data_3UVD
# 
_entry.id   3UVD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UVD         
RCSB  RCSB069255   
WWPDB D_1000069255 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3UV2 . unspecified 
PDB 3UV4 . unspecified 
PDB 3UV5 . unspecified 
PDB 3UVW . unspecified 
PDB 3UVX . unspecified 
PDB 3UVY . unspecified 
PDB 3UW9 . unspecified 
# 
_pdbx_database_status.entry_id                        3UVD 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Felletar, I.'                         2  
'Picaud, S.'                           3  
'Keates, T.'                           4  
'Muniz, J.'                            5  
'Gileadi, O.'                          6  
'von Delft, F.'                        7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Weigelt, J.'                          10 
'Bountra, C.'                          11 
'Knapp, S.'                            12 
'Structural Genomics Consortium (SGC)' 13 
# 
_citation.id                        primary 
_citation.title                     'Histone recognition and large-scale structural analysis of the human bromodomain family.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            149 
_citation.page_first                214 
_citation.page_last                 231 
_citation.year                      2012 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22464331 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2012.02.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1  
primary 'Picaud, S.'          2  
primary 'Mangos, M.'          3  
primary 'Keates, T.'          4  
primary 'Lambert, J.P.'       5  
primary 'Barsyte-Lovejoy, D.' 6  
primary 'Felletar, I.'        7  
primary 'Volkmer, R.'         8  
primary 'Muller, S.'          9  
primary 'Pawson, T.'          10 
primary 'Gingras, A.C.'       11 
primary 'Arrowsmith, C.H.'    12 
primary 'Knapp, S.'           13 
# 
_cell.length_a           30.200 
_cell.length_b           29.890 
_cell.length_c           67.060 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.450 
_cell.angle_gamma        90.000 
_cell.entry_id           3UVD 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3UVD 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcription activator BRG1' 14559.822 1  3.6.4.- ? 'unp residues 1448-1569' ? 
2 non-polymer syn 1-methylpyrrolidin-2-one       99.131    1  ?       ? ?                        ? 
3 water       nat water                          18.015    61 ?       ? ?                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BRG1-associated factor Protein BRG-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDL
EKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDL
EKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ALA n 
1 4   GLU n 
1 5   LYS n 
1 6   LEU n 
1 7   SER n 
1 8   PRO n 
1 9   ASN n 
1 10  PRO n 
1 11  PRO n 
1 12  ASN n 
1 13  LEU n 
1 14  THR n 
1 15  LYS n 
1 16  LYS n 
1 17  MET n 
1 18  LYS n 
1 19  LYS n 
1 20  ILE n 
1 21  VAL n 
1 22  ASP n 
1 23  ALA n 
1 24  VAL n 
1 25  ILE n 
1 26  LYS n 
1 27  TYR n 
1 28  LYS n 
1 29  ASP n 
1 30  SER n 
1 31  SER n 
1 32  SER n 
1 33  GLY n 
1 34  ARG n 
1 35  GLN n 
1 36  LEU n 
1 37  SER n 
1 38  GLU n 
1 39  VAL n 
1 40  PHE n 
1 41  ILE n 
1 42  GLN n 
1 43  LEU n 
1 44  PRO n 
1 45  SER n 
1 46  ARG n 
1 47  LYS n 
1 48  GLU n 
1 49  LEU n 
1 50  PRO n 
1 51  GLU n 
1 52  TYR n 
1 53  TYR n 
1 54  GLU n 
1 55  LEU n 
1 56  ILE n 
1 57  ARG n 
1 58  LYS n 
1 59  PRO n 
1 60  VAL n 
1 61  ASP n 
1 62  PHE n 
1 63  LYS n 
1 64  LYS n 
1 65  ILE n 
1 66  LYS n 
1 67  GLU n 
1 68  ARG n 
1 69  ILE n 
1 70  ARG n 
1 71  ASN n 
1 72  HIS n 
1 73  LYS n 
1 74  TYR n 
1 75  ARG n 
1 76  SER n 
1 77  LEU n 
1 78  ASN n 
1 79  ASP n 
1 80  LEU n 
1 81  GLU n 
1 82  LYS n 
1 83  ASP n 
1 84  VAL n 
1 85  MET n 
1 86  LEU n 
1 87  LEU n 
1 88  CYS n 
1 89  GLN n 
1 90  ASN n 
1 91  ALA n 
1 92  GLN n 
1 93  THR n 
1 94  PHE n 
1 95  ASN n 
1 96  LEU n 
1 97  GLU n 
1 98  GLY n 
1 99  SER n 
1 100 LEU n 
1 101 ILE n 
1 102 TYR n 
1 103 GLU n 
1 104 ASP n 
1 105 SER n 
1 106 ILE n 
1 107 VAL n 
1 108 LEU n 
1 109 GLN n 
1 110 SER n 
1 111 VAL n 
1 112 PHE n 
1 113 THR n 
1 114 SER n 
1 115 VAL n 
1 116 ARG n 
1 117 GLN n 
1 118 LYS n 
1 119 ILE n 
1 120 GLU n 
1 121 LYS n 
1 122 GLU n 
1 123 ASP n 
1 124 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BRG1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SMCA4_HUMAN 
_struct_ref.pdbx_db_accession          P51532 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEK
DVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
;
_struct_ref.pdbx_align_begin           1448 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3UVD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 124 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P51532 
_struct_ref_seq.db_align_beg                  1448 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1569 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1448 
_struct_ref_seq.pdbx_auth_seq_align_end       1569 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UVD SER A 1 ? UNP P51532 ? ? 'EXPRESSION TAG' 1446 1 
1 3UVD MET A 2 ? UNP P51532 ? ? 'EXPRESSION TAG' 1447 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MB3 non-polymer         . 1-methylpyrrolidin-2-one ? 'C5 H9 N O'      99.131  
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3UVD 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.08 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.83 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;28% MMW PEG smear 
0.1M Tris.HCl pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2010-07-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.52 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.52 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3UVD 
_reflns.d_resolution_high            1.850 
_reflns.d_resolution_low             29.890 
_reflns.number_all                   10488 
_reflns.number_obs                   10488 
_reflns.pdbx_netI_over_sigmaI        10.000 
_reflns.pdbx_Rsym_value              0.067 
_reflns.pdbx_redundancy              3.500 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.B_iso_Wilson_estimate        35.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.850 1.950  ? 5136 ? 0.544 1.400 0.544 ? 3.400 ? 1502 100.000 1  1 
1.950 2.070  ? 4956 ? 0.304 2.500 0.304 ? 3.500 ? 1423 100.000 2  1 
2.070 2.210  ? 4791 ? 0.169 4.200 0.169 ? 3.500 ? 1365 100.000 3  1 
2.210 2.390  ? 4438 ? 0.113 6.000 0.113 ? 3.500 ? 1263 100.000 4  1 
2.390 2.620  ? 4066 ? 0.086 7.700 0.086 ? 3.600 ? 1144 100.000 5  1 
2.620 2.930  ? 3798 ? 0.071 8.300 0.071 ? 3.500 ? 1070 100.000 6  1 
2.930 3.380  ? 3363 ? 0.071 8.200 0.071 ? 3.600 ? 941  100.000 7  1 
3.380 4.140  ? 2838 ? 0.059 8.800 0.059 ? 3.600 ? 790  100.000 8  1 
4.140 5.850  ? 2214 ? 0.053 9.000 0.053 ? 3.500 ? 625  100.000 9  1 
5.850 29.890 ? 1201 ? 0.058 7.100 0.058 ? 3.300 ? 365  99.500  10 1 
# 
_refine.entry_id                                 3UVD 
_refine.ls_d_res_high                            1.8500 
_refine.ls_d_res_low                             29.89 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9700 
_refine.ls_number_reflns_obs                     10479 
_refine.ls_number_reflns_all                     10482 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS   
U VALUES: WITH TLS ADDED
;
_refine.ls_R_factor_all                          0.2027 
_refine.ls_R_factor_obs                          0.2027 
_refine.ls_R_factor_R_work                       0.1996 
_refine.ls_wR_factor_R_work                      0.2228 
_refine.ls_R_factor_R_free                       0.2624 
_refine.ls_wR_factor_R_free                      0.2907 
_refine.ls_percent_reflns_R_free                 4.8000 
_refine.ls_number_reflns_R_free                  502 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               46.1641 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -1.6700 
_refine.aniso_B[2][2]                            2.1300 
_refine.aniso_B[3][3]                            -0.4800 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.8200 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9650 
_refine.correlation_coeff_Fo_to_Fc_free          0.9280 
_refine.overall_SU_R_Cruickshank_DPI             0.1611 
_refine.overall_SU_R_free                        0.1607 
_refine.pdbx_overall_ESU_R                       0.1610 
_refine.pdbx_overall_ESU_R_Free                  0.1610 
_refine.overall_SU_ML                            0.1320 
_refine.overall_SU_B                             8.5590 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      
'Ensemble of PDB entries 2GRC, 2OSS, 2OUO, 2OO1, 3DAI, 3D7C, 3DWY, 3G0L, 3G0J, 3GG3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7914 
_refine.B_iso_max                                152.180 
_refine.B_iso_min                                18.120 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        990 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             61 
_refine_hist.number_atoms_total               1058 
_refine_hist.d_res_high                       1.8500 
_refine_hist.d_res_low                        29.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1012 0.016  0.020  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         732  0.003  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1359 1.722  1.999  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      1787 1.035  3.001  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 121  5.846  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 46   36.184 24.783 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 205  17.639 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 7    18.259 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         152  0.104  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1084 0.009  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     185  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.8500 
_refine_ls_shell.d_res_low                        1.8980 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.number_reflns_R_work             702 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3640 
_refine_ls_shell.R_factor_R_free                  0.3680 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                733 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UVD 
_struct.title                     
'Crystal Structure of the bromodomain of human Transcription activator BRG1 (SMARCA4) in complex with N-Methyl-2-pyrrolidone' 
_struct.pdbx_descriptor           'Transcription activator BRG1 (E.C.3.6.4.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UVD 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;Bromodomain, ATP-dependent helicase SMARCA4, BRG1-associated factor 190A, BAF190A, Mitotic growth and transcription activator, Protein BRG-1, Protein brahma homolog 1, SNF2-beta, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4, Structural Genomics Consortium, SGC, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   monomer 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 10 ? TYR A 27  ? PRO A 1455 TYR A 1472 1 ? 18 
HELX_P HELX_P2 2 GLN A 35 ? ILE A 41  ? GLN A 1480 ILE A 1486 5 ? 7  
HELX_P HELX_P3 3 LEU A 49 ? ILE A 56  ? LEU A 1494 ILE A 1501 1 ? 8  
HELX_P HELX_P4 4 ASP A 61 ? ASN A 71  ? ASP A 1506 ASN A 1516 1 ? 11 
HELX_P HELX_P5 5 SER A 76 ? ASN A 95  ? SER A 1521 ASN A 1540 1 ? 20 
HELX_P HELX_P6 6 SER A 99 ? GLU A 122 ? SER A 1544 GLU A 1567 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE MB3 A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 HOH C .  ? HOH A 58   . ? 1_555 ? 
2 AC1 5 VAL A 39 ? VAL A 1484 . ? 1_555 ? 
3 AC1 5 PHE A 40 ? PHE A 1485 . ? 1_555 ? 
4 AC1 5 PHE A 94 ? PHE A 1539 . ? 1_555 ? 
5 AC1 5 ASN A 95 ? ASN A 1540 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3UVD 
_atom_sites.fract_transf_matrix[1][1]   0.033113 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000260 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.033456 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014912 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2   ? 24.106 -9.951  38.308 1.00 82.21  ? 1447 MET A N   1 
ATOM   2    C CA  . MET A 1 2   ? 24.195 -8.518  37.866 1.00 113.79 ? 1447 MET A CA  1 
ATOM   3    C C   . MET A 1 2   ? 25.307 -7.740  38.607 1.00 94.48  ? 1447 MET A C   1 
ATOM   4    O O   . MET A 1 2   ? 26.459 -8.168  38.575 1.00 60.26  ? 1447 MET A O   1 
ATOM   5    C CB  . MET A 1 2   ? 22.834 -7.828  38.013 1.00 60.78  ? 1447 MET A CB  1 
ATOM   6    N N   . ALA A 1 3   ? 24.968 -6.617  39.263 1.00 72.10  ? 1448 ALA A N   1 
ATOM   7    C CA  . ALA A 1 3   ? 25.957 -5.678  39.856 1.00 94.05  ? 1448 ALA A CA  1 
ATOM   8    C C   . ALA A 1 3   ? 26.976 -6.369  40.788 1.00 99.60  ? 1448 ALA A C   1 
ATOM   9    O O   . ALA A 1 3   ? 26.648 -7.341  41.465 1.00 70.27  ? 1448 ALA A O   1 
ATOM   10   C CB  . ALA A 1 3   ? 25.244 -4.528  40.591 1.00 58.44  ? 1448 ALA A CB  1 
ATOM   11   N N   . GLU A 1 4   ? 28.214 -5.876  40.789 1.00 79.53  ? 1449 GLU A N   1 
ATOM   12   C CA  . GLU A 1 4   ? 29.260 -6.360  41.698 1.00 58.09  ? 1449 GLU A CA  1 
ATOM   13   C C   . GLU A 1 4   ? 29.254 -5.535  42.987 1.00 54.36  ? 1449 GLU A C   1 
ATOM   14   O O   . GLU A 1 4   ? 29.340 -4.311  42.953 1.00 53.91  ? 1449 GLU A O   1 
ATOM   15   C CB  . GLU A 1 4   ? 30.637 -6.255  41.039 1.00 76.40  ? 1449 GLU A CB  1 
ATOM   16   C CG  . GLU A 1 4   ? 30.964 -7.429  40.138 1.00 81.07  ? 1449 GLU A CG  1 
ATOM   17   C CD  . GLU A 1 4   ? 31.009 -8.735  40.904 1.00 89.89  ? 1449 GLU A CD  1 
ATOM   18   O OE1 . GLU A 1 4   ? 30.497 -9.752  40.388 1.00 152.18 ? 1449 GLU A OE1 1 
ATOM   19   O OE2 . GLU A 1 4   ? 31.545 -8.741  42.034 1.00 97.37  ? 1449 GLU A OE2 1 
ATOM   20   N N   . LYS A 1 5   ? 29.193 -6.208  44.123 1.00 59.73  ? 1450 LYS A N   1 
ATOM   21   C CA  . LYS A 1 5   ? 29.215 -5.539  45.440 1.00 59.21  ? 1450 LYS A CA  1 
ATOM   22   C C   . LYS A 1 5   ? 30.311 -4.427  45.595 1.00 56.52  ? 1450 LYS A C   1 
ATOM   23   O O   . LYS A 1 5   ? 31.461 -4.617  45.236 1.00 53.79  ? 1450 LYS A O   1 
ATOM   24   C CB  . LYS A 1 5   ? 29.370 -6.617  46.545 1.00 66.44  ? 1450 LYS A CB  1 
ATOM   25   C CG  . LYS A 1 5   ? 28.664 -6.332  47.873 1.00 59.31  ? 1450 LYS A CG  1 
ATOM   26   C CD  . LYS A 1 5   ? 28.638 -7.573  48.755 1.00 41.73  ? 1450 LYS A CD  1 
ATOM   27   C CE  . LYS A 1 5   ? 28.676 -7.278  50.245 1.00 65.49  ? 1450 LYS A CE  1 
ATOM   28   N NZ  . LYS A 1 5   ? 29.035 -8.493  51.047 1.00 56.31  ? 1450 LYS A NZ  1 
ATOM   29   N N   . LEU A 1 6   ? 29.936 -3.282  46.158 1.00 48.89  ? 1451 LEU A N   1 
ATOM   30   C CA  . LEU A 1 6   ? 30.886 -2.209  46.474 1.00 50.05  ? 1451 LEU A CA  1 
ATOM   31   C C   . LEU A 1 6   ? 31.565 -2.461  47.814 1.00 43.69  ? 1451 LEU A C   1 
ATOM   32   O O   . LEU A 1 6   ? 30.955 -3.023  48.722 1.00 41.06  ? 1451 LEU A O   1 
ATOM   33   C CB  . LEU A 1 6   ? 30.174 -0.842  46.531 1.00 48.81  ? 1451 LEU A CB  1 
ATOM   34   C CG  . LEU A 1 6   ? 29.832 -0.181  45.194 1.00 45.99  ? 1451 LEU A CG  1 
ATOM   35   C CD1 . LEU A 1 6   ? 29.382 1.250   45.447 1.00 49.76  ? 1451 LEU A CD1 1 
ATOM   36   C CD2 . LEU A 1 6   ? 30.999 -0.253  44.179 1.00 36.72  ? 1451 LEU A CD2 1 
ATOM   37   N N   . SER A 1 7   ? 32.802 -2.001  47.969 1.00 41.15  ? 1452 SER A N   1 
ATOM   38   C CA  . SER A 1 7   ? 33.426 -2.032  49.305 1.00 42.32  ? 1452 SER A CA  1 
ATOM   39   C C   . SER A 1 7   ? 32.623 -1.156  50.300 1.00 38.70  ? 1452 SER A C   1 
ATOM   40   O O   . SER A 1 7   ? 32.374 0.008   50.024 1.00 38.55  ? 1452 SER A O   1 
ATOM   41   C CB  . SER A 1 7   ? 34.892 -1.623  49.256 1.00 35.52  ? 1452 SER A CB  1 
ATOM   42   O OG  . SER A 1 7   ? 35.490 -1.863  50.511 1.00 35.33  ? 1452 SER A OG  1 
ATOM   43   N N   . PRO A 1 8   ? 32.161 -1.748  51.415 1.00 41.90  ? 1453 PRO A N   1 
ATOM   44   C CA  . PRO A 1 8   ? 31.440 -0.978  52.447 1.00 44.31  ? 1453 PRO A CA  1 
ATOM   45   C C   . PRO A 1 8   ? 32.186 0.279   52.900 1.00 43.34  ? 1453 PRO A C   1 
ATOM   46   O O   . PRO A 1 8   ? 33.393 0.268   53.070 1.00 34.30  ? 1453 PRO A O   1 
ATOM   47   C CB  . PRO A 1 8   ? 31.303 -1.977  53.624 1.00 44.55  ? 1453 PRO A CB  1 
ATOM   48   C CG  . PRO A 1 8   ? 31.437 -3.323  53.026 1.00 54.06  ? 1453 PRO A CG  1 
ATOM   49   C CD  . PRO A 1 8   ? 32.274 -3.173  51.783 1.00 43.81  ? 1453 PRO A CD  1 
ATOM   50   N N   . ASN A 1 9   ? 31.470 1.374   53.079 1.00 40.26  ? 1454 ASN A N   1 
ATOM   51   C CA  . ASN A 1 9   ? 32.054 2.562   53.705 1.00 42.87  ? 1454 ASN A CA  1 
ATOM   52   C C   . ASN A 1 9   ? 32.509 2.231   55.136 1.00 33.94  ? 1454 ASN A C   1 
ATOM   53   O O   . ASN A 1 9   ? 32.026 1.258   55.714 1.00 34.60  ? 1454 ASN A O   1 
ATOM   54   C CB  . ASN A 1 9   ? 30.992 3.690   53.723 1.00 38.59  ? 1454 ASN A CB  1 
ATOM   55   C CG  . ASN A 1 9   ? 30.906 4.424   52.405 1.00 45.28  ? 1454 ASN A CG  1 
ATOM   56   O OD1 . ASN A 1 9   ? 31.927 4.752   51.802 1.00 36.22  ? 1454 ASN A OD1 1 
ATOM   57   N ND2 . ASN A 1 9   ? 29.680 4.730   51.972 1.00 40.11  ? 1454 ASN A ND2 1 
ATOM   58   N N   . PRO A 1 10  ? 33.440 3.040   55.706 1.00 30.63  ? 1455 PRO A N   1 
ATOM   59   C CA  . PRO A 1 10  ? 33.578 3.033   57.146 1.00 39.02  ? 1455 PRO A CA  1 
ATOM   60   C C   . PRO A 1 10  ? 32.199 3.182   57.818 1.00 43.73  ? 1455 PRO A C   1 
ATOM   61   O O   . PRO A 1 10  ? 31.422 4.068   57.436 1.00 36.05  ? 1455 PRO A O   1 
ATOM   62   C CB  . PRO A 1 10  ? 34.487 4.252   57.419 1.00 38.63  ? 1455 PRO A CB  1 
ATOM   63   C CG  . PRO A 1 10  ? 34.996 4.725   56.108 1.00 47.82  ? 1455 PRO A CG  1 
ATOM   64   C CD  . PRO A 1 10  ? 33.994 4.269   55.107 1.00 42.14  ? 1455 PRO A CD  1 
ATOM   65   N N   . PRO A 1 11  ? 31.878 2.308   58.801 1.00 40.10  ? 1456 PRO A N   1 
ATOM   66   C CA  . PRO A 1 11  ? 30.510 2.285   59.341 1.00 39.16  ? 1456 PRO A CA  1 
ATOM   67   C C   . PRO A 1 11  ? 30.077 3.639   59.892 1.00 41.15  ? 1456 PRO A C   1 
ATOM   68   O O   . PRO A 1 11  ? 28.902 4.003   59.783 1.00 44.68  ? 1456 PRO A O   1 
ATOM   69   C CB  . PRO A 1 11  ? 30.582 1.237   60.456 1.00 52.57  ? 1456 PRO A CB  1 
ATOM   70   C CG  . PRO A 1 11  ? 31.743 0.375   60.082 1.00 49.99  ? 1456 PRO A CG  1 
ATOM   71   C CD  . PRO A 1 11  ? 32.726 1.254   59.380 1.00 48.45  ? 1456 PRO A CD  1 
ATOM   72   N N   . ASN A 1 12  ? 31.026 4.368   60.484 1.00 46.45  ? 1457 ASN A N   1 
ATOM   73   C CA  . ASN A 1 12  ? 30.744 5.679   61.045 1.00 35.13  ? 1457 ASN A CA  1 
ATOM   74   C C   . ASN A 1 12  ? 30.213 6.619   59.985 1.00 42.51  ? 1457 ASN A C   1 
ATOM   75   O O   . ASN A 1 12  ? 29.441 7.540   60.293 1.00 37.46  ? 1457 ASN A O   1 
ATOM   76   C CB  . ASN A 1 12  ? 31.990 6.308   61.669 1.00 42.39  ? 1457 ASN A CB  1 
ATOM   77   C CG  . ASN A 1 12  ? 32.457 5.564   62.902 1.00 68.22  ? 1457 ASN A CG  1 
ATOM   78   O OD1 . ASN A 1 12  ? 31.677 4.853   63.517 1.00 61.21  ? 1457 ASN A OD1 1 
ATOM   79   N ND2 . ASN A 1 12  ? 33.735 5.711   63.259 1.00 65.38  ? 1457 ASN A ND2 1 
ATOM   80   N N   . LEU A 1 13  ? 30.726 6.460   58.766 1.00 37.86  ? 1458 LEU A N   1 
ATOM   81   C CA  . LEU A 1 13  ? 30.305 7.320   57.681 1.00 40.27  ? 1458 LEU A CA  1 
ATOM   82   C C   . LEU A 1 13  ? 28.889 6.965   57.282 1.00 32.68  ? 1458 LEU A C   1 
ATOM   83   O O   . LEU A 1 13  ? 28.079 7.866   57.100 1.00 33.73  ? 1458 LEU A O   1 
ATOM   84   C CB  . LEU A 1 13  ? 31.266 7.284   56.480 1.00 34.31  ? 1458 LEU A CB  1 
ATOM   85   C CG  . LEU A 1 13  ? 30.896 8.175   55.324 1.00 31.13  ? 1458 LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 13  ? 30.901 9.638   55.769 1.00 41.97  ? 1458 LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 13  ? 31.835 7.896   54.109 1.00 31.72  ? 1458 LEU A CD2 1 
ATOM   88   N N   . THR A 1 14  ? 28.571 5.665   57.259 1.00 38.33  ? 1459 THR A N   1 
ATOM   89   C CA  . THR A 1 14  ? 27.187 5.214   56.943 1.00 36.12  ? 1459 THR A CA  1 
ATOM   90   C C   . THR A 1 14  ? 26.169 5.681   57.982 1.00 47.99  ? 1459 THR A C   1 
ATOM   91   O O   . THR A 1 14  ? 25.028 6.067   57.623 1.00 30.52  ? 1459 THR A O   1 
ATOM   92   C CB  . THR A 1 14  ? 27.118 3.682   56.761 1.00 43.56  ? 1459 THR A CB  1 
ATOM   93   O OG1 . THR A 1 14  ? 28.061 3.259   55.751 1.00 35.97  ? 1459 THR A OG1 1 
ATOM   94   C CG2 . THR A 1 14  ? 25.732 3.282   56.367 1.00 42.99  ? 1459 THR A CG2 1 
ATOM   95   N N   . LYS A 1 15  ? 26.571 5.635   59.258 1.00 41.93  ? 1460 LYS A N   1 
ATOM   96   C CA  . LYS A 1 15  ? 25.740 6.124   60.364 1.00 34.41  ? 1460 LYS A CA  1 
ATOM   97   C C   . LYS A 1 15  ? 25.525 7.632   60.263 1.00 29.77  ? 1460 LYS A C   1 
ATOM   98   O O   . LYS A 1 15  ? 24.398 8.092   60.404 1.00 35.90  ? 1460 LYS A O   1 
ATOM   99   C CB  . LYS A 1 15  ? 26.303 5.749   61.758 1.00 46.45  ? 1460 LYS A CB  1 
ATOM   100  C CG  . LYS A 1 15  ? 25.823 4.389   62.315 1.00 46.99  ? 1460 LYS A CG  1 
ATOM   101  C CD  . LYS A 1 15  ? 26.149 4.192   63.803 1.00 49.25  ? 1460 LYS A CD  1 
ATOM   102  N N   . LYS A 1 16  ? 26.559 8.387   59.894 1.00 29.15  ? 1461 LYS A N   1 
ATOM   103  C CA  . LYS A 1 16  ? 26.383 9.804   59.679 1.00 31.39  ? 1461 LYS A CA  1 
ATOM   104  C C   . LYS A 1 16  ? 25.392 10.097  58.512 1.00 31.76  ? 1461 LYS A C   1 
ATOM   105  O O   . LYS A 1 16  ? 24.447 10.931  58.659 1.00 32.43  ? 1461 LYS A O   1 
ATOM   106  C CB  . LYS A 1 16  ? 27.720 10.537  59.434 1.00 36.70  ? 1461 LYS A CB  1 
ATOM   107  C CG  . LYS A 1 16  ? 28.565 10.724  60.675 1.00 52.33  ? 1461 LYS A CG  1 
ATOM   108  C CD  . LYS A 1 16  ? 29.656 11.768  60.486 1.00 42.67  ? 1461 LYS A CD  1 
ATOM   109  C CE  . LYS A 1 16  ? 30.614 11.396  59.361 1.00 53.01  ? 1461 LYS A CE  1 
ATOM   110  N N   . MET A 1 17  ? 25.596 9.419   57.394 1.00 30.78  ? 1462 MET A N   1 
ATOM   111  C CA  . MET A 1 17  ? 24.701 9.548   56.264 1.00 31.69  ? 1462 MET A CA  1 
ATOM   112  C C   . MET A 1 17  ? 23.248 9.285   56.718 1.00 31.45  ? 1462 MET A C   1 
ATOM   113  O O   . MET A 1 17  ? 22.394 10.111  56.455 1.00 30.15  ? 1462 MET A O   1 
ATOM   114  C CB  . MET A 1 17  ? 25.110 8.600   55.143 1.00 27.13  ? 1462 MET A CB  1 
ATOM   115  C CG  . MET A 1 17  ? 26.330 9.031   54.372 1.00 30.25  ? 1462 MET A CG  1 
ATOM   116  S SD  . MET A 1 17  ? 26.888 7.790   53.217 1.00 34.79  ? 1462 MET A SD  1 
ATOM   117  C CE  . MET A 1 17  ? 28.348 8.687   52.576 1.00 35.58  ? 1462 MET A CE  1 
ATOM   118  N N   . LYS A 1 18  ? 22.991 8.183   57.401 1.00 32.90  ? 1463 LYS A N   1 
ATOM   119  C CA  . LYS A 1 18  ? 21.601 7.825   57.776 1.00 35.53  ? 1463 LYS A CA  1 
ATOM   120  C C   . LYS A 1 18  ? 20.968 8.805   58.752 1.00 27.19  ? 1463 LYS A C   1 
ATOM   121  O O   . LYS A 1 18  ? 19.753 9.025   58.707 1.00 35.79  ? 1463 LYS A O   1 
ATOM   122  C CB  . LYS A 1 18  ? 21.524 6.463   58.357 1.00 36.93  ? 1463 LYS A CB  1 
ATOM   123  C CG  . LYS A 1 18  ? 21.955 5.329   57.406 1.00 46.35  ? 1463 LYS A CG  1 
ATOM   124  C CD  . LYS A 1 18  ? 22.549 4.127   58.142 1.00 78.87  ? 1463 LYS A CD  1 
ATOM   125  C CE  . LYS A 1 18  ? 21.541 3.432   59.040 1.00 78.56  ? 1463 LYS A CE  1 
ATOM   126  N NZ  . LYS A 1 18  ? 20.553 2.654   58.244 1.00 108.58 ? 1463 LYS A NZ  1 
ATOM   127  N N   . LYS A 1 19  ? 21.756 9.272   59.723 1.00 34.05  ? 1464 LYS A N   1 
ATOM   128  C CA  . LYS A 1 19  ? 21.335 10.262  60.686 1.00 33.92  ? 1464 LYS A CA  1 
ATOM   129  C C   . LYS A 1 19  ? 20.884 11.545  60.025 1.00 33.04  ? 1464 LYS A C   1 
ATOM   130  O O   . LYS A 1 19  ? 19.822 12.118  60.380 1.00 27.89  ? 1464 LYS A O   1 
ATOM   131  C CB  . LYS A 1 19  ? 22.404 10.531  61.762 1.00 39.07  ? 1464 LYS A CB  1 
ATOM   132  C CG  . LYS A 1 19  ? 22.443 9.497   62.873 1.00 79.67  ? 1464 LYS A CG  1 
ATOM   133  C CD  . LYS A 1 19  ? 23.508 9.772   63.937 1.00 102.15 ? 1464 LYS A CD  1 
ATOM   134  C CE  . LYS A 1 19  ? 23.515 8.685   65.014 1.00 93.30  ? 1464 LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 19  ? 24.886 8.310   65.463 1.00 87.83  ? 1464 LYS A NZ  1 
ATOM   136  N N   . ILE A 1 20  ? 21.644 11.994  59.049 1.00 30.64  ? 1465 ILE A N   1 
ATOM   137  C CA  . ILE A 1 20  ? 21.389 13.242  58.377 1.00 29.00  ? 1465 ILE A CA  1 
ATOM   138  C C   . ILE A 1 20  ? 20.071 13.173  57.551 1.00 27.25  ? 1465 ILE A C   1 
ATOM   139  O O   . ILE A 1 20  ? 19.194 14.039  57.640 1.00 30.30  ? 1465 ILE A O   1 
ATOM   140  C CB  . ILE A 1 20  ? 22.569 13.574  57.425 1.00 27.80  ? 1465 ILE A CB  1 
ATOM   141  C CG1 . ILE A 1 20  ? 23.805 13.968  58.248 1.00 31.37  ? 1465 ILE A CG1 1 
ATOM   142  C CG2 . ILE A 1 20  ? 22.217 14.768  56.605 1.00 28.54  ? 1465 ILE A CG2 1 
ATOM   143  C CD1 . ILE A 1 20  ? 25.053 14.110  57.384 1.00 28.27  ? 1465 ILE A CD1 1 
ATOM   144  N N   . VAL A 1 21  ? 19.947 12.100  56.785 1.00 27.08  ? 1466 VAL A N   1 
ATOM   145  C CA  . VAL A 1 21  ? 18.759 11.932  55.927 1.00 26.85  ? 1466 VAL A CA  1 
ATOM   146  C C   . VAL A 1 21  ? 17.532 11.688  56.792 1.00 27.60  ? 1466 VAL A C   1 
ATOM   147  O O   . VAL A 1 21  ? 16.456 12.198  56.505 1.00 30.95  ? 1466 VAL A O   1 
ATOM   148  C CB  . VAL A 1 21  ? 18.957 10.748  54.968 1.00 32.91  ? 1466 VAL A CB  1 
ATOM   149  C CG1 . VAL A 1 21  ? 17.631 10.445  54.251 1.00 32.59  ? 1466 VAL A CG1 1 
ATOM   150  C CG2 . VAL A 1 21  ? 20.036 11.059  53.939 1.00 32.34  ? 1466 VAL A CG2 1 
ATOM   151  N N   . ASP A 1 22  ? 17.680 10.935  57.871 1.00 34.57  ? 1467 ASP A N   1 
ATOM   152  C CA  . ASP A 1 22  ? 16.568 10.829  58.821 1.00 39.45  ? 1467 ASP A CA  1 
ATOM   153  C C   . ASP A 1 22  ? 16.106 12.136  59.433 1.00 38.88  ? 1467 ASP A C   1 
ATOM   154  O O   . ASP A 1 22  ? 14.898 12.349  59.537 1.00 36.60  ? 1467 ASP A O   1 
ATOM   155  C CB  . ASP A 1 22  ? 16.871 9.842   59.937 1.00 36.10  ? 1467 ASP A CB  1 
ATOM   156  C CG  . ASP A 1 22  ? 16.718 8.447   59.494 1.00 56.08  ? 1467 ASP A CG  1 
ATOM   157  O OD1 . ASP A 1 22  ? 16.012 8.219   58.475 1.00 56.38  ? 1467 ASP A OD1 1 
ATOM   158  O OD2 . ASP A 1 22  ? 17.312 7.582   60.162 1.00 82.08  ? 1467 ASP A OD2 1 
ATOM   159  N N   . ALA A 1 23  ? 17.006 13.025  59.853 1.00 30.91  ? 1468 ALA A N   1 
ATOM   160  C CA  . ALA A 1 23  ? 16.568 14.323  60.368 1.00 34.00  ? 1468 ALA A CA  1 
ATOM   161  C C   . ALA A 1 23  ? 15.883 15.174  59.328 1.00 34.47  ? 1468 ALA A C   1 
ATOM   162  O O   . ALA A 1 23  ? 14.940 15.892  59.649 1.00 28.52  ? 1468 ALA A O   1 
ATOM   163  C CB  . ALA A 1 23  ? 17.718 15.104  61.009 1.00 34.81  ? 1468 ALA A CB  1 
ATOM   164  N N   . VAL A 1 24  ? 16.382 15.110  58.097 1.00 29.91  ? 1469 VAL A N   1 
ATOM   165  C CA  . VAL A 1 24  ? 15.824 15.828  56.971 1.00 26.10  ? 1469 VAL A CA  1 
ATOM   166  C C   . VAL A 1 24  ? 14.401 15.334  56.705 1.00 25.83  ? 1469 VAL A C   1 
ATOM   167  O O   . VAL A 1 24  ? 13.520 16.119  56.477 1.00 28.67  ? 1469 VAL A O   1 
ATOM   168  C CB  . VAL A 1 24  ? 16.731 15.716  55.735 1.00 27.60  ? 1469 VAL A CB  1 
ATOM   169  C CG1 . VAL A 1 24  ? 16.072 16.338  54.495 1.00 27.88  ? 1469 VAL A CG1 1 
ATOM   170  C CG2 . VAL A 1 24  ? 18.056 16.383  56.057 1.00 31.22  ? 1469 VAL A CG2 1 
ATOM   171  N N   . ILE A 1 25  ? 14.258 14.028  56.679 1.00 30.28  ? 1470 ILE A N   1 
ATOM   172  C CA  . ILE A 1 25  ? 12.961 13.392  56.402 1.00 27.76  ? 1470 ILE A CA  1 
ATOM   173  C C   . ILE A 1 25  ? 11.977 13.726  57.508 1.00 30.08  ? 1470 ILE A C   1 
ATOM   174  O O   . ILE A 1 25  ? 10.799 14.043  57.230 1.00 36.60  ? 1470 ILE A O   1 
ATOM   175  C CB  . ILE A 1 25  ? 13.164 11.867  56.198 1.00 28.11  ? 1470 ILE A CB  1 
ATOM   176  C CG1 . ILE A 1 25  ? 13.816 11.591  54.848 1.00 27.11  ? 1470 ILE A CG1 1 
ATOM   177  C CG2 . ILE A 1 25  ? 11.832 11.128  56.400 1.00 37.55  ? 1470 ILE A CG2 1 
ATOM   178  C CD1 . ILE A 1 25  ? 14.181 10.117  54.686 1.00 33.53  ? 1470 ILE A CD1 1 
ATOM   179  N N   . LYS A 1 26  ? 12.428 13.722  58.763 1.00 31.18  ? 1471 LYS A N   1 
ATOM   180  C CA  . LYS A 1 26  ? 11.549 13.979  59.913 1.00 40.21  ? 1471 LYS A CA  1 
ATOM   181  C C   . LYS A 1 26  ? 11.116 15.416  60.102 1.00 37.87  ? 1471 LYS A C   1 
ATOM   182  O O   . LYS A 1 26  ? 10.170 15.718  60.840 1.00 37.14  ? 1471 LYS A O   1 
ATOM   183  C CB  . LYS A 1 26  ? 12.225 13.539  61.206 1.00 44.43  ? 1471 LYS A CB  1 
ATOM   184  C CG  . LYS A 1 26  ? 12.577 12.060  61.319 1.00 65.53  ? 1471 LYS A CG  1 
ATOM   185  C CD  . LYS A 1 26  ? 11.423 11.070  61.222 1.00 88.70  ? 1471 LYS A CD  1 
ATOM   186  C CE  . LYS A 1 26  ? 11.942 9.690   60.806 1.00 123.19 ? 1471 LYS A CE  1 
ATOM   187  N NZ  . LYS A 1 26  ? 13.238 9.303   61.450 1.00 104.12 ? 1471 LYS A NZ  1 
ATOM   188  N N   . TYR A 1 27  ? 11.868 16.326  59.524 1.00 27.56  ? 1472 TYR A N   1 
ATOM   189  C CA  . TYR A 1 27  ? 11.643 17.743  59.736 1.00 28.46  ? 1472 TYR A CA  1 
ATOM   190  C C   . TYR A 1 27  ? 10.199 18.137  59.468 1.00 37.22  ? 1472 TYR A C   1 
ATOM   191  O O   . TYR A 1 27  ? 9.654  17.738  58.457 1.00 28.63  ? 1472 TYR A O   1 
ATOM   192  C CB  . TYR A 1 27  ? 12.543 18.574  58.860 1.00 30.99  ? 1472 TYR A CB  1 
ATOM   193  C CG  . TYR A 1 27  ? 12.377 20.060  59.015 1.00 30.77  ? 1472 TYR A CG  1 
ATOM   194  C CD1 . TYR A 1 27  ? 11.586 20.806  58.118 1.00 34.61  ? 1472 TYR A CD1 1 
ATOM   195  C CD2 . TYR A 1 27  ? 12.977 20.704  60.075 1.00 37.57  ? 1472 TYR A CD2 1 
ATOM   196  C CE1 . TYR A 1 27  ? 11.420 22.165  58.323 1.00 38.53  ? 1472 TYR A CE1 1 
ATOM   197  C CE2 . TYR A 1 27  ? 12.822 22.052  60.271 1.00 42.73  ? 1472 TYR A CE2 1 
ATOM   198  C CZ  . TYR A 1 27  ? 12.076 22.782  59.387 1.00 38.70  ? 1472 TYR A CZ  1 
ATOM   199  O OH  . TYR A 1 27  ? 11.964 24.141  59.652 1.00 47.34  ? 1472 TYR A OH  1 
ATOM   200  N N   . LYS A 1 28  ? 9.631  18.960  60.369 1.00 35.58  ? 1473 LYS A N   1 
ATOM   201  C CA  . LYS A 1 28  ? 8.254  19.492  60.288 1.00 33.50  ? 1473 LYS A CA  1 
ATOM   202  C C   . LYS A 1 28  ? 8.196  21.042  60.305 1.00 31.16  ? 1473 LYS A C   1 
ATOM   203  O O   . LYS A 1 28  ? 8.911  21.710  61.012 1.00 41.01  ? 1473 LYS A O   1 
ATOM   204  C CB  . LYS A 1 28  ? 7.362  18.892  61.393 1.00 34.73  ? 1473 LYS A CB  1 
ATOM   205  C CG  . LYS A 1 28  ? 6.902  17.468  61.142 1.00 39.53  ? 1473 LYS A CG  1 
ATOM   206  C CD  . LYS A 1 28  ? 6.393  16.795  62.426 1.00 49.19  ? 1473 LYS A CD  1 
ATOM   207  N N   . ASP A 1 29  ? 7.347  21.589  59.442 1.00 35.67  ? 1474 ASP A N   1 
ATOM   208  C CA  . ASP A 1 29  ? 7.062  23.039  59.424 1.00 44.63  ? 1474 ASP A CA  1 
ATOM   209  C C   . ASP A 1 29  ? 6.429  23.270  60.761 1.00 50.22  ? 1474 ASP A C   1 
ATOM   210  O O   . ASP A 1 29  ? 5.447  22.575  61.044 1.00 40.05  ? 1474 ASP A O   1 
ATOM   211  C CB  . ASP A 1 29  ? 6.008  23.311  58.337 1.00 45.07  ? 1474 ASP A CB  1 
ATOM   212  C CG  . ASP A 1 29  ? 5.452  24.701  58.379 1.00 55.60  ? 1474 ASP A CG  1 
ATOM   213  O OD1 . ASP A 1 29  ? 6.224  25.621  58.086 1.00 49.08  ? 1474 ASP A OD1 1 
ATOM   214  O OD2 . ASP A 1 29  ? 4.241  24.861  58.677 1.00 50.23  ? 1474 ASP A OD2 1 
ATOM   215  N N   . SER A 1 30  ? 6.950  24.195  61.578 1.00 51.45  ? 1475 SER A N   1 
ATOM   216  C CA  . SER A 1 30  ? 6.394  24.408  62.942 1.00 92.30  ? 1475 SER A CA  1 
ATOM   217  C C   . SER A 1 30  ? 4.920  24.867  62.999 1.00 80.72  ? 1475 SER A C   1 
ATOM   218  O O   . SER A 1 30  ? 4.245  24.612  63.994 1.00 59.24  ? 1475 SER A O   1 
ATOM   219  C CB  . SER A 1 30  ? 7.270  25.349  63.790 1.00 74.71  ? 1475 SER A CB  1 
ATOM   220  O OG  . SER A 1 30  ? 8.232  26.030  63.012 1.00 77.28  ? 1475 SER A OG  1 
ATOM   221  N N   . SER A 1 31  ? 4.422  25.513  61.943 1.00 56.25  ? 1476 SER A N   1 
ATOM   222  C CA  . SER A 1 31  ? 3.044  25.980  61.918 1.00 76.65  ? 1476 SER A CA  1 
ATOM   223  C C   . SER A 1 31  ? 1.992  24.912  61.561 1.00 68.07  ? 1476 SER A C   1 
ATOM   224  O O   . SER A 1 31  ? 0.999  24.778  62.278 1.00 63.36  ? 1476 SER A O   1 
ATOM   225  C CB  . SER A 1 31  ? 2.900  27.162  60.961 1.00 82.34  ? 1476 SER A CB  1 
ATOM   226  O OG  . SER A 1 31  ? 1.535  27.551  60.900 1.00 98.26  ? 1476 SER A OG  1 
ATOM   227  N N   . SER A 1 32  ? 2.185  24.202  60.442 1.00 36.64  ? 1477 SER A N   1 
ATOM   228  C CA  . SER A 1 32  ? 1.196  23.249  59.922 1.00 57.70  ? 1477 SER A CA  1 
ATOM   229  C C   . SER A 1 32  ? 1.453  21.830  60.431 1.00 41.88  ? 1477 SER A C   1 
ATOM   230  O O   . SER A 1 32  ? 0.540  20.981  60.440 1.00 49.58  ? 1477 SER A O   1 
ATOM   231  C CB  . SER A 1 32  ? 1.163  23.264  58.366 1.00 60.14  ? 1477 SER A CB  1 
ATOM   232  O OG  . SER A 1 32  ? 2.394  22.822  57.746 1.00 42.13  ? 1477 SER A OG  1 
ATOM   233  N N   . GLY A 1 33  ? 2.701  21.568  60.793 1.00 46.00  ? 1478 GLY A N   1 
ATOM   234  C CA  . GLY A 1 33  ? 3.162  20.221  61.111 1.00 46.26  ? 1478 GLY A CA  1 
ATOM   235  C C   . GLY A 1 33  ? 3.436  19.367  59.904 1.00 44.00  ? 1478 GLY A C   1 
ATOM   236  O O   . GLY A 1 33  ? 3.694  18.197  60.066 1.00 37.69  ? 1478 GLY A O   1 
ATOM   237  N N   . ARG A 1 34  ? 3.357  19.960  58.709 1.00 36.74  ? 1479 ARG A N   1 
ATOM   238  C CA  . ARG A 1 34  ? 3.521  19.228  57.454 1.00 36.06  ? 1479 ARG A CA  1 
ATOM   239  C C   . ARG A 1 34  ? 4.960  18.759  57.519 1.00 35.11  ? 1479 ARG A C   1 
ATOM   240  O O   . ARG A 1 34  ? 5.831  19.534  57.883 1.00 32.63  ? 1479 ARG A O   1 
ATOM   241  C CB  . ARG A 1 34  ? 3.276  20.191  56.297 1.00 49.81  ? 1479 ARG A CB  1 
ATOM   242  C CG  . ARG A 1 34  ? 3.101  19.561  54.943 1.00 61.34  ? 1479 ARG A CG  1 
ATOM   243  C CD  . ARG A 1 34  ? 2.776  20.642  53.923 1.00 82.88  ? 1479 ARG A CD  1 
ATOM   244  N NE  . ARG A 1 34  ? 3.898  21.553  53.616 1.00 49.90  ? 1479 ARG A NE  1 
ATOM   245  C CZ  . ARG A 1 34  ? 3.978  22.821  54.002 1.00 49.06  ? 1479 ARG A CZ  1 
ATOM   246  N NH1 . ARG A 1 34  ? 3.019  23.430  54.722 1.00 60.99  ? 1479 ARG A NH1 1 
ATOM   247  N NH2 . ARG A 1 34  ? 5.009  23.517  53.624 1.00 40.33  ? 1479 ARG A NH2 1 
ATOM   248  N N   . GLN A 1 35  ? 5.188  17.467  57.278 1.00 36.09  ? 1480 GLN A N   1 
ATOM   249  C CA  . GLN A 1 35  ? 6.531  16.960  57.051 1.00 32.70  ? 1480 GLN A CA  1 
ATOM   250  C C   . GLN A 1 35  ? 6.910  17.373  55.629 1.00 29.43  ? 1480 GLN A C   1 
ATOM   251  O O   . GLN A 1 35  ? 6.320  16.903  54.601 1.00 32.71  ? 1480 GLN A O   1 
ATOM   252  C CB  . GLN A 1 35  ? 6.481  15.483  57.250 1.00 36.34  ? 1480 GLN A CB  1 
ATOM   253  C CG  . GLN A 1 35  ? 7.797  14.784  56.982 1.00 35.92  ? 1480 GLN A CG  1 
ATOM   254  C CD  . GLN A 1 35  ? 7.640  13.296  57.005 1.00 43.94  ? 1480 GLN A CD  1 
ATOM   255  O OE1 . GLN A 1 35  ? 7.054  12.766  57.941 1.00 53.66  ? 1480 GLN A OE1 1 
ATOM   256  N NE2 . GLN A 1 35  ? 8.140  12.596  55.955 1.00 43.55  ? 1480 GLN A NE2 1 
ATOM   257  N N   . LEU A 1 36  ? 7.847  18.318  55.514 1.00 30.79  ? 1481 LEU A N   1 
ATOM   258  C CA  . LEU A 1 36  ? 8.181  18.819  54.190 1.00 34.27  ? 1481 LEU A CA  1 
ATOM   259  C C   . LEU A 1 36  ? 8.559  17.703  53.188 1.00 27.06  ? 1481 LEU A C   1 
ATOM   260  O O   . LEU A 1 36  ? 8.253  17.803  51.942 1.00 30.24  ? 1481 LEU A O   1 
ATOM   261  C CB  . LEU A 1 36  ? 9.317  19.792  54.280 1.00 30.22  ? 1481 LEU A CB  1 
ATOM   262  C CG  . LEU A 1 36  ? 8.851  21.242  54.582 1.00 43.29  ? 1481 LEU A CG  1 
ATOM   263  C CD1 . LEU A 1 36  ? 7.834  21.381  55.700 1.00 40.74  ? 1481 LEU A CD1 1 
ATOM   264  C CD2 . LEU A 1 36  ? 10.080 22.097  54.871 1.00 38.89  ? 1481 LEU A CD2 1 
ATOM   265  N N   . SER A 1 37  ? 9.224  16.686  53.738 1.00 33.33  ? 1482 SER A N   1 
ATOM   266  C CA  . SER A 1 37  ? 9.805  15.570  52.983 1.00 30.20  ? 1482 SER A CA  1 
ATOM   267  C C   . SER A 1 37  ? 8.776  14.688  52.375 1.00 39.97  ? 1482 SER A C   1 
ATOM   268  O O   . SER A 1 37  ? 9.071  13.936  51.454 1.00 28.08  ? 1482 SER A O   1 
ATOM   269  C CB  . SER A 1 37  ? 10.722 14.749  53.884 1.00 27.29  ? 1482 SER A CB  1 
ATOM   270  O OG  . SER A 1 37  ? 9.986  13.916  54.764 1.00 27.72  ? 1482 SER A OG  1 
ATOM   271  N N   . GLU A 1 38  ? 7.533  14.774  52.858 1.00 38.53  ? 1483 GLU A N   1 
ATOM   272  C CA  . GLU A 1 38  ? 6.609  13.687  52.570 1.00 30.68  ? 1483 GLU A CA  1 
ATOM   273  C C   . GLU A 1 38  ? 6.347  13.481  51.084 1.00 29.74  ? 1483 GLU A C   1 
ATOM   274  O O   . GLU A 1 38  ? 6.081  12.344  50.673 1.00 43.63  ? 1483 GLU A O   1 
ATOM   275  C CB  . GLU A 1 38  ? 5.262  13.816  53.333 1.00 36.21  ? 1483 GLU A CB  1 
ATOM   276  C CG  . GLU A 1 38  ? 4.354  14.969  52.901 1.00 46.84  ? 1483 GLU A CG  1 
ATOM   277  C CD  . GLU A 1 38  ? 2.854  14.614  52.923 1.00 40.68  ? 1483 GLU A CD  1 
ATOM   278  O OE1 . GLU A 1 38  ? 2.394  13.780  53.751 1.00 35.80  ? 1483 GLU A OE1 1 
ATOM   279  O OE2 . GLU A 1 38  ? 2.154  15.134  52.050 1.00 33.28  ? 1483 GLU A OE2 1 
ATOM   280  N N   . VAL A 1 39  ? 6.370  14.558  50.298 1.00 29.23  ? 1484 VAL A N   1 
ATOM   281  C CA  . VAL A 1 39  ? 6.088  14.433  48.834 1.00 32.76  ? 1484 VAL A CA  1 
ATOM   282  C C   . VAL A 1 39  ? 7.301  13.969  48.005 1.00 34.84  ? 1484 VAL A C   1 
ATOM   283  O O   . VAL A 1 39  ? 7.187  13.588  46.802 1.00 31.78  ? 1484 VAL A O   1 
ATOM   284  C CB  . VAL A 1 39  ? 5.583  15.756  48.273 1.00 39.27  ? 1484 VAL A CB  1 
ATOM   285  C CG1 . VAL A 1 39  ? 4.285  16.087  48.945 1.00 43.97  ? 1484 VAL A CG1 1 
ATOM   286  C CG2 . VAL A 1 39  ? 6.647  16.849  48.451 1.00 38.71  ? 1484 VAL A CG2 1 
ATOM   287  N N   . PHE A 1 40  ? 8.448  13.987  48.679 1.00 34.28  ? 1485 PHE A N   1 
ATOM   288  C CA  . PHE A 1 40  ? 9.771  13.671  48.089 1.00 34.26  ? 1485 PHE A CA  1 
ATOM   289  C C   . PHE A 1 40  ? 10.212 12.273  48.471 1.00 33.43  ? 1485 PHE A C   1 
ATOM   290  O O   . PHE A 1 40  ? 11.274 11.844  48.064 1.00 39.65  ? 1485 PHE A O   1 
ATOM   291  C CB  . PHE A 1 40  ? 10.829 14.737  48.494 1.00 26.66  ? 1485 PHE A CB  1 
ATOM   292  C CG  . PHE A 1 40  ? 10.444 16.184  48.154 1.00 29.56  ? 1485 PHE A CG  1 
ATOM   293  C CD1 . PHE A 1 40  ? 10.494 16.650  46.841 1.00 40.25  ? 1485 PHE A CD1 1 
ATOM   294  C CD2 . PHE A 1 40  ? 10.047 17.090  49.148 1.00 31.62  ? 1485 PHE A CD2 1 
ATOM   295  C CE1 . PHE A 1 40  ? 10.154 17.976  46.525 1.00 46.74  ? 1485 PHE A CE1 1 
ATOM   296  C CE2 . PHE A 1 40  ? 9.694  18.402  48.842 1.00 33.74  ? 1485 PHE A CE2 1 
ATOM   297  C CZ  . PHE A 1 40  ? 9.762  18.855  47.516 1.00 33.90  ? 1485 PHE A CZ  1 
ATOM   298  N N   . ILE A 1 41  ? 9.417  11.538  49.273 1.00 31.95  ? 1486 ILE A N   1 
ATOM   299  C CA  . ILE A 1 41  ? 9.781  10.189  49.691 1.00 35.53  ? 1486 ILE A CA  1 
ATOM   300  C C   . ILE A 1 41  ? 9.828  9.203   48.530 1.00 40.50  ? 1486 ILE A C   1 
ATOM   301  O O   . ILE A 1 41  ? 10.794 8.489   48.326 1.00 33.34  ? 1486 ILE A O   1 
ATOM   302  C CB  . ILE A 1 41  ? 8.806  9.649   50.782 1.00 45.67  ? 1486 ILE A CB  1 
ATOM   303  C CG1 . ILE A 1 41  ? 8.977  10.417  52.111 1.00 37.97  ? 1486 ILE A CG1 1 
ATOM   304  C CG2 . ILE A 1 41  ? 9.029  8.153   50.997 1.00 52.49  ? 1486 ILE A CG2 1 
ATOM   305  C CD1 . ILE A 1 41  ? 10.416 10.438  52.583 1.00 34.75  ? 1486 ILE A CD1 1 
ATOM   306  N N   . GLN A 1 42  ? 8.767  9.211   47.767 1.00 38.51  ? 1487 GLN A N   1 
ATOM   307  C CA  . GLN A 1 42  ? 8.520  8.244   46.717 1.00 34.43  ? 1487 GLN A CA  1 
ATOM   308  C C   . GLN A 1 42  ? 8.066  8.968   45.490 1.00 29.30  ? 1487 GLN A C   1 
ATOM   309  O O   . GLN A 1 42  ? 6.917  9.465   45.420 1.00 30.33  ? 1487 GLN A O   1 
ATOM   310  C CB  . GLN A 1 42  ? 7.413  7.274   47.140 1.00 38.87  ? 1487 GLN A CB  1 
ATOM   311  C CG  . GLN A 1 42  ? 7.336  6.041   46.232 1.00 52.42  ? 1487 GLN A CG  1 
ATOM   312  C CD  . GLN A 1 42  ? 6.127  5.195   46.526 1.00 50.63  ? 1487 GLN A CD  1 
ATOM   313  O OE1 . GLN A 1 42  ? 5.806  4.926   47.696 1.00 48.55  ? 1487 GLN A OE1 1 
ATOM   314  N NE2 . GLN A 1 42  ? 5.437  4.760   45.465 1.00 48.85  ? 1487 GLN A NE2 1 
ATOM   315  N N   . LEU A 1 43  ? 8.932  9.059   44.494 1.00 34.38  ? 1488 LEU A N   1 
ATOM   316  C CA  . LEU A 1 43  ? 8.512  9.739   43.259 1.00 35.99  ? 1488 LEU A CA  1 
ATOM   317  C C   . LEU A 1 43  ? 7.360  8.889   42.617 1.00 55.75  ? 1488 LEU A C   1 
ATOM   318  O O   . LEU A 1 43  ? 7.319  7.688   42.810 1.00 49.12  ? 1488 LEU A O   1 
ATOM   319  C CB  . LEU A 1 43  ? 9.686  9.880   42.259 1.00 54.72  ? 1488 LEU A CB  1 
ATOM   320  C CG  . LEU A 1 43  ? 10.571 11.140  42.340 1.00 59.36  ? 1488 LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 43  ? 11.764 11.057  41.402 1.00 47.41  ? 1488 LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 43  ? 9.772  12.396  42.042 1.00 53.44  ? 1488 LEU A CD2 1 
ATOM   323  N N   . PRO A 1 44  ? 6.441  9.516   41.844 1.00 44.15  ? 1489 PRO A N   1 
ATOM   324  C CA  . PRO A 1 44  ? 5.319  8.768   41.219 1.00 47.64  ? 1489 PRO A CA  1 
ATOM   325  C C   . PRO A 1 44  ? 5.825  7.995   40.010 1.00 47.88  ? 1489 PRO A C   1 
ATOM   326  O O   . PRO A 1 44  ? 6.965  8.250   39.564 1.00 44.65  ? 1489 PRO A O   1 
ATOM   327  C CB  . PRO A 1 44  ? 4.329  9.871   40.829 1.00 66.01  ? 1489 PRO A CB  1 
ATOM   328  C CG  . PRO A 1 44  ? 5.147  11.131  40.711 1.00 66.29  ? 1489 PRO A CG  1 
ATOM   329  C CD  . PRO A 1 44  ? 6.477  10.927  41.406 1.00 49.48  ? 1489 PRO A CD  1 
ATOM   330  N N   . SER A 1 45  ? 5.044  7.036   39.516 1.00 74.09  ? 1490 SER A N   1 
ATOM   331  C CA  . SER A 1 45  ? 5.517  6.162   38.442 1.00 74.93  ? 1490 SER A CA  1 
ATOM   332  C C   . SER A 1 45  ? 5.701  6.936   37.130 1.00 70.22  ? 1490 SER A C   1 
ATOM   333  O O   . SER A 1 45  ? 5.065  7.980   36.918 1.00 63.10  ? 1490 SER A O   1 
ATOM   334  C CB  . SER A 1 45  ? 4.585  4.943   38.258 1.00 79.07  ? 1490 SER A CB  1 
ATOM   335  O OG  . SER A 1 45  ? 3.209  5.263   38.394 1.00 78.53  ? 1490 SER A OG  1 
ATOM   336  N N   . ARG A 1 46  ? 6.600  6.444   36.274 1.00 87.33  ? 1491 ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 6.712  6.976   34.917 1.00 80.75  ? 1491 ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 5.396  6.752   34.180 1.00 72.10  ? 1491 ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 4.985  7.612   33.389 1.00 55.28  ? 1491 ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 7.900  6.376   34.141 1.00 106.71 ? 1491 ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 7.784  6.469   32.608 1.00 107.85 ? 1491 ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 9.017  7.040   31.916 1.00 106.83 ? 1491 ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 10.274 6.491   32.424 1.00 134.55 ? 1491 ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 11.481 6.798   31.948 1.00 107.43 ? 1491 ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 11.620 7.649   30.930 1.00 80.36  ? 1491 ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 12.559 6.236   32.489 1.00 95.96  ? 1491 ARG A NH2 1 
ATOM   347  N N   . LYS A 1 47  ? 4.723  5.628   34.457 1.00 81.84  ? 1492 LYS A N   1 
ATOM   348  C CA  . LYS A 1 47  ? 3.389  5.386   33.883 1.00 86.08  ? 1492 LYS A CA  1 
ATOM   349  C C   . LYS A 1 47  ? 2.346  6.430   34.346 1.00 80.36  ? 1492 LYS A C   1 
ATOM   350  O O   . LYS A 1 47  ? 1.602  6.943   33.513 1.00 72.47  ? 1492 LYS A O   1 
ATOM   351  C CB  . LYS A 1 47  ? 2.902  3.939   34.118 1.00 107.38 ? 1492 LYS A CB  1 
ATOM   352  C CG  . LYS A 1 47  ? 2.708  3.498   35.564 1.00 118.60 ? 1492 LYS A CG  1 
ATOM   353  C CD  . LYS A 1 47  ? 2.009  2.141   35.624 1.00 94.46  ? 1492 LYS A CD  1 
ATOM   354  N N   . GLU A 1 48  ? 2.319  6.760   35.646 1.00 70.10  ? 1493 GLU A N   1 
ATOM   355  C CA  . GLU A 1 48  ? 1.385  7.778   36.211 1.00 69.53  ? 1493 GLU A CA  1 
ATOM   356  C C   . GLU A 1 48  ? 1.740  9.246   35.903 1.00 59.52  ? 1493 GLU A C   1 
ATOM   357  O O   . GLU A 1 48  ? 0.852  10.091  35.738 1.00 77.41  ? 1493 GLU A O   1 
ATOM   358  C CB  . GLU A 1 48  ? 1.260  7.626   37.736 1.00 79.14  ? 1493 GLU A CB  1 
ATOM   359  C CG  . GLU A 1 48  ? 0.774  8.881   38.457 1.00 62.46  ? 1493 GLU A CG  1 
ATOM   360  N N   . LEU A 1 49  ? 3.029  9.554   35.830 1.00 56.83  ? 1494 LEU A N   1 
ATOM   361  C CA  . LEU A 1 49  ? 3.477  10.922  35.578 1.00 59.94  ? 1494 LEU A CA  1 
ATOM   362  C C   . LEU A 1 49  ? 4.600  10.931  34.517 1.00 60.59  ? 1494 LEU A C   1 
ATOM   363  O O   . LEU A 1 49  ? 5.732  11.388  34.774 1.00 49.74  ? 1494 LEU A O   1 
ATOM   364  C CB  . LEU A 1 49  ? 3.951  11.576  36.900 1.00 65.14  ? 1494 LEU A CB  1 
ATOM   365  C CG  . LEU A 1 49  ? 3.641  13.065  37.152 1.00 71.89  ? 1494 LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 49  ? 4.552  13.612  38.253 1.00 55.11  ? 1494 LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 49  ? 3.743  13.914  35.889 1.00 65.75  ? 1494 LEU A CD2 1 
ATOM   368  N N   . PRO A 1 50  ? 4.280  10.456  33.300 1.00 56.36  ? 1495 PRO A N   1 
ATOM   369  C CA  . PRO A 1 50  ? 5.244  10.385  32.188 1.00 59.40  ? 1495 PRO A CA  1 
ATOM   370  C C   . PRO A 1 50  ? 6.002  11.687  31.911 1.00 50.16  ? 1495 PRO A C   1 
ATOM   371  O O   . PRO A 1 50  ? 7.240  11.669  31.752 1.00 57.36  ? 1495 PRO A O   1 
ATOM   372  C CB  . PRO A 1 50  ? 4.367  10.048  30.968 1.00 82.52  ? 1495 PRO A CB  1 
ATOM   373  C CG  . PRO A 1 50  ? 3.025  9.670   31.497 1.00 68.26  ? 1495 PRO A CG  1 
ATOM   374  C CD  . PRO A 1 50  ? 2.888  10.201  32.866 1.00 68.15  ? 1495 PRO A CD  1 
ATOM   375  N N   . GLU A 1 51  ? 5.272  12.800  31.876 1.00 46.25  ? 1496 GLU A N   1 
ATOM   376  C CA  . GLU A 1 51  ? 5.869  14.141  31.696 1.00 54.46  ? 1496 GLU A CA  1 
ATOM   377  C C   . GLU A 1 51  ? 6.992  14.488  32.712 1.00 64.85  ? 1496 GLU A C   1 
ATOM   378  O O   . GLU A 1 51  ? 7.915  15.279  32.405 1.00 52.79  ? 1496 GLU A O   1 
ATOM   379  C CB  . GLU A 1 51  ? 4.768  15.223  31.714 1.00 56.71  ? 1496 GLU A CB  1 
ATOM   380  C CG  . GLU A 1 51  ? 3.987  15.413  33.019 1.00 66.87  ? 1496 GLU A CG  1 
ATOM   381  C CD  . GLU A 1 51  ? 2.686  14.608  33.116 1.00 90.18  ? 1496 GLU A CD  1 
ATOM   382  O OE1 . GLU A 1 51  ? 2.556  13.497  32.535 1.00 68.89  ? 1496 GLU A OE1 1 
ATOM   383  O OE2 . GLU A 1 51  ? 1.778  15.093  33.815 1.00 94.03  ? 1496 GLU A OE2 1 
ATOM   384  N N   . TYR A 1 52  ? 6.930  13.902  33.913 1.00 47.81  ? 1497 TYR A N   1 
ATOM   385  C CA  . TYR A 1 52  ? 8.004  14.149  34.913 1.00 41.44  ? 1497 TYR A CA  1 
ATOM   386  C C   . TYR A 1 52  ? 9.319  13.657  34.356 1.00 51.30  ? 1497 TYR A C   1 
ATOM   387  O O   . TYR A 1 52  ? 10.311 14.386  34.268 1.00 44.36  ? 1497 TYR A O   1 
ATOM   388  C CB  . TYR A 1 52  ? 7.727  13.411  36.229 1.00 43.53  ? 1497 TYR A CB  1 
ATOM   389  C CG  . TYR A 1 52  ? 8.724  13.783  37.299 1.00 44.11  ? 1497 TYR A CG  1 
ATOM   390  C CD1 . TYR A 1 52  ? 8.539  14.924  38.082 1.00 38.26  ? 1497 TYR A CD1 1 
ATOM   391  C CD2 . TYR A 1 52  ? 9.890  13.043  37.484 1.00 52.53  ? 1497 TYR A CD2 1 
ATOM   392  C CE1 . TYR A 1 52  ? 9.489  15.288  39.039 1.00 40.26  ? 1497 TYR A CE1 1 
ATOM   393  C CE2 . TYR A 1 52  ? 10.831 13.408  38.416 1.00 49.13  ? 1497 TYR A CE2 1 
ATOM   394  C CZ  . TYR A 1 52  ? 10.621 14.525  39.209 1.00 36.20  ? 1497 TYR A CZ  1 
ATOM   395  O OH  . TYR A 1 52  ? 11.596 14.877  40.155 1.00 37.72  ? 1497 TYR A OH  1 
ATOM   396  N N   . TYR A 1 53  ? 9.304  12.391  33.975 1.00 41.54  ? 1498 TYR A N   1 
ATOM   397  C CA  . TYR A 1 53  ? 10.511 11.704  33.526 1.00 59.55  ? 1498 TYR A CA  1 
ATOM   398  C C   . TYR A 1 53  ? 11.005 12.228  32.158 1.00 62.46  ? 1498 TYR A C   1 
ATOM   399  O O   . TYR A 1 53  ? 12.143 11.944  31.762 1.00 64.27  ? 1498 TYR A O   1 
ATOM   400  C CB  . TYR A 1 53  ? 10.239 10.195  33.508 1.00 53.36  ? 1498 TYR A CB  1 
ATOM   401  C CG  . TYR A 1 53  ? 9.978  9.651   34.909 1.00 71.93  ? 1498 TYR A CG  1 
ATOM   402  C CD1 . TYR A 1 53  ? 8.713  9.758   35.508 1.00 54.22  ? 1498 TYR A CD1 1 
ATOM   403  C CD2 . TYR A 1 53  ? 11.002 9.079   35.649 1.00 69.50  ? 1498 TYR A CD2 1 
ATOM   404  C CE1 . TYR A 1 53  ? 8.477  9.294   36.786 1.00 52.45  ? 1498 TYR A CE1 1 
ATOM   405  C CE2 . TYR A 1 53  ? 10.778 8.603   36.931 1.00 77.01  ? 1498 TYR A CE2 1 
ATOM   406  C CZ  . TYR A 1 53  ? 9.521  8.707   37.492 1.00 66.62  ? 1498 TYR A CZ  1 
ATOM   407  O OH  . TYR A 1 53  ? 9.332  8.235   38.767 1.00 60.07  ? 1498 TYR A OH  1 
ATOM   408  N N   . GLU A 1 54  ? 10.157 13.005  31.469 1.00 73.20  ? 1499 GLU A N   1 
ATOM   409  C CA  . GLU A 1 54  ? 10.515 13.653  30.204 1.00 76.80  ? 1499 GLU A CA  1 
ATOM   410  C C   . GLU A 1 54  ? 11.450 14.838  30.472 1.00 71.04  ? 1499 GLU A C   1 
ATOM   411  O O   . GLU A 1 54  ? 12.561 14.904  29.936 1.00 66.68  ? 1499 GLU A O   1 
ATOM   412  C CB  . GLU A 1 54  ? 9.243  14.041  29.407 1.00 88.52  ? 1499 GLU A CB  1 
ATOM   413  C CG  . GLU A 1 54  ? 8.444  12.800  28.955 1.00 89.14  ? 1499 GLU A CG  1 
ATOM   414  C CD  . GLU A 1 54  ? 7.359  13.044  27.904 1.00 113.59 ? 1499 GLU A CD  1 
ATOM   415  O OE1 . GLU A 1 54  ? 7.007  14.219  27.645 1.00 115.14 ? 1499 GLU A OE1 1 
ATOM   416  O OE2 . GLU A 1 54  ? 6.846  12.035  27.342 1.00 81.23  ? 1499 GLU A OE2 1 
ATOM   417  N N   . LEU A 1 55  ? 11.028 15.730  31.354 1.00 61.60  ? 1500 LEU A N   1 
ATOM   418  C CA  . LEU A 1 55  ? 11.855 16.886  31.739 1.00 65.16  ? 1500 LEU A CA  1 
ATOM   419  C C   . LEU A 1 55  ? 13.008 16.563  32.731 1.00 47.84  ? 1500 LEU A C   1 
ATOM   420  O O   . LEU A 1 55  ? 14.051 17.220  32.724 1.00 47.33  ? 1500 LEU A O   1 
ATOM   421  C CB  . LEU A 1 55  ? 10.941 17.979  32.319 1.00 62.43  ? 1500 LEU A CB  1 
ATOM   422  C CG  . LEU A 1 55  ? 11.597 19.300  32.733 1.00 61.39  ? 1500 LEU A CG  1 
ATOM   423  C CD1 . LEU A 1 55  ? 11.855 20.148  31.503 1.00 60.03  ? 1500 LEU A CD1 1 
ATOM   424  C CD2 . LEU A 1 55  ? 10.760 20.045  33.766 1.00 69.20  ? 1500 LEU A CD2 1 
ATOM   425  N N   . ILE A 1 56  ? 12.830 15.576  33.607 1.00 48.85  ? 1501 ILE A N   1 
ATOM   426  C CA  . ILE A 1 56  ? 13.827 15.307  34.659 1.00 37.27  ? 1501 ILE A CA  1 
ATOM   427  C C   . ILE A 1 56  ? 14.627 14.025  34.341 1.00 39.61  ? 1501 ILE A C   1 
ATOM   428  O O   . ILE A 1 56  ? 14.144 12.885  34.522 1.00 43.46  ? 1501 ILE A O   1 
ATOM   429  C CB  . ILE A 1 56  ? 13.168 15.176  36.069 1.00 45.30  ? 1501 ILE A CB  1 
ATOM   430  C CG1 . ILE A 1 56  ? 12.333 16.434  36.421 1.00 30.72  ? 1501 ILE A CG1 1 
ATOM   431  C CG2 . ILE A 1 56  ? 14.223 14.902  37.142 1.00 44.18  ? 1501 ILE A CG2 1 
ATOM   432  C CD1 . ILE A 1 56  ? 13.082 17.761  36.439 1.00 37.62  ? 1501 ILE A CD1 1 
ATOM   433  N N   . ARG A 1 57  ? 15.882 14.221  33.945 1.00 48.82  ? 1502 ARG A N   1 
ATOM   434  C CA  . ARG A 1 57  ? 16.710 13.128  33.452 1.00 67.81  ? 1502 ARG A CA  1 
ATOM   435  C C   . ARG A 1 57  ? 17.343 12.267  34.539 1.00 78.50  ? 1502 ARG A C   1 
ATOM   436  O O   . ARG A 1 57  ? 17.624 11.082  34.304 1.00 56.86  ? 1502 ARG A O   1 
ATOM   437  C CB  . ARG A 1 57  ? 17.773 13.683  32.508 1.00 74.67  ? 1502 ARG A CB  1 
ATOM   438  C CG  . ARG A 1 57  ? 17.173 14.090  31.175 1.00 106.81 ? 1502 ARG A CG  1 
ATOM   439  C CD  . ARG A 1 57  ? 17.568 13.127  30.058 1.00 139.98 ? 1502 ARG A CD  1 
ATOM   440  N NE  . ARG A 1 57  ? 18.977 13.332  29.751 1.00 113.09 ? 1502 ARG A NE  1 
ATOM   441  C CZ  . ARG A 1 57  ? 19.457 14.356  29.044 1.00 117.86 ? 1502 ARG A CZ  1 
ATOM   442  N NH1 . ARG A 1 57  ? 18.646 15.271  28.506 1.00 106.59 ? 1502 ARG A NH1 1 
ATOM   443  N NH2 . ARG A 1 57  ? 20.765 14.463  28.867 1.00 124.12 ? 1502 ARG A NH2 1 
ATOM   444  N N   . LYS A 1 58  ? 17.548 12.840  35.728 1.00 45.27  ? 1503 LYS A N   1 
ATOM   445  C CA  . LYS A 1 58  ? 18.175 12.117  36.832 1.00 42.89  ? 1503 LYS A CA  1 
ATOM   446  C C   . LYS A 1 58  ? 17.251 12.291  38.035 1.00 58.41  ? 1503 LYS A C   1 
ATOM   447  O O   . LYS A 1 58  ? 17.514 13.114  38.884 1.00 43.27  ? 1503 LYS A O   1 
ATOM   448  C CB  . LYS A 1 58  ? 19.571 12.661  37.124 1.00 57.71  ? 1503 LYS A CB  1 
ATOM   449  C CG  . LYS A 1 58  ? 20.595 12.350  36.030 1.00 68.88  ? 1503 LYS A CG  1 
ATOM   450  C CD  . LYS A 1 58  ? 20.951 10.865  35.992 1.00 85.24  ? 1503 LYS A CD  1 
ATOM   451  C CE  . LYS A 1 58  ? 21.963 10.539  34.896 1.00 96.56  ? 1503 LYS A CE  1 
ATOM   452  N NZ  . LYS A 1 58  ? 23.362 10.861  35.296 1.00 82.31  ? 1503 LYS A NZ  1 
ATOM   453  N N   . PRO A 1 59  ? 16.152 11.518  38.075 1.00 54.63  ? 1504 PRO A N   1 
ATOM   454  C CA  . PRO A 1 59  ? 15.216 11.660  39.163 1.00 52.77  ? 1504 PRO A CA  1 
ATOM   455  C C   . PRO A 1 59  ? 15.772 11.041  40.428 1.00 41.48  ? 1504 PRO A C   1 
ATOM   456  O O   . PRO A 1 59  ? 16.580 10.102  40.374 1.00 44.82  ? 1504 PRO A O   1 
ATOM   457  C CB  . PRO A 1 59  ? 13.989 10.874  38.682 1.00 53.14  ? 1504 PRO A CB  1 
ATOM   458  C CG  . PRO A 1 59  ? 14.132 10.776  37.197 1.00 63.08  ? 1504 PRO A CG  1 
ATOM   459  C CD  . PRO A 1 59  ? 15.611 10.640  37.010 1.00 56.61  ? 1504 PRO A CD  1 
ATOM   460  N N   . VAL A 1 60  ? 15.336 11.568  41.563 1.00 35.84  ? 1505 VAL A N   1 
ATOM   461  C CA  . VAL A 1 60  ? 15.787 11.062  42.858 1.00 35.60  ? 1505 VAL A CA  1 
ATOM   462  C C   . VAL A 1 60  ? 14.700 11.343  43.917 1.00 30.04  ? 1505 VAL A C   1 
ATOM   463  O O   . VAL A 1 60  ? 14.103 12.431  43.960 1.00 33.85  ? 1505 VAL A O   1 
ATOM   464  C CB  . VAL A 1 60  ? 17.214 11.556  43.250 1.00 50.83  ? 1505 VAL A CB  1 
ATOM   465  C CG1 . VAL A 1 60  ? 17.437 13.003  42.886 1.00 33.91  ? 1505 VAL A CG1 1 
ATOM   466  C CG2 . VAL A 1 60  ? 17.474 11.372  44.743 1.00 46.45  ? 1505 VAL A CG2 1 
ATOM   467  N N   . ASP A 1 61  ? 14.427 10.320  44.731 1.00 36.18  ? 1506 ASP A N   1 
ATOM   468  C CA  . ASP A 1 61  ? 13.547 10.463  45.931 1.00 34.16  ? 1506 ASP A CA  1 
ATOM   469  C C   . ASP A 1 61  ? 14.383 10.034  47.122 1.00 29.76  ? 1506 ASP A C   1 
ATOM   470  O O   . ASP A 1 61  ? 15.573 9.531   46.944 1.00 32.63  ? 1506 ASP A O   1 
ATOM   471  C CB  . ASP A 1 61  ? 12.214 9.665   45.848 1.00 30.85  ? 1506 ASP A CB  1 
ATOM   472  C CG  . ASP A 1 61  ? 12.350 8.269   45.308 1.00 39.59  ? 1506 ASP A CG  1 
ATOM   473  O OD1 . ASP A 1 61  ? 13.339 7.545   45.602 1.00 38.23  ? 1506 ASP A OD1 1 
ATOM   474  O OD2 . ASP A 1 61  ? 11.409 7.883   44.570 1.00 37.54  ? 1506 ASP A OD2 1 
ATOM   475  N N   . PHE A 1 62  ? 13.835 10.266  48.305 1.00 30.13  ? 1507 PHE A N   1 
ATOM   476  C CA  . PHE A 1 62  ? 14.496 9.772   49.530 1.00 35.58  ? 1507 PHE A CA  1 
ATOM   477  C C   . PHE A 1 62  ? 14.577 8.217   49.637 1.00 30.32  ? 1507 PHE A C   1 
ATOM   478  O O   . PHE A 1 62  ? 15.552 7.702   50.225 1.00 27.75  ? 1507 PHE A O   1 
ATOM   479  C CB  . PHE A 1 62  ? 13.896 10.378  50.772 1.00 29.58  ? 1507 PHE A CB  1 
ATOM   480  C CG  . PHE A 1 62  ? 14.252 11.848  50.978 1.00 23.99  ? 1507 PHE A CG  1 
ATOM   481  C CD1 . PHE A 1 62  ? 15.499 12.220  51.386 1.00 27.79  ? 1507 PHE A CD1 1 
ATOM   482  C CD2 . PHE A 1 62  ? 13.282 12.832  50.776 1.00 24.09  ? 1507 PHE A CD2 1 
ATOM   483  C CE1 . PHE A 1 62  ? 15.821 13.559  51.578 1.00 26.94  ? 1507 PHE A CE1 1 
ATOM   484  C CE2 . PHE A 1 62  ? 13.577 14.202  51.020 1.00 24.61  ? 1507 PHE A CE2 1 
ATOM   485  C CZ  . PHE A 1 62  ? 14.874 14.543  51.377 1.00 27.36  ? 1507 PHE A CZ  1 
ATOM   486  N N   . LYS A 1 63  ? 13.673 7.462   49.000 1.00 35.96  ? 1508 LYS A N   1 
ATOM   487  C CA  . LYS A 1 63  ? 13.860 5.974   48.916 1.00 31.48  ? 1508 LYS A CA  1 
ATOM   488  C C   . LYS A 1 63  ? 15.161 5.586   48.228 1.00 30.39  ? 1508 LYS A C   1 
ATOM   489  O O   . LYS A 1 63  ? 15.837 4.677   48.699 1.00 39.84  ? 1508 LYS A O   1 
ATOM   490  C CB  . LYS A 1 63  ? 12.725 5.201   48.180 1.00 43.33  ? 1508 LYS A CB  1 
ATOM   491  C CG  . LYS A 1 63  ? 11.461 4.914   49.000 1.00 50.09  ? 1508 LYS A CG  1 
ATOM   492  C CD  . LYS A 1 63  ? 10.262 4.551   48.113 1.00 85.97  ? 1508 LYS A CD  1 
ATOM   493  C CE  . LYS A 1 63  ? 10.233 3.082   47.679 1.00 74.73  ? 1508 LYS A CE  1 
ATOM   494  N NZ  . LYS A 1 63  ? 8.973  2.719   46.958 1.00 70.85  ? 1508 LYS A NZ  1 
ATOM   495  N N   . LYS A 1 64  ? 15.475 6.234   47.107 1.00 29.89  ? 1509 LYS A N   1 
ATOM   496  C CA  . LYS A 1 64  ? 16.715 5.979   46.398 1.00 39.56  ? 1509 LYS A CA  1 
ATOM   497  C C   . LYS A 1 64  ? 17.923 6.470   47.142 1.00 35.95  ? 1509 LYS A C   1 
ATOM   498  O O   . LYS A 1 64  ? 18.979 5.824   47.087 1.00 41.87  ? 1509 LYS A O   1 
ATOM   499  C CB  . LYS A 1 64  ? 16.740 6.579   45.000 1.00 36.86  ? 1509 LYS A CB  1 
ATOM   500  C CG  . LYS A 1 64  ? 15.766 5.913   44.029 1.00 61.25  ? 1509 LYS A CG  1 
ATOM   501  C CD  . LYS A 1 64  ? 15.705 6.644   42.687 1.00 96.55  ? 1509 LYS A CD  1 
ATOM   502  C CE  . LYS A 1 64  ? 14.437 6.329   41.887 1.00 104.40 ? 1509 LYS A CE  1 
ATOM   503  N NZ  . LYS A 1 64  ? 13.345 7.351   42.005 1.00 65.90  ? 1509 LYS A NZ  1 
ATOM   504  N N   . ILE A 1 65  ? 17.787 7.606   47.814 1.00 34.81  ? 1510 ILE A N   1 
ATOM   505  C CA  . ILE A 1 65  ? 18.928 8.152   48.539 1.00 33.84  ? 1510 ILE A CA  1 
ATOM   506  C C   . ILE A 1 65  ? 19.250 7.110   49.617 1.00 28.76  ? 1510 ILE A C   1 
ATOM   507  O O   . ILE A 1 65  ? 20.413 6.740   49.816 1.00 27.50  ? 1510 ILE A O   1 
ATOM   508  C CB  . ILE A 1 65  ? 18.682 9.579   49.084 1.00 27.47  ? 1510 ILE A CB  1 
ATOM   509  C CG1 . ILE A 1 65  ? 18.660 10.631  47.923 1.00 32.03  ? 1510 ILE A CG1 1 
ATOM   510  C CG2 . ILE A 1 65  ? 19.728 9.986   50.130 1.00 31.18  ? 1510 ILE A CG2 1 
ATOM   511  C CD1 . ILE A 1 65  ? 18.120 12.035  48.313 1.00 28.68  ? 1510 ILE A CD1 1 
ATOM   512  N N   . LYS A 1 66  ? 18.219 6.638   50.322 1.00 27.59  ? 1511 LYS A N   1 
ATOM   513  C CA  . LYS A 1 66  ? 18.410 5.620   51.363 1.00 37.58  ? 1511 LYS A CA  1 
ATOM   514  C C   . LYS A 1 66  ? 19.054 4.348   50.802 1.00 45.66  ? 1511 LYS A C   1 
ATOM   515  O O   . LYS A 1 66  ? 20.057 3.858   51.349 1.00 35.41  ? 1511 LYS A O   1 
ATOM   516  C CB  . LYS A 1 66  ? 17.078 5.376   52.126 1.00 34.91  ? 1511 LYS A CB  1 
ATOM   517  C CG  . LYS A 1 66  ? 16.813 6.408   53.214 1.00 39.30  ? 1511 LYS A CG  1 
ATOM   518  C CD  . LYS A 1 66  ? 15.691 5.961   54.148 1.00 48.48  ? 1511 LYS A CD  1 
ATOM   519  C CE  . LYS A 1 66  ? 15.063 7.134   54.890 1.00 69.14  ? 1511 LYS A CE  1 
ATOM   520  N NZ  . LYS A 1 66  ? 13.982 6.695   55.825 1.00 51.83  ? 1511 LYS A NZ  1 
ATOM   521  N N   . GLU A 1 67  ? 18.566 3.888   49.652 1.00 41.78  ? 1512 GLU A N   1 
ATOM   522  C CA  . GLU A 1 67  ? 19.190 2.768   48.955 1.00 41.76  ? 1512 GLU A CA  1 
ATOM   523  C C   . GLU A 1 67  ? 20.656 3.042   48.647 1.00 41.57  ? 1512 GLU A C   1 
ATOM   524  O O   . GLU A 1 67  ? 21.495 2.156   48.768 1.00 41.75  ? 1512 GLU A O   1 
ATOM   525  C CB  . GLU A 1 67  ? 18.503 2.510   47.618 1.00 40.79  ? 1512 GLU A CB  1 
ATOM   526  C CG  . GLU A 1 67  ? 19.005 1.292   46.866 1.00 51.05  ? 1512 GLU A CG  1 
ATOM   527  C CD  . GLU A 1 67  ? 18.936 1.467   45.358 1.00 70.00  ? 1512 GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 67  ? 17.824 1.324   44.806 1.00 68.04  ? 1512 GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 67  ? 19.996 1.733   44.727 1.00 82.49  ? 1512 GLU A OE2 1 
ATOM   530  N N   . ARG A 1 68  ? 20.955 4.260   48.202 1.00 41.24  ? 1513 ARG A N   1 
ATOM   531  C CA  . ARG A 1 68  ? 22.319 4.553   47.818 1.00 35.83  ? 1513 ARG A CA  1 
ATOM   532  C C   . ARG A 1 68  ? 23.269 4.592   49.010 1.00 32.69  ? 1513 ARG A C   1 
ATOM   533  O O   . ARG A 1 68  ? 24.453 4.229   48.869 1.00 30.06  ? 1513 ARG A O   1 
ATOM   534  C CB  . ARG A 1 68  ? 22.388 5.824   46.977 1.00 36.40  ? 1513 ARG A CB  1 
ATOM   535  C CG  . ARG A 1 68  ? 21.917 5.580   45.567 1.00 39.06  ? 1513 ARG A CG  1 
ATOM   536  C CD  . ARG A 1 68  ? 21.921 6.830   44.724 1.00 40.95  ? 1513 ARG A CD  1 
ATOM   537  N NE  . ARG A 1 68  ? 21.370 6.503   43.407 1.00 39.37  ? 1513 ARG A NE  1 
ATOM   538  C CZ  . ARG A 1 68  ? 20.632 7.317   42.640 1.00 36.15  ? 1513 ARG A CZ  1 
ATOM   539  N NH1 . ARG A 1 68  ? 20.372 8.576   42.986 1.00 39.55  ? 1513 ARG A NH1 1 
ATOM   540  N NH2 . ARG A 1 68  ? 20.173 6.875   41.467 1.00 48.60  ? 1513 ARG A NH2 1 
ATOM   541  N N   . ILE A 1 69  ? 22.784 5.026   50.168 1.00 32.61  ? 1514 ILE A N   1 
ATOM   542  C CA  . ILE A 1 69  ? 23.535 4.917   51.437 1.00 30.59  ? 1514 ILE A CA  1 
ATOM   543  C C   . ILE A 1 69  ? 23.765 3.429   51.766 1.00 31.36  ? 1514 ILE A C   1 
ATOM   544  O O   . ILE A 1 69  ? 24.898 3.016   51.941 1.00 40.74  ? 1514 ILE A O   1 
ATOM   545  C CB  . ILE A 1 69  ? 22.847 5.615   52.643 1.00 25.24  ? 1514 ILE A CB  1 
ATOM   546  C CG1 . ILE A 1 69  ? 22.614 7.127   52.415 1.00 36.40  ? 1514 ILE A CG1 1 
ATOM   547  C CG2 . ILE A 1 69  ? 23.668 5.405   53.932 1.00 29.24  ? 1514 ILE A CG2 1 
ATOM   548  C CD1 . ILE A 1 69  ? 21.650 7.742   53.424 1.00 31.86  ? 1514 ILE A CD1 1 
ATOM   549  N N   . ARG A 1 70  ? 22.716 2.605   51.725 1.00 43.91  ? 1515 ARG A N   1 
ATOM   550  C CA  . ARG A 1 70  ? 22.868 1.190   52.132 1.00 50.82  ? 1515 ARG A CA  1 
ATOM   551  C C   . ARG A 1 70  ? 23.803 0.440   51.202 1.00 50.48  ? 1515 ARG A C   1 
ATOM   552  O O   . ARG A 1 70  ? 24.516 -0.470  51.626 1.00 42.88  ? 1515 ARG A O   1 
ATOM   553  C CB  . ARG A 1 70  ? 21.530 0.457   52.202 1.00 53.11  ? 1515 ARG A CB  1 
ATOM   554  C CG  . ARG A 1 70  ? 20.621 0.931   53.337 1.00 64.66  ? 1515 ARG A CG  1 
ATOM   555  C CD  . ARG A 1 70  ? 19.286 0.174   53.405 1.00 73.14  ? 1515 ARG A CD  1 
ATOM   556  N NE  . ARG A 1 70  ? 18.194 0.842   52.685 1.00 86.45  ? 1515 ARG A NE  1 
ATOM   557  C CZ  . ARG A 1 70  ? 17.768 0.565   51.443 1.00 78.19  ? 1515 ARG A CZ  1 
ATOM   558  N NH1 . ARG A 1 70  ? 18.319 -0.390  50.670 1.00 57.87  ? 1515 ARG A NH1 1 
ATOM   559  N NH2 . ARG A 1 70  ? 16.775 1.290   50.951 1.00 62.23  ? 1515 ARG A NH2 1 
ATOM   560  N N   . ASN A 1 71  ? 23.853 0.858   49.948 1.00 38.64  ? 1516 ASN A N   1 
ATOM   561  C CA  . ASN A 1 71  ? 24.688 0.156   48.958 1.00 41.66  ? 1516 ASN A CA  1 
ATOM   562  C C   . ASN A 1 71  ? 26.090 0.694   48.822 1.00 35.78  ? 1516 ASN A C   1 
ATOM   563  O O   . ASN A 1 71  ? 26.907 0.174   47.985 1.00 44.66  ? 1516 ASN A O   1 
ATOM   564  C CB  . ASN A 1 71  ? 23.979 0.120   47.580 1.00 50.77  ? 1516 ASN A CB  1 
ATOM   565  C CG  . ASN A 1 71  ? 22.756 -0.793  47.573 1.00 47.45  ? 1516 ASN A CG  1 
ATOM   566  O OD1 . ASN A 1 71  ? 21.714 -0.467  47.005 1.00 58.85  ? 1516 ASN A OD1 1 
ATOM   567  N ND2 . ASN A 1 71  ? 22.876 -1.951  48.237 1.00 67.26  ? 1516 ASN A ND2 1 
ATOM   568  N N   . HIS A 1 72  ? 26.405 1.697   49.642 1.00 32.94  ? 1517 HIS A N   1 
ATOM   569  C CA  . HIS A 1 72  ? 27.709 2.354   49.651 1.00 37.76  ? 1517 HIS A CA  1 
ATOM   570  C C   . HIS A 1 72  ? 28.016 3.075   48.368 1.00 41.50  ? 1517 HIS A C   1 
ATOM   571  O O   . HIS A 1 72  ? 29.189 3.239   48.011 1.00 33.36  ? 1517 HIS A O   1 
ATOM   572  C CB  . HIS A 1 72  ? 28.849 1.321   49.990 1.00 36.30  ? 1517 HIS A CB  1 
ATOM   573  C CG  . HIS A 1 72  ? 28.483 0.378   51.107 1.00 35.47  ? 1517 HIS A CG  1 
ATOM   574  N ND1 . HIS A 1 72  ? 28.372 0.778   52.417 1.00 38.10  ? 1517 HIS A ND1 1 
ATOM   575  C CD2 . HIS A 1 72  ? 28.107 -0.958  51.074 1.00 43.70  ? 1517 HIS A CD2 1 
ATOM   576  C CE1 . HIS A 1 72  ? 27.999 -0.275  53.153 1.00 34.62  ? 1517 HIS A CE1 1 
ATOM   577  N NE2 . HIS A 1 72  ? 27.818 -1.319  52.334 1.00 38.94  ? 1517 HIS A NE2 1 
ATOM   578  N N   . LYS A 1 73  ? 26.975 3.519   47.661 1.00 34.12  ? 1518 LYS A N   1 
ATOM   579  C CA  . LYS A 1 73  ? 27.169 4.206   46.393 1.00 38.15  ? 1518 LYS A CA  1 
ATOM   580  C C   . LYS A 1 73  ? 27.797 5.545   46.702 1.00 40.02  ? 1518 LYS A C   1 
ATOM   581  O O   . LYS A 1 73  ? 28.700 5.971   45.988 1.00 33.50  ? 1518 LYS A O   1 
ATOM   582  C CB  . LYS A 1 73  ? 25.861 4.401   45.626 1.00 41.42  ? 1518 LYS A CB  1 
ATOM   583  C CG  . LYS A 1 73  ? 24.991 3.152   45.484 1.00 78.51  ? 1518 LYS A CG  1 
ATOM   584  C CD  . LYS A 1 73  ? 24.972 2.551   44.078 1.00 83.13  ? 1518 LYS A CD  1 
ATOM   585  C CE  . LYS A 1 73  ? 23.955 1.419   43.989 1.00 98.74  ? 1518 LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 73  ? 22.664 1.752   44.677 1.00 77.59  ? 1518 LYS A NZ  1 
ATOM   587  N N   . TYR A 1 74  ? 27.343 6.183   47.790 1.00 37.43  ? 1519 TYR A N   1 
ATOM   588  C CA  . TYR A 1 74  ? 27.977 7.416   48.264 1.00 35.21  ? 1519 TYR A CA  1 
ATOM   589  C C   . TYR A 1 74  ? 29.297 7.105   49.019 1.00 28.91  ? 1519 TYR A C   1 
ATOM   590  O O   . TYR A 1 74  ? 29.273 6.305   49.898 1.00 34.38  ? 1519 TYR A O   1 
ATOM   591  C CB  . TYR A 1 74  ? 27.043 8.232   49.178 1.00 32.58  ? 1519 TYR A CB  1 
ATOM   592  C CG  . TYR A 1 74  ? 25.662 8.534   48.609 1.00 29.86  ? 1519 TYR A CG  1 
ATOM   593  C CD1 . TYR A 1 74  ? 25.493 9.130   47.346 1.00 27.47  ? 1519 TYR A CD1 1 
ATOM   594  C CD2 . TYR A 1 74  ? 24.528 8.299   49.375 1.00 30.84  ? 1519 TYR A CD2 1 
ATOM   595  C CE1 . TYR A 1 74  ? 24.236 9.361   46.829 1.00 30.47  ? 1519 TYR A CE1 1 
ATOM   596  C CE2 . TYR A 1 74  ? 23.288 8.579   48.891 1.00 29.81  ? 1519 TYR A CE2 1 
ATOM   597  C CZ  . TYR A 1 74  ? 23.132 9.134   47.621 1.00 23.71  ? 1519 TYR A CZ  1 
ATOM   598  O OH  . TYR A 1 74  ? 21.800 9.405   47.207 1.00 26.57  ? 1519 TYR A OH  1 
ATOM   599  N N   . ARG A 1 75  ? 30.385 7.782   48.671 1.00 32.35  ? 1520 ARG A N   1 
ATOM   600  C CA  . ARG A 1 75  ? 31.744 7.549   49.278 1.00 42.03  ? 1520 ARG A CA  1 
ATOM   601  C C   . ARG A 1 75  ? 32.103 8.681   50.216 1.00 33.26  ? 1520 ARG A C   1 
ATOM   602  O O   . ARG A 1 75  ? 33.139 8.651   50.894 1.00 39.23  ? 1520 ARG A O   1 
ATOM   603  C CB  . ARG A 1 75  ? 32.835 7.377   48.200 1.00 34.36  ? 1520 ARG A CB  1 
ATOM   604  C CG  . ARG A 1 75  ? 32.435 6.435   47.088 1.00 38.27  ? 1520 ARG A CG  1 
ATOM   605  C CD  . ARG A 1 75  ? 31.919 5.133   47.682 1.00 35.46  ? 1520 ARG A CD  1 
ATOM   606  N NE  . ARG A 1 75  ? 32.979 4.440   48.410 1.00 33.12  ? 1520 ARG A NE  1 
ATOM   607  C CZ  . ARG A 1 75  ? 32.881 3.197   48.919 1.00 39.22  ? 1520 ARG A CZ  1 
ATOM   608  N NH1 . ARG A 1 75  ? 31.743 2.473   48.861 1.00 38.29  ? 1520 ARG A NH1 1 
ATOM   609  N NH2 . ARG A 1 75  ? 33.927 2.680   49.521 1.00 49.35  ? 1520 ARG A NH2 1 
ATOM   610  N N   . SER A 1 76  ? 31.220 9.663   50.319 1.00 37.41  ? 1521 SER A N   1 
ATOM   611  C CA  . SER A 1 76  ? 31.466 10.823  51.127 1.00 33.39  ? 1521 SER A CA  1 
ATOM   612  C C   . SER A 1 76  ? 30.091 11.482  51.435 1.00 35.83  ? 1521 SER A C   1 
ATOM   613  O O   . SER A 1 76  ? 29.044 11.133  50.853 1.00 30.88  ? 1521 SER A O   1 
ATOM   614  C CB  . SER A 1 76  ? 32.395 11.815  50.418 1.00 34.95  ? 1521 SER A CB  1 
ATOM   615  O OG  . SER A 1 76  ? 31.820 12.331  49.193 1.00 30.00  ? 1521 SER A OG  1 
ATOM   616  N N   . LEU A 1 77  ? 30.119 12.416  52.374 1.00 32.24  ? 1522 LEU A N   1 
ATOM   617  C CA  . LEU A 1 77  ? 28.994 13.307  52.587 1.00 31.21  ? 1522 LEU A CA  1 
ATOM   618  C C   . LEU A 1 77  ? 28.767 14.235  51.412 1.00 33.96  ? 1522 LEU A C   1 
ATOM   619  O O   . LEU A 1 77  ? 27.583 14.532  51.114 1.00 32.78  ? 1522 LEU A O   1 
ATOM   620  C CB  . LEU A 1 77  ? 29.107 14.067  53.905 1.00 30.76  ? 1522 LEU A CB  1 
ATOM   621  C CG  . LEU A 1 77  ? 29.149 13.161  55.186 1.00 30.41  ? 1522 LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 77  ? 29.145 14.088  56.423 1.00 33.76  ? 1522 LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 77  ? 28.023 12.169  55.393 1.00 27.48  ? 1522 LEU A CD2 1 
ATOM   624  N N   . ASN A 1 78  ? 29.821 14.678  50.724 1.00 28.35  ? 1523 ASN A N   1 
ATOM   625  C CA  . ASN A 1 78  ? 29.656 15.449  49.484 1.00 27.69  ? 1523 ASN A CA  1 
ATOM   626  C C   . ASN A 1 78  ? 28.784 14.680  48.526 1.00 33.10  ? 1523 ASN A C   1 
ATOM   627  O O   . ASN A 1 78  ? 27.921 15.300  47.908 1.00 27.77  ? 1523 ASN A O   1 
ATOM   628  C CB  . ASN A 1 78  ? 31.003 15.915  48.811 1.00 34.19  ? 1523 ASN A CB  1 
ATOM   629  C CG  . ASN A 1 78  ? 30.795 17.017  47.734 1.00 39.26  ? 1523 ASN A CG  1 
ATOM   630  O OD1 . ASN A 1 78  ? 30.221 18.083  48.036 1.00 47.03  ? 1523 ASN A OD1 1 
ATOM   631  N ND2 . ASN A 1 78  ? 31.331 16.806  46.509 1.00 39.27  ? 1523 ASN A ND2 1 
ATOM   632  N N   . ASP A 1 79  ? 29.006 13.360  48.389 1.00 31.65  ? 1524 ASP A N   1 
ATOM   633  C CA  . ASP A 1 79  ? 28.243 12.531  47.434 1.00 33.31  ? 1524 ASP A CA  1 
ATOM   634  C C   . ASP A 1 79  ? 26.723 12.467  47.815 1.00 25.57  ? 1524 ASP A C   1 
ATOM   635  O O   . ASP A 1 79  ? 25.801 12.584  46.963 1.00 27.40  ? 1524 ASP A O   1 
ATOM   636  C CB  . ASP A 1 79  ? 28.810 11.114  47.362 1.00 32.07  ? 1524 ASP A CB  1 
ATOM   637  C CG  . ASP A 1 79  ? 30.164 11.037  46.659 1.00 35.59  ? 1524 ASP A CG  1 
ATOM   638  O OD1 . ASP A 1 79  ? 30.548 11.933  45.875 1.00 33.28  ? 1524 ASP A OD1 1 
ATOM   639  O OD2 . ASP A 1 79  ? 30.826 10.030  46.861 1.00 41.79  ? 1524 ASP A OD2 1 
ATOM   640  N N   . LEU A 1 80  ? 26.469 12.311  49.098 1.00 28.12  ? 1525 LEU A N   1 
ATOM   641  C CA  . LEU A 1 80  ? 25.086 12.374  49.614 1.00 22.59  ? 1525 LEU A CA  1 
ATOM   642  C C   . LEU A 1 80  ? 24.467 13.761  49.399 1.00 24.80  ? 1525 LEU A C   1 
ATOM   643  O O   . LEU A 1 80  ? 23.350 13.844  48.912 1.00 26.58  ? 1525 LEU A O   1 
ATOM   644  C CB  . LEU A 1 80  ? 25.070 12.059  51.116 1.00 28.18  ? 1525 LEU A CB  1 
ATOM   645  C CG  . LEU A 1 80  ? 23.803 12.327  51.941 1.00 25.62  ? 1525 LEU A CG  1 
ATOM   646  C CD1 . LEU A 1 80  ? 22.672 11.554  51.317 1.00 24.34  ? 1525 LEU A CD1 1 
ATOM   647  C CD2 . LEU A 1 80  ? 23.999 11.850  53.388 1.00 32.19  ? 1525 LEU A CD2 1 
ATOM   648  N N   . GLU A 1 81  ? 25.226 14.807  49.720 1.00 25.85  ? 1526 GLU A N   1 
ATOM   649  C CA  . GLU A 1 81  ? 24.716 16.146  49.611 1.00 27.26  ? 1526 GLU A CA  1 
ATOM   650  C C   . GLU A 1 81  ? 24.309 16.432  48.169 1.00 29.26  ? 1526 GLU A C   1 
ATOM   651  O O   . GLU A 1 81  ? 23.252 17.037  47.914 1.00 24.69  ? 1526 GLU A O   1 
ATOM   652  C CB  . GLU A 1 81  ? 25.732 17.147  50.065 1.00 35.84  ? 1526 GLU A CB  1 
ATOM   653  C CG  . GLU A 1 81  ? 25.230 18.555  49.885 1.00 32.17  ? 1526 GLU A CG  1 
ATOM   654  C CD  . GLU A 1 81  ? 25.933 19.625  50.721 1.00 31.35  ? 1526 GLU A CD  1 
ATOM   655  O OE1 . GLU A 1 81  ? 26.520 19.320  51.775 1.00 31.97  ? 1526 GLU A OE1 1 
ATOM   656  O OE2 . GLU A 1 81  ? 25.936 20.800  50.288 1.00 46.82  ? 1526 GLU A OE2 1 
ATOM   657  N N   . LYS A 1 82  ? 25.196 16.090  47.233 1.00 32.52  ? 1527 LYS A N   1 
ATOM   658  C CA  . LYS A 1 82  ? 24.935 16.277  45.807 1.00 22.95  ? 1527 LYS A CA  1 
ATOM   659  C C   . LYS A 1 82  ? 23.580 15.693  45.411 1.00 28.53  ? 1527 LYS A C   1 
ATOM   660  O O   . LYS A 1 82  ? 22.858 16.320  44.686 1.00 25.79  ? 1527 LYS A O   1 
ATOM   661  C CB  . LYS A 1 82  ? 26.050 15.750  44.914 1.00 29.99  ? 1527 LYS A CB  1 
ATOM   662  C CG  . LYS A 1 82  ? 27.140 16.786  44.684 1.00 40.14  ? 1527 LYS A CG  1 
ATOM   663  C CD  . LYS A 1 82  ? 28.426 16.185  44.091 1.00 58.21  ? 1527 LYS A CD  1 
ATOM   664  C CE  . LYS A 1 82  ? 28.253 15.602  42.700 1.00 66.64  ? 1527 LYS A CE  1 
ATOM   665  N NZ  . LYS A 1 82  ? 29.581 15.394  42.013 1.00 48.38  ? 1527 LYS A NZ  1 
ATOM   666  N N   . ASP A 1 83  ? 23.254 14.497  45.885 1.00 23.18  ? 1528 ASP A N   1 
ATOM   667  C CA  . ASP A 1 83  ? 22.000 13.867  45.541 1.00 26.68  ? 1528 ASP A CA  1 
ATOM   668  C C   . ASP A 1 83  ? 20.749 14.483  46.217 1.00 26.69  ? 1528 ASP A C   1 
ATOM   669  O O   . ASP A 1 83  ? 19.682 14.559  45.588 1.00 23.68  ? 1528 ASP A O   1 
ATOM   670  C CB  . ASP A 1 83  ? 22.080 12.398  45.821 1.00 26.64  ? 1528 ASP A CB  1 
ATOM   671  C CG  . ASP A 1 83  ? 21.901 11.547  44.546 1.00 42.06  ? 1528 ASP A CG  1 
ATOM   672  O OD1 . ASP A 1 83  ? 22.036 12.056  43.423 1.00 33.67  ? 1528 ASP A OD1 1 
ATOM   673  O OD2 . ASP A 1 83  ? 21.598 10.351  44.679 1.00 33.90  ? 1528 ASP A OD2 1 
ATOM   674  N N   . VAL A 1 84  ? 20.898 14.962  47.435 1.00 27.52  ? 1529 VAL A N   1 
ATOM   675  C CA  . VAL A 1 84  ? 19.794 15.682  48.117 1.00 22.54  ? 1529 VAL A CA  1 
ATOM   676  C C   . VAL A 1 84  ? 19.598 17.054  47.364 1.00 29.82  ? 1529 VAL A C   1 
ATOM   677  O O   . VAL A 1 84  ? 18.450 17.511  47.104 1.00 24.17  ? 1529 VAL A O   1 
ATOM   678  C CB  . VAL A 1 84  ? 20.104 15.917  49.606 1.00 19.94  ? 1529 VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 84  ? 19.139 16.975  50.190 1.00 19.90  ? 1529 VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 84  ? 20.123 14.623  50.398 1.00 18.12  ? 1529 VAL A CG2 1 
ATOM   681  N N   . MET A 1 85  ? 20.706 17.711  46.971 1.00 26.76  ? 1530 MET A N   1 
ATOM   682  C CA  . MET A 1 85  ? 20.589 18.961  46.247 1.00 28.83  ? 1530 MET A CA  1 
ATOM   683  C C   . MET A 1 85  ? 19.938 18.790  44.864 1.00 29.17  ? 1530 MET A C   1 
ATOM   684  O O   . MET A 1 85  ? 19.218 19.682  44.415 1.00 30.45  ? 1530 MET A O   1 
ATOM   685  C CB  . MET A 1 85  ? 21.906 19.738  46.183 1.00 33.18  ? 1530 MET A CB  1 
ATOM   686  C CG  . MET A 1 85  ? 22.417 20.247  47.544 1.00 43.33  ? 1530 MET A CG  1 
ATOM   687  S SD  . MET A 1 85  ? 21.271 21.265  48.505 1.00 38.60  ? 1530 MET A SD  1 
ATOM   688  C CE  . MET A 1 85  ? 21.965 21.236  50.168 1.00 29.36  ? 1530 MET A CE  1 
ATOM   689  N N   . LEU A 1 86  ? 20.181 17.628  44.239 1.00 26.70  ? 1531 LEU A N   1 
ATOM   690  C CA  . LEU A 1 86  ? 19.565 17.210  42.979 1.00 27.56  ? 1531 LEU A CA  1 
ATOM   691  C C   . LEU A 1 86  ? 18.060 16.948  43.144 1.00 27.00  ? 1531 LEU A C   1 
ATOM   692  O O   . LEU A 1 86  ? 17.233 17.415  42.316 1.00 30.77  ? 1531 LEU A O   1 
ATOM   693  C CB  . LEU A 1 86  ? 20.271 15.984  42.419 1.00 28.47  ? 1531 LEU A CB  1 
ATOM   694  C CG  . LEU A 1 86  ? 19.739 15.471  41.074 1.00 35.51  ? 1531 LEU A CG  1 
ATOM   695  C CD1 . LEU A 1 86  ? 19.775 16.595  40.044 1.00 38.62  ? 1531 LEU A CD1 1 
ATOM   696  C CD2 . LEU A 1 86  ? 20.510 14.233  40.567 1.00 37.04  ? 1531 LEU A CD2 1 
ATOM   697  N N   . LEU A 1 87  ? 17.695 16.278  44.231 1.00 27.19  ? 1532 LEU A N   1 
ATOM   698  C CA  . LEU A 1 87  ? 16.321 16.079  44.598 1.00 26.39  ? 1532 LEU A CA  1 
ATOM   699  C C   . LEU A 1 87  ? 15.607 17.432  44.655 1.00 33.53  ? 1532 LEU A C   1 
ATOM   700  O O   . LEU A 1 87  ? 14.533 17.578  44.071 1.00 28.69  ? 1532 LEU A O   1 
ATOM   701  C CB  . LEU A 1 87  ? 16.203 15.286  45.912 1.00 23.76  ? 1532 LEU A CB  1 
ATOM   702  C CG  . LEU A 1 87  ? 14.870 14.824  46.476 1.00 25.80  ? 1532 LEU A CG  1 
ATOM   703  C CD1 . LEU A 1 87  ? 15.074 13.590  47.371 1.00 26.02  ? 1532 LEU A CD1 1 
ATOM   704  C CD2 . LEU A 1 87  ? 14.277 15.961  47.246 1.00 27.24  ? 1532 LEU A CD2 1 
ATOM   705  N N   . CYS A 1 88  ? 16.240 18.412  45.302 1.00 27.62  ? 1533 CYS A N   1 
ATOM   706  C CA  . CYS A 1 88  ? 15.652 19.723  45.480 1.00 27.40  ? 1533 CYS A CA  1 
ATOM   707  C C   . CYS A 1 88  ? 15.610 20.497  44.150 1.00 36.80  ? 1533 CYS A C   1 
ATOM   708  O O   . CYS A 1 88  ? 14.590 21.144  43.843 1.00 33.87  ? 1533 CYS A O   1 
ATOM   709  C CB  . CYS A 1 88  ? 16.390 20.479  46.581 1.00 33.70  ? 1533 CYS A CB  1 
ATOM   710  S SG  . CYS A 1 88  ? 16.097 19.761  48.231 1.00 29.09  ? 1533 CYS A SG  1 
ATOM   711  N N   . GLN A 1 89  ? 16.674 20.390  43.346 1.00 42.11  ? 1534 GLN A N   1 
ATOM   712  C CA  . GLN A 1 89  ? 16.755 21.030  42.030 1.00 31.76  ? 1534 GLN A CA  1 
ATOM   713  C C   . GLN A 1 89  ? 15.704 20.490  41.098 1.00 35.14  ? 1534 GLN A C   1 
ATOM   714  O O   . GLN A 1 89  ? 15.024 21.257  40.435 1.00 45.47  ? 1534 GLN A O   1 
ATOM   715  C CB  . GLN A 1 89  ? 18.136 20.849  41.354 1.00 35.92  ? 1534 GLN A CB  1 
ATOM   716  C CG  . GLN A 1 89  ? 18.197 21.551  40.000 1.00 58.48  ? 1534 GLN A CG  1 
ATOM   717  C CD  . GLN A 1 89  ? 19.547 21.415  39.316 1.00 58.17  ? 1534 GLN A CD  1 
ATOM   718  O OE1 . GLN A 1 89  ? 20.170 22.411  38.936 1.00 102.59 ? 1534 GLN A OE1 1 
ATOM   719  N NE2 . GLN A 1 89  ? 20.014 20.179  39.183 1.00 55.77  ? 1534 GLN A NE2 1 
ATOM   720  N N   . ASN A 1 90  ? 15.576 19.174  41.032 1.00 27.42  ? 1535 ASN A N   1 
ATOM   721  C CA  . ASN A 1 90  ? 14.480 18.538  40.280 1.00 29.40  ? 1535 ASN A CA  1 
ATOM   722  C C   . ASN A 1 90  ? 13.013 18.994  40.574 1.00 34.70  ? 1535 ASN A C   1 
ATOM   723  O O   . ASN A 1 90  ? 12.245 19.256  39.616 1.00 34.04  ? 1535 ASN A O   1 
ATOM   724  C CB  . ASN A 1 90  ? 14.574 17.042  40.475 1.00 33.68  ? 1535 ASN A CB  1 
ATOM   725  C CG  . ASN A 1 90  ? 15.764 16.435  39.750 1.00 43.14  ? 1535 ASN A CG  1 
ATOM   726  O OD1 . ASN A 1 90  ? 16.477 17.105  38.982 1.00 34.63  ? 1535 ASN A OD1 1 
ATOM   727  N ND2 . ASN A 1 90  ? 16.004 15.178  40.029 1.00 31.35  ? 1535 ASN A ND2 1 
ATOM   728  N N   . ALA A 1 91  ? 12.645 19.086  41.874 1.00 34.93  ? 1536 ALA A N   1 
ATOM   729  C CA  . ALA A 1 91  ? 11.496 19.848  42.386 1.00 37.21  ? 1536 ALA A CA  1 
ATOM   730  C C   . ALA A 1 91  ? 11.313 21.280  41.872 1.00 30.98  ? 1536 ALA A C   1 
ATOM   731  O O   . ALA A 1 91  ? 10.186 21.678  41.469 1.00 35.16  ? 1536 ALA A O   1 
ATOM   732  C CB  . ALA A 1 91  ? 11.530 19.893  43.904 1.00 31.06  ? 1536 ALA A CB  1 
ATOM   733  N N   . GLN A 1 92  ? 12.398 22.053  41.925 1.00 36.04  ? 1537 GLN A N   1 
ATOM   734  C CA  . GLN A 1 92  ? 12.406 23.403  41.457 1.00 33.94  ? 1537 GLN A CA  1 
ATOM   735  C C   . GLN A 1 92  ? 12.333 23.542  39.938 1.00 38.53  ? 1537 GLN A C   1 
ATOM   736  O O   . GLN A 1 92  ? 12.070 24.629  39.440 1.00 64.91  ? 1537 GLN A O   1 
ATOM   737  C CB  . GLN A 1 92  ? 13.636 24.147  41.981 1.00 35.19  ? 1537 GLN A CB  1 
ATOM   738  C CG  . GLN A 1 92  ? 13.545 24.526  43.473 1.00 47.70  ? 1537 GLN A CG  1 
ATOM   739  C CD  . GLN A 1 92  ? 14.904 24.521  44.174 1.00 49.88  ? 1537 GLN A CD  1 
ATOM   740  O OE1 . GLN A 1 92  ? 15.849 25.107  43.688 1.00 51.24  ? 1537 GLN A OE1 1 
ATOM   741  N NE2 . GLN A 1 92  ? 14.991 23.876  45.331 1.00 39.80  ? 1537 GLN A NE2 1 
ATOM   742  N N   . THR A 1 93  ? 12.606 22.461  39.220 1.00 50.15  ? 1538 THR A N   1 
ATOM   743  C CA  . THR A 1 93  ? 12.559 22.438  37.758 1.00 46.77  ? 1538 THR A CA  1 
ATOM   744  C C   . THR A 1 93  ? 11.166 22.038  37.293 1.00 44.68  ? 1538 THR A C   1 
ATOM   745  O O   . THR A 1 93  ? 10.566 22.682  36.395 1.00 43.18  ? 1538 THR A O   1 
ATOM   746  C CB  . THR A 1 93  ? 13.669 21.484  37.217 1.00 41.43  ? 1538 THR A CB  1 
ATOM   747  O OG1 . THR A 1 93  ? 14.975 22.047  37.481 1.00 44.78  ? 1538 THR A OG1 1 
ATOM   748  C CG2 . THR A 1 93  ? 13.497 21.125  35.695 1.00 46.97  ? 1538 THR A CG2 1 
ATOM   749  N N   . PHE A 1 94  ? 10.620 20.997  37.910 1.00 43.81  ? 1539 PHE A N   1 
ATOM   750  C CA  . PHE A 1 94  ? 9.295  20.473  37.544 1.00 44.78  ? 1539 PHE A CA  1 
ATOM   751  C C   . PHE A 1 94  ? 8.129  21.275  38.093 1.00 48.72  ? 1539 PHE A C   1 
ATOM   752  O O   . PHE A 1 94  ? 7.061  21.373  37.453 1.00 41.01  ? 1539 PHE A O   1 
ATOM   753  C CB  . PHE A 1 94  ? 9.191  19.031  38.026 1.00 44.18  ? 1539 PHE A CB  1 
ATOM   754  C CG  . PHE A 1 94  ? 7.950  18.353  37.578 1.00 40.30  ? 1539 PHE A CG  1 
ATOM   755  C CD1 . PHE A 1 94  ? 7.773  18.026  36.223 1.00 64.77  ? 1539 PHE A CD1 1 
ATOM   756  C CD2 . PHE A 1 94  ? 6.959  18.061  38.463 1.00 40.86  ? 1539 PHE A CD2 1 
ATOM   757  C CE1 . PHE A 1 94  ? 6.627  17.391  35.789 1.00 62.60  ? 1539 PHE A CE1 1 
ATOM   758  C CE2 . PHE A 1 94  ? 5.780  17.450  38.035 1.00 51.27  ? 1539 PHE A CE2 1 
ATOM   759  C CZ  . PHE A 1 94  ? 5.625  17.096  36.701 1.00 67.54  ? 1539 PHE A CZ  1 
ATOM   760  N N   . ASN A 1 95  ? 8.310  21.864  39.266 1.00 41.79  ? 1540 ASN A N   1 
ATOM   761  C CA  . ASN A 1 95  ? 7.290  22.742  39.833 1.00 49.02  ? 1540 ASN A CA  1 
ATOM   762  C C   . ASN A 1 95  ? 7.574  24.252  39.711 1.00 41.00  ? 1540 ASN A C   1 
ATOM   763  O O   . ASN A 1 95  ? 8.720  24.727  39.719 1.00 43.10  ? 1540 ASN A O   1 
ATOM   764  C CB  . ASN A 1 95  ? 6.998  22.379  41.276 1.00 40.77  ? 1540 ASN A CB  1 
ATOM   765  C CG  . ASN A 1 95  ? 6.797  20.901  41.450 1.00 58.89  ? 1540 ASN A CG  1 
ATOM   766  O OD1 . ASN A 1 95  ? 5.690  20.413  41.294 1.00 46.70  ? 1540 ASN A OD1 1 
ATOM   767  N ND2 . ASN A 1 95  ? 7.879  20.167  41.727 1.00 39.51  ? 1540 ASN A ND2 1 
ATOM   768  N N   . LEU A 1 96  ? 6.477  24.995  39.596 1.00 67.64  ? 1541 LEU A N   1 
ATOM   769  C CA  . LEU A 1 96  ? 6.533  26.429  39.397 1.00 62.95  ? 1541 LEU A CA  1 
ATOM   770  C C   . LEU A 1 96  ? 6.957  27.041  40.715 1.00 49.39  ? 1541 LEU A C   1 
ATOM   771  O O   . LEU A 1 96  ? 6.571  26.575  41.780 1.00 46.55  ? 1541 LEU A O   1 
ATOM   772  C CB  . LEU A 1 96  ? 5.169  26.956  38.949 1.00 61.61  ? 1541 LEU A CB  1 
ATOM   773  N N   . GLU A 1 97  ? 7.763  28.087  40.637 1.00 44.58  ? 1542 GLU A N   1 
ATOM   774  C CA  . GLU A 1 97  ? 8.187  28.825  41.812 1.00 44.26  ? 1542 GLU A CA  1 
ATOM   775  C C   . GLU A 1 97  ? 6.964  29.331  42.558 1.00 51.65  ? 1542 GLU A C   1 
ATOM   776  O O   . GLU A 1 97  ? 5.862  29.363  41.999 1.00 68.18  ? 1542 GLU A O   1 
ATOM   777  C CB  . GLU A 1 97  ? 9.151  29.948  41.381 1.00 37.77  ? 1542 GLU A CB  1 
ATOM   778  C CG  . GLU A 1 97  ? 9.686  30.841  42.501 1.00 50.54  ? 1542 GLU A CG  1 
ATOM   779  C CD  . GLU A 1 97  ? 10.724 31.847  42.014 1.00 67.49  ? 1542 GLU A CD  1 
ATOM   780  O OE1 . GLU A 1 97  ? 11.094 31.849  40.794 1.00 61.01  ? 1542 GLU A OE1 1 
ATOM   781  O OE2 . GLU A 1 97  ? 11.161 32.647  42.867 1.00 62.10  ? 1542 GLU A OE2 1 
ATOM   782  N N   . GLY A 1 98  ? 7.138  29.643  43.839 1.00 64.84  ? 1543 GLY A N   1 
ATOM   783  C CA  . GLY A 1 98  ? 6.013  29.947  44.717 1.00 51.30  ? 1543 GLY A CA  1 
ATOM   784  C C   . GLY A 1 98  ? 5.085  28.768  45.041 1.00 47.20  ? 1543 GLY A C   1 
ATOM   785  O O   . GLY A 1 98  ? 4.304  28.895  45.969 1.00 41.58  ? 1543 GLY A O   1 
ATOM   786  N N   . SER A 1 99  ? 5.152  27.622  44.325 1.00 47.83  ? 1544 SER A N   1 
ATOM   787  C CA  . SER A 1 99  ? 4.296  26.471  44.673 1.00 40.22  ? 1544 SER A CA  1 
ATOM   788  C C   . SER A 1 99  ? 4.769  25.807  45.965 1.00 31.45  ? 1544 SER A C   1 
ATOM   789  O O   . SER A 1 99  ? 5.889  26.037  46.390 1.00 40.65  ? 1544 SER A O   1 
ATOM   790  C CB  . SER A 1 99  ? 4.138  25.442  43.537 1.00 38.57  ? 1544 SER A CB  1 
ATOM   791  O OG  . SER A 1 99  ? 5.315  24.628  43.332 1.00 43.38  ? 1544 SER A OG  1 
ATOM   792  N N   . LEU A 1 100 ? 3.868  25.022  46.574 1.00 35.54  ? 1545 LEU A N   1 
ATOM   793  C CA  . LEU A 1 100 ? 4.106  24.386  47.859 1.00 31.39  ? 1545 LEU A CA  1 
ATOM   794  C C   . LEU A 1 100 ? 5.360  23.481  47.696 1.00 28.33  ? 1545 LEU A C   1 
ATOM   795  O O   . LEU A 1 100 ? 6.329  23.646  48.439 1.00 32.42  ? 1545 LEU A O   1 
ATOM   796  C CB  . LEU A 1 100 ? 2.883  23.588  48.328 1.00 38.22  ? 1545 LEU A CB  1 
ATOM   797  C CG  . LEU A 1 100 ? 3.136  22.700  49.566 1.00 36.28  ? 1545 LEU A CG  1 
ATOM   798  C CD1 . LEU A 1 100 ? 2.148  22.877  50.693 1.00 42.26  ? 1545 LEU A CD1 1 
ATOM   799  C CD2 . LEU A 1 100 ? 3.172  21.232  49.132 1.00 62.44  ? 1545 LEU A CD2 1 
ATOM   800  N N   . ILE A 1 101 ? 5.372  22.660  46.647 1.00 32.35  ? 1546 ILE A N   1 
ATOM   801  C CA  . ILE A 1 101 ? 6.482  21.692  46.395 1.00 39.89  ? 1546 ILE A CA  1 
ATOM   802  C C   . ILE A 1 101 ? 7.817  22.378  46.086 1.00 32.88  ? 1546 ILE A C   1 
ATOM   803  O O   . ILE A 1 101 ? 8.878  21.940  46.572 1.00 31.44  ? 1546 ILE A O   1 
ATOM   804  C CB  . ILE A 1 101 ? 6.152  20.659  45.261 1.00 36.29  ? 1546 ILE A CB  1 
ATOM   805  C CG1 . ILE A 1 101 ? 4.876  19.889  45.584 1.00 47.69  ? 1546 ILE A CG1 1 
ATOM   806  C CG2 . ILE A 1 101 ? 7.333  19.642  45.105 1.00 39.96  ? 1546 ILE A CG2 1 
ATOM   807  C CD1 . ILE A 1 101 ? 4.617  18.674  44.699 1.00 51.70  ? 1546 ILE A CD1 1 
ATOM   808  N N   . TYR A 1 102 ? 7.817  23.401  45.225 1.00 31.43  ? 1547 TYR A N   1 
ATOM   809  C CA  . TYR A 1 102 ? 9.019  24.217  44.972 1.00 29.29  ? 1547 TYR A CA  1 
ATOM   810  C C   . TYR A 1 102 ? 9.595  24.924  46.203 1.00 36.97  ? 1547 TYR A C   1 
ATOM   811  O O   . TYR A 1 102 ? 10.810 24.897  46.471 1.00 31.62  ? 1547 TYR A O   1 
ATOM   812  C CB  . TYR A 1 102 ? 8.709  25.241  43.868 1.00 40.82  ? 1547 TYR A CB  1 
ATOM   813  C CG  . TYR A 1 102 ? 9.845  26.201  43.529 1.00 35.41  ? 1547 TYR A CG  1 
ATOM   814  C CD1 . TYR A 1 102 ? 10.311 27.133  44.451 1.00 42.41  ? 1547 TYR A CD1 1 
ATOM   815  C CD2 . TYR A 1 102 ? 10.389 26.237  42.239 1.00 47.78  ? 1547 TYR A CD2 1 
ATOM   816  C CE1 . TYR A 1 102 ? 11.352 28.004  44.134 1.00 41.82  ? 1547 TYR A CE1 1 
ATOM   817  C CE2 . TYR A 1 102 ? 11.410 27.120  41.911 1.00 48.99  ? 1547 TYR A CE2 1 
ATOM   818  C CZ  . TYR A 1 102 ? 11.890 28.005  42.863 1.00 59.04  ? 1547 TYR A CZ  1 
ATOM   819  O OH  . TYR A 1 102 ? 12.904 28.902  42.559 1.00 54.49  ? 1547 TYR A OH  1 
ATOM   820  N N   . GLU A 1 103 ? 8.744  25.584  46.973 1.00 32.92  ? 1548 GLU A N   1 
ATOM   821  C CA  . GLU A 1 103 ? 9.228  26.267  48.179 1.00 32.82  ? 1548 GLU A CA  1 
ATOM   822  C C   . GLU A 1 103 ? 9.635  25.295  49.295 1.00 38.91  ? 1548 GLU A C   1 
ATOM   823  O O   . GLU A 1 103 ? 10.591 25.545  50.035 1.00 30.20  ? 1548 GLU A O   1 
ATOM   824  C CB  . GLU A 1 103 ? 8.130  27.242  48.655 1.00 40.08  ? 1548 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 103 ? 7.818  28.346  47.639 1.00 41.00  ? 1548 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 103 ? 9.048  29.198  47.281 1.00 38.86  ? 1548 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 103 ? 9.949  29.336  48.126 1.00 46.60  ? 1548 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 103 ? 9.101  29.732  46.144 1.00 52.32  ? 1548 GLU A OE2 1 
ATOM   829  N N   . ASP A 1 104 ? 8.935  24.175  49.428 1.00 28.55  ? 1549 ASP A N   1 
ATOM   830  C CA  . ASP A 1 104 ? 9.344  23.139  50.418 1.00 24.31  ? 1549 ASP A CA  1 
ATOM   831  C C   . ASP A 1 104 ? 10.729 22.572  50.117 1.00 31.46  ? 1549 ASP A C   1 
ATOM   832  O O   . ASP A 1 104 ? 11.542 22.352  51.026 1.00 25.39  ? 1549 ASP A O   1 
ATOM   833  C CB  . ASP A 1 104 ? 8.307  22.011  50.441 1.00 29.77  ? 1549 ASP A CB  1 
ATOM   834  C CG  . ASP A 1 104 ? 7.103  22.327  51.343 1.00 31.94  ? 1549 ASP A CG  1 
ATOM   835  O OD1 . ASP A 1 104 ? 7.023  23.404  52.022 1.00 29.52  ? 1549 ASP A OD1 1 
ATOM   836  O OD2 . ASP A 1 104 ? 6.249  21.442  51.389 1.00 37.38  ? 1549 ASP A OD2 1 
ATOM   837  N N   . SER A 1 105 ? 11.040 22.438  48.842 1.00 26.36  ? 1550 SER A N   1 
ATOM   838  C CA  . SER A 1 105 ? 12.329 21.861  48.409 1.00 27.67  ? 1550 SER A CA  1 
ATOM   839  C C   . SER A 1 105 ? 13.446 22.828  48.764 1.00 30.66  ? 1550 SER A C   1 
ATOM   840  O O   . SER A 1 105 ? 14.496 22.413  49.220 1.00 30.90  ? 1550 SER A O   1 
ATOM   841  C CB  . SER A 1 105 ? 12.304 21.558  46.894 1.00 25.87  ? 1550 SER A CB  1 
ATOM   842  O OG  . SER A 1 105 ? 12.421 22.773  46.091 1.00 27.74  ? 1550 SER A OG  1 
ATOM   843  N N   . ILE A 1 106 ? 13.138 24.126  48.711 1.00 32.28  ? 1551 ILE A N   1 
ATOM   844  C CA  . ILE A 1 106 ? 14.066 25.187  49.046 1.00 31.38  ? 1551 ILE A CA  1 
ATOM   845  C C   . ILE A 1 106 ? 14.414 25.123  50.510 1.00 33.04  ? 1551 ILE A C   1 
ATOM   846  O O   . ILE A 1 106 ? 15.590 25.212  50.874 1.00 33.16  ? 1551 ILE A O   1 
ATOM   847  C CB  . ILE A 1 106 ? 13.472 26.554  48.644 1.00 37.56  ? 1551 ILE A CB  1 
ATOM   848  C CG1 . ILE A 1 106 ? 13.510 26.701  47.135 1.00 32.85  ? 1551 ILE A CG1 1 
ATOM   849  C CG2 . ILE A 1 106 ? 14.156 27.669  49.410 1.00 45.67  ? 1551 ILE A CG2 1 
ATOM   850  C CD1 . ILE A 1 106 ? 14.819 27.233  46.565 1.00 38.18  ? 1551 ILE A CD1 1 
ATOM   851  N N   . VAL A 1 107 ? 13.420 24.852  51.356 1.00 29.41  ? 1552 VAL A N   1 
ATOM   852  C CA  . VAL A 1 107 ? 13.604 24.738  52.799 1.00 24.85  ? 1552 VAL A CA  1 
ATOM   853  C C   . VAL A 1 107 ? 14.386 23.476  53.173 1.00 24.03  ? 1552 VAL A C   1 
ATOM   854  O O   . VAL A 1 107 ? 15.208 23.476  54.094 1.00 24.92  ? 1552 VAL A O   1 
ATOM   855  C CB  . VAL A 1 107 ? 12.236 24.734  53.543 1.00 28.83  ? 1552 VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 107 ? 12.439 24.400  54.998 1.00 29.59  ? 1552 VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 107 ? 11.473 26.062  53.349 1.00 27.51  ? 1552 VAL A CG2 1 
ATOM   858  N N   . LEU A 1 108 ? 14.107 22.384  52.466 1.00 27.95  ? 1553 LEU A N   1 
ATOM   859  C CA  . LEU A 1 108 ? 14.806 21.155  52.699 1.00 25.53  ? 1553 LEU A CA  1 
ATOM   860  C C   . LEU A 1 108 ? 16.319 21.254  52.416 1.00 25.00  ? 1553 LEU A C   1 
ATOM   861  O O   . LEU A 1 108 ? 17.059 20.602  53.109 1.00 25.56  ? 1553 LEU A O   1 
ATOM   862  C CB  . LEU A 1 108 ? 14.168 19.954  51.957 1.00 27.93  ? 1553 LEU A CB  1 
ATOM   863  C CG  . LEU A 1 108 ? 12.908 19.489  52.713 1.00 25.12  ? 1553 LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 108 ? 12.309 18.484  51.741 1.00 28.17  ? 1553 LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 108 ? 13.132 18.879  54.080 1.00 26.13  ? 1553 LEU A CD2 1 
ATOM   866  N N   . GLN A 1 109 ? 16.758 22.066  51.453 1.00 25.95  ? 1554 GLN A N   1 
ATOM   867  C CA  . GLN A 1 109 ? 18.170 22.303  51.190 1.00 33.91  ? 1554 GLN A CA  1 
ATOM   868  C C   . GLN A 1 109 ? 18.784 22.842  52.471 1.00 29.01  ? 1554 GLN A C   1 
ATOM   869  O O   . GLN A 1 109 ? 19.868 22.444  52.864 1.00 31.50  ? 1554 GLN A O   1 
ATOM   870  C CB  . GLN A 1 109 ? 18.332 23.375  50.109 1.00 34.23  ? 1554 GLN A CB  1 
ATOM   871  C CG  . GLN A 1 109 ? 17.832 23.042  48.710 1.00 35.19  ? 1554 GLN A CG  1 
ATOM   872  C CD  . GLN A 1 109 ? 17.892 24.206  47.670 1.00 55.00  ? 1554 GLN A CD  1 
ATOM   873  O OE1 . GLN A 1 109 ? 17.592 23.992  46.502 1.00 49.20  ? 1554 GLN A OE1 1 
ATOM   874  N NE2 . GLN A 1 109 ? 18.232 25.425  48.100 1.00 47.10  ? 1554 GLN A NE2 1 
ATOM   875  N N   . SER A 1 110 ? 18.101 23.825  53.081 1.00 32.86  ? 1555 SER A N   1 
ATOM   876  C CA  . SER A 1 110 ? 18.622 24.481  54.258 1.00 28.26  ? 1555 SER A CA  1 
ATOM   877  C C   . SER A 1 110 ? 18.635 23.571  55.475 1.00 33.66  ? 1555 SER A C   1 
ATOM   878  O O   . SER A 1 110 ? 19.547 23.630  56.333 1.00 30.59  ? 1555 SER A O   1 
ATOM   879  C CB  . SER A 1 110 ? 17.852 25.776  54.551 1.00 40.53  ? 1555 SER A CB  1 
ATOM   880  O OG  . SER A 1 110 ? 18.609 26.633  55.341 1.00 60.66  ? 1555 SER A OG  1 
ATOM   881  N N   . VAL A 1 111 ? 17.704 22.636  55.490 1.00 26.43  ? 1556 VAL A N   1 
ATOM   882  C CA  . VAL A 1 111 ? 17.606 21.719  56.600 1.00 28.52  ? 1556 VAL A CA  1 
ATOM   883  C C   . VAL A 1 111 ? 18.708 20.700  56.463 1.00 22.46  ? 1556 VAL A C   1 
ATOM   884  O O   . VAL A 1 111 ? 19.322 20.283  57.463 1.00 29.00  ? 1556 VAL A O   1 
ATOM   885  C CB  . VAL A 1 111 ? 16.237 21.016  56.645 1.00 33.28  ? 1556 VAL A CB  1 
ATOM   886  C CG1 . VAL A 1 111 ? 16.331 19.792  57.547 1.00 25.28  ? 1556 VAL A CG1 1 
ATOM   887  C CG2 . VAL A 1 111 ? 15.125 22.010  57.084 1.00 32.05  ? 1556 VAL A CG2 1 
ATOM   888  N N   . PHE A 1 112 ? 18.928 20.239  55.231 1.00 22.68  ? 1557 PHE A N   1 
ATOM   889  C CA  . PHE A 1 112 ? 20.104 19.368  54.996 1.00 21.49  ? 1557 PHE A CA  1 
ATOM   890  C C   . PHE A 1 112 ? 21.431 20.012  55.474 1.00 25.55  ? 1557 PHE A C   1 
ATOM   891  O O   . PHE A 1 112 ? 22.234 19.398  56.155 1.00 26.48  ? 1557 PHE A O   1 
ATOM   892  C CB  . PHE A 1 112 ? 20.219 18.942  53.535 1.00 21.79  ? 1557 PHE A CB  1 
ATOM   893  C CG  . PHE A 1 112 ? 21.404 18.084  53.286 1.00 25.39  ? 1557 PHE A CG  1 
ATOM   894  C CD1 . PHE A 1 112 ? 22.656 18.645  53.168 1.00 24.66  ? 1557 PHE A CD1 1 
ATOM   895  C CD2 . PHE A 1 112 ? 21.287 16.681  53.336 1.00 21.05  ? 1557 PHE A CD2 1 
ATOM   896  C CE1 . PHE A 1 112 ? 23.777 17.822  52.969 1.00 23.97  ? 1557 PHE A CE1 1 
ATOM   897  C CE2 . PHE A 1 112 ? 22.380 15.858  53.147 1.00 22.48  ? 1557 PHE A CE2 1 
ATOM   898  C CZ  . PHE A 1 112 ? 23.634 16.445  53.033 1.00 21.89  ? 1557 PHE A CZ  1 
ATOM   899  N N   . THR A 1 113 ? 21.643 21.253  55.121 1.00 29.43  ? 1558 THR A N   1 
ATOM   900  C CA  . THR A 1 113 ? 22.900 21.915  55.386 1.00 29.43  ? 1558 THR A CA  1 
ATOM   901  C C   . THR A 1 113 ? 23.118 22.072  56.880 1.00 31.94  ? 1558 THR A C   1 
ATOM   902  O O   . THR A 1 113 ? 24.193 21.723  57.407 1.00 31.97  ? 1558 THR A O   1 
ATOM   903  C CB  . THR A 1 113 ? 22.940 23.257  54.621 1.00 31.78  ? 1558 THR A CB  1 
ATOM   904  O OG1 . THR A 1 113 ? 23.013 22.983  53.201 1.00 31.97  ? 1558 THR A OG1 1 
ATOM   905  C CG2 . THR A 1 113 ? 24.144 24.102  55.032 1.00 46.35  ? 1558 THR A CG2 1 
ATOM   906  N N   . SER A 1 114 ? 22.098 22.512  57.601 1.00 31.13  ? 1559 SER A N   1 
ATOM   907  C CA  . SER A 1 114 ? 22.233 22.675  59.047 1.00 37.08  ? 1559 SER A CA  1 
ATOM   908  C C   . SER A 1 114 ? 22.303 21.334  59.765 1.00 34.81  ? 1559 SER A C   1 
ATOM   909  O O   . SER A 1 114 ? 23.133 21.176  60.665 1.00 35.11  ? 1559 SER A O   1 
ATOM   910  C CB  . SER A 1 114 ? 21.132 23.540  59.660 1.00 43.34  ? 1559 SER A CB  1 
ATOM   911  O OG  . SER A 1 114 ? 19.953 22.815  59.761 1.00 47.68  ? 1559 SER A OG  1 
ATOM   912  N N   . VAL A 1 115 ? 21.492 20.378  59.366 1.00 28.60  ? 1560 VAL A N   1 
ATOM   913  C CA  . VAL A 1 115 ? 21.591 19.011  59.910 1.00 27.88  ? 1560 VAL A CA  1 
ATOM   914  C C   . VAL A 1 115 ? 23.008 18.397  59.695 1.00 34.50  ? 1560 VAL A C   1 
ATOM   915  O O   . VAL A 1 115 ? 23.587 17.727  60.592 1.00 31.16  ? 1560 VAL A O   1 
ATOM   916  C CB  . VAL A 1 115 ? 20.484 18.068  59.392 1.00 37.59  ? 1560 VAL A CB  1 
ATOM   917  C CG1 . VAL A 1 115 ? 20.770 16.616  59.751 1.00 31.94  ? 1560 VAL A CG1 1 
ATOM   918  C CG2 . VAL A 1 115 ? 19.096 18.484  59.995 1.00 32.97  ? 1560 VAL A CG2 1 
ATOM   919  N N   . ARG A 1 116 ? 23.535 18.552  58.492 1.00 26.90  ? 1561 ARG A N   1 
ATOM   920  C CA  . ARG A 1 116 ? 24.892 18.043  58.192 1.00 27.29  ? 1561 ARG A CA  1 
ATOM   921  C C   . ARG A 1 116 ? 25.948 18.620  59.133 1.00 33.42  ? 1561 ARG A C   1 
ATOM   922  O O   . ARG A 1 116 ? 26.710 17.856  59.760 1.00 36.07  ? 1561 ARG A O   1 
ATOM   923  C CB  . ARG A 1 116 ? 25.280 18.325  56.731 1.00 25.16  ? 1561 ARG A CB  1 
ATOM   924  C CG  . ARG A 1 116 ? 26.601 17.670  56.367 1.00 42.28  ? 1561 ARG A CG  1 
ATOM   925  C CD  . ARG A 1 116 ? 27.152 18.123  55.028 1.00 31.41  ? 1561 ARG A CD  1 
ATOM   926  N NE  . ARG A 1 116 ? 28.588 17.817  54.958 1.00 32.06  ? 1561 ARG A NE  1 
ATOM   927  C CZ  . ARG A 1 116 ? 29.292 17.666  53.839 1.00 43.64  ? 1561 ARG A CZ  1 
ATOM   928  N NH1 . ARG A 1 116 ? 28.707 17.744  52.668 1.00 41.40  ? 1561 ARG A NH1 1 
ATOM   929  N NH2 . ARG A 1 116 ? 30.595 17.406  53.891 1.00 44.40  ? 1561 ARG A NH2 1 
ATOM   930  N N   . GLN A 1 117 ? 26.002 19.947  59.181 1.00 38.25  ? 1562 GLN A N   1 
ATOM   931  C CA  . GLN A 1 117 ? 26.855 20.691  60.130 1.00 39.43  ? 1562 GLN A CA  1 
ATOM   932  C C   . GLN A 1 117 ? 26.786 20.262  61.569 1.00 44.17  ? 1562 GLN A C   1 
ATOM   933  O O   . GLN A 1 117 ? 27.837 19.970  62.173 1.00 48.77  ? 1562 GLN A O   1 
ATOM   934  C CB  . GLN A 1 117 ? 26.595 22.208  60.030 1.00 42.56  ? 1562 GLN A CB  1 
ATOM   935  C CG  . GLN A 1 117 ? 27.399 22.878  58.905 1.00 68.04  ? 1562 GLN A CG  1 
ATOM   936  C CD  . GLN A 1 117 ? 26.795 24.179  58.360 1.00 80.39  ? 1562 GLN A CD  1 
ATOM   937  O OE1 . GLN A 1 117 ? 27.092 24.568  57.229 1.00 72.80  ? 1562 GLN A OE1 1 
ATOM   938  N NE2 . GLN A 1 117 ? 25.944 24.847  59.146 1.00 71.55  ? 1562 GLN A NE2 1 
ATOM   939  N N   . LYS A 1 118 ? 25.573 20.244  62.110 1.00 41.30  ? 1563 LYS A N   1 
ATOM   940  C CA  . LYS A 1 118 ? 25.319 19.692  63.417 1.00 51.15  ? 1563 LYS A CA  1 
ATOM   941  C C   . LYS A 1 118 ? 25.971 18.320  63.558 1.00 44.68  ? 1563 LYS A C   1 
ATOM   942  O O   . LYS A 1 118 ? 26.739 18.119  64.510 1.00 47.98  ? 1563 LYS A O   1 
ATOM   943  C CB  . LYS A 1 118 ? 23.804 19.648  63.699 1.00 44.52  ? 1563 LYS A CB  1 
ATOM   944  C CG  . LYS A 1 118 ? 23.398 18.932  64.982 1.00 67.41  ? 1563 LYS A CG  1 
ATOM   945  C CD  . LYS A 1 118 ? 21.865 18.819  65.099 1.00 78.42  ? 1563 LYS A CD  1 
ATOM   946  C CE  . LYS A 1 118 ? 21.322 17.642  64.266 1.00 113.06 ? 1563 LYS A CE  1 
ATOM   947  N NZ  . LYS A 1 118 ? 19.827 17.534  64.173 1.00 85.03  ? 1563 LYS A NZ  1 
ATOM   948  N N   . ILE A 1 119 ? 25.756 17.402  62.610 1.00 53.31  ? 1564 ILE A N   1 
ATOM   949  C CA  . ILE A 1 119 ? 26.170 15.982  62.819 1.00 42.68  ? 1564 ILE A CA  1 
ATOM   950  C C   . ILE A 1 119 ? 27.681 15.855  62.762 1.00 50.13  ? 1564 ILE A C   1 
ATOM   951  O O   . ILE A 1 119 ? 28.301 15.146  63.567 1.00 50.72  ? 1564 ILE A O   1 
ATOM   952  C CB  . ILE A 1 119 ? 25.452 14.968  61.880 1.00 45.81  ? 1564 ILE A CB  1 
ATOM   953  C CG1 . ILE A 1 119 ? 24.114 14.489  62.489 1.00 60.12  ? 1564 ILE A CG1 1 
ATOM   954  C CG2 . ILE A 1 119 ? 26.348 13.758  61.550 1.00 59.93  ? 1564 ILE A CG2 1 
ATOM   955  C CD1 . ILE A 1 119 ? 22.979 15.450  62.260 1.00 64.42  ? 1564 ILE A CD1 1 
ATOM   956  N N   . GLU A 1 120 ? 28.264 16.601  61.834 1.00 42.60  ? 1565 GLU A N   1 
ATOM   957  C CA  . GLU A 1 120 ? 29.706 16.616  61.647 1.00 45.68  ? 1565 GLU A CA  1 
ATOM   958  C C   . GLU A 1 120 ? 30.373 17.303  62.823 1.00 50.42  ? 1565 GLU A C   1 
ATOM   959  O O   . GLU A 1 120 ? 31.426 16.864  63.238 1.00 59.14  ? 1565 GLU A O   1 
ATOM   960  C CB  . GLU A 1 120 ? 30.094 17.287  60.337 1.00 41.53  ? 1565 GLU A CB  1 
ATOM   961  C CG  . GLU A 1 120 ? 29.872 16.367  59.102 1.00 40.10  ? 1565 GLU A CG  1 
ATOM   962  C CD  . GLU A 1 120 ? 30.801 16.622  57.902 1.00 62.54  ? 1565 GLU A CD  1 
ATOM   963  O OE1 . GLU A 1 120 ? 30.445 17.455  57.024 1.00 47.92  ? 1565 GLU A OE1 1 
ATOM   964  O OE2 . GLU A 1 120 ? 31.853 15.936  57.781 1.00 50.94  ? 1565 GLU A OE2 1 
ATOM   965  N N   . LYS A 1 121 ? 29.768 18.357  63.369 1.00 52.37  ? 1566 LYS A N   1 
ATOM   966  C CA  . LYS A 1 121 ? 30.317 19.020  64.590 1.00 51.22  ? 1566 LYS A CA  1 
ATOM   967  C C   . LYS A 1 121 ? 30.402 18.141  65.868 1.00 67.55  ? 1566 LYS A C   1 
ATOM   968  O O   . LYS A 1 121 ? 31.162 18.473  66.789 1.00 103.90 ? 1566 LYS A O   1 
ATOM   969  C CB  . LYS A 1 121 ? 29.670 20.380  64.872 1.00 64.11  ? 1566 LYS A CB  1 
ATOM   970  C CG  . LYS A 1 121 ? 30.361 21.529  64.139 1.00 68.31  ? 1566 LYS A CG  1 
ATOM   971  C CD  . LYS A 1 121 ? 29.542 22.820  64.132 1.00 81.20  ? 1566 LYS A CD  1 
ATOM   972  C CE  . LYS A 1 121 ? 30.026 23.848  65.152 1.00 75.53  ? 1566 LYS A CE  1 
ATOM   973  N NZ  . LYS A 1 121 ? 29.683 23.439  66.537 1.00 75.37  ? 1566 LYS A NZ  1 
ATOM   974  N N   . GLU A 1 122 ? 29.688 17.005  65.883 1.00 69.80  ? 1567 GLU A N   1 
ATOM   975  C CA  . GLU A 1 122 ? 29.718 16.018  66.995 1.00 71.40  ? 1567 GLU A CA  1 
ATOM   976  C C   . GLU A 1 122 ? 31.009 15.197  67.118 1.00 92.11  ? 1567 GLU A C   1 
ATOM   977  O O   . GLU A 1 122 ? 31.323 14.713  68.203 1.00 93.38  ? 1567 GLU A O   1 
ATOM   978  C CB  . GLU A 1 122 ? 28.562 15.014  66.866 1.00 76.83  ? 1567 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 122 ? 27.185 15.550  67.241 1.00 83.51  ? 1567 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 122 ? 26.037 14.699  66.686 1.00 104.84 ? 1567 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 122 ? 26.319 13.594  66.167 1.00 103.07 ? 1567 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 122 ? 24.853 15.131  66.764 1.00 71.74  ? 1567 GLU A OE2 1 
ATOM   983  N N   . ASP A 1 123 ? 31.740 14.995  66.026 1.00 90.39  ? 1568 ASP A N   1 
ATOM   984  C CA  . ASP A 1 123 ? 32.942 14.145  66.082 1.00 136.11 ? 1568 ASP A CA  1 
ATOM   985  C C   . ASP A 1 123 ? 34.227 14.968  66.188 1.00 114.91 ? 1568 ASP A C   1 
ATOM   986  O O   . ASP A 1 123 ? 34.460 15.627  67.208 1.00 77.44  ? 1568 ASP A O   1 
ATOM   987  C CB  . ASP A 1 123 ? 32.967 13.193  64.883 1.00 145.85 ? 1568 ASP A CB  1 
ATOM   988  C CG  . ASP A 1 123 ? 31.812 12.193  64.915 1.00 133.41 ? 1568 ASP A CG  1 
ATOM   989  O OD1 . ASP A 1 123 ? 30.811 12.405  64.201 1.00 83.32  ? 1568 ASP A OD1 1 
ATOM   990  O OD2 . ASP A 1 123 ? 31.888 11.210  65.686 1.00 125.55 ? 1568 ASP A OD2 1 
HETATM 991  C CAA . MB3 B 2 .   ? 8.479  15.936  44.492 1.00 44.21  ? 1    MB3 A CAA 1 
HETATM 992  O OAB . MB3 B 2 .   ? 8.341  17.674  41.922 1.00 45.46  ? 1    MB3 A OAB 1 
HETATM 993  C CAC . MB3 B 2 .   ? 5.887  14.992  41.790 1.00 60.27  ? 1    MB3 A CAC 1 
HETATM 994  C CAD . MB3 B 2 .   ? 6.452  16.304  41.222 1.00 43.91  ? 1    MB3 A CAD 1 
HETATM 995  C CAE . MB3 B 2 .   ? 6.510  14.878  43.187 1.00 63.34  ? 1    MB3 A CAE 1 
HETATM 996  C CAF . MB3 B 2 .   ? 7.626  16.683  42.153 1.00 26.77  ? 1    MB3 A CAF 1 
HETATM 997  N NAG . MB3 B 2 .   ? 7.561  15.926  43.276 1.00 42.65  ? 1    MB3 A NAG 1 
HETATM 998  O O   . HOH C 3 .   ? 13.842 13.827  41.499 1.00 29.79  ? 2    HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? 27.341 3.381   53.358 1.00 30.47  ? 3    HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? 11.663 13.567  45.042 1.00 30.75  ? 4    HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? 21.768 11.010  40.888 1.00 33.27  ? 5    HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? 21.288 27.127  54.726 1.00 47.28  ? 6    HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? 30.423 4.904   44.238 1.00 36.72  ? 7    HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? 35.162 10.207  52.329 1.00 37.09  ? 8    HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? 30.470 18.929  50.690 1.00 32.71  ? 9    HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? 6.228  10.582  48.619 1.00 35.21  ? 10   HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? 11.065 19.410  62.996 1.00 36.15  ? 11   HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? 2.752  22.394  44.818 1.00 38.85  ? 12   HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? 16.045 12.411  63.149 1.00 37.92  ? 13   HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? -0.379 19.998  57.619 1.00 41.69  ? 14   HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? 24.193 13.232  42.674 1.00 37.74  ? 15   HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? 14.697 16.818  62.149 1.00 34.81  ? 16   HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? 17.024 16.496  33.832 1.00 41.24  ? 17   HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? 4.012  21.623  62.738 1.00 43.91  ? 18   HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? 12.298 15.633  43.789 1.00 38.37  ? 19   HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? 15.050 3.038   50.481 1.00 42.24  ? 20   HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? 22.600 6.330   61.977 1.00 43.31  ? 21   HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? 29.466 0.886   56.271 1.00 42.73  ? 23   HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? 33.676 2.374   45.781 1.00 49.80  ? 24   HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? 33.446 11.423  47.545 1.00 41.68  ? 25   HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? 15.354 15.370  29.623 1.00 58.37  ? 26   HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? 26.176 12.174  44.476 1.00 29.76  ? 27   HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? 22.011 19.962  41.790 1.00 50.19  ? 28   HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? 5.603  18.723  50.618 1.00 62.26  ? 29   HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? 19.164 9.630   40.321 1.00 39.54  ? 30   HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? 9.020  25.242  56.989 1.00 45.78  ? 31   HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? 11.904 12.778  26.757 1.00 46.00  ? 32   HOH A O   1 
HETATM 1028 O O   . HOH C 3 .   ? 33.975 3.854   60.772 1.00 42.13  ? 33   HOH A O   1 
HETATM 1029 O O   . HOH C 3 .   ? 6.499  1.888   48.065 1.00 46.42  ? 34   HOH A O   1 
HETATM 1030 O O   . HOH C 3 .   ? 27.240 -2.511  47.341 1.00 42.97  ? 35   HOH A O   1 
HETATM 1031 O O   . HOH C 3 .   ? 17.612 15.792  36.676 1.00 38.42  ? 36   HOH A O   1 
HETATM 1032 O O   . HOH C 3 .   ? 2.568  18.188  51.604 1.00 38.78  ? 37   HOH A O   1 
HETATM 1033 O O   . HOH C 3 .   ? 23.324 13.026  38.647 1.00 49.09  ? 38   HOH A O   1 
HETATM 1034 O O   . HOH C 3 .   ? 18.240 7.747   57.136 1.00 48.96  ? 39   HOH A O   1 
HETATM 1035 O O   . HOH C 3 .   ? 35.502 -1.743  54.245 1.00 51.80  ? 40   HOH A O   1 
HETATM 1036 O O   . HOH C 3 .   ? 35.556 1.783   52.604 1.00 46.56  ? 41   HOH A O   1 
HETATM 1037 O O   . HOH C 3 .   ? 35.838 -4.211  50.476 1.00 41.13  ? 42   HOH A O   1 
HETATM 1038 O O   . HOH C 3 .   ? 34.472 6.264   51.750 1.00 31.00  ? 43   HOH A O   1 
HETATM 1039 O O   . HOH C 3 .   ? 36.622 5.753   50.200 1.00 46.28  ? 44   HOH A O   1 
HETATM 1040 O O   . HOH C 3 .   ? 29.931 -7.588  53.315 1.00 58.31  ? 45   HOH A O   1 
HETATM 1041 O O   . HOH C 3 .   ? 30.222 2.833   63.821 1.00 50.16  ? 46   HOH A O   1 
HETATM 1042 O O   . HOH C 3 .   ? 15.031 26.518  57.699 1.00 58.27  ? 47   HOH A O   1 
HETATM 1043 O O   . HOH C 3 .   ? 21.202 25.809  56.747 1.00 41.82  ? 48   HOH A O   1 
HETATM 1044 O O   . HOH C 3 .   ? 20.009 21.322  62.645 1.00 45.79  ? 49   HOH A O   1 
HETATM 1045 O O   . HOH C 3 .   ? 3.075  12.713  55.827 1.00 35.09  ? 50   HOH A O   1 
HETATM 1046 O O   . HOH C 3 .   ? 9.012  5.013   51.213 1.00 49.15  ? 51   HOH A O   1 
HETATM 1047 O O   . HOH C 3 .   ? 14.081 10.202  33.532 1.00 43.54  ? 52   HOH A O   1 
HETATM 1048 O O   . HOH C 3 .   ? 14.818 5.477   37.016 1.00 52.84  ? 53   HOH A O   1 
HETATM 1049 O O   . HOH C 3 .   ? 24.158 8.890   42.794 1.00 40.52  ? 54   HOH A O   1 
HETATM 1050 O O   . HOH C 3 .   ? 26.100 21.312  53.319 1.00 48.26  ? 55   HOH A O   1 
HETATM 1051 O O   . HOH C 3 .   ? 18.307 23.981  42.838 1.00 46.10  ? 56   HOH A O   1 
HETATM 1052 O O   . HOH C 3 .   ? 10.940 28.450  50.366 1.00 43.29  ? 57   HOH A O   1 
HETATM 1053 O O   . HOH C 3 .   ? 10.862 16.582  41.796 1.00 35.26  ? 58   HOH A O   1 
HETATM 1054 O O   . HOH C 3 .   ? 29.484 -8.810  44.010 1.00 53.17  ? 59   HOH A O   1 
HETATM 1055 O O   . HOH C 3 .   ? 31.591 -12.133 42.516 1.00 44.67  ? 60   HOH A O   1 
HETATM 1056 O O   . HOH C 3 .   ? 22.212 -1.546  43.617 1.00 55.82  ? 61   HOH A O   1 
HETATM 1057 O O   . HOH C 3 .   ? 8.275  25.241  53.733 1.00 43.05  ? 62   HOH A O   1 
HETATM 1058 O O   . HOH C 3 .   ? 10.828 17.095  56.135 1.00 24.68  ? 1570 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . MET A 2   ? 1.0631 1.0327 1.0276 0.0504  0.1399  -0.0454 1447 MET A N   
2   C CA  . MET A 2   ? 1.4668 1.4426 1.4140 0.0487  0.1321  -0.0415 1447 MET A CA  
3   C C   . MET A 2   ? 1.2200 1.1944 1.1755 0.0584  0.1279  -0.0346 1447 MET A C   
4   O O   . MET A 2   ? 0.7832 0.7529 0.7535 0.0597  0.1354  -0.0384 1447 MET A O   
5   C CB  . MET A 2   ? 0.7987 0.7810 0.7296 0.0484  0.1212  -0.0343 1447 MET A CB  
6   N N   . ALA A 3   ? 0.9380 0.9164 0.8851 0.0645  0.1165  -0.0248 1448 ALA A N   
7   C CA  . ALA A 3   ? 1.2146 1.1930 1.1655 0.0718  0.1120  -0.0186 1448 ALA A CA  
8   C C   . ALA A 3   ? 1.2797 1.2527 1.2519 0.0792  0.1155  -0.0162 1448 ALA A C   
9   O O   . ALA A 3   ? 0.9053 0.8756 0.8891 0.0820  0.1171  -0.0147 1448 ALA A O   
10  C CB  . ALA A 3   ? 0.7656 0.7484 0.7065 0.0770  0.1004  -0.0089 1448 ALA A CB  
11  N N   . GLU A 4   ? 1.0238 0.9959 1.0019 0.0817  0.1166  -0.0153 1449 GLU A N   
12  C CA  . GLU A 4   ? 0.7464 0.7151 0.7455 0.0885  0.1184  -0.0107 1449 GLU A CA  
13  C C   . GLU A 4   ? 0.6987 0.6707 0.6958 0.0961  0.1077  0.0007  1449 GLU A C   
14  O O   . GLU A 4   ? 0.6962 0.6714 0.6806 0.0969  0.1019  0.0033  1449 GLU A O   
15  C CB  . GLU A 4   ? 0.9762 0.9426 0.9838 0.0868  0.1254  -0.0154 1449 GLU A CB  
16  C CG  . GLU A 4   ? 1.0329 0.9944 1.0531 0.0805  0.1389  -0.0264 1449 GLU A CG  
17  C CD  . GLU A 4   ? 1.1378 1.0953 1.1819 0.0844  0.1434  -0.0239 1449 GLU A CD  
18  O OE1 . GLU A 4   ? 1.9262 1.8806 1.9752 0.0792  0.1518  -0.0318 1449 GLU A OE1 
19  O OE2 . GLU A 4   ? 1.2278 1.1858 1.2860 0.0922  0.1384  -0.0134 1449 GLU A OE2 
20  N N   . LYS A 5   ? 0.7626 0.7339 0.7728 0.1009  0.1056  0.0074  1450 LYS A N   
21  C CA  . LYS A 5   ? 0.7553 0.7302 0.7639 0.1064  0.0962  0.0179  1450 LYS A CA  
22  C C   . LYS A 5   ? 0.7213 0.6983 0.7277 0.1086  0.0929  0.0214  1450 LYS A C   
23  O O   . LYS A 5   ? 0.6834 0.6586 0.7015 0.1087  0.0978  0.0200  1450 LYS A O   
24  C CB  . LYS A 5   ? 0.8407 0.8152 0.8685 0.1098  0.0960  0.0250  1450 LYS A CB  
25  C CG  . LYS A 5   ? 0.7508 0.7296 0.7731 0.1125  0.0870  0.0338  1450 LYS A CG  
26  C CD  . LYS A 5   ? 0.5219 0.5008 0.5628 0.1141  0.0874  0.0401  1450 LYS A CD  
27  C CE  . LYS A 5   ? 0.8207 0.8053 0.8622 0.1160  0.0788  0.0515  1450 LYS A CE  
28  N NZ  . LYS A 5   ? 0.6963 0.6824 0.7607 0.1171  0.0791  0.0599  1450 LYS A NZ  
29  N N   . LEU A 6   ? 0.6281 0.6088 0.6207 0.1102  0.0852  0.0259  1451 LEU A N   
30  C CA  . LEU A 6   ? 0.6428 0.6259 0.6330 0.1121  0.0816  0.0298  1451 LEU A CA  
31  C C   . LEU A 6   ? 0.5573 0.5428 0.5598 0.1152  0.0780  0.0391  1451 LEU A C   
32  O O   . LEU A 6   ? 0.5223 0.5094 0.5283 0.1159  0.0751  0.0440  1451 LEU A O   
33  C CB  . LEU A 6   ? 0.6321 0.6181 0.6040 0.1119  0.0759  0.0303  1451 LEU A CB  
34  C CG  . LEU A 6   ? 0.6005 0.5865 0.5604 0.1083  0.0776  0.0239  1451 LEU A CG  
35  C CD1 . LEU A 6   ? 0.6511 0.6404 0.5988 0.1091  0.0718  0.0268  1451 LEU A CD1 
36  C CD2 . LEU A 6   ? 0.4822 0.4663 0.4467 0.1063  0.0834  0.0189  1451 LEU A CD2 
37  N N   . SER A 7   ? 0.5227 0.5095 0.5310 0.1165  0.0774  0.0424  1452 SER A N   
38  C CA  . SER A 7   ? 0.5330 0.5243 0.5503 0.1180  0.0723  0.0528  1452 SER A CA  
39  C C   . SER A 7   ? 0.4910 0.4865 0.4926 0.1172  0.0651  0.0565  1452 SER A C   
40  O O   . SER A 7   ? 0.4939 0.4897 0.4807 0.1168  0.0636  0.0530  1452 SER A O   
41  C CB  . SER A 7   ? 0.4438 0.4363 0.4694 0.1189  0.0727  0.0559  1452 SER A CB  
42  O OG  . SER A 7   ? 0.4359 0.4338 0.4725 0.1191  0.0678  0.0671  1452 SER A OG  
43  N N   . PRO A 8   ? 0.5290 0.5279 0.5349 0.1165  0.0615  0.0630  1453 PRO A N   
44  C CA  . PRO A 8   ? 0.5628 0.5658 0.5549 0.1145  0.0559  0.0659  1453 PRO A CA  
45  C C   . PRO A 8   ? 0.5518 0.5585 0.5361 0.1132  0.0528  0.0681  1453 PRO A C   
46  O O   . PRO A 8   ? 0.4336 0.4427 0.4269 0.1132  0.0521  0.0730  1453 PRO A O   
47  C CB  . PRO A 8   ? 0.5609 0.5683 0.5635 0.1130  0.0526  0.0746  1453 PRO A CB  
48  C CG  . PRO A 8   ? 0.6768 0.6804 0.6967 0.1150  0.0573  0.0743  1453 PRO A CG  
49  C CD  . PRO A 8   ? 0.5469 0.5459 0.5716 0.1169  0.0630  0.0682  1453 PRO A CD  
50  N N   . ASN A 9   ? 0.5179 0.5250 0.4867 0.1120  0.0513  0.0645  1454 ASN A N   
51  C CA  . ASN A 9   ? 0.5521 0.5631 0.5133 0.1097  0.0488  0.0664  1454 ASN A CA  
52  C C   . ASN A 9   ? 0.4354 0.4535 0.4006 0.1054  0.0444  0.0755  1454 ASN A C   
53  O O   . ASN A 9   ? 0.4412 0.4612 0.4121 0.1041  0.0428  0.0797  1454 ASN A O   
54  C CB  . ASN A 9   ? 0.5032 0.5129 0.4500 0.1087  0.0492  0.0607  1454 ASN A CB  
55  C CG  . ASN A 9   ? 0.5908 0.5962 0.5333 0.1115  0.0521  0.0542  1454 ASN A CG  
56  O OD1 . ASN A 9   ? 0.4755 0.4803 0.4204 0.1128  0.0530  0.0538  1454 ASN A OD1 
57  N ND2 . ASN A 9   ? 0.5280 0.5312 0.4645 0.1120  0.0532  0.0499  1454 ASN A ND2 
58  N N   . PRO A 10  ? 0.3929 0.4156 0.3551 0.1023  0.0421  0.0789  1455 PRO A N   
59  C CA  . PRO A 10  ? 0.4972 0.5282 0.4572 0.0956  0.0376  0.0864  1455 PRO A CA  
60  C C   . PRO A 10  ? 0.5604 0.5917 0.5093 0.0922  0.0377  0.0829  1455 PRO A C   
61  O O   . PRO A 10  ? 0.4680 0.4949 0.4066 0.0934  0.0408  0.0746  1455 PRO A O   
62  C CB  . PRO A 10  ? 0.4936 0.5278 0.4462 0.0925  0.0367  0.0864  1455 PRO A CB  
63  C CG  . PRO A 10  ? 0.6115 0.6394 0.5659 0.0985  0.0403  0.0807  1455 PRO A CG  
64  C CD  . PRO A 10  ? 0.5417 0.5624 0.4968 0.1035  0.0438  0.0741  1455 PRO A CD  
65  N N   . PRO A 11  ? 0.5115 0.5482 0.4639 0.0879  0.0343  0.0898  1456 PRO A N   
66  C CA  . PRO A 11  ? 0.5026 0.5390 0.4461 0.0852  0.0351  0.0860  1456 PRO A CA  
67  C C   . PRO A 11  ? 0.5326 0.5700 0.4608 0.0800  0.0370  0.0797  1456 PRO A C   
68  O O   . PRO A 11  ? 0.5809 0.6141 0.5024 0.0807  0.0403  0.0726  1456 PRO A O   
69  C CB  . PRO A 11  ? 0.6676 0.7120 0.6176 0.0796  0.0302  0.0964  1456 PRO A CB  
70  C CG  . PRO A 11  ? 0.6284 0.6745 0.5963 0.0829  0.0281  0.1049  1456 PRO A CG  
71  C CD  . PRO A 11  ? 0.6100 0.6536 0.5770 0.0857  0.0299  0.1017  1456 PRO A CD  
72  N N   . ASN A 12  ? 0.5992 0.6422 0.5231 0.0745  0.0356  0.0824  1457 ASN A N   
73  C CA  . ASN A 12  ? 0.4600 0.5041 0.3706 0.0685  0.0386  0.0759  1457 ASN A CA  
74  C C   . ASN A 12  ? 0.5573 0.5925 0.4654 0.0751  0.0440  0.0660  1457 ASN A C   
75  O O   . ASN A 12  ? 0.4963 0.5298 0.3969 0.0720  0.0483  0.0590  1457 ASN A O   
76  C CB  . ASN A 12  ? 0.5507 0.6020 0.4579 0.0618  0.0364  0.0801  1457 ASN A CB  
77  C CG  . ASN A 12  ? 0.8737 0.9363 0.7819 0.0523  0.0306  0.0910  1457 ASN A CG  
78  O OD1 . ASN A 12  ? 0.7842 0.8495 0.6917 0.0488  0.0291  0.0934  1457 ASN A OD1 
79  N ND2 . ASN A 12  ? 0.8346 0.9046 0.7449 0.0478  0.0267  0.0986  1457 ASN A ND2 
80  N N   . LEU A 13  ? 0.4975 0.5279 0.4128 0.0831  0.0440  0.0659  1458 LEU A N   
81  C CA  . LEU A 13  ? 0.5309 0.5544 0.4447 0.0886  0.0481  0.0584  1458 LEU A CA  
82  C C   . LEU A 13  ? 0.4361 0.4550 0.3503 0.0917  0.0500  0.0545  1458 LEU A C   
83  O O   . LEU A 13  ? 0.4515 0.4675 0.3623 0.0920  0.0536  0.0488  1458 LEU A O   
84  C CB  . LEU A 13  ? 0.4543 0.4747 0.3742 0.0947  0.0478  0.0591  1458 LEU A CB  
85  C CG  . LEU A 13  ? 0.4164 0.4313 0.3347 0.0994  0.0511  0.0527  1458 LEU A CG  
86  C CD1 . LEU A 13  ? 0.5556 0.5713 0.4675 0.0960  0.0537  0.0488  1458 LEU A CD1 
87  C CD2 . LEU A 13  ? 0.4228 0.4352 0.3470 0.1044  0.0508  0.0534  1458 LEU A CD2 
88  N N   . THR A 14  ? 0.5058 0.5248 0.4254 0.0933  0.0479  0.0582  1459 THR A N   
89  C CA  . THR A 14  ? 0.4791 0.4943 0.3988 0.0956  0.0493  0.0550  1459 THR A CA  
90  C C   . THR A 14  ? 0.6310 0.6479 0.5442 0.0903  0.0511  0.0522  1459 THR A C   
91  O O   . THR A 14  ? 0.4113 0.4244 0.3237 0.0922  0.0541  0.0474  1459 THR A O   
92  C CB  . THR A 14  ? 0.5708 0.5859 0.4983 0.0979  0.0471  0.0593  1459 THR A CB  
93  O OG1 . THR A 14  ? 0.4729 0.4858 0.4079 0.1023  0.0472  0.0605  1459 THR A OG1 
94  C CG2 . THR A 14  ? 0.5651 0.5763 0.4920 0.1001  0.0487  0.0558  1459 THR A CG2 
95  N N   . LYS A 15  ? 0.5536 0.5766 0.4628 0.0830  0.0495  0.0555  1460 LYS A N   
96  C CA  . LYS A 15  ? 0.4600 0.4854 0.3619 0.0758  0.0521  0.0521  1460 LYS A CA  
97  C C   . LYS A 15  ? 0.4034 0.4260 0.3017 0.0746  0.0578  0.0445  1460 LYS A C   
98  O O   . LYS A 15  ? 0.4821 0.5018 0.3799 0.0738  0.0623  0.0390  1460 LYS A O   
99  C CB  . LYS A 15  ? 0.6110 0.6454 0.5083 0.0660  0.0489  0.0578  1460 LYS A CB  
100 C CG  . LYS A 15  ? 0.6158 0.6536 0.5159 0.0641  0.0450  0.0638  1460 LYS A CG  
101 C CD  . LYS A 15  ? 0.6430 0.6912 0.5368 0.0521  0.0420  0.0693  1460 LYS A CD  
102 N N   . LYS A 16  ? 0.3955 0.4183 0.2936 0.0755  0.0580  0.0443  1461 LYS A N   
103 C CA  . LYS A 16  ? 0.4252 0.4448 0.3224 0.0753  0.0636  0.0376  1461 LYS A CA  
104 C C   . LYS A 16  ? 0.4298 0.4428 0.3339 0.0830  0.0661  0.0343  1461 LYS A C   
105 O O   . LYS A 16  ? 0.4384 0.4488 0.3448 0.0818  0.0716  0.0290  1461 LYS A O   
106 C CB  . LYS A 16  ? 0.4924 0.5135 0.3885 0.0751  0.0631  0.0384  1461 LYS A CB  
107 C CG  . LYS A 16  ? 0.6904 0.7188 0.5790 0.0652  0.0623  0.0402  1461 LYS A CG  
108 C CD  . LYS A 16  ? 0.5683 0.5974 0.4553 0.0643  0.0636  0.0388  1461 LYS A CD  
109 C CE  . LYS A 16  ? 0.6979 0.7252 0.5908 0.0725  0.0592  0.0438  1461 LYS A CE  
110 N N   . MET A 17  ? 0.4167 0.4276 0.3251 0.0900  0.0624  0.0377  1462 MET A N   
111 C CA  . MET A 17  ? 0.4280 0.4344 0.3418 0.0958  0.0634  0.0362  1462 MET A CA  
112 C C   . MET A 17  ? 0.4249 0.4301 0.3400 0.0944  0.0656  0.0342  1462 MET A C   
113 O O   . MET A 17  ? 0.4076 0.4105 0.3275 0.0953  0.0693  0.0313  1462 MET A O   
114 C CB  . MET A 17  ? 0.3697 0.3750 0.2859 0.1010  0.0595  0.0396  1462 MET A CB  
115 C CG  . MET A 17  ? 0.4090 0.4142 0.3258 0.1033  0.0586  0.0404  1462 MET A CG  
116 S SD  . MET A 17  ? 0.4659 0.4698 0.3860 0.1075  0.0557  0.0430  1462 MET A SD  
117 C CE  . MET A 17  ? 0.4758 0.4800 0.3958 0.1087  0.0558  0.0429  1462 MET A CE  
118 N N   . LYS A 18  ? 0.4434 0.4506 0.3558 0.0921  0.0633  0.0363  1463 LYS A N   
119 C CA  . LYS A 18  ? 0.4768 0.4828 0.3904 0.0911  0.0650  0.0347  1463 LYS A CA  
120 C C   . LYS A 18  ? 0.3713 0.3774 0.2841 0.0854  0.0711  0.0293  1463 LYS A C   
121 O O   . LYS A 18  ? 0.4795 0.4831 0.3973 0.0861  0.0744  0.0267  1463 LYS A O   
122 C CB  . LYS A 18  ? 0.4945 0.5029 0.4056 0.0894  0.0614  0.0383  1463 LYS A CB  
123 C CG  . LYS A 18  ? 0.6130 0.6204 0.5277 0.0948  0.0570  0.0426  1463 LYS A CG  
124 C CD  . LYS A 18  ? 1.0235 1.0349 0.9381 0.0923  0.0532  0.0480  1463 LYS A CD  
125 C CE  . LYS A 18  ? 1.0196 1.0325 0.9326 0.0888  0.0530  0.0486  1463 LYS A CE  
126 N NZ  . LYS A 18  ? 1.3997 1.4087 1.3168 0.0937  0.0528  0.0479  1463 LYS A NZ  
127 N N   . LYS A 19  ? 0.4590 0.4686 0.3659 0.0786  0.0727  0.0279  1464 LYS A N   
128 C CA  . LYS A 19  ? 0.4577 0.4677 0.3631 0.0714  0.0798  0.0214  1464 LYS A CA  
129 C C   . LYS A 19  ? 0.4450 0.4503 0.3599 0.0748  0.0858  0.0169  1464 LYS A C   
130 O O   . LYS A 19  ? 0.3786 0.3814 0.2995 0.0726  0.0925  0.0118  1464 LYS A O   
131 C CB  . LYS A 19  ? 0.5242 0.5399 0.4201 0.0622  0.0801  0.0209  1464 LYS A CB  
132 C CG  . LYS A 19  ? 1.0391 1.0610 0.9269 0.0546  0.0765  0.0244  1464 LYS A CG  
133 C CD  . LYS A 19  ? 1.3245 1.3540 1.2027 0.0438  0.0759  0.0253  1464 LYS A CD  
134 C CE  . LYS A 19  ? 1.2121 1.2494 1.0832 0.0356  0.0712  0.0309  1464 LYS A CE  
135 N NZ  . LYS A 19  ? 1.1416 1.1873 1.0081 0.0303  0.0646  0.0391  1464 LYS A NZ  
136 N N   . ILE A 20  ? 0.4140 0.4181 0.3319 0.0801  0.0836  0.0192  1465 ILE A N   
137 C CA  . ILE A 20  ? 0.3910 0.3918 0.3191 0.0832  0.0884  0.0166  1465 ILE A CA  
138 C C   . ILE A 20  ? 0.3661 0.3639 0.3055 0.0888  0.0887  0.0183  1465 ILE A C   
139 O O   . ILE A 20  ? 0.4017 0.3972 0.3522 0.0882  0.0951  0.0152  1465 ILE A O   
140 C CB  . ILE A 20  ? 0.3758 0.3769 0.3036 0.0877  0.0845  0.0199  1465 ILE A CB  
141 C CG1 . ILE A 20  ? 0.4228 0.4270 0.3421 0.0817  0.0855  0.0179  1465 ILE A CG1 
142 C CG2 . ILE A 20  ? 0.3820 0.3804 0.3219 0.0913  0.0883  0.0191  1465 ILE A CG2 
143 C CD1 . ILE A 20  ? 0.3836 0.3885 0.3017 0.0859  0.0811  0.0216  1465 ILE A CD1 
144 N N   . VAL A 21  ? 0.3644 0.3626 0.3017 0.0935  0.0820  0.0235  1466 VAL A N   
145 C CA  . VAL A 21  ? 0.3590 0.3556 0.3054 0.0979  0.0811  0.0262  1466 VAL A CA  
146 C C   . VAL A 21  ? 0.3678 0.3634 0.3171 0.0948  0.0851  0.0233  1466 VAL A C   
147 O O   . VAL A 21  ? 0.4068 0.4008 0.3682 0.0963  0.0884  0.0235  1466 VAL A O   
148 C CB  . VAL A 21  ? 0.4370 0.4346 0.3787 0.1019  0.0738  0.0312  1466 VAL A CB  
149 C CG1 . VAL A 21  ? 0.4306 0.4277 0.3798 0.1046  0.0726  0.0340  1466 VAL A CG1 
150 C CG2 . VAL A 21  ? 0.4299 0.4283 0.3705 0.1048  0.0707  0.0337  1466 VAL A CG2 
151 N N   . ASP A 22  ? 0.4589 0.4560 0.3984 0.0901  0.0848  0.0213  1467 ASP A N   
152 C CA  . ASP A 22  ? 0.5203 0.5166 0.4617 0.0858  0.0897  0.0174  1467 ASP A CA  
153 C C   . ASP A 22  ? 0.5109 0.5052 0.4611 0.0815  0.0995  0.0109  1467 ASP A C   
154 O O   . ASP A 22  ? 0.4792 0.4713 0.4398 0.0816  0.1042  0.0090  1467 ASP A O   
155 C CB  . ASP A 22  ? 0.4811 0.4806 0.4099 0.0800  0.0876  0.0169  1467 ASP A CB  
156 C CG  . ASP A 22  ? 0.7350 0.7353 0.6604 0.0839  0.0804  0.0224  1467 ASP A CG  
157 O OD1 . ASP A 22  ? 0.7372 0.7353 0.6694 0.0899  0.0784  0.0250  1467 ASP A OD1 
158 O OD2 . ASP A 22  ? 1.0661 1.0698 0.9828 0.0805  0.0767  0.0245  1467 ASP A OD2 
159 N N   . ALA A 23  ? 0.4105 0.4054 0.3583 0.0774  0.1035  0.0070  1468 ALA A N   
160 C CA  . ALA A 23  ? 0.4469 0.4393 0.4055 0.0731  0.1143  -0.0001 1468 ALA A CA  
161 C C   . ALA A 23  ? 0.4474 0.4365 0.4258 0.0798  0.1168  0.0024  1468 ALA A C   
162 O O   . ALA A 23  ? 0.3680 0.3544 0.3612 0.0780  0.1256  -0.0017 1468 ALA A O   
163 C CB  . ALA A 23  ? 0.4591 0.4530 0.4106 0.0666  0.1183  -0.0050 1468 ALA A CB  
164 N N   . VAL A 24  ? 0.3888 0.3789 0.3687 0.0868  0.1095  0.0096  1469 VAL A N   
165 C CA  . VAL A 24  ? 0.3348 0.3239 0.3327 0.0927  0.1096  0.0146  1469 VAL A CA  
166 C C   . VAL A 24  ? 0.3283 0.3169 0.3361 0.0950  0.1089  0.0181  1469 VAL A C   
167 O O   . VAL A 24  ? 0.3583 0.3455 0.3855 0.0963  0.1140  0.0192  1469 VAL A O   
168 C CB  . VAL A 24  ? 0.3545 0.3459 0.3482 0.0979  0.1011  0.0214  1469 VAL A CB  
169 C CG1 . VAL A 24  ? 0.3518 0.3440 0.3633 0.1028  0.0996  0.0287  1469 VAL A CG1 
170 C CG2 . VAL A 24  ? 0.4026 0.3941 0.3895 0.0954  0.1031  0.0177  1469 VAL A CG2 
171 N N   . ILE A 25  ? 0.3883 0.3783 0.3835 0.0958  0.1022  0.0204  1470 ILE A N   
172 C CA  . ILE A 25  ? 0.3543 0.3442 0.3561 0.0979  0.1004  0.0240  1470 ILE A CA  
173 C C   . ILE A 25  ? 0.3817 0.3690 0.3921 0.0935  0.1097  0.0176  1470 ILE A C   
174 O O   . ILE A 25  ? 0.4588 0.4452 0.4866 0.0954  0.1126  0.0201  1470 ILE A O   
175 C CB  . ILE A 25  ? 0.3636 0.3554 0.3491 0.0992  0.0919  0.0269  1470 ILE A CB  
176 C CG1 . ILE A 25  ? 0.3513 0.3454 0.3333 0.1035  0.0841  0.0333  1470 ILE A CG1 
177 C CG2 . ILE A 25  ? 0.4821 0.4734 0.4712 0.0992  0.0918  0.0278  1470 ILE A CG2 
178 C CD1 . ILE A 25  ? 0.4371 0.4323 0.4045 0.1042  0.0774  0.0348  1470 ILE A CD1 
179 N N   . LYS A 26  ? 0.3994 0.3859 0.3991 0.0869  0.1149  0.0096  1471 LYS A N   
180 C CA  . LYS A 26  ? 0.5127 0.4970 0.5180 0.0807  0.1247  0.0019  1471 LYS A CA  
181 C C   . LYS A 26  ? 0.4771 0.4582 0.5034 0.0788  0.1364  -0.0029 1471 LYS A C   
182 O O   . LYS A 26  ? 0.4652 0.4436 0.5020 0.0746  0.1458  -0.0089 1471 LYS A O   
183 C CB  . LYS A 26  ? 0.5721 0.5581 0.5580 0.0720  0.1264  -0.0048 1471 LYS A CB  
184 C CG  . LYS A 26  ? 0.8442 0.8337 0.8119 0.0723  0.1165  -0.0004 1471 LYS A CG  
185 C CD  . LYS A 26  ? 1.1372 1.1262 1.1067 0.0749  0.1134  0.0025  1471 LYS A CD  
186 C CE  . LYS A 26  ? 1.5776 1.5695 1.5336 0.0783  0.1023  0.0091  1471 LYS A CE  
187 N NZ  . LYS A 26  ? 1.3400 1.3355 1.2803 0.0735  0.0990  0.0088  1471 LYS A NZ  
188 N N   . TYR A 27  ? 0.2950 0.3729 0.3793 0.0134  0.0398  -0.0111 1472 TYR A N   
189 C CA  . TYR A 27  ? 0.3193 0.3766 0.3853 0.0112  0.0465  -0.0155 1472 TYR A CA  
190 C C   . TYR A 27  ? 0.4315 0.4752 0.5075 0.0217  0.0488  -0.0075 1472 TYR A C   
191 O O   . TYR A 27  ? 0.3172 0.3625 0.4081 0.0244  0.0419  -0.0025 1472 TYR A O   
192 C CB  . TYR A 27  ? 0.3621 0.4067 0.4087 -0.0003 0.0446  -0.0237 1472 TYR A CB  
193 C CG  . TYR A 27  ? 0.3767 0.3926 0.3998 -0.0038 0.0532  -0.0287 1472 TYR A CG  
194 C CD1 . TYR A 27  ? 0.4345 0.4262 0.4541 0.0018  0.0548  -0.0247 1472 TYR A CD1 
195 C CD2 . TYR A 27  ? 0.4711 0.4829 0.4735 -0.0118 0.0603  -0.0373 1472 TYR A CD2 
196 C CE1 . TYR A 27  ? 0.5035 0.4631 0.4974 0.0007  0.0652  -0.0284 1472 TYR A CE1 
197 C CE2 . TYR A 27  ? 0.5560 0.5350 0.5324 -0.0157 0.0696  -0.0429 1472 TYR A CE2 
198 C CZ  . TYR A 27  ? 0.5161 0.4669 0.4874 -0.0091 0.0729  -0.0382 1472 TYR A CZ  
199 O OH  . TYR A 27  ? 0.6485 0.5610 0.5892 -0.0119 0.0847  -0.0437 1472 TYR A OH  
200 N N   . LYS A 28  ? 0.4184 0.4497 0.4837 0.0278  0.0588  -0.0068 1473 LYS A N   
201 C CA  . LYS A 28  ? 0.3936 0.4139 0.4652 0.0409  0.0639  0.0019  1473 LYS A CA  
202 C C   . LYS A 28  ? 0.3852 0.3721 0.4266 0.0425  0.0738  -0.0025 1473 LYS A C   
203 O O   . LYS A 28  ? 0.5233 0.4954 0.5393 0.0353  0.0804  -0.0120 1473 LYS A O   
204 C CB  . LYS A 28  ? 0.3978 0.4343 0.4871 0.0520  0.0691  0.0110  1473 LYS A CB  
205 C CG  . LYS A 28  ? 0.4393 0.5014 0.5613 0.0531  0.0613  0.0194  1473 LYS A CG  
206 C CD  . LYS A 28  ? 0.5518 0.6299 0.6872 0.0608  0.0682  0.0270  1473 LYS A CD  
207 N N   . ASP A 29  ? 0.4458 0.4205 0.4888 0.0519  0.0745  0.0043  1474 ASP A N   
208 C CA  . ASP A 29  ? 0.5811 0.5196 0.5948 0.0584  0.0865  0.0033  1474 ASP A CA  
209 C C   . ASP A 29  ? 0.6547 0.5900 0.6632 0.0696  0.0976  0.0064  1474 ASP A C   
210 O O   . ASP A 29  ? 0.5086 0.4689 0.5442 0.0817  0.0963  0.0178  1474 ASP A O   
211 C CB  . ASP A 29  ? 0.5836 0.5210 0.6076 0.0726  0.0849  0.0149  1474 ASP A CB  
212 C CG  . ASP A 29  ? 0.7384 0.6398 0.7341 0.0862  0.0994  0.0182  1474 ASP A CG  
213 O OD1 . ASP A 29  ? 0.6778 0.5447 0.6421 0.0776  0.1053  0.0096  1474 ASP A OD1 
214 O OD2 . ASP A 29  ? 0.6654 0.5730 0.6699 0.1058  0.1056  0.0302  1474 ASP A OD2 
215 N N   . SER A 30  ? 0.6913 0.5975 0.6658 0.0651  0.1085  -0.0035 1475 SER A N   
216 C CA  . SER A 30  ? 1.2130 1.1151 1.1787 0.0767  0.1197  -0.0016 1475 SER A CA  
217 C C   . SER A 30  ? 1.0675 0.9624 1.0370 0.1016  0.1296  0.0129  1475 SER A C   
218 O O   . SER A 30  ? 0.7888 0.6960 0.7659 0.1142  0.1359  0.0195  1475 SER A O   
219 C CB  . SER A 30  ? 1.0149 0.8845 0.9389 0.0652  0.1291  -0.0173 1475 SER A CB  
220 O OG  . SER A 30  ? 1.0630 0.9082 0.9648 0.0474  0.1276  -0.0283 1475 SER A OG  
221 N N   . SER A 31  ? 0.7645 0.6430 0.7294 0.1101  0.1314  0.0192  1476 SER A N   
222 C CA  . SER A 31  ? 1.0225 0.8988 0.9908 0.1359  0.1409  0.0346  1476 SER A CA  
223 C C   . SER A 31  ? 0.8814 0.8077 0.8972 0.1459  0.1313  0.0506  1476 SER A C   
224 O O   . SER A 31  ? 0.8119 0.7549 0.8405 0.1627  0.1384  0.0621  1476 SER A O   
225 C CB  . SER A 31  ? 1.1162 0.9549 1.0573 0.1441  0.1484  0.0365  1476 SER A CB  
226 O OG  . SER A 31  ? 1.3144 1.1579 1.2610 0.1721  0.1575  0.0537  1476 SER A OG  
227 N N   . SER A 32  ? 0.4677 0.4167 0.5076 0.1355  0.1159  0.0512  1477 SER A N   
228 C CA  . SER A 32  ? 0.7054 0.6990 0.7876 0.1414  0.1057  0.0646  1477 SER A CA  
229 C C   . SER A 32  ? 0.4846 0.5102 0.5965 0.1278  0.0962  0.0627  1477 SER A C   
230 O O   . SER A 32  ? 0.5585 0.6199 0.7052 0.1317  0.0913  0.0740  1477 SER A O   
231 C CB  . SER A 32  ? 0.7321 0.7314 0.8215 0.1389  0.0944  0.0663  1477 SER A CB  
232 O OG  . SER A 32  ? 0.5077 0.5004 0.5926 0.1178  0.0833  0.0532  1477 SER A OG  
233 N N   . GLY A 33  ? 0.5454 0.5589 0.6434 0.1115  0.0937  0.0492  1478 GLY A N   
234 C CA  . GLY A 33  ? 0.5327 0.5715 0.6533 0.0988  0.0848  0.0467  1478 GLY A CA  
235 C C   . GLY A 33  ? 0.4927 0.5466 0.6324 0.0870  0.0695  0.0452  1478 GLY A C   
236 O O   . GLY A 33  ? 0.4004 0.4727 0.5587 0.0785  0.0630  0.0447  1478 GLY A O   
237 N N   . ARG A 34  ? 0.4064 0.4503 0.5390 0.0882  0.0649  0.0448  1479 ARG A N   
238 C CA  . ARG A 34  ? 0.3882 0.4455 0.5362 0.0789  0.0502  0.0433  1479 ARG A CA  
239 C C   . ARG A 34  ? 0.3831 0.4319 0.5189 0.0635  0.0461  0.0309  1479 ARG A C   
240 O O   . ARG A 34  ? 0.3681 0.3950 0.4767 0.0597  0.0528  0.0227  1479 ARG A O   
241 C CB  . ARG A 34  ? 0.5713 0.6152 0.7059 0.0858  0.0490  0.0451  1479 ARG A CB  
242 C CG  . ARG A 34  ? 0.7062 0.7673 0.8571 0.0809  0.0342  0.0460  1479 ARG A CG  
243 C CD  . ARG A 34  ? 0.9886 1.0369 1.1236 0.0920  0.0355  0.0499  1479 ARG A CD  
244 N NE  . ARG A 34  ? 0.5944 0.6066 0.6949 0.0873  0.0413  0.0409  1479 ARG A NE  
245 C CZ  . ARG A 34  ? 0.6041 0.5842 0.6758 0.0956  0.0559  0.0411  1479 ARG A CZ  
246 N NH1 . ARG A 34  ? 0.7570 0.7338 0.8265 0.1123  0.0675  0.0502  1479 ARG A NH1 
247 N NH2 . ARG A 34  ? 0.5131 0.4628 0.5564 0.0873  0.0598  0.0326  1479 ARG A NH2 
248 N N   . GLN A 35  ? 0.3829 0.4500 0.5382 0.0547  0.0365  0.0301  1480 GLN A N   
249 C CA  . GLN A 35  ? 0.3450 0.4076 0.4895 0.0427  0.0314  0.0202  1480 GLN A CA  
250 C C   . GLN A 35  ? 0.3107 0.3631 0.4445 0.0391  0.0238  0.0159  1480 GLN A C   
251 O O   . GLN A 35  ? 0.3440 0.4061 0.4926 0.0396  0.0141  0.0193  1480 GLN A O   
252 C CB  . GLN A 35  ? 0.3778 0.4585 0.5440 0.0384  0.0260  0.0226  1480 GLN A CB  
253 C CG  . GLN A 35  ? 0.3764 0.4555 0.5329 0.0295  0.0213  0.0146  1480 GLN A CG  
254 C CD  . GLN A 35  ? 0.4679 0.5582 0.6431 0.0269  0.0169  0.0180  1480 GLN A CD  
255 O OE1 . GLN A 35  ? 0.5833 0.6825 0.7728 0.0302  0.0224  0.0247  1480 GLN A OE1 
256 N NE2 . GLN A 35  ? 0.4646 0.5519 0.6381 0.0211  0.0078  0.0136  1480 GLN A NE2 
257 N N   . LEU A 36  ? 0.3433 0.3759 0.4504 0.0349  0.0285  0.0085  1481 LEU A N   
258 C CA  . LEU A 36  ? 0.3952 0.4163 0.4904 0.0328  0.0234  0.0059  1481 LEU A CA  
259 C C   . LEU A 36  ? 0.2957 0.3301 0.4021 0.0269  0.0106  0.0039  1481 LEU A C   
260 O O   . LEU A 36  ? 0.3362 0.3695 0.4430 0.0294  0.0032  0.0054  1481 LEU A O   
261 C CB  . LEU A 36  ? 0.3607 0.3606 0.4269 0.0248  0.0305  -0.0022 1481 LEU A CB  
262 C CG  . LEU A 36  ? 0.5421 0.5148 0.5876 0.0316  0.0430  -0.0006 1481 LEU A CG  
263 C CD1 . LEU A 36  ? 0.5069 0.4816 0.5595 0.0428  0.0509  0.0054  1481 LEU A CD1 
264 C CD2 . LEU A 36  ? 0.5034 0.4545 0.5196 0.0184  0.0506  -0.0109 1481 LEU A CD2 
265 N N   . SER A 37  ? 0.3695 0.4150 0.4820 0.0209  0.0088  0.0006  1482 SER A N   
266 C CA  . SER A 37  ? 0.3257 0.3789 0.4428 0.0160  -0.0005 -0.0024 1482 SER A CA  
267 C C   . SER A 37  ? 0.4396 0.5017 0.5773 0.0180  -0.0095 0.0019  1482 SER A C   
268 O O   . SER A 37  ? 0.2890 0.3513 0.4264 0.0147  -0.0182 -0.0011 1482 SER A O   
269 C CB  . SER A 37  ? 0.2862 0.3482 0.4023 0.0124  0.0025  -0.0051 1482 SER A CB  
270 O OG  . SER A 37  ? 0.2823 0.3538 0.4170 0.0158  0.0046  0.0004  1482 SER A OG  
271 N N   . GLU A 38  ? 0.4128 0.4831 0.5679 0.0229  -0.0076 0.0091  1483 GLU A N   
272 C CA  . GLU A 38  ? 0.3010 0.3850 0.4795 0.0206  -0.0155 0.0129  1483 GLU A CA  
273 C C   . GLU A 38  ? 0.2885 0.3739 0.4673 0.0182  -0.0281 0.0104  1483 GLU A C   
274 O O   . GLU A 38  ? 0.4589 0.5495 0.6491 0.0115  -0.0362 0.0087  1483 GLU A O   
275 C CB  . GLU A 38  ? 0.3589 0.4578 0.5591 0.0259  -0.0110 0.0227  1483 GLU A CB  
276 C CG  . GLU A 38  ? 0.4919 0.5953 0.6926 0.0356  -0.0104 0.0286  1483 GLU A CG  
277 C CD  . GLU A 38  ? 0.3953 0.5250 0.6251 0.0381  -0.0139 0.0385  1483 GLU A CD  
278 O OE1 . GLU A 38  ? 0.3227 0.4649 0.5724 0.0340  -0.0113 0.0428  1483 GLU A OE1 
279 O OE2 . GLU A 38  ? 0.2970 0.4372 0.5300 0.0438  -0.0196 0.0423  1483 GLU A OE2 
280 N N   . VAL A 39  ? 0.2885 0.3680 0.4538 0.0237  -0.0291 0.0103  1484 VAL A N   
281 C CA  . VAL A 39  ? 0.3325 0.4157 0.4962 0.0234  -0.0413 0.0084  1484 VAL A CA  
282 C C   . VAL A 39  ? 0.3694 0.4396 0.5145 0.0183  -0.0464 -0.0002 1484 VAL A C   
283 O O   . VAL A 39  ? 0.3313 0.4031 0.4730 0.0171  -0.0574 -0.0035 1484 VAL A O   
284 C CB  . VAL A 39  ? 0.4182 0.5004 0.5733 0.0343  -0.0393 0.0137  1484 VAL A CB  
285 C CG1 . VAL A 39  ? 0.4657 0.5648 0.6401 0.0418  -0.0352 0.0236  1484 VAL A CG1 
286 C CG2 . VAL A 39  ? 0.4280 0.4864 0.5563 0.0368  -0.0284 0.0111  1484 VAL A CG2 
287 N N   . PHE A 40  ? 0.3699 0.4299 0.5024 0.0160  -0.0382 -0.0036 1485 PHE A N   
288 C CA  . PHE A 40  ? 0.3791 0.4299 0.4927 0.0131  -0.0397 -0.0102 1485 PHE A CA  
289 C C   . PHE A 40  ? 0.3667 0.4185 0.4848 0.0091  -0.0410 -0.0131 1485 PHE A C   
290 O O   . PHE A 40  ? 0.4522 0.4987 0.5555 0.0088  -0.0414 -0.0173 1485 PHE A O   
291 C CB  . PHE A 40  ? 0.2916 0.3346 0.3868 0.0128  -0.0295 -0.0116 1485 PHE A CB  
292 C CG  . PHE A 40  ? 0.3346 0.3682 0.4202 0.0172  -0.0252 -0.0084 1485 PHE A CG  
293 C CD1 . PHE A 40  ? 0.4762 0.5032 0.5497 0.0206  -0.0299 -0.0084 1485 PHE A CD1 
294 C CD2 . PHE A 40  ? 0.3624 0.3908 0.4479 0.0194  -0.0151 -0.0051 1485 PHE A CD2 
295 C CE1 . PHE A 40  ? 0.5664 0.5813 0.6283 0.0267  -0.0239 -0.0040 1485 PHE A CE1 
296 C CE2 . PHE A 40  ? 0.3985 0.4124 0.4711 0.0252  -0.0089 -0.0017 1485 PHE A CE2 
297 C CZ  . PHE A 40  ? 0.4069 0.4135 0.4675 0.0290  -0.0129 -0.0007 1485 PHE A CZ  
298 N N   . ILE A 41  ? 0.3395 0.3974 0.4767 0.0070  -0.0401 -0.0097 1486 ILE A N   
299 C CA  . ILE A 41  ? 0.3854 0.4395 0.5248 0.0044  -0.0389 -0.0111 1486 ILE A CA  
300 C C   . ILE A 41  ? 0.4540 0.4978 0.5867 0.0011  -0.0486 -0.0166 1486 ILE A C   
301 O O   . ILE A 41  ? 0.3719 0.4054 0.4892 0.0031  -0.0472 -0.0201 1486 ILE A O   
302 C CB  . ILE A 41  ? 0.5040 0.5653 0.6659 0.0022  -0.0346 -0.0050 1486 ILE A CB  
303 C CG1 . ILE A 41  ? 0.4035 0.4722 0.5670 0.0069  -0.0231 -0.0003 1486 ILE A CG1 
304 C CG2 . ILE A 41  ? 0.5935 0.6449 0.7559 -0.0008 -0.0335 -0.0059 1486 ILE A CG2 
305 C CD1 . ILE A 41  ? 0.3696 0.4362 0.5146 0.0097  -0.0165 -0.0033 1486 ILE A CD1 
306 N N   . GLN A 42  ? 0.4242 0.4720 0.5669 -0.0028 -0.0584 -0.0173 1487 GLN A N   
307 C CA  . GLN A 42  ? 0.3771 0.4157 0.5153 -0.0086 -0.0691 -0.0237 1487 GLN A CA  
308 C C   . GLN A 42  ? 0.3109 0.3569 0.4452 -0.0074 -0.0797 -0.0259 1487 GLN A C   
309 O O   . GLN A 42  ? 0.3123 0.3759 0.4641 -0.0088 -0.0845 -0.0217 1487 GLN A O   
310 C CB  . GLN A 42  ? 0.4253 0.4665 0.5848 -0.0189 -0.0715 -0.0223 1487 GLN A CB  
311 C CG  . GLN A 42  ? 0.6061 0.6296 0.7559 -0.0277 -0.0803 -0.0309 1487 GLN A CG  
312 C CD  . GLN A 42  ? 0.5746 0.6022 0.7466 -0.0420 -0.0837 -0.0302 1487 GLN A CD  
313 O OE1 . GLN A 42  ? 0.5415 0.5729 0.7301 -0.0439 -0.0742 -0.0230 1487 GLN A OE1 
314 N NE2 . GLN A 42  ? 0.5518 0.5801 0.7240 -0.0531 -0.0973 -0.0376 1487 GLN A NE2 
315 N N   . LEU A 43  ? 0.3866 0.4219 0.4976 -0.0030 -0.0831 -0.0312 1488 LEU A N   
316 C CA  . LEU A 43  ? 0.4066 0.4490 0.5115 0.0000  -0.0930 -0.0327 1488 LEU A CA  
317 C C   . LEU A 43  ? 0.6511 0.7000 0.7671 -0.0096 -0.1067 -0.0374 1488 LEU A C   
318 O O   . LEU A 43  ? 0.5707 0.6076 0.6880 -0.0185 -0.1081 -0.0423 1488 LEU A O   
319 C CB  . LEU A 43  ? 0.6577 0.6869 0.7342 0.0065  -0.0937 -0.0374 1488 LEU A CB  
320 C CG  . LEU A 43  ? 0.7203 0.7499 0.7850 0.0143  -0.0843 -0.0327 1488 LEU A CG  
321 C CD1 . LEU A 43  ? 0.5812 0.6001 0.6200 0.0194  -0.0842 -0.0366 1488 LEU A CD1 
322 C CD2 . LEU A 43  ? 0.6400 0.6800 0.7102 0.0190  -0.0854 -0.0269 1488 LEU A CD2 
323 N N   . PRO A 44  ? 0.4955 0.5636 0.6181 -0.0080 -0.1165 -0.0357 1489 PRO A N   
324 C CA  . PRO A 44  ? 0.5314 0.6128 0.6658 -0.0192 -0.1310 -0.0406 1489 PRO A CA  
325 C C   . PRO A 44  ? 0.5490 0.6122 0.6581 -0.0224 -0.1408 -0.0525 1489 PRO A C   
326 O O   . PRO A 44  ? 0.5223 0.5679 0.6063 -0.0124 -0.1363 -0.0545 1489 PRO A O   
327 C CB  . PRO A 44  ? 0.7495 0.8618 0.8965 -0.0119 -0.1363 -0.0328 1489 PRO A CB  
328 C CG  . PRO A 44  ? 0.7620 0.8656 0.8911 0.0042  -0.1268 -0.0272 1489 PRO A CG  
329 C CD  . PRO A 44  ? 0.5624 0.6397 0.6779 0.0046  -0.1144 -0.0294 1489 PRO A CD  
330 N N   . SER A 45  ? 0.8782 0.9444 0.9922 -0.0367 -0.1532 -0.0607 1490 SER A N   
331 C CA  . SER A 45  ? 0.9060 0.9487 0.9923 -0.0408 -0.1618 -0.0738 1490 SER A CA  
332 C C   . SER A 45  ? 0.8499 0.9017 0.9165 -0.0289 -0.1706 -0.0756 1490 SER A C   
333 O O   . SER A 45  ? 0.7458 0.8270 0.8246 -0.0215 -0.1740 -0.0677 1490 SER A O   
334 C CB  . SER A 45  ? 0.9562 0.9971 1.0508 -0.0624 -0.1728 -0.0836 1490 SER A CB  
335 O OG  . SER A 45  ? 0.9257 1.0062 1.0518 -0.0718 -0.1814 -0.0788 1490 SER A OG  
336 N N   . ARG A 46  ? 1.0861 1.1115 1.1204 -0.0246 -0.1725 -0.0847 1491 ARG A N   
337 C CA  . ARG A 46  ? 1.0075 1.0400 1.0205 -0.0144 -0.1820 -0.0877 1491 ARG A CA  
338 C C   . ARG A 46  ? 0.8861 0.9445 0.9089 -0.0256 -0.2006 -0.0938 1491 ARG A C   
339 O O   . ARG A 46  ? 0.6651 0.7491 0.6861 -0.0158 -0.2084 -0.0899 1491 ARG A O   
340 C CB  . ARG A 46  ? 1.3599 1.3591 1.3352 -0.0074 -0.1802 -0.0965 1491 ARG A CB  
341 C CG  . ARG A 46  ? 1.3814 1.3845 1.3318 -0.0018 -0.1941 -0.1041 1491 ARG A CG  
342 C CD  . ARG A 46  ? 1.3823 1.3729 1.3037 0.0175  -0.1866 -0.1007 1491 ARG A CD  
343 N NE  . ARG A 46  ? 1.7481 1.7094 1.6548 0.0220  -0.1724 -0.1009 1491 ARG A NE  
344 C CZ  . ARG A 46  ? 1.4164 1.3667 1.2987 0.0372  -0.1639 -0.0978 1491 ARG A CZ  
345 N NH1 . ARG A 46  ? 1.0745 1.0361 0.9427 0.0492  -0.1674 -0.0945 1491 ARG A NH1 
346 N NH2 . ARG A 46  ? 1.2815 1.2111 1.1533 0.0414  -0.1513 -0.0970 1491 ARG A NH2 
347 N N   . LYS A 47  ? 1.0073 1.0612 1.0407 -0.0463 -0.2073 -0.1027 1492 LYS A N   
348 C CA  . LYS A 47  ? 1.0457 1.1313 1.0936 -0.0613 -0.2255 -0.1085 1492 LYS A CA  
349 C C   . LYS A 47  ? 0.9450 1.0797 1.0284 -0.0571 -0.2267 -0.0939 1492 LYS A C   
350 O O   . LYS A 47  ? 0.8323 1.0023 0.9188 -0.0534 -0.2398 -0.0929 1492 LYS A O   
351 C CB  . LYS A 47  ? 1.3202 1.3879 1.3717 -0.0879 -0.2310 -0.1214 1492 LYS A CB  
352 C CG  . LYS A 47  ? 1.4558 1.5162 1.5339 -0.0987 -0.2182 -0.1147 1492 LYS A CG  
353 C CD  . LYS A 47  ? 1.1533 1.2000 1.2356 -0.1275 -0.2253 -0.1272 1492 LYS A CD  
354 N N   . GLU A 48  ? 0.8062 0.9435 0.9136 -0.0553 -0.2124 -0.0823 1493 GLU A N   
355 C CA  . GLU A 48  ? 0.7746 0.9539 0.9133 -0.0482 -0.2101 -0.0670 1493 GLU A CA  
356 C C   . GLU A 48  ? 0.6482 0.8364 0.7768 -0.0226 -0.2035 -0.0553 1493 GLU A C   
357 O O   . GLU A 48  ? 0.8572 1.0829 1.0009 -0.0134 -0.2072 -0.0452 1493 GLU A O   
358 C CB  . GLU A 48  ? 0.8890 1.0645 1.0533 -0.0539 -0.1959 -0.0589 1493 GLU A CB  
359 C CG  . GLU A 48  ? 0.6614 0.8649 0.8468 -0.0386 -0.1866 -0.0418 1493 GLU A CG  
360 N N   . LEU A 49  ? 0.6340 0.7882 0.7368 -0.0109 -0.1927 -0.0559 1494 LEU A N   
361 C CA  . LEU A 49  ? 0.6773 0.8325 0.7677 0.0106  -0.1840 -0.0452 1494 LEU A CA  
362 C C   . LEU A 49  ? 0.7060 0.8357 0.7603 0.0192  -0.1848 -0.0519 1494 LEU A C   
363 O O   . LEU A 49  ? 0.5818 0.6871 0.6209 0.0278  -0.1711 -0.0486 1494 LEU A O   
364 C CB  . LEU A 49  ? 0.7440 0.8865 0.8442 0.0161  -0.1649 -0.0352 1494 LEU A CB  
365 C CG  . LEU A 49  ? 0.8239 0.9794 0.9283 0.0335  -0.1551 -0.0205 1494 LEU A CG  
366 C CD1 . LEU A 49  ? 0.6209 0.7511 0.7217 0.0369  -0.1362 -0.0157 1494 LEU A CD1 
367 C CD2 . LEU A 49  ? 0.7521 0.9119 0.8342 0.0497  -0.1588 -0.0171 1494 LEU A CD2 
368 N N   . PRO A 50  ? 0.6542 0.7925 0.6944 0.0169  -0.2009 -0.0611 1495 PRO A N   
369 C CA  . PRO A 50  ? 0.7120 0.8284 0.7164 0.0259  -0.2028 -0.0677 1495 PRO A CA  
370 C C   . PRO A 50  ? 0.6023 0.7124 0.5908 0.0467  -0.1904 -0.0561 1495 PRO A C   
371 O O   . PRO A 50  ? 0.7102 0.7927 0.6764 0.0520  -0.1812 -0.0578 1495 PRO A O   
372 C CB  . PRO A 50  ? 0.9990 1.1398 0.9965 0.0230  -0.2233 -0.0758 1495 PRO A CB  
373 C CG  . PRO A 50  ? 0.7964 0.9698 0.8272 0.0071  -0.2330 -0.0760 1495 PRO A CG  
374 C CD  . PRO A 50  ? 0.7847 0.9617 0.8428 0.0083  -0.2180 -0.0633 1495 PRO A CD  
375 N N   . GLU A 51  ? 0.5409 0.6759 0.5403 0.0584  -0.1889 -0.0437 1496 GLU A N   
376 C CA  . GLU A 51  ? 0.6530 0.7787 0.6374 0.0772  -0.1748 -0.0313 1496 GLU A CA  
377 C C   . GLU A 51  ? 0.7948 0.8914 0.7777 0.0755  -0.1554 -0.0276 1496 GLU A C   
378 O O   . GLU A 51  ? 0.6547 0.7338 0.6173 0.0856  -0.1439 -0.0221 1496 GLU A O   
379 C CB  . GLU A 51  ? 0.6673 0.8219 0.6653 0.0903  -0.1740 -0.0174 1496 GLU A CB  
380 C CG  . GLU A 51  ? 0.7809 0.9491 0.8104 0.0849  -0.1679 -0.0105 1496 GLU A CG  
381 C CD  . GLU A 51  ? 1.0547 1.2602 1.1115 0.0729  -0.1842 -0.0144 1496 GLU A CD  
382 O OE1 . GLU A 51  ? 0.7840 0.9949 0.8385 0.0590  -0.1999 -0.0279 1496 GLU A OE1 
383 O OE2 . GLU A 51  ? 1.0877 1.3167 1.1679 0.0767  -0.1805 -0.0040 1496 GLU A OE2 
384 N N   . TYR A 52  ? 0.5733 0.6662 0.5770 0.0620  -0.1517 -0.0304 1497 TYR A N   
385 C CA  . TYR A 52  ? 0.5007 0.5707 0.5028 0.0593  -0.1349 -0.0280 1497 TYR A CA  
386 C C   . TYR A 52  ? 0.6410 0.6897 0.6182 0.0596  -0.1327 -0.0348 1497 TYR A C   
387 O O   . TYR A 52  ? 0.5625 0.5984 0.5243 0.0659  -0.1209 -0.0299 1497 TYR A O   
388 C CB  . TYR A 52  ? 0.5188 0.5898 0.5452 0.0457  -0.1326 -0.0307 1497 TYR A CB  
389 C CG  . TYR A 52  ? 0.5321 0.5861 0.5576 0.0443  -0.1161 -0.0274 1497 TYR A CG  
390 C CD1 . TYR A 52  ? 0.4552 0.5102 0.4883 0.0489  -0.1042 -0.0179 1497 TYR A CD1 
391 C CD2 . TYR A 52  ? 0.6481 0.6853 0.6622 0.0394  -0.1119 -0.0336 1497 TYR A CD2 
392 C CE1 . TYR A 52  ? 0.4863 0.5269 0.5163 0.0455  -0.0900 -0.0165 1497 TYR A CE1 
393 C CE2 . TYR A 52  ? 0.6085 0.6366 0.6214 0.0378  -0.0979 -0.0306 1497 TYR A CE2 
394 C CZ  . TYR A 52  ? 0.4412 0.4715 0.4627 0.0394  -0.0876 -0.0229 1497 TYR A CZ  
395 O OH  . TYR A 52  ? 0.4639 0.4864 0.4827 0.0355  -0.0745 -0.0216 1497 TYR A OH  
396 N N   . TYR A 53  ? 0.5202 0.5651 0.4929 0.0521  -0.1436 -0.0460 1498 TYR A N   
397 C CA  . TYR A 53  ? 0.7634 0.7873 0.7120 0.0533  -0.1412 -0.0528 1498 TYR A CA  
398 C C   . TYR A 53  ? 0.8103 0.8316 0.7310 0.0669  -0.1431 -0.0515 1498 TYR A C   
399 O O   . TYR A 53  ? 0.8454 0.8516 0.7447 0.0716  -0.1376 -0.0537 1498 TYR A O   
400 C CB  . TYR A 53  ? 0.6880 0.7030 0.6363 0.0422  -0.1513 -0.0653 1498 TYR A CB  
401 C CG  . TYR A 53  ? 0.9155 0.9290 0.8884 0.0302  -0.1458 -0.0649 1498 TYR A CG  
402 C CD1 . TYR A 53  ? 0.6752 0.7082 0.6764 0.0217  -0.1508 -0.0621 1498 TYR A CD1 
403 C CD2 . TYR A 53  ? 0.8924 0.8880 0.8601 0.0291  -0.1347 -0.0657 1498 TYR A CD2 
404 C CE1 . TYR A 53  ? 0.6459 0.6779 0.6689 0.0120  -0.1447 -0.0606 1498 TYR A CE1 
405 C CE2 . TYR A 53  ? 0.9811 0.9756 0.9694 0.0201  -0.1288 -0.0643 1498 TYR A CE2 
406 C CZ  . TYR A 53  ? 0.8348 0.8460 0.8503 0.0113  -0.1337 -0.0619 1498 TYR A CZ  
407 O OH  . TYR A 53  ? 0.7458 0.7557 0.7806 0.0035  -0.1266 -0.0596 1498 TYR A OH  
408 N N   . GLU A 54  ? 0.9407 0.9787 0.8617 0.0748  -0.1496 -0.0464 1499 GLU A N   
409 C CA  . GLU A 54  ? 0.9952 1.0326 0.8903 0.0898  -0.1500 -0.0426 1499 GLU A CA  
410 C C   . GLU A 54  ? 0.9281 0.9548 0.8163 0.0971  -0.1313 -0.0308 1499 GLU A C   
411 O O   . GLU A 54  ? 0.8843 0.8984 0.7509 0.1026  -0.1243 -0.0301 1499 GLU A O   
412 C CB  . GLU A 54  ? 1.1345 1.1965 1.0320 0.0971  -0.1633 -0.0402 1499 GLU A CB  
413 C CG  . GLU A 54  ? 1.1379 1.2111 1.0377 0.0868  -0.1833 -0.0543 1499 GLU A CG  
414 C CD  . GLU A 54  ? 1.4391 1.5413 1.3352 0.0944  -0.1992 -0.0541 1499 GLU A CD  
415 O OE1 . GLU A 54  ? 1.4536 1.5709 1.3500 0.1097  -0.1944 -0.0408 1499 GLU A OE1 
416 O OE2 . GLU A 54  ? 1.0282 1.1381 0.9198 0.0847  -0.2163 -0.0676 1499 GLU A OE2 
417 N N   . LEU A 55  ? 0.8013 0.8318 0.7072 0.0958  -0.1223 -0.0220 1500 LEU A N   
418 C CA  . LEU A 55  ? 0.8532 0.8699 0.7524 0.0987  -0.1038 -0.0122 1500 LEU A CA  
419 C C   . LEU A 55  ? 0.6363 0.6417 0.5397 0.0868  -0.0929 -0.0152 1500 LEU A C   
420 O O   . LEU A 55  ? 0.6373 0.6326 0.5284 0.0869  -0.0798 -0.0104 1500 LEU A O   
421 C CB  . LEU A 55  ? 0.8130 0.8339 0.7252 0.1028  -0.0973 -0.0022 1500 LEU A CB  
422 C CG  . LEU A 55  ? 0.8094 0.8109 0.7122 0.1046  -0.0774 0.0074  1500 LEU A CG  
423 C CD1 . LEU A 55  ? 0.8034 0.7968 0.6803 0.1194  -0.0724 0.0157  1500 LEU A CD1 
424 C CD2 . LEU A 55  ? 0.9032 0.9039 0.8219 0.1045  -0.0701 0.0138  1500 LEU A CD2 
425 N N   . ILE A 56  ? 0.6420 0.6512 0.5628 0.0761  -0.0976 -0.0225 1501 ILE A N   
426 C CA  . ILE A 56  ? 0.4955 0.4987 0.4218 0.0667  -0.0872 -0.0240 1501 ILE A CA  
427 C C   . ILE A 56  ? 0.5300 0.5294 0.4453 0.0661  -0.0914 -0.0320 1501 ILE A C   
428 O O   . ILE A 56  ? 0.5767 0.5755 0.4990 0.0619  -0.1007 -0.0397 1501 ILE A O   
429 C CB  . ILE A 56  ? 0.5869 0.5952 0.5392 0.0572  -0.0854 -0.0242 1501 ILE A CB  
430 C CG1 . ILE A 56  ? 0.3988 0.4087 0.3595 0.0604  -0.0798 -0.0158 1501 ILE A CG1 
431 C CG2 . ILE A 56  ? 0.5722 0.5779 0.5283 0.0490  -0.0751 -0.0255 1501 ILE A CG2 
432 C CD1 . ILE A 56  ? 0.4952 0.4923 0.4416 0.0623  -0.0646 -0.0086 1501 ILE A CD1 
433 N N   . ARG A 57  ? 0.6189 0.7225 0.5132 0.1954  -0.0247 -0.0559 1502 ARG A N   
434 C CA  . ARG A 57  ? 0.8643 0.9675 0.7444 0.2070  -0.0308 -0.0660 1502 ARG A CA  
435 C C   . ARG A 57  ? 0.9998 1.0886 0.8940 0.1906  -0.0313 -0.0700 1502 ARG A C   
436 O O   . ARG A 57  ? 0.7299 0.8129 0.6176 0.1968  -0.0419 -0.0841 1502 ARG A O   
437 C CB  . ARG A 57  ? 0.9533 1.0713 0.8122 0.2271  -0.0176 -0.0522 1502 ARG A CB  
438 C CG  . ARG A 57  ? 1.3621 1.4960 1.2001 0.2511  -0.0215 -0.0531 1502 ARG A CG  
439 C CD  . ARG A 57  ? 1.7883 1.9303 1.6000 0.2764  -0.0320 -0.0670 1502 ARG A CD  
440 N NE  . ARG A 57  ? 1.4486 1.5998 1.2485 0.2874  -0.0160 -0.0513 1502 ARG A NE  
441 C CZ  . ARG A 57  ? 1.5069 1.6754 1.2956 0.3026  0.0004  -0.0302 1502 ARG A CZ  
442 N NH1 . ARG A 57  ? 1.3624 1.5405 1.1468 0.3109  0.0030  -0.0226 1502 ARG A NH1 
443 N NH2 . ARG A 57  ? 1.5852 1.7624 1.3682 0.3103  0.0150  -0.0153 1502 ARG A NH2 
444 N N   . LYS A 58  ? 0.5746 0.6575 0.4877 0.1709  -0.0204 -0.0585 1503 LYS A N   
445 C CA  . LYS A 58  ? 0.5439 0.6158 0.4699 0.1564  -0.0194 -0.0602 1503 LYS A CA  
446 C C   . LYS A 58  ? 0.7357 0.7988 0.6849 0.1361  -0.0211 -0.0602 1503 LYS A C   
447 O O   . LYS A 58  ? 0.5405 0.6034 0.5000 0.1244  -0.0098 -0.0487 1503 LYS A O   
448 C CB  . LYS A 58  ? 0.7301 0.8077 0.6546 0.1553  -0.0033 -0.0452 1503 LYS A CB  
449 C CG  . LYS A 58  ? 0.8752 0.9634 0.7782 0.1760  -0.0004 -0.0437 1503 LYS A CG  
450 C CD  . LYS A 58  ? 1.0874 1.1676 0.9837 0.1815  -0.0114 -0.0586 1503 LYS A CD  
451 C CE  . LYS A 58  ? 1.2348 1.3265 1.1074 0.2047  -0.0085 -0.0575 1503 LYS A CE  
452 N NZ  . LYS A 58  ? 1.0503 1.1506 0.9262 0.2022  0.0069  -0.0421 1503 LYS A NZ  
453 N N   . PRO A 59  ? 0.6870 0.7437 0.6450 0.1327  -0.0356 -0.0734 1504 PRO A N   
454 C CA  . PRO A 59  ? 0.6578 0.7090 0.6381 0.1154  -0.0365 -0.0718 1504 PRO A CA  
455 C C   . PRO A 59  ? 0.5134 0.5553 0.5072 0.1019  -0.0327 -0.0694 1504 PRO A C   
456 O O   . PRO A 59  ? 0.5593 0.5957 0.5480 0.1056  -0.0350 -0.0744 1504 PRO A O   
457 C CB  . PRO A 59  ? 0.6608 0.7100 0.6482 0.1174  -0.0539 -0.0867 1504 PRO A CB  
458 C CG  . PRO A 59  ? 0.7917 0.8486 0.7563 0.1381  -0.0611 -0.0951 1504 PRO A CG  
459 C CD  . PRO A 59  ? 0.7152 0.7720 0.6635 0.1462  -0.0520 -0.0901 1504 PRO A CD  
460 N N   . VAL A 60  ? 0.4371 0.4778 0.4468 0.0880  -0.0266 -0.0618 1505 VAL A N   
461 C CA  . VAL A 60  ? 0.4319 0.4666 0.4541 0.0765  -0.0222 -0.0583 1505 VAL A CA  
462 C C   . VAL A 60  ? 0.3552 0.3895 0.3967 0.0642  -0.0215 -0.0541 1505 VAL A C   
463 O O   . VAL A 60  ? 0.4012 0.4411 0.4437 0.0628  -0.0173 -0.0489 1505 VAL A O   
464 C CB  . VAL A 60  ? 0.6263 0.6645 0.6405 0.0765  -0.0099 -0.0497 1505 VAL A CB  
465 C CG1 . VAL A 60  ? 0.4115 0.4577 0.4190 0.0790  -0.0006 -0.0410 1505 VAL A CG1 
466 C CG2 . VAL A 60  ? 0.5671 0.6029 0.5946 0.0647  -0.0047 -0.0449 1505 VAL A CG2 
467 N N   . ASP A 61  ? 0.4299 0.4579 0.4869 0.0568  -0.0252 -0.0558 1506 ASP A N   
468 C CA  . ASP A 61  ? 0.3973 0.4270 0.4735 0.0461  -0.0222 -0.0491 1506 ASP A CA  
469 C C   . ASP A 61  ? 0.3410 0.3685 0.4210 0.0413  -0.0148 -0.0431 1506 ASP A C   
470 O O   . ASP A 61  ? 0.3821 0.4061 0.4515 0.0457  -0.0134 -0.0452 1506 ASP A O   
471 C CB  . ASP A 61  ? 0.3493 0.3770 0.4459 0.0418  -0.0330 -0.0538 1506 ASP A CB  
472 C CG  . ASP A 61  ? 0.4618 0.4791 0.5634 0.0440  -0.0441 -0.0640 1506 ASP A CG  
473 O OD1 . ASP A 61  ? 0.4486 0.4582 0.5458 0.0452  -0.0416 -0.0640 1506 ASP A OD1 
474 O OD2 . ASP A 61  ? 0.4327 0.4496 0.5437 0.0448  -0.0563 -0.0729 1506 ASP A OD2 
475 N N   . PHE A 62  ? 0.3402 0.3716 0.4331 0.0343  -0.0095 -0.0355 1507 PHE A N   
476 C CA  . PHE A 62  ? 0.4076 0.4392 0.5048 0.0314  -0.0029 -0.0293 1507 PHE A CA  
477 C C   . PHE A 62  ? 0.3404 0.3629 0.4486 0.0309  -0.0080 -0.0308 1507 PHE A C   
478 O O   . PHE A 62  ? 0.3096 0.3308 0.4139 0.0326  -0.0033 -0.0278 1507 PHE A O   
479 C CB  . PHE A 62  ? 0.3259 0.3656 0.4321 0.0271  0.0039  -0.0207 1507 PHE A CB  
480 C CG  . PHE A 62  ? 0.2572 0.3031 0.3512 0.0281  0.0105  -0.0196 1507 PHE A CG  
481 C CD1 . PHE A 62  ? 0.3080 0.3562 0.3915 0.0294  0.0160  -0.0195 1507 PHE A CD1 
482 C CD2 . PHE A 62  ? 0.2569 0.3059 0.3524 0.0278  0.0107  -0.0187 1507 PHE A CD2 
483 C CE1 . PHE A 62  ? 0.2984 0.3504 0.3748 0.0291  0.0210  -0.0195 1507 PHE A CE1 
484 C CE2 . PHE A 62  ? 0.2656 0.3174 0.3519 0.0287  0.0168  -0.0178 1507 PHE A CE2 
485 C CZ  . PHE A 62  ? 0.3032 0.3555 0.3809 0.0288  0.0215  -0.0188 1507 PHE A CZ  
486 N N   . LYS A 63  ? 0.4097 0.4254 0.5313 0.0294  -0.0179 -0.0362 1508 LYS A N   
487 C CA  . LYS A 63  ? 0.3536 0.3565 0.4857 0.0295  -0.0240 -0.0398 1508 LYS A CA  
488 C C   . LYS A 63  ? 0.3488 0.3450 0.4607 0.0381  -0.0255 -0.0472 1508 LYS A C   
489 O O   . LYS A 63  ? 0.4702 0.4594 0.5841 0.0395  -0.0233 -0.0449 1508 LYS A O   
490 C CB  . LYS A 63  ? 0.4998 0.4949 0.6514 0.0264  -0.0374 -0.0481 1508 LYS A CB  
491 C CG  . LYS A 63  ? 0.5740 0.5727 0.7564 0.0168  -0.0369 -0.0388 1508 LYS A CG  
492 C CD  . LYS A 63  ? 1.0227 1.0191 1.2243 0.0132  -0.0512 -0.0486 1508 LYS A CD  
493 C CE  . LYS A 63  ? 0.8805 0.8593 1.0994 0.0116  -0.0629 -0.0578 1508 LYS A CE  
494 N NZ  . LYS A 63  ? 0.8232 0.8017 1.0668 0.0064  -0.0781 -0.0677 1508 LYS A NZ  
495 N N   . LYS A 64  ? 0.3478 0.3469 0.4409 0.0450  -0.0288 -0.0550 1509 LYS A N   
496 C CA  . LYS A 64  ? 0.4780 0.4743 0.5508 0.0550  -0.0289 -0.0604 1509 LYS A CA  
497 C C   . LYS A 64  ? 0.4328 0.4375 0.4954 0.0556  -0.0169 -0.0517 1509 LYS A C   
498 O O   . LYS A 64  ? 0.5118 0.5135 0.5656 0.0617  -0.0154 -0.0528 1509 LYS A O   
499 C CB  . LYS A 64  ? 0.4483 0.4487 0.5035 0.0642  -0.0340 -0.0686 1509 LYS A CB  
500 C CG  . LYS A 64  ? 0.7578 0.7505 0.8189 0.0675  -0.0492 -0.0817 1509 LYS A CG  
501 C CD  . LYS A 64  ? 1.2087 1.2094 1.2504 0.0789  -0.0534 -0.0884 1509 LYS A CD  
502 C CE  . LYS A 64  ? 1.3057 1.3046 1.3562 0.0804  -0.0686 -0.1006 1509 LYS A CE  
503 N NZ  . LYS A 64  ? 0.8115 0.8214 0.8708 0.0746  -0.0671 -0.0952 1509 LYS A NZ  
504 N N   . ILE A 65  ? 0.4145 0.4298 0.4784 0.0501  -0.0090 -0.0441 1510 ILE A N   
505 C CA  . ILE A 65  ? 0.4015 0.4260 0.4580 0.0500  0.0008  -0.0377 1510 ILE A CA  
506 C C   . ILE A 65  ? 0.3353 0.3569 0.4003 0.0487  0.0031  -0.0332 1510 ILE A C   
507 O O   . ILE A 65  ? 0.3211 0.3455 0.3782 0.0533  0.0067  -0.0320 1510 ILE A O   
508 C CB  . ILE A 65  ? 0.3172 0.3516 0.3748 0.0446  0.0073  -0.0324 1510 ILE A CB  
509 C CG1 . ILE A 65  ? 0.3776 0.4146 0.4248 0.0482  0.0072  -0.0347 1510 ILE A CG1 
510 C CG2 . ILE A 65  ? 0.3617 0.4056 0.4173 0.0430  0.0154  -0.0274 1510 ILE A CG2 
511 C CD1 . ILE A 65  ? 0.3323 0.3745 0.3828 0.0431  0.0121  -0.0305 1510 ILE A CD1 
512 N N   . LYS A 66  ? 0.3161 0.3338 0.3982 0.0432  0.0019  -0.0293 1511 LYS A N   
513 C CA  . LYS A 66  ? 0.4401 0.4552 0.5322 0.0429  0.0053  -0.0224 1511 LYS A CA  
514 C C   . LYS A 66  ? 0.5478 0.5500 0.6370 0.0492  0.0007  -0.0273 1511 LYS A C   
515 O O   . LYS A 66  ? 0.4191 0.4234 0.5027 0.0539  0.0058  -0.0233 1511 LYS A O   
516 C CB  . LYS A 66  ? 0.3993 0.4138 0.5131 0.0363  0.0057  -0.0151 1511 LYS A CB  
517 C CG  . LYS A 66  ? 0.4498 0.4794 0.5639 0.0339  0.0139  -0.0071 1511 LYS A CG  
518 C CD  . LYS A 66  ? 0.5583 0.5901 0.6936 0.0303  0.0169  0.0035  1511 LYS A CD  
519 C CE  . LYS A 66  ? 0.8154 0.8613 0.9503 0.0289  0.0223  0.0084  1511 LYS A CE  
520 N NZ  . LYS A 66  ? 0.5874 0.6388 0.7429 0.0273  0.0267  0.0211  1511 LYS A NZ  
521 N N   . GLU A 67  ? 0.5023 0.4923 0.5927 0.0508  -0.0094 -0.0374 1512 GLU A N   
522 C CA  . GLU A 67  ? 0.5086 0.4850 0.5931 0.0588  -0.0154 -0.0451 1512 GLU A CA  
523 C C   . GLU A 67  ? 0.5110 0.4955 0.5727 0.0681  -0.0104 -0.0460 1512 GLU A C   
524 O O   . GLU A 67  ? 0.5168 0.4956 0.5738 0.0749  -0.0092 -0.0458 1512 GLU A O   
525 C CB  . GLU A 67  ? 0.4999 0.4657 0.5840 0.0614  -0.0285 -0.0590 1512 GLU A CB  
526 C CG  . GLU A 67  ? 0.6373 0.5864 0.7159 0.0709  -0.0369 -0.0698 1512 GLU A CG  
527 C CD  . GLU A 67  ? 0.8833 0.8307 0.9457 0.0802  -0.0475 -0.0849 1512 GLU A CD  
528 O OE1 . GLU A 67  ? 0.8566 0.7978 0.9307 0.0769  -0.0588 -0.0939 1512 GLU A OE1 
529 O OE2 . GLU A 67  ? 1.0473 1.0012 1.0857 0.0919  -0.0446 -0.0873 1512 GLU A OE2 
530 N N   . ARG A 68  ? 0.5067 0.5044 0.5556 0.0689  -0.0073 -0.0464 1513 ARG A N   
531 C CA  . ARG A 68  ? 0.4409 0.4483 0.4721 0.0772  -0.0024 -0.0461 1513 ARG A CA  
532 C C   . ARG A 68  ? 0.3971 0.4156 0.4292 0.0759  0.0068  -0.0370 1513 ARG A C   
533 O O   . ARG A 68  ? 0.3656 0.3891 0.3874 0.0841  0.0098  -0.0365 1513 ARG A O   
534 C CB  . ARG A 68  ? 0.4480 0.4662 0.4687 0.0785  -0.0008 -0.0472 1513 ARG A CB  
535 C CG  . ARG A 68  ? 0.4873 0.4977 0.4990 0.0867  -0.0101 -0.0573 1513 ARG A CG  
536 C CD  . ARG A 68  ? 0.5108 0.5325 0.5123 0.0897  -0.0073 -0.0559 1513 ARG A CD  
537 N NE  . ARG A 68  ? 0.4961 0.5118 0.4879 0.0998  -0.0173 -0.0664 1513 ARG A NE  
538 C CZ  . ARG A 68  ? 0.4550 0.4753 0.4430 0.1017  -0.0199 -0.0681 1513 ARG A CZ  
539 N NH1 . ARG A 68  ? 0.4935 0.5228 0.4863 0.0942  -0.0123 -0.0593 1513 ARG A NH1 
540 N NH2 . ARG A 68  ? 0.6174 0.6335 0.5954 0.1130  -0.0306 -0.0794 1513 ARG A NH2 
541 N N   . ILE A 69  ? 0.3902 0.4148 0.4339 0.0674  0.0113  -0.0301 1514 ILE A N   
542 C CA  . ILE A 69  ? 0.3603 0.3960 0.4059 0.0676  0.0187  -0.0223 1514 ILE A CA  
543 C C   . ILE A 69  ? 0.3726 0.3973 0.4216 0.0736  0.0181  -0.0199 1514 ILE A C   
544 O O   . ILE A 69  ? 0.4921 0.5228 0.5329 0.0810  0.0215  -0.0181 1514 ILE A O   
545 C CB  . ILE A 69  ? 0.2862 0.3306 0.3420 0.0599  0.0229  -0.0161 1514 ILE A CB  
546 C CG1 . ILE A 69  ? 0.4255 0.4786 0.4789 0.0542  0.0238  -0.0185 1514 ILE A CG1 
547 C CG2 . ILE A 69  ? 0.3326 0.3904 0.3879 0.0632  0.0294  -0.0093 1514 ILE A CG2 
548 C CD1 . ILE A 69  ? 0.3634 0.4211 0.4261 0.0482  0.0262  -0.0144 1514 ILE A CD1 
549 N N   . ARG A 70  ? 0.5327 0.5406 0.5949 0.0709  0.0133  -0.0203 1515 ARG A N   
550 C CA  . ARG A 70  ? 0.6221 0.6171 0.6916 0.0759  0.0136  -0.0163 1515 ARG A CA  
551 C C   . ARG A 70  ? 0.6254 0.6112 0.6814 0.0866  0.0097  -0.0240 1515 ARG A C   
552 O O   . ARG A 70  ? 0.5309 0.5129 0.5852 0.0941  0.0130  -0.0196 1515 ARG A O   
553 C CB  . ARG A 70  ? 0.6495 0.6273 0.7411 0.0695  0.0087  -0.0150 1515 ARG A CB  
554 C CG  . ARG A 70  ? 0.7871 0.7751 0.8943 0.0615  0.0147  -0.0036 1515 ARG A CG  
555 C CD  . ARG A 70  ? 0.8907 0.8639 1.0244 0.0546  0.0106  -0.0001 1515 ARG A CD  
556 N NE  . ARG A 70  ? 1.0572 1.0297 1.1978 0.0468  0.0031  -0.0075 1515 ARG A NE  
557 C CZ  . ARG A 70  ? 0.9565 0.9153 1.0989 0.0459  -0.0088 -0.0210 1515 ARG A CZ  
558 N NH1 . ARG A 70  ? 0.7065 0.6485 0.8437 0.0525  -0.0159 -0.0307 1515 ARG A NH1 
559 N NH2 . ARG A 70  ? 0.7511 0.7141 0.8992 0.0397  -0.0143 -0.0258 1515 ARG A NH2 
560 N N   . ASN A 71  ? 0.4798 0.4638 0.5242 0.0894  0.0034  -0.0347 1516 ASN A N   
561 C CA  . ASN A 71  ? 0.5260 0.5018 0.5551 0.1022  -0.0007 -0.0429 1516 ASN A CA  
562 C C   . ASN A 71  ? 0.4509 0.4463 0.4623 0.1101  0.0061  -0.0401 1516 ASN A C   
563 O O   . ASN A 71  ? 0.5693 0.5618 0.5657 0.1230  0.0041  -0.0456 1516 ASN A O   
564 C CB  . ASN A 71  ? 0.6469 0.6102 0.6719 0.1046  -0.0122 -0.0568 1516 ASN A CB  
565 C CG  . ASN A 71  ? 0.6057 0.5464 0.6506 0.0990  -0.0217 -0.0622 1516 ASN A CG  
566 O OD1 . ASN A 71  ? 0.7489 0.6859 0.8010 0.0935  -0.0297 -0.0693 1516 ASN A OD1 
567 N ND2 . ASN A 71  ? 0.8575 0.7840 0.9140 0.1002  -0.0204 -0.0578 1516 ASN A ND2 
568 N N   . HIS A 72  ? 0.4073 0.4230 0.4211 0.1033  0.0139  -0.0319 1517 HIS A N   
569 C CA  . HIS A 72  ? 0.4646 0.5023 0.4678 0.1078  0.0205  -0.0283 1517 HIS A CA  
570 C C   . HIS A 72  ? 0.5137 0.5576 0.5053 0.1121  0.0191  -0.0330 1517 HIS A C   
571 O O   . HIS A 72  ? 0.4090 0.4674 0.3910 0.1200  0.0236  -0.0306 1517 HIS A O   
572 C CB  . HIS A 72  ? 0.4475 0.4875 0.4441 0.1194  0.0239  -0.0249 1517 HIS A CB  
573 C CG  . HIS A 72  ? 0.4367 0.4667 0.4441 0.1185  0.0254  -0.0191 1517 HIS A CG  
574 N ND1 . HIS A 72  ? 0.4624 0.5057 0.4792 0.1119  0.0310  -0.0106 1517 HIS A ND1 
575 C CD2 . HIS A 72  ? 0.5472 0.5540 0.5591 0.1238  0.0219  -0.0202 1517 HIS A CD2 
576 C CE1 . HIS A 72  ? 0.4197 0.4506 0.4450 0.1143  0.0324  -0.0046 1517 HIS A CE1 
577 N NE2 . HIS A 72  ? 0.4826 0.4901 0.5067 0.1204  0.0269  -0.0102 1517 HIS A NE2 
578 N N   . LYS A 73  ? 0.4227 0.4577 0.4157 0.1079  0.0136  -0.0385 1518 LYS A N   
579 C CA  . LYS A 73  ? 0.4757 0.5170 0.4567 0.1140  0.0129  -0.0417 1518 LYS A CA  
580 C C   . LYS A 73  ? 0.4912 0.5539 0.4754 0.1076  0.0216  -0.0334 1518 LYS A C   
581 O O   . LYS A 73  ? 0.4069 0.4830 0.3827 0.1149  0.0260  -0.0303 1518 LYS A O   
582 C CB  . LYS A 73  ? 0.5210 0.5498 0.5030 0.1116  0.0047  -0.0494 1518 LYS A CB  
583 C CG  . LYS A 73  ? 0.9967 1.0028 0.9835 0.1134  -0.0058 -0.0588 1518 LYS A CG  
584 C CD  . LYS A 73  ? 1.0634 1.0600 1.0349 0.1281  -0.0150 -0.0711 1518 LYS A CD  
585 C CE  . LYS A 73  ? 1.2655 1.2382 1.2476 0.1267  -0.0274 -0.0822 1518 LYS A CE  
586 N NZ  . LYS A 73  ? 0.9918 0.9605 0.9957 0.1104  -0.0294 -0.0795 1518 LYS A NZ  
587 N N   . TYR A 74  ? 0.4527 0.5190 0.4503 0.0947  0.0240  -0.0296 1519 TYR A N   
588 C CA  . TYR A 74  ? 0.4162 0.5013 0.4201 0.0877  0.0310  -0.0235 1519 TYR A CA  
589 C C   . TYR A 74  ? 0.3307 0.4316 0.3359 0.0905  0.0358  -0.0191 1519 TYR A C   
590 O O   . TYR A 74  ? 0.4004 0.4980 0.4078 0.0912  0.0349  -0.0189 1519 TYR A O   
591 C CB  . TYR A 74  ? 0.3794 0.4630 0.3954 0.0749  0.0310  -0.0228 1519 TYR A CB  
592 C CG  . TYR A 74  ? 0.3491 0.4192 0.3661 0.0716  0.0262  -0.0264 1519 TYR A CG  
593 C CD1 . TYR A 74  ? 0.3214 0.3909 0.3314 0.0756  0.0257  -0.0275 1519 TYR A CD1 
594 C CD2 . TYR A 74  ? 0.3615 0.4225 0.3875 0.0652  0.0232  -0.0273 1519 TYR A CD2 
595 C CE1 . TYR A 74  ? 0.3625 0.4219 0.3730 0.0739  0.0207  -0.0311 1519 TYR A CE1 
596 C CE2 . TYR A 74  ? 0.3507 0.4023 0.3795 0.0621  0.0187  -0.0302 1519 TYR A CE2 
597 C CZ  . TYR A 74  ? 0.2764 0.3272 0.2971 0.0663  0.0170  -0.0327 1519 TYR A CZ  
598 O OH  . TYR A 74  ? 0.3139 0.3571 0.3382 0.0637  0.0119  -0.0358 1519 TYR A OH  
599 N N   . ARG A 75  ? 0.3681 0.4872 0.3737 0.0921  0.0411  -0.0147 1520 ARG A N   
600 C CA  . ARG A 75  ? 0.4832 0.6219 0.4915 0.0954  0.0453  -0.0105 1520 ARG A CA  
601 C C   . ARG A 75  ? 0.3615 0.5169 0.3852 0.0836  0.0478  -0.0086 1520 ARG A C   
602 O O   . ARG A 75  ? 0.4289 0.6032 0.4584 0.0842  0.0499  -0.0065 1520 ARG A O   
603 C CB  . ARG A 75  ? 0.3849 0.5355 0.3850 0.1072  0.0493  -0.0065 1520 ARG A CB  
604 C CG  . ARG A 75  ? 0.4458 0.5795 0.4286 0.1205  0.0456  -0.0108 1520 ARG A CG  
605 C CD  . ARG A 75  ? 0.4177 0.5329 0.3965 0.1238  0.0400  -0.0164 1520 ARG A CD  
606 N NE  . ARG A 75  ? 0.3842 0.5111 0.3628 0.1298  0.0432  -0.0126 1520 ARG A NE  
607 C CZ  . ARG A 75  ? 0.4671 0.5809 0.4418 0.1360  0.0407  -0.0144 1520 ARG A CZ  
608 N NH1 . ARG A 75  ? 0.4643 0.5520 0.4386 0.1352  0.0345  -0.0201 1520 ARG A NH1 
609 N NH2 . ARG A 75  ? 0.5912 0.7189 0.5649 0.1429  0.0447  -0.0097 1520 ARG A NH2 
610 N N   . SER A 76  ? 0.4141 0.5625 0.4449 0.0734  0.0467  -0.0105 1521 SER A N   
611 C CA  . SER A 76  ? 0.3541 0.5148 0.3996 0.0625  0.0478  -0.0109 1521 SER A CA  
612 C C   . SER A 76  ? 0.3891 0.5345 0.4375 0.0543  0.0450  -0.0146 1521 SER A C   
613 O O   . SER A 76  ? 0.3348 0.4630 0.3755 0.0565  0.0429  -0.0156 1521 SER A O   
614 C CB  . SER A 76  ? 0.3655 0.5410 0.4212 0.0596  0.0527  -0.0057 1521 SER A CB  
615 O OG  . SER A 76  ? 0.3077 0.4726 0.3596 0.0607  0.0550  -0.0024 1521 SER A OG  
616 N N   . LEU A 77  ? 0.3374 0.4902 0.3972 0.0455  0.0444  -0.0175 1522 LEU A N   
617 C CA  . LEU A 77  ? 0.3270 0.4681 0.3906 0.0383  0.0429  -0.0205 1522 LEU A CA  
618 C C   . LEU A 77  ? 0.3631 0.4976 0.4296 0.0354  0.0459  -0.0171 1522 LEU A C   
619 O O   . LEU A 77  ? 0.3541 0.4741 0.4172 0.0341  0.0447  -0.0179 1522 LEU A O   
620 C CB  . LEU A 77  ? 0.3151 0.4653 0.3884 0.0318  0.0407  -0.0261 1522 LEU A CB  
621 C CG  . LEU A 77  ? 0.3097 0.4677 0.3779 0.0372  0.0383  -0.0285 1522 LEU A CG  
622 C CD1 . LEU A 77  ? 0.3466 0.5139 0.4223 0.0326  0.0351  -0.0360 1522 LEU A CD1 
623 C CD2 . LEU A 77  ? 0.2802 0.4248 0.3390 0.0425  0.0378  -0.0259 1522 LEU A CD2 
624 N N   . ASN A 78  ? 0.2860 0.4318 0.3593 0.0354  0.0502  -0.0120 1523 ASN A N   
625 C CA  . ASN A 78  ? 0.2787 0.4196 0.3535 0.0357  0.0549  -0.0056 1523 ASN A CA  
626 C C   . ASN A 78  ? 0.3576 0.4853 0.4147 0.0452  0.0534  -0.0050 1523 ASN A C   
627 O O   . ASN A 78  ? 0.2941 0.4116 0.3494 0.0447  0.0541  -0.0036 1523 ASN A O   
628 C CB  . ASN A 78  ? 0.3516 0.5097 0.4376 0.0362  0.0616  0.0030  1523 ASN A CB  
629 C CG  . ASN A 78  ? 0.4151 0.5690 0.5074 0.0351  0.0681  0.0118  1523 ASN A CG  
630 O OD1 . ASN A 78  ? 0.5130 0.6579 0.6160 0.0262  0.0681  0.0104  1523 ASN A OD1 
631 N ND2 . ASN A 78  ? 0.4145 0.5763 0.5009 0.0452  0.0744  0.0219  1523 ASN A ND2 
632 N N   . ASP A 79  ? 0.3432 0.4710 0.3882 0.0542  0.0508  -0.0068 1524 ASP A N   
633 C CA  . ASP A 79  ? 0.3737 0.4887 0.4031 0.0640  0.0474  -0.0087 1524 ASP A CA  
634 C C   . ASP A 79  ? 0.2813 0.3799 0.3101 0.0594  0.0416  -0.0144 1524 ASP A C   
635 O O   . ASP A 79  ? 0.3098 0.3988 0.3325 0.0627  0.0391  -0.0156 1524 ASP A O   
636 C CB  . ASP A 79  ? 0.3611 0.4771 0.3800 0.0741  0.0450  -0.0109 1524 ASP A CB  
637 C CG  . ASP A 79  ? 0.4015 0.5336 0.4171 0.0828  0.0507  -0.0047 1524 ASP A CG  
638 O OD1 . ASP A 79  ? 0.3681 0.5092 0.3871 0.0838  0.0565  0.0023  1524 ASP A OD1 
639 O OD2 . ASP A 79  ? 0.4806 0.6167 0.4904 0.0899  0.0498  -0.0058 1524 ASP A OD2 
640 N N   . LEU A 80  ? 0.3116 0.4095 0.3473 0.0528  0.0397  -0.0173 1525 LEU A N   
641 C CA  . LEU A 80  ? 0.2445 0.3308 0.2828 0.0480  0.0359  -0.0204 1525 LEU A CA  
642 C C   . LEU A 80  ? 0.2715 0.3554 0.3151 0.0422  0.0379  -0.0192 1525 LEU A C   
643 O O   . LEU A 80  ? 0.2981 0.3724 0.3391 0.0431  0.0352  -0.0203 1525 LEU A O   
644 C CB  . LEU A 80  ? 0.3119 0.4022 0.3563 0.0440  0.0353  -0.0216 1525 LEU A CB  
645 C CG  . LEU A 80  ? 0.2799 0.3640 0.3295 0.0392  0.0336  -0.0227 1525 LEU A CG  
646 C CD1 . LEU A 80  ? 0.2686 0.3396 0.3163 0.0417  0.0293  -0.0232 1525 LEU A CD1 
647 C CD2 . LEU A 80  ? 0.3595 0.4514 0.4122 0.0394  0.0342  -0.0222 1525 LEU A CD2 
648 N N   . GLU A 81  ? 0.2792 0.3718 0.3312 0.0368  0.0423  -0.0172 1526 GLU A N   
649 C CA  . GLU A 81  ? 0.2963 0.3844 0.3549 0.0314  0.0447  -0.0160 1526 GLU A CA  
650 C C   . GLU A 81  ? 0.3256 0.4084 0.3776 0.0372  0.0466  -0.0112 1526 GLU A C   
651 O O   . GLU A 81  ? 0.2707 0.3450 0.3222 0.0366  0.0461  -0.0110 1526 GLU A O   
652 C CB  . GLU A 81  ? 0.3975 0.4949 0.4693 0.0246  0.0484  -0.0150 1526 GLU A CB  
653 C CG  . GLU A 81  ? 0.3508 0.4404 0.4308 0.0194  0.0512  -0.0135 1526 GLU A CG  
654 C CD  . GLU A 81  ? 0.3332 0.4275 0.4302 0.0102  0.0520  -0.0166 1526 GLU A CD  
655 O OE1 . GLU A 81  ? 0.3366 0.4404 0.4376 0.0076  0.0485  -0.0230 1526 GLU A OE1 
656 O OE2 . GLU A 81  ? 0.5275 0.6163 0.6350 0.0061  0.0561  -0.0128 1526 GLU A OE2 
657 N N   . LYS A 82  ? 0.3663 0.4562 0.4131 0.0442  0.0496  -0.0067 1527 LYS A N   
658 C CA  . LYS A 82  ? 0.2487 0.3371 0.2862 0.0534  0.0518  -0.0016 1527 LYS A CA  
659 C C   . LYS A 82  ? 0.3265 0.4039 0.3535 0.0584  0.0445  -0.0074 1527 LYS A C   
660 O O   . LYS A 82  ? 0.2940 0.3679 0.3178 0.0618  0.0453  -0.0049 1527 LYS A O   
661 C CB  . LYS A 82  ? 0.3366 0.4360 0.3667 0.0635  0.0554  0.0033  1527 LYS A CB  
662 C CG  . LYS A 82  ? 0.4568 0.5684 0.4999 0.0606  0.0651  0.0141  1527 LYS A CG  
663 C CD  . LYS A 82  ? 0.6819 0.8089 0.7207 0.0699  0.0694  0.0199  1527 LYS A CD  
664 C CE  . LYS A 82  ? 0.7951 0.9232 0.8135 0.0875  0.0696  0.0223  1527 LYS A CE  
665 N NZ  . LYS A 82  ? 0.5584 0.7048 0.5749 0.0978  0.0771  0.0320  1527 LYS A NZ  
666 N N   . ASP A 83  ? 0.2614 0.3343 0.2851 0.0589  0.0376  -0.0146 1528 ASP A N   
667 C CA  . ASP A 83  ? 0.3105 0.3738 0.3292 0.0621  0.0296  -0.0206 1528 ASP A CA  
668 C C   . ASP A 83  ? 0.3097 0.3671 0.3372 0.0541  0.0280  -0.0215 1528 ASP A C   
669 O O   . ASP A 83  ? 0.2739 0.3270 0.2987 0.0574  0.0237  -0.0235 1528 ASP A O   
670 C CB  . ASP A 83  ? 0.3124 0.3712 0.3286 0.0647  0.0233  -0.0267 1528 ASP A CB  
671 C CG  . ASP A 83  ? 0.5133 0.5680 0.5167 0.0770  0.0165  -0.0325 1528 ASP A CG  
672 O OD1 . ASP A 83  ? 0.4088 0.4684 0.4021 0.0859  0.0182  -0.0304 1528 ASP A OD1 
673 O OD2 . ASP A 83  ? 0.4126 0.4589 0.4164 0.0785  0.0090  -0.0393 1528 ASP A OD2 
674 N N   . VAL A 84  ? 0.3165 0.3755 0.3536 0.0454  0.0313  -0.0202 1529 VAL A N   
675 C CA  . VAL A 84  ? 0.2523 0.3074 0.2965 0.0396  0.0311  -0.0204 1529 VAL A CA  
676 C C   . VAL A 84  ? 0.3452 0.3990 0.3885 0.0409  0.0359  -0.0159 1529 VAL A C   
677 O O   . VAL A 84  ? 0.2752 0.3247 0.3183 0.0420  0.0343  -0.0156 1529 VAL A O   
678 C CB  . VAL A 84  ? 0.2157 0.2741 0.2678 0.0327  0.0334  -0.0212 1529 VAL A CB  
679 C CG1 . VAL A 84  ? 0.2144 0.2696 0.2718 0.0290  0.0348  -0.0211 1529 VAL A CG1 
680 C CG2 . VAL A 84  ? 0.1916 0.2516 0.2451 0.0329  0.0302  -0.0231 1529 VAL A CG2 
681 N N   . MET A 85  ? 0.3048 0.3630 0.3489 0.0412  0.0422  -0.0111 1530 MET A N   
682 C CA  . MET A 85  ? 0.3312 0.3874 0.3766 0.0430  0.0481  -0.0045 1530 MET A CA  
683 C C   . MET A 85  ? 0.3395 0.3956 0.3729 0.0542  0.0464  -0.0020 1530 MET A C   
684 O O   . MET A 85  ? 0.3570 0.4097 0.3900 0.0568  0.0490  0.0021  1530 MET A O   
685 C CB  . MET A 85  ? 0.3815 0.4431 0.4357 0.0397  0.0559  0.0018  1530 MET A CB  
686 C CG  . MET A 85  ? 0.5055 0.5672 0.5735 0.0286  0.0564  -0.0022 1530 MET A CG  
687 S SD  . MET A 85  ? 0.4473 0.4977 0.5214 0.0228  0.0550  -0.0070 1530 MET A SD  
688 C CE  . MET A 85  ? 0.3254 0.3808 0.4090 0.0144  0.0517  -0.0161 1530 MET A CE  
689 N N   . LEU A 86  ? 0.3104 0.3703 0.3337 0.0618  0.0415  -0.0055 1531 LEU A N   
690 C CA  . LEU A 86  ? 0.3253 0.3864 0.3354 0.0742  0.0367  -0.0072 1531 LEU A CA  
691 C C   . LEU A 86  ? 0.3195 0.3750 0.3311 0.0728  0.0281  -0.0140 1531 LEU A C   
692 O O   . LEU A 86  ? 0.3687 0.4255 0.3746 0.0801  0.0266  -0.0127 1531 LEU A O   
693 C CB  . LEU A 86  ? 0.3390 0.4040 0.3386 0.0826  0.0323  -0.0118 1531 LEU A CB  
694 C CG  . LEU A 86  ? 0.4327 0.4998 0.4166 0.0978  0.0254  -0.0164 1531 LEU A CG  
695 C CD1 . LEU A 86  ? 0.4721 0.5465 0.4486 0.1078  0.0334  -0.0059 1531 LEU A CD1 
696 C CD2 . LEU A 86  ? 0.4551 0.5244 0.4275 0.1076  0.0206  -0.0226 1531 LEU A CD2 
697 N N   . LEU A 87  ? 0.3203 0.3716 0.3410 0.0639  0.0233  -0.0196 1532 LEU A N   
698 C CA  . LEU A 87  ? 0.3089 0.3571 0.3364 0.0605  0.0168  -0.0237 1532 LEU A CA  
699 C C   . LEU A 87  ? 0.3986 0.4465 0.4288 0.0595  0.0219  -0.0181 1532 LEU A C   
700 O O   . LEU A 87  ? 0.3373 0.3866 0.3659 0.0643  0.0175  -0.0192 1532 LEU A O   
701 C CB  . LEU A 87  ? 0.2728 0.3182 0.3115 0.0514  0.0144  -0.0265 1532 LEU A CB  
702 C CG  . LEU A 87  ? 0.2953 0.3394 0.3456 0.0470  0.0085  -0.0288 1532 LEU A CG  
703 C CD1 . LEU A 87  ? 0.2959 0.3378 0.3549 0.0421  0.0058  -0.0307 1532 LEU A CD1 
704 C CD2 . LEU A 87  ? 0.3112 0.3567 0.3669 0.0427  0.0142  -0.0239 1532 LEU A CD2 
705 N N   . CYS A 88  ? 0.3229 0.3690 0.3574 0.0541  0.0306  -0.0127 1533 CYS A N   
706 C CA  . CYS A 88  ? 0.3201 0.3628 0.3582 0.0530  0.0358  -0.0080 1533 CYS A CA  
707 C C   . CYS A 88  ? 0.4414 0.4855 0.4712 0.0629  0.0400  -0.0011 1533 CYS A C   
708 O O   . CYS A 88  ? 0.4050 0.4481 0.4337 0.0671  0.0401  0.0012  1533 CYS A O   
709 C CB  . CYS A 88  ? 0.3982 0.4373 0.4448 0.0445  0.0421  -0.0067 1533 CYS A CB  
710 S SG  . CYS A 88  ? 0.3369 0.3771 0.3910 0.0367  0.0378  -0.0134 1533 CYS A SG  
711 N N   . GLN A 89  ? 0.5093 0.5575 0.5329 0.0684  0.0438  0.0028  1534 GLN A N   
712 C CA  . GLN A 89  ? 0.3800 0.4323 0.3945 0.0805  0.0492  0.0116  1534 GLN A CA  
713 C C   . GLN A 89  ? 0.4249 0.4825 0.4276 0.0919  0.0406  0.0069  1534 GLN A C   
714 O O   . GLN A 89  ? 0.5566 0.6161 0.5548 0.1002  0.0431  0.0125  1534 GLN A O   
715 C CB  . GLN A 89  ? 0.4319 0.4910 0.4417 0.0858  0.0551  0.0177  1534 GLN A CB  
716 C CG  . GLN A 89  ? 0.7187 0.7842 0.7190 0.1005  0.0624  0.0295  1534 GLN A CG  
717 C CD  . GLN A 89  ? 0.7128 0.7878 0.7094 0.1075  0.0699  0.0380  1534 GLN A CD  
718 O OE1 . GLN A 89  ? 1.2724 1.3498 1.2757 0.1094  0.0822  0.0527  1534 GLN A OE1 
719 N NE2 . GLN A 89  ? 0.6836 0.7641 0.6713 0.1112  0.0630  0.0297  1534 GLN A NE2 
720 N N   . ASN A 90  ? 0.3275 0.3877 0.3264 0.0930  0.0300  -0.0036 1535 ASN A N   
721 C CA  . ASN A 90  ? 0.3534 0.4183 0.3452 0.1019  0.0185  -0.0117 1535 ASN A CA  
722 C C   . ASN A 90  ? 0.4180 0.4829 0.4174 0.0992  0.0146  -0.0129 1535 ASN A C   
723 O O   . ASN A 90  ? 0.4100 0.4821 0.4013 0.1109  0.0109  -0.0129 1535 ASN A O   
724 C CB  . ASN A 90  ? 0.4077 0.4711 0.4009 0.0992  0.0074  -0.0239 1535 ASN A CB  
725 C CG  . ASN A 90  ? 0.5308 0.5973 0.5110 0.1085  0.0081  -0.0250 1535 ASN A CG  
726 O OD1 . ASN A 90  ? 0.4243 0.4971 0.3941 0.1184  0.0169  -0.0158 1535 ASN A OD1 
727 N ND2 . ASN A 90  ? 0.3822 0.4447 0.3643 0.1058  0.0000  -0.0347 1535 ASN A ND2 
728 N N   . ALA A 91  ? 0.4180 0.4769 0.4320 0.0859  0.0156  -0.0135 1536 ALA A N   
729 C CA  . ALA A 91  ? 0.4444 0.5030 0.4663 0.0830  0.0167  -0.0107 1536 ALA A CA  
730 C C   . ALA A 91  ? 0.3677 0.4256 0.3838 0.0905  0.0259  -0.0006 1536 ALA A C   
731 O O   . ALA A 91  ? 0.4192 0.4824 0.4341 0.0971  0.0232  0.0004  1536 ALA A O   
732 C CB  . ALA A 91  ? 0.3643 0.4167 0.3991 0.0700  0.0199  -0.0107 1536 ALA A CB  
733 N N   . GLN A 92  ? 0.4343 0.4860 0.4490 0.0892  0.0368  0.0071  1537 GLN A N   
734 C CA  . GLN A 92  ? 0.4096 0.4579 0.4217 0.0956  0.0470  0.0184  1537 GLN A CA  
735 C C   . GLN A 92  ? 0.4695 0.5273 0.4672 0.1125  0.0481  0.0244  1537 GLN A C   
736 O O   . GLN A 92  ? 0.8048 0.8614 0.7998 0.1205  0.0562  0.0350  1537 GLN A O   
737 C CB  . GLN A 92  ? 0.4260 0.4650 0.4460 0.0877  0.0577  0.0249  1537 GLN A CB  
738 C CG  . GLN A 92  ? 0.5835 0.6125 0.6163 0.0745  0.0585  0.0203  1537 GLN A CG  
739 C CD  . GLN A 92  ? 0.6097 0.6344 0.6511 0.0643  0.0623  0.0193  1537 GLN A CD  
740 O OE1 . GLN A 92  ? 0.6264 0.6495 0.6709 0.0651  0.0701  0.0273  1537 GLN A OE1 
741 N NE2 . GLN A 92  ? 0.4803 0.5050 0.5269 0.0553  0.0570  0.0103  1537 GLN A NE2 
742 N N   . THR A 93  ? 0.6168 0.6837 0.6048 0.1192  0.0402  0.0178  1538 THR A N   
743 C CA  . THR A 93  ? 0.5756 0.6544 0.5468 0.1382  0.0395  0.0214  1538 THR A CA  
744 C C   . THR A 93  ? 0.5477 0.6358 0.5141 0.1461  0.0268  0.0124  1538 THR A C   
745 O O   . THR A 93  ? 0.5291 0.6259 0.4855 0.1611  0.0286  0.0185  1538 THR A O   
746 C CB  . THR A 93  ? 0.5095 0.5935 0.4712 0.1434  0.0372  0.0177  1538 THR A CB  
747 O OG1 . THR A 93  ? 0.5515 0.6308 0.5188 0.1382  0.0507  0.0292  1538 THR A OG1 
748 C CG2 . THR A 93  ? 0.5816 0.6807 0.5221 0.1660  0.0320  0.0162  1538 THR A CG2 
749 N N   . PHE A 94  ? 0.5338 0.6214 0.5093 0.1364  0.0141  -0.0013 1539 PHE A N   
750 C CA  . PHE A 94  ? 0.5423 0.6399 0.5191 0.1412  0.0000  -0.0115 1539 PHE A CA  
751 C C   . PHE A 94  ? 0.5884 0.6868 0.5757 0.1374  0.0019  -0.0070 1539 PHE A C   
752 O O   . PHE A 94  ? 0.4876 0.5983 0.4722 0.1473  -0.0052 -0.0096 1539 PHE A O   
753 C CB  . PHE A 94  ? 0.5318 0.6274 0.5191 0.1311  -0.0133 -0.0263 1539 PHE A CB  
754 C CG  . PHE A 94  ? 0.4774 0.5837 0.4701 0.1349  -0.0295 -0.0383 1539 PHE A CG  
755 C CD1 . PHE A 94  ? 0.7885 0.9069 0.7656 0.1526  -0.0395 -0.0462 1539 PHE A CD1 
756 C CD2 . PHE A 94  ? 0.4774 0.5838 0.4911 0.1224  -0.0352 -0.0417 1539 PHE A CD2 
757 C CE1 . PHE A 94  ? 0.7549 0.8844 0.7391 0.1559  -0.0565 -0.0594 1539 PHE A CE1 
758 C CE2 . PHE A 94  ? 0.6020 0.7203 0.6254 0.1248  -0.0508 -0.0524 1539 PHE A CE2 
759 C CZ  . PHE A 94  ? 0.8090 0.9384 0.8185 0.1408  -0.0624 -0.0625 1539 PHE A CZ  
760 N N   . ASN A 95  ? 0.5008 0.5874 0.4993 0.1246  0.0112  -0.0009 1540 ASN A N   
761 C CA  . ASN A 95  ? 0.5899 0.6761 0.5964 0.1228  0.0149  0.0043  1540 ASN A CA  
762 C C   . ASN A 95  ? 0.4929 0.5710 0.4936 0.1287  0.0299  0.0184  1540 ASN A C   
763 O O   . ASN A 95  ? 0.5237 0.5920 0.5218 0.1270  0.0400  0.0252  1540 ASN A O   
764 C CB  . ASN A 95  ? 0.4817 0.5621 0.5050 0.1070  0.0135  0.0004  1540 ASN A CB  
765 C CG  . ASN A 95  ? 0.7063 0.7922 0.7389 0.1002  0.0006  -0.0109 1540 ASN A CG  
766 O OD1 . ASN A 95  ? 0.5453 0.6421 0.5867 0.1011  -0.0094 -0.0161 1540 ASN A OD1 
767 N ND2 . ASN A 95  ? 0.4634 0.5421 0.4956 0.0937  0.0006  -0.0146 1540 ASN A ND2 
768 N N   . LEU A 96  ? 0.8287 0.9115 0.8296 0.1358  0.0309  0.0229  1541 LEU A N   
769 C CA  . LEU A 96  ? 0.7737 0.8482 0.7699 0.1435  0.0443  0.0364  1541 LEU A CA  
770 C C   . LEU A 96  ? 0.6042 0.6605 0.6116 0.1298  0.0524  0.0381  1541 LEU A C   
771 O O   . LEU A 96  ? 0.5652 0.6208 0.5826 0.1192  0.0473  0.0304  1541 LEU A O   
772 C CB  . LEU A 96  ? 0.7541 0.8398 0.7470 0.1559  0.0421  0.0397  1541 LEU A CB  
773 N N   . GLU A 97  ? 0.5481 0.5906 0.5551 0.1309  0.0650  0.0483  1542 GLU A N   
774 C CA  . GLU A 97  ? 0.5465 0.5708 0.5643 0.1196  0.0720  0.0486  1542 GLU A CA  
775 C C   . GLU A 97  ? 0.6395 0.6619 0.6608 0.1208  0.0709  0.0468  1542 GLU A C   
776 O O   . GLU A 97  ? 0.8467 0.8811 0.8626 0.1316  0.0675  0.0490  1542 GLU A O   
777 C CB  . GLU A 97  ? 0.4684 0.4785 0.4881 0.1220  0.0854  0.0611  1542 GLU A CB  
778 C CG  . GLU A 97  ? 0.6327 0.6219 0.6656 0.1107  0.0918  0.0602  1542 GLU A CG  
779 C CD  . GLU A 97  ? 0.8494 0.8252 0.8897 0.1111  0.1043  0.0730  1542 GLU A CD  
780 O OE1 . GLU A 97  ? 0.7666 0.7506 0.8007 0.1211  0.1099  0.0849  1542 GLU A OE1 
781 O OE2 . GLU A 97  ? 0.7828 0.7403 0.8362 0.1019  0.1086  0.0712  1542 GLU A OE2 
782 N N   . GLY A 98  ? 0.8078 0.8179 0.8377 0.1107  0.0726  0.0417  1543 GLY A N   
783 C CA  . GLY A 98  ? 0.6352 0.6458 0.6679 0.1121  0.0709  0.0386  1543 GLY A CA  
784 C C   . GLY A 98  ? 0.5759 0.6060 0.6115 0.1101  0.0602  0.0319  1543 GLY A C   
785 O O   . GLY A 98  ? 0.5025 0.5347 0.5426 0.1096  0.0595  0.0296  1543 GLY A O   
786 N N   . SER A 99  ? 0.5794 0.6236 0.6141 0.1092  0.0520  0.0286  1544 SER A N   
787 C CA  . SER A 99  ? 0.4748 0.5356 0.5176 0.1054  0.0415  0.0222  1544 SER A CA  
788 C C   . SER A 99  ? 0.3620 0.4192 0.4136 0.0927  0.0403  0.0164  1544 SER A C   
789 O O   . SER A 99  ? 0.4835 0.5277 0.5332 0.0869  0.0451  0.0150  1544 SER A O   
790 C CB  . SER A 99  ? 0.4496 0.5252 0.4905 0.1088  0.0313  0.0184  1544 SER A CB  
791 O OG  . SER A 99  ? 0.5127 0.5840 0.5514 0.1025  0.0289  0.0136  1544 SER A OG  
792 N N   . LEU A 100 ? 0.4058 0.4762 0.4683 0.0895  0.0342  0.0140  1545 LEU A N   
793 C CA  . LEU A 100 ? 0.3503 0.4207 0.4216 0.0802  0.0340  0.0109  1545 LEU A CA  
794 C C   . LEU A 100 ? 0.3138 0.3789 0.3838 0.0723  0.0310  0.0058  1545 LEU A C   
795 O O   . LEU A 100 ? 0.3696 0.4248 0.4373 0.0672  0.0356  0.0039  1545 LEU A O   
796 C CB  . LEU A 100 ? 0.4258 0.5140 0.5121 0.0789  0.0284  0.0121  1545 LEU A CB  
797 C CG  . LEU A 100 ? 0.3970 0.4879 0.4936 0.0703  0.0284  0.0112  1545 LEU A CG  
798 C CD1 . LEU A 100 ? 0.4661 0.5678 0.5715 0.0731  0.0323  0.0168  1545 LEU A CD1 
799 C CD2 . LEU A 100 ? 0.7218 0.8202 0.8304 0.0632  0.0192  0.0080  1545 LEU A CD2 
800 N N   . ILE A 101 ? 0.3625 0.4340 0.4326 0.0731  0.0234  0.0030  1546 ILE A N   
801 C CA  . ILE A 101 ? 0.4599 0.5275 0.5281 0.0675  0.0198  -0.0020 1546 ILE A CA  
802 C C   . ILE A 101 ? 0.3791 0.4344 0.4355 0.0684  0.0271  -0.0005 1546 ILE A C   
803 O O   . ILE A 101 ? 0.3625 0.4126 0.4194 0.0618  0.0285  -0.0031 1546 ILE A O   
804 C CB  . ILE A 101 ? 0.4108 0.4876 0.4805 0.0704  0.0086  -0.0073 1546 ILE A CB  
805 C CG1 . ILE A 101 ? 0.5450 0.6344 0.6325 0.0672  0.0003  -0.0090 1546 ILE A CG1 
806 C CG2 . ILE A 101 ? 0.4600 0.5312 0.5269 0.0658  0.0054  -0.0129 1546 ILE A CG2 
807 C CD1 . ILE A 101 ? 0.5913 0.6876 0.6853 0.0671  -0.0130 -0.0174 1546 ILE A CD1 
808 N N   . TYR A 102 ? 0.3648 0.4169 0.4123 0.0768  0.0321  0.0046  1547 TYR A N   
809 C CA  . TYR A 102 ? 0.3436 0.3843 0.3847 0.0772  0.0408  0.0088  1547 TYR A CA  
810 C C   . TYR A 102 ? 0.4430 0.4719 0.4895 0.0695  0.0474  0.0084  1547 TYR A C   
811 O O   . TYR A 102 ? 0.3767 0.3998 0.4247 0.0635  0.0503  0.0071  1547 TYR A O   
812 C CB  . TYR A 102 ? 0.4928 0.5326 0.5255 0.0890  0.0461  0.0171  1547 TYR A CB  
813 C CG  . TYR A 102 ? 0.4290 0.4572 0.4593 0.0899  0.0568  0.0248  1547 TYR A CG  
814 C CD1 . TYR A 102 ? 0.5198 0.5336 0.5578 0.0830  0.0640  0.0261  1547 TYR A CD1 
815 C CD2 . TYR A 102 ? 0.5870 0.6196 0.6085 0.0991  0.0598  0.0315  1547 TYR A CD2 
816 C CE1 . TYR A 102 ? 0.5148 0.5180 0.5559 0.0822  0.0733  0.0335  1547 TYR A CE1 
817 C CE2 . TYR A 102 ? 0.6049 0.6285 0.6280 0.0998  0.0709  0.0413  1547 TYR A CE2 
818 C CZ  . TYR A 102 ? 0.7333 0.7416 0.7682 0.0902  0.0776  0.0424  1547 TYR A CZ  
819 O OH  . TYR A 102 ? 0.6765 0.6754 0.7184 0.0891  0.0883  0.0525  1547 TYR A OH  
820 N N   . GLU A 103 ? 0.3915 0.4179 0.4413 0.0706  0.0494  0.0088  1548 GLU A N   
821 C CA  . GLU A 103 ? 0.3926 0.4082 0.4462 0.0653  0.0539  0.0058  1548 GLU A CA  
822 C C   . GLU A 103 ? 0.4664 0.4874 0.5247 0.0574  0.0498  -0.0009 1548 GLU A C   
823 O O   . GLU A 103 ? 0.3575 0.3719 0.4178 0.0520  0.0518  -0.0050 1548 GLU A O   
824 C CB  . GLU A 103 ? 0.4858 0.4978 0.5391 0.0717  0.0569  0.0077  1548 GLU A CB  
825 C CG  . GLU A 103 ? 0.5015 0.5059 0.5502 0.0806  0.0627  0.0156  1548 GLU A CG  
826 C CD  . GLU A 103 ? 0.4792 0.4677 0.5295 0.0778  0.0698  0.0187  1548 GLU A CD  
827 O OE1 . GLU A 103 ? 0.5780 0.5582 0.6342 0.0694  0.0704  0.0127  1548 GLU A OE1 
828 O OE2 . GLU A 103 ? 0.6517 0.6375 0.6986 0.0847  0.0748  0.0278  1548 GLU A OE2 
829 N N   . ASP A 104 ? 0.3298 0.3633 0.3914 0.0569  0.0438  -0.0017 1549 ASP A N   
830 C CA  . ASP A 104 ? 0.2726 0.3117 0.3391 0.0505  0.0409  -0.0057 1549 ASP A CA  
831 C C   . ASP A 104 ? 0.3648 0.4010 0.4294 0.0453  0.0401  -0.0084 1549 ASP A C   
832 O O   . ASP A 104 ? 0.2876 0.3232 0.3537 0.0408  0.0410  -0.0120 1549 ASP A O   
833 C CB  . ASP A 104 ? 0.3348 0.3869 0.4093 0.0505  0.0351  -0.0040 1549 ASP A CB  
834 C CG  . ASP A 104 ? 0.3580 0.4176 0.4380 0.0542  0.0370  -0.0007 1549 ASP A CG  
835 O OD1 . ASP A 104 ? 0.3308 0.3850 0.4059 0.0582  0.0423  -0.0010 1549 ASP A OD1 
836 O OD2 . ASP A 104 ? 0.4194 0.4907 0.5101 0.0533  0.0329  0.0021  1549 ASP A OD2 
837 N N   . SER A 105 ? 0.3019 0.3372 0.3622 0.0476  0.0390  -0.0066 1550 SER A N   
838 C CA  . SER A 105 ? 0.3196 0.3542 0.3773 0.0448  0.0387  -0.0081 1550 SER A CA  
839 C C   . SER A 105 ? 0.3598 0.3865 0.4184 0.0413  0.0452  -0.0078 1550 SER A C   
840 O O   . SER A 105 ? 0.3618 0.3898 0.4225 0.0363  0.0451  -0.0107 1550 SER A O   
841 C CB  . SER A 105 ? 0.2982 0.3356 0.3489 0.0514  0.0361  -0.0059 1550 SER A CB  
842 O OG  . SER A 105 ? 0.3252 0.3577 0.3710 0.0571  0.0427  0.0004  1550 SER A OG  
843 N N   . ILE A 106 ? 0.3828 0.4013 0.4420 0.0436  0.0502  -0.0048 1551 ILE A N   
844 C CA  . ILE A 106 ? 0.3729 0.3818 0.4375 0.0395  0.0558  -0.0050 1551 ILE A CA  
845 C C   . ILE A 106 ? 0.3924 0.4015 0.4615 0.0338  0.0535  -0.0134 1551 ILE A C   
846 O O   . ILE A 106 ? 0.3923 0.4007 0.4669 0.0280  0.0541  -0.0168 1551 ILE A O   
847 C CB  . ILE A 106 ? 0.4547 0.4525 0.5197 0.0445  0.0614  0.0002  1551 ILE A CB  
848 C CG1 . ILE A 106 ? 0.3961 0.3953 0.4566 0.0512  0.0652  0.0101  1551 ILE A CG1 
849 C CG2 . ILE A 106 ? 0.5586 0.5437 0.6329 0.0391  0.0650  -0.0033 1551 ILE A CG2 
850 C CD1 . ILE A 106 ? 0.4631 0.4576 0.5299 0.0484  0.0721  0.0164  1551 ILE A CD1 
851 N N   . VAL A 107 ? 0.3458 0.3590 0.4127 0.0364  0.0506  -0.0164 1552 VAL A N   
852 C CA  . VAL A 107 ? 0.2864 0.3030 0.3547 0.0346  0.0486  -0.0238 1552 VAL A CA  
853 C C   . VAL A 107 ? 0.2724 0.2995 0.3412 0.0308  0.0454  -0.0258 1552 VAL A C   
854 O O   . VAL A 107 ? 0.2822 0.3120 0.3527 0.0281  0.0443  -0.0320 1552 VAL A O   
855 C CB  . VAL A 107 ? 0.3361 0.3574 0.4016 0.0409  0.0480  -0.0235 1552 VAL A CB  
856 C CG1 . VAL A 107 ? 0.3435 0.3724 0.4082 0.0417  0.0463  -0.0295 1552 VAL A CG1 
857 C CG2 . VAL A 107 ? 0.3235 0.3340 0.3875 0.0464  0.0514  -0.0224 1552 VAL A CG2 
858 N N   . LEU A 108 ? 0.3204 0.3535 0.3879 0.0314  0.0432  -0.0213 1553 LEU A N   
859 C CA  . LEU A 108 ? 0.2870 0.3278 0.3550 0.0288  0.0406  -0.0223 1553 LEU A CA  
860 C C   . LEU A 108 ? 0.2804 0.3203 0.3492 0.0247  0.0418  -0.0243 1553 LEU A C   
861 O O   . LEU A 108 ? 0.2850 0.3316 0.3546 0.0229  0.0404  -0.0272 1553 LEU A O   
862 C CB  . LEU A 108 ? 0.3160 0.3608 0.3841 0.0304  0.0368  -0.0186 1553 LEU A CB  
863 C CG  . LEU A 108 ? 0.2768 0.3278 0.3498 0.0323  0.0354  -0.0163 1553 LEU A CG  
864 C CD1 . LEU A 108 ? 0.3136 0.3663 0.3902 0.0326  0.0303  -0.0142 1553 LEU A CD1 
865 C CD2 . LEU A 108 ? 0.2861 0.3447 0.3618 0.0321  0.0362  -0.0165 1553 LEU A CD2 
866 N N   . GLN A 109 ? 0.2942 0.3276 0.3640 0.0241  0.0451  -0.0215 1554 GLN A N   
867 C CA  . GLN A 109 ? 0.3931 0.4275 0.4675 0.0200  0.0474  -0.0215 1554 GLN A CA  
868 C C   . GLN A 109 ? 0.3285 0.3638 0.4096 0.0153  0.0464  -0.0292 1554 GLN A C   
869 O O   . GLN A 109 ? 0.3563 0.3995 0.4410 0.0120  0.0452  -0.0322 1554 GLN A O   
870 C CB  . GLN A 109 ? 0.3988 0.4253 0.4764 0.0207  0.0530  -0.0149 1554 GLN A CB  
871 C CG  . GLN A 109 ? 0.4135 0.4407 0.4828 0.0278  0.0542  -0.0074 1554 GLN A CG  
872 C CD  . GLN A 109 ? 0.6659 0.6863 0.7376 0.0311  0.0614  0.0016  1554 GLN A CD  
873 O OE1 . GLN A 109 ? 0.5941 0.6175 0.6577 0.0391  0.0627  0.0079  1554 GLN A OE1 
874 N NE2 . GLN A 109 ? 0.5650 0.5763 0.6480 0.0261  0.0659  0.0021  1554 GLN A NE2 
875 N N   . SER A 110 ? 0.3794 0.4071 0.4621 0.0160  0.0466  -0.0330 1555 SER A N   
876 C CA  . SER A 110 ? 0.3193 0.3467 0.4076 0.0132  0.0442  -0.0429 1555 SER A CA  
877 C C   . SER A 110 ? 0.3853 0.4255 0.4679 0.0161  0.0400  -0.0486 1555 SER A C   
878 O O   . SER A 110 ? 0.3429 0.3901 0.4293 0.0141  0.0367  -0.0567 1555 SER A O   
879 C CB  . SER A 110 ? 0.4787 0.4927 0.5685 0.0153  0.0452  -0.0464 1555 SER A CB  
880 O OG  . SER A 110 ? 0.7319 0.7419 0.8307 0.0113  0.0424  -0.0569 1555 SER A OG  
881 N N   . VAL A 111 ? 0.2947 0.3398 0.3698 0.0211  0.0400  -0.0433 1556 VAL A N   
882 C CA  . VAL A 111 ? 0.3184 0.3760 0.3891 0.0252  0.0379  -0.0451 1556 VAL A CA  
883 C C   . VAL A 111 ? 0.2384 0.3046 0.3101 0.0226  0.0369  -0.0439 1556 VAL A C   
884 O O   . VAL A 111 ? 0.3180 0.3953 0.3884 0.0247  0.0350  -0.0481 1556 VAL A O   
885 C CB  . VAL A 111 ? 0.3789 0.4392 0.4461 0.0304  0.0390  -0.0378 1556 VAL A CB  
886 C CG1 . VAL A 111 ? 0.2737 0.3472 0.3394 0.0340  0.0385  -0.0354 1556 VAL A CG1 
887 C CG2 . VAL A 111 ? 0.3656 0.4214 0.4307 0.0354  0.0403  -0.0393 1556 VAL A CG2 
888 N N   . PHE A 112 ? 0.2422 0.3047 0.3147 0.0201  0.0381  -0.0379 1557 PHE A N   
889 C CA  . PHE A 112 ? 0.2245 0.2945 0.2975 0.0186  0.0375  -0.0370 1557 PHE A CA  
890 C C   . PHE A 112 ? 0.2716 0.3478 0.3513 0.0144  0.0367  -0.0434 1557 PHE A C   
891 O O   . PHE A 112 ? 0.2795 0.3674 0.3589 0.0155  0.0349  -0.0462 1557 PHE A O   
892 C CB  . PHE A 112 ? 0.2304 0.2957 0.3018 0.0184  0.0388  -0.0309 1557 PHE A CB  
893 C CG  . PHE A 112 ? 0.2735 0.3466 0.3443 0.0187  0.0387  -0.0299 1557 PHE A CG  
894 C CD1 . PHE A 112 ? 0.2604 0.3389 0.3374 0.0151  0.0404  -0.0311 1557 PHE A CD1 
895 C CD2 . PHE A 112 ? 0.2194 0.2952 0.2852 0.0227  0.0367  -0.0279 1557 PHE A CD2 
896 C CE1 . PHE A 112 ? 0.2487 0.3369 0.3250 0.0165  0.0406  -0.0295 1557 PHE A CE1 
897 C CE2 . PHE A 112 ? 0.2359 0.3184 0.2999 0.0245  0.0367  -0.0271 1557 PHE A CE2 
898 C CZ  . PHE A 112 ? 0.2243 0.3145 0.2928 0.0219  0.0387  -0.0280 1557 PHE A CZ  
899 N N   . THR A 113 ? 0.3207 0.3893 0.4081 0.0098  0.0379  -0.0456 1558 THR A N   
900 C CA  . THR A 113 ? 0.3152 0.3887 0.4142 0.0040  0.0367  -0.0512 1558 THR A CA  
901 C C   . THR A 113 ? 0.3440 0.4263 0.4432 0.0056  0.0312  -0.0628 1558 THR A C   
902 O O   . THR A 113 ? 0.3384 0.4346 0.4417 0.0045  0.0282  -0.0674 1558 THR A O   
903 C CB  . THR A 113 ? 0.3455 0.4060 0.4560 -0.0014 0.0401  -0.0492 1558 THR A CB  
904 O OG1 . THR A 113 ? 0.3491 0.4071 0.4583 -0.0006 0.0456  -0.0375 1558 THR A OG1 
905 C CG2 . THR A 113 ? 0.5228 0.5870 0.6513 -0.0092 0.0378  -0.0563 1558 THR A CG2 
906 N N   . SER A 114 ? 0.3376 0.4143 0.4307 0.0102  0.0297  -0.0675 1559 SER A N   
907 C CA  . SER A 114 ? 0.4107 0.4972 0.5007 0.0150  0.0243  -0.0791 1559 SER A CA  
908 C C   . SER A 114 ? 0.3798 0.4830 0.4596 0.0226  0.0239  -0.0760 1559 SER A C   
909 O O   . SER A 114 ? 0.3787 0.4965 0.4585 0.0252  0.0195  -0.0838 1559 SER A O   
910 C CB  . SER A 114 ? 0.4949 0.5721 0.5795 0.0204  0.0232  -0.0850 1559 SER A CB  
911 O OG  . SER A 114 ? 0.5531 0.6320 0.6263 0.0279  0.0268  -0.0764 1559 SER A OG  
912 N N   . VAL A 115 ? 0.3041 0.4055 0.3768 0.0261  0.0281  -0.0649 1560 VAL A N   
913 C CA  . VAL A 115 ? 0.2928 0.4075 0.3589 0.0326  0.0291  -0.0592 1560 VAL A CA  
914 C C   . VAL A 115 ? 0.3721 0.4968 0.4417 0.0299  0.0279  -0.0594 1560 VAL A C   
915 O O   . VAL A 115 ? 0.3259 0.4664 0.3916 0.0360  0.0265  -0.0608 1560 VAL A O   
916 C CB  . VAL A 115 ? 0.4189 0.5276 0.4818 0.0349  0.0332  -0.0471 1560 VAL A CB  
917 C CG1 . VAL A 115 ? 0.3449 0.4636 0.4051 0.0398  0.0347  -0.0401 1560 VAL A CG1 
918 C CG2 . VAL A 115 ? 0.3621 0.4687 0.4217 0.0406  0.0347  -0.0457 1560 VAL A CG2 
919 N N   . ARG A 116 ? 0.2761 0.3936 0.3524 0.0226  0.0293  -0.0565 1561 ARG A N   
920 C CA  . ARG A 116 ? 0.2760 0.4041 0.3565 0.0206  0.0289  -0.0557 1561 ARG A CA  
921 C C   . ARG A 116 ? 0.3463 0.4895 0.4339 0.0194  0.0239  -0.0666 1561 ARG A C   
922 O O   . ARG A 116 ? 0.3754 0.5351 0.4601 0.0244  0.0223  -0.0674 1561 ARG A O   
923 C CB  . ARG A 116 ? 0.2497 0.3694 0.3368 0.0143  0.0321  -0.0503 1561 ARG A CB  
924 C CG  . ARG A 116 ? 0.4613 0.5935 0.5515 0.0143  0.0328  -0.0474 1561 ARG A CG  
925 C CD  . ARG A 116 ? 0.3224 0.4506 0.4204 0.0096  0.0367  -0.0416 1561 ARG A CD  
926 N NE  . ARG A 116 ? 0.3225 0.4676 0.4278 0.0090  0.0371  -0.0405 1561 ARG A NE  
927 C CZ  . ARG A 116 ? 0.4670 0.6153 0.5755 0.0093  0.0416  -0.0326 1561 ARG A CZ  
928 N NH1 . ARG A 116 ? 0.4447 0.5805 0.5478 0.0111  0.0457  -0.0255 1561 ARG A NH1 
929 N NH2 . ARG A 116 ? 0.4680 0.6344 0.5844 0.0093  0.0420  -0.0313 1561 ARG A NH2 
930 N N   . GLN A 117 ? 0.3615 0.7525 0.3391 0.1124  0.0367  -0.1812 1562 GLN A N   
931 C CA  . GLN A 117 ? 0.3667 0.7647 0.3666 0.1252  0.0179  -0.2045 1562 GLN A CA  
932 C C   . GLN A 117 ? 0.4042 0.8737 0.4002 0.1510  0.0318  -0.2315 1562 GLN A C   
933 O O   . GLN A 117 ? 0.4600 0.9425 0.4504 0.1487  0.0409  -0.2278 1562 GLN A O   
934 C CB  . GLN A 117 ? 0.4044 0.7558 0.4568 0.1315  -0.0463 -0.2248 1562 GLN A CB  
935 C CG  . GLN A 117 ? 0.7409 1.0412 0.8030 0.0753  -0.0828 -0.1681 1562 GLN A CG  
936 C CD  . GLN A 117 ? 0.9024 1.1256 1.0265 0.0584  -0.1761 -0.1544 1562 GLN A CD  
937 O OE1 . GLN A 117 ? 0.8123 1.0175 0.9359 -0.0106 -0.2112 -0.0807 1562 GLN A OE1 
938 N NE2 . GLN A 117 ? 0.7770 0.9768 0.9645 0.1180  -0.2293 -0.2283 1562 GLN A NE2 
939 N N   . LYS A 118 ? 0.3423 0.8844 0.3423 0.1689  0.0302  -0.2571 1563 LYS A N   
940 C CA  . LYS A 118 ? 0.4271 1.1019 0.4143 0.1705  0.0433  -0.2654 1563 LYS A CA  
941 C C   . LYS A 118 ? 0.3610 1.0195 0.3171 0.1332  0.0578  -0.1977 1563 LYS A C   
942 O O   . LYS A 118 ? 0.3877 1.0930 0.3422 0.1267  0.0552  -0.1918 1563 LYS A O   
943 C CB  . LYS A 118 ? 0.3008 1.1012 0.2892 0.1770  0.0430  -0.2900 1563 LYS A CB  
944 C CG  . LYS A 118 ? 0.5309 1.5342 0.4961 0.1492  0.0540  -0.2733 1563 LYS A CG  
945 C CD  . LYS A 118 ? 0.6175 1.7824 0.5795 0.1427  0.0559  -0.2906 1563 LYS A CD  
946 C CE  . LYS A 118 ? 1.0955 2.1773 1.0229 0.0916  0.0619  -0.1939 1563 LYS A CE  
947 N NZ  . LYS A 118 ? 0.6975 1.9135 0.6196 0.0807  0.0642  -0.2016 1563 LYS A NZ  
948 N N   . ILE A 119 ? 0.4980 1.0836 0.4437 0.1134  0.0584  -0.1553 1564 ILE A N   
949 C CA  . ILE A 119 ? 0.3695 0.9353 0.3167 0.0846  0.0360  -0.1017 1564 ILE A CA  
950 C C   . ILE A 119 ? 0.4777 0.9839 0.4430 0.0972  0.0290  -0.1179 1564 ILE A C   
951 O O   . ILE A 119 ? 0.4779 0.9932 0.4560 0.0822  0.0000  -0.0913 1564 ILE A O   
952 C CB  . ILE A 119 ? 0.4255 0.9346 0.3805 0.0699  0.0157  -0.0693 1564 ILE A CB  
953 C CG1 . ILE A 119 ? 0.5807 1.1829 0.5206 0.0300  0.0004  -0.0157 1564 ILE A CG1 
954 C CG2 . ILE A 119 ? 0.6172 1.0457 0.6139 0.0697  -0.0327 -0.0589 1564 ILE A CG2 
955 C CD1 . ILE A 119 ? 0.6188 1.2889 0.5398 0.0473  0.0354  -0.0537 1564 ILE A CD1 
956 N N   . GLU A 120 ? 0.3953 0.8594 0.3637 0.1164  0.0486  -0.1559 1565 GLU A N   
957 C CA  . GLU A 120 ? 0.4343 0.8827 0.4184 0.1250  0.0474  -0.1798 1565 GLU A CA  
958 C C   . GLU A 120 ? 0.4861 0.9627 0.4669 0.1292  0.0508  -0.1866 1565 GLU A C   
959 O O   . GLU A 120 ? 0.5926 1.0670 0.5873 0.1325  0.0399  -0.1917 1565 GLU A O   
960 C CB  . GLU A 120 ? 0.3810 0.8328 0.3639 0.1203  0.0626  -0.2002 1565 GLU A CB  
961 C CG  . GLU A 120 ? 0.3542 0.8181 0.3511 0.1230  0.0574  -0.2166 1565 GLU A CG  
962 C CD  . GLU A 120 ? 0.6069 1.1582 0.6107 0.1113  0.0678  -0.2494 1565 GLU A CD  
963 O OE1 . GLU A 120 ? 0.4180 1.0023 0.4005 0.0773  0.0790  -0.2249 1565 GLU A OE1 
964 O OE2 . GLU A 120 ? 0.4289 1.0406 0.4661 0.1317  0.0556  -0.3016 1565 GLU A OE2 
965 N N   . LYS A 121 ? 0.5015 1.0116 0.4764 0.1365  0.0563  -0.2001 1566 LYS A N   
966 C CA  . LYS A 121 ? 0.4675 1.0278 0.4507 0.1496  0.0518  -0.2246 1566 LYS A CA  
967 C C   . LYS A 121 ? 0.6508 1.2921 0.6235 0.1341  0.0465  -0.1983 1566 LYS A C   
968 O O   . LYS A 121 ? 1.0955 1.7787 1.0735 0.1409  0.0443  -0.2146 1566 LYS A O   
969 C CB  . LYS A 121 ? 0.6117 1.2038 0.6202 0.1765  0.0349  -0.2758 1566 LYS A CB  
970 C CG  . LYS A 121 ? 0.6840 1.1879 0.7235 0.1773  0.0056  -0.2867 1566 LYS A CG  
971 C CD  . LYS A 121 ? 0.8330 1.3242 0.9278 0.2056  -0.0492 -0.3372 1566 LYS A CD  
972 C CE  . LYS A 121 ? 0.7337 1.2495 0.8864 0.2432  -0.0975 -0.4033 1566 LYS A CE  
973 N NZ  . LYS A 121 ? 0.6810 1.3573 0.8253 0.2758  -0.0704 -0.4585 1566 LYS A NZ  
974 N N   . GLU A 122 ? 0.6761 1.3371 0.6388 0.1035  0.0326  -0.1463 1567 GLU A N   
975 C CA  . GLU A 122 ? 0.6719 1.4099 0.6308 0.0596  0.0007  -0.0846 1567 GLU A CA  
976 C C   . GLU A 122 ? 0.9540 1.6053 0.9402 0.0532  -0.0369 -0.0616 1567 GLU A C   
977 O O   . GLU A 122 ? 0.9489 1.6618 0.9374 0.0168  -0.0702 -0.0137 1567 GLU A O   
978 C CB  . GLU A 122 ? 0.7321 1.5009 0.6860 0.0124  -0.0301 -0.0150 1567 GLU A CB  
979 C CG  . GLU A 122 ? 0.7703 1.7051 0.6976 0.0005  -0.0051 -0.0244 1567 GLU A CG  
980 C CD  . GLU A 122 ? 1.0431 1.9741 0.9661 -0.0392 -0.0287 0.0367  1567 GLU A CD  
981 O OE1 . GLU A 122 ? 1.0560 1.8550 1.0051 -0.0620 -0.0800 0.0933  1567 GLU A OE1 
982 O OE2 . GLU A 122 ? 0.5853 1.6499 0.4903 -0.0424 -0.0058 0.0178  1567 GLU A OE2 
983 N N   . ASP A 123 ? 0.9617 1.4977 0.9750 0.0849  -0.0403 -0.0984 1568 ASP A N   
984 C CA  . ASP A 123 ? 1.5467 2.0186 1.6063 0.0926  -0.0896 -0.1034 1568 ASP A CA  
985 C C   . ASP A 123 ? 1.2768 1.7552 1.3340 0.1224  -0.0553 -0.1581 1568 ASP A C   
986 O O   . ASP A 123 ? 0.7912 1.3259 0.8250 0.1149  -0.0363 -0.1507 1568 ASP A O   
987 C CB  . ASP A 123 ? 1.6788 2.0712 1.7913 0.1143  -0.1335 -0.1317 1568 ASP A CB  
988 C CG  . ASP A 123 ? 1.5242 1.8887 1.6560 0.0771  -0.1950 -0.0636 1568 ASP A CG  
989 O OD1 . ASP A 123 ? 0.8952 1.2677 1.0026 0.0770  -0.1638 -0.0641 1568 ASP A OD1 
990 O OD2 . ASP A 123 ? 1.4199 1.7562 1.5942 0.0384  -0.2847 0.0023  1568 ASP A OD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1446 ?    ?   ?   A . n 
A 1 2   MET 2   1447 1447 MET MET A . n 
A 1 3   ALA 3   1448 1448 ALA ALA A . n 
A 1 4   GLU 4   1449 1449 GLU GLU A . n 
A 1 5   LYS 5   1450 1450 LYS LYS A . n 
A 1 6   LEU 6   1451 1451 LEU LEU A . n 
A 1 7   SER 7   1452 1452 SER SER A . n 
A 1 8   PRO 8   1453 1453 PRO PRO A . n 
A 1 9   ASN 9   1454 1454 ASN ASN A . n 
A 1 10  PRO 10  1455 1455 PRO PRO A . n 
A 1 11  PRO 11  1456 1456 PRO PRO A . n 
A 1 12  ASN 12  1457 1457 ASN ASN A . n 
A 1 13  LEU 13  1458 1458 LEU LEU A . n 
A 1 14  THR 14  1459 1459 THR THR A . n 
A 1 15  LYS 15  1460 1460 LYS LYS A . n 
A 1 16  LYS 16  1461 1461 LYS LYS A . n 
A 1 17  MET 17  1462 1462 MET MET A . n 
A 1 18  LYS 18  1463 1463 LYS LYS A . n 
A 1 19  LYS 19  1464 1464 LYS LYS A . n 
A 1 20  ILE 20  1465 1465 ILE ILE A . n 
A 1 21  VAL 21  1466 1466 VAL VAL A . n 
A 1 22  ASP 22  1467 1467 ASP ASP A . n 
A 1 23  ALA 23  1468 1468 ALA ALA A . n 
A 1 24  VAL 24  1469 1469 VAL VAL A . n 
A 1 25  ILE 25  1470 1470 ILE ILE A . n 
A 1 26  LYS 26  1471 1471 LYS LYS A . n 
A 1 27  TYR 27  1472 1472 TYR TYR A . n 
A 1 28  LYS 28  1473 1473 LYS LYS A . n 
A 1 29  ASP 29  1474 1474 ASP ASP A . n 
A 1 30  SER 30  1475 1475 SER SER A . n 
A 1 31  SER 31  1476 1476 SER SER A . n 
A 1 32  SER 32  1477 1477 SER SER A . n 
A 1 33  GLY 33  1478 1478 GLY GLY A . n 
A 1 34  ARG 34  1479 1479 ARG ARG A . n 
A 1 35  GLN 35  1480 1480 GLN GLN A . n 
A 1 36  LEU 36  1481 1481 LEU LEU A . n 
A 1 37  SER 37  1482 1482 SER SER A . n 
A 1 38  GLU 38  1483 1483 GLU GLU A . n 
A 1 39  VAL 39  1484 1484 VAL VAL A . n 
A 1 40  PHE 40  1485 1485 PHE PHE A . n 
A 1 41  ILE 41  1486 1486 ILE ILE A . n 
A 1 42  GLN 42  1487 1487 GLN GLN A . n 
A 1 43  LEU 43  1488 1488 LEU LEU A . n 
A 1 44  PRO 44  1489 1489 PRO PRO A . n 
A 1 45  SER 45  1490 1490 SER SER A . n 
A 1 46  ARG 46  1491 1491 ARG ARG A . n 
A 1 47  LYS 47  1492 1492 LYS LYS A . n 
A 1 48  GLU 48  1493 1493 GLU GLU A . n 
A 1 49  LEU 49  1494 1494 LEU LEU A . n 
A 1 50  PRO 50  1495 1495 PRO PRO A . n 
A 1 51  GLU 51  1496 1496 GLU GLU A . n 
A 1 52  TYR 52  1497 1497 TYR TYR A . n 
A 1 53  TYR 53  1498 1498 TYR TYR A . n 
A 1 54  GLU 54  1499 1499 GLU GLU A . n 
A 1 55  LEU 55  1500 1500 LEU LEU A . n 
A 1 56  ILE 56  1501 1501 ILE ILE A . n 
A 1 57  ARG 57  1502 1502 ARG ARG A . n 
A 1 58  LYS 58  1503 1503 LYS LYS A . n 
A 1 59  PRO 59  1504 1504 PRO PRO A . n 
A 1 60  VAL 60  1505 1505 VAL VAL A . n 
A 1 61  ASP 61  1506 1506 ASP ASP A . n 
A 1 62  PHE 62  1507 1507 PHE PHE A . n 
A 1 63  LYS 63  1508 1508 LYS LYS A . n 
A 1 64  LYS 64  1509 1509 LYS LYS A . n 
A 1 65  ILE 65  1510 1510 ILE ILE A . n 
A 1 66  LYS 66  1511 1511 LYS LYS A . n 
A 1 67  GLU 67  1512 1512 GLU GLU A . n 
A 1 68  ARG 68  1513 1513 ARG ARG A . n 
A 1 69  ILE 69  1514 1514 ILE ILE A . n 
A 1 70  ARG 70  1515 1515 ARG ARG A . n 
A 1 71  ASN 71  1516 1516 ASN ASN A . n 
A 1 72  HIS 72  1517 1517 HIS HIS A . n 
A 1 73  LYS 73  1518 1518 LYS LYS A . n 
A 1 74  TYR 74  1519 1519 TYR TYR A . n 
A 1 75  ARG 75  1520 1520 ARG ARG A . n 
A 1 76  SER 76  1521 1521 SER SER A . n 
A 1 77  LEU 77  1522 1522 LEU LEU A . n 
A 1 78  ASN 78  1523 1523 ASN ASN A . n 
A 1 79  ASP 79  1524 1524 ASP ASP A . n 
A 1 80  LEU 80  1525 1525 LEU LEU A . n 
A 1 81  GLU 81  1526 1526 GLU GLU A . n 
A 1 82  LYS 82  1527 1527 LYS LYS A . n 
A 1 83  ASP 83  1528 1528 ASP ASP A . n 
A 1 84  VAL 84  1529 1529 VAL VAL A . n 
A 1 85  MET 85  1530 1530 MET MET A . n 
A 1 86  LEU 86  1531 1531 LEU LEU A . n 
A 1 87  LEU 87  1532 1532 LEU LEU A . n 
A 1 88  CYS 88  1533 1533 CYS CYS A . n 
A 1 89  GLN 89  1534 1534 GLN GLN A . n 
A 1 90  ASN 90  1535 1535 ASN ASN A . n 
A 1 91  ALA 91  1536 1536 ALA ALA A . n 
A 1 92  GLN 92  1537 1537 GLN GLN A . n 
A 1 93  THR 93  1538 1538 THR THR A . n 
A 1 94  PHE 94  1539 1539 PHE PHE A . n 
A 1 95  ASN 95  1540 1540 ASN ASN A . n 
A 1 96  LEU 96  1541 1541 LEU LEU A . n 
A 1 97  GLU 97  1542 1542 GLU GLU A . n 
A 1 98  GLY 98  1543 1543 GLY GLY A . n 
A 1 99  SER 99  1544 1544 SER SER A . n 
A 1 100 LEU 100 1545 1545 LEU LEU A . n 
A 1 101 ILE 101 1546 1546 ILE ILE A . n 
A 1 102 TYR 102 1547 1547 TYR TYR A . n 
A 1 103 GLU 103 1548 1548 GLU GLU A . n 
A 1 104 ASP 104 1549 1549 ASP ASP A . n 
A 1 105 SER 105 1550 1550 SER SER A . n 
A 1 106 ILE 106 1551 1551 ILE ILE A . n 
A 1 107 VAL 107 1552 1552 VAL VAL A . n 
A 1 108 LEU 108 1553 1553 LEU LEU A . n 
A 1 109 GLN 109 1554 1554 GLN GLN A . n 
A 1 110 SER 110 1555 1555 SER SER A . n 
A 1 111 VAL 111 1556 1556 VAL VAL A . n 
A 1 112 PHE 112 1557 1557 PHE PHE A . n 
A 1 113 THR 113 1558 1558 THR THR A . n 
A 1 114 SER 114 1559 1559 SER SER A . n 
A 1 115 VAL 115 1560 1560 VAL VAL A . n 
A 1 116 ARG 116 1561 1561 ARG ARG A . n 
A 1 117 GLN 117 1562 1562 GLN GLN A . n 
A 1 118 LYS 118 1563 1563 LYS LYS A . n 
A 1 119 ILE 119 1564 1564 ILE ILE A . n 
A 1 120 GLU 120 1565 1565 GLU GLU A . n 
A 1 121 LYS 121 1566 1566 LYS LYS A . n 
A 1 122 GLU 122 1567 1567 GLU GLU A . n 
A 1 123 ASP 123 1568 1568 ASP ASP A . n 
A 1 124 ASP 124 1569 ?    ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-18 
2 'Structure model' 1 1 2012-04-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             1.850 
_diffrn_reflns.pdbx_d_res_low              29.890 
_diffrn_reflns.pdbx_number_obs             10488 
_diffrn_reflns.pdbx_Rmerge_I_obs           ? 
_diffrn_reflns.pdbx_Rsym_value             0.067 
_diffrn_reflns.pdbx_chi_squared            ? 
_diffrn_reflns.av_sigmaI_over_netI         4.20 
_diffrn_reflns.pdbx_redundancy             3.50 
_diffrn_reflns.pdbx_percent_possible_obs   100.00 
_diffrn_reflns.number                      36801 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 5.85 29.89 ? ? 0.058 0.058 ? 3.30 99.50  
1 4.14 5.85  ? ? 0.053 0.053 ? 3.50 100.00 
1 3.38 4.14  ? ? 0.059 0.059 ? 3.60 100.00 
1 2.93 3.38  ? ? 0.071 0.071 ? 3.60 100.00 
1 2.62 2.93  ? ? 0.071 0.071 ? 3.50 100.00 
1 2.39 2.62  ? ? 0.086 0.086 ? 3.60 100.00 
1 2.21 2.39  ? ? 0.113 0.113 ? 3.50 100.00 
1 2.07 2.21  ? ? 0.169 0.169 ? 3.50 100.00 
1 1.95 2.07  ? ? 0.304 0.304 ? 3.50 100.00 
1 1.85 1.95  ? ? 0.544 0.544 ? 3.40 100.00 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 25.0202 5.3306  54.8682 0.2502 0.2556 0.1714 0.1041 0.0535  0.0465  1.3738  0.7340 0.1213  0.9998  
-0.4003 -0.2958 0.0889 -0.0950 0.0062  -0.1224 -0.0694 -0.0233 0.0540  -0.0035 0.0353  
'X-RAY DIFFRACTION' 2 ? refined 7.2747  14.5517 45.5281 0.1539 0.2214 0.2784 0.0244 -0.0613 -0.0033 1.4764  1.0409 3.5482  -0.6275 
-1.0277 -0.6028 0.1387 0.0472  -0.1859 0.2127  -0.1081 0.4091  -0.2096 -0.1107 -0.3601 
'X-RAY DIFFRACTION' 3 ? refined 18.1196 15.4936 47.2092 0.1196 0.1683 0.1610 0.0443 0.0244  -0.0226 2.4938  1.2434 1.4648  -1.4982 
-0.0006 -0.3733 0.1925 -0.1302 -0.0623 0.1805  -0.0039 0.0732  -0.1870 0.0226  0.0751  
'X-RAY DIFFRACTION' 4 ? refined 28.1998 17.6264 63.3937 0.1659 0.7156 0.1269 0.1238 0.0545  -0.1724 26.9265 1.1739 12.6838 4.6683  
18.3442 3.4404  0.1836 0.0603  -0.2439 -1.8301 -0.0842 -0.2023 0.0698  0.1970  -0.9278 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1447 A 1471 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 1472 A 1501 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 1502 A 1561 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 A 1562 A 1568 ? . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     3UVD 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     52.460 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           27.620 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        27.620 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALA        3.3.16 2010/01/06                 other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
2 PHASER       2.1.4  'Wed Jun 24 14:00:05 2009' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
3 REFMAC       .      ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT  3.10   'June 10, 2010'            package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 CrystalClear .      ?                          ?       ?                    ?                           'data collection' ? ? ? 
6 MOSFLM       .      ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 1447 ? CG  ? A MET 2  CG  
2  1 Y 1 A MET 1447 ? SD  ? A MET 2  SD  
3  1 Y 1 A MET 1447 ? CE  ? A MET 2  CE  
4  1 Y 1 A LYS 1460 ? CE  ? A LYS 15 CE  
5  1 Y 1 A LYS 1460 ? NZ  ? A LYS 15 NZ  
6  1 Y 1 A LYS 1461 ? NZ  ? A LYS 16 NZ  
7  1 Y 1 A LYS 1473 ? CE  ? A LYS 28 CE  
8  1 Y 1 A LYS 1473 ? NZ  ? A LYS 28 NZ  
9  1 Y 1 A LYS 1492 ? CE  ? A LYS 47 CE  
10 1 Y 1 A LYS 1492 ? NZ  ? A LYS 47 NZ  
11 1 Y 1 A GLU 1493 ? CD  ? A GLU 48 CD  
12 1 Y 1 A GLU 1493 ? OE1 ? A GLU 48 OE1 
13 1 Y 1 A GLU 1493 ? OE2 ? A GLU 48 OE2 
14 1 Y 1 A LEU 1541 ? CG  ? A LEU 96 CG  
15 1 Y 1 A LEU 1541 ? CD1 ? A LEU 96 CD1 
16 1 Y 1 A LEU 1541 ? CD2 ? A LEU 96 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1446 ? A SER 1   
2 1 Y 1 A ASP 1569 ? A ASP 124 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1-methylpyrrolidin-2-one MB3 
3 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MB3 1  1    1  MB3 MB3 A . 
C 3 HOH 1  2    2  HOH HOH A . 
C 3 HOH 2  3    3  HOH HOH A . 
C 3 HOH 3  4    4  HOH HOH A . 
C 3 HOH 4  5    5  HOH HOH A . 
C 3 HOH 5  6    6  HOH HOH A . 
C 3 HOH 6  7    7  HOH HOH A . 
C 3 HOH 7  8    8  HOH HOH A . 
C 3 HOH 8  9    9  HOH HOH A . 
C 3 HOH 9  10   10 HOH HOH A . 
C 3 HOH 10 11   11 HOH HOH A . 
C 3 HOH 11 12   12 HOH HOH A . 
C 3 HOH 12 13   13 HOH HOH A . 
C 3 HOH 13 14   14 HOH HOH A . 
C 3 HOH 14 15   15 HOH HOH A . 
C 3 HOH 15 16   16 HOH HOH A . 
C 3 HOH 16 17   17 HOH HOH A . 
C 3 HOH 17 18   18 HOH HOH A . 
C 3 HOH 18 19   19 HOH HOH A . 
C 3 HOH 19 20   20 HOH HOH A . 
C 3 HOH 20 21   21 HOH HOH A . 
C 3 HOH 21 23   23 HOH HOH A . 
C 3 HOH 22 24   24 HOH HOH A . 
C 3 HOH 23 25   25 HOH HOH A . 
C 3 HOH 24 26   26 HOH HOH A . 
C 3 HOH 25 27   27 HOH HOH A . 
C 3 HOH 26 28   28 HOH HOH A . 
C 3 HOH 27 29   29 HOH HOH A . 
C 3 HOH 28 30   30 HOH HOH A . 
C 3 HOH 29 31   31 HOH HOH A . 
C 3 HOH 30 32   32 HOH HOH A . 
C 3 HOH 31 33   33 HOH HOH A . 
C 3 HOH 32 34   34 HOH HOH A . 
C 3 HOH 33 35   35 HOH HOH A . 
C 3 HOH 34 36   36 HOH HOH A . 
C 3 HOH 35 37   37 HOH HOH A . 
C 3 HOH 36 38   38 HOH HOH A . 
C 3 HOH 37 39   39 HOH HOH A . 
C 3 HOH 38 40   40 HOH HOH A . 
C 3 HOH 39 41   41 HOH HOH A . 
C 3 HOH 40 42   42 HOH HOH A . 
C 3 HOH 41 43   43 HOH HOH A . 
C 3 HOH 42 44   44 HOH HOH A . 
C 3 HOH 43 45   45 HOH HOH A . 
C 3 HOH 44 46   46 HOH HOH A . 
C 3 HOH 45 47   47 HOH HOH A . 
C 3 HOH 46 48   48 HOH HOH A . 
C 3 HOH 47 49   49 HOH HOH A . 
C 3 HOH 48 50   50 HOH HOH A . 
C 3 HOH 49 51   51 HOH HOH A . 
C 3 HOH 50 52   52 HOH HOH A . 
C 3 HOH 51 53   53 HOH HOH A . 
C 3 HOH 52 54   54 HOH HOH A . 
C 3 HOH 53 55   55 HOH HOH A . 
C 3 HOH 54 56   56 HOH HOH A . 
C 3 HOH 55 57   57 HOH HOH A . 
C 3 HOH 56 58   58 HOH HOH A . 
C 3 HOH 57 59   59 HOH HOH A . 
C 3 HOH 58 60   60 HOH HOH A . 
C 3 HOH 59 61   61 HOH HOH A . 
C 3 HOH 60 62   62 HOH HOH A . 
C 3 HOH 61 1570 1  HOH HOH A . 
#