEU B C   1 
ATOM   2562 O  O   . LEU B 1 117 ? 6.202   14.846 217.914 1.00 70.97  ? 136 LEU B O   1 
ATOM   2563 C  CB  . LEU B 1 117 ? 3.849   17.109 218.216 1.00 58.42  ? 136 LEU B CB  1 
ATOM   2564 C  CG  . LEU B 1 117 ? 3.574   18.612 218.221 1.00 59.83  ? 136 LEU B CG  1 
ATOM   2565 C  CD1 . LEU B 1 117 ? 2.501   18.948 219.237 1.00 55.39  ? 136 LEU B CD1 1 
ATOM   2566 C  CD2 . LEU B 1 117 ? 4.853   19.397 218.514 1.00 59.30  ? 136 LEU B CD2 1 
ATOM   2567 N  N   . GLU B 1 118 ? 4.240   14.213 216.973 1.00 60.98  ? 137 GLU B N   1 
ATOM   2568 C  CA  . GLU B 1 118 ? 4.417   12.762 217.164 1.00 58.92  ? 137 GLU B CA  1 
ATOM   2569 C  C   . GLU B 1 118 ? 3.844   12.017 215.969 1.00 56.38  ? 137 GLU B C   1 
ATOM   2570 O  O   . GLU B 1 118 ? 2.624   11.874 215.871 1.00 56.62  ? 137 GLU B O   1 
ATOM   2571 C  CB  . GLU B 1 118 ? 3.676   12.333 218.447 1.00 56.19  ? 137 GLU B CB  1 
ATOM   2572 C  CG  . GLU B 1 118 ? 3.693   10.826 218.705 1.00 60.14  ? 137 GLU B CG  1 
ATOM   2573 C  CD  . GLU B 1 118 ? 2.987   10.406 219.975 1.00 61.31  ? 137 GLU B CD  1 
ATOM   2574 O  OE1 . GLU B 1 118 ? 2.097   11.128 220.444 1.00 54.76  ? 137 GLU B OE1 1 
ATOM   2575 O  OE2 . GLU B 1 118 ? 3.315   9.313  220.475 1.00 65.15  ? 137 GLU B OE2 1 
ATOM   2576 N  N   . ALA B 1 119 ? 4.707   11.516 215.095 1.00 62.43  ? 138 ALA B N   1 
ATOM   2577 C  CA  . ALA B 1 119 ? 4.279   10.824 213.862 1.00 61.74  ? 138 ALA B CA  1 
ATOM   2578 C  C   . ALA B 1 119 ? 3.427   9.559  214.039 1.00 62.39  ? 138 ALA B C   1 
ATOM   2579 O  O   . ALA B 1 119 ? 2.573   9.284  213.193 1.00 64.90  ? 138 ALA B O   1 
ATOM   2580 C  CB  . ALA B 1 119 ? 5.484   10.509 212.988 1.00 58.00  ? 138 ALA B CB  1 
ATOM   2581 N  N   . ASP B 1 120 ? 3.661   8.801  215.114 1.00 59.10  ? 139 ASP B N   1 
ATOM   2582 C  CA  . ASP B 1 120 ? 2.936   7.539  215.370 1.00 61.93  ? 139 ASP B CA  1 
ATOM   2583 C  C   . ASP B 1 120 ? 1.722   7.692  216.314 1.00 61.30  ? 139 ASP B C   1 
ATOM   2584 O  O   . ASP B 1 120 ? 1.215   6.687  216.814 1.00 60.33  ? 139 ASP B O   1 
ATOM   2585 C  CB  . ASP B 1 120 ? 3.915   6.457  215.910 1.00 65.08  ? 139 ASP B CB  1 
ATOM   2586 C  CG  . ASP B 1 120 ? 4.456   6.772  217.308 1.00 66.57  ? 139 ASP B CG  1 
ATOM   2587 O  OD1 . ASP B 1 120 ? 4.172   7.866  217.825 1.00 72.77  ? 139 ASP B OD1 1 
ATOM   2588 O  OD2 . ASP B 1 120 ? 5.170   5.942  217.923 1.00 70.99  ? 139 ASP B OD2 1 
ATOM   2589 N  N   . ASN B 1 121 ? 1.276   8.933  216.555 1.00 59.84  ? 140 ASN B N   1 
ATOM   2590 C  CA  . ASN B 1 121 ? 0.174   9.223  217.472 1.00 54.37  ? 140 ASN B CA  1 
ATOM   2591 C  C   . ASN B 1 121 ? -1.025  8.400  217.040 1.00 54.15  ? 140 ASN B C   1 
ATOM   2592 O  O   . ASN B 1 121 ? -1.419  8.445  215.881 1.00 51.48  ? 140 ASN B O   1 
ATOM   2593 C  CB  . ASN B 1 121 ? -0.136  10.715 217.516 1.00 53.84  ? 140 ASN B CB  1 
ATOM   2594 C  CG  . ASN B 1 121 ? -1.212  11.056 218.510 1.00 51.01  ? 140 ASN B CG  1 
ATOM   2595 O  OD1 . ASN B 1 121 ? -2.402  10.991 218.205 1.00 53.39  ? 140 ASN B OD1 1 
ATOM   2596 N  ND2 . ASN B 1 121 ? -0.800  11.467 219.695 1.00 51.05  ? 140 ASN B ND2 1 
ATOM   2597 N  N   . LEU B 1 122 ? -1.547  7.614  217.977 1.00 54.49  ? 141 LEU B N   1 
ATOM   2598 C  CA  . LEU B 1 122 ? -2.621  6.672  217.691 1.00 57.02  ? 141 LEU B CA  1 
ATOM   2599 C  C   . LEU B 1 122 ? -3.909  7.376  217.297 1.00 54.25  ? 141 LEU B C   1 
ATOM   2600 O  O   . LEU B 1 122 ? -4.453  7.083  216.243 1.00 52.76  ? 141 LEU B O   1 
ATOM   2601 C  CB  . LEU B 1 122 ? -2.804  5.712  218.877 1.00 57.39  ? 141 LEU B CB  1 
ATOM   2602 C  CG  . LEU B 1 122 ? -3.656  4.465  218.707 1.00 59.09  ? 141 LEU B CG  1 
ATOM   2603 C  CD1 . LEU B 1 122 ? -3.194  3.614  217.532 1.00 57.49  ? 141 LEU B CD1 1 
ATOM   2604 C  CD2 . LEU B 1 122 ? -3.584  3.666  220.004 1.00 61.98  ? 141 LEU B CD2 1 
ATOM   2605 N  N   . ALA B 1 123 ? -4.324  8.368  218.078 1.00 53.06  ? 142 ALA B N   1 
ATOM   2606 C  CA  . ALA B 1 123 ? -5.571  9.119  217.802 1.00 51.76  ? 142 ALA B CA  1 
ATOM   2607 C  C   . ALA B 1 123 ? -5.615  9.848  216.468 1.00 55.19  ? 142 ALA B C   1 
ATOM   2608 O  O   . ALA B 1 123 ? -6.625  9.783  215.775 1.00 54.62  ? 142 ALA B O   1 
ATOM   2609 C  CB  . ALA B 1 123 ? -5.852  10.111 218.918 1.00 50.48  ? 142 ALA B CB  1 
ATOM   2610 N  N   . ALA B 1 124 ? -4.526  10.544 216.122 1.00 53.32  ? 143 ALA B N   1 
ATOM   2611 C  CA  . ALA B 1 124 ? -4.451  11.305 214.888 1.00 53.36  ? 143 ALA B CA  1 
ATOM   2612 C  C   . ALA B 1 124 ? -4.422  10.392 213.657 1.00 54.05  ? 143 ALA B C   1 
ATOM   2613 O  O   . ALA B 1 124 ? -4.942  10.763 212.623 1.00 56.44  ? 143 ALA B O   1 
ATOM   2614 C  CB  . ALA B 1 124 ? -3.253  12.248 214.888 1.00 52.30  ? 143 ALA B CB  1 
ATOM   2615 N  N   . ASN B 1 125 ? -3.787  9.229  213.781 1.00 54.38  ? 144 ASN B N   1 
ATOM   2616 C  CA  . ASN B 1 125 ? -3.728  8.241  212.706 1.00 57.39  ? 144 ASN B CA  1 
ATOM   2617 C  C   . ASN B 1 125 ? -5.066  7.515  212.498 1.00 57.45  ? 144 ASN B C   1 
ATOM   2618 O  O   . ASN B 1 125 ? -5.408  7.173  211.371 1.00 56.87  ? 144 ASN B O   1 
ATOM   2619 C  CB  . ASN B 1 125 ? -2.548  7.282  212.907 1.00 56.73  ? 144 ASN B CB  1 
ATOM   2620 C  CG  . ASN B 1 125 ? -1.235  7.908  212.490 1.00 59.28  ? 144 ASN B CG  1 
ATOM   2621 O  OD1 . ASN B 1 125 ? -1.062  8.258  211.319 1.00 57.69  ? 144 ASN B OD1 1 
ATOM   2622 N  ND2 . ASN B 1 125 ? -0.289  8.008  213.418 1.00 53.51  ? 144 ASN B ND2 1 
ATOM   2623 N  N   . ILE B 1 126 ? -5.808  7.268  213.569 1.00 57.79  ? 145 ILE B N   1 
ATOM   2624 C  CA  . ILE B 1 126 ? -7.143  6.667  213.432 1.00 61.41  ? 145 ILE B CA  1 
ATOM   2625 C  C   . ILE B 1 126 ? -8.049  7.667  212.720 1.00 60.87  ? 145 ILE B C   1 
ATOM   2626 O  O   . ILE B 1 126 ? -8.708  7.292  211.753 1.00 60.28  ? 145 ILE B O   1 
ATOM   2627 C  CB  . ILE B 1 126 ? -7.772  6.277  214.772 1.00 56.53  ? 145 ILE B CB  1 
ATOM   2628 C  CG1 . ILE B 1 126 ? -6.977  5.135  215.409 1.00 55.40  ? 145 ILE B CG1 1 
ATOM   2629 C  CG2 . ILE B 1 126 ? -9.211  5.795  214.560 1.00 57.63  ? 145 ILE B CG2 1 
ATOM   2630 C  CD1 . ILE B 1 126 ? -7.365  4.845  216.845 1.00 52.17  ? 145 ILE B CD1 1 
ATOM   2631 N  N   . PHE B 1 127 ? -8.050  8.928  213.171 1.00 57.93  ? 146 PHE B N   1 
ATOM   2632 C  CA  . PHE B 1 127 ? -8.890  9.947  212.548 1.00 57.39  ? 146 PHE B CA  1 
ATOM   2633 C  C   . PHE B 1 127 ? -8.544  10.179 211.082 1.00 61.28  ? 146 PHE B C   1 
ATOM   2634 O  O   . PHE B 1 127 ? -9.438  10.152 210.249 1.00 62.03  ? 146 PHE B O   1 
ATOM   2635 C  CB  . PHE B 1 127 ? -8.862  11.308 213.249 1.00 57.89  ? 146 PHE B CB  1 
ATOM   2636 C  CG  . PHE B 1 127 ? -9.807  12.293 212.621 1.00 60.16  ? 146 PHE B CG  1 
ATOM   2637 C  CD1 . PHE B 1 127 ? -11.163 12.284 212.964 1.00 61.96  ? 146 PHE B CD1 1 
ATOM   2638 C  CD2 . PHE B 1 127 ? -9.378  13.155 211.607 1.00 62.86  ? 146 PHE B CD2 1 
ATOM   2639 C  CE1 . PHE B 1 127 ? -12.057 13.153 212.342 1.00 63.50  ? 146 PHE B CE1 1 
ATOM   2640 C  CE2 . PHE B 1 127 ? -10.274 14.022 210.971 1.00 60.33  ? 146 PHE B CE2 1 
ATOM   2641 C  CZ  . PHE B 1 127 ? -11.608 14.022 211.342 1.00 60.13  ? 146 PHE B CZ  1 
ATOM   2642 N  N   . LEU B 1 128 ? -7.267  10.449 210.801 1.00 60.83  ? 147 LEU B N   1 
ATOM   2643 C  CA  . LEU B 1 128 ? -6.807  10.733 209.438 1.00 63.33  ? 147 LEU B CA  1 
ATOM   2644 C  C   . LEU B 1 128 ? -6.931  9.543  208.492 1.00 61.86  ? 147 LEU B C   1 
ATOM   2645 O  O   . LEU B 1 128 ? -7.273  9.736  207.340 1.00 64.05  ? 147 LEU B O   1 
ATOM   2646 C  CB  . LEU B 1 128 ? -5.401  11.354 209.429 1.00 67.99  ? 147 LEU B CB  1 
ATOM   2647 C  CG  . LEU B 1 128 ? -5.340  12.771 210.027 1.00 71.33  ? 147 LEU B CG  1 
ATOM   2648 C  CD1 . LEU B 1 128 ? -3.907  13.272 210.091 1.00 71.64  ? 147 LEU B CD1 1 
ATOM   2649 C  CD2 . LEU B 1 128 ? -6.189  13.764 209.234 1.00 72.99  ? 147 LEU B CD2 1 
ATOM   2650 N  N   . GLY B 1 129 ? -6.691  8.326  208.984 1.00 60.93  ? 148 GLY B N   1 
ATOM   2651 C  CA  . GLY B 1 129 ? -6.863  7.108  208.186 1.00 64.55  ? 148 GLY B CA  1 
ATOM   2652 C  C   . GLY B 1 129 ? -8.288  7.010  207.653 1.00 68.57  ? 148 GLY B C   1 
ATOM   2653 O  O   . GLY B 1 129 ? -8.495  6.776  206.459 1.00 67.03  ? 148 GLY B O   1 
ATOM   2654 N  N   . ASN B 1 130 ? -9.259  7.265  208.535 1.00 69.10  ? 149 ASN B N   1 
ATOM   2655 C  CA  . ASN B 1 130 ? -10.685 7.229  208.175 1.00 71.14  ? 149 ASN B CA  1 
ATOM   2656 C  C   . ASN B 1 130 ? -11.155 8.417  207.335 1.00 72.94  ? 149 ASN B C   1 
ATOM   2657 O  O   . ASN B 1 130 ? -11.935 8.224  206.406 1.00 75.01  ? 149 ASN B O   1 
ATOM   2658 C  CB  . ASN B 1 130 ? -11.546 7.068  209.425 1.00 64.81  ? 149 ASN B CB  1 
ATOM   2659 C  CG  . ASN B 1 130 ? -11.282 5.754  210.126 1.00 67.39  ? 149 ASN B CG  1 
ATOM   2660 O  OD1 . ASN B 1 130 ? -11.149 4.714  209.471 1.00 67.29  ? 149 ASN B OD1 1 
ATOM   2661 N  ND2 . ASN B 1 130 ? -11.199 5.785  211.462 1.00 60.97  ? 149 ASN B ND2 1 
ATOM   2662 N  N   . TYR B 1 131 ? -10.685 9.625  207.660 1.00 71.91  ? 150 TYR B N   1 
ATOM   2663 C  CA  . TYR B 1 131 ? -11.052 10.837 206.915 1.00 70.96  ? 150 TYR B CA  1 
ATOM   2664 C  C   . TYR B 1 131 ? -10.638 10.714 205.456 1.00 70.62  ? 150 TYR B C   1 
ATOM   2665 O  O   . TYR B 1 131 ? -11.449 10.994 204.569 1.00 73.89  ? 150 TYR B O   1 
ATOM   2666 C  CB  . TYR B 1 131 ? -10.447 12.106 207.540 1.00 77.02  ? 150 TYR B CB  1 
ATOM   2667 C  CG  . TYR B 1 131 ? -10.704 13.373 206.741 1.00 77.10  ? 150 TYR B CG  1 
ATOM   2668 C  CD1 . TYR B 1 131 ? -11.918 14.070 206.863 1.00 83.46  ? 150 TYR B CD1 1 
ATOM   2669 C  CD2 . TYR B 1 131 ? -9.740  13.878 205.862 1.00 83.46  ? 150 TYR B CD2 1 
ATOM   2670 C  CE1 . TYR B 1 131 ? -12.165 15.227 206.125 1.00 87.45  ? 150 TYR B CE1 1 
ATOM   2671 C  CE2 . TYR B 1 131 ? -9.982  15.029 205.104 1.00 92.70  ? 150 TYR B CE2 1 
ATOM   2672 C  CZ  . TYR B 1 131 ? -11.192 15.703 205.241 1.00 94.84  ? 150 TYR B CZ  1 
ATOM   2673 O  OH  . TYR B 1 131 ? -11.430 16.843 204.506 1.00 106.55 ? 150 TYR B OH  1 
ATOM   2674 N  N   . TYR B 1 132 ? -9.390  10.301 205.214 1.00 67.64  ? 151 TYR B N   1 
ATOM   2675 C  CA  . TYR B 1 132 ? -8.901  10.125 203.847 1.00 71.41  ? 151 TYR B CA  1 
ATOM   2676 C  C   . TYR B 1 132 ? -9.623  9.005  203.083 1.00 72.25  ? 151 TYR B C   1 
ATOM   2677 O  O   . TYR B 1 132 ? -9.780  9.112  201.867 1.00 70.10  ? 151 TYR B O   1 
ATOM   2678 C  CB  . TYR B 1 132 ? -7.371  9.983  203.772 1.00 76.27  ? 151 TYR B CB  1 
ATOM   2679 C  CG  . TYR B 1 132 ? -6.628  11.292 203.985 1.00 85.03  ? 151 TYR B CG  1 
ATOM   2680 C  CD1 . TYR B 1 132 ? -6.697  12.317 203.028 1.00 93.77  ? 151 TYR B CD1 1 
ATOM   2681 C  CD2 . TYR B 1 132 ? -5.811  11.500 205.109 1.00 86.60  ? 151 TYR B CD2 1 
ATOM   2682 C  CE1 . TYR B 1 132 ? -6.014  13.522 203.206 1.00 103.22 ? 151 TYR B CE1 1 
ATOM   2683 C  CE2 . TYR B 1 132 ? -5.121  12.697 205.292 1.00 91.64  ? 151 TYR B CE2 1 
ATOM   2684 C  CZ  . TYR B 1 132 ? -5.223  13.705 204.341 1.00 104.77 ? 151 TYR B CZ  1 
ATOM   2685 O  OH  . TYR B 1 132 ? -4.543  14.886 204.520 1.00 123.93 ? 151 TYR B OH  1 
ATOM   2686 N  N   . TYR B 1 133 ? -10.069 7.959  203.785 1.00 69.21  ? 152 TYR B N   1 
ATOM   2687 C  CA  . TYR B 1 133 ? -10.807 6.863  203.157 1.00 74.82  ? 152 TYR B CA  1 
ATOM   2688 C  C   . TYR B 1 133 ? -12.201 7.316  202.680 1.00 78.55  ? 152 TYR B C   1 
ATOM   2689 O  O   . TYR B 1 133 ? -12.557 7.085  201.519 1.00 76.60  ? 152 TYR B O   1 
ATOM   2690 C  CB  . TYR B 1 133 ? -10.932 5.641  204.084 1.00 74.08  ? 152 TYR B CB  1 
ATOM   2691 C  CG  . TYR B 1 133 ? -11.806 4.549  203.490 1.00 78.33  ? 152 TYR B CG  1 
ATOM   2692 C  CD1 . TYR B 1 133 ? -11.301 3.663  202.531 1.00 81.70  ? 152 TYR B CD1 1 
ATOM   2693 C  CD2 . TYR B 1 133 ? -13.153 4.425  203.862 1.00 80.93  ? 152 TYR B CD2 1 
ATOM   2694 C  CE1 . TYR B 1 133 ? -12.113 2.678  201.968 1.00 87.96  ? 152 TYR B CE1 1 
ATOM   2695 C  CE2 . TYR B 1 133 ? -13.970 3.448  203.308 1.00 84.80  ? 152 TYR B CE2 1 
ATOM   2696 C  CZ  . TYR B 1 133 ? -13.451 2.577  202.364 1.00 88.78  ? 152 TYR B CZ  1 
ATOM   2697 O  OH  . TYR B 1 133 ? -14.268 1.614  201.827 1.00 98.54  ? 152 TYR B OH  1 
ATOM   2698 N  N   . LEU B 1 134 ? -12.975 7.931  203.578 1.00 77.11  ? 153 LEU B N   1 
ATOM   2699 C  CA  . LEU B 1 134 ? -14.340 8.397  203.254 1.00 79.62  ? 153 LEU B CA  1 
ATOM   2700 C  C   . LEU B 1 134 ? -14.371 9.475  202.173 1.00 84.73  ? 153 LEU B C   1 
ATOM   2701 O  O   . LEU B 1 134 ? -15.219 9.411  201.279 1.00 93.33  ? 153 LEU B O   1 
ATOM   2702 C  CB  . LEU B 1 134 ? -15.086 8.874  204.503 1.00 80.34  ? 153 LEU B CB  1 
ATOM   2703 C  CG  . LEU B 1 134 ? -15.406 7.798  205.548 1.00 80.48  ? 153 LEU B CG  1 
ATOM   2704 C  CD1 . LEU B 1 134 ? -15.969 8.442  206.809 1.00 80.31  ? 153 LEU B CD1 1 
ATOM   2705 C  CD2 . LEU B 1 134 ? -16.368 6.749  205.003 1.00 79.51  ? 153 LEU B CD2 1 
ATOM   2706 N  N   . THR B 1 135 ? -13.457 10.446 202.249 1.00 83.21  ? 154 THR B N   1 
ATOM   2707 C  CA  . THR B 1 135 ? -13.365 11.499 201.225 1.00 84.77  ? 154 THR B CA  1 
ATOM   2708 C  C   . THR B 1 135 ? -12.907 10.921 199.873 1.00 87.11  ? 154 THR B C   1 
ATOM   2709 O  O   . THR B 1 135 ? -13.310 11.424 198.818 1.00 90.43  ? 154 THR B O   1 
ATOM   2710 C  CB  . THR B 1 135 ? -12.452 12.659 201.637 1.00 82.41  ? 154 THR B CB  1 
ATOM   2711 O  OG1 . THR B 1 135 ? -11.163 12.147 201.983 1.00 91.75  ? 154 THR B OG1 1 
ATOM   2712 C  CG2 . THR B 1 135 ? -13.045 13.406 202.814 1.00 81.24  ? 154 THR B CG2 1 
ATOM   2713 N  N   . ALA B 1 136 ? -12.057 9.889  199.917 1.00 82.93  ? 155 ALA B N   1 
ATOM   2714 C  CA  . ALA B 1 136 ? -11.604 9.182  198.713 1.00 85.90  ? 155 ALA B CA  1 
ATOM   2715 C  C   . ALA B 1 136 ? -12.754 8.377  198.084 1.00 90.22  ? 155 ALA B C   1 
ATOM   2716 O  O   . ALA B 1 136 ? -12.807 8.231  196.858 1.00 90.17  ? 155 ALA B O   1 
ATOM   2717 C  CB  . ALA B 1 136 ? -10.442 8.250  199.029 1.00 80.45  ? 155 ALA B CB  1 
ATOM   2718 N  N   . GLU B 1 137 ? -13.660 7.876  198.933 1.00 90.01  ? 156 GLU B N   1 
ATOM   2719 C  CA  . GLU B 1 137 ? -14.822 7.081  198.514 1.00 94.47  ? 156 GLU B CA  1 
ATOM   2720 C  C   . GLU B 1 137 ? -15.846 7.965  197.774 1.00 99.22  ? 156 GLU B C   1 
ATOM   2721 O  O   . GLU B 1 137 ? -16.290 7.601  196.673 1.00 98.12  ? 156 GLU B O   1 
ATOM   2722 C  CB  . GLU B 1 137 ? -15.463 6.382  199.730 1.00 97.00  ? 156 GLU B CB  1 
ATOM   2723 C  CG  . GLU B 1 137 ? -16.360 5.184  199.422 1.00 106.01 ? 156 GLU B CG  1 
ATOM   2724 C  CD  . GLU B 1 137 ? -15.614 3.916  198.987 1.00 112.29 ? 156 GLU B CD  1 
ATOM   2725 O  OE1 . GLU B 1 137 ? -14.368 3.913  198.856 1.00 111.46 ? 156 GLU B OE1 1 
ATOM   2726 O  OE2 . GLU B 1 137 ? -16.292 2.887  198.778 1.00 120.86 ? 156 GLU B OE2 1 
ATOM   2727 N  N   . GLN B 1 138 ? -16.194 9.119  198.357 1.00 98.98  ? 157 GLN B N   1 
ATOM   2728 C  CA  . GLN B 1 138 ? -17.158 10.060 197.730 1.00 106.11 ? 157 GLN B CA  1 
ATOM   2729 C  C   . GLN B 1 138 ? -16.636 10.683 196.420 1.00 112.28 ? 157 GLN B C   1 
ATOM   2730 O  O   . GLN B 1 138 ? -17.447 10.985 195.536 1.00 121.25 ? 157 GLN B O   1 
ATOM   2731 C  CB  . GLN B 1 138 ? -17.678 11.130 198.711 1.00 109.99 ? 157 GLN B CB  1 
ATOM   2732 C  CG  . GLN B 1 138 ? -16.658 12.151 199.201 1.00 113.52 ? 157 GLN B CG  1 
ATOM   2733 C  CD  . GLN B 1 138 ? -17.183 13.061 200.313 1.00 116.43 ? 157 GLN B CD  1 
ATOM   2734 O  OE1 . GLN B 1 138 ? -18.355 13.007 200.695 1.00 122.91 ? 157 GLN B OE1 1 
ATOM   2735 N  NE2 . GLN B 1 138 ? -16.304 13.908 200.836 1.00 111.47 ? 157 GLN B NE2 1 
ATOM   2736 N  N   . GLU B 1 139 ? -15.315 10.885 196.300 1.00 109.95 ? 158 GLU B N   1 
ATOM   2737 C  CA  . GLU B 1 139 ? -14.712 11.382 195.036 1.00 112.19 ? 158 GLU B CA  1 
ATOM   2738 C  C   . GLU B 1 139 ? -14.727 10.298 193.944 1.00 110.39 ? 158 GLU B C   1 
ATOM   2739 O  O   . GLU B 1 139 ? -14.813 10.627 192.756 1.00 115.13 ? 158 GLU B O   1 
ATOM   2740 C  CB  . GLU B 1 139 ? -13.288 11.922 195.211 1.00 112.54 ? 158 GLU B CB  1 
ATOM   2741 C  CG  . GLU B 1 139 ? -13.212 13.261 195.933 1.00 119.58 ? 158 GLU B CG  1 
ATOM   2742 C  CD  . GLU B 1 139 ? -11.802 13.844 196.014 1.00 124.36 ? 158 GLU B CD  1 
ATOM   2743 O  OE1 . GLU B 1 139 ? -10.942 13.527 195.158 1.00 126.66 ? 158 GLU B OE1 1 
ATOM   2744 O  OE2 . GLU B 1 139 ? -11.560 14.656 196.933 1.00 117.27 ? 158 GLU B OE2 1 
ATOM   2745 N  N   . LYS B 1 140 ? -14.612 9.027  194.349 1.00 104.89 ? 159 LYS B N   1 
ATOM   2746 C  CA  . LYS B 1 140 ? -14.672 7.879  193.427 1.00 105.05 ? 159 LYS B CA  1 
ATOM   2747 C  C   . LYS B 1 140 ? -16.094 7.742  192.853 1.00 114.46 ? 159 LYS B C   1 
ATOM   2748 O  O   . LYS B 1 140 ? -16.252 7.486  191.658 1.00 112.36 ? 159 LYS B O   1 
ATOM   2749 C  CB  . LYS B 1 140 ? -14.250 6.590  194.145 1.00 100.37 ? 159 LYS B CB  1 
ATOM   2750 C  CG  . LYS B 1 140 ? -14.112 5.346  193.284 1.00 101.72 ? 159 LYS B CG  1 
ATOM   2751 C  CD  . LYS B 1 140 ? -13.649 4.170  194.126 1.00 103.69 ? 159 LYS B CD  1 
ATOM   2752 C  CE  . LYS B 1 140 ? -13.443 2.899  193.319 1.00 111.95 ? 159 LYS B CE  1 
ATOM   2753 N  NZ  . LYS B 1 140 ? -14.694 2.367  192.711 1.00 122.59 ? 159 LYS B NZ  1 
ATOM   2754 N  N   . LYS B 1 141 ? -17.111 7.923  193.707 1.00 122.05 ? 160 LYS B N   1 
ATOM   2755 C  CA  . LYS B 1 141 ? -18.532 7.861  193.303 1.00 131.64 ? 160 LYS B CA  1 
ATOM   2756 C  C   . LYS B 1 141 ? -18.881 8.972  192.293 1.00 130.96 ? 160 LYS B C   1 
ATOM   2757 O  O   . LYS B 1 141 ? -19.555 8.700  191.297 1.00 131.42 ? 160 LYS B O   1 
ATOM   2758 C  CB  . LYS B 1 141 ? -19.462 7.938  194.529 1.00 134.19 ? 160 LYS B CB  1 
ATOM   2759 C  CG  . LYS B 1 141 ? -20.942 7.728  194.222 1.00 149.27 ? 160 LYS B CG  1 
ATOM   2760 C  CD  . LYS B 1 141 ? -21.804 7.796  195.471 1.00 151.34 ? 160 LYS B CD  1 
ATOM   2761 C  CE  . LYS B 1 141 ? -23.270 7.611  195.112 1.00 156.27 ? 160 LYS B CE  1 
ATOM   2762 N  NZ  . LYS B 1 141 ? -24.149 7.704  196.308 1.00 166.18 ? 160 LYS B NZ  1 
ATOM   2763 N  N   . LYS B 1 142 ? -18.435 10.203 192.573 1.00 127.21 ? 161 LYS B N   1 
ATOM   2764 C  CA  . LYS B 1 142 ? -18.641 11.371 191.684 1.00 132.63 ? 161 LYS B CA  1 
ATOM   2765 C  C   . LYS B 1 142 ? -17.963 11.177 190.316 1.00 132.36 ? 161 LYS B C   1 
ATOM   2766 O  O   . LYS B 1 142 ? -18.513 11.579 189.287 1.00 133.14 ? 161 LYS B O   1 
ATOM   2767 C  CB  . LYS B 1 142 ? -18.131 12.664 192.356 1.00 135.74 ? 161 LYS B CB  1 
ATOM   2768 C  CG  . LYS B 1 142 ? -18.184 13.931 191.504 1.00 142.62 ? 161 LYS B CG  1 
ATOM   2769 C  CD  . LYS B 1 142 ? -17.798 15.163 192.310 1.00 144.65 ? 161 LYS B CD  1 
ATOM   2770 C  CE  . LYS B 1 142 ? -17.635 16.386 191.416 1.00 151.45 ? 161 LYS B CE  1 
ATOM   2771 N  NZ  . LYS B 1 142 ? -18.851 16.709 190.619 1.00 149.23 ? 161 LYS B NZ  1 
ATOM   2772 N  N   . LEU B 1 143 ? -16.772 10.575 190.333 1.00 128.87 ? 162 LEU B N   1 
ATOM   2773 C  CA  . LEU B 1 143 ? -15.980 10.277 189.126 1.00 128.46 ? 162 LEU B CA  1 
ATOM   2774 C  C   . LEU B 1 143 ? -16.683 9.241  188.220 1.00 128.08 ? 162 LEU B C   1 
ATOM   2775 O  O   . LEU B 1 143 ? -16.657 9.370  186.988 1.00 129.84 ? 162 LEU B O   1 
ATOM   2776 C  CB  . LEU B 1 143 ? -14.578 9.796  189.547 1.00 127.93 ? 162 LEU B CB  1 
ATOM   2777 C  CG  . LEU B 1 143 ? -13.453 9.534  188.550 1.00 131.89 ? 162 LEU B CG  1 
ATOM   2778 C  CD1 . LEU B 1 143 ? -13.133 10.780 187.742 1.00 136.43 ? 162 LEU B CD1 1 
ATOM   2779 C  CD2 . LEU B 1 143 ? -12.220 9.066  189.312 1.00 123.76 ? 162 LEU B CD2 1 
ATOM   2780 N  N   . GLU B 1 144 ? -17.311 8.235  188.838 1.00 123.31 ? 163 GLU B N   1 
ATOM   2781 C  CA  . GLU B 1 144 ? -18.059 7.182  188.117 1.00 132.06 ? 163 GLU B CA  1 
ATOM   2782 C  C   . GLU B 1 144 ? -19.389 7.674  187.538 1.00 133.02 ? 163 GLU B C   1 
ATOM   2783 O  O   . GLU B 1 144 ? -19.761 7.265  186.429 1.00 127.57 ? 163 GLU B O   1 
ATOM   2784 C  CB  . GLU B 1 144 ? -18.310 5.972  189.024 1.00 133.54 ? 163 GLU B CB  1 
ATOM   2785 C  CG  . GLU B 1 144 ? -17.037 5.220  189.385 1.00 138.72 ? 163 GLU B CG  1 
ATOM   2786 C  CD  . GLU B 1 144 ? -17.204 4.199  190.500 1.00 141.61 ? 163 GLU B CD  1 
ATOM   2787 O  OE1 . GLU B 1 144 ? -18.345 3.905  190.925 1.00 148.46 ? 163 GLU B OE1 1 
ATOM   2788 O  OE2 . GLU B 1 144 ? -16.166 3.679  190.955 1.00 136.72 ? 163 GLU B OE2 1 
ATOM   2789 N  N   . THR B 1 145 ? -20.101 8.521  188.293 1.00 129.24 ? 164 THR B N   1 
ATOM   2790 C  CA  . THR B 1 145 ? -21.393 9.091  187.862 1.00 135.23 ? 164 THR B CA  1 
ATOM   2791 C  C   . THR B 1 145 ? -21.243 10.014 186.639 1.00 143.15 ? 164 THR B C   1 
ATOM   2792 O  O   . THR B 1 145 ? -22.087 9.972  185.734 1.00 152.96 ? 164 THR B O   1 
ATOM   2793 C  CB  . THR B 1 145 ? -22.102 9.854  189.001 1.00 132.32 ? 164 THR B CB  1 
ATOM   2794 O  OG1 . THR B 1 145 ? -22.217 9.002  190.145 1.00 131.32 ? 164 THR B OG1 1 
ATOM   2795 C  CG2 . THR B 1 145 ? -23.501 10.315 188.576 1.00 137.09 ? 164 THR B CG2 1 
ATOM   2796 N  N   . ASP B 1 146 ? -20.186 10.837 186.625 1.00 140.74 ? 165 ASP B N   1 
ATOM   2797 C  CA  . ASP B 1 146 ? -19.891 11.740 185.489 1.00 144.30 ? 165 ASP B CA  1 
ATOM   2798 C  C   . ASP B 1 146 ? -19.589 10.952 184.212 1.00 144.50 ? 165 ASP B C   1 
ATOM   2799 O  O   . ASP B 1 146 ? -20.007 11.366 183.125 1.00 153.85 ? 165 ASP B O   1 
ATOM   2800 C  CB  . ASP B 1 146 ? -18.738 12.708 185.810 1.00 142.20 ? 165 ASP B CB  1 
ATOM   2801 C  CG  . ASP B 1 146 ? -19.099 13.739 186.880 1.00 140.28 ? 165 ASP B CG  1 
ATOM   2802 O  OD1 . ASP B 1 146 ? -20.297 13.925 187.197 1.00 137.35 ? 165 ASP B OD1 1 
ATOM   2803 O  OD2 . ASP B 1 146 ? -18.165 14.390 187.398 1.00 144.60 ? 165 ASP B OD2 1 
ATOM   2804 N  N   . TYR B 1 147 ? -18.869 9.833  184.352 1.00 138.29 ? 166 TYR B N   1 
ATOM   2805 C  CA  . TYR B 1 147 ? -18.588 8.931  183.226 1.00 140.32 ? 166 TYR B CA  1 
ATOM   2806 C  C   . TYR B 1 147 ? -19.900 8.232  182.798 1.00 143.95 ? 166 TYR B C   1 
ATOM   2807 O  O   . TYR B 1 147 ? -20.087 7.960  181.617 1.00 144.12 ? 166 TYR B O   1 
ATOM   2808 C  CB  . TYR B 1 147 ? -17.499 7.902  183.570 1.00 135.20 ? 166 TYR B CB  1 
ATOM   2809 C  CG  . TYR B 1 147 ? -17.108 7.031  182.396 1.00 140.74 ? 166 TYR B CG  1 
ATOM   2810 C  CD1 . TYR B 1 147 ? -16.195 7.488  181.435 1.00 142.76 ? 166 TYR B CD1 1 
ATOM   2811 C  CD2 . TYR B 1 147 ? -17.660 5.750  182.228 1.00 142.95 ? 166 TYR B CD2 1 
ATOM   2812 C  CE1 . TYR B 1 147 ? -15.842 6.697  180.340 1.00 148.84 ? 166 TYR B CE1 1 
ATOM   2813 C  CE2 . TYR B 1 147 ? -17.309 4.948  181.142 1.00 145.56 ? 166 TYR B CE2 1 
ATOM   2814 C  CZ  . TYR B 1 147 ? -16.404 5.426  180.196 1.00 148.92 ? 166 TYR B CZ  1 
ATOM   2815 O  OH  . TYR B 1 147 ? -16.048 4.644  179.121 1.00 149.37 ? 166 TYR B OH  1 
ATOM   2816 N  N   . LYS B 1 148 ? -20.780 7.941  183.766 1.00 145.17 ? 167 LYS B N   1 
ATOM   2817 C  CA  . LYS B 1 148 ? -22.104 7.340  183.512 1.00 148.66 ? 167 LYS B CA  1 
ATOM   2818 C  C   . LYS B 1 148 ? -23.037 8.245  182.673 1.00 155.24 ? 167 LYS B C   1 
ATOM   2819 O  O   . LYS B 1 148 ? -23.931 7.731  181.999 1.00 156.58 ? 167 LYS B O   1 
ATOM   2820 C  CB  . LYS B 1 148 ? -22.795 6.958  184.831 1.00 142.49 ? 167 LYS B CB  1 
ATOM   2821 N  N   . LYS B 1 149 ? -22.836 9.572  182.732 1.00 158.64 ? 168 LYS B N   1 
ATOM   2822 C  CA  . LYS B 1 149 ? -23.609 10.544 181.934 1.00 164.65 ? 168 LYS B CA  1 
ATOM   2823 C  C   . LYS B 1 149 ? -23.168 10.402 180.470 1.00 172.98 ? 168 LYS B C   1 
ATOM   2824 O  O   . LYS B 1 149 ? -22.006 10.659 180.141 1.00 174.10 ? 168 LYS B O   1 
ATOM   2825 C  CB  . LYS B 1 149 ? -23.376 11.975 182.426 1.00 163.34 ? 168 LYS B CB  1 
ATOM   2826 N  N   . LEU B 1 150 ? -24.105 10.014 179.603 1.00 179.15 ? 169 LEU B N   1 
ATOM   2827 C  CA  . LEU B 1 150 ? -23.808 9.720  178.193 1.00 188.70 ? 169 LEU B CA  1 
ATOM   2828 C  C   . LEU B 1 150 ? -23.616 10.875 177.191 1.00 198.02 ? 169 LEU B C   1 
ATOM   2829 O  O   . LEU B 1 150 ? -24.370 11.850 177.167 1.00 203.88 ? 169 LEU B O   1 
ATOM   2830 C  CB  . LEU B 1 150 ? -24.876 8.762  177.622 1.00 193.95 ? 169 LEU B CB  1 
ATOM   2831 C  CG  . LEU B 1 150 ? -24.761 8.218  176.179 1.00 195.54 ? 169 LEU B CG  1 
ATOM   2832 C  CD1 . LEU B 1 150 ? -25.655 7.009  176.027 1.00 197.90 ? 169 LEU B CD1 1 
ATOM   2833 C  CD2 . LEU B 1 150 ? -25.085 9.213  175.068 1.00 197.83 ? 169 LEU B CD2 1 
ATOM   2834 N  N   . SER B 1 151 ? -22.576 10.700 176.376 1.00 199.99 ? 170 SER B N   1 
ATOM   2835 C  CA  . SER B 1 151 ? -22.224 11.530 175.213 1.00 198.19 ? 170 SER B CA  1 
ATOM   2836 C  C   . SER B 1 151 ? -22.058 10.544 174.031 1.00 204.49 ? 170 SER B C   1 
ATOM   2837 O  O   . SER B 1 151 ? -22.678 10.720 172.978 1.00 206.09 ? 170 SER B O   1 
ATOM   2838 C  CB  . SER B 1 151 ? -20.941 12.321 175.452 1.00 196.83 ? 170 SER B CB  1 
ATOM   2839 O  OG  . SER B 1 151 ? -21.088 13.212 176.545 1.00 196.08 ? 170 SER B OG  1 
ATOM   2840 N  N   . SER B 1 152 ? -21.209 9.525  174.235 1.00 199.24 ? 171 SER B N   1 
ATOM   2841 C  CA  . SER B 1 152 ? -20.939 8.419  173.295 1.00 205.07 ? 171 SER B CA  1 
ATOM   2842 C  C   . SER B 1 152 ? -20.802 7.033  173.993 1.00 200.23 ? 171 SER B C   1 
ATOM   2843 O  O   . SER B 1 152 ? -21.587 6.135  173.670 1.00 202.90 ? 171 SER B O   1 
ATOM   2844 C  CB  . SER B 1 152 ? -19.752 8.723  172.377 1.00 205.77 ? 171 SER B CB  1 
ATOM   2845 O  OG  . SER B 1 152 ? -20.093 9.718  171.423 1.00 200.01 ? 171 SER B OG  1 
ATOM   2846 N  N   . PRO B 1 153 ? -19.805 6.826  174.903 1.00 199.27 ? 172 PRO B N   1 
ATOM   2847 C  CA  . PRO B 1 153 ? -18.712 7.668  175.403 1.00 192.64 ? 172 PRO B CA  1 
ATOM   2848 C  C   . PRO B 1 153 ? -17.396 7.431  174.660 1.00 191.99 ? 172 PRO B C   1 
ATOM   2849 O  O   . PRO B 1 153 ? -17.081 6.292  174.297 1.00 191.17 ? 172 PRO B O   1 
ATOM   2850 C  CB  . PRO B 1 153 ? -18.588 7.228  176.860 1.00 182.34 ? 172 PRO B CB  1 
ATOM   2851 C  CG  . PRO B 1 153 ? -18.887 5.776  176.816 1.00 184.45 ? 172 PRO B CG  1 
ATOM   2852 C  CD  . PRO B 1 153 ? -19.885 5.581  175.705 1.00 195.25 ? 172 PRO B CD  1 
ATOM   2853 N  N   . THR B 1 154 ? -16.641 8.509  174.457 1.00 189.67 ? 173 THR B N   1 
ATOM   2854 C  CA  . THR B 1 154 ? -15.356 8.454  173.764 1.00 187.63 ? 173 THR B CA  1 
ATOM   2855 C  C   . THR B 1 154 ? -14.327 7.823  174.698 1.00 184.02 ? 173 THR B C   1 
ATOM   2856 O  O   . THR B 1 154 ? -14.280 8.166  175.880 1.00 180.26 ? 173 THR B O   1 
ATOM   2857 C  CB  . THR B 1 154 ? -14.883 9.868  173.354 1.00 191.35 ? 173 THR B CB  1 
ATOM   2858 O  OG1 . THR B 1 154 ? -15.905 10.512 172.583 1.00 194.25 ? 173 THR B OG1 1 
ATOM   2859 C  CG2 . THR B 1 154 ? -13.600 9.813  172.534 1.00 195.45 ? 173 THR B CG2 1 
ATOM   2860 N  N   . LYS B 1 155 ? -13.511 6.907  174.169 1.00 180.92 ? 174 LYS B N   1 
ATOM   2861 C  CA  . LYS B 1 155 ? -12.455 6.230  174.976 1.00 180.24 ? 174 LYS B CA  1 
ATOM   2862 C  C   . LYS B 1 155 ? -11.282 7.135  175.436 1.00 180.02 ? 174 LYS B C   1 
ATOM   2863 O  O   . LYS B 1 155 ? -10.458 6.711  176.254 1.00 166.86 ? 174 LYS B O   1 
ATOM   2864 C  CB  . LYS B 1 155 ? -12.003 4.880  174.374 1.00 177.40 ? 174 LYS B CB  1 
ATOM   2865 C  CG  . LYS B 1 155 ? -11.628 4.858  172.908 1.00 182.54 ? 174 LYS B CG  1 
ATOM   2866 C  CD  . LYS B 1 155 ? -11.402 3.441  172.418 1.00 186.04 ? 174 LYS B CD  1 
ATOM   2867 C  CE  . LYS B 1 155 ? -11.350 3.392  170.898 1.00 193.82 ? 174 LYS B CE  1 
ATOM   2868 N  NZ  . LYS B 1 155 ? -12.615 3.736  170.184 1.00 192.30 ? 174 LYS B NZ  1 
HETATM 2869 N  N   . MSE B 1 156 ? -11.219 8.365  174.906 1.00 188.89 ? 175 MSE B N   1 
HETATM 2870 C  CA  . MSE B 1 156 ? -10.278 9.408  175.351 1.00 191.49 ? 175 MSE B CA  1 
HETATM 2871 C  C   . MSE B 1 156 ? -10.749 9.836  176.757 1.00 184.89 ? 175 MSE B C   1 
HETATM 2872 O  O   . MSE B 1 156 ? -9.922  10.102 177.631 1.00 183.33 ? 175 MSE B O   1 
HETATM 2873 C  CB  . MSE B 1 156 ? -10.306 10.620 174.403 1.00 212.95 ? 175 MSE B CB  1 
HETATM 2874 C  CG  . MSE B 1 156 ? -9.215  11.677 174.604 1.00 223.85 ? 175 MSE B CG  1 
HETATM 2875 SE SE  . MSE B 1 156 ? -7.427  11.070 174.083 0.75 244.13 ? 175 MSE B SE  1 
HETATM 2876 C  CE  . MSE B 1 156 ? -6.481  12.771 174.214 1.00 237.48 ? 175 MSE B CE  1 
ATOM   2877 N  N   . GLN B 1 157 ? -12.076 9.912  176.950 1.00 177.88 ? 176 GLN B N   1 
ATOM   2878 C  CA  . GLN B 1 157 ? -12.696 10.246 178.250 1.00 170.74 ? 176 GLN B CA  1 
ATOM   2879 C  C   . GLN B 1 157 ? -12.535 9.080  179.251 1.00 166.70 ? 176 GLN B C   1 
ATOM   2880 O  O   . GLN B 1 157 ? -12.459 9.317  180.463 1.00 155.95 ? 176 GLN B O   1 
ATOM   2881 C  CB  . GLN B 1 157 ? -14.187 10.605 178.106 1.00 171.71 ? 176 GLN B CB  1 
ATOM   2882 C  CG  . GLN B 1 157 ? -14.492 11.761 177.155 1.00 177.93 ? 176 GLN B CG  1 
ATOM   2883 C  CD  . GLN B 1 157 ? -15.982 11.994 176.941 1.00 180.33 ? 176 GLN B CD  1 
ATOM   2884 O  OE1 . GLN B 1 157 ? -16.817 11.633 177.772 1.00 185.62 ? 176 GLN B OE1 1 
ATOM   2885 N  NE2 . GLN B 1 157 ? -16.317 12.616 175.820 1.00 176.71 ? 176 GLN B NE2 1 
ATOM   2886 N  N   . TYR B 1 158 ? -12.523 7.838  178.742 1.00 166.22 ? 177 TYR B N   1 
ATOM   2887 C  CA  . TYR B 1 158 ? -12.309 6.622  179.560 1.00 160.98 ? 177 TYR B CA  1 
ATOM   2888 C  C   . TYR B 1 158 ? -10.890 6.596  180.176 1.00 159.16 ? 177 TYR B C   1 
ATOM   2889 O  O   . TYR B 1 158 ? -10.710 6.094  181.293 1.00 151.26 ? 177 TYR B O   1 
ATOM   2890 C  CB  . TYR B 1 158 ? -12.607 5.341  178.746 1.00 159.97 ? 177 TYR B CB  1 
ATOM   2891 C  CG  . TYR B 1 158 ? -12.390 4.042  179.505 1.00 156.79 ? 177 TYR B CG  1 
ATOM   2892 C  CD1 . TYR B 1 158 ? -13.220 3.691  180.584 1.00 155.70 ? 177 TYR B CD1 1 
ATOM   2893 C  CD2 . TYR B 1 158 ? -11.368 3.148  179.142 1.00 154.81 ? 177 TYR B CD2 1 
ATOM   2894 C  CE1 . TYR B 1 158 ? -13.028 2.505  181.294 1.00 153.01 ? 177 TYR B CE1 1 
ATOM   2895 C  CE2 . TYR B 1 158 ? -11.171 1.954  179.842 1.00 157.00 ? 177 TYR B CE2 1 
ATOM   2896 C  CZ  . TYR B 1 158 ? -12.001 1.636  180.920 1.00 154.94 ? 177 TYR B CZ  1 
ATOM   2897 O  OH  . TYR B 1 158 ? -11.818 0.462  181.618 1.00 150.26 ? 177 TYR B OH  1 
ATOM   2898 N  N   . ALA B 1 159 ? -9.900  7.120  179.443 1.00 161.75 ? 178 ALA B N   1 
ATOM   2899 C  CA  . ALA B 1 159 ? -8.515  7.238  179.939 1.00 155.89 ? 178 ALA B CA  1 
ATOM   2900 C  C   . ALA B 1 159 ? -8.461  8.265  181.078 1.00 152.67 ? 178 ALA B C   1 
ATOM   2901 O  O   . ALA B 1 159 ? -7.764  8.049  182.073 1.00 148.07 ? 178 ALA B O   1 
ATOM   2902 C  CB  . ALA B 1 159 ? -7.563  7.635  178.822 1.00 162.19 ? 178 ALA B CB  1 
ATOM   2903 N  N   . ARG B 1 160 ? -9.198  9.371  180.920 1.00 152.26 ? 179 ARG B N   1 
ATOM   2904 C  CA  . ARG B 1 160 ? -9.307  10.420 181.953 1.00 149.90 ? 179 ARG B CA  1 
ATOM   2905 C  C   . ARG B 1 160 ? -10.064 9.887  183.191 1.00 146.42 ? 179 ARG B C   1 
ATOM   2906 O  O   . ARG B 1 160 ? -9.815  10.351 184.314 1.00 140.65 ? 179 ARG B O   1 
ATOM   2907 C  CB  . ARG B 1 160 ? -9.976  11.681 181.384 1.00 155.74 ? 179 ARG B CB  1 
ATOM   2908 C  CG  . ARG B 1 160 ? -9.933  12.900 182.300 1.00 158.21 ? 179 ARG B CG  1 
ATOM   2909 C  CD  . ARG B 1 160 ? -10.508 14.163 181.663 1.00 166.33 ? 179 ARG B CD  1 
ATOM   2910 N  NE  . ARG B 1 160 ? -9.772  14.617 180.469 1.00 172.28 ? 179 ARG B NE  1 
ATOM   2911 C  CZ  . ARG B 1 160 ? -10.039 14.308 179.189 1.00 184.73 ? 179 ARG B CZ  1 
ATOM   2912 N  NH1 . ARG B 1 160 ? -11.052 13.502 178.841 1.00 189.09 ? 179 ARG B NH1 1 
ATOM   2913 N  NH2 . ARG B 1 160 ? -9.263  14.812 178.223 1.00 190.53 ? 179 ARG B NH2 1 
ATOM   2914 N  N   . TYR B 1 161 ? -10.991 8.942  182.973 1.00 142.86 ? 180 TYR B N   1 
ATOM   2915 C  CA  . TYR B 1 161 ? -11.732 8.272  184.058 1.00 139.48 ? 180 TYR B CA  1 
ATOM   2916 C  C   . TYR B 1 161 ? -10.769 7.376  184.855 1.00 135.64 ? 180 TYR B C   1 
ATOM   2917 O  O   . TYR B 1 161 ? -10.681 7.522  186.076 1.00 124.58 ? 180 TYR B O   1 
ATOM   2918 C  CB  . TYR B 1 161 ? -12.961 7.497  183.524 1.00 141.40 ? 180 TYR B CB  1 
ATOM   2919 C  CG  . TYR B 1 161 ? -13.533 6.440  184.459 1.00 141.08 ? 180 TYR B CG  1 
ATOM   2920 C  CD1 . TYR B 1 161 ? -14.285 6.793  185.593 1.00 142.95 ? 180 TYR B CD1 1 
ATOM   2921 C  CD2 . TYR B 1 161 ? -13.335 5.073  184.198 1.00 143.46 ? 180 TYR B CD2 1 
ATOM   2922 C  CE1 . TYR B 1 161 ? -14.806 5.815  186.446 1.00 140.76 ? 180 TYR B CE1 1 
ATOM   2923 C  CE2 . TYR B 1 161 ? -13.854 4.090  185.038 1.00 143.89 ? 180 TYR B CE2 1 
ATOM   2924 C  CZ  . TYR B 1 161 ? -14.587 4.459  186.160 1.00 142.44 ? 180 TYR B CZ  1 
ATOM   2925 O  OH  . TYR B 1 161 ? -15.092 3.477  186.981 1.00 138.72 ? 180 TYR B OH  1 
ATOM   2926 N  N   . ARG B 1 162 ? -10.052 6.478  184.165 1.00 137.77 ? 181 ARG B N   1 
ATOM   2927 C  CA  . ARG B 1 162 ? -9.060  5.589  184.825 1.00 136.41 ? 181 ARG B CA  1 
ATOM   2928 C  C   . ARG B 1 162 ? -7.872  6.344  185.446 1.00 131.66 ? 181 ARG B C   1 
ATOM   2929 O  O   . ARG B 1 162 ? -7.398  5.958  186.527 1.00 127.74 ? 181 ARG B O   1 
ATOM   2930 C  CB  . ARG B 1 162 ? -8.572  4.444  183.911 1.00 136.26 ? 181 ARG B CB  1 
ATOM   2931 C  CG  . ARG B 1 162 ? -9.484  3.221  183.836 1.00 141.86 ? 181 ARG B CG  1 
ATOM   2932 C  CD  . ARG B 1 162 ? -9.564  2.497  185.180 1.00 144.32 ? 181 ARG B CD  1 
ATOM   2933 N  NE  . ARG B 1 162 ? -10.193 1.175  185.112 1.00 153.79 ? 181 ARG B NE  1 
ATOM   2934 C  CZ  . ARG B 1 162 ? -9.570  0.008  184.890 1.00 165.16 ? 181 ARG B CZ  1 
ATOM   2935 N  NH1 . ARG B 1 162 ? -8.247  -0.073 184.680 1.00 167.12 ? 181 ARG B NH1 1 
ATOM   2936 N  NH2 . ARG B 1 162 ? -10.292 -1.116 184.867 1.00 172.66 ? 181 ARG B NH2 1 
ATOM   2937 N  N   . ASP B 1 163 ? -7.409  7.402  184.769 1.00 127.45 ? 182 ASP B N   1 
ATOM   2938 C  CA  . ASP B 1 163 ? -6.328  8.261  185.290 1.00 124.93 ? 182 ASP B CA  1 
ATOM   2939 C  C   . ASP B 1 163 ? -6.772  9.011  186.565 1.00 119.49 ? 182 ASP B C   1 
ATOM   2940 O  O   . ASP B 1 163 ? -5.947  9.265  187.439 1.00 113.58 ? 182 ASP B O   1 
ATOM   2941 C  CB  . ASP B 1 163 ? -5.847  9.269  184.243 1.00 121.96 ? 182 ASP B CB  1 
ATOM   2942 N  N   . GLY B 1 164 ? -8.061  9.370  186.642 1.00 119.22 ? 183 GLY B N   1 
ATOM   2943 C  CA  . GLY B 1 164 ? -8.653  10.043 187.803 1.00 114.10 ? 183 GLY B CA  1 
ATOM   2944 C  C   . GLY B 1 164 ? -8.686  9.141  189.031 1.00 112.79 ? 183 GLY B C   1 
ATOM   2945 O  O   . GLY B 1 164 ? -8.420  9.606  190.139 1.00 104.18 ? 183 GLY B O   1 
ATOM   2946 N  N   . LEU B 1 165 ? -9.025  7.862  188.825 1.00 115.71 ? 184 LEU B N   1 
ATOM   2947 C  CA  . LEU B 1 165 ? -9.046  6.843  189.894 1.00 114.27 ? 184 LEU B CA  1 
ATOM   2948 C  C   . LEU B 1 165 ? -7.634  6.566  190.439 1.00 111.14 ? 184 LEU B C   1 
ATOM   2949 O  O   . LEU B 1 165 ? -7.464  6.366  191.651 1.00 104.51 ? 184 LEU B O   1 
ATOM   2950 C  CB  . LEU B 1 165 ? -9.653  5.524  189.383 1.00 116.70 ? 184 LEU B CB  1 
ATOM   2951 C  CG  . LEU B 1 165 ? -11.118 5.518  188.926 1.00 117.70 ? 184 LEU B CG  1 
ATOM   2952 C  CD1 . LEU B 1 165 ? -11.458 4.211  188.222 1.00 121.10 ? 184 LEU B CD1 1 
ATOM   2953 C  CD2 . LEU B 1 165 ? -12.062 5.771  190.092 1.00 116.04 ? 184 LEU B CD2 1 
ATOM   2954 N  N   . SER B 1 166 ? -6.644  6.556  189.537 1.00 112.68 ? 185 SER B N   1 
ATOM   2955 C  CA  . SER B 1 166 ? -5.231  6.323  189.872 1.00 116.78 ? 185 SER B CA  1 
ATOM   2956 C  C   . SER B 1 166 ? -4.673  7.485  190.702 1.00 116.68 ? 185 SER B C   1 
ATOM   2957 O  O   . SER B 1 166 ? -4.103  7.251  191.775 1.00 107.17 ? 185 SER B O   1 
ATOM   2958 C  CB  . SER B 1 166 ? -4.395  6.112  188.602 1.00 129.42 ? 185 SER B CB  1 
ATOM   2959 O  OG  . SER B 1 166 ? -3.055  5.772  188.916 1.00 138.65 ? 185 SER B OG  1 
ATOM   2960 N  N   . LYS B 1 167 ? -4.848  8.720  190.212 1.00 118.36 ? 186 LYS B N   1 
ATOM   2961 C  CA  . LYS B 1 167 ? -4.410  9.933  190.945 1.00 116.64 ? 186 LYS B CA  1 
ATOM   2962 C  C   . LYS B 1 167 ? -5.113  10.059 192.292 1.00 112.56 ? 186 LYS B C   1 
ATOM   2963 O  O   . LYS B 1 167 ? -4.486  10.452 193.276 1.00 112.10 ? 186 LYS B O   1 
ATOM   2964 C  CB  . LYS B 1 167 ? -4.612  11.233 190.148 1.00 127.66 ? 186 LYS B CB  1 
ATOM   2965 C  CG  . LYS B 1 167 ? -3.610  11.452 189.024 1.00 134.59 ? 186 LYS B CG  1 
ATOM   2966 C  CD  . LYS B 1 167 ? -3.704  12.862 188.460 1.00 135.84 ? 186 LYS B CD  1 
ATOM   2967 C  CE  . LYS B 1 167 ? -2.589  13.139 187.466 1.00 147.53 ? 186 LYS B CE  1 
ATOM   2968 N  NZ  . LYS B 1 167 ? -2.645  14.531 186.943 1.00 157.21 ? 186 LYS B NZ  1 
ATOM   2969 N  N   . LEU B 1 168 ? -6.407  9.731  192.322 1.00 107.59 ? 187 LEU B N   1 
ATOM   2970 C  CA  . LEU B 1 168 ? -7.196  9.759  193.560 1.00 102.89 ? 187 LEU B CA  1 
ATOM   2971 C  C   . LEU B 1 168 ? -6.714  8.690  194.567 1.00 97.53  ? 187 LEU B C   1 
ATOM   2972 O  O   . LEU B 1 168 ? -6.810  8.919  195.767 1.00 97.14  ? 187 LEU B O   1 
ATOM   2973 C  CB  . LEU B 1 168 ? -8.702  9.647  193.252 1.00 102.65 ? 187 LEU B CB  1 
ATOM   2974 C  CG  . LEU B 1 168 ? -9.765  9.637  194.362 1.00 101.45 ? 187 LEU B CG  1 
ATOM   2975 C  CD1 . LEU B 1 168 ? -9.955  8.257  194.966 1.00 105.57 ? 187 LEU B CD1 1 
ATOM   2976 C  CD2 . LEU B 1 168 ? -9.489  10.686 195.434 1.00 91.32  ? 187 LEU B CD2 1 
ATOM   2977 N  N   . PHE B 1 169 ? -6.181  7.560  194.074 1.00 98.30  ? 188 PHE B N   1 
ATOM   2978 C  CA  . PHE B 1 169 ? -5.660  6.484  194.924 1.00 95.57  ? 188 PHE B CA  1 
ATOM   2979 C  C   . PHE B 1 169 ? -4.346  6.874  195.606 1.00 100.50 ? 188 PHE B C   1 
ATOM   2980 O  O   . PHE B 1 169 ? -4.199  6.669  196.817 1.00 90.23  ? 188 PHE B O   1 
ATOM   2981 C  CB  . PHE B 1 169 ? -5.489  5.151  194.168 1.00 99.93  ? 188 PHE B CB  1 
ATOM   2982 C  CG  . PHE B 1 169 ? -5.156  3.993  195.073 1.00 104.40 ? 188 PHE B CG  1 
ATOM   2983 C  CD1 . PHE B 1 169 ? -6.170  3.193  195.610 1.00 105.70 ? 188 PHE B CD1 1 
ATOM   2984 C  CD2 . PHE B 1 169 ? -3.828  3.729  195.441 1.00 109.38 ? 188 PHE B CD2 1 
ATOM   2985 C  CE1 . PHE B 1 169 ? -5.864  2.145  196.482 1.00 105.01 ? 188 PHE B CE1 1 
ATOM   2986 C  CE2 . PHE B 1 169 ? -3.518  2.689  196.313 1.00 106.77 ? 188 PHE B CE2 1 
ATOM   2987 C  CZ  . PHE B 1 169 ? -4.537  1.894  196.834 1.00 103.20 ? 188 PHE B CZ  1 
ATOM   2988 N  N   . THR B 1 170 ? -3.390  7.390  194.831 1.00 104.02 ? 189 THR B N   1 
ATOM   2989 C  CA  . THR B 1 170 ? -2.094  7.830  195.385 1.00 106.59 ? 189 THR B CA  1 
ATOM   2990 C  C   . THR B 1 170 ? -2.205  9.130  196.217 1.00 106.07 ? 189 THR B C   1 
ATOM   2991 O  O   . THR B 1 170 ? -1.333  9.392  197.044 1.00 110.85 ? 189 THR B O   1 
ATOM   2992 C  CB  . THR B 1 170 ? -1.019  7.982  194.289 1.00 111.76 ? 189 THR B CB  1 
ATOM   2993 O  OG1 . THR B 1 170 ? -1.450  8.938  193.316 1.00 115.80 ? 189 THR B OG1 1 
ATOM   2994 C  CG2 . THR B 1 170 ? -0.759  6.642  193.598 1.00 112.12 ? 189 THR B CG2 1 
ATOM   2995 N  N   . THR B 1 171 ? -3.266  9.920  195.998 1.00 105.72 ? 190 THR B N   1 
ATOM   2996 C  CA  . THR B 1 171 ? -3.522  11.174 196.731 1.00 100.82 ? 190 THR B CA  1 
ATOM   2997 C  C   . THR B 1 171 ? -4.256  10.936 198.054 1.00 101.40 ? 190 THR B C   1 
ATOM   2998 O  O   . THR B 1 171 ? -3.853  11.499 199.085 1.00 103.60 ? 190 THR B O   1 
ATOM   2999 C  CB  . THR B 1 171 ? -4.332  12.176 195.862 1.00 97.31  ? 190 THR B CB  1 
ATOM   3000 O  OG1 . THR B 1 171 ? -3.548  12.532 194.727 1.00 103.97 ? 190 THR B OG1 1 
ATOM   3001 C  CG2 . THR B 1 171 ? -4.688  13.463 196.613 1.00 98.61  ? 190 THR B CG2 1 
ATOM   3002 N  N   . ARG B 1 172 ? -5.317  10.117 198.026 1.00 94.32  ? 191 ARG B N   1 
ATOM   3003 C  CA  . ARG B 1 172 ? -6.137  9.854  199.223 1.00 89.79  ? 191 ARG B CA  1 
ATOM   3004 C  C   . ARG B 1 172 ? -6.141  8.440  199.784 1.00 84.17  ? 191 ARG B C   1 
ATOM   3005 O  O   . ARG B 1 172 ? -5.974  8.282  200.997 1.00 77.56  ? 191 ARG B O   1 
ATOM   3006 C  CB  . ARG B 1 172 ? -7.569  10.369 199.033 1.00 93.88  ? 191 ARG B CB  1 
ATOM   3007 C  CG  . ARG B 1 172 ? -7.604  11.868 198.761 1.00 103.02 ? 191 ARG B CG  1 
ATOM   3008 C  CD  . ARG B 1 172 ? -8.764  12.570 199.441 1.00 112.71 ? 191 ARG B CD  1 
ATOM   3009 N  NE  . ARG B 1 172 ? -8.644  14.024 199.277 1.00 119.86 ? 191 ARG B NE  1 
ATOM   3010 C  CZ  . ARG B 1 172 ? -9.159  14.964 200.085 1.00 120.84 ? 191 ARG B CZ  1 
ATOM   3011 N  NH1 . ARG B 1 172 ? -9.821  14.659 201.210 1.00 113.11 ? 191 ARG B NH1 1 
ATOM   3012 N  NH2 . ARG B 1 172 ? -8.962  16.253 199.787 1.00 121.43 ? 191 ARG B NH2 1 
ATOM   3013 N  N   . TYR B 1 173 ? -6.341  7.416  198.952 1.00 81.28  ? 192 TYR B N   1 
ATOM   3014 C  CA  . TYR B 1 173 ? -6.345  6.030  199.471 1.00 81.88  ? 192 TYR B CA  1 
ATOM   3015 C  C   . TYR B 1 173 ? -4.991  5.622  200.099 1.00 83.34  ? 192 TYR B C   1 
ATOM   3016 O  O   . TYR B 1 173 ? -4.990  4.948  201.140 1.00 78.15  ? 192 TYR B O   1 
ATOM   3017 C  CB  . TYR B 1 173 ? -6.823  4.997  198.447 1.00 86.64  ? 192 TYR B CB  1 
ATOM   3018 C  CG  . TYR B 1 173 ? -8.321  4.995  198.157 1.00 87.68  ? 192 TYR B CG  1 
ATOM   3019 C  CD1 . TYR B 1 173 ? -9.239  4.527  199.110 1.00 86.08  ? 192 TYR B CD1 1 
ATOM   3020 C  CD2 . TYR B 1 173 ? -8.823  5.385  196.907 1.00 89.13  ? 192 TYR B CD2 1 
ATOM   3021 C  CE1 . TYR B 1 173 ? -10.610 4.498  198.842 1.00 90.29  ? 192 TYR B CE1 1 
ATOM   3022 C  CE2 . TYR B 1 173 ? -10.187 5.351  196.626 1.00 92.46  ? 192 TYR B CE2 1 
ATOM   3023 C  CZ  . TYR B 1 173 ? -11.078 4.907  197.587 1.00 95.56  ? 192 TYR B CZ  1 
ATOM   3024 O  OH  . TYR B 1 173 ? -12.417 4.885  197.270 1.00 100.51 ? 192 TYR B OH  1 
ATOM   3025 N  N   . GLU B 1 174 ? -3.874  6.067  199.500 1.00 80.85  ? 193 GLU B N   1 
ATOM   3026 C  CA  . GLU B 1 174 ? -2.512  5.800  200.025 1.00 82.04  ? 193 GLU B CA  1 
ATOM   3027 C  C   . GLU B 1 174 ? -2.274  6.463  201.402 1.00 82.53  ? 193 GLU B C   1 
ATOM   3028 O  O   . GLU B 1 174 ? -1.722  5.825  202.311 1.00 77.88  ? 193 GLU B O   1 
ATOM   3029 C  CB  . GLU B 1 174 ? -1.434  6.247  199.034 1.00 83.02  ? 193 GLU B CB  1 
ATOM   3030 N  N   . LYS B 1 175 ? -2.684  7.731  201.544 1.00 81.99  ? 194 LYS B N   1 
ATOM   3031 C  CA  . LYS B 1 175 ? -2.580  8.461  202.818 1.00 80.58  ? 194 LYS B CA  1 
ATOM   3032 C  C   . LYS B 1 175 ? -3.441  7.779  203.888 1.00 79.17  ? 194 LYS B C   1 
ATOM   3033 O  O   . LYS B 1 175 ? -3.037  7.710  205.056 1.00 75.33  ? 194 LYS B O   1 
ATOM   3034 C  CB  . LYS B 1 175 ? -2.965  9.942  202.689 1.00 83.84  ? 194 LYS B CB  1 
ATOM   3035 C  CG  . LYS B 1 175 ? -2.003  10.769 201.849 1.00 96.30  ? 194 LYS B CG  1 
ATOM   3036 C  CD  . LYS B 1 175 ? -2.367  12.250 201.866 1.00 105.19 ? 194 LYS B CD  1 
ATOM   3037 C  CE  . LYS B 1 175 ? -1.480  13.060 200.926 1.00 111.92 ? 194 LYS B CE  1 
ATOM   3038 N  NZ  . LYS B 1 175 ? -1.863  14.501 200.891 1.00 112.60 ? 194 LYS B NZ  1 
ATOM   3039 N  N   . ALA B 1 176 ? -4.611  7.271  203.477 1.00 74.85  ? 195 ALA B N   1 
ATOM   3040 C  CA  . ALA B 1 176 ? -5.496  6.530  204.373 1.00 73.18  ? 195 ALA B CA  1 
ATOM   3041 C  C   . ALA B 1 176 ? -4.840  5.209  204.817 1.00 73.86  ? 195 ALA B C   1 
ATOM   3042 O  O   . ALA B 1 176 ? -4.902  4.868  205.990 1.00 68.10  ? 195 ALA B O   1 
ATOM   3043 C  CB  . ALA B 1 176 ? -6.854  6.286  203.738 1.00 69.25  ? 195 ALA B CB  1 
ATOM   3044 N  N   . ARG B 1 177 ? -4.176  4.505  203.897 1.00 76.14  ? 196 ARG B N   1 
ATOM   3045 C  CA  . ARG B 1 177 ? -3.491  3.237  204.236 1.00 81.31  ? 196 ARG B CA  1 
ATOM   3046 C  C   . ARG B 1 177 ? -2.312  3.460  205.213 1.00 77.02  ? 196 ARG B C   1 
ATOM   3047 O  O   . ARG B 1 177 ? -2.136  2.670  206.137 1.00 72.38  ? 196 ARG B O   1 
ATOM   3048 C  CB  . ARG B 1 177 ? -2.936  2.530  202.997 1.00 85.21  ? 196 ARG B CB  1 
ATOM   3049 C  CG  . ARG B 1 177 ? -2.715  1.031  203.189 1.00 95.19  ? 196 ARG B CG  1 
ATOM   3050 C  CD  . ARG B 1 177 ? -1.601  0.454  202.316 1.00 98.66  ? 196 ARG B CD  1 
ATOM   3051 N  NE  . ARG B 1 177 ? -1.531  0.972  200.951 1.00 102.13 ? 196 ARG B NE  1 
ATOM   3052 C  CZ  . ARG B 1 177 ? -1.968  0.392  199.822 1.00 113.06 ? 196 ARG B CZ  1 
ATOM   3053 N  NH1 . ARG B 1 177 ? -2.574  -0.805 199.796 1.00 112.24 ? 196 ARG B NH1 1 
ATOM   3054 N  NH2 . ARG B 1 177 ? -1.784  1.041  198.672 1.00 109.82 ? 196 ARG B NH2 1 
ATOM   3055 N  N   . ASN B 1 178 ? -1.511  4.507  204.967 1.00 77.79  ? 197 ASN B N   1 
ATOM   3056 C  CA  . ASN B 1 178 ? -0.333  4.861  205.786 1.00 78.92  ? 197 ASN B CA  1 
ATOM   3057 C  C   . ASN B 1 178 ? -0.706  5.040  207.254 1.00 75.52  ? 197 ASN B C   1 
ATOM   3058 O  O   . ASN B 1 178 ? -0.042  4.495  208.134 1.00 70.73  ? 197 ASN B O   1 
ATOM   3059 C  CB  . ASN B 1 178 ? 0.344   6.142  205.256 1.00 93.15  ? 197 ASN B CB  1 
ATOM   3060 C  CG  . ASN B 1 178 ? 1.599   6.535  206.042 1.00 112.21 ? 197 ASN B CG  1 
ATOM   3061 O  OD1 . ASN B 1 178 ? 2.339   5.682  206.545 1.00 129.56 ? 197 ASN B OD1 1 
ATOM   3062 N  ND2 . ASN B 1 178 ? 1.851   7.838  206.129 1.00 124.13 ? 197 ASN B ND2 1 
ATOM   3063 N  N   . SER B 1 179 ? -1.758  5.818  207.492 1.00 69.57  ? 198 SER B N   1 
ATOM   3064 C  CA  . SER B 1 179 ? -2.272  6.029  208.826 1.00 67.17  ? 198 SER B CA  1 
ATOM   3065 C  C   . SER B 1 179 ? -2.816  4.734  209.434 1.00 67.74  ? 198 SER B C   1 
ATOM   3066 O  O   . SER B 1 179 ? -2.449  4.398  210.554 1.00 65.63  ? 198 SER B O   1 
ATOM   3067 C  CB  . SER B 1 179 ? -3.336  7.124  208.850 1.00 64.71  ? 198 SER B CB  1 
ATOM   3068 O  OG  . SER B 1 179 ? -2.767  8.404  208.685 1.00 65.91  ? 198 SER B OG  1 
ATOM   3069 N  N   . LEU B 1 180 ? -3.634  3.987  208.687 1.00 67.80  ? 199 LEU B N   1 
ATOM   3070 C  CA  . LEU B 1 180 ? -4.227  2.736  209.220 1.00 69.50  ? 199 LEU B CA  1 
ATOM   3071 C  C   . LEU B 1 180 ? -3.203  1.625  209.505 1.00 71.11  ? 199 LEU B C   1 
ATOM   3072 O  O   . LEU B 1 180 ? -3.442  0.799  210.382 1.00 72.80  ? 199 LEU B O   1 
ATOM   3073 C  CB  . LEU B 1 180 ? -5.380  2.244  208.342 1.00 72.93  ? 199 LEU B CB  1 
ATOM   3074 C  CG  . LEU B 1 180 ? -6.602  3.176  208.262 1.00 71.12  ? 199 LEU B CG  1 
ATOM   3075 C  CD1 . LEU B 1 180 ? -7.530  2.756  207.133 1.00 75.14  ? 199 LEU B CD1 1 
ATOM   3076 C  CD2 . LEU B 1 180 ? -7.356  3.257  209.573 1.00 69.57  ? 199 LEU B CD2 1 
ATOM   3077 N  N   . GLN B 1 181 ? -2.080  1.610  208.781 1.00 71.17  ? 200 GLN B N   1 
ATOM   3078 C  CA  . GLN B 1 181 ? -1.004  0.635  209.040 1.00 75.18  ? 200 GLN B CA  1 
ATOM   3079 C  C   . GLN B 1 181 ? -0.300  0.927  210.362 1.00 75.42  ? 200 GLN B C   1 
ATOM   3080 O  O   . GLN B 1 181 ? 0.009   -0.011 211.093 1.00 75.94  ? 200 GLN B O   1 
ATOM   3081 C  CB  . GLN B 1 181 ? 0.009   0.571  207.909 1.00 78.56  ? 200 GLN B CB  1 
ATOM   3082 C  CG  . GLN B 1 181 ? -0.523  -0.179 206.708 1.00 84.04  ? 200 GLN B CG  1 
ATOM   3083 C  CD  . GLN B 1 181 ? 0.438   -0.205 205.536 1.00 91.37  ? 200 GLN B CD  1 
ATOM   3084 O  OE1 . GLN B 1 181 ? 1.418   0.545  205.487 1.00 94.51  ? 200 GLN B OE1 1 
ATOM   3085 N  NE2 . GLN B 1 181 ? 0.151   -1.072 204.572 1.00 91.97  ? 200 GLN B NE2 1 
ATOM   3086 N  N   . LYS B 1 182 ? -0.043  2.213  210.645 1.00 68.58  ? 201 LYS B N   1 
ATOM   3087 C  CA  . LYS B 1 182 ? 0.574   2.630  211.908 1.00 69.65  ? 201 LYS B CA  1 
ATOM   3088 C  C   . LYS B 1 182 ? -0.308  2.290  213.112 1.00 68.54  ? 201 LYS B C   1 
ATOM   3089 O  O   . LYS B 1 182 ? 0.218   2.023  214.187 1.00 75.36  ? 201 LYS B O   1 
ATOM   3090 C  CB  . LYS B 1 182 ? 0.880   4.129  211.919 1.00 69.84  ? 201 LYS B CB  1 
ATOM   3091 C  CG  . LYS B 1 182 ? 1.969   4.553  210.951 1.00 71.18  ? 201 LYS B CG  1 
ATOM   3092 C  CD  . LYS B 1 182 ? 2.149   6.054  211.038 1.00 72.87  ? 201 LYS B CD  1 
ATOM   3093 C  CE  . LYS B 1 182 ? 3.252   6.575  210.137 1.00 75.56  ? 201 LYS B CE  1 
ATOM   3094 N  NZ  . LYS B 1 182 ? 3.363   8.050  210.322 1.00 78.76  ? 201 LYS B NZ  1 
ATOM   3095 N  N   . VAL B 1 183 ? -1.632  2.313  212.919 1.00 63.20  ? 202 VAL B N   1 
ATOM   3096 C  CA  . VAL B 1 183 ? -2.613  1.964  213.952 1.00 63.61  ? 202 VAL B CA  1 
ATOM   3097 C  C   . VAL B 1 183 ? -2.512  0.466  214.300 1.00 67.33  ? 202 VAL B C   1 
ATOM   3098 O  O   . VAL B 1 183 ? -2.291  0.123  215.450 1.00 70.49  ? 202 VAL B O   1 
ATOM   3099 C  CB  . VAL B 1 183 ? -4.059  2.288  213.507 1.00 61.60  ? 202 VAL B CB  1 
ATOM   3100 C  CG1 . VAL B 1 183 ? -5.069  1.864  214.572 1.00 57.01  ? 202 VAL B CG1 1 
ATOM   3101 C  CG2 . VAL B 1 183 ? -4.199  3.773  213.174 1.00 59.21  ? 202 VAL B CG2 1 
ATOM   3102 N  N   . ILE B 1 184 ? -2.662  -0.386 213.291 1.00 68.20  ? 203 ILE B N   1 
ATOM   3103 C  CA  . ILE B 1 184 ? -2.596  -1.863 213.401 1.00 76.67  ? 203 ILE B CA  1 
ATOM   3104 C  C   . ILE B 1 184 ? -1.254  -2.396 213.939 1.00 80.99  ? 203 ILE B C   1 
ATOM   3105 O  O   . ILE B 1 184 ? -1.228  -3.436 214.601 1.00 82.93  ? 203 ILE B O   1 
ATOM   3106 C  CB  . ILE B 1 184 ? -2.915  -2.532 212.016 1.00 82.28  ? 203 ILE B CB  1 
ATOM   3107 C  CG1 . ILE B 1 184 ? -4.367  -2.272 211.587 1.00 85.45  ? 203 ILE B CG1 1 
ATOM   3108 C  CG2 . ILE B 1 184 ? -2.712  -4.042 212.014 1.00 86.96  ? 203 ILE B CG2 1 
ATOM   3109 C  CD1 . ILE B 1 184 ? -5.426  -2.834 212.515 1.00 85.65  ? 203 ILE B CD1 1 
ATOM   3110 N  N   . LEU B 1 185 ? -0.162  -1.685 213.647 1.00 81.59  ? 204 LEU B N   1 
ATOM   3111 C  CA  . LEU B 1 185 ? 1.194   -2.052 214.094 1.00 88.98  ? 204 LEU B CA  1 
ATOM   3112 C  C   . LEU B 1 185 ? 1.339   -2.047 215.627 1.00 92.97  ? 204 LEU B C   1 
ATOM   3113 O  O   . LEU B 1 185 ? 2.062   -2.871 216.178 1.00 96.90  ? 204 LEU B O   1 
ATOM   3114 C  CB  . LEU B 1 185 ? 2.216   -1.065 213.507 1.00 93.08  ? 204 LEU B CB  1 
ATOM   3115 C  CG  . LEU B 1 185 ? 3.717   -1.325 213.658 1.00 103.19 ? 204 LEU B CG  1 
ATOM   3116 C  CD1 . LEU B 1 185 ? 4.101   -2.608 212.936 1.00 108.00 ? 204 LEU B CD1 1 
ATOM   3117 C  CD2 . LEU B 1 185 ? 4.502   -0.150 213.091 1.00 111.07 ? 204 LEU B CD2 1 
ATOM   3118 N  N   . ARG B 1 186 ? 0.631   -1.107 216.264 1.00 94.80  ? 205 ARG B N   1 
ATOM   3119 C  CA  A ARG B 1 186 ? 0.631   -0.906 217.723 0.50 97.64  ? 205 ARG B CA  1 
ATOM   3120 C  CA  B ARG B 1 186 ? 0.632   -0.888 217.713 0.50 93.84  ? 205 ARG B CA  1 
ATOM   3121 C  C   . ARG B 1 186 ? -0.679  -1.262 218.427 1.00 93.61  ? 205 ARG B C   1 
ATOM   3122 O  O   . ARG B 1 186 ? -0.667  -1.554 219.621 1.00 101.75 ? 205 ARG B O   1 
ATOM   3123 C  CB  A ARG B 1 186 ? 0.930   0.568  218.056 0.50 99.92  ? 205 ARG B CB  1 
ATOM   3124 C  CB  B ARG B 1 186 ? 0.909   0.607  217.952 0.50 89.81  ? 205 ARG B CB  1 
ATOM   3125 C  CG  A ARG B 1 186 ? 2.354   1.036  217.806 0.50 107.96 ? 205 ARG B CG  1 
ATOM   3126 C  CG  B ARG B 1 186 ? 2.257   1.069  217.406 0.50 92.23  ? 205 ARG B CG  1 
ATOM   3127 C  CD  A ARG B 1 186 ? 2.526   2.454  218.339 0.50 106.03 ? 205 ARG B CD  1 
ATOM   3128 C  CD  B ARG B 1 186 ? 2.382   2.576  217.278 0.50 86.51  ? 205 ARG B CD  1 
ATOM   3129 N  NE  A ARG B 1 186 ? 3.916   2.901  218.341 0.50 103.33 ? 205 ARG B NE  1 
ATOM   3130 N  NE  B ARG B 1 186 ? 3.686   2.899  216.708 0.50 85.53  ? 205 ARG B NE  1 
ATOM   3131 C  CZ  A ARG B 1 186 ? 4.755   2.723  219.358 0.50 97.92  ? 205 ARG B CZ  1 
ATOM   3132 C  CZ  B ARG B 1 186 ? 3.963   2.832  215.411 0.50 84.33  ? 205 ARG B CZ  1 
ATOM   3133 N  NH1 A ARG B 1 186 ? 4.350   2.094  220.454 0.50 93.90  ? 205 ARG B NH1 1 
ATOM   3134 N  NH1 B ARG B 1 186 ? 3.024   2.458  214.557 0.50 80.13  ? 205 ARG B NH1 1 
ATOM   3135 N  NH2 A ARG B 1 186 ? 6.002   3.164  219.274 0.50 99.61  ? 205 ARG B NH2 1 
ATOM   3136 N  NH2 B ARG B 1 186 ? 5.175   3.133  214.968 0.50 86.07  ? 205 ARG B NH2 1 
ATOM   3137 N  N   . PHE B 1 187 ? -1.797  -1.247 217.698 1.00 90.08  ? 206 PHE B N   1 
ATOM   3138 C  CA  . PHE B 1 187 ? -3.132  -1.466 218.262 1.00 84.01  ? 206 PHE B CA  1 
ATOM   3139 C  C   . PHE B 1 187 ? -4.065  -2.313 217.379 1.00 84.30  ? 206 PHE B C   1 
ATOM   3140 O  O   . PHE B 1 187 ? -4.542  -1.803 216.359 1.00 84.25  ? 206 PHE B O   1 
ATOM   3141 C  CB  . PHE B 1 187 ? -3.660  -0.030 218.417 1.00 79.55  ? 206 PHE B CB  1 
ATOM   3142 C  CG  . PHE B 1 187 ? -4.999  0.102  219.063 1.00 78.43  ? 206 PHE B CG  1 
ATOM   3143 C  CD1 . PHE B 1 187 ? -5.130  -0.070 220.436 1.00 77.12  ? 206 PHE B CD1 1 
ATOM   3144 C  CD2 . PHE B 1 187 ? -6.110  0.535  218.321 1.00 74.88  ? 206 PHE B CD2 1 
ATOM   3145 C  CE1 . PHE B 1 187 ? -6.357  0.105  221.056 1.00 79.67  ? 206 PHE B CE1 1 
ATOM   3146 C  CE2 . PHE B 1 187 ? -7.341  0.714  218.936 1.00 75.36  ? 206 PHE B CE2 1 
ATOM   3147 C  CZ  . PHE B 1 187 ? -7.463  0.505  220.306 1.00 77.86  ? 206 PHE B CZ  1 
ATOM   3148 N  N   . PRO B 1 188 ? -4.347  -3.593 217.764 1.00 88.58  ? 207 PRO B N   1 
ATOM   3149 C  CA  . PRO B 1 188 ? -5.242  -4.420 216.930 1.00 88.74  ? 207 PRO B CA  1 
ATOM   3150 C  C   . PRO B 1 188 ? -6.682  -3.870 216.910 1.00 93.53  ? 207 PRO B C   1 
ATOM   3151 O  O   . PRO B 1 188 ? -7.338  -3.811 217.953 1.00 103.56 ? 207 PRO B O   1 
ATOM   3152 C  CB  . PRO B 1 188 ? -5.171  -5.817 217.576 1.00 92.68  ? 207 PRO B CB  1 
ATOM   3153 C  CG  . PRO B 1 188 ? -4.114  -5.746 218.624 1.00 93.74  ? 207 PRO B CG  1 
ATOM   3154 C  CD  . PRO B 1 188 ? -3.966  -4.310 218.997 1.00 85.84  ? 207 PRO B CD  1 
ATOM   3155 N  N   . SER B 1 189 ? -7.121  -3.444 215.723 1.00 94.26  ? 208 SER B N   1 
ATOM   3156 C  CA  . SER B 1 189 ? -8.436  -2.840 215.481 1.00 89.82  ? 208 SER B CA  1 
ATOM   3157 C  C   . SER B 1 189 ? -9.106  -3.529 214.291 1.00 91.80  ? 208 SER B C   1 
ATOM   3158 O  O   . SER B 1 189 ? -8.541  -3.533 213.194 1.00 89.23  ? 208 SER B O   1 
ATOM   3159 C  CB  . SER B 1 189 ? -8.239  -1.345 215.194 1.00 82.50  ? 208 SER B CB  1 
ATOM   3160 O  OG  . SER B 1 189 ? -9.446  -0.695 214.843 1.00 82.61  ? 208 SER B OG  1 
ATOM   3161 N  N   . THR B 1 190 ? -10.289 -4.112 214.518 1.00 96.29  ? 209 THR B N   1 
ATOM   3162 C  CA  . THR B 1 190 ? -11.060 -4.824 213.474 1.00 99.33  ? 209 THR B CA  1 
ATOM   3163 C  C   . THR B 1 190 ? -11.529 -3.847 212.386 1.00 99.79  ? 209 THR B C   1 
ATOM   3164 O  O   . THR B 1 190 ? -11.453 -4.160 211.187 1.00 95.66  ? 209 THR B O   1 
ATOM   3165 C  CB  . THR B 1 190 ? -12.286 -5.560 214.064 1.00 100.38 ? 209 THR B CB  1 
ATOM   3166 O  OG1 . THR B 1 190 ? -11.895 -6.301 215.227 1.00 105.38 ? 209 THR B OG1 1 
ATOM   3167 C  CG2 . THR B 1 190 ? -12.901 -6.509 213.044 1.00 96.84  ? 209 THR B CG2 1 
ATOM   3168 N  N   . GLU B 1 191 ? -12.007 -2.680 212.832 1.00 96.80  ? 210 GLU B N   1 
ATOM   3169 C  CA  . GLU B 1 191 ? -12.453 -1.578 211.965 1.00 101.19 ? 210 GLU B CA  1 
ATOM   3170 C  C   . GLU B 1 191 ? -11.297 -1.081 211.069 1.00 103.27 ? 210 GLU B C   1 
ATOM   3171 O  O   . GLU B 1 191 ? -11.524 -0.751 209.902 1.00 105.07 ? 210 GLU B O   1 
ATOM   3172 C  CB  . GLU B 1 191 ? -13.007 -0.416 212.820 1.00 104.89 ? 210 GLU B CB  1 
ATOM   3173 C  CG  . GLU B 1 191 ? -13.702 0.718  212.065 1.00 113.24 ? 210 GLU B CG  1 
ATOM   3174 C  CD  . GLU B 1 191 ? -14.976 0.301  211.332 1.00 134.49 ? 210 GLU B CD  1 
ATOM   3175 O  OE1 . GLU B 1 191 ? -15.557 -0.769 211.634 1.00 143.55 ? 210 GLU B OE1 1 
ATOM   3176 O  OE2 . GLU B 1 191 ? -15.417 1.066  210.449 1.00 148.47 ? 210 GLU B OE2 1 
ATOM   3177 N  N   . ALA B 1 192 ? -10.076 -1.038 211.620 1.00 98.68  ? 211 ALA B N   1 
ATOM   3178 C  CA  . ALA B 1 192 ? -8.874  -0.636 210.874 1.00 90.82  ? 211 ALA B CA  1 
ATOM   3179 C  C   . ALA B 1 192 ? -8.523  -1.680 209.811 1.00 89.00  ? 211 ALA B C   1 
ATOM   3180 O  O   . ALA B 1 192 ? -8.288  -1.310 208.664 1.00 99.53  ? 211 ALA B O   1 
ATOM   3181 C  CB  . ALA B 1 192 ? -7.696  -0.409 211.807 1.00 83.96  ? 211 ALA B CB  1 
ATOM   3182 N  N   . GLN B 1 193 ? -8.471  -2.964 210.191 1.00 91.96  ? 212 GLN B N   1 
ATOM   3183 C  CA  . GLN B 1 193 ? -8.203  -4.068 209.223 1.00 101.89 ? 212 GLN B CA  1 
ATOM   3184 C  C   . GLN B 1 193 ? -9.300  -4.210 208.159 1.00 100.17 ? 212 GLN B C   1 
ATOM   3185 O  O   . GLN B 1 193 ? -9.003  -4.608 207.037 1.00 103.84 ? 212 GLN B O   1 
ATOM   3186 C  CB  . GLN B 1 193 ? -7.940  -5.433 209.908 1.00 108.41 ? 212 GLN B CB  1 
ATOM   3187 C  CG  . GLN B 1 193 ? -6.480  -5.717 210.263 1.00 109.40 ? 212 GLN B CG  1 
ATOM   3188 C  CD  . GLN B 1 193 ? -5.582  -5.978 209.050 1.00 109.36 ? 212 GLN B CD  1 
ATOM   3189 O  OE1 . GLN B 1 193 ? -6.041  -6.034 207.907 1.00 105.38 ? 212 GLN B OE1 1 
ATOM   3190 N  NE2 . GLN B 1 193 ? -4.288  -6.146 209.306 1.00 111.31 ? 212 GLN B NE2 1 
ATOM   3191 N  N   . LYS B 1 194 ? -10.549 -3.912 208.533 1.00 103.18 ? 213 LYS B N   1 
ATOM   3192 C  CA  . LYS B 1 194 ? -11.700 -3.940 207.617 1.00 108.41 ? 213 LYS B CA  1 
ATOM   3193 C  C   . LYS B 1 194 ? -11.513 -2.909 206.496 1.00 103.32 ? 213 LYS B C   1 
ATOM   3194 O  O   . LYS B 1 194 ? -11.831 -3.194 205.341 1.00 107.52 ? 213 LYS B O   1 
ATOM   3195 C  CB  . LYS B 1 194 ? -13.007 -3.660 208.380 1.00 116.57 ? 213 LYS B CB  1 
ATOM   3196 C  CG  . LYS B 1 194 ? -14.284 -3.686 207.543 1.00 124.35 ? 213 LYS B CG  1 
ATOM   3197 C  CD  . LYS B 1 194 ? -15.502 -3.308 208.368 1.00 129.38 ? 213 LYS B CD  1 
ATOM   3198 C  CE  . LYS B 1 194 ? -16.758 -3.309 207.512 1.00 135.64 ? 213 LYS B CE  1 
ATOM   3199 N  NZ  . LYS B 1 194 ? -17.972 -2.952 208.295 1.00 137.71 ? 213 LYS B NZ  1 
ATOM   3200 N  N   . THR B 1 195 ? -11.011 -1.723 206.849 1.00 92.65  ? 214 THR B N   1 
ATOM   3201 C  CA  . THR B 1 195 ? -10.753 -0.653 205.881 1.00 88.42  ? 214 THR B CA  1 
ATOM   3202 C  C   . THR B 1 195 ? -9.520  -0.969 205.021 1.00 94.42  ? 214 THR B C   1 
ATOM   3203 O  O   . THR B 1 195 ? -9.557  -0.716 203.812 1.00 97.85  ? 214 THR B O   1 
ATOM   3204 C  CB  . THR B 1 195 ? -10.609 0.720  206.571 1.00 83.53  ? 214 THR B CB  1 
ATOM   3205 O  OG1 . THR B 1 195 ? -11.795 0.989  207.325 1.00 75.83  ? 214 THR B OG1 1 
ATOM   3206 C  CG2 . THR B 1 195 ? -10.406 1.845  205.550 1.00 82.89  ? 214 THR B CG2 1 
ATOM   3207 N  N   . LEU B 1 196 ? -8.455  -1.521 205.623 1.00 90.48  ? 215 LEU B N   1 
ATOM   3208 C  CA  . LEU B 1 196 ? -7.220  -1.882 204.875 1.00 95.64  ? 215 LEU B CA  1 
ATOM   3209 C  C   . LEU B 1 196 ? -7.431  -2.864 203.714 1.00 100.84 ? 215 LEU B C   1 
ATOM   3210 O  O   . LEU B 1 196 ? -6.793  -2.706 202.661 1.00 97.24  ? 215 LEU B O   1 
ATOM   3211 C  CB  . LEU B 1 196 ? -6.112  -2.417 205.803 1.00 97.74  ? 215 LEU B CB  1 
ATOM   3212 C  CG  . LEU B 1 196 ? -5.389  -1.419 206.710 1.00 99.92  ? 215 LEU B CG  1 
ATOM   3213 C  CD1 . LEU B 1 196 ? -4.462  -2.146 207.669 1.00 97.18  ? 215 LEU B CD1 1 
ATOM   3214 C  CD2 . LEU B 1 196 ? -4.607  -0.410 205.880 1.00 104.50 ? 215 LEU B CD2 1 
ATOM   3215 N  N   . ASP B 1 197 ? -8.295  -3.867 203.915 1.00 105.76 ? 216 ASP B N   1 
ATOM   3216 C  CA  . ASP B 1 197 ? -8.601  -4.869 202.861 1.00 111.90 ? 216 ASP B CA  1 
ATOM   3217 C  C   . ASP B 1 197 ? -9.454  -4.275 201.715 1.00 110.76 ? 216 ASP B C   1 
ATOM   3218 O  O   . ASP B 1 197 ? -9.283  -4.672 200.560 1.00 112.51 ? 216 ASP B O   1 
ATOM   3219 C  CB  . ASP B 1 197 ? -9.165  -6.192 203.436 1.00 116.47 ? 216 ASP B CB  1 
ATOM   3220 C  CG  . ASP B 1 197 ? -10.487 -6.029 204.181 1.00 120.11 ? 216 ASP B CG  1 
ATOM   3221 O  OD1 . ASP B 1 197 ? -11.456 -5.484 203.616 1.00 126.96 ? 216 ASP B OD1 1 
ATOM   3222 O  OD2 . ASP B 1 197 ? -10.575 -6.520 205.326 1.00 125.72 ? 216 ASP B OD2 1 
ATOM   3223 N  N   . LYS B 1 198 ? -10.369 -3.351 202.043 1.00 108.29 ? 217 LYS B N   1 
ATOM   3224 C  CA  . LYS B 1 198 ? -11.177 -2.637 201.031 1.00 103.76 ? 217 LYS B CA  1 
ATOM   3225 C  C   . LYS B 1 198 ? -10.281 -1.739 200.163 1.00 104.09 ? 217 LYS B C   1 
ATOM   3226 O  O   . LYS B 1 198 ? -10.527 -1.606 198.957 1.00 102.57 ? 217 LYS B O   1 
ATOM   3227 C  CB  . LYS B 1 198 ? -12.319 -1.823 201.655 1.00 103.66 ? 217 LYS B CB  1 
ATOM   3228 C  CG  . LYS B 1 198 ? -13.437 -2.687 202.219 1.00 111.90 ? 217 LYS B CG  1 
ATOM   3229 C  CD  . LYS B 1 198 ? -14.654 -1.891 202.685 1.00 113.97 ? 217 LYS B CD  1 
ATOM   3230 C  CE  . LYS B 1 198 ? -14.382 -1.013 203.896 1.00 112.00 ? 217 LYS B CE  1 
ATOM   3231 N  NZ  . LYS B 1 198 ? -15.609 -0.292 204.335 1.00 113.04 ? 217 LYS B NZ  1 
ATOM   3232 N  N   . ILE B 1 199 ? -9.262  -1.121 200.775 1.00 96.69  ? 218 ILE B N   1 
ATOM   3233 C  CA  . ILE B 1 199 ? -8.279  -0.309 200.033 1.00 95.20  ? 218 ILE B CA  1 
ATOM   3234 C  C   . ILE B 1 199 ? -7.463  -1.242 199.122 1.00 96.90  ? 218 ILE B C   1 
ATOM   3235 O  O   . ILE B 1 199 ? -7.153  -0.856 197.997 1.00 93.89  ? 218 ILE B O   1 
ATOM   3236 C  CB  . ILE B 1 199 ? -7.348  0.521  200.945 1.00 90.57  ? 218 ILE B CB  1 
ATOM   3237 C  CG1 . ILE B 1 199 ? -8.155  1.562  201.736 1.00 87.57  ? 218 ILE B CG1 1 
ATOM   3238 C  CG2 . ILE B 1 199 ? -6.295  1.260  200.119 1.00 83.58  ? 218 ILE B CG2 1 
ATOM   3239 C  CD1 . ILE B 1 199 ? -7.353  2.319  202.772 1.00 80.94  ? 218 ILE B CD1 1 
ATOM   3240 N  N   . LEU B 1 200 ? -7.127  -2.446 199.613 1.00 97.90  ? 219 LEU B N   1 
ATOM   3241 C  CA  . LEU B 1 200 ? -6.399  -3.459 198.819 1.00 106.17 ? 219 LEU B CA  1 
ATOM   3242 C  C   . LEU B 1 200 ? -7.241  -3.925 197.613 1.00 109.00 ? 219 LEU B C   1 
ATOM   3243 O  O   . LEU B 1 200 ? -6.684  -4.208 196.554 1.00 113.52 ? 219 LEU B O   1 
ATOM   3244 C  CB  . LEU B 1 200 ? -5.975  -4.666 199.680 1.00 106.03 ? 219 LEU B CB  1 
ATOM   3245 C  CG  . LEU B 1 200 ? -5.133  -5.772 199.022 1.00 111.23 ? 219 LEU B CG  1 
ATOM   3246 C  CD1 . LEU B 1 200 ? -3.805  -5.243 198.492 1.00 111.33 ? 219 LEU B CD1 1 
ATOM   3247 C  CD2 . LEU B 1 200 ? -4.895  -6.903 200.010 1.00 110.97 ? 219 LEU B CD2 1 
ATOM   3248 N  N   . ARG B 1 201 ? -8.565  -4.000 197.796 1.00 110.77 ? 220 ARG B N   1 
ATOM   3249 C  CA  . ARG B 1 201 ? -9.521  -4.362 196.734 1.00 121.47 ? 220 ARG B CA  1 
ATOM   3250 C  C   . ARG B 1 201 ? -9.548  -3.237 195.687 1.00 118.28 ? 220 ARG B C   1 
ATOM   3251 O  O   . ARG B 1 201 ? -9.425  -3.503 194.490 1.00 122.66 ? 220 ARG B O   1 
ATOM   3252 C  CB  . ARG B 1 201 ? -10.925 -4.552 197.323 1.00 127.09 ? 220 ARG B CB  1 
ATOM   3253 C  CG  . ARG B 1 201 ? -11.991 -5.127 196.392 1.00 135.22 ? 220 ARG B CG  1 
ATOM   3254 C  CD  . ARG B 1 201 ? -13.383 -4.904 196.976 1.00 138.21 ? 220 ARG B CD  1 
ATOM   3255 N  NE  . ARG B 1 201 ? -13.506 -5.392 198.356 1.00 140.39 ? 220 ARG B NE  1 
ATOM   3256 C  CZ  . ARG B 1 201 ? -14.537 -5.159 199.179 1.00 139.89 ? 220 ARG B CZ  1 
ATOM   3257 N  NH1 . ARG B 1 201 ? -15.592 -4.427 198.801 1.00 143.12 ? 220 ARG B NH1 1 
ATOM   3258 N  NH2 . ARG B 1 201 ? -14.507 -5.663 200.416 1.00 140.12 ? 220 ARG B NH2 1 
ATOM   3259 N  N   . ILE B 1 202 ? -9.709  -1.995 196.158 1.00 109.50 ? 221 ILE B N   1 
ATOM   3260 C  CA  . ILE B 1 202 ? -9.720  -0.788 195.304 1.00 110.87 ? 221 ILE B CA  1 
ATOM   3261 C  C   . ILE B 1 202 ? -8.371  -0.613 194.567 1.00 115.31 ? 221 ILE B C   1 
ATOM   3262 O  O   . ILE B 1 202 ? -8.365  -0.179 193.408 1.00 117.17 ? 221 ILE B O   1 
ATOM   3263 C  CB  . ILE B 1 202 ? -10.133 0.478  196.111 1.00 107.63 ? 221 ILE B CB  1 
ATOM   3264 C  CG1 . ILE B 1 202 ? -11.608 0.385  196.525 1.00 107.21 ? 221 ILE B CG1 1 
ATOM   3265 C  CG2 . ILE B 1 202 ? -9.963  1.758  195.301 1.00 106.42 ? 221 ILE B CG2 1 
ATOM   3266 C  CD1 . ILE B 1 202 ? -12.045 1.467  197.492 1.00 105.70 ? 221 ILE B CD1 1 
ATOM   3267 N  N   . GLU B 1 203 ? -7.256  -0.968 195.225 1.00 109.24 ? 222 GLU B N   1 
ATOM   3268 C  CA  . GLU B 1 203 ? -5.902  -0.917 194.616 1.00 114.41 ? 222 GLU B CA  1 
ATOM   3269 C  C   . GLU B 1 203 ? -5.818  -1.847 193.388 1.00 121.07 ? 222 GLU B C   1 
ATOM   3270 O  O   . GLU B 1 203 ? -5.254  -1.473 192.355 1.00 123.01 ? 222 GLU B O   1 
ATOM   3271 C  CB  . GLU B 1 203 ? -4.820  -1.346 195.626 1.00 114.36 ? 222 GLU B CB  1 
ATOM   3272 C  CG  . GLU B 1 203 ? -3.364  -1.122 195.187 1.00 117.30 ? 222 GLU B CG  1 
ATOM   3273 C  CD  . GLU B 1 203 ? -2.325  -1.571 196.223 1.00 121.29 ? 222 GLU B CD  1 
ATOM   3274 O  OE1 . GLU B 1 203 ? -2.608  -2.481 197.039 1.00 116.66 ? 222 GLU B OE1 1 
ATOM   3275 O  OE2 . GLU B 1 203 ? -1.198  -1.020 196.218 1.00 119.07 ? 222 GLU B OE2 1 
ATOM   3276 N  N   . LYS B 1 204 ? -6.374  -3.052 193.535 1.00 125.66 ? 223 LYS B N   1 
ATOM   3277 C  CA  . LYS B 1 204 ? -6.394  -4.085 192.483 1.00 134.79 ? 223 LYS B CA  1 
ATOM   3278 C  C   . LYS B 1 204 ? -7.247  -3.670 191.272 1.00 138.43 ? 223 LYS B C   1 
ATOM   3279 O  O   . LYS B 1 204 ? -6.829  -3.871 190.126 1.00 136.59 ? 223 LYS B O   1 
ATOM   3280 C  CB  . LYS B 1 204 ? -6.856  -5.426 193.102 1.00 137.53 ? 223 LYS B CB  1 
ATOM   3281 C  CG  . LYS B 1 204 ? -6.863  -6.685 192.236 1.00 149.40 ? 223 LYS B CG  1 
ATOM   3282 C  CD  . LYS B 1 204 ? -8.084  -6.845 191.333 1.00 151.94 ? 223 LYS B CD  1 
ATOM   3283 C  CE  . LYS B 1 204 ? -8.155  -8.246 190.753 1.00 152.96 ? 223 LYS B CE  1 
ATOM   3284 N  NZ  . LYS B 1 204 ? -9.372  -8.438 189.920 1.00 156.01 ? 223 LYS B NZ  1 
ATOM   3285 N  N   . GLU B 1 205 ? -8.420  -3.087 191.532 1.00 138.55 ? 224 GLU B N   1 
ATOM   3286 C  CA  . GLU B 1 205 ? -9.340  -2.641 190.469 1.00 140.92 ? 224 GLU B CA  1 
ATOM   3287 C  C   . GLU B 1 205 ? -8.816  -1.454 189.650 1.00 140.13 ? 224 GLU B C   1 
ATOM   3288 O  O   . GLU B 1 205 ? -8.930  -1.451 188.424 1.00 148.45 ? 224 GLU B O   1 
ATOM   3289 C  CB  . GLU B 1 205 ? -10.722 -2.315 191.046 1.00 137.97 ? 224 GLU B CB  1 
ATOM   3290 C  CG  . GLU B 1 205 ? -11.426 -3.532 191.634 1.00 142.20 ? 224 GLU B CG  1 
ATOM   3291 C  CD  . GLU B 1 205 ? -12.787 -3.228 192.238 1.00 145.72 ? 224 GLU B CD  1 
ATOM   3292 O  OE1 . GLU B 1 205 ? -13.376 -2.164 191.942 1.00 147.56 ? 224 GLU B OE1 1 
ATOM   3293 O  OE2 . GLU B 1 205 ? -13.283 -4.079 193.007 1.00 150.33 ? 224 GLU B OE2 1 
ATOM   3294 N  N   . VAL B 1 206 ? -8.240  -0.465 190.330 1.00 135.28 ? 225 VAL B N   1 
ATOM   3295 C  CA  . VAL B 1 206 ? -7.682  0.732  189.671 1.00 134.80 ? 225 VAL B CA  1 
ATOM   3296 C  C   . VAL B 1 206 ? -6.367  0.444  188.898 1.00 137.98 ? 225 VAL B C   1 
ATOM   3297 O  O   . VAL B 1 206 ? -6.027  1.203  187.986 1.00 134.31 ? 225 VAL B O   1 
ATOM   3298 C  CB  . VAL B 1 206 ? -7.495  1.892  190.696 1.00 128.15 ? 225 VAL B CB  1 
ATOM   3299 C  CG1 . VAL B 1 206 ? -6.919  3.150  190.054 1.00 124.31 ? 225 VAL B CG1 1 
ATOM   3300 C  CG2 . VAL B 1 206 ? -8.824  2.236  191.359 1.00 127.10 ? 225 VAL B CG2 1 
ATOM   3301 N  N   . ASN B 1 207 ? -5.670  -0.652 189.243 1.00 136.33 ? 226 ASN B N   1 
ATOM   3302 C  CA  . ASN B 1 207 ? -4.377  -1.070 188.645 1.00 137.16 ? 226 ASN B CA  1 
ATOM   3303 C  C   . ASN B 1 207 ? -3.244  -0.124 189.046 1.00 129.79 ? 226 ASN B C   1 
ATOM   3304 O  O   . ASN B 1 207 ? -3.270  0.477  190.118 1.00 116.49 ? 226 ASN B O   1 
ATOM   3305 C  CB  . ASN B 1 207 ? -4.406  -1.229 187.103 1.00 139.85 ? 226 ASN B CB  1 
ATOM   3306 C  CG  . ASN B 1 207 ? -5.439  -2.238 186.614 1.00 142.53 ? 226 ASN B CG  1 
ATOM   3307 O  OD1 . ASN B 1 207 ? -6.266  -2.740 187.376 1.00 140.66 ? 226 ASN B OD1 1 
ATOM   3308 N  ND2 . ASN B 1 207 ? -5.396  -2.533 185.316 1.00 150.28 ? 226 ASN B ND2 1 
HETATM 3309 ZN ZN  . ZN  C 2 .   ? -17.242 9.572  132.366 1.00 97.65  ? 250 ZN  A ZN  1 
HETATM 3310 ZN ZN  . ZN  D 2 .   ? -30.388 6.208  138.751 1.00 101.65 ? 260 ZN  A ZN  1 
HETATM 3311 ZN ZN  . ZN  E 2 .   ? -9.779  11.597 221.923 1.00 55.99  ? 250 ZN  B ZN  1 
HETATM 3312 ZN ZN  . ZN  F 2 .   ? 4.695   7.910  219.873 1.00 59.38  ? 260 ZN  B ZN  1 
HETATM 3313 O  O1  . PG4 G 3 .   ? -27.626 27.604 229.185 1.00 108.57 ? 300 PG4 B O1  1 
HETATM 3314 C  C1  . PG4 G 3 .   ? -26.432 27.917 228.461 1.00 105.74 ? 300 PG4 B C1  1 
HETATM 3315 C  C2  . PG4 G 3 .   ? -25.945 26.661 227.750 1.00 111.73 ? 300 PG4 B C2  1 
HETATM 3316 O  O2  . PG4 G 3 .   ? -25.165 25.786 228.595 1.00 99.79  ? 300 PG4 B O2  1 
HETATM 3317 C  C3  . PG4 G 3 .   ? -25.866 24.802 229.380 1.00 64.59  ? 300 PG4 B C3  1 
HETATM 3318 C  C4  . PG4 G 3 .   ? -25.447 23.329 229.123 1.00 78.34  ? 300 PG4 B C4  1 
HETATM 3319 O  O3  . PG4 G 3 .   ? -25.204 22.915 227.778 1.00 58.00  ? 300 PG4 B O3  1 
HETATM 3320 C  C5  . PG4 G 3 .   ? -26.182 23.432 226.837 1.00 70.91  ? 300 PG4 B C5  1 
HETATM 3321 C  C6  . PG4 G 3 .   ? -26.588 22.518 225.715 1.00 56.15  ? 300 PG4 B C6  1 
HETATM 3322 O  O4  . PG4 G 3 .   ? -27.726 21.774 226.095 1.00 73.28  ? 300 PG4 B O4  1 
HETATM 3323 C  C1  . EDO H 4 .   ? 8.586   9.734  220.917 1.00 104.02 ? 301 EDO B C1  1 
HETATM 3324 O  O1  . EDO H 4 .   ? 7.641   10.573 221.592 1.00 109.01 ? 301 EDO B O1  1 
HETATM 3325 C  C2  . EDO H 4 .   ? 7.947   8.392  220.579 1.00 100.72 ? 301 EDO B C2  1 
HETATM 3326 O  O2  . EDO H 4 .   ? 6.639   8.595  220.032 1.00 61.69  ? 301 EDO B O2  1 
HETATM 3327 O  O   . HOH I 5 .   ? -18.894 10.955 130.962 1.00 73.81  ? 302 HOH A O   1 
HETATM 3328 O  O   . HOH I 5 .   ? -32.137 7.103  139.015 1.00 76.58  ? 303 HOH A O   1 
HETATM 3329 O  O   . HOH I 5 .   ? -13.428 13.418 117.970 1.00 79.01  ? 343 HOH A O   1 
HETATM 3330 O  O   . HOH J 5 .   ? -9.771  13.213 223.249 1.00 64.59  ? 304 HOH B O   1 
HETATM 3331 O  O   . HOH J 5 .   ? -27.861 16.057 223.587 1.00 49.38  ? 305 HOH B O   1 
HETATM 3332 O  O   . HOH J 5 .   ? 1.216   5.766  219.454 1.00 66.21  ? 306 HOH B O   1 
HETATM 3333 O  O   . HOH J 5 .   ? -18.616 31.138 225.737 1.00 68.85  ? 307 HOH B O   1 
HETATM 3334 O  O   . HOH J 5 .   ? -11.175 13.980 234.830 1.00 75.60  ? 308 HOH B O   1 
HETATM 3335 O  O   . HOH J 5 .   ? -17.228 16.510 234.525 1.00 50.59  ? 309 HOH B O   1 
HETATM 3336 O  O   . HOH J 5 .   ? -9.531  11.832 217.618 1.00 51.32  ? 310 HOH B O   1 
HETATM 3337 O  O   . HOH J 5 .   ? 1.126   16.524 209.613 1.00 76.51  ? 311 HOH B O   1 
HETATM 3338 O  O   . HOH J 5 .   ? -3.069  8.995  220.873 1.00 45.38  ? 312 HOH B O   1 
HETATM 3339 O  O   . HOH J 5 .   ? -8.221  15.802 249.201 1.00 60.69  ? 313 HOH B O   1 
HETATM 3340 O  O   . HOH J 5 .   ? -9.050  9.264  216.902 1.00 48.65  ? 314 HOH B O   1 
HETATM 3341 O  O   . HOH J 5 .   ? 7.634   11.799 215.793 1.00 77.02  ? 315 HOH B O   1 
HETATM 3342 O  O   . HOH J 5 .   ? -23.322 12.664 219.654 1.00 71.09  ? 316 HOH B O   1 
HETATM 3343 O  O   . HOH J 5 .   ? -7.591  8.338  221.646 1.00 53.93  ? 317 HOH B O   1 
HETATM 3344 O  O   . HOH J 5 .   ? -5.016  7.595  221.906 1.00 48.96  ? 318 HOH B O   1 
HETATM 3345 O  O   . HOH J 5 .   ? -1.395  22.277 211.197 1.00 65.91  ? 319 HOH B O   1 
HETATM 3346 O  O   . HOH J 5 .   ? -2.849  11.749 221.766 1.00 58.17  ? 320 HOH B O   1 
HETATM 3347 O  O   . HOH J 5 .   ? -2.484  21.802 208.419 1.00 88.21  ? 321 HOH B O   1 
HETATM 3348 O  O   . HOH J 5 .   ? -1.410  24.841 220.252 1.00 72.62  ? 322 HOH B O   1 
HETATM 3349 O  O   . HOH J 5 .   ? -7.398  20.299 225.354 1.00 56.72  ? 323 HOH B O   1 
HETATM 3350 O  O   . HOH J 5 .   ? -8.248  17.018 202.423 1.00 89.57  ? 324 HOH B O   1 
HETATM 3351 O  O   . HOH J 5 .   ? 6.465   9.252  216.764 1.00 58.66  ? 325 HOH B O   1 
HETATM 3352 O  O   . HOH J 5 .   ? -3.488  24.695 217.802 1.00 68.35  ? 326 HOH B O   1 
HETATM 3353 O  O   . HOH J 5 .   ? -10.157 16.392 236.626 1.00 75.48  ? 327 HOH B O   1 
HETATM 3354 O  O   . HOH J 5 .   ? -21.024 13.577 223.089 1.00 75.72  ? 328 HOH B O   1 
HETATM 3355 O  O   . HOH J 5 .   ? -10.186 13.719 243.322 1.00 74.88  ? 329 HOH B O   1 
HETATM 3356 O  O   . HOH J 5 .   ? -10.671 25.750 254.284 1.00 53.17  ? 330 HOH B O   1 
HETATM 3357 O  O   . HOH J 5 .   ? -10.533 23.530 256.329 1.00 68.95  ? 331 HOH B O   1 
HETATM 3358 O  O   . HOH J 5 .   ? -3.392  20.928 230.236 1.00 71.96  ? 332 HOH B O   1 
HETATM 3359 O  O   . HOH J 5 .   ? -27.166 25.074 233.403 1.00 63.14  ? 333 HOH B O   1 
HETATM 3360 O  O   . HOH J 5 .   ? -25.416 19.654 232.285 1.00 72.66  ? 334 HOH B O   1 
HETATM 3361 O  O   . HOH J 5 .   ? -26.831 15.043 226.000 1.00 55.13  ? 335 HOH B O   1 
HETATM 3362 O  O   . HOH J 5 .   ? -26.379 20.844 234.873 1.00 69.21  ? 336 HOH B O   1 
HETATM 3363 O  O   . HOH J 5 .   ? -11.724 12.746 241.172 1.00 64.98  ? 337 HOH B O   1 
HETATM 3364 O  O   . HOH J 5 .   ? -27.746 20.920 230.870 1.00 78.82  ? 338 HOH B O   1 
HETATM 3365 O  O   . HOH J 5 .   ? -20.012 17.070 251.907 1.00 71.91  ? 339 HOH B O   1 
HETATM 3366 O  O   . HOH J 5 .   ? -8.002  27.053 255.351 1.00 84.69  ? 340 HOH B O   1 
HETATM 3367 O  O   . HOH J 5 .   ? -7.202  13.257 224.283 1.00 67.33  ? 341 HOH B O   1 
HETATM 3368 O  O   . HOH J 5 .   ? -19.576 32.998 240.401 1.00 70.24  ? 342 HOH B O   1 
HETATM 3369 O  O   . HOH J 5 .   ? -11.810 28.269 254.089 1.00 60.84  ? 344 HOH B O   1 
HETATM 3370 O  O   . HOH J 5 .   ? -12.667 13.190 215.729 1.00 63.08  ? 345 HOH B O   1 
HETATM 3371 O  O   . HOH J 5 .   ? -15.135 14.149 216.944 1.00 63.98  ? 346 HOH B O   1 
HETATM 3372 O  O   . HOH J 5 .   ? 8.686   15.644 216.390 1.00 84.17  ? 347 HOH B O   1 
HETATM 3373 O  O   . HOH J 5 .   ? 8.268   20.795 211.669 1.00 84.90  ? 348 HOH B O   1 
HETATM 3374 O  O   . HOH J 5 .   ? -22.470 24.322 220.828 1.00 54.62  ? 349 HOH B O   1 
HETATM 3375 O  O   . HOH J 5 .   ? -13.206 24.927 209.975 1.00 77.14  ? 350 HOH B O   1 
HETATM 3376 O  O   . HOH J 5 .   ? -14.904 23.872 207.523 1.00 72.74  ? 351 HOH B O   1 
HETATM 3377 O  O   . HOH J 5 .   ? -5.338  29.205 251.920 1.00 83.94  ? 352 HOH B O   1 
HETATM 3378 O  O   . HOH J 5 .   ? 1.495   24.728 243.407 1.00 81.91  ? 353 HOH B O   1 
HETATM 3379 O  O   . HOH J 5 .   ? -29.341 26.788 231.713 1.00 76.15  ? 354 HOH B O   1 
HETATM 3380 O  O   . HOH J 5 .   ? -19.195 29.454 223.500 1.00 72.66  ? 355 HOH B O   1 
HETATM 3381 O  O   . HOH J 5 .   ? -27.436 19.204 226.299 1.00 57.91  ? 356 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 3   ? 1.9017 1.8774 0.8854 -0.0769 0.0190  0.0850  22  SER A N   
2    C  CA  . SER A 3   ? 1.8505 1.8456 0.8833 -0.1100 -0.0032 0.0951  22  SER A CA  
3    C  C   . SER A 3   ? 1.8401 1.7510 0.8770 -0.1107 -0.0240 0.0774  22  SER A C   
4    O  O   . SER A 3   ? 1.8640 1.7024 0.8703 -0.1048 -0.0284 0.0645  22  SER A O   
5    C  CB  . SER A 3   ? 1.8597 1.8741 0.9015 -0.1619 -0.0182 0.1184  22  SER A CB  
6    O  OG  . SER A 3   ? 1.7896 1.8096 0.8673 -0.1954 -0.0414 0.1272  22  SER A OG  
7    N  N   . VAL A 4   ? 1.8283 1.7544 0.9020 -0.1195 -0.0369 0.0780  23  VAL A N   
8    C  CA  . VAL A 4   ? 1.8055 1.6631 0.8863 -0.1193 -0.0556 0.0622  23  VAL A CA  
9    C  C   . VAL A 4   ? 1.8035 1.6016 0.8797 -0.1530 -0.0794 0.0654  23  VAL A C   
10   O  O   . VAL A 4   ? 1.7795 1.5145 0.8460 -0.1453 -0.0891 0.0517  23  VAL A O   
11   C  CB  . VAL A 4   ? 1.7937 1.6831 0.9102 -0.1183 -0.0627 0.0610  23  VAL A CB  
12   C  CG1 . VAL A 4   ? 1.8354 1.7760 0.9547 -0.0777 -0.0405 0.0570  23  VAL A CG1 
13   C  CG2 . VAL A 4   ? 1.7851 1.7201 0.9273 -0.1601 -0.0772 0.0807  23  VAL A CG2 
14   N  N   . ASP A 5   ? 1.8397 1.6595 0.9210 -0.1894 -0.0892 0.0850  24  ASP A N   
15   C  CA  . ASP A 5   ? 1.8299 1.5897 0.9021 -0.2194 -0.1131 0.0907  24  ASP A CA  
16   C  C   . ASP A 5   ? 1.8271 1.5377 0.8675 -0.2116 -0.1118 0.0861  24  ASP A C   
17   O  O   . ASP A 5   ? 1.8140 1.4659 0.8489 -0.2197 -0.1308 0.0834  24  ASP A O   
18   C  CB  . ASP A 5   ? 1.8618 1.6510 0.9388 -0.2631 -0.1246 0.1154  24  ASP A CB  
19   C  CG  . ASP A 5   ? 1.9092 1.7305 1.0137 -0.2817 -0.1355 0.1207  24  ASP A CG  
20   O  OD1 . ASP A 5   ? 1.9086 1.7450 1.0316 -0.2578 -0.1300 0.1066  24  ASP A OD1 
21   O  OD2 . ASP A 5   ? 1.9918 1.8210 1.0956 -0.3238 -0.1512 0.1404  24  ASP A OD2 
22   N  N   . GLU A 6   ? 1.8279 1.5635 0.8450 -0.1944 -0.0899 0.0851  25  GLU A N   
23   C  CA  . GLU A 6   ? 1.8352 1.5262 0.8149 -0.1880 -0.0877 0.0799  25  GLU A CA  
24   C  C   . GLU A 6   ? 1.8045 1.4473 0.7759 -0.1610 -0.0882 0.0582  25  GLU A C   
25   O  O   . GLU A 6   ? 1.7701 1.3626 0.7253 -0.1661 -0.1009 0.0545  25  GLU A O   
26   C  CB  . GLU A 6   ? 1.8819 1.6126 0.8314 -0.1777 -0.0633 0.0847  25  GLU A CB  
27   C  CG  . GLU A 6   ? 1.9163 1.7071 0.8728 -0.2067 -0.0605 0.1093  25  GLU A CG  
28   C  CD  . GLU A 6   ? 1.9281 1.6836 0.8768 -0.2461 -0.0835 0.1260  25  GLU A CD  
29   O  OE1 . GLU A 6   ? 1.9155 1.6085 0.8427 -0.2463 -0.0958 0.1197  25  GLU A OE1 
30   O  OE2 . GLU A 6   ? 1.9663 1.7587 0.9286 -0.2785 -0.0903 0.1475  25  GLU A OE2 
31   N  N   . MSE A 7   ? 1.8135 1.4760 0.7947 -0.1340 -0.0749 0.0462  26  MSE A N   
32   C  CA  . MSE A 7   ? 1.8044 1.4250 0.7778 -0.1107 -0.0753 0.0275  26  MSE A CA  
33   C  C   . MSE A 7   ? 1.7069 1.2918 0.7037 -0.1235 -0.0984 0.0245  26  MSE A C   
34   O  O   . MSE A 7   ? 1.6887 1.2314 0.6710 -0.1189 -0.1053 0.0159  26  MSE A O   
35   C  CB  . MSE A 7   ? 1.9437 1.5971 0.9294 -0.0824 -0.0601 0.0196  26  MSE A CB  
36   C  CG  . MSE A 7   ? 2.1081 1.7907 1.0651 -0.0551 -0.0345 0.0184  26  MSE A CG  
37   SE SE  . MSE A 7   ? 2.4548 2.0591 1.3480 -0.0239 -0.0250 -0.0027 26  MSE A SE  
38   C  CE  . MSE A 7   ? 1.9911 1.5849 0.9137 -0.0066 -0.0317 -0.0136 26  MSE A CE  
39   N  N   . LEU A 8   ? 1.6571 1.2600 0.6864 -0.1395 -0.1106 0.0321  27  LEU A N   
40   C  CA  . LEU A 8   ? 1.6221 1.1910 0.6703 -0.1469 -0.1317 0.0286  27  LEU A CA  
41   C  C   . LEU A 8   ? 1.6255 1.1542 0.6606 -0.1605 -0.1478 0.0351  27  LEU A C   
42   O  O   . LEU A 8   ? 1.6175 1.1175 0.6612 -0.1547 -0.1608 0.0290  27  LEU A O   
43   C  CB  . LEU A 8   ? 1.6228 1.2106 0.6980 -0.1611 -0.1417 0.0341  27  LEU A CB  
44   C  CG  . LEU A 8   ? 1.6126 1.2399 0.7071 -0.1469 -0.1312 0.0270  27  LEU A CG  
45   C  CD1 . LEU A 8   ? 1.6023 1.2499 0.7166 -0.1701 -0.1436 0.0357  27  LEU A CD1 
46   C  CD2 . LEU A 8   ? 1.5981 1.2022 0.6971 -0.1228 -0.1307 0.0096  27  LEU A CD2 
47   N  N   . GLN A 9   ? 1.6245 1.1561 0.6392 -0.1770 -0.1470 0.0486  28  GLN A N   
48   C  CA  . GLN A 9   ? 1.6398 1.1361 0.6388 -0.1890 -0.1626 0.0568  28  GLN A CA  
49   C  C   . GLN A 9   ? 1.6294 1.1052 0.6091 -0.1755 -0.1598 0.0466  28  GLN A C   
50   O  O   . GLN A 9   ? 1.6230 1.0742 0.6041 -0.1776 -0.1758 0.0488  28  GLN A O   
51   C  CB  . GLN A 9   ? 1.6582 1.1637 0.6358 -0.2119 -0.1623 0.0750  28  GLN A CB  
52   C  CG  . GLN A 9   ? 1.6637 1.1828 0.6552 -0.2351 -0.1709 0.0901  28  GLN A CG  
53   C  CD  . GLN A 9   ? 1.6880 1.2097 0.6569 -0.2626 -0.1754 0.1117  28  GLN A CD  
54   O  OE1 . GLN A 9   ? 1.7255 1.2194 0.6728 -0.2665 -0.1836 0.1173  28  GLN A OE1 
55   N  NE2 . GLN A 9   ? 1.6934 1.2517 0.6671 -0.2847 -0.1718 0.1260  28  GLN A NE2 
56   N  N   . LYS A 10  ? 1.6344 1.1196 0.5933 -0.1620 -0.1405 0.0367  29  LYS A N   
57   C  CA  . LYS A 10  ? 1.6536 1.1112 0.5850 -0.1536 -0.1388 0.0265  29  LYS A CA  
58   C  C   . LYS A 10  ? 1.6203 1.0682 0.5761 -0.1440 -0.1480 0.0175  29  LYS A C   
59   O  O   . LYS A 10  ? 1.6249 1.0538 0.5721 -0.1488 -0.1591 0.0175  29  LYS A O   
60   C  CB  . LYS A 10  ? 1.6925 1.1502 0.5880 -0.1378 -0.1166 0.0165  29  LYS A CB  
61   N  N   . VAL A 11  ? 1.6135 1.0799 0.5994 -0.1323 -0.1439 0.0115  30  VAL A N   
62   C  CA  . VAL A 11  ? 1.5735 1.0364 0.5840 -0.1221 -0.1514 0.0031  30  VAL A CA  
63   C  C   . VAL A 11  ? 1.5718 1.0253 0.5997 -0.1301 -0.1716 0.0110  30  VAL A C   
64   O  O   . VAL A 11  ? 1.5878 1.0356 0.6182 -0.1271 -0.1796 0.0094  30  VAL A O   
65   C  CB  . VAL A 11  ? 1.5517 1.0372 0.5889 -0.1104 -0.1449 -0.0034 30  VAL A CB  
66   C  CG1 . VAL A 11  ? 1.5138 0.9960 0.5736 -0.1004 -0.1528 -0.0118 30  VAL A CG1 
67   C  CG2 . VAL A 11  ? 1.5501 1.0496 0.5713 -0.0963 -0.1251 -0.0095 30  VAL A CG2 
68   N  N   . SER A 12  ? 1.5804 1.0328 0.6171 -0.1402 -0.1802 0.0210  31  SER A N   
69   C  CA  . SER A 12  ? 1.6260 1.0612 0.6726 -0.1432 -0.2002 0.0298  31  SER A CA  
70   C  C   . SER A 12  ? 1.6754 1.1028 0.7052 -0.1498 -0.2089 0.0387  31  SER A C   
71   O  O   . SER A 12  ? 1.7107 1.1365 0.7534 -0.1418 -0.2223 0.0416  31  SER A O   
72   C  CB  . SER A 12  ? 1.6496 1.0735 0.6961 -0.1576 -0.2091 0.0415  31  SER A CB  
73   O  OG  . SER A 12  ? 1.6666 1.0961 0.7288 -0.1557 -0.2068 0.0349  31  SER A OG  
74   N  N   . ALA A 13  ? 1.6881 1.1143 0.6880 -0.1632 -0.2014 0.0434  32  ALA A N   
75   C  CA  . ALA A 13  ? 1.7189 1.1370 0.6957 -0.1740 -0.2104 0.0520  32  ALA A CA  
76   C  C   . ALA A 13  ? 1.7026 1.1244 0.6763 -0.1693 -0.2104 0.0437  32  ALA A C   
77   O  O   . ALA A 13  ? 1.7578 1.1854 0.7360 -0.1734 -0.2255 0.0521  32  ALA A O   
78   C  CB  . ALA A 13  ? 1.7355 1.1477 0.6736 -0.1893 -0.2011 0.0570  32  ALA A CB  
79   N  N   . ALA A 14  ? 1.6665 1.0871 0.6316 -0.1617 -0.1947 0.0297  33  ALA A N   
80   C  CA  . ALA A 14  ? 1.6933 1.1116 0.6494 -0.1615 -0.1950 0.0228  33  ALA A CA  
81   C  C   . ALA A 14  ? 1.7256 1.1678 0.7215 -0.1520 -0.2059 0.0241  33  ALA A C   
82   O  O   . ALA A 14  ? 1.7864 1.2387 0.7794 -0.1601 -0.2146 0.0282  33  ALA A O   
83   C  CB  . ALA A 14  ? 1.6719 1.0771 0.6077 -0.1518 -0.1766 0.0084  33  ALA A CB  
84   N  N   . ILE A 15  ? 1.7095 1.1617 0.7387 -0.1360 -0.2057 0.0212  34  ILE A N   
85   C  CA  . ILE A 15  ? 1.6901 1.1634 0.7540 -0.1205 -0.2142 0.0207  34  ILE A CA  
86   C  C   . ILE A 15  ? 1.7195 1.2047 0.7929 -0.1214 -0.2323 0.0358  34  ILE A C   
87   O  O   . ILE A 15  ? 1.7379 1.2523 0.8273 -0.1158 -0.2390 0.0397  34  ILE A O   
88   C  CB  . ILE A 15  ? 1.6553 1.1249 0.7417 -0.1040 -0.2109 0.0125  34  ILE A CB  
89   C  CG1 . ILE A 15  ? 1.6205 1.0920 0.7047 -0.0994 -0.1948 -0.0010 34  ILE A CG1 
90   C  CG2 . ILE A 15  ? 1.6355 1.1200 0.7496 -0.0839 -0.2200 0.0112  34  ILE A CG2 
91   C  CD1 . ILE A 15  ? 1.5858 1.0544 0.6856 -0.0908 -0.1923 -0.0075 34  ILE A CD1 
92   N  N   . GLU A 16  ? 1.7424 1.2098 0.8056 -0.1283 -0.2401 0.0461  35  GLU A N   
93   C  CA  . GLU A 16  ? 1.7585 1.2339 0.8274 -0.1272 -0.2586 0.0629  35  GLU A CA  
94   C  C   . GLU A 16  ? 1.7804 1.2738 0.8319 -0.1470 -0.2661 0.0738  35  GLU A C   
95   O  O   . GLU A 16  ? 1.7676 1.2866 0.8325 -0.1430 -0.2817 0.0880  35  GLU A O   
96   C  CB  . GLU A 16  ? 1.7993 1.2443 0.8575 -0.1313 -0.2662 0.0725  35  GLU A CB  
97   C  CG  . GLU A 16  ? 1.8107 1.2342 0.8828 -0.1154 -0.2654 0.0650  35  GLU A CG  
98   C  CD  . GLU A 16  ? 1.8548 1.2433 0.9106 -0.1264 -0.2741 0.0763  35  GLU A CD  
99   O  OE1 . GLU A 16  ? 1.8034 1.1864 0.8392 -0.1438 -0.2806 0.0911  35  GLU A OE1 
100  O  OE2 . GLU A 16  ? 1.8939 1.2582 0.9536 -0.1203 -0.2755 0.0710  35  GLU A OE2 
101  N  N   . ALA A 17  ? 1.7887 1.2676 0.8072 -0.1673 -0.2559 0.0675  36  ALA A N   
102  C  CA  . ALA A 17  ? 1.8340 1.3186 0.8240 -0.1918 -0.2637 0.0754  36  ALA A CA  
103  C  C   . ALA A 17  ? 1.8514 1.3620 0.8491 -0.1961 -0.2643 0.0723  36  ALA A C   
104  O  O   . ALA A 17  ? 1.8554 1.3704 0.8272 -0.2213 -0.2732 0.0797  36  ALA A O   
105  C  CB  . ALA A 17  ? 1.8122 1.2583 0.7519 -0.2099 -0.2530 0.0689  36  ALA A CB  
106  N  N   . GLY A 18  ? 1.8155 1.3425 0.8446 -0.1752 -0.2559 0.0626  37  GLY A N   
107  C  CA  . GLY A 18  ? 1.8499 1.4050 0.8875 -0.1796 -0.2552 0.0609  37  GLY A CA  
108  C  C   . GLY A 18  ? 1.9014 1.4212 0.8998 -0.1953 -0.2435 0.0487  37  GLY A C   
109  O  O   . GLY A 18  ? 1.9423 1.4782 0.9387 -0.2058 -0.2447 0.0495  37  GLY A O   
110  N  N   . GLN A 19  ? 1.8957 1.3688 0.8618 -0.1949 -0.2319 0.0384  38  GLN A N   
111  C  CA  . GLN A 19  ? 1.9336 1.3638 0.8547 -0.2022 -0.2197 0.0260  38  GLN A CA  
112  C  C   . GLN A 19  ? 1.8813 1.3096 0.8229 -0.1762 -0.2031 0.0121  38  GLN A C   
113  O  O   . GLN A 19  ? 1.8507 1.2562 0.7789 -0.1644 -0.1898 0.0035  38  GLN A O   
114  C  CB  . GLN A 19  ? 2.0566 1.4434 0.9264 -0.2136 -0.2164 0.0242  38  GLN A CB  
115  C  CG  . GLN A 19  ? 2.1471 1.5338 0.9908 -0.2430 -0.2348 0.0381  38  GLN A CG  
116  C  CD  . GLN A 19  ? 2.2886 1.6337 1.0790 -0.2533 -0.2316 0.0361  38  GLN A CD  
117  O  OE1 . GLN A 19  ? 2.3427 1.6728 1.1272 -0.2360 -0.2158 0.0280  38  GLN A OE1 
118  N  NE2 . GLN A 19  ? 2.3752 1.7072 1.1262 -0.2833 -0.2472 0.0451  38  GLN A NE2 
119  N  N   . ASN A 20  ? 1.8242 1.2836 0.7988 -0.1678 -0.2043 0.0116  39  ASN A N   
120  C  CA  . ASN A 20  ? 1.7797 1.2428 0.7751 -0.1451 -0.1912 -0.0004 39  ASN A CA  
121  C  C   . ASN A 20  ? 1.7676 1.1899 0.7234 -0.1429 -0.1777 -0.0112 39  ASN A C   
122  O  O   . ASN A 20  ? 1.7557 1.1759 0.7217 -0.1230 -0.1655 -0.0202 39  ASN A O   
123  C  CB  . ASN A 20  ? 1.7701 1.2749 0.8008 -0.1385 -0.1952 0.0016  39  ASN A CB  
124  C  CG  . ASN A 20  ? 1.7758 1.3207 0.8485 -0.1263 -0.2051 0.0091  39  ASN A CG  
125  O  OD1 . ASN A 20  ? 1.7418 1.2821 0.8153 -0.1281 -0.2127 0.0162  39  ASN A OD1 
126  N  ND2 . ASN A 20  ? 1.7811 1.3637 0.8852 -0.1114 -0.2048 0.0079  39  ASN A ND2 
127  N  N   . GLY A 21  ? 1.7993 1.1878 0.7070 -0.1633 -0.1814 -0.0093 40  GLY A N   
128  C  CA  . GLY A 21  ? 1.8469 1.1831 0.7039 -0.1592 -0.1704 -0.0191 40  GLY A CA  
129  C  C   . GLY A 21  ? 1.8590 1.1740 0.6994 -0.1391 -0.1556 -0.0275 40  GLY A C   
130  O  O   . GLY A 21  ? 1.8653 1.1763 0.7078 -0.1158 -0.1420 -0.0359 40  GLY A O   
131  N  N   . GLN A 22  ? 1.8442 1.1532 0.6700 -0.1480 -0.1583 -0.0235 41  GLN A N   
132  C  CA  . GLN A 22  ? 1.9003 1.2006 0.7114 -0.1309 -0.1434 -0.0288 41  GLN A CA  
133  C  C   . GLN A 22  ? 1.8401 1.1892 0.7090 -0.1151 -0.1380 -0.0270 41  GLN A C   
134  O  O   . GLN A 22  ? 1.8189 1.1744 0.6847 -0.0985 -0.1235 -0.0307 41  GLN A O   
135  C  CB  . GLN A 22  ? 1.9804 1.2559 0.7489 -0.1472 -0.1471 -0.0249 41  GLN A CB  
136  C  CG  . GLN A 22  ? 1.9775 1.2842 0.7758 -0.1661 -0.1627 -0.0113 41  GLN A CG  
137  C  CD  . GLN A 22  ? 2.0956 1.3762 0.8458 -0.1822 -0.1657 -0.0074 41  GLN A CD  
138  O  OE1 . GLN A 22  ? 2.2225 1.4534 0.9087 -0.1867 -0.1612 -0.0151 41  GLN A OE1 
139  N  NE2 . GLN A 22  ? 2.0339 1.3423 0.8091 -0.1908 -0.1741 0.0045  41  GLN A NE2 
140  N  N   . ALA A 23  ? 1.8215 1.2043 0.7387 -0.1201 -0.1500 -0.0208 42  ALA A N   
141  C  CA  . ALA A 23  ? 1.7596 1.1765 0.7239 -0.1084 -0.1486 -0.0200 42  ALA A CA  
142  C  C   . ALA A 23  ? 1.7478 1.1739 0.7237 -0.0888 -0.1364 -0.0294 42  ALA A C   
143  O  O   . ALA A 23  ? 1.7355 1.1798 0.7251 -0.0793 -0.1281 -0.0301 42  ALA A O   
144  C  CB  . ALA A 23  ? 1.6826 1.1219 0.6852 -0.1125 -0.1641 -0.0139 42  ALA A CB  
145  N  N   . VAL A 24  ? 1.7802 1.1967 0.7491 -0.0855 -0.1364 -0.0343 43  VAL A N   
146  C  CA  . VAL A 24  ? 1.7643 1.1866 0.7394 -0.0669 -0.1263 -0.0420 43  VAL A CA  
147  C  C   . VAL A 24  ? 1.8005 1.2012 0.7379 -0.0517 -0.1108 -0.0463 43  VAL A C   
148  O  O   . VAL A 24  ? 1.7460 1.1670 0.6969 -0.0327 -0.1009 -0.0494 43  VAL A O   
149  C  CB  . VAL A 24  ? 1.7652 1.1805 0.7370 -0.0701 -0.1313 -0.0437 43  VAL A CB  
150  C  CG1 . VAL A 24  ? 1.7974 1.2168 0.7729 -0.0509 -0.1220 -0.0502 43  VAL A CG1 
151  C  CG2 . VAL A 24  ? 1.7131 1.1600 0.7234 -0.0783 -0.1438 -0.0394 43  VAL A CG2 
152  N  N   . SER A 25  ? 1.8206 1.1817 0.7088 -0.0585 -0.1092 -0.0464 44  SER A N   
153  C  CA  . SER A 25  ? 1.8989 1.2327 0.7413 -0.0387 -0.0933 -0.0519 44  SER A CA  
154  C  C   . SER A 25  ? 1.8646 1.2393 0.7266 -0.0265 -0.0816 -0.0488 44  SER A C   
155  O  O   . SER A 25  ? 1.8996 1.2879 0.7561 -0.0003 -0.0665 -0.0517 44  SER A O   
156  C  CB  . SER A 25  ? 2.0312 1.3054 0.8082 -0.0509 -0.0961 -0.0540 44  SER A CB  
157  O  OG  . SER A 25  ? 2.1651 1.4021 0.9188 -0.0659 -0.1074 -0.0548 44  SER A OG  
158  N  N   . TYR A 26  ? 1.8286 1.2248 0.7114 -0.0456 -0.0890 -0.0410 45  TYR A N   
159  C  CA  . TYR A 26  ? 1.8020 1.2418 0.7056 -0.0424 -0.0806 -0.0343 45  TYR A CA  
160  C  C   . TYR A 26  ? 1.7360 1.2236 0.6925 -0.0376 -0.0817 -0.0318 45  TYR A C   
161  O  O   . TYR A 26  ? 1.7256 1.2546 0.6954 -0.0287 -0.0711 -0.0271 45  TYR A O   
162  C  CB  . TYR A 26  ? 1.8198 1.2620 0.7246 -0.0670 -0.0901 -0.0245 45  TYR A CB  
163  C  CG  . TYR A 26  ? 1.8690 1.2750 0.7173 -0.0712 -0.0854 -0.0256 45  TYR A CG  
164  C  CD1 . TYR A 26  ? 1.9207 1.3319 0.7352 -0.0527 -0.0656 -0.0279 45  TYR A CD1 
165  C  CD2 . TYR A 26  ? 1.8974 1.2690 0.7247 -0.0933 -0.1010 -0.0234 45  TYR A CD2 
166  C  CE1 . TYR A 26  ? 1.9539 1.3265 0.7087 -0.0551 -0.0608 -0.0309 45  TYR A CE1 
167  C  CE2 . TYR A 26  ? 1.9647 1.2998 0.7344 -0.1005 -0.0986 -0.0248 45  TYR A CE2 
168  C  CZ  . TYR A 26  ? 1.9820 1.3132 0.7128 -0.0811 -0.0783 -0.0298 45  TYR A CZ  
169  O  OH  . TYR A 26  ? 2.1441 1.4341 0.8109 -0.0867 -0.0755 -0.0330 45  TYR A OH  
170  N  N   . PHE A 27  ? 1.6886 1.1734 0.6725 -0.0443 -0.0948 -0.0343 46  PHE A N   
171  C  CA  . PHE A 27  ? 1.6510 1.1711 0.6770 -0.0410 -0.0981 -0.0343 46  PHE A CA  
172  C  C   . PHE A 27  ? 1.6640 1.2011 0.6862 -0.0162 -0.0843 -0.0387 46  PHE A C   
173  O  O   . PHE A 27  ? 1.6058 1.1872 0.6529 -0.0121 -0.0803 -0.0344 46  PHE A O   
174  C  CB  . PHE A 27  ? 1.5914 1.1011 0.6390 -0.0487 -0.1130 -0.0379 46  PHE A CB  
175  C  CG  . PHE A 27  ? 1.5692 1.1059 0.6528 -0.0491 -0.1193 -0.0389 46  PHE A CG  
176  C  CD1 . PHE A 27  ? 1.5604 1.1037 0.6617 -0.0647 -0.1303 -0.0328 46  PHE A CD1 
177  C  CD2 . PHE A 27  ? 1.5631 1.1120 0.6570 -0.0354 -0.1161 -0.0457 46  PHE A CD2 
178  C  CE1 . PHE A 27  ? 1.5724 1.1292 0.6972 -0.0678 -0.1384 -0.0350 46  PHE A CE1 
179  C  CE2 . PHE A 27  ? 1.5452 1.1150 0.6663 -0.0380 -0.1234 -0.0477 46  PHE A CE2 
180  C  CZ  . PHE A 27  ? 1.5574 1.1287 0.6921 -0.0547 -0.1348 -0.0431 46  PHE A CZ  
181  N  N   . ARG A 28  ? 1.7316 1.2330 0.7202 -0.0013 -0.0785 -0.0456 47  ARG A N   
182  C  CA  . ARG A 28  ? 1.7654 1.2738 0.7419 0.0275  -0.0656 -0.0489 47  ARG A CA  
183  C  C   . ARG A 28  ? 1.7883 1.3282 0.7546 0.0468  -0.0488 -0.0443 47  ARG A C   
184  O  O   . ARG A 28  ? 1.8126 1.3945 0.7954 0.0675  -0.0403 -0.0415 47  ARG A O   
185  C  CB  . ARG A 28  ? 1.8395 1.2888 0.7696 0.0384  -0.0642 -0.0559 47  ARG A CB  
186  C  CG  . ARG A 28  ? 1.8550 1.2962 0.8001 0.0319  -0.0748 -0.0585 47  ARG A CG  
187  C  CD  . ARG A 28  ? 1.9387 1.3210 0.8317 0.0415  -0.0730 -0.0624 47  ARG A CD  
188  N  NE  . ARG A 28  ? 2.0337 1.3647 0.8868 0.0199  -0.0802 -0.0630 47  ARG A NE  
189  C  CZ  . ARG A 28  ? 2.0858 1.3989 0.9365 -0.0055 -0.0938 -0.0610 47  ARG A CZ  
190  N  NH1 . ARG A 28  ? 2.0296 1.3679 0.9126 -0.0110 -0.1005 -0.0594 47  ARG A NH1 
191  N  NH2 . ARG A 28  ? 2.1623 1.4344 0.9743 -0.0269 -0.1010 -0.0596 47  ARG A NH2 
192  N  N   . GLN A 29  ? 1.8472 1.3724 0.7863 0.0408  -0.0438 -0.0425 48  GLN A N   
193  C  CA  . GLN A 29  ? 1.8870 1.4492 0.8150 0.0590  -0.0261 -0.0372 48  GLN A CA  
194  C  C   . GLN A 29  ? 1.8261 1.4668 0.8066 0.0443  -0.0274 -0.0241 48  GLN A C   
195  O  O   . GLN A 29  ? 1.7960 1.4937 0.7853 0.0641  -0.0129 -0.0172 48  GLN A O   
196  C  CB  . GLN A 29  ? 1.9831 1.5052 0.8616 0.0549  -0.0207 -0.0394 48  GLN A CB  
197  C  CG  . GLN A 29  ? 2.0655 1.5079 0.8786 0.0712  -0.0175 -0.0517 48  GLN A CG  
198  C  CD  . GLN A 29  ? 2.1529 1.5507 0.9126 0.0612  -0.0157 -0.0546 48  GLN A CD  
199  O  OE1 . GLN A 29  ? 2.0872 1.5196 0.8569 0.0486  -0.0125 -0.0469 48  GLN A OE1 
200  N  NE2 . GLN A 29  ? 2.2729 1.5908 0.9711 0.0638  -0.0190 -0.0649 48  GLN A NE2 
201  N  N   . THR A 30  ? 1.8059 1.4490 0.8177 0.0105  -0.0453 -0.0197 49  THR A N   
202  C  CA  . THR A 30  ? 1.7674 1.4703 0.8214 -0.0106 -0.0515 -0.0070 49  THR A CA  
203  C  C   . THR A 30  ? 1.7075 1.4543 0.7944 -0.0014 -0.0527 -0.0060 49  THR A C   
204  O  O   . THR A 30  ? 1.6906 1.5012 0.8042 -0.0109 -0.0517 0.0062  49  THR A O   
205  C  CB  . THR A 30  ? 1.7525 1.4318 0.8228 -0.0460 -0.0725 -0.0035 49  THR A CB  
206  O  OG1 . THR A 30  ? 1.7160 1.3597 0.7960 -0.0464 -0.0856 -0.0139 49  THR A OG1 
207  C  CG2 . THR A 30  ? 1.7527 1.3977 0.7945 -0.0580 -0.0738 -0.0010 49  THR A CG2 
208  N  N   . ILE A 31  ? 1.6897 1.4048 0.7735 0.0132  -0.0563 -0.0172 50  ILE A N   
209  C  CA  . ILE A 31  ? 1.6652 1.4165 0.7744 0.0242  -0.0579 -0.0172 50  ILE A CA  
210  C  C   . ILE A 31  ? 1.6953 1.4994 0.8008 0.0562  -0.0391 -0.0104 50  ILE A C   
211  O  O   . ILE A 31  ? 1.6965 1.5665 0.8331 0.0566  -0.0397 -0.0011 50  ILE A O   
212  C  CB  . ILE A 31  ? 1.6415 1.3448 0.7420 0.0335  -0.0647 -0.0297 50  ILE A CB  
213  C  CG1 . ILE A 31  ? 1.6261 1.2969 0.7388 0.0059  -0.0827 -0.0346 50  ILE A CG1 
214  C  CG2 . ILE A 31  ? 1.6306 1.3709 0.7508 0.0484  -0.0648 -0.0290 50  ILE A CG2 
215  C  CD1 . ILE A 31  ? 1.6197 1.2534 0.7256 0.0121  -0.0886 -0.0449 50  ILE A CD1 
216  N  N   . ALA A 32  ? 1.6973 1.4721 0.7619 0.0837  -0.0233 -0.0147 51  ALA A N   
217  C  CA  . ALA A 32  ? 1.7443 1.5625 0.7963 0.1234  -0.0027 -0.0095 51  ALA A CA  
218  C  C   . ALA A 32  ? 1.7676 1.6720 0.8459 0.1132  0.0051  0.0069  51  ALA A C   
219  O  O   . ALA A 32  ? 1.8128 1.7961 0.9152 0.1314  0.0137  0.0183  51  ALA A O   
220  C  CB  . ALA A 32  ? 1.7573 1.5080 0.7476 0.1535  0.0108  -0.0201 51  ALA A CB  
221  N  N   . LEU A 33  ? 1.7795 1.6726 0.8534 0.0826  0.0011  0.0104  52  LEU A N   
222  C  CA  . LEU A 33  ? 1.7783 1.7491 0.8732 0.0646  0.0069  0.0283  52  LEU A CA  
223  C  C   . LEU A 33  ? 1.7417 1.7731 0.8876 0.0283  -0.0098 0.0422  52  LEU A C   
224  O  O   . LEU A 33  ? 1.7694 1.8934 0.9415 0.0296  -0.0024 0.0589  52  LEU A O   
225  C  CB  . LEU A 33  ? 1.7966 1.7292 0.8674 0.0393  0.0049  0.0290  52  LEU A CB  
226  C  CG  . LEU A 33  ? 1.8451 1.7215 0.8584 0.0675  0.0207  0.0173  52  LEU A CG  
227  C  CD1 . LEU A 33  ? 1.8394 1.6761 0.8338 0.0343  0.0123  0.0189  52  LEU A CD1 
228  C  CD2 . LEU A 33  ? 1.8550 1.7888 0.8499 0.1094  0.0482  0.0222  52  LEU A CD2 
229  N  N   . ASN A 34  ? 1.6699 1.6503 0.8263 -0.0032 -0.0326 0.0357  53  ASN A N   
230  C  CA  . ASN A 34  ? 1.6291 1.6454 0.8216 -0.0404 -0.0520 0.0457  53  ASN A CA  
231  C  C   . ASN A 34  ? 1.6249 1.5719 0.8189 -0.0526 -0.0722 0.0307  53  ASN A C   
232  O  O   . ASN A 34  ? 1.6169 1.5033 0.7992 -0.0727 -0.0844 0.0251  53  ASN A O   
233  C  CB  . ASN A 34  ? 1.6308 1.6728 0.8290 -0.0824 -0.0591 0.0629  53  ASN A CB  
234  C  CG  . ASN A 34  ? 1.6302 1.7117 0.8575 -0.1251 -0.0796 0.0766  53  ASN A CG  
235  O  OD1 . ASN A 34  ? 1.6060 1.6996 0.8506 -0.1243 -0.0890 0.0726  53  ASN A OD1 
236  N  ND2 . ASN A 34  ? 1.6302 1.7289 0.8578 -0.1656 -0.0880 0.0937  53  ASN A ND2 
237  N  N   . ILE A 35  ? 1.6289 1.5903 0.8366 -0.0378 -0.0750 0.0253  54  ILE A N   
238  C  CA  . ILE A 35  ? 1.6102 1.5168 0.8190 -0.0449 -0.0916 0.0110  54  ILE A CA  
239  C  C   . ILE A 35  ? 1.6182 1.5169 0.8400 -0.0871 -0.1146 0.0145  54  ILE A C   
240  O  O   . ILE A 35  ? 1.6384 1.4743 0.8512 -0.0951 -0.1277 0.0021  54  ILE A O   
241  C  CB  . ILE A 35  ? 1.5576 1.4824 0.7729 -0.0165 -0.0876 0.0052  54  ILE A CB  
242  C  CG1 . ILE A 35  ? 1.5637 1.4264 0.7722 -0.0178 -0.1000 -0.0111 54  ILE A CG1 
243  C  CG2 . ILE A 35  ? 1.5712 1.5801 0.8156 -0.0257 -0.0913 0.0198  54  ILE A CG2 
244  C  CD1 . ILE A 35  ? 1.5374 1.4097 0.7465 0.0088  -0.0964 -0.0163 54  ILE A CD1 
245  N  N   . ASP A 36  ? 1.6468 1.6074 0.8859 -0.1137 -0.1198 0.0318  55  ASP A N   
246  C  CA  . ASP A 36  ? 1.6890 1.6342 0.9309 -0.1586 -0.1442 0.0367  55  ASP A CA  
247  C  C   . ASP A 36  ? 1.6719 1.5511 0.8936 -0.1800 -0.1540 0.0360  55  ASP A C   
248  O  O   . ASP A 36  ? 1.6170 1.4335 0.8267 -0.1961 -0.1731 0.0270  55  ASP A O   
249  C  CB  . ASP A 36  ? 1.7409 1.7742 1.0034 -0.1880 -0.1484 0.0596  55  ASP A CB  
250  C  CG  . ASP A 36  ? 1.8200 1.8294 1.0768 -0.2394 -0.1770 0.0650  55  ASP A CG  
251  O  OD1 . ASP A 36  ? 1.8364 1.7757 1.0783 -0.2425 -0.1929 0.0478  55  ASP A OD1 
252  O  OD2 . ASP A 36  ? 1.8848 1.9464 1.1487 -0.2774 -0.1839 0.0871  55  ASP A OD2 
253  N  N   . ARG A 37  ? 1.6782 1.5714 0.8933 -0.1773 -0.1407 0.0457  56  ARG A N   
254  C  CA  . ARG A 37  ? 1.7192 1.5557 0.9142 -0.1956 -0.1489 0.0480  56  ARG A CA  
255  C  C   . ARG A 37  ? 1.6884 1.4494 0.8676 -0.1715 -0.1498 0.0288  56  ARG A C   
256  O  O   . ARG A 37  ? 1.6836 1.3859 0.8496 -0.1858 -0.1653 0.0266  56  ARG A O   
257  C  CB  . ARG A 37  ? 1.7584 1.6381 0.9484 -0.1990 -0.1331 0.0643  56  ARG A CB  
258  C  CG  . ARG A 37  ? 1.8338 1.6636 1.0020 -0.2203 -0.1416 0.0707  56  ARG A CG  
259  C  CD  . ARG A 37  ? 1.8863 1.6866 1.0492 -0.2657 -0.1680 0.0821  56  ARG A CD  
260  N  NE  . ARG A 37  ? 1.9403 1.6882 1.0797 -0.2816 -0.1767 0.0891  56  ARG A NE  
261  C  CZ  . ARG A 37  ? 1.9411 1.6104 1.0643 -0.2707 -0.1876 0.0771  56  ARG A CZ  
262  N  NH1 . ARG A 37  ? 1.9319 1.5643 1.0595 -0.2440 -0.1905 0.0563  56  ARG A NH1 
263  N  NH2 . ARG A 37  ? 2.0122 1.6446 1.1147 -0.2864 -0.1958 0.0879  56  ARG A NH2 
264  N  N   . THR A 38  ? 1.6418 1.4065 0.8206 -0.1356 -0.1338 0.0170  57  THR A N   
265  C  CA  . THR A 38  ? 1.6134 1.3191 0.7790 -0.1153 -0.1341 0.0011  57  THR A CA  
266  C  C   . THR A 38  ? 1.6131 1.2829 0.7842 -0.1188 -0.1510 -0.0105 57  THR A C   
267  O  O   . THR A 38  ? 1.5840 1.2038 0.7459 -0.1167 -0.1598 -0.0177 57  THR A O   
268  C  CB  . THR A 38  ? 1.6209 1.3363 0.7791 -0.0809 -0.1152 -0.0070 57  THR A CB  
269  O  OG1 . THR A 38  ? 1.6595 1.4005 0.8042 -0.0728 -0.0985 0.0013  57  THR A OG1 
270  C  CG2 . THR A 38  ? 1.6181 1.2780 0.7615 -0.0677 -0.1175 -0.0202 57  THR A CG2 
271  N  N   . GLU A 39  ? 1.5867 1.2859 0.7714 -0.1220 -0.1551 -0.0118 58  GLU A N   
272  C  CA  . GLU A 39  ? 1.6336 1.3010 0.8183 -0.1255 -0.1707 -0.0238 58  GLU A CA  
273  C  C   . GLU A 39  ? 1.6560 1.2737 0.8269 -0.1507 -0.1907 -0.0216 58  GLU A C   
274  O  O   . GLU A 39  ? 1.6505 1.2168 0.8108 -0.1419 -0.2002 -0.0337 58  GLU A O   
275  C  CB  . GLU A 39  ? 1.6039 1.3163 0.8016 -0.1325 -0.1742 -0.0221 58  GLU A CB  
276  C  CG  . GLU A 39  ? 1.6647 1.3437 0.8565 -0.1297 -0.1870 -0.0377 58  GLU A CG  
277  C  CD  . GLU A 39  ? 1.6401 1.3546 0.8386 -0.1458 -0.1967 -0.0354 58  GLU A CD  
278  O  OE1 . GLU A 39  ? 1.6423 1.4239 0.8581 -0.1487 -0.1893 -0.0223 58  GLU A OE1 
279  O  OE2 . GLU A 39  ? 1.6864 1.3620 0.8705 -0.1540 -0.2123 -0.0471 58  GLU A OE2 
280  N  N   . MSE A 40  ? 1.6722 1.3069 0.8412 -0.1807 -0.1967 -0.0050 59  MSE A N   
281  C  CA  . MSE A 40  ? 1.7520 1.3344 0.9012 -0.2088 -0.2174 0.0008  59  MSE A CA  
282  C  C   . MSE A 40  ? 1.7389 1.2693 0.8748 -0.1950 -0.2184 -0.0020 59  MSE A C   
283  O  O   . MSE A 40  ? 1.7477 1.2160 0.8655 -0.1963 -0.2352 -0.0077 59  MSE A O   
284  C  CB  . MSE A 40  ? 1.8744 1.4965 1.0245 -0.2467 -0.2214 0.0234  59  MSE A CB  
285  C  CG  . MSE A 40  ? 2.0647 1.6305 1.1886 -0.2837 -0.2464 0.0322  59  MSE A CG  
286  SE SE  . MSE A 40  ? 2.3533 1.9912 1.4825 -0.3395 -0.2519 0.0639  59  MSE A SE  
287  C  CE  . MSE A 40  ? 2.2665 1.9690 1.4175 -0.3443 -0.2536 0.0590  59  MSE A CE  
288  N  N   . TYR A 41  ? 1.6728 1.2279 0.8145 -0.1802 -0.2011 0.0019  60  TYR A N   
289  C  CA  . TYR A 41  ? 1.6502 1.1674 0.7811 -0.1678 -0.2013 0.0007  60  TYR A CA  
290  C  C   . TYR A 41  ? 1.6345 1.1173 0.7660 -0.1415 -0.2054 -0.0162 60  TYR A C   
291  O  O   . TYR A 41  ? 1.6284 1.0688 0.7495 -0.1367 -0.2166 -0.0166 60  TYR A O   
292  C  CB  . TYR A 41  ? 1.6275 1.1775 0.7586 -0.1574 -0.1816 0.0057  60  TYR A CB  
293  C  CG  . TYR A 41  ? 1.6572 1.1748 0.7767 -0.1457 -0.1821 0.0039  60  TYR A CG  
294  C  CD1 . TYR A 41  ? 1.6347 1.1282 0.7396 -0.1617 -0.1915 0.0167  60  TYR A CD1 
295  C  CD2 . TYR A 41  ? 1.6433 1.1568 0.7650 -0.1215 -0.1747 -0.0084 60  TYR A CD2 
296  C  CE1 . TYR A 41  ? 1.6581 1.1281 0.7534 -0.1521 -0.1939 0.0167  60  TYR A CE1 
297  C  CE2 . TYR A 41  ? 1.6273 1.1187 0.7391 -0.1154 -0.1772 -0.0077 60  TYR A CE2 
298  C  CZ  . TYR A 41  ? 1.6542 1.1261 0.7540 -0.1299 -0.1869 0.0046  60  TYR A CZ  
299  O  OH  . TYR A 41  ? 1.6844 1.1412 0.7754 -0.1250 -0.1909 0.0069  60  TYR A OH  
300  N  N   . TYR A 42  ? 1.5937 1.0995 0.7370 -0.1236 -0.1961 -0.0284 61  TYR A N   
301  C  CA  . TYR A 42  ? 1.5728 1.0582 0.7179 -0.0997 -0.1979 -0.0434 61  TYR A CA  
302  C  C   . TYR A 42  ? 1.6093 1.0487 0.7425 -0.1012 -0.2164 -0.0502 61  TYR A C   
303  O  O   . TYR A 42  ? 1.6138 1.0235 0.7415 -0.0841 -0.2222 -0.0551 61  TYR A O   
304  C  CB  . TYR A 42  ? 1.5484 1.0673 0.7048 -0.0843 -0.1854 -0.0530 61  TYR A CB  
305  C  CG  . TYR A 42  ? 1.5433 1.0489 0.7011 -0.0633 -0.1870 -0.0671 61  TYR A CG  
306  C  CD1 . TYR A 42  ? 1.5480 1.0567 0.7078 -0.0476 -0.1798 -0.0689 61  TYR A CD1 
307  C  CD2 . TYR A 42  ? 1.5677 1.0593 0.7216 -0.0613 -0.1964 -0.0778 61  TYR A CD2 
308  C  CE1 . TYR A 42  ? 1.5511 1.0590 0.7140 -0.0296 -0.1802 -0.0792 61  TYR A CE1 
309  C  CE2 . TYR A 42  ? 1.6147 1.0993 0.7680 -0.0397 -0.1959 -0.0907 61  TYR A CE2 
310  C  CZ  . TYR A 42  ? 1.6133 1.1108 0.7735 -0.0235 -0.1871 -0.0905 61  TYR A CZ  
311  O  OH  . TYR A 42  ? 1.6711 1.1728 0.8325 -0.0034 -0.1855 -0.1008 61  TYR A OH  
312  N  N   . TRP A 43  ? 1.6406 1.0745 0.7667 -0.1211 -0.2261 -0.0498 62  TRP A N   
313  C  CA  . TRP A 43  ? 1.6815 1.0584 0.7844 -0.1245 -0.2456 -0.0579 62  TRP A CA  
314  C  C   . TRP A 43  ? 1.7454 1.0662 0.8257 -0.1339 -0.2614 -0.0491 62  TRP A C   
315  O  O   . TRP A 43  ? 1.7941 1.0607 0.8544 -0.1158 -0.2729 -0.0586 62  TRP A O   
316  C  CB  . TRP A 43  ? 1.6925 1.0752 0.7878 -0.1503 -0.2548 -0.0585 62  TRP A CB  
317  C  CG  . TRP A 43  ? 1.6722 1.1014 0.7846 -0.1379 -0.2434 -0.0686 62  TRP A CG  
318  C  CD1 . TRP A 43  ? 1.6499 1.1424 0.7818 -0.1500 -0.2342 -0.0604 62  TRP A CD1 
319  C  CD2 . TRP A 43  ? 1.6564 1.0785 0.7682 -0.1078 -0.2387 -0.0873 62  TRP A CD2 
320  N  NE1 . TRP A 43  ? 1.6552 1.1725 0.7962 -0.1310 -0.2265 -0.0723 62  TRP A NE1 
321  C  CE2 . TRP A 43  ? 1.6477 1.1253 0.7769 -0.1074 -0.2285 -0.0885 62  TRP A CE2 
322  C  CE3 . TRP A 43  ? 1.6704 1.0523 0.7692 -0.0805 -0.2415 -0.1014 62  TRP A CE3 
323  C  CZ2 . TRP A 43  ? 1.6232 1.1098 0.7541 -0.0846 -0.2223 -0.1029 62  TRP A CZ2 
324  C  CZ3 . TRP A 43  ? 1.6734 1.0722 0.7763 -0.0569 -0.2334 -0.1162 62  TRP A CZ3 
325  C  CH2 . TRP A 43  ? 1.6509 1.0984 0.7683 -0.0609 -0.2244 -0.1168 62  TRP A CH2 
326  N  N   . THR A 44  ? 1.7672 1.1006 0.8480 -0.1593 -0.2617 -0.0304 63  THR A N   
327  C  CA  . THR A 44  ? 1.8367 1.1160 0.8929 -0.1732 -0.2783 -0.0180 63  THR A CA  
328  C  C   . THR A 44  ? 1.8669 1.1363 0.9263 -0.1501 -0.2751 -0.0142 63  THR A C   
329  O  O   . THR A 44  ? 1.9604 1.1725 0.9990 -0.1372 -0.2899 -0.0149 63  THR A O   
330  C  CB  . THR A 44  ? 1.8353 1.1353 0.8874 -0.2157 -0.2815 0.0033  63  THR A CB  
331  O  OG1 . THR A 44  ? 1.8365 1.2080 0.9151 -0.2136 -0.2594 0.0103  63  THR A OG1 
332  C  CG2 . THR A 44  ? 1.8549 1.1578 0.8980 -0.2464 -0.2921 0.0041  63  THR A CG2 
333  N  N   . ASN A 45  ? 1.8335 1.1562 0.9150 -0.1440 -0.2569 -0.0100 64  ASN A N   
334  C  CA  . ASN A 45  ? 1.8206 1.1420 0.9039 -0.1300 -0.2548 -0.0033 64  ASN A CA  
335  C  C   . ASN A 45  ? 1.7947 1.1342 0.8936 -0.0973 -0.2465 -0.0143 64  ASN A C   
336  O  O   . ASN A 45  ? 1.7729 1.0990 0.8692 -0.0842 -0.2531 -0.0087 64  ASN A O   
337  C  CB  . ASN A 45  ? 1.8386 1.1978 0.9250 -0.1497 -0.2431 0.0109  64  ASN A CB  
338  C  CG  . ASN A 45  ? 1.9153 1.2640 0.9859 -0.1846 -0.2520 0.0277  64  ASN A CG  
339  O  OD1 . ASN A 45  ? 1.9585 1.2941 1.0227 -0.2020 -0.2611 0.0275  64  ASN A OD1 
340  N  ND2 . ASN A 45  ? 1.9573 1.3143 1.0193 -0.1984 -0.2497 0.0434  64  ASN A ND2 
341  N  N   . VAL A 46  ? 1.7533 1.1265 0.8678 -0.0859 -0.2332 -0.0271 65  VAL A N   
342  C  CA  . VAL A 46  ? 1.7044 1.1012 0.8326 -0.0611 -0.2250 -0.0347 65  VAL A CA  
343  C  C   . VAL A 46  ? 1.7263 1.1012 0.8536 -0.0340 -0.2344 -0.0437 65  VAL A C   
344  O  O   . VAL A 46  ? 1.7568 1.1029 0.8735 -0.0288 -0.2414 -0.0538 65  VAL A O   
345  C  CB  . VAL A 46  ? 1.6603 1.0963 0.8005 -0.0585 -0.2083 -0.0435 65  VAL A CB  
346  C  CG1 . VAL A 46  ? 1.6077 1.0660 0.7584 -0.0385 -0.2019 -0.0496 65  VAL A CG1 
347  C  CG2 . VAL A 46  ? 1.6142 1.0716 0.7512 -0.0756 -0.1971 -0.0348 65  VAL A CG2 
348  N  N   . ASP A 47  ? 1.7278 1.1184 0.8637 -0.0168 -0.2349 -0.0392 66  ASP A N   
349  C  CA  . ASP A 47  ? 1.7304 1.1161 0.8690 0.0156  -0.2407 -0.0457 66  ASP A CA  
350  C  C   . ASP A 47  ? 1.7190 1.1419 0.8713 0.0280  -0.2274 -0.0594 66  ASP A C   
351  O  O   . ASP A 47  ? 1.6568 1.1228 0.8233 0.0221  -0.2167 -0.0559 66  ASP A O   
352  C  CB  . ASP A 47  ? 1.7013 1.1088 0.8493 0.0266  -0.2453 -0.0318 66  ASP A CB  
353  C  CG  . ASP A 47  ? 1.7165 1.1321 0.8705 0.0662  -0.2500 -0.0358 66  ASP A CG  
354  O  OD1 . ASP A 47  ? 1.7244 1.1215 0.8706 0.0876  -0.2491 -0.0513 66  ASP A OD1 
355  O  OD2 . ASP A 47  ? 1.7027 1.1468 0.8680 0.0773  -0.2545 -0.0227 66  ASP A OD2 
356  N  N   . LYS A 48  ? 1.7559 1.1568 0.8986 0.0433  -0.2294 -0.0745 67  LYS A N   
357  C  CA  . LYS A 48  ? 1.7789 1.2127 0.9308 0.0549  -0.2176 -0.0877 67  LYS A CA  
358  C  C   . LYS A 48  ? 1.7965 1.2764 0.9650 0.0819  -0.2111 -0.0874 67  LYS A C   
359  O  O   . LYS A 48  ? 1.7365 1.2556 0.9153 0.0844  -0.1997 -0.0928 67  LYS A O   
360  C  CB  . LYS A 48  ? 1.8147 1.2099 0.9457 0.0609  -0.2227 -0.1044 67  LYS A CB  
361  C  CG  . LYS A 48  ? 1.8200 1.1782 0.9350 0.0301  -0.2311 -0.1027 67  LYS A CG  
362  C  CD  . LYS A 48  ? 1.7834 1.1799 0.9147 0.0030  -0.2206 -0.0941 67  LYS A CD  
363  C  CE  . LYS A 48  ? 1.8316 1.2059 0.9506 -0.0265 -0.2285 -0.0898 67  LYS A CE  
364  N  NZ  . LYS A 48  ? 1.8915 1.2241 0.9948 -0.0404 -0.2425 -0.0780 67  LYS A NZ  
365  N  N   . ASN A 49  ? 1.8594 1.3391 1.0303 0.1011  -0.2189 -0.0791 68  ASN A N   
366  C  CA  . ASN A 49  ? 1.8707 1.4077 1.0613 0.1266  -0.2138 -0.0743 68  ASN A CA  
367  C  C   . ASN A 49  ? 1.7977 1.3897 1.0091 0.1048  -0.2098 -0.0566 68  ASN A C   
368  O  O   . ASN A 49  ? 1.8218 1.4718 1.0518 0.1189  -0.2067 -0.0489 68  ASN A O   
369  C  CB  . ASN A 49  ? 1.9367 1.4535 1.1197 0.1636  -0.2247 -0.0725 68  ASN A CB  
370  C  CG  . ASN A 49  ? 2.0016 1.4596 1.1549 0.1907  -0.2289 -0.0923 68  ASN A CG  
371  O  OD1 . ASN A 49  ? 2.0193 1.4665 1.1625 0.1844  -0.2226 -0.1079 68  ASN A OD1 
372  N  ND2 . ASN A 49  ? 2.1060 1.5219 1.2404 0.2219  -0.2409 -0.0916 68  ASN A ND2 
373  N  N   . SER A 50  ? 1.7225 1.2984 0.9280 0.0706  -0.2099 -0.0499 69  SER A N   
374  C  CA  . SER A 50  ? 1.6966 1.3084 0.9095 0.0466  -0.2078 -0.0350 69  SER A CA  
375  C  C   . SER A 50  ? 1.6326 1.2681 0.8455 0.0306  -0.1955 -0.0393 69  SER A C   
376  O  O   . SER A 50  ? 1.6539 1.2753 0.8619 0.0344  -0.1884 -0.0526 69  SER A O   
377  C  CB  . SER A 50  ? 1.6638 1.2405 0.8620 0.0213  -0.2140 -0.0260 69  SER A CB  
378  O  OG  . SER A 50  ? 1.6555 1.1982 0.8399 0.0065  -0.2081 -0.0349 69  SER A OG  
379  N  N   . GLU A 51  ? 1.6096 1.2778 0.8242 0.0111  -0.1949 -0.0266 70  GLU A N   
380  C  CA  . GLU A 51  ? 1.5800 1.2608 0.7860 -0.0073 -0.1857 -0.0277 70  GLU A CA  
381  C  C   . GLU A 51  ? 1.5772 1.2102 0.7601 -0.0237 -0.1804 -0.0340 70  GLU A C   
382  O  O   . GLU A 51  ? 1.5406 1.1686 0.7159 -0.0252 -0.1716 -0.0417 70  GLU A O   
383  C  CB  . GLU A 51  ? 1.5550 1.2743 0.7605 -0.0294 -0.1899 -0.0109 70  GLU A CB  
384  N  N   . ILE A 52  ? 1.5709 1.1736 0.7425 -0.0338 -0.1855 -0.0296 71  ILE A N   
385  C  CA  . ILE A 52  ? 1.6031 1.1692 0.7537 -0.0456 -0.1793 -0.0339 71  ILE A CA  
386  C  C   . ILE A 52  ? 1.6160 1.1696 0.7723 -0.0330 -0.1737 -0.0463 71  ILE A C   
387  O  O   . ILE A 52  ? 1.6148 1.1572 0.7589 -0.0377 -0.1652 -0.0504 71  ILE A O   
388  C  CB  . ILE A 52  ? 1.6568 1.2005 0.7946 -0.0583 -0.1856 -0.0251 71  ILE A CB  
389  C  CG1 . ILE A 52  ? 1.7007 1.2170 0.8128 -0.0698 -0.1765 -0.0275 71  ILE A CG1 
390  C  CG2 . ILE A 52  ? 1.6517 1.1850 0.8025 -0.0470 -0.1946 -0.0242 71  ILE A CG2 
391  C  CD1 . ILE A 52  ? 1.7263 1.2342 0.8116 -0.0804 -0.1698 -0.0277 71  ILE A CD1 
392  N  N   . SER A 53  ? 1.6303 1.1850 0.8016 -0.0166 -0.1794 -0.0519 72  SER A N   
393  C  CA  . SER A 53  ? 1.6499 1.1910 0.8228 -0.0083 -0.1779 -0.0637 72  SER A CA  
394  C  C   . SER A 53  ? 1.5665 1.1221 0.7379 -0.0070 -0.1673 -0.0711 72  SER A C   
395  O  O   . SER A 53  ? 1.5011 1.0487 0.6677 -0.0115 -0.1634 -0.0747 72  SER A O   
396  C  CB  . SER A 53  ? 1.6854 1.2221 0.8657 0.0127  -0.1856 -0.0709 72  SER A CB  
397  O  OG  . SER A 53  ? 1.8228 1.3388 0.9972 0.0158  -0.1870 -0.0824 72  SER A OG  
398  N  N   . SER A 54  ? 1.5664 1.1480 0.7420 -0.0014 -0.1635 -0.0710 73  SER A N   
399  C  CA  . SER A 54  ? 1.5898 1.1838 0.7606 -0.0006 -0.1547 -0.0756 73  SER A CA  
400  C  C   . SER A 54  ? 1.5696 1.1484 0.7215 -0.0138 -0.1481 -0.0707 73  SER A C   
401  O  O   . SER A 54  ? 1.6046 1.1820 0.7506 -0.0100 -0.1420 -0.0751 73  SER A O   
402  C  CB  . SER A 54  ? 1.6129 1.2412 0.7901 0.0039  -0.1527 -0.0730 73  SER A CB  
403  O  OG  . SER A 54  ? 1.6418 1.2860 0.8333 0.0243  -0.1560 -0.0799 73  SER A OG  
404  N  N   . LYS A 55  ? 1.6167 1.1825 0.7559 -0.0269 -0.1497 -0.0618 74  LYS A N   
405  C  CA  . LYS A 55  ? 1.6223 1.1637 0.7340 -0.0353 -0.1432 -0.0587 74  LYS A CA  
406  C  C   . LYS A 55  ? 1.5874 1.1209 0.7001 -0.0291 -0.1385 -0.0624 74  LYS A C   
407  O  O   . LYS A 55  ? 1.5602 1.0900 0.6614 -0.0222 -0.1304 -0.0645 74  LYS A O   
408  C  CB  . LYS A 55  ? 1.6639 1.1884 0.7557 -0.0517 -0.1473 -0.0497 74  LYS A CB  
409  C  CG  . LYS A 55  ? 1.7418 1.2805 0.8302 -0.0650 -0.1539 -0.0417 74  LYS A CG  
410  C  CD  . LYS A 55  ? 1.8318 1.3590 0.8947 -0.0726 -0.1498 -0.0404 74  LYS A CD  
411  C  CE  . LYS A 55  ? 1.9075 1.4538 0.9651 -0.0941 -0.1583 -0.0287 74  LYS A CE  
412  N  NZ  . LYS A 55  ? 1.9798 1.5074 1.0053 -0.1078 -0.1568 -0.0250 74  LYS A NZ  
413  N  N   . LEU A 56  ? 1.5824 1.1165 0.7087 -0.0316 -0.1445 -0.0614 75  LEU A N   
414  C  CA  . LEU A 56  ? 1.5349 1.0700 0.6641 -0.0322 -0.1419 -0.0613 75  LEU A CA  
415  C  C   . LEU A 56  ? 1.4803 1.0328 0.6227 -0.0238 -0.1404 -0.0682 75  LEU A C   
416  O  O   . LEU A 56  ? 1.4467 1.0117 0.5874 -0.0216 -0.1338 -0.0665 75  LEU A O   
417  C  CB  . LEU A 56  ? 1.5019 1.0289 0.6382 -0.0420 -0.1515 -0.0562 75  LEU A CB  
418  C  CG  . LEU A 56  ? 1.5354 1.0480 0.6590 -0.0521 -0.1553 -0.0475 75  LEU A CG  
419  C  CD1 . LEU A 56  ? 1.4985 1.0010 0.6277 -0.0608 -0.1658 -0.0412 75  LEU A CD1 
420  C  CD2 . LEU A 56  ? 1.4983 1.0026 0.5956 -0.0565 -0.1448 -0.0439 75  LEU A CD2 
421  N  N   . ALA A 57  ? 1.4711 1.0282 0.6251 -0.0179 -0.1464 -0.0753 76  ALA A N   
422  C  CA  . ALA A 57  ? 1.4786 1.0496 0.6404 -0.0116 -0.1470 -0.0829 76  ALA A CA  
423  C  C   . ALA A 57  ? 1.5177 1.1021 0.6719 -0.0033 -0.1371 -0.0828 76  ALA A C   
424  O  O   . ALA A 57  ? 1.5127 1.1139 0.6710 -0.0003 -0.1354 -0.0837 76  ALA A O   
425  C  CB  . ALA A 57  ? 1.4382 1.0066 0.6062 -0.0038 -0.1544 -0.0920 76  ALA A CB  
426  N  N   . THR A 58  ? 1.5598 1.1361 0.7009 -0.0012 -0.1322 -0.0802 77  THR A N   
427  C  CA  . THR A 58  ? 1.6033 1.1788 0.7280 0.0061  -0.1244 -0.0784 77  THR A CA  
428  C  C   . THR A 58  ? 1.6240 1.1945 0.7354 0.0125  -0.1165 -0.0736 77  THR A C   
429  O  O   . THR A 58  ? 1.6254 1.2057 0.7319 0.0249  -0.1116 -0.0730 77  THR A O   
430  C  CB  . THR A 58  ? 1.6548 1.2146 0.7607 0.0000  -0.1237 -0.0742 77  THR A CB  
431  O  OG1 . THR A 58  ? 1.6572 1.2358 0.7790 -0.0024 -0.1291 -0.0769 77  THR A OG1 
432  C  CG2 . THR A 58  ? 1.6266 1.1738 0.7076 0.0059  -0.1180 -0.0714 77  THR A CG2 
433  N  N   . GLU A 59  ? 1.6083 1.1672 0.7130 0.0065  -0.1149 -0.0696 78  GLU A N   
434  C  CA  . GLU A 59  ? 1.6394 1.1990 0.7297 0.0161  -0.1051 -0.0651 78  GLU A CA  
435  C  C   . GLU A 59  ? 1.5660 1.1673 0.6802 0.0210  -0.1041 -0.0632 78  GLU A C   
436  O  O   . GLU A 59  ? 1.6010 1.2191 0.7085 0.0379  -0.0952 -0.0594 78  GLU A O   
437  C  CB  . GLU A 59  ? 1.6932 1.2345 0.7691 0.0070  -0.1036 -0.0612 78  GLU A CB  
438  C  CG  . GLU A 59  ? 1.7932 1.2950 0.8407 -0.0021 -0.1062 -0.0610 78  GLU A CG  
439  C  CD  . GLU A 59  ? 1.8614 1.3286 0.8688 0.0080  -0.0999 -0.0616 78  GLU A CD  
440  O  OE1 . GLU A 59  ? 1.9122 1.3805 0.9076 0.0289  -0.0905 -0.0620 78  GLU A OE1 
441  O  OE2 . GLU A 59  ? 1.8342 1.2713 0.8188 -0.0055 -0.1055 -0.0604 78  GLU A OE2 
442  N  N   . LEU A 60  ? 1.4897 1.1067 0.6284 0.0061  -0.1144 -0.0646 79  LEU A N   
443  C  CA  . LEU A 60  ? 1.4817 1.1378 0.6408 0.0019  -0.1177 -0.0615 79  LEU A CA  
444  C  C   . LEU A 60  ? 1.4580 1.1331 0.6223 0.0132  -0.1184 -0.0651 79  LEU A C   
445  O  O   . LEU A 60  ? 1.4285 1.1421 0.6010 0.0202  -0.1150 -0.0588 79  LEU A O   
446  C  CB  . LEU A 60  ? 1.4807 1.1325 0.6533 -0.0202 -0.1316 -0.0625 79  LEU A CB  
447  C  CG  . LEU A 60  ? 1.4746 1.1174 0.6435 -0.0339 -0.1320 -0.0546 79  LEU A CG  
448  C  CD1 . LEU A 60  ? 1.4893 1.1078 0.6623 -0.0526 -0.1479 -0.0563 79  LEU A CD1 
449  C  CD2 . LEU A 60  ? 1.4401 1.1254 0.6142 -0.0367 -0.1241 -0.0428 79  LEU A CD2 
450  N  N   . ALA A 61  ? 1.4602 1.1144 0.6196 0.0155  -0.1224 -0.0734 80  ALA A N   
451  C  CA  . ALA A 61  ? 1.4891 1.1583 0.6491 0.0252  -0.1234 -0.0766 80  ALA A CA  
452  C  C   . ALA A 61  ? 1.5274 1.2034 0.6729 0.0457  -0.1126 -0.0694 80  ALA A C   
453  O  O   . ALA A 61  ? 1.5106 1.2198 0.6636 0.0548  -0.1127 -0.0654 80  ALA A O   
454  C  CB  . ALA A 61  ? 1.4844 1.1329 0.6384 0.0246  -0.1270 -0.0850 80  ALA A CB  
455  N  N   . LEU A 62  ? 1.5772 1.2188 0.6982 0.0530  -0.1048 -0.0674 81  LEU A N   
456  C  CA  . LEU A 62  ? 1.5996 1.2290 0.6942 0.0760  -0.0948 -0.0616 81  LEU A CA  
457  C  C   . LEU A 62  ? 1.6219 1.2887 0.7247 0.0913  -0.0871 -0.0541 81  LEU A C   
458  O  O   . LEU A 62  ? 1.6995 1.3844 0.7960 0.1150  -0.0818 -0.0484 81  LEU A O   
459  C  CB  . LEU A 62  ? 1.6571 1.2310 0.7149 0.0755  -0.0905 -0.0620 81  LEU A CB  
460  C  CG  . LEU A 62  ? 1.6702 1.2128 0.7137 0.0617  -0.0966 -0.0646 81  LEU A CG  
461  C  CD1 . LEU A 62  ? 1.6764 1.1726 0.6890 0.0503  -0.0962 -0.0637 81  LEU A CD1 
462  C  CD2 . LEU A 62  ? 1.6829 1.2158 0.7074 0.0741  -0.0962 -0.0615 81  LEU A CD2 
463  N  N   . ALA A 63  ? 1.5541 1.2368 0.6709 0.0784  -0.0866 -0.0524 82  ALA A N   
464  C  CA  . ALA A 63  ? 1.5590 1.2893 0.6869 0.0888  -0.0784 -0.0429 82  ALA A CA  
465  C  C   . ALA A 63  ? 1.5341 1.3293 0.6933 0.0879  -0.0840 -0.0362 82  ALA A C   
466  O  O   . ALA A 63  ? 1.5739 1.4108 0.7352 0.1122  -0.0754 -0.0270 82  ALA A O   
467  C  CB  . ALA A 63  ? 1.5255 1.2587 0.6602 0.0686  -0.0785 -0.0408 82  ALA A CB  
468  N  N   . TYR A 64  ? 1.5232 1.3265 0.7031 0.0615  -0.0988 -0.0406 83  TYR A N   
469  C  CA  . TYR A 64  ? 1.5269 1.3867 0.7310 0.0542  -0.1079 -0.0349 83  TYR A CA  
470  C  C   . TYR A 64  ? 1.5243 1.3935 0.7217 0.0780  -0.1066 -0.0341 83  TYR A C   
471  O  O   . TYR A 64  ? 1.4934 1.4219 0.7073 0.0850  -0.1084 -0.0237 83  TYR A O   
472  C  CB  . TYR A 64  ? 1.5101 1.3617 0.7261 0.0202  -0.1256 -0.0421 83  TYR A CB  
473  C  CG  . TYR A 64  ? 1.5220 1.3793 0.7470 -0.0063 -0.1308 -0.0372 83  TYR A CG  
474  C  CD1 . TYR A 64  ? 1.5155 1.4368 0.7590 -0.0178 -0.1312 -0.0216 83  TYR A CD1 
475  C  CD2 . TYR A 64  ? 1.5380 1.3414 0.7532 -0.0215 -0.1365 -0.0458 83  TYR A CD2 
476  C  CE1 . TYR A 64  ? 1.5591 1.4853 0.8078 -0.0467 -0.1370 -0.0145 83  TYR A CE1 
477  C  CE2 . TYR A 64  ? 1.5535 1.3564 0.7727 -0.0467 -0.1430 -0.0396 83  TYR A CE2 
478  C  CZ  . TYR A 64  ? 1.5660 1.4277 0.8005 -0.0612 -0.1434 -0.0239 83  TYR A CZ  
479  O  OH  . TYR A 64  ? 1.5973 1.4580 0.8327 -0.0900 -0.1505 -0.0153 83  TYR A OH  
480  N  N   . LYS A 65  ? 1.5520 1.3667 0.7253 0.0880  -0.1047 -0.0428 84  LYS A N   
481  C  CA  . LYS A 65  ? 1.5716 1.3832 0.7308 0.1095  -0.1037 -0.0408 84  LYS A CA  
482  C  C   . LYS A 65  ? 1.6310 1.4602 0.7778 0.1456  -0.0913 -0.0290 84  LYS A C   
483  O  O   . LYS A 65  ? 1.6567 1.5199 0.8070 0.1640  -0.0927 -0.0209 84  LYS A O   
484  C  CB  . LYS A 65  ? 1.5747 1.3237 0.7072 0.1075  -0.1041 -0.0498 84  LYS A CB  
485  C  CG  . LYS A 65  ? 1.5996 1.3383 0.7120 0.1254  -0.1043 -0.0461 84  LYS A CG  
486  C  CD  . LYS A 65  ? 1.6195 1.3120 0.7116 0.1134  -0.1073 -0.0531 84  LYS A CD  
487  C  CE  . LYS A 65  ? 1.6368 1.2736 0.7016 0.1102  -0.1015 -0.0546 84  LYS A CE  
488  N  NZ  . LYS A 65  ? 1.6971 1.2988 0.7255 0.1353  -0.0931 -0.0469 84  LYS A NZ  
489  N  N   . LYS A 66  ? 1.7023 1.5071 0.8313 0.1579  -0.0794 -0.0283 85  LYS A N   
490  C  CA  . LYS A 66  ? 1.7554 1.5720 0.8661 0.1982  -0.0654 -0.0189 85  LYS A CA  
491  C  C   . LYS A 66  ? 1.7496 1.6608 0.8975 0.2048  -0.0626 -0.0056 85  LYS A C   
492  O  O   . LYS A 66  ? 1.7793 1.7276 0.9244 0.2414  -0.0549 0.0052  85  LYS A O   
493  C  CB  . LYS A 66  ? 1.8177 1.5725 0.8892 0.2095  -0.0537 -0.0242 85  LYS A CB  
494  C  CG  . LYS A 66  ? 1.8847 1.5512 0.9137 0.2046  -0.0574 -0.0329 85  LYS A CG  
495  C  CD  . LYS A 66  ? 1.9648 1.5644 0.9491 0.2090  -0.0492 -0.0383 85  LYS A CD  
496  C  CE  . LYS A 66  ? 2.0373 1.6173 0.9803 0.2552  -0.0349 -0.0342 85  LYS A CE  
497  N  NZ  . LYS A 66  ? 2.1390 1.6402 1.0263 0.2580  -0.0286 -0.0416 85  LYS A NZ  
498  N  N   . ASN A 67  ? 1.7215 1.6725 0.9024 0.1691  -0.0699 -0.0047 86  ASN A N   
499  C  CA  . ASN A 67  ? 1.7272 1.7749 0.9452 0.1635  -0.0703 0.0107  86  ASN A CA  
500  C  C   . ASN A 67  ? 1.6861 1.7940 0.9321 0.1518  -0.0853 0.0185  86  ASN A C   
501  O  O   . ASN A 67  ? 1.6733 1.8682 0.9506 0.1420  -0.0885 0.0338  86  ASN A O   
502  C  CB  . ASN A 67  ? 1.7535 1.8123 0.9887 0.1239  -0.0748 0.0107  86  ASN A CB  
503  C  CG  . ASN A 67  ? 1.8098 1.8270 1.0205 0.1337  -0.0602 0.0066  86  ASN A CG  
504  O  OD1 . ASN A 67  ? 1.8536 1.8447 1.0345 0.1724  -0.0448 0.0053  86  ASN A OD1 
505  N  ND2 . ASN A 67  ? 1.8447 1.8506 1.0630 0.0983  -0.0663 0.0048  86  ASN A ND2 
506  N  N   . ARG A 68  ? 1.6665 1.7324 0.8997 0.1500  -0.0949 0.0093  87  ARG A N   
507  C  CA  . ARG A 68  ? 1.6305 1.7416 0.8818 0.1378  -0.1104 0.0141  87  ARG A CA  
508  C  C   . ARG A 68  ? 1.5891 1.7224 0.8622 0.0875  -0.1288 0.0111  87  ARG A C   
509  O  O   . ARG A 68  ? 1.6169 1.8028 0.9061 0.0724  -0.1428 0.0184  87  ARG A O   
510  C  CB  . ARG A 68  ? 1.6461 1.8398 0.9128 0.1709  -0.1058 0.0341  87  ARG A CB  
511  N  N   . ASN A 69  ? 1.5544 1.6421 0.8226 0.0616  -0.1303 0.0008  88  ASN A N   
512  C  CA  . ASN A 69  ? 1.5397 1.6251 0.8166 0.0155  -0.1485 -0.0038 88  ASN A CA  
513  C  C   . ASN A 69  ? 1.5208 1.5317 0.7753 0.0101  -0.1557 -0.0241 88  ASN A C   
514  O  O   . ASN A 69  ? 1.5105 1.4608 0.7516 0.0047  -0.1533 -0.0362 88  ASN A O   
515  C  CB  . ASN A 69  ? 1.5306 1.6094 0.8121 -0.0045 -0.1454 -0.0007 88  ASN A CB  
516  C  CG  . ASN A 69  ? 1.5354 1.6012 0.8183 -0.0527 -0.1661 -0.0038 88  ASN A CG  
517  O  OD1 . ASN A 69  ? 1.5032 1.5540 0.7788 -0.0712 -0.1828 -0.0120 88  ASN A OD1 
518  N  ND2 . ASN A 69  ? 1.6017 1.6671 0.8878 -0.0733 -0.1655 0.0027  88  ASN A ND2 
519  N  N   . TYR A 70  ? 1.5485 1.5715 0.7995 0.0126  -0.1644 -0.0265 89  TYR A N   
520  C  CA  . TYR A 70  ? 1.5596 1.5244 0.7887 0.0115  -0.1693 -0.0444 89  TYR A CA  
521  C  C   . TYR A 70  ? 1.5606 1.4847 0.7799 -0.0206 -0.1839 -0.0595 89  TYR A C   
522  O  O   . TYR A 70  ? 1.5696 1.4410 0.7708 -0.0164 -0.1832 -0.0752 89  TYR A O   
523  C  CB  . TYR A 70  ? 1.5800 1.5699 0.8040 0.0248  -0.1736 -0.0416 89  TYR A CB  
524  C  CG  . TYR A 70  ? 1.6164 1.6323 0.8416 0.0624  -0.1601 -0.0272 89  TYR A CG  
525  C  CD1 . TYR A 70  ? 1.6078 1.5715 0.8125 0.0878  -0.1454 -0.0307 89  TYR A CD1 
526  C  CD2 . TYR A 70  ? 1.6329 1.7234 0.8756 0.0731  -0.1633 -0.0091 89  TYR A CD2 
527  C  CE1 . TYR A 70  ? 1.6440 1.6157 0.8388 0.1240  -0.1344 -0.0185 89  TYR A CE1 
528  C  CE2 . TYR A 70  ? 1.6280 1.7362 0.8666 0.1146  -0.1508 0.0039  89  TYR A CE2 
529  C  CZ  . TYR A 70  ? 1.6473 1.6893 0.8584 0.1407  -0.1365 -0.0017 89  TYR A CZ  
530  O  OH  . TYR A 70  ? 1.6576 1.7019 0.8542 0.1829  -0.1256 0.0101  89  TYR A OH  
531  N  N   . ASP A 71  ? 1.5648 1.5122 0.7929 -0.0518 -0.1973 -0.0537 90  ASP A N   
532  C  CA  . ASP A 71  ? 1.5939 1.4901 0.8040 -0.0821 -0.2131 -0.0673 90  ASP A CA  
533  C  C   . ASP A 71  ? 1.5616 1.4028 0.7660 -0.0766 -0.2044 -0.0744 90  ASP A C   
534  O  O   . ASP A 71  ? 1.5497 1.3327 0.7343 -0.0745 -0.2077 -0.0911 90  ASP A O   
535  C  CB  . ASP A 71  ? 1.6188 1.5489 0.8345 -0.1223 -0.2314 -0.0557 90  ASP A CB  
536  C  CG  . ASP A 71  ? 1.6848 1.6728 0.9049 -0.1352 -0.2446 -0.0476 90  ASP A CG  
537  O  OD1 . ASP A 71  ? 1.6525 1.6336 0.8607 -0.1197 -0.2454 -0.0571 90  ASP A OD1 
538  O  OD2 . ASP A 71  ? 1.7614 1.8064 0.9966 -0.1643 -0.2555 -0.0298 90  ASP A OD2 
539  N  N   . LYS A 72  ? 1.5388 1.4028 0.7593 -0.0724 -0.1933 -0.0609 91  LYS A N   
540  C  CA  . LYS A 72  ? 1.5720 1.3899 0.7871 -0.0681 -0.1855 -0.0649 91  LYS A CA  
541  C  C   . LYS A 72  ? 1.5409 1.3238 0.7466 -0.0386 -0.1721 -0.0750 91  LYS A C   
542  O  O   . LYS A 72  ? 1.5391 1.2744 0.7344 -0.0383 -0.1727 -0.0845 91  LYS A O   
543  C  CB  . LYS A 72  ? 1.5740 1.4276 0.8043 -0.0716 -0.1765 -0.0479 91  LYS A CB  
544  C  CG  . LYS A 72  ? 1.6368 1.5172 0.8739 -0.1093 -0.1907 -0.0359 91  LYS A CG  
545  C  CD  . LYS A 72  ? 1.6968 1.5097 0.9143 -0.1334 -0.2043 -0.0442 91  LYS A CD  
546  C  CE  . LYS A 72  ? 1.7427 1.5759 0.9611 -0.1758 -0.2195 -0.0291 91  LYS A CE  
547  N  NZ  . LYS A 72  ? 1.7977 1.5541 0.9903 -0.1970 -0.2341 -0.0360 91  LYS A NZ  
548  N  N   . ALA A 73  ? 1.5124 1.3198 0.7200 -0.0150 -0.1616 -0.0711 92  ALA A N   
549  C  CA  . ALA A 73  ? 1.5027 1.2778 0.6969 0.0073  -0.1509 -0.0776 92  ALA A CA  
550  C  C   . ALA A 73  ? 1.5151 1.2575 0.6973 0.0040  -0.1581 -0.0931 92  ALA A C   
551  O  O   . ALA A 73  ? 1.5249 1.2351 0.6990 0.0105  -0.1531 -0.0992 92  ALA A O   
552  C  CB  . ALA A 73  ? 1.5069 1.3081 0.6984 0.0306  -0.1421 -0.0694 92  ALA A CB  
553  N  N   . TYR A 74  ? 1.5790 1.3337 0.7585 -0.0062 -0.1700 -0.0987 93  TYR A N   
554  C  CA  . TYR A 74  ? 1.5705 1.2961 0.7334 -0.0069 -0.1767 -0.1152 93  TYR A CA  
555  C  C   . TYR A 74  ? 1.5430 1.2249 0.6985 -0.0151 -0.1826 -0.1250 93  TYR A C   
556  O  O   . TYR A 74  ? 1.5427 1.1994 0.6887 -0.0027 -0.1790 -0.1353 93  TYR A O   
557  C  CB  . TYR A 74  ? 1.5906 1.3350 0.7453 -0.0183 -0.1899 -0.1194 93  TYR A CB  
558  C  CG  . TYR A 74  ? 1.6480 1.3583 0.7782 -0.0173 -0.1967 -0.1387 93  TYR A CG  
559  C  CD1 . TYR A 74  ? 1.6514 1.3607 0.7723 0.0020  -0.1872 -0.1451 93  TYR A CD1 
560  C  CD2 . TYR A 74  ? 1.7044 1.3809 0.8155 -0.0356 -0.2127 -0.1502 93  TYR A CD2 
561  C  CE1 . TYR A 74  ? 1.6883 1.3728 0.7853 0.0073  -0.1909 -0.1631 93  TYR A CE1 
562  C  CE2 . TYR A 74  ? 1.7608 1.4002 0.8420 -0.0287 -0.2178 -0.1701 93  TYR A CE2 
563  C  CZ  . TYR A 74  ? 1.7663 1.4145 0.8425 -0.0052 -0.2055 -0.1767 93  TYR A CZ  
564  O  OH  . TYR A 74  ? 1.8765 1.4954 0.9222 0.0056  -0.2080 -0.1964 93  TYR A OH  
565  N  N   . LEU A 75  ? 1.5570 1.2337 0.7163 -0.0353 -0.1918 -0.1197 94  LEU A N   
566  C  CA  . LEU A 75  ? 1.6043 1.2332 0.7526 -0.0442 -0.2000 -0.1262 94  LEU A CA  
567  C  C   . LEU A 75  ? 1.5880 1.1991 0.7413 -0.0268 -0.1884 -0.1261 94  LEU A C   
568  O  O   . LEU A 75  ? 1.6269 1.2034 0.7683 -0.0174 -0.1912 -0.1368 94  LEU A O   
569  C  CB  . LEU A 75  ? 1.6155 1.2484 0.7684 -0.0721 -0.2101 -0.1142 94  LEU A CB  
570  C  CG  . LEU A 75  ? 1.6651 1.2423 0.8001 -0.0869 -0.2231 -0.1181 94  LEU A CG  
571  C  CD1 . LEU A 75  ? 1.7247 1.2522 0.8266 -0.0910 -0.2392 -0.1357 94  LEU A CD1 
572  C  CD2 . LEU A 75  ? 1.6899 1.2840 0.8319 -0.1181 -0.2309 -0.1009 94  LEU A CD2 
573  N  N   . PHE A 76  ? 1.5663 1.2019 0.7341 -0.0212 -0.1758 -0.1137 95  PHE A N   
574  C  CA  . PHE A 76  ? 1.5680 1.1892 0.7376 -0.0100 -0.1664 -0.1115 95  PHE A CA  
575  C  C   . PHE A 76  ? 1.5786 1.2017 0.7437 0.0070  -0.1587 -0.1172 95  PHE A C   
576  O  O   . PHE A 76  ? 1.6684 1.2766 0.8323 0.0133  -0.1573 -0.1196 95  PHE A O   
577  C  CB  . PHE A 76  ? 1.5722 1.2069 0.7490 -0.0128 -0.1576 -0.0977 95  PHE A CB  
578  C  CG  . PHE A 76  ? 1.5946 1.2221 0.7743 -0.0311 -0.1649 -0.0913 95  PHE A CG  
579  C  CD1 . PHE A 76  ? 1.6049 1.1977 0.7793 -0.0351 -0.1704 -0.0927 95  PHE A CD1 
580  C  CD2 . PHE A 76  ? 1.6219 1.2803 0.8092 -0.0458 -0.1679 -0.0821 95  PHE A CD2 
581  C  CE1 . PHE A 76  ? 1.6399 1.2203 0.8126 -0.0541 -0.1788 -0.0854 95  PHE A CE1 
582  C  CE2 . PHE A 76  ? 1.6763 1.3292 0.8641 -0.0678 -0.1757 -0.0738 95  PHE A CE2 
583  C  CZ  . PHE A 76  ? 1.6494 1.2586 0.8279 -0.0724 -0.1815 -0.0758 95  PHE A CZ  
584  N  N   . TYR A 77  ? 1.5544 1.1997 0.7171 0.0136  -0.1545 -0.1174 96  TYR A N   
585  C  CA  . TYR A 77  ? 1.5305 1.1801 0.6862 0.0257  -0.1482 -0.1212 96  TYR A CA  
586  C  C   . TYR A 77  ? 1.5523 1.1913 0.7013 0.0315  -0.1541 -0.1358 96  TYR A C   
587  O  O   . TYR A 77  ? 1.5464 1.1895 0.6942 0.0415  -0.1488 -0.1380 96  TYR A O   
588  C  CB  . TYR A 77  ? 1.5377 1.2090 0.6877 0.0314  -0.1432 -0.1163 96  TYR A CB  
589  C  CG  . TYR A 77  ? 1.5541 1.2245 0.7003 0.0351  -0.1346 -0.1030 96  TYR A CG  
590  C  CD1 . TYR A 77  ? 1.5117 1.1639 0.6492 0.0348  -0.1285 -0.0981 96  TYR A CD1 
591  C  CD2 . TYR A 77  ? 1.5561 1.2433 0.7026 0.0403  -0.1329 -0.0948 96  TYR A CD2 
592  C  CE1 . TYR A 77  ? 1.5293 1.1667 0.6517 0.0382  -0.1220 -0.0879 96  TYR A CE1 
593  C  CE2 . TYR A 77  ? 1.5307 1.2081 0.6652 0.0502  -0.1242 -0.0844 96  TYR A CE2 
594  C  CZ  . TYR A 77  ? 1.5466 1.1926 0.6653 0.0486  -0.1191 -0.0821 96  TYR A CZ  
595  O  OH  . TYR A 77  ? 1.6298 1.2522 0.7256 0.0578  -0.1120 -0.0737 96  TYR A OH  
596  N  N   . LYS A 78  ? 1.6046 1.2300 0.7464 0.0250  -0.1653 -0.1448 97  LYS A N   
597  C  CA  . LYS A 78  ? 1.6693 1.2700 0.7943 0.0336  -0.1723 -0.1612 97  LYS A CA  
598  C  C   . LYS A 78  ? 1.6853 1.2595 0.8121 0.0407  -0.1738 -0.1620 97  LYS A C   
599  O  O   . LYS A 78  ? 1.7154 1.2827 0.8336 0.0598  -0.1720 -0.1717 97  LYS A O   
600  C  CB  . LYS A 78  ? 1.7198 1.3006 0.8274 0.0194  -0.1872 -0.1698 97  LYS A CB  
601  C  CG  . LYS A 78  ? 1.7892 1.3322 0.8665 0.0304  -0.1953 -0.1897 97  LYS A CG  
602  C  CD  . LYS A 78  ? 1.8594 1.3736 0.9117 0.0089  -0.2134 -0.1970 97  LYS A CD  
603  C  CE  . LYS A 78  ? 1.9192 1.3790 0.9295 0.0220  -0.2225 -0.2192 97  LYS A CE  
604  N  NZ  . LYS A 78  ? 1.9579 1.3773 0.9347 -0.0051 -0.2439 -0.2263 97  LYS A NZ  
605  N  N   . GLU A 79  ? 1.7124 1.2759 0.8493 0.0274  -0.1767 -0.1511 98  GLU A N   
606  C  CA  . GLU A 79  ? 1.7349 1.2750 0.8740 0.0323  -0.1793 -0.1483 98  GLU A CA  
607  C  C   . GLU A 79  ? 1.7242 1.2908 0.8758 0.0466  -0.1680 -0.1427 98  GLU A C   
608  O  O   . GLU A 79  ? 1.7766 1.3355 0.9286 0.0606  -0.1697 -0.1442 98  GLU A O   
609  C  CB  . GLU A 79  ? 1.7334 1.2630 0.8793 0.0120  -0.1837 -0.1356 98  GLU A CB  
610  N  N   . LEU A 80  ? 1.6786 1.2756 0.8381 0.0418  -0.1580 -0.1345 99  LEU A N   
611  C  CA  . LEU A 80  ? 1.6337 1.2569 0.7999 0.0472  -0.1492 -0.1271 99  LEU A CA  
612  C  C   . LEU A 80  ? 1.6655 1.3117 0.8283 0.0645  -0.1451 -0.1360 99  LEU A C   
613  O  O   . LEU A 80  ? 1.6943 1.3627 0.8643 0.0746  -0.1418 -0.1326 99  LEU A O   
614  C  CB  . LEU A 80  ? 1.5542 1.1892 0.7185 0.0356  -0.1417 -0.1161 99  LEU A CB  
615  C  CG  . LEU A 80  ? 1.5342 1.1526 0.6978 0.0231  -0.1415 -0.1063 99  LEU A CG  
616  C  CD1 . LEU A 80  ? 1.4924 1.1137 0.6449 0.0197  -0.1342 -0.0990 99  LEU A CD1 
617  C  CD2 . LEU A 80  ? 1.5246 1.1373 0.6913 0.0184  -0.1430 -0.0989 99  LEU A CD2 
618  N  N   . LEU A 81  ? 1.6575 1.3040 0.8092 0.0677  -0.1455 -0.1461 100 LEU A N   
619  C  CA  . LEU A 81  ? 1.7220 1.3905 0.8650 0.0846  -0.1407 -0.1561 100 LEU A CA  
620  C  C   . LEU A 81  ? 1.7738 1.4307 0.9097 0.1085  -0.1434 -0.1688 100 LEU A C   
621  O  O   . LEU A 81  ? 1.7589 1.4475 0.8928 0.1274  -0.1356 -0.1730 100 LEU A O   
622  C  CB  . LEU A 81  ? 1.6886 1.3548 0.8166 0.0807  -0.1428 -0.1644 100 LEU A CB  
623  C  CG  . LEU A 81  ? 1.7038 1.3971 0.8188 0.0938  -0.1362 -0.1726 100 LEU A CG  
624  C  CD1 . LEU A 81  ? 1.6611 1.3967 0.7854 0.0901  -0.1250 -0.1576 100 LEU A CD1 
625  C  CD2 . LEU A 81  ? 1.7056 1.3912 0.8042 0.0863  -0.1420 -0.1797 100 LEU A CD2 
626  N  N   . GLN A 82  ? 1.8414 1.4534 0.9707 0.1092  -0.1543 -0.1739 101 GLN A N   
627  C  CA  . GLN A 82  ? 1.9161 1.5038 1.0322 0.1360  -0.1587 -0.1852 101 GLN A CA  
628  C  C   . GLN A 82  ? 1.9135 1.5390 1.0506 0.1522  -0.1519 -0.1741 101 GLN A C   
629  O  O   . GLN A 82  ? 1.9659 1.6030 1.0967 0.1839  -0.1485 -0.1819 101 GLN A O   
630  C  CB  . GLN A 82  ? 2.0202 1.5427 1.1192 0.1282  -0.1745 -0.1899 101 GLN A CB  
631  C  CG  . GLN A 82  ? 2.1128 1.5956 1.1835 0.1147  -0.1849 -0.2031 101 GLN A CG  
632  C  CD  . GLN A 82  ? 2.1997 1.6168 1.2493 0.1004  -0.2027 -0.2049 101 GLN A CD  
633  O  OE1 . GLN A 82  ? 2.1638 1.5676 1.2243 0.0955  -0.2066 -0.1934 101 GLN A OE1 
634  N  NE2 . GLN A 82  ? 2.3055 1.6802 1.3213 0.0898  -0.2151 -0.2181 101 GLN A NE2 
635  N  N   . LYS A 83  ? 1.9039 1.5497 1.0632 0.1315  -0.1504 -0.1557 102 LYS A N   
636  C  CA  . LYS A 83  ? 1.8753 1.5629 1.0553 0.1384  -0.1465 -0.1415 102 LYS A CA  
637  C  C   . LYS A 83  ? 1.8143 1.5697 1.0050 0.1441  -0.1341 -0.1356 102 LYS A C   
638  O  O   . LYS A 83  ? 1.8221 1.6232 1.0281 0.1584  -0.1308 -0.1267 102 LYS A O   
639  C  CB  . LYS A 83  ? 1.8911 1.5730 1.0831 0.1103  -0.1503 -0.1245 102 LYS A CB  
640  C  CG  . LYS A 83  ? 1.9740 1.6008 1.1582 0.1036  -0.1618 -0.1257 102 LYS A CG  
641  C  CD  . LYS A 83  ? 2.0011 1.6269 1.1937 0.0779  -0.1635 -0.1096 102 LYS A CD  
642  C  CE  . LYS A 83  ? 2.0628 1.6407 1.2476 0.0698  -0.1742 -0.1083 102 LYS A CE  
643  N  NZ  . LYS A 83  ? 2.0994 1.6441 1.2708 0.0591  -0.1775 -0.1175 102 LYS A NZ  
644  N  N   . ALA A 84  ? 1.7467 1.5127 0.9297 0.1314  -0.1280 -0.1379 103 ALA A N   
645  C  CA  . ALA A 84  ? 1.7185 1.5462 0.9067 0.1313  -0.1169 -0.1307 103 ALA A CA  
646  C  C   . ALA A 84  ? 1.6879 1.5103 0.8566 0.1329  -0.1125 -0.1431 103 ALA A C   
647  O  O   . ALA A 84  ? 1.6242 1.4478 0.7886 0.1098  -0.1110 -0.1351 103 ALA A O   
648  C  CB  . ALA A 84  ? 1.6531 1.5034 0.8515 0.0993  -0.1162 -0.1088 103 ALA A CB  
649  N  N   . PRO A 85  ? 1.7468 1.5589 0.8989 0.1613  -0.1114 -0.1628 104 PRO A N   
650  C  CA  . PRO A 85  ? 1.7683 1.5730 0.8969 0.1639  -0.1089 -0.1766 104 PRO A CA  
651  C  C   . PRO A 85  ? 1.7736 1.6307 0.9021 0.1524  -0.0986 -0.1665 104 PRO A C   
652  O  O   . PRO A 85  ? 1.8014 1.6438 0.9143 0.1406  -0.1004 -0.1703 104 PRO A O   
653  C  CB  . PRO A 85  ? 1.8039 1.5967 0.9114 0.2018  -0.1075 -0.1978 104 PRO A CB  
654  C  CG  . PRO A 85  ? 1.7880 1.5479 0.9019 0.2146  -0.1155 -0.1983 104 PRO A CG  
655  C  CD  . PRO A 85  ? 1.7684 1.5637 0.9160 0.1942  -0.1143 -0.1742 104 PRO A CD  
656  N  N   . ASN A 86  ? 1.7765 1.6960 0.9213 0.1540  -0.0892 -0.1519 105 ASN A N   
657  C  CA  . ASN A 86  ? 1.7305 1.7036 0.8730 0.1390  -0.0799 -0.1384 105 ASN A CA  
658  C  C   . ASN A 86  ? 1.6594 1.6330 0.8083 0.1004  -0.0833 -0.1146 105 ASN A C   
659  O  O   . ASN A 86  ? 1.6355 1.6488 0.7792 0.0834  -0.0777 -0.0997 105 ASN A O   
660  C  CB  . ASN A 86  ? 1.7502 1.8008 0.9030 0.1609  -0.0673 -0.1343 105 ASN A CB  
661  C  CG  . ASN A 86  ? 1.7759 1.8220 0.9114 0.2049  -0.0620 -0.1596 105 ASN A CG  
662  O  OD1 . ASN A 86  ? 1.7924 1.7831 0.9010 0.2122  -0.0671 -0.1799 105 ASN A OD1 
663  N  ND2 . ASN A 86  ? 1.7937 1.8990 0.9414 0.2349  -0.0521 -0.1580 105 ASN A ND2 
664  N  N   . ASN A 87  ? 1.5922 1.5175 0.7465 0.0866  -0.0927 -0.1111 106 ASN A N   
665  C  CA  . ASN A 87  ? 1.5814 1.4917 0.7322 0.0542  -0.0966 -0.0917 106 ASN A CA  
666  C  C   . ASN A 87  ? 1.5781 1.4543 0.7070 0.0446  -0.0983 -0.0929 106 ASN A C   
667  O  O   . ASN A 87  ? 1.5950 1.4297 0.7204 0.0515  -0.1035 -0.1046 106 ASN A O   
668  C  CB  . ASN A 87  ? 1.5624 1.4353 0.7231 0.0475  -0.1045 -0.0891 106 ASN A CB  
669  C  CG  . ASN A 87  ? 1.5547 1.4096 0.7050 0.0162  -0.1083 -0.0701 106 ASN A CG  
670  O  OD1 . ASN A 87  ? 1.5878 1.4212 0.7166 0.0018  -0.1083 -0.0638 106 ASN A OD1 
671  N  ND2 . ASN A 87  ? 1.5996 1.4571 0.7603 0.0065  -0.1128 -0.0611 106 ASN A ND2 
672  N  N   . VAL A 88  ? 1.5657 1.4629 0.6796 0.0278  -0.0949 -0.0787 107 VAL A N   
673  C  CA  . VAL A 88  ? 1.5505 1.4190 0.6408 0.0206  -0.0970 -0.0763 107 VAL A CA  
674  C  C   . VAL A 88  ? 1.5484 1.3576 0.6306 0.0149  -0.1042 -0.0744 107 VAL A C   
675  O  O   . VAL A 88  ? 1.5517 1.3399 0.6251 0.0230  -0.1068 -0.0805 107 VAL A O   
676  C  CB  . VAL A 88  ? 1.5376 1.4298 0.6074 -0.0012 -0.0942 -0.0564 107 VAL A CB  
677  C  CG1 . VAL A 88  ? 1.5167 1.4755 0.5914 0.0080  -0.0849 -0.0591 107 VAL A CG1 
678  C  CG2 . VAL A 88  ? 1.5194 1.4037 0.5833 -0.0296 -0.0980 -0.0359 107 VAL A CG2 
679  N  N   . ASP A 89  ? 1.5206 1.3082 0.6050 0.0023  -0.1072 -0.0658 108 ASP A N   
680  C  CA  . ASP A 89  ? 1.5660 1.2999 0.6402 0.0002  -0.1118 -0.0643 108 ASP A CA  
681  C  C   . ASP A 89  ? 1.5352 1.2578 0.6284 0.0179  -0.1139 -0.0804 108 ASP A C   
682  O  O   . ASP A 89  ? 1.5294 1.2256 0.6162 0.0231  -0.1159 -0.0815 108 ASP A O   
683  C  CB  . ASP A 89  ? 1.5871 1.2985 0.6518 -0.0194 -0.1147 -0.0517 108 ASP A CB  
684  C  CG  . ASP A 89  ? 1.6406 1.3508 0.6766 -0.0451 -0.1161 -0.0328 108 ASP A CG  
685  O  OD1 . ASP A 89  ? 1.6770 1.4099 0.7038 -0.0470 -0.1137 -0.0283 108 ASP A OD1 
686  O  OD2 . ASP A 89  ? 1.6642 1.3487 0.6827 -0.0664 -0.1209 -0.0215 108 ASP A OD2 
687  N  N   . CSX A 90  ? 1.5233 1.2668 0.6376 0.0273  -0.1140 -0.0911 109 CSX A N   
688  C  CA  . CSX A 90  ? 1.5485 1.2764 0.6751 0.0397  -0.1184 -0.1056 109 CSX A CA  
689  C  CB  . CSX A 90  ? 1.6123 1.3505 0.7548 0.0488  -0.1197 -0.1129 109 CSX A CB  
690  S  SG  . CSX A 90  ? 1.7507 1.4882 0.9004 0.0351  -0.1203 -0.0984 109 CSX A SG  
691  C  C   . CSX A 90  ? 1.5325 1.2655 0.6524 0.0490  -0.1200 -0.1164 109 CSX A C   
692  O  O   . CSX A 90  ? 1.5356 1.2512 0.6567 0.0499  -0.1254 -0.1213 109 CSX A O   
693  O  OD  . CSX A 90  ? 1.6988 1.3969 0.8450 0.0269  -0.1242 -0.0957 109 CSX A OD  
694  N  N   . LEU A 91  ? 1.5111 1.2724 0.6229 0.0540  -0.1158 -0.1191 110 LEU A N   
695  C  CA  . LEU A 91  ? 1.5126 1.2793 0.6124 0.0607  -0.1181 -0.1289 110 LEU A CA  
696  C  C   . LEU A 91  ? 1.5028 1.2581 0.5929 0.0535  -0.1210 -0.1181 110 LEU A C   
697  O  O   . LEU A 91  ? 1.4989 1.2484 0.5886 0.0558  -0.1276 -0.1241 110 LEU A O   
698  C  CB  . LEU A 91  ? 1.5333 1.3359 0.6225 0.0679  -0.1113 -0.1325 110 LEU A CB  
699  C  CG  . LEU A 91  ? 1.5516 1.3709 0.6452 0.0858  -0.1075 -0.1469 110 LEU A CG  
700  C  CD1 . LEU A 91  ? 1.5534 1.4207 0.6374 0.0927  -0.0973 -0.1455 110 LEU A CD1 
701  C  CD2 . LEU A 91  ? 1.5552 1.3434 0.6391 0.0982  -0.1157 -0.1682 110 LEU A CD2 
702  N  N   . GLU A 92  ? 1.4997 1.2506 0.5800 0.0447  -0.1171 -0.1014 111 GLU A N   
703  C  CA  . GLU A 92  ? 1.5394 1.2721 0.6042 0.0435  -0.1191 -0.0891 111 GLU A CA  
704  C  C   . GLU A 92  ? 1.5233 1.2386 0.5986 0.0495  -0.1232 -0.0907 111 GLU A C   
705  O  O   . GLU A 92  ? 1.5139 1.2349 0.5862 0.0563  -0.1270 -0.0884 111 GLU A O   
706  C  CB  . GLU A 92  ? 1.6092 1.3208 0.6540 0.0316  -0.1161 -0.0717 111 GLU A CB  
707  C  CG  . GLU A 92  ? 1.6795 1.3566 0.6990 0.0354  -0.1181 -0.0586 111 GLU A CG  
708  C  CD  . GLU A 92  ? 1.7913 1.4305 0.7802 0.0208  -0.1175 -0.0431 111 GLU A CD  
709  O  OE1 . GLU A 92  ? 1.9000 1.5534 0.8848 0.0022  -0.1164 -0.0377 111 GLU A OE1 
710  O  OE2 . GLU A 92  ? 1.7462 1.3409 0.7113 0.0279  -0.1188 -0.0356 111 GLU A OE2 
711  N  N   . ALA A 93  ? 1.5244 1.2247 0.6124 0.0464  -0.1226 -0.0928 112 ALA A N   
712  C  CA  . ALA A 93  ? 1.5027 1.1921 0.6013 0.0498  -0.1249 -0.0927 112 ALA A CA  
713  C  C   . ALA A 93  ? 1.4621 1.1707 0.5749 0.0512  -0.1322 -0.1026 112 ALA A C   
714  O  O   . ALA A 93  ? 1.4360 1.1543 0.5534 0.0546  -0.1348 -0.0974 112 ALA A O   
715  C  CB  . ALA A 93  ? 1.4745 1.1452 0.5809 0.0435  -0.1232 -0.0927 112 ALA A CB  
716  N  N   . CYS A 94  ? 1.5034 1.2174 0.6199 0.0487  -0.1360 -0.1161 113 CYS A N   
717  C  CA  . CYS A 94  ? 1.5748 1.2957 0.6941 0.0453  -0.1460 -0.1269 113 CYS A CA  
718  C  C   . CYS A 94  ? 1.5427 1.2863 0.6522 0.0471  -0.1499 -0.1245 113 CYS A C   
719  O  O   . CYS A 94  ? 1.5548 1.3124 0.6697 0.0415  -0.1584 -0.1226 113 CYS A O   
720  C  CB  . CYS A 94  ? 1.6623 1.3719 0.7757 0.0471  -0.1491 -0.1438 113 CYS A CB  
721  S  SG  . CYS A 94  ? 1.8113 1.4963 0.9357 0.0477  -0.1477 -0.1462 113 CYS A SG  
722  N  N   . ALA A 95  ? 1.5430 1.2947 0.6381 0.0527  -0.1445 -0.1226 114 ALA A N   
723  C  CA  . ALA A 95  ? 1.5527 1.3255 0.6344 0.0550  -0.1483 -0.1189 114 ALA A CA  
724  C  C   . ALA A 95  ? 1.5643 1.3488 0.6509 0.0594  -0.1508 -0.1028 114 ALA A C   
725  O  O   . ALA A 95  ? 1.6048 1.4137 0.6913 0.0580  -0.1597 -0.1014 114 ALA A O   
726  C  CB  . ALA A 95  ? 1.5207 1.2989 0.5847 0.0583  -0.1408 -0.1151 114 ALA A CB  
727  N  N   . GLU A 96  ? 1.5482 1.3162 0.6365 0.0660  -0.1434 -0.0908 115 GLU A N   
728  C  CA  . GLU A 96  ? 1.5607 1.3370 0.6503 0.0784  -0.1433 -0.0757 115 GLU A CA  
729  C  C   . GLU A 96  ? 1.5689 1.3741 0.6820 0.0751  -0.1498 -0.0760 115 GLU A C   
730  O  O   . GLU A 96  ? 1.5398 1.3777 0.6579 0.0837  -0.1541 -0.0653 115 GLU A O   
731  C  CB  . GLU A 96  ? 1.6059 1.3472 0.6843 0.0870  -0.1338 -0.0663 115 GLU A CB  
732  C  CG  . GLU A 96  ? 1.6169 1.3290 0.6659 0.0868  -0.1297 -0.0595 115 GLU A CG  
733  C  CD  . GLU A 96  ? 1.6704 1.3373 0.7004 0.0889  -0.1232 -0.0522 115 GLU A CD  
734  O  OE1 . GLU A 96  ? 1.6476 1.3054 0.6849 0.0964  -0.1200 -0.0519 115 GLU A OE1 
735  O  OE2 . GLU A 96  ? 1.7703 1.4095 0.7740 0.0806  -0.1218 -0.0460 115 GLU A OE2 
736  N  N   . MSE A 97  ? 1.6011 1.3971 0.7278 0.0621  -0.1513 -0.0858 116 MSE A N   
737  C  CA  . MSE A 97  ? 1.5962 1.4184 0.7428 0.0514  -0.1590 -0.0846 116 MSE A CA  
738  C  C   . MSE A 97  ? 1.5948 1.4430 0.7404 0.0368  -0.1737 -0.0904 116 MSE A C   
739  O  O   . MSE A 97  ? 1.6186 1.5069 0.7780 0.0297  -0.1818 -0.0811 116 MSE A O   
740  C  CB  . MSE A 97  ? 1.5901 1.3876 0.7455 0.0395  -0.1580 -0.0916 116 MSE A CB  
741  C  CG  . MSE A 97  ? 1.5866 1.3606 0.7410 0.0503  -0.1453 -0.0852 116 MSE A CG  
742  SE SE  . MSE A 97  ? 1.5996 1.3978 0.7568 0.0731  -0.1352 -0.0656 116 MSE A SE  
743  C  CE  . MSE A 97  ? 1.6848 1.4763 0.8161 0.0960  -0.1322 -0.0581 116 MSE A CE  
744  N  N   . GLN A 98  ? 1.6230 1.4520 0.7504 0.0320  -0.1775 -0.1047 117 GLN A N   
745  C  CA  . GLN A 98  ? 1.6825 1.5278 0.7985 0.0181  -0.1923 -0.1124 117 GLN A CA  
746  C  C   . GLN A 98  ? 1.6681 1.5575 0.7842 0.0253  -0.1964 -0.0978 117 GLN A C   
747  O  O   . GLN A 98  ? 1.6675 1.5882 0.7845 0.0101  -0.2112 -0.0957 117 GLN A O   
748  C  CB  . GLN A 98  ? 1.7382 1.5520 0.8287 0.0177  -0.1926 -0.1323 117 GLN A CB  
749  C  CG  . GLN A 98  ? 1.7788 1.5507 0.8649 0.0132  -0.1922 -0.1480 117 GLN A CG  
750  C  CD  . GLN A 98  ? 1.8328 1.5894 0.9128 -0.0092 -0.2092 -0.1558 117 GLN A CD  
751  O  OE1 . GLN A 98  ? 1.8040 1.5856 0.9005 -0.0244 -0.2169 -0.1431 117 GLN A OE1 
752  N  NE2 . GLN A 98  ? 1.9024 1.6163 0.9559 -0.0111 -0.2149 -0.1760 117 GLN A NE2 
753  N  N   . VAL A 99  ? 1.6515 1.5407 0.7634 0.0468  -0.1852 -0.0866 118 VAL A N   
754  C  CA  . VAL A 99  ? 1.6425 1.5676 0.7516 0.0599  -0.1884 -0.0699 118 VAL A CA  
755  C  C   . VAL A 99  ? 1.6412 1.6110 0.7760 0.0660  -0.1910 -0.0529 118 VAL A C   
756  O  O   . VAL A 99  ? 1.6109 1.6308 0.7523 0.0649  -0.2020 -0.0419 118 VAL A O   
757  C  CB  . VAL A 99  ? 1.6225 1.5224 0.7129 0.0809  -0.1766 -0.0609 118 VAL A CB  
758  C  CG1 . VAL A 99  ? 1.5924 1.5229 0.6762 0.0983  -0.1811 -0.0420 118 VAL A CG1 
759  C  CG2 . VAL A 99  ? 1.6052 1.4775 0.6732 0.0731  -0.1734 -0.0742 118 VAL A CG2 
760  N  N   . CYS A 100 ? 1.6277 1.5849 0.7762 0.0727  -0.1808 -0.0499 119 CYS A N   
761  C  CA  . CYS A 100 ? 1.6476 1.6523 0.8209 0.0810  -0.1798 -0.0338 119 CYS A CA  
762  C  C   . CYS A 100 ? 1.6581 1.7079 0.8514 0.0503  -0.1952 -0.0340 119 CYS A C   
763  O  O   . CYS A 100 ? 1.7212 1.8376 0.9342 0.0523  -0.2011 -0.0169 119 CYS A O   
764  C  CB  . CYS A 100 ? 1.6649 1.6409 0.8417 0.0947  -0.1643 -0.0323 119 CYS A CB  
765  S  SG  . CYS A 100 ? 1.7220 1.6455 0.8685 0.1293  -0.1490 -0.0266 119 CYS A SG  
766  N  N   . ARG A 101 ? 1.6583 1.6719 0.8438 0.0223  -0.2024 -0.0519 120 ARG A N   
767  C  CA  . ARG A 101 ? 1.6984 1.7365 0.8910 -0.0134 -0.2205 -0.0535 120 ARG A CA  
768  C  C   . ARG A 101 ? 1.7135 1.7875 0.8966 -0.0292 -0.2390 -0.0517 120 ARG A C   
769  O  O   . ARG A 101 ? 1.6986 1.8144 0.8910 -0.0584 -0.2557 -0.0441 120 ARG A O   
770  C  CB  . ARG A 101 ? 1.7361 1.7100 0.9115 -0.0353 -0.2251 -0.0747 120 ARG A CB  
771  C  CG  . ARG A 101 ? 1.8071 1.7521 0.9931 -0.0325 -0.2137 -0.0752 120 ARG A CG  
772  C  CD  . ARG A 101 ? 1.8802 1.7597 1.0449 -0.0489 -0.2200 -0.0957 120 ARG A CD  
773  N  NE  . ARG A 101 ? 1.9592 1.8360 1.1117 -0.0845 -0.2417 -0.0999 120 ARG A NE  
774  C  CZ  . ARG A 101 ? 1.9974 1.8129 1.1194 -0.1000 -0.2531 -0.1191 120 ARG A CZ  
775  N  NH1 . ARG A 101 ? 1.9959 1.7568 1.1015 -0.0800 -0.2436 -0.1363 120 ARG A NH1 
776  N  NH2 . ARG A 101 ? 2.0750 1.8839 1.1794 -0.1361 -0.2754 -0.1205 120 ARG A NH2 
777  N  N   . GLY A 102 ? 1.7178 1.7759 0.8801 -0.0137 -0.2372 -0.0576 121 GLY A N   
778  C  CA  . GLY A 102 ? 1.7256 1.8115 0.8722 -0.0272 -0.2543 -0.0575 121 GLY A CA  
779  C  C   . GLY A 102 ? 1.7702 1.7985 0.8784 -0.0410 -0.2606 -0.0832 121 GLY A C   
780  O  O   . GLY A 102 ? 1.8460 1.8882 0.9330 -0.0510 -0.2737 -0.0861 121 GLY A O   
781  N  N   . GLN A 103 ? 1.7772 1.7438 0.8746 -0.0394 -0.2513 -0.1013 122 GLN A N   
782  C  CA  . GLN A 103 ? 1.8349 1.7467 0.8950 -0.0439 -0.2535 -0.1267 122 GLN A CA  
783  C  C   . GLN A 103 ? 1.8847 1.7941 0.9329 -0.0177 -0.2394 -0.1272 122 GLN A C   
784  O  O   . GLN A 103 ? 1.9060 1.7851 0.9536 -0.0006 -0.2232 -0.1329 122 GLN A O   
785  C  CB  . GLN A 103 ? 1.8594 1.7143 0.9157 -0.0460 -0.2479 -0.1422 122 GLN A CB  
786  C  CG  . GLN A 103 ? 1.8581 1.7059 0.9202 -0.0753 -0.2626 -0.1407 122 GLN A CG  
787  C  CD  . GLN A 103 ? 1.8637 1.6976 0.8920 -0.1078 -0.2872 -0.1513 122 GLN A CD  
788  O  OE1 . GLN A 103 ? 1.9422 1.7543 0.9350 -0.1054 -0.2921 -0.1672 122 GLN A OE1 
789  N  NE2 . GLN A 103 ? 1.8703 1.7149 0.9052 -0.1407 -0.3035 -0.1423 122 GLN A NE2 
790  N  N   . GLU A 104 ? 1.9342 1.8793 0.9721 -0.0178 -0.2475 -0.1189 123 GLU A N   
791  C  CA  . GLU A 104 ? 1.9601 1.9093 0.9833 0.0023  -0.2375 -0.1145 123 GLU A CA  
792  C  C   . GLU A 104 ? 1.9475 1.8573 0.9370 0.0044  -0.2313 -0.1374 123 GLU A C   
793  O  O   . GLU A 104 ? 1.8904 1.7883 0.8768 0.0213  -0.2151 -0.1361 123 GLU A O   
794  C  CB  . GLU A 104 ? 2.0466 2.0458 1.0645 -0.0014 -0.2515 -0.0994 123 GLU A CB  
795  C  CG  . GLU A 104 ? 2.1207 2.1285 1.1222 0.0178  -0.2442 -0.0888 123 GLU A CG  
796  C  CD  . GLU A 104 ? 2.1922 2.2511 1.1881 0.0145  -0.2604 -0.0724 123 GLU A CD  
797  O  OE1 . GLU A 104 ? 2.2046 2.3003 1.2118 -0.0042 -0.2780 -0.0682 123 GLU A OE1 
798  O  OE2 . GLU A 104 ? 2.2625 2.3272 1.2412 0.0287  -0.2569 -0.0618 123 GLU A OE2 
799  N  N   . LYS A 105 ? 1.9637 1.8537 0.9252 -0.0129 -0.2445 -0.1577 124 LYS A N   
800  C  CA  . LYS A 105 ? 1.9861 1.8406 0.9095 -0.0063 -0.2387 -0.1818 124 LYS A CA  
801  C  C   . LYS A 105 ? 1.9482 1.7652 0.8790 0.0081  -0.2229 -0.1935 124 LYS A C   
802  O  O   . LYS A 105 ? 1.9338 1.7477 0.8543 0.0256  -0.2074 -0.1992 124 LYS A O   
803  C  CB  . LYS A 105 ? 2.1038 1.9364 0.9860 -0.0273 -0.2587 -0.2017 124 LYS A CB  
804  C  CG  . LYS A 105 ? 2.2054 2.0100 1.0391 -0.0158 -0.2530 -0.2259 124 LYS A CG  
805  C  CD  . LYS A 105 ? 2.3146 2.0991 1.0988 -0.0383 -0.2755 -0.2427 124 LYS A CD  
806  C  CE  . LYS A 105 ? 2.4152 2.1765 1.1455 -0.0228 -0.2682 -0.2667 124 LYS A CE  
807  N  NZ  . LYS A 105 ? 2.4940 2.2076 1.2101 0.0017  -0.2524 -0.2888 124 LYS A NZ  
808  N  N   . ASP A 106 ? 1.9049 1.7001 0.8545 -0.0003 -0.2272 -0.1945 125 ASP A N   
809  C  CA  . ASP A 106 ? 1.8951 1.6565 0.8538 0.0128  -0.2147 -0.2032 125 ASP A CA  
810  C  C   . ASP A 106 ? 1.8246 1.6078 0.8143 0.0287  -0.1961 -0.1852 125 ASP A C   
811  O  O   . ASP A 106 ? 1.7454 1.5157 0.7363 0.0429  -0.1827 -0.1909 125 ASP A O   
812  C  CB  . ASP A 106 ? 1.9538 1.6852 0.9213 -0.0036 -0.2262 -0.2061 125 ASP A CB  
813  C  CG  . ASP A 106 ? 1.9985 1.6874 0.9660 0.0101  -0.2172 -0.2181 125 ASP A CG  
814  O  OD1 . ASP A 106 ? 1.9980 1.6761 0.9500 0.0319  -0.2051 -0.2305 125 ASP A OD1 
815  O  OD2 . ASP A 106 ? 2.0976 1.7676 1.0804 -0.0008 -0.2227 -0.2138 125 ASP A OD2 
816  N  N   . ALA A 107 ? 1.7513 1.5662 0.7624 0.0265  -0.1964 -0.1632 126 ALA A N   
817  C  CA  . ALA A 107 ? 1.7216 1.5460 0.7498 0.0397  -0.1816 -0.1460 126 ALA A CA  
818  C  C   . ALA A 107 ? 1.6975 1.5319 0.7048 0.0487  -0.1725 -0.1449 126 ALA A C   
819  O  O   . ALA A 107 ? 1.6660 1.4952 0.6767 0.0557  -0.1596 -0.1395 126 ALA A O   
820  C  CB  . ALA A 107 ? 1.7288 1.5779 0.7759 0.0406  -0.1849 -0.1241 126 ALA A CB  
821  N  N   . LEU A 108 ? 1.7942 1.6454 0.7782 0.0452  -0.1803 -0.1486 127 LEU A N   
822  C  CA  . LEU A 108 ? 1.7836 1.6491 0.7437 0.0513  -0.1723 -0.1471 127 LEU A CA  
823  C  C   . LEU A 108 ? 1.7804 1.6354 0.7295 0.0594  -0.1601 -0.1647 127 LEU A C   
824  O  O   . LEU A 108 ? 1.8288 1.6991 0.7733 0.0645  -0.1474 -0.1569 127 LEU A O   
825  C  CB  . LEU A 108 ? 1.8050 1.6900 0.7386 0.0449  -0.1846 -0.1499 127 LEU A CB  
826  C  CG  . LEU A 108 ? 1.8480 1.7542 0.7562 0.0488  -0.1783 -0.1416 127 LEU A CG  
827  C  CD1 . LEU A 108 ? 1.8505 1.7656 0.7696 0.0523  -0.1759 -0.1127 127 LEU A CD1 
828  C  CD2 . LEU A 108 ? 1.8694 1.7908 0.7460 0.0414  -0.1914 -0.1501 127 LEU A CD2 
829  N  N   . ARG A 109 ? 1.7650 1.5951 0.7084 0.0606  -0.1648 -0.1866 128 ARG A N   
830  C  CA  . ARG A 109 ? 1.7662 1.5854 0.6987 0.0755  -0.1537 -0.2045 128 ARG A CA  
831  C  C   . ARG A 109 ? 1.7457 1.5705 0.7075 0.0817  -0.1404 -0.1928 128 ARG A C   
832  O  O   . ARG A 109 ? 1.7390 1.5877 0.6977 0.0917  -0.1266 -0.1915 128 ARG A O   
833  C  CB  . ARG A 109 ? 1.7973 1.5734 0.7136 0.0765  -0.1646 -0.2284 128 ARG A CB  
834  C  CG  . ARG A 109 ? 1.8647 1.6233 0.7644 0.0995  -0.1543 -0.2486 128 ARG A CG  
835  C  CD  . ARG A 109 ? 1.9737 1.6736 0.8515 0.1000  -0.1678 -0.2701 128 ARG A CD  
836  N  NE  . ARG A 109 ? 1.9780 1.6575 0.8870 0.0854  -0.1761 -0.2594 128 ARG A NE  
837  C  CZ  . ARG A 109 ? 2.0143 1.6889 0.9510 0.0944  -0.1681 -0.2531 128 ARG A CZ  
838  N  NH1 . ARG A 109 ? 2.0639 1.7581 1.0065 0.1182  -0.1516 -0.2545 128 ARG A NH1 
839  N  NH2 . ARG A 109 ? 2.0079 1.6644 0.9677 0.0783  -0.1769 -0.2434 128 ARG A NH2 
840  N  N   . MSE A 110 ? 1.6816 1.4889 0.6702 0.0742  -0.1448 -0.1835 129 MSE A N   
841  C  CA  . MSE A 110 ? 1.7111 1.5185 0.7242 0.0767  -0.1348 -0.1725 129 MSE A CA  
842  C  C   . MSE A 110 ? 1.6928 1.5258 0.7074 0.0726  -0.1251 -0.1517 129 MSE A C   
843  O  O   . MSE A 110 ? 1.7582 1.6053 0.7797 0.0748  -0.1150 -0.1468 129 MSE A O   
844  C  CB  . MSE A 110 ? 1.6630 1.4458 0.6993 0.0690  -0.1415 -0.1667 129 MSE A CB  
845  C  CG  . MSE A 110 ? 1.6948 1.4472 0.7273 0.0681  -0.1522 -0.1845 129 MSE A CG  
846  SE SE  . MSE A 110 ? 1.7638 1.4913 0.8257 0.0584  -0.1568 -0.1757 129 MSE A SE  
847  C  CE  . MSE A 110 ? 1.6673 1.3964 0.7408 0.0726  -0.1422 -0.1742 129 MSE A CE  
848  N  N   . TYR A 111 ? 1.6864 1.5253 0.6917 0.0656  -0.1296 -0.1382 130 TYR A N   
849  C  CA  . TYR A 111 ? 1.6781 1.5297 0.6741 0.0594  -0.1232 -0.1172 130 TYR A CA  
850  C  C   . TYR A 111 ? 1.7020 1.5875 0.6799 0.0605  -0.1141 -0.1195 130 TYR A C   
851  O  O   . TYR A 111 ? 1.7231 1.6238 0.6992 0.0523  -0.1060 -0.1045 130 TYR A O   
852  C  CB  . TYR A 111 ? 1.6714 1.5166 0.6567 0.0565  -0.1311 -0.1012 130 TYR A CB  
853  C  CG  . TYR A 111 ? 1.6342 1.4529 0.6341 0.0580  -0.1349 -0.0903 130 TYR A CG  
854  C  CD1 . TYR A 111 ? 1.6404 1.4360 0.6409 0.0538  -0.1290 -0.0774 130 TYR A CD1 
855  C  CD2 . TYR A 111 ? 1.6129 1.4327 0.6225 0.0628  -0.1446 -0.0912 130 TYR A CD2 
856  C  CE1 . TYR A 111 ? 1.6070 1.3749 0.6138 0.0586  -0.1310 -0.0689 130 TYR A CE1 
857  C  CE2 . TYR A 111 ? 1.6126 1.4161 0.6346 0.0683  -0.1456 -0.0804 130 TYR A CE2 
858  C  CZ  . TYR A 111 ? 1.6088 1.3833 0.6274 0.0683  -0.1380 -0.0705 130 TYR A CZ  
859  O  OH  . TYR A 111 ? 1.6348 1.3897 0.6593 0.0771  -0.1377 -0.0618 130 TYR A OH  
860  N  N   . GLU A 112 ? 1.7233 1.6213 0.6847 0.0688  -0.1159 -0.1374 131 GLU A N   
861  C  CA  . GLU A 112 ? 1.7602 1.6955 0.7014 0.0741  -0.1054 -0.1422 131 GLU A CA  
862  C  C   . GLU A 112 ? 1.7141 1.6672 0.6699 0.0855  -0.0931 -0.1501 131 GLU A C   
863  O  O   . GLU A 112 ? 1.6873 1.6837 0.6396 0.0848  -0.0809 -0.1411 131 GLU A O   
864  C  CB  . GLU A 112 ? 1.8568 1.7937 0.7691 0.0818  -0.1111 -0.1618 131 GLU A CB  
865  C  CG  . GLU A 112 ? 1.9572 1.9358 0.8416 0.0854  -0.1005 -0.1617 131 GLU A CG  
866  C  CD  . GLU A 112 ? 2.1499 2.1250 0.9982 0.0903  -0.1080 -0.1803 131 GLU A CD  
867  O  OE1 . GLU A 112 ? 2.2661 2.2055 1.1096 0.0913  -0.1215 -0.1970 131 GLU A OE1 
868  O  OE2 . GLU A 112 ? 2.2315 2.2403 1.0528 0.0904  -0.1011 -0.1773 131 GLU A OE2 
869  N  N   . LYS A 113 ? 1.7016 1.6257 0.6741 0.0950  -0.0969 -0.1642 132 LYS A N   
870  C  CA  . LYS A 113 ? 1.7205 1.6587 0.7093 0.1091  -0.0875 -0.1700 132 LYS A CA  
871  C  C   . LYS A 113 ? 1.7018 1.6622 0.7135 0.0933  -0.0817 -0.1449 132 LYS A C   
872  O  O   . LYS A 113 ? 1.7091 1.7113 0.7310 0.0999  -0.0709 -0.1410 132 LYS A O   
873  C  CB  . LYS A 113 ? 1.7665 1.6589 0.7637 0.1200  -0.0960 -0.1879 132 LYS A CB  
874  C  CG  . LYS A 113 ? 1.8234 1.7265 0.8340 0.1403  -0.0880 -0.1950 132 LYS A CG  
875  C  CD  . LYS A 113 ? 1.8603 1.7085 0.8727 0.1487  -0.0988 -0.2107 132 LYS A CD  
876  C  CE  . LYS A 113 ? 1.9278 1.7855 0.9506 0.1735  -0.0917 -0.2165 132 LYS A CE  
877  N  NZ  . LYS A 113 ? 2.0227 1.8200 1.0439 0.1794  -0.1039 -0.2288 132 LYS A NZ  
878  N  N   . ILE A 114 ? 1.6593 1.5916 0.6763 0.0736  -0.0894 -0.1282 133 ILE A N   
879  C  CA  . ILE A 114 ? 1.6377 1.5758 0.6640 0.0540  -0.0869 -0.1043 133 ILE A CA  
880  C  C   . ILE A 114 ? 1.6733 1.6582 0.6840 0.0411  -0.0789 -0.0876 133 ILE A C   
881  O  O   . ILE A 114 ? 1.7219 1.7417 0.7424 0.0303  -0.0726 -0.0742 133 ILE A O   
882  C  CB  . ILE A 114 ? 1.6042 1.4934 0.6275 0.0405  -0.0965 -0.0918 133 ILE A CB  
883  C  CG1 . ILE A 114 ? 1.6000 1.4549 0.6435 0.0479  -0.1021 -0.1025 133 ILE A CG1 
884  C  CG2 . ILE A 114 ? 1.5857 1.4704 0.6004 0.0176  -0.0956 -0.0671 133 ILE A CG2 
885  C  CD1 . ILE A 114 ? 1.5774 1.3907 0.6182 0.0415  -0.1094 -0.0929 133 ILE A CD1 
886  N  N   . LEU A 115 ? 1.6733 1.6622 0.6595 0.0399  -0.0802 -0.0866 134 LEU A N   
887  C  CA  . LEU A 115 ? 1.7302 1.7641 0.6966 0.0261  -0.0730 -0.0700 134 LEU A CA  
888  C  C   . LEU A 115 ? 1.7855 1.8884 0.7591 0.0385  -0.0582 -0.0768 134 LEU A C   
889  O  O   . LEU A 115 ? 1.8621 2.0150 0.8312 0.0211  -0.0507 -0.0568 134 LEU A O   
890  C  CB  . LEU A 115 ? 1.6907 1.7154 0.6278 0.0257  -0.0781 -0.0694 134 LEU A CB  
891  C  CG  . LEU A 115 ? 1.6856 1.6557 0.6108 0.0159  -0.0914 -0.0561 134 LEU A CG  
892  C  CD1 . LEU A 115 ? 1.6913 1.6661 0.5889 0.0181  -0.0963 -0.0549 134 LEU A CD1 
893  C  CD2 . LEU A 115 ? 1.6932 1.6424 0.6080 -0.0089 -0.0935 -0.0283 134 LEU A CD2 
894  N  N   . GLN A 116 ? 1.8237 1.9283 0.8053 0.0687  -0.0546 -0.1039 135 GLN A N   
895  C  CA  . GLN A 116 ? 1.8374 2.0031 0.8242 0.0919  -0.0396 -0.1141 135 GLN A CA  
896  C  C   . GLN A 116 ? 1.7983 1.9988 0.8172 0.0861  -0.0348 -0.0993 135 GLN A C   
897  O  O   . GLN A 116 ? 1.8136 2.0896 0.8396 0.0861  -0.0222 -0.0873 135 GLN A O   
898  C  CB  . GLN A 116 ? 1.8782 2.0147 0.8555 0.1273  -0.0403 -0.1481 135 GLN A CB  
899  C  CG  . GLN A 116 ? 1.9644 2.1549 0.9341 0.1612  -0.0240 -0.1633 135 GLN A CG  
900  C  CD  . GLN A 116 ? 2.0275 2.1687 0.9724 0.1949  -0.0275 -0.1985 135 GLN A CD  
901  O  OE1 . GLN A 116 ? 2.0034 2.0739 0.9458 0.1904  -0.0432 -0.2100 135 GLN A OE1 
902  N  NE2 . GLN A 116 ? 2.1114 2.2892 1.0339 0.2286  -0.0132 -0.2153 135 GLN A NE2 
903  N  N   . LEU A 117 ? 1.7733 1.9242 0.8111 0.0804  -0.0452 -0.0991 136 LEU A N   
904  C  CA  . LEU A 117 ? 1.7291 1.9049 0.7953 0.0708  -0.0443 -0.0841 136 LEU A CA  
905  C  C   . LEU A 117 ? 1.7050 1.9001 0.7675 0.0282  -0.0469 -0.0513 136 LEU A C   
906  O  O   . LEU A 117 ? 1.7444 1.9927 0.8250 0.0154  -0.0431 -0.0341 136 LEU A O   
907  C  CB  . LEU A 117 ? 1.7212 1.8338 0.8031 0.0765  -0.0551 -0.0942 136 LEU A CB  
908  C  CG  . LEU A 117 ? 1.7416 1.8294 0.8264 0.1137  -0.0553 -0.1230 136 LEU A CG  
909  C  CD1 . LEU A 117 ? 1.7034 1.7233 0.7982 0.1098  -0.0681 -0.1288 136 LEU A CD1 
910  C  CD2 . LEU A 117 ? 1.7614 1.9092 0.8620 0.1415  -0.0441 -0.1266 136 LEU A CD2 
911  N  N   . GLU A 118 ? 1.6835 1.8327 0.7200 0.0061  -0.0549 -0.0417 137 GLU A N   
912  C  CA  . GLU A 118 ? 1.6798 1.8261 0.6987 -0.0354 -0.0601 -0.0110 137 GLU A CA  
913  C  C   . GLU A 118 ? 1.7048 1.8250 0.6878 -0.0455 -0.0637 -0.0043 137 GLU A C   
914  O  O   . GLU A 118 ? 1.6964 1.7501 0.6666 -0.0393 -0.0728 -0.0115 137 GLU A O   
915  C  CB  . GLU A 118 ? 1.6545 1.7370 0.6753 -0.0535 -0.0722 -0.0030 137 GLU A CB  
916  C  CG  . GLU A 118 ? 1.6794 1.7407 0.6716 -0.0976 -0.0804 0.0272  137 GLU A CG  
917  C  CD  . GLU A 118 ? 1.6771 1.6724 0.6640 -0.1134 -0.0917 0.0327  137 GLU A CD  
918  O  OE1 . GLU A 118 ? 1.6227 1.5832 0.6277 -0.0902 -0.0934 0.0140  137 GLU A OE1 
919  O  OE2 . GLU A 118 ? 1.6907 1.6652 0.6500 -0.1515 -0.0997 0.0566  137 GLU A OE2 
920  N  N   . ALA A 119 ? 1.7257 1.9034 0.6933 -0.0611 -0.0565 0.0116  138 ALA A N   
921  C  CA  . ALA A 119 ? 1.7633 1.9249 0.6942 -0.0718 -0.0597 0.0211  138 ALA A CA  
922  C  C   . ALA A 119 ? 1.8065 1.8835 0.7073 -0.0943 -0.0753 0.0379  138 ALA A C   
923  O  O   . ALA A 119 ? 1.7988 1.8286 0.6833 -0.0800 -0.0819 0.0299  138 ALA A O   
924  C  CB  . ALA A 119 ? 1.7913 2.0331 0.7100 -0.0932 -0.0498 0.0421  138 ALA A CB  
925  N  N   . ASP A 120 ? 1.8330 1.8903 0.7247 -0.1275 -0.0818 0.0606  139 ASP A N   
926  C  CA  . ASP A 120 ? 1.8647 1.8326 0.7169 -0.1490 -0.0967 0.0780  139 ASP A CA  
927  C  C   . ASP A 120 ? 1.7946 1.6875 0.6543 -0.1342 -0.1045 0.0654  139 ASP A C   
928  O  O   . ASP A 120 ? 1.7865 1.6078 0.6120 -0.1534 -0.1155 0.0806  139 ASP A O   
929  C  CB  . ASP A 120 ? 1.9463 1.9197 0.7690 -0.1992 -0.1024 0.1114  139 ASP A CB  
930  C  CG  . ASP A 120 ? 1.9165 1.9158 0.7644 -0.2175 -0.1024 0.1157  139 ASP A CG  
931  O  OD1 . ASP A 120 ? 1.8431 1.9039 0.7380 -0.1926 -0.0917 0.0974  139 ASP A OD1 
932  O  OD2 . ASP A 120 ? 1.9788 1.9331 0.7956 -0.2565 -0.1144 0.1377  139 ASP A OD2 
933  N  N   . ASN A 121 ? 1.7419 1.6468 0.6397 -0.1008 -0.0993 0.0386  140 ASN A N   
934  C  CA  . ASN A 121 ? 1.7021 1.5472 0.6104 -0.0857 -0.1050 0.0263  140 ASN A CA  
935  C  C   . ASN A 121 ? 1.7418 1.5140 0.6146 -0.0802 -0.1142 0.0330  140 ASN A C   
936  O  O   . ASN A 121 ? 1.7081 1.4864 0.5720 -0.0659 -0.1146 0.0303  140 ASN A O   
937  C  CB  . ASN A 121 ? 1.6313 1.4994 0.5788 -0.0518 -0.0995 -0.0020 140 ASN A CB  
938  C  CG  . ASN A 121 ? 1.6046 1.4243 0.5663 -0.0413 -0.1042 -0.0118 140 ASN A CG  
939  O  OD1 . ASN A 121 ? 1.5873 1.3753 0.5505 -0.0218 -0.1078 -0.0225 140 ASN A OD1 
940  N  ND2 . ASN A 121 ? 1.5452 1.3636 0.5161 -0.0560 -0.1047 -0.0062 140 ASN A ND2 
941  N  N   . LEU A 122 ? 1.7391 1.4433 0.5884 -0.0899 -0.1217 0.0420  141 LEU A N   
942  C  CA  . LEU A 122 ? 1.7846 1.4147 0.5936 -0.0799 -0.1299 0.0503  141 LEU A CA  
943  C  C   . LEU A 122 ? 1.7582 1.3839 0.5900 -0.0411 -0.1288 0.0322  141 LEU A C   
944  O  O   . LEU A 122 ? 1.7573 1.3735 0.5728 -0.0260 -0.1324 0.0364  141 LEU A O   
945  C  CB  . LEU A 122 ? 1.8412 1.3934 0.6113 -0.0975 -0.1376 0.0626  141 LEU A CB  
946  C  CG  . LEU A 122 ? 1.9191 1.3829 0.6306 -0.0898 -0.1468 0.0760  141 LEU A CG  
947  C  CD1 . LEU A 122 ? 1.9787 1.4381 0.6497 -0.1114 -0.1527 0.0980  141 LEU A CD1 
948  C  CD2 . LEU A 122 ? 1.9658 1.3485 0.6370 -0.1044 -0.1536 0.0821  141 LEU A CD2 
949  N  N   . ALA A 123 ? 1.7034 1.3421 0.5730 -0.0277 -0.1248 0.0142  142 ALA A N   
950  C  CA  . ALA A 123 ? 1.6966 1.3379 0.5906 0.0027  -0.1247 -0.0013 142 ALA A CA  
951  C  C   . ALA A 123 ? 1.6985 1.3881 0.6082 0.0157  -0.1245 -0.0102 142 ALA A C   
952  O  O   . ALA A 123 ? 1.6952 1.3762 0.5982 0.0333  -0.1293 -0.0082 142 ALA A O   
953  C  CB  . ALA A 123 ? 1.6786 1.3294 0.6084 0.0075  -0.1211 -0.0170 142 ALA A CB  
954  N  N   . ALA A 124 ? 1.6812 1.4219 0.6085 0.0081  -0.1193 -0.0194 143 ALA A N   
955  C  CA  . ALA A 124 ? 1.6470 1.4300 0.5822 0.0187  -0.1191 -0.0311 143 ALA A CA  
956  C  C   . ALA A 124 ? 1.7049 1.4879 0.6071 0.0156  -0.1233 -0.0157 143 ALA A C   
957  O  O   . ALA A 124 ? 1.6793 1.4734 0.5807 0.0290  -0.1286 -0.0204 143 ALA A O   
958  C  CB  . ALA A 124 ? 1.5977 1.4291 0.5505 0.0157  -0.1110 -0.0447 143 ALA A CB  
959  N  N   . ASN A 125 ? 1.7575 1.5283 0.6308 -0.0048 -0.1225 0.0042  144 ASN A N   
960  C  CA  . ASN A 125 ? 1.8183 1.5809 0.6533 -0.0116 -0.1277 0.0233  144 ASN A CA  
961  C  C   . ASN A 125 ? 1.8400 1.5487 0.6523 0.0055  -0.1377 0.0344  144 ASN A C   
962  O  O   . ASN A 125 ? 1.8410 1.5522 0.6312 0.0114  -0.1437 0.0445  144 ASN A O   
963  C  CB  . ASN A 125 ? 1.8650 1.6262 0.6717 -0.0437 -0.1257 0.0444  144 ASN A CB  
964  C  CG  . ASN A 125 ? 1.8577 1.6937 0.6835 -0.0556 -0.1147 0.0377  144 ASN A CG  
965  O  OD1 . ASN A 125 ? 1.8142 1.6960 0.6463 -0.0439 -0.1105 0.0261  144 ASN A OD1 
966  N  ND2 . ASN A 125 ? 1.8301 1.6805 0.6609 -0.0787 -0.1103 0.0463  144 ASN A ND2 
967  N  N   . ILE A 126 ? 1.8204 1.4833 0.6364 0.0159  -0.1392 0.0333  145 ILE A N   
968  C  CA  . ILE A 126 ? 1.8599 1.4774 0.6568 0.0407  -0.1464 0.0423  145 ILE A CA  
969  C  C   . ILE A 126 ? 1.8559 1.5186 0.6851 0.0649  -0.1489 0.0300  145 ILE A C   
970  O  O   . ILE A 126 ? 1.8711 1.5354 0.6840 0.0797  -0.1562 0.0410  145 ILE A O   
971  C  CB  . ILE A 126 ? 1.8478 1.4082 0.6380 0.0486  -0.1453 0.0423  145 ILE A CB  
972  C  CG1 . ILE A 126 ? 1.9025 1.4008 0.6440 0.0232  -0.1479 0.0592  145 ILE A CG1 
973  C  CG2 . ILE A 126 ? 1.8664 1.3973 0.6457 0.0841  -0.1496 0.0477  145 ILE A CG2 
974  C  CD1 . ILE A 126 ? 1.8613 1.3055 0.5938 0.0237  -0.1464 0.0556  145 ILE A CD1 
975  N  N   . PHE A 127 ? 1.8027 1.5009 0.6744 0.0665  -0.1445 0.0089  146 PHE A N   
976  C  CA  . PHE A 127 ? 1.7811 1.5211 0.6818 0.0815  -0.1491 -0.0028 146 PHE A CA  
977  C  C   . PHE A 127 ? 1.7935 1.5733 0.6858 0.0774  -0.1545 -0.0036 146 PHE A C   
978  O  O   . PHE A 127 ? 1.8256 1.6216 0.7159 0.0910  -0.1633 0.0031  146 PHE A O   
979  C  CB  . PHE A 127 ? 1.7264 1.4881 0.6656 0.0777  -0.1452 -0.0248 146 PHE A CB  
980  C  CG  . PHE A 127 ? 1.7045 1.5039 0.6676 0.0856  -0.1527 -0.0354 146 PHE A CG  
981  C  CD1 . PHE A 127 ? 1.7002 1.5029 0.6792 0.1012  -0.1567 -0.0299 146 PHE A CD1 
982  C  CD2 . PHE A 127 ? 1.7223 1.5551 0.6882 0.0765  -0.1564 -0.0501 146 PHE A CD2 
983  C  CE1 . PHE A 127 ? 1.7030 1.5473 0.7040 0.1020  -0.1657 -0.0362 146 PHE A CE1 
984  C  CE2 . PHE A 127 ? 1.7041 1.5658 0.6850 0.0774  -0.1666 -0.0588 146 PHE A CE2 
985  C  CZ  . PHE A 127 ? 1.7031 1.5736 0.7035 0.0874  -0.1720 -0.0505 146 PHE A CZ  
986  N  N   . LEU A 128 ? 1.7908 1.5910 0.6785 0.0601  -0.1488 -0.0118 147 LEU A N   
987  C  CA  . LEU A 128 ? 1.8010 1.6391 0.6755 0.0554  -0.1518 -0.0155 147 LEU A CA  
988  C  C   . LEU A 128 ? 1.8307 1.6591 0.6686 0.0556  -0.1583 0.0083  147 LEU A C   
989  O  O   . LEU A 128 ? 1.8542 1.7089 0.6843 0.0608  -0.1667 0.0093  147 LEU A O   
990  C  CB  . LEU A 128 ? 1.7942 1.6593 0.6700 0.0421  -0.1413 -0.0297 147 LEU A CB  
991  C  CG  . LEU A 128 ? 1.7438 1.6189 0.6506 0.0463  -0.1372 -0.0554 147 LEU A CG  
992  C  CD1 . LEU A 128 ? 1.7220 1.6212 0.6292 0.0399  -0.1248 -0.0653 147 LEU A CD1 
993  C  CD2 . LEU A 128 ? 1.7204 1.6116 0.6335 0.0536  -0.1467 -0.0727 147 LEU A CD2 
994  N  N   . GLY A 129 ? 1.8442 1.6306 0.6559 0.0484  -0.1563 0.0283  148 GLY A N   
995  C  CA  . GLY A 129 ? 1.9127 1.6735 0.6813 0.0482  -0.1640 0.0543  148 GLY A CA  
996  C  C   . GLY A 129 ? 1.9301 1.6833 0.6973 0.0759  -0.1754 0.0632  148 GLY A C   
997  O  O   . GLY A 129 ? 1.9510 1.7167 0.6956 0.0803  -0.1842 0.0765  148 GLY A O   
998  N  N   . ASN A 130 ? 1.9174 1.6566 0.7096 0.0951  -0.1750 0.0570  149 ASN A N   
999  C  CA  . ASN A 130 ? 1.9141 1.6608 0.7142 0.1252  -0.1838 0.0653  149 ASN A CA  
1000 C  C   . ASN A 130 ? 1.8470 1.6629 0.6808 0.1260  -0.1902 0.0515  149 ASN A C   
1001 O  O   . ASN A 130 ? 1.8960 1.7378 0.7282 0.1426  -0.2011 0.0635  149 ASN A O   
1002 C  CB  . ASN A 130 ? 1.9139 1.6275 0.7277 0.1453  -0.1791 0.0639  149 ASN A CB  
1003 C  CG  . ASN A 130 ? 1.9733 1.6061 0.7431 0.1462  -0.1760 0.0780  149 ASN A CG  
1004 O  OD1 . ASN A 130 ? 2.0454 1.6409 0.7693 0.1404  -0.1812 0.0963  149 ASN A OD1 
1005 N  ND2 . ASN A 130 ? 2.0136 1.6147 0.7923 0.1518  -0.1688 0.0702  149 ASN A ND2 
1006 N  N   . TYR A 131 ? 1.7744 1.6169 0.6346 0.1082  -0.1849 0.0274  150 TYR A N   
1007 C  CA  . TYR A 131 ? 1.7833 1.6785 0.6666 0.1028  -0.1926 0.0113  150 TYR A CA  
1008 C  C   . TYR A 131 ? 1.8344 1.7585 0.6919 0.0955  -0.2015 0.0161  150 TYR A C   
1009 O  O   . TYR A 131 ? 1.8259 1.7864 0.6889 0.1012  -0.2149 0.0208  150 TYR A O   
1010 C  CB  . TYR A 131 ? 1.7832 1.6831 0.6867 0.0865  -0.1850 -0.0156 150 TYR A CB  
1011 C  CG  . TYR A 131 ? 1.8268 1.7640 0.7421 0.0773  -0.1945 -0.0343 150 TYR A CG  
1012 C  CD1 . TYR A 131 ? 1.8551 1.8117 0.7989 0.0796  -0.2032 -0.0374 150 TYR A CD1 
1013 C  CD2 . TYR A 131 ? 1.9230 1.8747 0.8160 0.0646  -0.1952 -0.0486 150 TYR A CD2 
1014 C  CE1 . TYR A 131 ? 1.9044 1.8877 0.8519 0.0647  -0.2151 -0.0532 150 TYR A CE1 
1015 C  CE2 . TYR A 131 ? 1.9756 1.9485 0.8684 0.0545  -0.2060 -0.0673 150 TYR A CE2 
1016 C  CZ  . TYR A 131 ? 1.9871 1.9725 0.9060 0.0522  -0.2172 -0.0692 150 TYR A CZ  
1017 O  OH  . TYR A 131 ? 2.0929 2.0922 1.0050 0.0361  -0.2309 -0.0865 150 TYR A OH  
1018 N  N   . TYR A 132 ? 1.8483 1.7618 0.6782 0.0813  -0.1943 0.0157  151 TYR A N   
1019 C  CA  . TYR A 132 ? 1.8868 1.8265 0.6864 0.0727  -0.2006 0.0204  151 TYR A CA  
1020 C  C   . TYR A 132 ? 1.9120 1.8452 0.6874 0.0862  -0.2122 0.0502  151 TYR A C   
1021 O  O   . TYR A 132 ? 1.9779 1.9456 0.7424 0.0864  -0.2245 0.0546  151 TYR A O   
1022 C  CB  . TYR A 132 ? 1.9164 1.8559 0.6934 0.0547  -0.1879 0.0142  151 TYR A CB  
1023 C  CG  . TYR A 132 ? 1.9315 1.8880 0.7268 0.0476  -0.1785 -0.0167 151 TYR A CG  
1024 C  CD1 . TYR A 132 ? 1.9900 1.9741 0.7841 0.0458  -0.1855 -0.0383 151 TYR A CD1 
1025 C  CD2 . TYR A 132 ? 1.9478 1.8900 0.7561 0.0428  -0.1638 -0.0240 151 TYR A CD2 
1026 C  CE1 . TYR A 132 ? 2.0226 2.0101 0.8243 0.0433  -0.1779 -0.0673 151 TYR A CE1 
1027 C  CE2 . TYR A 132 ? 1.9564 1.9125 0.7790 0.0419  -0.1556 -0.0513 151 TYR A CE2 
1028 C  CZ  . TYR A 132 ? 2.0263 2.0004 0.8434 0.0441  -0.1624 -0.0735 151 TYR A CZ  
1029 O  OH  . TYR A 132 ? 2.0628 2.0386 0.8853 0.0470  -0.1552 -0.1009 151 TYR A OH  
1030 N  N   . TYR A 133 ? 1.9308 1.8162 0.6941 0.0985  -0.2097 0.0703  152 TYR A N   
1031 C  CA  . TYR A 133 ? 1.9782 1.8445 0.7127 0.1178  -0.2210 0.0998  152 TYR A CA  
1032 C  C   . TYR A 133 ? 1.9544 1.8589 0.7151 0.1434  -0.2335 0.1049  152 TYR A C   
1033 O  O   . TYR A 133 ? 1.9861 1.9158 0.7307 0.1524  -0.2469 0.1217  152 TYR A O   
1034 C  CB  . TYR A 133 ? 2.0411 1.8328 0.7481 0.1266  -0.2161 0.1178  152 TYR A CB  
1035 C  CG  . TYR A 133 ? 2.1012 1.8596 0.7725 0.1536  -0.2282 0.1477  152 TYR A CG  
1036 C  CD1 . TYR A 133 ? 2.1577 1.9072 0.7838 0.1447  -0.2369 0.1687  152 TYR A CD1 
1037 C  CD2 . TYR A 133 ? 2.1117 1.8476 0.7915 0.1908  -0.2306 0.1561  152 TYR A CD2 
1038 C  CE1 . TYR A 133 ? 2.2149 1.9282 0.8041 0.1725  -0.2495 0.1975  152 TYR A CE1 
1039 C  CE2 . TYR A 133 ? 2.1735 1.8764 0.8171 0.2228  -0.2415 0.1836  152 TYR A CE2 
1040 C  CZ  . TYR A 133 ? 2.2315 1.9201 0.8294 0.2139  -0.2518 0.2046  152 TYR A CZ  
1041 O  OH  . TYR A 133 ? 2.2798 1.9301 0.8381 0.2482  -0.2638 0.2331  152 TYR A OH  
1042 N  N   . LEU A 134 ? 1.9163 1.8306 0.7169 0.1536  -0.2295 0.0925  153 LEU A N   
1043 C  CA  . LEU A 134 ? 1.9108 1.8746 0.7425 0.1751  -0.2401 0.0986  153 LEU A CA  
1044 C  C   . LEU A 134 ? 1.8908 1.9226 0.7384 0.1556  -0.2529 0.0874  153 LEU A C   
1045 O  O   . LEU A 134 ? 1.8759 1.9556 0.7299 0.1681  -0.2678 0.1031  153 LEU A O   
1046 C  CB  . LEU A 134 ? 1.8882 1.8470 0.7562 0.1881  -0.2314 0.0900  153 LEU A CB  
1047 C  CG  . LEU A 134 ? 1.9443 1.8379 0.7938 0.2151  -0.2218 0.1029  153 LEU A CG  
1048 C  CD1 . LEU A 134 ? 1.8759 1.7674 0.7598 0.2206  -0.2113 0.0892  153 LEU A CD1 
1049 C  CD2 . LEU A 134 ? 1.9980 1.8891 0.8271 0.2547  -0.2306 0.1313  153 LEU A CD2 
1050 N  N   . THR A 135 ? 1.8610 1.8957 0.7113 0.1263  -0.2480 0.0609  154 THR A N   
1051 C  CA  . THR A 135 ? 1.8756 1.9589 0.7280 0.1048  -0.2608 0.0463  154 THR A CA  
1052 C  C   . THR A 135 ? 1.9488 2.0477 0.7617 0.0989  -0.2708 0.0578  154 THR A C   
1053 O  O   . THR A 135 ? 1.9422 2.0878 0.7532 0.0894  -0.2876 0.0579  154 THR A O   
1054 C  CB  . THR A 135 ? 1.8523 1.9235 0.7104 0.0810  -0.2526 0.0132  154 THR A CB  
1055 O  OG1 . THR A 135 ? 1.8828 1.9148 0.7180 0.0765  -0.2364 0.0069  154 THR A OG1 
1056 C  CG2 . THR A 135 ? 1.8381 1.9046 0.7358 0.0832  -0.2481 0.0032  154 THR A CG2 
1057 N  N   . ALA A 136 ? 1.9895 2.0503 0.7687 0.1006  -0.2616 0.0684  155 ALA A N   
1058 C  CA  . ALA A 136 ? 2.0521 2.1241 0.7897 0.0951  -0.2702 0.0835  155 ALA A CA  
1059 C  C   . ALA A 136 ? 2.0706 2.1566 0.8029 0.1204  -0.2857 0.1165  155 ALA A C   
1060 O  O   . ALA A 136 ? 2.0592 2.1759 0.7675 0.1166  -0.2999 0.1289  155 ALA A O   
1061 C  CB  . ALA A 136 ? 2.0744 2.1046 0.7770 0.0850  -0.2558 0.0877  155 ALA A CB  
1062 N  N   . GLU A 137 ? 2.0642 2.1278 0.8159 0.1485  -0.2827 0.1305  156 GLU A N   
1063 C  CA  . GLU A 137 ? 2.1232 2.1975 0.8702 0.1825  -0.2955 0.1623  156 GLU A CA  
1064 C  C   . GLU A 137 ? 2.0995 2.2582 0.8780 0.1848  -0.3137 0.1652  156 GLU A C   
1065 O  O   . GLU A 137 ? 2.0784 2.2704 0.8413 0.1965  -0.3302 0.1885  156 GLU A O   
1066 C  CB  . GLU A 137 ? 2.1413 2.1675 0.8974 0.2155  -0.2855 0.1723  156 GLU A CB  
1067 C  CG  . GLU A 137 ? 2.2373 2.2465 0.9702 0.2583  -0.2948 0.2065  156 GLU A CG  
1068 C  CD  . GLU A 137 ? 2.3370 2.2850 1.0073 0.2563  -0.2985 0.2271  156 GLU A CD  
1069 O  OE1 . GLU A 137 ? 2.3698 2.2738 1.0141 0.2247  -0.2889 0.2169  156 GLU A OE1 
1070 O  OE2 . GLU A 137 ? 2.3878 2.3331 1.0337 0.2871  -0.3116 0.2560  156 GLU A OE2 
1071 N  N   . GLN A 138 ? 2.0350 2.2279 0.8554 0.1714  -0.3121 0.1437  157 GLN A N   
1072 C  CA  . GLN A 138 ? 2.0386 2.3148 0.8892 0.1631  -0.3310 0.1456  157 GLN A CA  
1073 C  C   . GLN A 138 ? 2.0622 2.3692 0.8851 0.1302  -0.3468 0.1373  157 GLN A C   
1074 O  O   . GLN A 138 ? 2.0312 2.4035 0.8598 0.1286  -0.3679 0.1529  157 GLN A O   
1075 C  CB  . GLN A 138 ? 2.0050 2.3038 0.9016 0.1514  -0.3268 0.1265  157 GLN A CB  
1076 C  CG  . GLN A 138 ? 2.0246 2.2825 0.9174 0.1187  -0.3153 0.0908  157 GLN A CG  
1077 C  CD  . GLN A 138 ? 2.0021 2.2768 0.9369 0.1085  -0.3127 0.0761  157 GLN A CD  
1078 O  OE1 . GLN A 138 ? 2.0306 2.3675 0.9981 0.1126  -0.3245 0.0897  157 GLN A OE1 
1079 N  NE2 . GLN A 138 ? 1.9426 2.1664 0.8766 0.0944  -0.2978 0.0501  157 GLN A NE2 
1080 N  N   . GLU A 139 ? 2.0624 2.3264 0.8545 0.1052  -0.3366 0.1134  158 GLU A N   
1081 C  CA  . GLU A 139 ? 2.0936 2.3764 0.8486 0.0769  -0.3481 0.1024  158 GLU A CA  
1082 C  C   . GLU A 139 ? 2.1117 2.4037 0.8302 0.0889  -0.3584 0.1321  158 GLU A C   
1083 O  O   . GLU A 139 ? 2.0676 2.4018 0.7648 0.0731  -0.3770 0.1355  158 GLU A O   
1084 C  CB  . GLU A 139 ? 2.1292 2.3659 0.8595 0.0554  -0.3307 0.0703  158 GLU A CB  
1085 C  CG  . GLU A 139 ? 2.1426 2.3687 0.8984 0.0399  -0.3245 0.0385  158 GLU A CG  
1086 C  CD  . GLU A 139 ? 2.1946 2.4569 0.9462 0.0125  -0.3450 0.0217  158 GLU A CD  
1087 O  OE1 . GLU A 139 ? 2.2347 2.5381 0.9660 0.0031  -0.3652 0.0337  158 GLU A OE1 
1088 O  OE2 . GLU A 139 ? 2.2608 2.5061 1.0259 -0.0019 -0.3423 -0.0035 158 GLU A OE2 
1089 N  N   . LYS A 140 ? 2.1186 2.3655 0.8248 0.1146  -0.3476 0.1534  159 LYS A N   
1090 C  CA  . LYS A 140 ? 2.1703 2.4118 0.8382 0.1297  -0.3572 0.1857  159 LYS A CA  
1091 C  C   . LYS A 140 ? 2.2187 2.5196 0.9061 0.1555  -0.3793 0.2147  159 LYS A C   
1092 O  O   . LYS A 140 ? 2.2851 2.6125 0.9437 0.1569  -0.3961 0.2361  159 LYS A O   
1093 C  CB  . LYS A 140 ? 2.1865 2.3515 0.8320 0.1482  -0.3413 0.2004  159 LYS A CB  
1094 C  CG  . LYS A 140 ? 2.2608 2.4005 0.8573 0.1618  -0.3507 0.2350  159 LYS A CG  
1095 C  CD  . LYS A 140 ? 2.2987 2.3514 0.8672 0.1702  -0.3356 0.2455  159 LYS A CD  
1096 C  CE  . LYS A 140 ? 2.3774 2.3907 0.8896 0.1820  -0.3464 0.2820  159 LYS A CE  
1097 N  NZ  . LYS A 140 ? 2.4322 2.4617 0.9490 0.2260  -0.3641 0.3111  159 LYS A NZ  
1098 N  N   . LYS A 141 ? 2.2175 2.5443 0.9535 0.1765  -0.3787 0.2170  160 LYS A N   
1099 C  CA  . LYS A 141 ? 2.2349 2.6347 0.9987 0.2038  -0.3979 0.2451  160 LYS A CA  
1100 C  C   . LYS A 141 ? 2.2029 2.6868 0.9779 0.1699  -0.4205 0.2387  160 LYS A C   
1101 O  O   . LYS A 141 ? 2.2262 2.7707 0.9986 0.1805  -0.4421 0.2659  160 LYS A O   
1102 C  CB  . LYS A 141 ? 2.2402 2.6510 1.0529 0.2347  -0.3880 0.2481  160 LYS A CB  
1103 C  CG  . LYS A 141 ? 2.2766 2.7688 1.1201 0.2720  -0.4040 0.2808  160 LYS A CG  
1104 C  CD  . LYS A 141 ? 2.2914 2.7948 1.1798 0.3045  -0.3905 0.2824  160 LYS A CD  
1105 C  CE  . LYS A 141 ? 2.3095 2.9093 1.2317 0.3446  -0.4050 0.3161  160 LYS A CE  
1106 N  NZ  . LYS A 141 ? 2.2985 2.9187 1.2638 0.3786  -0.3900 0.3181  160 LYS A NZ  
1107 N  N   . LYS A 142 ? 2.1630 2.6473 0.9478 0.1301  -0.4171 0.2040  161 LYS A N   
1108 C  CA  . LYS A 142 ? 2.1607 2.7060 0.9443 0.0897  -0.4393 0.1920  161 LYS A CA  
1109 C  C   . LYS A 142 ? 2.2414 2.7876 0.9697 0.0727  -0.4525 0.1963  161 LYS A C   
1110 O  O   . LYS A 142 ? 2.2620 2.8747 0.9850 0.0569  -0.4785 0.2085  161 LYS A O   
1111 C  CB  . LYS A 142 ? 2.1171 2.6330 0.9062 0.0534  -0.4303 0.1508  161 LYS A CB  
1112 C  CG  . LYS A 142 ? 2.1212 2.6807 0.8994 0.0080  -0.4541 0.1344  161 LYS A CG  
1113 C  CD  . LYS A 142 ? 2.0794 2.5902 0.8534 -0.0219 -0.4440 0.0934  161 LYS A CD  
1114 C  CE  . LYS A 142 ? 2.1021 2.6396 0.8528 -0.0690 -0.4698 0.0758  161 LYS A CE  
1115 N  NZ  . LYS A 142 ? 2.1449 2.6822 0.8362 -0.0851 -0.4828 0.0724  161 LYS A NZ  
1116 N  N   . LEU A 143 ? 2.2633 2.7400 0.9503 0.0734  -0.4348 0.1870  162 LEU A N   
1117 C  CA  . LEU A 143 ? 2.3133 2.7838 0.9430 0.0586  -0.4422 0.1912  162 LEU A CA  
1118 C  C   . LEU A 143 ? 2.3891 2.8957 1.0068 0.0844  -0.4610 0.2350  162 LEU A C   
1119 O  O   . LEU A 143 ? 2.4255 2.9706 1.0109 0.0668  -0.4812 0.2434  162 LEU A O   
1120 C  CB  . LEU A 143 ? 2.3040 2.6987 0.8996 0.0562  -0.4160 0.1763  162 LEU A CB  
1121 C  CG  . LEU A 143 ? 2.3963 2.7776 0.9302 0.0400  -0.4160 0.1782  162 LEU A CG  
1122 C  CD1 . LEU A 143 ? 2.4508 2.8685 0.9560 0.0055  -0.4308 0.1548  162 LEU A CD1 
1123 C  CD2 . LEU A 143 ? 2.3685 2.6866 0.8840 0.0369  -0.3873 0.1632  162 LEU A CD2 
1124 N  N   . GLU A 144 ? 2.4044 2.8946 1.0437 0.1274  -0.4548 0.2622  163 GLU A N   
1125 C  CA  . GLU A 144 ? 2.4736 2.9895 1.1018 0.1625  -0.4717 0.3061  163 GLU A CA  
1126 C  C   . GLU A 144 ? 2.4419 3.0609 1.1104 0.1713  -0.4974 0.3259  163 GLU A C   
1127 O  O   . GLU A 144 ? 2.4898 3.1538 1.1406 0.1823  -0.5193 0.3564  163 GLU A O   
1128 C  CB  . GLU A 144 ? 2.5410 2.9909 1.1689 0.2090  -0.4560 0.3264  163 GLU A CB  
1129 C  CG  . GLU A 144 ? 2.6046 2.9587 1.1835 0.1988  -0.4366 0.3190  163 GLU A CG  
1130 C  CD  . GLU A 144 ? 2.6516 2.9276 1.2270 0.2365  -0.4210 0.3326  163 GLU A CD  
1131 O  OE1 . GLU A 144 ? 2.6962 2.9862 1.2948 0.2811  -0.4266 0.3543  163 GLU A OE1 
1132 O  OE2 . GLU A 144 ? 2.6316 2.8322 1.1776 0.2215  -0.4031 0.3218  163 GLU A OE2 
1133 N  N   . THR A 145 ? 2.3787 3.0383 1.1011 0.1657  -0.4954 0.3113  164 THR A N   
1134 C  CA  . THR A 145 ? 2.3405 3.1107 1.1077 0.1674  -0.5193 0.3303  164 THR A CA  
1135 C  C   . THR A 145 ? 2.3273 3.1570 1.0718 0.1181  -0.5471 0.3247  164 THR A C   
1136 O  O   . THR A 145 ? 2.3400 3.2603 1.0988 0.1229  -0.5735 0.3544  164 THR A O   
1137 C  CB  . THR A 145 ? 2.2804 3.0779 1.1067 0.1637  -0.5097 0.3143  164 THR A CB  
1138 O  OG1 . THR A 145 ? 2.2486 2.9849 1.0896 0.2070  -0.4835 0.3161  164 THR A OG1 
1139 C  CG2 . THR A 145 ? 2.2616 3.1845 1.1381 0.1681  -0.5335 0.3409  164 THR A CG2 
1140 N  N   . ASP A 146 ? 2.3164 3.0955 1.0232 0.0730  -0.5412 0.2871  165 ASP A N   
1141 C  CA  . ASP A 146 ? 2.3577 3.1728 1.0282 0.0241  -0.5656 0.2749  165 ASP A CA  
1142 C  C   . ASP A 146 ? 2.4060 3.2330 1.0274 0.0307  -0.5811 0.3009  165 ASP A C   
1143 O  O   . ASP A 146 ? 2.4248 3.3268 1.0386 0.0114  -0.6114 0.3172  165 ASP A O   
1144 C  CB  . ASP A 146 ? 2.3568 3.1021 0.9912 -0.0169 -0.5516 0.2255  165 ASP A CB  
1145 C  CG  . ASP A 146 ? 2.3284 3.0641 1.0033 -0.0331 -0.5427 0.1982  165 ASP A CG  
1146 O  OD1 . ASP A 146 ? 2.3067 3.0867 1.0399 -0.0130 -0.5432 0.2161  165 ASP A OD1 
1147 O  OD2 . ASP A 146 ? 2.3346 3.0168 0.9798 -0.0645 -0.5345 0.1586  165 ASP A OD2 
1148 N  N   . TYR A 147 ? 2.4254 3.1796 1.0124 0.0544  -0.5615 0.3061  166 TYR A N   
1149 C  CA  . TYR A 147 ? 2.4912 3.2437 1.0255 0.0606  -0.5734 0.3320  166 TYR A CA  
1150 C  C   . TYR A 147 ? 2.5535 3.3634 1.1084 0.1042  -0.5928 0.3826  166 TYR A C   
1151 O  O   . TYR A 147 ? 2.5661 3.4399 1.1024 0.0952  -0.6211 0.4054  166 TYR A O   
1152 C  CB  . TYR A 147 ? 2.4810 3.1379 0.9718 0.0691  -0.5465 0.3250  166 TYR A CB  
1153 N  N   . LYS A 148 ? 2.5519 3.3382 1.1420 0.1532  -0.5782 0.3999  167 LYS A N   
1154 C  CA  . LYS A 148 ? 2.6081 3.4398 1.2162 0.2067  -0.5930 0.4477  167 LYS A CA  
1155 C  C   . LYS A 148 ? 2.5632 3.5129 1.2351 0.2120  -0.6124 0.4609  167 LYS A C   
1156 O  O   . LYS A 148 ? 2.5221 3.5610 1.1955 0.2081  -0.6421 0.4877  167 LYS A O   
1157 C  CB  . LYS A 148 ? 2.6420 3.3903 1.2505 0.2600  -0.5694 0.4599  167 LYS A CB  
1158 C  CG  . LYS A 148 ? 2.7006 3.3381 1.2438 0.2524  -0.5536 0.4548  167 LYS A CG  
1159 C  CD  . LYS A 148 ? 2.7273 3.2751 1.2548 0.3032  -0.5375 0.4745  167 LYS A CD  
1160 C  CE  . LYS A 148 ? 2.6727 3.1783 1.2395 0.3167  -0.5117 0.4506  167 LYS A CE  
1161 N  NZ  . LYS A 148 ? 2.6474 3.2336 1.2815 0.3458  -0.5158 0.4554  167 LYS A NZ  
1162 N  N   . SER A 152 ? 2.9418 4.1607 1.1762 -0.0044 -0.8283 0.5802  171 SER A N   
1163 C  CA  . SER A 152 ? 2.8557 4.0262 1.1366 -0.0006 -0.7970 0.5436  171 SER A CA  
1164 C  C   . SER A 152 ? 2.8536 3.9548 1.1582 0.0601  -0.7691 0.5622  171 SER A C   
1165 O  O   . SER A 152 ? 2.8621 3.9928 1.1836 0.1100  -0.7819 0.6091  171 SER A O   
1166 C  CB  . SER A 152 ? 2.8008 4.0642 1.1510 -0.0114 -0.8147 0.5414  171 SER A CB  
1167 O  OG  . SER A 152 ? 2.7219 3.9430 1.1191 -0.0059 -0.7860 0.5098  171 SER A OG  
1168 N  N   . PRO A 153 ? 2.8536 3.8616 1.1573 0.0577  -0.7323 0.5261  172 PRO A N   
1169 C  CA  . PRO A 153 ? 2.8383 3.8015 1.1239 0.0097  -0.7124 0.4702  172 PRO A CA  
1170 C  C   . PRO A 153 ? 2.9069 3.8269 1.1094 -0.0260 -0.7080 0.4535  172 PRO A C   
1171 O  O   . PRO A 153 ? 2.9685 3.8652 1.1275 -0.0103 -0.7101 0.4841  172 PRO A O   
1172 C  CB  . PRO A 153 ? 2.8071 3.6925 1.1266 0.0373  -0.6757 0.4534  172 PRO A CB  
1173 C  CG  . PRO A 153 ? 2.8324 3.6807 1.1436 0.0885  -0.6719 0.4965  172 PRO A CG  
1174 C  CD  . PRO A 153 ? 2.8357 3.7715 1.1562 0.1109  -0.7077 0.5427  172 PRO A CD  
1175 N  N   . THR A 154 ? 2.8895 3.7978 1.0674 -0.0721 -0.7019 0.4058  173 THR A N   
1176 C  CA  . THR A 154 ? 2.9465 3.8195 1.0440 -0.1057 -0.6950 0.3834  173 THR A CA  
1177 C  C   . THR A 154 ? 2.9111 3.6965 0.9940 -0.0945 -0.6536 0.3645  173 THR A C   
1178 O  O   . THR A 154 ? 2.8856 3.6349 1.0157 -0.0807 -0.6306 0.3448  173 THR A O   
1179 C  CB  . THR A 154 ? 2.9720 3.8625 1.0404 -0.1562 -0.7063 0.3382  173 THR A CB  
1180 O  OG1 . THR A 154 ? 2.9781 3.9549 1.0602 -0.1729 -0.7476 0.3586  173 THR A OG1 
1181 C  CG2 . THR A 154 ? 3.0346 3.8918 1.0138 -0.1853 -0.6983 0.3149  173 THR A CG2 
1182 N  N   . LYS A 155 ? 2.9486 3.7055 0.9662 -0.1026 -0.6451 0.3723  174 LYS A N   
1183 C  CA  . LYS A 155 ? 2.9454 3.6303 0.9432 -0.0980 -0.6072 0.3590  174 LYS A CA  
1184 C  C   . LYS A 155 ? 2.9332 3.5865 0.9279 -0.1197 -0.5794 0.3013  174 LYS A C   
1185 O  O   . LYS A 155 ? 2.8574 3.4601 0.8587 -0.1111 -0.5473 0.2895  174 LYS A O   
1186 C  CB  . LYS A 155 ? 2.9801 3.6521 0.9074 -0.1047 -0.6065 0.3865  174 LYS A CB  
1187 C  CG  . LYS A 155 ? 3.0537 3.7596 0.9101 -0.1414 -0.6187 0.3709  174 LYS A CG  
1188 C  CD  . LYS A 155 ? 3.1058 3.8082 0.8991 -0.1441 -0.6234 0.4099  174 LYS A CD  
1189 C  CE  . LYS A 155 ? 3.1678 3.9087 0.8878 -0.1793 -0.6380 0.3966  174 LYS A CE  
1190 N  NZ  . LYS A 155 ? 3.2284 3.9719 0.8852 -0.1839 -0.6455 0.4381  174 LYS A NZ  
1191 N  N   . MSE A 156 ? 2.9934 3.6745 0.9740 -0.1478 -0.5932 0.2671  175 MSE A N   
1192 C  CA  . MSE A 156 ? 3.0308 3.6778 1.0053 -0.1647 -0.5714 0.2112  175 MSE A CA  
1193 C  C   . MSE A 156 ? 2.9808 3.6082 1.0336 -0.1464 -0.5602 0.2002  175 MSE A C   
1194 O  O   . MSE A 156 ? 2.8927 3.4732 0.9575 -0.1409 -0.5295 0.1709  175 MSE A O   
1195 C  CB  . MSE A 156 ? 3.1606 3.8328 1.0883 -0.2009 -0.5953 0.1810  175 MSE A CB  
1196 C  CG  . MSE A 156 ? 3.2338 3.8635 1.1458 -0.2175 -0.5792 0.1222  175 MSE A CG  
1197 SE SE  . MSE A 156 ? 3.4168 3.9838 1.2923 -0.2045 -0.5257 0.0861  175 MSE A SE  
1198 C  CE  . MSE A 156 ? 3.4263 3.9487 1.2682 -0.2258 -0.5235 0.0151  175 MSE A CE  
1199 N  N   . GLN A 157 ? 2.9533 3.6233 1.0584 -0.1367 -0.5856 0.2250  176 GLN A N   
1200 C  CA  . GLN A 157 ? 2.8517 3.5148 1.0328 -0.1178 -0.5782 0.2213  176 GLN A CA  
1201 C  C   . GLN A 157 ? 2.7779 3.3974 0.9897 -0.0805 -0.5521 0.2430  176 GLN A C   
1202 O  O   . GLN A 157 ? 2.7479 3.3330 1.0030 -0.0686 -0.5310 0.2251  176 GLN A O   
1203 C  CB  . GLN A 157 ? 2.8717 3.6066 1.0979 -0.1159 -0.6124 0.2477  176 GLN A CB  
1204 C  CG  . GLN A 157 ? 2.9208 3.6982 1.1192 -0.1599 -0.6420 0.2271  176 GLN A CG  
1205 C  CD  . GLN A 157 ? 2.9280 3.7938 1.1701 -0.1621 -0.6786 0.2602  176 GLN A CD  
1206 O  OE1 . GLN A 157 ? 2.9426 3.8429 1.2385 -0.1244 -0.6811 0.2991  176 GLN A OE1 
1207 N  NE2 . GLN A 157 ? 2.9608 3.8647 1.1762 -0.2065 -0.7079 0.2452  176 GLN A NE2 
1208 N  N   . TYR A 158 ? 2.7630 3.3801 0.9479 -0.0642 -0.5557 0.2821  177 TYR A N   
1209 C  CA  . TYR A 158 ? 2.7201 3.2840 0.9168 -0.0340 -0.5344 0.3055  177 TYR A CA  
1210 C  C   . TYR A 158 ? 2.6793 3.1872 0.8506 -0.0475 -0.4995 0.2756  177 TYR A C   
1211 O  O   . TYR A 158 ? 2.6362 3.0967 0.8341 -0.0302 -0.4776 0.2778  177 TYR A O   
1212 C  CB  . TYR A 158 ? 2.7657 3.3343 0.9293 -0.0165 -0.5510 0.3565  177 TYR A CB  
1213 C  CG  . TYR A 158 ? 2.7680 3.2706 0.9346 0.0126  -0.5338 0.3830  177 TYR A CG  
1214 C  CD1 . TYR A 158 ? 2.7589 3.2456 0.9781 0.0513  -0.5342 0.3999  177 TYR A CD1 
1215 C  CD2 . TYR A 158 ? 2.7967 3.2514 0.9093 0.0000  -0.5174 0.3915  177 TYR A CD2 
1216 C  CE1 . TYR A 158 ? 2.7748 3.1884 0.9870 0.0768  -0.5200 0.4222  177 TYR A CE1 
1217 C  CE2 . TYR A 158 ? 2.8208 3.2074 0.9290 0.0202  -0.5045 0.4167  177 TYR A CE2 
1218 C  CZ  . TYR A 158 ? 2.8128 3.1731 0.9678 0.0587  -0.5065 0.4309  177 TYR A CZ  
1219 O  OH  . TYR A 158 ? 2.8106 3.0921 0.9517 0.0776  -0.4956 0.4540  177 TYR A OH  
1220 N  N   . ALA A 159 ? 2.6681 3.1850 0.7867 -0.0772 -0.4947 0.2490  178 ALA A N   
1221 C  CA  . ALA A 159 ? 2.6503 3.1308 0.7450 -0.0886 -0.4612 0.2185  178 ALA A CA  
1222 C  C   . ALA A 159 ? 2.5974 3.0560 0.7404 -0.0852 -0.4444 0.1790  178 ALA A C   
1223 O  O   . ALA A 159 ? 2.5418 2.9630 0.7046 -0.0761 -0.4174 0.1715  178 ALA A O   
1224 C  CB  . ALA A 159 ? 2.7163 3.2175 0.7413 -0.1156 -0.4608 0.1971  178 ALA A CB  
1225 N  N   . ARG A 160 ? 2.5868 3.0691 0.7462 -0.0953 -0.4626 0.1564  179 ARG A N   
1226 C  CA  . ARG A 160 ? 2.5668 3.0285 0.7702 -0.0945 -0.4523 0.1212  179 ARG A CA  
1227 C  C   . ARG A 160 ? 2.4958 2.9402 0.7682 -0.0673 -0.4448 0.1407  179 ARG A C   
1228 O  O   . ARG A 160 ? 2.4507 2.8628 0.7546 -0.0620 -0.4244 0.1165  179 ARG A O   
1229 C  CB  . ARG A 160 ? 2.5858 3.0769 0.7870 -0.1165 -0.4795 0.1009  179 ARG A CB  
1230 N  N   . TYR A 161 ? 2.5262 2.9911 0.8174 -0.0480 -0.4615 0.1839  180 TYR A N   
1231 C  CA  . TYR A 161 ? 2.5019 2.9474 0.8480 -0.0163 -0.4555 0.2064  180 TYR A CA  
1232 C  C   . TYR A 161 ? 2.5254 2.9099 0.8643 -0.0059 -0.4263 0.2097  180 TYR A C   
1233 O  O   . TYR A 161 ? 2.4520 2.8046 0.8299 0.0038  -0.4084 0.1948  180 TYR A O   
1234 C  CB  . TYR A 161 ? 2.5307 3.0127 0.8878 0.0071  -0.4815 0.2527  180 TYR A CB  
1235 C  CG  . TYR A 161 ? 2.5204 2.9661 0.9073 0.0464  -0.4733 0.2826  180 TYR A CG  
1236 C  CD1 . TYR A 161 ? 2.4997 2.9403 0.9460 0.0666  -0.4659 0.2753  180 TYR A CD1 
1237 C  CD2 . TYR A 161 ? 2.5568 2.9675 0.9058 0.0632  -0.4739 0.3188  180 TYR A CD2 
1238 C  CE1 . TYR A 161 ? 2.4887 2.8887 0.9535 0.1049  -0.4579 0.3005  180 TYR A CE1 
1239 C  CE2 . TYR A 161 ? 2.5878 2.9508 0.9521 0.0999  -0.4680 0.3448  180 TYR A CE2 
1240 C  CZ  . TYR A 161 ? 2.5466 2.9037 0.9679 0.1221  -0.4594 0.3344  180 TYR A CZ  
1241 O  OH  . TYR A 161 ? 2.5757 2.8792 1.0039 0.1604  -0.4532 0.3580  180 TYR A OH  
1242 N  N   . ARG A 162 ? 2.5906 2.9615 0.8788 -0.0110 -0.4232 0.2308  181 ARG A N   
1243 C  CA  . ARG A 162 ? 2.6148 2.9326 0.8885 -0.0094 -0.3982 0.2384  181 ARG A CA  
1244 C  C   . ARG A 162 ? 2.5294 2.8351 0.8040 -0.0271 -0.3701 0.1973  181 ARG A C   
1245 O  O   . ARG A 162 ? 2.4589 2.7259 0.7474 -0.0233 -0.3492 0.1974  181 ARG A O   
1246 C  CB  . ARG A 162 ? 2.7228 3.0316 0.9377 -0.0160 -0.4036 0.2743  181 ARG A CB  
1247 C  CG  . ARG A 162 ? 2.8176 3.1095 1.0274 0.0099  -0.4247 0.3220  181 ARG A CG  
1248 C  CD  . ARG A 162 ? 2.8991 3.1277 1.1368 0.0347  -0.4138 0.3353  181 ARG A CD  
1249 N  NE  . ARG A 162 ? 3.0052 3.1941 1.2161 0.0597  -0.4294 0.3822  181 ARG A NE  
1250 C  CZ  . ARG A 162 ? 3.1081 3.2430 1.2650 0.0507  -0.4266 0.4110  181 ARG A CZ  
1251 N  NH1 . ARG A 162 ? 3.1174 3.2419 1.2434 0.0147  -0.4074 0.4007  181 ARG A NH1 
1252 N  NH2 . ARG A 162 ? 3.2113 3.3020 1.3417 0.0787  -0.4441 0.4529  181 ARG A NH2 
1253 N  N   . ASP A 163 ? 2.5003 2.8372 0.7552 -0.0452 -0.3707 0.1639  182 ASP A N   
1254 C  CA  . ASP A 163 ? 2.4586 2.7859 0.7124 -0.0549 -0.3452 0.1220  182 ASP A CA  
1255 C  C   . ASP A 163 ? 2.3568 2.6619 0.6699 -0.0432 -0.3378 0.0999  182 ASP A C   
1256 O  O   . ASP A 163 ? 2.3160 2.5997 0.6415 -0.0422 -0.3134 0.0794  182 ASP A O   
1257 C  CB  . ASP A 163 ? 2.5129 2.8679 0.7208 -0.0728 -0.3494 0.0897  182 ASP A CB  
1258 C  CG  . ASP A 163 ? 2.5929 2.9658 0.7373 -0.0858 -0.3411 0.0992  182 ASP A CG  
1259 O  OD1 . ASP A 163 ? 2.6015 2.9650 0.7391 -0.0861 -0.3156 0.1035  182 ASP A OD1 
1260 O  OD2 . ASP A 163 ? 2.6883 3.0887 0.7883 -0.0980 -0.3596 0.1014  182 ASP A OD2 
1261 N  N   . GLY A 164 ? 2.3187 2.6356 0.6674 -0.0353 -0.3592 0.1051  183 GLY A N   
1262 C  CA  . GLY A 164 ? 2.2735 2.5737 0.6795 -0.0247 -0.3548 0.0897  183 GLY A CA  
1263 C  C   . GLY A 164 ? 2.2352 2.4973 0.6708 -0.0057 -0.3385 0.1097  183 GLY A C   
1264 O  O   . GLY A 164 ? 2.2169 2.4531 0.6834 -0.0019 -0.3211 0.0899  183 GLY A O   
1265 N  N   . LEU A 165 ? 2.2598 2.5136 0.6807 0.0057  -0.3459 0.1492  184 LEU A N   
1266 C  CA  . LEU A 165 ? 2.2781 2.4832 0.7107 0.0215  -0.3336 0.1715  184 LEU A CA  
1267 C  C   . LEU A 165 ? 2.2830 2.4620 0.6966 0.0053  -0.3077 0.1600  184 LEU A C   
1268 O  O   . LEU A 165 ? 2.1963 2.3384 0.6336 0.0109  -0.2930 0.1585  184 LEU A O   
1269 C  CB  . LEU A 165 ? 2.3127 2.5041 0.7176 0.0362  -0.3492 0.2167  184 LEU A CB  
1270 C  CG  . LEU A 165 ? 2.3211 2.5395 0.7462 0.0615  -0.3742 0.2391  184 LEU A CG  
1271 C  CD1 . LEU A 165 ? 2.4065 2.6005 0.7916 0.0774  -0.3871 0.2835  184 LEU A CD1 
1272 C  CD2 . LEU A 165 ? 2.3171 2.5238 0.7981 0.0864  -0.3707 0.2340  184 LEU A CD2 
1273 N  N   . SER A 166 ? 2.3483 2.5520 0.7186 -0.0147 -0.3024 0.1532  185 SER A N   
1274 C  CA  . SER A 166 ? 2.3719 2.5700 0.7239 -0.0305 -0.2770 0.1438  185 SER A CA  
1275 C  C   . SER A 166 ? 2.3373 2.5400 0.7213 -0.0298 -0.2586 0.1018  185 SER A C   
1276 O  O   . SER A 166 ? 2.3456 2.5295 0.7474 -0.0311 -0.2394 0.0988  185 SER A O   
1277 C  CB  . SER A 166 ? 2.4100 2.6428 0.7046 -0.0490 -0.2761 0.1487  185 SER A CB  
1278 O  OG  . SER A 166 ? 2.4211 2.6614 0.6989 -0.0637 -0.2510 0.1445  185 SER A OG  
1279 N  N   . LYS A 167 ? 2.3287 2.5529 0.7165 -0.0288 -0.2665 0.0712  186 LYS A N   
1280 C  CA  . LYS A 167 ? 2.2831 2.5041 0.6920 -0.0265 -0.2525 0.0297  186 LYS A CA  
1281 C  C   . LYS A 167 ? 2.2420 2.4320 0.7075 -0.0141 -0.2491 0.0272  186 LYS A C   
1282 O  O   . LYS A 167 ? 2.1834 2.3606 0.6684 -0.0114 -0.2295 0.0089  186 LYS A O   
1283 C  CB  . LYS A 167 ? 2.3317 2.5689 0.7231 -0.0315 -0.2683 0.0013  186 LYS A CB  
1284 C  CG  . LYS A 167 ? 2.3558 2.5843 0.7400 -0.0304 -0.2540 -0.0433 186 LYS A CG  
1285 C  CD  . LYS A 167 ? 2.4569 2.7046 0.7948 -0.0322 -0.2322 -0.0544 186 LYS A CD  
1286 C  CE  . LYS A 167 ? 2.4849 2.7224 0.8012 -0.0251 -0.2209 -0.1008 186 LYS A CE  
1287 N  NZ  . LYS A 167 ? 2.3879 2.5963 0.7513 -0.0123 -0.2097 -0.1182 186 LYS A NZ  
1288 N  N   . LEU A 168 ? 2.2146 2.3975 0.7056 -0.0050 -0.2680 0.0463  187 LEU A N   
1289 C  CA  . LEU A 168 ? 2.1322 2.2884 0.6741 0.0086  -0.2659 0.0474  187 LEU A CA  
1290 C  C   . LEU A 168 ? 2.1165 2.2376 0.6636 0.0125  -0.2496 0.0667  187 LEU A C   
1291 O  O   . LEU A 168 ? 2.1074 2.2049 0.6886 0.0183  -0.2386 0.0562  187 LEU A O   
1292 C  CB  . LEU A 168 ? 2.1286 2.2968 0.6926 0.0209  -0.2892 0.0669  187 LEU A CB  
1293 C  CG  . LEU A 168 ? 2.1080 2.2622 0.7239 0.0378  -0.2908 0.0691  187 LEU A CG  
1294 C  CD1 . LEU A 168 ? 2.1210 2.2322 0.7448 0.0546  -0.2808 0.0933  187 LEU A CD1 
1295 C  CD2 . LEU A 168 ? 2.0439 2.1925 0.6873 0.0300  -0.2818 0.0332  187 LEU A CD2 
1296 N  N   . PHE A 169 ? 2.1403 2.2557 0.6501 0.0061  -0.2496 0.0951  188 PHE A N   
1297 C  CA  . PHE A 169 ? 2.1706 2.2474 0.6746 0.0023  -0.2376 0.1164  188 PHE A CA  
1298 C  C   . PHE A 169 ? 2.1682 2.2542 0.6769 -0.0119 -0.2137 0.0965  188 PHE A C   
1299 O  O   . PHE A 169 ? 2.1206 2.1794 0.6565 -0.0102 -0.2034 0.0935  188 PHE A O   
1300 C  CB  . PHE A 169 ? 2.2265 2.2901 0.6821 -0.0053 -0.2462 0.1544  188 PHE A CB  
1301 C  CG  . PHE A 169 ? 2.2941 2.3058 0.7363 -0.0134 -0.2386 0.1789  188 PHE A CG  
1302 C  CD1 . PHE A 169 ? 2.3111 2.2651 0.7612 0.0055  -0.2476 0.1977  188 PHE A CD1 
1303 C  CD2 . PHE A 169 ? 2.3455 2.3666 0.7644 -0.0406 -0.2226 0.1835  188 PHE A CD2 
1304 C  CE1 . PHE A 169 ? 2.3547 2.2488 0.7832 -0.0048 -0.2428 0.2189  188 PHE A CE1 
1305 C  CE2 . PHE A 169 ? 2.3942 2.3659 0.7973 -0.0550 -0.2184 0.2076  188 PHE A CE2 
1306 C  CZ  . PHE A 169 ? 2.3910 2.2928 0.7957 -0.0384 -0.2296 0.2245  188 PHE A CZ  
1307 N  N   . THR A 170 ? 2.1841 2.3114 0.6651 -0.0242 -0.2051 0.0837  189 THR A N   
1308 C  CA  . THR A 170 ? 2.1775 2.3278 0.6616 -0.0331 -0.1811 0.0660  189 THR A CA  
1309 C  C   . THR A 170 ? 2.1767 2.3251 0.7016 -0.0196 -0.1720 0.0293  189 THR A C   
1310 O  O   . THR A 170 ? 2.1628 2.3156 0.7060 -0.0215 -0.1542 0.0220  189 THR A O   
1311 C  CB  . THR A 170 ? 2.2104 2.4105 0.6511 -0.0436 -0.1725 0.0596  189 THR A CB  
1312 O  OG1 . THR A 170 ? 2.2282 2.4421 0.6559 -0.0348 -0.1844 0.0360  189 THR A OG1 
1313 C  CG2 . THR A 170 ? 2.2240 2.4267 0.6225 -0.0622 -0.1781 0.0993  189 THR A CG2 
1314 N  N   . THR A 171 ? 2.1823 2.3250 0.7204 -0.0081 -0.1858 0.0093  190 THR A N   
1315 C  CA  . THR A 171 ? 2.1272 2.2604 0.6975 0.0024  -0.1813 -0.0241 190 THR A CA  
1316 C  C   . THR A 171 ? 2.1365 2.2343 0.7527 0.0097  -0.1836 -0.0169 190 THR A C   
1317 O  O   . THR A 171 ? 2.0929 2.1810 0.7349 0.0135  -0.1700 -0.0313 190 THR A O   
1318 C  CB  . THR A 171 ? 2.1565 2.2951 0.7158 0.0047  -0.1982 -0.0471 190 THR A CB  
1319 O  OG1 . THR A 171 ? 2.2406 2.4075 0.7499 -0.0018 -0.1978 -0.0547 190 THR A OG1 
1320 C  CG2 . THR A 171 ? 2.1401 2.2611 0.7217 0.0123  -0.1944 -0.0821 190 THR A CG2 
1321 N  N   . ARG A 172 ? 2.1272 2.2084 0.7513 0.0141  -0.2003 0.0059  191 ARG A N   
1322 C  CA  . ARG A 172 ? 2.0367 2.0861 0.7000 0.0251  -0.2035 0.0125  191 ARG A CA  
1323 C  C   . ARG A 172 ? 2.0337 2.0471 0.6934 0.0261  -0.1998 0.0429  191 ARG A C   
1324 O  O   . ARG A 172 ? 2.0094 1.9976 0.6919 0.0269  -0.1894 0.0392  191 ARG A O   
1325 C  CB  . ARG A 172 ? 2.0435 2.1031 0.7214 0.0341  -0.2239 0.0134  191 ARG A CB  
1326 C  CG  . ARG A 172 ? 2.0681 2.1094 0.7902 0.0461  -0.2258 0.0107  191 ARG A CG  
1327 C  CD  . ARG A 172 ? 2.0851 2.1546 0.8244 0.0485  -0.2446 0.0055  191 ARG A CD  
1328 N  NE  . ARG A 172 ? 2.0798 2.1615 0.8155 0.0342  -0.2466 -0.0269 191 ARG A NE  
1329 C  CZ  . ARG A 172 ? 2.0231 2.0896 0.7833 0.0317  -0.2416 -0.0504 191 ARG A CZ  
1330 N  NH1 . ARG A 172 ? 2.0416 2.0864 0.8370 0.0412  -0.2330 -0.0462 191 ARG A NH1 
1331 N  NH2 . ARG A 172 ? 2.0192 2.0864 0.7625 0.0194  -0.2461 -0.0790 191 ARG A NH2 
1332 N  N   . TYR A 173 ? 2.0491 2.0538 0.6765 0.0256  -0.2097 0.0725  192 TYR A N   
1333 C  CA  . TYR A 173 ? 2.0889 2.0438 0.6990 0.0248  -0.2088 0.1025  192 TYR A CA  
1334 C  C   . TYR A 173 ? 2.0803 2.0269 0.6803 0.0023  -0.1917 0.1039  192 TYR A C   
1335 O  O   . TYR A 173 ? 2.0532 1.9543 0.6566 0.0000  -0.1882 0.1146  192 TYR A O   
1336 C  CB  . TYR A 173 ? 2.1928 2.1337 0.7604 0.0277  -0.2238 0.1355  192 TYR A CB  
1337 C  CG  . TYR A 173 ? 2.2836 2.2151 0.8603 0.0562  -0.2415 0.1485  192 TYR A CG  
1338 C  CD1 . TYR A 173 ? 2.3718 2.2451 0.9438 0.0762  -0.2454 0.1690  192 TYR A CD1 
1339 C  CD2 . TYR A 173 ? 2.3559 2.3379 0.9416 0.0639  -0.2549 0.1422  192 TYR A CD2 
1340 C  CE1 . TYR A 173 ? 2.4149 2.2872 0.9954 0.1086  -0.2598 0.1827  192 TYR A CE1 
1341 C  CE2 . TYR A 173 ? 2.3815 2.3687 0.9793 0.0907  -0.2713 0.1579  192 TYR A CE2 
1342 C  CZ  . TYR A 173 ? 2.3925 2.3284 0.9896 0.1158  -0.2726 0.1784  192 TYR A CZ  
1343 O  OH  . TYR A 173 ? 2.3906 2.3399 1.0005 0.1483  -0.2868 0.1947  192 TYR A OH  
1344 N  N   . GLU A 174 ? 2.0286 2.0219 0.6147 -0.0136 -0.1815 0.0936  193 GLU A N   
1345 C  CA  . GLU A 174 ? 2.0221 2.0303 0.6027 -0.0353 -0.1640 0.0957  193 GLU A CA  
1346 C  C   . GLU A 174 ? 1.9698 1.9687 0.5922 -0.0316 -0.1527 0.0771  193 GLU A C   
1347 O  O   . GLU A 174 ? 1.9204 1.9038 0.5413 -0.0485 -0.1456 0.0909  193 GLU A O   
1348 C  CB  . GLU A 174 ? 2.0180 2.0903 0.5819 -0.0438 -0.1527 0.0820  193 GLU A CB  
1349 N  N   . LYS A 175 ? 1.9489 1.9568 0.6050 -0.0126 -0.1528 0.0475  194 LYS A N   
1350 C  CA  . LYS A 175 ? 1.9601 1.9569 0.6559 -0.0064 -0.1442 0.0292  194 LYS A CA  
1351 C  C   . LYS A 175 ? 1.9463 1.8855 0.6531 -0.0022 -0.1517 0.0451  194 LYS A C   
1352 O  O   . LYS A 175 ? 2.0479 1.9699 0.7733 -0.0073 -0.1440 0.0429  194 LYS A O   
1353 C  CB  . LYS A 175 ? 1.9616 1.9759 0.6822 0.0102  -0.1449 -0.0047 194 LYS A CB  
1354 C  CG  . LYS A 175 ? 2.0446 2.1052 0.7475 0.0100  -0.1356 -0.0251 194 LYS A CG  
1355 C  CD  . LYS A 175 ? 2.0868 2.1483 0.8010 0.0242  -0.1399 -0.0587 194 LYS A CD  
1356 C  CE  . LYS A 175 ? 2.1392 2.2366 0.8238 0.0278  -0.1304 -0.0803 194 LYS A CE  
1357 N  NZ  . LYS A 175 ? 2.2014 2.2857 0.8830 0.0391  -0.1378 -0.1135 194 LYS A NZ  
1358 N  N   . ALA A 176 ? 1.9401 1.8513 0.6328 0.0092  -0.1665 0.0610  195 ALA A N   
1359 C  CA  . ALA A 176 ? 1.9213 1.7741 0.6145 0.0201  -0.1733 0.0769  195 ALA A CA  
1360 C  C   . ALA A 176 ? 1.9848 1.7932 0.6429 -0.0002 -0.1711 0.1023  195 ALA A C   
1361 O  O   . ALA A 176 ? 2.0331 1.7994 0.6974 -0.0025 -0.1682 0.1041  195 ALA A O   
1362 C  CB  . ALA A 176 ? 1.9093 1.7520 0.5929 0.0421  -0.1890 0.0898  195 ALA A CB  
1363 N  N   . ARG A 177 ? 2.0282 1.8451 0.6463 -0.0181 -0.1736 0.1222  196 ARG A N   
1364 C  CA  . ARG A 177 ? 2.0964 1.8714 0.6729 -0.0458 -0.1743 0.1500  196 ARG A CA  
1365 C  C   . ARG A 177 ? 2.0886 1.8915 0.6819 -0.0729 -0.1597 0.1433  196 ARG A C   
1366 O  O   . ARG A 177 ? 2.1482 1.9042 0.7214 -0.0938 -0.1614 0.1601  196 ARG A O   
1367 C  CB  . ARG A 177 ? 2.1404 1.9215 0.6680 -0.0609 -0.1817 0.1756  196 ARG A CB  
1368 C  CG  . ARG A 177 ? 2.2075 1.9351 0.6830 -0.0939 -0.1864 0.2088  196 ARG A CG  
1369 C  CD  . ARG A 177 ? 2.2772 1.9956 0.6984 -0.1055 -0.1975 0.2378  196 ARG A CD  
1370 N  NE  . ARG A 177 ? 2.2332 2.0391 0.6601 -0.1171 -0.1886 0.2309  196 ARG A NE  
1371 C  CZ  . ARG A 177 ? 2.3229 2.1412 0.7062 -0.1303 -0.1954 0.2533  196 ARG A CZ  
1372 N  NH1 . ARG A 177 ? 2.4195 2.1647 0.7485 -0.1344 -0.2129 0.2866  196 ARG A NH1 
1373 N  NH2 . ARG A 177 ? 2.2804 2.1819 0.6698 -0.1382 -0.1848 0.2423  196 ARG A NH2 
1374 N  N   . ASN A 178 ? 2.0440 1.9207 0.6698 -0.0719 -0.1466 0.1197  197 ASN A N   
1375 C  CA  . ASN A 178 ? 2.0477 1.9648 0.6957 -0.0907 -0.1318 0.1126  197 ASN A CA  
1376 C  C   . ASN A 178 ? 2.0299 1.9082 0.7069 -0.0856 -0.1312 0.1034  197 ASN A C   
1377 O  O   . ASN A 178 ? 2.0113 1.8873 0.6872 -0.1105 -0.1270 0.1144  197 ASN A O   
1378 C  CB  . ASN A 178 ? 2.0495 2.0455 0.7239 -0.0784 -0.1180 0.0852  197 ASN A CB  
1379 C  CG  . ASN A 178 ? 2.0846 2.1334 0.7823 -0.0913 -0.1017 0.0797  197 ASN A CG  
1380 O  OD1 . ASN A 178 ? 2.1640 2.2174 0.8480 -0.1220 -0.0997 0.1042  197 ASN A OD1 
1381 N  ND2 . ASN A 178 ? 2.0955 2.1849 0.8256 -0.0683 -0.0910 0.0488  197 ASN A ND2 
1382 N  N   . SER A 179 ? 1.9760 1.8293 0.6778 -0.0559 -0.1359 0.0847  198 SER A N   
1383 C  CA  . SER A 179 ? 1.9765 1.7925 0.7039 -0.0481 -0.1355 0.0753  198 SER A CA  
1384 C  C   . SER A 179 ? 2.0163 1.7506 0.7078 -0.0558 -0.1458 0.0988  198 SER A C   
1385 O  O   . SER A 179 ? 2.0224 1.7271 0.7149 -0.0699 -0.1442 0.1017  198 SER A O   
1386 C  CB  . SER A 179 ? 1.9484 1.7692 0.7114 -0.0168 -0.1374 0.0501  198 SER A CB  
1387 O  OG  . SER A 179 ? 1.9771 1.8572 0.7644 -0.0105 -0.1296 0.0264  198 SER A OG  
1388 N  N   . LEU A 180 ? 2.0313 1.7264 0.6871 -0.0452 -0.1571 0.1152  199 LEU A N   
1389 C  CA  . LEU A 180 ? 2.0967 1.7010 0.7061 -0.0459 -0.1680 0.1374  199 LEU A CA  
1390 C  C   . LEU A 180 ? 2.1605 1.7307 0.7239 -0.0889 -0.1708 0.1624  199 LEU A C   
1391 O  O   . LEU A 180 ? 2.1439 1.6336 0.6725 -0.0965 -0.1779 0.1740  199 LEU A O   
1392 C  CB  . LEU A 180 ? 2.1181 1.6919 0.6997 -0.0181 -0.1799 0.1500  199 LEU A CB  
1393 C  CG  . LEU A 180 ? 2.0785 1.6727 0.7005 0.0229  -0.1806 0.1312  199 LEU A CG  
1394 C  CD1 . LEU A 180 ? 2.1367 1.7321 0.7390 0.0472  -0.1922 0.1448  199 LEU A CD1 
1395 C  CD2 . LEU A 180 ? 2.0775 1.6177 0.7065 0.0420  -0.1796 0.1253  199 LEU A CD2 
1396 N  N   . GLN A 181 ? 2.2071 1.8370 0.7661 -0.1178 -0.1659 0.1713  200 GLN A N   
1397 C  CA  . GLN A 181 ? 2.2581 1.8736 0.7775 -0.1663 -0.1685 0.1977  200 GLN A CA  
1398 C  C   . GLN A 181 ? 2.2183 1.8493 0.7651 -0.1878 -0.1614 0.1902  200 GLN A C   
1399 O  O   . GLN A 181 ? 2.2915 1.8701 0.7994 -0.2233 -0.1696 0.2110  200 GLN A O   
1400 C  CB  . GLN A 181 ? 2.2503 1.9377 0.7587 -0.1906 -0.1637 0.2114  200 GLN A CB  
1401 C  CG  . GLN A 181 ? 2.3049 1.9552 0.7635 -0.1851 -0.1760 0.2319  200 GLN A CG  
1402 C  CD  . GLN A 181 ? 2.3120 2.0385 0.7592 -0.2077 -0.1703 0.2443  200 GLN A CD  
1403 O  OE1 . GLN A 181 ? 2.2653 2.0809 0.7452 -0.2214 -0.1548 0.2344  200 GLN A OE1 
1404 N  NE2 . GLN A 181 ? 2.3340 2.0268 0.7322 -0.2085 -0.1824 0.2664  200 GLN A NE2 
1405 N  N   . LYS A 182 ? 2.1229 1.8223 0.7316 -0.1682 -0.1481 0.1620  201 LYS A N   
1406 C  CA  . LYS A 182 ? 2.1184 1.8376 0.7587 -0.1822 -0.1418 0.1534  201 LYS A CA  
1407 C  C   . LYS A 182 ? 2.0899 1.7199 0.7196 -0.1720 -0.1501 0.1490  201 LYS A C   
1408 O  O   . LYS A 182 ? 2.1180 1.7362 0.7489 -0.1960 -0.1510 0.1528  201 LYS A O   
1409 C  CB  . LYS A 182 ? 2.0815 1.8894 0.7849 -0.1591 -0.1264 0.1246  201 LYS A CB  
1410 C  CG  . LYS A 182 ? 2.1226 2.0231 0.8344 -0.1682 -0.1151 0.1268  201 LYS A CG  
1411 C  CD  . LYS A 182 ? 2.1077 2.0804 0.8724 -0.1399 -0.1006 0.0962  201 LYS A CD  
1412 C  CE  . LYS A 182 ? 2.1803 2.2422 0.9463 -0.1422 -0.0878 0.0962  201 LYS A CE  
1413 N  NZ  . LYS A 182 ? 2.2077 2.3285 1.0153 -0.1100 -0.0740 0.0650  201 LYS A NZ  
1414 N  N   . VAL A 183 ? 2.0708 1.6451 0.6900 -0.1361 -0.1558 0.1417  202 VAL A N   
1415 C  CA  . VAL A 183 ? 2.1329 1.6227 0.7365 -0.1187 -0.1621 0.1374  202 VAL A CA  
1416 C  C   . VAL A 183 ? 2.2602 1.6557 0.7913 -0.1498 -0.1752 0.1637  202 VAL A C   
1417 O  O   . VAL A 183 ? 2.3259 1.6736 0.8434 -0.1644 -0.1783 0.1631  202 VAL A O   
1418 C  CB  . VAL A 183 ? 2.1193 1.5863 0.7291 -0.0702 -0.1642 0.1267  202 VAL A CB  
1419 C  CG1 . VAL A 183 ? 2.1707 1.5516 0.7571 -0.0491 -0.1690 0.1248  202 VAL A CG1 
1420 C  CG2 . VAL A 183 ? 2.0248 1.5745 0.7006 -0.0462 -0.1542 0.1005  202 VAL A CG2 
1421 N  N   . ILE A 184 ? 2.3414 1.7076 0.8219 -0.1624 -0.1842 0.1870  203 ILE A N   
1422 C  CA  . ILE A 184 ? 2.4726 1.7391 0.8717 -0.1968 -0.1998 0.2152  203 ILE A CA  
1423 C  C   . ILE A 184 ? 2.5054 1.8138 0.8908 -0.2599 -0.2017 0.2370  203 ILE A C   
1424 O  O   . ILE A 184 ? 2.6374 1.8860 0.9545 -0.2956 -0.2154 0.2660  203 ILE A O   
1425 C  CB  . ILE A 184 ? 2.5557 1.7448 0.8945 -0.1741 -0.2120 0.2322  203 ILE A CB  
1426 C  CG1 . ILE A 184 ? 2.5323 1.7910 0.8788 -0.1781 -0.2104 0.2433  203 ILE A CG1 
1427 C  CG2 . ILE A 184 ? 2.5759 1.7287 0.9280 -0.1126 -0.2102 0.2137  203 ILE A CG2 
1428 C  CD1 . ILE A 184 ? 2.6197 1.8003 0.9021 -0.1598 -0.2247 0.2643  203 ILE A CD1 
1429 N  N   . LEU A 185 ? 2.4206 1.8314 0.8688 -0.2733 -0.1886 0.2246  204 LEU A N   
1430 C  CA  . LEU A 185 ? 2.4813 1.9580 0.9300 -0.3292 -0.1875 0.2448  204 LEU A CA  
1431 C  C   . LEU A 185 ? 2.6515 2.0499 1.0494 -0.3756 -0.2023 0.2630  204 LEU A C   
1432 O  O   . LEU A 185 ? 2.7824 2.1624 1.1288 -0.4295 -0.2139 0.2942  204 LEU A O   
1433 C  CB  . LEU A 185 ? 2.3443 1.9492 0.8752 -0.3193 -0.1688 0.2241  204 LEU A CB  
1434 C  CG  . LEU A 185 ? 2.3358 2.0415 0.8848 -0.3657 -0.1626 0.2419  204 LEU A CG  
1435 C  CD1 . LEU A 185 ? 2.3007 2.0466 0.8203 -0.3900 -0.1625 0.2662  204 LEU A CD1 
1436 C  CD2 . LEU A 185 ? 2.2270 2.0417 0.8550 -0.3377 -0.1439 0.2157  204 LEU A CD2 
1437 N  N   . ARG A 186 ? 2.7254 2.0796 1.1361 -0.3568 -0.2026 0.2437  205 ARG A N   
1438 C  CA  . ARG A 186 ? 2.8392 2.1076 1.1990 -0.3952 -0.2174 0.2551  205 ARG A CA  
1439 C  C   . ARG A 186 ? 2.9253 2.0678 1.2459 -0.3590 -0.2242 0.2394  205 ARG A C   
1440 O  O   . ARG A 186 ? 3.0020 2.0547 1.2649 -0.3898 -0.2382 0.2483  205 ARG A O   
1441 C  CB  . ARG A 186 ? 2.8352 2.1973 1.2454 -0.4298 -0.2119 0.2549  205 ARG A CB  
1442 C  CG  . ARG A 186 ? 2.7516 2.2242 1.2562 -0.3877 -0.1915 0.2256  205 ARG A CG  
1443 C  CD  . ARG A 186 ? 2.6934 2.2655 1.2424 -0.4225 -0.1872 0.2318  205 ARG A CD  
1444 N  NE  . ARG A 186 ? 2.5737 2.2633 1.2054 -0.3841 -0.1671 0.2094  205 ARG A NE  
1445 C  CZ  . ARG A 186 ? 2.4941 2.2944 1.1769 -0.3981 -0.1585 0.2118  205 ARG A CZ  
1446 N  NH1 . ARG A 186 ? 2.5114 2.3360 1.1796 -0.4538 -0.1682 0.2375  205 ARG A NH1 
1447 N  NH2 . ARG A 186 ? 2.3743 2.2624 1.1214 -0.3551 -0.1407 0.1888  205 ARG A NH2 
1448 N  N   . PHE A 187 ? 2.9559 2.0938 1.3040 -0.2960 -0.2149 0.2175  206 PHE A N   
1449 C  CA  . PHE A 187 ? 3.0632 2.0971 1.3786 -0.2532 -0.2181 0.2031  206 PHE A CA  
1450 C  C   . PHE A 187 ? 2.9816 1.9707 1.2674 -0.2106 -0.2205 0.2073  206 PHE A C   
1451 O  O   . PHE A 187 ? 2.8987 1.9632 1.2431 -0.1712 -0.2090 0.1931  206 PHE A O   
1452 C  CB  . PHE A 187 ? 3.1070 2.1947 1.4949 -0.2149 -0.2034 0.1725  206 PHE A CB  
1453 C  CG  . PHE A 187 ? 3.1561 2.3019 1.5824 -0.2498 -0.2003 0.1680  206 PHE A CG  
1454 C  CD1 . PHE A 187 ? 3.2075 2.2810 1.5805 -0.2909 -0.2131 0.1787  206 PHE A CD1 
1455 C  CD2 . PHE A 187 ? 3.1763 2.4453 1.6882 -0.2406 -0.1857 0.1531  206 PHE A CD2 
1456 C  CE1 . PHE A 187 ? 3.2115 2.3460 1.6217 -0.3238 -0.2117 0.1771  206 PHE A CE1 
1457 C  CE2 . PHE A 187 ? 3.0942 2.4191 1.6417 -0.2681 -0.1833 0.1507  206 PHE A CE2 
1458 C  CZ  . PHE A 187 ? 3.1277 2.3908 1.6275 -0.3101 -0.1963 0.1636  206 PHE A CZ  
1459 N  N   . PRO A 188 ? 3.0201 1.8839 1.2118 -0.2180 -0.2370 0.2273  207 PRO A N   
1460 C  CA  . PRO A 188 ? 3.0141 1.8366 1.1754 -0.1752 -0.2406 0.2345  207 PRO A CA  
1461 C  C   . PRO A 188 ? 2.9809 1.7957 1.1709 -0.1031 -0.2311 0.2114  207 PRO A C   
1462 O  O   . PRO A 188 ? 2.8964 1.6855 1.0951 -0.0874 -0.2259 0.1934  207 PRO A O   
1463 C  CB  . PRO A 188 ? 3.1520 1.8273 1.1978 -0.2017 -0.2619 0.2606  207 PRO A CB  
1464 C  CG  . PRO A 188 ? 3.1983 1.8089 1.2115 -0.2325 -0.2674 0.2551  207 PRO A CG  
1465 C  CD  . PRO A 188 ? 3.0997 1.8424 1.2046 -0.2581 -0.2538 0.2412  207 PRO A CD  
1466 N  N   . SER A 189 ? 2.9408 1.7865 1.1468 -0.0624 -0.2291 0.2135  208 SER A N   
1467 C  CA  . SER A 189 ? 2.9432 1.8006 1.1808 0.0046  -0.2209 0.1965  208 SER A CA  
1468 C  C   . SER A 189 ? 2.9822 1.8108 1.1854 0.0432  -0.2289 0.2129  208 SER A C   
1469 O  O   . SER A 189 ? 2.9317 1.8053 1.1388 0.0242  -0.2333 0.2276  208 SER A O   
1470 C  CB  . SER A 189 ? 2.8055 1.7985 1.1470 0.0143  -0.2050 0.1732  208 SER A CB  
1471 O  OG  . SER A 189 ? 2.8256 1.8413 1.2016 0.0720  -0.1979 0.1589  208 SER A OG  
1472 N  N   . THR A 190 ? 3.0799 1.8350 1.2470 0.0984  -0.2305 0.2113  209 THR A N   
1473 C  CA  . THR A 190 ? 3.1528 1.8817 1.2888 0.1461  -0.2380 0.2271  209 THR A CA  
1474 C  C   . THR A 190 ? 3.0692 1.9357 1.2959 0.1740  -0.2287 0.2173  209 THR A C   
1475 O  O   . THR A 190 ? 3.0561 1.9494 1.2785 0.1853  -0.2361 0.2330  209 THR A O   
1476 C  CB  . THR A 190 ? 3.2351 1.8554 1.3103 0.2055  -0.2400 0.2265  209 THR A CB  
1477 O  OG1 . THR A 190 ? 3.3856 1.8685 1.3697 0.1764  -0.2499 0.2326  209 THR A OG1 
1478 C  CG2 . THR A 190 ? 3.2540 1.8452 1.2922 0.2573  -0.2493 0.2466  209 THR A CG2 
1479 N  N   . GLU A 191 ? 3.0100 1.9578 1.3130 0.1824  -0.2143 0.1923  210 GLU A N   
1480 C  CA  . GLU A 191 ? 2.9869 2.0622 1.3749 0.2012  -0.2068 0.1804  210 GLU A CA  
1481 C  C   . GLU A 191 ? 2.9310 2.0850 1.3503 0.1571  -0.2082 0.1827  210 GLU A C   
1482 O  O   . GLU A 191 ? 2.8508 2.0797 1.3045 0.1715  -0.2099 0.1841  210 GLU A O   
1483 C  CB  . GLU A 191 ? 2.9962 2.1258 1.4486 0.2106  -0.1927 0.1542  210 GLU A CB  
1484 C  CG  . GLU A 191 ? 3.0046 2.2505 1.5361 0.2339  -0.1869 0.1424  210 GLU A CG  
1485 C  CD  . GLU A 191 ? 3.1432 2.3986 1.6707 0.2918  -0.1905 0.1536  210 GLU A CD  
1486 O  OE1 . GLU A 191 ? 3.3009 2.4681 1.7669 0.3260  -0.1941 0.1664  210 GLU A OE1 
1487 O  OE2 . GLU A 191 ? 3.1835 2.5364 1.7684 0.3040  -0.1902 0.1497  210 GLU A OE2 
1488 N  N   . ALA A 192 ? 2.8685 2.0094 1.2746 0.1044  -0.2075 0.1834  211 ALA A N   
1489 C  CA  . ALA A 192 ? 2.7154 1.9306 1.1452 0.0634  -0.2065 0.1860  211 ALA A CA  
1490 C  C   . ALA A 192 ? 2.7642 1.9446 1.1353 0.0533  -0.2194 0.2143  211 ALA A C   
1491 O  O   . ALA A 192 ? 2.6776 1.9286 1.0715 0.0542  -0.2203 0.2170  211 ALA A O   
1492 C  CB  . ALA A 192 ? 2.6688 1.8929 1.1066 0.0136  -0.2006 0.1802  211 ALA A CB  
1493 N  N   . GLN A 193 ? 2.8403 1.9076 1.1312 0.0419  -0.2306 0.2353  212 GLN A N   
1494 C  CA  . GLN A 193 ? 2.9247 1.9402 1.1471 0.0294  -0.2456 0.2661  212 GLN A CA  
1495 C  C   . GLN A 193 ? 2.9238 1.9402 1.1370 0.0815  -0.2533 0.2767  212 GLN A C   
1496 O  O   . GLN A 193 ? 2.8743 1.9049 1.0633 0.0691  -0.2621 0.2968  212 GLN A O   
1497 C  CB  . GLN A 193 ? 3.0132 1.8920 1.1411 0.0015  -0.2588 0.2872  212 GLN A CB  
1498 C  CG  . GLN A 193 ? 2.9891 1.8782 1.1035 -0.0716 -0.2596 0.2967  212 GLN A CG  
1499 C  CD  . GLN A 193 ? 2.9944 1.9346 1.0968 -0.1091 -0.2644 0.3195  212 GLN A CD  
1500 O  OE1 . GLN A 193 ? 2.9385 1.9099 1.0451 -0.0820 -0.2674 0.3267  212 GLN A OE1 
1501 N  NE2 . GLN A 193 ? 3.0317 1.9857 1.1185 -0.1732 -0.2655 0.3326  212 GLN A NE2 
1502 N  N   . LYS A 194 ? 2.9513 1.9586 1.1835 0.1384  -0.2502 0.2651  213 LYS A N   
1503 C  CA  . LYS A 194 ? 2.9787 2.0032 1.2110 0.1923  -0.2573 0.2760  213 LYS A CA  
1504 C  C   . LYS A 194 ? 2.8379 1.9980 1.1429 0.1881  -0.2534 0.2672  213 LYS A C   
1505 O  O   . LYS A 194 ? 2.8159 1.9996 1.1110 0.2082  -0.2634 0.2837  213 LYS A O   
1506 C  CB  . LYS A 194 ? 3.0623 2.0492 1.2947 0.2560  -0.2538 0.2685  213 LYS A CB  
1507 C  CG  . LYS A 194 ? 3.0006 2.0735 1.3166 0.2738  -0.2380 0.2395  213 LYS A CG  
1508 C  CD  . LYS A 194 ? 2.9424 2.1381 1.3311 0.3020  -0.2360 0.2338  213 LYS A CD  
1509 C  CE  . LYS A 194 ? 3.0023 2.1879 1.3709 0.3659  -0.2443 0.2523  213 LYS A CE  
1510 N  NZ  . LYS A 194 ? 3.0775 2.1967 1.4214 0.4156  -0.2379 0.2490  213 LYS A NZ  
1511 N  N   . THR A 195 ? 2.6779 1.9203 1.0498 0.1625  -0.2401 0.2415  214 THR A N   
1512 C  CA  . THR A 195 ? 2.5474 1.9069 0.9796 0.1534  -0.2366 0.2293  214 THR A CA  
1513 C  C   . THR A 195 ? 2.5562 1.9360 0.9628 0.1089  -0.2402 0.2421  214 THR A C   
1514 O  O   . THR A 195 ? 2.4872 1.9295 0.9059 0.1119  -0.2451 0.2460  214 THR A O   
1515 C  CB  . THR A 195 ? 2.4002 1.8289 0.9044 0.1446  -0.2221 0.1972  214 THR A CB  
1516 O  OG1 . THR A 195 ? 2.3414 1.7576 0.8680 0.1848  -0.2187 0.1880  214 THR A OG1 
1517 C  CG2 . THR A 195 ? 2.2925 1.8276 0.8475 0.1365  -0.2206 0.1832  214 THR A CG2 
1518 N  N   . LEU A 196 ? 2.6136 1.9461 0.9845 0.0666  -0.2380 0.2496  215 LEU A N   
1519 C  CA  . LEU A 196 ? 2.6603 2.0173 1.0048 0.0210  -0.2398 0.2649  215 LEU A CA  
1520 C  C   . LEU A 196 ? 2.8041 2.1232 1.0884 0.0276  -0.2562 0.2965  215 LEU A C   
1521 O  O   . LEU A 196 ? 2.8404 2.2195 1.1240 0.0071  -0.2572 0.3037  215 LEU A O   
1522 C  CB  . LEU A 196 ? 2.6791 1.9965 0.9961 -0.0283 -0.2359 0.2713  215 LEU A CB  
1523 C  CG  . LEU A 196 ? 2.6017 1.9746 0.9770 -0.0466 -0.2196 0.2443  215 LEU A CG  
1524 C  CD1 . LEU A 196 ? 2.6296 1.9586 0.9687 -0.0961 -0.2201 0.2581  215 LEU A CD1 
1525 C  CD2 . LEU A 196 ? 2.4733 1.9640 0.9053 -0.0536 -0.2077 0.2252  215 LEU A CD2 
1526 N  N   . ASP A 197 ? 2.9050 2.1234 1.1353 0.0575  -0.2688 0.3152  216 ASP A N   
1527 C  CA  . ASP A 197 ? 2.9990 2.1714 1.1675 0.0711  -0.2865 0.3473  216 ASP A CA  
1528 C  C   . ASP A 197 ? 2.9495 2.2040 1.1586 0.1120  -0.2904 0.3441  216 ASP A C   
1529 O  O   . ASP A 197 ? 2.9759 2.2427 1.1544 0.1085  -0.3020 0.3660  216 ASP A O   
1530 C  CB  . ASP A 197 ? 3.1238 2.1502 1.2092 0.0913  -0.3002 0.3699  216 ASP A CB  
1531 C  CG  . ASP A 197 ? 3.1231 2.1152 1.2246 0.1538  -0.2976 0.3560  216 ASP A CG  
1532 O  OD1 . ASP A 197 ? 3.1270 2.1892 1.2769 0.1995  -0.2963 0.3485  216 ASP A OD1 
1533 O  OD2 . ASP A 197 ? 3.1291 2.0193 1.1871 0.1569  -0.2981 0.3552  216 ASP A OD2 
1534 N  N   . LYS A 198 ? 2.8654 2.1762 1.1404 0.1470  -0.2822 0.3189  217 LYS A N   
1535 C  CA  . LYS A 198 ? 2.8027 2.2046 1.1241 0.1788  -0.2865 0.3139  217 LYS A CA  
1536 C  C   . LYS A 198 ? 2.7357 2.2364 1.0909 0.1409  -0.2815 0.3007  217 LYS A C   
1537 O  O   . LYS A 198 ? 2.7613 2.3147 1.1175 0.1490  -0.2916 0.3098  217 LYS A O   
1538 C  CB  . LYS A 198 ? 2.7444 2.1824 1.1251 0.2198  -0.2796 0.2927  217 LYS A CB  
1539 C  CG  . LYS A 198 ? 2.8245 2.1827 1.1718 0.2728  -0.2852 0.3074  217 LYS A CG  
1540 C  CD  . LYS A 198 ? 2.7738 2.1839 1.1824 0.3138  -0.2772 0.2891  217 LYS A CD  
1541 C  CE  . LYS A 198 ? 2.6999 2.1108 1.1458 0.2925  -0.2602 0.2599  217 LYS A CE  
1542 N  NZ  . LYS A 198 ? 2.6362 2.1019 1.1398 0.3296  -0.2530 0.2448  217 LYS A NZ  
1543 N  N   . ILE A 199 ? 2.6112 2.1370 0.9916 0.1029  -0.2664 0.2792  218 ILE A N   
1544 C  CA  . ILE A 199 ? 2.5519 2.1628 0.9553 0.0691  -0.2590 0.2651  218 ILE A CA  
1545 C  C   . ILE A 199 ? 2.6144 2.2100 0.9574 0.0404  -0.2668 0.2937  218 ILE A C   
1546 O  O   . ILE A 199 ? 2.6162 2.2768 0.9606 0.0312  -0.2693 0.2933  218 ILE A O   
1547 C  CB  . ILE A 199 ? 2.4578 2.0957 0.8978 0.0403  -0.2404 0.2382  218 ILE A CB  
1548 C  CG1 . ILE A 199 ? 2.4049 2.0666 0.9054 0.0655  -0.2335 0.2095  218 ILE A CG1 
1549 C  CG2 . ILE A 199 ? 2.4003 2.1183 0.8520 0.0109  -0.2319 0.2257  218 ILE A CG2 
1550 C  CD1 . ILE A 199 ? 2.3196 2.0015 0.8551 0.0427  -0.2168 0.1845  218 ILE A CD1 
1551 N  N   . LEU A 200 ? 2.6875 2.1945 0.9735 0.0239  -0.2715 0.3185  219 LEU A N   
1552 C  CA  . LEU A 200 ? 2.7822 2.2598 1.0016 -0.0068 -0.2811 0.3515  219 LEU A CA  
1553 C  C   . LEU A 200 ? 2.8237 2.2899 1.0104 0.0241  -0.3003 0.3755  219 LEU A C   
1554 O  O   . LEU A 200 ? 2.8510 2.3398 1.0030 0.0018  -0.3069 0.3948  219 LEU A O   
1555 C  CB  . LEU A 200 ? 2.8573 2.2283 1.0175 -0.0329 -0.2853 0.3736  219 LEU A CB  
1556 C  CG  . LEU A 200 ? 2.9477 2.2741 1.0314 -0.0752 -0.2963 0.4112  219 LEU A CG  
1557 C  CD1 . LEU A 200 ? 2.8957 2.3220 0.9975 -0.1216 -0.2833 0.4073  219 LEU A CD1 
1558 C  CD2 . LEU A 200 ? 3.0128 2.2227 1.0381 -0.1001 -0.3030 0.4295  219 LEU A CD2 
1559 N  N   . ARG A 201 ? 2.8544 2.2899 1.0518 0.0760  -0.3087 0.3755  220 ARG A N   
1560 C  CA  . ARG A 201 ? 2.9188 2.3520 1.0935 0.1147  -0.3274 0.3984  220 ARG A CA  
1561 C  C   . ARG A 201 ? 2.8380 2.3900 1.0592 0.1145  -0.3279 0.3843  220 ARG A C   
1562 O  O   . ARG A 201 ? 2.8681 2.4405 1.0573 0.1107  -0.3409 0.4057  220 ARG A O   
1563 C  CB  . ARG A 201 ? 2.9621 2.3503 1.1469 0.1743  -0.3327 0.3989  220 ARG A CB  
1564 C  CG  . ARG A 201 ? 3.0573 2.4291 1.2106 0.2216  -0.3529 0.4283  220 ARG A CG  
1565 C  CD  . ARG A 201 ? 3.0717 2.4393 1.2563 0.2848  -0.3531 0.4224  220 ARG A CD  
1566 N  NE  . ARG A 201 ? 3.1374 2.4038 1.2971 0.2974  -0.3450 0.4166  220 ARG A NE  
1567 C  CZ  . ARG A 201 ? 3.1934 2.4454 1.3755 0.3494  -0.3402 0.4078  220 ARG A CZ  
1568 N  NH1 . ARG A 201 ? 3.1692 2.5089 1.4049 0.3947  -0.3429 0.4057  220 ARG A NH1 
1569 N  NH2 . ARG A 201 ? 3.2465 2.3981 1.3954 0.3547  -0.3330 0.4016  220 ARG A NH2 
1570 N  N   . ILE A 202 ? 2.7042 2.3276 0.9953 0.1175  -0.3151 0.3489  221 ILE A N   
1571 C  CA  . ILE A 202 ? 2.6377 2.3664 0.9708 0.1135  -0.3158 0.3299  221 ILE A CA  
1572 C  C   . ILE A 202 ? 2.6557 2.4265 0.9670 0.0676  -0.3096 0.3266  221 ILE A C   
1573 O  O   . ILE A 202 ? 2.6414 2.4760 0.9525 0.0639  -0.3173 0.3252  221 ILE A O   
1574 C  CB  . ILE A 202 ? 2.5484 2.3275 0.9535 0.1235  -0.3042 0.2928  221 ILE A CB  
1575 C  CG1 . ILE A 202 ? 2.5603 2.3226 0.9897 0.1721  -0.3114 0.2985  221 ILE A CG1 
1576 C  CG2 . ILE A 202 ? 2.4553 2.3294 0.8936 0.1114  -0.3058 0.2706  221 ILE A CG2 
1577 C  CD1 . ILE A 202 ? 2.4793 2.2789 0.9737 0.1791  -0.2997 0.2666  221 ILE A CD1 
1578 N  N   . GLU A 203 ? 2.6676 2.4060 0.9585 0.0333  -0.2961 0.3268  222 GLU A N   
1579 C  CA  . GLU A 203 ? 2.6619 2.4451 0.9321 -0.0092 -0.2865 0.3254  222 GLU A CA  
1580 C  C   . GLU A 203 ? 2.7808 2.5561 0.9887 -0.0210 -0.3015 0.3606  222 GLU A C   
1581 O  O   . GLU A 203 ? 2.7306 2.5741 0.9326 -0.0355 -0.3007 0.3550  222 GLU A O   
1582 C  CB  . GLU A 203 ? 2.6595 2.4132 0.9235 -0.0427 -0.2701 0.3237  222 GLU A CB  
1583 C  CG  . GLU A 203 ? 2.6334 2.4507 0.8883 -0.0836 -0.2549 0.3184  222 GLU A CG  
1584 C  CD  . GLU A 203 ? 2.6298 2.4321 0.8879 -0.1155 -0.2393 0.3178  222 GLU A CD  
1585 O  OE1 . GLU A 203 ? 2.6229 2.3447 0.8651 -0.1173 -0.2449 0.3327  222 GLU A OE1 
1586 O  OE2 . GLU A 203 ? 2.6008 2.4737 0.8746 -0.1385 -0.2216 0.3028  222 GLU A OE2 
1587 N  N   . LYS A 204 ? 2.8866 2.5741 1.0431 -0.0141 -0.3158 0.3962  223 LYS A N   
1588 C  CA  . LYS A 204 ? 2.9665 2.6325 1.0562 -0.0252 -0.3326 0.4346  223 LYS A CA  
1589 C  C   . LYS A 204 ? 2.9781 2.6868 1.0705 0.0074  -0.3507 0.4419  223 LYS A C   
1590 O  O   . LYS A 204 ? 2.9853 2.7098 1.0328 -0.0074 -0.3616 0.4655  223 LYS A O   
1591 C  CB  . LYS A 204 ? 3.0674 2.6137 1.0898 -0.0321 -0.3439 0.4719  223 LYS A CB  
1592 C  CG  . LYS A 204 ? 3.1115 2.5663 1.1229 0.0170  -0.3573 0.4826  223 LYS A CG  
1593 C  CD  . LYS A 204 ? 3.1703 2.6170 1.1577 0.0604  -0.3798 0.5073  223 LYS A CD  
1594 C  CE  . LYS A 204 ? 3.2212 2.5592 1.1766 0.1086  -0.3925 0.5253  223 LYS A CE  
1595 N  NZ  . LYS A 204 ? 3.1264 2.4703 1.1426 0.1417  -0.3799 0.4940  223 LYS A NZ  
1596 N  N   . GLU A 205 ? 2.9453 2.6771 1.0893 0.0491  -0.3546 0.4239  224 GLU A N   
1597 C  CA  . GLU A 205 ? 2.9658 2.7533 1.1221 0.0786  -0.3727 0.4297  224 GLU A CA  
1598 C  C   . GLU A 205 ? 2.8934 2.7816 1.0742 0.0536  -0.3670 0.4028  224 GLU A C   
1599 O  O   . GLU A 205 ? 2.9251 2.8538 1.0795 0.0495  -0.3814 0.4170  224 GLU A O   
1600 C  CB  . GLU A 205 ? 2.9606 2.7510 1.1669 0.1279  -0.3779 0.4206  224 GLU A CB  
1601 C  CG  . GLU A 205 ? 3.0887 2.7795 1.2642 0.1651  -0.3856 0.4472  224 GLU A CG  
1602 C  CD  . GLU A 205 ? 3.1261 2.8289 1.3542 0.2151  -0.3859 0.4358  224 GLU A CD  
1603 O  OE1 . GLU A 205 ? 3.1148 2.9098 1.4020 0.2223  -0.3860 0.4148  224 GLU A OE1 
1604 O  OE2 . GLU A 205 ? 3.2090 2.8270 1.4151 0.2468  -0.3864 0.4486  224 GLU A OE2 
1605 N  N   . VAL A 206 ? 2.7905 2.7131 1.0166 0.0385  -0.3469 0.3640  225 VAL A N   
1606 C  CA  . VAL A 206 ? 2.7223 2.7272 0.9668 0.0175  -0.3394 0.3324  225 VAL A CA  
1607 C  C   . VAL A 206 ? 2.7100 2.7337 0.9065 -0.0216 -0.3295 0.3378  225 VAL A C   
1608 O  O   . VAL A 206 ? 2.6427 2.7293 0.8321 -0.0347 -0.3287 0.3208  225 VAL A O   
1609 C  CB  . VAL A 206 ? 2.6440 2.6701 0.9480 0.0180  -0.3214 0.2895  225 VAL A CB  
1610 C  CG1 . VAL A 206 ? 2.6062 2.7033 0.9208 0.0010  -0.3157 0.2552  225 VAL A CG1 
1611 C  CG2 . VAL A 206 ? 2.6169 2.6335 0.9681 0.0537  -0.3302 0.2854  225 VAL A CG2 
1612 N  N   . ASN A 207 ? 2.7320 2.7020 0.8926 -0.0410 -0.3225 0.3619  226 ASN A N   
1613 C  CA  . ASN A 207 ? 2.7348 2.7244 0.8498 -0.0814 -0.3114 0.3733  226 ASN A CA  
1614 C  C   . ASN A 207 ? 2.6639 2.7105 0.8097 -0.1004 -0.2846 0.3351  226 ASN A C   
1615 O  O   . ASN A 207 ? 2.5216 2.5500 0.7047 -0.0990 -0.2704 0.3179  226 ASN A O   
1616 C  CB  . ASN A 207 ? 2.7810 2.8074 0.8475 -0.0902 -0.3261 0.3933  226 ASN A CB  
1617 C  CG  . ASN A 207 ? 2.8192 2.7919 0.8512 -0.0684 -0.3539 0.4343  226 ASN A CG  
1618 O  OD1 . ASN A 207 ? 2.8255 2.7173 0.8432 -0.0579 -0.3602 0.4584  226 ASN A OD1 
1619 N  ND2 . ASN A 207 ? 2.8486 2.8639 0.8615 -0.0609 -0.3714 0.4430  226 ASN A ND2 
1620 N  N   . GLN B 2   ? 1.4230 1.5370 1.1708 -0.0569 0.1498  -0.0275 21  GLN B N   
1621 C  CA  . GLN B 2   ? 1.3983 1.5583 1.1913 -0.0719 0.1553  -0.0302 21  GLN B CA  
1622 C  C   . GLN B 2   ? 1.1800 1.3671 1.0135 -0.0556 0.1350  -0.0348 21  GLN B C   
1623 O  O   . GLN B 2   ? 1.1543 1.3556 1.0119 -0.0634 0.1250  -0.0323 21  GLN B O   
1624 C  CB  . GLN B 2   ? 1.3770 1.5759 1.1821 -0.0812 0.1816  -0.0373 21  GLN B CB  
1625 C  CG  . GLN B 2   ? 1.2742 1.5274 1.1255 -0.1001 0.1890  -0.0427 21  GLN B CG  
1626 C  CD  . GLN B 2   ? 1.3597 1.6583 1.2264 -0.1115 0.2167  -0.0515 21  GLN B CD  
1627 O  OE1 . GLN B 2   ? 1.2779 1.5626 1.1157 -0.1071 0.2337  -0.0520 21  GLN B OE1 
1628 N  NE2 . GLN B 2   ? 1.3115 1.6687 1.2245 -0.1265 0.2215  -0.0597 21  GLN B NE2 
1629 N  N   . SER B 3   ? 1.0804 1.2712 0.9176 -0.0327 0.1303  -0.0415 22  SER B N   
1630 C  CA  . SER B 3   ? 0.9172 1.1228 0.7846 -0.0140 0.1134  -0.0447 22  SER B CA  
1631 C  C   . SER B 3   ? 0.9360 1.1038 0.7921 -0.0112 0.0924  -0.0381 22  SER B C   
1632 O  O   . SER B 3   ? 0.8535 0.9837 0.6759 -0.0141 0.0892  -0.0351 22  SER B O   
1633 C  CB  . SER B 3   ? 0.9830 1.1908 0.8489 0.0092  0.1168  -0.0545 22  SER B CB  
1634 O  OG  . SER B 3   ? 1.1341 1.3437 1.0212 0.0287  0.1022  -0.0564 22  SER B OG  
1635 N  N   . VAL B 4   ? 0.8328 1.0132 0.7162 -0.0044 0.0786  -0.0360 23  VAL B N   
1636 C  CA  . VAL B 4   ? 0.8799 1.0296 0.7569 -0.0023 0.0605  -0.0302 23  VAL B CA  
1637 C  C   . VAL B 4   ? 0.7695 0.8867 0.6286 0.0118  0.0541  -0.0355 23  VAL B C   
1638 O  O   . VAL B 4   ? 0.7707 0.8591 0.6124 0.0084  0.0438  -0.0334 23  VAL B O   
1639 C  CB  . VAL B 4   ? 0.8239 0.9935 0.7307 0.0021  0.0492  -0.0258 23  VAL B CB  
1640 C  CG1 . VAL B 4   ? 0.9951 1.1943 0.9166 -0.0152 0.0526  -0.0227 23  VAL B CG1 
1641 C  CG2 . VAL B 4   ? 0.8252 1.0159 0.7529 0.0235  0.0502  -0.0307 23  VAL B CG2 
1642 N  N   . ASP B 5   ? 0.7676 0.8912 0.6317 0.0277  0.0601  -0.0440 24  ASP B N   
1643 C  CA  . ASP B 5   ? 0.7642 0.8560 0.6101 0.0395  0.0558  -0.0526 24  ASP B CA  
1644 C  C   . ASP B 5   ? 0.8010 0.8710 0.6109 0.0319  0.0579  -0.0559 24  ASP B C   
1645 O  O   . ASP B 5   ? 0.7952 0.8386 0.5894 0.0315  0.0464  -0.0589 24  ASP B O   
1646 C  CB  . ASP B 5   ? 0.7705 0.8729 0.6245 0.0587  0.0652  -0.0622 24  ASP B CB  
1647 N  N   . GLU B 6   ? 0.7785 0.8619 0.5754 0.0256  0.0728  -0.0550 25  GLU B N   
1648 C  CA  . GLU B 6   ? 0.8019 0.8635 0.5584 0.0208  0.0768  -0.0554 25  GLU B CA  
1649 C  C   . GLU B 6   ? 0.8247 0.8658 0.5663 0.0106  0.0647  -0.0462 25  GLU B C   
1650 O  O   . GLU B 6   ? 0.8034 0.8211 0.5161 0.0145  0.0561  -0.0490 25  GLU B O   
1651 C  CB  . GLU B 6   ? 0.8660 0.9445 0.6118 0.0134  0.0988  -0.0532 25  GLU B CB  
1652 C  CG  . GLU B 6   ? 0.9295 1.0329 0.6867 0.0249  0.1137  -0.0636 25  GLU B CG  
1653 C  CD  . GLU B 6   ? 0.9971 1.0791 0.7259 0.0406  0.1136  -0.0758 25  GLU B CD  
1654 O  OE1 . GLU B 6   ? 1.0172 1.0680 0.7140 0.0415  0.1028  -0.0773 25  GLU B OE1 
1655 O  OE2 . GLU B 6   ? 1.0476 1.1470 0.7854 0.0532  0.1246  -0.0857 25  GLU B OE2 
1656 N  N   . MSE B 7   ? 0.7986 0.8514 0.5606 -0.0006 0.0631  -0.0365 26  MSE B N   
1657 C  CA  . MSE B 7   ? 0.7875 0.8222 0.5374 -0.0087 0.0528  -0.0279 26  MSE B CA  
1658 C  C   . MSE B 7   ? 0.7329 0.7553 0.4887 -0.0020 0.0333  -0.0309 26  MSE B C   
1659 O  O   . MSE B 7   ? 0.7224 0.7273 0.4573 -0.0019 0.0239  -0.0289 26  MSE B O   
1660 C  CB  . MSE B 7   ? 0.8588 0.9101 0.6309 -0.0225 0.0561  -0.0196 26  MSE B CB  
1661 C  CG  . MSE B 7   ? 0.9498 1.0106 0.7143 -0.0363 0.0761  -0.0166 26  MSE B CG  
1662 SE SE  . MSE B 7   ? 1.1871 1.2015 0.8943 -0.0435 0.0830  -0.0073 26  MSE B SE  
1663 C  CE  . MSE B 7   ? 0.9147 0.9125 0.6265 -0.0466 0.0634  0.0002  26  MSE B CE  
1664 N  N   . LEU B 8   ? 0.6920 0.7241 0.4759 0.0038  0.0282  -0.0356 27  LEU B N   
1665 C  CA  . LEU B 8   ? 0.6997 0.7194 0.4914 0.0069  0.0132  -0.0394 27  LEU B CA  
1666 C  C   . LEU B 8   ? 0.6947 0.6972 0.4624 0.0130  0.0078  -0.0520 27  LEU B C   
1667 O  O   . LEU B 8   ? 0.6999 0.6940 0.4651 0.0112  -0.0050 -0.0558 27  LEU B O   
1668 C  CB  . LEU B 8   ? 0.6555 0.6825 0.4773 0.0118  0.0120  -0.0393 27  LEU B CB  
1669 C  CG  . LEU B 8   ? 0.6773 0.7234 0.5220 0.0065  0.0116  -0.0277 27  LEU B CG  
1670 C  CD1 . LEU B 8   ? 0.6780 0.7301 0.5456 0.0170  0.0115  -0.0273 27  LEU B CD1 
1671 C  CD2 . LEU B 8   ? 0.6327 0.6724 0.4766 -0.0028 0.0011  -0.0206 27  LEU B CD2 
1672 N  N   . GLN B 9   ? 0.7140 0.7148 0.4644 0.0199  0.0175  -0.0597 28  GLN B N   
1673 C  CA  . GLN B 9   ? 0.7702 0.7566 0.4924 0.0261  0.0119  -0.0732 28  GLN B CA  
1674 C  C   . GLN B 9   ? 0.8069 0.7869 0.4995 0.0249  0.0042  -0.0691 28  GLN B C   
1675 O  O   . GLN B 9   ? 0.7967 0.7713 0.4760 0.0285  -0.0086 -0.0797 28  GLN B O   
1676 C  CB  . GLN B 9   ? 0.7740 0.7601 0.4786 0.0348  0.0252  -0.0818 28  GLN B CB  
1677 C  CG  . GLN B 9   ? 0.7786 0.7674 0.5061 0.0420  0.0317  -0.0894 28  GLN B CG  
1678 C  CD  . GLN B 9   ? 0.8760 0.8644 0.5831 0.0529  0.0449  -0.1006 28  GLN B CD  
1679 O  OE1 . GLN B 9   ? 0.8805 0.8607 0.5532 0.0554  0.0450  -0.1072 28  GLN B OE1 
1680 N  NE2 . GLN B 9   ? 0.8864 0.8845 0.6131 0.0619  0.0556  -0.1035 28  GLN B NE2 
1681 N  N   . LYS B 10  ? 0.7958 0.7764 0.4787 0.0201  0.0117  -0.0546 29  LYS B N   
1682 C  CA  . LYS B 10  ? 0.8140 0.7821 0.4643 0.0223  0.0058  -0.0480 29  LYS B CA  
1683 C  C   . LYS B 10  ? 0.7784 0.7498 0.4451 0.0205  -0.0115 -0.0470 29  LYS B C   
1684 O  O   . LYS B 10  ? 0.7716 0.7389 0.4167 0.0281  -0.0236 -0.0501 29  LYS B O   
1685 C  CB  . LYS B 10  ? 0.9075 0.8673 0.5410 0.0157  0.0213  -0.0329 29  LYS B CB  
1686 C  CG  . LYS B 10  ? 0.9463 0.9072 0.5661 0.0141  0.0423  -0.0327 29  LYS B CG  
1687 C  CD  . LYS B 10  ? 1.0370 0.9888 0.6438 0.0018  0.0588  -0.0185 29  LYS B CD  
1688 C  CE  . LYS B 10  ? 1.1230 1.0849 0.7267 -0.0045 0.0825  -0.0190 29  LYS B CE  
1689 N  NZ  . LYS B 10  ? 1.2346 1.1826 0.8205 -0.0201 0.1005  -0.0064 29  LYS B NZ  
1690 N  N   . VAL B 11  ? 0.7523 0.7339 0.4563 0.0118  -0.0123 -0.0428 30  VAL B N   
1691 C  CA  . VAL B 11  ? 0.7002 0.6876 0.4237 0.0085  -0.0260 -0.0420 30  VAL B CA  
1692 C  C   . VAL B 11  ? 0.7135 0.7046 0.4403 0.0119  -0.0387 -0.0584 30  VAL B C   
1693 O  O   . VAL B 11  ? 0.6989 0.6954 0.4183 0.0151  -0.0514 -0.0626 30  VAL B O   
1694 C  CB  . VAL B 11  ? 0.6904 0.6873 0.4502 -0.0001 -0.0230 -0.0348 30  VAL B CB  
1695 C  CG1 . VAL B 11  ? 0.6345 0.6369 0.4118 -0.0037 -0.0351 -0.0341 30  VAL B CG1 
1696 C  CG2 . VAL B 11  ? 0.6696 0.6683 0.4285 -0.0059 -0.0118 -0.0223 30  VAL B CG2 
1697 N  N   . SER B 12  ? 0.6819 0.6707 0.4187 0.0115  -0.0348 -0.0691 31  SER B N   
1698 C  CA  . SER B 12  ? 0.7325 0.7212 0.4722 0.0110  -0.0448 -0.0878 31  SER B CA  
1699 C  C   . SER B 12  ? 0.7585 0.7501 0.4649 0.0199  -0.0539 -0.0989 31  SER B C   
1700 O  O   . SER B 12  ? 0.7268 0.7304 0.4365 0.0186  -0.0684 -0.1105 31  SER B O   
1701 C  CB  . SER B 12  ? 0.7460 0.7233 0.4959 0.0108  -0.0363 -0.0969 31  SER B CB  
1702 O  OG  . SER B 12  ? 0.7782 0.7538 0.5566 0.0062  -0.0299 -0.0859 31  SER B OG  
1703 N  N   . ALA B 13  ? 0.7643 0.7476 0.4382 0.0292  -0.0451 -0.0956 32  ALA B N   
1704 C  CA  . ALA B 13  ? 0.7633 0.7467 0.3966 0.0415  -0.0529 -0.1035 32  ALA B CA  
1705 C  C   . ALA B 13  ? 0.7882 0.7794 0.4094 0.0478  -0.0659 -0.0965 32  ALA B C   
1706 O  O   . ALA B 13  ? 0.8124 0.8170 0.4215 0.0556  -0.0818 -0.1098 32  ALA B O   
1707 C  CB  . ALA B 13  ? 0.8147 0.7841 0.4123 0.0497  -0.0372 -0.0967 32  ALA B CB  
1708 N  N   . ALA B 14  ? 0.8192 0.8041 0.4455 0.0449  -0.0596 -0.0774 33  ALA B N   
1709 C  CA  . ALA B 14  ? 0.8527 0.8405 0.4672 0.0529  -0.0698 -0.0693 33  ALA B CA  
1710 C  C   . ALA B 14  ? 0.8359 0.8501 0.4828 0.0490  -0.0869 -0.0812 33  ALA B C   
1711 O  O   . ALA B 14  ? 0.8621 0.8911 0.4953 0.0613  -0.1019 -0.0871 33  ALA B O   
1712 C  CB  . ALA B 14  ? 0.7609 0.7330 0.3762 0.0476  -0.0576 -0.0488 33  ALA B CB  
1713 N  N   . ILE B 15  ? 0.8085 0.8293 0.4967 0.0329  -0.0839 -0.0848 34  ILE B N   
1714 C  CA  . ILE B 15  ? 0.7969 0.8411 0.5183 0.0243  -0.0958 -0.0965 34  ILE B CA  
1715 C  C   . ILE B 15  ? 0.7702 0.8325 0.4872 0.0264  -0.1093 -0.1206 34  ILE B C   
1716 O  O   . ILE B 15  ? 0.7705 0.8601 0.4948 0.0293  -0.1239 -0.1302 34  ILE B O   
1717 C  CB  . ILE B 15  ? 0.7759 0.8155 0.5354 0.0071  -0.0870 -0.0938 34  ILE B CB  
1718 C  CG1 . ILE B 15  ? 0.7740 0.8069 0.5416 0.0052  -0.0789 -0.0730 34  ILE B CG1 
1719 C  CG2 . ILE B 15  ? 0.7130 0.7731 0.5030 -0.0047 -0.0964 -0.1082 34  ILE B CG2 
1720 C  CD1 . ILE B 15  ? 0.7641 0.7900 0.5609 -0.0068 -0.0693 -0.0671 34  ILE B CD1 
1721 N  N   . GLU B 16  ? 0.8200 0.8704 0.5248 0.0256  -0.1049 -0.1320 35  GLU B N   
1722 C  CA  . GLU B 16  ? 0.8968 0.9641 0.5955 0.0262  -0.1181 -0.1580 35  GLU B CA  
1723 C  C   . GLU B 16  ? 0.9353 1.0199 0.5972 0.0468  -0.1328 -0.1630 35  GLU B C   
1724 O  O   . GLU B 16  ? 0.9609 1.0733 0.6247 0.0476  -0.1491 -0.1858 35  GLU B O   
1725 C  CB  . GLU B 16  ? 0.9310 0.9779 0.6228 0.0216  -0.1091 -0.1703 35  GLU B CB  
1726 C  CG  . GLU B 16  ? 0.9438 0.9741 0.6712 0.0039  -0.0974 -0.1691 35  GLU B CG  
1727 C  CD  . GLU B 16  ? 1.0075 1.0144 0.7274 0.0021  -0.0880 -0.1821 35  GLU B CD  
1728 O  OE1 . GLU B 16  ? 0.9434 0.9494 0.6322 0.0123  -0.0909 -0.1950 35  GLU B OE1 
1729 O  OE2 . GLU B 16  ? 1.0184 1.0059 0.7613 -0.0077 -0.0774 -0.1795 35  GLU B OE2 
1730 N  N   . ALA B 17  ? 0.9238 0.9910 0.5504 0.0633  -0.1268 -0.1427 36  ALA B N   
1731 C  CA  . ALA B 17  ? 0.9143 0.9894 0.4971 0.0877  -0.1392 -0.1424 36  ALA B CA  
1732 C  C   . ALA B 17  ? 0.9575 1.0526 0.5489 0.0970  -0.1508 -0.1347 36  ALA B C   
1733 O  O   . ALA B 17  ? 1.0138 1.1159 0.5695 0.1208  -0.1623 -0.1332 36  ALA B O   
1734 C  CB  . ALA B 17  ? 0.8691 0.9081 0.4038 0.1004  -0.1238 -0.1235 36  ALA B CB  
1735 N  N   . GLY B 18  ? 0.8619 0.9653 0.4971 0.0810  -0.1476 -0.1299 37  GLY B N   
1736 C  CA  . GLY B 18  ? 0.9025 1.0249 0.5477 0.0897  -0.1564 -0.1231 37  GLY B CA  
1737 C  C   . GLY B 18  ? 0.9888 1.0775 0.5989 0.1053  -0.1470 -0.0974 37  GLY B C   
1738 O  O   . GLY B 18  ? 1.0061 1.1045 0.6021 0.1244  -0.1569 -0.0928 37  GLY B O   
1739 N  N   . GLN B 19  ? 0.9096 0.9598 0.5064 0.0969  -0.1276 -0.0820 38  GLN B N   
1740 C  CA  . GLN B 19  ? 0.9148 0.9274 0.4784 0.1051  -0.1146 -0.0589 38  GLN B CA  
1741 C  C   . GLN B 19  ? 0.9032 0.9094 0.5036 0.0849  -0.1028 -0.0486 38  GLN B C   
1742 O  O   . GLN B 19  ? 0.9669 0.9517 0.5698 0.0715  -0.0861 -0.0395 38  GLN B O   
1743 C  CB  . GLN B 19  ? 0.9706 0.9507 0.4913 0.1090  -0.1007 -0.0518 38  GLN B CB  
1744 C  CG  . GLN B 19  ? 1.0091 0.9931 0.4855 0.1315  -0.1122 -0.0610 38  GLN B CG  
1745 C  CD  . GLN B 19  ? 1.1312 1.1059 0.5640 0.1603  -0.1222 -0.0517 38  GLN B CD  
1746 O  OE1 . GLN B 19  ? 1.1771 1.1317 0.6047 0.1637  -0.1168 -0.0360 38  GLN B OE1 
1747 N  NE2 . GLN B 19  ? 1.2886 1.2762 0.6863 0.1831  -0.1370 -0.0619 38  GLN B NE2 
1748 N  N   . ASN B 20  ? 0.8504 0.8800 0.4797 0.0840  -0.1124 -0.0515 39  ASN B N   
1749 C  CA  . ASN B 20  ? 0.8602 0.8903 0.5255 0.0667  -0.1045 -0.0439 39  ASN B CA  
1750 C  C   . ASN B 20  ? 0.8432 0.8393 0.4899 0.0653  -0.0904 -0.0250 39  ASN B C   
1751 O  O   . ASN B 20  ? 0.8305 0.8217 0.5009 0.0479  -0.0797 -0.0192 39  ASN B O   
1752 C  CB  . ASN B 20  ? 0.8695 0.9343 0.5656 0.0678  -0.1171 -0.0519 39  ASN B CB  
1753 C  CG  . ASN B 20  ? 0.8980 0.9992 0.6240 0.0595  -0.1279 -0.0729 39  ASN B CG  
1754 O  OD1 . ASN B 20  ? 0.8716 0.9682 0.6033 0.0484  -0.1241 -0.0810 39  ASN B OD1 
1755 N  ND2 . ASN B 20  ? 1.0659 1.2040 0.8118 0.0641  -0.1405 -0.0832 39  ASN B ND2 
1756 N  N   . GLY B 21  ? 0.9296 0.9014 0.5323 0.0837  -0.0903 -0.0162 40  GLY B N   
1757 C  CA  . GLY B 21  ? 0.9068 0.8391 0.4845 0.0816  -0.0757 0.0002  40  GLY B CA  
1758 C  C   . GLY B 21  ? 0.9089 0.8205 0.4811 0.0647  -0.0576 0.0059  40  GLY B C   
1759 O  O   . GLY B 21  ? 0.9288 0.8328 0.5182 0.0474  -0.0460 0.0122  40  GLY B O   
1760 N  N   . GLN B 22  ? 0.9050 0.8128 0.4556 0.0696  -0.0554 0.0019  41  GLN B N   
1761 C  CA  . GLN B 22  ? 0.9971 0.8911 0.5441 0.0545  -0.0368 0.0059  41  GLN B CA  
1762 C  C   . GLN B 22  ? 0.9243 0.8470 0.5228 0.0365  -0.0353 -0.0020 41  GLN B C   
1763 O  O   . GLN B 22  ? 0.9280 0.8466 0.5372 0.0219  -0.0203 0.0025  41  GLN B O   
1764 C  CB  . GLN B 22  ? 1.0766 0.9541 0.5792 0.0661  -0.0318 0.0055  41  GLN B CB  
1765 C  CG  . GLN B 22  ? 1.1664 1.0707 0.6760 0.0743  -0.0449 -0.0108 41  GLN B CG  
1766 C  CD  . GLN B 22  ? 1.3083 1.1939 0.7657 0.0886  -0.0401 -0.0103 41  GLN B CD  
1767 O  OE1 . GLN B 22  ? 1.5230 1.3788 0.9304 0.1045  -0.0376 0.0009  41  GLN B OE1 
1768 N  NE2 . GLN B 22  ? 1.2325 1.1326 0.6977 0.0849  -0.0384 -0.0225 41  GLN B NE2 
1769 N  N   . ALA B 23  ? 0.9087 0.8599 0.5378 0.0378  -0.0500 -0.0140 42  ALA B N   
1770 C  CA  . ALA B 23  ? 0.8470 0.8180 0.5203 0.0234  -0.0484 -0.0200 42  ALA B CA  
1771 C  C   . ALA B 23  ? 0.7911 0.7631 0.4888 0.0112  -0.0424 -0.0102 42  ALA B C   
1772 O  O   . ALA B 23  ? 0.7810 0.7579 0.4990 0.0004  -0.0330 -0.0083 42  ALA B O   
1773 C  CB  . ALA B 23  ? 0.7866 0.7815 0.4835 0.0249  -0.0636 -0.0344 42  ALA B CB  
1774 N  N   . VAL B 24  ? 0.7822 0.7506 0.4753 0.0150  -0.0480 -0.0047 43  VAL B N   
1775 C  CA  . VAL B 24  ? 0.7763 0.7446 0.4874 0.0045  -0.0433 0.0032  43  VAL B CA  
1776 C  C   . VAL B 24  ? 0.8476 0.7961 0.5433 -0.0052 -0.0272 0.0116  43  VAL B C   
1777 O  O   . VAL B 24  ? 0.6945 0.6539 0.4147 -0.0181 -0.0212 0.0135  43  VAL B O   
1778 C  CB  . VAL B 24  ? 0.8155 0.7837 0.5223 0.0127  -0.0524 0.0053  43  VAL B CB  
1779 C  CG1 . VAL B 24  ? 0.8562 0.8221 0.5767 0.0022  -0.0472 0.0121  43  VAL B CG1 
1780 C  CG2 . VAL B 24  ? 0.7286 0.7253 0.4593 0.0174  -0.0663 -0.0048 43  VAL B CG2 
1781 N  N   . SER B 25  ? 0.8292 0.7504 0.4844 0.0004  -0.0197 0.0159  44  SER B N   
1782 C  CA  . SER B 25  ? 0.8839 0.7840 0.5218 -0.0121 -0.0013 0.0228  44  SER B CA  
1783 C  C   . SER B 25  ? 0.8187 0.7403 0.4810 -0.0239 0.0083  0.0186  44  SER B C   
1784 O  O   . SER B 25  ? 0.9003 0.8302 0.5798 -0.0394 0.0183  0.0202  44  SER B O   
1785 C  CB  . SER B 25  ? 0.9458 0.8082 0.5301 -0.0027 0.0069  0.0291  44  SER B CB  
1786 O  OG  . SER B 25  ? 1.1299 0.9694 0.6872 0.0119  -0.0011 0.0339  44  SER B OG  
1787 N  N   . TYR B 26  ? 0.7958 0.7277 0.4582 -0.0154 0.0053  0.0119  45  TYR B N   
1788 C  CA  . TYR B 26  ? 0.7632 0.7162 0.4486 -0.0218 0.0138  0.0065  45  TYR B CA  
1789 C  C   . TYR B 26  ? 0.6941 0.6751 0.4254 -0.0283 0.0087  0.0041  45  TYR B C   
1790 O  O   . TYR B 26  ? 0.7219 0.7212 0.4738 -0.0361 0.0180  0.0033  45  TYR B O   
1791 C  CB  . TYR B 26  ? 0.8184 0.7741 0.4941 -0.0096 0.0096  -0.0024 45  TYR B CB  
1792 C  CG  . TYR B 26  ? 0.8933 0.8257 0.5221 -0.0023 0.0180  -0.0005 45  TYR B CG  
1793 C  CD1 . TYR B 26  ? 1.0121 0.9339 0.6235 -0.0120 0.0390  0.0055  45  TYR B CD1 
1794 C  CD2 . TYR B 26  ? 0.9660 0.8905 0.5682 0.0139  0.0059  -0.0061 45  TYR B CD2 
1795 C  CE1 . TYR B 26  ? 1.0390 0.9358 0.6026 -0.0052 0.0493  0.0089  45  TYR B CE1 
1796 C  CE2 . TYR B 26  ? 1.0163 0.9188 0.5702 0.0234  0.0133  -0.0035 45  TYR B CE2 
1797 C  CZ  . TYR B 26  ? 1.0915 0.9773 0.6242 0.0141  0.0359  0.0051  45  TYR B CZ  
1798 O  OH  . TYR B 26  ? 1.2314 1.0915 0.7119 0.0234  0.0456  0.0095  45  TYR B OH  
1799 N  N   . PHE B 27  ? 0.6321 0.6182 0.3779 -0.0236 -0.0057 0.0030  46  PHE B N   
1800 C  CA  . PHE B 27  ? 0.6802 0.6869 0.4622 -0.0278 -0.0104 0.0030  46  PHE B CA  
1801 C  C   . PHE B 27  ? 0.7241 0.7376 0.5155 -0.0393 -0.0047 0.0092  46  PHE B C   
1802 O  O   . PHE B 27  ? 0.8023 0.8381 0.6200 -0.0430 -0.0026 0.0088  46  PHE B O   
1803 C  CB  . PHE B 27  ? 0.6477 0.6560 0.4389 -0.0224 -0.0243 0.0008  46  PHE B CB  
1804 C  CG  . PHE B 27  ? 0.6257 0.6492 0.4485 -0.0246 -0.0276 0.0011  46  PHE B CG  
1805 C  CD1 . PHE B 27  ? 0.6498 0.6762 0.4852 -0.0208 -0.0270 -0.0047 46  PHE B CD1 
1806 C  CD2 . PHE B 27  ? 0.5792 0.6099 0.4146 -0.0291 -0.0306 0.0074  46  PHE B CD2 
1807 C  CE1 . PHE B 27  ? 0.6744 0.7070 0.5330 -0.0208 -0.0288 -0.0024 46  PHE B CE1 
1808 C  CE2 . PHE B 27  ? 0.6084 0.6495 0.4671 -0.0291 -0.0331 0.0095  46  PHE B CE2 
1809 C  CZ  . PHE B 27  ? 0.6568 0.6971 0.5261 -0.0247 -0.0318 0.0055  46  PHE B CZ  
1810 N  N   . ARG B 28  ? 0.8286 0.8229 0.5974 -0.0437 -0.0023 0.0138  47  ARG B N   
1811 C  CA  . ARG B 28  ? 0.7884 0.7858 0.5627 -0.0578 0.0042  0.0167  47  ARG B CA  
1812 C  C   . ARG B 28  ? 0.7292 0.7410 0.5112 -0.0699 0.0188  0.0143  47  ARG B C   
1813 O  O   . ARG B 28  ? 0.7218 0.7588 0.5282 -0.0798 0.0208  0.0122  47  ARG B O   
1814 C  CB  . ARG B 28  ? 0.8649 0.8292 0.6067 -0.0607 0.0072  0.0212  47  ARG B CB  
1815 C  CG  . ARG B 28  ? 0.9619 0.9222 0.7053 -0.0543 -0.0048 0.0228  47  ARG B CG  
1816 C  CD  . ARG B 28  ? 0.9634 0.8911 0.6777 -0.0592 0.0008  0.0262  47  ARG B CD  
1817 N  NE  . ARG B 28  ? 1.0191 0.9098 0.6914 -0.0506 0.0066  0.0303  47  ARG B NE  
1818 C  CZ  . ARG B 28  ? 0.9943 0.8712 0.6454 -0.0306 -0.0029 0.0321  47  ARG B CZ  
1819 N  NH1 . ARG B 28  ? 1.1316 1.0308 0.8028 -0.0194 -0.0181 0.0289  47  ARG B NH1 
1820 N  NH2 . ARG B 28  ? 1.2353 1.0773 0.8434 -0.0212 0.0030  0.0369  47  ARG B NH2 
1821 N  N   . GLN B 29  ? 0.7639 0.7623 0.5243 -0.0686 0.0291  0.0138  48  GLN B N   
1822 C  CA  . GLN B 29  ? 0.8119 0.8258 0.5782 -0.0803 0.0459  0.0108  48  GLN B CA  
1823 C  C   . GLN B 29  ? 0.7063 0.7618 0.5107 -0.0752 0.0437  0.0047  48  GLN B C   
1824 O  O   . GLN B 29  ? 0.7989 0.8838 0.6241 -0.0860 0.0533  0.0008  48  GLN B O   
1825 C  CB  . GLN B 29  ? 0.8689 0.8561 0.5980 -0.0775 0.0580  0.0127  48  GLN B CB  
1826 C  CG  . GLN B 29  ? 0.9451 0.8861 0.6299 -0.0809 0.0636  0.0204  48  GLN B CG  
1827 C  CD  . GLN B 29  ? 1.0926 1.0041 0.7337 -0.0727 0.0737  0.0240  48  GLN B CD  
1828 O  OE1 . GLN B 29  ? 1.1538 1.0815 0.7987 -0.0699 0.0809  0.0197  48  GLN B OE1 
1829 N  NE2 . GLN B 29  ? 1.1087 0.9759 0.7053 -0.0666 0.0744  0.0321  48  GLN B NE2 
1830 N  N   . THR B 30  ? 0.7007 0.7581 0.5134 -0.0588 0.0318  0.0032  49  THR B N   
1831 C  CA  . THR B 30  ? 0.7591 0.8466 0.6025 -0.0497 0.0296  -0.0013 49  THR B CA  
1832 C  C   . THR B 30  ? 0.7112 0.8241 0.5838 -0.0517 0.0216  0.0005  49  THR B C   
1833 O  O   . THR B 30  ? 0.6641 0.8100 0.5621 -0.0476 0.0236  -0.0025 49  THR B O   
1834 C  CB  . THR B 30  ? 0.7785 0.8528 0.6183 -0.0335 0.0213  -0.0046 49  THR B CB  
1835 O  OG1 . THR B 30  ? 1.0769 1.1380 0.9176 -0.0306 0.0073  -0.0014 49  THR B OG1 
1836 C  CG2 . THR B 30  ? 0.7527 0.8052 0.5614 -0.0307 0.0270  -0.0076 49  THR B CG2 
1837 N  N   . ILE B 31  ? 0.6822 0.7816 0.5495 -0.0556 0.0123  0.0054  50  ILE B N   
1838 C  CA  . ILE B 31  ? 0.6492 0.7713 0.5384 -0.0579 0.0049  0.0072  50  ILE B CA  
1839 C  C   . ILE B 31  ? 0.6696 0.8222 0.5725 -0.0723 0.0137  0.0024  50  ILE B C   
1840 O  O   . ILE B 31  ? 0.6351 0.8245 0.5640 -0.0683 0.0103  0.0000  50  ILE B O   
1841 C  CB  . ILE B 31  ? 0.6373 0.7394 0.5149 -0.0608 -0.0040 0.0120  50  ILE B CB  
1842 C  CG1 . ILE B 31  ? 0.6411 0.7271 0.5162 -0.0481 -0.0134 0.0148  50  ILE B CG1 
1843 C  CG2 . ILE B 31  ? 0.6814 0.8073 0.5761 -0.0656 -0.0095 0.0126  50  ILE B CG2 
1844 C  CD1 . ILE B 31  ? 0.6098 0.6786 0.4727 -0.0496 -0.0206 0.0182  50  ILE B CD1 
1845 N  N   . ALA B 32  ? 0.7006 0.8380 0.5848 -0.0885 0.0255  0.0007  51  ALA B N   
1846 C  CA  . ALA B 32  ? 0.7096 0.8737 0.6059 -0.1083 0.0372  -0.0060 51  ALA B CA  
1847 C  C   . ALA B 32  ? 0.7557 0.9642 0.6787 -0.1045 0.0450  -0.0128 51  ALA B C   
1848 O  O   . ALA B 32  ? 0.8108 1.0634 0.7603 -0.1145 0.0476  -0.0204 51  ALA B O   
1849 C  CB  . ALA B 32  ? 0.7242 0.8515 0.5882 -0.1264 0.0520  -0.0050 51  ALA B CB  
1850 N  N   . LEU B 33  ? 0.7237 0.9228 0.6395 -0.0898 0.0486  -0.0117 52  LEU B N   
1851 C  CA  . LEU B 33  ? 0.6724 0.9105 0.6110 -0.0811 0.0562  -0.0184 52  LEU B CA  
1852 C  C   . LEU B 33  ? 0.6608 0.9302 0.6281 -0.0599 0.0423  -0.0187 52  LEU B C   
1853 O  O   . LEU B 33  ? 0.6616 0.9813 0.6580 -0.0578 0.0441  -0.0254 52  LEU B O   
1854 C  CB  . LEU B 33  ? 0.7406 0.9538 0.6574 -0.0711 0.0649  -0.0182 52  LEU B CB  
1855 C  CG  . LEU B 33  ? 0.8334 1.0166 0.7168 -0.0870 0.0814  -0.0169 52  LEU B CG  
1856 C  CD1 . LEU B 33  ? 0.8769 1.0338 0.7350 -0.0717 0.0844  -0.0166 52  LEU B CD1 
1857 C  CD2 . LEU B 33  ? 0.8559 1.0728 0.7528 -0.1077 0.1014  -0.0235 52  LEU B CD2 
1858 N  N   . ASN B 34  ? 0.6406 0.8808 0.5985 -0.0441 0.0292  -0.0118 53  ASN B N   
1859 C  CA  . ASN B 34  ? 0.5898 0.8467 0.5664 -0.0222 0.0179  -0.0094 53  ASN B CA  
1860 C  C   . ASN B 34  ? 0.6326 0.8518 0.5951 -0.0159 0.0055  -0.0006 53  ASN B C   
1861 O  O   . ASN B 34  ? 0.6637 0.8497 0.6119 -0.0078 0.0048  0.0008  53  ASN B O   
1862 C  CB  . ASN B 34  ? 0.6449 0.9097 0.6278 -0.0025 0.0240  -0.0138 53  ASN B CB  
1863 C  CG  . ASN B 34  ? 0.6044 0.8849 0.6036 0.0230  0.0150  -0.0110 53  ASN B CG  
1864 O  OD1 . ASN B 34  ? 0.5876 0.8589 0.5863 0.0283  0.0035  -0.0033 53  ASN B OD1 
1865 N  ND2 . ASN B 34  ? 0.6971 0.9989 0.7077 0.0408  0.0215  -0.0169 53  ASN B ND2 
1866 N  N   . ILE B 35  ? 0.6225 0.8507 0.5905 -0.0202 -0.0035 0.0036  54  ILE B N   
1867 C  CA  . ILE B 35  ? 0.6048 0.8029 0.5611 -0.0169 -0.0133 0.0118  54  ILE B CA  
1868 C  C   . ILE B 35  ? 0.5982 0.7823 0.5562 0.0036  -0.0179 0.0173  54  ILE B C   
1869 O  O   . ILE B 35  ? 0.5892 0.7389 0.5342 0.0036  -0.0206 0.0211  54  ILE B O   
1870 C  CB  . ILE B 35  ? 0.5459 0.7585 0.5053 -0.0261 -0.0207 0.0142  54  ILE B CB  
1871 C  CG1 . ILE B 35  ? 0.5200 0.6992 0.4635 -0.0271 -0.0273 0.0215  54  ILE B CG1 
1872 C  CG2 . ILE B 35  ? 0.5403 0.7934 0.5196 -0.0139 -0.0268 0.0144  54  ILE B CG2 
1873 C  CD1 . ILE B 35  ? 0.5433 0.7299 0.4836 -0.0381 -0.0323 0.0219  54  ILE B CD1 
1874 N  N   . ASP B 36  ? 0.6257 0.8356 0.5987 0.0208  -0.0181 0.0170  55  ASP B N   
1875 C  CA  A ASP B 36  ? 0.7001 0.8897 0.6703 0.0428  -0.0203 0.0231  55  ASP B CA  
1876 C  CA  B ASP B 36  ? 0.6698 0.8585 0.6395 0.0424  -0.0204 0.0232  55  ASP B CA  
1877 C  C   . ASP B 36  ? 0.6608 0.8144 0.6192 0.0458  -0.0135 0.0186  55  ASP B C   
1878 O  O   . ASP B 36  ? 0.6722 0.7889 0.6198 0.0514  -0.0147 0.0228  55  ASP B O   
1879 C  CB  A ASP B 36  ? 0.7920 1.0190 0.7785 0.0650  -0.0218 0.0231  55  ASP B CB  
1880 C  CB  B ASP B 36  ? 0.7100 0.9348 0.6953 0.0646  -0.0227 0.0241  55  ASP B CB  
1881 C  CG  A ASP B 36  ? 0.9670 1.1654 0.9443 0.0906  -0.0238 0.0321  55  ASP B CG  
1882 C  CG  B ASP B 36  ? 0.7614 1.0171 0.7540 0.0645  -0.0324 0.0289  55  ASP B CG  
1883 O  OD1 A ASP B 36  ? 1.1195 1.2780 1.0812 0.0873  -0.0260 0.0408  55  ASP B OD1 
1884 O  OD1 B ASP B 36  ? 0.8069 1.0409 0.7874 0.0555  -0.0375 0.0361  55  ASP B OD1 
1885 O  OD2 A ASP B 36  ? 1.1005 1.3160 1.0855 0.1142  -0.0221 0.0305  55  ASP B OD2 
1886 O  OD2 B ASP B 36  ? 0.8941 1.1993 0.9050 0.0739  -0.0352 0.0242  55  ASP B OD2 
1887 N  N   . ARG B 37  ? 0.6901 0.8550 0.6497 0.0411  -0.0055 0.0091  56  ARG B N   
1888 C  CA  A ARG B 37  ? 0.6910 0.8252 0.6368 0.0436  0.0006  0.0024  56  ARG B CA  
1889 C  CA  B ARG B 37  ? 0.7113 0.8459 0.6572 0.0436  0.0007  0.0023  56  ARG B CA  
1890 C  C   . ARG B 37  ? 0.6849 0.7864 0.6137 0.0280  -0.0032 0.0028  56  ARG B C   
1891 O  O   . ARG B 37  ? 0.7016 0.7709 0.6205 0.0307  -0.0042 0.0003  56  ARG B O   
1892 C  CB  A ARG B 37  ? 0.7092 0.8655 0.6570 0.0416  0.0112  -0.0071 56  ARG B CB  
1893 C  CB  B ARG B 37  ? 0.7628 0.9201 0.7107 0.0404  0.0112  -0.0070 56  ARG B CB  
1894 C  CG  A ARG B 37  ? 0.7982 0.9258 0.7290 0.0463  0.0176  -0.0156 56  ARG B CG  
1895 C  CG  B ARG B 37  ? 0.9021 1.0358 0.8357 0.0479  0.0185  -0.0159 56  ARG B CG  
1896 C  CD  A ARG B 37  ? 0.8005 0.9055 0.7305 0.0675  0.0173  -0.0172 56  ARG B CD  
1897 C  CD  B ARG B 37  ? 0.9373 1.0685 0.8775 0.0728  0.0212  -0.0185 56  ARG B CD  
1898 N  NE  A ARG B 37  ? 0.8279 0.9019 0.7394 0.0689  0.0220  -0.0277 56  ARG B NE  
1899 N  NE  B ARG B 37  ? 0.9744 1.0937 0.9026 0.0796  0.0307  -0.0300 56  ARG B NE  
1900 C  CZ  A ARG B 37  ? 0.8431 0.8793 0.7398 0.0610  0.0167  -0.0302 56  ARG B CZ  
1901 C  CZ  B ARG B 37  ? 0.9783 1.1307 0.9138 0.0843  0.0418  -0.0371 56  ARG B CZ  
1902 N  NH1 A ARG B 37  ? 0.7586 0.7834 0.6579 0.0518  0.0083  -0.0218 56  ARG B NH1 
1903 N  NH1 B ARG B 37  ? 1.0766 1.2155 0.9977 0.0914  0.0508  -0.0477 56  ARG B NH1 
1904 N  NH2 A ARG B 37  ? 0.8928 0.9057 0.7727 0.0622  0.0201  -0.0426 56  ARG B NH2 
1905 N  NH2 B ARG B 37  ? 0.9240 1.1254 0.8816 0.0809  0.0444  -0.0349 56  ARG B NH2 
1906 N  N   . THR B 38  ? 0.6514 0.7623 0.5772 0.0119  -0.0053 0.0048  57  THR B N   
1907 C  CA  . THR B 38  ? 0.6506 0.7374 0.5608 0.0000  -0.0100 0.0052  57  THR B CA  
1908 C  C   . THR B 38  ? 0.6519 0.7206 0.5640 0.0018  -0.0172 0.0106  57  THR B C   
1909 O  O   . THR B 38  ? 0.6464 0.6926 0.5496 -0.0015 -0.0195 0.0065  57  THR B O   
1910 C  CB  . THR B 38  ? 0.6662 0.7634 0.5711 -0.0141 -0.0101 0.0076  57  THR B CB  
1911 O  OG1 . THR B 38  ? 0.7246 0.8349 0.6259 -0.0189 -0.0002 0.0029  57  THR B OG1 
1912 C  CG2 . THR B 38  ? 0.7016 0.7750 0.5884 -0.0209 -0.0150 0.0075  57  THR B CG2 
1913 N  N   . GLU B 39  ? 0.6448 0.7256 0.5678 0.0066  -0.0203 0.0190  58  GLU B N   
1914 C  CA  . GLU B 39  ? 0.6386 0.7012 0.5612 0.0087  -0.0243 0.0263  58  GLU B CA  
1915 C  C   . GLU B 39  ? 0.6497 0.6822 0.5684 0.0166  -0.0204 0.0234  58  GLU B C   
1916 O  O   . GLU B 39  ? 0.7217 0.7306 0.6358 0.0092  -0.0210 0.0227  58  GLU B O   
1917 C  CB  . GLU B 39  ? 0.6037 0.6847 0.5339 0.0167  -0.0275 0.0364  58  GLU B CB  
1918 C  CG  . GLU B 39  ? 0.6824 0.7394 0.6075 0.0208  -0.0283 0.0457  58  GLU B CG  
1919 C  CD  . GLU B 39  ? 0.7407 0.8124 0.6666 0.0302  -0.0322 0.0571  58  GLU B CD  
1920 O  OE1 . GLU B 39  ? 0.8211 0.9273 0.7548 0.0349  -0.0362 0.0565  58  GLU B OE1 
1921 O  OE2 . GLU B 39  ? 0.7344 0.7823 0.6518 0.0326  -0.0306 0.0662  58  GLU B OE2 
1922 N  N   . MSE B 40  ? 0.6660 0.7005 0.5871 0.0313  -0.0157 0.0208  59  MSE B N   
1923 C  CA  . MSE B 40  ? 0.8074 0.8083 0.7215 0.0407  -0.0104 0.0162  59  MSE B CA  
1924 C  C   . MSE B 40  ? 0.7275 0.7086 0.6325 0.0275  -0.0099 0.0033  59  MSE B C   
1925 O  O   . MSE B 40  ? 0.7226 0.6718 0.6220 0.0234  -0.0082 -0.0005 59  MSE B O   
1926 C  CB  . MSE B 40  ? 0.8075 0.8206 0.7254 0.0606  -0.0052 0.0131  59  MSE B CB  
1927 C  CG  . MSE B 40  ? 1.0654 1.0420 0.9746 0.0775  0.0007  0.0115  59  MSE B CG  
1928 SE SE  . MSE B 40  ? 1.4214 1.4284 1.3391 0.1072  0.0068  0.0067  59  MSE B SE  
1929 C  CE  . MSE B 40  ? 0.9122 0.9819 0.8510 0.1119  -0.0011 0.0183  59  MSE B CE  
1930 N  N   . TYR B 41  ? 0.6943 0.6944 0.5964 0.0203  -0.0111 -0.0034 60  TYR B N   
1931 C  CA  . TYR B 41  ? 0.7076 0.6953 0.5980 0.0106  -0.0129 -0.0156 60  TYR B CA  
1932 C  C   . TYR B 41  ? 0.6704 0.6496 0.5618 -0.0029 -0.0196 -0.0152 60  TYR B C   
1933 O  O   . TYR B 41  ? 0.6796 0.6417 0.5668 -0.0093 -0.0210 -0.0262 60  TYR B O   
1934 C  CB  . TYR B 41  ? 0.7236 0.7311 0.6052 0.0077  -0.0121 -0.0191 60  TYR B CB  
1935 C  CG  . TYR B 41  ? 0.7320 0.7303 0.5972 0.0008  -0.0164 -0.0297 60  TYR B CG  
1936 C  CD1 . TYR B 41  ? 0.6943 0.6817 0.5461 0.0058  -0.0132 -0.0427 60  TYR B CD1 
1937 C  CD2 . TYR B 41  ? 0.7192 0.7221 0.5806 -0.0082 -0.0243 -0.0274 60  TYR B CD2 
1938 C  CE1 . TYR B 41  ? 0.7757 0.7585 0.6103 0.0015  -0.0192 -0.0534 60  TYR B CE1 
1939 C  CE2 . TYR B 41  ? 0.7373 0.7368 0.5830 -0.0106 -0.0303 -0.0374 60  TYR B CE2 
1940 C  CZ  . TYR B 41  ? 0.7698 0.7603 0.6018 -0.0059 -0.0284 -0.0504 60  TYR B CZ  
1941 O  OH  . TYR B 41  ? 0.7517 0.7427 0.5661 -0.0063 -0.0361 -0.0609 60  TYR B OH  
1942 N  N   . TYR B 42  ? 0.6312 0.6257 0.5289 -0.0077 -0.0234 -0.0046 61  TYR B N   
1943 C  CA  . TYR B 42  ? 0.6351 0.6276 0.5359 -0.0190 -0.0284 -0.0037 61  TYR B CA  
1944 C  C   . TYR B 42  ? 0.6913 0.6588 0.5969 -0.0228 -0.0245 -0.0043 61  TYR B C   
1945 O  O   . TYR B 42  ? 0.6946 0.6561 0.6022 -0.0345 -0.0264 -0.0135 61  TYR B O   
1946 C  CB  . TYR B 42  ? 0.6302 0.6412 0.5353 -0.0210 -0.0314 0.0081  61  TYR B CB  
1947 C  CG  . TYR B 42  ? 0.6387 0.6499 0.5483 -0.0305 -0.0346 0.0096  61  TYR B CG  
1948 C  CD1 . TYR B 42  ? 0.7172 0.7388 0.6235 -0.0363 -0.0406 0.0024  61  TYR B CD1 
1949 C  CD2 . TYR B 42  ? 0.6360 0.6376 0.5520 -0.0321 -0.0308 0.0183  61  TYR B CD2 
1950 C  CE1 . TYR B 42  ? 0.6836 0.7121 0.5974 -0.0442 -0.0430 0.0021  61  TYR B CE1 
1951 C  CE2 . TYR B 42  ? 0.6186 0.6232 0.5399 -0.0424 -0.0314 0.0190  61  TYR B CE2 
1952 C  CZ  . TYR B 42  ? 0.6993 0.7206 0.6219 -0.0487 -0.0376 0.0100  61  TYR B CZ  
1953 O  OH  . TYR B 42  ? 0.7514 0.7827 0.6824 -0.0578 -0.0377 0.0093  61  TYR B OH  
1954 N  N   . TRP B 43  ? 0.7131 0.6664 0.6195 -0.0125 -0.0185 0.0049  62  TRP B N   
1955 C  CA  . TRP B 43  ? 0.7490 0.6691 0.6540 -0.0150 -0.0119 0.0075  62  TRP B CA  
1956 C  C   . TRP B 43  ? 0.8195 0.7099 0.7187 -0.0181 -0.0072 -0.0072 62  TRP B C   
1957 O  O   . TRP B 43  ? 0.8678 0.7360 0.7678 -0.0325 -0.0035 -0.0129 62  TRP B O   
1958 C  CB  . TRP B 43  ? 0.7905 0.7006 0.6921 0.0016  -0.0072 0.0234  62  TRP B CB  
1959 C  CG  . TRP B 43  ? 0.7731 0.7075 0.6786 0.0024  -0.0113 0.0375  62  TRP B CG  
1960 C  CD1 . TRP B 43  ? 0.7711 0.7338 0.6793 0.0155  -0.0156 0.0454  62  TRP B CD1 
1961 C  CD2 . TRP B 43  ? 0.7566 0.6933 0.6642 -0.0114 -0.0117 0.0432  62  TRP B CD2 
1962 N  NE1 . TRP B 43  ? 0.8375 0.8155 0.7466 0.0110  -0.0191 0.0551  62  TRP B NE1 
1963 C  CE2 . TRP B 43  ? 0.7546 0.7178 0.6628 -0.0038 -0.0165 0.0549  62  TRP B CE2 
1964 C  CE3 . TRP B 43  ? 0.8335 0.7571 0.7440 -0.0295 -0.0081 0.0383  62  TRP B CE3 
1965 C  CZ2 . TRP B 43  ? 0.7905 0.7621 0.6985 -0.0120 -0.0172 0.0623  62  TRP B CZ2 
1966 C  CZ3 . TRP B 43  ? 0.8500 0.7864 0.7634 -0.0380 -0.0081 0.0463  62  TRP B CZ3 
1967 C  CH2 . TRP B 43  ? 0.8067 0.7646 0.7173 -0.0284 -0.0124 0.0585  62  TRP B CH2 
1968 N  N   . THR B 44  ? 0.7925 0.6835 0.6858 -0.0062 -0.0065 -0.0149 63  THR B N   
1969 C  CA  . THR B 44  ? 0.8321 0.6928 0.7164 -0.0063 -0.0018 -0.0307 63  THR B CA  
1970 C  C   . THR B 44  ? 0.8490 0.7204 0.7306 -0.0191 -0.0081 -0.0504 63  THR B C   
1971 O  O   . THR B 44  ? 0.8761 0.7221 0.7533 -0.0284 -0.0056 -0.0656 63  THR B O   
1972 C  CB  . THR B 44  ? 0.8393 0.6950 0.7166 0.0164  0.0034  -0.0302 63  THR B CB  
1973 O  OG1 . THR B 44  ? 0.9369 0.8319 0.8170 0.0215  -0.0008 -0.0307 63  THR B OG1 
1974 C  CG2 . THR B 44  ? 0.8815 0.7267 0.7593 0.0333  0.0082  -0.0126 63  THR B CG2 
1975 N  N   . ASN B 45  ? 0.8010 0.7073 0.6827 -0.0192 -0.0159 -0.0506 64  ASN B N   
1976 C  CA  . ASN B 45  ? 0.7988 0.7172 0.6722 -0.0256 -0.0231 -0.0678 64  ASN B CA  
1977 C  C   . ASN B 45  ? 0.7907 0.7340 0.6691 -0.0374 -0.0333 -0.0704 64  ASN B C   
1978 O  O   . ASN B 45  ? 0.8015 0.7538 0.6724 -0.0410 -0.0404 -0.0860 64  ASN B O   
1979 C  CB  . ASN B 45  ? 0.8622 0.7955 0.7223 -0.0123 -0.0224 -0.0681 64  ASN B CB  
1980 C  CG  . ASN B 45  ? 0.9901 0.9057 0.8442 0.0014  -0.0127 -0.0712 64  ASN B CG  
1981 O  OD1 . ASN B 45  ? 1.0922 0.9949 0.9540 0.0094  -0.0063 -0.0617 64  ASN B OD1 
1982 N  ND2 . ASN B 45  ? 1.0526 0.9685 0.8906 0.0070  -0.0114 -0.0843 64  ASN B ND2 
1983 N  N   . VAL B 46  ? 0.7655 0.7227 0.6549 -0.0409 -0.0349 -0.0564 65  VAL B N   
1984 C  CA  . VAL B 46  ? 0.6987 0.6812 0.5922 -0.0484 -0.0444 -0.0597 65  VAL B CA  
1985 C  C   . VAL B 46  ? 0.7685 0.7504 0.6781 -0.0652 -0.0446 -0.0680 65  VAL B C   
1986 O  O   . VAL B 46  ? 0.7671 0.7320 0.6861 -0.0716 -0.0361 -0.0590 65  VAL B O   
1987 C  CB  . VAL B 46  ? 0.7093 0.7093 0.6033 -0.0431 -0.0461 -0.0432 65  VAL B CB  
1988 C  CG1 . VAL B 46  ? 0.6358 0.6593 0.5334 -0.0478 -0.0552 -0.0471 65  VAL B CG1 
1989 C  CG2 . VAL B 46  ? 0.6568 0.6592 0.5350 -0.0313 -0.0446 -0.0383 65  VAL B CG2 
1990 N  N   . ASP B 47  ? 0.7666 0.7683 0.6781 -0.0720 -0.0539 -0.0855 66  ASP B N   
1991 C  CA  . ASP B 47  ? 0.7826 0.7957 0.7133 -0.0908 -0.0550 -0.0977 66  ASP B CA  
1992 C  C   . ASP B 47  ? 0.7529 0.7881 0.6959 -0.0919 -0.0554 -0.0835 66  ASP B C   
1993 O  O   . ASP B 47  ? 0.6898 0.7509 0.6276 -0.0812 -0.0645 -0.0805 66  ASP B O   
1994 C  CB  . ASP B 47  ? 0.8769 0.9171 0.8066 -0.0938 -0.0679 -0.1216 66  ASP B CB  
1995 C  CG  . ASP B 47  ? 1.0076 1.0722 0.9626 -0.1151 -0.0702 -0.1378 66  ASP B CG  
1996 O  OD1 . ASP B 47  ? 1.0354 1.0874 1.0070 -0.1313 -0.0586 -0.1320 66  ASP B OD1 
1997 O  OD2 . ASP B 47  ? 1.0787 1.1776 1.0364 -0.1157 -0.0834 -0.1573 66  ASP B OD2 
1998 N  N   . LYS B 48  ? 0.7577 0.7786 0.7129 -0.1034 -0.0446 -0.0744 67  LYS B N   
1999 C  CA  . LYS B 48  ? 0.8119 0.8516 0.7769 -0.1044 -0.0429 -0.0606 67  LYS B CA  
2000 C  C   . LYS B 48  ? 0.7326 0.8143 0.7156 -0.1138 -0.0499 -0.0738 67  LYS B C   
2001 O  O   . LYS B 48  ? 0.7308 0.8348 0.7184 -0.1089 -0.0516 -0.0649 67  LYS B O   
2002 C  CB  . LYS B 48  ? 0.7771 0.7875 0.7446 -0.1116 -0.0282 -0.0452 67  LYS B CB  
2003 C  CG  . LYS B 48  ? 0.7448 0.7192 0.6958 -0.0981 -0.0223 -0.0322 67  LYS B CG  
2004 C  CD  . LYS B 48  ? 0.7113 0.6984 0.6509 -0.0786 -0.0296 -0.0226 67  LYS B CD  
2005 C  CE  . LYS B 48  ? 0.7090 0.6703 0.6377 -0.0654 -0.0236 -0.0114 67  LYS B CE  
2006 N  NZ  . LYS B 48  ? 0.7485 0.6800 0.6711 -0.0648 -0.0186 -0.0217 67  LYS B NZ  
2007 N  N   . ASN B 49  ? 0.7970 0.8920 0.7904 -0.1263 -0.0544 -0.0965 68  ASN B N   
2008 C  CA  . ASN B 49  ? 0.8335 0.9784 0.8468 -0.1332 -0.0634 -0.1130 68  ASN B CA  
2009 C  C   . ASN B 49  ? 0.8655 1.0415 0.8660 -0.1118 -0.0816 -0.1206 68  ASN B C   
2010 O  O   . ASN B 49  ? 0.8375 1.0593 0.8527 -0.1116 -0.0914 -0.1342 68  ASN B O   
2011 C  CB  . ASN B 49  ? 0.8346 0.9850 0.8682 -0.1600 -0.0596 -0.1365 68  ASN B CB  
2012 C  CG  . ASN B 49  ? 0.8526 0.9733 0.8977 -0.1828 -0.0395 -0.1285 68  ASN B CG  
2013 O  OD1 . ASN B 49  ? 0.9453 1.0664 0.9937 -0.1817 -0.0311 -0.1102 68  ASN B OD1 
2014 N  ND2 . ASN B 49  ? 0.9000 0.9922 0.9484 -0.2037 -0.0309 -0.1426 68  ASN B ND2 
2015 N  N   . SER B 50  ? 0.8175 0.9699 0.7902 -0.0932 -0.0852 -0.1116 69  SER B N   
2016 C  CA  . SER B 50  ? 0.7924 0.9637 0.7447 -0.0718 -0.0997 -0.1156 69  SER B CA  
2017 C  C   . SER B 50  ? 0.7470 0.9265 0.6903 -0.0554 -0.1014 -0.0985 69  SER B C   
2018 O  O   . SER B 50  ? 0.7331 0.8975 0.6807 -0.0588 -0.0914 -0.0820 69  SER B O   
2019 C  CB  . SER B 50  ? 0.8080 0.9486 0.7323 -0.0616 -0.0997 -0.1144 69  SER B CB  
2020 O  OG  . SER B 50  ? 0.7342 0.8427 0.6467 -0.0560 -0.0891 -0.0933 69  SER B OG  
2021 N  N   . GLU B 51  ? 0.7835 0.9842 0.7109 -0.0361 -0.1142 -0.1026 70  GLU B N   
2022 C  CA  . GLU B 51  ? 0.8225 1.0254 0.7367 -0.0188 -0.1155 -0.0879 70  GLU B CA  
2023 C  C   . GLU B 51  ? 0.7834 0.9438 0.6718 -0.0124 -0.1068 -0.0683 70  GLU B C   
2024 O  O   . GLU B 51  ? 0.8546 1.0065 0.7407 -0.0096 -0.1014 -0.0544 70  GLU B O   
2025 C  CB  . GLU B 51  ? 0.9754 1.2060 0.8737 0.0038  -0.1310 -0.0966 70  GLU B CB  
2026 C  CG  . GLU B 51  ? 1.1605 1.4431 1.0839 -0.0001 -0.1430 -0.1207 70  GLU B CG  
2027 C  CD  . GLU B 51  ? 1.1361 1.4503 1.1019 -0.0208 -0.1368 -0.1272 70  GLU B CD  
2028 O  OE1 . GLU B 51  ? 1.0778 1.3840 1.0497 -0.0224 -0.1271 -0.1124 70  GLU B OE1 
2029 O  OE2 . GLU B 51  ? 1.1621 1.5106 1.1547 -0.0368 -0.1410 -0.1487 70  GLU B OE2 
2030 N  N   . ILE B 52  ? 0.7320 0.8690 0.6026 -0.0114 -0.1050 -0.0689 71  ILE B N   
2031 C  CA  . ILE B 52  ? 0.7333 0.8364 0.5834 -0.0079 -0.0954 -0.0531 71  ILE B CA  
2032 C  C   . ILE B 52  ? 0.6768 0.7675 0.5453 -0.0208 -0.0840 -0.0413 71  ILE B C   
2033 O  O   . ILE B 52  ? 0.7399 0.8169 0.5984 -0.0176 -0.0784 -0.0281 71  ILE B O   
2034 C  CB  . ILE B 52  ? 0.7213 0.8077 0.5525 -0.0053 -0.0942 -0.0587 71  ILE B CB  
2035 C  CG1 . ILE B 52  ? 0.8542 0.9134 0.6601 0.0006  -0.0850 -0.0446 71  ILE B CG1 
2036 C  CG2 . ILE B 52  ? 0.7115 0.7937 0.5633 -0.0201 -0.0895 -0.0679 71  ILE B CG2 
2037 C  CD1 . ILE B 52  ? 0.9795 1.0307 0.7544 0.0157  -0.0878 -0.0371 71  ILE B CD1 
2038 N  N   . SER B 53  ? 0.6723 0.7671 0.5652 -0.0349 -0.0804 -0.0469 72  SER B N   
2039 C  CA  . SER B 53  ? 0.7491 0.8309 0.6565 -0.0447 -0.0700 -0.0357 72  SER B CA  
2040 C  C   . SER B 53  ? 0.7202 0.8034 0.6259 -0.0411 -0.0671 -0.0210 72  SER B C   
2041 O  O   . SER B 53  ? 0.6295 0.6985 0.5314 -0.0405 -0.0609 -0.0096 72  SER B O   
2042 C  CB  . SER B 53  ? 0.8162 0.9061 0.7476 -0.0601 -0.0670 -0.0438 72  SER B CB  
2043 O  OG  . SER B 53  ? 1.1464 1.2184 1.0856 -0.0672 -0.0563 -0.0318 72  SER B OG  
2044 N  N   . SER B 54  ? 0.6578 0.7613 0.5663 -0.0377 -0.0723 -0.0232 73  SER B N   
2045 C  CA  . SER B 54  ? 0.7170 0.8227 0.6223 -0.0338 -0.0701 -0.0121 73  SER B CA  
2046 C  C   . SER B 54  ? 0.6964 0.7846 0.5771 -0.0242 -0.0701 -0.0045 73  SER B C   
2047 O  O   . SER B 54  ? 0.6560 0.7369 0.5338 -0.0256 -0.0654 0.0050  73  SER B O   
2048 C  CB  . SER B 54  ? 0.7292 0.8621 0.6418 -0.0292 -0.0756 -0.0185 73  SER B CB  
2049 O  OG  . SER B 54  ? 0.9279 1.0803 0.8660 -0.0422 -0.0737 -0.0270 73  SER B OG  
2050 N  N   . LYS B 55  ? 0.6312 0.7126 0.4923 -0.0151 -0.0747 -0.0093 74  LYS B N   
2051 C  CA  . LYS B 55  ? 0.6900 0.7493 0.5245 -0.0089 -0.0715 -0.0020 74  LYS B CA  
2052 C  C   . LYS B 55  ? 0.6381 0.6851 0.4758 -0.0177 -0.0629 0.0037  74  LYS B C   
2053 O  O   . LYS B 55  ? 0.6570 0.6946 0.4871 -0.0203 -0.0577 0.0108  74  LYS B O   
2054 C  CB  . LYS B 55  ? 0.8266 0.8777 0.6343 0.0039  -0.0766 -0.0068 74  LYS B CB  
2055 C  CG  . LYS B 55  ? 1.0332 1.0989 0.8345 0.0180  -0.0862 -0.0117 74  LYS B CG  
2056 C  CD  . LYS B 55  ? 1.3605 1.4165 1.1291 0.0354  -0.0924 -0.0150 74  LYS B CD  
2057 C  CE  . LYS B 55  ? 1.3923 1.4650 1.1526 0.0548  -0.1029 -0.0195 74  LYS B CE  
2058 N  NZ  . LYS B 55  ? 1.4155 1.4711 1.1632 0.0612  -0.0983 -0.0100 74  LYS B NZ  
2059 N  N   . LEU B 56  ? 0.6187 0.6678 0.4688 -0.0222 -0.0615 -0.0008 75  LEU B N   
2060 C  CA  . LEU B 56  ? 0.6755 0.7177 0.5307 -0.0266 -0.0539 0.0034  75  LEU B CA  
2061 C  C   . LEU B 56  ? 0.6215 0.6700 0.4935 -0.0316 -0.0508 0.0117  75  LEU B C   
2062 O  O   . LEU B 56  ? 0.6439 0.6928 0.5158 -0.0328 -0.0463 0.0172  75  LEU B O   
2063 C  CB  . LEU B 56  ? 0.6208 0.6599 0.4819 -0.0270 -0.0530 -0.0045 75  LEU B CB  
2064 C  CG  . LEU B 56  ? 0.6489 0.6841 0.4914 -0.0211 -0.0570 -0.0142 75  LEU B CG  
2065 C  CD1 . LEU B 56  ? 0.6057 0.6355 0.4539 -0.0225 -0.0546 -0.0231 75  LEU B CD1 
2066 C  CD2 . LEU B 56  ? 0.6448 0.6690 0.4605 -0.0156 -0.0530 -0.0096 75  LEU B CD2 
2067 N  N   . ALA B 57  ? 0.5996 0.6552 0.4851 -0.0344 -0.0529 0.0121  76  ALA B N   
2068 C  CA  . ALA B 57  ? 0.6182 0.6780 0.5140 -0.0372 -0.0499 0.0210  76  ALA B CA  
2069 C  C   . ALA B 57  ? 0.6239 0.6881 0.5103 -0.0361 -0.0506 0.0261  76  ALA B C   
2070 O  O   . ALA B 57  ? 0.6096 0.6776 0.4986 -0.0369 -0.0485 0.0321  76  ALA B O   
2071 C  CB  . ALA B 57  ? 0.5828 0.6478 0.4911 -0.0421 -0.0495 0.0204  76  ALA B CB  
2072 N  N   . THR B 58  ? 0.6707 0.7332 0.5441 -0.0332 -0.0539 0.0226  77  THR B N   
2073 C  CA  . THR B 58  ? 0.6683 0.7272 0.5281 -0.0325 -0.0537 0.0254  77  THR B CA  
2074 C  C   . THR B 58  ? 0.6627 0.7129 0.5128 -0.0367 -0.0493 0.0265  77  THR B C   
2075 O  O   . THR B 58  ? 0.6465 0.6988 0.4944 -0.0413 -0.0476 0.0286  77  THR B O   
2076 C  CB  . THR B 58  ? 0.7291 0.7819 0.5725 -0.0246 -0.0575 0.0214  77  THR B CB  
2077 O  OG1 . THR B 58  ? 0.7333 0.8028 0.5903 -0.0215 -0.0615 0.0176  77  THR B OG1 
2078 C  CG2 . THR B 58  ? 0.6022 0.6459 0.4303 -0.0234 -0.0561 0.0236  77  THR B CG2 
2079 N  N   . GLU B 59  ? 0.6569 0.6993 0.5010 -0.0361 -0.0469 0.0236  78  GLU B N   
2080 C  CA  . GLU B 59  ? 0.6952 0.7333 0.5328 -0.0421 -0.0400 0.0237  78  GLU B CA  
2081 C  C   . GLU B 59  ? 0.6545 0.7131 0.5135 -0.0461 -0.0384 0.0258  78  GLU B C   
2082 O  O   . GLU B 59  ? 0.6465 0.7126 0.5061 -0.0534 -0.0349 0.0253  78  GLU B O   
2083 C  CB  . GLU B 59  ? 0.7308 0.7581 0.5564 -0.0395 -0.0363 0.0204  78  GLU B CB  
2084 C  CG  . GLU B 59  ? 0.8663 0.8732 0.6646 -0.0320 -0.0384 0.0190  78  GLU B CG  
2085 C  CD  . GLU B 59  ? 0.9483 0.9325 0.7206 -0.0345 -0.0334 0.0221  78  GLU B CD  
2086 O  OE1 . GLU B 59  ? 1.0247 1.0094 0.8004 -0.0462 -0.0269 0.0233  78  GLU B OE1 
2087 O  OE2 . GLU B 59  ? 1.0057 0.9705 0.7524 -0.0240 -0.0360 0.0226  78  GLU B OE2 
2088 N  N   . LEU B 60  ? 0.5868 0.6537 0.4618 -0.0409 -0.0408 0.0276  79  LEU B N   
2089 C  CA  . LEU B 60  ? 0.5726 0.6566 0.4639 -0.0389 -0.0402 0.0311  79  LEU B CA  
2090 C  C   . LEU B 60  ? 0.5725 0.6678 0.4659 -0.0405 -0.0438 0.0354  79  LEU B C   
2091 O  O   . LEU B 60  ? 0.5253 0.6393 0.4250 -0.0420 -0.0440 0.0352  79  LEU B O   
2092 C  CB  . LEU B 60  ? 0.5853 0.6647 0.4865 -0.0313 -0.0402 0.0329  79  LEU B CB  
2093 C  CG  . LEU B 60  ? 0.5845 0.6579 0.4857 -0.0278 -0.0360 0.0273  79  LEU B CG  
2094 C  CD1 . LEU B 60  ? 0.6586 0.7173 0.5643 -0.0230 -0.0359 0.0264  79  LEU B CD1 
2095 C  CD2 . LEU B 60  ? 0.5508 0.6429 0.4602 -0.0248 -0.0318 0.0267  79  LEU B CD2 
2096 N  N   . ALA B 61  ? 0.5344 0.6223 0.4227 -0.0401 -0.0467 0.0376  80  ALA B N   
2097 C  CA  . ALA B 61  ? 0.6214 0.7186 0.5079 -0.0406 -0.0495 0.0412  80  ALA B CA  
2098 C  C   . ALA B 61  ? 0.6015 0.7030 0.4792 -0.0483 -0.0494 0.0360  80  ALA B C   
2099 O  O   . ALA B 61  ? 0.6382 0.7574 0.5196 -0.0499 -0.0518 0.0359  80  ALA B O   
2100 C  CB  . ALA B 61  ? 0.6111 0.7010 0.4932 -0.0393 -0.0505 0.0426  80  ALA B CB  
2101 N  N   . LEU B 62  ? 0.6504 0.7346 0.5148 -0.0530 -0.0464 0.0311  81  LEU B N   
2102 C  CA  . LEU B 62  ? 0.6568 0.7346 0.5085 -0.0630 -0.0434 0.0256  81  LEU B CA  
2103 C  C   . LEU B 62  ? 0.6349 0.7328 0.4984 -0.0720 -0.0401 0.0215  81  LEU B C   
2104 O  O   . LEU B 62  ? 0.6177 0.7284 0.4821 -0.0811 -0.0406 0.0163  81  LEU B O   
2105 C  CB  . LEU B 62  ? 0.7464 0.7936 0.5759 -0.0631 -0.0392 0.0237  81  LEU B CB  
2106 C  CG  . LEU B 62  ? 0.9367 0.9597 0.7425 -0.0720 -0.0337 0.0192  81  LEU B CG  
2107 C  CD1 . LEU B 62  ? 0.8988 0.9189 0.6969 -0.0703 -0.0376 0.0174  81  LEU B CD1 
2108 C  CD2 . LEU B 62  ? 1.0763 1.0668 0.8574 -0.0654 -0.0299 0.0207  81  LEU B CD2 
2109 N  N   . ALA B 63  ? 0.6320 0.7367 0.5061 -0.0691 -0.0370 0.0223  82  ALA B N   
2110 C  CA  . ALA B 63  ? 0.5938 0.7241 0.4826 -0.0757 -0.0328 0.0174  82  ALA B CA  
2111 C  C   . ALA B 63  ? 0.5548 0.7211 0.4631 -0.0697 -0.0400 0.0180  82  ALA B C   
2112 O  O   . ALA B 63  ? 0.6042 0.7992 0.5234 -0.0784 -0.0396 0.0106  82  ALA B O   
2113 C  CB  . ALA B 63  ? 0.5602 0.6877 0.4530 -0.0710 -0.0269 0.0176  82  ALA B CB  
2114 N  N   . TYR B 64  ? 0.5262 0.6916 0.4378 -0.0551 -0.0459 0.0262  83  TYR B N   
2115 C  CA  . TYR B 64  ? 0.5482 0.7417 0.4707 -0.0450 -0.0530 0.0297  83  TYR B CA  
2116 C  C   . TYR B 64  ? 0.5607 0.7665 0.4768 -0.0521 -0.0584 0.0258  83  TYR B C   
2117 O  O   . TYR B 64  ? 0.5760 0.8162 0.5019 -0.0497 -0.0642 0.0223  83  TYR B O   
2118 C  CB  . TYR B 64  ? 0.5623 0.7428 0.4841 -0.0286 -0.0551 0.0411  83  TYR B CB  
2119 C  CG  . TYR B 64  ? 0.5530 0.7309 0.4840 -0.0181 -0.0513 0.0429  83  TYR B CG  
2120 C  CD1 . TYR B 64  ? 0.5685 0.7772 0.5138 -0.0097 -0.0522 0.0400  83  TYR B CD1 
2121 C  CD2 . TYR B 64  ? 0.5812 0.7287 0.5072 -0.0155 -0.0473 0.0460  83  TYR B CD2 
2122 C  CE1 . TYR B 64  ? 0.5952 0.8005 0.5472 0.0027  -0.0483 0.0410  83  TYR B CE1 
2123 C  CE2 . TYR B 64  ? 0.6482 0.7900 0.5801 -0.0056 -0.0435 0.0460  83  TYR B CE2 
2124 C  CZ  . TYR B 64  ? 0.6530 0.8218 0.5968 0.0045  -0.0436 0.0441  83  TYR B CZ  
2125 O  OH  . TYR B 64  ? 0.7168 0.8798 0.6651 0.0169  -0.0393 0.0432  83  TYR B OH  
2126 N  N   . LYS B 65  ? 0.5542 0.7339 0.4533 -0.0592 -0.0571 0.0252  84  LYS B N   
2127 C  CA  . LYS B 65  ? 0.5930 0.7770 0.4815 -0.0668 -0.0608 0.0195  84  LYS B CA  
2128 C  C   . LYS B 65  ? 0.6061 0.8072 0.4993 -0.0844 -0.0586 0.0058  84  LYS B C   
2129 O  O   . LYS B 65  ? 0.6068 0.8361 0.5040 -0.0880 -0.0648 -0.0012 84  LYS B O   
2130 C  CB  . LYS B 65  ? 0.6580 0.8080 0.5265 -0.0684 -0.0582 0.0206  84  LYS B CB  
2131 C  CG  . LYS B 65  ? 0.7504 0.8975 0.6037 -0.0768 -0.0600 0.0121  84  LYS B CG  
2132 C  CD  . LYS B 65  ? 0.8939 1.0112 0.7280 -0.0720 -0.0580 0.0142  84  LYS B CD  
2133 C  CE  . LYS B 65  ? 0.9490 1.0327 0.7702 -0.0756 -0.0512 0.0122  84  LYS B CE  
2134 N  NZ  . LYS B 65  ? 1.1021 1.1627 0.9058 -0.0664 -0.0506 0.0134  84  LYS B NZ  
2135 N  N   . LYS B 66  ? 0.6227 0.8077 0.5143 -0.0961 -0.0492 0.0014  85  LYS B N   
2136 C  CA  . LYS B 66  ? 0.6637 0.8638 0.5608 -0.1170 -0.0435 -0.0120 85  LYS B CA  
2137 C  C   . LYS B 66  ? 0.6396 0.8953 0.5653 -0.1157 -0.0482 -0.0178 85  LYS B C   
2138 O  O   . LYS B 66  ? 0.6270 0.9116 0.5620 -0.1321 -0.0487 -0.0316 85  LYS B O   
2139 C  CB  . LYS B 66  ? 0.8322 1.0048 0.7205 -0.1293 -0.0298 -0.0136 85  LYS B CB  
2140 C  CG  . LYS B 66  ? 1.0174 1.1376 0.8739 -0.1380 -0.0221 -0.0139 85  LYS B CG  
2141 C  CD  . LYS B 66  ? 1.1353 1.2196 0.9748 -0.1224 -0.0208 -0.0027 85  LYS B CD  
2142 C  CE  . LYS B 66  ? 1.0845 1.1208 0.8926 -0.1319 -0.0092 -0.0037 85  LYS B CE  
2143 N  NZ  . LYS B 66  ? 1.1180 1.1284 0.9114 -0.1158 -0.0086 0.0055  85  LYS B NZ  
2144 N  N   . ASN B 67  ? 0.6172 0.8872 0.5566 -0.0967 -0.0509 -0.0088 86  ASN B N   
2145 C  CA  . ASN B 67  ? 0.5500 0.8730 0.5154 -0.0873 -0.0564 -0.0124 86  ASN B CA  
2146 C  C   . ASN B 67  ? 0.4954 0.8490 0.4629 -0.0745 -0.0707 -0.0117 86  ASN B C   
2147 O  O   . ASN B 67  ? 0.4905 0.8932 0.4773 -0.0664 -0.0775 -0.0169 86  ASN B O   
2148 C  CB  . ASN B 67  ? 0.5536 0.8724 0.5266 -0.0667 -0.0543 -0.0019 86  ASN B CB  
2149 C  CG  . ASN B 67  ? 0.6234 0.9239 0.5964 -0.0762 -0.0410 -0.0043 86  ASN B CG  
2150 O  OD1 . ASN B 67  ? 0.6995 0.9915 0.6672 -0.0980 -0.0320 -0.0125 86  ASN B OD1 
2151 N  ND2 . ASN B 67  ? 0.6582 0.9493 0.6341 -0.0594 -0.0389 0.0028  86  ASN B ND2 
2152 N  N   . ARG B 68  ? 0.5245 0.8509 0.4711 -0.0714 -0.0749 -0.0054 87  ARG B N   
2153 C  CA  . ARG B 68  ? 0.5358 0.8823 0.4763 -0.0579 -0.0869 -0.0023 87  ARG B CA  
2154 C  C   . ARG B 68  ? 0.5632 0.9154 0.5063 -0.0296 -0.0914 0.0132  87  ARG B C   
2155 O  O   . ARG B 68  ? 0.5514 0.9355 0.4950 -0.0137 -0.1018 0.0152  87  ARG B O   
2156 C  CB  . ARG B 68  ? 0.6041 0.9991 0.5545 -0.0694 -0.0951 -0.0198 87  ARG B CB  
2157 C  CG  . ARG B 68  ? 0.6026 0.9798 0.5450 -0.0994 -0.0881 -0.0351 87  ARG B CG  
2158 C  CD  . ARG B 68  ? 0.6328 1.0541 0.5817 -0.1122 -0.0970 -0.0540 87  ARG B CD  
2159 N  NE  . ARG B 68  ? 0.6661 1.0606 0.6020 -0.1417 -0.0891 -0.0692 87  ARG B NE  
2160 C  CZ  . ARG B 68  ? 0.7024 1.0954 0.6481 -0.1688 -0.0774 -0.0825 87  ARG B CZ  
2161 N  NH1 . ARG B 68  ? 0.6984 1.1194 0.6699 -0.1714 -0.0714 -0.0835 87  ARG B NH1 
2162 N  NH2 . ARG B 68  ? 0.7646 1.1227 0.6911 -0.1936 -0.0695 -0.0947 87  ARG B NH2 
2163 N  N   . ASN B 69  ? 0.5491 0.8678 0.4911 -0.0231 -0.0834 0.0236  88  ASN B N   
2164 C  CA  . ASN B 69  ? 0.5894 0.8973 0.5287 0.0008  -0.0842 0.0386  88  ASN B CA  
2165 C  C   . ASN B 69  ? 0.5987 0.8662 0.5171 0.0000  -0.0814 0.0489  88  ASN B C   
2166 O  O   . ASN B 69  ? 0.5783 0.8110 0.4930 -0.0049 -0.0737 0.0528  88  ASN B O   
2167 C  CB  . ASN B 69  ? 0.5698 0.8646 0.5202 0.0052  -0.0761 0.0402  88  ASN B CB  
2168 C  CG  . ASN B 69  ? 0.6211 0.9044 0.5678 0.0311  -0.0767 0.0538  88  ASN B CG  
2169 O  OD1 . ASN B 69  ? 0.5702 0.8432 0.5016 0.0444  -0.0805 0.0654  88  ASN B OD1 
2170 N  ND2 . ASN B 69  ? 0.5918 0.8737 0.5493 0.0388  -0.0714 0.0524  88  ASN B ND2 
2171 N  N   . TYR B 70  ? 0.5722 0.8490 0.4772 0.0042  -0.0878 0.0516  89  TYR B N   
2172 C  CA  . TYR B 70  ? 0.6177 0.8639 0.5037 0.0024  -0.0843 0.0596  89  TYR B CA  
2173 C  C   . TYR B 70  ? 0.6026 0.8189 0.4814 0.0159  -0.0779 0.0764  89  TYR B C   
2174 O  O   . TYR B 70  ? 0.5780 0.7661 0.4501 0.0088  -0.0709 0.0802  89  TYR B O   
2175 C  CB  . TYR B 70  ? 0.6230 0.8878 0.4942 0.0032  -0.0917 0.0568  89  TYR B CB  
2176 C  CG  . TYR B 70  ? 0.6298 0.9195 0.5072 -0.0141 -0.0966 0.0375  89  TYR B CG  
2177 C  CD1 . TYR B 70  ? 0.6093 0.8766 0.4863 -0.0337 -0.0899 0.0279  89  TYR B CD1 
2178 C  CD2 . TYR B 70  ? 0.6429 0.9776 0.5245 -0.0108 -0.1078 0.0282  89  TYR B CD2 
2179 C  CE1 . TYR B 70  ? 0.6150 0.8960 0.4940 -0.0521 -0.0916 0.0103  89  TYR B CE1 
2180 C  CE2 . TYR B 70  ? 0.6588 1.0148 0.5469 -0.0313 -0.1108 0.0080  89  TYR B CE2 
2181 C  CZ  . TYR B 70  ? 0.6763 1.0015 0.5622 -0.0530 -0.1014 -0.0004 89  TYR B CZ  
2182 O  OH  . TYR B 70  ? 0.7432 1.0802 0.6318 -0.0755 -0.1015 -0.0199 89  TYR B OH  
2183 N  N   . ASP B 71  ? 0.6239 0.8464 0.5040 0.0348  -0.0799 0.0850  90  ASP B N   
2184 C  CA  . ASP B 71  ? 0.6413 0.8279 0.5121 0.0467  -0.0718 0.1004  90  ASP B CA  
2185 C  C   . ASP B 71  ? 0.6182 0.7763 0.4997 0.0340  -0.0628 0.0964  90  ASP B C   
2186 O  O   . ASP B 71  ? 0.6884 0.8162 0.5631 0.0282  -0.0549 0.1023  90  ASP B O   
2187 C  CB  . ASP B 71  ? 0.6863 0.8818 0.5546 0.0725  -0.0755 0.1089  90  ASP B CB  
2188 C  CG  . ASP B 71  ? 0.7737 0.9930 0.6245 0.0905  -0.0847 0.1163  90  ASP B CG  
2189 O  OD1 . ASP B 71  ? 0.8528 1.0718 0.6892 0.0833  -0.0855 0.1180  90  ASP B OD1 
2190 O  OD2 . ASP B 71  ? 0.8873 1.1284 0.7377 0.1141  -0.0919 0.1198  90  ASP B OD2 
2191 N  N   . LYS B 72  ? 0.6465 0.8179 0.5446 0.0288  -0.0640 0.0850  91  LYS B N   
2192 C  CA  . LYS B 72  ? 0.6042 0.7527 0.5097 0.0181  -0.0571 0.0795  91  LYS B CA  
2193 C  C   . LYS B 72  ? 0.6475 0.7867 0.5503 0.0000  -0.0554 0.0730  91  LYS B C   
2194 O  O   . LYS B 72  ? 0.5712 0.6869 0.4739 -0.0061 -0.0501 0.0725  91  LYS B O   
2195 C  CB  . LYS B 72  ? 0.6285 0.7948 0.5486 0.0191  -0.0575 0.0700  91  LYS B CB  
2196 C  CG  . LYS B 72  ? 0.6653 0.8356 0.5892 0.0404  -0.0573 0.0752  91  LYS B CG  
2197 C  CD  . LYS B 72  ? 0.7870 0.9147 0.7047 0.0445  -0.0490 0.0804  91  LYS B CD  
2198 C  CE  . LYS B 72  ? 0.8294 0.9545 0.7491 0.0664  -0.0471 0.0832  91  LYS B CE  
2199 N  NZ  . LYS B 72  ? 0.9117 0.9884 0.8222 0.0668  -0.0381 0.0864  91  LYS B NZ  
2200 N  N   . ALA B 73  ? 0.5898 0.7474 0.4897 -0.0077 -0.0600 0.0669  92  ALA B N   
2201 C  CA  . ALA B 73  ? 0.6311 0.7772 0.5245 -0.0208 -0.0584 0.0611  92  ALA B CA  
2202 C  C   . ALA B 73  ? 0.6051 0.7345 0.4909 -0.0193 -0.0547 0.0691  92  ALA B C   
2203 O  O   . ALA B 73  ? 0.6196 0.7344 0.5064 -0.0253 -0.0510 0.0664  92  ALA B O   
2204 C  CB  . ALA B 73  ? 0.5503 0.7136 0.4378 -0.0281 -0.0630 0.0532  92  ALA B CB  
2205 N  N   . TYR B 74  ? 0.6451 0.7796 0.5232 -0.0105 -0.0554 0.0787  93  TYR B N   
2206 C  CA  . TYR B 74  ? 0.6485 0.7686 0.5182 -0.0096 -0.0491 0.0880  93  TYR B CA  
2207 C  C   . TYR B 74  ? 0.6848 0.7811 0.5617 -0.0121 -0.0412 0.0914  93  TYR B C   
2208 O  O   . TYR B 74  ? 0.6702 0.7582 0.5501 -0.0212 -0.0358 0.0892  93  TYR B O   
2209 C  CB  . TYR B 74  ? 0.6482 0.7753 0.5031 0.0027  -0.0505 0.0996  93  TYR B CB  
2210 C  CG  . TYR B 74  ? 0.6903 0.7982 0.5335 0.0033  -0.0405 0.1118  93  TYR B CG  
2211 C  CD1 . TYR B 74  ? 0.7809 0.8910 0.6198 -0.0052 -0.0359 0.1095  93  TYR B CD1 
2212 C  CD2 . TYR B 74  ? 0.8141 0.8998 0.6489 0.0128  -0.0337 0.1259  93  TYR B CD2 
2213 C  CE1 . TYR B 74  ? 0.8118 0.9076 0.6416 -0.0072 -0.0240 0.1203  93  TYR B CE1 
2214 C  CE2 . TYR B 74  ? 0.8167 0.8804 0.6387 0.0101  -0.0211 0.1378  93  TYR B CE2 
2215 C  CZ  . TYR B 74  ? 0.8499 0.9215 0.6712 -0.0013 -0.0159 0.1346  93  TYR B CZ  
2216 O  OH  . TYR B 74  ? 1.0812 1.1351 0.8919 -0.0065 -0.0012 0.1454  93  TYR B OH  
2217 N  N   . LEU B 75  ? 0.7387 0.8264 0.6195 -0.0044 -0.0408 0.0943  94  LEU B N   
2218 C  CA  . LEU B 75  ? 0.6914 0.7524 0.5773 -0.0072 -0.0331 0.0953  94  LEU B CA  
2219 C  C   . LEU B 75  ? 0.6795 0.7393 0.5764 -0.0208 -0.0328 0.0826  94  LEU B C   
2220 O  O   . LEU B 75  ? 0.6862 0.7334 0.5868 -0.0299 -0.0265 0.0813  94  LEU B O   
2221 C  CB  . LEU B 75  ? 0.7541 0.8083 0.6419 0.0054  -0.0339 0.0969  94  LEU B CB  
2222 C  CG  . LEU B 75  ? 0.7902 0.8116 0.6792 0.0052  -0.0259 0.0970  94  LEU B CG  
2223 C  CD1 . LEU B 75  ? 0.8152 0.8064 0.6907 0.0054  -0.0156 0.1100  94  LEU B CD1 
2224 C  CD2 . LEU B 75  ? 0.7836 0.8055 0.6743 0.0214  -0.0281 0.0964  94  LEU B CD2 
2225 N  N   . PHE B 76  ? 0.7327 0.8071 0.6335 -0.0225 -0.0392 0.0730  95  PHE B N   
2226 C  CA  . PHE B 76  ? 0.6726 0.7454 0.5782 -0.0310 -0.0402 0.0619  95  PHE B CA  
2227 C  C   . PHE B 76  ? 0.7616 0.8419 0.6653 -0.0368 -0.0408 0.0588  95  PHE B C   
2228 O  O   . PHE B 76  ? 0.7070 0.7857 0.6163 -0.0419 -0.0403 0.0517  95  PHE B O   
2229 C  CB  . PHE B 76  ? 0.6287 0.7066 0.5345 -0.0301 -0.0437 0.0543  95  PHE B CB  
2230 C  CG  . PHE B 76  ? 0.6696 0.7381 0.5802 -0.0254 -0.0412 0.0532  95  PHE B CG  
2231 C  CD1 . PHE B 76  ? 0.7077 0.7620 0.6208 -0.0292 -0.0391 0.0463  95  PHE B CD1 
2232 C  CD2 . PHE B 76  ? 0.6769 0.7523 0.5896 -0.0157 -0.0411 0.0579  95  PHE B CD2 
2233 C  CE1 . PHE B 76  ? 0.6911 0.7330 0.6063 -0.0243 -0.0359 0.0438  95  PHE B CE1 
2234 C  CE2 . PHE B 76  ? 0.6400 0.7053 0.5562 -0.0084 -0.0378 0.0563  95  PHE B CE2 
2235 C  CZ  . PHE B 76  ? 0.7050 0.7507 0.6213 -0.0132 -0.0346 0.0493  95  PHE B CZ  
2236 N  N   . TYR B 77  ? 0.7484 0.8393 0.6443 -0.0348 -0.0424 0.0625  96  TYR B N   
2237 C  CA  . TYR B 77  ? 0.6944 0.7926 0.5876 -0.0375 -0.0418 0.0595  96  TYR B CA  
2238 C  C   . TYR B 77  ? 0.7068 0.8037 0.6069 -0.0421 -0.0339 0.0643  96  TYR B C   
2239 O  O   . TYR B 77  ? 0.6784 0.7845 0.5849 -0.0461 -0.0323 0.0582  96  TYR B O   
2240 C  CB  . TYR B 77  ? 0.6700 0.7771 0.5504 -0.0345 -0.0448 0.0600  96  TYR B CB  
2241 C  CG  . TYR B 77  ? 0.6231 0.7283 0.4960 -0.0352 -0.0499 0.0518  96  TYR B CG  
2242 C  CD1 . TYR B 77  ? 0.6104 0.7078 0.4796 -0.0353 -0.0510 0.0442  96  TYR B CD1 
2243 C  CD2 . TYR B 77  ? 0.6745 0.7858 0.5418 -0.0359 -0.0531 0.0512  96  TYR B CD2 
2244 C  CE1 . TYR B 77  ? 0.6094 0.6965 0.4658 -0.0366 -0.0528 0.0384  96  TYR B CE1 
2245 C  CE2 . TYR B 77  ? 0.6143 0.7207 0.4738 -0.0409 -0.0548 0.0429  96  TYR B CE2 
2246 C  CZ  . TYR B 77  ? 0.6502 0.7403 0.5023 -0.0415 -0.0535 0.0377  96  TYR B CZ  
2247 O  OH  . TYR B 77  ? 0.7136 0.7906 0.5529 -0.0470 -0.0524 0.0313  96  TYR B OH  
2248 N  N   . LYS B 78  ? 0.6867 0.7722 0.5847 -0.0410 -0.0284 0.0748  97  LYS B N   
2249 C  CA  . LYS B 78  ? 0.7529 0.8291 0.6544 -0.0483 -0.0173 0.0806  97  LYS B CA  
2250 C  C   . LYS B 78  ? 0.7796 0.8492 0.6971 -0.0588 -0.0148 0.0704  97  LYS B C   
2251 O  O   . LYS B 78  ? 0.8011 0.8779 0.7289 -0.0698 -0.0081 0.0661  97  LYS B O   
2252 C  CB  . LYS B 78  ? 0.7504 0.8077 0.6385 -0.0417 -0.0114 0.0960  97  LYS B CB  
2253 C  CG  . LYS B 78  ? 0.9047 0.9462 0.7887 -0.0497 0.0033  0.1054  97  LYS B CG  
2254 C  CD  . LYS B 78  ? 0.9838 1.0025 0.8457 -0.0377 0.0083  0.1233  97  LYS B CD  
2255 N  N   . GLU B 79  ? 0.8364 0.8962 0.7562 -0.0560 -0.0200 0.0649  98  GLU B N   
2256 C  CA  . GLU B 79  ? 0.8477 0.9034 0.7799 -0.0648 -0.0199 0.0523  98  GLU B CA  
2257 C  C   . GLU B 79  ? 0.8152 0.8970 0.7566 -0.0684 -0.0258 0.0396  98  GLU B C   
2258 O  O   . GLU B 79  ? 0.8180 0.9078 0.7730 -0.0787 -0.0237 0.0294  98  GLU B O   
2259 C  CB  . GLU B 79  ? 0.8662 0.9095 0.7955 -0.0583 -0.0249 0.0481  98  GLU B CB  
2260 C  CG  . GLU B 79  ? 1.1251 1.1418 1.0479 -0.0529 -0.0186 0.0573  98  GLU B CG  
2261 N  N   . LEU B 80  ? 0.7510 0.8457 0.6841 -0.0591 -0.0332 0.0391  99  LEU B N   
2262 C  CA  . LEU B 80  ? 0.6696 0.7857 0.6058 -0.0566 -0.0391 0.0288  99  LEU B CA  
2263 C  C   . LEU B 80  ? 0.6645 0.8006 0.6107 -0.0618 -0.0330 0.0286  99  LEU B C   
2264 O  O   . LEU B 80  ? 0.6977 0.8563 0.6581 -0.0652 -0.0344 0.0173  99  LEU B O   
2265 C  CB  . LEU B 80  ? 0.7311 0.8456 0.6502 -0.0452 -0.0457 0.0300  99  LEU B CB  
2266 C  CG  . LEU B 80  ? 0.7904 0.8902 0.7003 -0.0415 -0.0504 0.0276  99  LEU B CG  
2267 C  CD1 . LEU B 80  ? 0.7022 0.7948 0.5953 -0.0362 -0.0523 0.0315  99  LEU B CD1 
2268 C  CD2 . LEU B 80  ? 0.6082 0.7138 0.5188 -0.0386 -0.0563 0.0159  99  LEU B CD2 
2269 N  N   . LEU B 81  ? 0.6457 0.7770 0.5847 -0.0619 -0.0260 0.0405  100 LEU B N   
2270 C  CA  . LEU B 81  ? 0.6511 0.7992 0.5960 -0.0669 -0.0173 0.0426  100 LEU B CA  
2271 C  C   . LEU B 81  ? 0.7342 0.8870 0.6984 -0.0839 -0.0068 0.0387  100 LEU B C   
2272 O  O   . LEU B 81  ? 0.7137 0.8941 0.6917 -0.0897 -0.0017 0.0322  100 LEU B O   
2273 C  CB  . LEU B 81  ? 0.6707 0.8085 0.5984 -0.0628 -0.0117 0.0572  100 LEU B CB  
2274 C  CG  . LEU B 81  ? 0.7052 0.8596 0.6323 -0.0654 -0.0014 0.0611  100 LEU B CG  
2275 C  CD1 . LEU B 81  ? 0.6586 0.8380 0.5860 -0.0560 -0.0074 0.0508  100 LEU B CD1 
2276 C  CD2 . LEU B 81  ? 0.6623 0.8016 0.5677 -0.0604 0.0033  0.0766  100 LEU B CD2 
2277 N  N   . GLN B 82  ? 0.8249 0.9521 0.7907 -0.0925 -0.0027 0.0408  101 GLN B N   
2278 C  CA  A GLN B 82  ? 0.8194 0.9450 0.8022 -0.1127 0.0091  0.0353  101 GLN B CA  
2279 C  CA  B GLN B 82  ? 0.8233 0.9483 0.8060 -0.1128 0.0091  0.0354  101 GLN B CA  
2280 C  C   . GLN B 82  ? 0.7408 0.9009 0.7474 -0.1200 0.0025  0.0142  101 GLN B C   
2281 O  O   . GLN B 82  ? 0.8061 0.9868 0.8328 -0.1370 0.0118  0.0059  101 GLN B O   
2282 C  CB  A GLN B 82  ? 0.9248 1.0077 0.8991 -0.1181 0.0153  0.0419  101 GLN B CB  
2283 C  CB  B GLN B 82  ? 0.9302 1.0129 0.9052 -0.1183 0.0146  0.0407  101 GLN B CB  
2284 C  CG  A GLN B 82  ? 0.9696 1.0228 0.9213 -0.1113 0.0246  0.0632  101 GLN B CG  
2285 C  CG  B GLN B 82  ? 0.9659 1.0431 0.9466 -0.1176 0.0044  0.0268  101 GLN B CG  
2286 C  CD  A GLN B 82  ? 1.0560 1.0648 0.9949 -0.1092 0.0292  0.0709  101 GLN B CD  
2287 C  CD  B GLN B 82  ? 0.9673 1.0018 0.9341 -0.1139 0.0076  0.0340  101 GLN B CD  
2288 O  OE1 A GLN B 82  ? 0.9911 0.9902 0.9363 -0.1105 0.0238  0.0601  101 GLN B OE1 
2289 O  OE1 B GLN B 82  ? 0.9429 0.9467 0.8980 -0.1157 0.0198  0.0480  101 GLN B OE1 
2290 N  NE2 A GLN B 82  ? 0.9865 0.9674 0.9045 -0.1033 0.0393  0.0897  101 GLN B NE2 
2291 N  NE2 B GLN B 82  ? 0.8550 0.8866 0.8206 -0.1067 -0.0026 0.0247  101 GLN B NE2 
2292 N  N   . LYS B 83  ? 0.7130 0.8814 0.7164 -0.1066 -0.0131 0.0054  102 LYS B N   
2293 C  CA  . LYS B 83  ? 0.8304 1.0332 0.8506 -0.1067 -0.0231 -0.0142 102 LYS B CA  
2294 C  C   . LYS B 83  ? 0.7893 1.0350 0.8193 -0.0989 -0.0255 -0.0197 102 LYS B C   
2295 O  O   . LYS B 83  ? 0.7735 1.0582 0.8257 -0.1038 -0.0289 -0.0365 102 LYS B O   
2296 C  CB  . LYS B 83  ? 0.9274 1.1194 0.9329 -0.0916 -0.0377 -0.0186 102 LYS B CB  
2297 C  CG  . LYS B 83  ? 1.0821 1.2385 1.0805 -0.0976 -0.0359 -0.0173 102 LYS B CG  
2298 C  CD  . LYS B 83  ? 1.2208 1.3625 1.1992 -0.0812 -0.0464 -0.0160 102 LYS B CD  
2299 C  CE  . LYS B 83  ? 1.3289 1.4372 1.3005 -0.0848 -0.0428 -0.0139 102 LYS B CE  
2300 N  NZ  . LYS B 83  ? 1.2255 1.3195 1.1777 -0.0702 -0.0488 -0.0094 102 LYS B NZ  
2301 N  N   . ALA B 84  ? 0.8270 1.0675 0.8406 -0.0860 -0.0240 -0.0073 103 ALA B N   
2302 C  CA  . ALA B 84  ? 0.6916 0.9669 0.7094 -0.0750 -0.0249 -0.0112 103 ALA B CA  
2303 C  C   . ALA B 84  ? 0.6310 0.8953 0.6367 -0.0756 -0.0128 0.0039  103 ALA B C   
2304 O  O   . ALA B 84  ? 0.6584 0.9096 0.6420 -0.0602 -0.0173 0.0111  103 ALA B O   
2305 C  CB  . ALA B 84  ? 0.6149 0.8897 0.6146 -0.0511 -0.0400 -0.0149 103 ALA B CB  
2306 N  N   . PRO B 85  ? 0.5909 0.8585 0.6086 -0.0942 0.0033  0.0084  104 PRO B N   
2307 C  CA  . PRO B 85  ? 0.5886 0.8418 0.5893 -0.0941 0.0155  0.0246  104 PRO B CA  
2308 C  C   . PRO B 85  ? 0.6464 0.9237 0.6396 -0.0799 0.0164  0.0245  104 PRO B C   
2309 O  O   . PRO B 85  ? 0.6823 0.9421 0.6531 -0.0746 0.0215  0.0375  104 PRO B O   
2310 C  CB  . PRO B 85  ? 0.6514 0.9015 0.6657 -0.1187 0.0347  0.0282  104 PRO B CB  
2311 C  CG  . PRO B 85  ? 0.6184 0.8969 0.6640 -0.1328 0.0329  0.0090  104 PRO B CG  
2312 C  CD  . PRO B 85  ? 0.6129 0.8910 0.6561 -0.1177 0.0122  -0.0006 104 PRO B CD  
2313 N  N   . ASN B 86  ? 0.6009 0.9180 0.6110 -0.0720 0.0110  0.0093  105 ASN B N   
2314 C  CA  . ASN B 86  ? 0.5974 0.9392 0.6014 -0.0555 0.0118  0.0062  105 ASN B CA  
2315 C  C   . ASN B 86  ? 0.5389 0.8709 0.5237 -0.0307 -0.0050 0.0012  105 ASN B C   
2316 O  O   . ASN B 86  ? 0.6136 0.9640 0.5926 -0.0134 -0.0064 -0.0045 105 ASN B O   
2317 C  CB  . ASN B 86  ? 0.6429 1.0398 0.6796 -0.0619 0.0198  -0.0077 105 ASN B CB  
2318 C  CG  . ASN B 86  ? 0.6468 1.0502 0.7009 -0.0902 0.0403  -0.0031 105 ASN B CG  
2319 O  OD1 . ASN B 86  ? 0.6892 1.0832 0.7298 -0.0947 0.0554  0.0092  105 ASN B OD1 
2320 N  ND2 . ASN B 86  ? 0.6171 1.0372 0.6999 -0.1097 0.0418  -0.0142 105 ASN B ND2 
2321 N  N   . ASN B 87  ? 0.5315 0.8312 0.5038 -0.0286 -0.0161 0.0038  106 ASN B N   
2322 C  CA  . ASN B 87  ? 0.5963 0.8784 0.5464 -0.0082 -0.0292 0.0007  106 ASN B CA  
2323 C  C   . ASN B 87  ? 0.5842 0.8360 0.5056 -0.0034 -0.0269 0.0109  106 ASN B C   
2324 O  O   . ASN B 87  ? 0.5746 0.8011 0.4875 -0.0135 -0.0254 0.0208  106 ASN B O   
2325 C  CB  . ASN B 87  ? 0.5785 0.8414 0.5272 -0.0103 -0.0394 -0.0010 106 ASN B CB  
2326 C  CG  . ASN B 87  ? 0.6225 0.8632 0.5453 0.0091  -0.0504 -0.0031 106 ASN B CG  
2327 O  OD1 . ASN B 87  ? 0.7335 0.9492 0.6319 0.0165  -0.0498 0.0021  106 ASN B OD1 
2328 N  ND2 . ASN B 87  ? 0.6753 0.9217 0.6006 0.0161  -0.0598 -0.0110 106 ASN B ND2 
2329 N  N   . VAL B 88  ? 0.5779 0.8346 0.4847 0.0127  -0.0270 0.0067  107 VAL B N   
2330 C  CA  . VAL B 88  ? 0.6070 0.8383 0.4857 0.0169  -0.0250 0.0124  107 VAL B CA  
2331 C  C   . VAL B 88  ? 0.5963 0.7877 0.4536 0.0156  -0.0331 0.0161  107 VAL B C   
2332 O  O   . VAL B 88  ? 0.6492 0.8248 0.4923 0.0097  -0.0314 0.0221  107 VAL B O   
2333 C  CB  . VAL B 88  ? 0.6189 0.8596 0.4835 0.0361  -0.0232 0.0045  107 VAL B CB  
2334 C  CG1 . VAL B 88  ? 0.5886 0.8743 0.4763 0.0351  -0.0124 0.0012  107 VAL B CG1 
2335 C  CG2 . VAL B 88  ? 0.5971 0.8276 0.4503 0.0564  -0.0329 -0.0044 107 VAL B CG2 
2336 N  N   . ASP B 89  ? 0.5974 0.7761 0.4528 0.0206  -0.0412 0.0121  108 ASP B N   
2337 C  CA  . ASP B 89  ? 0.6518 0.7949 0.4889 0.0171  -0.0465 0.0150  108 ASP B CA  
2338 C  C   . ASP B 89  ? 0.6838 0.8246 0.5337 0.0002  -0.0454 0.0230  108 ASP B C   
2339 O  O   . ASP B 89  ? 0.6822 0.8048 0.5202 -0.0055 -0.0463 0.0268  108 ASP B O   
2340 C  CB  . ASP B 89  ? 0.7184 0.8470 0.5463 0.0278  -0.0535 0.0099  108 ASP B CB  
2341 C  CG  . ASP B 89  ? 0.8775 1.0024 0.6871 0.0500  -0.0553 0.0028  108 ASP B CG  
2342 O  OD1 . ASP B 89  ? 0.8569 0.9800 0.6547 0.0564  -0.0510 0.0008  108 ASP B OD1 
2343 O  OD2 . ASP B 89  ? 1.0592 1.1817 0.8634 0.0633  -0.0613 -0.0009 108 ASP B OD2 
2344 N  N   . CSX B 90  ? 0.6399 0.7993 0.5135 -0.0070 -0.0432 0.0243  109 CSX B N   
2345 C  CA  . CSX B 90  ? 0.6539 0.8076 0.5379 -0.0203 -0.0406 0.0322  109 CSX B CA  
2346 C  CB  . CSX B 90  ? 0.6879 0.8566 0.5958 -0.0281 -0.0383 0.0291  109 CSX B CB  
2347 S  SG  . CSX B 90  ? 0.8718 1.0424 0.7818 -0.0208 -0.0480 0.0180  109 CSX B SG  
2348 C  C   . CSX B 90  ? 0.6179 0.7728 0.4969 -0.0247 -0.0339 0.0415  109 CSX B C   
2349 O  O   . CSX B 90  ? 0.6878 0.8306 0.5618 -0.0287 -0.0345 0.0488  109 CSX B O   
2350 O  OD  . CSX B 90  ? 1.0610 1.2037 0.9566 -0.0209 -0.0522 0.0214  109 CSX B OD  
2351 N  N   . LEU B 91  ? 0.5778 0.7499 0.4572 -0.0223 -0.0274 0.0412  110 LEU B N   
2352 C  CA  . LEU B 91  ? 0.6037 0.7768 0.4723 -0.0241 -0.0205 0.0504  110 LEU B CA  
2353 C  C   . LEU B 91  ? 0.6272 0.7861 0.4720 -0.0185 -0.0272 0.0502  110 LEU B C   
2354 O  O   . LEU B 91  ? 0.6388 0.7926 0.4756 -0.0208 -0.0277 0.0582  110 LEU B O   
2355 C  CB  . LEU B 91  ? 0.5974 0.7936 0.4697 -0.0222 -0.0107 0.0485  110 LEU B CB  
2356 C  CG  . LEU B 91  ? 0.6487 0.8635 0.5451 -0.0337 0.0003  0.0500  110 LEU B CG  
2357 C  CD1 . LEU B 91  ? 0.6003 0.8472 0.5050 -0.0297 0.0086  0.0427  110 LEU B CD1 
2358 C  CD2 . LEU B 91  ? 0.6762 0.8767 0.5672 -0.0440 0.0104  0.0652  110 LEU B CD2 
2359 N  N   . GLU B 92  ? 0.6470 0.7992 0.4806 -0.0112 -0.0325 0.0402  111 GLU B N   
2360 C  CA  . GLU B 92  ? 0.6428 0.7794 0.4545 -0.0094 -0.0378 0.0358  111 GLU B CA  
2361 C  C   . GLU B 92  ? 0.6319 0.7581 0.4457 -0.0174 -0.0435 0.0387  111 GLU B C   
2362 O  O   . GLU B 92  ? 0.5903 0.7181 0.3945 -0.0200 -0.0463 0.0397  111 GLU B O   
2363 C  CB  . GLU B 92  ? 0.6477 0.7694 0.4462 -0.0008 -0.0403 0.0249  111 GLU B CB  
2364 C  CG  . GLU B 92  ? 0.6920 0.7892 0.4659 -0.0022 -0.0439 0.0174  111 GLU B CG  
2365 C  CD  . GLU B 92  ? 0.7812 0.8516 0.5398 0.0060  -0.0449 0.0095  111 GLU B CD  
2366 O  OE1 . GLU B 92  ? 0.7557 0.8325 0.5181 0.0192  -0.0438 0.0080  111 GLU B OE1 
2367 O  OE2 . GLU B 92  ? 0.7093 0.7521 0.4508 -0.0006 -0.0463 0.0047  111 GLU B OE2 
2368 N  N   . ALA B 93  ? 0.6281 0.7472 0.4540 -0.0202 -0.0456 0.0386  112 ALA B N   
2369 C  CA  . ALA B 93  ? 0.6294 0.7420 0.4599 -0.0268 -0.0494 0.0407  112 ALA B CA  
2370 C  C   . ALA B 93  ? 0.6366 0.7607 0.4745 -0.0283 -0.0485 0.0508  112 ALA B C   
2371 O  O   . ALA B 93  ? 0.6204 0.7484 0.4556 -0.0300 -0.0527 0.0513  112 ALA B O   
2372 C  CB  . ALA B 93  ? 0.5911 0.6950 0.4316 -0.0278 -0.0503 0.0390  112 ALA B CB  
2373 N  N   . CYS B 94  ? 0.6977 0.8276 0.5436 -0.0273 -0.0424 0.0583  113 CYS B N   
2374 C  CA  A CYS B 94  ? 0.6474 0.7797 0.4939 -0.0263 -0.0393 0.0705  113 CYS B CA  
2375 C  CA  B CYS B 94  ? 0.6734 0.8054 0.5203 -0.0264 -0.0393 0.0703  113 CYS B CA  
2376 C  C   . CYS B 94  ? 0.7175 0.8589 0.5459 -0.0211 -0.0408 0.0739  113 CYS B C   
2377 O  O   . CYS B 94  ? 0.7269 0.8724 0.5501 -0.0168 -0.0452 0.0795  113 CYS B O   
2378 C  CB  A CYS B 94  ? 0.6431 0.7735 0.4990 -0.0296 -0.0291 0.0775  113 CYS B CB  
2379 C  CB  B CYS B 94  ? 0.7021 0.8323 0.5599 -0.0302 -0.0294 0.0763  113 CYS B CB  
2380 S  SG  A CYS B 94  ? 0.6452 0.7663 0.5222 -0.0366 -0.0281 0.0733  113 CYS B SG  
2381 S  SG  B CYS B 94  ? 0.8213 0.9372 0.6799 -0.0304 -0.0226 0.0914  113 CYS B SG  
2382 N  N   . ALA B 95  ? 0.6689 0.8159 0.4866 -0.0194 -0.0379 0.0696  114 ALA B N   
2383 C  CA  . ALA B 95  ? 0.6814 0.8377 0.4782 -0.0141 -0.0393 0.0706  114 ALA B CA  
2384 C  C   . ALA B 95  ? 0.7004 0.8615 0.4892 -0.0147 -0.0507 0.0621  114 ALA B C   
2385 O  O   . ALA B 95  ? 0.6585 0.8317 0.4361 -0.0096 -0.0553 0.0660  114 ALA B O   
2386 C  CB  . ALA B 95  ? 0.7358 0.8963 0.5227 -0.0117 -0.0338 0.0642  114 ALA B CB  
2387 N  N   . GLU B 96  ? 0.6695 0.8221 0.4638 -0.0210 -0.0546 0.0505  115 GLU B N   
2388 C  CA  . GLU B 96  ? 0.7168 0.8739 0.5074 -0.0270 -0.0630 0.0399  115 GLU B CA  
2389 C  C   . GLU B 96  ? 0.7129 0.8858 0.5151 -0.0258 -0.0685 0.0456  115 GLU B C   
2390 O  O   . GLU B 96  ? 0.6932 0.8856 0.4905 -0.0260 -0.0760 0.0402  115 GLU B O   
2391 C  CB  . GLU B 96  ? 0.7401 0.8776 0.5326 -0.0353 -0.0622 0.0290  115 GLU B CB  
2392 C  CG  . GLU B 96  ? 0.8147 0.9360 0.5894 -0.0331 -0.0588 0.0205  115 GLU B CG  
2393 C  CD  . GLU B 96  ? 0.8326 0.9269 0.6032 -0.0362 -0.0564 0.0135  115 GLU B CD  
2394 O  OE1 . GLU B 96  ? 0.8664 0.9540 0.6462 -0.0431 -0.0569 0.0137  115 GLU B OE1 
2395 O  OE2 . GLU B 96  ? 0.8051 0.8836 0.5605 -0.0296 -0.0532 0.0082  115 GLU B OE2 
2396 N  N   . MSE B 97  ? 0.6164 0.7827 0.4341 -0.0237 -0.0650 0.0549  116 MSE B N   
2397 C  CA  . MSE B 97  ? 0.6003 0.7785 0.4280 -0.0184 -0.0688 0.0613  116 MSE B CA  
2398 C  C   . MSE B 97  ? 0.6629 0.8534 0.4779 -0.0053 -0.0709 0.0727  116 MSE B C   
2399 O  O   . MSE B 97  ? 0.6813 0.8927 0.4971 0.0018  -0.0788 0.0729  116 MSE B O   
2400 C  CB  . MSE B 97  ? 0.5658 0.7287 0.4091 -0.0185 -0.0636 0.0672  116 MSE B CB  
2401 C  CG  . MSE B 97  ? 0.6103 0.7631 0.4625 -0.0288 -0.0628 0.0565  116 MSE B CG  
2402 SE SE  . MSE B 97  ? 0.6406 0.8120 0.4964 -0.0387 -0.0691 0.0420  116 MSE B SE  
2403 C  CE  . MSE B 97  ? 0.6957 0.8628 0.5296 -0.0474 -0.0708 0.0294  116 MSE B CE  
2404 N  N   . GLN B 98  ? 0.6749 0.8550 0.4766 -0.0017 -0.0637 0.0815  117 GLN B N   
2405 C  CA  . GLN B 98  ? 0.7210 0.9074 0.5032 0.0112  -0.0634 0.0940  117 GLN B CA  
2406 C  C   . GLN B 98  ? 0.7292 0.9413 0.4954 0.0153  -0.0742 0.0851  117 GLN B C   
2407 O  O   . GLN B 98  ? 0.7376 0.9647 0.4908 0.0293  -0.0804 0.0927  117 GLN B O   
2408 C  CB  . GLN B 98  ? 0.7530 0.9222 0.5247 0.0111  -0.0497 0.1052  117 GLN B CB  
2409 C  CG  . GLN B 98  ? 0.7394 0.8855 0.5243 0.0074  -0.0386 0.1153  117 GLN B CG  
2410 C  CD  . GLN B 98  ? 0.8137 0.9481 0.5916 0.0195  -0.0377 0.1306  117 GLN B CD  
2411 O  OE1 . GLN B 98  ? 0.7941 0.9386 0.5774 0.0274  -0.0478 0.1283  117 GLN B OE1 
2412 N  NE2 . GLN B 98  ? 0.8431 0.9549 0.6087 0.0212  -0.0241 0.1462  117 GLN B NE2 
2413 N  N   . VAL B 99  ? 0.7559 0.9716 0.5209 0.0041  -0.0768 0.0684  118 VAL B N   
2414 C  CA  . VAL B 99  ? 0.7843 1.0231 0.5352 0.0036  -0.0872 0.0549  118 VAL B CA  
2415 C  C   . VAL B 99  ? 0.7340 0.9996 0.5001 0.0025  -0.0990 0.0471  118 VAL B C   
2416 O  O   . VAL B 99  ? 0.7389 1.0340 0.4959 0.0122  -0.1095 0.0455  118 VAL B O   
2417 C  CB  . VAL B 99  ? 0.8388 1.0661 0.5835 -0.0094 -0.0851 0.0375  118 VAL B CB  
2418 C  CG1 . VAL B 99  ? 0.7453 0.9938 0.4773 -0.0145 -0.0959 0.0193  118 VAL B CG1 
2419 C  CG2 . VAL B 99  ? 0.7972 1.0077 0.5277 -0.0046 -0.0741 0.0439  118 VAL B CG2 
2420 N  N   . CYS B 100 ? 0.7129 0.9714 0.5020 -0.0078 -0.0970 0.0423  119 CYS B N   
2421 C  CA  . CYS B 100 ? 0.7027 0.9896 0.5108 -0.0101 -0.1054 0.0343  119 CYS B CA  
2422 C  C   . CYS B 100 ? 0.7217 1.0276 0.5324 0.0111  -0.1106 0.0487  119 CYS B C   
2423 O  O   . CYS B 100 ? 0.7663 1.1103 0.5863 0.0157  -0.1214 0.0410  119 CYS B O   
2424 C  CB  . CYS B 100 ? 0.7618 1.0324 0.5900 -0.0247 -0.0989 0.0284  119 CYS B CB  
2425 S  SG  . CYS B 100 ? 0.8148 1.0579 0.6333 -0.0453 -0.0929 0.0127  119 CYS B SG  
2426 N  N   . ARG B 101 ? 0.7820 1.0617 0.5836 0.0242  -0.1026 0.0686  120 ARG B N   
2427 C  CA  . ARG B 101 ? 0.7726 1.0574 0.5685 0.0474  -0.1051 0.0852  120 ARG B CA  
2428 C  C   . ARG B 101 ? 0.8388 1.1375 0.6052 0.0656  -0.1113 0.0937  120 ARG B C   
2429 O  O   . ARG B 101 ? 0.8639 1.1635 0.6181 0.0887  -0.1136 0.1092  120 ARG B O   
2430 C  CB  . ARG B 101 ? 0.7761 1.0187 0.5720 0.0509  -0.0912 0.1025  120 ARG B CB  
2431 C  CG  . ARG B 101 ? 0.7487 0.9789 0.5703 0.0387  -0.0863 0.0960  120 ARG B CG  
2432 C  CD  . ARG B 101 ? 0.8593 1.0493 0.6812 0.0384  -0.0732 0.1087  120 ARG B CD  
2433 N  NE  . ARG B 101 ? 0.8995 1.0757 0.7116 0.0585  -0.0707 0.1250  120 ARG B NE  
2434 C  CZ  . ARG B 101 ? 0.9705 1.1148 0.7625 0.0661  -0.0604 0.1424  120 ARG B CZ  
2435 N  NH1 . ARG B 101 ? 1.0413 1.1670 0.8246 0.0537  -0.0500 0.1462  120 ARG B NH1 
2436 N  NH2 . ARG B 101 ? 1.0073 1.1355 0.7878 0.0865  -0.0587 0.1564  120 ARG B NH2 
2437 N  N   . GLY B 102 ? 0.8725 1.1797 0.6237 0.0575  -0.1139 0.0841  121 GLY B N   
2438 C  CA  . GLY B 102 ? 0.8480 1.1672 0.5666 0.0744  -0.1191 0.0915  121 GLY B CA  
2439 C  C   . GLY B 102 ? 0.9082 1.1886 0.6022 0.0833  -0.1037 0.1145  121 GLY B C   
2440 O  O   . GLY B 102 ? 1.0025 1.2856 0.6652 0.1021  -0.1052 0.1273  121 GLY B O   
2441 N  N   . GLN B 103 ? 0.8344 1.0803 0.5414 0.0693  -0.0885 0.1192  122 GLN B N   
2442 C  CA  . GLN B 103 ? 0.9059 1.1170 0.5958 0.0713  -0.0711 0.1381  122 GLN B CA  
2443 C  C   . GLN B 103 ? 0.9373 1.1485 0.6205 0.0578  -0.0648 0.1282  122 GLN B C   
2444 O  O   . GLN B 103 ? 0.9007 1.0951 0.5998 0.0430  -0.0540 0.1248  122 GLN B O   
2445 C  CB  . GLN B 103 ? 0.9187 1.0988 0.6300 0.0637  -0.0595 0.1457  122 GLN B CB  
2446 C  CG  . GLN B 103 ? 0.9478 1.1234 0.6636 0.0793  -0.0642 0.1550  122 GLN B CG  
2447 C  CD  . GLN B 103 ? 1.0340 1.1956 0.7150 0.1038  -0.0614 0.1771  122 GLN B CD  
2448 O  OE1 . GLN B 103 ? 1.1552 1.2907 0.8119 0.1037  -0.0471 0.1916  122 GLN B OE1 
2449 N  NE2 . GLN B 103 ? 1.0333 1.2123 0.7107 0.1258  -0.0740 0.1800  122 GLN B NE2 
2450 N  N   . GLU B 104 ? 0.8744 1.1073 0.5332 0.0651  -0.0728 0.1223  123 GLU B N   
2451 C  CA  . GLU B 104 ? 0.9501 1.1860 0.5972 0.0565  -0.0686 0.1107  123 GLU B CA  
2452 C  C   . GLU B 104 ? 0.9790 1.1923 0.6127 0.0559  -0.0486 0.1255  123 GLU B C   
2453 O  O   . GLU B 104 ? 1.0576 1.2662 0.6999 0.0445  -0.0403 0.1164  123 GLU B O   
2454 C  CB  . GLU B 104 ? 0.8877 1.1522 0.5076 0.0660  -0.0820 0.1006  123 GLU B CB  
2455 N  N   . LYS B 105 ? 1.0366 1.2357 0.6488 0.0687  -0.0401 0.1482  124 LYS B N   
2456 C  CA  . LYS B 105 ? 1.1081 1.2852 0.7065 0.0655  -0.0177 0.1637  124 LYS B CA  
2457 C  C   . LYS B 105 ? 0.9677 1.1292 0.6020 0.0466  -0.0059 0.1605  124 LYS B C   
2458 O  O   . LYS B 105 ? 0.9812 1.1463 0.6233 0.0360  0.0045  0.1533  124 LYS B O   
2459 C  CB  . LYS B 105 ? 1.2063 1.3612 0.7737 0.0814  -0.0090 0.1905  124 LYS B CB  
2460 C  CG  . LYS B 105 ? 1.4704 1.6067 1.0100 0.0799  0.0145  0.2069  124 LYS B CG  
2461 C  CD  . LYS B 105 ? 1.6728 1.8304 1.1754 0.0917  0.0109  0.2036  124 LYS B CD  
2462 C  CE  . LYS B 105 ? 1.7660 1.9063 1.2371 0.0912  0.0365  0.2213  124 LYS B CE  
2463 N  NZ  . LYS B 105 ? 1.9193 2.0226 1.3602 0.1023  0.0497  0.2508  124 LYS B NZ  
2464 N  N   . ASP B 106 ? 0.9335 1.0818 0.5896 0.0440  -0.0091 0.1638  125 ASP B N   
2465 C  CA  . ASP B 106 ? 0.9017 1.0373 0.5909 0.0269  -0.0001 0.1592  125 ASP B CA  
2466 C  C   . ASP B 106 ? 0.8771 1.0307 0.5900 0.0164  -0.0081 0.1367  125 ASP B C   
2467 O  O   . ASP B 106 ? 0.7954 0.9476 0.5263 0.0050  0.0014  0.1314  125 ASP B O   
2468 C  CB  . ASP B 106 ? 0.8724 0.9885 0.5765 0.0277  -0.0022 0.1659  125 ASP B CB  
2469 C  CG  . ASP B 106 ? 0.9589 1.0589 0.6905 0.0099  0.0098  0.1633  125 ASP B CG  
2470 O  OD1 . ASP B 106 ? 1.0455 1.1316 0.7726 0.0012  0.0282  0.1724  125 ASP B OD1 
2471 O  OD2 . ASP B 106 ? 0.9196 1.0225 0.6771 0.0037  0.0017  0.1514  125 ASP B OD2 
2472 N  N   . ALA B 107 ? 0.8131 0.9831 0.5247 0.0205  -0.0247 0.1232  126 ALA B N   
2473 C  CA  . ALA B 107 ? 0.8214 0.9994 0.5481 0.0116  -0.0306 0.1031  126 ALA B CA  
2474 C  C   . ALA B 107 ? 0.8505 1.0340 0.5663 0.0107  -0.0218 0.0971  126 ALA B C   
2475 O  O   . ALA B 107 ? 0.7359 0.9182 0.4676 0.0044  -0.0179 0.0874  126 ALA B O   
2476 C  CB  . ALA B 107 ? 0.8201 1.0118 0.5437 0.0131  -0.0473 0.0895  126 ALA B CB  
2477 N  N   . LEU B 108 ? 0.8058 0.9967 0.4930 0.0194  -0.0188 0.1029  127 LEU B N   
2478 C  CA  . LEU B 108 ? 0.8668 1.0652 0.5395 0.0211  -0.0093 0.0974  127 LEU B CA  
2479 C  C   . LEU B 108 ? 0.8780 1.0735 0.5665 0.0142  0.0098  0.1053  127 LEU B C   
2480 O  O   . LEU B 108 ? 0.8379 1.0427 0.5342 0.0125  0.0158  0.0944  127 LEU B O   
2481 C  CB  . LEU B 108 ? 0.9199 1.1269 0.5548 0.0329  -0.0097 0.1033  127 LEU B CB  
2482 C  CG  . LEU B 108 ? 1.0507 1.2683 0.6649 0.0369  -0.0066 0.0900  127 LEU B CG  
2483 C  CD1 . LEU B 108 ? 0.9894 1.2093 0.6055 0.0343  -0.0230 0.0668  127 LEU B CD1 
2484 C  CD2 . LEU B 108 ? 1.0722 1.2975 0.6464 0.0491  -0.0033 0.0997  127 LEU B CD2 
2485 N  N   . ARG B 109 ? 0.8938 1.0770 0.5871 0.0103  0.0193  0.1228  128 ARG B N   
2486 C  CA  . ARG B 109 ? 0.9522 1.1333 0.6646 -0.0013 0.0382  0.1288  128 ARG B CA  
2487 C  C   . ARG B 109 ? 0.9090 1.0981 0.6572 -0.0100 0.0340  0.1130  128 ARG B C   
2488 O  O   . ARG B 109 ? 0.9477 1.1530 0.7112 -0.0150 0.0442  0.1061  128 ARG B O   
2489 C  CB  . ARG B 109 ? 0.9537 1.1105 0.6648 -0.0059 0.0470  0.1481  128 ARG B CB  
2490 C  CG  . ARG B 109 ? 1.0468 1.1985 0.7777 -0.0228 0.0679  0.1532  128 ARG B CG  
2491 C  CD  . ARG B 109 ? 1.0978 1.2162 0.8280 -0.0286 0.0749  0.1690  128 ARG B CD  
2492 N  NE  . ARG B 109 ? 1.0429 1.1532 0.7921 -0.0272 0.0580  0.1618  128 ARG B NE  
2493 C  CZ  . ARG B 109 ? 1.1330 1.2491 0.9160 -0.0390 0.0546  0.1484  128 ARG B CZ  
2494 N  NH1 . ARG B 109 ? 1.0333 1.1681 0.8399 -0.0531 0.0650  0.1384  128 ARG B NH1 
2495 N  NH2 . ARG B 109 ? 1.1980 1.3049 0.9916 -0.0355 0.0402  0.1438  128 ARG B NH2 
2496 N  N   . MSE B 110 ? 0.8079 0.9879 0.5680 -0.0101 0.0189  0.1074  129 MSE B N   
2497 C  CA  . MSE B 110 ? 0.7914 0.9750 0.5794 -0.0157 0.0134  0.0941  129 MSE B CA  
2498 C  C   . MSE B 110 ? 0.7685 0.9652 0.5544 -0.0093 0.0091  0.0779  129 MSE B C   
2499 O  O   . MSE B 110 ? 0.6748 0.8836 0.4798 -0.0109 0.0130  0.0695  129 MSE B O   
2500 C  CB  . MSE B 110 ? 0.7502 0.9195 0.5466 -0.0167 0.0003  0.0931  129 MSE B CB  
2501 C  CG  . MSE B 110 ? 0.8901 1.0432 0.6885 -0.0203 0.0055  0.1083  129 MSE B CG  
2502 SE SE  . MSE B 110 ? 0.8928 1.0319 0.7092 -0.0222 -0.0071 0.1045  129 MSE B SE  
2503 C  CE  . MSE B 110 ? 0.6729 0.8190 0.5191 -0.0344 -0.0011 0.0928  129 MSE B CE  
2504 N  N   . TYR B 111 ? 0.7419 0.9366 0.5035 -0.0011 0.0014  0.0727  130 TYR B N   
2505 C  CA  . TYR B 111 ? 0.7229 0.9218 0.4757 0.0063  -0.0012 0.0569  130 TYR B CA  
2506 C  C   . TYR B 111 ? 0.7371 0.9555 0.4889 0.0109  0.0132  0.0557  130 TYR B C   
2507 O  O   . TYR B 111 ? 0.7321 0.9579 0.4906 0.0176  0.0139  0.0436  130 TYR B O   
2508 C  CB  . TYR B 111 ? 0.6821 0.8728 0.4077 0.0110  -0.0114 0.0493  130 TYR B CB  
2509 C  CG  . TYR B 111 ? 0.6721 0.8480 0.4016 0.0059  -0.0250 0.0427  130 TYR B CG  
2510 C  CD1 . TYR B 111 ? 0.7039 0.8660 0.4415 0.0053  -0.0286 0.0317  130 TYR B CD1 
2511 C  CD2 . TYR B 111 ? 0.6844 0.8613 0.4072 0.0030  -0.0338 0.0467  130 TYR B CD2 
2512 C  CE1 . TYR B 111 ? 0.6996 0.8462 0.4385 -0.0012 -0.0381 0.0258  130 TYR B CE1 
2513 C  CE2 . TYR B 111 ? 0.6949 0.8634 0.4239 -0.0035 -0.0444 0.0389  130 TYR B CE2 
2514 C  CZ  . TYR B 111 ? 0.6845 0.8363 0.4214 -0.0072 -0.0453 0.0288  130 TYR B CZ  
2515 O  OH  . TYR B 111 ? 0.7257 0.8671 0.4667 -0.0157 -0.0527 0.0216  130 TYR B OH  
2516 N  N   . GLU B 112 ? 0.7524 0.9787 0.4940 0.0088  0.0252  0.0685  131 GLU B N   
2517 C  CA  . GLU B 112 ? 0.7900 1.0383 0.5321 0.0106  0.0426  0.0687  131 GLU B CA  
2518 C  C   . GLU B 112 ? 0.7265 0.9920 0.5052 0.0011  0.0520  0.0676  131 GLU B C   
2519 O  O   . GLU B 112 ? 0.7870 1.0785 0.5765 0.0051  0.0611  0.0588  131 GLU B O   
2520 C  CB  . GLU B 112 ? 0.9070 1.1553 0.6220 0.0107  0.0547  0.0839  131 GLU B CB  
2521 C  CG  . GLU B 112 ? 1.0246 1.2676 0.7025 0.0231  0.0454  0.0788  131 GLU B CG  
2522 C  CD  . GLU B 112 ? 1.3572 1.6003 1.0017 0.0271  0.0550  0.0938  131 GLU B CD  
2523 O  OE1 . GLU B 112 ? 1.7357 1.9794 1.3824 0.0201  0.0728  0.1101  131 GLU B OE1 
2524 O  OE2 . GLU B 112 ? 1.4755 1.7169 1.0887 0.0371  0.0453  0.0888  131 GLU B OE2 
2525 N  N   . LYS B 113 ? 0.7178 0.9722 0.5162 -0.0107 0.0495  0.0745  132 LYS B N   
2526 C  CA  . LYS B 113 ? 0.7397 1.0120 0.5743 -0.0216 0.0558  0.0697  132 LYS B CA  
2527 C  C   . LYS B 113 ? 0.7229 1.0081 0.5720 -0.0107 0.0435  0.0516  132 LYS B C   
2528 O  O   . LYS B 113 ? 0.6498 0.9665 0.5225 -0.0102 0.0494  0.0420  132 LYS B O   
2529 C  CB  . LYS B 113 ? 0.7766 1.0285 0.6248 -0.0358 0.0545  0.0788  132 LYS B CB  
2530 C  CG  . LYS B 113 ? 0.8322 1.1042 0.7171 -0.0497 0.0610  0.0714  132 LYS B CG  
2531 C  CD  . LYS B 113 ? 0.9653 1.2132 0.8610 -0.0643 0.0612  0.0786  132 LYS B CD  
2532 C  CE  . LYS B 113 ? 1.1039 1.3769 1.0367 -0.0798 0.0673  0.0670  132 LYS B CE  
2533 N  NZ  . LYS B 113 ? 1.1472 1.3953 1.0907 -0.0942 0.0663  0.0698  132 LYS B NZ  
2534 N  N   . ILE B 114 ? 0.6686 0.9300 0.5028 -0.0018 0.0271  0.0472  133 ILE B N   
2535 C  CA  . ILE B 114 ? 0.6435 0.9061 0.4812 0.0110  0.0164  0.0326  133 ILE B CA  
2536 C  C   . ILE B 114 ? 0.6560 0.9408 0.4873 0.0259  0.0230  0.0225  133 ILE B C   
2537 O  O   . ILE B 114 ? 0.6139 0.9212 0.4632 0.0349  0.0224  0.0122  133 ILE B O   
2538 C  CB  . ILE B 114 ? 0.6424 0.8707 0.4581 0.0158  0.0019  0.0301  133 ILE B CB  
2539 C  CG1 . ILE B 114 ? 0.6535 0.8657 0.4808 0.0044  -0.0052 0.0367  133 ILE B CG1 
2540 C  CG2 . ILE B 114 ? 0.6619 0.8828 0.4702 0.0315  -0.0052 0.0166  133 ILE B CG2 
2541 C  CD1 . ILE B 114 ? 0.6162 0.7998 0.4250 0.0051  -0.0168 0.0349  133 ILE B CD1 
2542 N  N   . LEU B 115 ? 0.6897 0.9713 0.4953 0.0302  0.0294  0.0250  134 LEU B N   
2543 C  CA  . LEU B 115 ? 0.7112 1.0129 0.5073 0.0459  0.0374  0.0149  134 LEU B CA  
2544 C  C   . LEU B 115 ? 0.7431 1.0909 0.5685 0.0426  0.0533  0.0138  134 LEU B C   
2545 O  O   . LEU B 115 ? 0.7348 1.1088 0.5672 0.0585  0.0566  0.0013  134 LEU B O   
2546 C  CB  . LEU B 115 ? 0.8184 1.1066 0.5778 0.0506  0.0405  0.0165  134 LEU B CB  
2547 C  CG  . LEU B 115 ? 0.8581 1.1077 0.5892 0.0547  0.0252  0.0108  134 LEU B CG  
2548 C  CD1 . LEU B 115 ? 0.8301 1.0753 0.5266 0.0599  0.0287  0.0086  134 LEU B CD1 
2549 C  CD2 . LEU B 115 ? 0.8315 1.0640 0.5586 0.0688  0.0166  -0.0037 134 LEU B CD2 
2550 N  N   . GLN B 116 ? 0.7121 1.0693 0.5546 0.0223  0.0637  0.0258  135 GLN B N   
2551 C  CA  . GLN B 116 ? 0.7783 1.1791 0.6526 0.0119  0.0808  0.0242  135 GLN B CA  
2552 C  C   . GLN B 116 ? 0.6884 1.1166 0.5985 0.0156  0.0720  0.0099  135 GLN B C   
2553 O  O   . GLN B 116 ? 0.6836 1.1578 0.6159 0.0228  0.0793  -0.0018 135 GLN B O   
2554 C  CB  . GLN B 116 ? 0.9153 1.3059 0.7944 -0.0129 0.0940  0.0411  135 GLN B CB  
2555 C  CG  . GLN B 116 ? 1.0815 1.5108 0.9880 -0.0303 0.1171  0.0415  135 GLN B CG  
2556 C  CD  . GLN B 116 ? 1.2294 1.6330 1.1271 -0.0534 0.1329  0.0612  135 GLN B CD  
2557 O  OE1 . GLN B 116 ? 1.1224 1.4825 1.0001 -0.0553 0.1236  0.0737  135 GLN B OE1 
2558 N  NE2 . GLN B 116 ? 1.1850 1.6150 1.0967 -0.0704 0.1581  0.0641  135 GLN B NE2 
2559 N  N   . LEU B 117 ? 0.6784 1.0811 0.5923 0.0130  0.0558  0.0103  136 LEU B N   
2560 C  CA  . LEU B 117 ? 0.6668 1.0917 0.6080 0.0191  0.0449  -0.0026 136 LEU B CA  
2561 C  C   . LEU B 117 ? 0.7166 1.1459 0.6449 0.0495  0.0343  -0.0156 136 LEU B C   
2562 O  O   . LEU B 117 ? 0.7578 1.2288 0.7097 0.0616  0.0325  -0.0286 136 LEU B O   
2563 C  CB  . LEU B 117 ? 0.6278 1.0207 0.5712 0.0088  0.0318  0.0021  136 LEU B CB  
2564 C  CG  . LEU B 117 ? 0.6432 1.0289 0.6011 -0.0187 0.0411  0.0129  136 LEU B CG  
2565 C  CD1 . LEU B 117 ? 0.6008 0.9499 0.5539 -0.0237 0.0275  0.0173  136 LEU B CD1 
2566 C  CD2 . LEU B 117 ? 0.6070 1.0408 0.6051 -0.0341 0.0524  0.0038  136 LEU B CD2 
2567 N  N   . GLU B 118 ? 0.6800 1.0664 0.5702 0.0620  0.0278  -0.0128 137 GLU B N   
2568 C  CA  . GLU B 118 ? 0.6657 1.0392 0.5337 0.0907  0.0192  -0.0237 137 GLU B CA  
2569 C  C   . GLU B 118 ? 0.6560 1.0000 0.4861 0.0975  0.0234  -0.0224 137 GLU B C   
2570 O  O   . GLU B 118 ? 0.6815 0.9823 0.4873 0.0896  0.0169  -0.0162 137 GLU B O   
2571 C  CB  . GLU B 118 ? 0.6473 0.9829 0.5047 0.0956  0.0024  -0.0239 137 GLU B CB  
2572 C  CG  . GLU B 118 ? 0.7177 1.0237 0.5435 0.1241  -0.0052 -0.0326 137 GLU B CG  
2573 C  CD  . GLU B 118 ? 0.7507 1.0164 0.5622 0.1279  -0.0188 -0.0313 137 GLU B CD  
2574 O  OE1 . GLU B 118 ? 0.6712 0.9205 0.4887 0.1070  -0.0226 -0.0229 137 GLU B OE1 
2575 O  OE2 . GLU B 118 ? 0.8124 1.0598 0.6031 0.1536  -0.0244 -0.0382 137 GLU B OE2 
2576 N  N   . ALA B 119 ? 0.7256 1.0953 0.5509 0.1125  0.0339  -0.0300 138 ALA B N   
2577 C  CA  . ALA B 119 ? 0.7372 1.0832 0.5252 0.1196  0.0391  -0.0312 138 ALA B CA  
2578 C  C   . ALA B 119 ? 0.7771 1.0674 0.5260 0.1329  0.0273  -0.0376 138 ALA B C   
2579 O  O   . ALA B 119 ? 0.8283 1.0900 0.5476 0.1270  0.0274  -0.0365 138 ALA B O   
2580 C  CB  . ALA B 119 ? 0.6748 1.0625 0.4664 0.1356  0.0538  -0.0401 138 ALA B CB  
2581 N  N   . ASP B 120 ? 0.7411 1.0160 0.4882 0.1503  0.0176  -0.0448 139 ASP B N   
2582 C  CA  . ASP B 120 ? 0.8101 1.0254 0.5174 0.1624  0.0092  -0.0510 139 ASP B CA  
2583 C  C   . ASP B 120 ? 0.8171 0.9923 0.5197 0.1448  -0.0019 -0.0437 139 ASP B C   
2584 O  O   . ASP B 120 ? 0.8307 0.9570 0.5044 0.1531  -0.0077 -0.0484 139 ASP B O   
2585 C  CB  . ASP B 120 ? 0.8543 1.0668 0.5515 0.1971  0.0075  -0.0626 139 ASP B CB  
2586 C  CG  . ASP B 120 ? 0.8573 1.0906 0.5812 0.2049  -0.0010 -0.0607 139 ASP B CG  
2587 O  OD1 . ASP B 120 ? 0.9196 1.1725 0.6726 0.1819  -0.0041 -0.0520 139 ASP B OD1 
2588 O  OD2 . ASP B 120 ? 0.9178 1.1475 0.6320 0.2355  -0.0052 -0.0684 139 ASP B OD2 
2589 N  N   . ASN B 121 ? 0.7834 0.9774 0.5128 0.1212  -0.0032 -0.0324 140 ASN B N   
2590 C  CA  . ASN B 121 ? 0.7235 0.8884 0.4536 0.1050  -0.0126 -0.0255 140 ASN B CA  
2591 C  C   . ASN B 121 ? 0.7483 0.8655 0.4433 0.0986  -0.0156 -0.0289 140 ASN B C   
2592 O  O   . ASN B 121 ? 0.7178 0.8374 0.4008 0.0914  -0.0118 -0.0298 140 ASN B O   
2593 C  CB  . ASN B 121 ? 0.6981 0.8892 0.4582 0.0822  -0.0113 -0.0137 140 ASN B CB  
2594 C  CG  . ASN B 121 ? 0.6698 0.8356 0.4327 0.0682  -0.0202 -0.0077 140 ASN B CG  
2595 O  OD1 . ASN B 121 ? 0.7131 0.8544 0.4611 0.0562  -0.0232 -0.0049 140 ASN B OD1 
2596 N  ND2 . ASN B 121 ? 0.6598 0.8363 0.4434 0.0695  -0.0245 -0.0067 140 ASN B ND2 
2597 N  N   . LEU B 122 ? 0.7726 0.8477 0.4498 0.1015  -0.0217 -0.0318 141 LEU B N   
2598 C  CA  . LEU B 122 ? 0.8320 0.8588 0.4755 0.0938  -0.0230 -0.0383 141 LEU B CA  
2599 C  C   . LEU B 122 ? 0.7929 0.8242 0.4441 0.0672  -0.0263 -0.0332 141 LEU B C   
2600 O  O   . LEU B 122 ? 0.7812 0.8076 0.4156 0.0602  -0.0254 -0.0393 141 LEU B O   
2601 C  CB  . LEU B 122 ? 0.8603 0.8383 0.4819 0.1022  -0.0258 -0.0410 141 LEU B CB  
2602 C  CG  . LEU B 122 ? 0.9151 0.8335 0.4964 0.0968  -0.0238 -0.0506 141 LEU B CG  
2603 C  CD1 . LEU B 122 ? 0.9076 0.8144 0.4623 0.1102  -0.0182 -0.0632 141 LEU B CD1 
2604 C  CD2 . LEU B 122 ? 0.9748 0.8457 0.5342 0.1088  -0.0239 -0.0493 141 LEU B CD2 
2605 N  N   . ALA B 123 ? 0.7642 0.8103 0.4415 0.0547  -0.0303 -0.0227 142 ALA B N   
2606 C  CA  . ALA B 123 ? 0.7422 0.7958 0.4287 0.0332  -0.0340 -0.0172 142 ALA B CA  
2607 C  C   . ALA B 123 ? 0.7740 0.8584 0.4646 0.0292  -0.0318 -0.0133 142 ALA B C   
2608 O  O   . ALA B 123 ? 0.7713 0.8532 0.4508 0.0187  -0.0354 -0.0161 142 ALA B O   
2609 C  CB  . ALA B 123 ? 0.7136 0.7774 0.4268 0.0248  -0.0374 -0.0068 142 ALA B CB  
2610 N  N   . ALA B 124 ? 0.7350 0.8499 0.4408 0.0374  -0.0254 -0.0072 143 ALA B N   
2611 C  CA  . ALA B 124 ? 0.7267 0.8678 0.4328 0.0347  -0.0202 -0.0007 143 ALA B CA  
2612 C  C   . ALA B 124 ? 0.7476 0.8828 0.4230 0.0422  -0.0178 -0.0115 143 ALA B C   
2613 O  O   . ALA B 124 ? 0.7781 0.9241 0.4423 0.0375  -0.0179 -0.0085 143 ALA B O   
2614 C  CB  . ALA B 124 ? 0.6946 0.8677 0.4247 0.0381  -0.0108 0.0076  143 ALA B CB  
2615 N  N   . ASN B 125 ? 0.7631 0.8803 0.4226 0.0559  -0.0156 -0.0239 144 ASN B N   
2616 C  CA  . ASN B 125 ? 0.8161 0.9210 0.4432 0.0642  -0.0129 -0.0372 144 ASN B CA  
2617 C  C   . ASN B 125 ? 0.8350 0.9090 0.4385 0.0512  -0.0212 -0.0477 144 ASN B C   
2618 O  O   . ASN B 125 ? 0.8351 0.9100 0.4155 0.0501  -0.0216 -0.0565 144 ASN B O   
2619 C  CB  . ASN B 125 ? 0.8145 0.9094 0.4315 0.0864  -0.0067 -0.0471 144 ASN B CB  
2620 C  CG  . ASN B 125 ? 0.8259 0.9648 0.4617 0.0985  0.0037  -0.0419 144 ASN B CG  
2621 O  OD1 . ASN B 125 ? 0.8008 0.9619 0.4292 0.0981  0.0108  -0.0405 144 ASN B OD1 
2622 N  ND2 . ASN B 125 ? 0.7403 0.8937 0.3988 0.1095  0.0052  -0.0404 144 ASN B ND2 
2623 N  N   . ILE B 126 ? 0.8460 0.8947 0.4549 0.0406  -0.0272 -0.0483 145 ILE B N   
2624 C  CA  . ILE B 126 ? 0.9050 0.9305 0.4977 0.0233  -0.0339 -0.0592 145 ILE B CA  
2625 C  C   . ILE B 126 ? 0.8827 0.9432 0.4867 0.0108  -0.0404 -0.0527 145 ILE B C   
2626 O  O   . ILE B 126 ? 0.8806 0.9441 0.4655 0.0047  -0.0446 -0.0641 145 ILE B O   
2627 C  CB  . ILE B 126 ? 0.8521 0.8459 0.4496 0.0125  -0.0363 -0.0597 145 ILE B CB  
2628 C  CG1 . ILE B 126 ? 0.8596 0.8098 0.4354 0.0277  -0.0303 -0.0666 145 ILE B CG1 
2629 C  CG2 . ILE B 126 ? 0.8741 0.8542 0.4612 -0.0101 -0.0417 -0.0718 145 ILE B CG2 
2630 C  CD1 . ILE B 126 ? 0.8290 0.7466 0.4066 0.0216  -0.0305 -0.0629 145 ILE B CD1 
2631 N  N   . PHE B 127 ? 0.8273 0.9136 0.4599 0.0090  -0.0413 -0.0354 146 PHE B N   
2632 C  CA  . PHE B 127 ? 0.8080 0.9238 0.4486 0.0020  -0.0472 -0.0268 146 PHE B CA  
2633 C  C   . PHE B 127 ? 0.8566 0.9935 0.4781 0.0110  -0.0444 -0.0259 146 PHE B C   
2634 O  O   . PHE B 127 ? 0.8668 1.0156 0.4742 0.0064  -0.0522 -0.0317 146 PHE B O   
2635 C  CB  . PHE B 127 ? 0.7988 0.9316 0.4690 0.0006  -0.0465 -0.0079 146 PHE B CB  
2636 C  CG  . PHE B 127 ? 0.8185 0.9755 0.4917 -0.0027 -0.0527 0.0010  146 PHE B CG  
2637 C  CD1 . PHE B 127 ? 0.8377 0.9985 0.5179 -0.0136 -0.0630 -0.0037 146 PHE B CD1 
2638 C  CD2 . PHE B 127 ? 0.8488 1.0252 0.5143 0.0061  -0.0479 0.0133  146 PHE B CD2 
2639 C  CE1 . PHE B 127 ? 0.8481 1.0350 0.5296 -0.0121 -0.0703 0.0035  146 PHE B CE1 
2640 C  CE2 . PHE B 127 ? 0.8118 1.0069 0.4732 0.0075  -0.0543 0.0225  146 PHE B CE2 
2641 C  CZ  . PHE B 127 ? 0.8043 1.0061 0.4742 0.0001  -0.0666 0.0173  146 PHE B CZ  
2642 N  N   . LEU B 128 ? 0.8479 0.9932 0.4701 0.0235  -0.0334 -0.0188 147 LEU B N   
2643 C  CA  . LEU B 128 ? 0.8794 1.0446 0.4820 0.0326  -0.0272 -0.0158 147 LEU B CA  
2644 C  C   . LEU B 128 ? 0.8758 1.0304 0.4440 0.0370  -0.0291 -0.0356 147 LEU B C   
2645 O  O   . LEU B 128 ? 0.9054 1.0760 0.4523 0.0395  -0.0312 -0.0364 147 LEU B O   
2646 C  CB  . LEU B 128 ? 0.9289 1.1096 0.5448 0.0418  -0.0123 -0.0041 147 LEU B CB  
2647 C  CG  . LEU B 128 ? 0.9573 1.1508 0.6019 0.0351  -0.0091 0.0158  147 LEU B CG  
2648 C  CD1 . LEU B 128 ? 0.9500 1.1607 0.6112 0.0397  0.0065  0.0231  147 LEU B CD1 
2649 C  CD2 . LEU B 128 ? 0.9783 1.1825 0.6122 0.0323  -0.0120 0.0293  147 LEU B CD2 
2650 N  N   . GLY B 129 ? 0.8769 1.0016 0.4365 0.0386  -0.0286 -0.0519 148 GLY B N   
2651 C  CA  . GLY B 129 ? 0.9408 1.0462 0.4655 0.0409  -0.0299 -0.0737 148 GLY B CA  
2652 C  C   . GLY B 129 ? 0.9939 1.1046 0.5069 0.0254  -0.0431 -0.0837 148 GLY B C   
2653 O  O   . GLY B 129 ? 0.9795 1.1014 0.4656 0.0283  -0.0456 -0.0939 148 GLY B O   
2654 N  N   . ASN B 130 ? 0.9940 1.1026 0.5287 0.0098  -0.0515 -0.0808 149 ASN B N   
2655 C  CA  . ASN B 130 ? 1.0161 1.1387 0.5479 -0.0061 -0.0649 -0.0913 149 ASN B CA  
2656 C  C   . ASN B 130 ? 1.0235 1.1899 0.5577 -0.0009 -0.0720 -0.0779 149 ASN B C   
2657 O  O   . ASN B 130 ? 1.0495 1.2348 0.5656 -0.0042 -0.0821 -0.0905 149 ASN B O   
2658 C  CB  . ASN B 130 ? 0.9331 1.0413 0.4880 -0.0241 -0.0693 -0.0935 149 ASN B CB  
2659 C  CG  . ASN B 130 ? 0.9869 1.0447 0.5288 -0.0302 -0.0626 -0.1085 149 ASN B CG  
2660 O  OD1 . ASN B 130 ? 1.0033 1.0381 0.5152 -0.0304 -0.0605 -0.1278 149 ASN B OD1 
2661 N  ND2 . ASN B 130 ? 0.9063 0.9431 0.4669 -0.0339 -0.0586 -0.0997 149 ASN B ND2 
2662 N  N   . TYR B 131 ? 0.9992 1.1798 0.5532 0.0076  -0.0666 -0.0533 150 TYR B N   
2663 C  CA  . TYR B 131 ? 0.9771 1.1901 0.5288 0.0156  -0.0707 -0.0367 150 TYR B CA  
2664 C  C   . TYR B 131 ? 0.9807 1.2060 0.4963 0.0282  -0.0679 -0.0398 150 TYR B C   
2665 O  O   . TYR B 131 ? 1.0200 1.2695 0.5180 0.0316  -0.0788 -0.0417 150 TYR B O   
2666 C  CB  . TYR B 131 ? 1.0452 1.2605 0.6207 0.0211  -0.0614 -0.0105 150 TYR B CB  
2667 C  CG  . TYR B 131 ? 1.0418 1.2795 0.6078 0.0316  -0.0621 0.0092  150 TYR B CG  
2668 C  CD1 . TYR B 131 ? 1.1140 1.3684 0.6886 0.0311  -0.0749 0.0152  150 TYR B CD1 
2669 C  CD2 . TYR B 131 ? 1.1278 1.3691 0.6741 0.0434  -0.0487 0.0223  150 TYR B CD2 
2670 C  CE1 . TYR B 131 ? 1.1643 1.4336 0.7245 0.0448  -0.0754 0.0347  150 TYR B CE1 
2671 C  CE2 . TYR B 131 ? 1.2458 1.5000 0.7763 0.0540  -0.0473 0.0424  150 TYR B CE2 
2672 C  CZ  . TYR B 131 ? 1.2674 1.5330 0.8031 0.0561  -0.0611 0.0491  150 TYR B CZ  
2673 O  OH  . TYR B 131 ? 1.4202 1.6928 0.9353 0.0704  -0.0596 0.0705  150 TYR B OH  
2674 N  N   . TYR B 132 ? 0.9513 1.1631 0.4555 0.0367  -0.0537 -0.0409 151 TYR B N   
2675 C  CA  . TYR B 132 ? 1.0076 1.2299 0.4755 0.0494  -0.0482 -0.0448 151 TYR B CA  
2676 C  C   . TYR B 132 ? 1.0289 1.2493 0.4668 0.0454  -0.0599 -0.0727 151 TYR B C   
2677 O  O   . TYR B 132 ? 1.0058 1.2453 0.4121 0.0543  -0.0630 -0.0755 151 TYR B O   
2678 C  CB  . TYR B 132 ? 1.0725 1.2870 0.5382 0.0604  -0.0287 -0.0402 151 TYR B CB  
2679 C  CG  . TYR B 132 ? 1.1725 1.4002 0.6579 0.0644  -0.0153 -0.0129 151 TYR B CG  
2680 C  CD1 . TYR B 132 ? 1.2833 1.5294 0.7500 0.0713  -0.0107 0.0051  151 TYR B CD1 
2681 C  CD2 . TYR B 132 ? 1.1835 1.4038 0.7031 0.0613  -0.0062 -0.0057 151 TYR B CD2 
2682 C  CE1 . TYR B 132 ? 1.3960 1.6476 0.8781 0.0718  0.0042  0.0297  151 TYR B CE1 
2683 C  CE2 . TYR B 132 ? 1.2369 1.4693 0.7754 0.0611  0.0068  0.0162  151 TYR B CE2 
2684 C  CZ  . TYR B 132 ? 1.4052 1.6507 0.9249 0.0649  0.0131  0.0339  151 TYR B CZ  
2685 O  OH  . TYR B 132 ? 1.6406 1.8914 1.1765 0.0617  0.0286  0.0551  151 TYR B OH  
2686 N  N   . TYR B 133 ? 0.9959 1.1921 0.4413 0.0313  -0.0658 -0.0934 152 TYR B N   
2687 C  CA  . TYR B 133 ? 1.0778 1.2680 0.4970 0.0221  -0.0761 -0.1230 152 TYR B CA  
2688 C  C   . TYR B 133 ? 1.1126 1.3397 0.5322 0.0139  -0.0950 -0.1274 152 TYR B C   
2689 O  O   . TYR B 133 ? 1.0917 1.3384 0.4804 0.0181  -0.1032 -0.1414 152 TYR B O   
2690 C  CB  . TYR B 133 ? 1.0807 1.2281 0.5058 0.0067  -0.0746 -0.1430 152 TYR B CB  
2691 C  CG  . TYR B 133 ? 1.1458 1.2845 0.5459 -0.0085 -0.0846 -0.1755 152 TYR B CG  
2692 C  CD1 . TYR B 133 ? 1.2073 1.3290 0.5679 -0.0007 -0.0800 -0.1956 152 TYR B CD1 
2693 C  CD2 . TYR B 133 ? 1.1692 1.3198 0.5858 -0.0319 -0.0981 -0.1879 152 TYR B CD2 
2694 C  CE1 . TYR B 133 ? 1.2976 1.4102 0.6341 -0.0171 -0.0892 -0.2281 152 TYR B CE1 
2695 C  CE2 . TYR B 133 ? 1.2262 1.3730 0.6227 -0.0499 -0.1069 -0.2203 152 TYR B CE2 
2696 C  CZ  . TYR B 133 ? 1.2971 1.4230 0.6529 -0.0433 -0.1028 -0.2408 152 TYR B CZ  
2697 O  OH  . TYR B 133 ? 1.4294 1.5498 0.7648 -0.0636 -0.1114 -0.2754 152 TYR B OH  
2698 N  N   . LEU B 134 ? 1.0791 1.3178 0.5327 0.0039  -0.1022 -0.1172 153 LEU B N   
2699 C  CA  . LEU B 134 ? 1.0952 1.3749 0.5552 -0.0015 -0.1208 -0.1215 153 LEU B CA  
2700 C  C   . LEU B 134 ? 1.1548 1.4700 0.5945 0.0201  -0.1257 -0.1036 153 LEU B C   
2701 O  O   . LEU B 134 ? 1.2587 1.6073 0.6798 0.0223  -0.1414 -0.1170 153 LEU B O   
2702 C  CB  . LEU B 134 ? 1.0887 1.3735 0.5904 -0.0139 -0.1251 -0.1130 153 LEU B CB  
2703 C  CG  . LEU B 134 ? 1.0951 1.3490 0.6137 -0.0384 -0.1225 -0.1323 153 LEU B CG  
2704 C  CD1 . LEU B 134 ? 1.0780 1.3372 0.6361 -0.0467 -0.1233 -0.1189 153 LEU B CD1 
2705 C  CD2 . LEU B 134 ? 1.0840 1.3477 0.5893 -0.0579 -0.1339 -0.1663 153 LEU B CD2 
2706 N  N   . THR B 135 ? 1.1375 1.4451 0.5790 0.0358  -0.1119 -0.0743 154 THR B N   
2707 C  CA  . THR B 135 ? 1.1580 1.4888 0.5739 0.0571  -0.1119 -0.0535 154 THR B CA  
2708 C  C   . THR B 135 ? 1.2017 1.5368 0.5711 0.0676  -0.1096 -0.0660 154 THR B C   
2709 O  O   . THR B 135 ? 1.2450 1.6070 0.5837 0.0828  -0.1179 -0.0606 154 THR B O   
2710 C  CB  . THR B 135 ? 1.1291 1.4453 0.5568 0.0669  -0.0943 -0.0204 154 THR B CB  
2711 O  OG1 . THR B 135 ? 1.2549 1.5436 0.6874 0.0636  -0.0758 -0.0216 154 THR B OG1 
2712 C  CG2 . THR B 135 ? 1.1011 1.4172 0.5683 0.0602  -0.0987 -0.0075 154 THR B CG2 
2713 N  N   . ALA B 136 ? 1.1604 1.4682 0.5222 0.0620  -0.0982 -0.0820 155 ALA B N   
2714 C  CA  . ALA B 136 ? 1.2126 1.5207 0.5304 0.0711  -0.0950 -0.0984 155 ALA B CA  
2715 C  C   . ALA B 136 ? 1.2673 1.5948 0.5658 0.0622  -0.1164 -0.1303 155 ALA B C   
2716 O  O   . ALA B 136 ? 1.2744 1.6198 0.5317 0.0737  -0.1212 -0.1398 155 ALA B O   
2717 C  CB  . ALA B 136 ? 1.1557 1.4283 0.4727 0.0694  -0.0776 -0.1090 155 ALA B CB  
2718 N  N   . GLU B 137 ? 1.2554 1.5808 0.5836 0.0406  -0.1282 -0.1472 156 GLU B N   
2719 C  CA  . GLU B 137 ? 1.3079 1.6542 0.6273 0.0251  -0.1480 -0.1808 156 GLU B CA  
2720 C  C   . GLU B 137 ? 1.3519 1.7544 0.6635 0.0367  -0.1681 -0.1749 156 GLU B C   
2721 O  O   . GLU B 137 ? 1.3402 1.7696 0.6182 0.0409  -0.1814 -0.1956 156 GLU B O   
2722 C  CB  . GLU B 137 ? 1.3337 1.6612 0.6903 -0.0033 -0.1509 -0.1975 156 GLU B CB  
2723 C  CG  . GLU B 137 ? 1.4500 1.7810 0.7968 -0.0273 -0.1636 -0.2389 156 GLU B CG  
2724 C  CD  . GLU B 137 ? 1.5567 1.8416 0.8682 -0.0313 -0.1526 -0.2634 156 GLU B CD  
2725 O  OE1 . GLU B 137 ? 1.5619 1.8168 0.8559 -0.0127 -0.1356 -0.2494 156 GLU B OE1 
2726 O  OE2 . GLU B 137 ? 1.6707 1.9492 0.9722 -0.0538 -0.1605 -0.2988 156 GLU B OE2 
2727 N  N   . GLN B 138 ? 1.3339 1.7534 0.6733 0.0442  -0.1706 -0.1474 157 GLN B N   
2728 C  CA  . GLN B 138 ? 1.4097 1.8806 0.7412 0.0610  -0.1895 -0.1380 157 GLN B CA  
2729 C  C   . GLN B 138 ? 1.5014 1.9825 0.7819 0.0905  -0.1866 -0.1209 157 GLN B C   
2730 O  O   . GLN B 138 ? 1.6086 2.1331 0.8651 0.1050  -0.2058 -0.1260 157 GLN B O   
2731 C  CB  . GLN B 138 ? 1.4419 1.9234 0.8135 0.0639  -0.1918 -0.1135 157 GLN B CB  
2732 C  CG  . GLN B 138 ? 1.4959 1.9437 0.8734 0.0773  -0.1708 -0.0753 157 GLN B CG  
2733 C  CD  . GLN B 138 ? 1.5178 1.9692 0.9366 0.0763  -0.1724 -0.0564 157 GLN B CD  
2734 O  OE1 . GLN B 138 ? 1.5808 2.0646 1.0245 0.0684  -0.1893 -0.0697 157 GLN B OE1 
2735 N  NE2 . GLN B 138 ? 1.4629 1.8826 0.8897 0.0836  -0.1539 -0.0267 157 GLN B NE2 
2736 N  N   . GLU B 139 ? 1.4897 1.9343 0.7536 0.0999  -0.1629 -0.1010 158 GLU B N   
2737 C  CA  . GLU B 139 ? 1.5338 1.9833 0.7455 0.1255  -0.1553 -0.0853 158 GLU B CA  
2738 C  C   . GLU B 139 ? 1.5215 1.9814 0.6914 0.1253  -0.1627 -0.1180 158 GLU B C   
2739 O  O   . GLU B 139 ? 1.5897 2.0722 0.7125 0.1464  -0.1682 -0.1139 158 GLU B O   
2740 C  CB  . GLU B 139 ? 1.5512 1.9642 0.7603 0.1328  -0.1256 -0.0562 158 GLU B CB  
2741 C  CG  . GLU B 139 ? 1.6350 2.0391 0.8694 0.1389  -0.1172 -0.0199 158 GLU B CG  
2742 C  CD  . GLU B 139 ? 1.7068 2.0802 0.9380 0.1434  -0.0872 0.0067  158 GLU B CD  
2743 O  OE1 . GLU B 139 ? 1.7492 2.1171 0.9459 0.1511  -0.0727 0.0050  158 GLU B OE1 
2744 O  OE2 . GLU B 139 ? 1.6115 1.9685 0.8754 0.1388  -0.0774 0.0288  158 GLU B OE2 
2745 N  N   . LYS B 140 ? 1.4542 1.8933 0.6376 0.1026  -0.1615 -0.1495 159 LYS B N   
2746 C  CA  . LYS B 140 ? 1.4678 1.9100 0.6137 0.0985  -0.1683 -0.1859 159 LYS B CA  
2747 C  C   . LYS B 140 ? 1.5727 2.0662 0.7101 0.0947  -0.1988 -0.2107 159 LYS B C   
2748 O  O   . LYS B 140 ? 1.5537 2.0704 0.6448 0.1065  -0.2087 -0.2269 159 LYS B O   
2749 C  CB  . LYS B 140 ? 1.4171 1.8156 0.5806 0.0747  -0.1584 -0.2121 159 LYS B CB  
2750 C  CG  . LYS B 140 ? 1.4517 1.8385 0.5747 0.0701  -0.1601 -0.2498 159 LYS B CG  
2751 C  CD  . LYS B 140 ? 1.4889 1.8222 0.6285 0.0499  -0.1476 -0.2700 159 LYS B CD  
2752 C  CE  . LYS B 140 ? 1.6152 1.9264 0.7120 0.0460  -0.1466 -0.3082 159 LYS B CE  
2753 N  NZ  . LYS B 140 ? 1.7442 2.0865 0.8270 0.0288  -0.1712 -0.3447 159 LYS B NZ  
2754 N  N   . LYS B 141 ? 1.6468 2.1615 0.8290 0.0791  -0.2133 -0.2144 160 LYS B N   
2755 C  CA  . LYS B 141 ? 1.7474 2.3213 0.9327 0.0742  -0.2431 -0.2385 160 LYS B CA  
2756 C  C   . LYS B 141 ? 1.7353 2.3547 0.8856 0.1095  -0.2566 -0.2169 160 LYS B C   
2757 O  O   . LYS B 141 ? 1.7367 2.4004 0.8563 0.1163  -0.2778 -0.2407 160 LYS B O   
2758 C  CB  . LYS B 141 ? 1.7550 2.3433 1.0001 0.0517  -0.2517 -0.2425 160 LYS B CB  
2759 C  CG  . LYS B 141 ? 1.9196 2.5746 1.1771 0.0413  -0.2814 -0.2732 160 LYS B CG  
2760 C  CD  . LYS B 141 ? 1.9207 2.5904 1.2390 0.0181  -0.2860 -0.2768 160 LYS B CD  
2761 C  CE  . LYS B 141 ? 1.9524 2.6987 1.2862 0.0080  -0.3153 -0.3091 160 LYS B CE  
2762 N  NZ  . LYS B 141 ? 2.0509 2.8178 1.4452 -0.0144 -0.3184 -0.3131 160 LYS B NZ  
2763 N  N   . LYS B 142 ? 1.6911 2.2975 0.8447 0.1314  -0.2442 -0.1730 161 LYS B N   
2764 C  CA  . LYS B 142 ? 1.7632 2.3983 0.8779 0.1683  -0.2519 -0.1449 161 LYS B CA  
2765 C  C   . LYS B 142 ? 1.7835 2.4142 0.8311 0.1878  -0.2459 -0.1463 161 LYS B C   
2766 O  O   . LYS B 142 ? 1.7942 2.4647 0.7994 0.2130  -0.2634 -0.1453 161 LYS B O   
2767 C  CB  . LYS B 142 ? 1.8071 2.4125 0.9376 0.1829  -0.2335 -0.0976 161 LYS B CB  
2768 C  CG  . LYS B 142 ? 1.9056 2.5229 0.9904 0.2217  -0.2349 -0.0627 161 LYS B CG  
2769 C  CD  . LYS B 142 ? 1.9355 2.5189 1.0415 0.2304  -0.2168 -0.0203 161 LYS B CD  
2770 C  CE  . LYS B 142 ? 2.0418 2.6196 1.0929 0.2680  -0.2111 0.0172  161 LYS B CE  
2771 N  NZ  . LYS B 142 ? 2.0053 2.6378 1.0267 0.2961  -0.2418 0.0118  161 LYS B NZ  
2772 N  N   . LEU B 143 ? 1.7582 2.3422 0.7960 0.1781  -0.2211 -0.1483 162 LEU B N   
2773 C  CA  . LEU B 143 ? 1.7763 2.3512 0.7531 0.1940  -0.2103 -0.1516 162 LEU B CA  
2774 C  C   . LEU B 143 ? 1.7702 2.3799 0.7163 0.1887  -0.2340 -0.1974 162 LEU B C   
2775 O  O   . LEU B 143 ? 1.8050 2.4357 0.6925 0.2120  -0.2397 -0.1985 162 LEU B O   
2776 C  CB  . LEU B 143 ? 1.7850 2.3057 0.7700 0.1828  -0.1784 -0.1468 162 LEU B CB  
2777 C  CG  . LEU B 143 ? 1.8589 2.3609 0.7912 0.1976  -0.1574 -0.1449 162 LEU B CG  
2778 C  CD1 . LEU B 143 ? 1.9283 2.4380 0.8171 0.2281  -0.1471 -0.1055 162 LEU B CD1 
2779 C  CD2 . LEU B 143 ? 1.7620 2.2179 0.7221 0.1841  -0.1291 -0.1421 162 LEU B CD2 
2780 N  N   . GLU B 144 ? 1.6956 2.3100 0.6794 0.1573  -0.2467 -0.2350 163 GLU B N   
2781 C  CA  . GLU B 144 ? 1.8029 2.4491 0.7654 0.1445  -0.2695 -0.2840 163 GLU B CA  
2782 C  C   . GLU B 144 ? 1.7932 2.5129 0.7478 0.1575  -0.3034 -0.2930 163 GLU B C   
2783 O  O   . GLU B 144 ? 1.7274 2.4820 0.6373 0.1659  -0.3211 -0.3201 163 GLU B O   
2784 C  CB  . GLU B 144 ? 1.8154 2.4372 0.8211 0.1034  -0.2691 -0.3204 163 GLU B CB  
2785 C  CG  . GLU B 144 ? 1.9056 2.4580 0.9072 0.0939  -0.2396 -0.3214 163 GLU B CG  
2786 C  CD  . GLU B 144 ? 1.9399 2.4555 0.9852 0.0570  -0.2349 -0.3466 163 GLU B CD  
2787 O  OE1 . GLU B 144 ? 2.0065 2.5504 1.0838 0.0326  -0.2539 -0.3698 163 GLU B OE1 
2788 O  OE2 . GLU B 144 ? 1.8968 2.3547 0.9431 0.0530  -0.2110 -0.3428 163 GLU B OE2 
2789 N  N   . THR B 145 ? 1.7228 2.4675 0.7203 0.1603  -0.3130 -0.2724 164 THR B N   
2790 C  CA  . THR B 145 ? 1.7741 2.5935 0.7706 0.1770  -0.3457 -0.2780 164 THR B CA  
2791 C  C   . THR B 145 ? 1.8896 2.7299 0.8196 0.2233  -0.3512 -0.2511 164 THR B C   
2792 O  O   . THR B 145 ? 2.0033 2.9049 0.9036 0.2385  -0.3798 -0.2721 164 THR B O   
2793 C  CB  . THR B 145 ? 1.7111 2.5480 0.7682 0.1734  -0.3512 -0.2587 164 THR B CB  
2794 O  OG1 . THR B 145 ? 1.6871 2.5011 0.8012 0.1309  -0.3439 -0.2816 164 THR B OG1 
2795 C  CG2 . THR B 145 ? 1.7421 2.6640 0.8027 0.1907  -0.3869 -0.2706 164 THR B CG2 
2796 N  N   . ASP B 146 ? 1.8834 2.6741 0.7898 0.2446  -0.3236 -0.2056 165 ASP B N   
2797 C  CA  . ASP B 146 ? 1.9498 2.7460 0.7867 0.2876  -0.3216 -0.1746 165 ASP B CA  
2798 C  C   . ASP B 146 ? 1.9700 2.7761 0.7440 0.2940  -0.3255 -0.2022 165 ASP B C   
2799 O  O   . ASP B 146 ? 2.0943 2.9390 0.8121 0.3264  -0.3428 -0.1988 165 ASP B O   
2800 C  CB  . ASP B 146 ? 1.9465 2.6814 0.7750 0.3012  -0.2860 -0.1226 165 ASP B CB  
2801 C  CG  . ASP B 146 ? 1.9087 2.6362 0.7851 0.3043  -0.2841 -0.0907 165 ASP B CG  
2802 O  OD1 . ASP B 146 ? 1.8458 2.6215 0.7514 0.3067  -0.3116 -0.1018 165 ASP B OD1 
2803 O  OD2 . ASP B 146 ? 1.9784 2.6530 0.8628 0.3046  -0.2544 -0.0550 165 ASP B OD2 
2804 N  N   . TYR B 147 ? 1.9011 2.6711 0.6820 0.2657  -0.3094 -0.2290 166 TYR B N   
2805 C  CA  . TYR B 147 ? 1.9437 2.7192 0.6686 0.2677  -0.3124 -0.2619 166 TYR B CA  
2806 C  C   . TYR B 147 ? 1.9671 2.8089 0.6933 0.2567  -0.3517 -0.3118 166 TYR B C   
2807 O  O   . TYR B 147 ? 1.9782 2.8514 0.6463 0.2732  -0.3667 -0.3324 166 TYR B O   
2808 C  CB  . TYR B 147 ? 1.8953 2.6118 0.6296 0.2418  -0.2846 -0.2785 166 TYR B CB  
2809 C  CG  . TYR B 147 ? 1.9864 2.7023 0.6587 0.2472  -0.2841 -0.3101 166 TYR B CG  
2810 C  CD1 . TYR B 147 ? 2.0383 2.7389 0.6467 0.2780  -0.2642 -0.2848 166 TYR B CD1 
2811 C  CD2 . TYR B 147 ? 2.0090 2.7383 0.6840 0.2206  -0.3021 -0.3663 166 TYR B CD2 
2812 C  CE1 . TYR B 147 ? 2.1351 2.8363 0.6837 0.2848  -0.2631 -0.3145 166 TYR B CE1 
2813 C  CE2 . TYR B 147 ? 2.0630 2.7893 0.6782 0.2261  -0.3017 -0.3975 166 TYR B CE2 
2814 C  CZ  . TYR B 147 ? 2.1308 2.8446 0.6826 0.2596  -0.2827 -0.3715 166 TYR B CZ  
2815 O  OH  . TYR B 147 ? 2.1577 2.8691 0.6484 0.2665  -0.2813 -0.4027 166 TYR B OH  
2816 N  N   . LYS B 148 ? 1.9530 2.8171 0.7457 0.2277  -0.3672 -0.3320 167 LYS B N   
2817 C  CA  . LYS B 148 ? 1.9689 2.9033 0.7760 0.2119  -0.4040 -0.3801 167 LYS B CA  
2818 C  C   . LYS B 148 ? 2.0375 3.0482 0.8127 0.2512  -0.4355 -0.3708 167 LYS B C   
2819 O  O   . LYS B 148 ? 2.0373 3.1125 0.7993 0.2477  -0.4666 -0.4130 167 LYS B O   
2820 C  CB  . LYS B 148 ? 1.8618 2.8015 0.7505 0.1722  -0.4086 -0.3976 167 LYS B CB  
2821 N  N   . LYS B 149 ? 2.0874 3.0901 0.8498 0.2881  -0.4275 -0.3173 168 LYS B N   
2822 C  CA  . LYS B 149 ? 2.1561 3.2203 0.8793 0.3336  -0.4541 -0.3003 168 LYS B CA  
2823 C  C   . LYS B 149 ? 2.2899 3.3581 0.9241 0.3616  -0.4562 -0.3049 168 LYS B C   
2824 O  O   . LYS B 149 ? 2.3389 3.3463 0.9298 0.3749  -0.4250 -0.2741 168 LYS B O   
2825 C  CB  . LYS B 149 ? 2.1476 3.1835 0.8751 0.3645  -0.4389 -0.2395 168 LYS B CB  
2826 N  N   . LEU B 150 ? 2.3518 3.4954 0.9596 0.3705  -0.4927 -0.3438 169 LEU B N   
2827 C  CA  . LEU B 150 ? 2.4971 3.6526 1.0198 0.3941  -0.4991 -0.3576 169 LEU B CA  
2828 C  C   . LEU B 150 ? 2.6408 3.8011 1.0820 0.4535  -0.4995 -0.3121 169 LEU B C   
2829 O  O   . LEU B 150 ? 2.7021 3.9038 1.1405 0.4874  -0.5194 -0.2877 169 LEU B O   
2830 C  CB  . LEU B 150 ? 2.5363 3.7727 1.0601 0.3774  -0.5393 -0.4232 169 LEU B CB  
2831 C  CG  . LEU B 150 ? 2.5758 3.8368 1.0167 0.3945  -0.5528 -0.4534 169 LEU B CG  
2832 C  CD1 . LEU B 150 ? 2.5770 3.8981 1.0443 0.3564  -0.5838 -0.5260 169 LEU B CD1 
2833 C  CD2 . LEU B 150 ? 2.6149 3.9220 0.9794 0.4552  -0.5728 -0.4259 169 LEU B CD2 
2834 N  N   . SER B 151 ? 2.7035 3.8178 1.0771 0.4651  -0.4754 -0.3022 170 SER B N   
2835 C  CA  . SER B 151 ? 2.7134 3.8237 0.9930 0.5172  -0.4707 -0.2661 170 SER B CA  
2836 C  C   . SER B 151 ? 2.8074 3.9385 1.0238 0.5168  -0.4804 -0.3100 170 SER B C   
2837 O  O   . SER B 151 ? 2.8292 4.0176 0.9836 0.5512  -0.5095 -0.3205 170 SER B O   
2838 C  CB  . SER B 151 ? 2.7312 3.7557 0.9916 0.5279  -0.4229 -0.2072 170 SER B CB  
2839 O  OG  . SER B 151 ? 2.7099 3.7130 1.0272 0.5267  -0.4142 -0.1697 170 SER B OG  
2840 N  N   . SER B 152 ? 2.7521 3.8348 0.9831 0.4798  -0.4555 -0.3351 171 SER B N   
2841 C  CA  . SER B 152 ? 2.8405 3.9296 1.0214 0.4710  -0.4593 -0.3824 171 SER B CA  
2842 C  C   . SER B 152 ? 2.7673 3.8327 1.0078 0.4151  -0.4539 -0.4341 171 SER B C   
2843 O  O   . SER B 152 ? 2.7839 3.8976 1.0278 0.3954  -0.4842 -0.4912 171 SER B O   
2844 C  CB  . SER B 152 ? 2.8935 3.9345 0.9903 0.5008  -0.4261 -0.3508 171 SER B CB  
2845 O  OG  . SER B 152 ? 2.8343 3.9083 0.8567 0.5526  -0.4399 -0.3194 171 SER B OG  
2846 N  N   . PRO B 153 ? 2.7656 3.7568 1.0488 0.3900  -0.4155 -0.4162 172 PRO B N   
2847 C  CA  . PRO B 153 ? 2.7008 3.6286 0.9900 0.4019  -0.3749 -0.3572 172 PRO B CA  
2848 C  C   . PRO B 153 ? 2.7295 3.6080 0.9569 0.4145  -0.3397 -0.3472 172 PRO B C   
2849 O  O   . PRO B 153 ? 2.7286 3.5954 0.9394 0.3970  -0.3368 -0.3906 172 PRO B O   
2850 C  CB  . PRO B 153 ? 2.5521 3.4434 0.9324 0.3591  -0.3622 -0.3635 172 PRO B CB  
2851 C  CG  . PRO B 153 ? 2.5724 3.4700 0.9656 0.3236  -0.3756 -0.4273 172 PRO B CG  
2852 C  CD  . PRO B 153 ? 2.7011 3.6717 1.0455 0.3388  -0.4147 -0.4632 172 PRO B CD  
2853 N  N   . THR B 154 ? 2.7211 3.5700 0.9153 0.4438  -0.3119 -0.2908 173 THR B N   
2854 C  CA  . THR B 154 ? 2.7286 3.5348 0.8656 0.4577  -0.2745 -0.2746 173 THR B CA  
2855 C  C   . THR B 154 ? 2.6829 3.4323 0.8766 0.4247  -0.2410 -0.2788 173 THR B C   
2856 O  O   . THR B 154 ? 2.6191 3.3469 0.8831 0.4060  -0.2327 -0.2585 173 THR B O   
2857 C  CB  . THR B 154 ? 2.7973 3.5867 0.8865 0.4950  -0.2519 -0.2105 173 THR B CB  
2858 O  OG1 . THR B 154 ? 2.8340 3.6747 0.8717 0.5297  -0.2851 -0.2034 173 THR B OG1 
2859 C  CG2 . THR B 154 ? 2.8824 3.6356 0.9080 0.5092  -0.2126 -0.1956 173 THR B CG2 
2860 N  N   . LYS B 155 ? 2.6622 3.3883 0.8233 0.4201  -0.2223 -0.3054 174 LYS B N   
2861 C  CA  . LYS B 155 ? 2.6557 3.3286 0.8641 0.3942  -0.1900 -0.3114 174 LYS B CA  
2862 C  C   . LYS B 155 ? 2.6605 3.2939 0.8853 0.4017  -0.1475 -0.2565 174 LYS B C   
2863 O  O   . LYS B 155 ? 2.4903 3.0860 0.7636 0.3816  -0.1231 -0.2574 174 LYS B O   
2864 C  CB  . LYS B 155 ? 2.6357 3.2943 0.8103 0.3864  -0.1847 -0.3616 174 LYS B CB  
2865 C  CG  . LYS B 155 ? 2.7274 3.4000 0.8080 0.4175  -0.1778 -0.3663 174 LYS B CG  
2866 C  CD  . LYS B 155 ? 2.7851 3.4450 0.8385 0.4065  -0.1790 -0.4238 174 LYS B CD  
2867 C  CE  . LYS B 155 ? 2.9075 3.5934 0.8631 0.4375  -0.1825 -0.4363 174 LYS B CE  
2868 N  NZ  . LYS B 155 ? 2.8815 3.6270 0.7977 0.4520  -0.2251 -0.4481 174 LYS B NZ  
2869 N  N   . MSE B 156 ? 2.7841 3.4261 0.9668 0.4304  -0.1389 -0.2101 175 MSE B N   
2870 C  CA  . MSE B 156 ? 2.8228 3.4309 1.0218 0.4352  -0.1009 -0.1555 175 MSE B CA  
2871 C  C   . MSE B 156 ? 2.7135 3.3135 0.9977 0.4131  -0.1106 -0.1409 175 MSE B C   
2872 O  O   . MSE B 156 ? 2.6885 3.2549 1.0221 0.3981  -0.0823 -0.1184 175 MSE B O   
2873 C  CB  . MSE B 156 ? 3.1164 3.7324 1.2423 0.4711  -0.0931 -0.1113 175 MSE B CB  
2874 C  CG  . MSE B 156 ? 3.2674 3.8447 1.3932 0.4759  -0.0478 -0.0565 175 MSE B CG  
2875 SE SE  . MSE B 156 ? 3.5418 4.0919 1.6421 0.4724  0.0055  -0.0607 175 MSE B SE  
2876 C  CE  . MSE B 156 ? 3.4721 3.9864 1.5643 0.4801  0.0543  0.0143  175 MSE B CE  
2877 N  N   . GLN B 157 ? 2.6078 3.2428 0.9080 0.4123  -0.1505 -0.1548 176 GLN B N   
2878 C  CA  . GLN B 157 ? 2.4913 3.1256 0.8704 0.3921  -0.1639 -0.1464 176 GLN B CA  
2879 C  C   . GLN B 157 ? 2.4238 3.0395 0.8704 0.3543  -0.1637 -0.1838 176 GLN B C   
2880 O  O   . GLN B 157 ? 2.2720 2.8673 0.7859 0.3348  -0.1569 -0.1697 176 GLN B O   
2881 C  CB  . GLN B 157 ? 2.4877 3.1727 0.8637 0.4037  -0.2069 -0.1542 176 GLN B CB  
2882 C  CG  . GLN B 157 ? 2.5837 3.2870 0.8899 0.4457  -0.2118 -0.1171 176 GLN B CG  
2883 C  CD  . GLN B 157 ? 2.5959 3.3587 0.8972 0.4611  -0.2576 -0.1309 176 GLN B CD  
2884 O  OE1 . GLN B 157 ? 2.6330 3.4208 0.9989 0.4385  -0.2820 -0.1556 176 GLN B OE1 
2885 N  NE2 . GLN B 157 ? 2.5675 3.3553 0.7911 0.5012  -0.2688 -0.1143 176 GLN B NE2 
2886 N  N   . TYR B 158 ? 2.4234 3.0438 0.8482 0.3451  -0.1717 -0.2315 177 TYR B N   
2887 C  CA  . TYR B 158 ? 2.3493 2.9427 0.8244 0.3121  -0.1689 -0.2688 177 TYR B CA  
2888 C  C   . TYR B 158 ? 2.3338 2.8780 0.8355 0.3064  -0.1281 -0.2474 177 TYR B C   
2889 O  O   . TYR B 158 ? 2.2226 2.7398 0.7846 0.2817  -0.1230 -0.2568 177 TYR B O   
2890 C  CB  . TYR B 158 ? 2.3462 2.9508 0.7811 0.3064  -0.1853 -0.3248 177 TYR B CB  
2891 C  CG  . TYR B 158 ? 2.3044 2.8721 0.7806 0.2743  -0.1809 -0.3640 177 TYR B CG  
2892 C  CD1 . TYR B 158 ? 2.2693 2.8367 0.8097 0.2435  -0.1995 -0.3810 177 TYR B CD1 
2893 C  CD2 . TYR B 158 ? 2.3009 2.8318 0.7491 0.2761  -0.1570 -0.3842 177 TYR B CD2 
2894 C  CE1 . TYR B 158 ? 2.2383 2.7642 0.8110 0.2148  -0.1935 -0.4146 177 TYR B CE1 
2895 C  CE2 . TYR B 158 ? 2.3316 2.8215 0.8122 0.2501  -0.1524 -0.4188 177 TYR B CE2 
2896 C  CZ  . TYR B 158 ? 2.2870 2.7717 0.8281 0.2192  -0.1703 -0.4331 177 TYR B CZ  
2897 O  OH  . TYR B 158 ? 2.2348 2.6720 0.8023 0.1942  -0.1640 -0.4651 177 TYR B OH  
2898 N  N   . ALA B 159 ? 2.3846 2.9201 0.8407 0.3293  -0.0992 -0.2199 178 ALA B N   
2899 C  CA  . ALA B 159 ? 2.3141 2.8140 0.7949 0.3262  -0.0592 -0.1973 178 ALA B CA  
2900 C  C   . ALA B 159 ? 2.2569 2.7456 0.7982 0.3165  -0.0511 -0.1569 178 ALA B C   
2901 O  O   . ALA B 159 ? 2.1892 2.6518 0.7849 0.2999  -0.0335 -0.1535 178 ALA B O   
2902 C  CB  . ALA B 159 ? 2.4152 2.9156 0.8315 0.3517  -0.0299 -0.1773 178 ALA B CB  
2903 N  N   . ARG B 160 ? 2.2493 2.7572 0.7784 0.3288  -0.0644 -0.1273 179 ARG B N   
2904 C  CA  . ARG B 160 ? 2.2059 2.7027 0.7869 0.3214  -0.0598 -0.0900 179 ARG B CA  
2905 C  C   . ARG B 160 ? 2.1383 2.6348 0.7900 0.2946  -0.0830 -0.1128 179 ARG B C   
2906 O  O   . ARG B 160 ? 2.0528 2.5300 0.7612 0.2808  -0.0727 -0.0921 179 ARG B O   
2907 C  CB  . ARG B 160 ? 2.2874 2.8014 0.8286 0.3458  -0.0695 -0.0551 179 ARG B CB  
2908 C  CG  . ARG B 160 ? 2.3113 2.8059 0.8938 0.3423  -0.0584 -0.0121 179 ARG B CG  
2909 C  CD  . ARG B 160 ? 2.4280 2.9303 0.9613 0.3711  -0.0643 0.0248  179 ARG B CD  
2910 N  NE  . ARG B 160 ? 2.5320 3.0243 0.9895 0.3945  -0.0385 0.0482  179 ARG B NE  
2911 C  CZ  . ARG B 160 ? 2.7064 3.2221 1.0902 0.4180  -0.0493 0.0351  179 ARG B CZ  
2912 N  NH1 . ARG B 160 ? 2.7519 3.3070 1.1255 0.4212  -0.0879 -0.0050 179 ARG B NH1 
2913 N  NH2 . ARG B 160 ? 2.8070 3.3074 1.1245 0.4374  -0.0198 0.0616  179 ARG B NH2 
2914 N  N   . TYR B 161 ? 2.0878 2.6061 0.7342 0.2865  -0.1134 -0.1554 180 TYR B N   
2915 C  CA  . TYR B 161 ? 2.0248 2.5422 0.7325 0.2582  -0.1337 -0.1824 180 TYR B CA  
2916 C  C   . TYR B 161 ? 1.9779 2.4532 0.7224 0.2382  -0.1117 -0.1967 180 TYR B C   
2917 O  O   . TYR B 161 ? 1.8244 2.2808 0.6280 0.2214  -0.1066 -0.1855 180 TYR B O   
2918 C  CB  . TYR B 161 ? 2.0430 2.5969 0.7323 0.2522  -0.1698 -0.2263 180 TYR B CB  
2919 C  CG  . TYR B 161 ? 2.0246 2.5694 0.7663 0.2181  -0.1842 -0.2644 180 TYR B CG  
2920 C  CD1 . TYR B 161 ? 2.0254 2.5776 0.8284 0.2007  -0.1968 -0.2564 180 TYR B CD1 
2921 C  CD2 . TYR B 161 ? 2.0663 2.5916 0.7926 0.2032  -0.1838 -0.3089 180 TYR B CD2 
2922 C  CE1 . TYR B 161 ? 1.9865 2.5275 0.8342 0.1679  -0.2071 -0.2904 180 TYR B CE1 
2923 C  CE2 . TYR B 161 ? 2.0630 2.5721 0.8318 0.1706  -0.1942 -0.3429 180 TYR B CE2 
2924 C  CZ  . TYR B 161 ? 2.0218 2.5391 0.8511 0.1522  -0.2052 -0.3331 180 TYR B CZ  
2925 O  OH  . TYR B 161 ? 1.9682 2.4665 0.8358 0.1187  -0.2126 -0.3658 180 TYR B OH  
2926 N  N   . ARG B 162 ? 2.0219 2.4833 0.7293 0.2430  -0.0988 -0.2209 181 ARG B N   
2927 C  CA  . ARG B 162 ? 2.0090 2.4300 0.7439 0.2307  -0.0771 -0.2349 181 ARG B CA  
2928 C  C   . ARG B 162 ? 1.9447 2.3476 0.7099 0.2356  -0.0450 -0.1957 181 ARG B C   
2929 O  O   . ARG B 162 ? 1.8875 2.2637 0.7020 0.2212  -0.0353 -0.1978 181 ARG B O   
2930 C  CB  . ARG B 162 ? 2.0275 2.4368 0.7126 0.2380  -0.0704 -0.2715 181 ARG B CB  
2931 C  CG  . ARG B 162 ? 2.1023 2.5070 0.7805 0.2196  -0.0962 -0.3222 181 ARG B CG  
2932 C  CD  . ARG B 162 ? 2.1264 2.4938 0.8631 0.1928  -0.0967 -0.3366 181 ARG B CD  
2933 N  NE  . ARG B 162 ? 2.2562 2.6048 0.9822 0.1730  -0.1128 -0.3870 181 ARG B NE  
2934 C  CZ  . ARG B 162 ? 2.4221 2.7300 1.1229 0.1731  -0.1001 -0.4183 181 ARG B CZ  
2935 N  NH1 . ARG B 162 ? 2.4595 2.7462 1.1438 0.1946  -0.0712 -0.4063 181 ARG B NH1 
2936 N  NH2 . ARG B 162 ? 2.5269 2.8149 1.2185 0.1510  -0.1161 -0.4641 181 ARG B NH2 
2937 N  N   . ASP B 163 ? 1.8968 2.3140 0.6314 0.2550  -0.0286 -0.1611 182 ASP B N   
2938 C  CA  . ASP B 163 ? 1.8595 2.2646 0.6224 0.2567  0.0024  -0.1231 182 ASP B CA  
2939 C  C   . ASP B 163 ? 1.7721 2.1711 0.5968 0.2410  -0.0052 -0.1004 182 ASP B C   
2940 O  O   . ASP B 163 ? 1.6879 2.0709 0.5566 0.2324  0.0147  -0.0844 182 ASP B O   
2941 C  CB  . ASP B 163 ? 1.8348 2.2528 0.5464 0.2781  0.0226  -0.0906 182 ASP B CB  
2942 N  N   . GLY B 164 ? 1.7625 2.1782 0.5892 0.2387  -0.0342 -0.1003 183 GLY B N   
2943 C  CA  . GLY B 164 ? 1.6804 2.0931 0.5617 0.2254  -0.0447 -0.0824 183 GLY B CA  
2944 C  C   . GLY B 164 ? 1.6515 2.0445 0.5893 0.2015  -0.0501 -0.1059 183 GLY B C   
2945 O  O   . GLY B 164 ? 1.5306 1.9092 0.5181 0.1906  -0.0418 -0.0873 183 GLY B O   
2946 N  N   . LEU B 165 ? 1.6933 2.0830 0.6199 0.1933  -0.0635 -0.1467 184 LEU B N   
2947 C  CA  . LEU B 165 ? 1.6699 2.0324 0.6391 0.1715  -0.0668 -0.1717 184 LEU B CA  
2948 C  C   . LEU B 165 ? 1.6336 1.9665 0.6227 0.1732  -0.0380 -0.1643 184 LEU B C   
2949 O  O   . LEU B 165 ? 1.5408 1.8521 0.5777 0.1594  -0.0351 -0.1629 184 LEU B O   
2950 C  CB  . LEU B 165 ? 1.7109 2.0702 0.6530 0.1630  -0.0841 -0.2181 184 LEU B CB  
2951 C  CG  . LEU B 165 ? 1.7162 2.1104 0.6452 0.1564  -0.1162 -0.2368 184 LEU B CG  
2952 C  CD1 . LEU B 165 ? 1.7727 2.1621 0.6661 0.1486  -0.1277 -0.2844 184 LEU B CD1 
2953 C  CD2 . LEU B 165 ? 1.6748 2.0746 0.6595 0.1356  -0.1322 -0.2333 184 LEU B CD2 
2954 N  N   . SER B 166 ? 1.6647 2.0003 0.6163 0.1913  -0.0170 -0.1603 185 SER B N   
2955 C  CA  . SER B 166 ? 1.7169 2.0359 0.6841 0.1971  0.0115  -0.1546 185 SER B CA  
2956 C  C   . SER B 166 ? 1.6993 2.0227 0.7111 0.1935  0.0270  -0.1165 185 SER B C   
2957 O  O   . SER B 166 ? 1.5694 1.8766 0.6259 0.1856  0.0351  -0.1158 185 SER B O   
2958 C  CB  . SER B 166 ? 1.8915 2.2202 0.8057 0.2177  0.0306  -0.1597 185 SER B CB  
2959 O  OG  . SER B 166 ? 2.0059 2.3245 0.9375 0.2245  0.0572  -0.1591 185 SER B OG  
2960 N  N   . LYS B 167 ? 1.7192 2.0618 0.7159 0.1999  0.0308  -0.0859 186 LYS B N   
2961 C  CA  . LYS B 167 ? 1.6845 2.0276 0.7193 0.1942  0.0457  -0.0496 186 LYS B CA  
2962 C  C   . LYS B 167 ? 1.6188 1.9507 0.7070 0.1767  0.0281  -0.0481 186 LYS B C   
2963 O  O   . LYS B 167 ? 1.6008 1.9246 0.7338 0.1681  0.0406  -0.0337 186 LYS B O   
2964 C  CB  . LYS B 167 ? 1.8310 2.1872 0.8321 0.2047  0.0523  -0.0168 186 LYS B CB  
2965 C  CG  . LYS B 167 ? 1.9307 2.2956 0.8873 0.2196  0.0805  -0.0063 186 LYS B CG  
2966 C  CD  . LYS B 167 ? 1.9554 2.3228 0.8831 0.2274  0.0921  0.0322  186 LYS B CD  
2967 C  CE  . LYS B 167 ? 2.1144 2.4882 1.0026 0.2383  0.1262  0.0457  186 LYS B CE  
2968 N  NZ  . LYS B 167 ? 2.2500 2.6172 1.1057 0.2447  0.1412  0.0858  186 LYS B NZ  
2969 N  N   . LEU B 168 ? 1.5565 1.8914 0.6398 0.1711  -0.0002 -0.0642 187 LEU B N   
2970 C  CA  . LEU B 168 ? 1.4838 1.8103 0.6151 0.1539  -0.0174 -0.0660 187 LEU B CA  
2971 C  C   . LEU B 168 ? 1.4131 1.7140 0.5785 0.1418  -0.0138 -0.0870 187 LEU B C   
2972 O  O   . LEU B 168 ? 1.3968 1.6868 0.6074 0.1296  -0.0159 -0.0788 187 LEU B O   
2973 C  CB  . LEU B 168 ? 1.4795 1.8235 0.5969 0.1507  -0.0475 -0.0804 187 LEU B CB  
2974 C  CG  . LEU B 168 ? 1.4497 1.7934 0.6112 0.1329  -0.0678 -0.0860 187 LEU B CG  
2975 C  CD1 . LEU B 168 ? 1.5033 1.8262 0.6816 0.1150  -0.0750 -0.1206 187 LEU B CD1 
2976 C  CD2 . LEU B 168 ? 1.3100 1.6449 0.5149 0.1286  -0.0579 -0.0548 187 LEU B CD2 
2977 N  N   . PHE B 169 ? 1.4350 1.7242 0.5754 0.1475  -0.0078 -0.1130 188 PHE B N   
2978 C  CA  . PHE B 169 ? 1.4030 1.6622 0.5660 0.1416  -0.0029 -0.1328 188 PHE B CA  
2979 C  C   . PHE B 169 ? 1.4554 1.7124 0.6507 0.1473  0.0201  -0.1135 188 PHE B C   
2980 O  O   . PHE B 169 ? 1.3179 1.5574 0.5527 0.1387  0.0193  -0.1131 188 PHE B O   
2981 C  CB  . PHE B 169 ? 1.4774 1.7197 0.5996 0.1486  -0.0028 -0.1674 188 PHE B CB  
2982 C  CG  . PHE B 169 ? 1.5415 1.7439 0.6810 0.1434  -0.0004 -0.1884 188 PHE B CG  
2983 C  CD1 . PHE B 169 ? 1.5651 1.7410 0.7097 0.1247  -0.0185 -0.2112 188 PHE B CD1 
2984 C  CD2 . PHE B 169 ? 1.6041 1.7959 0.7558 0.1575  0.0205  -0.1844 188 PHE B CD2 
2985 C  CE1 . PHE B 169 ? 1.5678 1.6987 0.7232 0.1208  -0.0144 -0.2276 188 PHE B CE1 
2986 C  CE2 . PHE B 169 ? 1.5801 1.7322 0.7442 0.1572  0.0222  -0.2013 188 PHE B CE2 
2987 C  CZ  . PHE B 169 ? 1.5470 1.6642 0.7100 0.1392  0.0053  -0.2218 188 PHE B CZ  
2988 N  N   . THR B 170 ? 1.4992 1.7759 0.6772 0.1613  0.0411  -0.0994 189 THR B N   
2989 C  CA  . THR B 170 ? 1.5181 1.8029 0.7290 0.1651  0.0645  -0.0826 189 THR B CA  
2990 C  C   . THR B 170 ? 1.4950 1.7883 0.7468 0.1526  0.0659  -0.0521 189 THR B C   
2991 O  O   . THR B 170 ? 1.5412 1.8384 0.8319 0.1497  0.0789  -0.0431 189 THR B O   
2992 C  CB  . THR B 170 ? 1.5860 1.8926 0.7677 0.1813  0.0895  -0.0780 189 THR B CB  
2993 O  OG1 . THR B 170 ? 1.6427 1.9656 0.7914 0.1831  0.0914  -0.0586 189 THR B OG1 
2994 C  CG2 . THR B 170 ? 1.6066 1.9020 0.7511 0.1958  0.0904  -0.1102 189 THR B CG2 
2995 N  N   . THR B 171 ? 1.4926 1.7897 0.7345 0.1465  0.0520  -0.0381 190 THR B N   
2996 C  CA  . THR B 171 ? 1.4189 1.7183 0.6933 0.1360  0.0520  -0.0103 190 THR B CA  
2997 C  C   . THR B 171 ? 1.4182 1.7018 0.7325 0.1220  0.0332  -0.0171 190 THR B C   
2998 O  O   . THR B 171 ? 1.4335 1.7140 0.7888 0.1137  0.0396  -0.0035 190 THR B O   
2999 C  CB  . THR B 171 ? 1.3824 1.6914 0.6233 0.1409  0.0463  0.0094  190 THR B CB  
3000 O  OG1 . THR B 171 ? 1.4753 1.7959 0.6790 0.1530  0.0681  0.0207  190 THR B OG1 
3001 C  CG2 . THR B 171 ? 1.3906 1.6952 0.6607 0.1322  0.0457  0.0372  190 THR B CG2 
3002 N  N   . ARG B 172 ? 1.3355 1.6103 0.6377 0.1181  0.0113  -0.0390 191 ARG B N   
3003 C  CA  . ARG B 172 ? 1.2718 1.5319 0.6080 0.1032  -0.0055 -0.0462 191 ARG B CA  
3004 C  C   . ARG B 172 ? 1.2075 1.4420 0.5484 0.0977  -0.0112 -0.0747 191 ARG B C   
3005 O  O   . ARG B 172 ? 1.1179 1.3357 0.4932 0.0899  -0.0108 -0.0737 191 ARG B O   
3006 C  CB  . ARG B 172 ? 1.3213 1.5941 0.6515 0.0980  -0.0263 -0.0427 191 ARG B CB  
3007 C  CG  . ARG B 172 ? 1.4325 1.7203 0.7614 0.1047  -0.0204 -0.0105 191 ARG B CG  
3008 C  CD  . ARG B 172 ? 1.5458 1.8384 0.8980 0.0976  -0.0372 -0.0007 191 ARG B CD  
3009 N  NE  . ARG B 172 ? 1.6360 1.9325 0.9857 0.1056  -0.0279 0.0316  191 ARG B NE  
3010 C  CZ  . ARG B 172 ? 1.6405 1.9333 1.0173 0.1015  -0.0323 0.0490  191 ARG B CZ  
3011 N  NH1 . ARG B 172 ? 1.5316 1.8208 0.9451 0.0887  -0.0455 0.0383  191 ARG B NH1 
3012 N  NH2 . ARG B 172 ? 1.6532 1.9419 1.0187 0.1102  -0.0209 0.0781  191 ARG B NH2 
3013 N  N   . TYR B 173 ? 1.1855 1.4129 0.4898 0.1017  -0.0160 -0.1002 192 TYR B N   
3014 C  CA  . TYR B 173 ? 1.2052 1.3978 0.5081 0.0963  -0.0193 -0.1276 192 TYR B CA  
3015 C  C   . TYR B 173 ? 1.2244 1.3997 0.5424 0.1076  -0.0013 -0.1260 192 TYR B C   
3016 O  O   . TYR B 173 ? 1.1629 1.3077 0.4985 0.1020  -0.0037 -0.1346 192 TYR B O   
3017 C  CB  . TYR B 173 ? 1.2831 1.4670 0.5416 0.0969  -0.0273 -0.1579 192 TYR B CB  
3018 C  CG  . TYR B 173 ? 1.2945 1.4915 0.5454 0.0809  -0.0498 -0.1703 192 TYR B CG  
3019 C  CD1 . TYR B 173 ? 1.2723 1.4510 0.5471 0.0594  -0.0623 -0.1824 192 TYR B CD1 
3020 C  CD2 . TYR B 173 ? 1.3130 1.5425 0.5307 0.0878  -0.0586 -0.1722 192 TYR B CD2 
3021 C  CE1 . TYR B 173 ? 1.3198 1.5186 0.5921 0.0435  -0.0825 -0.1966 192 TYR B CE1 
3022 C  CE2 . TYR B 173 ? 1.3502 1.5998 0.5628 0.0749  -0.0810 -0.1864 192 TYR B CE2 
3023 C  CZ  . TYR B 173 ? 1.3838 1.6209 0.6261 0.0520  -0.0929 -0.1995 192 TYR B CZ  
3024 O  OH  . TYR B 173 ? 1.4373 1.7033 0.6780 0.0388  -0.1147 -0.2156 192 TYR B OH  
3025 N  N   . GLU B 174 ? 1.1878 1.3846 0.4994 0.1236  0.0165  -0.1144 193 GLU B N   
3026 C  CA  . GLU B 174 ? 1.1975 1.3917 0.5277 0.1367  0.0339  -0.1127 193 GLU B CA  
3027 C  C   . GLU B 174 ? 1.1864 1.3830 0.5664 0.1286  0.0344  -0.0943 193 GLU B C   
3028 O  O   . GLU B 174 ? 1.1280 1.3061 0.5249 0.1343  0.0367  -0.1015 193 GLU B O   
3029 C  CB  . GLU B 174 ? 1.2042 1.4299 0.5201 0.1524  0.0544  -0.1041 193 GLU B CB  
3030 N  N   . LYS B 175 ? 1.1660 1.3832 0.5657 0.1173  0.0321  -0.0712 194 LYS B N   
3031 C  CA  . LYS B 175 ? 1.1325 1.3517 0.5772 0.1076  0.0314  -0.0547 194 LYS B CA  
3032 C  C   . LYS B 175 ? 1.1214 1.3089 0.5776 0.0972  0.0149  -0.0661 194 LYS B C   
3033 O  O   . LYS B 175 ? 1.0663 1.2442 0.5515 0.0963  0.0158  -0.0632 194 LYS B O   
3034 C  CB  . LYS B 175 ? 1.1629 1.4028 0.6198 0.0981  0.0323  -0.0291 194 LYS B CB  
3035 C  CG  . LYS B 175 ? 1.3139 1.5808 0.7642 0.1048  0.0532  -0.0133 194 LYS B CG  
3036 C  CD  . LYS B 175 ? 1.4201 1.6958 0.8808 0.0950  0.0559  0.0134  194 LYS B CD  
3037 C  CE  . LYS B 175 ? 1.5032 1.7994 0.9497 0.0993  0.0794  0.0300  194 LYS B CE  
3038 N  NZ  . LYS B 175 ? 1.5115 1.8061 0.9605 0.0907  0.0837  0.0571  194 LYS B NZ  
3039 N  N   . ALA B 176 ? 1.0792 1.2526 0.5119 0.0888  0.0005  -0.0797 195 ALA B N   
3040 C  CA  . ALA B 176 ? 1.0663 1.2084 0.5057 0.0756  -0.0126 -0.0929 195 ALA B CA  
3041 C  C   . ALA B 176 ? 1.0910 1.1959 0.5192 0.0848  -0.0069 -0.1113 195 ALA B C   
3042 O  O   . ALA B 176 ? 1.0208 1.1003 0.4663 0.0802  -0.0092 -0.1116 195 ALA B O   
3043 C  CB  . ALA B 176 ? 1.0233 1.1660 0.4417 0.0626  -0.0280 -0.1062 195 ALA B CB  
3044 N  N   . ARG B 177 ? 1.1319 1.2323 0.5288 0.1004  0.0015  -0.1255 196 ARG B N   
3045 C  CA  . ARG B 177 ? 1.2156 1.2772 0.5965 0.1146  0.0081  -0.1431 196 ARG B CA  
3046 C  C   . ARG B 177 ? 1.1488 1.2175 0.5600 0.1298  0.0178  -0.1302 196 ARG B C   
3047 O  O   . ARG B 177 ? 1.1022 1.1342 0.5135 0.1358  0.0170  -0.1371 196 ARG B O   
3048 C  CB  . ARG B 177 ? 1.2790 1.3384 0.6201 0.1316  0.0167  -0.1607 196 ARG B CB  
3049 C  CG  . ARG B 177 ? 1.4336 1.4380 0.7450 0.1423  0.0194  -0.1852 196 ARG B CG  
3050 C  CD  . ARG B 177 ? 1.4859 1.4930 0.7695 0.1700  0.0337  -0.1974 196 ARG B CD  
3051 N  NE  . ARG B 177 ? 1.5227 1.5696 0.7882 0.1727  0.0379  -0.1972 196 ARG B NE  
3052 C  CZ  . ARG B 177 ? 1.6792 1.7152 0.9013 0.1722  0.0355  -0.2182 196 ARG B CZ  
3053 N  NH1 . ARG B 177 ? 1.6970 1.6801 0.8873 0.1660  0.0290  -0.2450 196 ARG B NH1 
3054 N  NH2 . ARG B 177 ? 1.6289 1.7070 0.8368 0.1775  0.0408  -0.2126 196 ARG B NH2 
3055 N  N   . ASN B 178 ? 1.1353 1.2508 0.5694 0.1361  0.0273  -0.1128 197 ASN B N   
3056 C  CA  . ASN B 178 ? 1.1315 1.2679 0.5991 0.1487  0.0365  -0.1022 197 ASN B CA  
3057 C  C   . ASN B 178 ? 1.0845 1.2041 0.5808 0.1385  0.0269  -0.0940 197 ASN B C   
3058 O  O   . ASN B 178 ? 1.0254 1.1316 0.5302 0.1529  0.0283  -0.0978 197 ASN B O   
3059 C  CB  . ASN B 178 ? 1.2864 1.4764 0.7762 0.1472  0.0486  -0.0841 197 ASN B CB  
3060 C  CG  . ASN B 178 ? 1.5049 1.7253 1.0332 0.1571  0.0585  -0.0767 197 ASN B CG  
3061 O  OD1 . ASN B 178 ? 1.7271 1.9390 1.2565 0.1767  0.0604  -0.0883 197 ASN B OD1 
3062 N  ND2 . ASN B 178 ? 1.6337 1.8900 1.1925 0.1442  0.0650  -0.0580 197 ASN B ND2 
3063 N  N   . SER B 179 ? 1.0040 1.1262 0.5131 0.1163  0.0173  -0.0829 198 SER B N   
3064 C  CA  . SER B 179 ? 0.9708 1.0771 0.5041 0.1047  0.0083  -0.0756 198 SER B CA  
3065 C  C   . SER B 179 ? 1.0034 1.0559 0.5143 0.1045  0.0018  -0.0914 198 SER B C   
3066 O  O   . SER B 179 ? 0.9798 1.0131 0.5006 0.1119  0.0014  -0.0900 198 SER B O   
3067 C  CB  . SER B 179 ? 0.9294 1.0509 0.4785 0.0832  0.0002  -0.0617 198 SER B CB  
3068 O  OG  . SER B 179 ? 0.9235 1.0839 0.4968 0.0824  0.0078  -0.0437 198 SER B OG  
3069 N  N   . LEU B 180 ? 1.0235 1.0505 0.5018 0.0967  -0.0022 -0.1072 199 LEU B N   
3070 C  CA  . LEU B 180 ? 1.0725 1.0416 0.5264 0.0916  -0.0059 -0.1234 199 LEU B CA  
3071 C  C   . LEU B 180 ? 1.1124 1.0451 0.5441 0.1175  0.0026  -0.1338 199 LEU B C   
3072 O  O   . LEU B 180 ? 1.1552 1.0372 0.5734 0.1172  0.0018  -0.1392 199 LEU B O   
3073 C  CB  . LEU B 180 ? 1.1299 1.0842 0.5567 0.0730  -0.0125 -0.1406 199 LEU B CB  
3074 C  CG  . LEU B 180 ? 1.0898 1.0750 0.5372 0.0486  -0.0237 -0.1326 199 LEU B CG  
3075 C  CD1 . LEU B 180 ? 1.1491 1.1359 0.5697 0.0354  -0.0309 -0.1517 199 LEU B CD1 
3076 C  CD2 . LEU B 180 ? 1.0690 1.0360 0.5382 0.0315  -0.0290 -0.1264 199 LEU B CD2 
3077 N  N   . GLN B 181 ? 1.1067 1.0642 0.5331 0.1409  0.0117  -0.1360 200 GLN B N   
3078 C  CA  . GLN B 181 ? 1.1724 1.1034 0.5805 0.1715  0.0199  -0.1452 200 GLN B CA  
3079 C  C   . GLN B 181 ? 1.1627 1.1027 0.6002 0.1846  0.0193  -0.1316 200 GLN B C   
3080 O  O   . GLN B 181 ? 1.1908 1.0857 0.6088 0.2026  0.0203  -0.1374 200 GLN B O   
3081 C  CB  . GLN B 181 ? 1.2082 1.1709 0.6058 0.1939  0.0307  -0.1523 200 GLN B CB  
3082 C  CG  . GLN B 181 ? 1.3010 1.2370 0.6551 0.1898  0.0319  -0.1724 200 GLN B CG  
3083 C  CD  . GLN B 181 ? 1.3871 1.3563 0.7281 0.2118  0.0438  -0.1795 200 GLN B CD  
3084 O  OE1 . GLN B 181 ? 1.3995 1.4222 0.7693 0.2245  0.0519  -0.1672 200 GLN B OE1 
3085 N  NE2 . GLN B 181 ? 1.4197 1.3581 0.7166 0.2147  0.0459  -0.2008 200 GLN B NE2 
3086 N  N   . LYS B 182 ? 1.0431 1.0387 0.5236 0.1765  0.0179  -0.1144 201 LYS B N   
3087 C  CA  . LYS B 182 ? 1.0409 1.0528 0.5527 0.1854  0.0155  -0.1028 201 LYS B CA  
3088 C  C   . LYS B 182 ? 1.0450 1.0085 0.5507 0.1734  0.0068  -0.0995 201 LYS B C   
3089 O  O   . LYS B 182 ? 1.1338 1.0856 0.6438 0.1898  0.0050  -0.0961 201 LYS B O   
3090 C  CB  . LYS B 182 ? 1.0069 1.0826 0.5640 0.1727  0.0165  -0.0868 201 LYS B CB  
3091 C  CG  . LYS B 182 ? 1.0024 1.1308 0.5710 0.1852  0.0286  -0.0876 201 LYS B CG  
3092 C  CD  . LYS B 182 ? 0.9927 1.1730 0.6030 0.1672  0.0312  -0.0712 201 LYS B CD  
3093 C  CE  . LYS B 182 ? 1.0038 1.2384 0.6285 0.1751  0.0464  -0.0704 201 LYS B CE  
3094 N  NZ  . LYS B 182 ? 1.0183 1.2930 0.6810 0.1538  0.0504  -0.0540 201 LYS B NZ  
3095 N  N   . VAL B 183 ? 0.9886 0.9282 0.4843 0.1455  0.0016  -0.1008 202 VAL B N   
3096 C  CA  . VAL B 183 ? 1.0114 0.9056 0.5000 0.1293  -0.0040 -0.0991 202 VAL B CA  
3097 C  C   . VAL B 183 ? 1.0967 0.9202 0.5411 0.1447  0.0002  -0.1119 202 VAL B C   
3098 O  O   . VAL B 183 ? 1.1480 0.9424 0.5877 0.1559  -0.0001 -0.1062 202 VAL B O   
3099 C  CB  . VAL B 183 ? 0.9859 0.8791 0.4754 0.0959  -0.0097 -0.1011 202 VAL B CB  
3100 C  CG1 . VAL B 183 ? 0.9449 0.7932 0.4278 0.0776  -0.0129 -0.1010 202 VAL B CG1 
3101 C  CG2 . VAL B 183 ? 0.9226 0.8773 0.4496 0.0840  -0.0135 -0.0868 202 VAL B CG2 
3102 N  N   . ILE B 184 ? 1.1288 0.9237 0.5387 0.1462  0.0049  -0.1288 203 ILE B N   
3103 C  CA  . ILE B 184 ? 1.2778 0.9967 0.6384 0.1600  0.0113  -0.1436 203 ILE B CA  
3104 C  C   . ILE B 184 ? 1.3406 1.0468 0.6895 0.2026  0.0162  -0.1415 203 ILE B C   
3105 O  O   . ILE B 184 ? 1.4004 1.0378 0.7125 0.2163  0.0203  -0.1453 203 ILE B O   
3106 C  CB  . ILE B 184 ? 1.3658 1.0665 0.6937 0.1539  0.0153  -0.1648 203 ILE B CB  
3107 C  CG1 . ILE B 184 ? 1.4036 1.1072 0.7356 0.1128  0.0089  -0.1711 203 ILE B CG1 
3108 C  CG2 . ILE B 184 ? 1.4704 1.0893 0.7441 0.1708  0.0240  -0.1818 203 ILE B CG2 
3109 C  CD1 . ILE B 184 ? 1.4292 1.0762 0.7489 0.0878  0.0088  -0.1735 203 ILE B CD1 
3110 N  N   . LEU B 185 ? 1.3161 1.0886 0.6951 0.2234  0.0165  -0.1356 204 LEU B N   
3111 C  CA  . LEU B 185 ? 1.4077 1.1883 0.7847 0.2658  0.0197  -0.1349 204 LEU B CA  
3112 C  C   . LEU B 185 ? 1.4616 1.2254 0.8453 0.2762  0.0140  -0.1222 204 LEU B C   
3113 O  O   . LEU B 185 ? 1.5308 1.2619 0.8889 0.3115  0.0159  -0.1245 204 LEU B O   
3114 C  CB  . LEU B 185 ? 1.4160 1.2853 0.8352 0.2764  0.0216  -0.1309 204 LEU B CB  
3115 C  CG  . LEU B 185 ? 1.5309 1.4326 0.9571 0.3196  0.0258  -0.1342 204 LEU B CG  
3116 C  CD1 . LEU B 185 ? 1.6234 1.4787 1.0012 0.3486  0.0344  -0.1518 204 LEU B CD1 
3117 C  CD2 . LEU B 185 ? 1.5836 1.5777 1.0587 0.3165  0.0294  -0.1293 204 LEU B CD2 
3118 N  N   . ARG B 186 ? 1.4668 1.2530 0.8821 0.2470  0.0069  -0.1093 205 ARG B N   
3119 C  CA  A ARG B 186 ? 1.5026 1.2798 0.9273 0.2511  0.0007  -0.0965 205 ARG B CA  
3120 C  CA  B ARG B 186 ? 1.4538 1.2322 0.8792 0.2509  0.0006  -0.0965 205 ARG B CA  
3121 C  C   . ARG B 186 ? 1.4800 1.1943 0.8824 0.2239  0.0001  -0.0928 205 ARG B C   
3122 O  O   . ARG B 186 ? 1.5985 1.2796 0.9876 0.2342  -0.0016 -0.0848 205 ARG B O   
3123 C  CB  A ARG B 186 ? 1.4857 1.3428 0.9677 0.2397  -0.0060 -0.0846 205 ARG B CB  
3124 C  CB  B ARG B 186 ? 1.3565 1.2162 0.8397 0.2381  -0.0057 -0.0850 205 ARG B CB  
3125 C  CG  A ARG B 186 ? 1.5545 1.4807 1.0668 0.2660  -0.0053 -0.0861 205 ARG B CG  
3126 C  CG  B ARG B 186 ? 1.3544 1.2836 0.8662 0.2612  -0.0033 -0.0880 205 ARG B CG  
3127 C  CD  A ARG B 186 ? 1.4905 1.4823 1.0556 0.2494  -0.0112 -0.0750 205 ARG B CD  
3128 C  CD  B ARG B 186 ? 1.2395 1.2426 0.8045 0.2393  -0.0055 -0.0790 205 ARG B CD  
3129 N  NE  A ARG B 186 ? 1.4227 1.4828 1.0206 0.2720  -0.0105 -0.0775 205 ARG B NE  
3130 N  NE  B ARG B 186 ? 1.1978 1.2643 0.7875 0.2591  0.0000  -0.0837 205 ARG B NE  
3131 C  CZ  A ARG B 186 ? 1.3467 1.4222 0.9514 0.2995  -0.0169 -0.0778 205 ARG B CZ  
3132 C  CZ  B ARG B 186 ? 1.1780 1.2634 0.7626 0.2606  0.0094  -0.0909 205 ARG B CZ  
3133 N  NH1 A ARG B 186 ? 1.3236 1.3446 0.8993 0.3097  -0.0237 -0.0736 205 ARG B NH1 
3134 N  NH1 B ARG B 186 ? 1.1478 1.1939 0.7029 0.2442  0.0122  -0.0949 205 ARG B NH1 
3135 N  NH2 A ARG B 186 ? 1.3325 1.4798 0.9723 0.3171  -0.0162 -0.0829 205 ARG B NH2 
3136 N  NH2 B ARG B 186 ? 1.1715 1.3180 0.7808 0.2781  0.0163  -0.0952 205 ARG B NH2 
3137 N  N   . PHE B 187 ? 1.4414 1.1418 0.8392 0.1899  0.0020  -0.0992 206 PHE B N   
3138 C  CA  . PHE B 187 ? 1.3842 1.0383 0.7694 0.1580  0.0025  -0.0976 206 PHE B CA  
3139 C  C   . PHE B 187 ? 1.4147 1.0209 0.7672 0.1351  0.0085  -0.1146 206 PHE B C   
3140 O  O   . PHE B 187 ? 1.3951 1.0406 0.7654 0.1149  0.0053  -0.1212 206 PHE B O   
3141 C  CB  . PHE B 187 ? 1.2890 1.0082 0.7252 0.1324  -0.0054 -0.0863 206 PHE B CB  
3142 C  CG  . PHE B 187 ? 1.2815 0.9780 0.7203 0.0994  -0.0063 -0.0825 206 PHE B CG  
3143 C  CD1 . PHE B 187 ? 1.2786 0.9425 0.7089 0.1023  -0.0054 -0.0726 206 PHE B CD1 
3144 C  CD2 . PHE B 187 ? 1.2244 0.9422 0.6782 0.0666  -0.0088 -0.0881 206 PHE B CD2 
3145 C  CE1 . PHE B 187 ? 1.3144 0.9629 0.7497 0.0715  -0.0045 -0.0691 206 PHE B CE1 
3146 C  CE2 . PHE B 187 ? 1.2315 0.9384 0.6933 0.0370  -0.0095 -0.0855 206 PHE B CE2 
3147 C  CZ  . PHE B 187 ? 1.2774 0.9498 0.7309 0.0385  -0.0064 -0.0761 206 PHE B CZ  
3148 N  N   . PRO B 188 ? 1.5142 1.0344 0.8169 0.1374  0.0173  -0.1222 207 PRO B N   
3149 C  CA  . PRO B 188 ? 1.5421 1.0156 0.8139 0.1118  0.0237  -0.1417 207 PRO B CA  
3150 C  C   . PRO B 188 ? 1.5872 1.0821 0.8844 0.0648  0.0197  -0.1434 207 PRO B C   
3151 O  O   . PRO B 188 ? 1.7200 1.1938 1.0209 0.0479  0.0217  -0.1343 207 PRO B O   
3152 C  CB  . PRO B 188 ? 1.6454 1.0170 0.8587 0.1246  0.0359  -0.1462 207 PRO B CB  
3153 C  CG  . PRO B 188 ? 1.6601 1.0301 0.8713 0.1645  0.0344  -0.1288 207 PRO B CG  
3154 C  CD  . PRO B 188 ? 1.5106 0.9697 0.7811 0.1602  0.0224  -0.1134 207 PRO B CD  
3155 N  N   . SER B 189 ? 1.5754 1.1162 0.8897 0.0472  0.0141  -0.1547 208 SER B N   
3156 C  CA  . SER B 189 ? 1.4982 1.0744 0.8399 0.0075  0.0077  -0.1584 208 SER B CA  
3157 C  C   . SER B 189 ? 1.5363 1.0969 0.8547 -0.0132 0.0087  -0.1841 208 SER B C   
3158 O  O   . SER B 189 ? 1.4991 1.0815 0.8096 0.0020  0.0064  -0.1929 208 SER B O   
3159 C  CB  . SER B 189 ? 1.3597 1.0241 0.7507 0.0114  -0.0034 -0.1438 208 SER B CB  
3160 O  OG  . SER B 189 ? 1.3391 1.0437 0.7558 -0.0200 -0.0110 -0.1470 208 SER B OG  
3161 N  N   . THR B 190 ? 1.6089 1.1334 0.9163 -0.0487 0.0128  -0.1972 209 THR B N   
3162 C  CA  . THR B 190 ? 1.6597 1.1684 0.9457 -0.0749 0.0133  -0.2257 209 THR B CA  
3163 C  C   . THR B 190 ? 1.6257 1.2208 0.9450 -0.0849 -0.0017 -0.2304 209 THR B C   
3164 O  O   . THR B 190 ? 1.5769 1.1800 0.8776 -0.0833 -0.0048 -0.2491 209 THR B O   
3165 C  CB  . THR B 190 ? 1.6933 1.1528 0.9677 -0.1160 0.0218  -0.2387 209 THR B CB  
3166 O  OG1 . THR B 190 ? 1.7935 1.1733 1.0370 -0.1056 0.0366  -0.2282 209 THR B OG1 
3167 C  CG2 . THR B 190 ? 1.6683 1.0981 0.9130 -0.1415 0.0246  -0.2720 209 THR B CG2 
3168 N  N   . GLU B 191 ? 1.5526 1.2082 0.9170 -0.0932 -0.0106 -0.2132 210 GLU B N   
3169 C  CA  . GLU B 191 ? 1.5701 1.3078 0.9668 -0.0981 -0.0251 -0.2116 210 GLU B CA  
3170 C  C   . GLU B 191 ? 1.5871 1.3566 0.9800 -0.0648 -0.0280 -0.2038 210 GLU B C   
3171 O  O   . GLU B 191 ? 1.5960 1.4075 0.9884 -0.0663 -0.0362 -0.2128 210 GLU B O   
3172 C  CB  . GLU B 191 ? 1.5862 1.3708 1.0282 -0.1063 -0.0313 -0.1909 210 GLU B CB  
3173 C  CG  . GLU B 191 ? 1.6552 1.5183 1.1289 -0.1131 -0.0460 -0.1885 210 GLU B CG  
3174 C  CD  . GLU B 191 ? 1.9191 1.8003 1.3904 -0.1434 -0.0533 -0.2147 210 GLU B CD  
3175 O  OE1 . GLU B 191 ? 2.0548 1.8902 1.5089 -0.1686 -0.0459 -0.2343 210 GLU B OE1 
3176 O  OE2 . GLU B 191 ? 2.0706 2.0135 1.5568 -0.1424 -0.0665 -0.2160 210 GLU B OE2 
3177 N  N   . ALA B 192 ? 1.5359 1.2878 0.9256 -0.0353 -0.0208 -0.1878 211 ALA B N   
3178 C  CA  . ALA B 192 ? 1.4273 1.2085 0.8149 -0.0042 -0.0200 -0.1809 211 ALA B CA  
3179 C  C   . ALA B 192 ? 1.4292 1.1784 0.7738 0.0045  -0.0150 -0.2041 211 ALA B C   
3180 O  O   . ALA B 192 ? 1.5504 1.3393 0.8918 0.0124  -0.0184 -0.2084 211 ALA B O   
3181 C  CB  . ALA B 192 ? 1.3392 1.1136 0.7371 0.0233  -0.0140 -0.1617 211 ALA B CB  
3182 N  N   . GLN B 193 ? 1.5036 1.1783 0.8120 0.0042  -0.0058 -0.2185 212 GLN B N   
3183 C  CA  . GLN B 193 ? 1.6587 1.2917 0.9208 0.0114  0.0001  -0.2439 212 GLN B CA  
3184 C  C   . GLN B 193 ? 1.6337 1.2847 0.8873 -0.0183 -0.0078 -0.2678 212 GLN B C   
3185 O  O   . GLN B 193 ? 1.6895 1.3406 0.9153 -0.0091 -0.0072 -0.2854 212 GLN B O   
3186 C  CB  . GLN B 193 ? 1.7868 1.3253 1.0067 0.0182  0.0133  -0.2538 212 GLN B CB  
3187 C  CG  . GLN B 193 ? 1.8118 1.3280 1.0168 0.0633  0.0218  -0.2428 212 GLN B CG  
3188 C  CD  . GLN B 193 ? 1.8144 1.3436 0.9971 0.0908  0.0251  -0.2556 212 GLN B CD  
3189 O  OE1 . GLN B 193 ? 1.7617 1.3088 0.9333 0.0766  0.0214  -0.2739 212 GLN B OE1 
3190 N  NE2 . GLN B 193 ? 1.8433 1.3667 1.0191 0.1317  0.0319  -0.2469 212 GLN B NE2 
3191 N  N   . LYS B 194 ? 1.6584 1.3264 0.9353 -0.0528 -0.0152 -0.2696 213 LYS B N   
3192 C  CA  . LYS B 194 ? 1.7146 1.4131 0.9913 -0.0828 -0.0258 -0.2926 213 LYS B CA  
3193 C  C   . LYS B 194 ? 1.6196 1.3957 0.9101 -0.0682 -0.0375 -0.2862 213 LYS B C   
3194 O  O   . LYS B 194 ? 1.6752 1.4661 0.9439 -0.0740 -0.0436 -0.3084 213 LYS B O   
3195 C  CB  . LYS B 194 ? 1.8022 1.5165 1.1104 -0.1188 -0.0312 -0.2921 213 LYS B CB  
3196 C  CG  . LYS B 194 ? 1.8854 1.6399 1.1993 -0.1512 -0.0437 -0.3177 213 LYS B CG  
3197 C  CD  . LYS B 194 ? 1.9279 1.7082 1.2796 -0.1832 -0.0481 -0.3151 213 LYS B CD  
3198 C  CE  . LYS B 194 ? 1.9869 1.8185 1.3483 -0.2133 -0.0622 -0.3425 213 LYS B CE  
3199 N  NZ  . LYS B 194 ? 1.9889 1.8530 1.3903 -0.2442 -0.0659 -0.3421 213 LYS B NZ  
3200 N  N   . THR B 195 ? 1.4582 1.2803 0.7817 -0.0501 -0.0399 -0.2564 214 THR B N   
3201 C  CA  . THR B 195 ? 1.3786 1.2676 0.7130 -0.0348 -0.0477 -0.2450 214 THR B CA  
3202 C  C   . THR B 195 ? 1.4677 1.3483 0.7714 -0.0050 -0.0387 -0.2484 214 THR B C   
3203 O  O   . THR B 195 ? 1.5046 1.4202 0.7930 0.0002  -0.0438 -0.2560 214 THR B O   
3204 C  CB  . THR B 195 ? 1.2875 1.2209 0.6652 -0.0276 -0.0506 -0.2127 214 THR B CB  
3205 O  OG1 . THR B 195 ? 1.1777 1.1209 0.5823 -0.0538 -0.0584 -0.2115 214 THR B OG1 
3206 C  CG2 . THR B 195 ? 1.2568 1.2519 0.6408 -0.0137 -0.0565 -0.1997 214 THR B CG2 
3207 N  N   . LEU B 196 ? 1.4356 1.2729 0.7292 0.0157  -0.0257 -0.2435 215 LEU B N   
3208 C  CA  . LEU B 196 ? 1.5122 1.3431 0.7786 0.0467  -0.0154 -0.2480 215 LEU B CA  
3209 C  C   . LEU B 196 ? 1.6018 1.4077 0.8218 0.0443  -0.0149 -0.2796 215 LEU B C   
3210 O  O   . LEU B 196 ? 1.5530 1.3857 0.7556 0.0637  -0.0117 -0.2827 215 LEU B O   
3211 C  CB  . LEU B 196 ? 1.5541 1.3424 0.8171 0.0714  -0.0029 -0.2401 215 LEU B CB  
3212 C  CG  . LEU B 196 ? 1.5562 1.3793 0.8608 0.0855  -0.0011 -0.2104 215 LEU B CG  
3213 C  CD1 . LEU B 196 ? 1.5399 1.3168 0.8357 0.1093  0.0083  -0.2077 215 LEU B CD1 
3214 C  CD2 . LEU B 196 ? 1.5875 1.4753 0.9075 0.1022  0.0014  -0.1973 215 LEU B CD2 
3215 N  N   . ASP B 197 ? 1.6885 1.4423 0.8874 0.0198  -0.0166 -0.3033 216 ASP B N   
3216 C  CA  . ASP B 197 ? 1.7914 1.5155 0.9446 0.0124  -0.0166 -0.3380 216 ASP B CA  
3217 C  C   . ASP B 197 ? 1.7553 1.5424 0.9104 -0.0034 -0.0320 -0.3486 216 ASP B C   
3218 O  O   . ASP B 197 ? 1.7884 1.5782 0.9081 0.0045  -0.0323 -0.3693 216 ASP B O   
3219 C  CB  . ASP B 197 ? 1.8862 1.5267 1.0124 -0.0098 -0.0105 -0.3618 216 ASP B CB  
3220 C  CG  . ASP B 197 ? 1.9215 1.5663 1.0758 -0.0501 -0.0187 -0.3625 216 ASP B CG  
3221 O  OD1 . ASP B 197 ? 1.9835 1.6847 1.1555 -0.0727 -0.0332 -0.3703 216 ASP B OD1 
3222 O  OD2 . ASP B 197 ? 2.0105 1.6002 1.1661 -0.0586 -0.0099 -0.3569 216 ASP B OD2 
3223 N  N   . LYS B 198 ? 1.6948 1.5314 0.8884 -0.0234 -0.0449 -0.3351 217 LYS B N   
3224 C  CA  . LYS B 198 ? 1.6137 1.5171 0.8115 -0.0330 -0.0614 -0.3406 217 LYS B CA  
3225 C  C   . LYS B 198 ? 1.6039 1.5546 0.7963 -0.0014 -0.0592 -0.3211 217 LYS B C   
3226 O  O   . LYS B 198 ? 1.5814 1.5660 0.7498 0.0018  -0.0672 -0.3336 217 LYS B O   
3227 C  CB  . LYS B 198 ? 1.5838 1.5295 0.8251 -0.0568 -0.0748 -0.3289 217 LYS B CB  
3228 C  CG  . LYS B 198 ? 1.6978 1.6111 0.9425 -0.0943 -0.0781 -0.3540 217 LYS B CG  
3229 C  CD  . LYS B 198 ? 1.6920 1.6584 0.9800 -0.1173 -0.0922 -0.3467 217 LYS B CD  
3230 C  CE  . LYS B 198 ? 1.6517 1.6244 0.9792 -0.1089 -0.0872 -0.3112 217 LYS B CE  
3231 N  NZ  . LYS B 198 ? 1.6349 1.6577 1.0024 -0.1301 -0.1001 -0.3067 217 LYS B NZ  
3232 N  N   . ILE B 199 ? 1.5017 1.4562 0.7156 0.0204  -0.0480 -0.2915 218 ILE B N   
3233 C  CA  . ILE B 199 ? 1.4710 1.4653 0.6808 0.0484  -0.0409 -0.2725 218 ILE B CA  
3234 C  C   . ILE B 199 ? 1.5167 1.4845 0.6803 0.0677  -0.0300 -0.2941 218 ILE B C   
3235 O  O   . ILE B 199 ? 1.4739 1.4768 0.6163 0.0819  -0.0287 -0.2936 218 ILE B O   
3236 C  CB  . ILE B 199 ? 1.3963 1.4019 0.6428 0.0637  -0.0303 -0.2394 218 ILE B CB  
3237 C  CG1 . ILE B 199 ? 1.3346 1.3692 0.6235 0.0467  -0.0409 -0.2180 218 ILE B CG1 
3238 C  CG2 . ILE B 199 ? 1.2970 1.3412 0.5372 0.0888  -0.0195 -0.2232 218 ILE B CG2 
3239 C  CD1 . ILE B 199 ? 1.2363 1.2770 0.5621 0.0568  -0.0319 -0.1894 218 ILE B CD1 
3240 N  N   . LEU B 200 ? 1.5566 1.4608 0.7022 0.0696  -0.0213 -0.3121 219 LEU B N   
3241 C  CA  . LEU B 200 ? 1.6884 1.5581 0.7871 0.0891  -0.0103 -0.3360 219 LEU B CA  
3242 C  C   . LEU B 200 ? 1.7356 1.6100 0.7958 0.0743  -0.0210 -0.3675 219 LEU B C   
3243 O  O   . LEU B 200 ? 1.8034 1.6827 0.8269 0.0932  -0.0149 -0.3808 219 LEU B O   
3244 C  CB  . LEU B 200 ? 1.7176 1.5094 0.8017 0.0948  0.0005  -0.3483 219 LEU B CB  
3245 C  CG  . LEU B 200 ? 1.8149 1.5612 0.8499 0.1199  0.0139  -0.3722 219 LEU B CG  
3246 C  CD1 . LEU B 200 ? 1.8013 1.5901 0.8383 0.1568  0.0263  -0.3567 219 LEU B CD1 
3247 C  CD2 . LEU B 200 ? 1.8446 1.5073 0.8644 0.1243  0.0232  -0.3813 219 LEU B CD2 
3248 N  N   . ARG B 201 ? 1.7540 1.6306 0.8238 0.0407  -0.0368 -0.3803 220 ARG B N   
3249 C  CA  . ARG B 201 ? 1.8945 1.7861 0.9347 0.0221  -0.0508 -0.4120 220 ARG B CA  
3250 C  C   . ARG B 201 ? 1.8292 1.7969 0.8678 0.0359  -0.0599 -0.3975 220 ARG B C   
3251 O  O   . ARG B 201 ? 1.8945 1.8739 0.8919 0.0462  -0.0613 -0.4165 220 ARG B O   
3252 C  CB  . ARG B 201 ? 1.9592 1.8479 1.0217 -0.0179 -0.0653 -0.4258 220 ARG B CB  
3253 C  CG  . ARG B 201 ? 2.0674 1.9673 1.1030 -0.0433 -0.0804 -0.4655 220 ARG B CG  
3254 C  CD  . ARG B 201 ? 2.0840 2.0104 1.1567 -0.0808 -0.0961 -0.4712 220 ARG B CD  
3255 N  NE  . ARG B 201 ? 2.1228 1.9927 1.2185 -0.0996 -0.0853 -0.4660 220 ARG B NE  
3256 C  CZ  . ARG B 201 ? 2.0982 1.9840 1.2327 -0.1299 -0.0930 -0.4636 220 ARG B CZ  
3257 N  NH1 . ARG B 201 ? 2.1057 2.0667 1.2654 -0.1448 -0.1131 -0.4666 220 ARG B NH1 
3258 N  NH2 . ARG B 201 ? 2.1166 1.9433 1.2640 -0.1434 -0.0798 -0.4575 220 ARG B NH2 
3259 N  N   . ILE B 202 ? 1.6887 1.7031 0.7686 0.0369  -0.0650 -0.3636 221 ILE B N   
3260 C  CA  . ILE B 202 ? 1.6844 1.7648 0.7633 0.0515  -0.0714 -0.3428 221 ILE B CA  
3261 C  C   . ILE B 202 ? 1.7478 1.8329 0.8002 0.0843  -0.0529 -0.3314 221 ILE B C   
3262 O  O   . ILE B 202 ? 1.7689 1.8914 0.7917 0.0967  -0.0559 -0.3311 221 ILE B O   
3263 C  CB  . ILE B 202 ? 1.6146 1.7318 0.7430 0.0459  -0.0779 -0.3083 221 ILE B CB  
3264 C  CG1 . ILE B 202 ? 1.5980 1.7276 0.7476 0.0152  -0.0981 -0.3230 221 ILE B CG1 
3265 C  CG2 . ILE B 202 ? 1.5826 1.7552 0.7056 0.0650  -0.0796 -0.2818 221 ILE B CG2 
3266 C  CD1 . ILE B 202 ? 1.5536 1.7098 0.7526 0.0091  -0.1032 -0.2926 221 ILE B CD1 
3267 N  N   . GLU B 203 ? 1.6797 1.7295 0.7414 0.0988  -0.0340 -0.3232 222 GLU B N   
3268 C  CA  . GLU B 203 ? 1.7499 1.8058 0.7912 0.1296  -0.0140 -0.3155 222 GLU B CA  
3269 C  C   . GLU B 203 ? 1.8584 1.8995 0.8420 0.1389  -0.0123 -0.3493 222 GLU B C   
3270 O  O   . GLU B 203 ? 1.8816 1.9540 0.8382 0.1587  -0.0040 -0.3446 222 GLU B O   
3271 C  CB  . GLU B 203 ? 1.7545 1.7740 0.8166 0.1435  0.0030  -0.3077 222 GLU B CB  
3272 C  CG  . GLU B 203 ? 1.7874 1.8262 0.8430 0.1749  0.0247  -0.2957 222 GLU B CG  
3273 C  CD  . GLU B 203 ? 1.8401 1.8499 0.9185 0.1910  0.0388  -0.2902 222 GLU B CD  
3274 O  OE1 . GLU B 203 ? 1.7996 1.7552 0.8776 0.1841  0.0348  -0.3045 222 GLU B OE1 
3275 O  OE2 . GLU B 203 ? 1.7953 1.8375 0.8913 0.2114  0.0548  -0.2718 222 GLU B OE2 
3276 N  N   . LYS B 204 ? 1.9402 1.9307 0.9037 0.1233  -0.0188 -0.3833 223 LYS B N   
3277 C  CA  . LYS B 204 ? 2.0830 2.0482 0.9902 0.1279  -0.0182 -0.4215 223 LYS B CA  
3278 C  C   . LYS B 204 ? 2.1216 2.1362 1.0016 0.1202  -0.0354 -0.4332 223 LYS B C   
3279 O  O   . LYS B 204 ? 2.1098 2.1351 0.9446 0.1385  -0.0300 -0.4471 223 LYS B O   
3280 C  CB  . LYS B 204 ? 2.1459 2.0375 1.0420 0.1080  -0.0199 -0.4535 223 LYS B CB  
3281 C  CG  . LYS B 204 ? 2.3310 2.1768 1.1686 0.1095  -0.0172 -0.4972 223 LYS B CG  
3282 C  CD  . LYS B 204 ? 2.3637 2.2327 1.1764 0.0835  -0.0380 -0.5281 223 LYS B CD  
3283 C  CE  . LYS B 204 ? 2.4152 2.2226 1.1737 0.0780  -0.0345 -0.5755 223 LYS B CE  
3284 N  NZ  . LYS B 204 ? 2.4524 2.2859 1.1894 0.0495  -0.0563 -0.6095 223 LYS B NZ  
3285 N  N   . GLU B 205 ? 2.1036 2.1504 1.0100 0.0958  -0.0559 -0.4277 224 GLU B N   
3286 C  CA  . GLU B 205 ? 2.1236 2.2233 1.0073 0.0899  -0.0761 -0.4381 224 GLU B CA  
3287 C  C   . GLU B 205 ? 2.0995 2.2536 0.9709 0.1171  -0.0711 -0.4069 224 GLU B C   
3288 O  O   . GLU B 205 ? 2.2115 2.3917 1.0369 0.1282  -0.0765 -0.4206 224 GLU B O   
3289 C  CB  . GLU B 205 ? 2.0659 2.1900 0.9860 0.0592  -0.0990 -0.4399 224 GLU B CB  
3290 C  CG  . GLU B 205 ? 2.1350 2.2092 1.0588 0.0267  -0.1045 -0.4764 224 GLU B CG  
3291 C  CD  . GLU B 205 ? 2.1564 2.2600 1.1203 -0.0053 -0.1249 -0.4794 224 GLU B CD  
3292 O  OE1 . GLU B 205 ? 2.1526 2.3217 1.1323 -0.0014 -0.1406 -0.4616 224 GLU B OE1 
3293 O  OE2 . GLU B 205 ? 2.2247 2.2844 1.2024 -0.0342 -0.1244 -0.5005 224 GLU B OE2 
3294 N  N   . VAL B 206 ? 2.0205 2.1890 0.9303 0.1268  -0.0598 -0.3659 225 VAL B N   
3295 C  CA  . VAL B 206 ? 2.0027 2.2155 0.9033 0.1497  -0.0506 -0.3323 225 VAL B CA  
3296 C  C   . VAL B 206 ? 2.0580 2.2628 0.9217 0.1768  -0.0258 -0.3337 225 VAL B C   
3297 O  O   . VAL B 206 ? 2.0087 2.2486 0.8456 0.1945  -0.0185 -0.3161 225 VAL B O   
3298 C  CB  . VAL B 206 ? 1.8957 2.1228 0.8505 0.1478  -0.0451 -0.2901 225 VAL B CB  
3299 C  CG1 . VAL B 206 ? 1.8380 2.1029 0.7821 0.1681  -0.0326 -0.2546 225 VAL B CG1 
3300 C  CG2 . VAL B 206 ? 1.8668 2.1076 0.8547 0.1243  -0.0690 -0.2889 225 VAL B CG2 
3301 N  N   . ASN B 207 ? 2.0538 2.2123 0.9135 0.1808  -0.0127 -0.3548 226 ASN B N   
3302 C  CA  . ASN B 207 ? 2.0775 2.2265 0.9072 0.2080  0.0120  -0.3598 226 ASN B CA  
3303 C  C   . ASN B 207 ? 1.9650 2.1381 0.8281 0.2237  0.0346  -0.3208 226 ASN B C   
3304 O  O   . ASN B 207 ? 1.7787 1.9545 0.6928 0.2132  0.0335  -0.2965 226 ASN B O   
3305 C  CB  . ASN B 207 ? 2.1261 2.2959 0.8917 0.2225  0.0118  -0.3784 226 ASN B CB  
3306 C  CG  . ASN B 207 ? 2.1794 2.3273 0.9085 0.2066  -0.0097 -0.4228 226 ASN B CG  
3307 O  OD1 . ASN B 207 ? 2.1569 2.2779 0.9094 0.1812  -0.0254 -0.4386 226 ASN B OD1 
3308 N  ND2 . ASN B 207 ? 2.2929 2.4537 0.9631 0.2203  -0.0096 -0.4441 226 ASN B ND2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   GLN 2   21  ?   ?   ?   A . n 
A 1 3   SER 3   22  22  SER SER A . n 
A 1 4   VAL 4   23  23  VAL VAL A . n 
A 1 5   ASP 5   24  24  ASP ASP A . n 
A 1 6   GLU 6   25  25  GLU GLU A . n 
A 1 7   MSE 7   26  26  MSE MSE A . n 
A 1 8   LEU 8   27  27  LEU LEU A . n 
A 1 9   GLN 9   28  28  GLN GLN A . n 
A 1 10  LYS 10  29  29  LYS LYS A . n 
A 1 11  VAL 11  30  30  VAL VAL A . n 
A 1 12  SER 12  31  31  SER SER A . n 
A 1 13  ALA 13  32  32  ALA ALA A . n 
A 1 14  ALA 14  33  33  ALA ALA A . n 
A 1 15  ILE 15  34  34  ILE ILE A . n 
A 1 16  GLU 16  35  35  GLU GLU A . n 
A 1 17  ALA 17  36  36  ALA ALA A . n 
A 1 18  GLY 18  37  37  GLY GLY A . n 
A 1 19  GLN 19  38  38  GLN GLN A . n 
A 1 20  ASN 20  39  39  ASN ASN A . n 
A 1 21  GLY 21  40  40  GLY GLY A . n 
A 1 22  GLN 22  41  41  GLN GLN A . n 
A 1 23  ALA 23  42  42  ALA ALA A . n 
A 1 24  VAL 24  43  43  VAL VAL A . n 
A 1 25  SER 25  44  44  SER SER A . n 
A 1 26  TYR 26  45  45  TYR TYR A . n 
A 1 27  PHE 27  46  46  PHE PHE A . n 
A 1 28  ARG 28  47  47  ARG ARG A . n 
A 1 29  GLN 29  48  48  GLN GLN A . n 
A 1 30  THR 30  49  49  THR THR A . n 
A 1 31  ILE 31  50  50  ILE ILE A . n 
A 1 32  ALA 32  51  51  ALA ALA A . n 
A 1 33  LEU 33  52  52  LEU LEU A . n 
A 1 34  ASN 34  53  53  ASN ASN A . n 
A 1 35  ILE 35  54  54  ILE ILE A . n 
A 1 36  ASP 36  55  55  ASP ASP A . n 
A 1 37  ARG 37  56  56  ARG ARG A . n 
A 1 38  THR 38  57  57  THR THR A . n 
A 1 39  GLU 39  58  58  GLU GLU A . n 
A 1 40  MSE 40  59  59  MSE MSE A . n 
A 1 41  TYR 41  60  60  TYR TYR A . n 
A 1 42  TYR 42  61  61  TYR TYR A . n 
A 1 43  TRP 43  62  62  TRP TRP A . n 
A 1 44  THR 44  63  63  THR THR A . n 
A 1 45  ASN 45  64  64  ASN ASN A . n 
A 1 46  VAL 46  65  65  VAL VAL A . n 
A 1 47  ASP 47  66  66  ASP ASP A . n 
A 1 48  LYS 48  67  67  LYS LYS A . n 
A 1 49  ASN 49  68  68  ASN ASN A . n 
A 1 50  SER 50  69  69  SER SER A . n 
A 1 51  GLU 51  70  70  GLU GLU A . n 
A 1 52  ILE 52  71  71  ILE ILE A . n 
A 1 53  SER 53  72  72  SER SER A . n 
A 1 54  SER 54  73  73  SER SER A . n 
A 1 55  LYS 55  74  74  LYS LYS A . n 
A 1 56  LEU 56  75  75  LEU LEU A . n 
A 1 57  ALA 57  76  76  ALA ALA A . n 
A 1 58  THR 58  77  77  THR THR A . n 
A 1 59  GLU 59  78  78  GLU GLU A . n 
A 1 60  LEU 60  79  79  LEU LEU A . n 
A 1 61  ALA 61  80  80  ALA ALA A . n 
A 1 62  LEU 62  81  81  LEU LEU A . n 
A 1 63  ALA 63  82  82  ALA ALA A . n 
A 1 64  TYR 64  83  83  TYR TYR A . n 
A 1 65  LYS 65  84  84  LYS LYS A . n 
A 1 66  LYS 66  85  85  LYS LYS A . n 
A 1 67  ASN 67  86  86  ASN ASN A . n 
A 1 68  ARG 68  87  87  ARG ARG A . n 
A 1 69  ASN 69  88  88  ASN ASN A . n 
A 1 70  TYR 70  89  89  TYR TYR A . n 
A 1 71  ASP 71  90  90  ASP ASP A . n 
A 1 72  LYS 72  91  91  LYS LYS A . n 
A 1 73  ALA 73  92  92  ALA ALA A . n 
A 1 74  TYR 74  93  93  TYR TYR A . n 
A 1 75  LEU 75  94  94  LEU LEU A . n 
A 1 76  PHE 76  95  95  PHE PHE A . n 
A 1 77  TYR 77  96  96  TYR TYR A . n 
A 1 78  LYS 78  97  97  LYS LYS A . n 
A 1 79  GLU 79  98  98  GLU GLU A . n 
A 1 80  LEU 80  99  99  LEU LEU A . n 
A 1 81  LEU 81  100 100 LEU LEU A . n 
A 1 82  GLN 82  101 101 GLN GLN A . n 
A 1 83  LYS 83  102 102 LYS LYS A . n 
A 1 84  ALA 84  103 103 ALA ALA A . n 
A 1 85  PRO 85  104 104 PRO PRO A . n 
A 1 86  ASN 86  105 105 ASN ASN A . n 
A 1 87  ASN 87  106 106 ASN ASN A . n 
A 1 88  VAL 88  107 107 VAL VAL A . n 
A 1 89  ASP 89  108 108 ASP ASP A . n 
A 1 90  CSX 90  109 109 CSX CSX A . n 
A 1 91  LEU 91  110 110 LEU LEU A . n 
A 1 92  GLU 92  111 111 GLU GLU A . n 
A 1 93  ALA 93  112 112 ALA ALA A . n 
A 1 94  CYS 94  113 113 CYS CYS A . n 
A 1 95  ALA 95  114 114 ALA ALA A . n 
A 1 96  GLU 96  115 115 GLU GLU A . n 
A 1 97  MSE 97  116 116 MSE MSE A . n 
A 1 98  GLN 98  117 117 GLN GLN A . n 
A 1 99  VAL 99  118 118 VAL VAL A . n 
A 1 100 CYS 100 119 119 CYS CYS A . n 
A 1 101 ARG 101 120 120 ARG ARG A . n 
A 1 102 GLY 102 121 121 GLY GLY A . n 
A 1 103 GLN 103 122 122 GLN GLN A . n 
A 1 104 GLU 104 123 123 GLU GLU A . n 
A 1 105 LYS 105 124 124 LYS LYS A . n 
A 1 106 ASP 106 125 125 ASP ASP A . n 
A 1 107 ALA 107 126 126 ALA ALA A . n 
A 1 108 LEU 108 127 127 LEU LEU A . n 
A 1 109 ARG 109 128 128 ARG ARG A . n 
A 1 110 MSE 110 129 129 MSE MSE A . n 
A 1 111 TYR 111 130 130 TYR TYR A . n 
A 1 112 GLU 112 131 131 GLU GLU A . n 
A 1 113 LYS 113 132 132 LYS LYS A . n 
A 1 114 ILE 114 133 133 ILE ILE A . n 
A 1 115 LEU 115 134 134 LEU LEU A . n 
A 1 116 GLN 116 135 135 GLN GLN A . n 
A 1 117 LEU 117 136 136 LEU LEU A . n 
A 1 118 GLU 118 137 137 GLU GLU A . n 
A 1 119 ALA 119 138 138 ALA ALA A . n 
A 1 120 ASP 120 139 139 ASP ASP A . n 
A 1 121 ASN 121 140 140 ASN ASN A . n 
A 1 122 LEU 122 141 141 LEU LEU A . n 
A 1 123 ALA 123 142 142 ALA ALA A . n 
A 1 124 ALA 124 143 143 ALA ALA A . n 
A 1 125 ASN 125 144 144 ASN ASN A . n 
A 1 126 ILE 126 145 145 ILE ILE A . n 
A 1 127 PHE 127 146 146 PHE PHE A . n 
A 1 128 LEU 128 147 147 LEU LEU A . n 
A 1 129 GLY 129 148 148 GLY GLY A . n 
A 1 130 ASN 130 149 149 ASN ASN A . n 
A 1 131 TYR 131 150 150 TYR TYR A . n 
A 1 132 TYR 132 151 151 TYR TYR A . n 
A 1 133 TYR 133 152 152 TYR TYR A . n 
A 1 134 LEU 134 153 153 LEU LEU A . n 
A 1 135 THR 135 154 154 THR THR A . n 
A 1 136 ALA 136 155 155 ALA ALA A . n 
A 1 137 GLU 137 156 156 GLU GLU A . n 
A 1 138 GLN 138 157 157 GLN GLN A . n 
A 1 139 GLU 139 158 158 GLU GLU A . n 
A 1 140 LYS 140 159 159 LYS LYS A . n 
A 1 141 LYS 141 160 160 LYS LYS A . n 
A 1 142 LYS 142 161 161 LYS LYS A . n 
A 1 143 LEU 143 162 162 LEU LEU A . n 
A 1 144 GLU 144 163 163 GLU GLU A . n 
A 1 145 THR 145 164 164 THR THR A . n 
A 1 146 ASP 146 165 165 ASP ASP A . n 
A 1 147 TYR 147 166 166 TYR TYR A . n 
A 1 148 LYS 148 167 167 LYS LYS A . n 
A 1 149 LYS 149 168 ?   ?   ?   A . n 
A 1 150 LEU 150 169 ?   ?   ?   A . n 
A 1 151 SER 151 170 ?   ?   ?   A . n 
A 1 152 SER 152 171 171 SER SER A . n 
A 1 153 PRO 153 172 172 PRO PRO A . n 
A 1 154 THR 154 173 173 THR THR A . n 
A 1 155 LYS 155 174 174 LYS LYS A . n 
A 1 156 MSE 156 175 175 MSE MSE A . n 
A 1 157 GLN 157 176 176 GLN GLN A . n 
A 1 158 TYR 158 177 177 TYR TYR A . n 
A 1 159 ALA 159 178 178 ALA ALA A . n 
A 1 160 ARG 160 179 179 ARG ARG A . n 
A 1 161 TYR 161 180 180 TYR TYR A . n 
A 1 162 ARG 162 181 181 ARG ARG A . n 
A 1 163 ASP 163 182 182 ASP ASP A . n 
A 1 164 GLY 164 183 183 GLY GLY A . n 
A 1 165 LEU 165 184 184 LEU LEU A . n 
A 1 166 SER 166 185 185 SER SER A . n 
A 1 167 LYS 167 186 186 LYS LYS A . n 
A 1 168 LEU 168 187 187 LEU LEU A . n 
A 1 169 PHE 169 188 188 PHE PHE A . n 
A 1 170 THR 170 189 189 THR THR A . n 
A 1 171 THR 171 190 190 THR THR A . n 
A 1 172 ARG 172 191 191 ARG ARG A . n 
A 1 173 TYR 173 192 192 TYR TYR A . n 
A 1 174 GLU 174 193 193 GLU GLU A . n 
A 1 175 LYS 175 194 194 LYS LYS A . n 
A 1 176 ALA 176 195 195 ALA ALA A . n 
A 1 177 ARG 177 196 196 ARG ARG A . n 
A 1 178 ASN 178 197 197 ASN ASN A . n 
A 1 179 SER 179 198 198 SER SER A . n 
A 1 180 LEU 180 199 199 LEU LEU A . n 
A 1 181 GLN 181 200 200 GLN GLN A . n 
A 1 182 LYS 182 201 201 LYS LYS A . n 
A 1 183 VAL 183 202 202 VAL VAL A . n 
A 1 184 ILE 184 203 203 ILE ILE A . n 
A 1 185 LEU 185 204 204 LEU LEU A . n 
A 1 186 ARG 186 205 205 ARG ARG A . n 
A 1 187 PHE 187 206 206 PHE PHE A . n 
A 1 188 PRO 188 207 207 PRO PRO A . n 
A 1 189 SER 189 208 208 SER SER A . n 
A 1 190 THR 190 209 209 THR THR A . n 
A 1 191 GLU 191 210 210 GLU GLU A . n 
A 1 192 ALA 192 211 211 ALA ALA A . n 
A 1 193 GLN 193 212 212 GLN GLN A . n 
A 1 194 LYS 194 213 213 LYS LYS A . n 
A 1 195 THR 195 214 214 THR THR A . n 
A 1 196 LEU 196 215 215 LEU LEU A . n 
A 1 197 ASP 197 216 216 ASP ASP A . n 
A 1 198 LYS 198 217 217 LYS LYS A . n 
A 1 199 ILE 199 218 218 ILE ILE A . n 
A 1 200 LEU 200 219 219 LEU LEU A . n 
A 1 201 ARG 201 220 220 ARG ARG A . n 
A 1 202 ILE 202 221 221 ILE ILE A . n 
A 1 203 GLU 203 222 222 GLU GLU A . n 
A 1 204 LYS 204 223 223 LYS LYS A . n 
A 1 205 GLU 205 224 224 GLU GLU A . n 
A 1 206 VAL 206 225 225 VAL VAL A . n 
A 1 207 ASN 207 226 226 ASN ASN A . n 
A 1 208 ARG 208 227 ?   ?   ?   A . n 
B 1 1   GLY 1   0   ?   ?   ?   B . n 
B 1 2   GLN 2   21  21  GLN GLN B . n 
B 1 3   SER 3   22  22  SER SER B . n 
B 1 4   VAL 4   23  23  VAL VAL B . n 
B 1 5   ASP 5   24  24  ASP ASP B . n 
B 1 6   GLU 6   25  25  GLU GLU B . n 
B 1 7   MSE 7   26  26  MSE MSE B . n 
B 1 8   LEU 8   27  27  LEU LEU B . n 
B 1 9   GLN 9   28  28  GLN GLN B . n 
B 1 10  LYS 10  29  29  LYS LYS B . n 
B 1 11  VAL 11  30  30  VAL VAL B . n 
B 1 12  SER 12  31  31  SER SER B . n 
B 1 13  ALA 13  32  32  ALA ALA B . n 
B 1 14  ALA 14  33  33  ALA ALA B . n 
B 1 15  ILE 15  34  34  ILE ILE B . n 
B 1 16  GLU 16  35  35  GLU GLU B . n 
B 1 17  ALA 17  36  36  ALA ALA B . n 
B 1 18  GLY 18  37  37  GLY GLY B . n 
B 1 19  GLN 19  38  38  GLN GLN B . n 
B 1 20  ASN 20  39  39  ASN ASN B . n 
B 1 21  GLY 21  40  40  GLY GLY B . n 
B 1 22  GLN 22  41  41  GLN GLN B . n 
B 1 23  ALA 23  42  42  ALA ALA B . n 
B 1 24  VAL 24  43  43  VAL VAL B . n 
B 1 25  SER 25  44  44  SER SER B . n 
B 1 26  TYR 26  45  45  TYR TYR B . n 
B 1 27  PHE 27  46  46  PHE PHE B . n 
B 1 28  ARG 28  47  47  ARG ARG B . n 
B 1 29  GLN 29  48  48  GLN GLN B . n 
B 1 30  THR 30  49  49  THR THR B . n 
B 1 31  ILE 31  50  50  ILE ILE B . n 
B 1 32  ALA 32  51  51  ALA ALA B . n 
B 1 33  LEU 33  52  52  LEU LEU B . n 
B 1 34  ASN 34  53  53  ASN ASN B . n 
B 1 35  ILE 35  54  54  ILE ILE B . n 
B 1 36  ASP 36  55  55  ASP ASP B . n 
B 1 37  ARG 37  56  56  ARG ARG B . n 
B 1 38  THR 38  57  57  THR THR B . n 
B 1 39  GLU 39  58  58  GLU GLU B . n 
B 1 40  MSE 40  59  59  MSE MSE B . n 
B 1 41  TYR 41  60  60  TYR TYR B . n 
B 1 42  TYR 42  61  61  TYR TYR B . n 
B 1 43  TRP 43  62  62  TRP TRP B . n 
B 1 44  THR 44  63  63  THR THR B . n 
B 1 45  ASN 45  64  64  ASN ASN B . n 
B 1 46  VAL 46  65  65  VAL VAL B . n 
B 1 47  ASP 47  66  66  ASP ASP B . n 
B 1 48  LYS 48  67  67  LYS LYS B . n 
B 1 49  ASN 49  68  68  ASN ASN B . n 
B 1 50  SER 50  69  69  SER SER B . n 
B 1 51  GLU 51  70  70  GLU GLU B . n 
B 1 52  ILE 52  71  71  ILE ILE B . n 
B 1 53  SER 53  72  72  SER SER B . n 
B 1 54  SER 54  73  73  SER SER B . n 
B 1 55  LYS 55  74  74  LYS LYS B . n 
B 1 56  LEU 56  75  75  LEU LEU B . n 
B 1 57  ALA 57  76  76  ALA ALA B . n 
B 1 58  THR 58  77  77  THR THR B . n 
B 1 59  GLU 59  78  78  GLU GLU B . n 
B 1 60  LEU 60  79  79  LEU LEU B . n 
B 1 61  ALA 61  80  80  ALA ALA B . n 
B 1 62  LEU 62  81  81  LEU LEU B . n 
B 1 63  ALA 63  82  82  ALA ALA B . n 
B 1 64  TYR 64  83  83  TYR TYR B . n 
B 1 65  LYS 65  84  84  LYS LYS B . n 
B 1 66  LYS 66  85  85  LYS LYS B . n 
B 1 67  ASN 67  86  86  ASN ASN B . n 
B 1 68  ARG 68  87  87  ARG ARG B . n 
B 1 69  ASN 69  88  88  ASN ASN B . n 
B 1 70  TYR 70  89  89  TYR TYR B . n 
B 1 71  ASP 71  90  90  ASP ASP B . n 
B 1 72  LYS 72  91  91  LYS LYS B . n 
B 1 73  ALA 73  92  92  ALA ALA B . n 
B 1 74  TYR 74  93  93  TYR TYR B . n 
B 1 75  LEU 75  94  94  LEU LEU B . n 
B 1 76  PHE 76  95  95  PHE PHE B . n 
B 1 77  TYR 77  96  96  TYR TYR B . n 
B 1 78  LYS 78  97  97  LYS LYS B . n 
B 1 79  GLU 79  98  98  GLU GLU B . n 
B 1 80  LEU 80  99  99  LEU LEU B . n 
B 1 81  LEU 81  100 100 LEU LEU B . n 
B 1 82  GLN 82  101 101 GLN GLN B . n 
B 1 83  LYS 83  102 102 LYS LYS B . n 
B 1 84  ALA 84  103 103 ALA ALA B . n 
B 1 85  PRO 85  104 104 PRO PRO B . n 
B 1 86  ASN 86  105 105 ASN ASN B . n 
B 1 87  ASN 87  106 106 ASN ASN B . n 
B 1 88  VAL 88  107 107 VAL VAL B . n 
B 1 89  ASP 89  108 108 ASP ASP B . n 
B 1 90  CSX 90  109 109 CSX CSX B . n 
B 1 91  LEU 91  110 110 LEU LEU B . n 
B 1 92  GLU 92  111 111 GLU GLU B . n 
B 1 93  ALA 93  112 112 ALA ALA B . n 
B 1 94  CYS 94  113 113 CYS CYS B . n 
B 1 95  ALA 95  114 114 ALA ALA B . n 
B 1 96  GLU 96  115 115 GLU GLU B . n 
B 1 97  MSE 97  116 116 MSE MSE B . n 
B 1 98  GLN 98  117 117 GLN GLN B . n 
B 1 99  VAL 99  118 118 VAL VAL B . n 
B 1 100 CYS 100 119 119 CYS CYS B . n 
B 1 101 ARG 101 120 120 ARG ARG B . n 
B 1 102 GLY 102 121 121 GLY GLY B . n 
B 1 103 GLN 103 122 122 GLN GLN B . n 
B 1 104 GLU 104 123 123 GLU GLU B . n 
B 1 105 LYS 105 124 124 LYS LYS B . n 
B 1 106 ASP 106 125 125 ASP ASP B . n 
B 1 107 ALA 107 126 126 ALA ALA B . n 
B 1 108 LEU 108 127 127 LEU LEU B . n 
B 1 109 ARG 109 128 128 ARG ARG B . n 
B 1 110 MSE 110 129 129 MSE MSE B . n 
B 1 111 TYR 111 130 130 TYR TYR B . n 
B 1 112 GLU 112 131 131 GLU GLU B . n 
B 1 113 LYS 113 132 132 LYS LYS B . n 
B 1 114 ILE 114 133 133 ILE ILE B . n 
B 1 115 LEU 115 134 134 LEU LEU B . n 
B 1 116 GLN 116 135 135 GLN GLN B . n 
B 1 117 LEU 117 136 136 LEU LEU B . n 
B 1 118 GLU 118 137 137 GLU GLU B . n 
B 1 119 ALA 119 138 138 ALA ALA B . n 
B 1 120 ASP 120 139 139 ASP ASP B . n 
B 1 121 ASN 121 140 140 ASN ASN B . n 
B 1 122 LEU 122 141 141 LEU LEU B . n 
B 1 123 ALA 123 142 142 ALA ALA B . n 
B 1 124 ALA 124 143 143 ALA ALA B . n 
B 1 125 ASN 125 144 144 ASN ASN B . n 
B 1 126 ILE 126 145 145 ILE ILE B . n 
B 1 127 PHE 127 146 146 PHE PHE B . n 
B 1 128 LEU 128 147 147 LEU LEU B . n 
B 1 129 GLY 129 148 148 GLY GLY B . n 
B 1 130 ASN 130 149 149 ASN ASN B . n 
B 1 131 TYR 131 150 150 TYR TYR B . n 
B 1 132 TYR 132 151 151 TYR TYR B . n 
B 1 133 TYR 133 152 152 TYR TYR B . n 
B 1 134 LEU 134 153 153 LEU LEU B . n 
B 1 135 THR 135 154 154 THR THR B . n 
B 1 136 ALA 136 155 155 ALA ALA B . n 
B 1 137 GLU 137 156 156 GLU GLU B . n 
B 1 138 GLN 138 157 157 GLN GLN B . n 
B 1 139 GLU 139 158 158 GLU GLU B . n 
B 1 140 LYS 140 159 159 LYS LYS B . n 
B 1 141 LYS 141 160 160 LYS LYS B . n 
B 1 142 LYS 142 161 161 LYS LYS B . n 
B 1 143 LEU 143 162 162 LEU LEU B . n 
B 1 144 GLU 144 163 163 GLU GLU B . n 
B 1 145 THR 145 164 164 THR THR B . n 
B 1 146 ASP 146 165 165 ASP ASP B . n 
B 1 147 TYR 147 166 166 TYR TYR B . n 
B 1 148 LYS 148 167 167 LYS LYS B . n 
B 1 149 LYS 149 168 168 LYS LYS B . n 
B 1 150 LEU 150 169 169 LEU LEU B . n 
B 1 151 SER 151 170 170 SER SER B . n 
B 1 152 SER 152 171 171 SER SER B . n 
B 1 153 PRO 153 172 172 PRO PRO B . n 
B 1 154 THR 154 173 173 THR THR B . n 
B 1 155 LYS 155 174 174 LYS LYS B . n 
B 1 156 MSE 156 175 175 MSE MSE B . n 
B 1 157 GLN 157 176 176 GLN GLN B . n 
B 1 158 TYR 158 177 177 TYR TYR B . n 
B 1 159 ALA 159 178 178 ALA ALA B . n 
B 1 160 ARG 160 179 179 ARG ARG B . n 
B 1 161 TYR 161 180 180 TYR TYR B . n 
B 1 162 ARG 162 181 181 ARG ARG B . n 
B 1 163 ASP 163 182 182 ASP ASP B . n 
B 1 164 GLY 164 183 183 GLY GLY B . n 
B 1 165 LEU 165 184 184 LEU LEU B . n 
B 1 166 SER 166 185 185 SER SER B . n 
B 1 167 LYS 167 186 186 LYS LYS B . n 
B 1 168 LEU 168 187 187 LEU LEU B . n 
B 1 169 PHE 169 188 188 PHE PHE B . n 
B 1 170 THR 170 189 189 THR THR B . n 
B 1 171 THR 171 190 190 THR THR B . n 
B 1 172 ARG 172 191 191 ARG ARG B . n 
B 1 173 TYR 173 192 192 TYR TYR B . n 
B 1 174 GLU 174 193 193 GLU GLU B . n 
B 1 175 LYS 175 194 194 LYS LYS B . n 
B 1 176 ALA 176 195 195 ALA ALA B . n 
B 1 177 ARG 177 196 196 ARG ARG B . n 
B 1 178 ASN 178 197 197 ASN ASN B . n 
B 1 179 SER 179 198 198 SER SER B . n 
B 1 180 LEU 180 199 199 LEU LEU B . n 
B 1 181 GLN 181 200 200 GLN GLN B . n 
B 1 182 LYS 182 201 201 LYS LYS B . n 
B 1 183 VAL 183 202 202 VAL VAL B . n 
B 1 184 ILE 184 203 203 ILE ILE B . n 
B 1 185 LEU 185 204 204 LEU LEU B . n 
B 1 186 ARG 186 205 205 ARG ARG B . n 
B 1 187 PHE 187 206 206 PHE PHE B . n 
B 1 188 PRO 188 207 207 PRO PRO B . n 
B 1 189 SER 189 208 208 SER SER B . n 
B 1 190 THR 190 209 209 THR THR B . n 
B 1 191 GLU 191 210 210 GLU GLU B . n 
B 1 192 ALA 192 211 211 ALA ALA B . n 
B 1 193 GLN 193 212 212 GLN GLN B . n 
B 1 194 LYS 194 213 213 LYS LYS B . n 
B 1 195 THR 195 214 214 THR THR B . n 
B 1 196 LEU 196 215 215 LEU LEU B . n 
B 1 197 ASP 197 216 216 ASP ASP B . n 
B 1 198 LYS 198 217 217 LYS LYS B . n 
B 1 199 ILE 199 218 218 ILE ILE B . n 
B 1 200 LEU 200 219 219 LEU LEU B . n 
B 1 201 ARG 201 220 220 ARG ARG B . n 
B 1 202 ILE 202 221 221 ILE ILE B . n 
B 1 203 GLU 203 222 222 GLU GLU B . n 
B 1 204 LYS 204 223 223 LYS LYS B . n 
B 1 205 GLU 205 224 224 GLU GLU B . n 
B 1 206 VAL 206 225 225 VAL VAL B . n 
B 1 207 ASN 207 226 226 ASN ASN B . n 
B 1 208 ARG 208 227 ?   ?   ?   B . n 
# 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Joint Center for Structural Genomics' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     JCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  250 250 ZN  ZN  A . 
D 2 ZN  1  260 260 ZN  ZN  A . 
E 2 ZN  1  250 250 ZN  ZN  B . 
F 2 ZN  1  260 260 ZN  ZN  B . 
G 3 PG4 1  300 300 PG4 PG4 B . 
H 4 EDO 1  301 301 EDO EDO B . 
I 5 HOH 1  302 302 HOH HOH A . 
I 5 HOH 2  303 303 HOH HOH A . 
I 5 HOH 3  343 343 HOH HOH A . 
J 5 HOH 1  304 304 HOH HOH B . 
J 5 HOH 2  305 305 HOH HOH B . 
J 5 HOH 3  306 306 HOH HOH B . 
J 5 HOH 4  307 307 HOH HOH B . 
J 5 HOH 5  308 308 HOH HOH B . 
J 5 HOH 6  309 309 HOH HOH B . 
J 5 HOH 7  310 310 HOH HOH B . 
J 5 HOH 8  311 311 HOH HOH B . 
J 5 HOH 9  312 312 HOH HOH B . 
J 5 HOH 10 313 313 HOH HOH B . 
J 5 HOH 11 314 314 HOH HOH B . 
J 5 HOH 12 315 315 HOH HOH B . 
J 5 HOH 13 316 316 HOH HOH B . 
J 5 HOH 14 317 317 HOH HOH B . 
J 5 HOH 15 318 318 HOH HOH B . 
J 5 HOH 16 319 319 HOH HOH B . 
J 5 HOH 17 320 320 HOH HOH B . 
J 5 HOH 18 321 321 HOH HOH B . 
J 5 HOH 19 322 322 HOH HOH B . 
J 5 HOH 20 323 323 HOH HOH B . 
J 5 HOH 21 324 324 HOH HOH B . 
J 5 HOH 22 325 325 HOH HOH B . 
J 5 HOH 23 326 326 HOH HOH B . 
J 5 HOH 24 327 327 HOH HOH B . 
J 5 HOH 25 328 328 HOH HOH B . 
J 5 HOH 26 329 329 HOH HOH B . 
J 5 HOH 27 330 330 HOH HOH B . 
J 5 HOH 28 331 331 HOH HOH B . 
J 5 HOH 29 332 332 HOH HOH B . 
J 5 HOH 30 333 333 HOH HOH B . 
J 5 HOH 31 334 334 HOH HOH B . 
J 5 HOH 32 335 335 HOH HOH B . 
J 5 HOH 33 336 336 HOH HOH B . 
J 5 HOH 34 337 337 HOH HOH B . 
J 5 HOH 35 338 338 HOH HOH B . 
J 5 HOH 36 339 339 HOH HOH B . 
J 5 HOH 37 340 340 HOH HOH B . 
J 5 HOH 38 341 341 HOH HOH B . 
J 5 HOH 39 342 342 HOH HOH B . 
J 5 HOH 40 344 344 HOH HOH B . 
J 5 HOH 41 345 345 HOH HOH B . 
J 5 HOH 42 346 346 HOH HOH B . 
J 5 HOH 43 347 347 HOH HOH B . 
J 5 HOH 44 348 348 HOH HOH B . 
J 5 HOH 45 349 349 HOH HOH B . 
J 5 HOH 46 350 350 HOH HOH B . 
J 5 HOH 47 351 351 HOH HOH B . 
J 5 HOH 48 352 352 HOH HOH B . 
J 5 HOH 49 353 353 HOH HOH B . 
J 5 HOH 50 354 354 HOH HOH B . 
J 5 HOH 51 355 355 HOH HOH B . 
J 5 HOH 52 356 356 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 7   A MSE 26  ? MET SELENOMETHIONINE 
2  A MSE 40  A MSE 59  ? MET SELENOMETHIONINE 
3  A CSX 90  A CSX 109 ? CYS 'S-OXY CYSTEINE' 
4  A MSE 97  A MSE 116 ? MET SELENOMETHIONINE 
5  A MSE 110 A MSE 129 ? MET SELENOMETHIONINE 
6  A MSE 156 A MSE 175 ? MET SELENOMETHIONINE 
7  B MSE 7   B MSE 26  ? MET SELENOMETHIONINE 
8  B MSE 40  B MSE 59  ? MET SELENOMETHIONINE 
9  B CSX 90  B CSX 109 ? CYS 'S-OXY CYSTEINE' 
10 B MSE 97  B MSE 116 ? MET SELENOMETHIONINE 
11 B MSE 110 B MSE 129 ? MET SELENOMETHIONINE 
12 B MSE 156 B MSE 175 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,I     
2 1 B,E,F,G,H,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 96  ? A GLU 115 ? 1_555 ZN ? C ZN . ? A ZN 250 ? 1_555 OE2 ? A GLU 92  ? A GLU 111 ? 1_555 115.9 ? 
2  OE2 ? A GLU 96  ? A GLU 115 ? 1_555 ZN ? C ZN . ? A ZN 250 ? 1_555 O   ? I HOH .   ? A HOH 302 ? 1_555 135.5 ? 
3  OE2 ? A GLU 92  ? A GLU 111 ? 1_555 ZN ? C ZN . ? A ZN 250 ? 1_555 O   ? I HOH .   ? A HOH 302 ? 1_555 75.2  ? 
4  O   ? I HOH .   ? A HOH 303 ? 1_555 ZN ? D ZN . ? A ZN 260 ? 1_555 OE2 ? A GLU 118 ? A GLU 137 ? 1_555 93.5  ? 
5  O   ? I HOH .   ? A HOH 303 ? 1_555 ZN ? D ZN . ? A ZN 260 ? 1_555 OD1 ? A ASP 120 ? A ASP 139 ? 1_555 84.7  ? 
6  OE2 ? A GLU 118 ? A GLU 137 ? 1_555 ZN ? D ZN . ? A ZN 260 ? 1_555 OD1 ? A ASP 120 ? A ASP 139 ? 1_555 113.7 ? 
7  OE2 ? B GLU 92  ? B GLU 111 ? 1_555 ZN ? E ZN . ? B ZN 250 ? 1_555 O   ? J HOH .   ? B HOH 304 ? 1_555 101.9 ? 
8  OE2 ? B GLU 92  ? B GLU 111 ? 1_555 ZN ? E ZN . ? B ZN 250 ? 1_555 OE2 ? B GLU 96  ? B GLU 115 ? 1_555 111.4 ? 
9  O   ? J HOH .   ? B HOH 304 ? 1_555 ZN ? E ZN . ? B ZN 250 ? 1_555 OE2 ? B GLU 96  ? B GLU 115 ? 1_555 105.4 ? 
10 OE2 ? B GLU 118 ? B GLU 137 ? 1_555 ZN ? F ZN . ? B ZN 260 ? 1_555 O2  ? H EDO .   ? B EDO 301 ? 1_555 112.5 ? 
11 OE2 ? B GLU 118 ? B GLU 137 ? 1_555 ZN ? F ZN . ? B ZN 260 ? 1_555 OD1 ? B ASP 120 ? B ASP 139 ? 1_555 97.6  ? 
12 O2  ? H EDO .   ? B EDO 301 ? 1_555 ZN ? F ZN . ? B ZN 260 ? 1_555 OD1 ? B ASP 120 ? B ASP 139 ? 1_555 108.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-12-14 
2 'Structure model' 1 1 2014-12-24 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'          
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Refinement description'     
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_struct_assembly_auth_evidence 
2 3 'Structure model' software                           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification' 
2 3 'Structure model' '_software.name'           
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -14.7040 12.3970 137.2460 1.2367 0.9996 0.2796 0.0776  -0.1396 -0.0687 2.1220 1.9500 7.2075 0.3181 
1.0303  -1.5269 -0.0281 -0.0894 0.1175 -0.6876 0.0232 -0.1848 0.2450  0.4240 0.3378  
'X-RAY DIFFRACTION' 2 ? refined -11.1620 14.6590 216.2390 0.3396 0.4930 0.0899 -0.0197 -0.0583 0.0274  2.2149 2.1768 4.5199 
-0.7328 -0.9272 1.0643  0.0960  -0.1266 0.0307 0.6426  0.0129 0.0345  -0.3567 0.2697 -0.1636 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 22 A 226 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 21 B 226 ? . . . . ? 
# 
_phasing.method   MAD 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MolProbity  3beta29        ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 
'model building'  http://kinemage.biochem.duke.edu/molprobity/                                ?          ? 
2 PDB_EXTRACT 3.10           'June 10, 2010' package PDB                          deposit@deposit.rcsb.org             
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 
3 SHELX       .              ?               package 'George M. Sheldrick'        gsheldr@shelx.uni-ac.gwdg.de         phasing 
http://shelx.uni-ac.gwdg.de/SHELX/                                          Fortran_77 ? 
4 SHARP       .              ?               package 'Eric de La Fortelle'        sharp-develop@globalphasing.com      phasing 
http://www.globalphasing.com/sharp/                                         ?          ? 
5 XSCALE      'May 10, 2010' ?               package 'Wolfgang Kabsch'            ?                                    
'data scaling'    http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 
6 REFMAC      5.6.0117       ?               program 'Garib N. Murshudov'         garib@ysbl.york.ac.uk                refinement 
http://www.ccp4.ac.uk/dist/html/refmac5.html                                Fortran_77 ? 
7 XDS         .              ?               ?       ?                            ?                                    
'data reduction'  ?                                                                           ?          ? 
8 SHELXD      .              ?               ?       ?                            ?                                    phasing ? ? 
? 
# 
_pdbx_entry_details.entry_id             3URZ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THIS CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY RESIDUES 21-227 OF THE TARGET SEQUENCE.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN B 38  ? ? -108.68 69.41  
2 1 ASN B 53  ? ? -160.58 98.41  
3 1 SER B 170 ? ? -127.74 -53.58 
4 1 SER B 171 ? ? -139.65 -61.90 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 29  ? CG  ? A LYS 10  CG  
2  1 Y 1 A LYS 29  ? CD  ? A LYS 10  CD  
3  1 Y 1 A LYS 29  ? CE  ? A LYS 10  CE  
4  1 Y 1 A LYS 29  ? NZ  ? A LYS 10  NZ  
5  1 Y 1 A GLU 70  ? CG  ? A GLU 51  CG  
6  1 Y 1 A GLU 70  ? CD  ? A GLU 51  CD  
7  1 Y 1 A GLU 70  ? OE1 ? A GLU 51  OE1 
8  1 Y 1 A GLU 70  ? OE2 ? A GLU 51  OE2 
9  1 Y 1 A ARG 87  ? CG  ? A ARG 68  CG  
10 1 Y 1 A ARG 87  ? CD  ? A ARG 68  CD  
11 1 Y 1 A ARG 87  ? NE  ? A ARG 68  NE  
12 1 Y 1 A ARG 87  ? CZ  ? A ARG 68  CZ  
13 1 Y 1 A ARG 87  ? NH1 ? A ARG 68  NH1 
14 1 Y 1 A ARG 87  ? NH2 ? A ARG 68  NH2 
15 1 Y 1 A GLU 98  ? CG  ? A GLU 79  CG  
16 1 Y 1 A GLU 98  ? CD  ? A GLU 79  CD  
17 1 Y 1 A GLU 98  ? OE1 ? A GLU 79  OE1 
18 1 Y 1 A GLU 98  ? OE2 ? A GLU 79  OE2 
19 1 Y 1 A TYR 166 ? CG  ? A TYR 147 CG  
20 1 Y 1 A TYR 166 ? CD1 ? A TYR 147 CD1 
21 1 Y 1 A TYR 166 ? CD2 ? A TYR 147 CD2 
22 1 Y 1 A TYR 166 ? CE1 ? A TYR 147 CE1 
23 1 Y 1 A TYR 166 ? CE2 ? A TYR 147 CE2 
24 1 Y 1 A TYR 166 ? CZ  ? A TYR 147 CZ  
25 1 Y 1 A TYR 166 ? OH  ? A TYR 147 OH  
26 1 Y 1 A ARG 179 ? CG  ? A ARG 160 CG  
27 1 Y 1 A ARG 179 ? CD  ? A ARG 160 CD  
28 1 Y 1 A ARG 179 ? NE  ? A ARG 160 NE  
29 1 Y 1 A ARG 179 ? CZ  ? A ARG 160 CZ  
30 1 Y 1 A ARG 179 ? NH1 ? A ARG 160 NH1 
31 1 Y 1 A ARG 179 ? NH2 ? A ARG 160 NH2 
32 1 Y 1 A GLU 193 ? CG  ? A GLU 174 CG  
33 1 Y 1 A GLU 193 ? CD  ? A GLU 174 CD  
34 1 Y 1 A GLU 193 ? OE1 ? A GLU 174 OE1 
35 1 Y 1 A GLU 193 ? OE2 ? A GLU 174 OE2 
36 1 Y 1 B ASP 24  ? CG  ? B ASP 5   CG  
37 1 Y 1 B ASP 24  ? OD1 ? B ASP 5   OD1 
38 1 Y 1 B ASP 24  ? OD2 ? B ASP 5   OD2 
39 1 Y 1 B LYS 97  ? CE  ? B LYS 78  CE  
40 1 Y 1 B LYS 97  ? NZ  ? B LYS 78  NZ  
41 1 Y 1 B GLU 98  ? CD  ? B GLU 79  CD  
42 1 Y 1 B GLU 98  ? OE1 ? B GLU 79  OE1 
43 1 Y 1 B GLU 98  ? OE2 ? B GLU 79  OE2 
44 1 Y 1 B GLU 123 ? CG  ? B GLU 104 CG  
45 1 Y 1 B GLU 123 ? CD  ? B GLU 104 CD  
46 1 Y 1 B GLU 123 ? OE1 ? B GLU 104 OE1 
47 1 Y 1 B GLU 123 ? OE2 ? B GLU 104 OE2 
48 1 Y 1 B LYS 167 ? CG  ? B LYS 148 CG  
49 1 Y 1 B LYS 167 ? CD  ? B LYS 148 CD  
50 1 Y 1 B LYS 167 ? CE  ? B LYS 148 CE  
51 1 Y 1 B LYS 167 ? NZ  ? B LYS 148 NZ  
52 1 Y 1 B LYS 168 ? CG  ? B LYS 149 CG  
53 1 Y 1 B LYS 168 ? CD  ? B LYS 149 CD  
54 1 Y 1 B LYS 168 ? CE  ? B LYS 149 CE  
55 1 Y 1 B LYS 168 ? NZ  ? B LYS 149 NZ  
56 1 Y 1 B ASP 182 ? CG  ? B ASP 163 CG  
57 1 Y 1 B ASP 182 ? OD1 ? B ASP 163 OD1 
58 1 Y 1 B ASP 182 ? OD2 ? B ASP 163 OD2 
59 1 Y 1 B GLU 193 ? CG  ? B GLU 174 CG  
60 1 Y 1 B GLU 193 ? CD  ? B GLU 174 CD  
61 1 Y 1 B GLU 193 ? OE1 ? B GLU 174 OE1 
62 1 Y 1 B GLU 193 ? OE2 ? B GLU 174 OE2 
63 1 N 1 B PG4 300 ? C7  ? G PG4 1   C7  
64 1 N 1 B PG4 300 ? C8  ? G PG4 1   C8  
65 1 N 1 B PG4 300 ? O5  ? G PG4 1   O5  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 0   ? A GLY 1   
2 1 Y 1 A GLN 21  ? A GLN 2   
3 1 Y 1 A LYS 168 ? A LYS 149 
4 1 Y 1 A LEU 169 ? A LEU 150 
5 1 Y 1 A SER 170 ? A SER 151 
6 1 Y 1 A ARG 227 ? A ARG 208 
7 1 Y 1 B GLY 0   ? B GLY 1   
8 1 Y 1 B ARG 227 ? B ARG 208 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'             ZN  
3 'TETRAETHYLENE GLYCOL' PG4 
4 1,2-ETHANEDIOL         EDO 
5 water                  HOH 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration' ? 
2 2 'gel filtration' ? 
#